data_5J2M
# 
_entry.id   5J2M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5J2M         
WWPDB D_1000219791 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5J2Q unspecified 
PDB . 5J2P unspecified 
PDB . 5J2N unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5J2M 
_pdbx_database_status.recvd_initial_deposition_date   2016-03-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Salie, Z.L.'      1 
'Kirby, K.A.'      2 
'Sarafianos, S.G.' 3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            113 
_citation.language                  ? 
_citation.page_first                9274 
_citation.page_last                 9279 
_citation.title                     
;Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
;
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1605223113 
_citation.pdbx_database_id_PubMed   27489345 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Salie, Z.L.'      1  ? 
primary 'Kirby, K.A.'      2  ? 
primary 'Michailidis, E.'  3  ? 
primary 'Marchand, B.'     4  ? 
primary 'Singh, K.'        5  ? 
primary 'Rohan, L.C.'      6  ? 
primary 'Kodama, E.N.'     7  ? 
primary 'Mitsuya, H.'      8  ? 
primary 'Parniak, M.A.'    9  ? 
primary 'Sarafianos, S.G.' 10 ? 
# 
_cell.length_a           167.468 
_cell.length_b           169.758 
_cell.length_c           101.951 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           5J2M 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.entry_id                         5J2M 
_symmetry.Int_Tables_number                20 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HIV-1 reverse transcriptase p51 subunit'                                           64521.895 1   2.7.7.- 
'Q258C, C280S' 'unp residues 1-560' ? 
2 polymer     man 'HIV-1 reverse transcriptase p51 subunit'                                           51382.984 1   2.7.7.- C280S 
'unp residues 1-440' ? 
3 polymer     syn 
;DNA (5'-D(*AP*CP*AP*GP*TP*CP*CP*CP*TP*GP*TP*TP*CP*GP*GP*(MRG)P*CP*GP*CP*CP*G)-3')
;
6490.267  1   ?       ?              ?                    ? 
4 polymer     syn 'DNA (27-MER)'                                                                      8383.385  1   ?       ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                                                     24.305    3   ?       ? ? ? 
6 non-polymer syn 
;2'-deoxy-4'-ethynyl-2-fluoroadenosine 5'-(tetrahydrogen triphosphate)
;
533.193   1   ?       ?              ?                    ? 
7 water       nat water                                                                               18.015    384 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 Pr160Gag-Pol 
2 Pr160Gag-Pol 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
;
A ? 
2 'polypeptide(L)'        no no  
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
B ? 
3 polydeoxyribonucleotide no yes 
;(DA)(DC)(DA)(DG)(DT)(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DG)(DG)(MRG)(DC)(DG)(DC)
(DC)(DG)
;
ACAGTCCCTGTTCGGGCGCCG P ? 
4 polydeoxyribonucleotide no no  
;(DA)(DT)(DG)(DG)(DT)(DC)(DG)(DG)(DC)(DG)(DC)(DC)(DC)(DG)(DA)(DA)(DC)(DA)(DG)(DG)
(DG)(DA)(DC)(DT)(DG)(DT)(DG)
;
ATGGTCGGCGCCCGAACAGGGACTGTG T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ILE n 
1 3   SER n 
1 4   PRO n 
1 5   ILE n 
1 6   GLU n 
1 7   THR n 
1 8   VAL n 
1 9   PRO n 
1 10  VAL n 
1 11  LYS n 
1 12  LEU n 
1 13  LYS n 
1 14  PRO n 
1 15  GLY n 
1 16  MET n 
1 17  ASP n 
1 18  GLY n 
1 19  PRO n 
1 20  LYS n 
1 21  VAL n 
1 22  LYS n 
1 23  GLN n 
1 24  TRP n 
1 25  PRO n 
1 26  LEU n 
1 27  THR n 
1 28  GLU n 
1 29  GLU n 
1 30  LYS n 
1 31  ILE n 
1 32  LYS n 
1 33  ALA n 
1 34  LEU n 
1 35  VAL n 
1 36  GLU n 
1 37  ILE n 
1 38  CYS n 
1 39  THR n 
1 40  GLU n 
1 41  MET n 
1 42  GLU n 
1 43  LYS n 
1 44  GLU n 
1 45  GLY n 
1 46  LYS n 
1 47  ILE n 
1 48  SER n 
1 49  LYS n 
1 50  ILE n 
1 51  GLY n 
1 52  PRO n 
1 53  GLU n 
1 54  ASN n 
1 55  PRO n 
1 56  TYR n 
1 57  ASN n 
1 58  THR n 
1 59  PRO n 
1 60  VAL n 
1 61  PHE n 
1 62  ALA n 
1 63  ILE n 
1 64  LYS n 
1 65  LYS n 
1 66  LYS n 
1 67  ASP n 
1 68  SER n 
1 69  THR n 
1 70  LYS n 
1 71  TRP n 
1 72  ARG n 
1 73  LYS n 
1 74  LEU n 
1 75  VAL n 
1 76  ASP n 
1 77  PHE n 
1 78  ARG n 
1 79  GLU n 
1 80  LEU n 
1 81  ASN n 
1 82  LYS n 
1 83  ARG n 
1 84  THR n 
1 85  GLN n 
1 86  ASP n 
1 87  PHE n 
1 88  TRP n 
1 89  GLU n 
1 90  VAL n 
1 91  GLN n 
1 92  LEU n 
1 93  GLY n 
1 94  ILE n 
1 95  PRO n 
1 96  HIS n 
1 97  PRO n 
1 98  ALA n 
1 99  GLY n 
1 100 LEU n 
1 101 LYS n 
1 102 LYS n 
1 103 LYS n 
1 104 LYS n 
1 105 SER n 
1 106 VAL n 
1 107 THR n 
1 108 VAL n 
1 109 LEU n 
1 110 ASP n 
1 111 VAL n 
1 112 GLY n 
1 113 ASP n 
1 114 ALA n 
1 115 TYR n 
1 116 PHE n 
1 117 SER n 
1 118 VAL n 
1 119 PRO n 
1 120 LEU n 
1 121 ASP n 
1 122 GLU n 
1 123 ASP n 
1 124 PHE n 
1 125 ARG n 
1 126 LYS n 
1 127 TYR n 
1 128 THR n 
1 129 ALA n 
1 130 PHE n 
1 131 THR n 
1 132 ILE n 
1 133 PRO n 
1 134 SER n 
1 135 ILE n 
1 136 ASN n 
1 137 ASN n 
1 138 GLU n 
1 139 THR n 
1 140 PRO n 
1 141 GLY n 
1 142 ILE n 
1 143 ARG n 
1 144 TYR n 
1 145 GLN n 
1 146 TYR n 
1 147 ASN n 
1 148 VAL n 
1 149 LEU n 
1 150 PRO n 
1 151 GLN n 
1 152 GLY n 
1 153 TRP n 
1 154 LYS n 
1 155 GLY n 
1 156 SER n 
1 157 PRO n 
1 158 ALA n 
1 159 ILE n 
1 160 PHE n 
1 161 GLN n 
1 162 SER n 
1 163 SER n 
1 164 MET n 
1 165 THR n 
1 166 LYS n 
1 167 ILE n 
1 168 LEU n 
1 169 GLU n 
1 170 PRO n 
1 171 PHE n 
1 172 ARG n 
1 173 LYS n 
1 174 GLN n 
1 175 ASN n 
1 176 PRO n 
1 177 ASP n 
1 178 ILE n 
1 179 VAL n 
1 180 ILE n 
1 181 TYR n 
1 182 GLN n 
1 183 TYR n 
1 184 MET n 
1 185 ASP n 
1 186 ASP n 
1 187 LEU n 
1 188 TYR n 
1 189 VAL n 
1 190 GLY n 
1 191 SER n 
1 192 ASP n 
1 193 LEU n 
1 194 GLU n 
1 195 ILE n 
1 196 GLY n 
1 197 GLN n 
1 198 HIS n 
1 199 ARG n 
1 200 THR n 
1 201 LYS n 
1 202 ILE n 
1 203 GLU n 
1 204 GLU n 
1 205 LEU n 
1 206 ARG n 
1 207 GLN n 
1 208 HIS n 
1 209 LEU n 
1 210 LEU n 
1 211 ARG n 
1 212 TRP n 
1 213 GLY n 
1 214 LEU n 
1 215 THR n 
1 216 THR n 
1 217 PRO n 
1 218 ASP n 
1 219 LYS n 
1 220 LYS n 
1 221 HIS n 
1 222 GLN n 
1 223 LYS n 
1 224 GLU n 
1 225 PRO n 
1 226 PRO n 
1 227 PHE n 
1 228 LEU n 
1 229 TRP n 
1 230 MET n 
1 231 GLY n 
1 232 TYR n 
1 233 GLU n 
1 234 LEU n 
1 235 HIS n 
1 236 PRO n 
1 237 ASP n 
1 238 LYS n 
1 239 TRP n 
1 240 THR n 
1 241 VAL n 
1 242 GLN n 
1 243 PRO n 
1 244 ILE n 
1 245 VAL n 
1 246 LEU n 
1 247 PRO n 
1 248 GLU n 
1 249 LYS n 
1 250 ASP n 
1 251 SER n 
1 252 TRP n 
1 253 THR n 
1 254 VAL n 
1 255 ASN n 
1 256 ASP n 
1 257 ILE n 
1 258 CYS n 
1 259 LYS n 
1 260 LEU n 
1 261 VAL n 
1 262 GLY n 
1 263 LYS n 
1 264 LEU n 
1 265 ASN n 
1 266 TRP n 
1 267 ALA n 
1 268 SER n 
1 269 GLN n 
1 270 ILE n 
1 271 TYR n 
1 272 PRO n 
1 273 GLY n 
1 274 ILE n 
1 275 LYS n 
1 276 VAL n 
1 277 ARG n 
1 278 GLN n 
1 279 LEU n 
1 280 SER n 
1 281 LYS n 
1 282 LEU n 
1 283 LEU n 
1 284 ARG n 
1 285 GLY n 
1 286 THR n 
1 287 LYS n 
1 288 ALA n 
1 289 LEU n 
1 290 THR n 
1 291 GLU n 
1 292 VAL n 
1 293 ILE n 
1 294 PRO n 
1 295 LEU n 
1 296 THR n 
1 297 GLU n 
1 298 GLU n 
1 299 ALA n 
1 300 GLU n 
1 301 LEU n 
1 302 GLU n 
1 303 LEU n 
1 304 ALA n 
1 305 GLU n 
1 306 ASN n 
1 307 ARG n 
1 308 GLU n 
1 309 ILE n 
1 310 LEU n 
1 311 LYS n 
1 312 GLU n 
1 313 PRO n 
1 314 VAL n 
1 315 HIS n 
1 316 GLY n 
1 317 VAL n 
1 318 TYR n 
1 319 TYR n 
1 320 ASP n 
1 321 PRO n 
1 322 SER n 
1 323 LYS n 
1 324 ASP n 
1 325 LEU n 
1 326 ILE n 
1 327 ALA n 
1 328 GLU n 
1 329 ILE n 
1 330 GLN n 
1 331 LYS n 
1 332 GLN n 
1 333 GLY n 
1 334 GLN n 
1 335 GLY n 
1 336 GLN n 
1 337 TRP n 
1 338 THR n 
1 339 TYR n 
1 340 GLN n 
1 341 ILE n 
1 342 TYR n 
1 343 GLN n 
1 344 GLU n 
1 345 PRO n 
1 346 PHE n 
1 347 LYS n 
1 348 ASN n 
1 349 LEU n 
1 350 LYS n 
1 351 THR n 
1 352 GLY n 
1 353 LYS n 
1 354 TYR n 
1 355 ALA n 
1 356 ARG n 
1 357 MET n 
1 358 ARG n 
1 359 GLY n 
1 360 ALA n 
1 361 HIS n 
1 362 THR n 
1 363 ASN n 
1 364 ASP n 
1 365 VAL n 
1 366 LYS n 
1 367 GLN n 
1 368 LEU n 
1 369 THR n 
1 370 GLU n 
1 371 ALA n 
1 372 VAL n 
1 373 GLN n 
1 374 LYS n 
1 375 ILE n 
1 376 THR n 
1 377 THR n 
1 378 GLU n 
1 379 SER n 
1 380 ILE n 
1 381 VAL n 
1 382 ILE n 
1 383 TRP n 
1 384 GLY n 
1 385 LYS n 
1 386 THR n 
1 387 PRO n 
1 388 LYS n 
1 389 PHE n 
1 390 LYS n 
1 391 LEU n 
1 392 PRO n 
1 393 ILE n 
1 394 GLN n 
1 395 LYS n 
1 396 GLU n 
1 397 THR n 
1 398 TRP n 
1 399 GLU n 
1 400 THR n 
1 401 TRP n 
1 402 TRP n 
1 403 THR n 
1 404 GLU n 
1 405 TYR n 
1 406 TRP n 
1 407 GLN n 
1 408 ALA n 
1 409 THR n 
1 410 TRP n 
1 411 ILE n 
1 412 PRO n 
1 413 GLU n 
1 414 TRP n 
1 415 GLU n 
1 416 PHE n 
1 417 VAL n 
1 418 ASN n 
1 419 THR n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 VAL n 
1 424 LYS n 
1 425 LEU n 
1 426 TRP n 
1 427 TYR n 
1 428 GLN n 
1 429 LEU n 
1 430 GLU n 
1 431 LYS n 
1 432 GLU n 
1 433 PRO n 
1 434 ILE n 
1 435 VAL n 
1 436 GLY n 
1 437 ALA n 
1 438 GLU n 
1 439 THR n 
1 440 PHE n 
1 441 TYR n 
1 442 VAL n 
1 443 ASP n 
1 444 GLY n 
1 445 ALA n 
1 446 ALA n 
1 447 ASN n 
1 448 ARG n 
1 449 GLU n 
1 450 THR n 
1 451 LYS n 
1 452 LEU n 
1 453 GLY n 
1 454 LYS n 
1 455 ALA n 
1 456 GLY n 
1 457 TYR n 
1 458 VAL n 
1 459 THR n 
1 460 ASN n 
1 461 ARG n 
1 462 GLY n 
1 463 ARG n 
1 464 GLN n 
1 465 LYS n 
1 466 VAL n 
1 467 VAL n 
1 468 THR n 
1 469 LEU n 
1 470 THR n 
1 471 ASP n 
1 472 THR n 
1 473 THR n 
1 474 ASN n 
1 475 GLN n 
1 476 LYS n 
1 477 THR n 
1 478 GLU n 
1 479 LEU n 
1 480 GLN n 
1 481 ALA n 
1 482 ILE n 
1 483 TYR n 
1 484 LEU n 
1 485 ALA n 
1 486 LEU n 
1 487 GLN n 
1 488 ASP n 
1 489 SER n 
1 490 GLY n 
1 491 LEU n 
1 492 GLU n 
1 493 VAL n 
1 494 ASN n 
1 495 ILE n 
1 496 VAL n 
1 497 THR n 
1 498 ASP n 
1 499 SER n 
1 500 GLN n 
1 501 TYR n 
1 502 ALA n 
1 503 LEU n 
1 504 GLY n 
1 505 ILE n 
1 506 ILE n 
1 507 GLN n 
1 508 ALA n 
1 509 GLN n 
1 510 PRO n 
1 511 ASP n 
1 512 GLN n 
1 513 SER n 
1 514 GLU n 
1 515 SER n 
1 516 GLU n 
1 517 LEU n 
1 518 VAL n 
1 519 ASN n 
1 520 GLN n 
1 521 ILE n 
1 522 ILE n 
1 523 GLU n 
1 524 GLN n 
1 525 LEU n 
1 526 ILE n 
1 527 LYS n 
1 528 LYS n 
1 529 GLU n 
1 530 LYS n 
1 531 VAL n 
1 532 TYR n 
1 533 LEU n 
1 534 ALA n 
1 535 TRP n 
1 536 VAL n 
1 537 PRO n 
1 538 ALA n 
1 539 HIS n 
1 540 LYS n 
1 541 GLY n 
1 542 ILE n 
1 543 GLY n 
1 544 GLY n 
1 545 ASN n 
1 546 GLU n 
1 547 GLN n 
1 548 VAL n 
1 549 ASP n 
1 550 LYS n 
1 551 LEU n 
1 552 VAL n 
1 553 SER n 
1 554 ALA n 
1 555 GLY n 
1 556 ILE n 
1 557 ARG n 
1 558 LYS n 
1 559 VAL n 
1 560 LEU n 
2 1   PRO n 
2 2   ILE n 
2 3   SER n 
2 4   PRO n 
2 5   ILE n 
2 6   GLU n 
2 7   THR n 
2 8   VAL n 
2 9   PRO n 
2 10  VAL n 
2 11  LYS n 
2 12  LEU n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  MET n 
2 17  ASP n 
2 18  GLY n 
2 19  PRO n 
2 20  LYS n 
2 21  VAL n 
2 22  LYS n 
2 23  GLN n 
2 24  TRP n 
2 25  PRO n 
2 26  LEU n 
2 27  THR n 
2 28  GLU n 
2 29  GLU n 
2 30  LYS n 
2 31  ILE n 
2 32  LYS n 
2 33  ALA n 
2 34  LEU n 
2 35  VAL n 
2 36  GLU n 
2 37  ILE n 
2 38  CYS n 
2 39  THR n 
2 40  GLU n 
2 41  MET n 
2 42  GLU n 
2 43  LYS n 
2 44  GLU n 
2 45  GLY n 
2 46  LYS n 
2 47  ILE n 
2 48  SER n 
2 49  LYS n 
2 50  ILE n 
2 51  GLY n 
2 52  PRO n 
2 53  GLU n 
2 54  ASN n 
2 55  PRO n 
2 56  TYR n 
2 57  ASN n 
2 58  THR n 
2 59  PRO n 
2 60  VAL n 
2 61  PHE n 
2 62  ALA n 
2 63  ILE n 
2 64  LYS n 
2 65  LYS n 
2 66  LYS n 
2 67  ASP n 
2 68  SER n 
2 69  THR n 
2 70  LYS n 
2 71  TRP n 
2 72  ARG n 
2 73  LYS n 
2 74  LEU n 
2 75  VAL n 
2 76  ASP n 
2 77  PHE n 
2 78  ARG n 
2 79  GLU n 
2 80  LEU n 
2 81  ASN n 
2 82  LYS n 
2 83  ARG n 
2 84  THR n 
2 85  GLN n 
2 86  ASP n 
2 87  PHE n 
2 88  TRP n 
2 89  GLU n 
2 90  VAL n 
2 91  GLN n 
2 92  LEU n 
2 93  GLY n 
2 94  ILE n 
2 95  PRO n 
2 96  HIS n 
2 97  PRO n 
2 98  ALA n 
2 99  GLY n 
2 100 LEU n 
2 101 LYS n 
2 102 LYS n 
2 103 LYS n 
2 104 LYS n 
2 105 SER n 
2 106 VAL n 
2 107 THR n 
2 108 VAL n 
2 109 LEU n 
2 110 ASP n 
2 111 VAL n 
2 112 GLY n 
2 113 ASP n 
2 114 ALA n 
2 115 TYR n 
2 116 PHE n 
2 117 SER n 
2 118 VAL n 
2 119 PRO n 
2 120 LEU n 
2 121 ASP n 
2 122 GLU n 
2 123 ASP n 
2 124 PHE n 
2 125 ARG n 
2 126 LYS n 
2 127 TYR n 
2 128 THR n 
2 129 ALA n 
2 130 PHE n 
2 131 THR n 
2 132 ILE n 
2 133 PRO n 
2 134 SER n 
2 135 ILE n 
2 136 ASN n 
2 137 ASN n 
2 138 GLU n 
2 139 THR n 
2 140 PRO n 
2 141 GLY n 
2 142 ILE n 
2 143 ARG n 
2 144 TYR n 
2 145 GLN n 
2 146 TYR n 
2 147 ASN n 
2 148 VAL n 
2 149 LEU n 
2 150 PRO n 
2 151 GLN n 
2 152 GLY n 
2 153 TRP n 
2 154 LYS n 
2 155 GLY n 
2 156 SER n 
2 157 PRO n 
2 158 ALA n 
2 159 ILE n 
2 160 PHE n 
2 161 GLN n 
2 162 SER n 
2 163 SER n 
2 164 MET n 
2 165 THR n 
2 166 LYS n 
2 167 ILE n 
2 168 LEU n 
2 169 GLU n 
2 170 PRO n 
2 171 PHE n 
2 172 ARG n 
2 173 LYS n 
2 174 GLN n 
2 175 ASN n 
2 176 PRO n 
2 177 ASP n 
2 178 ILE n 
2 179 VAL n 
2 180 ILE n 
2 181 TYR n 
2 182 GLN n 
2 183 TYR n 
2 184 MET n 
2 185 ASP n 
2 186 ASP n 
2 187 LEU n 
2 188 TYR n 
2 189 VAL n 
2 190 GLY n 
2 191 SER n 
2 192 ASP n 
2 193 LEU n 
2 194 GLU n 
2 195 ILE n 
2 196 GLY n 
2 197 GLN n 
2 198 HIS n 
2 199 ARG n 
2 200 THR n 
2 201 LYS n 
2 202 ILE n 
2 203 GLU n 
2 204 GLU n 
2 205 LEU n 
2 206 ARG n 
2 207 GLN n 
2 208 HIS n 
2 209 LEU n 
2 210 LEU n 
2 211 ARG n 
2 212 TRP n 
2 213 GLY n 
2 214 LEU n 
2 215 THR n 
2 216 THR n 
2 217 PRO n 
2 218 ASP n 
2 219 LYS n 
2 220 LYS n 
2 221 HIS n 
2 222 GLN n 
2 223 LYS n 
2 224 GLU n 
2 225 PRO n 
2 226 PRO n 
2 227 PHE n 
2 228 LEU n 
2 229 TRP n 
2 230 MET n 
2 231 GLY n 
2 232 TYR n 
2 233 GLU n 
2 234 LEU n 
2 235 HIS n 
2 236 PRO n 
2 237 ASP n 
2 238 LYS n 
2 239 TRP n 
2 240 THR n 
2 241 VAL n 
2 242 GLN n 
2 243 PRO n 
2 244 ILE n 
2 245 VAL n 
2 246 LEU n 
2 247 PRO n 
2 248 GLU n 
2 249 LYS n 
2 250 ASP n 
2 251 SER n 
2 252 TRP n 
2 253 THR n 
2 254 VAL n 
2 255 ASN n 
2 256 ASP n 
2 257 ILE n 
2 258 GLN n 
2 259 LYS n 
2 260 LEU n 
2 261 VAL n 
2 262 GLY n 
2 263 LYS n 
2 264 LEU n 
2 265 ASN n 
2 266 TRP n 
2 267 ALA n 
2 268 SER n 
2 269 GLN n 
2 270 ILE n 
2 271 TYR n 
2 272 PRO n 
2 273 GLY n 
2 274 ILE n 
2 275 LYS n 
2 276 VAL n 
2 277 ARG n 
2 278 GLN n 
2 279 LEU n 
2 280 SER n 
2 281 LYS n 
2 282 LEU n 
2 283 LEU n 
2 284 ARG n 
2 285 GLY n 
2 286 THR n 
2 287 LYS n 
2 288 ALA n 
2 289 LEU n 
2 290 THR n 
2 291 GLU n 
2 292 VAL n 
2 293 ILE n 
2 294 PRO n 
2 295 LEU n 
2 296 THR n 
2 297 GLU n 
2 298 GLU n 
2 299 ALA n 
2 300 GLU n 
2 301 LEU n 
2 302 GLU n 
2 303 LEU n 
2 304 ALA n 
2 305 GLU n 
2 306 ASN n 
2 307 ARG n 
2 308 GLU n 
2 309 ILE n 
2 310 LEU n 
2 311 LYS n 
2 312 GLU n 
2 313 PRO n 
2 314 VAL n 
2 315 HIS n 
2 316 GLY n 
2 317 VAL n 
2 318 TYR n 
2 319 TYR n 
2 320 ASP n 
2 321 PRO n 
2 322 SER n 
2 323 LYS n 
2 324 ASP n 
2 325 LEU n 
2 326 ILE n 
2 327 ALA n 
2 328 GLU n 
2 329 ILE n 
2 330 GLN n 
2 331 LYS n 
2 332 GLN n 
2 333 GLY n 
2 334 GLN n 
2 335 GLY n 
2 336 GLN n 
2 337 TRP n 
2 338 THR n 
2 339 TYR n 
2 340 GLN n 
2 341 ILE n 
2 342 TYR n 
2 343 GLN n 
2 344 GLU n 
2 345 PRO n 
2 346 PHE n 
2 347 LYS n 
2 348 ASN n 
2 349 LEU n 
2 350 LYS n 
2 351 THR n 
2 352 GLY n 
2 353 LYS n 
2 354 TYR n 
2 355 ALA n 
2 356 ARG n 
2 357 MET n 
2 358 ARG n 
2 359 GLY n 
2 360 ALA n 
2 361 HIS n 
2 362 THR n 
2 363 ASN n 
2 364 ASP n 
2 365 VAL n 
2 366 LYS n 
2 367 GLN n 
2 368 LEU n 
2 369 THR n 
2 370 GLU n 
2 371 ALA n 
2 372 VAL n 
2 373 GLN n 
2 374 LYS n 
2 375 ILE n 
2 376 THR n 
2 377 THR n 
2 378 GLU n 
2 379 SER n 
2 380 ILE n 
2 381 VAL n 
2 382 ILE n 
2 383 TRP n 
2 384 GLY n 
2 385 LYS n 
2 386 THR n 
2 387 PRO n 
2 388 LYS n 
2 389 PHE n 
2 390 LYS n 
2 391 LEU n 
2 392 PRO n 
2 393 ILE n 
2 394 GLN n 
2 395 LYS n 
2 396 GLU n 
2 397 THR n 
2 398 TRP n 
2 399 GLU n 
2 400 THR n 
2 401 TRP n 
2 402 TRP n 
2 403 THR n 
2 404 GLU n 
2 405 TYR n 
2 406 TRP n 
2 407 GLN n 
2 408 ALA n 
2 409 THR n 
2 410 TRP n 
2 411 ILE n 
2 412 PRO n 
2 413 GLU n 
2 414 TRP n 
2 415 GLU n 
2 416 PHE n 
2 417 VAL n 
2 418 ASN n 
2 419 THR n 
2 420 PRO n 
2 421 PRO n 
2 422 LEU n 
2 423 VAL n 
2 424 LYS n 
2 425 LEU n 
2 426 TRP n 
2 427 TYR n 
2 428 GLN n 
2 429 LEU n 
2 430 GLU n 
2 431 LYS n 
2 432 GLU n 
2 433 PRO n 
2 434 ILE n 
2 435 VAL n 
2 436 GLY n 
2 437 ALA n 
2 438 GLU n 
2 439 THR n 
2 440 PHE n 
3 1   DA  n 
3 2   DC  n 
3 3   DA  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DC  n 
3 8   DC  n 
3 9   DT  n 
3 10  DG  n 
3 11  DT  n 
3 12  DT  n 
3 13  DC  n 
3 14  DG  n 
3 15  DG  n 
3 16  MRG n 
3 17  DC  n 
3 18  DG  n 
3 19  DC  n 
3 20  DC  n 
3 21  DG  n 
4 1   DA  n 
4 2   DT  n 
4 3   DG  n 
4 4   DG  n 
4 5   DT  n 
4 6   DC  n 
4 7   DG  n 
4 8   DG  n 
4 9   DC  n 
4 10  DG  n 
4 11  DC  n 
4 12  DC  n 
4 13  DC  n 
4 14  DG  n 
4 15  DA  n 
4 16  DA  n 
4 17  DC  n 
4 18  DA  n 
4 19  DG  n 
4 20  DG  n 
4 21  DG  n 
4 22  DA  n 
4 23  DC  n 
4 24  DT  n 
4 25  DG  n 
4 26  DT  n 
4 27  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 560 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 
'BL21(DE3)-RIL' ? ? ? ? ? ? ? plasmid ? ? ? pCDFDuet1 ? ? 
2 1 sample 'Biological sequence' 1 440 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 
'BL21(DE3)-RIL' ? ? ? ? ? ? ? plasmid ? ? ? pRSFDuet1 ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 21 'Human immunodeficiency virus 1' ? 11676 ? 
4 1 sample 1 27 'Human immunodeficiency virus 1' ? 11676 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POL_HV1H2 P04585 ? 1 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL

;
588 
2 UNP POL_HV1H2 P04585 ? 2 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
588 
3 PDB 5J2M      5J2M   ? 3 ? 1   
4 PDB 5J2M      5J2M   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5J2M A 1 ? 560 ? P04585 588 ? 1147 ? 1   560 
2 2 5J2M B 1 ? 440 ? P04585 588 ? 1027 ? 1   440 
3 3 5J2M P 1 ? 21  ? 5J2M   802 ? 822  ? 802 822 
4 4 5J2M T 1 ? 27  ? 5J2M   701 ? 727  ? 701 727 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5J2M CYS A 258 ? UNP P04585 GLN 845 'engineered mutation' 258 1 
1 5J2M SER A 280 ? UNP P04585 CYS 867 'engineered mutation' 280 2 
2 5J2M SER B 280 ? UNP P04585 CYS 867 'engineered mutation' 280 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
6FN non-polymer         . 
;2'-deoxy-4'-ethynyl-2-fluoroadenosine 5'-(tetrahydrogen triphosphate)
;
? 'C12 H15 F N5 O12 P3' 533.193 
ALA 'L-peptide linking' y ALANINE                                                                 ? 'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                                                                ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                              ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                         ? 'C4 H7 N O4'          133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                ? 'C3 H7 N O2 S'        121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                    ? 'C10 H14 N5 O6 P'     331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                     ? 'C9 H14 N3 O7 P'      307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                    ? 'C10 H14 N5 O7 P'     347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                            ? 'C10 H15 N2 O8 P'     322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                               ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                         ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                                                                 ? 'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE                                                               ? 'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                                                                   ? 'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                              ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                                                                 ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                                                                  ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                                                              ? 'C5 H11 N O2 S'       149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                         ? 'Mg 2'                24.305  
MRG 'DNA linking'       n "N2-(3-MERCAPTOPROPYL)-2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"              ? 'C13 H20 N5 O7 P S'   421.366 
PHE 'L-peptide linking' y PHENYLALANINE                                                           ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                                                                 ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE                                                                  ? 'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE                                                               ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                              ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                                                                ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                                                                  ? 'C5 H11 N O2'         117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5J2M 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.80 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.14 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291.1 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '8% PEG4000, 25mM MES pH 6.0, 5mM magnesium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CMOS 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RDI CMOS_8M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-30 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0001 1.0 
2 1.000  1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 4.2.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   4.2.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.d_resolution_high            2.4320 
_reflns.d_resolution_low             65.230 
_reflns.pdbx_number_measured_all     402756 
_reflns.number_obs                   54563 
_reflns.pdbx_Rmerge_I_obs            0.080 
_reflns.pdbx_netI_over_sigmaI        19.800 
_reflns.pdbx_redundancy              7.400 
_reflns.percent_possible_obs         99.500 
_reflns.pdbx_Rrim_I_all              0.086 
_reflns.pdbx_Rpim_I_all              0.031 
_reflns.pdbx_CC_half                 0.999 
_reflns.B_iso_Wilson_estimate        44.800 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5J2M 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1 2.430  2.500  ? 28728 ? 0 0.948 ? ? ? 6.900 ? 2.000  ? 4170 ? ? ? ? 94.200 1.023 0.380 0.790 
1 2 10.320 65.230 ? 5249  ? 0 0.025 ? ? ? 6.600 ? 62.400 ? 798  ? ? ? ? 98.800 0.028 0.011 0.999 
# 
_refine.entry_id                                 5J2M 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            2.4320 
_refine.ls_d_res_low                             65.2310 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.4900 
_refine.ls_number_reflns_obs                     54531 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2011 
_refine.ls_R_factor_R_work                       0.1994 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2326 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0700 
_refine.ls_number_reflns_R_free                  2765 
_refine.ls_number_reflns_R_work                  51766 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               50.9125 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.3000 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      3KK1 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                151.760 
_refine.B_iso_min                                16.930 
_refine.pdbx_overall_phase_error                 25.3700 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.4320 
_refine_hist.d_res_low                        65.2310 
_refine_hist.pdbx_number_atoms_ligand         36 
_refine_hist.number_atoms_solvent             384 
_refine_hist.number_atoms_total               9107 
_refine_hist.pdbx_number_residues_total       998 
_refine_hist.pdbx_B_iso_mean_ligand           37.35 
_refine_hist.pdbx_B_iso_mean_solvent          46.43 
_refine_hist.pdbx_number_atoms_protein        7823 
_refine_hist.pdbx_number_atoms_nucleic_acid   864 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           9049  0.007  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          12446 0.456  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     1357  0.039  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      1415  0.003  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 5267  15.649 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_obs 
2.4323 2.4742  20 90.0000  2308 . 0.2774 0.3086 . 106 . 2414 . 'X-RAY DIFFRACTION' . 
2.4742 2.5192  20 100.0000 2591 . 0.2699 0.3398 . 122 . 2713 . 'X-RAY DIFFRACTION' . 
2.5192 2.5676  20 100.0000 2575 . 0.2478 0.3281 . 145 . 2720 . 'X-RAY DIFFRACTION' . 
2.5676 2.6201  20 100.0000 2563 . 0.2439 0.2747 . 152 . 2715 . 'X-RAY DIFFRACTION' . 
2.6201 2.6770  20 100.0000 2603 . 0.2409 0.2699 . 119 . 2722 . 'X-RAY DIFFRACTION' . 
2.6770 2.7393  20 100.0000 2570 . 0.2467 0.3088 . 137 . 2707 . 'X-RAY DIFFRACTION' . 
2.7393 2.8078  20 100.0000 2575 . 0.2492 0.2903 . 132 . 2707 . 'X-RAY DIFFRACTION' . 
2.8078 2.8837  20 100.0000 2580 . 0.2491 0.3018 . 146 . 2726 . 'X-RAY DIFFRACTION' . 
2.8837 2.9686  20 100.0000 2573 . 0.2422 0.2717 . 133 . 2706 . 'X-RAY DIFFRACTION' . 
2.9686 3.0644  20 100.0000 2597 . 0.2476 0.2939 . 138 . 2735 . 'X-RAY DIFFRACTION' . 
3.0644 3.1739  20 100.0000 2578 . 0.2431 0.3553 . 130 . 2708 . 'X-RAY DIFFRACTION' . 
3.1739 3.3010  20 100.0000 2596 . 0.2278 0.2495 . 149 . 2745 . 'X-RAY DIFFRACTION' . 
3.3010 3.4512  20 100.0000 2572 . 0.2047 0.2190 . 141 . 2713 . 'X-RAY DIFFRACTION' . 
3.4512 3.6332  20 100.0000 2611 . 0.1983 0.2248 . 163 . 2774 . 'X-RAY DIFFRACTION' . 
3.6332 3.8608  20 100.0000 2557 . 0.1903 0.2159 . 162 . 2719 . 'X-RAY DIFFRACTION' . 
3.8608 4.1588  20 100.0000 2613 . 0.1709 0.2053 . 144 . 2757 . 'X-RAY DIFFRACTION' . 
4.1588 4.5772  20 100.0000 2649 . 0.1616 0.1975 . 117 . 2766 . 'X-RAY DIFFRACTION' . 
4.5772 5.2393  20 100.0000 2647 . 0.1593 0.1877 . 130 . 2777 . 'X-RAY DIFFRACTION' . 
5.2393 6.6000  20 100.0000 2661 . 0.1829 0.2201 . 141 . 2802 . 'X-RAY DIFFRACTION' . 
6.6000 65.2545 20 100.0000 2747 . 0.1669 0.1694 . 158 . 2905 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                     5J2M 
_struct.title                        
'HIV-1 reverse transcriptase in complex with DNA and EFdA-triphosphate, a translocation-defective RT inhibitor' 
_struct.pdbx_descriptor              'Gag-Pol polyprotein, HIV-1 reverse transcriptase p51 subunit/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5J2M 
_struct_keywords.text            
;HIV-1, reverse transcriptase, RT, DNA, double stranded DNA, dsDNA, EFdA, 4'-ethynyl-2-fluoro-2'-deoxyadenosine, EFdA-triphosphate, EFdA-TP, inhibitors, NRTI, TDRTI, translocation defective, transferase-dna complex
;
_struct_keywords.pdbx_keywords   transferase/dna 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 27  ? GLU A 44  ? THR A 27  GLU A 44  1 ? 18 
HELX_P HELX_P2  AA2 PHE A 77  ? THR A 84  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P3  AA3 HIS A 96  ? LEU A 100 ? HIS A 96  LEU A 100 5 ? 5  
HELX_P HELX_P4  AA4 ALA A 114 ? VAL A 118 ? ALA A 114 VAL A 118 5 ? 5  
HELX_P HELX_P5  AA5 ASP A 121 ? ALA A 129 ? ASP A 121 ALA A 129 5 ? 9  
HELX_P HELX_P6  AA6 GLY A 155 ? ASN A 175 ? GLY A 155 ASN A 175 1 ? 21 
HELX_P HELX_P7  AA7 GLU A 194 ? TRP A 212 ? GLU A 194 TRP A 212 1 ? 19 
HELX_P HELX_P8  AA8 PRO A 217 ? HIS A 221 ? PRO A 217 HIS A 221 5 ? 5  
HELX_P HELX_P9  AA9 THR A 253 ? SER A 268 ? THR A 253 SER A 268 1 ? 16 
HELX_P HELX_P10 AB1 VAL A 276 ? LEU A 282 ? VAL A 276 LEU A 282 1 ? 7  
HELX_P HELX_P11 AB2 THR A 296 ? LYS A 311 ? THR A 296 LYS A 311 1 ? 16 
HELX_P HELX_P12 AB3 ASN A 363 ? GLY A 384 ? ASN A 363 GLY A 384 1 ? 22 
HELX_P HELX_P13 AB4 GLN A 394 ? TYR A 405 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P14 AB5 THR A 473 ? SER A 489 ? THR A 473 SER A 489 1 ? 17 
HELX_P HELX_P15 AB6 SER A 499 ? ALA A 508 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P16 AB7 SER A 515 ? LYS A 528 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P17 AB8 GLY A 544 ? ALA A 554 ? GLY A 544 ALA A 554 1 ? 11 
HELX_P HELX_P18 AB9 THR B 27  ? GLU B 44  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P19 AC1 PHE B 77  ? THR B 84  ? PHE B 77  THR B 84  1 ? 8  
HELX_P HELX_P20 AC2 PRO B 97  ? LYS B 103 ? PRO B 97  LYS B 103 5 ? 7  
HELX_P HELX_P21 AC3 GLY B 112 ? VAL B 118 ? GLY B 112 VAL B 118 5 ? 7  
HELX_P HELX_P22 AC4 ASP B 121 ? ALA B 129 ? ASP B 121 ALA B 129 5 ? 9  
HELX_P HELX_P23 AC5 SER B 134 ? GLU B 138 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P24 AC6 LYS B 154 ? PHE B 160 ? LYS B 154 PHE B 160 1 ? 7  
HELX_P HELX_P25 AC7 PHE B 160 ? ASN B 175 ? PHE B 160 ASN B 175 1 ? 16 
HELX_P HELX_P26 AC8 GLY B 196 ? ARG B 211 ? GLY B 196 ARG B 211 1 ? 16 
HELX_P HELX_P27 AC9 HIS B 235 ? TRP B 239 ? HIS B 235 TRP B 239 5 ? 5  
HELX_P HELX_P28 AD1 VAL B 254 ? SER B 268 ? VAL B 254 SER B 268 1 ? 15 
HELX_P HELX_P29 AD2 VAL B 276 ? LYS B 281 ? VAL B 276 LYS B 281 1 ? 6  
HELX_P HELX_P30 AD3 LEU B 282 ? ARG B 284 ? LEU B 282 ARG B 284 5 ? 3  
HELX_P HELX_P31 AD4 THR B 296 ? GLU B 312 ? THR B 296 GLU B 312 1 ? 17 
HELX_P HELX_P32 AD5 ASN B 363 ? GLY B 384 ? ASN B 363 GLY B 384 1 ? 22 
HELX_P HELX_P33 AD6 GLN B 394 ? TRP B 402 ? GLN B 394 TRP B 402 1 ? 9  
HELX_P HELX_P34 AD7 THR B 403 ? TYR B 405 ? THR B 403 TYR B 405 5 ? 3  
HELX_P HELX_P35 AD8 PRO B 420 ? TYR B 427 ? PRO B 420 TYR B 427 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ?    ? A CYS 258 SG    ? ? ? 1_555 C MRG 16 S24 ? ? A CYS 258 P MRG 817 1_555 ? ? ? ? ? ? ?            1.985 ? 
metalc1  metalc ?    ? A ASP 110 OD1   ? ? ? 1_555 E MG  .  MG  ? ? A ASP 110 A MG  601 1_555 ? ? ? ? ? ? ?            2.779 ? 
metalc2  metalc ?    ? A ASP 110 OD1   ? ? ? 1_555 G MG  .  MG  ? ? A ASP 110 A MG  603 1_555 ? ? ? ? ? ? ?            2.437 ? 
metalc3  metalc ?    ? A ASP 110 OD2   ? ? ? 1_555 E MG  .  MG  ? ? A ASP 110 A MG  601 1_555 ? ? ? ? ? ? ?            1.999 ? 
metalc4  metalc ?    ? A VAL 111 O     ? ? ? 1_555 E MG  .  MG  ? ? A VAL 111 A MG  601 1_555 ? ? ? ? ? ? ?            2.115 ? 
metalc5  metalc ?    ? A ASP 185 OD1   ? ? ? 1_555 E MG  .  MG  ? ? A ASP 185 A MG  601 1_555 ? ? ? ? ? ? ?            2.121 ? 
metalc6  metalc ?    ? A ASP 185 OD2   ? ? ? 1_555 G MG  .  MG  ? ? A ASP 185 A MG  603 1_555 ? ? ? ? ? ? ?            2.267 ? 
metalc7  metalc ?    ? A ASP 443 OD1   ? ? ? 1_555 F MG  .  MG  ? ? A ASP 443 A MG  602 1_555 ? ? ? ? ? ? ?            2.091 ? 
metalc8  metalc ?    ? A GLU 478 OE2   ? ? ? 1_555 F MG  .  MG  ? ? A GLU 478 A MG  602 1_555 ? ? ? ? ? ? ?            2.198 ? 
metalc9  metalc ?    ? A ASP 498 OD1   ? ? ? 1_555 F MG  .  MG  ? ? A ASP 498 A MG  602 1_555 ? ? ? ? ? ? ?            2.050 ? 
metalc10 metalc ?    ? A ASP 498 OD2   ? ? ? 1_555 F MG  .  MG  ? ? A ASP 498 A MG  602 1_555 ? ? ? ? ? ? ?            2.205 ? 
covale1  covale both ? C DG  15  "O3'" ? ? ? 1_555 C MRG 16 P   ? ? P DG  816 P MRG 817 1_555 ? ? ? ? ? ? ?            1.608 ? 
covale2  covale both ? C MRG 16  "O3'" ? ? ? 1_555 C DC  17 P   ? ? P MRG 817 P DC  818 1_555 ? ? ? ? ? ? ?            1.607 ? 
metalc11 metalc ?    ? E MG  .   MG    ? ? ? 1_555 H 6FN .  O1A ? ? A MG  601 A 6FN 604 1_555 ? ? ? ? ? ? ?            2.142 ? 
metalc12 metalc ?    ? E MG  .   MG    ? ? ? 1_555 H 6FN .  O1G ? ? A MG  601 A 6FN 604 1_555 ? ? ? ? ? ? ?            2.412 ? 
metalc13 metalc ?    ? E MG  .   MG    ? ? ? 1_555 H 6FN .  O2B ? ? A MG  601 A 6FN 604 1_555 ? ? ? ? ? ? ?            2.275 ? 
metalc14 metalc ?    ? F MG  .   MG    ? ? ? 1_555 I HOH .  O   ? ? A MG  602 A HOH 723 1_555 ? ? ? ? ? ? ?            2.079 ? 
metalc15 metalc ?    ? F MG  .   MG    ? ? ? 1_555 I HOH .  O   ? ? A MG  602 A HOH 729 1_555 ? ? ? ? ? ? ?            2.071 ? 
metalc16 metalc ?    ? F MG  .   MG    ? ? ? 1_555 I HOH .  O   ? ? A MG  602 A HOH 738 1_555 ? ? ? ? ? ? ?            2.073 ? 
metalc17 metalc ?    ? G MG  .   MG    ? ? ? 1_555 I HOH .  O   ? ? A MG  603 A HOH 816 1_555 ? ? ? ? ? ? ?            2.101 ? 
hydrog1  hydrog ?    ? C DG  4   N1    ? ? ? 1_555 D DC  23 N3  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? C DG  4   N2    ? ? ? 1_555 D DC  23 O2  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? C DG  4   O6    ? ? ? 1_555 D DC  23 N4  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? C DT  5   N3    ? ? ? 1_555 D DA  22 N1  ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? C DT  5   O4    ? ? ? 1_555 D DA  22 N6  ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? C DC  6   N3    ? ? ? 1_555 D DG  21 N1  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? C DC  6   N4    ? ? ? 1_555 D DG  21 O6  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? C DC  6   O2    ? ? ? 1_555 D DG  21 N2  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? C DC  7   N3    ? ? ? 1_555 D DG  20 N1  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? C DC  7   N4    ? ? ? 1_555 D DG  20 O6  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? C DC  7   O2    ? ? ? 1_555 D DG  20 N2  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? C DC  8   N3    ? ? ? 1_555 D DG  19 N1  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? C DC  8   N4    ? ? ? 1_555 D DG  19 O6  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? C DC  8   O2    ? ? ? 1_555 D DG  19 N2  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? C DT  9   N3    ? ? ? 1_555 D DA  18 N1  ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? C DT  9   O4    ? ? ? 1_555 D DA  18 N6  ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? C DG  10  N1    ? ? ? 1_555 D DC  17 N3  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? C DG  10  N2    ? ? ? 1_555 D DC  17 O2  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? C DG  10  O6    ? ? ? 1_555 D DC  17 N4  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? C DT  11  N3    ? ? ? 1_555 D DA  16 N1  ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? C DT  11  O4    ? ? ? 1_555 D DA  16 N6  ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? C DT  12  N3    ? ? ? 1_555 D DA  15 N1  ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? C DT  12  O4    ? ? ? 1_555 D DA  15 N6  ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? C DC  13  N3    ? ? ? 1_555 D DG  14 N1  ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? C DC  13  N4    ? ? ? 1_555 D DG  14 O6  ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? C DC  13  O2    ? ? ? 1_555 D DG  14 N2  ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? C DG  14  N1    ? ? ? 1_555 D DC  13 N3  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? C DG  14  N2    ? ? ? 1_555 D DC  13 O2  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? C DG  14  O6    ? ? ? 1_555 D DC  13 N4  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? C DG  15  N1    ? ? ? 1_555 D DC  12 N3  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? C DG  15  N2    ? ? ? 1_555 D DC  12 O2  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? C DG  15  O6    ? ? ? 1_555 D DC  12 N4  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? C MRG 16  N1    ? ? ? 1_555 D DC  11 N3  ? ? P MRG 817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? C MRG 16  N2    ? ? ? 1_555 D DC  11 O2  ? ? P MRG 817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? C MRG 16  O6    ? ? ? 1_555 D DC  11 N4  ? ? P MRG 817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? C DC  17  N3    ? ? ? 1_555 D DG  10 N1  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? C DC  17  N4    ? ? ? 1_555 D DG  10 O6  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? C DC  17  O2    ? ? ? 1_555 D DG  10 N2  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? C DG  18  N1    ? ? ? 1_555 D DC  9  N3  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? C DG  18  N2    ? ? ? 1_555 D DC  9  O2  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? C DG  18  O6    ? ? ? 1_555 D DC  9  N4  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? C DC  19  N3    ? ? ? 1_555 D DG  8  N1  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? C DC  19  N4    ? ? ? 1_555 D DG  8  O6  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? C DC  19  O2    ? ? ? 1_555 D DG  8  N2  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? C DC  20  N3    ? ? ? 1_555 D DG  7  N1  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? C DC  20  N4    ? ? ? 1_555 D DG  7  O6  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? C DC  20  O2    ? ? ? 1_555 D DG  7  N2  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? C DG  21  N1    ? ? ? 1_555 D DC  6  N3  ? ? P DG  822 T DC  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? C DG  21  N2    ? ? ? 1_555 D DC  6  O2  ? ? P DG  822 T DC  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? C DG  21  O6    ? ? ? 1_555 D DC  6  N4  ? ? P DG  822 T DC  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 225 A . ? PRO 225 A PRO 226 A ? PRO 226 A 1 -1.14 
2 PRO 420 A . ? PRO 420 A PRO 421 A ? PRO 421 A 1 0.61  
3 GLY 543 A . ? GLY 543 A GLY 544 A ? GLY 544 A 1 -0.09 
4 GLY 213 B . ? GLY 213 B LEU 214 B ? LEU 214 B 1 0.21  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 3 ? 
AA5 ? 5 ? 
AA6 ? 2 ? 
AA7 ? 5 ? 
AA8 ? 3 ? 
AA9 ? 2 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
AB3 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB3 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 47  ? LYS A 49  ? ILE A 47  LYS A 49  
AA1 2 ILE A 142 ? TYR A 146 ? ILE A 142 TYR A 146 
AA1 3 PHE A 130 ? ILE A 132 ? PHE A 130 ILE A 132 
AA2 1 VAL A 60  ? LYS A 64  ? VAL A 60  LYS A 64  
AA2 2 TRP A 71  ? VAL A 75  ? TRP A 71  VAL A 75  
AA3 1 SER A 105 ? ASP A 110 ? SER A 105 ASP A 110 
AA3 2 ASP A 186 ? SER A 191 ? ASP A 186 SER A 191 
AA3 3 VAL A 179 ? TYR A 183 ? VAL A 179 TYR A 183 
AA4 1 PHE A 227 ? TRP A 229 ? PHE A 227 TRP A 229 
AA4 2 TYR A 232 ? LEU A 234 ? TYR A 232 LEU A 234 
AA4 3 TRP A 239 ? VAL A 241 ? TRP A 239 VAL A 241 
AA5 1 LYS A 347 ? TYR A 354 ? LYS A 347 TYR A 354 
AA5 2 GLN A 336 ? GLU A 344 ? GLN A 336 GLU A 344 
AA5 3 ILE A 326 ? GLN A 332 ? ILE A 326 GLN A 332 
AA5 4 LYS A 388 ? LEU A 391 ? LYS A 388 LEU A 391 
AA5 5 TRP A 414 ? PHE A 416 ? TRP A 414 PHE A 416 
AA6 1 HIS A 361 ? THR A 362 ? HIS A 361 THR A 362 
AA6 2 GLN A 512 ? SER A 513 ? GLN A 512 SER A 513 
AA7 1 GLN A 464 ? LEU A 469 ? GLN A 464 LEU A 469 
AA7 2 GLY A 453 ? THR A 459 ? GLY A 453 THR A 459 
AA7 3 GLU A 438 ? ALA A 446 ? GLU A 438 ALA A 446 
AA7 4 GLU A 492 ? THR A 497 ? GLU A 492 THR A 497 
AA7 5 LYS A 530 ? TRP A 535 ? LYS A 530 TRP A 535 
AA8 1 ILE B 47  ? ILE B 50  ? ILE B 47  ILE B 50  
AA8 2 ILE B 142 ? TYR B 146 ? ILE B 142 TYR B 146 
AA8 3 PHE B 130 ? ILE B 132 ? PHE B 130 ILE B 132 
AA9 1 VAL B 60  ? LYS B 64  ? VAL B 60  LYS B 64  
AA9 2 TRP B 71  ? VAL B 75  ? TRP B 71  VAL B 75  
AB1 1 SER B 105 ? ASP B 110 ? SER B 105 ASP B 110 
AB1 2 ASP B 186 ? SER B 191 ? ASP B 186 SER B 191 
AB1 3 VAL B 179 ? TYR B 183 ? VAL B 179 TYR B 183 
AB2 1 TRP B 252 ? THR B 253 ? TRP B 252 THR B 253 
AB2 2 VAL B 292 ? ILE B 293 ? VAL B 292 ILE B 293 
AB3 1 ASN B 348 ? ALA B 355 ? ASN B 348 ALA B 355 
AB3 2 GLN B 336 ? TYR B 342 ? GLN B 336 TYR B 342 
AB3 3 ILE B 326 ? GLY B 333 ? ILE B 326 GLY B 333 
AB3 4 LYS B 388 ? LEU B 391 ? LYS B 388 LEU B 391 
AB3 5 TRP B 414 ? PHE B 416 ? TRP B 414 PHE B 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 48  ? N SER A 48  O GLN A 145 ? O GLN A 145 
AA1 2 3 O TYR A 144 ? O TYR A 144 N PHE A 130 ? N PHE A 130 
AA2 1 2 N PHE A 61  ? N PHE A 61  O LEU A 74  ? O LEU A 74  
AA3 1 2 N THR A 107 ? N THR A 107 O VAL A 189 ? O VAL A 189 
AA3 2 3 O ASP A 186 ? O ASP A 186 N TYR A 183 ? N TYR A 183 
AA4 1 2 N PHE A 227 ? N PHE A 227 O LEU A 234 ? O LEU A 234 
AA4 2 3 N GLU A 233 ? N GLU A 233 O THR A 240 ? O THR A 240 
AA5 1 2 O LEU A 349 ? O LEU A 349 N ILE A 341 ? N ILE A 341 
AA5 2 3 O THR A 338 ? O THR A 338 N GLN A 330 ? N GLN A 330 
AA5 3 4 N ALA A 327 ? N ALA A 327 O LYS A 388 ? O LYS A 388 
AA5 4 5 N LEU A 391 ? N LEU A 391 O GLU A 415 ? O GLU A 415 
AA6 1 2 N THR A 362 ? N THR A 362 O GLN A 512 ? O GLN A 512 
AA7 1 2 O VAL A 467 ? O VAL A 467 N ALA A 455 ? N ALA A 455 
AA7 2 3 O VAL A 458 ? O VAL A 458 N TYR A 441 ? N TYR A 441 
AA7 3 4 N PHE A 440 ? N PHE A 440 O ASN A 494 ? O ASN A 494 
AA7 4 5 N ILE A 495 ? N ILE A 495 O TYR A 532 ? O TYR A 532 
AA8 1 2 N SER B 48  ? N SER B 48  O GLN B 145 ? O GLN B 145 
AA8 2 3 O ILE B 142 ? O ILE B 142 N ILE B 132 ? N ILE B 132 
AA9 1 2 N ILE B 63  ? N ILE B 63  O ARG B 72  ? O ARG B 72  
AB1 1 2 N THR B 107 ? N THR B 107 O VAL B 189 ? O VAL B 189 
AB1 2 3 O TYR B 188 ? O TYR B 188 N TYR B 181 ? N TYR B 181 
AB2 1 2 N TRP B 252 ? N TRP B 252 O ILE B 293 ? O ILE B 293 
AB3 1 2 O LEU B 349 ? O LEU B 349 N ILE B 341 ? N ILE B 341 
AB3 2 3 O TYR B 342 ? O TYR B 342 N ILE B 326 ? N ILE B 326 
AB3 3 4 N ALA B 327 ? N ALA B 327 O LYS B 390 ? O LYS B 390 
AB3 4 5 N LEU B 391 ? N LEU B 391 O GLU B 415 ? O GLU B 415 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG 601 ? 3 'binding site for residue MG A 601' 
AC2 Software A MG 602 ? 6 'binding site for residue MG A 602' 
AC3 Software A MG 603 ? 4 'binding site for residue MG A 603' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 ASP A 110 ? ASP A 110 . ? 1_555 ? 
2  AC1 3 VAL A 111 ? VAL A 111 . ? 1_555 ? 
3  AC1 3 ASP A 185 ? ASP A 185 . ? 1_555 ? 
4  AC2 6 ASP A 443 ? ASP A 443 . ? 1_555 ? 
5  AC2 6 GLU A 478 ? GLU A 478 . ? 1_555 ? 
6  AC2 6 ASP A 498 ? ASP A 498 . ? 1_555 ? 
7  AC2 6 HOH I .   ? HOH A 723 . ? 1_555 ? 
8  AC2 6 HOH I .   ? HOH A 729 . ? 1_555 ? 
9  AC2 6 HOH I .   ? HOH A 738 . ? 1_555 ? 
10 AC3 4 ASP A 110 ? ASP A 110 . ? 1_555 ? 
11 AC3 4 ASP A 185 ? ASP A 185 . ? 1_555 ? 
12 AC3 4 HOH I .   ? HOH A 816 . ? 1_555 ? 
13 AC3 4 DG  C 21  ? DG  P 822 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5J2M 
_atom_sites.fract_transf_matrix[1][1]   0.005971 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005891 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009809 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
F  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 1   ? -44.552 10.614  -15.599 1.00 49.41  ? 1   PRO A N     1 
ATOM   2    C  CA    . PRO A 1 1   ? -43.335 11.075  -14.921 1.00 48.36  ? 1   PRO A CA    1 
ATOM   3    C  C     . PRO A 1 1   ? -42.153 10.139  -15.149 1.00 49.76  ? 1   PRO A C     1 
ATOM   4    O  O     . PRO A 1 1   ? -42.245 9.222   -15.965 1.00 46.65  ? 1   PRO A O     1 
ATOM   5    C  CB    . PRO A 1 1   ? -43.739 11.087  -13.443 1.00 44.39  ? 1   PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 1   ? -45.223 11.218  -13.455 1.00 53.88  ? 1   PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 1   ? -45.681 10.459  -14.665 1.00 54.85  ? 1   PRO A CD    1 
ATOM   8    N  N     . ILE A 1 2   ? -41.056 10.374  -14.434 1.00 42.43  ? 2   ILE A N     1 
ATOM   9    C  CA    . ILE A 1 2   ? -39.864 9.537   -14.502 1.00 39.88  ? 2   ILE A CA    1 
ATOM   10   C  C     . ILE A 1 2   ? -39.682 8.864   -13.149 1.00 44.58  ? 2   ILE A C     1 
ATOM   11   O  O     . ILE A 1 2   ? -39.782 9.519   -12.104 1.00 39.65  ? 2   ILE A O     1 
ATOM   12   C  CB    . ILE A 1 2   ? -38.619 10.352  -14.892 1.00 44.19  ? 2   ILE A CB    1 
ATOM   13   C  CG1   . ILE A 1 2   ? -38.814 10.981  -16.272 1.00 38.42  ? 2   ILE A CG1   1 
ATOM   14   C  CG2   . ILE A 1 2   ? -37.378 9.471   -14.884 1.00 33.11  ? 2   ILE A CG2   1 
ATOM   15   C  CD1   . ILE A 1 2   ? -37.616 11.764  -16.761 1.00 36.88  ? 2   ILE A CD1   1 
ATOM   16   N  N     . SER A 1 3   ? -39.420 7.561   -13.171 1.00 34.78  ? 3   SER A N     1 
ATOM   17   C  CA    . SER A 1 3   ? -39.342 6.794   -11.937 1.00 34.72  ? 3   SER A CA    1 
ATOM   18   C  C     . SER A 1 3   ? -38.158 7.259   -11.093 1.00 36.09  ? 3   SER A C     1 
ATOM   19   O  O     . SER A 1 3   ? -37.064 7.481   -11.624 1.00 33.53  ? 3   SER A O     1 
ATOM   20   C  CB    . SER A 1 3   ? -39.209 5.301   -12.244 1.00 31.98  ? 3   SER A CB    1 
ATOM   21   O  OG    . SER A 1 3   ? -39.138 4.542   -11.049 1.00 35.34  ? 3   SER A OG    1 
ATOM   22   N  N     . PRO A 1 4   ? -38.338 7.425   -9.782  1.00 29.43  ? 4   PRO A N     1 
ATOM   23   C  CA    . PRO A 1 4   ? -37.207 7.725   -8.897  1.00 29.73  ? 4   PRO A CA    1 
ATOM   24   C  C     . PRO A 1 4   ? -36.341 6.523   -8.555  1.00 29.45  ? 4   PRO A C     1 
ATOM   25   O  O     . PRO A 1 4   ? -35.498 6.629   -7.659  1.00 34.01  ? 4   PRO A O     1 
ATOM   26   C  CB    . PRO A 1 4   ? -37.900 8.269   -7.639  1.00 28.02  ? 4   PRO A CB    1 
ATOM   27   C  CG    . PRO A 1 4   ? -39.217 7.583   -7.622  1.00 31.04  ? 4   PRO A CG    1 
ATOM   28   C  CD    . PRO A 1 4   ? -39.625 7.445   -9.065  1.00 27.61  ? 4   PRO A CD    1 
ATOM   29   N  N     . ILE A 1 5   ? -36.528 5.388   -9.233  1.00 39.00  ? 5   ILE A N     1 
ATOM   30   C  CA    . ILE A 1 5   ? -35.697 4.219   -8.982  1.00 35.45  ? 5   ILE A CA    1 
ATOM   31   C  C     . ILE A 1 5   ? -34.271 4.503   -9.442  1.00 35.01  ? 5   ILE A C     1 
ATOM   32   O  O     . ILE A 1 5   ? -34.032 5.309   -10.352 1.00 35.30  ? 5   ILE A O     1 
ATOM   33   C  CB    . ILE A 1 5   ? -36.283 2.980   -9.686  1.00 36.95  ? 5   ILE A CB    1 
ATOM   34   C  CG1   . ILE A 1 5   ? -35.678 1.692   -9.121  1.00 40.26  ? 5   ILE A CG1   1 
ATOM   35   C  CG2   . ILE A 1 5   ? -36.062 3.057   -11.191 1.00 28.35  ? 5   ILE A CG2   1 
ATOM   36   C  CD1   . ILE A 1 5   ? -36.233 0.427   -9.750  1.00 38.87  ? 5   ILE A CD1   1 
ATOM   37   N  N     . GLU A 1 6   ? -33.309 3.852   -8.794  1.00 34.65  ? 6   GLU A N     1 
ATOM   38   C  CA    . GLU A 1 6   ? -31.914 4.043   -9.160  1.00 32.41  ? 6   GLU A CA    1 
ATOM   39   C  C     . GLU A 1 6   ? -31.640 3.471   -10.546 1.00 37.27  ? 6   GLU A C     1 
ATOM   40   O  O     . GLU A 1 6   ? -32.244 2.480   -10.967 1.00 33.58  ? 6   GLU A O     1 
ATOM   41   C  CB    . GLU A 1 6   ? -30.988 3.386   -8.136  1.00 42.58  ? 6   GLU A CB    1 
ATOM   42   C  CG    . GLU A 1 6   ? -30.997 4.044   -6.767  1.00 53.24  ? 6   GLU A CG    1 
ATOM   43   C  CD    . GLU A 1 6   ? -32.010 3.424   -5.825  1.00 65.74  ? 6   GLU A CD    1 
ATOM   44   O  OE1   . GLU A 1 6   ? -31.642 3.131   -4.668  1.00 71.46  ? 6   GLU A OE1   1 
ATOM   45   O  OE2   . GLU A 1 6   ? -33.170 3.220   -6.244  1.00 56.11  ? 6   GLU A OE2   1 
ATOM   46   N  N     . THR A 1 7   ? -30.722 4.114   -11.260 1.00 32.53  ? 7   THR A N     1 
ATOM   47   C  CA    . THR A 1 7   ? -30.317 3.637   -12.571 1.00 33.07  ? 7   THR A CA    1 
ATOM   48   C  C     . THR A 1 7   ? -29.398 2.430   -12.435 1.00 38.39  ? 7   THR A C     1 
ATOM   49   O  O     . THR A 1 7   ? -28.724 2.243   -11.418 1.00 40.90  ? 7   THR A O     1 
ATOM   50   C  CB    . THR A 1 7   ? -29.605 4.739   -13.356 1.00 38.76  ? 7   THR A CB    1 
ATOM   51   O  OG1   . THR A 1 7   ? -28.408 5.122   -12.667 1.00 31.28  ? 7   THR A OG1   1 
ATOM   52   C  CG2   . THR A 1 7   ? -30.508 5.952   -13.508 1.00 33.71  ? 7   THR A CG2   1 
ATOM   53   N  N     . VAL A 1 8   ? -29.383 1.603   -13.473 1.00 30.09  ? 8   VAL A N     1 
ATOM   54   C  CA    . VAL A 1 8   ? -28.495 0.447   -13.542 1.00 30.67  ? 8   VAL A CA    1 
ATOM   55   C  C     . VAL A 1 8   ? -27.211 0.886   -14.240 1.00 35.39  ? 8   VAL A C     1 
ATOM   56   O  O     . VAL A 1 8   ? -27.282 1.404   -15.366 1.00 37.93  ? 8   VAL A O     1 
ATOM   57   C  CB    . VAL A 1 8   ? -29.151 -0.722  -14.285 1.00 34.12  ? 8   VAL A CB    1 
ATOM   58   C  CG1   . VAL A 1 8   ? -28.138 -1.829  -14.525 1.00 32.19  ? 8   VAL A CG1   1 
ATOM   59   C  CG2   . VAL A 1 8   ? -30.343 -1.248  -13.499 1.00 37.84  ? 8   VAL A CG2   1 
ATOM   60   N  N     . PRO A 1 9   ? -26.043 0.715   -13.622 1.00 40.23  ? 9   PRO A N     1 
ATOM   61   C  CA    . PRO A 1 9   ? -24.794 1.125   -14.279 1.00 42.14  ? 9   PRO A CA    1 
ATOM   62   C  C     . PRO A 1 9   ? -24.491 0.235   -15.475 1.00 38.73  ? 9   PRO A C     1 
ATOM   63   O  O     . PRO A 1 9   ? -24.546 -0.994  -15.384 1.00 41.48  ? 9   PRO A O     1 
ATOM   64   C  CB    . PRO A 1 9   ? -23.742 0.970   -13.175 1.00 27.30  ? 9   PRO A CB    1 
ATOM   65   C  CG    . PRO A 1 9   ? -24.321 -0.049  -12.246 1.00 44.46  ? 9   PRO A CG    1 
ATOM   66   C  CD    . PRO A 1 9   ? -25.809 0.167   -12.274 1.00 32.87  ? 9   PRO A CD    1 
ATOM   67   N  N     . VAL A 1 10  ? -24.176 0.868   -16.602 1.00 41.85  ? 10  VAL A N     1 
ATOM   68   C  CA    . VAL A 1 10  ? -23.894 0.175   -17.853 1.00 44.18  ? 10  VAL A CA    1 
ATOM   69   C  C     . VAL A 1 10  ? -22.647 0.785   -18.477 1.00 44.54  ? 10  VAL A C     1 
ATOM   70   O  O     . VAL A 1 10  ? -22.497 2.011   -18.515 1.00 57.80  ? 10  VAL A O     1 
ATOM   71   C  CB    . VAL A 1 10  ? -25.088 0.251   -18.829 1.00 51.44  ? 10  VAL A CB    1 
ATOM   72   C  CG1   . VAL A 1 10  ? -24.701 -0.285  -20.199 1.00 60.06  ? 10  VAL A CG1   1 
ATOM   73   C  CG2   . VAL A 1 10  ? -26.280 -0.519  -18.278 1.00 55.28  ? 10  VAL A CG2   1 
ATOM   74   N  N     . LYS A 1 11  ? -21.753 -0.073  -18.962 1.00 49.41  ? 11  LYS A N     1 
ATOM   75   C  CA    . LYS A 1 11  ? -20.528 0.349   -19.620 1.00 47.69  ? 11  LYS A CA    1 
ATOM   76   C  C     . LYS A 1 11  ? -20.505 -0.167  -21.052 1.00 51.96  ? 11  LYS A C     1 
ATOM   77   O  O     . LYS A 1 11  ? -21.268 -1.061  -21.427 1.00 55.60  ? 11  LYS A O     1 
ATOM   78   C  CB    . LYS A 1 11  ? -19.287 -0.160  -18.875 1.00 43.49  ? 11  LYS A CB    1 
ATOM   79   C  CG    . LYS A 1 11  ? -19.250 0.187   -17.397 1.00 68.83  ? 11  LYS A CG    1 
ATOM   80   C  CD    . LYS A 1 11  ? -18.077 -0.485  -16.689 1.00 83.85  ? 11  LYS A CD    1 
ATOM   81   C  CE    . LYS A 1 11  ? -18.383 -1.934  -16.314 1.00 83.05  ? 11  LYS A CE    1 
ATOM   82   N  NZ    . LYS A 1 11  ? -18.388 -2.867  -17.478 1.00 71.85  ? 11  LYS A NZ    1 
ATOM   83   N  N     . LEU A 1 12  ? -19.618 0.414   -21.854 1.00 54.24  ? 12  LEU A N     1 
ATOM   84   C  CA    . LEU A 1 12  ? -19.329 -0.127  -23.170 1.00 48.28  ? 12  LEU A CA    1 
ATOM   85   C  C     . LEU A 1 12  ? -18.287 -1.237  -23.058 1.00 43.48  ? 12  LEU A C     1 
ATOM   86   O  O     . LEU A 1 12  ? -17.631 -1.410  -22.027 1.00 45.52  ? 12  LEU A O     1 
ATOM   87   C  CB    . LEU A 1 12  ? -18.833 0.971   -24.111 1.00 45.61  ? 12  LEU A CB    1 
ATOM   88   C  CG    . LEU A 1 12  ? -19.833 2.034   -24.568 1.00 47.16  ? 12  LEU A CG    1 
ATOM   89   C  CD1   . LEU A 1 12  ? -19.139 3.076   -25.430 1.00 44.26  ? 12  LEU A CD1   1 
ATOM   90   C  CD2   . LEU A 1 12  ? -20.983 1.395   -25.325 1.00 39.45  ? 12  LEU A CD2   1 
ATOM   91   N  N     . LYS A 1 13  ? -18.142 -2.001  -24.135 1.00 45.47  ? 13  LYS A N     1 
ATOM   92   C  CA    . LYS A 1 13  ? -17.085 -2.996  -24.186 1.00 56.56  ? 13  LYS A CA    1 
ATOM   93   C  C     . LYS A 1 13  ? -15.725 -2.299  -24.211 1.00 54.13  ? 13  LYS A C     1 
ATOM   94   O  O     . LYS A 1 13  ? -15.617 -1.151  -24.648 1.00 60.71  ? 13  LYS A O     1 
ATOM   95   C  CB    . LYS A 1 13  ? -17.247 -3.890  -25.414 1.00 52.48  ? 13  LYS A CB    1 
ATOM   96   C  CG    . LYS A 1 13  ? -18.441 -4.831  -25.341 1.00 54.55  ? 13  LYS A CG    1 
ATOM   97   C  CD    . LYS A 1 13  ? -18.521 -5.718  -26.574 1.00 61.80  ? 13  LYS A CD    1 
ATOM   98   C  CE    . LYS A 1 13  ? -19.678 -6.699  -26.481 1.00 52.59  ? 13  LYS A CE    1 
ATOM   99   N  NZ    . LYS A 1 13  ? -19.536 -7.623  -25.321 1.00 60.68  ? 13  LYS A NZ    1 
ATOM   100  N  N     . PRO A 1 14  ? -14.676 -2.962  -23.721 1.00 57.28  ? 14  PRO A N     1 
ATOM   101  C  CA    . PRO A 1 14  ? -13.358 -2.314  -23.663 1.00 49.81  ? 14  PRO A CA    1 
ATOM   102  C  C     . PRO A 1 14  ? -12.868 -1.896  -25.042 1.00 54.26  ? 14  PRO A C     1 
ATOM   103  O  O     . PRO A 1 14  ? -13.040 -2.613  -26.030 1.00 48.55  ? 14  PRO A O     1 
ATOM   104  C  CB    . PRO A 1 14  ? -12.460 -3.394  -23.051 1.00 55.01  ? 14  PRO A CB    1 
ATOM   105  C  CG    . PRO A 1 14  ? -13.393 -4.257  -22.273 1.00 52.05  ? 14  PRO A CG    1 
ATOM   106  C  CD    . PRO A 1 14  ? -14.672 -4.277  -23.057 1.00 63.14  ? 14  PRO A CD    1 
ATOM   107  N  N     . GLY A 1 15  ? -12.255 -0.715  -25.097 1.00 60.94  ? 15  GLY A N     1 
ATOM   108  C  CA    . GLY A 1 15  ? -11.712 -0.205  -26.342 1.00 61.94  ? 15  GLY A CA    1 
ATOM   109  C  C     . GLY A 1 15  ? -12.746 0.132   -27.391 1.00 67.86  ? 15  GLY A C     1 
ATOM   110  O  O     . GLY A 1 15  ? -12.455 0.040   -28.588 1.00 69.43  ? 15  GLY A O     1 
ATOM   111  N  N     . MET A 1 16  ? -13.947 0.527   -26.977 1.00 60.60  ? 16  MET A N     1 
ATOM   112  C  CA    . MET A 1 16  ? -15.036 0.825   -27.894 1.00 48.93  ? 16  MET A CA    1 
ATOM   113  C  C     . MET A 1 16  ? -15.543 2.242   -27.662 1.00 55.46  ? 16  MET A C     1 
ATOM   114  O  O     . MET A 1 16  ? -15.415 2.794   -26.565 1.00 52.24  ? 16  MET A O     1 
ATOM   115  C  CB    . MET A 1 16  ? -16.187 -0.175  -27.727 1.00 65.01  ? 16  MET A CB    1 
ATOM   116  C  CG    . MET A 1 16  ? -15.755 -1.631  -27.826 1.00 59.99  ? 16  MET A CG    1 
ATOM   117  S  SD    . MET A 1 16  ? -15.424 -2.176  -29.512 1.00 72.53  ? 16  MET A SD    1 
ATOM   118  C  CE    . MET A 1 16  ? -16.918 -3.101  -29.858 1.00 57.26  ? 16  MET A CE    1 
ATOM   119  N  N     . ASP A 1 17  ? -16.121 2.826   -28.709 1.00 54.93  ? 17  ASP A N     1 
ATOM   120  C  CA    . ASP A 1 17  ? -16.670 4.171   -28.656 1.00 58.84  ? 17  ASP A CA    1 
ATOM   121  C  C     . ASP A 1 17  ? -18.107 4.146   -29.158 1.00 55.92  ? 17  ASP A C     1 
ATOM   122  O  O     . ASP A 1 17  ? -18.548 3.181   -29.787 1.00 58.03  ? 17  ASP A O     1 
ATOM   123  C  CB    . ASP A 1 17  ? -15.827 5.153   -29.488 1.00 59.72  ? 17  ASP A CB    1 
ATOM   124  C  CG    . ASP A 1 17  ? -16.147 6.603   -29.182 1.00 60.85  ? 17  ASP A CG    1 
ATOM   125  O  OD1   . ASP A 1 17  ? -16.039 7.443   -30.101 1.00 64.07  ? 17  ASP A OD1   1 
ATOM   126  O  OD2   . ASP A 1 17  ? -16.508 6.903   -28.024 1.00 54.36  ? 17  ASP A OD2   1 
ATOM   127  N  N     . GLY A 1 18  ? -18.838 5.221   -28.872 1.00 59.06  ? 18  GLY A N     1 
ATOM   128  C  CA    . GLY A 1 18  ? -20.222 5.332   -29.266 1.00 54.17  ? 18  GLY A CA    1 
ATOM   129  C  C     . GLY A 1 18  ? -20.408 5.335   -30.770 1.00 53.95  ? 18  GLY A C     1 
ATOM   130  O  O     . GLY A 1 18  ? -19.459 5.516   -31.540 1.00 53.52  ? 18  GLY A O     1 
ATOM   131  N  N     . PRO A 1 19  ? -21.645 5.137   -31.217 1.00 54.07  ? 19  PRO A N     1 
ATOM   132  C  CA    . PRO A 1 19  ? -21.909 5.048   -32.655 1.00 48.41  ? 19  PRO A CA    1 
ATOM   133  C  C     . PRO A 1 19  ? -21.903 6.411   -33.328 1.00 58.61  ? 19  PRO A C     1 
ATOM   134  O  O     . PRO A 1 19  ? -22.183 7.443   -32.714 1.00 55.34  ? 19  PRO A O     1 
ATOM   135  C  CB    . PRO A 1 19  ? -23.305 4.419   -32.711 1.00 51.34  ? 19  PRO A CB    1 
ATOM   136  C  CG    . PRO A 1 19  ? -23.960 4.894   -31.459 1.00 47.06  ? 19  PRO A CG    1 
ATOM   137  C  CD    . PRO A 1 19  ? -22.870 4.960   -30.416 1.00 50.17  ? 19  PRO A CD    1 
ATOM   138  N  N     . LYS A 1 20  ? -21.576 6.397   -34.629 1.00 63.37  ? 20  LYS A N     1 
ATOM   139  C  CA    . LYS A 1 20  ? -21.563 7.602   -35.464 1.00 53.26  ? 20  LYS A CA    1 
ATOM   140  C  C     . LYS A 1 20  ? -22.202 7.232   -36.804 1.00 59.93  ? 20  LYS A C     1 
ATOM   141  O  O     . LYS A 1 20  ? -21.525 7.055   -37.819 1.00 63.37  ? 20  LYS A O     1 
ATOM   142  C  CB    . LYS A 1 20  ? -20.148 8.153   -35.638 1.00 48.03  ? 20  LYS A CB    1 
ATOM   143  C  CG    . LYS A 1 20  ? -19.497 8.611   -34.342 1.00 53.95  ? 20  LYS A CG    1 
ATOM   144  C  CD    . LYS A 1 20  ? -18.021 8.913   -34.536 1.00 51.33  ? 20  LYS A CD    1 
ATOM   145  C  CE    . LYS A 1 20  ? -17.345 9.216   -33.208 1.00 52.71  ? 20  LYS A CE    1 
ATOM   146  N  NZ    . LYS A 1 20  ? -15.870 9.356   -33.353 1.00 68.63  ? 20  LYS A NZ    1 
ATOM   147  N  N     . VAL A 1 21  ? -23.527 7.107   -36.799 1.00 55.60  ? 21  VAL A N     1 
ATOM   148  C  CA    . VAL A 1 21  ? -24.301 6.760   -37.984 1.00 48.20  ? 21  VAL A CA    1 
ATOM   149  C  C     . VAL A 1 21  ? -25.290 7.885   -38.251 1.00 61.61  ? 21  VAL A C     1 
ATOM   150  O  O     . VAL A 1 21  ? -26.007 8.317   -37.340 1.00 58.20  ? 21  VAL A O     1 
ATOM   151  C  CB    . VAL A 1 21  ? -25.032 5.415   -37.813 1.00 55.76  ? 21  VAL A CB    1 
ATOM   152  C  CG1   . VAL A 1 21  ? -25.694 4.999   -39.117 1.00 51.92  ? 21  VAL A CG1   1 
ATOM   153  C  CG2   . VAL A 1 21  ? -24.069 4.342   -37.329 1.00 42.96  ? 21  VAL A CG2   1 
ATOM   154  N  N     . LYS A 1 22  ? -25.331 8.355   -39.494 1.00 62.88  ? 22  LYS A N     1 
ATOM   155  C  CA    . LYS A 1 22  ? -26.182 9.481   -39.845 1.00 60.30  ? 22  LYS A CA    1 
ATOM   156  C  C     . LYS A 1 22  ? -27.615 9.026   -40.093 1.00 58.32  ? 22  LYS A C     1 
ATOM   157  O  O     . LYS A 1 22  ? -27.875 7.874   -40.451 1.00 59.93  ? 22  LYS A O     1 
ATOM   158  C  CB    . LYS A 1 22  ? -25.636 10.201  -41.078 1.00 67.94  ? 22  LYS A CB    1 
ATOM   159  C  CG    . LYS A 1 22  ? -24.330 10.936  -40.823 1.00 91.11  ? 22  LYS A CG    1 
ATOM   160  C  CD    . LYS A 1 22  ? -24.510 12.010  -39.759 1.00 90.02  ? 22  LYS A CD    1 
ATOM   161  C  CE    . LYS A 1 22  ? -23.180 12.616  -39.344 1.00 96.86  ? 22  LYS A CE    1 
ATOM   162  N  NZ    . LYS A 1 22  ? -22.314 11.631  -38.636 1.00 75.09  ? 22  LYS A NZ    1 
ATOM   163  N  N     . GLN A 1 23  ? -28.548 9.955   -39.899 1.00 53.61  ? 23  GLN A N     1 
ATOM   164  C  CA    . GLN A 1 23  ? -29.964 9.647   -40.041 1.00 54.36  ? 23  GLN A CA    1 
ATOM   165  C  C     . GLN A 1 23  ? -30.329 9.432   -41.504 1.00 53.50  ? 23  GLN A C     1 
ATOM   166  O  O     . GLN A 1 23  ? -29.898 10.181  -42.386 1.00 67.52  ? 23  GLN A O     1 
ATOM   167  C  CB    . GLN A 1 23  ? -30.807 10.778  -39.453 1.00 47.16  ? 23  GLN A CB    1 
ATOM   168  C  CG    . GLN A 1 23  ? -32.306 10.551  -39.539 1.00 51.17  ? 23  GLN A CG    1 
ATOM   169  C  CD    . GLN A 1 23  ? -32.772 9.420   -38.647 1.00 54.69  ? 23  GLN A CD    1 
ATOM   170  O  OE1   . GLN A 1 23  ? -32.497 9.406   -37.448 1.00 51.86  ? 23  GLN A OE1   1 
ATOM   171  N  NE2   . GLN A 1 23  ? -33.476 8.457   -39.232 1.00 63.28  ? 23  GLN A NE2   1 
ATOM   172  N  N     . TRP A 1 24  ? -31.131 8.397   -41.762 1.00 62.25  ? 24  TRP A N     1 
ATOM   173  C  CA    . TRP A 1 24  ? -31.646 8.181   -43.103 1.00 65.88  ? 24  TRP A CA    1 
ATOM   174  C  C     . TRP A 1 24  ? -32.920 8.989   -43.314 1.00 66.52  ? 24  TRP A C     1 
ATOM   175  O  O     . TRP A 1 24  ? -33.585 9.381   -42.350 1.00 61.80  ? 24  TRP A O     1 
ATOM   176  C  CB    . TRP A 1 24  ? -31.903 6.689   -43.340 1.00 63.17  ? 24  TRP A CB    1 
ATOM   177  C  CG    . TRP A 1 24  ? -32.822 6.017   -42.356 1.00 63.17  ? 24  TRP A CG    1 
ATOM   178  C  CD1   . TRP A 1 24  ? -34.130 6.324   -42.106 1.00 62.27  ? 24  TRP A CD1   1 
ATOM   179  C  CD2   . TRP A 1 24  ? -32.509 4.894   -41.522 1.00 59.52  ? 24  TRP A CD2   1 
ATOM   180  N  NE1   . TRP A 1 24  ? -34.642 5.476   -41.153 1.00 61.42  ? 24  TRP A NE1   1 
ATOM   181  C  CE2   . TRP A 1 24  ? -33.668 4.587   -40.780 1.00 57.51  ? 24  TRP A CE2   1 
ATOM   182  C  CE3   . TRP A 1 24  ? -31.359 4.123   -41.325 1.00 57.17  ? 24  TRP A CE3   1 
ATOM   183  C  CZ2   . TRP A 1 24  ? -33.710 3.544   -39.858 1.00 56.84  ? 24  TRP A CZ2   1 
ATOM   184  C  CZ3   . TRP A 1 24  ? -31.403 3.087   -40.408 1.00 59.06  ? 24  TRP A CZ3   1 
ATOM   185  C  CH2   . TRP A 1 24  ? -32.571 2.808   -39.686 1.00 58.22  ? 24  TRP A CH2   1 
ATOM   186  N  N     . PRO A 1 25  ? -33.280 9.278   -44.567 1.00 77.37  ? 25  PRO A N     1 
ATOM   187  C  CA    . PRO A 1 25  ? -34.482 10.085  -44.814 1.00 74.09  ? 25  PRO A CA    1 
ATOM   188  C  C     . PRO A 1 25  ? -35.739 9.401   -44.294 1.00 63.45  ? 25  PRO A C     1 
ATOM   189  O  O     . PRO A 1 25  ? -35.870 8.176   -44.338 1.00 60.35  ? 25  PRO A O     1 
ATOM   190  C  CB    . PRO A 1 25  ? -34.509 10.227  -46.341 1.00 66.17  ? 25  PRO A CB    1 
ATOM   191  C  CG    . PRO A 1 25  ? -33.654 9.112   -46.850 1.00 72.78  ? 25  PRO A CG    1 
ATOM   192  C  CD    . PRO A 1 25  ? -32.582 8.942   -45.820 1.00 66.85  ? 25  PRO A CD    1 
ATOM   193  N  N     . LEU A 1 26  ? -36.667 10.214  -43.795 1.00 56.92  ? 26  LEU A N     1 
ATOM   194  C  CA    . LEU A 1 26  ? -37.907 9.729   -43.210 1.00 64.37  ? 26  LEU A CA    1 
ATOM   195  C  C     . LEU A 1 26  ? -39.093 10.389  -43.897 1.00 64.77  ? 26  LEU A C     1 
ATOM   196  O  O     . LEU A 1 26  ? -38.983 11.476  -44.472 1.00 72.94  ? 26  LEU A O     1 
ATOM   197  C  CB    . LEU A 1 26  ? -37.962 10.003  -41.700 1.00 67.00  ? 26  LEU A CB    1 
ATOM   198  C  CG    . LEU A 1 26  ? -36.910 9.316   -40.828 1.00 60.58  ? 26  LEU A CG    1 
ATOM   199  C  CD1   . LEU A 1 26  ? -36.960 9.860   -39.411 1.00 57.20  ? 26  LEU A CD1   1 
ATOM   200  C  CD2   . LEU A 1 26  ? -37.115 7.809   -40.831 1.00 61.03  ? 26  LEU A CD2   1 
ATOM   201  N  N     . THR A 1 27  ? -40.237 9.713   -43.825 1.00 66.19  ? 27  THR A N     1 
ATOM   202  C  CA    . THR A 1 27  ? -41.470 10.258  -44.373 1.00 66.93  ? 27  THR A CA    1 
ATOM   203  C  C     . THR A 1 27  ? -41.881 11.509  -43.604 1.00 65.64  ? 27  THR A C     1 
ATOM   204  O  O     . THR A 1 27  ? -41.602 11.651  -42.411 1.00 72.61  ? 27  THR A O     1 
ATOM   205  C  CB    . THR A 1 27  ? -42.585 9.209   -44.313 1.00 70.41  ? 27  THR A CB    1 
ATOM   206  O  OG1   . THR A 1 27  ? -42.094 7.959   -44.812 1.00 85.52  ? 27  THR A OG1   1 
ATOM   207  C  CG2   . THR A 1 27  ? -43.784 9.637   -45.149 1.00 73.14  ? 27  THR A CG2   1 
ATOM   208  N  N     . GLU A 1 28  ? -42.540 12.434  -44.308 1.00 62.43  ? 28  GLU A N     1 
ATOM   209  C  CA    . GLU A 1 28  ? -43.073 13.624  -43.652 1.00 72.82  ? 28  GLU A CA    1 
ATOM   210  C  C     . GLU A 1 28  ? -44.052 13.249  -42.547 1.00 59.98  ? 28  GLU A C     1 
ATOM   211  O  O     . GLU A 1 28  ? -44.097 13.901  -41.497 1.00 63.62  ? 28  GLU A O     1 
ATOM   212  C  CB    . GLU A 1 28  ? -43.745 14.533  -44.682 1.00 75.32  ? 28  GLU A CB    1 
ATOM   213  C  CG    . GLU A 1 28  ? -44.370 15.792  -44.097 1.00 75.14  ? 28  GLU A CG    1 
ATOM   214  C  CD    . GLU A 1 28  ? -43.338 16.772  -43.572 1.00 82.23  ? 28  GLU A CD    1 
ATOM   215  O  OE1   . GLU A 1 28  ? -42.163 16.687  -43.990 1.00 77.16  ? 28  GLU A OE1   1 
ATOM   216  O  OE2   . GLU A 1 28  ? -43.703 17.630  -42.740 1.00 90.08  ? 28  GLU A OE2   1 
ATOM   217  N  N     . GLU A 1 29  ? -44.844 12.196  -42.766 1.00 67.82  ? 29  GLU A N     1 
ATOM   218  C  CA    . GLU A 1 29  ? -45.762 11.726  -41.733 1.00 68.18  ? 29  GLU A CA    1 
ATOM   219  C  C     . GLU A 1 29  ? -45.007 11.251  -40.498 1.00 65.24  ? 29  GLU A C     1 
ATOM   220  O  O     . GLU A 1 29  ? -45.399 11.558  -39.365 1.00 60.10  ? 29  GLU A O     1 
ATOM   221  C  CB    . GLU A 1 29  ? -46.643 10.608  -42.292 1.00 60.32  ? 29  GLU A CB    1 
ATOM   222  C  CG    . GLU A 1 29  ? -47.435 9.845   -41.243 1.00 65.12  ? 29  GLU A CG    1 
ATOM   223  C  CD    . GLU A 1 29  ? -48.281 8.740   -41.846 1.00 57.91  ? 29  GLU A CD    1 
ATOM   224  O  OE1   . GLU A 1 29  ? -49.523 8.876   -41.859 1.00 65.01  ? 29  GLU A OE1   1 
ATOM   225  O  OE2   . GLU A 1 29  ? -47.703 7.739   -42.318 1.00 64.05  ? 29  GLU A OE2   1 
ATOM   226  N  N     . LYS A 1 30  ? -43.918 10.505  -40.694 1.00 61.91  ? 30  LYS A N     1 
ATOM   227  C  CA    . LYS A 1 30  ? -43.146 10.017  -39.556 1.00 58.89  ? 30  LYS A CA    1 
ATOM   228  C  C     . LYS A 1 30  ? -42.396 11.151  -38.867 1.00 57.91  ? 30  LYS A C     1 
ATOM   229  O  O     . LYS A 1 30  ? -42.240 11.143  -37.641 1.00 60.97  ? 30  LYS A O     1 
ATOM   230  C  CB    . LYS A 1 30  ? -42.177 8.924   -40.005 1.00 58.86  ? 30  LYS A CB    1 
ATOM   231  C  CG    . LYS A 1 30  ? -42.859 7.667   -40.519 1.00 56.46  ? 30  LYS A CG    1 
ATOM   232  C  CD    . LYS A 1 30  ? -41.847 6.581   -40.851 1.00 62.18  ? 30  LYS A CD    1 
ATOM   233  C  CE    . LYS A 1 30  ? -42.537 5.310   -41.321 1.00 69.99  ? 30  LYS A CE    1 
ATOM   234  N  NZ    . LYS A 1 30  ? -41.565 4.213   -41.584 1.00 70.31  ? 30  LYS A NZ    1 
ATOM   235  N  N     . ILE A 1 31  ? -41.924 12.134  -39.638 1.00 65.11  ? 31  ILE A N     1 
ATOM   236  C  CA    . ILE A 1 31  ? -41.242 13.281  -39.042 1.00 57.43  ? 31  ILE A CA    1 
ATOM   237  C  C     . ILE A 1 31  ? -42.206 14.078  -38.173 1.00 55.87  ? 31  ILE A C     1 
ATOM   238  O  O     . ILE A 1 31  ? -41.850 14.530  -37.077 1.00 57.09  ? 31  ILE A O     1 
ATOM   239  C  CB    . ILE A 1 31  ? -40.605 14.155  -40.139 1.00 60.19  ? 31  ILE A CB    1 
ATOM   240  C  CG1   . ILE A 1 31  ? -39.447 13.412  -40.809 1.00 57.57  ? 31  ILE A CG1   1 
ATOM   241  C  CG2   . ILE A 1 31  ? -40.126 15.479  -39.562 1.00 53.22  ? 31  ILE A CG2   1 
ATOM   242  C  CD1   . ILE A 1 31  ? -38.779 14.196  -41.919 1.00 71.41  ? 31  ILE A CD1   1 
ATOM   243  N  N     . LYS A 1 32  ? -43.444 14.254  -38.641 1.00 54.56  ? 32  LYS A N     1 
ATOM   244  C  CA    . LYS A 1 32  ? -44.442 14.966  -37.848 1.00 55.17  ? 32  LYS A CA    1 
ATOM   245  C  C     . LYS A 1 32  ? -44.753 14.223  -36.555 1.00 57.12  ? 32  LYS A C     1 
ATOM   246  O  O     . LYS A 1 32  ? -44.999 14.845  -35.515 1.00 54.88  ? 32  LYS A O     1 
ATOM   247  C  CB    . LYS A 1 32  ? -45.716 15.168  -38.669 1.00 62.94  ? 32  LYS A CB    1 
ATOM   248  C  CG    . LYS A 1 32  ? -46.063 16.623  -38.933 1.00 70.66  ? 32  LYS A CG    1 
ATOM   249  C  CD    . LYS A 1 32  ? -47.376 16.746  -39.688 1.00 77.03  ? 32  LYS A CD    1 
ATOM   250  C  CE    . LYS A 1 32  ? -47.734 18.201  -39.938 1.00 91.06  ? 32  LYS A CE    1 
ATOM   251  N  NZ    . LYS A 1 32  ? -47.877 18.964  -38.667 1.00 82.42  ? 32  LYS A NZ    1 
ATOM   252  N  N     . ALA A 1 33  ? -44.746 12.889  -36.600 1.00 51.73  ? 33  ALA A N     1 
ATOM   253  C  CA    . ALA A 1 33  ? -45.007 12.111  -35.394 1.00 51.98  ? 33  ALA A CA    1 
ATOM   254  C  C     . ALA A 1 33  ? -43.829 12.171  -34.431 1.00 48.35  ? 33  ALA A C     1 
ATOM   255  O  O     . ALA A 1 33  ? -44.021 12.225  -33.210 1.00 47.66  ? 33  ALA A O     1 
ATOM   256  C  CB    . ALA A 1 33  ? -45.327 10.663  -35.763 1.00 56.84  ? 33  ALA A CB    1 
ATOM   257  N  N     . LEU A 1 34  ? -42.602 12.172  -34.958 1.00 41.52  ? 34  LEU A N     1 
ATOM   258  C  CA    . LEU A 1 34  ? -41.428 12.178  -34.092 1.00 44.42  ? 34  LEU A CA    1 
ATOM   259  C  C     . LEU A 1 34  ? -41.265 13.514  -33.377 1.00 48.47  ? 34  LEU A C     1 
ATOM   260  O  O     . LEU A 1 34  ? -40.950 13.545  -32.182 1.00 45.26  ? 34  LEU A O     1 
ATOM   261  C  CB    . LEU A 1 34  ? -40.175 11.843  -34.902 1.00 44.64  ? 34  LEU A CB    1 
ATOM   262  C  CG    . LEU A 1 34  ? -40.065 10.395  -35.384 1.00 53.70  ? 34  LEU A CG    1 
ATOM   263  C  CD1   . LEU A 1 34  ? -38.801 10.189  -36.204 1.00 56.94  ? 34  LEU A CD1   1 
ATOM   264  C  CD2   . LEU A 1 34  ? -40.108 9.434   -34.205 1.00 54.63  ? 34  LEU A CD2   1 
ATOM   265  N  N     . VAL A 1 35  ? -41.473 14.627  -34.085 1.00 48.64  ? 35  VAL A N     1 
ATOM   266  C  CA    . VAL A 1 35  ? -41.324 15.932  -33.447 1.00 47.59  ? 35  VAL A CA    1 
ATOM   267  C  C     . VAL A 1 35  ? -42.402 16.145  -32.392 1.00 38.58  ? 35  VAL A C     1 
ATOM   268  O  O     . VAL A 1 35  ? -42.153 16.783  -31.363 1.00 54.74  ? 35  VAL A O     1 
ATOM   269  C  CB    . VAL A 1 35  ? -41.328 17.061  -34.496 1.00 53.32  ? 35  VAL A CB    1 
ATOM   270  C  CG1   . VAL A 1 35  ? -40.151 16.907  -35.446 1.00 50.80  ? 35  VAL A CG1   1 
ATOM   271  C  CG2   . VAL A 1 35  ? -42.640 17.088  -35.265 1.00 54.96  ? 35  VAL A CG2   1 
ATOM   272  N  N     . GLU A 1 36  ? -43.607 15.613  -32.614 1.00 42.54  ? 36  GLU A N     1 
ATOM   273  C  CA    . GLU A 1 36  ? -44.655 15.725  -31.605 1.00 49.58  ? 36  GLU A CA    1 
ATOM   274  C  C     . GLU A 1 36  ? -44.308 14.914  -30.364 1.00 54.52  ? 36  GLU A C     1 
ATOM   275  O  O     . GLU A 1 36  ? -44.597 15.334  -29.238 1.00 57.12  ? 36  GLU A O     1 
ATOM   276  C  CB    . GLU A 1 36  ? -45.994 15.273  -32.186 1.00 47.49  ? 36  GLU A CB    1 
ATOM   277  C  CG    . GLU A 1 36  ? -47.158 15.369  -31.212 1.00 66.09  ? 36  GLU A CG    1 
ATOM   278  C  CD    . GLU A 1 36  ? -48.460 14.867  -31.807 1.00 91.01  ? 36  GLU A CD    1 
ATOM   279  O  OE1   . GLU A 1 36  ? -48.460 14.467  -32.990 1.00 83.38  ? 36  GLU A OE1   1 
ATOM   280  O  OE2   . GLU A 1 36  ? -49.484 14.874  -31.090 1.00 94.00  ? 36  GLU A OE2   1 
ATOM   281  N  N     . ILE A 1 37  ? -43.679 13.754  -30.552 1.00 50.39  ? 37  ILE A N     1 
ATOM   282  C  CA    . ILE A 1 37  ? -43.300 12.920  -29.418 1.00 52.02  ? 37  ILE A CA    1 
ATOM   283  C  C     . ILE A 1 37  ? -42.114 13.525  -28.677 1.00 49.72  ? 37  ILE A C     1 
ATOM   284  O  O     . ILE A 1 37  ? -42.082 13.543  -27.440 1.00 49.58  ? 37  ILE A O     1 
ATOM   285  C  CB    . ILE A 1 37  ? -43.005 11.485  -29.894 1.00 47.95  ? 37  ILE A CB    1 
ATOM   286  C  CG1   . ILE A 1 37  ? -44.294 10.800  -30.355 1.00 49.15  ? 37  ILE A CG1   1 
ATOM   287  C  CG2   . ILE A 1 37  ? -42.330 10.676  -28.798 1.00 52.40  ? 37  ILE A CG2   1 
ATOM   288  C  CD1   . ILE A 1 37  ? -44.079 9.418   -30.931 1.00 45.94  ? 37  ILE A CD1   1 
ATOM   289  N  N     . CYS A 1 38  ? -41.134 14.053  -29.412 1.00 46.06  ? 38  CYS A N     1 
ATOM   290  C  CA    . CYS A 1 38  ? -39.894 14.489  -28.781 1.00 52.02  ? 38  CYS A CA    1 
ATOM   291  C  C     . CYS A 1 38  ? -40.013 15.856  -28.119 1.00 51.33  ? 38  CYS A C     1 
ATOM   292  O  O     . CYS A 1 38  ? -39.346 16.101  -27.107 1.00 48.63  ? 38  CYS A O     1 
ATOM   293  C  CB    . CYS A 1 38  ? -38.760 14.491  -29.803 1.00 44.16  ? 38  CYS A CB    1 
ATOM   294  S  SG    . CYS A 1 38  ? -38.031 12.862  -30.008 1.00 56.00  ? 38  CYS A SG    1 
ATOM   295  N  N     . THR A 1 39  ? -40.834 16.757  -28.660 1.00 46.47  ? 39  THR A N     1 
ATOM   296  C  CA    . THR A 1 39  ? -41.061 18.020  -27.966 1.00 51.01  ? 39  THR A CA    1 
ATOM   297  C  C     . THR A 1 39  ? -41.749 17.795  -26.627 1.00 49.86  ? 39  THR A C     1 
ATOM   298  O  O     . THR A 1 39  ? -41.502 18.536  -25.669 1.00 47.43  ? 39  THR A O     1 
ATOM   299  C  CB    . THR A 1 39  ? -41.886 18.976  -28.831 1.00 46.08  ? 39  THR A CB    1 
ATOM   300  O  OG1   . THR A 1 39  ? -43.077 18.319  -29.279 1.00 68.69  ? 39  THR A OG1   1 
ATOM   301  C  CG2   . THR A 1 39  ? -41.075 19.445  -30.033 1.00 47.10  ? 39  THR A CG2   1 
ATOM   302  N  N     . GLU A 1 40  ? -42.602 16.773  -26.538 1.00 46.64  ? 40  GLU A N     1 
ATOM   303  C  CA    . GLU A 1 40  ? -43.250 16.455  -25.271 1.00 49.70  ? 40  GLU A CA    1 
ATOM   304  C  C     . GLU A 1 40  ? -42.294 15.749  -24.316 1.00 51.60  ? 40  GLU A C     1 
ATOM   305  O  O     . GLU A 1 40  ? -42.286 16.042  -23.116 1.00 53.15  ? 40  GLU A O     1 
ATOM   306  C  CB    . GLU A 1 40  ? -44.492 15.598  -25.518 1.00 44.81  ? 40  GLU A CB    1 
ATOM   307  C  CG    . GLU A 1 40  ? -45.330 15.360  -24.276 1.00 43.33  ? 40  GLU A CG    1 
ATOM   308  C  CD    . GLU A 1 40  ? -45.871 16.651  -23.687 1.00 67.85  ? 40  GLU A CD    1 
ATOM   309  O  OE1   . GLU A 1 40  ? -46.163 17.586  -24.463 1.00 56.89  ? 40  GLU A OE1   1 
ATOM   310  O  OE2   . GLU A 1 40  ? -45.996 16.731  -22.446 1.00 61.92  ? 40  GLU A OE2   1 
ATOM   311  N  N     . MET A 1 41  ? -41.481 14.820  -24.828 1.00 40.20  ? 41  MET A N     1 
ATOM   312  C  CA    . MET A 1 41  ? -40.517 14.134  -23.973 1.00 48.70  ? 41  MET A CA    1 
ATOM   313  C  C     . MET A 1 41  ? -39.450 15.087  -23.452 1.00 40.79  ? 41  MET A C     1 
ATOM   314  O  O     . MET A 1 41  ? -38.951 14.905  -22.335 1.00 41.31  ? 41  MET A O     1 
ATOM   315  C  CB    . MET A 1 41  ? -39.866 12.975  -24.730 1.00 43.36  ? 41  MET A CB    1 
ATOM   316  C  CG    . MET A 1 41  ? -40.816 11.838  -25.067 1.00 43.91  ? 41  MET A CG    1 
ATOM   317  S  SD    . MET A 1 41  ? -40.034 10.530  -26.031 1.00 45.09  ? 41  MET A SD    1 
ATOM   318  C  CE    . MET A 1 41  ? -38.862 9.879   -24.843 1.00 28.42  ? 41  MET A CE    1 
ATOM   319  N  N     . GLU A 1 42  ? -39.086 16.101  -24.239 1.00 41.31  ? 42  GLU A N     1 
ATOM   320  C  CA    . GLU A 1 42  ? -38.101 17.073  -23.778 1.00 42.31  ? 42  GLU A CA    1 
ATOM   321  C  C     . GLU A 1 42  ? -38.655 17.938  -22.654 1.00 41.15  ? 42  GLU A C     1 
ATOM   322  O  O     . GLU A 1 42  ? -37.911 18.320  -21.744 1.00 41.98  ? 42  GLU A O     1 
ATOM   323  C  CB    . GLU A 1 42  ? -37.634 17.938  -24.950 1.00 40.76  ? 42  GLU A CB    1 
ATOM   324  C  CG    . GLU A 1 42  ? -36.373 18.749  -24.679 1.00 49.69  ? 42  GLU A CG    1 
ATOM   325  C  CD    . GLU A 1 42  ? -36.655 20.067  -23.985 1.00 49.30  ? 42  GLU A CD    1 
ATOM   326  O  OE1   . GLU A 1 42  ? -37.813 20.534  -24.039 1.00 46.06  ? 42  GLU A OE1   1 
ATOM   327  O  OE2   . GLU A 1 42  ? -35.719 20.634  -23.383 1.00 48.13  ? 42  GLU A OE2   1 
ATOM   328  N  N     . LYS A 1 43  ? -39.954 18.251  -22.694 1.00 37.00  ? 43  LYS A N     1 
ATOM   329  C  CA    . LYS A 1 43  ? -40.564 19.020  -21.615 1.00 35.97  ? 43  LYS A CA    1 
ATOM   330  C  C     . LYS A 1 43  ? -40.600 18.232  -20.313 1.00 46.57  ? 43  LYS A C     1 
ATOM   331  O  O     . LYS A 1 43  ? -40.538 18.824  -19.229 1.00 43.11  ? 43  LYS A O     1 
ATOM   332  C  CB    . LYS A 1 43  ? -41.979 19.450  -22.006 1.00 41.14  ? 43  LYS A CB    1 
ATOM   333  C  CG    . LYS A 1 43  ? -42.040 20.469  -23.133 1.00 52.07  ? 43  LYS A CG    1 
ATOM   334  C  CD    . LYS A 1 43  ? -43.480 20.767  -23.522 1.00 55.02  ? 43  LYS A CD    1 
ATOM   335  C  CE    . LYS A 1 43  ? -44.285 21.264  -22.329 1.00 72.29  ? 43  LYS A CE    1 
ATOM   336  N  NZ    . LYS A 1 43  ? -45.701 21.546  -22.694 1.00 70.77  ? 43  LYS A NZ    1 
ATOM   337  N  N     . GLU A 1 44  ? -40.700 16.907  -20.394 1.00 51.47  ? 44  GLU A N     1 
ATOM   338  C  CA    . GLU A 1 44  ? -40.782 16.051  -19.219 1.00 43.93  ? 44  GLU A CA    1 
ATOM   339  C  C     . GLU A 1 44  ? -39.418 15.584  -18.729 1.00 43.46  ? 44  GLU A C     1 
ATOM   340  O  O     . GLU A 1 44  ? -39.352 14.812  -17.767 1.00 53.87  ? 44  GLU A O     1 
ATOM   341  C  CB    . GLU A 1 44  ? -41.669 14.838  -19.519 1.00 41.00  ? 44  GLU A CB    1 
ATOM   342  C  CG    . GLU A 1 44  ? -43.029 15.202  -20.094 1.00 37.85  ? 44  GLU A CG    1 
ATOM   343  C  CD    . GLU A 1 44  ? -43.798 13.994  -20.593 1.00 53.41  ? 44  GLU A CD    1 
ATOM   344  O  OE1   . GLU A 1 44  ? -45.030 13.946  -20.397 1.00 61.64  ? 44  GLU A OE1   1 
ATOM   345  O  OE2   . GLU A 1 44  ? -43.168 13.091  -21.183 1.00 53.46  ? 44  GLU A OE2   1 
ATOM   346  N  N     . GLY A 1 45  ? -38.333 16.032  -19.358 1.00 38.85  ? 45  GLY A N     1 
ATOM   347  C  CA    . GLY A 1 45  ? -37.004 15.615  -18.966 1.00 33.25  ? 45  GLY A CA    1 
ATOM   348  C  C     . GLY A 1 45  ? -36.598 14.238  -19.436 1.00 39.16  ? 45  GLY A C     1 
ATOM   349  O  O     . GLY A 1 45  ? -35.515 13.769  -19.067 1.00 43.12  ? 45  GLY A O     1 
ATOM   350  N  N     . LYS A 1 46  ? -37.430 13.573  -20.240 1.00 36.06  ? 46  LYS A N     1 
ATOM   351  C  CA    . LYS A 1 46  ? -37.103 12.226  -20.692 1.00 36.24  ? 46  LYS A CA    1 
ATOM   352  C  C     . LYS A 1 46  ? -36.007 12.238  -21.751 1.00 40.13  ? 46  LYS A C     1 
ATOM   353  O  O     . LYS A 1 46  ? -35.268 11.257  -21.885 1.00 44.08  ? 46  LYS A O     1 
ATOM   354  C  CB    . LYS A 1 46  ? -38.363 11.536  -21.213 1.00 36.96  ? 46  LYS A CB    1 
ATOM   355  C  CG    . LYS A 1 46  ? -39.432 11.366  -20.142 1.00 32.13  ? 46  LYS A CG    1 
ATOM   356  C  CD    . LYS A 1 46  ? -40.737 10.826  -20.703 1.00 30.02  ? 46  LYS A CD    1 
ATOM   357  C  CE    . LYS A 1 46  ? -41.742 10.586  -19.583 1.00 22.80  ? 46  LYS A CE    1 
ATOM   358  N  NZ    . LYS A 1 46  ? -43.041 10.063  -20.086 1.00 38.37  ? 46  LYS A NZ    1 
ATOM   359  N  N     . ILE A 1 47  ? -35.887 13.329  -22.509 1.00 43.56  ? 47  ILE A N     1 
ATOM   360  C  CA    . ILE A 1 47  ? -34.773 13.535  -23.424 1.00 47.39  ? 47  ILE A CA    1 
ATOM   361  C  C     . ILE A 1 47  ? -34.244 14.948  -23.220 1.00 42.13  ? 47  ILE A C     1 
ATOM   362  O  O     . ILE A 1 47  ? -34.950 15.839  -22.744 1.00 43.74  ? 47  ILE A O     1 
ATOM   363  C  CB    . ILE A 1 47  ? -35.159 13.312  -24.905 1.00 40.80  ? 47  ILE A CB    1 
ATOM   364  C  CG1   . ILE A 1 47  ? -36.182 14.352  -25.362 1.00 31.92  ? 47  ILE A CG1   1 
ATOM   365  C  CG2   . ILE A 1 47  ? -35.690 11.901  -25.119 1.00 44.13  ? 47  ILE A CG2   1 
ATOM   366  C  CD1   . ILE A 1 47  ? -36.630 14.173  -26.796 1.00 32.16  ? 47  ILE A CD1   1 
ATOM   367  N  N     . SER A 1 48  ? -32.978 15.144  -23.583 1.00 42.15  ? 48  SER A N     1 
ATOM   368  C  CA    . SER A 1 48  ? -32.306 16.423  -23.408 1.00 40.82  ? 48  SER A CA    1 
ATOM   369  C  C     . SER A 1 48  ? -31.628 16.835  -24.705 1.00 43.97  ? 48  SER A C     1 
ATOM   370  O  O     . SER A 1 48  ? -31.033 16.003  -25.396 1.00 43.96  ? 48  SER A O     1 
ATOM   371  C  CB    . SER A 1 48  ? -31.268 16.360  -22.279 1.00 33.66  ? 48  SER A CB    1 
ATOM   372  O  OG    . SER A 1 48  ? -31.883 16.067  -21.036 1.00 35.02  ? 48  SER A OG    1 
ATOM   373  N  N     . LYS A 1 49  ? -31.721 18.123  -25.028 1.00 45.00  ? 49  LYS A N     1 
ATOM   374  C  CA    . LYS A 1 49  ? -31.044 18.649  -26.205 1.00 40.26  ? 49  LYS A CA    1 
ATOM   375  C  C     . LYS A 1 49  ? -29.535 18.629  -25.999 1.00 41.65  ? 49  LYS A C     1 
ATOM   376  O  O     . LYS A 1 49  ? -29.040 18.837  -24.888 1.00 45.97  ? 49  LYS A O     1 
ATOM   377  C  CB    . LYS A 1 49  ? -31.515 20.072  -26.502 1.00 43.09  ? 49  LYS A CB    1 
ATOM   378  C  CG    . LYS A 1 49  ? -32.984 20.179  -26.874 1.00 50.10  ? 49  LYS A CG    1 
ATOM   379  C  CD    . LYS A 1 49  ? -33.356 21.608  -27.245 1.00 61.19  ? 49  LYS A CD    1 
ATOM   380  C  CE    . LYS A 1 49  ? -34.813 21.708  -27.669 1.00 61.17  ? 49  LYS A CE    1 
ATOM   381  N  NZ    . LYS A 1 49  ? -35.182 23.091  -28.072 1.00 62.07  ? 49  LYS A NZ    1 
ATOM   382  N  N     . ILE A 1 50  ? -28.802 18.372  -27.082 1.00 46.25  ? 50  ILE A N     1 
ATOM   383  C  CA    . ILE A 1 50  ? -27.349 18.303  -27.049 1.00 51.77  ? 50  ILE A CA    1 
ATOM   384  C  C     . ILE A 1 50  ? -26.786 19.234  -28.113 1.00 59.01  ? 50  ILE A C     1 
ATOM   385  O  O     . ILE A 1 50  ? -27.467 19.612  -29.070 1.00 54.55  ? 50  ILE A O     1 
ATOM   386  C  CB    . ILE A 1 50  ? -26.827 16.867  -27.266 1.00 45.02  ? 50  ILE A CB    1 
ATOM   387  C  CG1   . ILE A 1 50  ? -27.340 16.315  -28.596 1.00 49.76  ? 50  ILE A CG1   1 
ATOM   388  C  CG2   . ILE A 1 50  ? -27.240 15.967  -26.110 1.00 50.98  ? 50  ILE A CG2   1 
ATOM   389  C  CD1   . ILE A 1 50  ? -26.879 14.912  -28.890 1.00 44.55  ? 50  ILE A CD1   1 
ATOM   390  N  N     . GLY A 1 51  ? -25.520 19.601  -27.935 1.00 55.45  ? 51  GLY A N     1 
ATOM   391  C  CA    . GLY A 1 51  ? -24.843 20.477  -28.860 1.00 62.80  ? 51  GLY A CA    1 
ATOM   392  C  C     . GLY A 1 51  ? -23.696 19.790  -29.571 1.00 66.75  ? 51  GLY A C     1 
ATOM   393  O  O     . GLY A 1 51  ? -23.648 18.561  -29.683 1.00 51.03  ? 51  GLY A O     1 
ATOM   394  N  N     . PRO A 1 52  ? -22.739 20.581  -30.067 1.00 65.03  ? 52  PRO A N     1 
ATOM   395  C  CA    . PRO A 1 52  ? -21.599 19.995  -30.791 1.00 55.07  ? 52  PRO A CA    1 
ATOM   396  C  C     . PRO A 1 52  ? -20.660 19.187  -29.912 1.00 58.06  ? 52  PRO A C     1 
ATOM   397  O  O     . PRO A 1 52  ? -19.790 18.490  -30.451 1.00 52.00  ? 52  PRO A O     1 
ATOM   398  C  CB    . PRO A 1 52  ? -20.889 21.223  -31.376 1.00 68.45  ? 52  PRO A CB    1 
ATOM   399  C  CG    . PRO A 1 52  ? -21.257 22.339  -30.455 1.00 70.03  ? 52  PRO A CG    1 
ATOM   400  C  CD    . PRO A 1 52  ? -22.662 22.050  -30.005 1.00 63.17  ? 52  PRO A CD    1 
ATOM   401  N  N     . GLU A 1 53  ? -20.800 19.255  -28.587 1.00 59.83  ? 53  GLU A N     1 
ATOM   402  C  CA    . GLU A 1 53  ? -19.965 18.459  -27.697 1.00 55.00  ? 53  GLU A CA    1 
ATOM   403  C  C     . GLU A 1 53  ? -20.312 16.976  -27.735 1.00 63.01  ? 53  GLU A C     1 
ATOM   404  O  O     . GLU A 1 53  ? -19.585 16.173  -27.140 1.00 60.31  ? 53  GLU A O     1 
ATOM   405  C  CB    . GLU A 1 53  ? -20.076 18.977  -26.261 1.00 58.85  ? 53  GLU A CB    1 
ATOM   406  C  CG    . GLU A 1 53  ? -21.412 18.692  -25.584 1.00 72.51  ? 53  GLU A CG    1 
ATOM   407  C  CD    . GLU A 1 53  ? -22.539 19.571  -26.094 1.00 64.15  ? 53  GLU A CD    1 
ATOM   408  O  OE1   . GLU A 1 53  ? -22.254 20.550  -26.816 1.00 68.02  ? 53  GLU A OE1   1 
ATOM   409  O  OE2   . GLU A 1 53  ? -23.711 19.280  -25.773 1.00 65.75  ? 53  GLU A OE2   1 
ATOM   410  N  N     . ASN A 1 54  ? -21.394 16.598  -28.410 1.00 60.90  ? 54  ASN A N     1 
ATOM   411  C  CA    . ASN A 1 54  ? -21.774 15.198  -28.557 1.00 54.86  ? 54  ASN A CA    1 
ATOM   412  C  C     . ASN A 1 54  ? -21.510 14.764  -29.991 1.00 55.51  ? 54  ASN A C     1 
ATOM   413  O  O     . ASN A 1 54  ? -22.252 15.167  -30.901 1.00 55.26  ? 54  ASN A O     1 
ATOM   414  C  CB    . ASN A 1 54  ? -23.247 14.997  -28.196 1.00 61.15  ? 54  ASN A CB    1 
ATOM   415  C  CG    . ASN A 1 54  ? -23.607 13.536  -27.992 1.00 56.04  ? 54  ASN A CG    1 
ATOM   416  O  OD1   . ASN A 1 54  ? -23.220 12.670  -28.778 1.00 53.66  ? 54  ASN A OD1   1 
ATOM   417  N  ND2   . ASN A 1 54  ? -24.350 13.255  -26.928 1.00 48.35  ? 54  ASN A ND2   1 
ATOM   418  N  N     . PRO A 1 55  ? -20.479 13.960  -30.247 1.00 53.99  ? 55  PRO A N     1 
ATOM   419  C  CA    . PRO A 1 55  ? -20.149 13.564  -31.621 1.00 52.02  ? 55  PRO A CA    1 
ATOM   420  C  C     . PRO A 1 55  ? -20.879 12.331  -32.131 1.00 58.49  ? 55  PRO A C     1 
ATOM   421  O  O     . PRO A 1 55  ? -20.602 11.898  -33.255 1.00 53.56  ? 55  PRO A O     1 
ATOM   422  C  CB    . PRO A 1 55  ? -18.644 13.286  -31.517 1.00 50.26  ? 55  PRO A CB    1 
ATOM   423  C  CG    . PRO A 1 55  ? -18.490 12.724  -30.141 1.00 52.37  ? 55  PRO A CG    1 
ATOM   424  C  CD    . PRO A 1 55  ? -19.498 13.446  -29.274 1.00 49.78  ? 55  PRO A CD    1 
ATOM   425  N  N     . TYR A 1 56  ? -21.792 11.762  -31.353 1.00 56.78  ? 56  TYR A N     1 
ATOM   426  C  CA    . TYR A 1 56  ? -22.443 10.508  -31.696 1.00 52.52  ? 56  TYR A CA    1 
ATOM   427  C  C     . TYR A 1 56  ? -23.802 10.756  -32.344 1.00 50.10  ? 56  TYR A C     1 
ATOM   428  O  O     . TYR A 1 56  ? -24.361 11.853  -32.273 1.00 50.55  ? 56  TYR A O     1 
ATOM   429  C  CB    . TYR A 1 56  ? -22.607 9.633   -30.450 1.00 48.10  ? 56  TYR A CB    1 
ATOM   430  C  CG    . TYR A 1 56  ? -21.335 9.482   -29.647 1.00 46.12  ? 56  TYR A CG    1 
ATOM   431  C  CD1   . TYR A 1 56  ? -20.252 8.771   -30.151 1.00 52.97  ? 56  TYR A CD1   1 
ATOM   432  C  CD2   . TYR A 1 56  ? -21.217 10.046  -28.383 1.00 49.20  ? 56  TYR A CD2   1 
ATOM   433  C  CE1   . TYR A 1 56  ? -19.087 8.630   -29.420 1.00 45.59  ? 56  TYR A CE1   1 
ATOM   434  C  CE2   . TYR A 1 56  ? -20.056 9.910   -27.646 1.00 52.07  ? 56  TYR A CE2   1 
ATOM   435  C  CZ    . TYR A 1 56  ? -18.995 9.201   -28.169 1.00 48.44  ? 56  TYR A CZ    1 
ATOM   436  O  OH    . TYR A 1 56  ? -17.837 9.063   -27.438 1.00 45.46  ? 56  TYR A OH    1 
ATOM   437  N  N     . ASN A 1 57  ? -24.322 9.713   -32.989 1.00 50.71  ? 57  ASN A N     1 
ATOM   438  C  CA    . ASN A 1 57  ? -25.643 9.749   -33.604 1.00 49.33  ? 57  ASN A CA    1 
ATOM   439  C  C     . ASN A 1 57  ? -26.046 8.333   -33.987 1.00 49.64  ? 57  ASN A C     1 
ATOM   440  O  O     . ASN A 1 57  ? -25.190 7.477   -34.236 1.00 43.07  ? 57  ASN A O     1 
ATOM   441  C  CB    . ASN A 1 57  ? -25.672 10.661  -34.838 1.00 41.80  ? 57  ASN A CB    1 
ATOM   442  C  CG    . ASN A 1 57  ? -27.078 10.887  -35.360 1.00 50.79  ? 57  ASN A CG    1 
ATOM   443  O  OD1   . ASN A 1 57  ? -27.796 11.765  -34.881 1.00 53.47  ? 57  ASN A OD1   1 
ATOM   444  N  ND2   . ASN A 1 57  ? -27.481 10.092  -36.345 1.00 53.27  ? 57  ASN A ND2   1 
ATOM   445  N  N     . THR A 1 58  ? -27.360 8.099   -34.035 1.00 34.79  ? 58  THR A N     1 
ATOM   446  C  CA    . THR A 1 58  ? -27.932 6.811   -34.387 1.00 43.57  ? 58  THR A CA    1 
ATOM   447  C  C     . THR A 1 58  ? -29.267 7.072   -35.075 1.00 48.19  ? 58  THR A C     1 
ATOM   448  O  O     . THR A 1 58  ? -30.051 7.898   -34.579 1.00 42.19  ? 58  THR A O     1 
ATOM   449  C  CB    . THR A 1 58  ? -28.136 5.918   -33.162 1.00 46.70  ? 58  THR A CB    1 
ATOM   450  O  OG1   . THR A 1 58  ? -26.899 5.790   -32.448 1.00 43.51  ? 58  THR A OG1   1 
ATOM   451  C  CG2   . THR A 1 58  ? -28.610 4.539   -33.576 1.00 41.86  ? 58  THR A CG2   1 
ATOM   452  N  N     . PRO A 1 59  ? -29.549 6.409   -36.198 1.00 52.84  ? 59  PRO A N     1 
ATOM   453  C  CA    . PRO A 1 59  ? -30.810 6.665   -36.904 1.00 42.68  ? 59  PRO A CA    1 
ATOM   454  C  C     . PRO A 1 59  ? -32.022 6.291   -36.064 1.00 53.87  ? 59  PRO A C     1 
ATOM   455  O  O     . PRO A 1 59  ? -31.977 5.385   -35.229 1.00 53.90  ? 59  PRO A O     1 
ATOM   456  C  CB    . PRO A 1 59  ? -30.707 5.778   -38.151 1.00 41.76  ? 59  PRO A CB    1 
ATOM   457  C  CG    . PRO A 1 59  ? -29.250 5.539   -38.333 1.00 45.14  ? 59  PRO A CG    1 
ATOM   458  C  CD    . PRO A 1 59  ? -28.668 5.502   -36.953 1.00 50.11  ? 59  PRO A CD    1 
ATOM   459  N  N     . VAL A 1 60  ? -33.120 7.014   -36.296 1.00 36.76  ? 60  VAL A N     1 
ATOM   460  C  CA    . VAL A 1 60  ? -34.393 6.752   -35.642 1.00 45.65  ? 60  VAL A CA    1 
ATOM   461  C  C     . VAL A 1 60  ? -35.475 6.629   -36.706 1.00 50.04  ? 60  VAL A C     1 
ATOM   462  O  O     . VAL A 1 60  ? -35.324 7.089   -37.840 1.00 57.00  ? 60  VAL A O     1 
ATOM   463  C  CB    . VAL A 1 60  ? -34.774 7.846   -34.620 1.00 43.05  ? 60  VAL A CB    1 
ATOM   464  C  CG1   . VAL A 1 60  ? -33.724 7.947   -33.528 1.00 43.02  ? 60  VAL A CG1   1 
ATOM   465  C  CG2   . VAL A 1 60  ? -34.970 9.185   -35.316 1.00 50.30  ? 60  VAL A CG2   1 
ATOM   466  N  N     . PHE A 1 61  ? -36.576 5.994   -36.321 1.00 47.69  ? 61  PHE A N     1 
ATOM   467  C  CA    . PHE A 1 61  ? -37.741 5.840   -37.184 1.00 48.61  ? 61  PHE A CA    1 
ATOM   468  C  C     . PHE A 1 61  ? -38.946 5.568   -36.291 1.00 42.50  ? 61  PHE A C     1 
ATOM   469  O  O     . PHE A 1 61  ? -38.849 5.620   -35.060 1.00 44.15  ? 61  PHE A O     1 
ATOM   470  C  CB    . PHE A 1 61  ? -37.515 4.740   -38.229 1.00 52.80  ? 61  PHE A CB    1 
ATOM   471  C  CG    . PHE A 1 61  ? -37.203 3.390   -37.644 1.00 48.91  ? 61  PHE A CG    1 
ATOM   472  C  CD1   . PHE A 1 61  ? -35.919 3.078   -37.227 1.00 48.86  ? 61  PHE A CD1   1 
ATOM   473  C  CD2   . PHE A 1 61  ? -38.191 2.425   -37.531 1.00 54.08  ? 61  PHE A CD2   1 
ATOM   474  C  CE1   . PHE A 1 61  ? -35.627 1.835   -36.695 1.00 51.51  ? 61  PHE A CE1   1 
ATOM   475  C  CE2   . PHE A 1 61  ? -37.906 1.180   -37.001 1.00 47.78  ? 61  PHE A CE2   1 
ATOM   476  C  CZ    . PHE A 1 61  ? -36.623 0.884   -36.583 1.00 46.32  ? 61  PHE A CZ    1 
ATOM   477  N  N     . ALA A 1 62  ? -40.090 5.283   -36.909 1.00 49.19  ? 62  ALA A N     1 
ATOM   478  C  CA    . ALA A 1 62  ? -41.314 5.066   -36.154 1.00 50.28  ? 62  ALA A CA    1 
ATOM   479  C  C     . ALA A 1 62  ? -42.222 4.107   -36.907 1.00 55.71  ? 62  ALA A C     1 
ATOM   480  O  O     . ALA A 1 62  ? -42.217 4.059   -38.140 1.00 59.12  ? 62  ALA A O     1 
ATOM   481  C  CB    . ALA A 1 62  ? -42.050 6.383   -35.882 1.00 43.10  ? 62  ALA A CB    1 
ATOM   482  N  N     . ILE A 1 63  ? -43.000 3.338   -36.145 1.00 55.74  ? 63  ILE A N     1 
ATOM   483  C  CA    . ILE A 1 63  ? -44.003 2.431   -36.683 1.00 53.14  ? 63  ILE A CA    1 
ATOM   484  C  C     . ILE A 1 63  ? -45.295 2.631   -35.900 1.00 50.35  ? 63  ILE A C     1 
ATOM   485  O  O     . ILE A 1 63  ? -45.333 3.325   -34.883 1.00 54.78  ? 63  ILE A O     1 
ATOM   486  C  CB    . ILE A 1 63  ? -43.561 0.954   -36.623 1.00 48.07  ? 63  ILE A CB    1 
ATOM   487  C  CG1   . ILE A 1 63  ? -43.318 0.526   -35.174 1.00 57.32  ? 63  ILE A CG1   1 
ATOM   488  C  CG2   . ILE A 1 63  ? -42.320 0.727   -37.473 1.00 52.95  ? 63  ILE A CG2   1 
ATOM   489  C  CD1   . ILE A 1 63  ? -42.961 -0.936  -35.022 1.00 51.88  ? 63  ILE A CD1   1 
ATOM   490  N  N     . LYS A 1 64  ? -46.362 2.009   -36.391 1.00 55.36  ? 64  LYS A N     1 
ATOM   491  C  CA    . LYS A 1 64  ? -47.648 2.079   -35.717 1.00 59.11  ? 64  LYS A CA    1 
ATOM   492  C  C     . LYS A 1 64  ? -47.683 1.114   -34.538 1.00 57.90  ? 64  LYS A C     1 
ATOM   493  O  O     . LYS A 1 64  ? -47.000 0.086   -34.527 1.00 46.41  ? 64  LYS A O     1 
ATOM   494  C  CB    . LYS A 1 64  ? -48.786 1.757   -36.687 1.00 59.63  ? 64  LYS A CB    1 
ATOM   495  C  CG    . LYS A 1 64  ? -48.738 2.545   -37.986 1.00 71.24  ? 64  LYS A CG    1 
ATOM   496  C  CD    . LYS A 1 64  ? -48.768 4.043   -37.732 1.00 66.15  ? 64  LYS A CD    1 
ATOM   497  C  CE    . LYS A 1 64  ? -50.091 4.480   -37.127 1.00 66.42  ? 64  LYS A CE    1 
ATOM   498  N  NZ    . LYS A 1 64  ? -51.242 4.178   -38.023 1.00 70.25  ? 64  LYS A NZ    1 
ATOM   499  N  N     . LYS A 1 65  ? -48.486 1.459   -33.536 1.00 59.73  ? 65  LYS A N     1 
ATOM   500  C  CA    . LYS A 1 65  ? -48.680 0.594   -32.386 1.00 60.91  ? 65  LYS A CA    1 
ATOM   501  C  C     . LYS A 1 65  ? -49.861 -0.343  -32.632 1.00 68.91  ? 65  LYS A C     1 
ATOM   502  O  O     . LYS A 1 65  ? -50.510 -0.308  -33.680 1.00 64.38  ? 65  LYS A O     1 
ATOM   503  C  CB    . LYS A 1 65  ? -48.890 1.422   -31.118 1.00 52.61  ? 65  LYS A CB    1 
ATOM   504  C  CG    . LYS A 1 65  ? -47.642 2.129   -30.615 1.00 48.47  ? 65  LYS A CG    1 
ATOM   505  C  CD    . LYS A 1 65  ? -47.910 2.835   -29.295 1.00 46.25  ? 65  LYS A CD    1 
ATOM   506  C  CE    . LYS A 1 65  ? -46.642 3.447   -28.724 1.00 44.84  ? 65  LYS A CE    1 
ATOM   507  N  NZ    . LYS A 1 65  ? -46.896 4.133   -27.427 1.00 33.69  ? 65  LYS A NZ    1 
ATOM   508  N  N     . LYS A 1 66  ? -50.140 -1.200  -31.647 1.00 67.38  ? 66  LYS A N     1 
ATOM   509  C  CA    . LYS A 1 66  ? -51.281 -2.104  -31.754 1.00 65.27  ? 66  LYS A CA    1 
ATOM   510  C  C     . LYS A 1 66  ? -52.593 -1.334  -31.823 1.00 69.49  ? 66  LYS A C     1 
ATOM   511  O  O     . LYS A 1 66  ? -53.556 -1.800  -32.443 1.00 75.00  ? 66  LYS A O     1 
ATOM   512  C  CB    . LYS A 1 66  ? -51.290 -3.073  -30.572 1.00 72.60  ? 66  LYS A CB    1 
ATOM   513  C  CG    . LYS A 1 66  ? -52.029 -4.375  -30.827 1.00 75.67  ? 66  LYS A CG    1 
ATOM   514  C  CD    . LYS A 1 66  ? -52.062 -5.231  -29.570 1.00 75.07  ? 66  LYS A CD    1 
ATOM   515  C  CE    . LYS A 1 66  ? -52.432 -6.670  -29.886 1.00 76.09  ? 66  LYS A CE    1 
ATOM   516  N  NZ    . LYS A 1 66  ? -51.373 -7.353  -30.680 1.00 71.95  ? 66  LYS A NZ    1 
ATOM   517  N  N     . ASP A 1 67  ? -52.647 -0.156  -31.197 1.00 76.03  ? 67  ASP A N     1 
ATOM   518  C  CA    . ASP A 1 67  ? -53.831 0.691   -31.272 1.00 80.77  ? 67  ASP A CA    1 
ATOM   519  C  C     . ASP A 1 67  ? -54.003 1.317   -32.651 1.00 87.68  ? 67  ASP A C     1 
ATOM   520  O  O     . ASP A 1 67  ? -55.104 1.771   -32.980 1.00 98.77  ? 67  ASP A O     1 
ATOM   521  C  CB    . ASP A 1 67  ? -53.752 1.776   -30.194 1.00 79.89  ? 67  ASP A CB    1 
ATOM   522  C  CG    . ASP A 1 67  ? -54.995 2.639   -30.137 1.00 85.88  ? 67  ASP A CG    1 
ATOM   523  O  OD1   . ASP A 1 67  ? -56.018 2.178   -29.588 1.00 100.33 ? 67  ASP A OD1   1 
ATOM   524  O  OD2   . ASP A 1 67  ? -54.945 3.784   -30.632 1.00 71.44  ? 67  ASP A OD2   1 
ATOM   525  N  N     . SER A 1 68  ? -52.940 1.353   -33.457 1.00 82.09  ? 68  SER A N     1 
ATOM   526  C  CA    . SER A 1 68  ? -52.905 1.838   -34.836 1.00 82.71  ? 68  SER A CA    1 
ATOM   527  C  C     . SER A 1 68  ? -53.145 3.338   -34.955 1.00 73.55  ? 68  SER A C     1 
ATOM   528  O  O     . SER A 1 68  ? -53.068 3.872   -36.069 1.00 78.31  ? 68  SER A O     1 
ATOM   529  C  CB    . SER A 1 68  ? -53.907 1.104   -35.740 1.00 86.22  ? 68  SER A CB    1 
ATOM   530  O  OG    . SER A 1 68  ? -53.739 1.481   -37.096 1.00 76.01  ? 68  SER A OG    1 
ATOM   531  N  N     . THR A 1 69  ? -53.432 4.038   -33.859 1.00 70.03  ? 69  THR A N     1 
ATOM   532  C  CA    . THR A 1 69  ? -53.566 5.489   -33.879 1.00 60.15  ? 69  THR A CA    1 
ATOM   533  C  C     . THR A 1 69  ? -52.309 6.202   -33.402 1.00 75.15  ? 69  THR A C     1 
ATOM   534  O  O     . THR A 1 69  ? -52.021 7.310   -33.868 1.00 82.64  ? 69  THR A O     1 
ATOM   535  C  CB    . THR A 1 69  ? -54.756 5.926   -33.013 1.00 72.67  ? 69  THR A CB    1 
ATOM   536  O  OG1   . THR A 1 69  ? -55.909 5.146   -33.352 1.00 76.85  ? 69  THR A OG1   1 
ATOM   537  C  CG2   . THR A 1 69  ? -55.075 7.400   -33.230 1.00 81.96  ? 69  THR A CG2   1 
ATOM   538  N  N     . LYS A 1 70  ? -51.550 5.586   -32.503 1.00 59.78  ? 70  LYS A N     1 
ATOM   539  C  CA    . LYS A 1 70  ? -50.347 6.174   -31.937 1.00 61.42  ? 70  LYS A CA    1 
ATOM   540  C  C     . LYS A 1 70  ? -49.102 5.590   -32.598 1.00 55.57  ? 70  LYS A C     1 
ATOM   541  O  O     . LYS A 1 70  ? -49.134 4.516   -33.204 1.00 52.77  ? 70  LYS A O     1 
ATOM   542  C  CB    . LYS A 1 70  ? -50.302 5.940   -30.425 1.00 60.61  ? 70  LYS A CB    1 
ATOM   543  C  CG    . LYS A 1 70  ? -51.626 6.219   -29.728 1.00 55.52  ? 70  LYS A CG    1 
ATOM   544  C  CD    . LYS A 1 70  ? -51.555 5.909   -28.243 1.00 69.23  ? 70  LYS A CD    1 
ATOM   545  C  CE    . LYS A 1 70  ? -50.588 6.841   -27.533 1.00 68.03  ? 70  LYS A CE    1 
ATOM   546  N  NZ    . LYS A 1 70  ? -50.509 6.551   -26.075 1.00 60.88  ? 70  LYS A NZ    1 
ATOM   547  N  N     . TRP A 1 71  ? -47.997 6.319   -32.473 1.00 44.35  ? 71  TRP A N     1 
ATOM   548  C  CA    . TRP A 1 71  ? -46.723 5.929   -33.054 1.00 50.85  ? 71  TRP A CA    1 
ATOM   549  C  C     . TRP A 1 71  ? -45.756 5.476   -31.967 1.00 45.87  ? 71  TRP A C     1 
ATOM   550  O  O     . TRP A 1 71  ? -45.864 5.880   -30.805 1.00 46.32  ? 71  TRP A O     1 
ATOM   551  C  CB    . TRP A 1 71  ? -46.101 7.084   -33.846 1.00 57.95  ? 71  TRP A CB    1 
ATOM   552  C  CG    . TRP A 1 71  ? -46.844 7.434   -35.098 1.00 60.83  ? 71  TRP A CG    1 
ATOM   553  C  CD1   . TRP A 1 71  ? -47.910 8.278   -35.210 1.00 50.91  ? 71  TRP A CD1   1 
ATOM   554  C  CD2   . TRP A 1 71  ? -46.571 6.955   -36.421 1.00 55.69  ? 71  TRP A CD2   1 
ATOM   555  N  NE1   . TRP A 1 71  ? -48.321 8.352   -36.520 1.00 63.06  ? 71  TRP A NE1   1 
ATOM   556  C  CE2   . TRP A 1 71  ? -47.514 7.549   -37.284 1.00 61.57  ? 71  TRP A CE2   1 
ATOM   557  C  CE3   . TRP A 1 71  ? -45.621 6.081   -36.959 1.00 60.19  ? 71  TRP A CE3   1 
ATOM   558  C  CZ2   . TRP A 1 71  ? -47.536 7.297   -38.654 1.00 55.17  ? 71  TRP A CZ2   1 
ATOM   559  C  CZ3   . TRP A 1 71  ? -45.644 5.832   -38.321 1.00 64.55  ? 71  TRP A CZ3   1 
ATOM   560  C  CH2   . TRP A 1 71  ? -46.595 6.438   -39.152 1.00 60.63  ? 71  TRP A CH2   1 
ATOM   561  N  N     . ARG A 1 72  ? -44.804 4.634   -32.361 1.00 36.77  ? 72  ARG A N     1 
ATOM   562  C  CA    . ARG A 1 72  ? -43.765 4.131   -31.470 1.00 40.52  ? 72  ARG A CA    1 
ATOM   563  C  C     . ARG A 1 72  ? -42.411 4.586   -31.993 1.00 43.68  ? 72  ARG A C     1 
ATOM   564  O  O     . ARG A 1 72  ? -42.021 4.225   -33.109 1.00 43.26  ? 72  ARG A O     1 
ATOM   565  C  CB    . ARG A 1 72  ? -43.814 2.605   -31.371 1.00 39.27  ? 72  ARG A CB    1 
ATOM   566  C  CG    . ARG A 1 72  ? -42.716 2.010   -30.507 1.00 33.85  ? 72  ARG A CG    1 
ATOM   567  C  CD    . ARG A 1 72  ? -42.735 0.490   -30.552 1.00 38.95  ? 72  ARG A CD    1 
ATOM   568  N  NE    . ARG A 1 72  ? -44.052 -0.052  -30.233 1.00 40.40  ? 72  ARG A NE    1 
ATOM   569  C  CZ    . ARG A 1 72  ? -44.514 -0.220  -28.999 1.00 42.07  ? 72  ARG A CZ    1 
ATOM   570  N  NH1   . ARG A 1 72  ? -43.767 0.119   -27.956 1.00 39.43  ? 72  ARG A NH1   1 
ATOM   571  N  NH2   . ARG A 1 72  ? -45.727 -0.723  -28.808 1.00 35.77  ? 72  ARG A NH2   1 
ATOM   572  N  N     . LYS A 1 73  ? -41.697 5.370   -31.189 1.00 41.22  ? 73  LYS A N     1 
ATOM   573  C  CA    . LYS A 1 73  ? -40.381 5.864   -31.574 1.00 36.02  ? 73  LYS A CA    1 
ATOM   574  C  C     . LYS A 1 73  ? -39.342 4.767   -31.372 1.00 40.42  ? 73  LYS A C     1 
ATOM   575  O  O     . LYS A 1 73  ? -39.103 4.331   -30.241 1.00 44.86  ? 73  LYS A O     1 
ATOM   576  C  CB    . LYS A 1 73  ? -40.018 7.106   -30.763 1.00 31.23  ? 73  LYS A CB    1 
ATOM   577  C  CG    . LYS A 1 73  ? -38.644 7.668   -31.081 1.00 42.16  ? 73  LYS A CG    1 
ATOM   578  C  CD    . LYS A 1 73  ? -38.367 8.933   -30.289 1.00 40.14  ? 73  LYS A CD    1 
ATOM   579  C  CE    . LYS A 1 73  ? -37.053 9.566   -30.714 1.00 30.54  ? 73  LYS A CE    1 
ATOM   580  N  NZ    . LYS A 1 73  ? -35.893 8.661   -30.491 1.00 43.22  ? 73  LYS A NZ    1 
ATOM   581  N  N     . LEU A 1 74  ? -38.725 4.327   -32.464 1.00 41.56  ? 74  LEU A N     1 
ATOM   582  C  CA    . LEU A 1 74  ? -37.710 3.286   -32.433 1.00 36.67  ? 74  LEU A CA    1 
ATOM   583  C  C     . LEU A 1 74  ? -36.362 3.850   -32.863 1.00 42.21  ? 74  LEU A C     1 
ATOM   584  O  O     . LEU A 1 74  ? -36.289 4.834   -33.605 1.00 47.53  ? 74  LEU A O     1 
ATOM   585  C  CB    . LEU A 1 74  ? -38.093 2.116   -33.343 1.00 38.69  ? 74  LEU A CB    1 
ATOM   586  C  CG    . LEU A 1 74  ? -39.352 1.334   -32.967 1.00 47.01  ? 74  LEU A CG    1 
ATOM   587  C  CD1   . LEU A 1 74  ? -39.668 0.300   -34.033 1.00 36.89  ? 74  LEU A CD1   1 
ATOM   588  C  CD2   . LEU A 1 74  ? -39.184 0.666   -31.611 1.00 41.66  ? 74  LEU A CD2   1 
ATOM   589  N  N     . VAL A 1 75  ? -35.293 3.215   -32.387 1.00 44.58  ? 75  VAL A N     1 
ATOM   590  C  CA    . VAL A 1 75  ? -33.927 3.610   -32.707 1.00 44.30  ? 75  VAL A CA    1 
ATOM   591  C  C     . VAL A 1 75  ? -33.169 2.378   -33.178 1.00 43.74  ? 75  VAL A C     1 
ATOM   592  O  O     . VAL A 1 75  ? -33.209 1.331   -32.521 1.00 46.52  ? 75  VAL A O     1 
ATOM   593  C  CB    . VAL A 1 75  ? -33.214 4.250   -31.500 1.00 40.95  ? 75  VAL A CB    1 
ATOM   594  C  CG1   . VAL A 1 75  ? -31.847 4.765   -31.909 1.00 42.92  ? 75  VAL A CG1   1 
ATOM   595  C  CG2   . VAL A 1 75  ? -34.056 5.372   -30.906 1.00 40.03  ? 75  VAL A CG2   1 
ATOM   596  N  N     . ASP A 1 76  ? -32.480 2.502   -34.314 1.00 42.30  ? 76  ASP A N     1 
ATOM   597  C  CA    . ASP A 1 76  ? -31.692 1.404   -34.877 1.00 42.59  ? 76  ASP A CA    1 
ATOM   598  C  C     . ASP A 1 76  ? -30.309 1.389   -34.224 1.00 45.42  ? 76  ASP A C     1 
ATOM   599  O  O     . ASP A 1 76  ? -29.287 1.736   -34.820 1.00 50.81  ? 76  ASP A O     1 
ATOM   600  C  CB    . ASP A 1 76  ? -31.603 1.535   -36.392 1.00 50.21  ? 76  ASP A CB    1 
ATOM   601  C  CG    . ASP A 1 76  ? -30.790 0.422   -37.028 1.00 52.95  ? 76  ASP A CG    1 
ATOM   602  O  OD1   . ASP A 1 76  ? -30.713 -0.675  -36.436 1.00 57.50  ? 76  ASP A OD1   1 
ATOM   603  O  OD2   . ASP A 1 76  ? -30.225 0.648   -38.120 1.00 62.17  ? 76  ASP A OD2   1 
ATOM   604  N  N     . PHE A 1 77  ? -30.292 0.962   -32.961 1.00 46.71  ? 77  PHE A N     1 
ATOM   605  C  CA    . PHE A 1 77  ? -29.080 0.906   -32.153 1.00 46.54  ? 77  PHE A CA    1 
ATOM   606  C  C     . PHE A 1 77  ? -28.192 -0.294  -32.475 1.00 41.20  ? 77  PHE A C     1 
ATOM   607  O  O     . PHE A 1 77  ? -27.406 -0.700  -31.609 1.00 37.75  ? 77  PHE A O     1 
ATOM   608  C  CB    . PHE A 1 77  ? -29.442 0.886   -30.665 1.00 47.78  ? 77  PHE A CB    1 
ATOM   609  C  CG    . PHE A 1 77  ? -29.618 2.249   -30.061 1.00 42.94  ? 77  PHE A CG    1 
ATOM   610  C  CD1   . PHE A 1 77  ? -28.729 3.270   -30.348 1.00 43.67  ? 77  PHE A CD1   1 
ATOM   611  C  CD2   . PHE A 1 77  ? -30.671 2.506   -29.199 1.00 37.46  ? 77  PHE A CD2   1 
ATOM   612  C  CE1   . PHE A 1 77  ? -28.888 4.526   -29.790 1.00 46.16  ? 77  PHE A CE1   1 
ATOM   613  C  CE2   . PHE A 1 77  ? -30.837 3.760   -28.637 1.00 48.09  ? 77  PHE A CE2   1 
ATOM   614  C  CZ    . PHE A 1 77  ? -29.943 4.772   -28.933 1.00 38.69  ? 77  PHE A CZ    1 
ATOM   615  N  N     . ARG A 1 78  ? -28.288 -0.854  -33.685 1.00 47.15  ? 78  ARG A N     1 
ATOM   616  C  CA    . ARG A 1 78  ? -27.540 -2.067  -34.011 1.00 42.81  ? 78  ARG A CA    1 
ATOM   617  C  C     . ARG A 1 78  ? -26.043 -1.881  -33.798 1.00 44.46  ? 78  ARG A C     1 
ATOM   618  O  O     . ARG A 1 78  ? -25.352 -2.809  -33.362 1.00 52.55  ? 78  ARG A O     1 
ATOM   619  C  CB    . ARG A 1 78  ? -27.825 -2.493  -35.452 1.00 50.56  ? 78  ARG A CB    1 
ATOM   620  C  CG    . ARG A 1 78  ? -28.988 -3.462  -35.592 1.00 52.85  ? 78  ARG A CG    1 
ATOM   621  C  CD    . ARG A 1 78  ? -29.092 -4.024  -37.005 1.00 57.66  ? 78  ARG A CD    1 
ATOM   622  N  NE    . ARG A 1 78  ? -29.999 -3.251  -37.851 1.00 65.85  ? 78  ARG A NE    1 
ATOM   623  C  CZ    . ARG A 1 78  ? -29.608 -2.357  -38.752 1.00 69.06  ? 78  ARG A CZ    1 
ATOM   624  N  NH1   . ARG A 1 78  ? -28.317 -2.114  -38.936 1.00 65.48  ? 78  ARG A NH1   1 
ATOM   625  N  NH2   . ARG A 1 78  ? -30.511 -1.705  -39.473 1.00 60.72  ? 78  ARG A NH2   1 
ATOM   626  N  N     . GLU A 1 79  ? -25.522 -0.689  -34.090 1.00 38.91  ? 79  GLU A N     1 
ATOM   627  C  CA    . GLU A 1 79  ? -24.092 -0.457  -33.924 1.00 47.73  ? 79  GLU A CA    1 
ATOM   628  C  C     . GLU A 1 79  ? -23.719 -0.288  -32.456 1.00 49.33  ? 79  GLU A C     1 
ATOM   629  O  O     . GLU A 1 79  ? -22.695 -0.819  -32.009 1.00 53.67  ? 79  GLU A O     1 
ATOM   630  C  CB    . GLU A 1 79  ? -23.659 0.765   -34.733 1.00 60.77  ? 79  GLU A CB    1 
ATOM   631  C  CG    . GLU A 1 79  ? -22.166 0.831   -34.997 1.00 64.01  ? 79  GLU A CG    1 
ATOM   632  C  CD    . GLU A 1 79  ? -21.669 -0.337  -35.829 1.00 67.05  ? 79  GLU A CD    1 
ATOM   633  O  OE1   . GLU A 1 79  ? -22.446 -0.855  -36.660 1.00 63.11  ? 79  GLU A OE1   1 
ATOM   634  O  OE2   . GLU A 1 79  ? -20.501 -0.742  -35.648 1.00 75.82  ? 79  GLU A OE2   1 
ATOM   635  N  N     . LEU A 1 80  ? -24.533 0.446   -31.692 1.00 43.41  ? 80  LEU A N     1 
ATOM   636  C  CA    . LEU A 1 80  ? -24.269 0.598   -30.265 1.00 46.17  ? 80  LEU A CA    1 
ATOM   637  C  C     . LEU A 1 80  ? -24.454 -0.716  -29.517 1.00 45.55  ? 80  LEU A C     1 
ATOM   638  O  O     . LEU A 1 80  ? -23.755 -0.969  -28.528 1.00 39.95  ? 80  LEU A O     1 
ATOM   639  C  CB    . LEU A 1 80  ? -25.176 1.680   -29.676 1.00 41.61  ? 80  LEU A CB    1 
ATOM   640  C  CG    . LEU A 1 80  ? -25.150 1.881   -28.158 1.00 45.97  ? 80  LEU A CG    1 
ATOM   641  C  CD1   . LEU A 1 80  ? -23.754 2.246   -27.678 1.00 38.34  ? 80  LEU A CD1   1 
ATOM   642  C  CD2   . LEU A 1 80  ? -26.155 2.943   -27.738 1.00 42.65  ? 80  LEU A CD2   1 
ATOM   643  N  N     . ASN A 1 81  ? -25.382 -1.563  -29.971 1.00 38.99  ? 81  ASN A N     1 
ATOM   644  C  CA    . ASN A 1 81  ? -25.608 -2.840  -29.303 1.00 45.62  ? 81  ASN A CA    1 
ATOM   645  C  C     . ASN A 1 81  ? -24.392 -3.751  -29.421 1.00 51.32  ? 81  ASN A C     1 
ATOM   646  O  O     . ASN A 1 81  ? -24.077 -4.497  -28.486 1.00 49.90  ? 81  ASN A O     1 
ATOM   647  C  CB    . ASN A 1 81  ? -26.850 -3.522  -29.877 1.00 35.80  ? 81  ASN A CB    1 
ATOM   648  C  CG    . ASN A 1 81  ? -28.127 -2.758  -29.578 1.00 45.07  ? 81  ASN A CG    1 
ATOM   649  O  OD1   . ASN A 1 81  ? -28.220 -2.048  -28.575 1.00 47.27  ? 81  ASN A OD1   1 
ATOM   650  N  ND2   . ASN A 1 81  ? -29.119 -2.900  -30.451 1.00 41.38  ? 81  ASN A ND2   1 
ATOM   651  N  N     . LYS A 1 82  ? -23.693 -3.703  -30.558 1.00 48.73  ? 82  LYS A N     1 
ATOM   652  C  CA    . LYS A 1 82  ? -22.481 -4.503  -30.711 1.00 45.86  ? 82  LYS A CA    1 
ATOM   653  C  C     . LYS A 1 82  ? -21.393 -4.063  -29.743 1.00 48.39  ? 82  LYS A C     1 
ATOM   654  O  O     . LYS A 1 82  ? -20.536 -4.868  -29.362 1.00 54.54  ? 82  LYS A O     1 
ATOM   655  C  CB    . LYS A 1 82  ? -21.965 -4.415  -32.148 1.00 57.37  ? 82  LYS A CB    1 
ATOM   656  C  CG    . LYS A 1 82  ? -22.910 -4.971  -33.197 1.00 56.62  ? 82  LYS A CG    1 
ATOM   657  C  CD    . LYS A 1 82  ? -22.353 -4.752  -34.595 1.00 52.78  ? 82  LYS A CD    1 
ATOM   658  C  CE    . LYS A 1 82  ? -23.309 -5.259  -35.662 1.00 72.36  ? 82  LYS A CE    1 
ATOM   659  N  NZ    . LYS A 1 82  ? -22.797 -4.998  -37.036 1.00 78.41  ? 82  LYS A NZ    1 
ATOM   660  N  N     . ARG A 1 83  ? -21.413 -2.798  -29.328 1.00 52.75  ? 83  ARG A N     1 
ATOM   661  C  CA    . ARG A 1 83  ? -20.362 -2.222  -28.502 1.00 52.20  ? 83  ARG A CA    1 
ATOM   662  C  C     . ARG A 1 83  ? -20.763 -2.083  -27.040 1.00 55.11  ? 83  ARG A C     1 
ATOM   663  O  O     . ARG A 1 83  ? -19.956 -1.610  -26.233 1.00 47.93  ? 83  ARG A O     1 
ATOM   664  C  CB    . ARG A 1 83  ? -19.955 -0.858  -29.068 1.00 53.29  ? 83  ARG A CB    1 
ATOM   665  C  CG    . ARG A 1 83  ? -19.715 -0.886  -30.571 1.00 62.90  ? 83  ARG A CG    1 
ATOM   666  C  CD    . ARG A 1 83  ? -19.525 0.505   -31.143 1.00 57.06  ? 83  ARG A CD    1 
ATOM   667  N  NE    . ARG A 1 83  ? -19.340 0.478   -32.591 1.00 66.16  ? 83  ARG A NE    1 
ATOM   668  C  CZ    . ARG A 1 83  ? -19.128 1.557   -33.337 1.00 75.33  ? 83  ARG A CZ    1 
ATOM   669  N  NH1   . ARG A 1 83  ? -19.074 2.756   -32.773 1.00 63.29  ? 83  ARG A NH1   1 
ATOM   670  N  NH2   . ARG A 1 83  ? -18.969 1.439   -34.648 1.00 80.99  ? 83  ARG A NH2   1 
ATOM   671  N  N     . THR A 1 84  ? -21.978 -2.482  -26.680 1.00 46.73  ? 84  THR A N     1 
ATOM   672  C  CA    . THR A 1 84  ? -22.445 -2.428  -25.304 1.00 41.21  ? 84  THR A CA    1 
ATOM   673  C  C     . THR A 1 84  ? -22.082 -3.718  -24.576 1.00 40.05  ? 84  THR A C     1 
ATOM   674  O  O     . THR A 1 84  ? -21.991 -4.790  -25.181 1.00 53.45  ? 84  THR A O     1 
ATOM   675  C  CB    . THR A 1 84  ? -23.960 -2.203  -25.259 1.00 40.89  ? 84  THR A CB    1 
ATOM   676  O  OG1   . THR A 1 84  ? -24.301 -1.087  -26.089 1.00 43.85  ? 84  THR A OG1   1 
ATOM   677  C  CG2   . THR A 1 84  ? -24.433 -1.920  -23.837 1.00 40.30  ? 84  THR A CG2   1 
ATOM   678  N  N     . GLN A 1 85  ? -21.862 -3.597  -23.266 1.00 37.82  ? 85  GLN A N     1 
ATOM   679  C  CA    . GLN A 1 85  ? -21.544 -4.734  -22.409 1.00 42.35  ? 85  GLN A CA    1 
ATOM   680  C  C     . GLN A 1 85  ? -22.593 -5.833  -22.513 1.00 47.31  ? 85  GLN A C     1 
ATOM   681  O  O     . GLN A 1 85  ? -23.735 -5.579  -22.909 1.00 42.95  ? 85  GLN A O     1 
ATOM   682  C  CB    . GLN A 1 85  ? -21.428 -4.286  -20.951 1.00 40.94  ? 85  GLN A CB    1 
ATOM   683  C  CG    . GLN A 1 85  ? -22.753 -3.809  -20.368 1.00 40.19  ? 85  GLN A CG    1 
ATOM   684  C  CD    . GLN A 1 85  ? -22.749 -3.753  -18.854 1.00 45.18  ? 85  GLN A CD    1 
ATOM   685  O  OE1   . GLN A 1 85  ? -22.257 -2.796  -18.256 1.00 43.51  ? 85  GLN A OE1   1 
ATOM   686  N  NE2   . GLN A 1 85  ? -23.303 -4.784  -18.224 1.00 35.73  ? 85  GLN A NE2   1 
ATOM   687  N  N     . ASP A 1 86  ? -22.215 -7.057  -22.155 1.00 45.32  ? 86  ASP A N     1 
ATOM   688  C  CA    . ASP A 1 86  ? -23.180 -8.143  -22.088 1.00 44.44  ? 86  ASP A CA    1 
ATOM   689  C  C     . ASP A 1 86  ? -24.074 -7.984  -20.864 1.00 45.93  ? 86  ASP A C     1 
ATOM   690  O  O     . ASP A 1 86  ? -23.681 -7.407  -19.846 1.00 38.31  ? 86  ASP A O     1 
ATOM   691  C  CB    . ASP A 1 86  ? -22.472 -9.497  -22.033 1.00 42.10  ? 86  ASP A CB    1 
ATOM   692  C  CG    . ASP A 1 86  ? -21.769 -9.846  -23.329 1.00 52.64  ? 86  ASP A CG    1 
ATOM   693  O  OD1   . ASP A 1 86  ? -20.636 -10.367 -23.268 1.00 58.98  ? 86  ASP A OD1   1 
ATOM   694  O  OD2   . ASP A 1 86  ? -22.352 -9.606  -24.408 1.00 54.31  ? 86  ASP A OD2   1 
ATOM   695  N  N     . PHE A 1 87  ? -25.292 -8.500  -20.976 1.00 39.53  ? 87  PHE A N     1 
ATOM   696  C  CA    . PHE A 1 87  ? -26.226 -8.571  -19.865 1.00 41.44  ? 87  PHE A CA    1 
ATOM   697  C  C     . PHE A 1 87  ? -26.646 -10.019 -19.662 1.00 43.72  ? 87  PHE A C     1 
ATOM   698  O  O     . PHE A 1 87  ? -26.514 -10.855 -20.560 1.00 32.93  ? 87  PHE A O     1 
ATOM   699  C  CB    . PHE A 1 87  ? -27.472 -7.707  -20.116 1.00 36.33  ? 87  PHE A CB    1 
ATOM   700  C  CG    . PHE A 1 87  ? -27.177 -6.249  -20.317 1.00 44.00  ? 87  PHE A CG    1 
ATOM   701  C  CD1   . PHE A 1 87  ? -26.867 -5.758  -21.575 1.00 38.39  ? 87  PHE A CD1   1 
ATOM   702  C  CD2   . PHE A 1 87  ? -27.223 -5.366  -19.251 1.00 41.20  ? 87  PHE A CD2   1 
ATOM   703  C  CE1   . PHE A 1 87  ? -26.600 -4.416  -21.763 1.00 35.56  ? 87  PHE A CE1   1 
ATOM   704  C  CE2   . PHE A 1 87  ? -26.958 -4.023  -19.433 1.00 43.47  ? 87  PHE A CE2   1 
ATOM   705  C  CZ    . PHE A 1 87  ? -26.646 -3.547  -20.690 1.00 42.73  ? 87  PHE A CZ    1 
ATOM   706  N  N     . TRP A 1 88  ? -27.154 -10.316 -18.471 1.00 41.77  ? 88  TRP A N     1 
ATOM   707  C  CA    . TRP A 1 88  ? -27.815 -11.590 -18.224 1.00 40.09  ? 88  TRP A CA    1 
ATOM   708  C  C     . TRP A 1 88  ? -29.319 -11.363 -18.250 1.00 34.15  ? 88  TRP A C     1 
ATOM   709  O  O     . TRP A 1 88  ? -29.857 -10.632 -17.410 1.00 36.21  ? 88  TRP A O     1 
ATOM   710  C  CB    . TRP A 1 88  ? -27.397 -12.219 -16.898 1.00 35.17  ? 88  TRP A CB    1 
ATOM   711  C  CG    . TRP A 1 88  ? -27.996 -13.582 -16.753 1.00 33.99  ? 88  TRP A CG    1 
ATOM   712  C  CD1   . TRP A 1 88  ? -29.110 -13.921 -16.040 1.00 34.56  ? 88  TRP A CD1   1 
ATOM   713  C  CD2   . TRP A 1 88  ? -27.543 -14.784 -17.386 1.00 42.26  ? 88  TRP A CD2   1 
ATOM   714  N  NE1   . TRP A 1 88  ? -29.363 -15.265 -16.170 1.00 37.81  ? 88  TRP A NE1   1 
ATOM   715  C  CE2   . TRP A 1 88  ? -28.418 -15.817 -16.995 1.00 26.05  ? 88  TRP A CE2   1 
ATOM   716  C  CE3   . TRP A 1 88  ? -26.477 -15.088 -18.239 1.00 36.60  ? 88  TRP A CE3   1 
ATOM   717  C  CZ2   . TRP A 1 88  ? -28.257 -17.134 -17.423 1.00 37.05  ? 88  TRP A CZ2   1 
ATOM   718  C  CZ3   . TRP A 1 88  ? -26.319 -16.395 -18.664 1.00 33.46  ? 88  TRP A CZ3   1 
ATOM   719  C  CH2   . TRP A 1 88  ? -27.203 -17.402 -18.255 1.00 33.33  ? 88  TRP A CH2   1 
ATOM   720  N  N     . GLU A 1 89  ? -29.989 -11.990 -19.211 1.00 34.11  ? 89  GLU A N     1 
ATOM   721  C  CA    . GLU A 1 89  ? -31.422 -11.800 -19.374 1.00 34.63  ? 89  GLU A CA    1 
ATOM   722  C  C     . GLU A 1 89  ? -32.177 -12.459 -18.228 1.00 38.08  ? 89  GLU A C     1 
ATOM   723  O  O     . GLU A 1 89  ? -31.969 -13.639 -17.928 1.00 39.90  ? 89  GLU A O     1 
ATOM   724  C  CB    . GLU A 1 89  ? -31.875 -12.373 -20.714 1.00 35.86  ? 89  GLU A CB    1 
ATOM   725  C  CG    . GLU A 1 89  ? -31.109 -11.819 -21.905 1.00 25.90  ? 89  GLU A CG    1 
ATOM   726  C  CD    . GLU A 1 89  ? -31.354 -10.335 -22.122 1.00 43.61  ? 89  GLU A CD    1 
ATOM   727  O  OE1   . GLU A 1 89  ? -32.416 -9.833  -21.692 1.00 35.64  ? 89  GLU A OE1   1 
ATOM   728  O  OE2   . GLU A 1 89  ? -30.483 -9.670  -22.723 1.00 35.18  ? 89  GLU A OE2   1 
ATOM   729  N  N     . VAL A 1 90  ? -33.056 -11.688 -17.581 1.00 35.21  ? 90  VAL A N     1 
ATOM   730  C  CA    . VAL A 1 90  ? -33.842 -12.199 -16.462 1.00 36.21  ? 90  VAL A CA    1 
ATOM   731  C  C     . VAL A 1 90  ? -35.167 -12.804 -16.901 1.00 32.82  ? 90  VAL A C     1 
ATOM   732  O  O     . VAL A 1 90  ? -35.827 -13.477 -16.095 1.00 31.37  ? 90  VAL A O     1 
ATOM   733  C  CB    . VAL A 1 90  ? -34.106 -11.090 -15.424 1.00 42.19  ? 90  VAL A CB    1 
ATOM   734  C  CG1   . VAL A 1 90  ? -32.803 -10.651 -14.774 1.00 35.70  ? 90  VAL A CG1   1 
ATOM   735  C  CG2   . VAL A 1 90  ? -34.803 -9.907  -16.079 1.00 30.86  ? 90  VAL A CG2   1 
ATOM   736  N  N     . GLN A 1 91  ? -35.581 -12.585 -18.147 1.00 34.90  ? 91  GLN A N     1 
ATOM   737  C  CA    . GLN A 1 91  ? -36.799 -13.192 -18.674 1.00 29.63  ? 91  GLN A CA    1 
ATOM   738  C  C     . GLN A 1 91  ? -36.491 -14.635 -19.056 1.00 32.41  ? 91  GLN A C     1 
ATOM   739  O  O     . GLN A 1 91  ? -35.772 -14.888 -20.028 1.00 34.98  ? 91  GLN A O     1 
ATOM   740  C  CB    . GLN A 1 91  ? -37.319 -12.399 -19.869 1.00 29.63  ? 91  GLN A CB    1 
ATOM   741  C  CG    . GLN A 1 91  ? -38.752 -12.730 -20.255 1.00 35.53  ? 91  GLN A CG    1 
ATOM   742  C  CD    . GLN A 1 91  ? -39.750 -12.327 -19.186 1.00 31.80  ? 91  GLN A CD    1 
ATOM   743  O  OE1   . GLN A 1 91  ? -39.564 -11.328 -18.492 1.00 33.56  ? 91  GLN A OE1   1 
ATOM   744  N  NE2   . GLN A 1 91  ? -40.814 -13.108 -19.046 1.00 32.09  ? 91  GLN A NE2   1 
ATOM   745  N  N     . LEU A 1 92  ? -37.033 -15.584 -18.294 1.00 27.08  ? 92  LEU A N     1 
ATOM   746  C  CA    . LEU A 1 92  ? -36.709 -16.992 -18.471 1.00 34.23  ? 92  LEU A CA    1 
ATOM   747  C  C     . LEU A 1 92  ? -37.722 -17.745 -19.322 1.00 36.10  ? 92  LEU A C     1 
ATOM   748  O  O     . LEU A 1 92  ? -37.488 -18.915 -19.641 1.00 33.63  ? 92  LEU A O     1 
ATOM   749  C  CB    . LEU A 1 92  ? -36.581 -17.677 -17.105 1.00 27.25  ? 92  LEU A CB    1 
ATOM   750  C  CG    . LEU A 1 92  ? -35.667 -16.974 -16.096 1.00 37.55  ? 92  LEU A CG    1 
ATOM   751  C  CD1   . LEU A 1 92  ? -35.500 -17.816 -14.840 1.00 30.78  ? 92  LEU A CD1   1 
ATOM   752  C  CD2   . LEU A 1 92  ? -34.313 -16.650 -16.715 1.00 30.58  ? 92  LEU A CD2   1 
ATOM   753  N  N     . GLY A 1 93  ? -38.828 -17.114 -19.698 1.00 26.26  ? 93  GLY A N     1 
ATOM   754  C  CA    . GLY A 1 93  ? -39.826 -17.784 -20.503 1.00 25.08  ? 93  GLY A CA    1 
ATOM   755  C  C     . GLY A 1 93  ? -41.066 -16.925 -20.642 1.00 36.93  ? 93  GLY A C     1 
ATOM   756  O  O     . GLY A 1 93  ? -41.075 -15.748 -20.275 1.00 34.69  ? 93  GLY A O     1 
ATOM   757  N  N     . ILE A 1 94  ? -42.114 -17.542 -21.179 1.00 29.05  ? 94  ILE A N     1 
ATOM   758  C  CA    . ILE A 1 94  ? -43.369 -16.869 -21.484 1.00 30.02  ? 94  ILE A CA    1 
ATOM   759  C  C     . ILE A 1 94  ? -44.455 -17.495 -20.620 1.00 32.90  ? 94  ILE A C     1 
ATOM   760  O  O     . ILE A 1 94  ? -44.574 -18.721 -20.588 1.00 36.87  ? 94  ILE A O     1 
ATOM   761  C  CB    . ILE A 1 94  ? -43.746 -16.975 -22.973 1.00 31.90  ? 94  ILE A CB    1 
ATOM   762  C  CG1   . ILE A 1 94  ? -42.529 -16.680 -23.854 1.00 38.71  ? 94  ILE A CG1   1 
ATOM   763  C  CG2   . ILE A 1 94  ? -44.890 -16.029 -23.305 1.00 34.16  ? 94  ILE A CG2   1 
ATOM   764  C  CD1   . ILE A 1 94  ? -41.927 -15.305 -23.636 1.00 35.62  ? 94  ILE A CD1   1 
ATOM   765  N  N     . PRO A 1 95  ? -45.260 -16.706 -19.908 1.00 26.82  ? 95  PRO A N     1 
ATOM   766  C  CA    . PRO A 1 95  ? -46.336 -17.294 -19.101 1.00 22.02  ? 95  PRO A CA    1 
ATOM   767  C  C     . PRO A 1 95  ? -47.451 -17.839 -19.979 1.00 33.32  ? 95  PRO A C     1 
ATOM   768  O  O     . PRO A 1 95  ? -47.793 -17.260 -21.013 1.00 26.00  ? 95  PRO A O     1 
ATOM   769  C  CB    . PRO A 1 95  ? -46.822 -16.118 -18.246 1.00 28.65  ? 95  PRO A CB    1 
ATOM   770  C  CG    . PRO A 1 95  ? -46.479 -14.908 -19.050 1.00 22.24  ? 95  PRO A CG    1 
ATOM   771  C  CD    . PRO A 1 95  ? -45.192 -15.242 -19.761 1.00 30.46  ? 95  PRO A CD    1 
ATOM   772  N  N     . HIS A 1 96  ? -48.023 -18.967 -19.550 1.00 28.13  ? 96  HIS A N     1 
ATOM   773  C  CA    . HIS A 1 96  ? -49.095 -19.587 -20.308 1.00 30.66  ? 96  HIS A CA    1 
ATOM   774  C  C     . HIS A 1 96  ? -50.395 -19.562 -19.513 1.00 29.72  ? 96  HIS A C     1 
ATOM   775  O  O     . HIS A 1 96  ? -50.375 -19.756 -18.291 1.00 30.88  ? 96  HIS A O     1 
ATOM   776  C  CB    . HIS A 1 96  ? -48.749 -21.036 -20.672 1.00 24.88  ? 96  HIS A CB    1 
ATOM   777  C  CG    . HIS A 1 96  ? -49.570 -21.589 -21.794 1.00 30.10  ? 96  HIS A CG    1 
ATOM   778  N  ND1   . HIS A 1 96  ? -50.799 -22.180 -21.596 1.00 27.28  ? 96  HIS A ND1   1 
ATOM   779  C  CD2   . HIS A 1 96  ? -49.342 -21.632 -23.128 1.00 29.33  ? 96  HIS A CD2   1 
ATOM   780  C  CE1   . HIS A 1 96  ? -51.292 -22.566 -22.760 1.00 32.06  ? 96  HIS A CE1   1 
ATOM   781  N  NE2   . HIS A 1 96  ? -50.427 -22.246 -23.706 1.00 36.72  ? 96  HIS A NE2   1 
ATOM   782  N  N     . PRO A 1 97  ? -51.533 -19.320 -20.170 1.00 30.05  ? 97  PRO A N     1 
ATOM   783  C  CA    . PRO A 1 97  ? -52.804 -19.255 -19.428 1.00 30.88  ? 97  PRO A CA    1 
ATOM   784  C  C     . PRO A 1 97  ? -53.192 -20.563 -18.765 1.00 32.42  ? 97  PRO A C     1 
ATOM   785  O  O     . PRO A 1 97  ? -53.912 -20.542 -17.758 1.00 32.04  ? 97  PRO A O     1 
ATOM   786  C  CB    . PRO A 1 97  ? -53.817 -18.846 -20.508 1.00 30.48  ? 97  PRO A CB    1 
ATOM   787  C  CG    . PRO A 1 97  ? -53.185 -19.250 -21.802 1.00 26.92  ? 97  PRO A CG    1 
ATOM   788  C  CD    . PRO A 1 97  ? -51.714 -19.032 -21.601 1.00 29.73  ? 97  PRO A CD    1 
ATOM   789  N  N     . ALA A 1 98  ? -52.741 -21.703 -19.294 1.00 28.74  ? 98  ALA A N     1 
ATOM   790  C  CA    . ALA A 1 98  ? -53.055 -22.985 -18.671 1.00 28.46  ? 98  ALA A CA    1 
ATOM   791  C  C     . ALA A 1 98  ? -52.467 -23.104 -17.271 1.00 29.64  ? 98  ALA A C     1 
ATOM   792  O  O     . ALA A 1 98  ? -52.963 -23.903 -16.469 1.00 28.01  ? 98  ALA A O     1 
ATOM   793  C  CB    . ALA A 1 98  ? -52.557 -24.135 -19.549 1.00 32.00  ? 98  ALA A CB    1 
ATOM   794  N  N     . GLY A 1 99  ? -51.422 -22.335 -16.962 1.00 30.45  ? 99  GLY A N     1 
ATOM   795  C  CA    . GLY A 1 99  ? -50.860 -22.307 -15.628 1.00 28.14  ? 99  GLY A CA    1 
ATOM   796  C  C     . GLY A 1 99  ? -51.545 -21.369 -14.664 1.00 31.47  ? 99  GLY A C     1 
ATOM   797  O  O     . GLY A 1 99  ? -51.229 -21.379 -13.471 1.00 26.37  ? 99  GLY A O     1 
ATOM   798  N  N     . LEU A 1 100 ? -52.478 -20.554 -15.152 1.00 26.89  ? 100 LEU A N     1 
ATOM   799  C  CA    . LEU A 1 100 ? -53.226 -19.663 -14.278 1.00 23.77  ? 100 LEU A CA    1 
ATOM   800  C  C     . LEU A 1 100 ? -54.201 -20.456 -13.419 1.00 31.05  ? 100 LEU A C     1 
ATOM   801  O  O     . LEU A 1 100 ? -54.861 -21.384 -13.893 1.00 37.14  ? 100 LEU A O     1 
ATOM   802  C  CB    . LEU A 1 100 ? -53.987 -18.624 -15.102 1.00 26.86  ? 100 LEU A CB    1 
ATOM   803  C  CG    . LEU A 1 100 ? -53.159 -17.694 -15.988 1.00 36.10  ? 100 LEU A CG    1 
ATOM   804  C  CD1   . LEU A 1 100 ? -54.067 -16.853 -16.869 1.00 33.60  ? 100 LEU A CD1   1 
ATOM   805  C  CD2   . LEU A 1 100 ? -52.273 -16.806 -15.136 1.00 24.90  ? 100 LEU A CD2   1 
ATOM   806  N  N     . LYS A 1 101 ? -54.283 -20.090 -12.146 1.00 30.11  ? 101 LYS A N     1 
ATOM   807  C  CA    . LYS A 1 101 ? -55.259 -20.678 -11.245 1.00 35.09  ? 101 LYS A CA    1 
ATOM   808  C  C     . LYS A 1 101 ? -56.524 -19.832 -11.229 1.00 40.49  ? 101 LYS A C     1 
ATOM   809  O  O     . LYS A 1 101 ? -56.494 -18.629 -11.507 1.00 35.81  ? 101 LYS A O     1 
ATOM   810  C  CB    . LYS A 1 101 ? -54.687 -20.803 -9.832  1.00 39.81  ? 101 LYS A CB    1 
ATOM   811  C  CG    . LYS A 1 101 ? -53.456 -21.691 -9.744  1.00 40.12  ? 101 LYS A CG    1 
ATOM   812  C  CD    . LYS A 1 101 ? -52.860 -21.683 -8.347  1.00 31.31  ? 101 LYS A CD    1 
ATOM   813  C  CE    . LYS A 1 101 ? -51.635 -22.581 -8.270  1.00 41.80  ? 101 LYS A CE    1 
ATOM   814  N  NZ    . LYS A 1 101 ? -50.982 -22.519 -6.932  1.00 40.11  ? 101 LYS A NZ    1 
ATOM   815  N  N     . LYS A 1 102 ? -57.644 -20.477 -10.913 1.00 36.78  ? 102 LYS A N     1 
ATOM   816  C  CA    . LYS A 1 102 ? -58.918 -19.774 -10.848 1.00 44.76  ? 102 LYS A CA    1 
ATOM   817  C  C     . LYS A 1 102 ? -58.884 -18.711 -9.758  1.00 44.40  ? 102 LYS A C     1 
ATOM   818  O  O     . LYS A 1 102 ? -58.549 -18.995 -8.604  1.00 45.64  ? 102 LYS A O     1 
ATOM   819  C  CB    . LYS A 1 102 ? -60.053 -20.766 -10.589 1.00 39.58  ? 102 LYS A CB    1 
ATOM   820  C  CG    . LYS A 1 102 ? -61.381 -20.118 -10.231 1.00 49.59  ? 102 LYS A CG    1 
ATOM   821  C  CD    . LYS A 1 102 ? -61.903 -19.245 -11.361 1.00 62.38  ? 102 LYS A CD    1 
ATOM   822  C  CE    . LYS A 1 102 ? -63.222 -18.590 -10.980 1.00 61.53  ? 102 LYS A CE    1 
ATOM   823  N  NZ    . LYS A 1 102 ? -63.736 -17.708 -12.062 1.00 69.40  ? 102 LYS A NZ    1 
ATOM   824  N  N     . LYS A 1 103 ? -59.220 -17.479 -10.132 1.00 42.90  ? 103 LYS A N     1 
ATOM   825  C  CA    . LYS A 1 103 ? -59.303 -16.369 -9.197  1.00 48.85  ? 103 LYS A CA    1 
ATOM   826  C  C     . LYS A 1 103 ? -60.713 -15.797 -9.213  1.00 41.65  ? 103 LYS A C     1 
ATOM   827  O  O     . LYS A 1 103 ? -61.418 -15.868 -10.225 1.00 38.44  ? 103 LYS A O     1 
ATOM   828  C  CB    . LYS A 1 103 ? -58.292 -15.264 -9.535  1.00 34.15  ? 103 LYS A CB    1 
ATOM   829  C  CG    . LYS A 1 103 ? -56.890 -15.764 -9.843  1.00 42.93  ? 103 LYS A CG    1 
ATOM   830  C  CD    . LYS A 1 103 ? -56.316 -16.607 -8.713  1.00 45.68  ? 103 LYS A CD    1 
ATOM   831  C  CE    . LYS A 1 103 ? -56.101 -15.795 -7.449  1.00 43.99  ? 103 LYS A CE    1 
ATOM   832  N  NZ    . LYS A 1 103 ? -55.469 -16.615 -6.375  1.00 45.27  ? 103 LYS A NZ    1 
ATOM   833  N  N     . LYS A 1 104 ? -61.120 -15.226 -8.078  1.00 43.04  ? 104 LYS A N     1 
ATOM   834  C  CA    . LYS A 1 104 ? -62.458 -14.652 -7.985  1.00 37.85  ? 104 LYS A CA    1 
ATOM   835  C  C     . LYS A 1 104 ? -62.577 -13.386 -8.826  1.00 30.07  ? 104 LYS A C     1 
ATOM   836  O  O     . LYS A 1 104 ? -63.583 -13.187 -9.518  1.00 34.42  ? 104 LYS A O     1 
ATOM   837  C  CB    . LYS A 1 104 ? -62.803 -14.365 -6.524  1.00 32.76  ? 104 LYS A CB    1 
ATOM   838  C  CG    . LYS A 1 104 ? -64.275 -14.083 -6.277  1.00 45.90  ? 104 LYS A CG    1 
ATOM   839  C  CD    . LYS A 1 104 ? -64.564 -13.947 -4.790  1.00 53.40  ? 104 LYS A CD    1 
ATOM   840  C  CE    . LYS A 1 104 ? -66.054 -13.810 -4.527  1.00 58.27  ? 104 LYS A CE    1 
ATOM   841  N  NZ    . LYS A 1 104 ? -66.812 -14.998 -5.007  1.00 67.67  ? 104 LYS A NZ    1 
ATOM   842  N  N     . SER A 1 105 ? -61.562 -12.526 -8.788  1.00 38.73  ? 105 SER A N     1 
ATOM   843  C  CA    . SER A 1 105 ? -61.567 -11.278 -9.535  1.00 30.40  ? 105 SER A CA    1 
ATOM   844  C  C     . SER A 1 105 ? -60.258 -11.130 -10.296 1.00 32.37  ? 105 SER A C     1 
ATOM   845  O  O     . SER A 1 105 ? -59.194 -11.537 -9.821  1.00 29.67  ? 105 SER A O     1 
ATOM   846  C  CB    . SER A 1 105 ? -61.780 -10.078 -8.608  1.00 30.63  ? 105 SER A CB    1 
ATOM   847  O  OG    . SER A 1 105 ? -62.966 -10.227 -7.846  1.00 31.13  ? 105 SER A OG    1 
ATOM   848  N  N     . VAL A 1 106 ? -60.346 -10.538 -11.486 1.00 31.45  ? 106 VAL A N     1 
ATOM   849  C  CA    . VAL A 1 106 ? -59.223 -10.447 -12.412 1.00 28.65  ? 106 VAL A CA    1 
ATOM   850  C  C     . VAL A 1 106 ? -59.164 -9.038  -12.988 1.00 33.08  ? 106 VAL A C     1 
ATOM   851  O  O     . VAL A 1 106 ? -60.198 -8.434  -13.291 1.00 27.23  ? 106 VAL A O     1 
ATOM   852  C  CB    . VAL A 1 106 ? -59.340 -11.500 -13.537 1.00 35.05  ? 106 VAL A CB    1 
ATOM   853  C  CG1   . VAL A 1 106 ? -58.383 -11.193 -14.679 1.00 33.70  ? 106 VAL A CG1   1 
ATOM   854  C  CG2   . VAL A 1 106 ? -59.077 -12.894 -12.987 1.00 28.89  ? 106 VAL A CG2   1 
ATOM   855  N  N     . THR A 1 107 ? -57.947 -8.513  -13.132 1.00 26.40  ? 107 THR A N     1 
ATOM   856  C  CA    . THR A 1 107 ? -57.711 -7.225  -13.767 1.00 25.38  ? 107 THR A CA    1 
ATOM   857  C  C     . THR A 1 107 ? -56.479 -7.326  -14.655 1.00 32.97  ? 107 THR A C     1 
ATOM   858  O  O     . THR A 1 107 ? -55.486 -7.957  -14.279 1.00 35.85  ? 107 THR A O     1 
ATOM   859  C  CB    . THR A 1 107 ? -57.520 -6.111  -12.726 1.00 33.93  ? 107 THR A CB    1 
ATOM   860  O  OG1   . THR A 1 107 ? -58.711 -5.977  -11.941 1.00 31.50  ? 107 THR A OG1   1 
ATOM   861  C  CG2   . THR A 1 107 ? -57.214 -4.783  -13.400 1.00 22.42  ? 107 THR A CG2   1 
ATOM   862  N  N     . VAL A 1 108 ? -56.552 -6.715  -15.836 1.00 33.90  ? 108 VAL A N     1 
ATOM   863  C  CA    . VAL A 1 108 ? -55.422 -6.616  -16.754 1.00 27.92  ? 108 VAL A CA    1 
ATOM   864  C  C     . VAL A 1 108 ? -55.212 -5.146  -17.085 1.00 32.05  ? 108 VAL A C     1 
ATOM   865  O  O     . VAL A 1 108 ? -56.156 -4.458  -17.489 1.00 41.35  ? 108 VAL A O     1 
ATOM   866  C  CB    . VAL A 1 108 ? -55.645 -7.433  -18.041 1.00 34.19  ? 108 VAL A CB    1 
ATOM   867  C  CG1   . VAL A 1 108 ? -54.501 -7.205  -19.019 1.00 30.87  ? 108 VAL A CG1   1 
ATOM   868  C  CG2   . VAL A 1 108 ? -55.787 -8.912  -17.717 1.00 23.49  ? 108 VAL A CG2   1 
ATOM   869  N  N     . LEU A 1 109 ? -53.983 -4.663  -16.909 1.00 30.37  ? 109 LEU A N     1 
ATOM   870  C  CA    . LEU A 1 109 ? -53.669 -3.274  -17.210 1.00 28.97  ? 109 LEU A CA    1 
ATOM   871  C  C     . LEU A 1 109 ? -52.253 -3.183  -17.763 1.00 43.99  ? 109 LEU A C     1 
ATOM   872  O  O     . LEU A 1 109 ? -51.468 -4.132  -17.687 1.00 31.45  ? 109 LEU A O     1 
ATOM   873  C  CB    . LEU A 1 109 ? -53.852 -2.374  -15.978 1.00 33.31  ? 109 LEU A CB    1 
ATOM   874  C  CG    . LEU A 1 109 ? -53.335 -2.818  -14.605 1.00 38.89  ? 109 LEU A CG    1 
ATOM   875  C  CD1   . LEU A 1 109 ? -51.825 -2.669  -14.490 1.00 45.73  ? 109 LEU A CD1   1 
ATOM   876  C  CD2   . LEU A 1 109 ? -54.038 -2.042  -13.498 1.00 42.31  ? 109 LEU A CD2   1 
ATOM   877  N  N     . ASP A 1 110 ? -51.937 -2.015  -18.319 1.00 29.61  ? 110 ASP A N     1 
ATOM   878  C  CA    . ASP A 1 110 ? -50.678 -1.780  -19.009 1.00 32.21  ? 110 ASP A CA    1 
ATOM   879  C  C     . ASP A 1 110 ? -50.156 -0.403  -18.622 1.00 34.72  ? 110 ASP A C     1 
ATOM   880  O  O     . ASP A 1 110 ? -50.931 0.506   -18.313 1.00 28.12  ? 110 ASP A O     1 
ATOM   881  C  CB    . ASP A 1 110 ? -50.872 -1.908  -20.535 1.00 36.54  ? 110 ASP A CB    1 
ATOM   882  C  CG    . ASP A 1 110 ? -49.636 -1.525  -21.329 1.00 43.18  ? 110 ASP A CG    1 
ATOM   883  O  OD1   . ASP A 1 110 ? -48.858 -2.434  -21.723 1.00 50.31  ? 110 ASP A OD1   1 
ATOM   884  O  OD2   . ASP A 1 110 ? -49.461 -0.312  -21.577 1.00 39.57  ? 110 ASP A OD2   1 
ATOM   885  N  N     . VAL A 1 111 ? -48.831 -0.260  -18.624 1.00 34.28  ? 111 VAL A N     1 
ATOM   886  C  CA    . VAL A 1 111 ? -48.176 0.994   -18.260 1.00 31.63  ? 111 VAL A CA    1 
ATOM   887  C  C     . VAL A 1 111 ? -48.043 1.868   -19.499 1.00 34.31  ? 111 VAL A C     1 
ATOM   888  O  O     . VAL A 1 111 ? -47.673 1.390   -20.578 1.00 33.68  ? 111 VAL A O     1 
ATOM   889  C  CB    . VAL A 1 111 ? -46.802 0.728   -17.614 1.00 29.13  ? 111 VAL A CB    1 
ATOM   890  C  CG1   . VAL A 1 111 ? -46.055 2.036   -17.375 1.00 28.32  ? 111 VAL A CG1   1 
ATOM   891  C  CG2   . VAL A 1 111 ? -46.966 -0.038  -16.312 1.00 24.07  ? 111 VAL A CG2   1 
ATOM   892  N  N     . GLY A 1 112 ? -48.350 3.156   -19.348 1.00 31.89  ? 112 GLY A N     1 
ATOM   893  C  CA    . GLY A 1 112 ? -48.201 4.093   -20.450 1.00 33.17  ? 112 GLY A CA    1 
ATOM   894  C  C     . GLY A 1 112 ? -46.763 4.563   -20.576 1.00 33.00  ? 112 GLY A C     1 
ATOM   895  O  O     . GLY A 1 112 ? -46.157 5.012   -19.597 1.00 39.66  ? 112 GLY A O     1 
ATOM   896  N  N     . ASP A 1 113 ? -46.218 4.463   -21.789 1.00 38.10  ? 113 ASP A N     1 
ATOM   897  C  CA    . ASP A 1 113 ? -44.835 4.838   -22.088 1.00 32.36  ? 113 ASP A CA    1 
ATOM   898  C  C     . ASP A 1 113 ? -43.876 4.238   -21.058 1.00 37.07  ? 113 ASP A C     1 
ATOM   899  O  O     . ASP A 1 113 ? -43.179 4.941   -20.324 1.00 46.95  ? 113 ASP A O     1 
ATOM   900  C  CB    . ASP A 1 113 ? -44.689 6.360   -22.168 1.00 45.28  ? 113 ASP A CB    1 
ATOM   901  C  CG    . ASP A 1 113 ? -45.430 6.957   -23.352 1.00 47.25  ? 113 ASP A CG    1 
ATOM   902  O  OD1   . ASP A 1 113 ? -45.433 6.331   -24.433 1.00 41.84  ? 113 ASP A OD1   1 
ATOM   903  O  OD2   . ASP A 1 113 ? -46.013 8.052   -23.202 1.00 61.37  ? 113 ASP A OD2   1 
ATOM   904  N  N     . ALA A 1 114 ? -43.857 2.904   -21.023 1.00 39.16  ? 114 ALA A N     1 
ATOM   905  C  CA    . ALA A 1 114 ? -43.180 2.190   -19.945 1.00 30.23  ? 114 ALA A CA    1 
ATOM   906  C  C     . ALA A 1 114 ? -41.677 2.439   -19.963 1.00 35.87  ? 114 ALA A C     1 
ATOM   907  O  O     . ALA A 1 114 ? -41.092 2.839   -18.948 1.00 33.35  ? 114 ALA A O     1 
ATOM   908  C  CB    . ALA A 1 114 ? -43.478 0.695   -20.044 1.00 36.41  ? 114 ALA A CB    1 
ATOM   909  N  N     . TYR A 1 115 ? -41.029 2.188   -21.105 1.00 28.45  ? 115 TYR A N     1 
ATOM   910  C  CA    . TYR A 1 115 ? -39.593 2.434   -21.213 1.00 25.87  ? 115 TYR A CA    1 
ATOM   911  C  C     . TYR A 1 115 ? -39.250 3.875   -20.860 1.00 35.16  ? 115 TYR A C     1 
ATOM   912  O  O     . TYR A 1 115 ? -38.270 4.133   -20.152 1.00 30.96  ? 115 TYR A O     1 
ATOM   913  C  CB    . TYR A 1 115 ? -39.100 2.116   -22.624 1.00 29.53  ? 115 TYR A CB    1 
ATOM   914  C  CG    . TYR A 1 115 ? -38.697 0.679   -22.856 1.00 35.75  ? 115 TYR A CG    1 
ATOM   915  C  CD1   . TYR A 1 115 ? -38.986 -0.311  -21.926 1.00 32.90  ? 115 TYR A CD1   1 
ATOM   916  C  CD2   . TYR A 1 115 ? -38.012 0.316   -24.007 1.00 30.34  ? 115 TYR A CD2   1 
ATOM   917  C  CE1   . TYR A 1 115 ? -38.613 -1.624  -22.145 1.00 30.00  ? 115 TYR A CE1   1 
ATOM   918  C  CE2   . TYR A 1 115 ? -37.635 -0.989  -24.234 1.00 35.39  ? 115 TYR A CE2   1 
ATOM   919  C  CZ    . TYR A 1 115 ? -37.938 -1.956  -23.301 1.00 33.21  ? 115 TYR A CZ    1 
ATOM   920  O  OH    . TYR A 1 115 ? -37.563 -3.260  -23.527 1.00 29.31  ? 115 TYR A OH    1 
ATOM   921  N  N     . PHE A 1 116 ? -40.050 4.823   -21.332 1.00 33.13  ? 116 PHE A N     1 
ATOM   922  C  CA    . PHE A 1 116 ? -39.747 6.239   -21.159 1.00 33.29  ? 116 PHE A CA    1 
ATOM   923  C  C     . PHE A 1 116 ? -39.983 6.734   -19.738 1.00 36.63  ? 116 PHE A C     1 
ATOM   924  O  O     . PHE A 1 116 ? -39.855 7.942   -19.503 1.00 32.85  ? 116 PHE A O     1 
ATOM   925  C  CB    . PHE A 1 116 ? -40.563 7.065   -22.155 1.00 34.71  ? 116 PHE A CB    1 
ATOM   926  C  CG    . PHE A 1 116 ? -40.308 6.703   -23.594 1.00 36.48  ? 116 PHE A CG    1 
ATOM   927  C  CD1   . PHE A 1 116 ? -39.119 6.098   -23.974 1.00 36.86  ? 116 PHE A CD1   1 
ATOM   928  C  CD2   . PHE A 1 116 ? -41.258 6.966   -24.567 1.00 34.61  ? 116 PHE A CD2   1 
ATOM   929  C  CE1   . PHE A 1 116 ? -38.885 5.764   -25.292 1.00 33.82  ? 116 PHE A CE1   1 
ATOM   930  C  CE2   . PHE A 1 116 ? -41.027 6.635   -25.887 1.00 39.22  ? 116 PHE A CE2   1 
ATOM   931  C  CZ    . PHE A 1 116 ? -39.839 6.033   -26.250 1.00 34.33  ? 116 PHE A CZ    1 
ATOM   932  N  N     . SER A 1 117 ? -40.320 5.861   -18.787 1.00 30.99  ? 117 SER A N     1 
ATOM   933  C  CA    . SER A 1 117 ? -40.449 6.247   -17.390 1.00 30.71  ? 117 SER A CA    1 
ATOM   934  C  C     . SER A 1 117 ? -39.326 5.716   -16.513 1.00 32.52  ? 117 SER A C     1 
ATOM   935  O  O     . SER A 1 117 ? -39.270 6.068   -15.330 1.00 38.11  ? 117 SER A O     1 
ATOM   936  C  CB    . SER A 1 117 ? -41.797 5.775   -16.824 1.00 35.57  ? 117 SER A CB    1 
ATOM   937  O  OG    . SER A 1 117 ? -42.875 6.469   -17.427 1.00 38.20  ? 117 SER A OG    1 
ATOM   938  N  N     . VAL A 1 118 ? -38.437 4.890   -17.051 1.00 26.76  ? 118 VAL A N     1 
ATOM   939  C  CA    . VAL A 1 118 ? -37.324 4.319   -16.299 1.00 31.33  ? 118 VAL A CA    1 
ATOM   940  C  C     . VAL A 1 118 ? -36.059 5.083   -16.678 1.00 38.41  ? 118 VAL A C     1 
ATOM   941  O  O     . VAL A 1 118 ? -35.719 5.137   -17.870 1.00 35.80  ? 118 VAL A O     1 
ATOM   942  C  CB    . VAL A 1 118 ? -37.164 2.817   -16.582 1.00 31.57  ? 118 VAL A CB    1 
ATOM   943  C  CG1   . VAL A 1 118 ? -35.976 2.256   -15.814 1.00 29.75  ? 118 VAL A CG1   1 
ATOM   944  C  CG2   . VAL A 1 118 ? -38.441 2.072   -16.223 1.00 30.35  ? 118 VAL A CG2   1 
ATOM   945  N  N     . PRO A 1 119 ? -35.340 5.667   -15.722 1.00 38.36  ? 119 PRO A N     1 
ATOM   946  C  CA    . PRO A 1 119 ? -34.183 6.496   -16.075 1.00 37.23  ? 119 PRO A CA    1 
ATOM   947  C  C     . PRO A 1 119 ? -33.005 5.664   -16.557 1.00 34.00  ? 119 PRO A C     1 
ATOM   948  O  O     . PRO A 1 119 ? -32.832 4.502   -16.180 1.00 33.94  ? 119 PRO A O     1 
ATOM   949  C  CB    . PRO A 1 119 ? -33.851 7.214   -14.762 1.00 33.02  ? 119 PRO A CB    1 
ATOM   950  C  CG    . PRO A 1 119 ? -34.337 6.282   -13.702 1.00 27.12  ? 119 PRO A CG    1 
ATOM   951  C  CD    . PRO A 1 119 ? -35.570 5.621   -14.268 1.00 30.62  ? 119 PRO A CD    1 
ATOM   952  N  N     . LEU A 1 120 ? -32.186 6.286   -17.399 1.00 43.67  ? 120 LEU A N     1 
ATOM   953  C  CA    . LEU A 1 120 ? -30.992 5.669   -17.955 1.00 36.61  ? 120 LEU A CA    1 
ATOM   954  C  C     . LEU A 1 120 ? -29.754 6.179   -17.228 1.00 38.57  ? 120 LEU A C     1 
ATOM   955  O  O     . LEU A 1 120 ? -29.730 7.305   -16.722 1.00 43.09  ? 120 LEU A O     1 
ATOM   956  C  CB    . LEU A 1 120 ? -30.885 5.962   -19.455 1.00 39.78  ? 120 LEU A CB    1 
ATOM   957  C  CG    . LEU A 1 120 ? -29.706 5.370   -20.232 1.00 33.84  ? 120 LEU A CG    1 
ATOM   958  C  CD1   . LEU A 1 120 ? -29.726 3.851   -20.176 1.00 33.54  ? 120 LEU A CD1   1 
ATOM   959  C  CD2   . LEU A 1 120 ? -29.708 5.860   -21.674 1.00 31.75  ? 120 LEU A CD2   1 
ATOM   960  N  N     . ASP A 1 121 ? -28.727 5.330   -17.170 1.00 45.49  ? 121 ASP A N     1 
ATOM   961  C  CA    . ASP A 1 121 ? -27.477 5.695   -16.513 1.00 45.16  ? 121 ASP A CA    1 
ATOM   962  C  C     . ASP A 1 121 ? -26.901 6.964   -17.130 1.00 35.37  ? 121 ASP A C     1 
ATOM   963  O  O     . ASP A 1 121 ? -26.793 7.079   -18.354 1.00 44.20  ? 121 ASP A O     1 
ATOM   964  C  CB    . ASP A 1 121 ? -26.473 4.547   -16.620 1.00 38.53  ? 121 ASP A CB    1 
ATOM   965  C  CG    . ASP A 1 121 ? -25.144 4.870   -15.964 1.00 39.18  ? 121 ASP A CG    1 
ATOM   966  O  OD1   . ASP A 1 121 ? -25.126 5.674   -15.009 1.00 55.71  ? 121 ASP A OD1   1 
ATOM   967  O  OD2   . ASP A 1 121 ? -24.115 4.320   -16.405 1.00 45.82  ? 121 ASP A OD2   1 
ATOM   968  N  N     . GLU A 1 122 ? -26.523 7.913   -16.268 1.00 33.04  ? 122 GLU A N     1 
ATOM   969  C  CA    . GLU A 1 122 ? -26.120 9.236   -16.738 1.00 44.53  ? 122 GLU A CA    1 
ATOM   970  C  C     . GLU A 1 122 ? -24.854 9.175   -17.585 1.00 42.05  ? 122 GLU A C     1 
ATOM   971  O  O     . GLU A 1 122 ? -24.734 9.892   -18.585 1.00 46.83  ? 122 GLU A O     1 
ATOM   972  C  CB    . GLU A 1 122 ? -25.922 10.175  -15.546 1.00 40.09  ? 122 GLU A CB    1 
ATOM   973  C  CG    . GLU A 1 122 ? -27.195 10.465  -14.767 1.00 55.77  ? 122 GLU A CG    1 
ATOM   974  C  CD    . GLU A 1 122 ? -26.949 11.350  -13.560 1.00 69.26  ? 122 GLU A CD    1 
ATOM   975  O  OE1   . GLU A 1 122 ? -25.769 11.566  -13.212 1.00 74.58  ? 122 GLU A OE1   1 
ATOM   976  O  OE2   . GLU A 1 122 ? -27.934 11.830  -12.960 1.00 78.29  ? 122 GLU A OE2   1 
ATOM   977  N  N     . ASP A 1 123 ? -23.897 8.325   -17.203 1.00 43.43  ? 123 ASP A N     1 
ATOM   978  C  CA    . ASP A 1 123 ? -22.644 8.239   -17.947 1.00 48.01  ? 123 ASP A CA    1 
ATOM   979  C  C     . ASP A 1 123 ? -22.824 7.609   -19.322 1.00 42.24  ? 123 ASP A C     1 
ATOM   980  O  O     . ASP A 1 123 ? -21.946 7.762   -20.178 1.00 50.46  ? 123 ASP A O     1 
ATOM   981  C  CB    . ASP A 1 123 ? -21.608 7.448   -17.146 1.00 44.17  ? 123 ASP A CB    1 
ATOM   982  C  CG    . ASP A 1 123 ? -21.260 8.111   -15.828 1.00 63.26  ? 123 ASP A CG    1 
ATOM   983  O  OD1   . ASP A 1 123 ? -20.993 7.383   -14.848 1.00 67.04  ? 123 ASP A OD1   1 
ATOM   984  O  OD2   . ASP A 1 123 ? -21.257 9.359   -15.771 1.00 64.25  ? 123 ASP A OD2   1 
ATOM   985  N  N     . PHE A 1 124 ? -23.937 6.913   -19.553 1.00 44.60  ? 124 PHE A N     1 
ATOM   986  C  CA    . PHE A 1 124 ? -24.206 6.243   -20.818 1.00 41.29  ? 124 PHE A CA    1 
ATOM   987  C  C     . PHE A 1 124 ? -25.097 7.060   -21.747 1.00 37.74  ? 124 PHE A C     1 
ATOM   988  O  O     . PHE A 1 124 ? -25.212 6.717   -22.928 1.00 40.62  ? 124 PHE A O     1 
ATOM   989  C  CB    . PHE A 1 124 ? -24.858 4.878   -20.550 1.00 29.24  ? 124 PHE A CB    1 
ATOM   990  C  CG    . PHE A 1 124 ? -24.773 3.918   -21.704 1.00 37.95  ? 124 PHE A CG    1 
ATOM   991  C  CD1   . PHE A 1 124 ? -23.655 3.118   -21.874 1.00 41.92  ? 124 PHE A CD1   1 
ATOM   992  C  CD2   . PHE A 1 124 ? -25.819 3.798   -22.606 1.00 36.83  ? 124 PHE A CD2   1 
ATOM   993  C  CE1   . PHE A 1 124 ? -23.573 2.229   -22.929 1.00 41.87  ? 124 PHE A CE1   1 
ATOM   994  C  CE2   . PHE A 1 124 ? -25.743 2.912   -23.666 1.00 34.63  ? 124 PHE A CE2   1 
ATOM   995  C  CZ    . PHE A 1 124 ? -24.619 2.125   -23.826 1.00 41.94  ? 124 PHE A CZ    1 
ATOM   996  N  N     . ARG A 1 125 ? -25.704 8.140   -21.248 1.00 28.99  ? 125 ARG A N     1 
ATOM   997  C  CA    . ARG A 1 125 ? -26.733 8.845   -22.008 1.00 35.50  ? 125 ARG A CA    1 
ATOM   998  C  C     . ARG A 1 125 ? -26.197 9.442   -23.303 1.00 36.81  ? 125 ARG A C     1 
ATOM   999  O  O     . ARG A 1 125 ? -26.935 9.531   -24.292 1.00 45.65  ? 125 ARG A O     1 
ATOM   1000 C  CB    . ARG A 1 125 ? -27.361 9.937   -21.142 1.00 44.22  ? 125 ARG A CB    1 
ATOM   1001 C  CG    . ARG A 1 125 ? -28.149 9.397   -19.962 1.00 43.57  ? 125 ARG A CG    1 
ATOM   1002 C  CD    . ARG A 1 125 ? -28.720 10.505  -19.095 1.00 34.11  ? 125 ARG A CD    1 
ATOM   1003 N  NE    . ARG A 1 125 ? -29.504 9.962   -17.990 1.00 41.25  ? 125 ARG A NE    1 
ATOM   1004 C  CZ    . ARG A 1 125 ? -30.069 10.697  -17.039 1.00 38.64  ? 125 ARG A CZ    1 
ATOM   1005 N  NH1   . ARG A 1 125 ? -29.940 12.017  -17.051 1.00 42.15  ? 125 ARG A NH1   1 
ATOM   1006 N  NH2   . ARG A 1 125 ? -30.763 10.112  -16.072 1.00 36.38  ? 125 ARG A NH2   1 
ATOM   1007 N  N     . LYS A 1 126 ? -24.927 9.854   -23.326 1.00 39.67  ? 126 LYS A N     1 
ATOM   1008 C  CA    . LYS A 1 126 ? -24.398 10.527  -24.509 1.00 44.96  ? 126 LYS A CA    1 
ATOM   1009 C  C     . LYS A 1 126 ? -24.349 9.604   -25.722 1.00 49.68  ? 126 LYS A C     1 
ATOM   1010 O  O     . LYS A 1 126 ? -24.424 10.081  -26.861 1.00 41.37  ? 126 LYS A O     1 
ATOM   1011 C  CB    . LYS A 1 126 ? -23.009 11.097  -24.219 1.00 50.70  ? 126 LYS A CB    1 
ATOM   1012 C  CG    . LYS A 1 126 ? -22.009 10.092  -23.673 1.00 45.51  ? 126 LYS A CG    1 
ATOM   1013 C  CD    . LYS A 1 126 ? -20.622 10.712  -23.568 1.00 36.47  ? 126 LYS A CD    1 
ATOM   1014 C  CE    . LYS A 1 126 ? -19.664 9.816   -22.804 1.00 49.95  ? 126 LYS A CE    1 
ATOM   1015 N  NZ    . LYS A 1 126 ? -20.047 9.689   -21.370 1.00 65.01  ? 126 LYS A NZ    1 
ATOM   1016 N  N     . TYR A 1 127 ? -24.236 8.292   -25.508 1.00 42.25  ? 127 TYR A N     1 
ATOM   1017 C  CA    . TYR A 1 127 ? -24.158 7.360   -26.627 1.00 38.92  ? 127 TYR A CA    1 
ATOM   1018 C  C     . TYR A 1 127 ? -25.491 7.172   -27.339 1.00 40.54  ? 127 TYR A C     1 
ATOM   1019 O  O     . TYR A 1 127 ? -25.510 6.595   -28.431 1.00 42.37  ? 127 TYR A O     1 
ATOM   1020 C  CB    . TYR A 1 127 ? -23.636 6.003   -26.149 1.00 43.36  ? 127 TYR A CB    1 
ATOM   1021 C  CG    . TYR A 1 127 ? -22.321 6.079   -25.408 1.00 48.42  ? 127 TYR A CG    1 
ATOM   1022 C  CD1   . TYR A 1 127 ? -21.175 6.552   -26.035 1.00 47.36  ? 127 TYR A CD1   1 
ATOM   1023 C  CD2   . TYR A 1 127 ? -22.222 5.666   -24.086 1.00 41.01  ? 127 TYR A CD2   1 
ATOM   1024 C  CE1   . TYR A 1 127 ? -19.969 6.621   -25.362 1.00 49.13  ? 127 TYR A CE1   1 
ATOM   1025 C  CE2   . TYR A 1 127 ? -21.021 5.730   -23.405 1.00 47.60  ? 127 TYR A CE2   1 
ATOM   1026 C  CZ    . TYR A 1 127 ? -19.899 6.209   -24.048 1.00 49.20  ? 127 TYR A CZ    1 
ATOM   1027 O  OH    . TYR A 1 127 ? -18.702 6.273   -23.373 1.00 51.14  ? 127 TYR A OH    1 
ATOM   1028 N  N     . THR A 1 128 ? -26.595 7.640   -26.759 1.00 39.17  ? 128 THR A N     1 
ATOM   1029 C  CA    . THR A 1 128 ? -27.914 7.508   -27.361 1.00 39.20  ? 128 THR A CA    1 
ATOM   1030 C  C     . THR A 1 128 ? -28.299 8.718   -28.206 1.00 39.01  ? 128 THR A C     1 
ATOM   1031 O  O     . THR A 1 128 ? -29.493 8.957   -28.421 1.00 38.54  ? 128 THR A O     1 
ATOM   1032 C  CB    . THR A 1 128 ? -28.968 7.278   -26.275 1.00 31.88  ? 128 THR A CB    1 
ATOM   1033 O  OG1   . THR A 1 128 ? -29.022 8.422   -25.413 1.00 43.23  ? 128 THR A OG1   1 
ATOM   1034 C  CG2   . THR A 1 128 ? -28.621 6.048   -25.450 1.00 32.17  ? 128 THR A CG2   1 
ATOM   1035 N  N     . ALA A 1 129 ? -27.318 9.478   -28.687 1.00 47.03  ? 129 ALA A N     1 
ATOM   1036 C  CA    . ALA A 1 129 ? -27.608 10.689  -29.443 1.00 43.94  ? 129 ALA A CA    1 
ATOM   1037 C  C     . ALA A 1 129 ? -28.329 10.363  -30.744 1.00 41.10  ? 129 ALA A C     1 
ATOM   1038 O  O     . ALA A 1 129 ? -28.021 9.374   -31.416 1.00 45.04  ? 129 ALA A O     1 
ATOM   1039 C  CB    . ALA A 1 129 ? -26.314 11.447  -29.735 1.00 45.80  ? 129 ALA A CB    1 
ATOM   1040 N  N     . PHE A 1 130 ? -29.298 11.205  -31.098 1.00 37.69  ? 130 PHE A N     1 
ATOM   1041 C  CA    . PHE A 1 130 ? -30.040 11.043  -32.339 1.00 46.87  ? 130 PHE A CA    1 
ATOM   1042 C  C     . PHE A 1 130 ? -30.479 12.411  -32.838 1.00 45.27  ? 130 PHE A C     1 
ATOM   1043 O  O     . PHE A 1 130 ? -30.530 13.385  -32.082 1.00 45.25  ? 130 PHE A O     1 
ATOM   1044 C  CB    . PHE A 1 130 ? -31.248 10.114  -32.160 1.00 43.01  ? 130 PHE A CB    1 
ATOM   1045 C  CG    . PHE A 1 130 ? -32.297 10.645  -31.223 1.00 34.70  ? 130 PHE A CG    1 
ATOM   1046 C  CD1   . PHE A 1 130 ? -32.195 10.435  -29.858 1.00 37.17  ? 130 PHE A CD1   1 
ATOM   1047 C  CD2   . PHE A 1 130 ? -33.393 11.339  -31.711 1.00 41.71  ? 130 PHE A CD2   1 
ATOM   1048 C  CE1   . PHE A 1 130 ? -33.161 10.918  -28.995 1.00 42.54  ? 130 PHE A CE1   1 
ATOM   1049 C  CE2   . PHE A 1 130 ? -34.360 11.826  -30.854 1.00 45.68  ? 130 PHE A CE2   1 
ATOM   1050 C  CZ    . PHE A 1 130 ? -34.247 11.613  -29.494 1.00 39.85  ? 130 PHE A CZ    1 
ATOM   1051 N  N     . THR A 1 131 ? -30.799 12.471  -34.129 1.00 48.86  ? 131 THR A N     1 
ATOM   1052 C  CA    . THR A 1 131 ? -31.164 13.711  -34.800 1.00 51.12  ? 131 THR A CA    1 
ATOM   1053 C  C     . THR A 1 131 ? -32.533 13.563  -35.448 1.00 51.59  ? 131 THR A C     1 
ATOM   1054 O  O     . THR A 1 131 ? -32.865 12.502  -35.985 1.00 61.25  ? 131 THR A O     1 
ATOM   1055 C  CB    . THR A 1 131 ? -30.124 14.090  -35.863 1.00 51.96  ? 131 THR A CB    1 
ATOM   1056 O  OG1   . THR A 1 131 ? -28.812 14.019  -35.294 1.00 43.34  ? 131 THR A OG1   1 
ATOM   1057 C  CG2   . THR A 1 131 ? -30.369 15.504  -36.372 1.00 50.73  ? 131 THR A CG2   1 
ATOM   1058 N  N     . ILE A 1 132 ? -33.324 14.631  -35.394 1.00 56.19  ? 132 ILE A N     1 
ATOM   1059 C  CA    . ILE A 1 132 ? -34.654 14.637  -35.999 1.00 61.81  ? 132 ILE A CA    1 
ATOM   1060 C  C     . ILE A 1 132 ? -34.760 15.788  -36.990 1.00 68.48  ? 132 ILE A C     1 
ATOM   1061 O  O     . ILE A 1 132 ? -34.717 16.959  -36.586 1.00 73.19  ? 132 ILE A O     1 
ATOM   1062 C  CB    . ILE A 1 132 ? -35.753 14.738  -34.933 1.00 60.86  ? 132 ILE A CB    1 
ATOM   1063 C  CG1   . ILE A 1 132 ? -35.715 13.516  -34.022 1.00 74.73  ? 132 ILE A CG1   1 
ATOM   1064 C  CG2   . ILE A 1 132 ? -37.117 14.879  -35.591 1.00 55.82  ? 132 ILE A CG2   1 
ATOM   1065 C  CD1   . ILE A 1 132 ? -36.910 13.411  -33.136 1.00 64.61  ? 132 ILE A CD1   1 
ATOM   1066 N  N     . PRO A 1 133 ? -34.908 15.510  -38.281 1.00 76.75  ? 133 PRO A N     1 
ATOM   1067 C  CA    . PRO A 1 133 ? -35.065 16.590  -39.260 1.00 87.65  ? 133 PRO A CA    1 
ATOM   1068 C  C     . PRO A 1 133 ? -36.438 17.237  -39.153 1.00 88.92  ? 133 PRO A C     1 
ATOM   1069 O  O     . PRO A 1 133 ? -37.320 16.794  -38.415 1.00 80.25  ? 133 PRO A O     1 
ATOM   1070 C  CB    . PRO A 1 133 ? -34.882 15.878  -40.602 1.00 86.96  ? 133 PRO A CB    1 
ATOM   1071 C  CG    . PRO A 1 133 ? -35.318 14.474  -40.332 1.00 75.65  ? 133 PRO A CG    1 
ATOM   1072 C  CD    . PRO A 1 133 ? -34.906 14.180  -38.915 1.00 70.89  ? 133 PRO A CD    1 
ATOM   1073 N  N     . SER A 1 134 ? -36.607 18.316  -39.916 1.00 102.66 ? 134 SER A N     1 
ATOM   1074 C  CA    . SER A 1 134 ? -37.868 19.048  -39.941 1.00 107.72 ? 134 SER A CA    1 
ATOM   1075 C  C     . SER A 1 134 ? -38.024 19.788  -41.264 1.00 115.97 ? 134 SER A C     1 
ATOM   1076 O  O     . SER A 1 134 ? -37.528 19.330  -42.298 1.00 111.08 ? 134 SER A O     1 
ATOM   1077 C  CB    . SER A 1 134 ? -37.946 20.026  -38.768 1.00 102.02 ? 134 SER A CB    1 
ATOM   1078 O  OG    . SER A 1 134 ? -39.176 20.729  -38.770 1.00 112.08 ? 134 SER A OG    1 
ATOM   1079 N  N     . ILE A 1 135 ? -38.715 20.929  -41.242 1.00 126.43 ? 135 ILE A N     1 
ATOM   1080 C  CA    . ILE A 1 135 ? -38.830 21.752  -42.439 1.00 115.11 ? 135 ILE A CA    1 
ATOM   1081 C  C     . ILE A 1 135 ? -37.464 22.336  -42.772 1.00 118.16 ? 135 ILE A C     1 
ATOM   1082 O  O     . ILE A 1 135 ? -36.792 22.917  -41.911 1.00 127.19 ? 135 ILE A O     1 
ATOM   1083 C  CB    . ILE A 1 135 ? -39.880 22.855  -42.242 1.00 110.36 ? 135 ILE A CB    1 
ATOM   1084 C  CG1   . ILE A 1 135 ? -41.239 22.243  -41.895 1.00 118.61 ? 135 ILE A CG1   1 
ATOM   1085 C  CG2   . ILE A 1 135 ? -39.992 23.709  -43.494 1.00 100.46 ? 135 ILE A CG2   1 
ATOM   1086 C  CD1   . ILE A 1 135 ? -42.346 23.266  -41.732 1.00 108.41 ? 135 ILE A CD1   1 
ATOM   1087 N  N     . ASN A 1 136 ? -37.048 22.183  -44.026 1.00 109.64 ? 136 ASN A N     1 
ATOM   1088 C  CA    . ASN A 1 136 ? -35.687 22.529  -44.413 1.00 111.99 ? 136 ASN A CA    1 
ATOM   1089 C  C     . ASN A 1 136 ? -35.485 24.040  -44.417 1.00 118.40 ? 136 ASN A C     1 
ATOM   1090 O  O     . ASN A 1 136 ? -36.262 24.783  -45.026 1.00 114.73 ? 136 ASN A O     1 
ATOM   1091 C  CB    . ASN A 1 136 ? -35.370 21.944  -45.787 0.00 104.25 ? 136 ASN A CB    1 
ATOM   1092 C  CG    . ASN A 1 136 ? -35.373 20.428  -45.785 0.00 98.56  ? 136 ASN A CG    1 
ATOM   1093 O  OD1   . ASN A 1 136 ? -34.321 19.794  -45.697 0.00 97.99  ? 136 ASN A OD1   1 
ATOM   1094 N  ND2   . ASN A 1 136 ? -36.559 19.838  -45.876 0.00 93.64  ? 136 ASN A ND2   1 
ATOM   1095 N  N     . ASN A 1 137 ? -34.442 24.487  -43.711 1.00 121.94 ? 137 ASN A N     1 
ATOM   1096 C  CA    . ASN A 1 137 ? -33.999 25.879  -43.672 1.00 124.35 ? 137 ASN A CA    1 
ATOM   1097 C  C     . ASN A 1 137 ? -35.009 26.818  -43.020 1.00 125.71 ? 137 ASN A C     1 
ATOM   1098 O  O     . ASN A 1 137 ? -34.716 28.002  -42.823 1.00 118.37 ? 137 ASN A O     1 
ATOM   1099 C  CB    . ASN A 1 137 ? -33.650 26.368  -45.081 1.00 117.66 ? 137 ASN A CB    1 
ATOM   1100 C  CG    . ASN A 1 137 ? -32.267 25.929  -45.520 0.00 118.37 ? 137 ASN A CG    1 
ATOM   1101 O  OD1   . ASN A 1 137 ? -32.094 24.846  -46.079 0.00 117.08 ? 137 ASN A OD1   1 
ATOM   1102 N  ND2   . ASN A 1 137 ? -31.270 26.769  -45.262 0.00 118.60 ? 137 ASN A ND2   1 
ATOM   1103 N  N     . GLU A 1 138 ? -36.195 26.315  -42.678 1.00 123.08 ? 138 GLU A N     1 
ATOM   1104 C  CA    . GLU A 1 138 ? -37.108 27.081  -41.840 1.00 122.36 ? 138 GLU A CA    1 
ATOM   1105 C  C     . GLU A 1 138 ? -36.903 26.778  -40.364 1.00 121.45 ? 138 GLU A C     1 
ATOM   1106 O  O     . GLU A 1 138 ? -37.075 27.668  -39.523 1.00 122.03 ? 138 GLU A O     1 
ATOM   1107 C  CB    . GLU A 1 138 ? -38.561 26.804  -42.236 1.00 114.25 ? 138 GLU A CB    1 
ATOM   1108 C  CG    . GLU A 1 138 ? -39.540 27.863  -41.751 1.00 110.32 ? 138 GLU A CG    1 
ATOM   1109 C  CD    . GLU A 1 138 ? -40.951 27.635  -42.260 1.00 108.43 ? 138 GLU A CD    1 
ATOM   1110 O  OE1   . GLU A 1 138 ? -41.390 26.466  -42.299 1.00 119.37 ? 138 GLU A OE1   1 
ATOM   1111 O  OE2   . GLU A 1 138 ? -41.617 28.626  -42.627 1.00 83.19  ? 138 GLU A OE2   1 
ATOM   1112 N  N     . THR A 1 139 ? -36.541 25.539  -40.040 1.00 113.88 ? 139 THR A N     1 
ATOM   1113 C  CA    . THR A 1 139 ? -36.043 25.161  -38.725 1.00 107.60 ? 139 THR A CA    1 
ATOM   1114 C  C     . THR A 1 139 ? -35.206 23.894  -38.883 1.00 103.17 ? 139 THR A C     1 
ATOM   1115 O  O     . THR A 1 139 ? -35.715 22.854  -39.322 1.00 107.81 ? 139 THR A O     1 
ATOM   1116 C  CB    . THR A 1 139 ? -37.190 24.981  -37.720 1.00 107.32 ? 139 THR A CB    1 
ATOM   1117 O  OG1   . THR A 1 139 ? -36.665 24.562  -36.454 1.00 115.58 ? 139 THR A OG1   1 
ATOM   1118 C  CG2   . THR A 1 139 ? -38.230 23.972  -38.211 1.00 103.19 ? 139 THR A CG2   1 
ATOM   1119 N  N     . PRO A 1 140 ? -33.908 23.949  -38.579 1.00 99.46  ? 140 PRO A N     1 
ATOM   1120 C  CA    . PRO A 1 140 ? -33.041 22.792  -38.844 1.00 89.97  ? 140 PRO A CA    1 
ATOM   1121 C  C     . PRO A 1 140 ? -33.326 21.612  -37.929 1.00 81.36  ? 140 PRO A C     1 
ATOM   1122 O  O     . PRO A 1 140 ? -34.203 21.681  -37.062 1.00 79.20  ? 140 PRO A O     1 
ATOM   1123 C  CB    . PRO A 1 140 ? -31.631 23.353  -38.616 1.00 81.65  ? 140 PRO A CB    1 
ATOM   1124 C  CG    . PRO A 1 140 ? -31.831 24.487  -37.669 1.00 89.14  ? 140 PRO A CG    1 
ATOM   1125 C  CD    . PRO A 1 140 ? -33.160 25.091  -38.026 1.00 95.30  ? 140 PRO A CD    1 
ATOM   1126 N  N     . GLY A 1 141 ? -32.586 20.523  -38.118 1.00 77.01  ? 141 GLY A N     1 
ATOM   1127 C  CA    . GLY A 1 141 ? -32.801 19.340  -37.306 1.00 76.35  ? 141 GLY A CA    1 
ATOM   1128 C  C     . GLY A 1 141 ? -32.368 19.561  -35.868 1.00 66.82  ? 141 GLY A C     1 
ATOM   1129 O  O     . GLY A 1 141 ? -31.381 20.245  -35.589 1.00 70.46  ? 141 GLY A O     1 
ATOM   1130 N  N     . ILE A 1 142 ? -33.122 18.972  -34.943 1.00 60.02  ? 142 ILE A N     1 
ATOM   1131 C  CA    . ILE A 1 142 ? -32.852 19.081  -33.514 1.00 53.89  ? 142 ILE A CA    1 
ATOM   1132 C  C     . ILE A 1 142 ? -32.211 17.784  -33.044 1.00 53.43  ? 142 ILE A C     1 
ATOM   1133 O  O     . ILE A 1 142 ? -32.675 16.690  -33.391 1.00 56.01  ? 142 ILE A O     1 
ATOM   1134 C  CB    . ILE A 1 142 ? -34.137 19.380  -32.723 1.00 57.02  ? 142 ILE A CB    1 
ATOM   1135 C  CG1   . ILE A 1 142 ? -34.954 20.470  -33.419 1.00 54.88  ? 142 ILE A CG1   1 
ATOM   1136 C  CG2   . ILE A 1 142 ? -33.796 19.803  -31.303 1.00 49.24  ? 142 ILE A CG2   1 
ATOM   1137 C  CD1   . ILE A 1 142 ? -34.249 21.807  -33.505 1.00 79.34  ? 142 ILE A CD1   1 
ATOM   1138 N  N     . ARG A 1 143 ? -31.143 17.902  -32.262 1.00 50.19  ? 143 ARG A N     1 
ATOM   1139 C  CA    . ARG A 1 143 ? -30.434 16.753  -31.717 1.00 45.05  ? 143 ARG A CA    1 
ATOM   1140 C  C     . ARG A 1 143 ? -30.798 16.562  -30.250 1.00 52.08  ? 143 ARG A C     1 
ATOM   1141 O  O     . ARG A 1 143 ? -30.931 17.534  -29.501 1.00 51.97  ? 143 ARG A O     1 
ATOM   1142 C  CB    . ARG A 1 143 ? -28.921 16.927  -31.866 1.00 46.28  ? 143 ARG A CB    1 
ATOM   1143 C  CG    . ARG A 1 143 ? -28.409 16.731  -33.284 1.00 47.61  ? 143 ARG A CG    1 
ATOM   1144 C  CD    . ARG A 1 143 ? -26.959 17.175  -33.417 1.00 42.41  ? 143 ARG A CD    1 
ATOM   1145 N  NE    . ARG A 1 143 ? -26.102 16.585  -32.392 1.00 50.60  ? 143 ARG A NE    1 
ATOM   1146 C  CZ    . ARG A 1 143 ? -25.500 15.405  -32.505 1.00 61.51  ? 143 ARG A CZ    1 
ATOM   1147 N  NH1   . ARG A 1 143 ? -25.662 14.677  -33.601 1.00 80.17  ? 143 ARG A NH1   1 
ATOM   1148 N  NH2   . ARG A 1 143 ? -24.738 14.950  -31.519 1.00 61.75  ? 143 ARG A NH2   1 
ATOM   1149 N  N     . TYR A 1 144 ? -30.961 15.303  -29.847 1.00 51.12  ? 144 TYR A N     1 
ATOM   1150 C  CA    . TYR A 1 144 ? -31.312 14.963  -28.476 1.00 44.07  ? 144 TYR A CA    1 
ATOM   1151 C  C     . TYR A 1 144 ? -30.452 13.800  -28.001 1.00 48.60  ? 144 TYR A C     1 
ATOM   1152 O  O     . TYR A 1 144 ? -29.759 13.143  -28.783 1.00 49.38  ? 144 TYR A O     1 
ATOM   1153 C  CB    . TYR A 1 144 ? -32.789 14.574  -28.332 1.00 41.15  ? 144 TYR A CB    1 
ATOM   1154 C  CG    . TYR A 1 144 ? -33.802 15.600  -28.789 1.00 42.34  ? 144 TYR A CG    1 
ATOM   1155 C  CD1   . TYR A 1 144 ? -34.292 16.561  -27.914 1.00 38.56  ? 144 TYR A CD1   1 
ATOM   1156 C  CD2   . TYR A 1 144 ? -34.297 15.584  -30.087 1.00 43.67  ? 144 TYR A CD2   1 
ATOM   1157 C  CE1   . TYR A 1 144 ? -35.233 17.490  -28.324 1.00 37.76  ? 144 TYR A CE1   1 
ATOM   1158 C  CE2   . TYR A 1 144 ? -35.237 16.509  -30.507 1.00 35.26  ? 144 TYR A CE2   1 
ATOM   1159 C  CZ    . TYR A 1 144 ? -35.702 17.458  -29.621 1.00 43.71  ? 144 TYR A CZ    1 
ATOM   1160 O  OH    . TYR A 1 144 ? -36.637 18.381  -30.033 1.00 45.53  ? 144 TYR A OH    1 
ATOM   1161 N  N     . GLN A 1 145 ? -30.517 13.548  -26.696 1.00 46.55  ? 145 GLN A N     1 
ATOM   1162 C  CA    . GLN A 1 145 ? -30.001 12.330  -26.092 1.00 41.82  ? 145 GLN A CA    1 
ATOM   1163 C  C     . GLN A 1 145 ? -31.052 11.790  -25.133 1.00 36.68  ? 145 GLN A C     1 
ATOM   1164 O  O     . GLN A 1 145 ? -31.913 12.527  -24.645 1.00 44.58  ? 145 GLN A O     1 
ATOM   1165 C  CB    . GLN A 1 145 ? -28.677 12.564  -25.351 1.00 41.19  ? 145 GLN A CB    1 
ATOM   1166 C  CG    . GLN A 1 145 ? -28.829 13.237  -23.999 1.00 45.08  ? 145 GLN A CG    1 
ATOM   1167 C  CD    . GLN A 1 145 ? -27.513 13.352  -23.255 1.00 49.43  ? 145 GLN A CD    1 
ATOM   1168 O  OE1   . GLN A 1 145 ? -26.448 13.060  -23.802 1.00 39.07  ? 145 GLN A OE1   1 
ATOM   1169 N  NE2   . GLN A 1 145 ? -27.579 13.777  -21.998 1.00 46.84  ? 145 GLN A NE2   1 
ATOM   1170 N  N     . TYR A 1 146 ? -30.980 10.489  -24.867 1.00 37.51  ? 146 TYR A N     1 
ATOM   1171 C  CA    . TYR A 1 146 ? -31.966 9.821   -24.029 1.00 36.88  ? 146 TYR A CA    1 
ATOM   1172 C  C     . TYR A 1 146 ? -31.599 9.954   -22.556 1.00 35.69  ? 146 TYR A C     1 
ATOM   1173 O  O     . TYR A 1 146 ? -30.444 9.742   -22.175 1.00 33.78  ? 146 TYR A O     1 
ATOM   1174 C  CB    . TYR A 1 146 ? -32.085 8.343   -24.404 1.00 34.68  ? 146 TYR A CB    1 
ATOM   1175 C  CG    . TYR A 1 146 ? -33.176 8.043   -25.406 1.00 37.63  ? 146 TYR A CG    1 
ATOM   1176 C  CD1   . TYR A 1 146 ? -32.911 8.025   -26.768 1.00 35.16  ? 146 TYR A CD1   1 
ATOM   1177 C  CD2   . TYR A 1 146 ? -34.471 7.771   -24.986 1.00 38.54  ? 146 TYR A CD2   1 
ATOM   1178 C  CE1   . TYR A 1 146 ? -33.906 7.746   -27.687 1.00 31.24  ? 146 TYR A CE1   1 
ATOM   1179 C  CE2   . TYR A 1 146 ? -35.474 7.493   -25.895 1.00 42.69  ? 146 TYR A CE2   1 
ATOM   1180 C  CZ    . TYR A 1 146 ? -35.186 7.481   -27.244 1.00 37.87  ? 146 TYR A CZ    1 
ATOM   1181 O  OH    . TYR A 1 146 ? -36.182 7.205   -28.153 1.00 31.97  ? 146 TYR A OH    1 
ATOM   1182 N  N     . ASN A 1 147 ? -32.583 10.320  -21.738 1.00 35.77  ? 147 ASN A N     1 
ATOM   1183 C  CA    . ASN A 1 147 ? -32.472 10.255  -20.288 1.00 39.06  ? 147 ASN A CA    1 
ATOM   1184 C  C     . ASN A 1 147 ? -33.237 9.075   -19.711 1.00 41.63  ? 147 ASN A C     1 
ATOM   1185 O  O     . ASN A 1 147 ? -33.224 8.874   -18.493 1.00 39.59  ? 147 ASN A O     1 
ATOM   1186 C  CB    . ASN A 1 147 ? -32.975 11.556  -19.652 1.00 38.52  ? 147 ASN A CB    1 
ATOM   1187 C  CG    . ASN A 1 147 ? -32.233 12.777  -20.154 1.00 42.34  ? 147 ASN A CG    1 
ATOM   1188 O  OD1   . ASN A 1 147 ? -31.034 12.718  -20.427 1.00 41.34  ? 147 ASN A OD1   1 
ATOM   1189 N  ND2   . ASN A 1 147 ? -32.944 13.893  -20.281 1.00 32.92  ? 147 ASN A ND2   1 
ATOM   1190 N  N     . VAL A 1 148 ? -33.908 8.300   -20.560 1.00 38.80  ? 148 VAL A N     1 
ATOM   1191 C  CA    . VAL A 1 148 ? -34.683 7.139   -20.163 1.00 32.60  ? 148 VAL A CA    1 
ATOM   1192 C  C     . VAL A 1 148 ? -34.310 5.980   -21.082 1.00 37.35  ? 148 VAL A C     1 
ATOM   1193 O  O     . VAL A 1 148 ? -33.474 6.115   -21.975 1.00 37.31  ? 148 VAL A O     1 
ATOM   1194 C  CB    . VAL A 1 148 ? -36.200 7.412   -20.201 1.00 34.90  ? 148 VAL A CB    1 
ATOM   1195 C  CG1   . VAL A 1 148 ? -36.594 8.373   -19.089 1.00 32.39  ? 148 VAL A CG1   1 
ATOM   1196 C  CG2   . VAL A 1 148 ? -36.599 7.970   -21.557 1.00 30.87  ? 148 VAL A CG2   1 
ATOM   1197 N  N     . LEU A 1 149 ? -34.942 4.836   -20.855 1.00 36.89  ? 149 LEU A N     1 
ATOM   1198 C  CA    . LEU A 1 149 ? -34.639 3.651   -21.650 1.00 34.22  ? 149 LEU A CA    1 
ATOM   1199 C  C     . LEU A 1 149 ? -35.141 3.834   -23.079 1.00 39.63  ? 149 LEU A C     1 
ATOM   1200 O  O     . LEU A 1 149 ? -36.315 4.167   -23.281 1.00 30.79  ? 149 LEU A O     1 
ATOM   1201 C  CB    . LEU A 1 149 ? -35.272 2.410   -21.025 1.00 33.19  ? 149 LEU A CB    1 
ATOM   1202 C  CG    . LEU A 1 149 ? -34.716 1.979   -19.667 1.00 36.68  ? 149 LEU A CG    1 
ATOM   1203 C  CD1   . LEU A 1 149 ? -35.394 0.703   -19.194 1.00 28.89  ? 149 LEU A CD1   1 
ATOM   1204 C  CD2   . LEU A 1 149 ? -33.207 1.796   -19.735 1.00 24.71  ? 149 LEU A CD2   1 
ATOM   1205 N  N     . PRO A 1 150 ? -34.292 3.646   -24.086 1.00 30.26  ? 150 PRO A N     1 
ATOM   1206 C  CA    . PRO A 1 150 ? -34.742 3.740   -25.476 1.00 35.65  ? 150 PRO A CA    1 
ATOM   1207 C  C     . PRO A 1 150 ? -35.189 2.400   -26.035 1.00 32.06  ? 150 PRO A C     1 
ATOM   1208 O  O     . PRO A 1 150 ? -34.717 1.333   -25.638 1.00 30.41  ? 150 PRO A O     1 
ATOM   1209 C  CB    . PRO A 1 150 ? -33.485 4.239   -26.202 1.00 34.03  ? 150 PRO A CB    1 
ATOM   1210 C  CG    . PRO A 1 150 ? -32.367 3.619   -25.429 1.00 40.55  ? 150 PRO A CG    1 
ATOM   1211 C  CD    . PRO A 1 150 ? -32.825 3.546   -23.986 1.00 29.46  ? 150 PRO A CD    1 
ATOM   1212 N  N     . GLN A 1 151 ? -36.121 2.473   -26.983 1.00 34.18  ? 151 GLN A N     1 
ATOM   1213 C  CA    . GLN A 1 151 ? -36.644 1.288   -27.654 1.00 39.27  ? 151 GLN A CA    1 
ATOM   1214 C  C     . GLN A 1 151 ? -35.742 0.967   -28.841 1.00 43.18  ? 151 GLN A C     1 
ATOM   1215 O  O     . GLN A 1 151 ? -35.702 1.716   -29.823 1.00 39.66  ? 151 GLN A O     1 
ATOM   1216 C  CB    . GLN A 1 151 ? -38.089 1.509   -28.094 1.00 33.84  ? 151 GLN A CB    1 
ATOM   1217 C  CG    . GLN A 1 151 ? -39.006 1.966   -26.972 1.00 32.00  ? 151 GLN A CG    1 
ATOM   1218 C  CD    . GLN A 1 151 ? -40.474 1.875   -27.336 1.00 36.96  ? 151 GLN A CD    1 
ATOM   1219 O  OE1   . GLN A 1 151 ? -40.941 0.846   -27.828 1.00 42.61  ? 151 GLN A OE1   1 
ATOM   1220 N  NE2   . GLN A 1 151 ? -41.210 2.953   -27.098 1.00 41.04  ? 151 GLN A NE2   1 
ATOM   1221 N  N     . GLY A 1 152 ? -35.014 -0.142  -28.746 1.00 32.33  ? 152 GLY A N     1 
ATOM   1222 C  CA    . GLY A 1 152 ? -34.066 -0.523  -29.774 1.00 34.36  ? 152 GLY A CA    1 
ATOM   1223 C  C     . GLY A 1 152 ? -32.706 -0.859  -29.201 1.00 39.11  ? 152 GLY A C     1 
ATOM   1224 O  O     . GLY A 1 152 ? -31.860 -1.447  -29.881 1.00 37.45  ? 152 GLY A O     1 
ATOM   1225 N  N     . TRP A 1 153 ? -32.487 -0.487  -27.943 1.00 40.91  ? 153 TRP A N     1 
ATOM   1226 C  CA    . TRP A 1 153 ? -31.226 -0.754  -27.271 1.00 39.09  ? 153 TRP A CA    1 
ATOM   1227 C  C     . TRP A 1 153 ? -31.231 -2.155  -26.669 1.00 41.28  ? 153 TRP A C     1 
ATOM   1228 O  O     . TRP A 1 153 ? -32.264 -2.655  -26.213 1.00 38.66  ? 153 TRP A O     1 
ATOM   1229 C  CB    . TRP A 1 153 ? -30.972 0.294   -26.185 1.00 32.05  ? 153 TRP A CB    1 
ATOM   1230 C  CG    . TRP A 1 153 ? -29.669 0.137   -25.467 1.00 29.39  ? 153 TRP A CG    1 
ATOM   1231 C  CD1   . TRP A 1 153 ? -28.440 -0.063  -26.025 1.00 32.33  ? 153 TRP A CD1   1 
ATOM   1232 C  CD2   . TRP A 1 153 ? -29.461 0.195   -24.050 1.00 28.27  ? 153 TRP A CD2   1 
ATOM   1233 N  NE1   . TRP A 1 153 ? -27.482 -0.147  -25.044 1.00 27.92  ? 153 TRP A NE1   1 
ATOM   1234 C  CE2   . TRP A 1 153 ? -28.083 0.010   -23.822 1.00 32.41  ? 153 TRP A CE2   1 
ATOM   1235 C  CE3   . TRP A 1 153 ? -30.308 0.380   -22.953 1.00 28.34  ? 153 TRP A CE3   1 
ATOM   1236 C  CZ2   . TRP A 1 153 ? -27.532 0.003   -22.542 1.00 36.58  ? 153 TRP A CZ2   1 
ATOM   1237 C  CZ3   . TRP A 1 153 ? -29.760 0.372   -21.683 1.00 37.98  ? 153 TRP A CZ3   1 
ATOM   1238 C  CH2   . TRP A 1 153 ? -28.385 0.186   -21.488 1.00 37.63  ? 153 TRP A CH2   1 
ATOM   1239 N  N     . LYS A 1 154 ? -30.055 -2.789  -26.677 1.00 37.13  ? 154 LYS A N     1 
ATOM   1240 C  CA    . LYS A 1 154 ? -29.958 -4.178  -26.237 1.00 32.44  ? 154 LYS A CA    1 
ATOM   1241 C  C     . LYS A 1 154 ? -30.306 -4.325  -24.761 1.00 37.75  ? 154 LYS A C     1 
ATOM   1242 O  O     . LYS A 1 154 ? -30.987 -5.280  -24.368 1.00 36.83  ? 154 LYS A O     1 
ATOM   1243 C  CB    . LYS A 1 154 ? -28.552 -4.718  -26.504 1.00 34.79  ? 154 LYS A CB    1 
ATOM   1244 C  CG    . LYS A 1 154 ? -28.346 -6.151  -26.039 1.00 46.07  ? 154 LYS A CG    1 
ATOM   1245 C  CD    . LYS A 1 154 ? -26.969 -6.346  -25.426 1.00 54.84  ? 154 LYS A CD    1 
ATOM   1246 C  CE    . LYS A 1 154 ? -25.868 -6.077  -26.433 1.00 37.92  ? 154 LYS A CE    1 
ATOM   1247 N  NZ    . LYS A 1 154 ? -24.513 -6.194  -25.823 1.00 45.31  ? 154 LYS A NZ    1 
ATOM   1248 N  N     . GLY A 1 155 ? -29.853 -3.389  -23.928 1.00 36.61  ? 155 GLY A N     1 
ATOM   1249 C  CA    . GLY A 1 155 ? -30.036 -3.514  -22.495 1.00 35.26  ? 155 GLY A CA    1 
ATOM   1250 C  C     . GLY A 1 155 ? -31.382 -3.075  -21.963 1.00 38.74  ? 155 GLY A C     1 
ATOM   1251 O  O     . GLY A 1 155 ? -31.646 -3.267  -20.773 1.00 34.75  ? 155 GLY A O     1 
ATOM   1252 N  N     . SER A 1 156 ? -32.241 -2.500  -22.812 1.00 30.69  ? 156 SER A N     1 
ATOM   1253 C  CA    . SER A 1 156 ? -33.513 -1.973  -22.319 1.00 33.60  ? 156 SER A CA    1 
ATOM   1254 C  C     . SER A 1 156 ? -34.443 -3.058  -21.787 1.00 36.00  ? 156 SER A C     1 
ATOM   1255 O  O     . SER A 1 156 ? -35.031 -2.856  -20.709 1.00 36.57  ? 156 SER A O     1 
ATOM   1256 C  CB    . SER A 1 156 ? -34.188 -1.137  -23.411 1.00 31.78  ? 156 SER A CB    1 
ATOM   1257 O  OG    . SER A 1 156 ? -33.463 0.055   -23.660 1.00 35.67  ? 156 SER A OG    1 
ATOM   1258 N  N     . PRO A 1 157 ? -34.644 -4.199  -22.464 1.00 33.89  ? 157 PRO A N     1 
ATOM   1259 C  CA    . PRO A 1 157 ? -35.584 -5.196  -21.915 1.00 37.82  ? 157 PRO A CA    1 
ATOM   1260 C  C     . PRO A 1 157 ? -35.195 -5.716  -20.541 1.00 31.03  ? 157 PRO A C     1 
ATOM   1261 O  O     . PRO A 1 157 ? -36.029 -5.713  -19.628 1.00 26.84  ? 157 PRO A O     1 
ATOM   1262 C  CB    . PRO A 1 157 ? -35.569 -6.304  -22.978 1.00 33.24  ? 157 PRO A CB    1 
ATOM   1263 C  CG    . PRO A 1 157 ? -35.218 -5.600  -24.236 1.00 30.25  ? 157 PRO A CG    1 
ATOM   1264 C  CD    . PRO A 1 157 ? -34.208 -4.569  -23.824 1.00 38.84  ? 157 PRO A CD    1 
ATOM   1265 N  N     . ALA A 1 158 ? -33.948 -6.160  -20.361 1.00 31.93  ? 158 ALA A N     1 
ATOM   1266 C  CA    . ALA A 1 158 ? -33.551 -6.717  -19.071 1.00 30.14  ? 158 ALA A CA    1 
ATOM   1267 C  C     . ALA A 1 158 ? -33.513 -5.656  -17.979 1.00 35.18  ? 158 ALA A C     1 
ATOM   1268 O  O     . ALA A 1 158 ? -33.794 -5.960  -16.814 1.00 28.56  ? 158 ALA A O     1 
ATOM   1269 C  CB    . ALA A 1 158 ? -32.193 -7.409  -19.186 1.00 25.12  ? 158 ALA A CB    1 
ATOM   1270 N  N     . ILE A 1 159 ? -33.167 -4.414  -18.325 1.00 29.42  ? 159 ILE A N     1 
ATOM   1271 C  CA    . ILE A 1 159 ? -33.145 -3.352  -17.323 1.00 33.02  ? 159 ILE A CA    1 
ATOM   1272 C  C     . ILE A 1 159 ? -34.561 -3.000  -16.887 1.00 27.63  ? 159 ILE A C     1 
ATOM   1273 O  O     . ILE A 1 159 ? -34.823 -2.795  -15.695 1.00 34.85  ? 159 ILE A O     1 
ATOM   1274 C  CB    . ILE A 1 159 ? -32.387 -2.122  -17.857 1.00 27.96  ? 159 ILE A CB    1 
ATOM   1275 C  CG1   . ILE A 1 159 ? -30.879 -2.383  -17.843 1.00 30.75  ? 159 ILE A CG1   1 
ATOM   1276 C  CG2   . ILE A 1 159 ? -32.717 -0.883  -17.038 1.00 24.87  ? 159 ILE A CG2   1 
ATOM   1277 C  CD1   . ILE A 1 159 ? -30.057 -1.242  -18.402 1.00 28.05  ? 159 ILE A CD1   1 
ATOM   1278 N  N     . PHE A 1 160 ? -35.501 -2.936  -17.834 1.00 24.09  ? 160 PHE A N     1 
ATOM   1279 C  CA    . PHE A 1 160 ? -36.885 -2.661  -17.457 1.00 27.14  ? 160 PHE A CA    1 
ATOM   1280 C  C     . PHE A 1 160 ? -37.476 -3.808  -16.648 1.00 26.13  ? 160 PHE A C     1 
ATOM   1281 O  O     . PHE A 1 160 ? -38.150 -3.576  -15.637 1.00 25.70  ? 160 PHE A O     1 
ATOM   1282 C  CB    . PHE A 1 160 ? -37.743 -2.395  -18.693 1.00 33.15  ? 160 PHE A CB    1 
ATOM   1283 C  CG    . PHE A 1 160 ? -39.178 -2.077  -18.367 1.00 25.53  ? 160 PHE A CG    1 
ATOM   1284 C  CD1   . PHE A 1 160 ? -39.574 -0.772  -18.133 1.00 28.46  ? 160 PHE A CD1   1 
ATOM   1285 C  CD2   . PHE A 1 160 ? -40.127 -3.085  -18.274 1.00 27.55  ? 160 PHE A CD2   1 
ATOM   1286 C  CE1   . PHE A 1 160 ? -40.886 -0.476  -17.821 1.00 29.46  ? 160 PHE A CE1   1 
ATOM   1287 C  CE2   . PHE A 1 160 ? -41.440 -2.793  -17.961 1.00 25.94  ? 160 PHE A CE2   1 
ATOM   1288 C  CZ    . PHE A 1 160 ? -41.820 -1.487  -17.735 1.00 32.39  ? 160 PHE A CZ    1 
ATOM   1289 N  N     . GLN A 1 161 ? -37.251 -5.049  -17.086 1.00 32.59  ? 161 GLN A N     1 
ATOM   1290 C  CA    . GLN A 1 161 ? -37.818 -6.197  -16.386 1.00 26.30  ? 161 GLN A CA    1 
ATOM   1291 C  C     . GLN A 1 161 ? -37.297 -6.286  -14.956 1.00 33.23  ? 161 GLN A C     1 
ATOM   1292 O  O     . GLN A 1 161 ? -38.063 -6.557  -14.024 1.00 30.78  ? 161 GLN A O     1 
ATOM   1293 C  CB    . GLN A 1 161 ? -37.509 -7.482  -17.155 1.00 26.69  ? 161 GLN A CB    1 
ATOM   1294 C  CG    . GLN A 1 161 ? -38.232 -7.593  -18.488 1.00 29.73  ? 161 GLN A CG    1 
ATOM   1295 C  CD    . GLN A 1 161 ? -37.523 -8.513  -19.461 1.00 28.11  ? 161 GLN A CD    1 
ATOM   1296 O  OE1   . GLN A 1 161 ? -36.452 -9.044  -19.164 1.00 33.01  ? 161 GLN A OE1   1 
ATOM   1297 N  NE2   . GLN A 1 161 ? -38.112 -8.699  -20.635 1.00 27.54  ? 161 GLN A NE2   1 
ATOM   1298 N  N     . SER A 1 162 ? -35.997 -6.054  -14.763 1.00 28.27  ? 162 SER A N     1 
ATOM   1299 C  CA    . SER A 1 162 ? -35.443 -6.051  -13.413 1.00 32.73  ? 162 SER A CA    1 
ATOM   1300 C  C     . SER A 1 162 ? -35.965 -4.868  -12.607 1.00 27.75  ? 162 SER A C     1 
ATOM   1301 O  O     . SER A 1 162 ? -36.277 -5.010  -11.419 1.00 31.21  ? 162 SER A O     1 
ATOM   1302 C  CB    . SER A 1 162 ? -33.916 -6.033  -13.471 1.00 27.86  ? 162 SER A CB    1 
ATOM   1303 O  OG    . SER A 1 162 ? -33.356 -6.049  -12.169 1.00 33.39  ? 162 SER A OG    1 
ATOM   1304 N  N     . SER A 1 163 ? -36.073 -3.696  -13.238 1.00 25.59  ? 163 SER A N     1 
ATOM   1305 C  CA    . SER A 1 163 ? -36.585 -2.522  -12.536 1.00 30.25  ? 163 SER A CA    1 
ATOM   1306 C  C     . SER A 1 163 ? -38.054 -2.693  -12.171 1.00 27.01  ? 163 SER A C     1 
ATOM   1307 O  O     . SER A 1 163 ? -38.479 -2.287  -11.083 1.00 29.52  ? 163 SER A O     1 
ATOM   1308 C  CB    . SER A 1 163 ? -36.388 -1.270  -13.390 1.00 34.25  ? 163 SER A CB    1 
ATOM   1309 O  OG    . SER A 1 163 ? -35.016 -1.063  -13.681 1.00 35.03  ? 163 SER A OG    1 
ATOM   1310 N  N     . MET A 1 164 ? -38.844 -3.290  -13.067 1.00 33.35  ? 164 MET A N     1 
ATOM   1311 C  CA    . MET A 1 164 ? -40.251 -3.533  -12.765 1.00 29.08  ? 164 MET A CA    1 
ATOM   1312 C  C     . MET A 1 164 ? -40.400 -4.490  -11.589 1.00 26.67  ? 164 MET A C     1 
ATOM   1313 O  O     . MET A 1 164 ? -41.315 -4.344  -10.771 1.00 34.07  ? 164 MET A O     1 
ATOM   1314 C  CB    . MET A 1 164 ? -40.966 -4.082  -14.000 1.00 23.76  ? 164 MET A CB    1 
ATOM   1315 C  CG    . MET A 1 164 ? -42.472 -4.225  -13.842 1.00 27.92  ? 164 MET A CG    1 
ATOM   1316 S  SD    . MET A 1 164 ? -43.312 -2.636  -13.713 1.00 33.48  ? 164 MET A SD    1 
ATOM   1317 C  CE    . MET A 1 164 ? -44.996 -3.167  -13.424 1.00 29.08  ? 164 MET A CE    1 
ATOM   1318 N  N     . THR A 1 165 ? -39.501 -5.473  -11.486 1.00 29.21  ? 165 THR A N     1 
ATOM   1319 C  CA    . THR A 1 165 ? -39.556 -6.414  -10.371 1.00 26.61  ? 165 THR A CA    1 
ATOM   1320 C  C     . THR A 1 165 ? -39.255 -5.721  -9.047  1.00 27.77  ? 165 THR A C     1 
ATOM   1321 O  O     . THR A 1 165 ? -39.922 -5.981  -8.039  1.00 30.11  ? 165 THR A O     1 
ATOM   1322 C  CB    . THR A 1 165 ? -38.580 -7.566  -10.610 1.00 28.94  ? 165 THR A CB    1 
ATOM   1323 O  OG1   . THR A 1 165 ? -38.889 -8.205  -11.854 1.00 28.76  ? 165 THR A OG1   1 
ATOM   1324 C  CG2   . THR A 1 165 ? -38.673 -8.588  -9.487  1.00 26.55  ? 165 THR A CG2   1 
ATOM   1325 N  N     . LYS A 1 166 ? -38.250 -4.841  -9.030  1.00 25.61  ? 166 LYS A N     1 
ATOM   1326 C  CA    . LYS A 1 166 ? -37.954 -4.079  -7.820  1.00 28.14  ? 166 LYS A CA    1 
ATOM   1327 C  C     . LYS A 1 166 ? -39.121 -3.178  -7.439  1.00 28.01  ? 166 LYS A C     1 
ATOM   1328 O  O     . LYS A 1 166 ? -39.414 -2.998  -6.251  1.00 34.39  ? 166 LYS A O     1 
ATOM   1329 C  CB    . LYS A 1 166 ? -36.685 -3.248  -8.015  1.00 30.68  ? 166 LYS A CB    1 
ATOM   1330 C  CG    . LYS A 1 166 ? -35.395 -4.050  -8.009  1.00 35.11  ? 166 LYS A CG    1 
ATOM   1331 C  CD    . LYS A 1 166 ? -34.189 -3.135  -8.169  1.00 33.44  ? 166 LYS A CD    1 
ATOM   1332 C  CE    . LYS A 1 166 ? -32.895 -3.856  -7.825  1.00 38.31  ? 166 LYS A CE    1 
ATOM   1333 N  NZ    . LYS A 1 166 ? -32.707 -5.085  -8.643  1.00 43.34  ? 166 LYS A NZ    1 
ATOM   1334 N  N     . ILE A 1 167 ? -39.800 -2.606  -8.434  1.00 24.03  ? 167 ILE A N     1 
ATOM   1335 C  CA    . ILE A 1 167 ? -40.916 -1.706  -8.162  1.00 33.48  ? 167 ILE A CA    1 
ATOM   1336 C  C     . ILE A 1 167 ? -42.084 -2.467  -7.547  1.00 27.67  ? 167 ILE A C     1 
ATOM   1337 O  O     . ILE A 1 167 ? -42.717 -1.994  -6.595  1.00 31.48  ? 167 ILE A O     1 
ATOM   1338 C  CB    . ILE A 1 167 ? -41.323 -0.971  -9.453  1.00 24.19  ? 167 ILE A CB    1 
ATOM   1339 C  CG1   . ILE A 1 167 ? -40.283 0.097   -9.800  1.00 24.93  ? 167 ILE A CG1   1 
ATOM   1340 C  CG2   . ILE A 1 167 ? -42.710 -0.360  -9.319  1.00 29.06  ? 167 ILE A CG2   1 
ATOM   1341 C  CD1   . ILE A 1 167 ? -40.569 0.835   -11.093 1.00 30.00  ? 167 ILE A CD1   1 
ATOM   1342 N  N     . LEU A 1 168 ? -42.381 -3.658  -8.067  1.00 29.53  ? 168 LEU A N     1 
ATOM   1343 C  CA    . LEU A 1 168 ? -43.491 -4.454  -7.556  1.00 25.80  ? 168 LEU A CA    1 
ATOM   1344 C  C     . LEU A 1 168 ? -43.172 -5.143  -6.237  1.00 28.23  ? 168 LEU A C     1 
ATOM   1345 O  O     . LEU A 1 168 ? -44.099 -5.598  -5.556  1.00 32.60  ? 168 LEU A O     1 
ATOM   1346 C  CB    . LEU A 1 168 ? -43.900 -5.510  -8.586  1.00 21.69  ? 168 LEU A CB    1 
ATOM   1347 C  CG    . LEU A 1 168 ? -44.537 -5.007  -9.880  1.00 25.86  ? 168 LEU A CG    1 
ATOM   1348 C  CD1   . LEU A 1 168 ? -44.644 -6.139  -10.889 1.00 26.71  ? 168 LEU A CD1   1 
ATOM   1349 C  CD2   . LEU A 1 168 ? -45.906 -4.413  -9.593  1.00 21.94  ? 168 LEU A CD2   1 
ATOM   1350 N  N     . GLU A 1 169 ? -41.895 -5.227  -5.862  1.00 32.26  ? 169 GLU A N     1 
ATOM   1351 C  CA    . GLU A 1 169 ? -41.507 -6.012  -4.690  1.00 29.06  ? 169 GLU A CA    1 
ATOM   1352 C  C     . GLU A 1 169 ? -42.183 -5.548  -3.404  1.00 34.54  ? 169 GLU A C     1 
ATOM   1353 O  O     . GLU A 1 169 ? -42.682 -6.408  -2.656  1.00 45.10  ? 169 GLU A O     1 
ATOM   1354 C  CB    . GLU A 1 169 ? -39.979 -6.012  -4.563  1.00 28.69  ? 169 GLU A CB    1 
ATOM   1355 C  CG    . GLU A 1 169 ? -39.418 -7.005  -3.551  1.00 31.77  ? 169 GLU A CG    1 
ATOM   1356 C  CD    . GLU A 1 169 ? -39.388 -6.455  -2.139  1.00 34.50  ? 169 GLU A CD    1 
ATOM   1357 O  OE1   . GLU A 1 169 ? -39.357 -7.260  -1.185  1.00 47.26  ? 169 GLU A OE1   1 
ATOM   1358 O  OE2   . GLU A 1 169 ? -39.396 -5.217  -1.982  1.00 37.00  ? 169 GLU A OE2   1 
ATOM   1359 N  N     . PRO A 1 170 ? -42.238 -4.250  -3.072  1.00 33.67  ? 170 PRO A N     1 
ATOM   1360 C  CA    . PRO A 1 170 ? -42.955 -3.865  -1.843  1.00 32.89  ? 170 PRO A CA    1 
ATOM   1361 C  C     . PRO A 1 170 ? -44.430 -4.221  -1.870  1.00 34.74  ? 170 PRO A C     1 
ATOM   1362 O  O     . PRO A 1 170 ? -44.994 -4.569  -0.824  1.00 31.48  ? 170 PRO A O     1 
ATOM   1363 C  CB    . PRO A 1 170 ? -42.737 -2.347  -1.770  1.00 30.40  ? 170 PRO A CB    1 
ATOM   1364 C  CG    . PRO A 1 170 ? -41.483 -2.113  -2.535  1.00 22.54  ? 170 PRO A CG    1 
ATOM   1365 C  CD    . PRO A 1 170 ? -41.537 -3.097  -3.667  1.00 33.01  ? 170 PRO A CD    1 
ATOM   1366 N  N     . PHE A 1 171 ? -45.077 -4.148  -3.036  1.00 30.85  ? 171 PHE A N     1 
ATOM   1367 C  CA    . PHE A 1 171 ? -46.492 -4.496  -3.110  1.00 27.60  ? 171 PHE A CA    1 
ATOM   1368 C  C     . PHE A 1 171 ? -46.701 -5.997  -2.949  1.00 30.48  ? 171 PHE A C     1 
ATOM   1369 O  O     . PHE A 1 171 ? -47.664 -6.429  -2.305  1.00 30.31  ? 171 PHE A O     1 
ATOM   1370 C  CB    . PHE A 1 171 ? -47.091 -4.008  -4.430  1.00 25.80  ? 171 PHE A CB    1 
ATOM   1371 C  CG    . PHE A 1 171 ? -48.584 -4.180  -4.520  1.00 30.38  ? 171 PHE A CG    1 
ATOM   1372 C  CD1   . PHE A 1 171 ? -49.438 -3.166  -4.118  1.00 30.67  ? 171 PHE A CD1   1 
ATOM   1373 C  CD2   . PHE A 1 171 ? -49.135 -5.357  -5.006  1.00 24.14  ? 171 PHE A CD2   1 
ATOM   1374 C  CE1   . PHE A 1 171 ? -50.811 -3.320  -4.198  1.00 28.88  ? 171 PHE A CE1   1 
ATOM   1375 C  CE2   . PHE A 1 171 ? -50.508 -5.518  -5.087  1.00 20.09  ? 171 PHE A CE2   1 
ATOM   1376 C  CZ    . PHE A 1 171 ? -51.346 -4.498  -4.683  1.00 30.84  ? 171 PHE A CZ    1 
ATOM   1377 N  N     . ARG A 1 172 ? -45.815 -6.809  -3.534  1.00 29.69  ? 172 ARG A N     1 
ATOM   1378 C  CA    . ARG A 1 172 ? -45.948 -8.257  -3.407  1.00 35.83  ? 172 ARG A CA    1 
ATOM   1379 C  C     . ARG A 1 172 ? -45.742 -8.706  -1.965  1.00 32.17  ? 172 ARG A C     1 
ATOM   1380 O  O     . ARG A 1 172 ? -46.469 -9.576  -1.472  1.00 32.69  ? 172 ARG A O     1 
ATOM   1381 C  CB    . ARG A 1 172 ? -44.963 -8.967  -4.338  1.00 26.59  ? 172 ARG A CB    1 
ATOM   1382 C  CG    . ARG A 1 172 ? -45.351 -8.922  -5.810  1.00 30.14  ? 172 ARG A CG    1 
ATOM   1383 C  CD    . ARG A 1 172 ? -44.537 -9.919  -6.625  1.00 30.84  ? 172 ARG A CD    1 
ATOM   1384 N  NE    . ARG A 1 172 ? -45.046 -10.063 -7.986  1.00 28.05  ? 172 ARG A NE    1 
ATOM   1385 C  CZ    . ARG A 1 172 ? -44.451 -9.569  -9.067  1.00 23.38  ? 172 ARG A CZ    1 
ATOM   1386 N  NH1   . ARG A 1 172 ? -43.312 -8.901  -8.956  1.00 29.52  ? 172 ARG A NH1   1 
ATOM   1387 N  NH2   . ARG A 1 172 ? -44.992 -9.750  -10.264 1.00 28.42  ? 172 ARG A NH2   1 
ATOM   1388 N  N     . LYS A 1 173 ? -44.759 -8.124  -1.275  1.00 34.72  ? 173 LYS A N     1 
ATOM   1389 C  CA    . LYS A 1 173 ? -44.546 -8.453  0.132   1.00 30.84  ? 173 LYS A CA    1 
ATOM   1390 C  C     . LYS A 1 173 ? -45.757 -8.074  0.975   1.00 41.73  ? 173 LYS A C     1 
ATOM   1391 O  O     . LYS A 1 173 ? -46.149 -8.816  1.883   1.00 39.99  ? 173 LYS A O     1 
ATOM   1392 C  CB    . LYS A 1 173 ? -43.291 -7.751  0.651   1.00 43.70  ? 173 LYS A CB    1 
ATOM   1393 C  CG    . LYS A 1 173 ? -42.107 -8.671  0.910   1.00 47.10  ? 173 LYS A CG    1 
ATOM   1394 C  CD    . LYS A 1 173 ? -41.702 -9.434  -0.339  1.00 57.93  ? 173 LYS A CD    1 
ATOM   1395 C  CE    . LYS A 1 173 ? -40.377 -10.157 -0.137  1.00 42.47  ? 173 LYS A CE    1 
ATOM   1396 N  NZ    . LYS A 1 173 ? -40.388 -11.015 1.081   1.00 61.05  ? 173 LYS A NZ    1 
ATOM   1397 N  N     . GLN A 1 174 ? -46.367 -6.921  0.686   1.00 38.64  ? 174 GLN A N     1 
ATOM   1398 C  CA    . GLN A 1 174 ? -47.531 -6.492  1.452   1.00 38.59  ? 174 GLN A CA    1 
ATOM   1399 C  C     . GLN A 1 174 ? -48.774 -7.293  1.086   1.00 36.42  ? 174 GLN A C     1 
ATOM   1400 O  O     . GLN A 1 174 ? -49.651 -7.495  1.934   1.00 37.29  ? 174 GLN A O     1 
ATOM   1401 C  CB    . GLN A 1 174 ? -47.778 -4.997  1.241   1.00 40.45  ? 174 GLN A CB    1 
ATOM   1402 C  CG    . GLN A 1 174 ? -48.927 -4.434  2.064   1.00 40.75  ? 174 GLN A CG    1 
ATOM   1403 C  CD    . GLN A 1 174 ? -49.114 -2.943  1.870   1.00 50.60  ? 174 GLN A CD    1 
ATOM   1404 O  OE1   . GLN A 1 174 ? -48.213 -2.247  1.402   1.00 64.10  ? 174 GLN A OE1   1 
ATOM   1405 N  NE2   . GLN A 1 174 ? -50.292 -2.445  2.228   1.00 46.14  ? 174 GLN A NE2   1 
ATOM   1406 N  N     . ASN A 1 175 ? -48.867 -7.763  -0.156  1.00 36.88  ? 175 ASN A N     1 
ATOM   1407 C  CA    . ASN A 1 175 ? -50.024 -8.516  -0.639  1.00 30.48  ? 175 ASN A CA    1 
ATOM   1408 C  C     . ASN A 1 175 ? -49.553 -9.827  -1.256  1.00 40.36  ? 175 ASN A C     1 
ATOM   1409 O  O     . ASN A 1 175 ? -49.546 -9.987  -2.482  1.00 37.42  ? 175 ASN A O     1 
ATOM   1410 C  CB    . ASN A 1 175 ? -50.826 -7.690  -1.645  1.00 28.87  ? 175 ASN A CB    1 
ATOM   1411 C  CG    . ASN A 1 175 ? -51.216 -6.331  -1.101  1.00 35.24  ? 175 ASN A CG    1 
ATOM   1412 O  OD1   . ASN A 1 175 ? -52.199 -6.201  -0.373  1.00 41.24  ? 175 ASN A OD1   1 
ATOM   1413 N  ND2   . ASN A 1 175 ? -50.443 -5.308  -1.449  1.00 34.13  ? 175 ASN A ND2   1 
ATOM   1414 N  N     . PRO A 1 176 ? -49.156 -10.796 -0.425  1.00 42.05  ? 176 PRO A N     1 
ATOM   1415 C  CA    . PRO A 1 176 ? -48.663 -12.070 -0.972  1.00 34.23  ? 176 PRO A CA    1 
ATOM   1416 C  C     . PRO A 1 176 ? -49.748 -12.925 -1.602  1.00 35.74  ? 176 PRO A C     1 
ATOM   1417 O  O     . PRO A 1 176 ? -49.420 -13.833 -2.376  1.00 40.75  ? 176 PRO A O     1 
ATOM   1418 C  CB    . PRO A 1 176 ? -48.051 -12.763 0.251   1.00 38.30  ? 176 PRO A CB    1 
ATOM   1419 C  CG    . PRO A 1 176 ? -48.819 -12.207 1.405   1.00 43.00  ? 176 PRO A CG    1 
ATOM   1420 C  CD    . PRO A 1 176 ? -49.126 -10.777 1.048   1.00 37.27  ? 176 PRO A CD    1 
ATOM   1421 N  N     . ASP A 1 177 ? -51.021 -12.670 -1.302  1.00 34.58  ? 177 ASP A N     1 
ATOM   1422 C  CA    . ASP A 1 177 ? -52.124 -13.470 -1.816  1.00 34.98  ? 177 ASP A CA    1 
ATOM   1423 C  C     . ASP A 1 177 ? -52.798 -12.826 -3.022  1.00 36.81  ? 177 ASP A C     1 
ATOM   1424 O  O     . ASP A 1 177 ? -53.940 -13.169 -3.345  1.00 40.38  ? 177 ASP A O     1 
ATOM   1425 C  CB    . ASP A 1 177 ? -53.142 -13.727 -0.706  1.00 39.84  ? 177 ASP A CB    1 
ATOM   1426 C  CG    . ASP A 1 177 ? -52.499 -14.282 0.548   1.00 50.56  ? 177 ASP A CG    1 
ATOM   1427 O  OD1   . ASP A 1 177 ? -52.788 -13.760 1.646   1.00 60.65  ? 177 ASP A OD1   1 
ATOM   1428 O  OD2   . ASP A 1 177 ? -51.703 -15.238 0.432   1.00 43.02  ? 177 ASP A OD2   1 
ATOM   1429 N  N     . ILE A 1 178 ? -52.116 -11.899 -3.685  1.00 33.81  ? 178 ILE A N     1 
ATOM   1430 C  CA    . ILE A 1 178 ? -52.595 -11.279 -4.913  1.00 36.72  ? 178 ILE A CA    1 
ATOM   1431 C  C     . ILE A 1 178 ? -51.558 -11.567 -5.986  1.00 33.00  ? 178 ILE A C     1 
ATOM   1432 O  O     . ILE A 1 178 ? -50.431 -11.059 -5.923  1.00 40.07  ? 178 ILE A O     1 
ATOM   1433 C  CB    . ILE A 1 178 ? -52.826 -9.772  -4.749  1.00 36.30  ? 178 ILE A CB    1 
ATOM   1434 C  CG1   . ILE A 1 178 ? -54.006 -9.529  -3.809  1.00 31.89  ? 178 ILE A CG1   1 
ATOM   1435 C  CG2   . ILE A 1 178 ? -53.062 -9.116  -6.101  1.00 33.77  ? 178 ILE A CG2   1 
ATOM   1436 C  CD1   . ILE A 1 178 ? -54.292 -8.082  -3.565  1.00 33.09  ? 178 ILE A CD1   1 
ATOM   1437 N  N     . VAL A 1 179 ? -51.931 -12.384 -6.964  1.00 25.94  ? 179 VAL A N     1 
ATOM   1438 C  CA    . VAL A 1 179 ? -50.991 -12.826 -7.986  1.00 31.90  ? 179 VAL A CA    1 
ATOM   1439 C  C     . VAL A 1 179 ? -50.886 -11.760 -9.068  1.00 28.54  ? 179 VAL A C     1 
ATOM   1440 O  O     . VAL A 1 179 ? -51.899 -11.274 -9.585  1.00 28.53  ? 179 VAL A O     1 
ATOM   1441 C  CB    . VAL A 1 179 ? -51.417 -14.185 -8.567  1.00 33.02  ? 179 VAL A CB    1 
ATOM   1442 C  CG1   . VAL A 1 179 ? -52.875 -14.154 -9.023  1.00 30.81  ? 179 VAL A CG1   1 
ATOM   1443 C  CG2   . VAL A 1 179 ? -50.493 -14.591 -9.702  1.00 29.65  ? 179 VAL A CG2   1 
ATOM   1444 N  N     . ILE A 1 180 ? -49.656 -11.381 -9.400  1.00 28.54  ? 180 ILE A N     1 
ATOM   1445 C  CA    . ILE A 1 180 ? -49.379 -10.369 -10.414 1.00 24.92  ? 180 ILE A CA    1 
ATOM   1446 C  C     . ILE A 1 180 ? -48.464 -11.013 -11.447 1.00 28.37  ? 180 ILE A C     1 
ATOM   1447 O  O     . ILE A 1 180 ? -47.258 -11.160 -11.216 1.00 26.44  ? 180 ILE A O     1 
ATOM   1448 C  CB    . ILE A 1 180 ? -48.744 -9.108  -9.819  1.00 26.04  ? 180 ILE A CB    1 
ATOM   1449 C  CG1   . ILE A 1 180 ? -49.650 -8.513  -8.740  1.00 29.96  ? 180 ILE A CG1   1 
ATOM   1450 C  CG2   . ILE A 1 180 ? -48.472 -8.083  -10.909 1.00 22.07  ? 180 ILE A CG2   1 
ATOM   1451 C  CD1   . ILE A 1 180 ? -49.092 -7.255  -8.103  1.00 29.15  ? 180 ILE A CD1   1 
ATOM   1452 N  N     . TYR A 1 181 ? -49.031 -11.411 -12.584 1.00 33.36  ? 181 TYR A N     1 
ATOM   1453 C  CA    . TYR A 1 181 ? -48.233 -11.907 -13.699 1.00 25.20  ? 181 TYR A CA    1 
ATOM   1454 C  C     . TYR A 1 181 ? -47.646 -10.718 -14.449 1.00 28.87  ? 181 TYR A C     1 
ATOM   1455 O  O     . TYR A 1 181 ? -48.383 -9.904  -15.015 1.00 32.87  ? 181 TYR A O     1 
ATOM   1456 C  CB    . TYR A 1 181 ? -49.077 -12.783 -14.622 1.00 25.38  ? 181 TYR A CB    1 
ATOM   1457 C  CG    . TYR A 1 181 ? -49.035 -14.252 -14.264 1.00 26.29  ? 181 TYR A CG    1 
ATOM   1458 C  CD1   . TYR A 1 181 ? -49.765 -14.750 -13.192 1.00 29.73  ? 181 TYR A CD1   1 
ATOM   1459 C  CD2   . TYR A 1 181 ? -48.261 -15.142 -14.998 1.00 22.32  ? 181 TYR A CD2   1 
ATOM   1460 C  CE1   . TYR A 1 181 ? -49.725 -16.092 -12.860 1.00 31.56  ? 181 TYR A CE1   1 
ATOM   1461 C  CE2   . TYR A 1 181 ? -48.216 -16.485 -14.677 1.00 25.91  ? 181 TYR A CE2   1 
ATOM   1462 C  CZ    . TYR A 1 181 ? -48.951 -16.956 -13.607 1.00 30.13  ? 181 TYR A CZ    1 
ATOM   1463 O  OH    . TYR A 1 181 ? -48.909 -18.294 -13.283 1.00 29.86  ? 181 TYR A OH    1 
ATOM   1464 N  N     . GLN A 1 182 ? -46.321 -10.622 -14.448 1.00 37.60  ? 182 GLN A N     1 
ATOM   1465 C  CA    . GLN A 1 182 ? -45.600 -9.438  -14.905 1.00 31.97  ? 182 GLN A CA    1 
ATOM   1466 C  C     . GLN A 1 182 ? -44.788 -9.799  -16.147 1.00 30.68  ? 182 GLN A C     1 
ATOM   1467 O  O     . GLN A 1 182 ? -43.725 -10.419 -16.049 1.00 34.39  ? 182 GLN A O     1 
ATOM   1468 C  CB    . GLN A 1 182 ? -44.716 -8.909  -13.777 1.00 33.13  ? 182 GLN A CB    1 
ATOM   1469 C  CG    . GLN A 1 182 ? -43.638 -7.929  -14.191 1.00 27.07  ? 182 GLN A CG    1 
ATOM   1470 C  CD    . GLN A 1 182 ? -42.469 -7.936  -13.225 1.00 33.26  ? 182 GLN A CD    1 
ATOM   1471 O  OE1   . GLN A 1 182 ? -42.583 -8.429  -12.101 1.00 26.24  ? 182 GLN A OE1   1 
ATOM   1472 N  NE2   . GLN A 1 182 ? -41.333 -7.404  -13.663 1.00 23.69  ? 182 GLN A NE2   1 
ATOM   1473 N  N     . TYR A 1 183 ? -45.299 -9.416  -17.317 1.00 27.86  ? 183 TYR A N     1 
ATOM   1474 C  CA    . TYR A 1 183 ? -44.601 -9.587  -18.588 1.00 28.25  ? 183 TYR A CA    1 
ATOM   1475 C  C     . TYR A 1 183 ? -44.358 -8.201  -19.166 1.00 30.13  ? 183 TYR A C     1 
ATOM   1476 O  O     . TYR A 1 183 ? -45.308 -7.520  -19.571 1.00 29.10  ? 183 TYR A O     1 
ATOM   1477 C  CB    . TYR A 1 183 ? -45.405 -10.456 -19.554 1.00 29.71  ? 183 TYR A CB    1 
ATOM   1478 C  CG    . TYR A 1 183 ? -44.622 -10.878 -20.775 1.00 26.03  ? 183 TYR A CG    1 
ATOM   1479 C  CD1   . TYR A 1 183 ? -43.808 -12.004 -20.745 1.00 22.59  ? 183 TYR A CD1   1 
ATOM   1480 C  CD2   . TYR A 1 183 ? -44.694 -10.150 -21.956 1.00 25.69  ? 183 TYR A CD2   1 
ATOM   1481 C  CE1   . TYR A 1 183 ? -43.088 -12.395 -21.858 1.00 25.07  ? 183 TYR A CE1   1 
ATOM   1482 C  CE2   . TYR A 1 183 ? -43.977 -10.531 -23.074 1.00 26.77  ? 183 TYR A CE2   1 
ATOM   1483 C  CZ    . TYR A 1 183 ? -43.178 -11.656 -23.020 1.00 36.84  ? 183 TYR A CZ    1 
ATOM   1484 O  OH    . TYR A 1 183 ? -42.462 -12.043 -24.129 1.00 31.84  ? 183 TYR A OH    1 
ATOM   1485 N  N     . MET A 1 184 ? -43.088 -7.792  -19.210 1.00 28.43  ? 184 MET A N     1 
ATOM   1486 C  CA    . MET A 1 184 ? -42.717 -6.419  -19.535 1.00 30.69  ? 184 MET A CA    1 
ATOM   1487 C  C     . MET A 1 184 ? -43.491 -5.459  -18.642 1.00 28.16  ? 184 MET A C     1 
ATOM   1488 O  O     . MET A 1 184 ? -43.339 -5.485  -17.417 1.00 32.44  ? 184 MET A O     1 
ATOM   1489 C  CB    . MET A 1 184 ? -42.969 -6.113  -21.014 1.00 32.88  ? 184 MET A CB    1 
ATOM   1490 C  CG    . MET A 1 184 ? -42.174 -6.981  -21.980 1.00 28.97  ? 184 MET A CG    1 
ATOM   1491 S  SD    . MET A 1 184 ? -40.388 -6.777  -21.822 1.00 42.12  ? 184 MET A SD    1 
ATOM   1492 C  CE    . MET A 1 184 ? -40.199 -5.049  -22.253 1.00 33.53  ? 184 MET A CE    1 
ATOM   1493 N  N     . ASP A 1 185 ? -44.334 -4.620  -19.242 1.00 33.34  ? 185 ASP A N     1 
ATOM   1494 C  CA    . ASP A 1 185 ? -45.179 -3.697  -18.498 1.00 29.20  ? 185 ASP A CA    1 
ATOM   1495 C  C     . ASP A 1 185 ? -46.617 -4.181  -18.383 1.00 35.47  ? 185 ASP A C     1 
ATOM   1496 O  O     . ASP A 1 185 ? -47.454 -3.474  -17.812 1.00 36.30  ? 185 ASP A O     1 
ATOM   1497 C  CB    . ASP A 1 185 ? -45.151 -2.311  -19.152 1.00 33.15  ? 185 ASP A CB    1 
ATOM   1498 C  CG    . ASP A 1 185 ? -46.015 -2.224  -20.409 1.00 34.73  ? 185 ASP A CG    1 
ATOM   1499 O  OD1   . ASP A 1 185 ? -46.524 -1.113  -20.685 1.00 30.64  ? 185 ASP A OD1   1 
ATOM   1500 O  OD2   . ASP A 1 185 ? -46.186 -3.247  -21.118 1.00 29.75  ? 185 ASP A OD2   1 
ATOM   1501 N  N     . ASP A 1 186 ? -46.920 -5.361  -18.916 1.00 23.58  ? 186 ASP A N     1 
ATOM   1502 C  CA    . ASP A 1 186 ? -48.278 -5.888  -18.949 1.00 26.24  ? 186 ASP A CA    1 
ATOM   1503 C  C     . ASP A 1 186 ? -48.531 -6.688  -17.677 1.00 28.07  ? 186 ASP A C     1 
ATOM   1504 O  O     . ASP A 1 186 ? -47.783 -7.621  -17.366 1.00 34.60  ? 186 ASP A O     1 
ATOM   1505 C  CB    . ASP A 1 186 ? -48.468 -6.755  -20.195 1.00 33.36  ? 186 ASP A CB    1 
ATOM   1506 C  CG    . ASP A 1 186 ? -49.918 -7.094  -20.458 1.00 30.09  ? 186 ASP A CG    1 
ATOM   1507 O  OD1   . ASP A 1 186 ? -50.172 -8.128  -21.111 1.00 48.37  ? 186 ASP A OD1   1 
ATOM   1508 O  OD2   . ASP A 1 186 ? -50.801 -6.329  -20.019 1.00 44.00  ? 186 ASP A OD2   1 
ATOM   1509 N  N     . LEU A 1 187 ? -49.582 -6.326  -16.944 1.00 25.34  ? 187 LEU A N     1 
ATOM   1510 C  CA    . LEU A 1 187 ? -49.858 -6.904  -15.634 1.00 25.27  ? 187 LEU A CA    1 
ATOM   1511 C  C     . LEU A 1 187 ? -51.211 -7.599  -15.641 1.00 30.25  ? 187 LEU A C     1 
ATOM   1512 O  O     . LEU A 1 187 ? -52.234 -6.976  -15.947 1.00 29.93  ? 187 LEU A O     1 
ATOM   1513 C  CB    . LEU A 1 187 ? -49.822 -5.831  -14.544 1.00 28.91  ? 187 LEU A CB    1 
ATOM   1514 C  CG    . LEU A 1 187 ? -48.531 -5.021  -14.416 1.00 24.75  ? 187 LEU A CG    1 
ATOM   1515 C  CD1   . LEU A 1 187 ? -48.619 -4.062  -13.240 1.00 29.48  ? 187 LEU A CD1   1 
ATOM   1516 C  CD2   . LEU A 1 187 ? -47.324 -5.940  -14.280 1.00 21.94  ? 187 LEU A CD2   1 
ATOM   1517 N  N     . TYR A 1 188 ? -51.208 -8.885  -15.305 1.00 29.99  ? 188 TYR A N     1 
ATOM   1518 C  CA    . TYR A 1 188 ? -52.413 -9.628  -14.958 1.00 21.60  ? 188 TYR A CA    1 
ATOM   1519 C  C     . TYR A 1 188 ? -52.488 -9.715  -13.439 1.00 27.90  ? 188 TYR A C     1 
ATOM   1520 O  O     . TYR A 1 188 ? -51.543 -10.183 -12.796 1.00 26.40  ? 188 TYR A O     1 
ATOM   1521 C  CB    . TYR A 1 188 ? -52.386 -11.025 -15.587 1.00 35.00  ? 188 TYR A CB    1 
ATOM   1522 C  CG    . TYR A 1 188 ? -53.359 -12.030 -14.999 1.00 24.05  ? 188 TYR A CG    1 
ATOM   1523 C  CD1   . TYR A 1 188 ? -53.011 -12.802 -13.896 1.00 29.95  ? 188 TYR A CD1   1 
ATOM   1524 C  CD2   . TYR A 1 188 ? -54.614 -12.228 -15.562 1.00 29.53  ? 188 TYR A CD2   1 
ATOM   1525 C  CE1   . TYR A 1 188 ? -53.889 -13.723 -13.359 1.00 30.59  ? 188 TYR A CE1   1 
ATOM   1526 C  CE2   . TYR A 1 188 ? -55.497 -13.152 -15.031 1.00 26.74  ? 188 TYR A CE2   1 
ATOM   1527 C  CZ    . TYR A 1 188 ? -55.129 -13.895 -13.931 1.00 35.79  ? 188 TYR A CZ    1 
ATOM   1528 O  OH    . TYR A 1 188 ? -56.001 -14.816 -13.396 1.00 40.38  ? 188 TYR A OH    1 
ATOM   1529 N  N     . VAL A 1 189 ? -53.595 -9.248  -12.867 1.00 26.50  ? 189 VAL A N     1 
ATOM   1530 C  CA    . VAL A 1 189 ? -53.761 -9.178  -11.419 1.00 21.13  ? 189 VAL A CA    1 
ATOM   1531 C  C     . VAL A 1 189 ? -55.004 -9.971  -11.041 1.00 34.45  ? 189 VAL A C     1 
ATOM   1532 O  O     . VAL A 1 189 ? -56.100 -9.693  -11.543 1.00 32.38  ? 189 VAL A O     1 
ATOM   1533 C  CB    . VAL A 1 189 ? -53.866 -7.727  -10.923 1.00 27.00  ? 189 VAL A CB    1 
ATOM   1534 C  CG1   . VAL A 1 189 ? -53.832 -7.686  -9.406  1.00 16.93  ? 189 VAL A CG1   1 
ATOM   1535 C  CG2   . VAL A 1 189 ? -52.746 -6.879  -11.511 1.00 23.24  ? 189 VAL A CG2   1 
ATOM   1536 N  N     . GLY A 1 190 ? -54.833 -10.945 -10.162 1.00 25.18  ? 190 GLY A N     1 
ATOM   1537 C  CA    . GLY A 1 190 ? -55.942 -11.772 -9.713  1.00 28.86  ? 190 GLY A CA    1 
ATOM   1538 C  C     . GLY A 1 190 ? -55.971 -11.891 -8.206  1.00 29.86  ? 190 GLY A C     1 
ATOM   1539 O  O     . GLY A 1 190 ? -54.928 -11.949 -7.555  1.00 34.30  ? 190 GLY A O     1 
ATOM   1540 N  N     . SER A 1 191 ? -57.183 -11.925 -7.656  1.00 26.06  ? 191 SER A N     1 
ATOM   1541 C  CA    . SER A 1 191 ? -57.383 -12.034 -6.220  1.00 28.04  ? 191 SER A CA    1 
ATOM   1542 C  C     . SER A 1 191 ? -58.579 -12.935 -5.948  1.00 40.04  ? 191 SER A C     1 
ATOM   1543 O  O     . SER A 1 191 ? -59.370 -13.247 -6.842  1.00 36.40  ? 191 SER A O     1 
ATOM   1544 C  CB    . SER A 1 191 ? -57.594 -10.659 -5.573  1.00 35.30  ? 191 SER A CB    1 
ATOM   1545 O  OG    . SER A 1 191 ? -58.836 -10.097 -5.964  1.00 31.63  ? 191 SER A OG    1 
ATOM   1546 N  N     . ASP A 1 192 ? -58.700 -13.358 -4.690  1.00 33.93  ? 192 ASP A N     1 
ATOM   1547 C  CA    . ASP A 1 192 ? -59.853 -14.112 -4.216  1.00 40.71  ? 192 ASP A CA    1 
ATOM   1548 C  C     . ASP A 1 192 ? -60.814 -13.237 -3.418  1.00 36.80  ? 192 ASP A C     1 
ATOM   1549 O  O     . ASP A 1 192 ? -61.541 -13.733 -2.551  1.00 40.77  ? 192 ASP A O     1 
ATOM   1550 C  CB    . ASP A 1 192 ? -59.394 -15.309 -3.385  1.00 48.01  ? 192 ASP A CB    1 
ATOM   1551 C  CG    . ASP A 1 192 ? -58.686 -16.357 -4.221  1.00 42.56  ? 192 ASP A CG    1 
ATOM   1552 O  OD1   . ASP A 1 192 ? -57.558 -16.752 -3.857  1.00 45.71  ? 192 ASP A OD1   1 
ATOM   1553 O  OD2   . ASP A 1 192 ? -59.263 -16.790 -5.241  1.00 43.66  ? 192 ASP A OD2   1 
ATOM   1554 N  N     . LEU A 1 193 ? -60.823 -11.939 -3.698  1.00 33.90  ? 193 LEU A N     1 
ATOM   1555 C  CA    . LEU A 1 193 ? -61.676 -10.975 -3.023  1.00 33.31  ? 193 LEU A CA    1 
ATOM   1556 C  C     . LEU A 1 193 ? -62.926 -10.705 -3.851  1.00 31.04  ? 193 LEU A C     1 
ATOM   1557 O  O     . LEU A 1 193 ? -62.972 -10.963 -5.056  1.00 32.66  ? 193 LEU A O     1 
ATOM   1558 C  CB    . LEU A 1 193 ? -60.920 -9.665  -2.785  1.00 26.79  ? 193 LEU A CB    1 
ATOM   1559 C  CG    . LEU A 1 193 ? -59.536 -9.775  -2.143  1.00 42.84  ? 193 LEU A CG    1 
ATOM   1560 C  CD1   . LEU A 1 193 ? -58.800 -8.447  -2.210  1.00 25.22  ? 193 LEU A CD1   1 
ATOM   1561 C  CD2   . LEU A 1 193 ? -59.664 -10.239 -0.703  1.00 30.88  ? 193 LEU A CD2   1 
ATOM   1562 N  N     . GLU A 1 194 ? -63.950 -10.181 -3.181  1.00 38.11  ? 194 GLU A N     1 
ATOM   1563 C  CA    . GLU A 1 194 ? -65.119 -9.691  -3.892  1.00 44.71  ? 194 GLU A CA    1 
ATOM   1564 C  C     . GLU A 1 194 ? -64.717 -8.536  -4.806  1.00 40.12  ? 194 GLU A C     1 
ATOM   1565 O  O     . GLU A 1 194 ? -63.703 -7.864  -4.593  1.00 34.80  ? 194 GLU A O     1 
ATOM   1566 C  CB    . GLU A 1 194 ? -66.201 -9.244  -2.908  1.00 49.49  ? 194 GLU A CB    1 
ATOM   1567 C  CG    . GLU A 1 194 ? -66.669 -10.327 -1.943  1.00 56.60  ? 194 GLU A CG    1 
ATOM   1568 C  CD    . GLU A 1 194 ? -67.655 -11.300 -2.569  1.00 74.34  ? 194 GLU A CD    1 
ATOM   1569 O  OE1   . GLU A 1 194 ? -68.136 -12.202 -1.849  1.00 76.42  ? 194 GLU A OE1   1 
ATOM   1570 O  OE2   . GLU A 1 194 ? -67.955 -11.163 -3.774  1.00 68.92  ? 194 GLU A OE2   1 
ATOM   1571 N  N     . ILE A 1 195 ? -65.532 -8.309  -5.839  1.00 36.89  ? 195 ILE A N     1 
ATOM   1572 C  CA    . ILE A 1 195 ? -65.171 -7.346  -6.877  1.00 32.22  ? 195 ILE A CA    1 
ATOM   1573 C  C     . ILE A 1 195 ? -64.988 -5.949  -6.295  1.00 39.37  ? 195 ILE A C     1 
ATOM   1574 O  O     . ILE A 1 195 ? -64.180 -5.159  -6.799  1.00 39.44  ? 195 ILE A O     1 
ATOM   1575 C  CB    . ILE A 1 195 ? -66.222 -7.364  -8.005  1.00 37.13  ? 195 ILE A CB    1 
ATOM   1576 C  CG1   . ILE A 1 195 ? -65.744 -6.532  -9.197  1.00 50.32  ? 195 ILE A CG1   1 
ATOM   1577 C  CG2   . ILE A 1 195 ? -67.572 -6.870  -7.499  1.00 33.24  ? 195 ILE A CG2   1 
ATOM   1578 C  CD1   . ILE A 1 195 ? -64.459 -7.037  -9.814  1.00 45.91  ? 195 ILE A CD1   1 
ATOM   1579 N  N     . GLY A 1 196 ? -65.708 -5.626  -5.219  1.00 44.49  ? 196 GLY A N     1 
ATOM   1580 C  CA    . GLY A 1 196 ? -65.545 -4.318  -4.604  1.00 37.25  ? 196 GLY A CA    1 
ATOM   1581 C  C     . GLY A 1 196 ? -64.207 -4.171  -3.904  1.00 41.94  ? 196 GLY A C     1 
ATOM   1582 O  O     . GLY A 1 196 ? -63.474 -3.206  -4.135  1.00 34.66  ? 196 GLY A O     1 
ATOM   1583 N  N     . GLN A 1 197 ? -63.871 -5.129  -3.037  1.00 35.35  ? 197 GLN A N     1 
ATOM   1584 C  CA    . GLN A 1 197 ? -62.589 -5.082  -2.342  1.00 37.83  ? 197 GLN A CA    1 
ATOM   1585 C  C     . GLN A 1 197 ? -61.425 -5.308  -3.299  1.00 40.81  ? 197 GLN A C     1 
ATOM   1586 O  O     . GLN A 1 197 ? -60.308 -4.846  -3.036  1.00 40.95  ? 197 GLN A O     1 
ATOM   1587 C  CB    . GLN A 1 197 ? -62.568 -6.115  -1.215  1.00 34.11  ? 197 GLN A CB    1 
ATOM   1588 C  CG    . GLN A 1 197 ? -61.355 -6.029  -0.301  1.00 40.52  ? 197 GLN A CG    1 
ATOM   1589 C  CD    . GLN A 1 197 ? -61.449 -6.975  0.882   1.00 55.76  ? 197 GLN A CD    1 
ATOM   1590 O  OE1   . GLN A 1 197 ? -62.454 -7.663  1.063   1.00 50.22  ? 197 GLN A OE1   1 
ATOM   1591 N  NE2   . GLN A 1 197 ? -60.398 -7.013  1.695   1.00 50.79  ? 197 GLN A NE2   1 
ATOM   1592 N  N     . HIS A 1 198 ? -61.665 -6.007  -4.410  1.00 35.47  ? 198 HIS A N     1 
ATOM   1593 C  CA    . HIS A 1 198 ? -60.612 -6.213  -5.399  1.00 35.35  ? 198 HIS A CA    1 
ATOM   1594 C  C     . HIS A 1 198 ? -60.235 -4.904  -6.081  1.00 36.10  ? 198 HIS A C     1 
ATOM   1595 O  O     . HIS A 1 198 ? -59.048 -4.587  -6.224  1.00 36.76  ? 198 HIS A O     1 
ATOM   1596 C  CB    . HIS A 1 198 ? -61.061 -7.246  -6.433  1.00 28.89  ? 198 HIS A CB    1 
ATOM   1597 C  CG    . HIS A 1 198 ? -60.119 -7.396  -7.587  1.00 27.79  ? 198 HIS A CG    1 
ATOM   1598 N  ND1   . HIS A 1 198 ? -59.055 -8.272  -7.570  1.00 32.21  ? 198 HIS A ND1   1 
ATOM   1599 C  CD2   . HIS A 1 198 ? -60.083 -6.785  -8.795  1.00 29.72  ? 198 HIS A CD2   1 
ATOM   1600 C  CE1   . HIS A 1 198 ? -58.404 -8.194  -8.717  1.00 25.44  ? 198 HIS A CE1   1 
ATOM   1601 N  NE2   . HIS A 1 198 ? -59.008 -7.298  -9.478  1.00 33.88  ? 198 HIS A NE2   1 
ATOM   1602 N  N     . ARG A 1 199 ? -61.236 -4.131  -6.510  1.00 38.29  ? 199 ARG A N     1 
ATOM   1603 C  CA    . ARG A 1 199 ? -60.953 -2.882  -7.211  1.00 45.85  ? 199 ARG A CA    1 
ATOM   1604 C  C     . ARG A 1 199 ? -60.269 -1.867  -6.307  1.00 38.35  ? 199 ARG A C     1 
ATOM   1605 O  O     . ARG A 1 199 ? -59.497 -1.032  -6.792  1.00 34.27  ? 199 ARG A O     1 
ATOM   1606 C  CB    . ARG A 1 199 ? -62.239 -2.295  -7.792  1.00 40.06  ? 199 ARG A CB    1 
ATOM   1607 C  CG    . ARG A 1 199 ? -62.838 -3.119  -8.919  1.00 50.47  ? 199 ARG A CG    1 
ATOM   1608 C  CD    . ARG A 1 199 ? -63.730 -2.270  -9.809  1.00 72.36  ? 199 ARG A CD    1 
ATOM   1609 N  NE    . ARG A 1 199 ? -64.308 -3.046  -10.902 1.00 60.91  ? 199 ARG A NE    1 
ATOM   1610 C  CZ    . ARG A 1 199 ? -65.548 -3.523  -10.904 1.00 78.78  ? 199 ARG A CZ    1 
ATOM   1611 N  NH1   . ARG A 1 199 ? -66.348 -3.298  -9.871  1.00 78.92  ? 199 ARG A NH1   1 
ATOM   1612 N  NH2   . ARG A 1 199 ? -65.988 -4.221  -11.942 1.00 72.46  ? 199 ARG A NH2   1 
ATOM   1613 N  N     . THR A 1 200 ? -60.535 -1.916  -5.000  1.00 34.50  ? 200 THR A N     1 
ATOM   1614 C  CA    . THR A 1 200 ? -59.818 -1.041  -4.078  1.00 39.05  ? 200 THR A CA    1 
ATOM   1615 C  C     . THR A 1 200 ? -58.345 -1.421  -4.005  1.00 39.56  ? 200 THR A C     1 
ATOM   1616 O  O     . THR A 1 200 ? -57.474 -0.547  -3.922  1.00 39.31  ? 200 THR A O     1 
ATOM   1617 C  CB    . THR A 1 200 ? -60.455 -1.094  -2.690  1.00 33.49  ? 200 THR A CB    1 
ATOM   1618 O  OG1   . THR A 1 200 ? -61.864 -0.858  -2.799  1.00 45.66  ? 200 THR A OG1   1 
ATOM   1619 C  CG2   . THR A 1 200 ? -59.845 -0.032  -1.789  1.00 36.79  ? 200 THR A CG2   1 
ATOM   1620 N  N     . LYS A 1 201 ? -58.047 -2.722  -4.040  1.00 32.89  ? 201 LYS A N     1 
ATOM   1621 C  CA    . LYS A 1 201 ? -56.655 -3.153  -4.068  1.00 37.51  ? 201 LYS A CA    1 
ATOM   1622 C  C     . LYS A 1 201 ? -55.992 -2.812  -5.395  1.00 34.92  ? 201 LYS A C     1 
ATOM   1623 O  O     . LYS A 1 201 ? -54.785 -2.547  -5.431  1.00 33.13  ? 201 LYS A O     1 
ATOM   1624 C  CB    . LYS A 1 201 ? -56.564 -4.653  -3.797  1.00 35.69  ? 201 LYS A CB    1 
ATOM   1625 C  CG    . LYS A 1 201 ? -55.601 -5.012  -2.681  1.00 41.15  ? 201 LYS A CG    1 
ATOM   1626 C  CD    . LYS A 1 201 ? -56.157 -4.647  -1.317  1.00 48.70  ? 201 LYS A CD    1 
ATOM   1627 C  CE    . LYS A 1 201 ? -55.166 -4.993  -0.218  1.00 38.01  ? 201 LYS A CE    1 
ATOM   1628 N  NZ    . LYS A 1 201 ? -55.698 -4.699  1.142   1.00 65.94  ? 201 LYS A NZ    1 
ATOM   1629 N  N     . ILE A 1 202 ? -56.757 -2.818  -6.491  1.00 33.71  ? 202 ILE A N     1 
ATOM   1630 C  CA    . ILE A 1 202 ? -56.215 -2.394  -7.779  1.00 34.45  ? 202 ILE A CA    1 
ATOM   1631 C  C     . ILE A 1 202 ? -55.804 -0.930  -7.722  1.00 35.35  ? 202 ILE A C     1 
ATOM   1632 O  O     . ILE A 1 202 ? -54.757 -0.540  -8.256  1.00 32.30  ? 202 ILE A O     1 
ATOM   1633 C  CB    . ILE A 1 202 ? -57.238 -2.654  -8.902  1.00 32.60  ? 202 ILE A CB    1 
ATOM   1634 C  CG1   . ILE A 1 202 ? -57.487 -4.154  -9.059  1.00 34.39  ? 202 ILE A CG1   1 
ATOM   1635 C  CG2   . ILE A 1 202 ? -56.763 -2.049  -10.216 1.00 30.85  ? 202 ILE A CG2   1 
ATOM   1636 C  CD1   . ILE A 1 202 ? -56.245 -4.943  -9.400  1.00 35.51  ? 202 ILE A CD1   1 
ATOM   1637 N  N     . GLU A 1 203 ? -56.615 -0.096  -7.066  1.00 28.51  ? 203 GLU A N     1 
ATOM   1638 C  CA    . GLU A 1 203 ? -56.258 1.310   -6.915  1.00 36.90  ? 203 GLU A CA    1 
ATOM   1639 C  C     . GLU A 1 203 ? -55.039 1.486   -6.021  1.00 27.59  ? 203 GLU A C     1 
ATOM   1640 O  O     . GLU A 1 203 ? -54.239 2.402   -6.243  1.00 38.23  ? 203 GLU A O     1 
ATOM   1641 C  CB    . GLU A 1 203 ? -57.446 2.100   -6.367  1.00 36.03  ? 203 GLU A CB    1 
ATOM   1642 C  CG    . GLU A 1 203 ? -58.592 2.223   -7.356  1.00 43.78  ? 203 GLU A CG    1 
ATOM   1643 C  CD    . GLU A 1 203 ? -58.152 2.836   -8.673  1.00 59.31  ? 203 GLU A CD    1 
ATOM   1644 O  OE1   . GLU A 1 203 ? -57.419 3.849   -8.641  1.00 49.22  ? 203 GLU A OE1   1 
ATOM   1645 O  OE2   . GLU A 1 203 ? -58.526 2.296   -9.737  1.00 53.70  ? 203 GLU A OE2   1 
ATOM   1646 N  N     . GLU A 1 204 ? -54.878 0.625   -5.014  1.00 28.32  ? 204 GLU A N     1 
ATOM   1647 C  CA    . GLU A 1 204 ? -53.646 0.631   -4.231  1.00 31.77  ? 204 GLU A CA    1 
ATOM   1648 C  C     . GLU A 1 204 ? -52.445 0.292   -5.105  1.00 32.83  ? 204 GLU A C     1 
ATOM   1649 O  O     . GLU A 1 204 ? -51.377 0.900   -4.971  1.00 38.59  ? 204 GLU A O     1 
ATOM   1650 C  CB    . GLU A 1 204 ? -53.759 -0.352  -3.065  1.00 31.49  ? 204 GLU A CB    1 
ATOM   1651 C  CG    . GLU A 1 204 ? -52.466 -0.549  -2.288  1.00 45.73  ? 204 GLU A CG    1 
ATOM   1652 C  CD    . GLU A 1 204 ? -52.603 -1.566  -1.169  1.00 54.54  ? 204 GLU A CD    1 
ATOM   1653 O  OE1   . GLU A 1 204 ? -53.713 -1.687  -0.606  1.00 57.38  ? 204 GLU A OE1   1 
ATOM   1654 O  OE2   . GLU A 1 204 ? -51.604 -2.249  -0.858  1.00 45.31  ? 204 GLU A OE2   1 
ATOM   1655 N  N     . LEU A 1 205 ? -52.607 -0.673  -6.015  1.00 40.30  ? 205 LEU A N     1 
ATOM   1656 C  CA    . LEU A 1 205 ? -51.521 -1.025  -6.924  1.00 32.35  ? 205 LEU A CA    1 
ATOM   1657 C  C     . LEU A 1 205 ? -51.240 0.102   -7.912  1.00 27.20  ? 205 LEU A C     1 
ATOM   1658 O  O     . LEU A 1 205 ? -50.077 0.404   -8.200  1.00 34.78  ? 205 LEU A O     1 
ATOM   1659 C  CB    . LEU A 1 205 ? -51.857 -2.319  -7.664  1.00 29.44  ? 205 LEU A CB    1 
ATOM   1660 C  CG    . LEU A 1 205 ? -50.821 -2.831  -8.668  1.00 37.49  ? 205 LEU A CG    1 
ATOM   1661 C  CD1   . LEU A 1 205 ? -49.512 -3.173  -7.971  1.00 22.45  ? 205 LEU A CD1   1 
ATOM   1662 C  CD2   . LEU A 1 205 ? -51.358 -4.036  -9.426  1.00 31.62  ? 205 LEU A CD2   1 
ATOM   1663 N  N     . ARG A 1 206 ? -52.292 0.736   -8.440  1.00 28.48  ? 206 ARG A N     1 
ATOM   1664 C  CA    . ARG A 1 206 ? -52.092 1.849   -9.363  1.00 32.72  ? 206 ARG A CA    1 
ATOM   1665 C  C     . ARG A 1 206 ? -51.428 3.031   -8.667  1.00 29.77  ? 206 ARG A C     1 
ATOM   1666 O  O     . ARG A 1 206 ? -50.573 3.704   -9.256  1.00 33.68  ? 206 ARG A O     1 
ATOM   1667 C  CB    . ARG A 1 206 ? -53.425 2.270   -9.982  1.00 36.51  ? 206 ARG A CB    1 
ATOM   1668 C  CG    . ARG A 1 206 ? -54.025 1.237   -10.923 1.00 32.55  ? 206 ARG A CG    1 
ATOM   1669 C  CD    . ARG A 1 206 ? -55.268 1.761   -11.629 1.00 32.89  ? 206 ARG A CD    1 
ATOM   1670 N  NE    . ARG A 1 206 ? -54.986 2.936   -12.450 1.00 40.65  ? 206 ARG A NE    1 
ATOM   1671 C  CZ    . ARG A 1 206 ? -55.384 4.170   -12.154 1.00 46.73  ? 206 ARG A CZ    1 
ATOM   1672 N  NH1   . ARG A 1 206 ? -56.093 4.394   -11.057 1.00 35.83  ? 206 ARG A NH1   1 
ATOM   1673 N  NH2   . ARG A 1 206 ? -55.082 5.178   -12.960 1.00 42.93  ? 206 ARG A NH2   1 
ATOM   1674 N  N     . GLN A 1 207 ? -51.808 3.300   -7.416  1.00 33.53  ? 207 GLN A N     1 
ATOM   1675 C  CA    . GLN A 1 207 ? -51.139 4.349   -6.654  1.00 37.43  ? 207 GLN A CA    1 
ATOM   1676 C  C     . GLN A 1 207 ? -49.693 3.973   -6.355  1.00 37.31  ? 207 GLN A C     1 
ATOM   1677 O  O     . GLN A 1 207 ? -48.806 4.833   -6.376  1.00 31.64  ? 207 GLN A O     1 
ATOM   1678 C  CB    . GLN A 1 207 ? -51.900 4.627   -5.358  1.00 37.51  ? 207 GLN A CB    1 
ATOM   1679 C  CG    . GLN A 1 207 ? -53.172 5.433   -5.548  1.00 44.94  ? 207 GLN A CG    1 
ATOM   1680 C  CD    . GLN A 1 207 ? -52.892 6.862   -5.972  1.00 56.89  ? 207 GLN A CD    1 
ATOM   1681 O  OE1   . GLN A 1 207 ? -53.515 7.379   -6.899  1.00 57.60  ? 207 GLN A OE1   1 
ATOM   1682 N  NE2   . GLN A 1 207 ? -51.954 7.509   -5.290  1.00 57.16  ? 207 GLN A NE2   1 
ATOM   1683 N  N     . HIS A 1 208 ? -49.439 2.691   -6.078  1.00 35.73  ? 208 HIS A N     1 
ATOM   1684 C  CA    . HIS A 1 208 ? -48.074 2.240   -5.822  1.00 28.85  ? 208 HIS A CA    1 
ATOM   1685 C  C     . HIS A 1 208 ? -47.202 2.405   -7.060  1.00 30.13  ? 208 HIS A C     1 
ATOM   1686 O  O     . HIS A 1 208 ? -46.069 2.895   -6.976  1.00 32.19  ? 208 HIS A O     1 
ATOM   1687 C  CB    . HIS A 1 208 ? -48.087 0.783   -5.361  1.00 23.71  ? 208 HIS A CB    1 
ATOM   1688 C  CG    . HIS A 1 208 ? -46.726 0.166   -5.269  1.00 32.35  ? 208 HIS A CG    1 
ATOM   1689 N  ND1   . HIS A 1 208 ? -45.903 0.337   -4.177  1.00 39.75  ? 208 HIS A ND1   1 
ATOM   1690 C  CD2   . HIS A 1 208 ? -46.042 -0.618  -6.136  1.00 27.48  ? 208 HIS A CD2   1 
ATOM   1691 C  CE1   . HIS A 1 208 ? -44.773 -0.317  -4.373  1.00 31.85  ? 208 HIS A CE1   1 
ATOM   1692 N  NE2   . HIS A 1 208 ? -44.830 -0.904  -5.554  1.00 34.06  ? 208 HIS A NE2   1 
ATOM   1693 N  N     . LEU A 1 209 ? -47.717 2.002   -8.223  1.00 32.19  ? 209 LEU A N     1 
ATOM   1694 C  CA    . LEU A 1 209 ? -46.966 2.168   -9.463  1.00 35.37  ? 209 LEU A CA    1 
ATOM   1695 C  C     . LEU A 1 209 ? -46.772 3.641   -9.796  1.00 29.88  ? 209 LEU A C     1 
ATOM   1696 O  O     . LEU A 1 209 ? -45.722 4.032   -10.321 1.00 36.29  ? 209 LEU A O     1 
ATOM   1697 C  CB    . LEU A 1 209 ? -47.679 1.445   -10.606 1.00 27.18  ? 209 LEU A CB    1 
ATOM   1698 C  CG    . LEU A 1 209 ? -47.796 -0.075  -10.473 1.00 31.24  ? 209 LEU A CG    1 
ATOM   1699 C  CD1   . LEU A 1 209 ? -48.739 -0.633  -11.526 1.00 27.10  ? 209 LEU A CD1   1 
ATOM   1700 C  CD2   . LEU A 1 209 ? -46.426 -0.728  -10.578 1.00 30.91  ? 209 LEU A CD2   1 
ATOM   1701 N  N     . LEU A 1 210 ? -47.772 4.474   -9.497  1.00 35.26  ? 210 LEU A N     1 
ATOM   1702 C  CA    . LEU A 1 210 ? -47.645 5.907   -9.744  1.00 30.85  ? 210 LEU A CA    1 
ATOM   1703 C  C     . LEU A 1 210 ? -46.576 6.527   -8.853  1.00 31.95  ? 210 LEU A C     1 
ATOM   1704 O  O     . LEU A 1 210 ? -45.830 7.409   -9.293  1.00 34.97  ? 210 LEU A O     1 
ATOM   1705 C  CB    . LEU A 1 210 ? -48.990 6.596   -9.525  1.00 36.06  ? 210 LEU A CB    1 
ATOM   1706 C  CG    . LEU A 1 210 ? -49.048 8.095   -9.815  1.00 37.34  ? 210 LEU A CG    1 
ATOM   1707 C  CD1   . LEU A 1 210 ? -48.873 8.368   -11.303 1.00 26.20  ? 210 LEU A CD1   1 
ATOM   1708 C  CD2   . LEU A 1 210 ? -50.355 8.675   -9.306  1.00 45.18  ? 210 LEU A CD2   1 
ATOM   1709 N  N     . ARG A 1 211 ? -46.493 6.082   -7.596  1.00 33.78  ? 211 ARG A N     1 
ATOM   1710 C  CA    . ARG A 1 211 ? -45.436 6.555   -6.707  1.00 27.89  ? 211 ARG A CA    1 
ATOM   1711 C  C     . ARG A 1 211 ? -44.056 6.245   -7.271  1.00 32.52  ? 211 ARG A C     1 
ATOM   1712 O  O     . ARG A 1 211 ? -43.104 6.998   -7.037  1.00 33.83  ? 211 ARG A O     1 
ATOM   1713 C  CB    . ARG A 1 211 ? -45.612 5.933   -5.319  1.00 33.36  ? 211 ARG A CB    1 
ATOM   1714 C  CG    . ARG A 1 211 ? -44.491 6.225   -4.327  1.00 36.17  ? 211 ARG A CG    1 
ATOM   1715 C  CD    . ARG A 1 211 ? -43.513 5.060   -4.241  1.00 32.37  ? 211 ARG A CD    1 
ATOM   1716 N  NE    . ARG A 1 211 ? -42.471 5.281   -3.242  1.00 42.57  ? 211 ARG A NE    1 
ATOM   1717 C  CZ    . ARG A 1 211 ? -41.306 5.869   -3.494  1.00 38.92  ? 211 ARG A CZ    1 
ATOM   1718 N  NH1   . ARG A 1 211 ? -41.030 6.302   -4.718  1.00 41.46  ? 211 ARG A NH1   1 
ATOM   1719 N  NH2   . ARG A 1 211 ? -40.418 6.024   -2.522  1.00 31.76  ? 211 ARG A NH2   1 
ATOM   1720 N  N     . TRP A 1 212 ? -43.927 5.146   -8.015  1.00 32.88  ? 212 TRP A N     1 
ATOM   1721 C  CA    . TRP A 1 212 ? -42.685 4.799   -8.692  1.00 32.16  ? 212 TRP A CA    1 
ATOM   1722 C  C     . TRP A 1 212 ? -42.683 5.238   -10.152 1.00 24.96  ? 212 TRP A C     1 
ATOM   1723 O  O     . TRP A 1 212 ? -41.987 4.643   -10.980 1.00 26.61  ? 212 TRP A O     1 
ATOM   1724 C  CB    . TRP A 1 212 ? -42.418 3.299   -8.572  1.00 31.51  ? 212 TRP A CB    1 
ATOM   1725 C  CG    . TRP A 1 212 ? -42.064 2.893   -7.175  1.00 33.00  ? 212 TRP A CG    1 
ATOM   1726 C  CD1   . TRP A 1 212 ? -42.869 2.258   -6.274  1.00 26.38  ? 212 TRP A CD1   1 
ATOM   1727 C  CD2   . TRP A 1 212 ? -40.817 3.119   -6.510  1.00 27.84  ? 212 TRP A CD2   1 
ATOM   1728 N  NE1   . TRP A 1 212 ? -42.194 2.064   -5.091  1.00 36.10  ? 212 TRP A NE1   1 
ATOM   1729 C  CE2   . TRP A 1 212 ? -40.932 2.584   -5.211  1.00 29.83  ? 212 TRP A CE2   1 
ATOM   1730 C  CE3   . TRP A 1 212 ? -39.611 3.716   -6.890  1.00 29.60  ? 212 TRP A CE3   1 
ATOM   1731 C  CZ2   . TRP A 1 212 ? -39.886 2.630   -4.290  1.00 24.74  ? 212 TRP A CZ2   1 
ATOM   1732 C  CZ3   . TRP A 1 212 ? -38.575 3.760   -5.976  1.00 30.26  ? 212 TRP A CZ3   1 
ATOM   1733 C  CH2   . TRP A 1 212 ? -38.718 3.220   -4.691  1.00 25.97  ? 212 TRP A CH2   1 
ATOM   1734 N  N     . GLY A 1 213 ? -43.463 6.267   -10.481 1.00 32.15  ? 213 GLY A N     1 
ATOM   1735 C  CA    . GLY A 1 213 ? -43.384 6.905   -11.780 1.00 32.77  ? 213 GLY A CA    1 
ATOM   1736 C  C     . GLY A 1 213 ? -43.970 6.130   -12.937 1.00 31.66  ? 213 GLY A C     1 
ATOM   1737 O  O     . GLY A 1 213 ? -43.653 6.433   -14.089 1.00 30.52  ? 213 GLY A O     1 
ATOM   1738 N  N     . LEU A 1 214 ? -44.823 5.144   -12.673 1.00 29.30  ? 214 LEU A N     1 
ATOM   1739 C  CA    . LEU A 1 214 ? -45.420 4.321   -13.720 1.00 28.18  ? 214 LEU A CA    1 
ATOM   1740 C  C     . LEU A 1 214 ? -46.920 4.587   -13.762 1.00 28.25  ? 214 LEU A C     1 
ATOM   1741 O  O     . LEU A 1 214 ? -47.650 4.209   -12.840 1.00 27.41  ? 214 LEU A O     1 
ATOM   1742 C  CB    . LEU A 1 214 ? -45.129 2.841   -13.483 1.00 31.23  ? 214 LEU A CB    1 
ATOM   1743 C  CG    . LEU A 1 214 ? -43.650 2.454   -13.419 1.00 38.14  ? 214 LEU A CG    1 
ATOM   1744 C  CD1   . LEU A 1 214 ? -43.501 0.946   -13.318 1.00 24.43  ? 214 LEU A CD1   1 
ATOM   1745 C  CD2   . LEU A 1 214 ? -42.895 2.989   -14.625 1.00 25.96  ? 214 LEU A CD2   1 
ATOM   1746 N  N     . THR A 1 215 ? -47.374 5.235   -14.832 1.00 34.05  ? 215 THR A N     1 
ATOM   1747 C  CA    . THR A 1 215 ? -48.791 5.511   -15.009 1.00 30.57  ? 215 THR A CA    1 
ATOM   1748 C  C     . THR A 1 215 ? -49.519 4.274   -15.519 1.00 31.69  ? 215 THR A C     1 
ATOM   1749 O  O     . THR A 1 215 ? -48.940 3.417   -16.193 1.00 41.46  ? 215 THR A O     1 
ATOM   1750 C  CB    . THR A 1 215 ? -49.002 6.666   -15.990 1.00 33.15  ? 215 THR A CB    1 
ATOM   1751 O  OG1   . THR A 1 215 ? -48.533 6.282   -17.289 1.00 31.97  ? 215 THR A OG1   1 
ATOM   1752 C  CG2   . THR A 1 215 ? -48.245 7.900   -15.530 1.00 24.60  ? 215 THR A CG2   1 
ATOM   1753 N  N     . THR A 1 216 ? -50.804 4.187   -15.185 1.00 31.54  ? 216 THR A N     1 
ATOM   1754 C  CA    . THR A 1 216 ? -51.682 3.124   -15.672 1.00 37.50  ? 216 THR A CA    1 
ATOM   1755 C  C     . THR A 1 216 ? -52.916 3.788   -16.263 1.00 32.74  ? 216 THR A C     1 
ATOM   1756 O  O     . THR A 1 216 ? -53.923 3.990   -15.569 1.00 38.63  ? 216 THR A O     1 
ATOM   1757 C  CB    . THR A 1 216 ? -52.048 2.144   -14.561 1.00 30.84  ? 216 THR A CB    1 
ATOM   1758 O  OG1   . THR A 1 216 ? -52.432 2.869   -13.386 1.00 29.58  ? 216 THR A OG1   1 
ATOM   1759 C  CG2   . THR A 1 216 ? -50.864 1.242   -14.236 1.00 22.35  ? 216 THR A CG2   1 
ATOM   1760 N  N     . PRO A 1 217 ? -52.873 4.149   -17.545 1.00 32.60  ? 217 PRO A N     1 
ATOM   1761 C  CA    . PRO A 1 217 ? -54.012 4.848   -18.150 1.00 34.16  ? 217 PRO A CA    1 
ATOM   1762 C  C     . PRO A 1 217 ? -55.250 3.966   -18.194 1.00 34.82  ? 217 PRO A C     1 
ATOM   1763 O  O     . PRO A 1 217 ? -55.175 2.766   -18.465 1.00 40.45  ? 217 PRO A O     1 
ATOM   1764 C  CB    . PRO A 1 217 ? -53.510 5.190   -19.558 1.00 30.81  ? 217 PRO A CB    1 
ATOM   1765 C  CG    . PRO A 1 217 ? -52.427 4.194   -19.827 1.00 38.57  ? 217 PRO A CG    1 
ATOM   1766 C  CD    . PRO A 1 217 ? -51.774 3.940   -18.502 1.00 29.03  ? 217 PRO A CD    1 
ATOM   1767 N  N     . ASP A 1 218 ? -56.402 4.583   -17.919 1.00 39.02  ? 218 ASP A N     1 
ATOM   1768 C  CA    . ASP A 1 218 ? -57.669 3.861   -17.941 1.00 42.79  ? 218 ASP A CA    1 
ATOM   1769 C  C     . ASP A 1 218 ? -57.976 3.284   -19.316 1.00 45.93  ? 218 ASP A C     1 
ATOM   1770 O  O     . ASP A 1 218 ? -58.786 2.356   -19.422 1.00 38.51  ? 218 ASP A O     1 
ATOM   1771 C  CB    . ASP A 1 218 ? -58.801 4.789   -17.491 1.00 41.50  ? 218 ASP A CB    1 
ATOM   1772 C  CG    . ASP A 1 218 ? -60.020 4.029   -17.001 1.00 57.71  ? 218 ASP A CG    1 
ATOM   1773 O  OD1   . ASP A 1 218 ? -61.028 3.979   -17.738 1.00 37.35  ? 218 ASP A OD1   1 
ATOM   1774 O  OD2   . ASP A 1 218 ? -59.965 3.480   -15.880 1.00 54.19  ? 218 ASP A OD2   1 
ATOM   1775 N  N     . LYS A 1 219 ? -57.341 3.811   -20.367 1.00 44.34  ? 219 LYS A N     1 
ATOM   1776 C  CA    . LYS A 1 219 ? -57.555 3.292   -21.714 1.00 39.38  ? 219 LYS A CA    1 
ATOM   1777 C  C     . LYS A 1 219 ? -57.117 1.836   -21.824 1.00 46.29  ? 219 LYS A C     1 
ATOM   1778 O  O     . LYS A 1 219 ? -57.753 1.041   -22.525 1.00 52.77  ? 219 LYS A O     1 
ATOM   1779 C  CB    . LYS A 1 219 ? -56.805 4.158   -22.724 1.00 38.81  ? 219 LYS A CB    1 
ATOM   1780 C  CG    . LYS A 1 219 ? -57.641 4.587   -23.912 1.00 57.07  ? 219 LYS A CG    1 
ATOM   1781 C  CD    . LYS A 1 219 ? -57.434 3.670   -25.103 1.00 62.41  ? 219 LYS A CD    1 
ATOM   1782 C  CE    . LYS A 1 219 ? -58.594 3.782   -26.081 1.00 62.43  ? 219 LYS A CE    1 
ATOM   1783 N  NZ    . LYS A 1 219 ? -58.130 3.967   -27.484 1.00 61.63  ? 219 LYS A NZ    1 
ATOM   1784 N  N     . LYS A 1 220 ? -56.035 1.468   -21.138 1.00 38.28  ? 220 LYS A N     1 
ATOM   1785 C  CA    . LYS A 1 220 ? -55.533 0.101   -21.143 1.00 40.66  ? 220 LYS A CA    1 
ATOM   1786 C  C     . LYS A 1 220 ? -55.869 -0.648  -19.859 1.00 35.59  ? 220 LYS A C     1 
ATOM   1787 O  O     . LYS A 1 220 ? -55.179 -1.613  -19.511 1.00 34.06  ? 220 LYS A O     1 
ATOM   1788 C  CB    . LYS A 1 220 ? -54.024 0.094   -21.381 1.00 37.19  ? 220 LYS A CB    1 
ATOM   1789 C  CG    . LYS A 1 220 ? -53.628 0.672   -22.719 1.00 48.17  ? 220 LYS A CG    1 
ATOM   1790 C  CD    . LYS A 1 220 ? -52.418 -0.046  -23.281 1.00 69.21  ? 220 LYS A CD    1 
ATOM   1791 C  CE    . LYS A 1 220 ? -52.085 0.465   -24.667 1.00 56.11  ? 220 LYS A CE    1 
ATOM   1792 N  NZ    . LYS A 1 220 ? -50.665 0.212   -25.030 1.00 53.31  ? 220 LYS A NZ    1 
ATOM   1793 N  N     . HIS A 1 221 ? -56.921 -0.228  -19.159 1.00 38.08  ? 221 HIS A N     1 
ATOM   1794 C  CA    . HIS A 1 221 ? -57.333 -0.819  -17.887 1.00 32.22  ? 221 HIS A CA    1 
ATOM   1795 C  C     . HIS A 1 221 ? -58.572 -1.669  -18.151 1.00 34.52  ? 221 HIS A C     1 
ATOM   1796 O  O     . HIS A 1 221 ? -59.692 -1.155  -18.196 1.00 33.32  ? 221 HIS A O     1 
ATOM   1797 C  CB    . HIS A 1 221 ? -57.595 0.275   -16.855 1.00 37.42  ? 221 HIS A CB    1 
ATOM   1798 C  CG    . HIS A 1 221 ? -57.938 -0.234  -15.486 1.00 39.55  ? 221 HIS A CG    1 
ATOM   1799 N  ND1   . HIS A 1 221 ? -58.194 -1.562  -15.221 1.00 45.40  ? 221 HIS A ND1   1 
ATOM   1800 C  CD2   . HIS A 1 221 ? -58.068 0.415   -14.304 1.00 38.13  ? 221 HIS A CD2   1 
ATOM   1801 C  CE1   . HIS A 1 221 ? -58.471 -1.708  -13.938 1.00 38.82  ? 221 HIS A CE1   1 
ATOM   1802 N  NE2   . HIS A 1 221 ? -58.397 -0.525  -13.358 1.00 39.58  ? 221 HIS A NE2   1 
ATOM   1803 N  N     . GLN A 1 222 ? -58.367 -2.972  -18.326 1.00 29.73  ? 222 GLN A N     1 
ATOM   1804 C  CA    . GLN A 1 222 ? -59.471 -3.889  -18.570 1.00 34.28  ? 222 GLN A CA    1 
ATOM   1805 C  C     . GLN A 1 222 ? -60.109 -4.296  -17.249 1.00 38.45  ? 222 GLN A C     1 
ATOM   1806 O  O     . GLN A 1 222 ? -59.414 -4.704  -16.312 1.00 41.07  ? 222 GLN A O     1 
ATOM   1807 C  CB    . GLN A 1 222 ? -58.985 -5.122  -19.330 1.00 28.11  ? 222 GLN A CB    1 
ATOM   1808 C  CG    . GLN A 1 222 ? -58.304 -4.807  -20.652 1.00 32.73  ? 222 GLN A CG    1 
ATOM   1809 C  CD    . GLN A 1 222 ? -57.942 -6.056  -21.432 1.00 33.79  ? 222 GLN A CD    1 
ATOM   1810 O  OE1   . GLN A 1 222 ? -58.784 -6.925  -21.662 1.00 33.25  ? 222 GLN A OE1   1 
ATOM   1811 N  NE2   . GLN A 1 222 ? -56.681 -6.155  -21.838 1.00 27.75  ? 222 GLN A NE2   1 
ATOM   1812 N  N     . LYS A 1 223 ? -61.435 -4.185  -17.176 1.00 42.80  ? 223 LYS A N     1 
ATOM   1813 C  CA    . LYS A 1 223 ? -62.170 -4.466  -15.954 1.00 41.85  ? 223 LYS A CA    1 
ATOM   1814 C  C     . LYS A 1 223 ? -63.203 -5.573  -16.097 1.00 36.31  ? 223 LYS A C     1 
ATOM   1815 O  O     . LYS A 1 223 ? -63.724 -6.039  -15.078 1.00 45.00  ? 223 LYS A O     1 
ATOM   1816 C  CB    . LYS A 1 223 ? -62.872 -3.195  -15.450 1.00 46.70  ? 223 LYS A CB    1 
ATOM   1817 C  CG    . LYS A 1 223 ? -61.949 -1.994  -15.311 1.00 44.53  ? 223 LYS A CG    1 
ATOM   1818 C  CD    . LYS A 1 223 ? -62.713 -0.751  -14.887 1.00 57.97  ? 223 LYS A CD    1 
ATOM   1819 C  CE    . LYS A 1 223 ? -61.804 0.466   -14.840 1.00 45.79  ? 223 LYS A CE    1 
ATOM   1820 N  NZ    . LYS A 1 223 ? -61.222 0.777   -16.176 1.00 49.01  ? 223 LYS A NZ    1 
ATOM   1821 N  N     . GLU A 1 224 ? -63.515 -6.006  -17.315 1.00 45.41  ? 224 GLU A N     1 
ATOM   1822 C  CA    . GLU A 1 224 ? -64.528 -7.022  -17.544 1.00 49.84  ? 224 GLU A CA    1 
ATOM   1823 C  C     . GLU A 1 224 ? -64.012 -8.076  -18.510 1.00 38.42  ? 224 GLU A C     1 
ATOM   1824 O  O     . GLU A 1 224 ? -63.223 -7.769  -19.409 1.00 43.92  ? 224 GLU A O     1 
ATOM   1825 C  CB    . GLU A 1 224 ? -65.816 -6.404  -18.111 1.00 45.66  ? 224 GLU A CB    1 
ATOM   1826 C  CG    . GLU A 1 224 ? -66.448 -5.337  -17.228 1.00 56.37  ? 224 GLU A CG    1 
ATOM   1827 C  CD    . GLU A 1 224 ? -67.002 -5.896  -15.929 1.00 75.56  ? 224 GLU A CD    1 
ATOM   1828 O  OE1   . GLU A 1 224 ? -67.191 -7.128  -15.836 1.00 78.83  ? 224 GLU A OE1   1 
ATOM   1829 O  OE2   . GLU A 1 224 ? -67.251 -5.099  -15.000 1.00 79.14  ? 224 GLU A OE2   1 
ATOM   1830 N  N     . PRO A 1 225 ? -64.441 -9.338  -18.345 1.00 39.86  ? 225 PRO A N     1 
ATOM   1831 C  CA    . PRO A 1 225 ? -64.116 -10.406 -19.294 1.00 42.07  ? 225 PRO A CA    1 
ATOM   1832 C  C     . PRO A 1 225 ? -64.889 -10.259 -20.605 1.00 38.77  ? 225 PRO A C     1 
ATOM   1833 O  O     . PRO A 1 225 ? -65.969 -9.668  -20.604 1.00 41.85  ? 225 PRO A O     1 
ATOM   1834 C  CB    . PRO A 1 225 ? -64.532 -11.676 -18.547 1.00 40.66  ? 225 PRO A CB    1 
ATOM   1835 C  CG    . PRO A 1 225 ? -65.601 -11.225 -17.622 1.00 38.45  ? 225 PRO A CG    1 
ATOM   1836 C  CD    . PRO A 1 225 ? -65.212 -9.840  -17.194 1.00 35.68  ? 225 PRO A CD    1 
ATOM   1837 N  N     . PRO A 1 226 ? -64.341 -10.780 -21.716 1.00 39.67  ? 226 PRO A N     1 
ATOM   1838 C  CA    . PRO A 1 226 ? -63.044 -11.463 -21.787 1.00 44.46  ? 226 PRO A CA    1 
ATOM   1839 C  C     . PRO A 1 226 ? -61.862 -10.501 -21.732 1.00 40.34  ? 226 PRO A C     1 
ATOM   1840 O  O     . PRO A 1 226 ? -61.899 -9.434  -22.345 1.00 41.26  ? 226 PRO A O     1 
ATOM   1841 C  CB    . PRO A 1 226 ? -63.103 -12.175 -23.139 1.00 46.71  ? 226 PRO A CB    1 
ATOM   1842 C  CG    . PRO A 1 226 ? -63.992 -11.317 -23.963 1.00 48.63  ? 226 PRO A CG    1 
ATOM   1843 C  CD    . PRO A 1 226 ? -65.031 -10.777 -23.018 1.00 33.07  ? 226 PRO A CD    1 
ATOM   1844 N  N     . PHE A 1 227 ? -60.826 -10.880 -20.990 1.00 42.84  ? 227 PHE A N     1 
ATOM   1845 C  CA    . PHE A 1 227 ? -59.627 -10.067 -20.863 1.00 35.48  ? 227 PHE A CA    1 
ATOM   1846 C  C     . PHE A 1 227 ? -58.651 -10.417 -21.978 1.00 33.86  ? 227 PHE A C     1 
ATOM   1847 O  O     . PHE A 1 227 ? -58.319 -11.590 -22.177 1.00 42.96  ? 227 PHE A O     1 
ATOM   1848 C  CB    . PHE A 1 227 ? -58.970 -10.278 -19.499 1.00 34.02  ? 227 PHE A CB    1 
ATOM   1849 C  CG    . PHE A 1 227 ? -59.863 -9.950  -18.337 1.00 35.94  ? 227 PHE A CG    1 
ATOM   1850 C  CD1   . PHE A 1 227 ? -60.654 -10.927 -17.758 1.00 30.46  ? 227 PHE A CD1   1 
ATOM   1851 C  CD2   . PHE A 1 227 ? -59.907 -8.665  -17.820 1.00 33.90  ? 227 PHE A CD2   1 
ATOM   1852 C  CE1   . PHE A 1 227 ? -61.476 -10.630 -16.685 1.00 33.86  ? 227 PHE A CE1   1 
ATOM   1853 C  CE2   . PHE A 1 227 ? -60.728 -8.359  -16.748 1.00 31.78  ? 227 PHE A CE2   1 
ATOM   1854 C  CZ    . PHE A 1 227 ? -61.513 -9.344  -16.180 1.00 38.71  ? 227 PHE A CZ    1 
ATOM   1855 N  N     . LEU A 1 228 ? -58.205 -9.399  -22.709 1.00 32.18  ? 228 LEU A N     1 
ATOM   1856 C  CA    . LEU A 1 228 ? -57.202 -9.585  -23.750 1.00 31.55  ? 228 LEU A CA    1 
ATOM   1857 C  C     . LEU A 1 228 ? -55.820 -9.558  -23.110 1.00 36.39  ? 228 LEU A C     1 
ATOM   1858 O  O     . LEU A 1 228 ? -55.403 -8.531  -22.564 1.00 33.37  ? 228 LEU A O     1 
ATOM   1859 C  CB    . LEU A 1 228 ? -57.336 -8.499  -24.814 1.00 33.31  ? 228 LEU A CB    1 
ATOM   1860 C  CG    . LEU A 1 228 ? -58.737 -8.337  -25.410 1.00 42.44  ? 228 LEU A CG    1 
ATOM   1861 C  CD1   . LEU A 1 228 ? -58.773 -7.185  -26.402 1.00 35.06  ? 228 LEU A CD1   1 
ATOM   1862 C  CD2   . LEU A 1 228 ? -59.196 -9.629  -26.068 1.00 40.08  ? 228 LEU A CD2   1 
ATOM   1863 N  N     . TRP A 1 229 ? -55.110 -10.682 -23.173 1.00 35.29  ? 229 TRP A N     1 
ATOM   1864 C  CA    . TRP A 1 229 ? -53.869 -10.836 -22.421 1.00 31.44  ? 229 TRP A CA    1 
ATOM   1865 C  C     . TRP A 1 229 ? -52.943 -11.796 -23.151 1.00 32.83  ? 229 TRP A C     1 
ATOM   1866 O  O     . TRP A 1 229 ? -53.302 -12.957 -23.369 1.00 30.62  ? 229 TRP A O     1 
ATOM   1867 C  CB    . TRP A 1 229 ? -54.164 -11.338 -21.005 1.00 31.73  ? 229 TRP A CB    1 
ATOM   1868 C  CG    . TRP A 1 229 ? -52.949 -11.602 -20.172 1.00 33.87  ? 229 TRP A CG    1 
ATOM   1869 C  CD1   . TRP A 1 229 ? -52.183 -10.678 -19.525 1.00 31.38  ? 229 TRP A CD1   1 
ATOM   1870 C  CD2   . TRP A 1 229 ? -52.371 -12.879 -19.879 1.00 36.54  ? 229 TRP A CD2   1 
ATOM   1871 N  NE1   . TRP A 1 229 ? -51.157 -11.300 -18.854 1.00 29.84  ? 229 TRP A NE1   1 
ATOM   1872 C  CE2   . TRP A 1 229 ? -51.253 -12.652 -19.053 1.00 32.24  ? 229 TRP A CE2   1 
ATOM   1873 C  CE3   . TRP A 1 229 ? -52.688 -14.192 -20.239 1.00 32.45  ? 229 TRP A CE3   1 
ATOM   1874 C  CZ2   . TRP A 1 229 ? -50.447 -13.687 -18.584 1.00 31.97  ? 229 TRP A CZ2   1 
ATOM   1875 C  CZ3   . TRP A 1 229 ? -51.888 -15.220 -19.770 1.00 37.02  ? 229 TRP A CZ3   1 
ATOM   1876 C  CH2   . TRP A 1 229 ? -50.782 -14.961 -18.952 1.00 28.31  ? 229 TRP A CH2   1 
ATOM   1877 N  N     . MET A 1 230 ? -51.759 -11.304 -23.526 1.00 34.51  ? 230 MET A N     1 
ATOM   1878 C  CA    . MET A 1 230 ? -50.683 -12.127 -24.083 1.00 35.95  ? 230 MET A CA    1 
ATOM   1879 C  C     . MET A 1 230 ? -51.120 -12.891 -25.330 1.00 35.59  ? 230 MET A C     1 
ATOM   1880 O  O     . MET A 1 230 ? -50.634 -13.994 -25.595 1.00 41.09  ? 230 MET A O     1 
ATOM   1881 C  CB    . MET A 1 230 ? -50.132 -13.098 -23.034 1.00 29.96  ? 230 MET A CB    1 
ATOM   1882 C  CG    . MET A 1 230 ? -49.443 -12.417 -21.865 1.00 26.11  ? 230 MET A CG    1 
ATOM   1883 S  SD    . MET A 1 230 ? -47.943 -11.549 -22.353 1.00 29.35  ? 230 MET A SD    1 
ATOM   1884 C  CE    . MET A 1 230 ? -46.932 -12.921 -22.902 1.00 25.81  ? 230 MET A CE    1 
ATOM   1885 N  N     . GLY A 1 231 ? -52.024 -12.309 -26.113 1.00 37.90  ? 231 GLY A N     1 
ATOM   1886 C  CA    . GLY A 1 231 ? -52.529 -12.977 -27.292 1.00 30.77  ? 231 GLY A CA    1 
ATOM   1887 C  C     . GLY A 1 231 ? -53.640 -13.967 -27.037 1.00 37.79  ? 231 GLY A C     1 
ATOM   1888 O  O     . GLY A 1 231 ? -53.985 -14.734 -27.942 1.00 34.60  ? 231 GLY A O     1 
ATOM   1889 N  N     . TYR A 1 232 ? -54.205 -13.981 -25.835 1.00 37.99  ? 232 TYR A N     1 
ATOM   1890 C  CA    . TYR A 1 232 ? -55.306 -14.862 -25.483 1.00 30.54  ? 232 TYR A CA    1 
ATOM   1891 C  C     . TYR A 1 232 ? -56.528 -14.035 -25.106 1.00 35.06  ? 232 TYR A C     1 
ATOM   1892 O  O     . TYR A 1 232 ? -56.471 -12.808 -24.993 1.00 37.01  ? 232 TYR A O     1 
ATOM   1893 C  CB    . TYR A 1 232 ? -54.929 -15.789 -24.319 1.00 30.11  ? 232 TYR A CB    1 
ATOM   1894 C  CG    . TYR A 1 232 ? -53.652 -16.572 -24.524 1.00 34.41  ? 232 TYR A CG    1 
ATOM   1895 C  CD1   . TYR A 1 232 ? -53.664 -17.798 -25.177 1.00 29.68  ? 232 TYR A CD1   1 
ATOM   1896 C  CD2   . TYR A 1 232 ? -52.438 -16.091 -24.052 1.00 24.16  ? 232 TYR A CD2   1 
ATOM   1897 C  CE1   . TYR A 1 232 ? -52.501 -18.518 -25.363 1.00 29.22  ? 232 TYR A CE1   1 
ATOM   1898 C  CE2   . TYR A 1 232 ? -51.269 -16.802 -24.233 1.00 25.91  ? 232 TYR A CE2   1 
ATOM   1899 C  CZ    . TYR A 1 232 ? -51.306 -18.017 -24.888 1.00 33.82  ? 232 TYR A CZ    1 
ATOM   1900 O  OH    . TYR A 1 232 ? -50.144 -18.732 -25.070 1.00 29.18  ? 232 TYR A OH    1 
ATOM   1901 N  N     . GLU A 1 233 ? -57.644 -14.731 -24.911 1.00 37.41  ? 233 GLU A N     1 
ATOM   1902 C  CA    . GLU A 1 233 ? -58.865 -14.148 -24.370 1.00 39.86  ? 233 GLU A CA    1 
ATOM   1903 C  C     . GLU A 1 233 ? -59.214 -14.899 -23.096 1.00 30.69  ? 233 GLU A C     1 
ATOM   1904 O  O     . GLU A 1 233 ? -59.458 -16.110 -23.134 1.00 38.91  ? 233 GLU A O     1 
ATOM   1905 C  CB    . GLU A 1 233 ? -60.012 -14.221 -25.380 1.00 39.14  ? 233 GLU A CB    1 
ATOM   1906 C  CG    . GLU A 1 233 ? -59.882 -13.245 -26.536 1.00 55.13  ? 233 GLU A CG    1 
ATOM   1907 C  CD    . GLU A 1 233 ? -60.985 -13.407 -27.562 1.00 67.47  ? 233 GLU A CD    1 
ATOM   1908 O  OE1   . GLU A 1 233 ? -60.965 -14.414 -28.302 1.00 71.07  ? 233 GLU A OE1   1 
ATOM   1909 O  OE2   . GLU A 1 233 ? -61.876 -12.534 -27.620 1.00 65.27  ? 233 GLU A OE2   1 
ATOM   1910 N  N     . LEU A 1 234 ? -59.229 -14.188 -21.972 1.00 39.39  ? 234 LEU A N     1 
ATOM   1911 C  CA    . LEU A 1 234 ? -59.422 -14.795 -20.660 1.00 36.03  ? 234 LEU A CA    1 
ATOM   1912 C  C     . LEU A 1 234 ? -60.872 -14.609 -20.227 1.00 44.33  ? 234 LEU A C     1 
ATOM   1913 O  O     . LEU A 1 234 ? -61.303 -13.489 -19.935 1.00 42.29  ? 234 LEU A O     1 
ATOM   1914 C  CB    . LEU A 1 234 ? -58.463 -14.191 -19.637 1.00 30.79  ? 234 LEU A CB    1 
ATOM   1915 C  CG    . LEU A 1 234 ? -56.972 -14.301 -19.968 1.00 37.44  ? 234 LEU A CG    1 
ATOM   1916 C  CD1   . LEU A 1 234 ? -56.124 -13.864 -18.782 1.00 26.04  ? 234 LEU A CD1   1 
ATOM   1917 C  CD2   . LEU A 1 234 ? -56.615 -15.717 -20.398 1.00 30.48  ? 234 LEU A CD2   1 
ATOM   1918 N  N     . HIS A 1 235 ? -61.614 -15.702 -20.193 1.00 38.40  ? 235 HIS A N     1 
ATOM   1919 C  CA    . HIS A 1 235 ? -62.955 -15.764 -19.638 1.00 38.81  ? 235 HIS A CA    1 
ATOM   1920 C  C     . HIS A 1 235 ? -62.892 -16.244 -18.195 1.00 39.52  ? 235 HIS A C     1 
ATOM   1921 O  O     . HIS A 1 235 ? -61.856 -16.731 -17.734 1.00 40.39  ? 235 HIS A O     1 
ATOM   1922 C  CB    . HIS A 1 235 ? -63.825 -16.689 -20.494 1.00 44.11  ? 235 HIS A CB    1 
ATOM   1923 C  CG    . HIS A 1 235 ? -64.056 -16.182 -21.884 1.00 33.90  ? 235 HIS A CG    1 
ATOM   1924 N  ND1   . HIS A 1 235 ? -63.117 -16.300 -22.887 1.00 42.19  ? 235 HIS A ND1   1 
ATOM   1925 C  CD2   . HIS A 1 235 ? -65.118 -15.548 -22.436 1.00 36.68  ? 235 HIS A CD2   1 
ATOM   1926 C  CE1   . HIS A 1 235 ? -63.592 -15.764 -23.997 1.00 41.47  ? 235 HIS A CE1   1 
ATOM   1927 N  NE2   . HIS A 1 235 ? -64.804 -15.301 -23.751 1.00 38.10  ? 235 HIS A NE2   1 
ATOM   1928 N  N     . PRO A 1 236 ? -63.983 -16.095 -17.430 1.00 39.97  ? 236 PRO A N     1 
ATOM   1929 C  CA    . PRO A 1 236 ? -63.927 -16.494 -16.011 1.00 42.32  ? 236 PRO A CA    1 
ATOM   1930 C  C     . PRO A 1 236 ? -63.530 -17.945 -15.786 1.00 44.89  ? 236 PRO A C     1 
ATOM   1931 O  O     . PRO A 1 236 ? -62.793 -18.233 -14.834 1.00 43.58  ? 236 PRO A O     1 
ATOM   1932 C  CB    . PRO A 1 236 ? -65.353 -16.214 -15.520 1.00 45.21  ? 236 PRO A CB    1 
ATOM   1933 C  CG    . PRO A 1 236 ? -65.828 -15.111 -16.388 1.00 38.47  ? 236 PRO A CG    1 
ATOM   1934 C  CD    . PRO A 1 236 ? -65.233 -15.376 -17.743 1.00 33.75  ? 236 PRO A CD    1 
ATOM   1935 N  N     . ASP A 1 237 ? -63.989 -18.871 -16.631 1.00 42.65  ? 237 ASP A N     1 
ATOM   1936 C  CA    . ASP A 1 237 ? -63.719 -20.288 -16.421 1.00 38.61  ? 237 ASP A CA    1 
ATOM   1937 C  C     . ASP A 1 237 ? -63.100 -20.969 -17.636 1.00 41.46  ? 237 ASP A C     1 
ATOM   1938 O  O     . ASP A 1 237 ? -63.050 -22.205 -17.676 1.00 51.17  ? 237 ASP A O     1 
ATOM   1939 C  CB    . ASP A 1 237 ? -65.001 -21.025 -16.014 1.00 49.03  ? 237 ASP A CB    1 
ATOM   1940 C  CG    . ASP A 1 237 ? -65.600 -20.482 -14.733 1.00 73.08  ? 237 ASP A CG    1 
ATOM   1941 O  OD1   . ASP A 1 237 ? -65.141 -20.888 -13.644 1.00 75.08  ? 237 ASP A OD1   1 
ATOM   1942 O  OD2   . ASP A 1 237 ? -66.526 -19.647 -14.817 1.00 67.69  ? 237 ASP A OD2   1 
ATOM   1943 N  N     . LYS A 1 238 ? -62.629 -20.210 -18.621 1.00 42.11  ? 238 LYS A N     1 
ATOM   1944 C  CA    . LYS A 1 238 ? -61.982 -20.792 -19.788 1.00 40.33  ? 238 LYS A CA    1 
ATOM   1945 C  C     . LYS A 1 238 ? -61.136 -19.720 -20.458 1.00 36.26  ? 238 LYS A C     1 
ATOM   1946 O  O     . LYS A 1 238 ? -61.241 -18.532 -20.149 1.00 37.37  ? 238 LYS A O     1 
ATOM   1947 C  CB    . LYS A 1 238 ? -63.005 -21.376 -20.769 1.00 37.49  ? 238 LYS A CB    1 
ATOM   1948 C  CG    . LYS A 1 238 ? -63.921 -20.345 -21.405 1.00 49.46  ? 238 LYS A CG    1 
ATOM   1949 C  CD    . LYS A 1 238 ? -64.871 -20.993 -22.399 1.00 48.31  ? 238 LYS A CD    1 
ATOM   1950 C  CE    . LYS A 1 238 ? -65.756 -19.956 -23.069 1.00 61.18  ? 238 LYS A CE    1 
ATOM   1951 N  NZ    . LYS A 1 238 ? -66.674 -20.570 -24.070 1.00 76.49  ? 238 LYS A NZ    1 
ATOM   1952 N  N     . TRP A 1 239 ? -60.287 -20.161 -21.384 1.00 35.67  ? 239 TRP A N     1 
ATOM   1953 C  CA    . TRP A 1 239 ? -59.451 -19.260 -22.160 1.00 33.21  ? 239 TRP A CA    1 
ATOM   1954 C  C     . TRP A 1 239 ? -59.342 -19.786 -23.582 1.00 39.68  ? 239 TRP A C     1 
ATOM   1955 O  O     . TRP A 1 239 ? -59.472 -20.988 -23.828 1.00 41.12  ? 239 TRP A O     1 
ATOM   1956 C  CB    . TRP A 1 239 ? -58.050 -19.105 -21.550 1.00 29.01  ? 239 TRP A CB    1 
ATOM   1957 C  CG    . TRP A 1 239 ? -57.241 -20.366 -21.563 1.00 38.12  ? 239 TRP A CG    1 
ATOM   1958 C  CD1   . TRP A 1 239 ? -57.177 -21.309 -20.579 1.00 32.56  ? 239 TRP A CD1   1 
ATOM   1959 C  CD2   . TRP A 1 239 ? -56.380 -20.822 -22.614 1.00 24.41  ? 239 TRP A CD2   1 
ATOM   1960 N  NE1   . TRP A 1 239 ? -56.330 -22.325 -20.952 1.00 31.39  ? 239 TRP A NE1   1 
ATOM   1961 C  CE2   . TRP A 1 239 ? -55.826 -22.049 -22.196 1.00 31.11  ? 239 TRP A CE2   1 
ATOM   1962 C  CE3   . TRP A 1 239 ? -56.022 -20.311 -23.865 1.00 27.55  ? 239 TRP A CE3   1 
ATOM   1963 C  CZ2   . TRP A 1 239 ? -54.936 -22.774 -22.986 1.00 32.01  ? 239 TRP A CZ2   1 
ATOM   1964 C  CZ3   . TRP A 1 239 ? -55.136 -21.033 -24.648 1.00 35.64  ? 239 TRP A CZ3   1 
ATOM   1965 C  CH2   . TRP A 1 239 ? -54.604 -22.250 -24.205 1.00 26.95  ? 239 TRP A CH2   1 
ATOM   1966 N  N     . THR A 1 240 ? -59.104 -18.871 -24.517 1.00 34.97  ? 240 THR A N     1 
ATOM   1967 C  CA    . THR A 1 240 ? -58.930 -19.224 -25.916 1.00 46.97  ? 240 THR A CA    1 
ATOM   1968 C  C     . THR A 1 240 ? -57.835 -18.353 -26.511 1.00 48.01  ? 240 THR A C     1 
ATOM   1969 O  O     . THR A 1 240 ? -57.481 -17.304 -25.966 1.00 40.21  ? 240 THR A O     1 
ATOM   1970 C  CB    . THR A 1 240 ? -60.232 -19.059 -26.715 1.00 41.81  ? 240 THR A CB    1 
ATOM   1971 O  OG1   . THR A 1 240 ? -60.038 -19.537 -28.052 1.00 68.44  ? 240 THR A OG1   1 
ATOM   1972 C  CG2   . THR A 1 240 ? -60.648 -17.597 -26.762 1.00 44.67  ? 240 THR A CG2   1 
ATOM   1973 N  N     . VAL A 1 241 ? -57.295 -18.804 -27.629 1.00 39.66  ? 241 VAL A N     1 
ATOM   1974 C  CA    . VAL A 1 241 ? -56.291 -18.040 -28.358 1.00 43.99  ? 241 VAL A CA    1 
ATOM   1975 C  C     . VAL A 1 241 ? -57.006 -17.083 -29.300 1.00 39.46  ? 241 VAL A C     1 
ATOM   1976 O  O     . VAL A 1 241 ? -58.084 -17.383 -29.827 1.00 40.12  ? 241 VAL A O     1 
ATOM   1977 C  CB    . VAL A 1 241 ? -55.318 -18.975 -29.112 1.00 34.89  ? 241 VAL A CB    1 
ATOM   1978 C  CG1   . VAL A 1 241 ? -56.036 -19.724 -30.229 1.00 41.77  ? 241 VAL A CG1   1 
ATOM   1979 C  CG2   . VAL A 1 241 ? -54.126 -18.195 -29.650 1.00 42.77  ? 241 VAL A CG2   1 
ATOM   1980 N  N     . GLN A 1 242 ? -56.418 -15.905 -29.491 1.00 43.28  ? 242 GLN A N     1 
ATOM   1981 C  CA    . GLN A 1 242 ? -56.980 -14.943 -30.423 1.00 45.70  ? 242 GLN A CA    1 
ATOM   1982 C  C     . GLN A 1 242 ? -56.973 -15.531 -31.835 1.00 47.45  ? 242 GLN A C     1 
ATOM   1983 O  O     . GLN A 1 242 ? -56.118 -16.359 -32.163 1.00 53.78  ? 242 GLN A O     1 
ATOM   1984 C  CB    . GLN A 1 242 ? -56.194 -13.634 -30.373 1.00 45.88  ? 242 GLN A CB    1 
ATOM   1985 C  CG    . GLN A 1 242 ? -56.374 -12.875 -29.065 1.00 48.30  ? 242 GLN A CG    1 
ATOM   1986 C  CD    . GLN A 1 242 ? -55.570 -11.592 -29.009 1.00 52.04  ? 242 GLN A CD    1 
ATOM   1987 O  OE1   . GLN A 1 242 ? -54.901 -11.223 -29.974 1.00 54.86  ? 242 GLN A OE1   1 
ATOM   1988 N  NE2   . GLN A 1 242 ? -55.629 -10.906 -27.873 1.00 49.03  ? 242 GLN A NE2   1 
ATOM   1989 N  N     . PRO A 1 243 ? -57.927 -15.136 -32.678 1.00 50.38  ? 243 PRO A N     1 
ATOM   1990 C  CA    . PRO A 1 243 ? -58.096 -15.796 -33.980 1.00 54.12  ? 243 PRO A CA    1 
ATOM   1991 C  C     . PRO A 1 243 ? -56.812 -15.832 -34.796 1.00 57.78  ? 243 PRO A C     1 
ATOM   1992 O  O     . PRO A 1 243 ? -56.144 -14.815 -34.992 1.00 56.14  ? 243 PRO A O     1 
ATOM   1993 C  CB    . PRO A 1 243 ? -59.173 -14.948 -34.662 1.00 49.79  ? 243 PRO A CB    1 
ATOM   1994 C  CG    . PRO A 1 243 ? -59.967 -14.392 -33.534 1.00 63.57  ? 243 PRO A CG    1 
ATOM   1995 C  CD    . PRO A 1 243 ? -58.978 -14.132 -32.431 1.00 62.20  ? 243 PRO A CD    1 
ATOM   1996 N  N     . ILE A 1 244 ? -56.468 -17.028 -35.267 1.00 55.22  ? 244 ILE A N     1 
ATOM   1997 C  CA    . ILE A 1 244 ? -55.284 -17.257 -36.086 1.00 54.98  ? 244 ILE A CA    1 
ATOM   1998 C  C     . ILE A 1 244 ? -55.721 -17.361 -37.540 1.00 60.26  ? 244 ILE A C     1 
ATOM   1999 O  O     . ILE A 1 244 ? -56.619 -18.145 -37.872 1.00 48.77  ? 244 ILE A O     1 
ATOM   2000 C  CB    . ILE A 1 244 ? -54.539 -18.526 -35.641 1.00 55.50  ? 244 ILE A CB    1 
ATOM   2001 C  CG1   . ILE A 1 244 ? -54.115 -18.403 -34.176 1.00 55.16  ? 244 ILE A CG1   1 
ATOM   2002 C  CG2   . ILE A 1 244 ? -53.335 -18.783 -36.535 1.00 49.73  ? 244 ILE A CG2   1 
ATOM   2003 C  CD1   . ILE A 1 244 ? -53.528 -19.670 -33.605 1.00 46.27  ? 244 ILE A CD1   1 
ATOM   2004 N  N     . VAL A 1 245 ? -55.092 -16.572 -38.405 1.00 60.81  ? 245 VAL A N     1 
ATOM   2005 C  CA    . VAL A 1 245 ? -55.434 -16.517 -39.821 1.00 57.19  ? 245 VAL A CA    1 
ATOM   2006 C  C     . VAL A 1 245 ? -54.249 -17.065 -40.604 1.00 54.91  ? 245 VAL A C     1 
ATOM   2007 O  O     . VAL A 1 245 ? -53.163 -16.472 -40.602 1.00 54.99  ? 245 VAL A O     1 
ATOM   2008 C  CB    . VAL A 1 245 ? -55.785 -15.093 -40.270 1.00 59.47  ? 245 VAL A CB    1 
ATOM   2009 C  CG1   . VAL A 1 245 ? -56.281 -15.097 -41.708 1.00 52.36  ? 245 VAL A CG1   1 
ATOM   2010 C  CG2   . VAL A 1 245 ? -56.827 -14.488 -39.341 1.00 40.38  ? 245 VAL A CG2   1 
ATOM   2011 N  N     . LEU A 1 246 ? -54.454 -18.198 -41.273 1.00 50.54  ? 246 LEU A N     1 
ATOM   2012 C  CA    . LEU A 1 246 ? -53.389 -18.769 -42.084 1.00 59.20  ? 246 LEU A CA    1 
ATOM   2013 C  C     . LEU A 1 246 ? -53.335 -18.081 -43.446 1.00 73.57  ? 246 LEU A C     1 
ATOM   2014 O  O     . LEU A 1 246 ? -54.377 -17.743 -44.014 1.00 69.74  ? 246 LEU A O     1 
ATOM   2015 C  CB    . LEU A 1 246 ? -53.597 -20.270 -42.277 1.00 58.08  ? 246 LEU A CB    1 
ATOM   2016 C  CG    . LEU A 1 246 ? -53.467 -21.169 -41.048 1.00 60.35  ? 246 LEU A CG    1 
ATOM   2017 C  CD1   . LEU A 1 246 ? -53.468 -22.630 -41.471 1.00 50.68  ? 246 LEU A CD1   1 
ATOM   2018 C  CD2   . LEU A 1 246 ? -52.208 -20.833 -40.264 1.00 56.61  ? 246 LEU A CD2   1 
ATOM   2019 N  N     . PRO A 1 247 ? -52.138 -17.856 -43.985 1.00 77.27  ? 247 PRO A N     1 
ATOM   2020 C  CA    . PRO A 1 247 ? -52.035 -17.316 -45.346 1.00 75.02  ? 247 PRO A CA    1 
ATOM   2021 C  C     . PRO A 1 247 ? -52.618 -18.292 -46.356 1.00 79.01  ? 247 PRO A C     1 
ATOM   2022 O  O     . PRO A 1 247 ? -52.505 -19.511 -46.209 1.00 74.55  ? 247 PRO A O     1 
ATOM   2023 C  CB    . PRO A 1 247 ? -50.526 -17.130 -45.542 1.00 79.25  ? 247 PRO A CB    1 
ATOM   2024 C  CG    . PRO A 1 247 ? -49.961 -17.089 -44.155 1.00 72.83  ? 247 PRO A CG    1 
ATOM   2025 C  CD    . PRO A 1 247 ? -50.821 -18.002 -43.345 1.00 66.45  ? 247 PRO A CD    1 
ATOM   2026 N  N     . GLU A 1 248 ? -53.253 -17.742 -47.392 1.00 81.78  ? 248 GLU A N     1 
ATOM   2027 C  CA    . GLU A 1 248 ? -53.986 -18.534 -48.377 1.00 83.66  ? 248 GLU A CA    1 
ATOM   2028 C  C     . GLU A 1 248 ? -53.502 -18.147 -49.778 1.00 77.71  ? 248 GLU A C     1 
ATOM   2029 O  O     . GLU A 1 248 ? -54.222 -17.521 -50.558 1.00 91.99  ? 248 GLU A O     1 
ATOM   2030 C  CB    . GLU A 1 248 ? -55.494 -18.335 -48.217 1.00 81.65  ? 248 GLU A CB    1 
ATOM   2031 C  CG    . GLU A 1 248 ? -56.347 -19.374 -48.919 1.00 82.71  ? 248 GLU A CG    1 
ATOM   2032 C  CD    . GLU A 1 248 ? -57.748 -19.448 -48.344 1.00 95.21  ? 248 GLU A CD    1 
ATOM   2033 O  OE1   . GLU A 1 248 ? -58.225 -20.571 -48.076 1.00 100.24 ? 248 GLU A OE1   1 
ATOM   2034 O  OE2   . GLU A 1 248 ? -58.368 -18.381 -48.148 1.00 92.94  ? 248 GLU A OE2   1 
ATOM   2035 N  N     . LYS A 1 249 ? -52.269 -18.529 -50.091 1.00 77.16  ? 249 LYS A N     1 
ATOM   2036 C  CA    . LYS A 1 249 ? -51.670 -18.278 -51.392 1.00 84.27  ? 249 LYS A CA    1 
ATOM   2037 C  C     . LYS A 1 249 ? -51.829 -19.491 -52.301 1.00 84.48  ? 249 LYS A C     1 
ATOM   2038 O  O     . LYS A 1 249 ? -52.096 -20.608 -51.853 1.00 70.98  ? 249 LYS A O     1 
ATOM   2039 C  CB    . LYS A 1 249 ? -50.184 -17.933 -51.255 1.00 75.33  ? 249 LYS A CB    1 
ATOM   2040 C  CG    . LYS A 1 249 ? -49.880 -16.450 -51.115 1.00 90.32  ? 249 LYS A CG    1 
ATOM   2041 C  CD    . LYS A 1 249 ? -50.208 -15.930 -49.727 1.00 88.53  ? 249 LYS A CD    1 
ATOM   2042 C  CE    . LYS A 1 249 ? -49.819 -14.467 -49.590 1.00 96.76  ? 249 LYS A CE    1 
ATOM   2043 N  NZ    . LYS A 1 249 ? -48.376 -14.247 -49.891 1.00 90.11  ? 249 LYS A NZ    1 
ATOM   2044 N  N     . ASP A 1 250 ? -51.663 -19.250 -53.599 1.00 89.60  ? 250 ASP A N     1 
ATOM   2045 C  CA    . ASP A 1 250 ? -51.568 -20.313 -54.589 1.00 88.84  ? 250 ASP A CA    1 
ATOM   2046 C  C     . ASP A 1 250 ? -50.130 -20.577 -55.011 1.00 85.39  ? 250 ASP A C     1 
ATOM   2047 O  O     . ASP A 1 250 ? -49.885 -21.501 -55.793 1.00 81.41  ? 250 ASP A O     1 
ATOM   2048 C  CB    . ASP A 1 250 ? -52.417 -19.972 -55.818 1.00 96.23  ? 250 ASP A CB    1 
ATOM   2049 C  CG    . ASP A 1 250 ? -53.882 -19.777 -55.478 1.00 100.41 ? 250 ASP A CG    1 
ATOM   2050 O  OD1   . ASP A 1 250 ? -54.354 -20.398 -54.501 1.00 97.83  ? 250 ASP A OD1   1 
ATOM   2051 O  OD2   . ASP A 1 250 ? -54.560 -19.004 -56.186 1.00 99.09  ? 250 ASP A OD2   1 
ATOM   2052 N  N     . SER A 1 251 ? -49.181 -19.788 -54.510 1.00 80.27  ? 251 SER A N     1 
ATOM   2053 C  CA    . SER A 1 251 ? -47.760 -19.940 -54.824 1.00 82.36  ? 251 SER A CA    1 
ATOM   2054 C  C     . SER A 1 251 ? -46.983 -19.603 -53.555 1.00 74.66  ? 251 SER A C     1 
ATOM   2055 O  O     . SER A 1 251 ? -46.765 -18.427 -53.248 1.00 85.81  ? 251 SER A O     1 
ATOM   2056 C  CB    . SER A 1 251 ? -47.352 -19.042 -55.986 1.00 76.84  ? 251 SER A CB    1 
ATOM   2057 O  OG    . SER A 1 251 ? -45.953 -19.085 -56.202 1.00 83.29  ? 251 SER A OG    1 
ATOM   2058 N  N     . TRP A 1 252 ? -46.570 -20.634 -52.823 1.00 72.52  ? 252 TRP A N     1 
ATOM   2059 C  CA    . TRP A 1 252 ? -45.905 -20.452 -51.541 1.00 74.44  ? 252 TRP A CA    1 
ATOM   2060 C  C     . TRP A 1 252 ? -44.402 -20.281 -51.719 1.00 67.69  ? 252 TRP A C     1 
ATOM   2061 O  O     . TRP A 1 252 ? -43.778 -20.958 -52.541 1.00 73.75  ? 252 TRP A O     1 
ATOM   2062 C  CB    . TRP A 1 252 ? -46.182 -21.639 -50.617 1.00 59.32  ? 252 TRP A CB    1 
ATOM   2063 C  CG    . TRP A 1 252 ? -47.456 -21.513 -49.841 1.00 64.13  ? 252 TRP A CG    1 
ATOM   2064 C  CD1   . TRP A 1 252 ? -47.658 -20.769 -48.714 1.00 63.23  ? 252 TRP A CD1   1 
ATOM   2065 C  CD2   . TRP A 1 252 ? -48.704 -22.157 -50.126 1.00 60.11  ? 252 TRP A CD2   1 
ATOM   2066 N  NE1   . TRP A 1 252 ? -48.956 -20.906 -48.282 1.00 65.20  ? 252 TRP A NE1   1 
ATOM   2067 C  CE2   . TRP A 1 252 ? -49.619 -21.752 -49.132 1.00 65.07  ? 252 TRP A CE2   1 
ATOM   2068 C  CE3   . TRP A 1 252 ? -49.138 -23.034 -51.124 1.00 62.57  ? 252 TRP A CE3   1 
ATOM   2069 C  CZ2   . TRP A 1 252 ? -50.940 -22.195 -49.108 1.00 68.87  ? 252 TRP A CZ2   1 
ATOM   2070 C  CZ3   . TRP A 1 252 ? -50.451 -23.473 -51.099 1.00 74.71  ? 252 TRP A CZ3   1 
ATOM   2071 C  CH2   . TRP A 1 252 ? -51.335 -23.053 -50.096 1.00 81.10  ? 252 TRP A CH2   1 
ATOM   2072 N  N     . THR A 1 253 ? -43.831 -19.369 -50.940 1.00 68.11  ? 253 THR A N     1 
ATOM   2073 C  CA    . THR A 1 253 ? -42.394 -19.145 -50.882 1.00 63.77  ? 253 THR A CA    1 
ATOM   2074 C  C     . THR A 1 253 ? -41.853 -19.649 -49.550 1.00 69.72  ? 253 THR A C     1 
ATOM   2075 O  O     . THR A 1 253 ? -42.605 -20.061 -48.663 1.00 69.59  ? 253 THR A O     1 
ATOM   2076 C  CB    . THR A 1 253 ? -42.061 -17.659 -51.063 1.00 68.55  ? 253 THR A CB    1 
ATOM   2077 O  OG1   . THR A 1 253 ? -42.505 -16.924 -49.916 1.00 70.19  ? 253 THR A OG1   1 
ATOM   2078 C  CG2   . THR A 1 253 ? -42.743 -17.106 -52.306 1.00 78.77  ? 253 THR A CG2   1 
ATOM   2079 N  N     . VAL A 1 254 ? -40.524 -19.618 -49.419 1.00 67.96  ? 254 VAL A N     1 
ATOM   2080 C  CA    . VAL A 1 254 ? -39.893 -20.011 -48.159 1.00 63.11  ? 254 VAL A CA    1 
ATOM   2081 C  C     . VAL A 1 254 ? -40.399 -19.140 -47.018 1.00 64.56  ? 254 VAL A C     1 
ATOM   2082 O  O     . VAL A 1 254 ? -40.727 -19.638 -45.934 1.00 66.68  ? 254 VAL A O     1 
ATOM   2083 C  CB    . VAL A 1 254 ? -38.360 -19.948 -48.282 1.00 64.86  ? 254 VAL A CB    1 
ATOM   2084 C  CG1   . VAL A 1 254 ? -37.711 -20.088 -46.914 1.00 61.38  ? 254 VAL A CG1   1 
ATOM   2085 C  CG2   . VAL A 1 254 ? -37.860 -21.031 -49.216 1.00 67.49  ? 254 VAL A CG2   1 
ATOM   2086 N  N     . ASN A 1 255 ? -40.480 -17.827 -47.245 1.00 69.48  ? 255 ASN A N     1 
ATOM   2087 C  CA    . ASN A 1 255 ? -41.015 -16.932 -46.226 1.00 70.25  ? 255 ASN A CA    1 
ATOM   2088 C  C     . ASN A 1 255 ? -42.477 -17.247 -45.935 1.00 64.55  ? 255 ASN A C     1 
ATOM   2089 O  O     . ASN A 1 255 ? -42.930 -17.128 -44.791 1.00 70.69  ? 255 ASN A O     1 
ATOM   2090 C  CB    . ASN A 1 255 ? -40.852 -15.480 -46.672 1.00 71.01  ? 255 ASN A CB    1 
ATOM   2091 C  CG    . ASN A 1 255 ? -40.995 -14.497 -45.526 1.00 66.89  ? 255 ASN A CG    1 
ATOM   2092 O  OD1   . ASN A 1 255 ? -40.002 -14.040 -44.960 1.00 72.62  ? 255 ASN A OD1   1 
ATOM   2093 N  ND2   . ASN A 1 255 ? -42.233 -14.166 -45.178 1.00 64.29  ? 255 ASN A ND2   1 
ATOM   2094 N  N     . ASP A 1 256 ? -43.230 -17.656 -46.959 1.00 69.30  ? 256 ASP A N     1 
ATOM   2095 C  CA    . ASP A 1 256 ? -44.630 -18.013 -46.753 1.00 67.03  ? 256 ASP A CA    1 
ATOM   2096 C  C     . ASP A 1 256 ? -44.760 -19.301 -45.949 1.00 66.07  ? 256 ASP A C     1 
ATOM   2097 O  O     . ASP A 1 256 ? -45.682 -19.440 -45.136 1.00 57.85  ? 256 ASP A O     1 
ATOM   2098 C  CB    . ASP A 1 256 ? -45.344 -18.144 -48.097 1.00 63.83  ? 256 ASP A CB    1 
ATOM   2099 C  CG    . ASP A 1 256 ? -45.418 -16.831 -48.850 1.00 76.99  ? 256 ASP A CG    1 
ATOM   2100 O  OD1   . ASP A 1 256 ? -45.346 -15.766 -48.201 1.00 70.54  ? 256 ASP A OD1   1 
ATOM   2101 O  OD2   . ASP A 1 256 ? -45.550 -16.865 -50.092 1.00 77.95  ? 256 ASP A OD2   1 
ATOM   2102 N  N     . ILE A 1 257 ? -43.854 -20.256 -46.165 1.00 58.03  ? 257 ILE A N     1 
ATOM   2103 C  CA    . ILE A 1 257 ? -43.879 -21.483 -45.375 1.00 58.44  ? 257 ILE A CA    1 
ATOM   2104 C  C     . ILE A 1 257 ? -43.439 -21.202 -43.944 1.00 59.02  ? 257 ILE A C     1 
ATOM   2105 O  O     . ILE A 1 257 ? -43.966 -21.789 -42.991 1.00 44.05  ? 257 ILE A O     1 
ATOM   2106 C  CB    . ILE A 1 257 ? -43.009 -22.567 -46.037 1.00 61.87  ? 257 ILE A CB    1 
ATOM   2107 C  CG1   . ILE A 1 257 ? -43.496 -22.851 -47.459 1.00 59.16  ? 257 ILE A CG1   1 
ATOM   2108 C  CG2   . ILE A 1 257 ? -43.032 -23.847 -45.216 1.00 57.90  ? 257 ILE A CG2   1 
ATOM   2109 C  CD1   . ILE A 1 257 ? -44.917 -23.362 -47.528 1.00 54.70  ? 257 ILE A CD1   1 
ATOM   2110 N  N     . CYS A 1 258 ? -42.474 -20.293 -43.770 1.00 60.63  ? 258 CYS A N     1 
ATOM   2111 C  CA    . CYS A 1 258 ? -42.012 -19.938 -42.431 1.00 52.04  ? 258 CYS A CA    1 
ATOM   2112 C  C     . CYS A 1 258 ? -43.152 -19.387 -41.584 1.00 54.37  ? 258 CYS A C     1 
ATOM   2113 O  O     . CYS A 1 258 ? -43.349 -19.806 -40.438 1.00 49.83  ? 258 CYS A O     1 
ATOM   2114 C  CB    . CYS A 1 258 ? -40.871 -18.922 -42.517 1.00 67.63  ? 258 CYS A CB    1 
ATOM   2115 S  SG    . CYS A 1 258 ? -39.280 -19.582 -43.069 1.00 70.62  ? 258 CYS A SG    1 
ATOM   2116 N  N     . LYS A 1 259 ? -43.917 -18.440 -42.135 1.00 55.23  ? 259 LYS A N     1 
ATOM   2117 C  CA    . LYS A 1 259 ? -45.037 -17.882 -41.384 1.00 60.04  ? 259 LYS A CA    1 
ATOM   2118 C  C     . LYS A 1 259 ? -46.184 -18.877 -41.264 1.00 50.52  ? 259 LYS A C     1 
ATOM   2119 O  O     . LYS A 1 259 ? -46.967 -18.802 -40.311 1.00 54.70  ? 259 LYS A O     1 
ATOM   2120 C  CB    . LYS A 1 259 ? -45.518 -16.582 -42.032 1.00 60.15  ? 259 LYS A CB    1 
ATOM   2121 C  CG    . LYS A 1 259 ? -45.974 -16.721 -43.473 1.00 81.28  ? 259 LYS A CG    1 
ATOM   2122 C  CD    . LYS A 1 259 ? -46.589 -15.425 -43.980 1.00 84.02  ? 259 LYS A CD    1 
ATOM   2123 C  CE    . LYS A 1 259 ? -47.018 -15.547 -45.433 1.00 94.69  ? 259 LYS A CE    1 
ATOM   2124 N  NZ    . LYS A 1 259 ? -47.786 -14.358 -45.895 1.00 99.04  ? 259 LYS A NZ    1 
ATOM   2125 N  N     . LEU A 1 260 ? -46.297 -19.813 -42.208 1.00 50.52  ? 260 LEU A N     1 
ATOM   2126 C  CA    . LEU A 1 260 ? -47.329 -20.840 -42.108 1.00 51.15  ? 260 LEU A CA    1 
ATOM   2127 C  C     . LEU A 1 260 ? -47.025 -21.808 -40.972 1.00 50.91  ? 260 LEU A C     1 
ATOM   2128 O  O     . LEU A 1 260 ? -47.879 -22.066 -40.117 1.00 45.67  ? 260 LEU A O     1 
ATOM   2129 C  CB    . LEU A 1 260 ? -47.458 -21.590 -43.435 1.00 56.34  ? 260 LEU A CB    1 
ATOM   2130 C  CG    . LEU A 1 260 ? -48.477 -22.731 -43.470 1.00 47.48  ? 260 LEU A CG    1 
ATOM   2131 C  CD1   . LEU A 1 260 ? -49.879 -22.206 -43.198 1.00 44.11  ? 260 LEU A CD1   1 
ATOM   2132 C  CD2   . LEU A 1 260 ? -48.424 -23.462 -44.802 1.00 48.82  ? 260 LEU A CD2   1 
ATOM   2133 N  N     . VAL A 1 261 ? -45.806 -22.351 -40.944 1.00 42.24  ? 261 VAL A N     1 
ATOM   2134 C  CA    . VAL A 1 261 ? -45.427 -23.280 -39.884 1.00 52.55  ? 261 VAL A CA    1 
ATOM   2135 C  C     . VAL A 1 261 ? -45.393 -22.570 -38.536 1.00 46.90  ? 261 VAL A C     1 
ATOM   2136 O  O     . VAL A 1 261 ? -45.765 -23.146 -37.506 1.00 43.33  ? 261 VAL A O     1 
ATOM   2137 C  CB    . VAL A 1 261 ? -44.076 -23.941 -40.214 1.00 50.73  ? 261 VAL A CB    1 
ATOM   2138 C  CG1   . VAL A 1 261 ? -43.644 -24.872 -39.090 1.00 44.81  ? 261 VAL A CG1   1 
ATOM   2139 C  CG2   . VAL A 1 261 ? -44.164 -24.699 -41.528 1.00 49.06  ? 261 VAL A CG2   1 
ATOM   2140 N  N     . GLY A 1 262 ? -44.954 -21.309 -38.521 1.00 44.92  ? 262 GLY A N     1 
ATOM   2141 C  CA    . GLY A 1 262 ? -44.901 -20.571 -37.270 1.00 43.44  ? 262 GLY A CA    1 
ATOM   2142 C  C     . GLY A 1 262 ? -46.265 -20.407 -36.627 1.00 48.15  ? 262 GLY A C     1 
ATOM   2143 O  O     . GLY A 1 262 ? -46.416 -20.579 -35.414 1.00 52.13  ? 262 GLY A O     1 
ATOM   2144 N  N     . LYS A 1 263 ? -47.281 -20.079 -37.429 1.00 43.57  ? 263 LYS A N     1 
ATOM   2145 C  CA    . LYS A 1 263 ? -48.629 -19.954 -36.887 1.00 41.32  ? 263 LYS A CA    1 
ATOM   2146 C  C     . LYS A 1 263 ? -49.218 -21.312 -36.527 1.00 40.91  ? 263 LYS A C     1 
ATOM   2147 O  O     . LYS A 1 263 ? -50.051 -21.401 -35.617 1.00 40.13  ? 263 LYS A O     1 
ATOM   2148 C  CB    . LYS A 1 263 ? -49.534 -19.222 -37.879 1.00 40.00  ? 263 LYS A CB    1 
ATOM   2149 C  CG    . LYS A 1 263 ? -49.142 -17.774 -38.112 1.00 48.36  ? 263 LYS A CG    1 
ATOM   2150 C  CD    . LYS A 1 263 ? -50.266 -16.992 -38.769 1.00 55.24  ? 263 LYS A CD    1 
ATOM   2151 C  CE    . LYS A 1 263 ? -49.926 -15.511 -38.845 1.00 39.35  ? 263 LYS A CE    1 
ATOM   2152 N  NZ    . LYS A 1 263 ? -51.074 -14.691 -39.315 1.00 53.00  ? 263 LYS A NZ    1 
ATOM   2153 N  N     . LEU A 1 264 ? -48.802 -22.375 -37.219 1.00 38.88  ? 264 LEU A N     1 
ATOM   2154 C  CA    . LEU A 1 264 ? -49.270 -23.711 -36.865 1.00 46.03  ? 264 LEU A CA    1 
ATOM   2155 C  C     . LEU A 1 264 ? -48.706 -24.155 -35.521 1.00 47.37  ? 264 LEU A C     1 
ATOM   2156 O  O     . LEU A 1 264 ? -49.435 -24.707 -34.689 1.00 37.85  ? 264 LEU A O     1 
ATOM   2157 C  CB    . LEU A 1 264 ? -48.896 -24.708 -37.963 1.00 42.47  ? 264 LEU A CB    1 
ATOM   2158 C  CG    . LEU A 1 264 ? -49.654 -24.579 -39.286 1.00 45.20  ? 264 LEU A CG    1 
ATOM   2159 C  CD1   . LEU A 1 264 ? -49.111 -25.557 -40.315 1.00 46.42  ? 264 LEU A CD1   1 
ATOM   2160 C  CD2   . LEU A 1 264 ? -51.146 -24.792 -39.075 1.00 43.33  ? 264 LEU A CD2   1 
ATOM   2161 N  N     . ASN A 1 265 ? -47.410 -23.924 -35.293 1.00 39.41  ? 265 ASN A N     1 
ATOM   2162 C  CA    . ASN A 1 265 ? -46.821 -24.235 -33.994 1.00 41.50  ? 265 ASN A CA    1 
ATOM   2163 C  C     . ASN A 1 265 ? -47.484 -23.428 -32.887 1.00 38.13  ? 265 ASN A C     1 
ATOM   2164 O  O     . ASN A 1 265 ? -47.710 -23.937 -31.784 1.00 40.79  ? 265 ASN A O     1 
ATOM   2165 C  CB    . ASN A 1 265 ? -45.316 -23.967 -34.018 1.00 38.36  ? 265 ASN A CB    1 
ATOM   2166 C  CG    . ASN A 1 265 ? -44.604 -24.734 -35.112 1.00 48.93  ? 265 ASN A CG    1 
ATOM   2167 O  OD1   . ASN A 1 265 ? -44.963 -25.868 -35.426 1.00 55.58  ? 265 ASN A OD1   1 
ATOM   2168 N  ND2   . ASN A 1 265 ? -43.590 -24.115 -35.706 1.00 56.19  ? 265 ASN A ND2   1 
ATOM   2169 N  N     . TRP A 1 266 ? -47.802 -22.162 -33.167 1.00 39.65  ? 266 TRP A N     1 
ATOM   2170 C  CA    . TRP A 1 266 ? -48.519 -21.341 -32.198 1.00 33.29  ? 266 TRP A CA    1 
ATOM   2171 C  C     . TRP A 1 266 ? -49.931 -21.860 -31.962 1.00 35.99  ? 266 TRP A C     1 
ATOM   2172 O  O     . TRP A 1 266 ? -50.448 -21.759 -30.844 1.00 37.60  ? 266 TRP A O     1 
ATOM   2173 C  CB    . TRP A 1 266 ? -48.548 -19.888 -32.676 1.00 25.90  ? 266 TRP A CB    1 
ATOM   2174 C  CG    . TRP A 1 266 ? -49.413 -18.984 -31.854 1.00 30.89  ? 266 TRP A CG    1 
ATOM   2175 C  CD1   . TRP A 1 266 ? -50.623 -18.463 -32.209 1.00 41.31  ? 266 TRP A CD1   1 
ATOM   2176 C  CD2   . TRP A 1 266 ? -49.133 -18.490 -30.539 1.00 37.31  ? 266 TRP A CD2   1 
ATOM   2177 N  NE1   . TRP A 1 266 ? -51.115 -17.676 -31.198 1.00 39.31  ? 266 TRP A NE1   1 
ATOM   2178 C  CE2   . TRP A 1 266 ? -50.219 -17.676 -30.160 1.00 38.31  ? 266 TRP A CE2   1 
ATOM   2179 C  CE3   . TRP A 1 266 ? -48.071 -18.655 -29.646 1.00 36.69  ? 266 TRP A CE3   1 
ATOM   2180 C  CZ2   . TRP A 1 266 ? -50.275 -17.032 -28.927 1.00 33.01  ? 266 TRP A CZ2   1 
ATOM   2181 C  CZ3   . TRP A 1 266 ? -48.127 -18.014 -28.421 1.00 41.56  ? 266 TRP A CZ3   1 
ATOM   2182 C  CH2   . TRP A 1 266 ? -49.221 -17.212 -28.073 1.00 36.96  ? 266 TRP A CH2   1 
ATOM   2183 N  N     . ALA A 1 267 ? -50.563 -22.424 -32.994 1.00 33.60  ? 267 ALA A N     1 
ATOM   2184 C  CA    . ALA A 1 267 ? -51.914 -22.949 -32.835 1.00 29.83  ? 267 ALA A CA    1 
ATOM   2185 C  C     . ALA A 1 267 ? -51.921 -24.283 -32.101 1.00 39.29  ? 267 ALA A C     1 
ATOM   2186 O  O     . ALA A 1 267 ? -52.907 -24.615 -31.433 1.00 29.92  ? 267 ALA A O     1 
ATOM   2187 C  CB    . ALA A 1 267 ? -52.584 -23.096 -34.201 1.00 37.82  ? 267 ALA A CB    1 
ATOM   2188 N  N     . SER A 1 268 ? -50.835 -25.052 -32.200 1.00 30.85  ? 268 SER A N     1 
ATOM   2189 C  CA    . SER A 1 268 ? -50.791 -26.388 -31.615 1.00 34.64  ? 268 SER A CA    1 
ATOM   2190 C  C     . SER A 1 268 ? -50.904 -26.381 -30.096 1.00 39.47  ? 268 SER A C     1 
ATOM   2191 O  O     . SER A 1 268 ? -51.110 -27.448 -29.506 1.00 32.76  ? 268 SER A O     1 
ATOM   2192 C  CB    . SER A 1 268 ? -49.500 -27.097 -32.031 1.00 36.11  ? 268 SER A CB    1 
ATOM   2193 O  OG    . SER A 1 268 ? -48.360 -26.396 -31.567 1.00 38.20  ? 268 SER A OG    1 
ATOM   2194 N  N     . GLN A 1 269 ? -50.784 -25.218 -29.450 1.00 30.83  ? 269 GLN A N     1 
ATOM   2195 C  CA    . GLN A 1 269 ? -50.869 -25.159 -27.995 1.00 23.96  ? 269 GLN A CA    1 
ATOM   2196 C  C     . GLN A 1 269 ? -52.275 -25.441 -27.480 1.00 29.91  ? 269 GLN A C     1 
ATOM   2197 O  O     . GLN A 1 269 ? -52.430 -25.779 -26.302 1.00 29.34  ? 269 GLN A O     1 
ATOM   2198 C  CB    . GLN A 1 269 ? -50.405 -23.791 -27.491 1.00 27.37  ? 269 GLN A CB    1 
ATOM   2199 C  CG    . GLN A 1 269 ? -51.323 -22.646 -27.884 1.00 30.66  ? 269 GLN A CG    1 
ATOM   2200 C  CD    . GLN A 1 269 ? -50.880 -21.318 -27.306 1.00 37.85  ? 269 GLN A CD    1 
ATOM   2201 O  OE1   . GLN A 1 269 ? -50.781 -21.160 -26.090 1.00 32.13  ? 269 GLN A OE1   1 
ATOM   2202 N  NE2   . GLN A 1 269 ? -50.605 -20.353 -28.179 1.00 29.82  ? 269 GLN A NE2   1 
ATOM   2203 N  N     . ILE A 1 270 ? -53.297 -25.312 -28.325 1.00 32.73  ? 270 ILE A N     1 
ATOM   2204 C  CA    . ILE A 1 270 ? -54.674 -25.524 -27.890 1.00 34.62  ? 270 ILE A CA    1 
ATOM   2205 C  C     . ILE A 1 270 ? -55.435 -26.295 -28.963 1.00 33.27  ? 270 ILE A C     1 
ATOM   2206 O  O     . ILE A 1 270 ? -56.466 -26.918 -28.682 1.00 34.30  ? 270 ILE A O     1 
ATOM   2207 C  CB    . ILE A 1 270 ? -55.360 -24.185 -27.556 1.00 30.43  ? 270 ILE A CB    1 
ATOM   2208 C  CG1   . ILE A 1 270 ? -56.712 -24.421 -26.877 1.00 36.81  ? 270 ILE A CG1   1 
ATOM   2209 C  CG2   . ILE A 1 270 ? -55.514 -23.331 -28.805 1.00 36.63  ? 270 ILE A CG2   1 
ATOM   2210 C  CD1   . ILE A 1 270 ? -56.628 -25.287 -25.636 1.00 34.69  ? 270 ILE A CD1   1 
ATOM   2211 N  N     . TYR A 1 271 ? -54.930 -26.273 -30.195 1.00 31.97  ? 271 TYR A N     1 
ATOM   2212 C  CA    . TYR A 1 271 ? -55.535 -27.041 -31.277 1.00 33.92  ? 271 TYR A CA    1 
ATOM   2213 C  C     . TYR A 1 271 ? -54.882 -28.415 -31.356 1.00 38.70  ? 271 TYR A C     1 
ATOM   2214 O  O     . TYR A 1 271 ? -53.674 -28.499 -31.616 1.00 40.82  ? 271 TYR A O     1 
ATOM   2215 C  CB    . TYR A 1 271 ? -55.387 -26.319 -32.606 1.00 36.40  ? 271 TYR A CB    1 
ATOM   2216 C  CG    . TYR A 1 271 ? -56.338 -25.157 -32.786 1.00 42.21  ? 271 TYR A CG    1 
ATOM   2217 C  CD1   . TYR A 1 271 ? -57.604 -25.349 -33.329 1.00 41.08  ? 271 TYR A CD1   1 
ATOM   2218 C  CD2   . TYR A 1 271 ? -55.969 -23.868 -32.422 1.00 43.97  ? 271 TYR A CD2   1 
ATOM   2219 C  CE1   . TYR A 1 271 ? -58.477 -24.292 -33.499 1.00 48.66  ? 271 TYR A CE1   1 
ATOM   2220 C  CE2   . TYR A 1 271 ? -56.835 -22.803 -32.588 1.00 37.69  ? 271 TYR A CE2   1 
ATOM   2221 C  CZ    . TYR A 1 271 ? -58.087 -23.021 -33.127 1.00 51.37  ? 271 TYR A CZ    1 
ATOM   2222 O  OH    . TYR A 1 271 ? -58.951 -21.964 -33.294 1.00 52.56  ? 271 TYR A OH    1 
ATOM   2223 N  N     . PRO A 1 272 ? -55.620 -29.499 -31.142 1.00 38.72  ? 272 PRO A N     1 
ATOM   2224 C  CA    . PRO A 1 272 ? -55.011 -30.830 -31.185 1.00 33.40  ? 272 PRO A CA    1 
ATOM   2225 C  C     . PRO A 1 272 ? -54.855 -31.352 -32.606 1.00 40.21  ? 272 PRO A C     1 
ATOM   2226 O  O     . PRO A 1 272 ? -55.655 -31.062 -33.499 1.00 41.91  ? 272 PRO A O     1 
ATOM   2227 C  CB    . PRO A 1 272 ? -56.003 -31.689 -30.392 1.00 40.61  ? 272 PRO A CB    1 
ATOM   2228 C  CG    . PRO A 1 272 ? -57.319 -31.031 -30.641 1.00 42.74  ? 272 PRO A CG    1 
ATOM   2229 C  CD    . PRO A 1 272 ? -57.036 -29.549 -30.733 1.00 39.28  ? 272 PRO A CD    1 
ATOM   2230 N  N     . GLY A 1 273 ? -53.796 -32.136 -32.802 1.00 36.17  ? 273 GLY A N     1 
ATOM   2231 C  CA    . GLY A 1 273 ? -53.561 -32.826 -34.055 1.00 38.41  ? 273 GLY A CA    1 
ATOM   2232 C  C     . GLY A 1 273 ? -52.795 -32.056 -35.108 1.00 40.90  ? 273 GLY A C     1 
ATOM   2233 O  O     . GLY A 1 273 ? -52.812 -32.460 -36.276 1.00 47.23  ? 273 GLY A O     1 
ATOM   2234 N  N     . ILE A 1 274 ? -52.122 -30.967 -34.740 1.00 42.17  ? 274 ILE A N     1 
ATOM   2235 C  CA    . ILE A 1 274 ? -51.389 -30.171 -35.718 1.00 31.58  ? 274 ILE A CA    1 
ATOM   2236 C  C     . ILE A 1 274 ? -50.143 -30.928 -36.159 1.00 42.15  ? 274 ILE A C     1 
ATOM   2237 O  O     . ILE A 1 274 ? -49.404 -31.478 -35.332 1.00 35.52  ? 274 ILE A O     1 
ATOM   2238 C  CB    . ILE A 1 274 ? -51.031 -28.797 -35.132 1.00 44.58  ? 274 ILE A CB    1 
ATOM   2239 C  CG1   . ILE A 1 274 ? -52.301 -28.027 -34.762 1.00 39.08  ? 274 ILE A CG1   1 
ATOM   2240 C  CG2   . ILE A 1 274 ? -50.193 -27.990 -36.112 1.00 36.13  ? 274 ILE A CG2   1 
ATOM   2241 C  CD1   . ILE A 1 274 ? -53.182 -27.690 -35.945 1.00 41.08  ? 274 ILE A CD1   1 
ATOM   2242 N  N     . LYS A 1 275 ? -49.904 -30.959 -37.470 1.00 46.52  ? 275 LYS A N     1 
ATOM   2243 C  CA    . LYS A 1 275 ? -48.735 -31.603 -38.053 1.00 36.03  ? 275 LYS A CA    1 
ATOM   2244 C  C     . LYS A 1 275 ? -48.032 -30.629 -38.986 1.00 40.52  ? 275 LYS A C     1 
ATOM   2245 O  O     . LYS A 1 275 ? -48.685 -29.886 -39.726 1.00 46.95  ? 275 LYS A O     1 
ATOM   2246 C  CB    . LYS A 1 275 ? -49.121 -32.877 -38.817 1.00 47.87  ? 275 LYS A CB    1 
ATOM   2247 C  CG    . LYS A 1 275 ? -49.250 -34.112 -37.938 1.00 52.78  ? 275 LYS A CG    1 
ATOM   2248 C  CD    . LYS A 1 275 ? -50.583 -34.805 -38.149 1.00 49.55  ? 275 LYS A CD    1 
ATOM   2249 C  CE    . LYS A 1 275 ? -50.735 -35.298 -39.578 1.00 42.91  ? 275 LYS A CE    1 
ATOM   2250 N  NZ    . LYS A 1 275 ? -52.156 -35.627 -39.886 1.00 62.17  ? 275 LYS A NZ    1 
ATOM   2251 N  N     . VAL A 1 276 ? -46.698 -30.627 -38.945 1.00 39.20  ? 276 VAL A N     1 
ATOM   2252 C  CA    . VAL A 1 276 ? -45.906 -29.694 -39.742 1.00 44.74  ? 276 VAL A CA    1 
ATOM   2253 C  C     . VAL A 1 276 ? -44.699 -30.389 -40.361 1.00 46.50  ? 276 VAL A C     1 
ATOM   2254 O  O     . VAL A 1 276 ? -43.791 -29.726 -40.873 1.00 45.53  ? 276 VAL A O     1 
ATOM   2255 C  CB    . VAL A 1 276 ? -45.442 -28.489 -38.899 1.00 49.85  ? 276 VAL A CB    1 
ATOM   2256 C  CG1   . VAL A 1 276 ? -46.630 -27.687 -38.380 1.00 41.43  ? 276 VAL A CG1   1 
ATOM   2257 C  CG2   . VAL A 1 276 ? -44.556 -28.954 -37.754 1.00 39.86  ? 276 VAL A CG2   1 
ATOM   2258 N  N     . ARG A 1 277 ? -44.673 -31.725 -40.321 1.00 46.67  ? 277 ARG A N     1 
ATOM   2259 C  CA    . ARG A 1 277 ? -43.522 -32.456 -40.850 1.00 49.45  ? 277 ARG A CA    1 
ATOM   2260 C  C     . ARG A 1 277 ? -43.358 -32.225 -42.347 1.00 47.86  ? 277 ARG A C     1 
ATOM   2261 O  O     . ARG A 1 277 ? -42.270 -31.872 -42.817 1.00 60.06  ? 277 ARG A O     1 
ATOM   2262 C  CB    . ARG A 1 277 ? -43.663 -33.950 -40.557 1.00 52.46  ? 277 ARG A CB    1 
ATOM   2263 C  CG    . ARG A 1 277 ? -42.823 -34.852 -41.452 1.00 51.55  ? 277 ARG A CG    1 
ATOM   2264 C  CD    . ARG A 1 277 ? -41.359 -34.873 -41.038 1.00 51.21  ? 277 ARG A CD    1 
ATOM   2265 N  NE    . ARG A 1 277 ? -41.160 -35.531 -39.750 1.00 55.45  ? 277 ARG A NE    1 
ATOM   2266 C  CZ    . ARG A 1 277 ? -40.809 -34.902 -38.634 1.00 56.47  ? 277 ARG A CZ    1 
ATOM   2267 N  NH1   . ARG A 1 277 ? -40.608 -33.591 -38.646 1.00 62.09  ? 277 ARG A NH1   1 
ATOM   2268 N  NH2   . ARG A 1 277 ? -40.651 -35.584 -37.507 1.00 51.31  ? 277 ARG A NH2   1 
ATOM   2269 N  N     . GLN A 1 278 ? -44.430 -32.425 -43.115 1.00 45.66  ? 278 GLN A N     1 
ATOM   2270 C  CA    . GLN A 1 278 ? -44.322 -32.313 -44.565 1.00 54.27  ? 278 GLN A CA    1 
ATOM   2271 C  C     . GLN A 1 278 ? -44.121 -30.870 -45.009 1.00 63.24  ? 278 GLN A C     1 
ATOM   2272 O  O     . GLN A 1 278 ? -43.485 -30.625 -46.041 1.00 61.67  ? 278 GLN A O     1 
ATOM   2273 C  CB    . GLN A 1 278 ? -45.558 -32.916 -45.230 1.00 61.03  ? 278 GLN A CB    1 
ATOM   2274 C  CG    . GLN A 1 278 ? -45.804 -34.374 -44.866 1.00 55.05  ? 278 GLN A CG    1 
ATOM   2275 C  CD    . GLN A 1 278 ? -44.637 -35.277 -45.225 1.00 57.15  ? 278 GLN A CD    1 
ATOM   2276 O  OE1   . GLN A 1 278 ? -43.880 -34.999 -46.156 1.00 60.10  ? 278 GLN A OE1   1 
ATOM   2277 N  NE2   . GLN A 1 278 ? -44.483 -36.367 -44.480 1.00 57.17  ? 278 GLN A NE2   1 
ATOM   2278 N  N     . LEU A 1 279 ? -44.648 -29.907 -44.251 1.00 55.37  ? 279 LEU A N     1 
ATOM   2279 C  CA    . LEU A 1 279 ? -44.423 -28.507 -44.592 1.00 53.17  ? 279 LEU A CA    1 
ATOM   2280 C  C     . LEU A 1 279 ? -43.012 -28.064 -44.229 1.00 54.93  ? 279 LEU A C     1 
ATOM   2281 O  O     . LEU A 1 279 ? -42.420 -27.242 -44.937 1.00 63.60  ? 279 LEU A O     1 
ATOM   2282 C  CB    . LEU A 1 279 ? -45.458 -27.623 -43.898 1.00 48.38  ? 279 LEU A CB    1 
ATOM   2283 C  CG    . LEU A 1 279 ? -46.910 -27.861 -44.315 1.00 51.57  ? 279 LEU A CG    1 
ATOM   2284 C  CD1   . LEU A 1 279 ? -47.859 -27.026 -43.468 1.00 57.39  ? 279 LEU A CD1   1 
ATOM   2285 C  CD2   . LEU A 1 279 ? -47.100 -27.560 -45.793 1.00 60.60  ? 279 LEU A CD2   1 
ATOM   2286 N  N     . SER A 1 280 ? -42.454 -28.599 -43.142 1.00 52.80  ? 280 SER A N     1 
ATOM   2287 C  CA    . SER A 1 280 ? -41.091 -28.255 -42.755 1.00 57.60  ? 280 SER A CA    1 
ATOM   2288 C  C     . SER A 1 280 ? -40.053 -28.926 -43.646 1.00 64.96  ? 280 SER A C     1 
ATOM   2289 O  O     . SER A 1 280 ? -38.955 -28.385 -43.821 1.00 65.79  ? 280 SER A O     1 
ATOM   2290 C  CB    . SER A 1 280 ? -40.845 -28.635 -41.294 1.00 54.69  ? 280 SER A CB    1 
ATOM   2291 O  OG    . SER A 1 280 ? -41.745 -27.955 -40.433 1.00 54.38  ? 280 SER A OG    1 
ATOM   2292 N  N     . LYS A 1 281 ? -40.374 -30.096 -44.207 1.00 65.89  ? 281 LYS A N     1 
ATOM   2293 C  CA    . LYS A 1 281 ? -39.439 -30.768 -45.104 1.00 67.94  ? 281 LYS A CA    1 
ATOM   2294 C  C     . LYS A 1 281 ? -39.182 -29.949 -46.361 1.00 66.77  ? 281 LYS A C     1 
ATOM   2295 O  O     . LYS A 1 281 ? -38.087 -30.014 -46.933 1.00 76.64  ? 281 LYS A O     1 
ATOM   2296 C  CB    . LYS A 1 281 ? -39.970 -32.154 -45.474 1.00 70.54  ? 281 LYS A CB    1 
ATOM   2297 C  CG    . LYS A 1 281 ? -39.016 -32.983 -46.324 1.00 82.86  ? 281 LYS A CG    1 
ATOM   2298 C  CD    . LYS A 1 281 ? -39.691 -34.237 -46.855 1.00 86.72  ? 281 LYS A CD    1 
ATOM   2299 C  CE    . LYS A 1 281 ? -40.168 -35.134 -45.726 1.00 79.67  ? 281 LYS A CE    1 
ATOM   2300 N  NZ    . LYS A 1 281 ? -40.807 -36.375 -46.244 1.00 70.78  ? 281 LYS A NZ    1 
ATOM   2301 N  N     . LEU A 1 282 ? -40.170 -29.167 -46.802 1.00 68.10  ? 282 LEU A N     1 
ATOM   2302 C  CA    . LEU A 1 282 ? -40.015 -28.333 -47.987 1.00 69.19  ? 282 LEU A CA    1 
ATOM   2303 C  C     . LEU A 1 282 ? -38.963 -27.246 -47.813 1.00 64.76  ? 282 LEU A C     1 
ATOM   2304 O  O     . LEU A 1 282 ? -38.610 -26.587 -48.797 1.00 70.64  ? 282 LEU A O     1 
ATOM   2305 C  CB    . LEU A 1 282 ? -41.359 -27.695 -48.355 1.00 64.17  ? 282 LEU A CB    1 
ATOM   2306 C  CG    . LEU A 1 282 ? -42.255 -28.417 -49.366 1.00 57.75  ? 282 LEU A CG    1 
ATOM   2307 C  CD1   . LEU A 1 282 ? -42.430 -29.886 -49.015 1.00 72.08  ? 282 LEU A CD1   1 
ATOM   2308 C  CD2   . LEU A 1 282 ? -43.607 -27.725 -49.460 1.00 60.51  ? 282 LEU A CD2   1 
ATOM   2309 N  N     . LEU A 1 283 ? -38.453 -27.044 -46.601 1.00 62.92  ? 283 LEU A N     1 
ATOM   2310 C  CA    . LEU A 1 283 ? -37.472 -26.006 -46.318 1.00 69.48  ? 283 LEU A CA    1 
ATOM   2311 C  C     . LEU A 1 283 ? -36.036 -26.509 -46.379 1.00 74.65  ? 283 LEU A C     1 
ATOM   2312 O  O     . LEU A 1 283 ? -35.110 -25.719 -46.166 1.00 69.99  ? 283 LEU A O     1 
ATOM   2313 C  CB    . LEU A 1 283 ? -37.743 -25.400 -44.940 1.00 69.60  ? 283 LEU A CB    1 
ATOM   2314 C  CG    . LEU A 1 283 ? -39.177 -24.917 -44.731 1.00 70.40  ? 283 LEU A CG    1 
ATOM   2315 C  CD1   . LEU A 1 283 ? -39.496 -24.839 -43.249 1.00 60.59  ? 283 LEU A CD1   1 
ATOM   2316 C  CD2   . LEU A 1 283 ? -39.387 -23.572 -45.409 1.00 64.52  ? 283 LEU A CD2   1 
ATOM   2317 N  N     . ARG A 1 284 ? -35.827 -27.792 -46.659 1.00 69.84  ? 284 ARG A N     1 
ATOM   2318 C  CA    . ARG A 1 284 ? -34.479 -28.341 -46.685 1.00 72.16  ? 284 ARG A CA    1 
ATOM   2319 C  C     . ARG A 1 284 ? -33.739 -27.896 -47.940 1.00 72.79  ? 284 ARG A C     1 
ATOM   2320 O  O     . ARG A 1 284 ? -34.291 -27.905 -49.044 1.00 70.68  ? 284 ARG A O     1 
ATOM   2321 C  CB    . ARG A 1 284 ? -34.527 -29.867 -46.614 1.00 70.10  ? 284 ARG A CB    1 
ATOM   2322 C  CG    . ARG A 1 284 ? -35.218 -30.404 -45.372 1.00 71.53  ? 284 ARG A CG    1 
ATOM   2323 C  CD    . ARG A 1 284 ? -35.311 -31.920 -45.400 1.00 74.81  ? 284 ARG A CD    1 
ATOM   2324 N  NE    . ARG A 1 284 ? -35.997 -32.447 -44.223 1.00 87.03  ? 284 ARG A NE    1 
ATOM   2325 C  CZ    . ARG A 1 284 ? -36.227 -33.738 -44.008 1.00 91.65  ? 284 ARG A CZ    1 
ATOM   2326 N  NH1   . ARG A 1 284 ? -35.824 -34.641 -44.892 1.00 86.41  ? 284 ARG A NH1   1 
ATOM   2327 N  NH2   . ARG A 1 284 ? -36.860 -34.128 -42.910 1.00 87.22  ? 284 ARG A NH2   1 
ATOM   2328 N  N     . GLY A 1 285 ? -32.479 -27.503 -47.764 1.00 74.22  ? 285 GLY A N     1 
ATOM   2329 C  CA    . GLY A 1 285 ? -31.644 -27.085 -48.871 1.00 78.49  ? 285 GLY A CA    1 
ATOM   2330 C  C     . GLY A 1 285 ? -31.949 -25.719 -49.442 1.00 77.05  ? 285 GLY A C     1 
ATOM   2331 O  O     . GLY A 1 285 ? -31.236 -25.276 -50.349 1.00 84.81  ? 285 GLY A O     1 
ATOM   2332 N  N     . THR A 1 286 ? -32.978 -25.035 -48.947 1.00 79.57  ? 286 THR A N     1 
ATOM   2333 C  CA    . THR A 1 286 ? -33.328 -23.725 -49.470 1.00 80.53  ? 286 THR A CA    1 
ATOM   2334 C  C     . THR A 1 286 ? -32.261 -22.695 -49.105 1.00 90.17  ? 286 THR A C     1 
ATOM   2335 O  O     . THR A 1 286 ? -31.450 -22.891 -48.196 1.00 92.52  ? 286 THR A O     1 
ATOM   2336 C  CB    . THR A 1 286 ? -34.689 -23.278 -48.936 1.00 82.28  ? 286 THR A CB    1 
ATOM   2337 O  OG1   . THR A 1 286 ? -34.618 -23.119 -47.514 1.00 95.02  ? 286 THR A OG1   1 
ATOM   2338 C  CG2   . THR A 1 286 ? -35.752 -24.310 -49.270 1.00 76.00  ? 286 THR A CG2   1 
ATOM   2339 N  N     . LYS A 1 287 ? -32.271 -21.580 -49.836 1.00 91.21  ? 287 LYS A N     1 
ATOM   2340 C  CA    . LYS A 1 287 ? -31.277 -20.528 -49.653 1.00 91.03  ? 287 LYS A CA    1 
ATOM   2341 C  C     . LYS A 1 287 ? -31.900 -19.233 -49.151 1.00 87.25  ? 287 LYS A C     1 
ATOM   2342 O  O     . LYS A 1 287 ? -31.604 -18.810 -48.029 1.00 91.62  ? 287 LYS A O     1 
ATOM   2343 C  CB    . LYS A 1 287 ? -30.520 -20.290 -50.967 1.00 88.05  ? 287 LYS A CB    1 
ATOM   2344 C  CG    . LYS A 1 287 ? -29.881 -21.541 -51.550 1.00 97.02  ? 287 LYS A CG    1 
ATOM   2345 C  CD    . LYS A 1 287 ? -28.869 -22.149 -50.591 1.00 102.18 ? 287 LYS A CD    1 
ATOM   2346 C  CE    . LYS A 1 287 ? -27.681 -21.224 -50.379 1.00 102.72 ? 287 LYS A CE    1 
ATOM   2347 N  NZ    . LYS A 1 287 ? -26.929 -20.988 -51.642 1.00 89.23  ? 287 LYS A NZ    1 
ATOM   2348 N  N     . ALA A 1 288 ? -32.753 -18.589 -49.942 1.00 82.31  ? 288 ALA A N     1 
ATOM   2349 C  CA    . ALA A 1 288 ? -33.332 -17.302 -49.593 1.00 81.34  ? 288 ALA A CA    1 
ATOM   2350 C  C     . ALA A 1 288 ? -34.816 -17.444 -49.278 1.00 71.16  ? 288 ALA A C     1 
ATOM   2351 O  O     . ALA A 1 288 ? -35.452 -18.452 -49.597 1.00 67.39  ? 288 ALA A O     1 
ATOM   2352 C  CB    . ALA A 1 288 ? -33.133 -16.286 -50.724 1.00 78.89  ? 288 ALA A CB    1 
ATOM   2353 N  N     . LEU A 1 289 ? -35.363 -16.403 -48.645 1.00 73.32  ? 289 LEU A N     1 
ATOM   2354 C  CA    . LEU A 1 289 ? -36.772 -16.418 -48.267 1.00 69.84  ? 289 LEU A CA    1 
ATOM   2355 C  C     . LEU A 1 289 ? -37.685 -16.279 -49.478 1.00 71.62  ? 289 LEU A C     1 
ATOM   2356 O  O     . LEU A 1 289 ? -38.835 -16.729 -49.439 1.00 72.07  ? 289 LEU A O     1 
ATOM   2357 C  CB    . LEU A 1 289 ? -37.066 -15.303 -47.259 1.00 66.08  ? 289 LEU A CB    1 
ATOM   2358 C  CG    . LEU A 1 289 ? -36.351 -15.308 -45.903 1.00 72.25  ? 289 LEU A CG    1 
ATOM   2359 C  CD1   . LEU A 1 289 ? -36.254 -16.720 -45.337 1.00 74.76  ? 289 LEU A CD1   1 
ATOM   2360 C  CD2   . LEU A 1 289 ? -34.976 -14.648 -45.978 1.00 60.35  ? 289 LEU A CD2   1 
ATOM   2361 N  N     . THR A 1 290 ? -37.198 -15.663 -50.555 1.00 72.01  ? 290 THR A N     1 
ATOM   2362 C  CA    . THR A 1 290 ? -38.009 -15.432 -51.744 1.00 80.24  ? 290 THR A CA    1 
ATOM   2363 C  C     . THR A 1 290 ? -38.120 -16.658 -52.641 1.00 72.84  ? 290 THR A C     1 
ATOM   2364 O  O     . THR A 1 290 ? -38.712 -16.558 -53.722 1.00 75.67  ? 290 THR A O     1 
ATOM   2365 C  CB    . THR A 1 290 ? -37.441 -14.262 -52.552 1.00 82.20  ? 290 THR A CB    1 
ATOM   2366 O  OG1   . THR A 1 290 ? -36.103 -14.567 -52.966 1.00 79.23  ? 290 THR A OG1   1 
ATOM   2367 C  CG2   . THR A 1 290 ? -37.430 -12.992 -51.715 1.00 61.08  ? 290 THR A CG2   1 
ATOM   2368 N  N     . GLU A 1 291 ? -37.575 -17.800 -52.230 1.00 76.25  ? 291 GLU A N     1 
ATOM   2369 C  CA    . GLU A 1 291 ? -37.627 -19.010 -53.045 1.00 75.22  ? 291 GLU A CA    1 
ATOM   2370 C  C     . GLU A 1 291 ? -39.054 -19.541 -53.095 1.00 75.47  ? 291 GLU A C     1 
ATOM   2371 O  O     . GLU A 1 291 ? -39.577 -20.030 -52.089 1.00 87.42  ? 291 GLU A O     1 
ATOM   2372 C  CB    . GLU A 1 291 ? -36.685 -20.072 -52.488 1.00 77.82  ? 291 GLU A CB    1 
ATOM   2373 C  CG    . GLU A 1 291 ? -35.220 -19.872 -52.815 1.00 90.68  ? 291 GLU A CG    1 
ATOM   2374 C  CD    . GLU A 1 291 ? -34.420 -21.148 -52.635 1.00 88.57  ? 291 GLU A CD    1 
ATOM   2375 O  OE1   . GLU A 1 291 ? -34.969 -22.117 -52.069 1.00 84.58  ? 291 GLU A OE1   1 
ATOM   2376 O  OE2   . GLU A 1 291 ? -33.248 -21.186 -53.065 1.00 99.89  ? 291 GLU A OE2   1 
ATOM   2377 N  N     . VAL A 1 292 ? -39.686 -19.453 -54.266 1.00 65.80  ? 292 VAL A N     1 
ATOM   2378 C  CA    . VAL A 1 292 ? -40.974 -20.105 -54.464 1.00 77.19  ? 292 VAL A CA    1 
ATOM   2379 C  C     . VAL A 1 292 ? -40.767 -21.614 -54.480 1.00 78.79  ? 292 VAL A C     1 
ATOM   2380 O  O     . VAL A 1 292 ? -39.787 -22.120 -55.044 1.00 82.55  ? 292 VAL A O     1 
ATOM   2381 C  CB    . VAL A 1 292 ? -41.639 -19.605 -55.758 1.00 79.33  ? 292 VAL A CB    1 
ATOM   2382 C  CG1   . VAL A 1 292 ? -40.721 -19.814 -56.956 1.00 93.84  ? 292 VAL A CG1   1 
ATOM   2383 C  CG2   . VAL A 1 292 ? -42.977 -20.297 -55.977 1.00 74.16  ? 292 VAL A CG2   1 
ATOM   2384 N  N     . ILE A 1 293 ? -41.676 -22.342 -53.838 1.00 78.16  ? 293 ILE A N     1 
ATOM   2385 C  CA    . ILE A 1 293 ? -41.513 -23.784 -53.671 1.00 79.52  ? 293 ILE A CA    1 
ATOM   2386 C  C     . ILE A 1 293 ? -42.805 -24.508 -54.029 1.00 77.27  ? 293 ILE A C     1 
ATOM   2387 O  O     . ILE A 1 293 ? -43.882 -24.139 -53.539 1.00 76.01  ? 293 ILE A O     1 
ATOM   2388 C  CB    . ILE A 1 293 ? -41.072 -24.126 -52.240 1.00 73.44  ? 293 ILE A CB    1 
ATOM   2389 C  CG1   . ILE A 1 293 ? -39.629 -23.678 -52.009 1.00 76.14  ? 293 ILE A CG1   1 
ATOM   2390 C  CG2   . ILE A 1 293 ? -41.222 -25.616 -51.970 1.00 80.28  ? 293 ILE A CG2   1 
ATOM   2391 C  CD1   . ILE A 1 293 ? -39.089 -24.067 -50.663 1.00 78.04  ? 293 ILE A CD1   1 
ATOM   2392 N  N     . PRO A 1 294 ? -42.748 -25.535 -54.875 1.00 78.98  ? 294 PRO A N     1 
ATOM   2393 C  CA    . PRO A 1 294 ? -43.949 -26.327 -55.159 1.00 81.69  ? 294 PRO A CA    1 
ATOM   2394 C  C     . PRO A 1 294 ? -44.281 -27.262 -54.006 1.00 77.64  ? 294 PRO A C     1 
ATOM   2395 O  O     . PRO A 1 294 ? -43.406 -27.920 -53.438 1.00 60.08  ? 294 PRO A O     1 
ATOM   2396 C  CB    . PRO A 1 294 ? -43.562 -27.112 -56.418 1.00 82.57  ? 294 PRO A CB    1 
ATOM   2397 C  CG    . PRO A 1 294 ? -42.078 -27.251 -56.316 1.00 87.92  ? 294 PRO A CG    1 
ATOM   2398 C  CD    . PRO A 1 294 ? -41.584 -25.987 -55.657 1.00 77.49  ? 294 PRO A CD    1 
ATOM   2399 N  N     . LEU A 1 295 ? -45.565 -27.314 -53.663 1.00 68.35  ? 295 LEU A N     1 
ATOM   2400 C  CA    . LEU A 1 295 ? -46.025 -28.173 -52.581 1.00 72.25  ? 295 LEU A CA    1 
ATOM   2401 C  C     . LEU A 1 295 ? -46.184 -29.605 -53.074 1.00 79.33  ? 295 LEU A C     1 
ATOM   2402 O  O     . LEU A 1 295 ? -46.765 -29.846 -54.137 1.00 87.13  ? 295 LEU A O     1 
ATOM   2403 C  CB    . LEU A 1 295 ? -47.349 -27.660 -52.015 1.00 62.88  ? 295 LEU A CB    1 
ATOM   2404 C  CG    . LEU A 1 295 ? -47.276 -26.830 -50.732 1.00 56.21  ? 295 LEU A CG    1 
ATOM   2405 C  CD1   . LEU A 1 295 ? -46.451 -25.570 -50.939 1.00 69.05  ? 295 LEU A CD1   1 
ATOM   2406 C  CD2   . LEU A 1 295 ? -48.674 -26.488 -50.238 1.00 58.25  ? 295 LEU A CD2   1 
ATOM   2407 N  N     . THR A 1 296 ? -45.665 -30.553 -52.300 1.00 66.16  ? 296 THR A N     1 
ATOM   2408 C  CA    . THR A 1 296 ? -45.818 -31.962 -52.616 1.00 71.97  ? 296 THR A CA    1 
ATOM   2409 C  C     . THR A 1 296 ? -47.224 -32.435 -52.251 1.00 80.06  ? 296 THR A C     1 
ATOM   2410 O  O     . THR A 1 296 ? -48.003 -31.723 -51.612 1.00 76.50  ? 296 THR A O     1 
ATOM   2411 C  CB    . THR A 1 296 ? -44.765 -32.792 -51.882 1.00 75.69  ? 296 THR A CB    1 
ATOM   2412 O  OG1   . THR A 1 296 ? -44.947 -32.654 -50.467 1.00 69.57  ? 296 THR A OG1   1 
ATOM   2413 C  CG2   . THR A 1 296 ? -43.366 -32.323 -52.251 1.00 63.19  ? 296 THR A CG2   1 
ATOM   2414 N  N     . GLU A 1 297 ? -47.551 -33.659 -52.675 1.00 80.88  ? 297 GLU A N     1 
ATOM   2415 C  CA    . GLU A 1 297 ? -48.863 -34.219 -52.364 1.00 82.19  ? 297 GLU A CA    1 
ATOM   2416 C  C     . GLU A 1 297 ? -49.059 -34.365 -50.860 1.00 79.78  ? 297 GLU A C     1 
ATOM   2417 O  O     . GLU A 1 297 ? -50.136 -34.061 -50.333 1.00 74.46  ? 297 GLU A O     1 
ATOM   2418 C  CB    . GLU A 1 297 ? -49.041 -35.569 -53.058 1.00 94.37  ? 297 GLU A CB    1 
ATOM   2419 C  CG    . GLU A 1 297 ? -49.315 -35.476 -54.548 1.00 109.91 ? 297 GLU A CG    1 
ATOM   2420 C  CD    . GLU A 1 297 ? -49.579 -36.831 -55.179 1.00 111.99 ? 297 GLU A CD    1 
ATOM   2421 O  OE1   . GLU A 1 297 ? -49.542 -37.845 -54.451 1.00 97.96  ? 297 GLU A OE1   1 
ATOM   2422 O  OE2   . GLU A 1 297 ? -49.825 -36.880 -56.403 1.00 111.72 ? 297 GLU A OE2   1 
ATOM   2423 N  N     . GLU A 1 298 ? -48.027 -34.829 -50.152 1.00 75.56  ? 298 GLU A N     1 
ATOM   2424 C  CA    . GLU A 1 298 ? -48.125 -34.968 -48.703 1.00 76.88  ? 298 GLU A CA    1 
ATOM   2425 C  C     . GLU A 1 298 ? -48.208 -33.607 -48.021 1.00 73.67  ? 298 GLU A C     1 
ATOM   2426 O  O     . GLU A 1 298 ? -48.982 -33.429 -47.073 1.00 66.26  ? 298 GLU A O     1 
ATOM   2427 C  CB    . GLU A 1 298 ? -46.935 -35.768 -48.170 1.00 72.79  ? 298 GLU A CB    1 
ATOM   2428 C  CG    . GLU A 1 298 ? -45.605 -35.421 -48.823 1.00 89.16  ? 298 GLU A CG    1 
ATOM   2429 C  CD    . GLU A 1 298 ? -45.326 -36.252 -50.063 1.00 96.79  ? 298 GLU A CD    1 
ATOM   2430 O  OE1   . GLU A 1 298 ? -44.756 -37.355 -49.925 1.00 97.59  ? 298 GLU A OE1   1 
ATOM   2431 O  OE2   . GLU A 1 298 ? -45.688 -35.807 -51.173 1.00 84.95  ? 298 GLU A OE2   1 
ATOM   2432 N  N     . ALA A 1 299 ? -47.420 -32.635 -48.489 1.00 70.04  ? 299 ALA A N     1 
ATOM   2433 C  CA    . ALA A 1 299 ? -47.480 -31.296 -47.912 1.00 63.55  ? 299 ALA A CA    1 
ATOM   2434 C  C     . ALA A 1 299 ? -48.815 -30.627 -48.209 1.00 63.62  ? 299 ALA A C     1 
ATOM   2435 O  O     . ALA A 1 299 ? -49.366 -29.920 -47.357 1.00 56.49  ? 299 ALA A O     1 
ATOM   2436 C  CB    . ALA A 1 299 ? -46.324 -30.444 -48.435 1.00 66.45  ? 299 ALA A CB    1 
ATOM   2437 N  N     . GLU A 1 300 ? -49.351 -30.837 -49.413 1.00 68.89  ? 300 GLU A N     1 
ATOM   2438 C  CA    . GLU A 1 300 ? -50.661 -30.288 -49.745 1.00 63.15  ? 300 GLU A CA    1 
ATOM   2439 C  C     . GLU A 1 300 ? -51.755 -30.934 -48.905 1.00 63.03  ? 300 GLU A C     1 
ATOM   2440 O  O     . GLU A 1 300 ? -52.723 -30.270 -48.515 1.00 60.09  ? 300 GLU A O     1 
ATOM   2441 C  CB    . GLU A 1 300 ? -50.942 -30.479 -51.235 1.00 77.72  ? 300 GLU A CB    1 
ATOM   2442 C  CG    . GLU A 1 300 ? -52.204 -29.800 -51.738 1.00 85.36  ? 300 GLU A CG    1 
ATOM   2443 C  CD    . GLU A 1 300 ? -52.448 -30.051 -53.215 1.00 103.71 ? 300 GLU A CD    1 
ATOM   2444 O  OE1   . GLU A 1 300 ? -53.623 -30.012 -53.640 1.00 111.32 ? 300 GLU A OE1   1 
ATOM   2445 O  OE2   . GLU A 1 300 ? -51.466 -30.293 -53.949 1.00 97.87  ? 300 GLU A OE2   1 
ATOM   2446 N  N     . LEU A 1 301 ? -51.616 -32.228 -48.612 1.00 56.43  ? 301 LEU A N     1 
ATOM   2447 C  CA    . LEU A 1 301 ? -52.620 -32.912 -47.807 1.00 62.29  ? 301 LEU A CA    1 
ATOM   2448 C  C     . LEU A 1 301 ? -52.485 -32.540 -46.337 1.00 62.10  ? 301 LEU A C     1 
ATOM   2449 O  O     . LEU A 1 301 ? -53.486 -32.449 -45.617 1.00 59.98  ? 301 LEU A O     1 
ATOM   2450 C  CB    . LEU A 1 301 ? -52.504 -34.425 -48.002 1.00 63.55  ? 301 LEU A CB    1 
ATOM   2451 C  CG    . LEU A 1 301 ? -53.595 -35.331 -47.426 1.00 71.01  ? 301 LEU A CG    1 
ATOM   2452 C  CD1   . LEU A 1 301 ? -53.813 -36.528 -48.339 1.00 72.06  ? 301 LEU A CD1   1 
ATOM   2453 C  CD2   . LEU A 1 301 ? -53.244 -35.800 -46.020 1.00 64.38  ? 301 LEU A CD2   1 
ATOM   2454 N  N     . GLU A 1 302 ? -51.252 -32.325 -45.873 1.00 55.02  ? 302 GLU A N     1 
ATOM   2455 C  CA    . GLU A 1 302 ? -51.037 -31.953 -44.479 1.00 54.72  ? 302 GLU A CA    1 
ATOM   2456 C  C     . GLU A 1 302 ? -51.655 -30.594 -44.172 1.00 52.80  ? 302 GLU A C     1 
ATOM   2457 O  O     . GLU A 1 302 ? -52.283 -30.408 -43.122 1.00 45.56  ? 302 GLU A O     1 
ATOM   2458 C  CB    . GLU A 1 302 ? -49.541 -31.946 -44.163 1.00 53.37  ? 302 GLU A CB    1 
ATOM   2459 C  CG    . GLU A 1 302 ? -49.213 -31.851 -42.685 1.00 49.16  ? 302 GLU A CG    1 
ATOM   2460 C  CD    . GLU A 1 302 ? -47.721 -31.788 -42.420 1.00 53.71  ? 302 GLU A CD    1 
ATOM   2461 O  OE1   . GLU A 1 302 ? -47.070 -30.835 -42.897 1.00 51.72  ? 302 GLU A OE1   1 
ATOM   2462 O  OE2   . GLU A 1 302 ? -47.195 -32.697 -41.743 1.00 54.71  ? 302 GLU A OE2   1 
ATOM   2463 N  N     . LEU A 1 303 ? -51.500 -29.635 -45.087 1.00 54.02  ? 303 LEU A N     1 
ATOM   2464 C  CA    . LEU A 1 303 ? -52.097 -28.319 -44.893 1.00 46.70  ? 303 LEU A CA    1 
ATOM   2465 C  C     . LEU A 1 303 ? -53.619 -28.383 -44.913 1.00 54.12  ? 303 LEU A C     1 
ATOM   2466 O  O     . LEU A 1 303 ? -54.279 -27.622 -44.197 1.00 58.64  ? 303 LEU A O     1 
ATOM   2467 C  CB    . LEU A 1 303 ? -51.589 -27.354 -45.964 1.00 51.78  ? 303 LEU A CB    1 
ATOM   2468 C  CG    . LEU A 1 303 ? -52.148 -25.931 -45.951 1.00 60.79  ? 303 LEU A CG    1 
ATOM   2469 C  CD1   . LEU A 1 303 ? -51.823 -25.240 -44.636 1.00 60.47  ? 303 LEU A CD1   1 
ATOM   2470 C  CD2   . LEU A 1 303 ? -51.612 -25.135 -47.129 1.00 50.08  ? 303 LEU A CD2   1 
ATOM   2471 N  N     . ALA A 1 304 ? -54.191 -29.286 -45.713 1.00 63.73  ? 304 ALA A N     1 
ATOM   2472 C  CA    . ALA A 1 304 ? -55.644 -29.372 -45.815 1.00 56.61  ? 304 ALA A CA    1 
ATOM   2473 C  C     . ALA A 1 304 ? -56.268 -29.839 -44.506 1.00 55.98  ? 304 ALA A C     1 
ATOM   2474 O  O     . ALA A 1 304 ? -57.274 -29.278 -44.057 1.00 51.93  ? 304 ALA A O     1 
ATOM   2475 C  CB    . ALA A 1 304 ? -56.034 -30.307 -46.959 1.00 60.48  ? 304 ALA A CB    1 
ATOM   2476 N  N     . GLU A 1 305 ? -55.688 -30.865 -43.877 1.00 51.93  ? 305 GLU A N     1 
ATOM   2477 C  CA    . GLU A 1 305 ? -56.242 -31.352 -42.619 1.00 63.54  ? 305 GLU A CA    1 
ATOM   2478 C  C     . GLU A 1 305 ? -55.938 -30.404 -41.466 1.00 56.85  ? 305 GLU A C     1 
ATOM   2479 O  O     . GLU A 1 305 ? -56.686 -30.372 -40.483 1.00 59.95  ? 305 GLU A O     1 
ATOM   2480 C  CB    . GLU A 1 305 ? -55.725 -32.761 -42.322 1.00 50.96  ? 305 GLU A CB    1 
ATOM   2481 C  CG    . GLU A 1 305 ? -54.229 -32.943 -42.495 1.00 76.74  ? 305 GLU A CG    1 
ATOM   2482 C  CD    . GLU A 1 305 ? -53.833 -34.406 -42.583 1.00 79.13  ? 305 GLU A CD    1 
ATOM   2483 O  OE1   . GLU A 1 305 ? -54.739 -35.263 -42.664 1.00 84.11  ? 305 GLU A OE1   1 
ATOM   2484 O  OE2   . GLU A 1 305 ? -52.619 -34.701 -42.575 1.00 75.51  ? 305 GLU A OE2   1 
ATOM   2485 N  N     . ASN A 1 306 ? -54.860 -29.623 -41.565 1.00 54.22  ? 306 ASN A N     1 
ATOM   2486 C  CA    . ASN A 1 306 ? -54.610 -28.589 -40.565 1.00 57.06  ? 306 ASN A CA    1 
ATOM   2487 C  C     . ASN A 1 306 ? -55.652 -27.480 -40.652 1.00 56.86  ? 306 ASN A C     1 
ATOM   2488 O  O     . ASN A 1 306 ? -56.088 -26.948 -39.623 1.00 52.15  ? 306 ASN A O     1 
ATOM   2489 C  CB    . ASN A 1 306 ? -53.203 -28.015 -40.734 1.00 50.43  ? 306 ASN A CB    1 
ATOM   2490 C  CG    . ASN A 1 306 ? -52.146 -28.847 -40.034 1.00 42.68  ? 306 ASN A CG    1 
ATOM   2491 O  OD1   . ASN A 1 306 ? -52.403 -29.449 -38.992 1.00 46.88  ? 306 ASN A OD1   1 
ATOM   2492 N  ND2   . ASN A 1 306 ? -50.945 -28.878 -40.602 1.00 40.71  ? 306 ASN A ND2   1 
ATOM   2493 N  N     . ARG A 1 307 ? -56.061 -27.116 -41.871 1.00 49.21  ? 307 ARG A N     1 
ATOM   2494 C  CA    . ARG A 1 307 ? -57.079 -26.083 -42.033 1.00 48.96  ? 307 ARG A CA    1 
ATOM   2495 C  C     . ARG A 1 307 ? -58.429 -26.531 -41.488 1.00 55.82  ? 307 ARG A C     1 
ATOM   2496 O  O     . ARG A 1 307 ? -59.197 -25.703 -40.986 1.00 53.42  ? 307 ARG A O     1 
ATOM   2497 C  CB    . ARG A 1 307 ? -57.211 -25.695 -43.505 1.00 49.90  ? 307 ARG A CB    1 
ATOM   2498 C  CG    . ARG A 1 307 ? -56.019 -24.939 -44.064 1.00 52.73  ? 307 ARG A CG    1 
ATOM   2499 C  CD    . ARG A 1 307 ? -56.263 -24.524 -45.507 1.00 57.29  ? 307 ARG A CD    1 
ATOM   2500 N  NE    . ARG A 1 307 ? -55.124 -23.803 -46.068 1.00 66.64  ? 307 ARG A NE    1 
ATOM   2501 C  CZ    . ARG A 1 307 ? -54.951 -22.489 -45.973 1.00 66.92  ? 307 ARG A CZ    1 
ATOM   2502 N  NH1   . ARG A 1 307 ? -55.846 -21.745 -45.336 1.00 76.32  ? 307 ARG A NH1   1 
ATOM   2503 N  NH2   . ARG A 1 307 ? -53.883 -21.918 -46.514 1.00 64.47  ? 307 ARG A NH2   1 
ATOM   2504 N  N     . GLU A 1 308 ? -58.738 -27.827 -41.578 1.00 55.18  ? 308 GLU A N     1 
ATOM   2505 C  CA    . GLU A 1 308 ? -60.011 -28.314 -41.059 1.00 58.52  ? 308 GLU A CA    1 
ATOM   2506 C  C     . GLU A 1 308 ? -60.020 -28.353 -39.537 1.00 56.62  ? 308 GLU A C     1 
ATOM   2507 O  O     . GLU A 1 308 ? -61.078 -28.179 -38.922 1.00 62.57  ? 308 GLU A O     1 
ATOM   2508 C  CB    . GLU A 1 308 ? -60.317 -29.698 -41.633 1.00 66.51  ? 308 GLU A CB    1 
ATOM   2509 C  CG    . GLU A 1 308 ? -60.517 -29.704 -43.139 1.00 68.18  ? 308 GLU A CG    1 
ATOM   2510 C  CD    . GLU A 1 308 ? -61.678 -28.828 -43.572 1.00 79.33  ? 308 GLU A CD    1 
ATOM   2511 O  OE1   . GLU A 1 308 ? -62.700 -28.797 -42.855 1.00 73.66  ? 308 GLU A OE1   1 
ATOM   2512 O  OE2   . GLU A 1 308 ? -61.564 -28.164 -44.625 1.00 75.09  ? 308 GLU A OE2   1 
ATOM   2513 N  N     . ILE A 1 309 ? -58.861 -28.577 -38.916 1.00 58.33  ? 309 ILE A N     1 
ATOM   2514 C  CA    . ILE A 1 309 ? -58.786 -28.567 -37.459 1.00 55.16  ? 309 ILE A CA    1 
ATOM   2515 C  C     . ILE A 1 309 ? -59.030 -27.163 -36.921 1.00 47.30  ? 309 ILE A C     1 
ATOM   2516 O  O     . ILE A 1 309 ? -59.724 -26.981 -35.913 1.00 43.46  ? 309 ILE A O     1 
ATOM   2517 C  CB    . ILE A 1 309 ? -57.428 -29.125 -36.994 1.00 52.63  ? 309 ILE A CB    1 
ATOM   2518 C  CG1   . ILE A 1 309 ? -57.303 -30.604 -37.364 1.00 47.46  ? 309 ILE A CG1   1 
ATOM   2519 C  CG2   . ILE A 1 309 ? -57.249 -28.932 -35.495 1.00 46.94  ? 309 ILE A CG2   1 
ATOM   2520 C  CD1   . ILE A 1 309 ? -55.946 -31.201 -37.050 1.00 43.72  ? 309 ILE A CD1   1 
ATOM   2521 N  N     . LEU A 1 310 ? -58.480 -26.147 -37.590 1.00 43.86  ? 310 LEU A N     1 
ATOM   2522 C  CA    . LEU A 1 310 ? -58.597 -24.777 -37.105 1.00 50.87  ? 310 LEU A CA    1 
ATOM   2523 C  C     . LEU A 1 310 ? -60.015 -24.232 -37.207 1.00 53.01  ? 310 LEU A C     1 
ATOM   2524 O  O     . LEU A 1 310 ? -60.330 -23.236 -36.546 1.00 58.36  ? 310 LEU A O     1 
ATOM   2525 C  CB    . LEU A 1 310 ? -57.636 -23.867 -37.871 1.00 45.47  ? 310 LEU A CB    1 
ATOM   2526 C  CG    . LEU A 1 310 ? -56.148 -24.075 -37.587 1.00 46.18  ? 310 LEU A CG    1 
ATOM   2527 C  CD1   . LEU A 1 310 ? -55.305 -23.126 -38.420 1.00 53.83  ? 310 LEU A CD1   1 
ATOM   2528 C  CD2   . LEU A 1 310 ? -55.856 -23.887 -36.109 1.00 43.12  ? 310 LEU A CD2   1 
ATOM   2529 N  N     . LYS A 1 311 ? -60.877 -24.853 -38.015 1.00 49.49  ? 311 LYS A N     1 
ATOM   2530 C  CA    . LYS A 1 311 ? -62.246 -24.368 -38.144 1.00 49.97  ? 311 LYS A CA    1 
ATOM   2531 C  C     . LYS A 1 311 ? -63.105 -24.725 -36.938 1.00 57.35  ? 311 LYS A C     1 
ATOM   2532 O  O     . LYS A 1 311 ? -64.129 -24.074 -36.709 1.00 62.96  ? 311 LYS A O     1 
ATOM   2533 C  CB    . LYS A 1 311 ? -62.887 -24.924 -39.416 1.00 58.71  ? 311 LYS A CB    1 
ATOM   2534 C  CG    . LYS A 1 311 ? -62.235 -24.457 -40.706 1.00 62.32  ? 311 LYS A CG    1 
ATOM   2535 C  CD    . LYS A 1 311 ? -62.905 -25.090 -41.918 1.00 72.16  ? 311 LYS A CD    1 
ATOM   2536 C  CE    . LYS A 1 311 ? -62.260 -24.625 -43.213 1.00 79.91  ? 311 LYS A CE    1 
ATOM   2537 N  NZ    . LYS A 1 311 ? -62.879 -25.270 -44.403 1.00 83.35  ? 311 LYS A NZ    1 
ATOM   2538 N  N     . GLU A 1 312 ? -62.713 -25.731 -36.163 1.00 60.22  ? 312 GLU A N     1 
ATOM   2539 C  CA    . GLU A 1 312 ? -63.523 -26.165 -35.033 1.00 56.80  ? 312 GLU A CA    1 
ATOM   2540 C  C     . GLU A 1 312 ? -63.280 -25.264 -33.823 1.00 57.12  ? 312 GLU A C     1 
ATOM   2541 O  O     . GLU A 1 312 ? -62.157 -24.800 -33.608 1.00 56.06  ? 312 GLU A O     1 
ATOM   2542 C  CB    . GLU A 1 312 ? -63.206 -27.614 -34.672 1.00 64.76  ? 312 GLU A CB    1 
ATOM   2543 C  CG    . GLU A 1 312 ? -63.465 -28.606 -35.794 1.00 67.61  ? 312 GLU A CG    1 
ATOM   2544 C  CD    . GLU A 1 312 ? -64.928 -28.676 -36.187 1.00 78.44  ? 312 GLU A CD    1 
ATOM   2545 O  OE1   . GLU A 1 312 ? -65.793 -28.479 -35.307 1.00 81.92  ? 312 GLU A OE1   1 
ATOM   2546 O  OE2   . GLU A 1 312 ? -65.213 -28.924 -37.377 1.00 78.96  ? 312 GLU A OE2   1 
ATOM   2547 N  N     . PRO A 1 313 ? -64.311 -24.998 -33.023 1.00 55.40  ? 313 PRO A N     1 
ATOM   2548 C  CA    . PRO A 1 313 ? -64.114 -24.177 -31.824 1.00 59.31  ? 313 PRO A CA    1 
ATOM   2549 C  C     . PRO A 1 313 ? -63.374 -24.953 -30.746 1.00 58.32  ? 313 PRO A C     1 
ATOM   2550 O  O     . PRO A 1 313 ? -63.633 -26.138 -30.519 1.00 54.17  ? 313 PRO A O     1 
ATOM   2551 C  CB    . PRO A 1 313 ? -65.543 -23.836 -31.392 1.00 64.85  ? 313 PRO A CB    1 
ATOM   2552 C  CG    . PRO A 1 313 ? -66.356 -24.985 -31.891 1.00 67.63  ? 313 PRO A CG    1 
ATOM   2553 C  CD    . PRO A 1 313 ? -65.715 -25.415 -33.187 1.00 70.35  ? 313 PRO A CD    1 
ATOM   2554 N  N     . VAL A 1 314 ? -62.445 -24.271 -30.078 1.00 49.15  ? 314 VAL A N     1 
ATOM   2555 C  CA    . VAL A 1 314 ? -61.611 -24.903 -29.065 1.00 42.87  ? 314 VAL A CA    1 
ATOM   2556 C  C     . VAL A 1 314 ? -61.304 -23.882 -27.980 1.00 41.21  ? 314 VAL A C     1 
ATOM   2557 O  O     . VAL A 1 314 ? -61.295 -22.672 -28.222 1.00 42.87  ? 314 VAL A O     1 
ATOM   2558 C  CB    . VAL A 1 314 ? -60.314 -25.482 -29.682 1.00 46.53  ? 314 VAL A CB    1 
ATOM   2559 C  CG1   . VAL A 1 314 ? -59.312 -24.373 -29.976 1.00 36.46  ? 314 VAL A CG1   1 
ATOM   2560 C  CG2   . VAL A 1 314 ? -59.710 -26.546 -28.776 1.00 48.56  ? 314 VAL A CG2   1 
ATOM   2561 N  N     . HIS A 1 315 ? -61.067 -24.380 -26.770 1.00 36.87  ? 315 HIS A N     1 
ATOM   2562 C  CA    . HIS A 1 315 ? -60.699 -23.533 -25.645 1.00 43.59  ? 315 HIS A CA    1 
ATOM   2563 C  C     . HIS A 1 315 ? -59.960 -24.384 -24.623 1.00 41.59  ? 315 HIS A C     1 
ATOM   2564 O  O     . HIS A 1 315 ? -59.975 -25.616 -24.681 1.00 41.05  ? 315 HIS A O     1 
ATOM   2565 C  CB    . HIS A 1 315 ? -61.926 -22.864 -25.016 1.00 39.06  ? 315 HIS A CB    1 
ATOM   2566 C  CG    . HIS A 1 315 ? -62.838 -23.816 -24.306 1.00 48.73  ? 315 HIS A CG    1 
ATOM   2567 N  ND1   . HIS A 1 315 ? -63.879 -24.461 -24.937 1.00 48.74  ? 315 HIS A ND1   1 
ATOM   2568 C  CD2   . HIS A 1 315 ? -62.869 -24.227 -23.015 1.00 41.16  ? 315 HIS A CD2   1 
ATOM   2569 C  CE1   . HIS A 1 315 ? -64.511 -25.230 -24.068 1.00 44.44  ? 315 HIS A CE1   1 
ATOM   2570 N  NE2   . HIS A 1 315 ? -63.917 -25.106 -22.895 1.00 39.81  ? 315 HIS A NE2   1 
ATOM   2571 N  N     . GLY A 1 316 ? -59.305 -23.702 -23.680 1.00 42.33  ? 316 GLY A N     1 
ATOM   2572 C  CA    . GLY A 1 316 ? -58.644 -24.349 -22.572 1.00 31.44  ? 316 GLY A CA    1 
ATOM   2573 C  C     . GLY A 1 316 ? -59.261 -23.913 -21.252 1.00 30.79  ? 316 GLY A C     1 
ATOM   2574 O  O     . GLY A 1 316 ? -60.054 -22.968 -21.189 1.00 36.82  ? 316 GLY A O     1 
ATOM   2575 N  N     . VAL A 1 317 ? -58.889 -24.626 -20.190 1.00 26.60  ? 317 VAL A N     1 
ATOM   2576 C  CA    . VAL A 1 317 ? -59.361 -24.296 -18.850 1.00 22.08  ? 317 VAL A CA    1 
ATOM   2577 C  C     . VAL A 1 317 ? -58.176 -23.872 -17.995 1.00 29.09  ? 317 VAL A C     1 
ATOM   2578 O  O     . VAL A 1 317 ? -57.033 -23.846 -18.468 1.00 34.52  ? 317 VAL A O     1 
ATOM   2579 C  CB    . VAL A 1 317 ? -60.116 -25.476 -18.211 1.00 33.35  ? 317 VAL A CB    1 
ATOM   2580 C  CG1   . VAL A 1 317 ? -61.364 -25.802 -19.020 1.00 28.35  ? 317 VAL A CG1   1 
ATOM   2581 C  CG2   . VAL A 1 317 ? -59.212 -26.691 -18.101 1.00 26.93  ? 317 VAL A CG2   1 
ATOM   2582 N  N     . TYR A 1 318 ? -58.436 -23.539 -16.737 1.00 30.37  ? 318 TYR A N     1 
ATOM   2583 C  CA    . TYR A 1 318 ? -57.404 -23.083 -15.821 1.00 31.27  ? 318 TYR A CA    1 
ATOM   2584 C  C     . TYR A 1 318 ? -56.971 -24.210 -14.892 1.00 30.74  ? 318 TYR A C     1 
ATOM   2585 O  O     . TYR A 1 318 ? -57.646 -25.233 -14.754 1.00 38.15  ? 318 TYR A O     1 
ATOM   2586 C  CB    . TYR A 1 318 ? -57.894 -21.881 -15.010 1.00 21.78  ? 318 TYR A CB    1 
ATOM   2587 C  CG    . TYR A 1 318 ? -58.230 -20.679 -15.863 1.00 33.97  ? 318 TYR A CG    1 
ATOM   2588 C  CD1   . TYR A 1 318 ? -59.516 -20.154 -15.884 1.00 32.47  ? 318 TYR A CD1   1 
ATOM   2589 C  CD2   . TYR A 1 318 ? -57.263 -20.077 -16.660 1.00 32.89  ? 318 TYR A CD2   1 
ATOM   2590 C  CE1   . TYR A 1 318 ? -59.826 -19.057 -16.666 1.00 33.17  ? 318 TYR A CE1   1 
ATOM   2591 C  CE2   . TYR A 1 318 ? -57.564 -18.980 -17.445 1.00 30.58  ? 318 TYR A CE2   1 
ATOM   2592 C  CZ    . TYR A 1 318 ? -58.846 -18.475 -17.444 1.00 37.60  ? 318 TYR A CZ    1 
ATOM   2593 O  OH    . TYR A 1 318 ? -59.149 -17.385 -18.226 1.00 36.03  ? 318 TYR A OH    1 
ATOM   2594 N  N     . TYR A 1 319 ? -55.825 -24.003 -14.249 1.00 32.98  ? 319 TYR A N     1 
ATOM   2595 C  CA    . TYR A 1 319 ? -55.189 -25.051 -13.463 1.00 30.54  ? 319 TYR A CA    1 
ATOM   2596 C  C     . TYR A 1 319 ? -55.771 -25.109 -12.056 1.00 30.89  ? 319 TYR A C     1 
ATOM   2597 O  O     . TYR A 1 319 ? -55.942 -24.078 -11.398 1.00 30.09  ? 319 TYR A O     1 
ATOM   2598 C  CB    . TYR A 1 319 ? -53.679 -24.821 -13.402 1.00 24.81  ? 319 TYR A CB    1 
ATOM   2599 C  CG    . TYR A 1 319 ? -52.939 -25.792 -12.510 1.00 34.32  ? 319 TYR A CG    1 
ATOM   2600 C  CD1   . TYR A 1 319 ? -53.025 -27.163 -12.720 1.00 25.95  ? 319 TYR A CD1   1 
ATOM   2601 C  CD2   . TYR A 1 319 ? -52.145 -25.338 -11.465 1.00 35.97  ? 319 TYR A CD2   1 
ATOM   2602 C  CE1   . TYR A 1 319 ? -52.348 -28.054 -11.910 1.00 32.32  ? 319 TYR A CE1   1 
ATOM   2603 C  CE2   . TYR A 1 319 ? -51.463 -26.222 -10.650 1.00 38.12  ? 319 TYR A CE2   1 
ATOM   2604 C  CZ    . TYR A 1 319 ? -51.567 -27.578 -10.878 1.00 38.25  ? 319 TYR A CZ    1 
ATOM   2605 O  OH    . TYR A 1 319 ? -50.891 -28.462 -10.069 1.00 35.11  ? 319 TYR A OH    1 
ATOM   2606 N  N     . ASP A 1 320 ? -56.071 -26.319 -11.601 1.00 39.97  ? 320 ASP A N     1 
ATOM   2607 C  CA    . ASP A 1 320 ? -56.529 -26.567 -10.235 1.00 38.93  ? 320 ASP A CA    1 
ATOM   2608 C  C     . ASP A 1 320 ? -55.502 -27.447 -9.539  1.00 36.06  ? 320 ASP A C     1 
ATOM   2609 O  O     . ASP A 1 320 ? -55.408 -28.650 -9.852  1.00 36.38  ? 320 ASP A O     1 
ATOM   2610 C  CB    . ASP A 1 320 ? -57.907 -27.232 -10.235 1.00 33.80  ? 320 ASP A CB    1 
ATOM   2611 C  CG    . ASP A 1 320 ? -58.429 -27.512 -8.835  1.00 41.32  ? 320 ASP A CG    1 
ATOM   2612 O  OD1   . ASP A 1 320 ? -57.869 -26.971 -7.859  1.00 43.78  ? 320 ASP A OD1   1 
ATOM   2613 O  OD2   . ASP A 1 320 ? -59.414 -28.271 -8.713  1.00 33.88  ? 320 ASP A OD2   1 
ATOM   2614 N  N     . PRO A 1 321 ? -54.712 -26.912 -8.601  1.00 37.86  ? 321 PRO A N     1 
ATOM   2615 C  CA    . PRO A 1 321 ? -53.645 -27.717 -7.985  1.00 39.10  ? 321 PRO A CA    1 
ATOM   2616 C  C     . PRO A 1 321 ? -54.154 -28.858 -7.120  1.00 43.92  ? 321 PRO A C     1 
ATOM   2617 O  O     . PRO A 1 321 ? -53.356 -29.731 -6.752  1.00 45.44  ? 321 PRO A O     1 
ATOM   2618 C  CB    . PRO A 1 321 ? -52.872 -26.691 -7.148  1.00 37.56  ? 321 PRO A CB    1 
ATOM   2619 C  CG    . PRO A 1 321 ? -53.880 -25.638 -6.833  1.00 35.72  ? 321 PRO A CG    1 
ATOM   2620 C  CD    . PRO A 1 321 ? -54.783 -25.555 -8.034  1.00 43.86  ? 321 PRO A CD    1 
ATOM   2621 N  N     . SER A 1 322 ? -55.443 -28.882 -6.783  1.00 42.77  ? 322 SER A N     1 
ATOM   2622 C  CA    . SER A 1 322 ? -56.008 -29.975 -6.003  1.00 43.08  ? 322 SER A CA    1 
ATOM   2623 C  C     . SER A 1 322 ? -56.260 -31.226 -6.834  1.00 38.02  ? 322 SER A C     1 
ATOM   2624 O  O     . SER A 1 322 ? -56.608 -32.267 -6.266  1.00 48.96  ? 322 SER A O     1 
ATOM   2625 C  CB    . SER A 1 322 ? -57.314 -29.525 -5.340  1.00 35.66  ? 322 SER A CB    1 
ATOM   2626 O  OG    . SER A 1 322 ? -57.880 -30.566 -4.564  1.00 74.04  ? 322 SER A OG    1 
ATOM   2627 N  N     . LYS A 1 323 ? -56.095 -31.150 -8.150  1.00 44.53  ? 323 LYS A N     1 
ATOM   2628 C  CA    . LYS A 1 323 ? -56.285 -32.277 -9.050  1.00 34.05  ? 323 LYS A CA    1 
ATOM   2629 C  C     . LYS A 1 323 ? -54.947 -32.702 -9.642  1.00 35.11  ? 323 LYS A C     1 
ATOM   2630 O  O     . LYS A 1 323 ? -53.947 -31.982 -9.567  1.00 42.62  ? 323 LYS A O     1 
ATOM   2631 C  CB    . LYS A 1 323 ? -57.272 -31.919 -10.168 1.00 35.72  ? 323 LYS A CB    1 
ATOM   2632 C  CG    . LYS A 1 323 ? -58.617 -31.403 -9.678  1.00 43.83  ? 323 LYS A CG    1 
ATOM   2633 C  CD    . LYS A 1 323 ? -59.444 -32.510 -9.044  1.00 67.64  ? 323 LYS A CD    1 
ATOM   2634 C  CE    . LYS A 1 323 ? -60.789 -31.986 -8.567  1.00 63.90  ? 323 LYS A CE    1 
ATOM   2635 N  NZ    . LYS A 1 323 ? -60.637 -30.958 -7.499  1.00 57.49  ? 323 LYS A NZ    1 
ATOM   2636 N  N     . ASP A 1 324 ? -54.939 -33.888 -10.242 1.00 39.19  ? 324 ASP A N     1 
ATOM   2637 C  CA    . ASP A 1 324 ? -53.735 -34.405 -10.870 1.00 42.55  ? 324 ASP A CA    1 
ATOM   2638 C  C     . ASP A 1 324 ? -53.552 -33.810 -12.264 1.00 38.10  ? 324 ASP A C     1 
ATOM   2639 O  O     . ASP A 1 324 ? -54.502 -33.356 -12.908 1.00 37.19  ? 324 ASP A O     1 
ATOM   2640 C  CB    . ASP A 1 324 ? -53.783 -35.931 -10.964 1.00 48.04  ? 324 ASP A CB    1 
ATOM   2641 C  CG    . ASP A 1 324 ? -53.610 -36.606 -9.619  1.00 57.88  ? 324 ASP A CG    1 
ATOM   2642 O  OD1   . ASP A 1 324 ? -52.869 -36.066 -8.771  1.00 57.37  ? 324 ASP A OD1   1 
ATOM   2643 O  OD2   . ASP A 1 324 ? -54.215 -37.679 -9.412  1.00 58.25  ? 324 ASP A OD2   1 
ATOM   2644 N  N     . LEU A 1 325 ? -52.304 -33.818 -12.721 1.00 39.76  ? 325 LEU A N     1 
ATOM   2645 C  CA    . LEU A 1 325 ? -51.957 -33.445 -14.085 1.00 38.01  ? 325 LEU A CA    1 
ATOM   2646 C  C     . LEU A 1 325 ? -51.859 -34.706 -14.933 1.00 36.66  ? 325 LEU A C     1 
ATOM   2647 O  O     . LEU A 1 325 ? -51.124 -35.636 -14.584 1.00 34.07  ? 325 LEU A O     1 
ATOM   2648 C  CB    . LEU A 1 325 ? -50.634 -32.679 -14.125 1.00 43.92  ? 325 LEU A CB    1 
ATOM   2649 C  CG    . LEU A 1 325 ? -50.675 -31.153 -14.057 1.00 47.67  ? 325 LEU A CG    1 
ATOM   2650 C  CD1   . LEU A 1 325 ? -49.263 -30.598 -14.032 1.00 42.23  ? 325 LEU A CD1   1 
ATOM   2651 C  CD2   . LEU A 1 325 ? -51.447 -30.594 -15.238 1.00 39.90  ? 325 LEU A CD2   1 
ATOM   2652 N  N     . ILE A 1 326 ? -52.598 -34.737 -16.038 1.00 33.86  ? 326 ILE A N     1 
ATOM   2653 C  CA    . ILE A 1 326 ? -52.654 -35.899 -16.917 1.00 31.61  ? 326 ILE A CA    1 
ATOM   2654 C  C     . ILE A 1 326 ? -52.247 -35.470 -18.318 1.00 38.50  ? 326 ILE A C     1 
ATOM   2655 O  O     . ILE A 1 326 ? -52.774 -34.486 -18.851 1.00 39.94  ? 326 ILE A O     1 
ATOM   2656 C  CB    . ILE A 1 326 ? -54.053 -36.541 -16.925 1.00 33.96  ? 326 ILE A CB    1 
ATOM   2657 C  CG1   . ILE A 1 326 ? -54.439 -36.987 -15.513 1.00 30.91  ? 326 ILE A CG1   1 
ATOM   2658 C  CG2   . ILE A 1 326 ? -54.091 -37.719 -17.886 1.00 33.10  ? 326 ILE A CG2   1 
ATOM   2659 C  CD1   . ILE A 1 326 ? -55.806 -37.626 -15.426 1.00 38.04  ? 326 ILE A CD1   1 
ATOM   2660 N  N     . ALA A 1 327 ? -51.310 -36.207 -18.910 1.00 29.71  ? 327 ALA A N     1 
ATOM   2661 C  CA    . ALA A 1 327 ? -50.854 -35.973 -20.274 1.00 37.61  ? 327 ALA A CA    1 
ATOM   2662 C  C     . ALA A 1 327 ? -51.062 -37.244 -21.084 1.00 33.25  ? 327 ALA A C     1 
ATOM   2663 O  O     . ALA A 1 327 ? -50.451 -38.277 -20.792 1.00 40.27  ? 327 ALA A O     1 
ATOM   2664 C  CB    . ALA A 1 327 ? -49.383 -35.552 -20.298 1.00 26.18  ? 327 ALA A CB    1 
ATOM   2665 N  N     . GLU A 1 328 ? -51.925 -37.169 -22.092 1.00 32.34  ? 328 GLU A N     1 
ATOM   2666 C  CA    . GLU A 1 328 ? -52.193 -38.283 -22.990 1.00 34.78  ? 328 GLU A CA    1 
ATOM   2667 C  C     . GLU A 1 328 ? -51.528 -38.002 -24.330 1.00 37.17  ? 328 GLU A C     1 
ATOM   2668 O  O     . GLU A 1 328 ? -51.673 -36.906 -24.878 1.00 30.69  ? 328 GLU A O     1 
ATOM   2669 C  CB    . GLU A 1 328 ? -53.698 -38.493 -23.171 1.00 40.23  ? 328 GLU A CB    1 
ATOM   2670 C  CG    . GLU A 1 328 ? -54.061 -39.765 -23.917 1.00 46.49  ? 328 GLU A CG    1 
ATOM   2671 C  CD    . GLU A 1 328 ? -55.560 -39.969 -24.029 1.00 62.96  ? 328 GLU A CD    1 
ATOM   2672 O  OE1   . GLU A 1 328 ? -55.994 -40.698 -24.945 1.00 68.11  ? 328 GLU A OE1   1 
ATOM   2673 O  OE2   . GLU A 1 328 ? -56.303 -39.398 -23.202 1.00 64.51  ? 328 GLU A OE2   1 
ATOM   2674 N  N     . ILE A 1 329 ? -50.801 -38.988 -24.851 1.00 38.40  ? 329 ILE A N     1 
ATOM   2675 C  CA    . ILE A 1 329 ? -50.013 -38.835 -26.068 1.00 39.09  ? 329 ILE A CA    1 
ATOM   2676 C  C     . ILE A 1 329 ? -50.639 -39.674 -27.173 1.00 39.14  ? 329 ILE A C     1 
ATOM   2677 O  O     . ILE A 1 329 ? -50.971 -40.847 -26.962 1.00 37.61  ? 329 ILE A O     1 
ATOM   2678 C  CB    . ILE A 1 329 ? -48.544 -39.232 -25.838 1.00 31.05  ? 329 ILE A CB    1 
ATOM   2679 C  CG1   . ILE A 1 329 ? -47.918 -38.349 -24.757 1.00 31.37  ? 329 ILE A CG1   1 
ATOM   2680 C  CG2   . ILE A 1 329 ? -47.750 -39.130 -27.131 1.00 29.80  ? 329 ILE A CG2   1 
ATOM   2681 C  CD1   . ILE A 1 329 ? -46.443 -38.611 -24.536 1.00 33.08  ? 329 ILE A CD1   1 
ATOM   2682 N  N     . GLN A 1 330 ? -50.799 -39.069 -28.348 1.00 34.54  ? 330 GLN A N     1 
ATOM   2683 C  CA    . GLN A 1 330 ? -51.301 -39.736 -29.540 1.00 45.78  ? 330 GLN A CA    1 
ATOM   2684 C  C     . GLN A 1 330 ? -50.205 -39.758 -30.595 1.00 46.84  ? 330 GLN A C     1 
ATOM   2685 O  O     . GLN A 1 330 ? -49.448 -38.792 -30.734 1.00 49.69  ? 330 GLN A O     1 
ATOM   2686 C  CB    . GLN A 1 330 ? -52.552 -39.026 -30.079 1.00 53.98  ? 330 GLN A CB    1 
ATOM   2687 C  CG    . GLN A 1 330 ? -52.923 -39.368 -31.517 1.00 68.63  ? 330 GLN A CG    1 
ATOM   2688 C  CD    . GLN A 1 330 ? -53.425 -40.791 -31.677 1.00 71.46  ? 330 GLN A CD    1 
ATOM   2689 O  OE1   . GLN A 1 330 ? -53.825 -41.435 -30.708 1.00 83.11  ? 330 GLN A OE1   1 
ATOM   2690 N  NE2   . GLN A 1 330 ? -53.408 -41.287 -32.910 1.00 53.50  ? 330 GLN A NE2   1 
ATOM   2691 N  N     . LYS A 1 331 ? -50.113 -40.861 -31.333 1.00 43.08  ? 331 LYS A N     1 
ATOM   2692 C  CA    . LYS A 1 331 ? -49.087 -41.030 -32.352 1.00 42.33  ? 331 LYS A CA    1 
ATOM   2693 C  C     . LYS A 1 331 ? -49.646 -40.709 -33.731 1.00 43.03  ? 331 LYS A C     1 
ATOM   2694 O  O     . LYS A 1 331 ? -50.726 -41.184 -34.097 1.00 46.53  ? 331 LYS A O     1 
ATOM   2695 C  CB    . LYS A 1 331 ? -48.529 -42.454 -32.351 1.00 45.15  ? 331 LYS A CB    1 
ATOM   2696 C  CG    . LYS A 1 331 ? -47.463 -42.672 -33.418 1.00 45.32  ? 331 LYS A CG    1 
ATOM   2697 C  CD    . LYS A 1 331 ? -47.252 -44.141 -33.743 1.00 54.54  ? 331 LYS A CD    1 
ATOM   2698 C  CE    . LYS A 1 331 ? -46.304 -44.299 -34.923 1.00 52.52  ? 331 LYS A CE    1 
ATOM   2699 N  NZ    . LYS A 1 331 ? -46.165 -45.715 -35.354 1.00 62.65  ? 331 LYS A NZ    1 
ATOM   2700 N  N     . GLN A 1 332 ? -48.909 -39.901 -34.484 1.00 42.40  ? 332 GLN A N     1 
ATOM   2701 C  CA    . GLN A 1 332 ? -49.076 -39.775 -35.922 1.00 55.40  ? 332 GLN A CA    1 
ATOM   2702 C  C     . GLN A 1 332 ? -47.844 -40.342 -36.616 1.00 55.27  ? 332 GLN A C     1 
ATOM   2703 O  O     . GLN A 1 332 ? -46.844 -40.684 -35.979 1.00 67.56  ? 332 GLN A O     1 
ATOM   2704 C  CB    . GLN A 1 332 ? -49.308 -38.316 -36.332 1.00 60.68  ? 332 GLN A CB    1 
ATOM   2705 C  CG    . GLN A 1 332 ? -50.741 -37.836 -36.154 1.00 63.50  ? 332 GLN A CG    1 
ATOM   2706 C  CD    . GLN A 1 332 ? -50.975 -37.162 -34.817 1.00 62.82  ? 332 GLN A CD    1 
ATOM   2707 O  OE1   . GLN A 1 332 ? -50.032 -36.887 -34.075 1.00 59.01  ? 332 GLN A OE1   1 
ATOM   2708 N  NE2   . GLN A 1 332 ? -52.237 -36.889 -34.505 1.00 51.16  ? 332 GLN A NE2   1 
ATOM   2709 N  N     . GLY A 1 333 ? -47.924 -40.442 -37.938 1.00 47.60  ? 333 GLY A N     1 
ATOM   2710 C  CA    . GLY A 1 333 ? -46.841 -41.025 -38.699 1.00 50.40  ? 333 GLY A CA    1 
ATOM   2711 C  C     . GLY A 1 333 ? -45.639 -40.106 -38.840 1.00 55.45  ? 333 GLY A C     1 
ATOM   2712 O  O     . GLY A 1 333 ? -45.661 -38.938 -38.454 1.00 60.77  ? 333 GLY A O     1 
ATOM   2713 N  N     . GLN A 1 334 ? -44.567 -40.675 -39.398 1.00 53.36  ? 334 GLN A N     1 
ATOM   2714 C  CA    . GLN A 1 334 ? -43.361 -39.928 -39.766 1.00 56.15  ? 334 GLN A CA    1 
ATOM   2715 C  C     . GLN A 1 334 ? -42.753 -39.200 -38.569 1.00 51.97  ? 334 GLN A C     1 
ATOM   2716 O  O     . GLN A 1 334 ? -42.343 -38.041 -38.667 1.00 59.01  ? 334 GLN A O     1 
ATOM   2717 C  CB    . GLN A 1 334 ? -43.645 -38.948 -40.908 1.00 61.54  ? 334 GLN A CB    1 
ATOM   2718 C  CG    . GLN A 1 334 ? -44.209 -39.595 -42.166 1.00 56.80  ? 334 GLN A CG    1 
ATOM   2719 C  CD    . GLN A 1 334 ? -45.716 -39.767 -42.112 1.00 66.85  ? 334 GLN A CD    1 
ATOM   2720 O  OE1   . GLN A 1 334 ? -46.439 -38.878 -41.660 1.00 57.21  ? 334 GLN A OE1   1 
ATOM   2721 N  NE2   . GLN A 1 334 ? -46.197 -40.919 -42.568 1.00 68.94  ? 334 GLN A NE2   1 
ATOM   2722 N  N     . GLY A 1 335 ? -42.687 -39.884 -37.430 1.00 53.29  ? 335 GLY A N     1 
ATOM   2723 C  CA    . GLY A 1 335 ? -42.078 -39.302 -36.248 1.00 46.15  ? 335 GLY A CA    1 
ATOM   2724 C  C     . GLY A 1 335 ? -42.816 -38.113 -35.675 1.00 42.30  ? 335 GLY A C     1 
ATOM   2725 O  O     . GLY A 1 335 ? -42.182 -37.209 -35.122 1.00 43.88  ? 335 GLY A O     1 
ATOM   2726 N  N     . GLN A 1 336 ? -44.141 -38.088 -35.791 1.00 45.93  ? 336 GLN A N     1 
ATOM   2727 C  CA    . GLN A 1 336 ? -44.955 -36.987 -35.297 1.00 43.33  ? 336 GLN A CA    1 
ATOM   2728 C  C     . GLN A 1 336 ? -45.818 -37.455 -34.136 1.00 37.24  ? 336 GLN A C     1 
ATOM   2729 O  O     . GLN A 1 336 ? -46.366 -38.562 -34.160 1.00 43.89  ? 336 GLN A O     1 
ATOM   2730 C  CB    . GLN A 1 336 ? -45.844 -36.416 -36.400 1.00 42.43  ? 336 GLN A CB    1 
ATOM   2731 C  CG    . GLN A 1 336 ? -45.081 -35.785 -37.543 1.00 38.91  ? 336 GLN A CG    1 
ATOM   2732 C  CD    . GLN A 1 336 ? -46.002 -35.171 -38.570 1.00 45.66  ? 336 GLN A CD    1 
ATOM   2733 O  OE1   . GLN A 1 336 ? -46.135 -33.950 -38.645 1.00 41.78  ? 336 GLN A OE1   1 
ATOM   2734 N  NE2   . GLN A 1 336 ? -46.645 -36.014 -39.369 1.00 47.22  ? 336 GLN A NE2   1 
ATOM   2735 N  N     . TRP A 1 337 ? -45.937 -36.604 -33.121 1.00 43.01  ? 337 TRP A N     1 
ATOM   2736 C  CA    . TRP A 1 337 ? -46.697 -36.923 -31.925 1.00 39.14  ? 337 TRP A CA    1 
ATOM   2737 C  C     . TRP A 1 337 ? -47.468 -35.690 -31.481 1.00 44.27  ? 337 TRP A C     1 
ATOM   2738 O  O     . TRP A 1 337 ? -47.007 -34.559 -31.649 1.00 37.52  ? 337 TRP A O     1 
ATOM   2739 C  CB    . TRP A 1 337 ? -45.784 -37.410 -30.792 1.00 30.05  ? 337 TRP A CB    1 
ATOM   2740 C  CG    . TRP A 1 337 ? -44.875 -38.532 -31.199 1.00 37.27  ? 337 TRP A CG    1 
ATOM   2741 C  CD1   . TRP A 1 337 ? -43.718 -38.432 -31.918 1.00 37.04  ? 337 TRP A CD1   1 
ATOM   2742 C  CD2   . TRP A 1 337 ? -45.047 -39.925 -30.913 1.00 35.11  ? 337 TRP A CD2   1 
ATOM   2743 N  NE1   . TRP A 1 337 ? -43.162 -39.674 -32.100 1.00 39.80  ? 337 TRP A NE1   1 
ATOM   2744 C  CE2   . TRP A 1 337 ? -43.957 -40.608 -31.489 1.00 40.35  ? 337 TRP A CE2   1 
ATOM   2745 C  CE3   . TRP A 1 337 ? -46.015 -40.660 -30.223 1.00 37.39  ? 337 TRP A CE3   1 
ATOM   2746 C  CZ2   . TRP A 1 337 ? -43.810 -41.990 -31.398 1.00 34.79  ? 337 TRP A CZ2   1 
ATOM   2747 C  CZ3   . TRP A 1 337 ? -45.866 -42.032 -30.132 1.00 34.52  ? 337 TRP A CZ3   1 
ATOM   2748 C  CH2   . TRP A 1 337 ? -44.772 -42.682 -30.717 1.00 43.71  ? 337 TRP A CH2   1 
ATOM   2749 N  N     . THR A 1 338 ? -48.652 -35.921 -30.922 1.00 39.77  ? 338 THR A N     1 
ATOM   2750 C  CA    . THR A 1 338 ? -49.466 -34.864 -30.345 1.00 39.16  ? 338 THR A CA    1 
ATOM   2751 C  C     . THR A 1 338 ? -49.928 -35.300 -28.964 1.00 36.00  ? 338 THR A C     1 
ATOM   2752 O  O     . THR A 1 338 ? -50.029 -36.496 -28.676 1.00 40.15  ? 338 THR A O     1 
ATOM   2753 C  CB    . THR A 1 338 ? -50.680 -34.524 -31.229 1.00 40.08  ? 338 THR A CB    1 
ATOM   2754 O  OG1   . THR A 1 338 ? -51.415 -33.445 -30.639 1.00 54.29  ? 338 THR A OG1   1 
ATOM   2755 C  CG2   . THR A 1 338 ? -51.591 -35.732 -31.382 1.00 32.46  ? 338 THR A CG2   1 
ATOM   2756 N  N     . TYR A 1 339 ? -50.198 -34.322 -28.102 1.00 40.40  ? 339 TYR A N     1 
ATOM   2757 C  CA    . TYR A 1 339 ? -50.576 -34.634 -26.733 1.00 42.70  ? 339 TYR A CA    1 
ATOM   2758 C  C     . TYR A 1 339 ? -51.582 -33.614 -26.226 1.00 39.94  ? 339 TYR A C     1 
ATOM   2759 O  O     . TYR A 1 339 ? -51.671 -32.490 -26.728 1.00 37.55  ? 339 TYR A O     1 
ATOM   2760 C  CB    . TYR A 1 339 ? -49.354 -34.689 -25.806 1.00 32.50  ? 339 TYR A CB    1 
ATOM   2761 C  CG    . TYR A 1 339 ? -48.499 -33.441 -25.811 1.00 34.69  ? 339 TYR A CG    1 
ATOM   2762 C  CD1   . TYR A 1 339 ? -47.471 -33.283 -26.732 1.00 29.46  ? 339 TYR A CD1   1 
ATOM   2763 C  CD2   . TYR A 1 339 ? -48.709 -32.428 -24.883 1.00 33.24  ? 339 TYR A CD2   1 
ATOM   2764 C  CE1   . TYR A 1 339 ? -46.680 -32.151 -26.733 1.00 34.17  ? 339 TYR A CE1   1 
ATOM   2765 C  CE2   . TYR A 1 339 ? -47.925 -31.290 -24.878 1.00 31.83  ? 339 TYR A CE2   1 
ATOM   2766 C  CZ    . TYR A 1 339 ? -46.912 -31.156 -25.805 1.00 44.29  ? 339 TYR A CZ    1 
ATOM   2767 O  OH    . TYR A 1 339 ? -46.128 -30.025 -25.807 1.00 47.22  ? 339 TYR A OH    1 
ATOM   2768 N  N     . GLN A 1 340 ? -52.345 -34.032 -25.219 1.00 31.06  ? 340 GLN A N     1 
ATOM   2769 C  CA    . GLN A 1 340 ? -53.329 -33.189 -24.557 1.00 36.93  ? 340 GLN A CA    1 
ATOM   2770 C  C     . GLN A 1 340 ? -53.111 -33.285 -23.056 1.00 36.98  ? 340 GLN A C     1 
ATOM   2771 O  O     . GLN A 1 340 ? -53.081 -34.388 -22.502 1.00 39.95  ? 340 GLN A O     1 
ATOM   2772 C  CB    . GLN A 1 340 ? -54.761 -33.608 -24.912 1.00 32.34  ? 340 GLN A CB    1 
ATOM   2773 C  CG    . GLN A 1 340 ? -55.004 -33.847 -26.397 1.00 36.48  ? 340 GLN A CG    1 
ATOM   2774 C  CD    . GLN A 1 340 ? -54.702 -35.275 -26.820 1.00 63.39  ? 340 GLN A CD    1 
ATOM   2775 O  OE1   . GLN A 1 340 ? -54.765 -36.202 -26.011 1.00 66.11  ? 340 GLN A OE1   1 
ATOM   2776 N  NE2   . GLN A 1 340 ? -54.369 -35.457 -28.093 1.00 59.07  ? 340 GLN A NE2   1 
ATOM   2777 N  N     . ILE A 1 341 ? -52.951 -32.137 -22.404 1.00 37.68  ? 341 ILE A N     1 
ATOM   2778 C  CA    . ILE A 1 341 ? -52.762 -32.072 -20.960 1.00 29.03  ? 341 ILE A CA    1 
ATOM   2779 C  C     . ILE A 1 341 ? -54.059 -31.594 -20.328 1.00 31.81  ? 341 ILE A C     1 
ATOM   2780 O  O     . ILE A 1 341 ? -54.597 -30.547 -20.710 1.00 37.36  ? 341 ILE A O     1 
ATOM   2781 C  CB    . ILE A 1 341 ? -51.589 -31.148 -20.589 1.00 30.34  ? 341 ILE A CB    1 
ATOM   2782 C  CG1   . ILE A 1 341 ? -50.304 -31.623 -21.270 1.00 36.86  ? 341 ILE A CG1   1 
ATOM   2783 C  CG2   . ILE A 1 341 ? -51.406 -31.108 -19.080 1.00 29.33  ? 341 ILE A CG2   1 
ATOM   2784 C  CD1   . ILE A 1 341 ? -49.085 -30.794 -20.924 1.00 41.43  ? 341 ILE A CD1   1 
ATOM   2785 N  N     . TYR A 1 342 ? -54.565 -32.359 -19.364 1.00 32.12  ? 342 TYR A N     1 
ATOM   2786 C  CA    . TYR A 1 342 ? -55.848 -32.058 -18.749 1.00 31.50  ? 342 TYR A CA    1 
ATOM   2787 C  C     . TYR A 1 342 ? -55.861 -32.587 -17.322 1.00 39.02  ? 342 TYR A C     1 
ATOM   2788 O  O     . TYR A 1 342 ? -54.993 -33.360 -16.912 1.00 36.18  ? 342 TYR A O     1 
ATOM   2789 C  CB    . TYR A 1 342 ? -57.006 -32.656 -19.558 1.00 36.91  ? 342 TYR A CB    1 
ATOM   2790 C  CG    . TYR A 1 342 ? -56.933 -34.160 -19.728 1.00 35.31  ? 342 TYR A CG    1 
ATOM   2791 C  CD1   . TYR A 1 342 ? -56.308 -34.724 -20.833 1.00 39.16  ? 342 TYR A CD1   1 
ATOM   2792 C  CD2   . TYR A 1 342 ? -57.492 -35.015 -18.786 1.00 42.70  ? 342 TYR A CD2   1 
ATOM   2793 C  CE1   . TYR A 1 342 ? -56.240 -36.097 -20.992 1.00 35.43  ? 342 TYR A CE1   1 
ATOM   2794 C  CE2   . TYR A 1 342 ? -57.427 -36.386 -18.937 1.00 44.09  ? 342 TYR A CE2   1 
ATOM   2795 C  CZ    . TYR A 1 342 ? -56.801 -36.921 -20.041 1.00 47.29  ? 342 TYR A CZ    1 
ATOM   2796 O  OH    . TYR A 1 342 ? -56.736 -38.287 -20.194 1.00 46.67  ? 342 TYR A OH    1 
ATOM   2797 N  N     . GLN A 1 343 ? -56.865 -32.151 -16.567 1.00 32.63  ? 343 GLN A N     1 
ATOM   2798 C  CA    . GLN A 1 343 ? -57.140 -32.666 -15.235 1.00 37.34  ? 343 GLN A CA    1 
ATOM   2799 C  C     . GLN A 1 343 ? -58.464 -33.407 -15.143 1.00 44.86  ? 343 GLN A C     1 
ATOM   2800 O  O     . GLN A 1 343 ? -58.596 -34.308 -14.313 1.00 45.82  ? 343 GLN A O     1 
ATOM   2801 C  CB    . GLN A 1 343 ? -57.136 -31.525 -14.205 1.00 30.28  ? 343 GLN A CB    1 
ATOM   2802 C  CG    . GLN A 1 343 ? -55.857 -30.707 -14.207 1.00 36.73  ? 343 GLN A CG    1 
ATOM   2803 C  CD    . GLN A 1 343 ? -55.831 -29.668 -13.106 1.00 35.70  ? 343 GLN A CD    1 
ATOM   2804 O  OE1   . GLN A 1 343 ? -56.387 -28.579 -13.251 1.00 36.18  ? 343 GLN A OE1   1 
ATOM   2805 N  NE2   . GLN A 1 343 ? -55.185 -30.002 -11.995 1.00 30.98  ? 343 GLN A NE2   1 
ATOM   2806 N  N     . GLU A 1 344 ? -59.441 -33.047 -15.970 1.00 46.88  ? 344 GLU A N     1 
ATOM   2807 C  CA    . GLU A 1 344 ? -60.710 -33.733 -16.124 1.00 45.48  ? 344 GLU A CA    1 
ATOM   2808 C  C     . GLU A 1 344 ? -60.879 -34.150 -17.581 1.00 52.06  ? 344 GLU A C     1 
ATOM   2809 O  O     . GLU A 1 344 ? -60.404 -33.452 -18.483 1.00 45.46  ? 344 GLU A O     1 
ATOM   2810 C  CB    . GLU A 1 344 ? -61.883 -32.837 -15.704 1.00 55.84  ? 344 GLU A CB    1 
ATOM   2811 C  CG    . GLU A 1 344 ? -62.910 -33.528 -14.821 1.00 74.96  ? 344 GLU A CG    1 
ATOM   2812 C  CD    . GLU A 1 344 ? -64.171 -32.707 -14.643 1.00 91.63  ? 344 GLU A CD    1 
ATOM   2813 O  OE1   . GLU A 1 344 ? -64.062 -31.502 -14.328 1.00 89.33  ? 344 GLU A OE1   1 
ATOM   2814 O  OE2   . GLU A 1 344 ? -65.271 -33.268 -14.831 1.00 80.54  ? 344 GLU A OE2   1 
ATOM   2815 N  N     . PRO A 1 345 ? -61.529 -35.285 -17.844 1.00 59.46  ? 345 PRO A N     1 
ATOM   2816 C  CA    . PRO A 1 345 ? -61.645 -35.761 -19.229 1.00 53.07  ? 345 PRO A CA    1 
ATOM   2817 C  C     . PRO A 1 345 ? -62.334 -34.746 -20.131 1.00 45.07  ? 345 PRO A C     1 
ATOM   2818 O  O     . PRO A 1 345 ? -63.341 -34.138 -19.762 1.00 41.47  ? 345 PRO A O     1 
ATOM   2819 C  CB    . PRO A 1 345 ? -62.470 -37.045 -19.094 1.00 62.52  ? 345 PRO A CB    1 
ATOM   2820 C  CG    . PRO A 1 345 ? -62.197 -37.514 -17.706 1.00 63.38  ? 345 PRO A CG    1 
ATOM   2821 C  CD    . PRO A 1 345 ? -62.055 -36.267 -16.879 1.00 59.37  ? 345 PRO A CD    1 
ATOM   2822 N  N     . PHE A 1 346 ? -61.760 -34.562 -21.323 1.00 48.70  ? 346 PHE A N     1 
ATOM   2823 C  CA    . PHE A 1 346 ? -62.298 -33.675 -22.357 1.00 55.67  ? 346 PHE A CA    1 
ATOM   2824 C  C     . PHE A 1 346 ? -62.339 -32.217 -21.906 1.00 51.21  ? 346 PHE A C     1 
ATOM   2825 O  O     . PHE A 1 346 ? -63.150 -31.427 -22.396 1.00 41.01  ? 346 PHE A O     1 
ATOM   2826 C  CB    . PHE A 1 346 ? -63.685 -34.136 -22.818 1.00 51.65  ? 346 PHE A CB    1 
ATOM   2827 C  CG    . PHE A 1 346 ? -63.699 -35.523 -23.394 1.00 58.31  ? 346 PHE A CG    1 
ATOM   2828 C  CD1   . PHE A 1 346 ? -64.210 -36.586 -22.668 1.00 57.76  ? 346 PHE A CD1   1 
ATOM   2829 C  CD2   . PHE A 1 346 ? -63.188 -35.766 -24.659 1.00 63.36  ? 346 PHE A CD2   1 
ATOM   2830 C  CE1   . PHE A 1 346 ? -64.219 -37.864 -23.196 1.00 64.16  ? 346 PHE A CE1   1 
ATOM   2831 C  CE2   . PHE A 1 346 ? -63.194 -37.041 -25.192 1.00 63.92  ? 346 PHE A CE2   1 
ATOM   2832 C  CZ    . PHE A 1 346 ? -63.710 -38.091 -24.459 1.00 54.72  ? 346 PHE A CZ    1 
ATOM   2833 N  N     . LYS A 1 347 ? -61.455 -31.843 -20.976 1.00 44.58  ? 347 LYS A N     1 
ATOM   2834 C  CA    . LYS A 1 347 ? -61.295 -30.457 -20.526 1.00 38.61  ? 347 LYS A CA    1 
ATOM   2835 C  C     . LYS A 1 347 ? -59.800 -30.147 -20.554 1.00 32.27  ? 347 LYS A C     1 
ATOM   2836 O  O     . LYS A 1 347 ? -59.130 -30.151 -19.519 1.00 32.71  ? 347 LYS A O     1 
ATOM   2837 C  CB    . LYS A 1 347 ? -61.898 -30.245 -19.138 1.00 40.55  ? 347 LYS A CB    1 
ATOM   2838 C  CG    . LYS A 1 347 ? -63.412 -30.340 -19.092 1.00 43.68  ? 347 LYS A CG    1 
ATOM   2839 C  CD    . LYS A 1 347 ? -63.941 -29.943 -17.723 1.00 61.66  ? 347 LYS A CD    1 
ATOM   2840 C  CE    . LYS A 1 347 ? -65.458 -30.001 -17.680 1.00 71.93  ? 347 LYS A CE    1 
ATOM   2841 N  NZ    . LYS A 1 347 ? -65.986 -29.584 -16.352 1.00 76.12  ? 347 LYS A NZ    1 
ATOM   2842 N  N     . ASN A 1 348 ? -59.284 -29.875 -21.750 1.00 33.98  ? 348 ASN A N     1 
ATOM   2843 C  CA    . ASN A 1 348 ? -57.851 -29.684 -21.927 1.00 35.93  ? 348 ASN A CA    1 
ATOM   2844 C  C     . ASN A 1 348 ? -57.379 -28.405 -21.248 1.00 34.67  ? 348 ASN A C     1 
ATOM   2845 O  O     . ASN A 1 348 ? -57.971 -27.336 -21.428 1.00 39.86  ? 348 ASN A O     1 
ATOM   2846 C  CB    . ASN A 1 348 ? -57.500 -29.638 -23.413 1.00 33.89  ? 348 ASN A CB    1 
ATOM   2847 C  CG    . ASN A 1 348 ? -57.611 -30.991 -24.084 1.00 34.22  ? 348 ASN A CG    1 
ATOM   2848 O  OD1   . ASN A 1 348 ? -57.567 -32.029 -23.424 1.00 38.04  ? 348 ASN A OD1   1 
ATOM   2849 N  ND2   . ASN A 1 348 ? -57.745 -30.987 -25.405 1.00 29.27  ? 348 ASN A ND2   1 
ATOM   2850 N  N     . LEU A 1 349 ? -56.310 -28.521 -20.459 1.00 34.16  ? 349 LEU A N     1 
ATOM   2851 C  CA    . LEU A 1 349 ? -55.570 -27.334 -20.046 1.00 30.83  ? 349 LEU A CA    1 
ATOM   2852 C  C     . LEU A 1 349 ? -54.856 -26.714 -21.240 1.00 29.79  ? 349 LEU A C     1 
ATOM   2853 O  O     . LEU A 1 349 ? -55.003 -25.518 -21.515 1.00 36.67  ? 349 LEU A O     1 
ATOM   2854 C  CB    . LEU A 1 349 ? -54.570 -27.694 -18.947 1.00 31.63  ? 349 LEU A CB    1 
ATOM   2855 C  CG    . LEU A 1 349 ? -55.137 -27.992 -17.560 1.00 37.13  ? 349 LEU A CG    1 
ATOM   2856 C  CD1   . LEU A 1 349 ? -54.051 -28.534 -16.651 1.00 38.60  ? 349 LEU A CD1   1 
ATOM   2857 C  CD2   . LEU A 1 349 ? -55.748 -26.738 -16.967 1.00 30.12  ? 349 LEU A CD2   1 
ATOM   2858 N  N     . LYS A 1 350 ? -54.087 -27.523 -21.963 1.00 27.19  ? 350 LYS A N     1 
ATOM   2859 C  CA    . LYS A 1 350 ? -53.446 -27.105 -23.200 1.00 32.58  ? 350 LYS A CA    1 
ATOM   2860 C  C     . LYS A 1 350 ? -53.127 -28.357 -24.003 1.00 38.79  ? 350 LYS A C     1 
ATOM   2861 O  O     . LYS A 1 350 ? -53.270 -29.482 -23.519 1.00 33.68  ? 350 LYS A O     1 
ATOM   2862 C  CB    . LYS A 1 350 ? -52.180 -26.284 -22.933 1.00 31.30  ? 350 LYS A CB    1 
ATOM   2863 C  CG    . LYS A 1 350 ? -51.016 -27.100 -22.398 1.00 26.80  ? 350 LYS A CG    1 
ATOM   2864 C  CD    . LYS A 1 350 ? -49.843 -26.212 -22.016 1.00 36.76  ? 350 LYS A CD    1 
ATOM   2865 C  CE    . LYS A 1 350 ? -49.305 -25.447 -23.215 1.00 29.72  ? 350 LYS A CE    1 
ATOM   2866 N  NZ    . LYS A 1 350 ? -48.720 -26.353 -24.244 1.00 33.45  ? 350 LYS A NZ    1 
ATOM   2867 N  N     . THR A 1 351 ? -52.700 -28.149 -25.245 1.00 31.44  ? 351 THR A N     1 
ATOM   2868 C  CA    . THR A 1 351 ? -52.254 -29.230 -26.111 1.00 33.69  ? 351 THR A CA    1 
ATOM   2869 C  C     . THR A 1 351 ? -50.855 -28.905 -26.620 1.00 34.46  ? 351 THR A C     1 
ATOM   2870 O  O     . THR A 1 351 ? -50.264 -27.879 -26.270 1.00 34.35  ? 351 THR A O     1 
ATOM   2871 C  CB    . THR A 1 351 ? -53.217 -29.453 -27.285 1.00 34.32  ? 351 THR A CB    1 
ATOM   2872 O  OG1   . THR A 1 351 ? -53.165 -28.328 -28.169 1.00 32.44  ? 351 THR A OG1   1 
ATOM   2873 C  CG2   . THR A 1 351 ? -54.642 -29.637 -26.787 1.00 30.52  ? 351 THR A CG2   1 
ATOM   2874 N  N     . GLY A 1 352 ? -50.324 -29.793 -27.449 1.00 34.10  ? 352 GLY A N     1 
ATOM   2875 C  CA    . GLY A 1 352 ? -49.007 -29.578 -28.016 1.00 30.88  ? 352 GLY A CA    1 
ATOM   2876 C  C     . GLY A 1 352 ? -48.663 -30.695 -28.972 1.00 39.63  ? 352 GLY A C     1 
ATOM   2877 O  O     . GLY A 1 352 ? -49.470 -31.592 -29.239 1.00 36.46  ? 352 GLY A O     1 
ATOM   2878 N  N     . LYS A 1 353 ? -47.436 -30.632 -29.482 1.00 34.53  ? 353 LYS A N     1 
ATOM   2879 C  CA    . LYS A 1 353 ? -46.954 -31.640 -30.411 1.00 41.23  ? 353 LYS A CA    1 
ATOM   2880 C  C     . LYS A 1 353 ? -45.454 -31.808 -30.235 1.00 43.46  ? 353 LYS A C     1 
ATOM   2881 O  O     . LYS A 1 353 ? -44.759 -30.912 -29.747 1.00 34.63  ? 353 LYS A O     1 
ATOM   2882 C  CB    . LYS A 1 353 ? -47.286 -31.269 -31.861 1.00 34.46  ? 353 LYS A CB    1 
ATOM   2883 C  CG    . LYS A 1 353 ? -46.560 -30.034 -32.364 1.00 41.94  ? 353 LYS A CG    1 
ATOM   2884 C  CD    . LYS A 1 353 ? -46.931 -29.729 -33.804 1.00 41.14  ? 353 LYS A CD    1 
ATOM   2885 C  CE    . LYS A 1 353 ? -46.020 -28.665 -34.384 1.00 50.22  ? 353 LYS A CE    1 
ATOM   2886 N  NZ    . LYS A 1 353 ? -44.598 -29.112 -34.403 1.00 56.71  ? 353 LYS A NZ    1 
ATOM   2887 N  N     . TYR A 1 354 ? -44.962 -32.979 -30.632 1.00 34.25  ? 354 TYR A N     1 
ATOM   2888 C  CA    . TYR A 1 354 ? -43.533 -33.267 -30.639 1.00 38.15  ? 354 TYR A CA    1 
ATOM   2889 C  C     . TYR A 1 354 ? -43.206 -34.005 -31.926 1.00 43.15  ? 354 TYR A C     1 
ATOM   2890 O  O     . TYR A 1 354 ? -43.797 -35.051 -32.210 1.00 40.72  ? 354 TYR A O     1 
ATOM   2891 C  CB    . TYR A 1 354 ? -43.117 -34.096 -29.420 1.00 38.20  ? 354 TYR A CB    1 
ATOM   2892 C  CG    . TYR A 1 354 ? -41.663 -34.513 -29.444 1.00 45.93  ? 354 TYR A CG    1 
ATOM   2893 C  CD1   . TYR A 1 354 ? -40.662 -33.635 -29.044 1.00 32.98  ? 354 TYR A CD1   1 
ATOM   2894 C  CD2   . TYR A 1 354 ? -41.292 -35.784 -29.867 1.00 35.69  ? 354 TYR A CD2   1 
ATOM   2895 C  CE1   . TYR A 1 354 ? -39.332 -34.010 -29.066 1.00 42.06  ? 354 TYR A CE1   1 
ATOM   2896 C  CE2   . TYR A 1 354 ? -39.965 -36.168 -29.893 1.00 38.24  ? 354 TYR A CE2   1 
ATOM   2897 C  CZ    . TYR A 1 354 ? -38.990 -35.278 -29.491 1.00 43.62  ? 354 TYR A CZ    1 
ATOM   2898 O  OH    . TYR A 1 354 ? -37.667 -35.654 -29.513 1.00 45.78  ? 354 TYR A OH    1 
ATOM   2899 N  N     . ALA A 1 355 ? -42.267 -33.460 -32.702 1.00 39.21  ? 355 ALA A N     1 
ATOM   2900 C  CA    . ALA A 1 355 ? -41.894 -34.069 -33.972 1.00 46.14  ? 355 ALA A CA    1 
ATOM   2901 C  C     . ALA A 1 355 ? -40.396 -34.000 -34.240 1.00 42.18  ? 355 ALA A C     1 
ATOM   2902 O  O     . ALA A 1 355 ? -39.979 -34.231 -35.382 1.00 46.14  ? 355 ALA A O     1 
ATOM   2903 C  CB    . ALA A 1 355 ? -42.656 -33.408 -35.127 1.00 37.44  ? 355 ALA A CB    1 
ATOM   2904 N  N     . ARG A 1 356 ? -39.577 -33.694 -33.237 1.00 44.31  ? 356 ARG A N     1 
ATOM   2905 C  CA    . ARG A 1 356 ? -38.142 -33.580 -33.454 1.00 47.48  ? 356 ARG A CA    1 
ATOM   2906 C  C     . ARG A 1 356 ? -37.540 -34.949 -33.737 1.00 46.24  ? 356 ARG A C     1 
ATOM   2907 O  O     . ARG A 1 356 ? -37.811 -35.920 -33.024 1.00 48.73  ? 356 ARG A O     1 
ATOM   2908 C  CB    . ARG A 1 356 ? -37.466 -32.949 -32.239 1.00 45.57  ? 356 ARG A CB    1 
ATOM   2909 C  CG    . ARG A 1 356 ? -36.003 -32.612 -32.472 1.00 56.22  ? 356 ARG A CG    1 
ATOM   2910 C  CD    . ARG A 1 356 ? -35.312 -32.176 -31.193 1.00 54.71  ? 356 ARG A CD    1 
ATOM   2911 N  NE    . ARG A 1 356 ? -33.930 -31.776 -31.440 1.00 61.32  ? 356 ARG A NE    1 
ATOM   2912 C  CZ    . ARG A 1 356 ? -33.038 -31.538 -30.484 1.00 72.38  ? 356 ARG A CZ    1 
ATOM   2913 N  NH1   . ARG A 1 356 ? -33.379 -31.667 -29.209 1.00 76.99  ? 356 ARG A NH1   1 
ATOM   2914 N  NH2   . ARG A 1 356 ? -31.803 -31.177 -30.804 1.00 73.44  ? 356 ARG A NH2   1 
ATOM   2915 N  N     . MET A 1 357 ? -36.719 -35.024 -34.780 1.00 44.07  ? 357 MET A N     1 
ATOM   2916 C  CA    . MET A 1 357 ? -36.052 -36.259 -35.172 1.00 51.59  ? 357 MET A CA    1 
ATOM   2917 C  C     . MET A 1 357 ? -34.643 -36.249 -34.594 1.00 49.79  ? 357 MET A C     1 
ATOM   2918 O  O     . MET A 1 357 ? -33.791 -35.466 -35.027 1.00 57.60  ? 357 MET A O     1 
ATOM   2919 C  CB    . MET A 1 357 ? -36.022 -36.404 -36.692 1.00 64.80  ? 357 MET A CB    1 
ATOM   2920 C  CG    . MET A 1 357 ? -35.677 -37.803 -37.170 1.00 82.92  ? 357 MET A CG    1 
ATOM   2921 S  SD    . MET A 1 357 ? -36.866 -39.027 -36.584 1.00 99.24  ? 357 MET A SD    1 
ATOM   2922 C  CE    . MET A 1 357 ? -38.399 -38.322 -37.190 1.00 62.21  ? 357 MET A CE    1 
ATOM   2923 N  N     . ARG A 1 358 ? -34.401 -37.112 -33.613 1.00 36.74  ? 358 ARG A N     1 
ATOM   2924 C  CA    . ARG A 1 358 ? -33.092 -37.260 -32.994 1.00 46.45  ? 358 ARG A CA    1 
ATOM   2925 C  C     . ARG A 1 358 ? -32.451 -38.551 -33.481 1.00 52.34  ? 358 ARG A C     1 
ATOM   2926 O  O     . ARG A 1 358 ? -33.060 -39.623 -33.397 1.00 46.54  ? 358 ARG A O     1 
ATOM   2927 C  CB    . ARG A 1 358 ? -33.202 -37.263 -31.467 1.00 49.63  ? 358 ARG A CB    1 
ATOM   2928 C  CG    . ARG A 1 358 ? -33.625 -35.930 -30.874 1.00 58.54  ? 358 ARG A CG    1 
ATOM   2929 C  CD    . ARG A 1 358 ? -33.796 -36.027 -29.367 1.00 71.64  ? 358 ARG A CD    1 
ATOM   2930 N  NE    . ARG A 1 358 ? -32.554 -36.393 -28.690 1.00 69.50  ? 358 ARG A NE    1 
ATOM   2931 C  CZ    . ARG A 1 358 ? -31.683 -35.518 -28.199 1.00 71.10  ? 358 ARG A CZ    1 
ATOM   2932 N  NH1   . ARG A 1 358 ? -31.913 -34.216 -28.308 1.00 78.49  ? 358 ARG A NH1   1 
ATOM   2933 N  NH2   . ARG A 1 358 ? -30.580 -35.944 -27.597 1.00 76.48  ? 358 ARG A NH2   1 
ATOM   2934 N  N     . GLY A 1 359 ? -31.235 -38.444 -33.991 1.00 49.63  ? 359 GLY A N     1 
ATOM   2935 C  CA    . GLY A 1 359 ? -30.519 -39.622 -34.450 1.00 46.16  ? 359 GLY A CA    1 
ATOM   2936 C  C     . GLY A 1 359 ? -30.857 -39.990 -35.879 1.00 44.13  ? 359 GLY A C     1 
ATOM   2937 O  O     . GLY A 1 359 ? -31.959 -39.758 -36.375 1.00 46.43  ? 359 GLY A O     1 
ATOM   2938 N  N     . ALA A 1 360 ? -29.871 -40.580 -36.560 1.00 42.63  ? 360 ALA A N     1 
ATOM   2939 C  CA    . ALA A 1 360 ? -30.098 -41.056 -37.919 1.00 48.39  ? 360 ALA A CA    1 
ATOM   2940 C  C     . ALA A 1 360 ? -31.013 -42.272 -37.938 1.00 38.26  ? 360 ALA A C     1 
ATOM   2941 O  O     . ALA A 1 360 ? -31.751 -42.476 -38.909 1.00 36.54  ? 360 ALA A O     1 
ATOM   2942 C  CB    . ALA A 1 360 ? -28.765 -41.383 -38.592 1.00 44.90  ? 360 ALA A CB    1 
ATOM   2943 N  N     . HIS A 1 361 ? -30.988 -43.081 -36.881 1.00 38.93  ? 361 HIS A N     1 
ATOM   2944 C  CA    . HIS A 1 361 ? -31.800 -44.286 -36.787 1.00 34.05  ? 361 HIS A CA    1 
ATOM   2945 C  C     . HIS A 1 361 ? -32.472 -44.322 -35.423 1.00 38.75  ? 361 HIS A C     1 
ATOM   2946 O  O     . HIS A 1 361 ? -31.818 -44.092 -34.401 1.00 37.53  ? 361 HIS A O     1 
ATOM   2947 C  CB    . HIS A 1 361 ? -30.947 -45.542 -36.995 1.00 31.76  ? 361 HIS A CB    1 
ATOM   2948 C  CG    . HIS A 1 361 ? -29.792 -45.340 -37.926 1.00 27.73  ? 361 HIS A CG    1 
ATOM   2949 N  ND1   . HIS A 1 361 ? -29.946 -45.214 -39.290 1.00 29.63  ? 361 HIS A ND1   1 
ATOM   2950 C  CD2   . HIS A 1 361 ? -28.462 -45.240 -37.687 1.00 33.66  ? 361 HIS A CD2   1 
ATOM   2951 C  CE1   . HIS A 1 361 ? -28.761 -45.047 -39.851 1.00 30.65  ? 361 HIS A CE1   1 
ATOM   2952 N  NE2   . HIS A 1 361 ? -27.844 -45.059 -38.900 1.00 31.01  ? 361 HIS A NE2   1 
ATOM   2953 N  N     . THR A 1 362 ? -33.769 -44.616 -35.408 1.00 41.15  ? 362 THR A N     1 
ATOM   2954 C  CA    . THR A 1 362 ? -34.539 -44.637 -34.171 1.00 34.73  ? 362 THR A CA    1 
ATOM   2955 C  C     . THR A 1 362 ? -35.776 -45.500 -34.384 1.00 35.44  ? 362 THR A C     1 
ATOM   2956 O  O     . THR A 1 362 ? -36.005 -46.038 -35.471 1.00 41.66  ? 362 THR A O     1 
ATOM   2957 C  CB    . THR A 1 362 ? -34.923 -43.220 -33.736 1.00 36.52  ? 362 THR A CB    1 
ATOM   2958 O  OG1   . THR A 1 362 ? -35.619 -43.274 -32.485 1.00 43.67  ? 362 THR A OG1   1 
ATOM   2959 C  CG2   . THR A 1 362 ? -35.822 -42.572 -34.779 1.00 25.41  ? 362 THR A CG2   1 
ATOM   2960 N  N     . ASN A 1 363 ? -36.579 -45.629 -33.327 1.00 32.71  ? 363 ASN A N     1 
ATOM   2961 C  CA    . ASN A 1 363 ? -37.840 -46.354 -33.385 1.00 32.93  ? 363 ASN A CA    1 
ATOM   2962 C  C     . ASN A 1 363 ? -38.897 -45.562 -32.623 1.00 37.30  ? 363 ASN A C     1 
ATOM   2963 O  O     . ASN A 1 363 ? -38.609 -44.533 -32.004 1.00 34.79  ? 363 ASN A O     1 
ATOM   2964 C  CB    . ASN A 1 363 ? -37.694 -47.782 -32.839 1.00 33.09  ? 363 ASN A CB    1 
ATOM   2965 C  CG    . ASN A 1 363 ? -37.213 -47.822 -31.395 1.00 39.84  ? 363 ASN A CG    1 
ATOM   2966 O  OD1   . ASN A 1 363 ? -37.719 -47.104 -30.532 1.00 32.60  ? 363 ASN A OD1   1 
ATOM   2967 N  ND2   . ASN A 1 363 ? -36.229 -48.674 -31.129 1.00 36.49  ? 363 ASN A ND2   1 
ATOM   2968 N  N     . ASP A 1 364 ? -40.136 -46.058 -32.665 1.00 31.90  ? 364 ASP A N     1 
ATOM   2969 C  CA    . ASP A 1 364 ? -41.247 -45.359 -32.030 1.00 33.54  ? 364 ASP A CA    1 
ATOM   2970 C  C     . ASP A 1 364 ? -41.140 -45.340 -30.510 1.00 35.98  ? 364 ASP A C     1 
ATOM   2971 O  O     . ASP A 1 364 ? -41.707 -44.444 -29.877 1.00 36.41  ? 364 ASP A O     1 
ATOM   2972 C  CB    . ASP A 1 364 ? -42.575 -45.993 -32.449 1.00 40.10  ? 364 ASP A CB    1 
ATOM   2973 C  CG    . ASP A 1 364 ? -42.876 -45.797 -33.923 1.00 49.74  ? 364 ASP A CG    1 
ATOM   2974 O  OD1   . ASP A 1 364 ? -42.429 -44.777 -34.491 1.00 45.16  ? 364 ASP A OD1   1 
ATOM   2975 O  OD2   . ASP A 1 364 ? -43.559 -46.661 -34.512 1.00 61.28  ? 364 ASP A OD2   1 
ATOM   2976 N  N     . VAL A 1 365 ? -40.434 -46.300 -29.911 1.00 35.01  ? 365 VAL A N     1 
ATOM   2977 C  CA    . VAL A 1 365 ? -40.310 -46.319 -28.457 1.00 34.86  ? 365 VAL A CA    1 
ATOM   2978 C  C     . VAL A 1 365 ? -39.343 -45.241 -27.980 1.00 32.79  ? 365 VAL A C     1 
ATOM   2979 O  O     . VAL A 1 365 ? -39.576 -44.599 -26.950 1.00 31.80  ? 365 VAL A O     1 
ATOM   2980 C  CB    . VAL A 1 365 ? -39.888 -47.718 -27.978 1.00 33.28  ? 365 VAL A CB    1 
ATOM   2981 C  CG1   . VAL A 1 365 ? -39.788 -47.751 -26.461 1.00 25.05  ? 365 VAL A CG1   1 
ATOM   2982 C  CG2   . VAL A 1 365 ? -40.878 -48.763 -28.468 1.00 31.78  ? 365 VAL A CG2   1 
ATOM   2983 N  N     . LYS A 1 366 ? -38.252 -45.020 -28.718 1.00 30.98  ? 366 LYS A N     1 
ATOM   2984 C  CA    . LYS A 1 366 ? -37.334 -43.936 -28.376 1.00 32.03  ? 366 LYS A CA    1 
ATOM   2985 C  C     . LYS A 1 366 ? -38.025 -42.584 -28.486 1.00 37.22  ? 366 LYS A C     1 
ATOM   2986 O  O     . LYS A 1 366 ? -37.923 -41.746 -27.583 1.00 36.07  ? 366 LYS A O     1 
ATOM   2987 C  CB    . LYS A 1 366 ? -36.104 -43.976 -29.283 1.00 34.83  ? 366 LYS A CB    1 
ATOM   2988 C  CG    . LYS A 1 366 ? -35.159 -45.137 -29.044 1.00 40.32  ? 366 LYS A CG    1 
ATOM   2989 C  CD    . LYS A 1 366 ? -33.934 -45.005 -29.933 1.00 42.78  ? 366 LYS A CD    1 
ATOM   2990 C  CE    . LYS A 1 366 ? -32.954 -46.142 -29.719 1.00 46.89  ? 366 LYS A CE    1 
ATOM   2991 N  NZ    . LYS A 1 366 ? -31.747 -45.993 -30.583 1.00 44.62  ? 366 LYS A NZ    1 
ATOM   2992 N  N     . GLN A 1 367 ? -38.732 -42.353 -29.597 1.00 32.42  ? 367 GLN A N     1 
ATOM   2993 C  CA    . GLN A 1 367 ? -39.403 -41.073 -29.801 1.00 41.85  ? 367 GLN A CA    1 
ATOM   2994 C  C     . GLN A 1 367 ? -40.462 -40.826 -28.736 1.00 38.53  ? 367 GLN A C     1 
ATOM   2995 O  O     . GLN A 1 367 ? -40.629 -39.693 -28.268 1.00 42.17  ? 367 GLN A O     1 
ATOM   2996 C  CB    . GLN A 1 367 ? -40.023 -41.025 -31.196 1.00 31.49  ? 367 GLN A CB    1 
ATOM   2997 C  CG    . GLN A 1 367 ? -39.008 -41.035 -32.326 1.00 41.57  ? 367 GLN A CG    1 
ATOM   2998 C  CD    . GLN A 1 367 ? -39.660 -41.014 -33.694 1.00 48.41  ? 367 GLN A CD    1 
ATOM   2999 O  OE1   . GLN A 1 367 ? -40.882 -41.101 -33.814 1.00 51.06  ? 367 GLN A OE1   1 
ATOM   3000 N  NE2   . GLN A 1 367 ? -38.847 -40.894 -34.736 1.00 52.42  ? 367 GLN A NE2   1 
ATOM   3001 N  N     . LEU A 1 368 ? -41.190 -41.873 -28.339 1.00 37.65  ? 368 LEU A N     1 
ATOM   3002 C  CA    . LEU A 1 368 ? -42.173 -41.721 -27.271 1.00 36.03  ? 368 LEU A CA    1 
ATOM   3003 C  C     . LEU A 1 368 ? -41.501 -41.327 -25.962 1.00 39.64  ? 368 LEU A C     1 
ATOM   3004 O  O     . LEU A 1 368 ? -42.008 -40.470 -25.229 1.00 43.99  ? 368 LEU A O     1 
ATOM   3005 C  CB    . LEU A 1 368 ? -42.970 -43.014 -27.100 1.00 28.03  ? 368 LEU A CB    1 
ATOM   3006 C  CG    . LEU A 1 368 ? -44.101 -42.984 -26.070 1.00 36.05  ? 368 LEU A CG    1 
ATOM   3007 C  CD1   . LEU A 1 368 ? -45.120 -41.909 -26.419 1.00 27.36  ? 368 LEU A CD1   1 
ATOM   3008 C  CD2   . LEU A 1 368 ? -44.771 -44.346 -25.968 1.00 35.10  ? 368 LEU A CD2   1 
ATOM   3009 N  N     . THR A 1 369 ? -40.355 -41.941 -25.654 1.00 33.30  ? 369 THR A N     1 
ATOM   3010 C  CA    . THR A 1 369 ? -39.608 -41.561 -24.459 1.00 35.54  ? 369 THR A CA    1 
ATOM   3011 C  C     . THR A 1 369 ? -39.152 -40.109 -24.537 1.00 42.54  ? 369 THR A C     1 
ATOM   3012 O  O     . THR A 1 369 ? -39.162 -39.390 -23.530 1.00 38.88  ? 369 THR A O     1 
ATOM   3013 C  CB    . THR A 1 369 ? -38.407 -42.490 -24.272 1.00 37.91  ? 369 THR A CB    1 
ATOM   3014 O  OG1   . THR A 1 369 ? -38.855 -43.851 -24.218 1.00 43.28  ? 369 THR A OG1   1 
ATOM   3015 C  CG2   . THR A 1 369 ? -37.664 -42.156 -22.984 1.00 50.06  ? 369 THR A CG2   1 
ATOM   3016 N  N     . GLU A 1 370 ? -38.758 -39.656 -25.728 1.00 34.91  ? 370 GLU A N     1 
ATOM   3017 C  CA    . GLU A 1 370 ? -38.314 -38.276 -25.887 1.00 40.86  ? 370 GLU A CA    1 
ATOM   3018 C  C     . GLU A 1 370 ? -39.476 -37.300 -25.752 1.00 39.99  ? 370 GLU A C     1 
ATOM   3019 O  O     . GLU A 1 370 ? -39.316 -36.211 -25.190 1.00 34.93  ? 370 GLU A O     1 
ATOM   3020 C  CB    . GLU A 1 370 ? -37.617 -38.109 -27.236 1.00 28.13  ? 370 GLU A CB    1 
ATOM   3021 C  CG    . GLU A 1 370 ? -36.319 -38.891 -27.349 1.00 44.67  ? 370 GLU A CG    1 
ATOM   3022 C  CD    . GLU A 1 370 ? -35.945 -39.203 -28.785 1.00 51.80  ? 370 GLU A CD    1 
ATOM   3023 O  OE1   . GLU A 1 370 ? -34.998 -39.991 -28.993 1.00 44.61  ? 370 GLU A OE1   1 
ATOM   3024 O  OE2   . GLU A 1 370 ? -36.601 -38.666 -29.702 1.00 56.85  ? 370 GLU A OE2   1 
ATOM   3025 N  N     . ALA A 1 371 ? -40.653 -37.670 -26.263 1.00 34.70  ? 371 ALA A N     1 
ATOM   3026 C  CA    . ALA A 1 371 ? -41.825 -36.817 -26.100 1.00 29.06  ? 371 ALA A CA    1 
ATOM   3027 C  C     . ALA A 1 371 ? -42.234 -36.720 -24.635 1.00 35.89  ? 371 ALA A C     1 
ATOM   3028 O  O     . ALA A 1 371 ? -42.625 -35.646 -24.165 1.00 42.48  ? 371 ALA A O     1 
ATOM   3029 C  CB    . ALA A 1 371 ? -42.982 -37.341 -26.949 1.00 28.06  ? 371 ALA A CB    1 
ATOM   3030 N  N     . VAL A 1 372 ? -42.146 -37.832 -23.900 1.00 35.13  ? 372 VAL A N     1 
ATOM   3031 C  CA    . VAL A 1 372 ? -42.461 -37.814 -22.474 1.00 28.18  ? 372 VAL A CA    1 
ATOM   3032 C  C     . VAL A 1 372 ? -41.534 -36.858 -21.734 1.00 32.55  ? 372 VAL A C     1 
ATOM   3033 O  O     . VAL A 1 372 ? -41.959 -36.129 -20.829 1.00 30.64  ? 372 VAL A O     1 
ATOM   3034 C  CB    . VAL A 1 372 ? -42.387 -39.241 -21.895 1.00 30.26  ? 372 VAL A CB    1 
ATOM   3035 C  CG1   . VAL A 1 372 ? -42.460 -39.208 -20.377 1.00 28.02  ? 372 VAL A CG1   1 
ATOM   3036 C  CG2   . VAL A 1 372 ? -43.508 -40.099 -22.460 1.00 29.62  ? 372 VAL A CG2   1 
ATOM   3037 N  N     . GLN A 1 373 ? -40.256 -36.834 -22.118 1.00 33.19  ? 373 GLN A N     1 
ATOM   3038 C  CA    . GLN A 1 373 ? -39.301 -35.954 -21.454 1.00 39.69  ? 373 GLN A CA    1 
ATOM   3039 C  C     . GLN A 1 373 ? -39.542 -34.491 -21.803 1.00 32.32  ? 373 GLN A C     1 
ATOM   3040 O  O     . GLN A 1 373 ? -39.346 -33.615 -20.953 1.00 29.73  ? 373 GLN A O     1 
ATOM   3041 C  CB    . GLN A 1 373 ? -37.876 -36.367 -21.817 1.00 29.69  ? 373 GLN A CB    1 
ATOM   3042 C  CG    . GLN A 1 373 ? -37.498 -37.740 -21.300 1.00 48.13  ? 373 GLN A CG    1 
ATOM   3043 C  CD    . GLN A 1 373 ? -36.292 -38.319 -22.010 1.00 62.22  ? 373 GLN A CD    1 
ATOM   3044 O  OE1   . GLN A 1 373 ? -35.973 -39.497 -21.850 1.00 58.81  ? 373 GLN A OE1   1 
ATOM   3045 N  NE2   . GLN A 1 373 ? -35.616 -37.495 -22.802 1.00 53.97  ? 373 GLN A NE2   1 
ATOM   3046 N  N     . LYS A 1 374 ? -39.967 -34.205 -23.036 1.00 35.44  ? 374 LYS A N     1 
ATOM   3047 C  CA    . LYS A 1 374 ? -40.273 -32.826 -23.407 1.00 33.36  ? 374 LYS A CA    1 
ATOM   3048 C  C     . LYS A 1 374 ? -41.506 -32.320 -22.668 1.00 32.91  ? 374 LYS A C     1 
ATOM   3049 O  O     . LYS A 1 374 ? -41.518 -31.188 -22.171 1.00 33.01  ? 374 LYS A O     1 
ATOM   3050 C  CB    . LYS A 1 374 ? -40.471 -32.720 -24.919 1.00 30.45  ? 374 LYS A CB    1 
ATOM   3051 C  CG    . LYS A 1 374 ? -40.453 -31.297 -25.455 1.00 41.91  ? 374 LYS A CG    1 
ATOM   3052 C  CD    . LYS A 1 374 ? -39.071 -30.675 -25.312 1.00 59.57  ? 374 LYS A CD    1 
ATOM   3053 C  CE    . LYS A 1 374 ? -39.007 -29.298 -25.958 1.00 57.86  ? 374 LYS A CE    1 
ATOM   3054 N  NZ    . LYS A 1 374 ? -39.899 -28.319 -25.277 1.00 48.49  ? 374 LYS A NZ    1 
ATOM   3055 N  N     . ILE A 1 375 ? -42.550 -33.149 -22.582 1.00 32.40  ? 375 ILE A N     1 
ATOM   3056 C  CA    . ILE A 1 375 ? -43.757 -32.757 -21.862 1.00 34.02  ? 375 ILE A CA    1 
ATOM   3057 C  C     . ILE A 1 375 ? -43.476 -32.613 -20.373 1.00 32.92  ? 375 ILE A C     1 
ATOM   3058 O  O     . ILE A 1 375 ? -44.062 -31.753 -19.703 1.00 29.90  ? 375 ILE A O     1 
ATOM   3059 C  CB    . ILE A 1 375 ? -44.885 -33.772 -22.131 1.00 31.42  ? 375 ILE A CB    1 
ATOM   3060 C  CG1   . ILE A 1 375 ? -45.165 -33.869 -23.630 1.00 28.40  ? 375 ILE A CG1   1 
ATOM   3061 C  CG2   . ILE A 1 375 ? -46.154 -33.385 -21.386 1.00 31.29  ? 375 ILE A CG2   1 
ATOM   3062 C  CD1   . ILE A 1 375 ? -46.059 -35.028 -24.001 1.00 26.93  ? 375 ILE A CD1   1 
ATOM   3063 N  N     . THR A 1 376 ? -42.576 -33.437 -19.830 1.00 31.54  ? 376 THR A N     1 
ATOM   3064 C  CA    . THR A 1 376 ? -42.247 -33.347 -18.410 1.00 33.30  ? 376 THR A CA    1 
ATOM   3065 C  C     . THR A 1 376 ? -41.579 -32.015 -18.086 1.00 34.11  ? 376 THR A C     1 
ATOM   3066 O  O     . THR A 1 376 ? -41.957 -31.336 -17.124 1.00 32.03  ? 376 THR A O     1 
ATOM   3067 C  CB    . THR A 1 376 ? -41.344 -34.513 -18.004 1.00 32.87  ? 376 THR A CB    1 
ATOM   3068 O  OG1   . THR A 1 376 ? -42.038 -35.750 -18.205 1.00 32.00  ? 376 THR A OG1   1 
ATOM   3069 C  CG2   . THR A 1 376 ? -40.941 -34.394 -16.541 1.00 27.20  ? 376 THR A CG2   1 
ATOM   3070 N  N     . THR A 1 377 ? -40.581 -31.625 -18.883 1.00 34.62  ? 377 THR A N     1 
ATOM   3071 C  CA    . THR A 1 377 ? -39.910 -30.349 -18.657 1.00 35.37  ? 377 THR A CA    1 
ATOM   3072 C  C     . THR A 1 377 ? -40.859 -29.179 -18.889 1.00 38.58  ? 377 THR A C     1 
ATOM   3073 O  O     . THR A 1 377 ? -40.814 -28.180 -18.161 1.00 35.14  ? 377 THR A O     1 
ATOM   3074 C  CB    . THR A 1 377 ? -38.682 -30.233 -19.563 1.00 38.29  ? 377 THR A CB    1 
ATOM   3075 O  OG1   . THR A 1 377 ? -37.823 -31.360 -19.351 1.00 46.55  ? 377 THR A OG1   1 
ATOM   3076 C  CG2   . THR A 1 377 ? -37.911 -28.956 -19.260 1.00 36.39  ? 377 THR A CG2   1 
ATOM   3077 N  N     . GLU A 1 378 ? -41.727 -29.287 -19.897 1.00 32.08  ? 378 GLU A N     1 
ATOM   3078 C  CA    . GLU A 1 378 ? -42.711 -28.239 -20.146 1.00 29.74  ? 378 GLU A CA    1 
ATOM   3079 C  C     . GLU A 1 378 ? -43.696 -28.120 -18.990 1.00 34.49  ? 378 GLU A C     1 
ATOM   3080 O  O     . GLU A 1 378 ? -44.093 -27.010 -18.614 1.00 30.21  ? 378 GLU A O     1 
ATOM   3081 C  CB    . GLU A 1 378 ? -43.447 -28.522 -21.456 1.00 26.89  ? 378 GLU A CB    1 
ATOM   3082 C  CG    . GLU A 1 378 ? -44.636 -27.613 -21.724 1.00 42.30  ? 378 GLU A CG    1 
ATOM   3083 C  CD    . GLU A 1 378 ? -45.336 -27.945 -23.027 1.00 60.94  ? 378 GLU A CD    1 
ATOM   3084 O  OE1   . GLU A 1 378 ? -44.748 -28.692 -23.839 1.00 56.67  ? 378 GLU A OE1   1 
ATOM   3085 O  OE2   . GLU A 1 378 ? -46.471 -27.464 -23.235 1.00 43.97  ? 378 GLU A OE2   1 
ATOM   3086 N  N     . SER A 1 379 ? -44.099 -29.253 -18.410 1.00 31.34  ? 379 SER A N     1 
ATOM   3087 C  CA    . SER A 1 379 ? -45.051 -29.223 -17.305 1.00 29.49  ? 379 SER A CA    1 
ATOM   3088 C  C     . SER A 1 379 ? -44.435 -28.633 -16.043 1.00 26.92  ? 379 SER A C     1 
ATOM   3089 O  O     . SER A 1 379 ? -45.130 -27.961 -15.272 1.00 29.37  ? 379 SER A O     1 
ATOM   3090 C  CB    . SER A 1 379 ? -45.578 -30.629 -17.025 1.00 30.84  ? 379 SER A CB    1 
ATOM   3091 O  OG    . SER A 1 379 ? -46.205 -31.178 -18.171 1.00 38.22  ? 379 SER A OG    1 
ATOM   3092 N  N     . ILE A 1 380 ? -43.143 -28.875 -15.812 1.00 27.32  ? 380 ILE A N     1 
ATOM   3093 C  CA    . ILE A 1 380 ? -42.477 -28.301 -14.646 1.00 32.27  ? 380 ILE A CA    1 
ATOM   3094 C  C     . ILE A 1 380 ? -42.416 -26.783 -14.763 1.00 29.99  ? 380 ILE A C     1 
ATOM   3095 O  O     . ILE A 1 380 ? -42.545 -26.063 -13.766 1.00 35.72  ? 380 ILE A O     1 
ATOM   3096 C  CB    . ILE A 1 380 ? -41.078 -28.923 -14.477 1.00 39.48  ? 380 ILE A CB    1 
ATOM   3097 C  CG1   . ILE A 1 380 ? -41.200 -30.407 -14.124 1.00 28.17  ? 380 ILE A CG1   1 
ATOM   3098 C  CG2   . ILE A 1 380 ? -40.279 -28.187 -13.409 1.00 29.55  ? 380 ILE A CG2   1 
ATOM   3099 C  CD1   . ILE A 1 380 ? -39.869 -31.122 -13.994 1.00 32.99  ? 380 ILE A CD1   1 
ATOM   3100 N  N     . VAL A 1 381 ? -42.235 -26.271 -15.980 1.00 28.62  ? 381 VAL A N     1 
ATOM   3101 C  CA    . VAL A 1 381 ? -42.211 -24.826 -16.182 1.00 32.48  ? 381 VAL A CA    1 
ATOM   3102 C  C     . VAL A 1 381 ? -43.576 -24.220 -15.874 1.00 33.83  ? 381 VAL A C     1 
ATOM   3103 O  O     . VAL A 1 381 ? -43.688 -23.257 -15.107 1.00 34.58  ? 381 VAL A O     1 
ATOM   3104 C  CB    . VAL A 1 381 ? -41.762 -24.493 -17.616 1.00 31.35  ? 381 VAL A CB    1 
ATOM   3105 C  CG1   . VAL A 1 381 ? -41.935 -23.009 -17.895 1.00 22.74  ? 381 VAL A CG1   1 
ATOM   3106 C  CG2   . VAL A 1 381 ? -40.319 -24.914 -17.831 1.00 25.37  ? 381 VAL A CG2   1 
ATOM   3107 N  N     . ILE A 1 382 ? -44.634 -24.785 -16.456 1.00 29.79  ? 382 ILE A N     1 
ATOM   3108 C  CA    . ILE A 1 382 ? -45.948 -24.154 -16.389 1.00 23.91  ? 382 ILE A CA    1 
ATOM   3109 C  C     . ILE A 1 382 ? -46.616 -24.402 -15.042 1.00 30.10  ? 382 ILE A C     1 
ATOM   3110 O  O     . ILE A 1 382 ? -47.213 -23.491 -14.459 1.00 27.57  ? 382 ILE A O     1 
ATOM   3111 C  CB    . ILE A 1 382 ? -46.821 -24.642 -17.559 1.00 25.61  ? 382 ILE A CB    1 
ATOM   3112 C  CG1   . ILE A 1 382 ? -46.242 -24.151 -18.887 1.00 28.58  ? 382 ILE A CG1   1 
ATOM   3113 C  CG2   . ILE A 1 382 ? -48.258 -24.174 -17.398 1.00 27.32  ? 382 ILE A CG2   1 
ATOM   3114 C  CD1   . ILE A 1 382 ? -46.983 -24.659 -20.105 1.00 18.76  ? 382 ILE A CD1   1 
ATOM   3115 N  N     . TRP A 1 383 ? -46.532 -25.626 -14.519 1.00 26.65  ? 383 TRP A N     1 
ATOM   3116 C  CA    . TRP A 1 383 ? -47.246 -25.980 -13.301 1.00 28.31  ? 383 TRP A CA    1 
ATOM   3117 C  C     . TRP A 1 383 ? -46.350 -26.320 -12.118 1.00 29.39  ? 383 TRP A C     1 
ATOM   3118 O  O     . TRP A 1 383 ? -46.863 -26.451 -11.001 1.00 29.89  ? 383 TRP A O     1 
ATOM   3119 C  CB    . TRP A 1 383 ? -48.193 -27.161 -13.561 1.00 30.79  ? 383 TRP A CB    1 
ATOM   3120 C  CG    . TRP A 1 383 ? -49.219 -26.877 -14.613 1.00 33.68  ? 383 TRP A CG    1 
ATOM   3121 C  CD1   . TRP A 1 383 ? -50.334 -26.101 -14.482 1.00 28.93  ? 383 TRP A CD1   1 
ATOM   3122 C  CD2   . TRP A 1 383 ? -49.228 -27.367 -15.960 1.00 32.25  ? 383 TRP A CD2   1 
ATOM   3123 N  NE1   . TRP A 1 383 ? -51.035 -26.076 -15.662 1.00 29.66  ? 383 TRP A NE1   1 
ATOM   3124 C  CE2   . TRP A 1 383 ? -50.378 -26.846 -16.585 1.00 32.15  ? 383 TRP A CE2   1 
ATOM   3125 C  CE3   . TRP A 1 383 ? -48.376 -28.195 -16.696 1.00 32.71  ? 383 TRP A CE3   1 
ATOM   3126 C  CZ2   . TRP A 1 383 ? -50.697 -27.126 -17.912 1.00 35.97  ? 383 TRP A CZ2   1 
ATOM   3127 C  CZ3   . TRP A 1 383 ? -48.694 -28.471 -18.014 1.00 36.71  ? 383 TRP A CZ3   1 
ATOM   3128 C  CH2   . TRP A 1 383 ? -49.844 -27.938 -18.608 1.00 39.46  ? 383 TRP A CH2   1 
ATOM   3129 N  N     . GLY A 1 384 ? -45.043 -26.466 -12.319 1.00 27.70  ? 384 GLY A N     1 
ATOM   3130 C  CA    . GLY A 1 384 ? -44.155 -26.762 -11.213 1.00 28.88  ? 384 GLY A CA    1 
ATOM   3131 C  C     . GLY A 1 384 ? -44.142 -28.205 -10.770 1.00 37.95  ? 384 GLY A C     1 
ATOM   3132 O  O     . GLY A 1 384 ? -43.646 -28.500 -9.678  1.00 38.13  ? 384 GLY A O     1 
ATOM   3133 N  N     . LYS A 1 385 ? -44.669 -29.117 -11.581 1.00 26.14  ? 385 LYS A N     1 
ATOM   3134 C  CA    . LYS A 1 385 ? -44.709 -30.526 -11.217 1.00 37.58  ? 385 LYS A CA    1 
ATOM   3135 C  C     . LYS A 1 385 ? -44.791 -31.358 -12.488 1.00 36.82  ? 385 LYS A C     1 
ATOM   3136 O  O     . LYS A 1 385 ? -44.996 -30.838 -13.588 1.00 41.59  ? 385 LYS A O     1 
ATOM   3137 C  CB    . LYS A 1 385 ? -45.887 -30.830 -10.287 1.00 32.61  ? 385 LYS A CB    1 
ATOM   3138 C  CG    . LYS A 1 385 ? -47.238 -30.412 -10.844 1.00 41.58  ? 385 LYS A CG    1 
ATOM   3139 C  CD    . LYS A 1 385 ? -48.369 -30.835 -9.923  1.00 44.98  ? 385 LYS A CD    1 
ATOM   3140 C  CE    . LYS A 1 385 ? -48.455 -32.350 -9.814  1.00 49.02  ? 385 LYS A CE    1 
ATOM   3141 N  NZ    . LYS A 1 385 ? -49.611 -32.776 -8.978  1.00 54.65  ? 385 LYS A NZ    1 
ATOM   3142 N  N     . THR A 1 386 ? -44.627 -32.658 -12.319 1.00 39.55  ? 386 THR A N     1 
ATOM   3143 C  CA    . THR A 1 386 ? -44.656 -33.709 -13.328 1.00 29.38  ? 386 THR A CA    1 
ATOM   3144 C  C     . THR A 1 386 ? -46.072 -34.264 -13.470 1.00 30.64  ? 386 THR A C     1 
ATOM   3145 O  O     . THR A 1 386 ? -46.746 -34.506 -12.465 1.00 43.30  ? 386 THR A O     1 
ATOM   3146 C  CB    . THR A 1 386 ? -43.700 -34.838 -12.952 1.00 41.97  ? 386 THR A CB    1 
ATOM   3147 O  OG1   . THR A 1 386 ? -42.364 -34.326 -12.874 1.00 41.52  ? 386 THR A OG1   1 
ATOM   3148 C  CG2   . THR A 1 386 ? -43.746 -35.956 -13.984 1.00 38.71  ? 386 THR A CG2   1 
ATOM   3149 N  N     . PRO A 1 387 ? -46.554 -34.459 -14.694 1.00 32.04  ? 387 PRO A N     1 
ATOM   3150 C  CA    . PRO A 1 387 ? -47.884 -35.037 -14.889 1.00 37.50  ? 387 PRO A CA    1 
ATOM   3151 C  C     . PRO A 1 387 ? -47.849 -36.558 -14.943 1.00 29.30  ? 387 PRO A C     1 
ATOM   3152 O  O     . PRO A 1 387 ? -46.809 -37.183 -15.159 1.00 32.22  ? 387 PRO A O     1 
ATOM   3153 C  CB    . PRO A 1 387 ? -48.308 -34.459 -16.246 1.00 33.90  ? 387 PRO A CB    1 
ATOM   3154 C  CG    . PRO A 1 387 ? -47.020 -34.360 -16.992 1.00 31.28  ? 387 PRO A CG    1 
ATOM   3155 C  CD    . PRO A 1 387 ? -45.958 -34.017 -15.968 1.00 28.19  ? 387 PRO A CD    1 
ATOM   3156 N  N     . LYS A 1 388 ? -49.022 -37.146 -14.731 1.00 37.19  ? 388 LYS A N     1 
ATOM   3157 C  CA    . LYS A 1 388 ? -49.222 -38.568 -14.960 1.00 37.22  ? 388 LYS A CA    1 
ATOM   3158 C  C     . LYS A 1 388 ? -49.573 -38.782 -16.426 1.00 38.18  ? 388 LYS A C     1 
ATOM   3159 O  O     . LYS A 1 388 ? -50.292 -37.980 -17.025 1.00 42.98  ? 388 LYS A O     1 
ATOM   3160 C  CB    . LYS A 1 388 ? -50.327 -39.116 -14.056 1.00 40.85  ? 388 LYS A CB    1 
ATOM   3161 C  CG    . LYS A 1 388 ? -50.060 -38.920 -12.572 1.00 47.27  ? 388 LYS A CG    1 
ATOM   3162 C  CD    . LYS A 1 388 ? -51.187 -39.481 -11.723 1.00 61.86  ? 388 LYS A CD    1 
ATOM   3163 C  CE    . LYS A 1 388 ? -50.894 -39.306 -10.241 1.00 63.11  ? 388 LYS A CE    1 
ATOM   3164 N  NZ    . LYS A 1 388 ? -51.967 -39.888 -9.388  1.00 72.19  ? 388 LYS A NZ    1 
ATOM   3165 N  N     . PHE A 1 389 ? -49.056 -39.860 -17.004 1.00 32.18  ? 389 PHE A N     1 
ATOM   3166 C  CA    . PHE A 1 389 ? -49.113 -40.048 -18.445 1.00 37.89  ? 389 PHE A CA    1 
ATOM   3167 C  C     . PHE A 1 389 ? -50.105 -41.137 -18.834 1.00 44.23  ? 389 PHE A C     1 
ATOM   3168 O  O     . PHE A 1 389 ? -50.342 -42.090 -18.088 1.00 35.23  ? 389 PHE A O     1 
ATOM   3169 C  CB    . PHE A 1 389 ? -47.727 -40.379 -19.004 1.00 33.63  ? 389 PHE A CB    1 
ATOM   3170 C  CG    . PHE A 1 389 ? -46.804 -39.196 -19.058 1.00 34.94  ? 389 PHE A CG    1 
ATOM   3171 C  CD1   . PHE A 1 389 ? -46.825 -38.336 -20.146 1.00 35.93  ? 389 PHE A CD1   1 
ATOM   3172 C  CD2   . PHE A 1 389 ? -45.926 -38.935 -18.020 1.00 32.59  ? 389 PHE A CD2   1 
ATOM   3173 C  CE1   . PHE A 1 389 ? -45.983 -37.241 -20.200 1.00 31.06  ? 389 PHE A CE1   1 
ATOM   3174 C  CE2   . PHE A 1 389 ? -45.080 -37.842 -18.067 1.00 34.97  ? 389 PHE A CE2   1 
ATOM   3175 C  CZ    . PHE A 1 389 ? -45.108 -36.994 -19.159 1.00 33.85  ? 389 PHE A CZ    1 
ATOM   3176 N  N     . LYS A 1 390 ? -50.690 -40.965 -20.017 1.00 39.38  ? 390 LYS A N     1 
ATOM   3177 C  CA    . LYS A 1 390 ? -51.575 -41.940 -20.650 1.00 35.81  ? 390 LYS A CA    1 
ATOM   3178 C  C     . LYS A 1 390 ? -50.954 -42.275 -22.003 1.00 43.16  ? 390 LYS A C     1 
ATOM   3179 O  O     . LYS A 1 390 ? -51.109 -41.519 -22.967 1.00 47.42  ? 390 LYS A O     1 
ATOM   3180 C  CB    . LYS A 1 390 ? -52.990 -41.385 -20.801 1.00 38.14  ? 390 LYS A CB    1 
ATOM   3181 C  CG    . LYS A 1 390 ? -53.993 -41.890 -19.776 1.00 43.41  ? 390 LYS A CG    1 
ATOM   3182 C  CD    . LYS A 1 390 ? -53.665 -41.442 -18.366 1.00 54.54  ? 390 LYS A CD    1 
ATOM   3183 C  CE    . LYS A 1 390 ? -54.752 -41.890 -17.397 1.00 62.31  ? 390 LYS A CE    1 
ATOM   3184 N  NZ    . LYS A 1 390 ? -54.441 -41.529 -15.985 1.00 65.88  ? 390 LYS A NZ    1 
ATOM   3185 N  N     . LEU A 1 391 ? -50.245 -43.406 -22.077 1.00 40.05  ? 391 LEU A N     1 
ATOM   3186 C  CA    . LEU A 1 391 ? -49.461 -43.675 -23.272 1.00 35.92  ? 391 LEU A CA    1 
ATOM   3187 C  C     . LEU A 1 391 ? -50.046 -44.830 -24.077 1.00 41.47  ? 391 LEU A C     1 
ATOM   3188 O  O     . LEU A 1 391 ? -50.556 -45.797 -23.499 1.00 39.79  ? 391 LEU A O     1 
ATOM   3189 C  CB    . LEU A 1 391 ? -48.008 -44.003 -22.905 1.00 31.39  ? 391 LEU A CB    1 
ATOM   3190 C  CG    . LEU A 1 391 ? -47.293 -42.987 -22.012 1.00 38.19  ? 391 LEU A CG    1 
ATOM   3191 C  CD1   . LEU A 1 391 ? -45.849 -43.400 -21.785 1.00 37.09  ? 391 LEU A CD1   1 
ATOM   3192 C  CD2   . LEU A 1 391 ? -47.368 -41.592 -22.611 1.00 29.73  ? 391 LEU A CD2   1 
ATOM   3193 N  N     . PRO A 1 392 ? -49.985 -44.757 -25.420 1.00 38.28  ? 392 PRO A N     1 
ATOM   3194 C  CA    . PRO A 1 392 ? -50.482 -45.834 -26.287 1.00 38.40  ? 392 PRO A CA    1 
ATOM   3195 C  C     . PRO A 1 392 ? -49.459 -46.945 -26.519 1.00 41.05  ? 392 PRO A C     1 
ATOM   3196 O  O     . PRO A 1 392 ? -49.177 -47.329 -27.656 1.00 41.76  ? 392 PRO A O     1 
ATOM   3197 C  CB    . PRO A 1 392 ? -50.810 -45.091 -27.585 1.00 40.01  ? 392 PRO A CB    1 
ATOM   3198 C  CG    . PRO A 1 392 ? -49.780 -44.012 -27.638 1.00 40.51  ? 392 PRO A CG    1 
ATOM   3199 C  CD    . PRO A 1 392 ? -49.526 -43.595 -26.202 1.00 39.32  ? 392 PRO A CD    1 
ATOM   3200 N  N     . ILE A 1 393 ? -48.893 -47.459 -25.431 1.00 41.25  ? 393 ILE A N     1 
ATOM   3201 C  CA    . ILE A 1 393 ? -47.907 -48.531 -25.493 1.00 37.86  ? 393 ILE A CA    1 
ATOM   3202 C  C     . ILE A 1 393 ? -48.216 -49.532 -24.388 1.00 38.66  ? 393 ILE A C     1 
ATOM   3203 O  O     . ILE A 1 393 ? -48.536 -49.149 -23.257 1.00 32.51  ? 393 ILE A O     1 
ATOM   3204 C  CB    . ILE A 1 393 ? -46.464 -47.989 -25.377 1.00 37.84  ? 393 ILE A CB    1 
ATOM   3205 C  CG1   . ILE A 1 393 ? -45.448 -49.130 -25.464 1.00 35.68  ? 393 ILE A CG1   1 
ATOM   3206 C  CG2   . ILE A 1 393 ? -46.281 -47.183 -24.097 1.00 31.24  ? 393 ILE A CG2   1 
ATOM   3207 C  CD1   . ILE A 1 393 ? -44.011 -48.681 -25.315 1.00 27.65  ? 393 ILE A CD1   1 
ATOM   3208 N  N     . GLN A 1 394 ? -48.142 -50.817 -24.725 1.00 39.07  ? 394 GLN A N     1 
ATOM   3209 C  CA    . GLN A 1 394 ? -48.397 -51.863 -23.747 1.00 35.97  ? 394 GLN A CA    1 
ATOM   3210 C  C     . GLN A 1 394 ? -47.319 -51.866 -22.669 1.00 39.37  ? 394 GLN A C     1 
ATOM   3211 O  O     . GLN A 1 394 ? -46.153 -51.545 -22.921 1.00 40.48  ? 394 GLN A O     1 
ATOM   3212 C  CB    . GLN A 1 394 ? -48.449 -53.232 -24.426 1.00 48.01  ? 394 GLN A CB    1 
ATOM   3213 C  CG    . GLN A 1 394 ? -49.558 -53.387 -25.455 1.00 50.86  ? 394 GLN A CG    1 
ATOM   3214 C  CD    . GLN A 1 394 ? -50.917 -53.626 -24.826 1.00 68.56  ? 394 GLN A CD    1 
ATOM   3215 O  OE1   . GLN A 1 394 ? -51.034 -53.790 -23.612 1.00 85.53  ? 394 GLN A OE1   1 
ATOM   3216 N  NE2   . GLN A 1 394 ? -51.954 -53.650 -25.655 1.00 73.26  ? 394 GLN A NE2   1 
ATOM   3217 N  N     . LYS A 1 395 ? -47.727 -52.225 -21.450 1.00 36.91  ? 395 LYS A N     1 
ATOM   3218 C  CA    . LYS A 1 395 ? -46.760 -52.397 -20.370 1.00 41.31  ? 395 LYS A CA    1 
ATOM   3219 C  C     . LYS A 1 395 ? -45.738 -53.470 -20.720 1.00 42.22  ? 395 LYS A C     1 
ATOM   3220 O  O     . LYS A 1 395 ? -44.557 -53.352 -20.373 1.00 44.16  ? 395 LYS A O     1 
ATOM   3221 C  CB    . LYS A 1 395 ? -47.482 -52.749 -19.069 1.00 39.79  ? 395 LYS A CB    1 
ATOM   3222 C  CG    . LYS A 1 395 ? -48.228 -51.589 -18.428 1.00 43.60  ? 395 LYS A CG    1 
ATOM   3223 C  CD    . LYS A 1 395 ? -47.268 -50.630 -17.745 1.00 45.39  ? 395 LYS A CD    1 
ATOM   3224 C  CE    . LYS A 1 395 ? -48.004 -49.451 -17.128 1.00 47.92  ? 395 LYS A CE    1 
ATOM   3225 N  NZ    . LYS A 1 395 ? -47.074 -48.536 -16.410 1.00 44.70  ? 395 LYS A NZ    1 
ATOM   3226 N  N     . GLU A 1 396 ? -46.175 -54.523 -21.417 1.00 46.65  ? 396 GLU A N     1 
ATOM   3227 C  CA    . GLU A 1 396 ? -45.254 -55.582 -21.817 1.00 44.04  ? 396 GLU A CA    1 
ATOM   3228 C  C     . GLU A 1 396 ? -44.260 -55.085 -22.860 1.00 49.31  ? 396 GLU A C     1 
ATOM   3229 O  O     . GLU A 1 396 ? -43.093 -55.494 -22.854 1.00 45.52  ? 396 GLU A O     1 
ATOM   3230 C  CB    . GLU A 1 396 ? -46.033 -56.784 -22.352 1.00 46.37  ? 396 GLU A CB    1 
ATOM   3231 C  CG    . GLU A 1 396 ? -47.163 -57.259 -21.449 1.00 63.75  ? 396 GLU A CG    1 
ATOM   3232 C  CD    . GLU A 1 396 ? -46.718 -57.480 -20.015 1.00 92.09  ? 396 GLU A CD    1 
ATOM   3233 O  OE1   . GLU A 1 396 ? -47.084 -56.661 -19.145 1.00 87.07  ? 396 GLU A OE1   1 
ATOM   3234 O  OE2   . GLU A 1 396 ? -45.998 -58.469 -19.760 1.00 97.62  ? 396 GLU A OE2   1 
ATOM   3235 N  N     . THR A 1 397 ? -44.705 -54.210 -23.766 1.00 36.80  ? 397 THR A N     1 
ATOM   3236 C  CA    . THR A 1 397 ? -43.797 -53.658 -24.767 1.00 34.84  ? 397 THR A CA    1 
ATOM   3237 C  C     . THR A 1 397 ? -42.697 -52.832 -24.112 1.00 44.30  ? 397 THR A C     1 
ATOM   3238 O  O     . THR A 1 397 ? -41.522 -52.943 -24.483 1.00 40.83  ? 397 THR A O     1 
ATOM   3239 C  CB    . THR A 1 397 ? -44.574 -52.806 -25.772 1.00 38.58  ? 397 THR A CB    1 
ATOM   3240 O  OG1   . THR A 1 397 ? -45.611 -53.593 -26.372 1.00 41.72  ? 397 THR A OG1   1 
ATOM   3241 C  CG2   . THR A 1 397 ? -43.644 -52.287 -26.862 1.00 27.72  ? 397 THR A CG2   1 
ATOM   3242 N  N     . TRP A 1 398 ? -43.058 -52.003 -23.131 1.00 40.84  ? 398 TRP A N     1 
ATOM   3243 C  CA    . TRP A 1 398 ? -42.057 -51.196 -22.443 1.00 47.12  ? 398 TRP A CA    1 
ATOM   3244 C  C     . TRP A 1 398 ? -41.112 -52.065 -21.625 1.00 49.06  ? 398 TRP A C     1 
ATOM   3245 O  O     . TRP A 1 398 ? -39.899 -51.830 -21.616 1.00 53.88  ? 398 TRP A O     1 
ATOM   3246 C  CB    . TRP A 1 398 ? -42.740 -50.159 -21.552 1.00 44.98  ? 398 TRP A CB    1 
ATOM   3247 C  CG    . TRP A 1 398 ? -41.778 -49.372 -20.722 1.00 54.19  ? 398 TRP A CG    1 
ATOM   3248 C  CD1   . TRP A 1 398 ? -41.596 -49.458 -19.372 1.00 51.57  ? 398 TRP A CD1   1 
ATOM   3249 C  CD2   . TRP A 1 398 ? -40.852 -48.384 -21.189 1.00 48.57  ? 398 TRP A CD2   1 
ATOM   3250 N  NE1   . TRP A 1 398 ? -40.619 -48.581 -18.969 1.00 57.57  ? 398 TRP A NE1   1 
ATOM   3251 C  CE2   . TRP A 1 398 ? -40.147 -47.909 -20.066 1.00 51.30  ? 398 TRP A CE2   1 
ATOM   3252 C  CE3   . TRP A 1 398 ? -40.554 -47.854 -22.448 1.00 47.83  ? 398 TRP A CE3   1 
ATOM   3253 C  CZ2   . TRP A 1 398 ? -39.160 -46.930 -20.165 1.00 51.73  ? 398 TRP A CZ2   1 
ATOM   3254 C  CZ3   . TRP A 1 398 ? -39.575 -46.881 -22.543 1.00 52.39  ? 398 TRP A CZ3   1 
ATOM   3255 C  CH2   . TRP A 1 398 ? -38.890 -46.429 -21.408 1.00 49.58  ? 398 TRP A CH2   1 
ATOM   3256 N  N     . GLU A 1 399 ? -41.652 -53.073 -20.932 1.00 54.56  ? 399 GLU A N     1 
ATOM   3257 C  CA    . GLU A 1 399 ? -40.812 -53.979 -20.153 1.00 54.07  ? 399 GLU A CA    1 
ATOM   3258 C  C     . GLU A 1 399 ? -39.752 -54.637 -21.025 1.00 50.58  ? 399 GLU A C     1 
ATOM   3259 O  O     . GLU A 1 399 ? -38.597 -54.782 -20.607 1.00 46.35  ? 399 GLU A O     1 
ATOM   3260 C  CB    . GLU A 1 399 ? -41.675 -55.042 -19.473 1.00 57.15  ? 399 GLU A CB    1 
ATOM   3261 C  CG    . GLU A 1 399 ? -42.367 -54.565 -18.209 1.00 78.05  ? 399 GLU A CG    1 
ATOM   3262 C  CD    . GLU A 1 399 ? -41.406 -54.404 -17.049 1.00 79.60  ? 399 GLU A CD    1 
ATOM   3263 O  OE1   . GLU A 1 399 ? -40.376 -55.111 -17.029 1.00 67.07  ? 399 GLU A OE1   1 
ATOM   3264 O  OE2   . GLU A 1 399 ? -41.680 -53.570 -16.159 1.00 90.35  ? 399 GLU A OE2   1 
ATOM   3265 N  N     . THR A 1 400 ? -40.124 -55.039 -22.241 1.00 49.13  ? 400 THR A N     1 
ATOM   3266 C  CA    . THR A 1 400 ? -39.162 -55.665 -23.141 1.00 49.09  ? 400 THR A CA    1 
ATOM   3267 C  C     . THR A 1 400 ? -38.087 -54.677 -23.577 1.00 53.65  ? 400 THR A C     1 
ATOM   3268 O  O     . THR A 1 400 ? -36.909 -55.040 -23.683 1.00 50.34  ? 400 THR A O     1 
ATOM   3269 C  CB    . THR A 1 400 ? -39.886 -56.241 -24.360 1.00 51.09  ? 400 THR A CB    1 
ATOM   3270 O  OG1   . THR A 1 400 ? -40.920 -57.134 -23.927 1.00 57.22  ? 400 THR A OG1   1 
ATOM   3271 C  CG2   . THR A 1 400 ? -38.914 -56.998 -25.254 1.00 42.79  ? 400 THR A CG2   1 
ATOM   3272 N  N     . TRP A 1 401 ? -38.468 -53.421 -23.820 1.00 49.19  ? 401 TRP A N     1 
ATOM   3273 C  CA    . TRP A 1 401 ? -37.527 -52.448 -24.367 1.00 40.74  ? 401 TRP A CA    1 
ATOM   3274 C  C     . TRP A 1 401 ? -36.434 -52.101 -23.363 1.00 47.08  ? 401 TRP A C     1 
ATOM   3275 O  O     . TRP A 1 401 ? -35.242 -52.264 -23.645 1.00 39.86  ? 401 TRP A O     1 
ATOM   3276 C  CB    . TRP A 1 401 ? -38.270 -51.187 -24.812 1.00 49.31  ? 401 TRP A CB    1 
ATOM   3277 C  CG    . TRP A 1 401 ? -37.349 -50.050 -25.130 1.00 44.84  ? 401 TRP A CG    1 
ATOM   3278 C  CD1   . TRP A 1 401 ? -37.185 -48.903 -24.410 1.00 40.06  ? 401 TRP A CD1   1 
ATOM   3279 C  CD2   . TRP A 1 401 ? -36.449 -49.959 -26.241 1.00 43.97  ? 401 TRP A CD2   1 
ATOM   3280 N  NE1   . TRP A 1 401 ? -36.246 -48.099 -25.009 1.00 39.73  ? 401 TRP A NE1   1 
ATOM   3281 C  CE2   . TRP A 1 401 ? -35.778 -48.725 -26.134 1.00 37.95  ? 401 TRP A CE2   1 
ATOM   3282 C  CE3   . TRP A 1 401 ? -36.147 -50.800 -27.317 1.00 40.34  ? 401 TRP A CE3   1 
ATOM   3283 C  CZ2   . TRP A 1 401 ? -34.825 -48.310 -27.063 1.00 40.85  ? 401 TRP A CZ2   1 
ATOM   3284 C  CZ3   . TRP A 1 401 ? -35.201 -50.386 -28.238 1.00 38.21  ? 401 TRP A CZ3   1 
ATOM   3285 C  CH2   . TRP A 1 401 ? -34.551 -49.153 -28.105 1.00 43.81  ? 401 TRP A CH2   1 
ATOM   3286 N  N     . TRP A 1 402 ? -36.818 -51.613 -22.182 1.00 44.45  ? 402 TRP A N     1 
ATOM   3287 C  CA    . TRP A 1 402 ? -35.821 -51.159 -21.220 1.00 55.96  ? 402 TRP A CA    1 
ATOM   3288 C  C     . TRP A 1 402 ? -35.119 -52.305 -20.504 1.00 54.84  ? 402 TRP A C     1 
ATOM   3289 O  O     . TRP A 1 402 ? -34.161 -52.055 -19.764 1.00 62.70  ? 402 TRP A O     1 
ATOM   3290 C  CB    . TRP A 1 402 ? -36.455 -50.205 -20.198 1.00 58.09  ? 402 TRP A CB    1 
ATOM   3291 C  CG    . TRP A 1 402 ? -37.199 -50.865 -19.076 1.00 62.76  ? 402 TRP A CG    1 
ATOM   3292 C  CD1   . TRP A 1 402 ? -38.506 -51.256 -19.076 1.00 67.27  ? 402 TRP A CD1   1 
ATOM   3293 C  CD2   . TRP A 1 402 ? -36.686 -51.181 -17.776 1.00 65.25  ? 402 TRP A CD2   1 
ATOM   3294 N  NE1   . TRP A 1 402 ? -38.835 -51.809 -17.862 1.00 70.78  ? 402 TRP A NE1   1 
ATOM   3295 C  CE2   . TRP A 1 402 ? -37.735 -51.774 -17.046 1.00 71.35  ? 402 TRP A CE2   1 
ATOM   3296 C  CE3   . TRP A 1 402 ? -35.440 -51.024 -17.162 1.00 54.51  ? 402 TRP A CE3   1 
ATOM   3297 C  CZ2   . TRP A 1 402 ? -37.576 -52.211 -15.734 1.00 71.92  ? 402 TRP A CZ2   1 
ATOM   3298 C  CZ3   . TRP A 1 402 ? -35.283 -51.462 -15.861 1.00 62.36  ? 402 TRP A CZ3   1 
ATOM   3299 C  CH2   . TRP A 1 402 ? -36.345 -52.049 -15.161 1.00 71.94  ? 402 TRP A CH2   1 
ATOM   3300 N  N     . THR A 1 403 ? -35.557 -53.550 -20.709 1.00 57.19  ? 403 THR A N     1 
ATOM   3301 C  CA    . THR A 1 403 ? -34.804 -54.687 -20.188 1.00 54.57  ? 403 THR A CA    1 
ATOM   3302 C  C     . THR A 1 403 ? -33.548 -54.933 -21.014 1.00 54.73  ? 403 THR A C     1 
ATOM   3303 O  O     . THR A 1 403 ? -32.468 -55.170 -20.460 1.00 68.21  ? 403 THR A O     1 
ATOM   3304 C  CB    . THR A 1 403 ? -35.679 -55.941 -20.171 1.00 55.97  ? 403 THR A CB    1 
ATOM   3305 O  OG1   . THR A 1 403 ? -36.830 -55.716 -19.347 1.00 57.23  ? 403 THR A OG1   1 
ATOM   3306 C  CG2   . THR A 1 403 ? -34.901 -57.133 -19.629 1.00 59.22  ? 403 THR A CG2   1 
ATOM   3307 N  N     . GLU A 1 404 ? -33.668 -54.870 -22.339 1.00 51.81  ? 404 GLU A N     1 
ATOM   3308 C  CA    . GLU A 1 404 ? -32.566 -55.185 -23.237 1.00 55.07  ? 404 GLU A CA    1 
ATOM   3309 C  C     . GLU A 1 404 ? -31.773 -53.961 -23.676 1.00 57.05  ? 404 GLU A C     1 
ATOM   3310 O  O     . GLU A 1 404 ? -30.645 -54.115 -24.159 1.00 62.76  ? 404 GLU A O     1 
ATOM   3311 C  CB    . GLU A 1 404 ? -33.097 -55.908 -24.478 1.00 59.51  ? 404 GLU A CB    1 
ATOM   3312 C  CG    . GLU A 1 404 ? -34.082 -55.080 -25.289 1.00 71.56  ? 404 GLU A CG    1 
ATOM   3313 C  CD    . GLU A 1 404 ? -34.821 -55.899 -26.329 1.00 74.18  ? 404 GLU A CD    1 
ATOM   3314 O  OE1   . GLU A 1 404 ? -34.505 -57.099 -26.480 1.00 81.47  ? 404 GLU A OE1   1 
ATOM   3315 O  OE2   . GLU A 1 404 ? -35.723 -55.342 -26.992 1.00 64.19  ? 404 GLU A OE2   1 
ATOM   3316 N  N     . TYR A 1 405 ? -32.327 -52.760 -23.530 1.00 54.12  ? 405 TYR A N     1 
ATOM   3317 C  CA    . TYR A 1 405 ? -31.646 -51.563 -24.003 1.00 48.11  ? 405 TYR A CA    1 
ATOM   3318 C  C     . TYR A 1 405 ? -30.467 -51.232 -23.097 1.00 43.22  ? 405 TYR A C     1 
ATOM   3319 O  O     . TYR A 1 405 ? -30.601 -51.196 -21.869 1.00 46.14  ? 405 TYR A O     1 
ATOM   3320 C  CB    . TYR A 1 405 ? -32.621 -50.388 -24.069 1.00 42.89  ? 405 TYR A CB    1 
ATOM   3321 C  CG    . TYR A 1 405 ? -32.134 -49.246 -24.931 1.00 54.33  ? 405 TYR A CG    1 
ATOM   3322 C  CD1   . TYR A 1 405 ? -31.630 -49.481 -26.203 1.00 50.06  ? 405 TYR A CD1   1 
ATOM   3323 C  CD2   . TYR A 1 405 ? -32.186 -47.934 -24.480 1.00 41.73  ? 405 TYR A CD2   1 
ATOM   3324 C  CE1   . TYR A 1 405 ? -31.183 -48.442 -26.999 1.00 48.50  ? 405 TYR A CE1   1 
ATOM   3325 C  CE2   . TYR A 1 405 ? -31.744 -46.889 -25.270 1.00 45.62  ? 405 TYR A CE2   1 
ATOM   3326 C  CZ    . TYR A 1 405 ? -31.244 -47.149 -26.528 1.00 47.84  ? 405 TYR A CZ    1 
ATOM   3327 O  OH    . TYR A 1 405 ? -30.801 -46.110 -27.316 1.00 60.43  ? 405 TYR A OH    1 
ATOM   3328 N  N     . TRP A 1 406 ? -29.305 -50.990 -23.708 1.00 43.06  ? 406 TRP A N     1 
ATOM   3329 C  CA    . TRP A 1 406 ? -28.083 -50.769 -22.942 1.00 50.66  ? 406 TRP A CA    1 
ATOM   3330 C  C     . TRP A 1 406 ? -28.073 -49.429 -22.218 1.00 49.62  ? 406 TRP A C     1 
ATOM   3331 O  O     . TRP A 1 406 ? -27.339 -49.281 -21.235 1.00 52.74  ? 406 TRP A O     1 
ATOM   3332 C  CB    . TRP A 1 406 ? -26.861 -50.870 -23.857 1.00 58.53  ? 406 TRP A CB    1 
ATOM   3333 C  CG    . TRP A 1 406 ? -26.948 -50.007 -25.078 1.00 62.57  ? 406 TRP A CG    1 
ATOM   3334 C  CD1   . TRP A 1 406 ? -26.764 -48.656 -25.144 1.00 57.35  ? 406 TRP A CD1   1 
ATOM   3335 C  CD2   . TRP A 1 406 ? -27.231 -50.440 -26.414 1.00 80.76  ? 406 TRP A CD2   1 
ATOM   3336 N  NE1   . TRP A 1 406 ? -26.921 -48.220 -26.438 1.00 65.10  ? 406 TRP A NE1   1 
ATOM   3337 C  CE2   . TRP A 1 406 ? -27.208 -49.296 -27.237 1.00 71.09  ? 406 TRP A CE2   1 
ATOM   3338 C  CE3   . TRP A 1 406 ? -27.504 -51.684 -26.993 1.00 68.77  ? 406 TRP A CE3   1 
ATOM   3339 C  CZ2   . TRP A 1 406 ? -27.447 -49.359 -28.608 1.00 74.82  ? 406 TRP A CZ2   1 
ATOM   3340 C  CZ3   . TRP A 1 406 ? -27.742 -51.744 -28.355 1.00 66.58  ? 406 TRP A CZ3   1 
ATOM   3341 C  CH2   . TRP A 1 406 ? -27.711 -50.588 -29.147 1.00 64.46  ? 406 TRP A CH2   1 
ATOM   3342 N  N     . GLN A 1 407 ? -28.853 -48.456 -22.674 1.00 34.00  ? 407 GLN A N     1 
ATOM   3343 C  CA    . GLN A 1 407 ? -28.905 -47.164 -22.009 1.00 49.60  ? 407 GLN A CA    1 
ATOM   3344 C  C     . GLN A 1 407 ? -29.978 -47.155 -20.926 1.00 48.64  ? 407 GLN A C     1 
ATOM   3345 O  O     . GLN A 1 407 ? -30.936 -47.930 -20.954 1.00 44.74  ? 407 GLN A O     1 
ATOM   3346 C  CB    . GLN A 1 407 ? -29.170 -46.042 -23.013 1.00 39.20  ? 407 GLN A CB    1 
ATOM   3347 C  CG    . GLN A 1 407 ? -27.950 -45.617 -23.809 1.00 52.27  ? 407 GLN A CG    1 
ATOM   3348 C  CD    . GLN A 1 407 ? -28.188 -44.345 -24.601 1.00 72.29  ? 407 GLN A CD    1 
ATOM   3349 O  OE1   . GLN A 1 407 ? -29.329 -43.927 -24.798 1.00 57.37  ? 407 GLN A OE1   1 
ATOM   3350 N  NE2   . GLN A 1 407 ? -27.107 -43.718 -25.052 1.00 67.50  ? 407 GLN A NE2   1 
ATOM   3351 N  N     . ALA A 1 408 ? -29.795 -46.263 -19.957 1.00 40.69  ? 408 ALA A N     1 
ATOM   3352 C  CA    . ALA A 1 408 ? -30.780 -46.069 -18.903 1.00 37.43  ? 408 ALA A CA    1 
ATOM   3353 C  C     . ALA A 1 408 ? -31.924 -45.215 -19.437 1.00 41.05  ? 408 ALA A C     1 
ATOM   3354 O  O     . ALA A 1 408 ? -31.705 -44.087 -19.891 1.00 40.78  ? 408 ALA A O     1 
ATOM   3355 C  CB    . ALA A 1 408 ? -30.138 -45.415 -17.682 1.00 37.49  ? 408 ALA A CB    1 
ATOM   3356 N  N     . THR A 1 409 ? -33.137 -45.756 -19.394 1.00 41.91  ? 409 THR A N     1 
ATOM   3357 C  CA    . THR A 1 409 ? -34.324 -45.043 -19.839 1.00 38.38  ? 409 THR A CA    1 
ATOM   3358 C  C     . THR A 1 409 ? -35.449 -45.305 -18.851 1.00 47.24  ? 409 THR A C     1 
ATOM   3359 O  O     . THR A 1 409 ? -35.555 -46.404 -18.298 1.00 49.81  ? 409 THR A O     1 
ATOM   3360 C  CB    . THR A 1 409 ? -34.738 -45.465 -21.259 1.00 36.88  ? 409 THR A CB    1 
ATOM   3361 O  OG1   . THR A 1 409 ? -35.951 -44.799 -21.628 1.00 49.06  ? 409 THR A OG1   1 
ATOM   3362 C  CG2   . THR A 1 409 ? -34.940 -46.974 -21.343 1.00 32.55  ? 409 THR A CG2   1 
ATOM   3363 N  N     . TRP A 1 410 ? -36.278 -44.291 -18.620 1.00 41.00  ? 410 TRP A N     1 
ATOM   3364 C  CA    . TRP A 1 410 ? -37.329 -44.396 -17.622 1.00 50.39  ? 410 TRP A CA    1 
ATOM   3365 C  C     . TRP A 1 410 ? -38.472 -43.461 -17.985 1.00 51.32  ? 410 TRP A C     1 
ATOM   3366 O  O     . TRP A 1 410 ? -38.260 -42.377 -18.534 1.00 53.05  ? 410 TRP A O     1 
ATOM   3367 C  CB    . TRP A 1 410 ? -36.800 -44.074 -16.219 1.00 50.15  ? 410 TRP A CB    1 
ATOM   3368 C  CG    . TRP A 1 410 ? -37.835 -44.177 -15.140 1.00 54.72  ? 410 TRP A CG    1 
ATOM   3369 C  CD1   . TRP A 1 410 ? -38.396 -45.321 -14.649 1.00 40.67  ? 410 TRP A CD1   1 
ATOM   3370 C  CD2   . TRP A 1 410 ? -38.426 -43.096 -14.410 1.00 45.54  ? 410 TRP A CD2   1 
ATOM   3371 N  NE1   . TRP A 1 410 ? -39.303 -45.018 -13.662 1.00 45.74  ? 410 TRP A NE1   1 
ATOM   3372 C  CE2   . TRP A 1 410 ? -39.340 -43.659 -13.496 1.00 43.78  ? 410 TRP A CE2   1 
ATOM   3373 C  CE3   . TRP A 1 410 ? -38.274 -41.706 -14.442 1.00 42.92  ? 410 TRP A CE3   1 
ATOM   3374 C  CZ2   . TRP A 1 410 ? -40.097 -42.881 -12.622 1.00 39.29  ? 410 TRP A CZ2   1 
ATOM   3375 C  CZ3   . TRP A 1 410 ? -39.027 -40.935 -13.573 1.00 48.96  ? 410 TRP A CZ3   1 
ATOM   3376 C  CH2   . TRP A 1 410 ? -39.925 -41.525 -12.676 1.00 50.67  ? 410 TRP A CH2   1 
ATOM   3377 N  N     . ILE A 1 411 ? -39.687 -43.900 -17.671 1.00 43.61  ? 411 ILE A N     1 
ATOM   3378 C  CA    . ILE A 1 411 ? -40.901 -43.123 -17.877 1.00 41.02  ? 411 ILE A CA    1 
ATOM   3379 C  C     . ILE A 1 411 ? -41.600 -43.007 -16.529 1.00 45.78  ? 411 ILE A C     1 
ATOM   3380 O  O     . ILE A 1 411 ? -41.740 -44.013 -15.830 1.00 47.99  ? 411 ILE A O     1 
ATOM   3381 C  CB    . ILE A 1 411 ? -41.841 -43.765 -18.914 1.00 46.10  ? 411 ILE A CB    1 
ATOM   3382 C  CG1   . ILE A 1 411 ? -41.159 -43.839 -20.282 1.00 46.41  ? 411 ILE A CG1   1 
ATOM   3383 C  CG2   . ILE A 1 411 ? -43.149 -42.994 -19.011 1.00 39.98  ? 411 ILE A CG2   1 
ATOM   3384 C  CD1   . ILE A 1 411 ? -42.021 -44.463 -21.361 1.00 40.08  ? 411 ILE A CD1   1 
ATOM   3385 N  N     . PRO A 1 412 ? -42.042 -41.813 -16.118 1.00 41.05  ? 412 PRO A N     1 
ATOM   3386 C  CA    . PRO A 1 412 ? -42.749 -41.692 -14.833 1.00 45.17  ? 412 PRO A CA    1 
ATOM   3387 C  C     . PRO A 1 412 ? -44.093 -42.404 -14.834 1.00 38.64  ? 412 PRO A C     1 
ATOM   3388 O  O     . PRO A 1 412 ? -44.425 -43.110 -15.790 1.00 48.11  ? 412 PRO A O     1 
ATOM   3389 C  CB    . PRO A 1 412 ? -42.911 -40.175 -14.663 1.00 49.36  ? 412 PRO A CB    1 
ATOM   3390 C  CG    . PRO A 1 412 ? -42.812 -39.622 -16.045 1.00 47.49  ? 412 PRO A CG    1 
ATOM   3391 C  CD    . PRO A 1 412 ? -41.848 -40.508 -16.772 1.00 48.59  ? 412 PRO A CD    1 
ATOM   3392 N  N     . GLU A 1 413 ? -44.869 -42.220 -13.764 1.00 44.64  ? 413 GLU A N     1 
ATOM   3393 C  CA    . GLU A 1 413 ? -46.135 -42.926 -13.589 1.00 52.31  ? 413 GLU A CA    1 
ATOM   3394 C  C     . GLU A 1 413 ? -47.025 -42.777 -14.815 1.00 50.99  ? 413 GLU A C     1 
ATOM   3395 O  O     . GLU A 1 413 ? -47.321 -41.660 -15.249 1.00 40.75  ? 413 GLU A O     1 
ATOM   3396 C  CB    . GLU A 1 413 ? -46.855 -42.397 -12.347 1.00 45.28  ? 413 GLU A CB    1 
ATOM   3397 C  CG    . GLU A 1 413 ? -48.138 -43.140 -12.013 1.00 61.43  ? 413 GLU A CG    1 
ATOM   3398 C  CD    . GLU A 1 413 ? -48.909 -42.494 -10.880 1.00 69.85  ? 413 GLU A CD    1 
ATOM   3399 O  OE1   . GLU A 1 413 ? -50.154 -42.590 -10.879 1.00 67.49  ? 413 GLU A OE1   1 
ATOM   3400 O  OE2   . GLU A 1 413 ? -48.270 -41.884 -9.996  1.00 72.66  ? 413 GLU A OE2   1 
ATOM   3401 N  N     . TRP A 1 414 ? -47.444 -43.909 -15.376 1.00 39.93  ? 414 TRP A N     1 
ATOM   3402 C  CA    . TRP A 1 414 ? -48.237 -43.902 -16.596 1.00 44.56  ? 414 TRP A CA    1 
ATOM   3403 C  C     . TRP A 1 414 ? -49.104 -45.152 -16.647 1.00 41.45  ? 414 TRP A C     1 
ATOM   3404 O  O     . TRP A 1 414 ? -48.903 -46.108 -15.893 1.00 49.65  ? 414 TRP A O     1 
ATOM   3405 C  CB    . TRP A 1 414 ? -47.344 -43.813 -17.840 1.00 46.85  ? 414 TRP A CB    1 
ATOM   3406 C  CG    . TRP A 1 414 ? -46.515 -45.042 -18.089 1.00 45.58  ? 414 TRP A CG    1 
ATOM   3407 C  CD1   . TRP A 1 414 ? -45.338 -45.374 -17.483 1.00 45.69  ? 414 TRP A CD1   1 
ATOM   3408 C  CD2   . TRP A 1 414 ? -46.799 -46.096 -19.018 1.00 41.40  ? 414 TRP A CD2   1 
ATOM   3409 N  NE1   . TRP A 1 414 ? -44.874 -46.570 -17.974 1.00 37.74  ? 414 TRP A NE1   1 
ATOM   3410 C  CE2   . TRP A 1 414 ? -45.752 -47.033 -18.918 1.00 35.01  ? 414 TRP A CE2   1 
ATOM   3411 C  CE3   . TRP A 1 414 ? -47.835 -46.337 -19.924 1.00 37.11  ? 414 TRP A CE3   1 
ATOM   3412 C  CZ2   . TRP A 1 414 ? -45.711 -48.191 -19.689 1.00 42.23  ? 414 TRP A CZ2   1 
ATOM   3413 C  CZ3   . TRP A 1 414 ? -47.793 -47.489 -20.687 1.00 36.62  ? 414 TRP A CZ3   1 
ATOM   3414 C  CH2   . TRP A 1 414 ? -46.739 -48.401 -20.565 1.00 38.80  ? 414 TRP A CH2   1 
ATOM   3415 N  N     . GLU A 1 415 ? -50.086 -45.125 -17.546 1.00 44.83  ? 415 GLU A N     1 
ATOM   3416 C  CA    . GLU A 1 415 ? -50.937 -46.276 -17.809 1.00 45.72  ? 415 GLU A CA    1 
ATOM   3417 C  C     . GLU A 1 415 ? -51.223 -46.345 -19.303 1.00 43.44  ? 415 GLU A C     1 
ATOM   3418 O  O     . GLU A 1 415 ? -51.028 -45.375 -20.040 1.00 42.10  ? 415 GLU A O     1 
ATOM   3419 C  CB    . GLU A 1 415 ? -52.251 -46.218 -17.017 1.00 47.27  ? 415 GLU A CB    1 
ATOM   3420 C  CG    . GLU A 1 415 ? -53.313 -45.321 -17.628 1.00 63.19  ? 415 GLU A CG    1 
ATOM   3421 C  CD    . GLU A 1 415 ? -54.676 -45.518 -16.989 1.00 75.67  ? 415 GLU A CD    1 
ATOM   3422 O  OE1   . GLU A 1 415 ? -54.750 -46.197 -15.943 1.00 78.81  ? 415 GLU A OE1   1 
ATOM   3423 O  OE2   . GLU A 1 415 ? -55.673 -45.001 -17.536 1.00 70.08  ? 415 GLU A OE2   1 
ATOM   3424 N  N     . PHE A 1 416 ? -51.694 -47.509 -19.739 1.00 33.59  ? 416 PHE A N     1 
ATOM   3425 C  CA    . PHE A 1 416 ? -51.909 -47.783 -21.153 1.00 39.85  ? 416 PHE A CA    1 
ATOM   3426 C  C     . PHE A 1 416 ? -53.300 -47.343 -21.592 1.00 45.62  ? 416 PHE A C     1 
ATOM   3427 O  O     . PHE A 1 416 ? -54.288 -47.561 -20.885 1.00 44.72  ? 416 PHE A O     1 
ATOM   3428 C  CB    . PHE A 1 416 ? -51.714 -49.274 -21.433 1.00 37.51  ? 416 PHE A CB    1 
ATOM   3429 C  CG    . PHE A 1 416 ? -52.262 -49.724 -22.756 1.00 46.45  ? 416 PHE A CG    1 
ATOM   3430 C  CD1   . PHE A 1 416 ? -51.666 -49.326 -23.941 1.00 45.03  ? 416 PHE A CD1   1 
ATOM   3431 C  CD2   . PHE A 1 416 ? -53.363 -50.561 -22.814 1.00 48.09  ? 416 PHE A CD2   1 
ATOM   3432 C  CE1   . PHE A 1 416 ? -52.167 -49.744 -25.160 1.00 49.28  ? 416 PHE A CE1   1 
ATOM   3433 C  CE2   . PHE A 1 416 ? -53.868 -50.983 -24.029 1.00 53.32  ? 416 PHE A CE2   1 
ATOM   3434 C  CZ    . PHE A 1 416 ? -53.269 -50.574 -25.204 1.00 54.26  ? 416 PHE A CZ    1 
ATOM   3435 N  N     . VAL A 1 417 ? -53.368 -46.719 -22.767 1.00 35.67  ? 417 VAL A N     1 
ATOM   3436 C  CA    . VAL A 1 417 ? -54.625 -46.328 -23.393 1.00 47.69  ? 417 VAL A CA    1 
ATOM   3437 C  C     . VAL A 1 417 ? -54.668 -46.926 -24.791 1.00 50.66  ? 417 VAL A C     1 
ATOM   3438 O  O     . VAL A 1 417 ? -53.698 -46.818 -25.550 1.00 49.93  ? 417 VAL A O     1 
ATOM   3439 C  CB    . VAL A 1 417 ? -54.794 -44.797 -23.445 1.00 51.92  ? 417 VAL A CB    1 
ATOM   3440 C  CG1   . VAL A 1 417 ? -55.255 -44.274 -22.097 1.00 56.48  ? 417 VAL A CG1   1 
ATOM   3441 C  CG2   . VAL A 1 417 ? -53.495 -44.125 -23.867 1.00 41.95  ? 417 VAL A CG2   1 
ATOM   3442 N  N     . ASN A 1 418 ? -55.794 -47.558 -25.128 1.00 56.82  ? 418 ASN A N     1 
ATOM   3443 C  CA    . ASN A 1 418 ? -55.961 -48.216 -26.423 1.00 52.31  ? 418 ASN A CA    1 
ATOM   3444 C  C     . ASN A 1 418 ? -56.487 -47.196 -27.429 1.00 58.05  ? 418 ASN A C     1 
ATOM   3445 O  O     . ASN A 1 418 ? -57.669 -47.159 -27.777 1.00 65.06  ? 418 ASN A O     1 
ATOM   3446 C  CB    . ASN A 1 418 ? -56.888 -49.419 -26.297 1.00 65.80  ? 418 ASN A CB    1 
ATOM   3447 C  CG    . ASN A 1 418 ? -57.059 -50.165 -27.605 1.00 79.01  ? 418 ASN A CG    1 
ATOM   3448 O  OD1   . ASN A 1 418 ? -56.223 -50.065 -28.505 1.00 68.67  ? 418 ASN A OD1   1 
ATOM   3449 N  ND2   . ASN A 1 418 ? -58.147 -50.919 -27.719 1.00 92.58  ? 418 ASN A ND2   1 
ATOM   3450 N  N     . THR A 1 419 ? -55.576 -46.343 -27.898 1.00 51.90  ? 419 THR A N     1 
ATOM   3451 C  CA    . THR A 1 419 ? -55.859 -45.364 -28.947 1.00 67.38  ? 419 THR A CA    1 
ATOM   3452 C  C     . THR A 1 419 ? -54.855 -45.583 -30.070 1.00 66.81  ? 419 THR A C     1 
ATOM   3453 O  O     . THR A 1 419 ? -53.735 -45.047 -30.028 1.00 70.60  ? 419 THR A O     1 
ATOM   3454 C  CB    . THR A 1 419 ? -55.787 -43.933 -28.417 1.00 62.01  ? 419 THR A CB    1 
ATOM   3455 O  OG1   . THR A 1 419 ? -54.443 -43.635 -28.017 1.00 83.59  ? 419 THR A OG1   1 
ATOM   3456 C  CG2   . THR A 1 419 ? -56.717 -43.753 -27.226 1.00 66.98  ? 419 THR A CG2   1 
ATOM   3457 N  N     . PRO A 1 420 ? -55.209 -46.369 -31.099 1.00 58.13  ? 420 PRO A N     1 
ATOM   3458 C  CA    . PRO A 1 420 ? -54.328 -46.664 -32.235 1.00 52.68  ? 420 PRO A CA    1 
ATOM   3459 C  C     . PRO A 1 420 ? -53.880 -45.402 -32.969 1.00 45.45  ? 420 PRO A C     1 
ATOM   3460 O  O     . PRO A 1 420 ? -54.606 -44.408 -32.958 1.00 55.51  ? 420 PRO A O     1 
ATOM   3461 C  CB    . PRO A 1 420 ? -55.201 -47.544 -33.138 1.00 54.11  ? 420 PRO A CB    1 
ATOM   3462 C  CG    . PRO A 1 420 ? -56.602 -47.244 -32.731 1.00 62.97  ? 420 PRO A CG    1 
ATOM   3463 C  CD    . PRO A 1 420 ? -56.533 -46.991 -31.258 1.00 59.53  ? 420 PRO A CD    1 
ATOM   3464 N  N     . PRO A 1 421 ? -52.694 -45.437 -33.598 1.00 41.94  ? 421 PRO A N     1 
ATOM   3465 C  CA    . PRO A 1 421 ? -51.788 -46.591 -33.655 1.00 54.67  ? 421 PRO A CA    1 
ATOM   3466 C  C     . PRO A 1 421 ? -50.995 -46.814 -32.366 1.00 50.77  ? 421 PRO A C     1 
ATOM   3467 O  O     . PRO A 1 421 ? -50.521 -45.858 -31.752 1.00 57.56  ? 421 PRO A O     1 
ATOM   3468 C  CB    . PRO A 1 421 ? -50.850 -46.234 -34.808 1.00 54.70  ? 421 PRO A CB    1 
ATOM   3469 C  CG    . PRO A 1 421 ? -50.809 -44.751 -34.798 1.00 50.22  ? 421 PRO A CG    1 
ATOM   3470 C  CD    . PRO A 1 421 ? -52.186 -44.301 -34.387 1.00 43.67  ? 421 PRO A CD    1 
ATOM   3471 N  N     . LEU A 1 422 ? -50.860 -48.075 -31.968 1.00 44.74  ? 422 LEU A N     1 
ATOM   3472 C  CA    . LEU A 1 422 ? -50.124 -48.414 -30.761 1.00 45.26  ? 422 LEU A CA    1 
ATOM   3473 C  C     . LEU A 1 422 ? -48.627 -48.476 -31.041 1.00 47.42  ? 422 LEU A C     1 
ATOM   3474 O  O     . LEU A 1 422 ? -48.189 -48.835 -32.138 1.00 42.62  ? 422 LEU A O     1 
ATOM   3475 C  CB    . LEU A 1 422 ? -50.603 -49.751 -30.194 1.00 38.73  ? 422 LEU A CB    1 
ATOM   3476 C  CG    . LEU A 1 422 ? -52.078 -49.826 -29.793 1.00 54.46  ? 422 LEU A CG    1 
ATOM   3477 C  CD1   . LEU A 1 422 ? -52.371 -51.124 -29.053 1.00 42.46  ? 422 LEU A CD1   1 
ATOM   3478 C  CD2   . LEU A 1 422 ? -52.465 -48.623 -28.949 1.00 47.66  ? 422 LEU A CD2   1 
ATOM   3479 N  N     . VAL A 1 423 ? -47.842 -48.117 -30.031 1.00 45.04  ? 423 VAL A N     1 
ATOM   3480 C  CA    . VAL A 1 423 ? -46.387 -48.131 -30.127 1.00 42.21  ? 423 VAL A CA    1 
ATOM   3481 C  C     . VAL A 1 423 ? -45.894 -49.523 -29.758 1.00 33.31  ? 423 VAL A C     1 
ATOM   3482 O  O     . VAL A 1 423 ? -46.147 -50.005 -28.648 1.00 39.53  ? 423 VAL A O     1 
ATOM   3483 C  CB    . VAL A 1 423 ? -45.760 -47.065 -29.216 1.00 44.97  ? 423 VAL A CB    1 
ATOM   3484 C  CG1   . VAL A 1 423 ? -44.243 -47.132 -29.287 1.00 35.35  ? 423 VAL A CG1   1 
ATOM   3485 C  CG2   . VAL A 1 423 ? -46.258 -45.683 -29.602 1.00 39.30  ? 423 VAL A CG2   1 
ATOM   3486 N  N     . LYS A 1 424 ? -45.189 -50.170 -30.683 1.00 31.78  ? 424 LYS A N     1 
ATOM   3487 C  CA    . LYS A 1 424 ? -44.664 -51.506 -30.448 1.00 47.69  ? 424 LYS A CA    1 
ATOM   3488 C  C     . LYS A 1 424 ? -43.312 -51.654 -31.130 1.00 46.74  ? 424 LYS A C     1 
ATOM   3489 O  O     . LYS A 1 424 ? -42.945 -50.874 -32.012 1.00 44.53  ? 424 LYS A O     1 
ATOM   3490 C  CB    . LYS A 1 424 ? -45.622 -52.591 -30.958 1.00 43.24  ? 424 LYS A CB    1 
ATOM   3491 C  CG    . LYS A 1 424 ? -45.666 -52.719 -32.472 1.00 49.14  ? 424 LYS A CG    1 
ATOM   3492 C  CD    . LYS A 1 424 ? -46.383 -53.992 -32.897 1.00 67.34  ? 424 LYS A CD    1 
ATOM   3493 C  CE    . LYS A 1 424 ? -46.250 -54.229 -34.394 1.00 69.84  ? 424 LYS A CE    1 
ATOM   3494 N  NZ    . LYS A 1 424 ? -46.874 -53.135 -35.185 1.00 64.33  ? 424 LYS A NZ    1 
ATOM   3495 N  N     . LEU A 1 425 ? -42.572 -52.672 -30.700 1.00 48.56  ? 425 LEU A N     1 
ATOM   3496 C  CA    . LEU A 1 425 ? -41.330 -53.064 -31.350 1.00 40.40  ? 425 LEU A CA    1 
ATOM   3497 C  C     . LEU A 1 425 ? -41.652 -54.023 -32.488 1.00 41.06  ? 425 LEU A C     1 
ATOM   3498 O  O     . LEU A 1 425 ? -42.357 -55.018 -32.290 1.00 40.58  ? 425 LEU A O     1 
ATOM   3499 C  CB    . LEU A 1 425 ? -40.379 -53.715 -30.346 1.00 44.55  ? 425 LEU A CB    1 
ATOM   3500 C  CG    . LEU A 1 425 ? -39.920 -52.829 -29.186 1.00 47.20  ? 425 LEU A CG    1 
ATOM   3501 C  CD1   . LEU A 1 425 ? -39.202 -53.655 -28.131 1.00 50.35  ? 425 LEU A CD1   1 
ATOM   3502 C  CD2   . LEU A 1 425 ? -39.022 -51.710 -29.692 1.00 39.72  ? 425 LEU A CD2   1 
ATOM   3503 N  N     . TRP A 1 426 ? -41.140 -53.721 -33.678 1.00 34.81  ? 426 TRP A N     1 
ATOM   3504 C  CA    . TRP A 1 426 ? -41.516 -54.452 -34.880 1.00 46.06  ? 426 TRP A CA    1 
ATOM   3505 C  C     . TRP A 1 426 ? -40.707 -55.724 -35.098 1.00 42.43  ? 426 TRP A C     1 
ATOM   3506 O  O     . TRP A 1 426 ? -41.049 -56.505 -35.993 1.00 43.96  ? 426 TRP A O     1 
ATOM   3507 C  CB    . TRP A 1 426 ? -41.393 -53.537 -36.102 1.00 46.15  ? 426 TRP A CB    1 
ATOM   3508 C  CG    . TRP A 1 426 ? -42.401 -52.428 -36.093 1.00 57.26  ? 426 TRP A CG    1 
ATOM   3509 C  CD1   . TRP A 1 426 ? -42.333 -51.263 -35.385 1.00 54.21  ? 426 TRP A CD1   1 
ATOM   3510 C  CD2   . TRP A 1 426 ? -43.636 -52.384 -36.819 1.00 65.92  ? 426 TRP A CD2   1 
ATOM   3511 N  NE1   . TRP A 1 426 ? -43.447 -50.495 -35.627 1.00 61.16  ? 426 TRP A NE1   1 
ATOM   3512 C  CE2   . TRP A 1 426 ? -44.261 -51.161 -36.505 1.00 73.88  ? 426 TRP A CE2   1 
ATOM   3513 C  CE3   . TRP A 1 426 ? -44.270 -53.259 -37.707 1.00 70.17  ? 426 TRP A CE3   1 
ATOM   3514 C  CZ2   . TRP A 1 426 ? -45.490 -50.791 -37.047 1.00 77.25  ? 426 TRP A CZ2   1 
ATOM   3515 C  CZ3   . TRP A 1 426 ? -45.490 -52.890 -38.244 1.00 76.19  ? 426 TRP A CZ3   1 
ATOM   3516 C  CH2   . TRP A 1 426 ? -46.087 -51.666 -37.912 1.00 91.87  ? 426 TRP A CH2   1 
ATOM   3517 N  N     . TYR A 1 427 ? -39.656 -55.951 -34.315 1.00 41.39  ? 427 TYR A N     1 
ATOM   3518 C  CA    . TYR A 1 427 ? -38.893 -57.192 -34.371 1.00 39.60  ? 427 TYR A CA    1 
ATOM   3519 C  C     . TYR A 1 427 ? -37.984 -57.252 -33.154 1.00 43.78  ? 427 TYR A C     1 
ATOM   3520 O  O     . TYR A 1 427 ? -37.645 -56.225 -32.561 1.00 38.25  ? 427 TYR A O     1 
ATOM   3521 C  CB    . TYR A 1 427 ? -38.072 -57.306 -35.662 1.00 28.54  ? 427 TYR A CB    1 
ATOM   3522 C  CG    . TYR A 1 427 ? -37.024 -56.230 -35.826 1.00 39.65  ? 427 TYR A CG    1 
ATOM   3523 C  CD1   . TYR A 1 427 ? -37.338 -55.014 -36.418 1.00 40.97  ? 427 TYR A CD1   1 
ATOM   3524 C  CD2   . TYR A 1 427 ? -35.719 -56.433 -35.398 1.00 37.68  ? 427 TYR A CD2   1 
ATOM   3525 C  CE1   . TYR A 1 427 ? -36.384 -54.028 -36.573 1.00 37.80  ? 427 TYR A CE1   1 
ATOM   3526 C  CE2   . TYR A 1 427 ? -34.760 -55.454 -35.547 1.00 33.03  ? 427 TYR A CE2   1 
ATOM   3527 C  CZ    . TYR A 1 427 ? -35.098 -54.254 -36.135 1.00 37.22  ? 427 TYR A CZ    1 
ATOM   3528 O  OH    . TYR A 1 427 ? -34.144 -53.278 -36.288 1.00 35.75  ? 427 TYR A OH    1 
ATOM   3529 N  N     . GLN A 1 428 ? -37.590 -58.472 -32.793 1.00 42.91  ? 428 GLN A N     1 
ATOM   3530 C  CA    . GLN A 1 428 ? -36.688 -58.705 -31.674 1.00 47.38  ? 428 GLN A CA    1 
ATOM   3531 C  C     . GLN A 1 428 ? -35.569 -59.632 -32.120 1.00 45.25  ? 428 GLN A C     1 
ATOM   3532 O  O     . GLN A 1 428 ? -35.824 -60.652 -32.768 1.00 51.31  ? 428 GLN A O     1 
ATOM   3533 C  CB    . GLN A 1 428 ? -37.424 -59.313 -30.475 1.00 46.36  ? 428 GLN A CB    1 
ATOM   3534 C  CG    . GLN A 1 428 ? -38.519 -58.436 -29.897 1.00 61.98  ? 428 GLN A CG    1 
ATOM   3535 C  CD    . GLN A 1 428 ? -39.140 -59.034 -28.649 1.00 76.95  ? 428 GLN A CD    1 
ATOM   3536 O  OE1   . GLN A 1 428 ? -38.507 -59.822 -27.944 1.00 77.57  ? 428 GLN A OE1   1 
ATOM   3537 N  NE2   . GLN A 1 428 ? -40.385 -58.667 -28.373 1.00 83.40  ? 428 GLN A NE2   1 
ATOM   3538 N  N     . LEU A 1 429 ? -34.336 -59.274 -31.778 1.00 36.59  ? 429 LEU A N     1 
ATOM   3539 C  CA    . LEU A 1 429 ? -33.198 -60.139 -32.044 1.00 34.54  ? 429 LEU A CA    1 
ATOM   3540 C  C     . LEU A 1 429 ? -33.120 -61.234 -30.989 1.00 35.57  ? 429 LEU A C     1 
ATOM   3541 O  O     . LEU A 1 429 ? -33.407 -61.004 -29.811 1.00 33.70  ? 429 LEU A O     1 
ATOM   3542 C  CB    . LEU A 1 429 ? -31.901 -59.330 -32.060 1.00 33.67  ? 429 LEU A CB    1 
ATOM   3543 C  CG    . LEU A 1 429 ? -31.835 -58.166 -33.050 1.00 38.61  ? 429 LEU A CG    1 
ATOM   3544 C  CD1   . LEU A 1 429 ? -30.485 -57.468 -32.970 1.00 40.06  ? 429 LEU A CD1   1 
ATOM   3545 C  CD2   . LEU A 1 429 ? -32.111 -58.651 -34.464 1.00 37.40  ? 429 LEU A CD2   1 
ATOM   3546 N  N     . GLU A 1 430 ? -32.737 -62.432 -31.419 1.00 40.94  ? 430 GLU A N     1 
ATOM   3547 C  CA    . GLU A 1 430 ? -32.606 -63.545 -30.492 1.00 38.82  ? 430 GLU A CA    1 
ATOM   3548 C  C     . GLU A 1 430 ? -31.423 -63.328 -29.556 1.00 35.03  ? 430 GLU A C     1 
ATOM   3549 O  O     . GLU A 1 430 ? -30.428 -62.689 -29.909 1.00 37.14  ? 430 GLU A O     1 
ATOM   3550 C  CB    . GLU A 1 430 ? -32.430 -64.860 -31.251 1.00 36.55  ? 430 GLU A CB    1 
ATOM   3551 C  CG    . GLU A 1 430 ? -33.620 -65.263 -32.107 1.00 37.69  ? 430 GLU A CG    1 
ATOM   3552 C  CD    . GLU A 1 430 ? -34.902 -65.378 -31.307 1.00 45.47  ? 430 GLU A CD    1 
ATOM   3553 O  OE1   . GLU A 1 430 ? -35.774 -64.496 -31.453 1.00 59.43  ? 430 GLU A OE1   1 
ATOM   3554 O  OE2   . GLU A 1 430 ? -35.034 -66.343 -30.524 1.00 50.26  ? 430 GLU A OE2   1 
ATOM   3555 N  N     . LYS A 1 431 ? -31.542 -63.869 -28.345 1.00 36.77  ? 431 LYS A N     1 
ATOM   3556 C  CA    . LYS A 1 431 ? -30.448 -63.835 -27.386 1.00 32.34  ? 431 LYS A CA    1 
ATOM   3557 C  C     . LYS A 1 431 ? -29.495 -65.011 -27.536 1.00 39.57  ? 431 LYS A C     1 
ATOM   3558 O  O     . LYS A 1 431 ? -28.352 -64.930 -27.075 1.00 41.81  ? 431 LYS A O     1 
ATOM   3559 C  CB    . LYS A 1 431 ? -30.994 -63.809 -25.954 1.00 46.68  ? 431 LYS A CB    1 
ATOM   3560 C  CG    . LYS A 1 431 ? -31.846 -62.590 -25.630 1.00 65.06  ? 431 LYS A CG    1 
ATOM   3561 C  CD    . LYS A 1 431 ? -32.377 -62.654 -24.205 1.00 79.72  ? 431 LYS A CD    1 
ATOM   3562 C  CE    . LYS A 1 431 ? -33.239 -63.890 -23.994 1.00 96.80  ? 431 LYS A CE    1 
ATOM   3563 N  NZ    . LYS A 1 431 ? -33.756 -63.976 -22.600 1.00 85.71  ? 431 LYS A NZ    1 
ATOM   3564 N  N     . GLU A 1 432 ? -29.936 -66.094 -28.169 1.00 35.37  ? 432 GLU A N     1 
ATOM   3565 C  CA    . GLU A 1 432 ? -29.135 -67.291 -28.355 1.00 40.98  ? 432 GLU A CA    1 
ATOM   3566 C  C     . GLU A 1 432 ? -29.141 -67.694 -29.820 1.00 40.98  ? 432 GLU A C     1 
ATOM   3567 O  O     . GLU A 1 432 ? -30.088 -67.380 -30.550 1.00 42.32  ? 432 GLU A O     1 
ATOM   3568 C  CB    . GLU A 1 432 ? -29.668 -68.450 -27.498 1.00 29.04  ? 432 GLU A CB    1 
ATOM   3569 C  CG    . GLU A 1 432 ? -29.641 -68.179 -26.004 1.00 42.60  ? 432 GLU A CG    1 
ATOM   3570 C  CD    . GLU A 1 432 ? -28.235 -67.982 -25.469 1.00 51.03  ? 432 GLU A CD    1 
ATOM   3571 O  OE1   . GLU A 1 432 ? -27.286 -68.543 -26.057 1.00 46.53  ? 432 GLU A OE1   1 
ATOM   3572 O  OE2   . GLU A 1 432 ? -28.078 -67.262 -24.460 1.00 63.81  ? 432 GLU A OE2   1 
ATOM   3573 N  N     . PRO A 1 433 ? -28.095 -68.384 -30.281 1.00 42.38  ? 433 PRO A N     1 
ATOM   3574 C  CA    . PRO A 1 433 ? -28.078 -68.846 -31.673 1.00 34.10  ? 433 PRO A CA    1 
ATOM   3575 C  C     . PRO A 1 433 ? -29.236 -69.791 -31.956 1.00 35.57  ? 433 PRO A C     1 
ATOM   3576 O  O     . PRO A 1 433 ? -29.692 -70.532 -31.082 1.00 33.76  ? 433 PRO A O     1 
ATOM   3577 C  CB    . PRO A 1 433 ? -26.725 -69.560 -31.798 1.00 31.76  ? 433 PRO A CB    1 
ATOM   3578 C  CG    . PRO A 1 433 ? -26.328 -69.882 -30.391 1.00 35.42  ? 433 PRO A CG    1 
ATOM   3579 C  CD    . PRO A 1 433 ? -26.866 -68.758 -29.562 1.00 39.29  ? 433 PRO A CD    1 
ATOM   3580 N  N     . ILE A 1 434 ? -29.711 -69.753 -33.196 1.00 39.88  ? 434 ILE A N     1 
ATOM   3581 C  CA    . ILE A 1 434 ? -30.911 -70.478 -33.596 1.00 42.59  ? 434 ILE A CA    1 
ATOM   3582 C  C     . ILE A 1 434 ? -30.512 -71.857 -34.103 1.00 39.94  ? 434 ILE A C     1 
ATOM   3583 O  O     . ILE A 1 434 ? -29.711 -71.978 -35.036 1.00 31.66  ? 434 ILE A O     1 
ATOM   3584 C  CB    . ILE A 1 434 ? -31.690 -69.704 -34.669 1.00 37.89  ? 434 ILE A CB    1 
ATOM   3585 C  CG1   . ILE A 1 434 ? -31.935 -68.266 -34.211 1.00 31.70  ? 434 ILE A CG1   1 
ATOM   3586 C  CG2   . ILE A 1 434 ? -33.005 -70.404 -34.977 1.00 40.37  ? 434 ILE A CG2   1 
ATOM   3587 C  CD1   . ILE A 1 434 ? -32.217 -67.307 -35.349 1.00 35.51  ? 434 ILE A CD1   1 
ATOM   3588 N  N     . VAL A 1 435 ? -31.072 -72.898 -33.487 1.00 33.98  ? 435 VAL A N     1 
ATOM   3589 C  CA    . VAL A 1 435 ? -30.857 -74.257 -33.967 1.00 37.16  ? 435 VAL A CA    1 
ATOM   3590 C  C     . VAL A 1 435 ? -31.660 -74.469 -35.243 1.00 39.02  ? 435 VAL A C     1 
ATOM   3591 O  O     . VAL A 1 435 ? -32.852 -74.141 -35.308 1.00 35.91  ? 435 VAL A O     1 
ATOM   3592 C  CB    . VAL A 1 435 ? -31.247 -75.279 -32.890 1.00 41.06  ? 435 VAL A CB    1 
ATOM   3593 C  CG1   . VAL A 1 435 ? -31.169 -76.692 -33.447 1.00 38.43  ? 435 VAL A CG1   1 
ATOM   3594 C  CG2   . VAL A 1 435 ? -30.352 -75.133 -31.668 1.00 40.15  ? 435 VAL A CG2   1 
ATOM   3595 N  N     . GLY A 1 436 ? -31.009 -75.015 -36.266 1.00 41.60  ? 436 GLY A N     1 
ATOM   3596 C  CA    . GLY A 1 436 ? -31.673 -75.260 -37.528 1.00 39.27  ? 436 GLY A CA    1 
ATOM   3597 C  C     . GLY A 1 436 ? -31.747 -74.072 -38.456 1.00 51.18  ? 436 GLY A C     1 
ATOM   3598 O  O     . GLY A 1 436 ? -32.487 -74.124 -39.445 1.00 54.07  ? 436 GLY A O     1 
ATOM   3599 N  N     . ALA A 1 437 ? -31.016 -73.000 -38.170 1.00 45.49  ? 437 ALA A N     1 
ATOM   3600 C  CA    . ALA A 1 437 ? -30.946 -71.838 -39.042 1.00 34.13  ? 437 ALA A CA    1 
ATOM   3601 C  C     . ALA A 1 437 ? -29.575 -71.779 -39.699 1.00 41.42  ? 437 ALA A C     1 
ATOM   3602 O  O     . ALA A 1 437 ? -28.556 -72.064 -39.061 1.00 37.10  ? 437 ALA A O     1 
ATOM   3603 C  CB    . ALA A 1 437 ? -31.212 -70.545 -38.267 1.00 39.84  ? 437 ALA A CB    1 
ATOM   3604 N  N     . GLU A 1 438 ? -29.557 -71.419 -40.980 1.00 25.08  ? 438 GLU A N     1 
ATOM   3605 C  CA    . GLU A 1 438 ? -28.298 -71.298 -41.700 1.00 27.90  ? 438 GLU A CA    1 
ATOM   3606 C  C     . GLU A 1 438 ? -27.459 -70.172 -41.108 1.00 38.90  ? 438 GLU A C     1 
ATOM   3607 O  O     . GLU A 1 438 ? -27.972 -69.102 -40.770 1.00 30.09  ? 438 GLU A O     1 
ATOM   3608 C  CB    . GLU A 1 438 ? -28.567 -71.043 -43.183 1.00 31.23  ? 438 GLU A CB    1 
ATOM   3609 C  CG    . GLU A 1 438 ? -27.335 -71.116 -44.064 1.00 33.62  ? 438 GLU A CG    1 
ATOM   3610 C  CD    . GLU A 1 438 ? -27.676 -71.001 -45.535 1.00 39.55  ? 438 GLU A CD    1 
ATOM   3611 O  OE1   . GLU A 1 438 ? -28.825 -70.628 -45.852 1.00 39.19  ? 438 GLU A OE1   1 
ATOM   3612 O  OE2   . GLU A 1 438 ? -26.798 -71.289 -46.375 1.00 38.66  ? 438 GLU A OE2   1 
ATOM   3613 N  N     . THR A 1 439 ? -26.159 -70.423 -40.976 1.00 37.34  ? 439 THR A N     1 
ATOM   3614 C  CA    . THR A 1 439 ? -25.237 -69.478 -40.358 1.00 37.41  ? 439 THR A CA    1 
ATOM   3615 C  C     . THR A 1 439 ? -24.490 -68.714 -41.445 1.00 30.42  ? 439 THR A C     1 
ATOM   3616 O  O     . THR A 1 439 ? -23.726 -69.308 -42.212 1.00 29.31  ? 439 THR A O     1 
ATOM   3617 C  CB    . THR A 1 439 ? -24.252 -70.198 -39.438 1.00 35.12  ? 439 THR A CB    1 
ATOM   3618 O  OG1   . THR A 1 439 ? -24.964 -70.793 -38.346 1.00 37.62  ? 439 THR A OG1   1 
ATOM   3619 C  CG2   . THR A 1 439 ? -23.227 -69.217 -38.894 1.00 30.75  ? 439 THR A CG2   1 
ATOM   3620 N  N     . PHE A 1 440 ? -24.709 -67.403 -41.502 1.00 27.62  ? 440 PHE A N     1 
ATOM   3621 C  CA    . PHE A 1 440 ? -24.062 -66.532 -42.474 1.00 25.37  ? 440 PHE A CA    1 
ATOM   3622 C  C     . PHE A 1 440 ? -22.900 -65.797 -41.820 1.00 31.66  ? 440 PHE A C     1 
ATOM   3623 O  O     . PHE A 1 440 ? -23.072 -65.162 -40.775 1.00 33.85  ? 440 PHE A O     1 
ATOM   3624 C  CB    . PHE A 1 440 ? -25.053 -65.517 -43.048 1.00 31.92  ? 440 PHE A CB    1 
ATOM   3625 C  CG    . PHE A 1 440 ? -25.969 -66.077 -44.098 1.00 27.71  ? 440 PHE A CG    1 
ATOM   3626 C  CD1   . PHE A 1 440 ? -26.975 -66.966 -43.760 1.00 28.86  ? 440 PHE A CD1   1 
ATOM   3627 C  CD2   . PHE A 1 440 ? -25.837 -65.695 -45.422 1.00 37.05  ? 440 PHE A CD2   1 
ATOM   3628 C  CE1   . PHE A 1 440 ? -27.821 -67.477 -44.726 1.00 31.97  ? 440 PHE A CE1   1 
ATOM   3629 C  CE2   . PHE A 1 440 ? -26.681 -66.199 -46.393 1.00 30.72  ? 440 PHE A CE2   1 
ATOM   3630 C  CZ    . PHE A 1 440 ? -27.674 -67.091 -46.045 1.00 32.81  ? 440 PHE A CZ    1 
ATOM   3631 N  N     . TYR A 1 441 ? -21.725 -65.882 -42.438 1.00 27.96  ? 441 TYR A N     1 
ATOM   3632 C  CA    . TYR A 1 441 ? -20.572 -65.076 -42.053 1.00 23.73  ? 441 TYR A CA    1 
ATOM   3633 C  C     . TYR A 1 441 ? -20.435 -63.954 -43.074 1.00 30.06  ? 441 TYR A C     1 
ATOM   3634 O  O     . TYR A 1 441 ? -20.034 -64.192 -44.217 1.00 31.95  ? 441 TYR A O     1 
ATOM   3635 C  CB    . TYR A 1 441 ? -19.302 -65.922 -41.983 1.00 28.20  ? 441 TYR A CB    1 
ATOM   3636 C  CG    . TYR A 1 441 ? -19.325 -66.964 -40.889 1.00 32.54  ? 441 TYR A CG    1 
ATOM   3637 C  CD1   . TYR A 1 441 ? -19.857 -68.226 -41.117 1.00 29.79  ? 441 TYR A CD1   1 
ATOM   3638 C  CD2   . TYR A 1 441 ? -18.821 -66.683 -39.627 1.00 31.15  ? 441 TYR A CD2   1 
ATOM   3639 C  CE1   . TYR A 1 441 ? -19.883 -69.181 -40.119 1.00 31.77  ? 441 TYR A CE1   1 
ATOM   3640 C  CE2   . TYR A 1 441 ? -18.843 -67.631 -38.622 1.00 31.58  ? 441 TYR A CE2   1 
ATOM   3641 C  CZ    . TYR A 1 441 ? -19.374 -68.878 -38.874 1.00 34.53  ? 441 TYR A CZ    1 
ATOM   3642 O  OH    . TYR A 1 441 ? -19.396 -69.825 -37.877 1.00 36.01  ? 441 TYR A OH    1 
ATOM   3643 N  N     . VAL A 1 442 ? -20.773 -62.736 -42.664 1.00 25.78  ? 442 VAL A N     1 
ATOM   3644 C  CA    . VAL A 1 442 ? -20.812 -61.596 -43.566 1.00 30.69  ? 442 VAL A CA    1 
ATOM   3645 C  C     . VAL A 1 442 ? -19.608 -60.702 -43.309 1.00 36.53  ? 442 VAL A C     1 
ATOM   3646 O  O     . VAL A 1 442 ? -19.016 -60.697 -42.225 1.00 32.52  ? 442 VAL A O     1 
ATOM   3647 C  CB    . VAL A 1 442 ? -22.124 -60.798 -43.423 1.00 28.47  ? 442 VAL A CB    1 
ATOM   3648 C  CG1   . VAL A 1 442 ? -23.316 -61.702 -43.665 1.00 27.33  ? 442 VAL A CG1   1 
ATOM   3649 C  CG2   . VAL A 1 442 ? -22.208 -60.154 -42.047 1.00 28.27  ? 442 VAL A CG2   1 
ATOM   3650 N  N     . ASP A 1 443 ? -19.249 -59.931 -44.332 1.00 34.70  ? 443 ASP A N     1 
ATOM   3651 C  CA    . ASP A 1 443 ? -18.165 -58.966 -44.227 1.00 34.13  ? 443 ASP A CA    1 
ATOM   3652 C  C     . ASP A 1 443 ? -18.227 -58.021 -45.415 1.00 32.12  ? 443 ASP A C     1 
ATOM   3653 O  O     . ASP A 1 443 ? -18.668 -58.398 -46.505 1.00 36.68  ? 443 ASP A O     1 
ATOM   3654 C  CB    . ASP A 1 443 ? -16.794 -59.654 -44.169 1.00 37.52  ? 443 ASP A CB    1 
ATOM   3655 C  CG    . ASP A 1 443 ? -15.671 -58.687 -43.846 1.00 44.41  ? 443 ASP A CG    1 
ATOM   3656 O  OD1   . ASP A 1 443 ? -15.950 -57.639 -43.226 1.00 40.64  ? 443 ASP A OD1   1 
ATOM   3657 O  OD2   . ASP A 1 443 ? -14.511 -58.975 -44.210 1.00 52.45  ? 443 ASP A OD2   1 
ATOM   3658 N  N     . GLY A 1 444 ? -17.784 -56.785 -45.185 1.00 39.72  ? 444 GLY A N     1 
ATOM   3659 C  CA    . GLY A 1 444 ? -17.642 -55.820 -46.248 1.00 34.06  ? 444 GLY A CA    1 
ATOM   3660 C  C     . GLY A 1 444 ? -16.277 -55.165 -46.176 1.00 38.36  ? 444 GLY A C     1 
ATOM   3661 O  O     . GLY A 1 444 ? -15.612 -55.169 -45.140 1.00 42.00  ? 444 GLY A O     1 
ATOM   3662 N  N     . ALA A 1 445 ? -15.864 -54.605 -47.309 1.00 37.45  ? 445 ALA A N     1 
ATOM   3663 C  CA    . ALA A 1 445 ? -14.569 -53.950 -47.389 1.00 44.02  ? 445 ALA A CA    1 
ATOM   3664 C  C     . ALA A 1 445 ? -14.592 -52.966 -48.549 1.00 43.68  ? 445 ALA A C     1 
ATOM   3665 O  O     . ALA A 1 445 ? -15.156 -53.259 -49.605 1.00 43.32  ? 445 ALA A O     1 
ATOM   3666 C  CB    . ALA A 1 445 ? -13.441 -54.973 -47.560 1.00 36.04  ? 445 ALA A CB    1 
ATOM   3667 N  N     . ALA A 1 446 ? -13.983 -51.801 -48.341 1.00 39.91  ? 446 ALA A N     1 
ATOM   3668 C  CA    . ALA A 1 446 ? -13.994 -50.736 -49.330 1.00 43.07  ? 446 ALA A CA    1 
ATOM   3669 C  C     . ALA A 1 446 ? -12.605 -50.130 -49.450 1.00 44.31  ? 446 ALA A C     1 
ATOM   3670 O  O     . ALA A 1 446 ? -11.837 -50.099 -48.486 1.00 42.30  ? 446 ALA A O     1 
ATOM   3671 C  CB    . ALA A 1 446 ? -15.012 -49.645 -48.972 1.00 34.57  ? 446 ALA A CB    1 
ATOM   3672 N  N     . ASN A 1 447 ? -12.292 -49.648 -50.651 1.00 47.96  ? 447 ASN A N     1 
ATOM   3673 C  CA    . ASN A 1 447 ? -11.023 -48.988 -50.920 1.00 47.41  ? 447 ASN A CA    1 
ATOM   3674 C  C     . ASN A 1 447 ? -11.182 -47.485 -50.731 1.00 43.10  ? 447 ASN A C     1 
ATOM   3675 O  O     . ASN A 1 447 ? -12.083 -46.872 -51.313 1.00 44.16  ? 447 ASN A O     1 
ATOM   3676 C  CB    . ASN A 1 447 ? -10.544 -49.301 -52.338 1.00 54.45  ? 447 ASN A CB    1 
ATOM   3677 C  CG    . ASN A 1 447 ? -9.232  -48.619 -52.676 1.00 57.01  ? 447 ASN A CG    1 
ATOM   3678 O  OD1   . ASN A 1 447 ? -9.213  -47.480 -53.143 1.00 56.53  ? 447 ASN A OD1   1 
ATOM   3679 N  ND2   . ASN A 1 447 ? -8.125  -49.315 -52.442 1.00 55.85  ? 447 ASN A ND2   1 
ATOM   3680 N  N     . ARG A 1 448 ? -10.303 -46.896 -49.918 1.00 50.74  ? 448 ARG A N     1 
ATOM   3681 C  CA    . ARG A 1 448 ? -10.426 -45.478 -49.594 1.00 51.01  ? 448 ARG A CA    1 
ATOM   3682 C  C     . ARG A 1 448 ? -10.184 -44.600 -50.816 1.00 54.47  ? 448 ARG A C     1 
ATOM   3683 O  O     . ARG A 1 448 ? -10.841 -43.565 -50.984 1.00 51.05  ? 448 ARG A O     1 
ATOM   3684 C  CB    . ARG A 1 448 ? -9.457  -45.115 -48.469 1.00 55.66  ? 448 ARG A CB    1 
ATOM   3685 C  CG    . ARG A 1 448 ? -9.418  -43.634 -48.133 1.00 70.13  ? 448 ARG A CG    1 
ATOM   3686 C  CD    . ARG A 1 448 ? -8.560  -43.372 -46.908 1.00 71.51  ? 448 ARG A CD    1 
ATOM   3687 N  NE    . ARG A 1 448 ? -9.067  -44.075 -45.734 1.00 71.10  ? 448 ARG A NE    1 
ATOM   3688 C  CZ    . ARG A 1 448 ? -8.560  -43.953 -44.512 1.00 66.23  ? 448 ARG A CZ    1 
ATOM   3689 N  NH1   . ARG A 1 448 ? -7.526  -43.150 -44.298 1.00 69.22  ? 448 ARG A NH1   1 
ATOM   3690 N  NH2   . ARG A 1 448 ? -9.087  -44.634 -43.504 1.00 68.13  ? 448 ARG A NH2   1 
ATOM   3691 N  N     . GLU A 1 449 ? -9.251  -44.994 -51.682 1.00 53.02  ? 449 GLU A N     1 
ATOM   3692 C  CA    . GLU A 1 449 ? -8.905  -44.166 -52.833 1.00 63.05  ? 449 GLU A CA    1 
ATOM   3693 C  C     . GLU A 1 449 ? -9.962  -44.262 -53.929 1.00 58.35  ? 449 GLU A C     1 
ATOM   3694 O  O     . GLU A 1 449 ? -10.587 -43.260 -54.295 1.00 52.57  ? 449 GLU A O     1 
ATOM   3695 C  CB    . GLU A 1 449 ? -7.531  -44.568 -53.375 1.00 61.03  ? 449 GLU A CB    1 
ATOM   3696 C  CG    . GLU A 1 449 ? -6.410  -44.485 -52.350 1.00 60.35  ? 449 GLU A CG    1 
ATOM   3697 C  CD    . GLU A 1 449 ? -5.064  -44.879 -52.926 1.00 90.64  ? 449 GLU A CD    1 
ATOM   3698 O  OE1   . GLU A 1 449 ? -4.033  -44.379 -52.427 1.00 97.09  ? 449 GLU A OE1   1 
ATOM   3699 O  OE2   . GLU A 1 449 ? -5.037  -45.686 -53.879 1.00 83.33  ? 449 GLU A OE2   1 
ATOM   3700 N  N     . THR A 1 450 ? -10.179 -45.466 -54.460 1.00 52.06  ? 450 THR A N     1 
ATOM   3701 C  CA    . THR A 1 450 ? -11.059 -45.654 -55.607 1.00 48.84  ? 450 THR A CA    1 
ATOM   3702 C  C     . THR A 1 450 ? -12.539 -45.644 -55.246 1.00 45.85  ? 450 THR A C     1 
ATOM   3703 O  O     . THR A 1 450 ? -13.373 -45.578 -56.156 1.00 50.42  ? 450 THR A O     1 
ATOM   3704 C  CB    . THR A 1 450 ? -10.728 -46.972 -56.312 1.00 55.91  ? 450 THR A CB    1 
ATOM   3705 O  OG1   . THR A 1 450 ? -10.982 -48.066 -55.421 1.00 60.86  ? 450 THR A OG1   1 
ATOM   3706 C  CG2   . THR A 1 450 ? -9.267  -46.998 -56.732 1.00 46.12  ? 450 THR A CG2   1 
ATOM   3707 N  N     . LYS A 1 451 ? -12.880 -45.712 -53.960 1.00 53.63  ? 451 LYS A N     1 
ATOM   3708 C  CA    . LYS A 1 451 ? -14.252 -45.805 -53.464 1.00 47.63  ? 451 LYS A CA    1 
ATOM   3709 C  C     . LYS A 1 451 ? -14.959 -47.079 -53.915 1.00 42.70  ? 451 LYS A C     1 
ATOM   3710 O  O     . LYS A 1 451 ? -16.186 -47.178 -53.789 1.00 45.72  ? 451 LYS A O     1 
ATOM   3711 C  CB    . LYS A 1 451 ? -15.087 -44.578 -53.861 1.00 45.13  ? 451 LYS A CB    1 
ATOM   3712 C  CG    . LYS A 1 451 ? -15.161 -43.495 -52.794 1.00 51.30  ? 451 LYS A CG    1 
ATOM   3713 C  CD    . LYS A 1 451 ? -13.789 -42.944 -52.449 1.00 55.17  ? 451 LYS A CD    1 
ATOM   3714 C  CE    . LYS A 1 451 ? -13.884 -41.870 -51.377 1.00 60.88  ? 451 LYS A CE    1 
ATOM   3715 N  NZ    . LYS A 1 451 ? -12.544 -41.348 -50.990 1.00 60.42  ? 451 LYS A NZ    1 
ATOM   3716 N  N     . LEU A 1 452 ? -14.222 -48.054 -54.439 1.00 45.60  ? 452 LEU A N     1 
ATOM   3717 C  CA    . LEU A 1 452 ? -14.802 -49.339 -54.793 1.00 46.21  ? 452 LEU A CA    1 
ATOM   3718 C  C     . LEU A 1 452 ? -14.880 -50.235 -53.563 1.00 45.73  ? 452 LEU A C     1 
ATOM   3719 O  O     . LEU A 1 452 ? -14.069 -50.128 -52.638 1.00 42.22  ? 452 LEU A O     1 
ATOM   3720 C  CB    . LEU A 1 452 ? -13.979 -50.020 -55.886 1.00 40.46  ? 452 LEU A CB    1 
ATOM   3721 C  CG    . LEU A 1 452 ? -13.819 -49.257 -57.202 1.00 58.04  ? 452 LEU A CG    1 
ATOM   3722 C  CD1   . LEU A 1 452 ? -12.914 -50.021 -58.156 1.00 53.64  ? 452 LEU A CD1   1 
ATOM   3723 C  CD2   . LEU A 1 452 ? -15.174 -48.997 -57.841 1.00 49.90  ? 452 LEU A CD2   1 
ATOM   3724 N  N     . GLY A 1 453 ? -15.870 -51.126 -53.557 1.00 41.52  ? 453 GLY A N     1 
ATOM   3725 C  CA    . GLY A 1 453 ? -16.071 -51.998 -52.419 1.00 37.59  ? 453 GLY A CA    1 
ATOM   3726 C  C     . GLY A 1 453 ? -16.713 -53.308 -52.820 1.00 40.13  ? 453 GLY A C     1 
ATOM   3727 O  O     . GLY A 1 453 ? -17.195 -53.479 -53.942 1.00 42.23  ? 453 GLY A O     1 
ATOM   3728 N  N     . LYS A 1 454 ? -16.708 -54.242 -51.871 1.00 33.13  ? 454 LYS A N     1 
ATOM   3729 C  CA    . LYS A 1 454 ? -17.338 -55.541 -52.044 1.00 31.03  ? 454 LYS A CA    1 
ATOM   3730 C  C     . LYS A 1 454 ? -18.020 -55.941 -50.746 1.00 42.01  ? 454 LYS A C     1 
ATOM   3731 O  O     . LYS A 1 454 ? -17.513 -55.661 -49.655 1.00 36.95  ? 454 LYS A O     1 
ATOM   3732 C  CB    . LYS A 1 454 ? -16.321 -56.618 -52.453 1.00 30.63  ? 454 LYS A CB    1 
ATOM   3733 C  CG    . LYS A 1 454 ? -15.749 -56.443 -53.850 1.00 39.82  ? 454 LYS A CG    1 
ATOM   3734 C  CD    . LYS A 1 454 ? -14.817 -57.585 -54.213 1.00 40.07  ? 454 LYS A CD    1 
ATOM   3735 C  CE    . LYS A 1 454 ? -14.266 -57.418 -55.619 1.00 50.08  ? 454 LYS A CE    1 
ATOM   3736 N  NZ    . LYS A 1 454 ? -13.376 -58.549 -56.007 1.00 58.19  ? 454 LYS A NZ    1 
ATOM   3737 N  N     . ALA A 1 455 ? -19.173 -56.590 -50.872 1.00 38.21  ? 455 ALA A N     1 
ATOM   3738 C  CA    . ALA A 1 455 ? -19.913 -57.119 -49.737 1.00 30.52  ? 455 ALA A CA    1 
ATOM   3739 C  C     . ALA A 1 455 ? -20.357 -58.534 -50.067 1.00 38.36  ? 455 ALA A C     1 
ATOM   3740 O  O     . ALA A 1 455 ? -20.741 -58.821 -51.205 1.00 33.23  ? 455 ALA A O     1 
ATOM   3741 C  CB    . ALA A 1 455 ? -21.128 -56.248 -49.399 1.00 30.32  ? 455 ALA A CB    1 
ATOM   3742 N  N     . GLY A 1 456 ? -20.298 -59.417 -49.080 1.00 34.00  ? 456 GLY A N     1 
ATOM   3743 C  CA    . GLY A 1 456 ? -20.658 -60.793 -49.344 1.00 28.37  ? 456 GLY A CA    1 
ATOM   3744 C  C     . GLY A 1 456 ? -20.767 -61.607 -48.076 1.00 35.55  ? 456 GLY A C     1 
ATOM   3745 O  O     . GLY A 1 456 ? -20.659 -61.086 -46.965 1.00 34.39  ? 456 GLY A O     1 
ATOM   3746 N  N     . TYR A 1 457 ? -20.985 -62.906 -48.268 1.00 31.31  ? 457 TYR A N     1 
ATOM   3747 C  CA    . TYR A 1 457 ? -21.141 -63.830 -47.157 1.00 29.30  ? 457 TYR A CA    1 
ATOM   3748 C  C     . TYR A 1 457 ? -20.616 -65.202 -47.551 1.00 31.91  ? 457 TYR A C     1 
ATOM   3749 O  O     . TYR A 1 457 ? -20.461 -65.518 -48.734 1.00 34.23  ? 457 TYR A O     1 
ATOM   3750 C  CB    . TYR A 1 457 ? -22.607 -63.939 -46.707 1.00 29.56  ? 457 TYR A CB    1 
ATOM   3751 C  CG    . TYR A 1 457 ? -23.570 -64.391 -47.791 1.00 29.92  ? 457 TYR A CG    1 
ATOM   3752 C  CD1   . TYR A 1 457 ? -23.656 -65.728 -48.167 1.00 39.40  ? 457 TYR A CD1   1 
ATOM   3753 C  CD2   . TYR A 1 457 ? -24.408 -63.482 -48.424 1.00 36.82  ? 457 TYR A CD2   1 
ATOM   3754 C  CE1   . TYR A 1 457 ? -24.532 -66.140 -49.151 1.00 42.06  ? 457 TYR A CE1   1 
ATOM   3755 C  CE2   . TYR A 1 457 ? -25.293 -63.888 -49.407 1.00 28.73  ? 457 TYR A CE2   1 
ATOM   3756 C  CZ    . TYR A 1 457 ? -25.349 -65.217 -49.766 1.00 39.13  ? 457 TYR A CZ    1 
ATOM   3757 O  OH    . TYR A 1 457 ? -26.225 -65.627 -50.743 1.00 34.06  ? 457 TYR A OH    1 
ATOM   3758 N  N     . VAL A 1 458 ? -20.343 -66.013 -46.533 1.00 34.92  ? 458 VAL A N     1 
ATOM   3759 C  CA    . VAL A 1 458 ? -20.174 -67.452 -46.677 1.00 27.98  ? 458 VAL A CA    1 
ATOM   3760 C  C     . VAL A 1 458 ? -21.035 -68.110 -45.611 1.00 35.01  ? 458 VAL A C     1 
ATOM   3761 O  O     . VAL A 1 458 ? -21.220 -67.569 -44.516 1.00 36.02  ? 458 VAL A O     1 
ATOM   3762 C  CB    . VAL A 1 458 ? -18.699 -67.902 -46.551 1.00 32.99  ? 458 VAL A CB    1 
ATOM   3763 C  CG1   . VAL A 1 458 ? -17.864 -67.323 -47.682 1.00 31.91  ? 458 VAL A CG1   1 
ATOM   3764 C  CG2   . VAL A 1 458 ? -18.126 -67.504 -45.199 1.00 31.77  ? 458 VAL A CG2   1 
ATOM   3765 N  N     . THR A 1 459 ? -21.587 -69.272 -45.941 1.00 32.12  ? 459 THR A N     1 
ATOM   3766 C  CA    . THR A 1 459 ? -22.476 -69.978 -45.034 1.00 30.79  ? 459 THR A CA    1 
ATOM   3767 C  C     . THR A 1 459 ? -21.904 -71.348 -44.698 1.00 35.35  ? 459 THR A C     1 
ATOM   3768 O  O     . THR A 1 459 ? -21.104 -71.915 -45.449 1.00 31.43  ? 459 THR A O     1 
ATOM   3769 C  CB    . THR A 1 459 ? -23.882 -70.139 -45.630 1.00 35.83  ? 459 THR A CB    1 
ATOM   3770 O  OG1   . THR A 1 459 ? -23.872 -71.181 -46.613 1.00 35.87  ? 459 THR A OG1   1 
ATOM   3771 C  CG2   . THR A 1 459 ? -24.340 -68.842 -46.281 1.00 33.42  ? 459 THR A CG2   1 
ATOM   3772 N  N     . ASN A 1 460 ? -22.332 -71.875 -43.550 1.00 34.31  ? 460 ASN A N     1 
ATOM   3773 C  CA    . ASN A 1 460 ? -21.913 -73.209 -43.138 1.00 35.71  ? 460 ASN A CA    1 
ATOM   3774 C  C     . ASN A 1 460 ? -22.470 -74.294 -44.046 1.00 37.54  ? 460 ASN A C     1 
ATOM   3775 O  O     . ASN A 1 460 ? -21.981 -75.429 -44.008 1.00 37.10  ? 460 ASN A O     1 
ATOM   3776 C  CB    . ASN A 1 460 ? -22.346 -73.477 -41.697 1.00 29.13  ? 460 ASN A CB    1 
ATOM   3777 C  CG    . ASN A 1 460 ? -23.852 -73.548 -41.547 1.00 38.93  ? 460 ASN A CG    1 
ATOM   3778 O  OD1   . ASN A 1 460 ? -24.574 -72.647 -41.975 1.00 41.29  ? 460 ASN A OD1   1 
ATOM   3779 N  ND2   . ASN A 1 460 ? -24.337 -74.632 -40.948 1.00 29.13  ? 460 ASN A ND2   1 
ATOM   3780 N  N     . ARG A 1 461 ? -23.480 -73.977 -44.851 1.00 38.52  ? 461 ARG A N     1 
ATOM   3781 C  CA    . ARG A 1 461 ? -24.066 -74.927 -45.782 1.00 34.11  ? 461 ARG A CA    1 
ATOM   3782 C  C     . ARG A 1 461 ? -23.456 -74.837 -47.176 1.00 32.15  ? 461 ARG A C     1 
ATOM   3783 O  O     . ARG A 1 461 ? -23.998 -75.429 -48.115 1.00 39.11  ? 461 ARG A O     1 
ATOM   3784 C  CB    . ARG A 1 461 ? -25.583 -74.728 -45.843 1.00 32.04  ? 461 ARG A CB    1 
ATOM   3785 C  CG    . ARG A 1 461 ? -26.270 -74.998 -44.510 1.00 34.14  ? 461 ARG A CG    1 
ATOM   3786 C  CD    . ARG A 1 461 ? -27.766 -74.741 -44.560 1.00 41.62  ? 461 ARG A CD    1 
ATOM   3787 N  NE    . ARG A 1 461 ? -28.395 -75.011 -43.269 1.00 39.31  ? 461 ARG A NE    1 
ATOM   3788 C  CZ    . ARG A 1 461 ? -29.665 -74.744 -42.980 1.00 43.26  ? 461 ARG A CZ    1 
ATOM   3789 N  NH1   . ARG A 1 461 ? -30.454 -74.197 -43.894 1.00 31.48  ? 461 ARG A NH1   1 
ATOM   3790 N  NH2   . ARG A 1 461 ? -30.143 -75.026 -41.776 1.00 39.82  ? 461 ARG A NH2   1 
ATOM   3791 N  N     . GLY A 1 462 ? -22.347 -74.113 -47.332 1.00 32.82  ? 462 GLY A N     1 
ATOM   3792 C  CA    . GLY A 1 462 ? -21.593 -74.105 -48.568 1.00 30.92  ? 462 GLY A CA    1 
ATOM   3793 C  C     . GLY A 1 462 ? -21.866 -72.950 -49.507 1.00 31.04  ? 462 GLY A C     1 
ATOM   3794 O  O     . GLY A 1 462 ? -21.177 -72.834 -50.528 1.00 32.03  ? 462 GLY A O     1 
ATOM   3795 N  N     . ARG A 1 463 ? -22.837 -72.095 -49.203 1.00 27.72  ? 463 ARG A N     1 
ATOM   3796 C  CA    . ARG A 1 463 ? -23.183 -71.002 -50.099 1.00 34.39  ? 463 ARG A CA    1 
ATOM   3797 C  C     . ARG A 1 463 ? -22.247 -69.815 -49.901 1.00 32.71  ? 463 ARG A C     1 
ATOM   3798 O  O     . ARG A 1 463 ? -21.750 -69.562 -48.800 1.00 36.63  ? 463 ARG A O     1 
ATOM   3799 C  CB    . ARG A 1 463 ? -24.630 -70.562 -49.876 1.00 33.95  ? 463 ARG A CB    1 
ATOM   3800 C  CG    . ARG A 1 463 ? -25.654 -71.665 -50.077 1.00 38.65  ? 463 ARG A CG    1 
ATOM   3801 C  CD    . ARG A 1 463 ? -27.002 -71.251 -49.524 1.00 42.44  ? 463 ARG A CD    1 
ATOM   3802 N  NE    . ARG A 1 463 ? -27.511 -70.044 -50.164 1.00 47.61  ? 463 ARG A NE    1 
ATOM   3803 C  CZ    . ARG A 1 463 ? -28.439 -69.255 -49.633 1.00 39.55  ? 463 ARG A CZ    1 
ATOM   3804 N  NH1   . ARG A 1 463 ? -28.954 -69.540 -48.445 1.00 27.35  ? 463 ARG A NH1   1 
ATOM   3805 N  NH2   . ARG A 1 463 ? -28.851 -68.181 -50.289 1.00 39.28  ? 463 ARG A NH2   1 
ATOM   3806 N  N     . GLN A 1 464 ? -22.009 -69.084 -50.988 1.00 41.39  ? 464 GLN A N     1 
ATOM   3807 C  CA    . GLN A 1 464 ? -21.214 -67.865 -50.931 1.00 39.32  ? 464 GLN A CA    1 
ATOM   3808 C  C     . GLN A 1 464 ? -21.601 -66.974 -52.102 1.00 38.27  ? 464 GLN A C     1 
ATOM   3809 O  O     . GLN A 1 464 ? -22.011 -67.459 -53.159 1.00 41.92  ? 464 GLN A O     1 
ATOM   3810 C  CB    . GLN A 1 464 ? -19.709 -68.161 -50.951 1.00 32.32  ? 464 GLN A CB    1 
ATOM   3811 C  CG    . GLN A 1 464 ? -19.178 -68.654 -52.286 1.00 48.94  ? 464 GLN A CG    1 
ATOM   3812 C  CD    . GLN A 1 464 ? -17.681 -68.898 -52.259 1.00 61.28  ? 464 GLN A CD    1 
ATOM   3813 O  OE1   . GLN A 1 464 ? -17.161 -69.538 -51.344 1.00 55.77  ? 464 GLN A OE1   1 
ATOM   3814 N  NE2   . GLN A 1 464 ? -16.978 -68.382 -53.262 1.00 55.10  ? 464 GLN A NE2   1 
ATOM   3815 N  N     . LYS A 1 465 ? -21.470 -65.666 -51.895 1.00 41.21  ? 465 LYS A N     1 
ATOM   3816 C  CA    . LYS A 1 465 ? -21.842 -64.683 -52.902 1.00 35.29  ? 465 LYS A CA    1 
ATOM   3817 C  C     . LYS A 1 465 ? -21.135 -63.374 -52.581 1.00 39.79  ? 465 LYS A C     1 
ATOM   3818 O  O     . LYS A 1 465 ? -20.999 -63.015 -51.412 1.00 35.33  ? 465 LYS A O     1 
ATOM   3819 C  CB    . LYS A 1 465 ? -23.362 -64.475 -52.944 1.00 41.23  ? 465 LYS A CB    1 
ATOM   3820 C  CG    . LYS A 1 465 ? -23.814 -63.374 -53.892 1.00 32.47  ? 465 LYS A CG    1 
ATOM   3821 C  CD    . LYS A 1 465 ? -25.290 -63.055 -53.727 1.00 43.06  ? 465 LYS A CD    1 
ATOM   3822 C  CE    . LYS A 1 465 ? -26.168 -64.205 -54.187 1.00 49.86  ? 465 LYS A CE    1 
ATOM   3823 N  NZ    . LYS A 1 465 ? -27.615 -63.841 -54.144 1.00 43.28  ? 465 LYS A NZ    1 
ATOM   3824 N  N     . VAL A 1 466 ? -20.683 -62.674 -53.620 1.00 41.64  ? 466 VAL A N     1 
ATOM   3825 C  CA    . VAL A 1 466 ? -19.999 -61.393 -53.475 1.00 38.30  ? 466 VAL A CA    1 
ATOM   3826 C  C     . VAL A 1 466 ? -20.683 -60.375 -54.377 1.00 44.70  ? 466 VAL A C     1 
ATOM   3827 O  O     . VAL A 1 466 ? -20.948 -60.659 -55.551 1.00 40.87  ? 466 VAL A O     1 
ATOM   3828 C  CB    . VAL A 1 466 ? -18.499 -61.502 -53.816 1.00 37.71  ? 466 VAL A CB    1 
ATOM   3829 C  CG1   . VAL A 1 466 ? -17.871 -60.120 -53.920 1.00 37.12  ? 466 VAL A CG1   1 
ATOM   3830 C  CG2   . VAL A 1 466 ? -17.780 -62.334 -52.767 1.00 45.63  ? 466 VAL A CG2   1 
ATOM   3831 N  N     . VAL A 1 467 ? -20.968 -59.196 -53.829 1.00 36.45  ? 467 VAL A N     1 
ATOM   3832 C  CA    . VAL A 1 467 ? -21.606 -58.105 -54.556 1.00 39.52  ? 467 VAL A CA    1 
ATOM   3833 C  C     . VAL A 1 467 ? -20.639 -56.931 -54.606 1.00 43.86  ? 467 VAL A C     1 
ATOM   3834 O  O     . VAL A 1 467 ? -20.135 -56.491 -53.566 1.00 38.71  ? 467 VAL A O     1 
ATOM   3835 C  CB    . VAL A 1 467 ? -22.937 -57.690 -53.900 1.00 37.81  ? 467 VAL A CB    1 
ATOM   3836 C  CG1   . VAL A 1 467 ? -23.409 -56.355 -54.452 1.00 46.56  ? 467 VAL A CG1   1 
ATOM   3837 C  CG2   . VAL A 1 467 ? -23.993 -58.766 -54.115 1.00 47.37  ? 467 VAL A CG2   1 
ATOM   3838 N  N     . THR A 1 468 ? -20.380 -56.427 -55.810 1.00 40.38  ? 468 THR A N     1 
ATOM   3839 C  CA    . THR A 1 468 ? -19.500 -55.284 -55.996 1.00 42.36  ? 468 THR A CA    1 
ATOM   3840 C  C     . THR A 1 468 ? -20.278 -53.982 -55.839 1.00 46.05  ? 468 THR A C     1 
ATOM   3841 O  O     . THR A 1 468 ? -21.465 -53.900 -56.168 1.00 50.51  ? 468 THR A O     1 
ATOM   3842 C  CB    . THR A 1 468 ? -18.830 -55.327 -57.370 1.00 44.09  ? 468 THR A CB    1 
ATOM   3843 O  OG1   . THR A 1 468 ? -19.831 -55.269 -58.394 1.00 48.50  ? 468 THR A OG1   1 
ATOM   3844 C  CG2   . THR A 1 468 ? -18.024 -56.608 -57.529 1.00 33.21  ? 468 THR A CG2   1 
ATOM   3845 N  N     . LEU A 1 469 ? -19.592 -52.959 -55.333 1.00 43.81  ? 469 LEU A N     1 
ATOM   3846 C  CA    . LEU A 1 469 ? -20.214 -51.683 -55.015 1.00 41.21  ? 469 LEU A CA    1 
ATOM   3847 C  C     . LEU A 1 469 ? -19.365 -50.537 -55.549 1.00 42.85  ? 469 LEU A C     1 
ATOM   3848 O  O     . LEU A 1 469 ? -18.145 -50.657 -55.694 1.00 41.15  ? 469 LEU A O     1 
ATOM   3849 C  CB    . LEU A 1 469 ? -20.413 -51.527 -53.500 1.00 39.40  ? 469 LEU A CB    1 
ATOM   3850 C  CG    . LEU A 1 469 ? -21.282 -52.597 -52.834 1.00 46.21  ? 469 LEU A CG    1 
ATOM   3851 C  CD1   . LEU A 1 469 ? -21.156 -52.535 -51.322 1.00 36.43  ? 469 LEU A CD1   1 
ATOM   3852 C  CD2   . LEU A 1 469 ? -22.738 -52.448 -53.261 1.00 40.95  ? 469 LEU A CD2   1 
ATOM   3853 N  N     . THR A 1 470 ? -20.028 -49.415 -55.830 1.00 42.92  ? 470 THR A N     1 
ATOM   3854 C  CA    . THR A 1 470 ? -19.394 -48.229 -56.389 1.00 40.39  ? 470 THR A CA    1 
ATOM   3855 C  C     . THR A 1 470 ? -19.728 -47.021 -55.527 1.00 51.42  ? 470 THR A C     1 
ATOM   3856 O  O     . THR A 1 470 ? -20.867 -46.869 -55.076 1.00 49.51  ? 470 THR A O     1 
ATOM   3857 C  CB    . THR A 1 470 ? -19.855 -47.984 -57.838 1.00 43.07  ? 470 THR A CB    1 
ATOM   3858 O  OG1   . THR A 1 470 ? -19.405 -49.057 -58.674 1.00 46.37  ? 470 THR A OG1   1 
ATOM   3859 C  CG2   . THR A 1 470 ? -19.306 -46.666 -58.375 1.00 61.63  ? 470 THR A CG2   1 
ATOM   3860 N  N     . ASP A 1 471 ? -18.725 -46.167 -55.298 1.00 48.90  ? 471 ASP A N     1 
ATOM   3861 C  CA    . ASP A 1 471 ? -18.890 -44.935 -54.522 1.00 46.58  ? 471 ASP A CA    1 
ATOM   3862 C  C     . ASP A 1 471 ? -19.439 -45.235 -53.129 1.00 44.27  ? 471 ASP A C     1 
ATOM   3863 O  O     . ASP A 1 471 ? -20.440 -44.665 -52.691 1.00 41.66  ? 471 ASP A O     1 
ATOM   3864 C  CB    . ASP A 1 471 ? -19.782 -43.934 -55.260 1.00 52.17  ? 471 ASP A CB    1 
ATOM   3865 C  CG    . ASP A 1 471 ? -19.154 -43.427 -56.541 1.00 71.08  ? 471 ASP A CG    1 
ATOM   3866 O  OD1   . ASP A 1 471 ? -17.914 -43.278 -56.578 1.00 72.63  ? 471 ASP A OD1   1 
ATOM   3867 O  OD2   . ASP A 1 471 ? -19.901 -43.180 -57.511 1.00 76.56  ? 471 ASP A OD2   1 
ATOM   3868 N  N     . THR A 1 472 ? -18.769 -46.143 -52.429 1.00 39.92  ? 472 THR A N     1 
ATOM   3869 C  CA    . THR A 1 472 ? -19.213 -46.615 -51.129 1.00 35.63  ? 472 THR A CA    1 
ATOM   3870 C  C     . THR A 1 472 ? -18.133 -46.364 -50.084 1.00 34.91  ? 472 THR A C     1 
ATOM   3871 O  O     . THR A 1 472 ? -17.023 -45.920 -50.390 1.00 39.67  ? 472 THR A O     1 
ATOM   3872 C  CB    . THR A 1 472 ? -19.568 -48.106 -51.177 1.00 38.51  ? 472 THR A CB    1 
ATOM   3873 O  OG1   . THR A 1 472 ? -19.960 -48.550 -49.872 1.00 37.23  ? 472 THR A OG1   1 
ATOM   3874 C  CG2   . THR A 1 472 ? -18.373 -48.922 -51.650 1.00 41.36  ? 472 THR A CG2   1 
ATOM   3875 N  N     . THR A 1 473 ? -18.482 -46.648 -48.835 1.00 38.48  ? 473 THR A N     1 
ATOM   3876 C  CA    . THR A 1 473 ? -17.577 -46.529 -47.704 1.00 30.03  ? 473 THR A CA    1 
ATOM   3877 C  C     . THR A 1 473 ? -17.482 -47.872 -46.994 1.00 38.12  ? 473 THR A C     1 
ATOM   3878 O  O     . THR A 1 473 ? -18.285 -48.780 -47.223 1.00 40.93  ? 473 THR A O     1 
ATOM   3879 C  CB    . THR A 1 473 ? -18.046 -45.441 -46.728 1.00 48.10  ? 473 THR A CB    1 
ATOM   3880 O  OG1   . THR A 1 473 ? -19.275 -45.845 -46.112 1.00 36.93  ? 473 THR A OG1   1 
ATOM   3881 C  CG2   . THR A 1 473 ? -18.265 -44.126 -47.462 1.00 32.87  ? 473 THR A CG2   1 
ATOM   3882 N  N     . ASN A 1 474 ? -16.480 -47.992 -46.119 1.00 38.18  ? 474 ASN A N     1 
ATOM   3883 C  CA    . ASN A 1 474 ? -16.294 -49.237 -45.381 1.00 43.50  ? 474 ASN A CA    1 
ATOM   3884 C  C     . ASN A 1 474 ? -17.497 -49.552 -44.504 1.00 46.82  ? 474 ASN A C     1 
ATOM   3885 O  O     . ASN A 1 474 ? -17.843 -50.725 -44.322 1.00 49.92  ? 474 ASN A O     1 
ATOM   3886 C  CB    . ASN A 1 474 ? -15.022 -49.161 -44.536 1.00 46.27  ? 474 ASN A CB    1 
ATOM   3887 C  CG    . ASN A 1 474 ? -14.573 -50.520 -44.036 1.00 65.40  ? 474 ASN A CG    1 
ATOM   3888 O  OD1   . ASN A 1 474 ? -14.910 -50.928 -42.923 1.00 71.04  ? 474 ASN A OD1   1 
ATOM   3889 N  ND2   . ASN A 1 474 ? -13.811 -51.233 -44.861 1.00 52.79  ? 474 ASN A ND2   1 
ATOM   3890 N  N     . GLN A 1 475 ? -18.150 -48.524 -43.960 1.00 41.50  ? 475 GLN A N     1 
ATOM   3891 C  CA    . GLN A 1 475 ? -19.338 -48.752 -43.146 1.00 35.18  ? 475 GLN A CA    1 
ATOM   3892 C  C     . GLN A 1 475 ? -20.514 -49.209 -44.001 1.00 38.87  ? 475 GLN A C     1 
ATOM   3893 O  O     . GLN A 1 475 ? -21.295 -50.071 -43.580 1.00 34.16  ? 475 GLN A O     1 
ATOM   3894 C  CB    . GLN A 1 475 ? -19.700 -47.482 -42.375 1.00 37.38  ? 475 GLN A CB    1 
ATOM   3895 C  CG    . GLN A 1 475 ? -18.653 -47.029 -41.366 1.00 45.08  ? 475 GLN A CG    1 
ATOM   3896 C  CD    . GLN A 1 475 ? -17.579 -46.150 -41.984 1.00 52.49  ? 475 GLN A CD    1 
ATOM   3897 O  OE1   . GLN A 1 475 ? -17.332 -46.202 -43.189 1.00 51.56  ? 475 GLN A OE1   1 
ATOM   3898 N  NE2   . GLN A 1 475 ? -16.942 -45.327 -41.158 1.00 49.32  ? 475 GLN A NE2   1 
ATOM   3899 N  N     . LYS A 1 476 ? -20.658 -48.644 -45.202 1.00 30.91  ? 476 LYS A N     1 
ATOM   3900 C  CA    . LYS A 1 476 ? -21.773 -49.021 -46.064 1.00 38.08  ? 476 LYS A CA    1 
ATOM   3901 C  C     . LYS A 1 476 ? -21.638 -50.457 -46.554 1.00 34.03  ? 476 LYS A C     1 
ATOM   3902 O  O     . LYS A 1 476 ? -22.642 -51.164 -46.697 1.00 40.55  ? 476 LYS A O     1 
ATOM   3903 C  CB    . LYS A 1 476 ? -21.875 -48.058 -47.248 1.00 34.64  ? 476 LYS A CB    1 
ATOM   3904 C  CG    . LYS A 1 476 ? -22.316 -46.653 -46.871 1.00 31.62  ? 476 LYS A CG    1 
ATOM   3905 C  CD    . LYS A 1 476 ? -22.369 -45.744 -48.089 1.00 40.46  ? 476 LYS A CD    1 
ATOM   3906 C  CE    . LYS A 1 476 ? -22.742 -44.323 -47.697 1.00 49.09  ? 476 LYS A CE    1 
ATOM   3907 N  NZ    . LYS A 1 476 ? -22.775 -43.412 -48.874 1.00 56.12  ? 476 LYS A NZ    1 
ATOM   3908 N  N     . THR A 1 477 ? -20.408 -50.909 -46.814 1.00 30.42  ? 477 THR A N     1 
ATOM   3909 C  CA    . THR A 1 477 ? -20.214 -52.276 -47.289 1.00 36.26  ? 477 THR A CA    1 
ATOM   3910 C  C     . THR A 1 477 ? -20.563 -53.295 -46.211 1.00 42.55  ? 477 THR A C     1 
ATOM   3911 O  O     . THR A 1 477 ? -21.092 -54.370 -46.515 1.00 35.33  ? 477 THR A O     1 
ATOM   3912 C  CB    . THR A 1 477 ? -18.774 -52.475 -47.764 1.00 38.07  ? 477 THR A CB    1 
ATOM   3913 O  OG1   . THR A 1 477 ? -17.871 -52.235 -46.678 1.00 42.56  ? 477 THR A OG1   1 
ATOM   3914 C  CG2   . THR A 1 477 ? -18.453 -51.526 -48.909 1.00 34.44  ? 477 THR A CG2   1 
ATOM   3915 N  N     . GLU A 1 478 ? -20.274 -52.978 -44.946 1.00 38.78  ? 478 GLU A N     1 
ATOM   3916 C  CA    . GLU A 1 478 ? -20.641 -53.885 -43.863 1.00 45.41  ? 478 GLU A CA    1 
ATOM   3917 C  C     . GLU A 1 478 ? -22.156 -53.972 -43.712 1.00 35.02  ? 478 GLU A C     1 
ATOM   3918 O  O     . GLU A 1 478 ? -22.696 -55.049 -43.430 1.00 29.94  ? 478 GLU A O     1 
ATOM   3919 C  CB    . GLU A 1 478 ? -19.985 -53.438 -42.554 1.00 36.45  ? 478 GLU A CB    1 
ATOM   3920 C  CG    . GLU A 1 478 ? -18.453 -53.506 -42.544 1.00 43.77  ? 478 GLU A CG    1 
ATOM   3921 C  CD    . GLU A 1 478 ? -17.913 -54.920 -42.365 1.00 45.66  ? 478 GLU A CD    1 
ATOM   3922 O  OE1   . GLU A 1 478 ? -18.711 -55.880 -42.410 1.00 51.33  ? 478 GLU A OE1   1 
ATOM   3923 O  OE2   . GLU A 1 478 ? -16.685 -55.077 -42.172 1.00 46.13  ? 478 GLU A OE2   1 
ATOM   3924 N  N     . LEU A 1 479 ? -22.859 -52.852 -43.903 1.00 37.35  ? 479 LEU A N     1 
ATOM   3925 C  CA    . LEU A 1 479 ? -24.318 -52.886 -43.894 1.00 33.32  ? 479 LEU A CA    1 
ATOM   3926 C  C     . LEU A 1 479 ? -24.860 -53.598 -45.127 1.00 35.41  ? 479 LEU A C     1 
ATOM   3927 O  O     . LEU A 1 479 ? -25.868 -54.311 -45.044 1.00 32.43  ? 479 LEU A O     1 
ATOM   3928 C  CB    . LEU A 1 479 ? -24.882 -51.468 -43.808 1.00 33.81  ? 479 LEU A CB    1 
ATOM   3929 C  CG    . LEU A 1 479 ? -24.859 -50.759 -42.453 1.00 45.43  ? 479 LEU A CG    1 
ATOM   3930 C  CD1   . LEU A 1 479 ? -25.332 -49.322 -42.608 1.00 25.88  ? 479 LEU A CD1   1 
ATOM   3931 C  CD2   . LEU A 1 479 ? -25.720 -51.499 -41.444 1.00 31.20  ? 479 LEU A CD2   1 
ATOM   3932 N  N     . GLN A 1 480 ? -24.211 -53.411 -46.280 1.00 27.64  ? 480 GLN A N     1 
ATOM   3933 C  CA    . GLN A 1 480 ? -24.639 -54.104 -47.492 1.00 31.12  ? 480 GLN A CA    1 
ATOM   3934 C  C     . GLN A 1 480 ? -24.501 -55.614 -47.342 1.00 35.71  ? 480 GLN A C     1 
ATOM   3935 O  O     . GLN A 1 480 ? -25.321 -56.375 -47.869 1.00 32.29  ? 480 GLN A O     1 
ATOM   3936 C  CB    . GLN A 1 480 ? -23.834 -53.611 -48.696 1.00 26.61  ? 480 GLN A CB    1 
ATOM   3937 C  CG    . GLN A 1 480 ? -24.225 -52.227 -49.197 1.00 37.48  ? 480 GLN A CG    1 
ATOM   3938 C  CD    . GLN A 1 480 ? -25.502 -52.235 -50.015 1.00 40.22  ? 480 GLN A CD    1 
ATOM   3939 O  OE1   . GLN A 1 480 ? -26.044 -53.292 -50.334 1.00 36.08  ? 480 GLN A OE1   1 
ATOM   3940 N  NE2   . GLN A 1 480 ? -25.988 -51.049 -50.362 1.00 32.90  ? 480 GLN A NE2   1 
ATOM   3941 N  N     . ALA A 1 481 ? -23.468 -56.066 -46.626 1.00 26.75  ? 481 ALA A N     1 
ATOM   3942 C  CA    . ALA A 1 481 ? -23.279 -57.499 -46.421 1.00 27.48  ? 481 ALA A CA    1 
ATOM   3943 C  C     . ALA A 1 481 ? -24.384 -58.085 -45.552 1.00 32.47  ? 481 ALA A C     1 
ATOM   3944 O  O     . ALA A 1 481 ? -24.883 -59.182 -45.830 1.00 37.18  ? 481 ALA A O     1 
ATOM   3945 C  CB    . ALA A 1 481 ? -21.907 -57.767 -45.801 1.00 26.57  ? 481 ALA A CB    1 
ATOM   3946 N  N     . ILE A 1 482 ? -24.779 -57.370 -44.496 1.00 31.69  ? 482 ILE A N     1 
ATOM   3947 C  CA    . ILE A 1 482 ? -25.878 -57.835 -43.655 1.00 31.68  ? 482 ILE A CA    1 
ATOM   3948 C  C     . ILE A 1 482 ? -27.179 -57.846 -44.446 1.00 37.62  ? 482 ILE A C     1 
ATOM   3949 O  O     . ILE A 1 482 ? -27.989 -58.775 -44.329 1.00 33.47  ? 482 ILE A O     1 
ATOM   3950 C  CB    . ILE A 1 482 ? -25.991 -56.965 -42.388 1.00 35.82  ? 482 ILE A CB    1 
ATOM   3951 C  CG1   . ILE A 1 482 ? -24.694 -57.027 -41.578 1.00 32.62  ? 482 ILE A CG1   1 
ATOM   3952 C  CG2   . ILE A 1 482 ? -27.176 -57.403 -41.541 1.00 24.42  ? 482 ILE A CG2   1 
ATOM   3953 C  CD1   . ILE A 1 482 ? -24.773 -56.323 -40.245 1.00 27.21  ? 482 ILE A CD1   1 
ATOM   3954 N  N     . TYR A 1 483 ? -27.397 -56.816 -45.268 1.00 28.62  ? 483 TYR A N     1 
ATOM   3955 C  CA    . TYR A 1 483 ? -28.590 -56.769 -46.107 1.00 30.35  ? 483 TYR A CA    1 
ATOM   3956 C  C     . TYR A 1 483 ? -28.620 -57.935 -47.088 1.00 34.70  ? 483 TYR A C     1 
ATOM   3957 O  O     . TYR A 1 483 ? -29.684 -58.509 -47.348 1.00 32.65  ? 483 TYR A O     1 
ATOM   3958 C  CB    . TYR A 1 483 ? -28.646 -55.434 -46.851 1.00 27.74  ? 483 TYR A CB    1 
ATOM   3959 C  CG    . TYR A 1 483 ? -29.817 -55.285 -47.797 1.00 35.21  ? 483 TYR A CG    1 
ATOM   3960 C  CD1   . TYR A 1 483 ? -31.122 -55.421 -47.346 1.00 39.16  ? 483 TYR A CD1   1 
ATOM   3961 C  CD2   . TYR A 1 483 ? -29.617 -54.983 -49.137 1.00 41.58  ? 483 TYR A CD2   1 
ATOM   3962 C  CE1   . TYR A 1 483 ? -32.195 -55.278 -48.206 1.00 33.44  ? 483 TYR A CE1   1 
ATOM   3963 C  CE2   . TYR A 1 483 ? -30.683 -54.835 -50.004 1.00 35.38  ? 483 TYR A CE2   1 
ATOM   3964 C  CZ    . TYR A 1 483 ? -31.970 -54.985 -49.534 1.00 42.83  ? 483 TYR A CZ    1 
ATOM   3965 O  OH    . TYR A 1 483 ? -33.035 -54.841 -50.394 1.00 52.07  ? 483 TYR A OH    1 
ATOM   3966 N  N     . LEU A 1 484 ? -27.458 -58.306 -47.631 1.00 33.31  ? 484 LEU A N     1 
ATOM   3967 C  CA    . LEU A 1 484 ? -27.405 -59.407 -48.588 1.00 34.40  ? 484 LEU A CA    1 
ATOM   3968 C  C     . LEU A 1 484 ? -27.738 -60.737 -47.923 1.00 36.96  ? 484 LEU A C     1 
ATOM   3969 O  O     . LEU A 1 484 ? -28.438 -61.571 -48.508 1.00 35.80  ? 484 LEU A O     1 
ATOM   3970 C  CB    . LEU A 1 484 ? -26.025 -59.465 -49.242 1.00 34.26  ? 484 LEU A CB    1 
ATOM   3971 C  CG    . LEU A 1 484 ? -25.830 -60.527 -50.325 1.00 47.16  ? 484 LEU A CG    1 
ATOM   3972 C  CD1   . LEU A 1 484 ? -26.787 -60.297 -51.484 1.00 48.92  ? 484 LEU A CD1   1 
ATOM   3973 C  CD2   . LEU A 1 484 ? -24.389 -60.539 -50.809 1.00 41.44  ? 484 LEU A CD2   1 
ATOM   3974 N  N     . ALA A 1 485 ? -27.244 -60.954 -46.702 1.00 35.35  ? 485 ALA A N     1 
ATOM   3975 C  CA    . ALA A 1 485 ? -27.545 -62.193 -45.995 1.00 32.55  ? 485 ALA A CA    1 
ATOM   3976 C  C     . ALA A 1 485 ? -29.031 -62.300 -45.673 1.00 36.06  ? 485 ALA A C     1 
ATOM   3977 O  O     . ALA A 1 485 ? -29.607 -63.392 -45.730 1.00 36.68  ? 485 ALA A O     1 
ATOM   3978 C  CB    . ALA A 1 485 ? -26.713 -62.284 -44.718 1.00 23.51  ? 485 ALA A CB    1 
ATOM   3979 N  N     . LEU A 1 486 ? -29.667 -61.176 -45.335 1.00 32.08  ? 486 LEU A N     1 
ATOM   3980 C  CA    . LEU A 1 486 ? -31.095 -61.197 -45.041 1.00 30.54  ? 486 LEU A CA    1 
ATOM   3981 C  C     . LEU A 1 486 ? -31.923 -61.516 -46.280 1.00 33.52  ? 486 LEU A C     1 
ATOM   3982 O  O     . LEU A 1 486 ? -32.990 -62.129 -46.168 1.00 31.80  ? 486 LEU A O     1 
ATOM   3983 C  CB    . LEU A 1 486 ? -31.528 -59.857 -44.446 1.00 30.02  ? 486 LEU A CB    1 
ATOM   3984 C  CG    . LEU A 1 486 ? -30.970 -59.497 -43.068 1.00 38.03  ? 486 LEU A CG    1 
ATOM   3985 C  CD1   . LEU A 1 486 ? -31.338 -58.070 -42.695 1.00 33.70  ? 486 LEU A CD1   1 
ATOM   3986 C  CD2   . LEU A 1 486 ? -31.479 -60.467 -42.015 1.00 22.64  ? 486 LEU A CD2   1 
ATOM   3987 N  N     . GLN A 1 487 ? -31.452 -61.112 -47.462 1.00 31.09  ? 487 GLN A N     1 
ATOM   3988 C  CA    . GLN A 1 487 ? -32.213 -61.358 -48.683 1.00 33.45  ? 487 GLN A CA    1 
ATOM   3989 C  C     . GLN A 1 487 ? -32.174 -62.829 -49.079 1.00 37.12  ? 487 GLN A C     1 
ATOM   3990 O  O     . GLN A 1 487 ? -33.193 -63.394 -49.492 1.00 34.61  ? 487 GLN A O     1 
ATOM   3991 C  CB    . GLN A 1 487 ? -31.675 -60.494 -49.823 1.00 29.42  ? 487 GLN A CB    1 
ATOM   3992 C  CG    . GLN A 1 487 ? -31.907 -59.006 -49.661 1.00 34.01  ? 487 GLN A CG    1 
ATOM   3993 C  CD    . GLN A 1 487 ? -31.330 -58.207 -50.816 1.00 46.09  ? 487 GLN A CD    1 
ATOM   3994 O  OE1   . GLN A 1 487 ? -30.115 -58.037 -50.923 1.00 45.18  ? 487 GLN A OE1   1 
ATOM   3995 N  NE2   . GLN A 1 487 ? -32.202 -57.720 -51.693 1.00 42.24  ? 487 GLN A NE2   1 
ATOM   3996 N  N     . ASP A 1 488 ? -31.010 -63.464 -48.963 1.00 29.64  ? 488 ASP A N     1 
ATOM   3997 C  CA    . ASP A 1 488 ? -30.810 -64.817 -49.462 1.00 29.80  ? 488 ASP A CA    1 
ATOM   3998 C  C     . ASP A 1 488 ? -31.028 -65.893 -48.405 1.00 39.82  ? 488 ASP A C     1 
ATOM   3999 O  O     . ASP A 1 488 ? -30.813 -67.074 -48.695 1.00 36.44  ? 488 ASP A O     1 
ATOM   4000 C  CB    . ASP A 1 488 ? -29.402 -64.956 -50.046 1.00 25.30  ? 488 ASP A CB    1 
ATOM   4001 C  CG    . ASP A 1 488 ? -29.123 -63.947 -51.139 1.00 34.75  ? 488 ASP A CG    1 
ATOM   4002 O  OD1   . ASP A 1 488 ? -30.092 -63.383 -51.691 1.00 36.40  ? 488 ASP A OD1   1 
ATOM   4003 O  OD2   . ASP A 1 488 ? -27.935 -63.723 -51.450 1.00 36.97  ? 488 ASP A OD2   1 
ATOM   4004 N  N     . SER A 1 489 ? -31.441 -65.525 -47.199 1.00 34.54  ? 489 SER A N     1 
ATOM   4005 C  CA    . SER A 1 489 ? -31.681 -66.489 -46.136 1.00 30.06  ? 489 SER A CA    1 
ATOM   4006 C  C     . SER A 1 489 ? -33.175 -66.745 -45.970 1.00 33.35  ? 489 SER A C     1 
ATOM   4007 O  O     . SER A 1 489 ? -34.023 -66.010 -46.480 1.00 31.62  ? 489 SER A O     1 
ATOM   4008 C  CB    . SER A 1 489 ? -31.074 -66.001 -44.818 1.00 35.66  ? 489 SER A CB    1 
ATOM   4009 O  OG    . SER A 1 489 ? -31.523 -64.695 -44.496 1.00 28.32  ? 489 SER A OG    1 
ATOM   4010 N  N     . GLY A 1 490 ? -33.487 -67.809 -45.237 1.00 32.73  ? 490 GLY A N     1 
ATOM   4011 C  CA    . GLY A 1 490 ? -34.859 -68.164 -44.941 1.00 29.78  ? 490 GLY A CA    1 
ATOM   4012 C  C     . GLY A 1 490 ? -35.433 -67.313 -43.827 1.00 32.89  ? 490 GLY A C     1 
ATOM   4013 O  O     . GLY A 1 490 ? -34.899 -66.262 -43.466 1.00 34.56  ? 490 GLY A O     1 
ATOM   4014 N  N     . LEU A 1 491 ? -36.548 -67.789 -43.270 1.00 25.46  ? 491 LEU A N     1 
ATOM   4015 C  CA    . LEU A 1 491 ? -37.225 -67.047 -42.212 1.00 32.94  ? 491 LEU A CA    1 
ATOM   4016 C  C     . LEU A 1 491 ? -36.429 -67.023 -40.913 1.00 33.41  ? 491 LEU A C     1 
ATOM   4017 O  O     . LEU A 1 491 ? -36.673 -66.155 -40.068 1.00 39.93  ? 491 LEU A O     1 
ATOM   4018 C  CB    . LEU A 1 491 ? -38.615 -67.636 -41.971 1.00 26.55  ? 491 LEU A CB    1 
ATOM   4019 C  CG    . LEU A 1 491 ? -39.564 -67.544 -43.169 1.00 31.80  ? 491 LEU A CG    1 
ATOM   4020 C  CD1   . LEU A 1 491 ? -40.936 -68.100 -42.824 1.00 22.49  ? 491 LEU A CD1   1 
ATOM   4021 C  CD2   . LEU A 1 491 ? -39.668 -66.105 -43.658 1.00 28.72  ? 491 LEU A CD2   1 
ATOM   4022 N  N     . GLU A 1 492 ? -35.487 -67.947 -40.735 1.00 31.77  ? 492 GLU A N     1 
ATOM   4023 C  CA    . GLU A 1 492 ? -34.606 -67.965 -39.575 1.00 37.00  ? 492 GLU A CA    1 
ATOM   4024 C  C     . GLU A 1 492 ? -33.164 -67.999 -40.057 1.00 41.48  ? 492 GLU A C     1 
ATOM   4025 O  O     . GLU A 1 492 ? -32.834 -68.735 -40.992 1.00 40.14  ? 492 GLU A O     1 
ATOM   4026 C  CB    . GLU A 1 492 ? -34.901 -69.168 -38.666 1.00 36.09  ? 492 GLU A CB    1 
ATOM   4027 C  CG    . GLU A 1 492 ? -36.344 -69.227 -38.183 1.00 39.54  ? 492 GLU A CG    1 
ATOM   4028 C  CD    . GLU A 1 492 ? -36.584 -70.326 -37.163 1.00 51.31  ? 492 GLU A CD    1 
ATOM   4029 O  OE1   . GLU A 1 492 ? -37.723 -70.434 -36.659 1.00 51.01  ? 492 GLU A OE1   1 
ATOM   4030 O  OE2   . GLU A 1 492 ? -35.636 -71.080 -36.864 1.00 56.06  ? 492 GLU A OE2   1 
ATOM   4031 N  N     . VAL A 1 493 ? -32.307 -67.200 -39.426 1.00 31.51  ? 493 VAL A N     1 
ATOM   4032 C  CA    . VAL A 1 493 ? -30.944 -67.024 -39.916 1.00 30.46  ? 493 VAL A CA    1 
ATOM   4033 C  C     . VAL A 1 493 ? -30.047 -66.614 -38.754 1.00 37.80  ? 493 VAL A C     1 
ATOM   4034 O  O     . VAL A 1 493 ? -30.456 -65.860 -37.865 1.00 32.72  ? 493 VAL A O     1 
ATOM   4035 C  CB    . VAL A 1 493 ? -30.897 -65.992 -41.070 1.00 27.99  ? 493 VAL A CB    1 
ATOM   4036 C  CG1   . VAL A 1 493 ? -31.466 -64.654 -40.617 1.00 28.98  ? 493 VAL A CG1   1 
ATOM   4037 C  CG2   . VAL A 1 493 ? -29.478 -65.827 -41.590 1.00 35.58  ? 493 VAL A CG2   1 
ATOM   4038 N  N     . ASN A 1 494 ? -28.822 -67.132 -38.766 1.00 35.79  ? 494 ASN A N     1 
ATOM   4039 C  CA    . ASN A 1 494 ? -27.746 -66.686 -37.891 1.00 34.19  ? 494 ASN A CA    1 
ATOM   4040 C  C     . ASN A 1 494 ? -26.753 -65.883 -38.718 1.00 34.54  ? 494 ASN A C     1 
ATOM   4041 O  O     . ASN A 1 494 ? -26.300 -66.348 -39.770 1.00 33.35  ? 494 ASN A O     1 
ATOM   4042 C  CB    . ASN A 1 494 ? -27.040 -67.873 -37.231 1.00 34.74  ? 494 ASN A CB    1 
ATOM   4043 C  CG    . ASN A 1 494 ? -27.959 -68.676 -36.333 1.00 39.49  ? 494 ASN A CG    1 
ATOM   4044 O  OD1   . ASN A 1 494 ? -28.594 -68.132 -35.430 1.00 39.31  ? 494 ASN A OD1   1 
ATOM   4045 N  ND2   . ASN A 1 494 ? -28.036 -69.979 -36.580 1.00 34.30  ? 494 ASN A ND2   1 
ATOM   4046 N  N     . ILE A 1 495 ? -26.417 -64.684 -38.249 1.00 26.63  ? 495 ILE A N     1 
ATOM   4047 C  CA    . ILE A 1 495 ? -25.517 -63.783 -38.960 1.00 29.96  ? 495 ILE A CA    1 
ATOM   4048 C  C     . ILE A 1 495 ? -24.357 -63.425 -38.041 1.00 32.49  ? 495 ILE A C     1 
ATOM   4049 O  O     . ILE A 1 495 ? -24.570 -62.999 -36.900 1.00 31.44  ? 495 ILE A O     1 
ATOM   4050 C  CB    . ILE A 1 495 ? -26.243 -62.513 -39.440 1.00 28.94  ? 495 ILE A CB    1 
ATOM   4051 C  CG1   . ILE A 1 495 ? -27.423 -62.882 -40.342 1.00 29.74  ? 495 ILE A CG1   1 
ATOM   4052 C  CG2   . ILE A 1 495 ? -25.279 -61.595 -40.180 1.00 20.31  ? 495 ILE A CG2   1 
ATOM   4053 C  CD1   . ILE A 1 495 ? -28.228 -61.691 -40.807 1.00 20.19  ? 495 ILE A CD1   1 
ATOM   4054 N  N     . VAL A 1 496 ? -23.134 -63.591 -38.541 1.00 29.12  ? 496 VAL A N     1 
ATOM   4055 C  CA    . VAL A 1 496 ? -21.921 -63.244 -37.808 1.00 28.60  ? 496 VAL A CA    1 
ATOM   4056 C  C     . VAL A 1 496 ? -21.211 -62.138 -38.575 1.00 32.77  ? 496 VAL A C     1 
ATOM   4057 O  O     . VAL A 1 496 ? -20.884 -62.306 -39.757 1.00 33.81  ? 496 VAL A O     1 
ATOM   4058 C  CB    . VAL A 1 496 ? -20.998 -64.457 -37.614 1.00 28.78  ? 496 VAL A CB    1 
ATOM   4059 C  CG1   . VAL A 1 496 ? -19.765 -64.058 -36.817 1.00 23.28  ? 496 VAL A CG1   1 
ATOM   4060 C  CG2   . VAL A 1 496 ? -21.745 -65.583 -36.920 1.00 20.72  ? 496 VAL A CG2   1 
ATOM   4061 N  N     . THR A 1 497 ? -20.976 -61.013 -37.906 1.00 30.14  ? 497 THR A N     1 
ATOM   4062 C  CA    . THR A 1 497 ? -20.315 -59.863 -38.501 1.00 34.42  ? 497 THR A CA    1 
ATOM   4063 C  C     . THR A 1 497 ? -19.164 -59.425 -37.606 1.00 36.48  ? 497 THR A C     1 
ATOM   4064 O  O     . THR A 1 497 ? -19.126 -59.735 -36.413 1.00 34.22  ? 497 THR A O     1 
ATOM   4065 C  CB    . THR A 1 497 ? -21.292 -58.695 -38.706 1.00 38.18  ? 497 THR A CB    1 
ATOM   4066 O  OG1   . THR A 1 497 ? -20.599 -57.584 -39.288 1.00 38.33  ? 497 THR A OG1   1 
ATOM   4067 C  CG2   . THR A 1 497 ? -21.900 -58.269 -37.375 1.00 27.00  ? 497 THR A CG2   1 
ATOM   4068 N  N     . ASP A 1 498 ? -18.213 -58.704 -38.198 1.00 32.72  ? 498 ASP A N     1 
ATOM   4069 C  CA    . ASP A 1 498 ? -17.105 -58.127 -37.449 1.00 40.97  ? 498 ASP A CA    1 
ATOM   4070 C  C     . ASP A 1 498 ? -17.262 -56.627 -37.233 1.00 41.67  ? 498 ASP A C     1 
ATOM   4071 O  O     . ASP A 1 498 ? -16.361 -55.995 -36.673 1.00 49.24  ? 498 ASP A O     1 
ATOM   4072 C  CB    . ASP A 1 498 ? -15.768 -58.422 -38.150 1.00 37.15  ? 498 ASP A CB    1 
ATOM   4073 C  CG    . ASP A 1 498 ? -15.692 -57.857 -39.567 1.00 48.23  ? 498 ASP A CG    1 
ATOM   4074 O  OD1   . ASP A 1 498 ? -16.318 -56.814 -39.851 1.00 54.28  ? 498 ASP A OD1   1 
ATOM   4075 O  OD2   . ASP A 1 498 ? -14.988 -58.458 -40.406 1.00 43.20  ? 498 ASP A OD2   1 
ATOM   4076 N  N     . SER A 1 499 ? -18.379 -56.050 -37.665 1.00 37.50  ? 499 SER A N     1 
ATOM   4077 C  CA    . SER A 1 499 ? -18.599 -54.609 -37.617 1.00 37.32  ? 499 SER A CA    1 
ATOM   4078 C  C     . SER A 1 499 ? -19.471 -54.279 -36.413 1.00 30.97  ? 499 SER A C     1 
ATOM   4079 O  O     . SER A 1 499 ? -20.675 -54.557 -36.415 1.00 31.49  ? 499 SER A O     1 
ATOM   4080 C  CB    . SER A 1 499 ? -19.247 -54.122 -38.911 1.00 40.48  ? 499 SER A CB    1 
ATOM   4081 O  OG    . SER A 1 499 ? -19.659 -52.772 -38.797 1.00 40.12  ? 499 SER A OG    1 
ATOM   4082 N  N     . GLN A 1 500 ? -18.862 -53.688 -35.384 1.00 35.76  ? 500 GLN A N     1 
ATOM   4083 C  CA    . GLN A 1 500 ? -19.644 -53.197 -34.257 1.00 42.07  ? 500 GLN A CA    1 
ATOM   4084 C  C     . GLN A 1 500 ? -20.497 -51.996 -34.639 1.00 37.63  ? 500 GLN A C     1 
ATOM   4085 O  O     . GLN A 1 500 ? -21.515 -51.743 -33.987 1.00 36.85  ? 500 GLN A O     1 
ATOM   4086 C  CB    . GLN A 1 500 ? -18.727 -52.847 -33.084 1.00 50.08  ? 500 GLN A CB    1 
ATOM   4087 C  CG    . GLN A 1 500 ? -17.552 -51.951 -33.437 1.00 57.86  ? 500 GLN A CG    1 
ATOM   4088 C  CD    . GLN A 1 500 ? -16.623 -51.726 -32.257 1.00 62.85  ? 500 GLN A CD    1 
ATOM   4089 O  OE1   . GLN A 1 500 ? -17.005 -51.117 -31.257 1.00 59.54  ? 500 GLN A OE1   1 
ATOM   4090 N  NE2   . GLN A 1 500 ? -15.397 -52.228 -32.365 1.00 60.10  ? 500 GLN A NE2   1 
ATOM   4091 N  N     . TYR A 1 501 ? -20.105 -51.258 -35.681 1.00 32.71  ? 501 TYR A N     1 
ATOM   4092 C  CA    . TYR A 1 501 ? -20.940 -50.176 -36.192 1.00 30.76  ? 501 TYR A CA    1 
ATOM   4093 C  C     . TYR A 1 501 ? -22.303 -50.699 -36.626 1.00 30.97  ? 501 TYR A C     1 
ATOM   4094 O  O     . TYR A 1 501 ? -23.346 -50.225 -36.161 1.00 35.85  ? 501 TYR A O     1 
ATOM   4095 C  CB    . TYR A 1 501 ? -20.232 -49.479 -37.357 1.00 29.70  ? 501 TYR A CB    1 
ATOM   4096 C  CG    . TYR A 1 501 ? -21.146 -48.629 -38.212 1.00 37.80  ? 501 TYR A CG    1 
ATOM   4097 C  CD1   . TYR A 1 501 ? -21.556 -47.371 -37.786 1.00 38.39  ? 501 TYR A CD1   1 
ATOM   4098 C  CD2   . TYR A 1 501 ? -21.595 -49.082 -39.448 1.00 36.44  ? 501 TYR A CD2   1 
ATOM   4099 C  CE1   . TYR A 1 501 ? -22.390 -46.591 -38.565 1.00 44.77  ? 501 TYR A CE1   1 
ATOM   4100 C  CE2   . TYR A 1 501 ? -22.430 -48.310 -40.233 1.00 32.23  ? 501 TYR A CE2   1 
ATOM   4101 C  CZ    . TYR A 1 501 ? -22.824 -47.065 -39.786 1.00 44.65  ? 501 TYR A CZ    1 
ATOM   4102 O  OH    . TYR A 1 501 ? -23.655 -46.288 -40.560 1.00 31.28  ? 501 TYR A OH    1 
ATOM   4103 N  N     . ALA A 1 502 ? -22.311 -51.687 -37.523 1.00 34.47  ? 502 ALA A N     1 
ATOM   4104 C  CA    . ALA A 1 502 ? -23.570 -52.267 -37.975 1.00 34.11  ? 502 ALA A CA    1 
ATOM   4105 C  C     . ALA A 1 502 ? -24.280 -53.012 -36.854 1.00 30.67  ? 502 ALA A C     1 
ATOM   4106 O  O     . ALA A 1 502 ? -25.516 -53.044 -36.819 1.00 32.35  ? 502 ALA A O     1 
ATOM   4107 C  CB    . ALA A 1 502 ? -23.321 -53.198 -39.160 1.00 40.85  ? 502 ALA A CB    1 
ATOM   4108 N  N     . LEU A 1 503 ? -23.522 -53.611 -35.932 1.00 35.03  ? 503 LEU A N     1 
ATOM   4109 C  CA    . LEU A 1 503 ? -24.129 -54.324 -34.813 1.00 31.11  ? 503 LEU A CA    1 
ATOM   4110 C  C     . LEU A 1 503 ? -24.902 -53.371 -33.909 1.00 40.87  ? 503 LEU A C     1 
ATOM   4111 O  O     . LEU A 1 503 ? -26.042 -53.650 -33.522 1.00 39.11  ? 503 LEU A O     1 
ATOM   4112 C  CB    . LEU A 1 503 ? -23.051 -55.061 -34.018 1.00 41.84  ? 503 LEU A CB    1 
ATOM   4113 C  CG    . LEU A 1 503 ? -23.508 -55.776 -32.746 1.00 45.30  ? 503 LEU A CG    1 
ATOM   4114 C  CD1   . LEU A 1 503 ? -24.396 -56.963 -33.080 1.00 49.28  ? 503 LEU A CD1   1 
ATOM   4115 C  CD2   . LEU A 1 503 ? -22.309 -56.212 -31.917 1.00 54.50  ? 503 LEU A CD2   1 
ATOM   4116 N  N     . GLY A 1 504 ? -24.291 -52.236 -33.561 1.00 35.79  ? 504 GLY A N     1 
ATOM   4117 C  CA    . GLY A 1 504 ? -24.951 -51.289 -32.680 1.00 40.14  ? 504 GLY A CA    1 
ATOM   4118 C  C     . GLY A 1 504 ? -26.213 -50.696 -33.272 1.00 31.92  ? 504 GLY A C     1 
ATOM   4119 O  O     . GLY A 1 504 ? -27.174 -50.422 -32.547 1.00 46.15  ? 504 GLY A O     1 
ATOM   4120 N  N     . ILE A 1 505 ? -26.233 -50.489 -34.589 1.00 31.13  ? 505 ILE A N     1 
ATOM   4121 C  CA    . ILE A 1 505 ? -27.421 -49.943 -35.239 1.00 31.69  ? 505 ILE A CA    1 
ATOM   4122 C  C     . ILE A 1 505 ? -28.570 -50.942 -35.174 1.00 32.52  ? 505 ILE A C     1 
ATOM   4123 O  O     . ILE A 1 505 ? -29.697 -50.596 -34.803 1.00 38.19  ? 505 ILE A O     1 
ATOM   4124 C  CB    . ILE A 1 505 ? -27.099 -49.545 -36.691 1.00 39.87  ? 505 ILE A CB    1 
ATOM   4125 C  CG1   . ILE A 1 505 ? -26.200 -48.307 -36.720 1.00 32.60  ? 505 ILE A CG1   1 
ATOM   4126 C  CG2   . ILE A 1 505 ? -28.380 -49.305 -37.480 1.00 28.89  ? 505 ILE A CG2   1 
ATOM   4127 C  CD1   . ILE A 1 505 ? -25.815 -47.863 -38.115 1.00 37.45  ? 505 ILE A CD1   1 
ATOM   4128 N  N     . ILE A 1 506 ? -28.297 -52.200 -35.524 1.00 33.14  ? 506 ILE A N     1 
ATOM   4129 C  CA    . ILE A 1 506 ? -29.359 -53.199 -35.590 1.00 29.97  ? 506 ILE A CA    1 
ATOM   4130 C  C     . ILE A 1 506 ? -29.825 -53.600 -34.194 1.00 31.53  ? 506 ILE A C     1 
ATOM   4131 O  O     . ILE A 1 506 ? -31.013 -53.876 -33.985 1.00 35.14  ? 506 ILE A O     1 
ATOM   4132 C  CB    . ILE A 1 506 ? -28.880 -54.410 -36.413 1.00 31.44  ? 506 ILE A CB    1 
ATOM   4133 C  CG1   . ILE A 1 506 ? -28.610 -53.984 -37.859 1.00 28.69  ? 506 ILE A CG1   1 
ATOM   4134 C  CG2   . ILE A 1 506 ? -29.899 -55.539 -36.372 1.00 28.47  ? 506 ILE A CG2   1 
ATOM   4135 C  CD1   . ILE A 1 506 ? -28.168 -55.111 -38.763 1.00 29.43  ? 506 ILE A CD1   1 
ATOM   4136 N  N     . GLN A 1 507 ? -28.917 -53.622 -33.213 1.00 32.88  ? 507 GLN A N     1 
ATOM   4137 C  CA    . GLN A 1 507 ? -29.302 -54.002 -31.857 1.00 36.34  ? 507 GLN A CA    1 
ATOM   4138 C  C     . GLN A 1 507 ? -30.283 -53.019 -31.230 1.00 42.76  ? 507 GLN A C     1 
ATOM   4139 O  O     . GLN A 1 507 ? -31.028 -53.402 -30.321 1.00 43.40  ? 507 GLN A O     1 
ATOM   4140 C  CB    . GLN A 1 507 ? -28.067 -54.129 -30.963 1.00 39.89  ? 507 GLN A CB    1 
ATOM   4141 C  CG    . GLN A 1 507 ? -27.297 -55.427 -31.129 1.00 53.94  ? 507 GLN A CG    1 
ATOM   4142 C  CD    . GLN A 1 507 ? -26.441 -55.747 -29.917 1.00 76.68  ? 507 GLN A CD    1 
ATOM   4143 O  OE1   . GLN A 1 507 ? -25.379 -56.359 -30.033 1.00 79.35  ? 507 GLN A OE1   1 
ATOM   4144 N  NE2   . GLN A 1 507 ? -26.906 -55.337 -28.743 1.00 78.47  ? 507 GLN A NE2   1 
ATOM   4145 N  N     . ALA A 1 508 ? -30.303 -51.768 -31.687 1.00 35.52  ? 508 ALA A N     1 
ATOM   4146 C  CA    . ALA A 1 508 ? -31.227 -50.774 -31.155 1.00 40.04  ? 508 ALA A CA    1 
ATOM   4147 C  C     . ALA A 1 508 ? -32.642 -50.929 -31.697 1.00 40.30  ? 508 ALA A C     1 
ATOM   4148 O  O     . ALA A 1 508 ? -33.529 -50.170 -31.287 1.00 45.79  ? 508 ALA A O     1 
ATOM   4149 C  CB    . ALA A 1 508 ? -30.710 -49.364 -31.452 1.00 41.57  ? 508 ALA A CB    1 
ATOM   4150 N  N     . GLN A 1 509 ? -32.866 -51.879 -32.600 1.00 39.31  ? 509 GLN A N     1 
ATOM   4151 C  CA    . GLN A 1 509 ? -34.181 -52.165 -33.162 1.00 38.69  ? 509 GLN A CA    1 
ATOM   4152 C  C     . GLN A 1 509 ? -34.862 -50.934 -33.769 1.00 30.05  ? 509 GLN A C     1 
ATOM   4153 O  O     . GLN A 1 509 ? -35.973 -50.577 -33.371 1.00 37.72  ? 509 GLN A O     1 
ATOM   4154 C  CB    . GLN A 1 509 ? -35.077 -52.802 -32.109 1.00 28.24  ? 509 GLN A CB    1 
ATOM   4155 C  CG    . GLN A 1 509 ? -34.448 -53.973 -31.375 1.00 43.32  ? 509 GLN A CG    1 
ATOM   4156 C  CD    . GLN A 1 509 ? -35.256 -54.396 -30.165 1.00 43.44  ? 509 GLN A CD    1 
ATOM   4157 O  OE1   . GLN A 1 509 ? -36.356 -54.934 -30.295 1.00 45.21  ? 509 GLN A OE1   1 
ATOM   4158 N  NE2   . GLN A 1 509 ? -34.719 -54.142 -28.978 1.00 41.22  ? 509 GLN A NE2   1 
ATOM   4159 N  N     . PRO A 1 510 ? -34.231 -50.276 -34.742 1.00 33.42  ? 510 PRO A N     1 
ATOM   4160 C  CA    . PRO A 1 510 ? -34.882 -49.130 -35.377 1.00 34.09  ? 510 PRO A CA    1 
ATOM   4161 C  C     . PRO A 1 510 ? -35.955 -49.568 -36.361 1.00 34.77  ? 510 PRO A C     1 
ATOM   4162 O  O     . PRO A 1 510 ? -35.855 -50.612 -37.009 1.00 37.24  ? 510 PRO A O     1 
ATOM   4163 C  CB    . PRO A 1 510 ? -33.726 -48.429 -36.100 1.00 33.76  ? 510 PRO A CB    1 
ATOM   4164 C  CG    . PRO A 1 510 ? -32.811 -49.542 -36.458 1.00 27.96  ? 510 PRO A CG    1 
ATOM   4165 C  CD    . PRO A 1 510 ? -32.901 -50.534 -35.326 1.00 26.17  ? 510 PRO A CD    1 
ATOM   4166 N  N     . ASP A 1 511 ? -37.003 -48.749 -36.457 1.00 36.63  ? 511 ASP A N     1 
ATOM   4167 C  CA    . ASP A 1 511 ? -38.036 -48.940 -37.465 1.00 35.98  ? 511 ASP A CA    1 
ATOM   4168 C  C     . ASP A 1 511 ? -38.033 -47.856 -38.532 1.00 35.36  ? 511 ASP A C     1 
ATOM   4169 O  O     . ASP A 1 511 ? -38.772 -47.975 -39.515 1.00 40.68  ? 511 ASP A O     1 
ATOM   4170 C  CB    . ASP A 1 511 ? -39.428 -49.015 -36.812 1.00 41.27  ? 511 ASP A CB    1 
ATOM   4171 C  CG    . ASP A 1 511 ? -39.730 -47.825 -35.913 1.00 41.26  ? 511 ASP A CG    1 
ATOM   4172 O  OD1   . ASP A 1 511 ? -39.348 -46.686 -36.255 1.00 39.11  ? 511 ASP A OD1   1 
ATOM   4173 O  OD2   . ASP A 1 511 ? -40.366 -48.032 -34.857 1.00 45.87  ? 511 ASP A OD2   1 
ATOM   4174 N  N     . GLN A 1 512 ? -37.229 -46.808 -38.361 1.00 40.57  ? 512 GLN A N     1 
ATOM   4175 C  CA    . GLN A 1 512 ? -37.123 -45.727 -39.328 1.00 38.83  ? 512 GLN A CA    1 
ATOM   4176 C  C     . GLN A 1 512 ? -35.685 -45.233 -39.341 1.00 35.51  ? 512 GLN A C     1 
ATOM   4177 O  O     . GLN A 1 512 ? -34.967 -45.346 -38.344 1.00 35.30  ? 512 GLN A O     1 
ATOM   4178 C  CB    . GLN A 1 512 ? -38.087 -44.581 -38.998 1.00 32.33  ? 512 GLN A CB    1 
ATOM   4179 C  CG    . GLN A 1 512 ? -37.992 -44.089 -37.564 1.00 42.95  ? 512 GLN A CG    1 
ATOM   4180 C  CD    . GLN A 1 512 ? -39.131 -43.162 -37.188 1.00 55.62  ? 512 GLN A CD    1 
ATOM   4181 O  OE1   . GLN A 1 512 ? -39.360 -42.143 -37.840 1.00 53.94  ? 512 GLN A OE1   1 
ATOM   4182 N  NE2   . GLN A 1 512 ? -39.859 -43.516 -36.132 1.00 49.04  ? 512 GLN A NE2   1 
ATOM   4183 N  N     . SER A 1 513 ? -35.270 -44.683 -40.480 1.00 32.20  ? 513 SER A N     1 
ATOM   4184 C  CA    . SER A 1 513 ? -33.884 -44.272 -40.644 1.00 37.36  ? 513 SER A CA    1 
ATOM   4185 C  C     . SER A 1 513 ? -33.773 -43.280 -41.791 1.00 38.29  ? 513 SER A C     1 
ATOM   4186 O  O     . SER A 1 513 ? -34.585 -43.288 -42.719 1.00 33.00  ? 513 SER A O     1 
ATOM   4187 C  CB    . SER A 1 513 ? -32.975 -45.478 -40.901 1.00 34.45  ? 513 SER A CB    1 
ATOM   4188 O  OG    . SER A 1 513 ? -31.673 -45.066 -41.276 1.00 33.29  ? 513 SER A OG    1 
ATOM   4189 N  N     . GLU A 1 514 ? -32.751 -42.425 -41.710 1.00 35.98  ? 514 GLU A N     1 
ATOM   4190 C  CA    . GLU A 1 514 ? -32.424 -41.545 -42.824 1.00 45.54  ? 514 GLU A CA    1 
ATOM   4191 C  C     . GLU A 1 514 ? -31.753 -42.299 -43.963 1.00 38.57  ? 514 GLU A C     1 
ATOM   4192 O  O     . GLU A 1 514 ? -31.812 -41.848 -45.111 1.00 37.45  ? 514 GLU A O     1 
ATOM   4193 C  CB    . GLU A 1 514 ? -31.515 -40.408 -42.352 1.00 37.97  ? 514 GLU A CB    1 
ATOM   4194 C  CG    . GLU A 1 514 ? -31.999 -39.693 -41.102 1.00 50.83  ? 514 GLU A CG    1 
ATOM   4195 C  CD    . GLU A 1 514 ? -31.029 -38.626 -40.631 1.00 58.98  ? 514 GLU A CD    1 
ATOM   4196 O  OE1   . GLU A 1 514 ? -31.478 -37.645 -40.000 1.00 72.19  ? 514 GLU A OE1   1 
ATOM   4197 O  OE2   . GLU A 1 514 ? -29.816 -38.766 -40.897 1.00 53.43  ? 514 GLU A OE2   1 
ATOM   4198 N  N     . SER A 1 515 ? -31.122 -43.433 -43.669 1.00 34.75  ? 515 SER A N     1 
ATOM   4199 C  CA    . SER A 1 515 ? -30.434 -44.232 -44.673 1.00 38.06  ? 515 SER A CA    1 
ATOM   4200 C  C     . SER A 1 515 ? -31.424 -45.194 -45.320 1.00 41.82  ? 515 SER A C     1 
ATOM   4201 O  O     . SER A 1 515 ? -32.068 -45.989 -44.628 1.00 40.51  ? 515 SER A O     1 
ATOM   4202 C  CB    . SER A 1 515 ? -29.272 -44.999 -44.044 1.00 33.66  ? 515 SER A CB    1 
ATOM   4203 O  OG    . SER A 1 515 ? -28.775 -45.989 -44.928 1.00 43.00  ? 515 SER A OG    1 
ATOM   4204 N  N     . GLU A 1 516 ? -31.543 -45.117 -46.648 1.00 37.62  ? 516 GLU A N     1 
ATOM   4205 C  CA    . GLU A 1 516 ? -32.425 -46.034 -47.361 1.00 43.86  ? 516 GLU A CA    1 
ATOM   4206 C  C     . GLU A 1 516 ? -31.938 -47.474 -47.251 1.00 42.49  ? 516 GLU A C     1 
ATOM   4207 O  O     . GLU A 1 516 ? -32.756 -48.400 -47.206 1.00 37.13  ? 516 GLU A O     1 
ATOM   4208 C  CB    . GLU A 1 516 ? -32.542 -45.614 -48.826 1.00 44.56  ? 516 GLU A CB    1 
ATOM   4209 C  CG    . GLU A 1 516 ? -33.595 -46.380 -49.613 1.00 69.56  ? 516 GLU A CG    1 
ATOM   4210 C  CD    . GLU A 1 516 ? -34.950 -46.383 -48.925 1.00 74.85  ? 516 GLU A CD    1 
ATOM   4211 O  OE1   . GLU A 1 516 ? -35.553 -47.471 -48.802 1.00 72.11  ? 516 GLU A OE1   1 
ATOM   4212 O  OE2   . GLU A 1 516 ? -35.406 -45.301 -48.497 1.00 70.71  ? 516 GLU A OE2   1 
ATOM   4213 N  N     . LEU A 1 517 ? -30.619 -47.680 -47.203 1.00 34.05  ? 517 LEU A N     1 
ATOM   4214 C  CA    . LEU A 1 517 ? -30.087 -49.024 -47.004 1.00 30.89  ? 517 LEU A CA    1 
ATOM   4215 C  C     . LEU A 1 517 ? -30.537 -49.601 -45.668 1.00 32.99  ? 517 LEU A C     1 
ATOM   4216 O  O     . LEU A 1 517 ? -30.924 -50.773 -45.589 1.00 29.35  ? 517 LEU A O     1 
ATOM   4217 C  CB    . LEU A 1 517 ? -28.560 -49.003 -47.090 1.00 28.47  ? 517 LEU A CB    1 
ATOM   4218 C  CG    . LEU A 1 517 ? -27.829 -50.301 -46.733 1.00 34.86  ? 517 LEU A CG    1 
ATOM   4219 C  CD1   . LEU A 1 517 ? -28.293 -51.452 -47.614 1.00 38.09  ? 517 LEU A CD1   1 
ATOM   4220 C  CD2   . LEU A 1 517 ? -26.326 -50.113 -46.846 1.00 38.49  ? 517 LEU A CD2   1 
ATOM   4221 N  N     . VAL A 1 518 ? -30.491 -48.793 -44.606 1.00 30.94  ? 518 VAL A N     1 
ATOM   4222 C  CA    . VAL A 1 518 ? -30.939 -49.264 -43.298 1.00 34.29  ? 518 VAL A CA    1 
ATOM   4223 C  C     . VAL A 1 518 ? -32.434 -49.556 -43.324 1.00 36.97  ? 518 VAL A C     1 
ATOM   4224 O  O     . VAL A 1 518 ? -32.902 -50.530 -42.721 1.00 40.21  ? 518 VAL A O     1 
ATOM   4225 C  CB    . VAL A 1 518 ? -30.574 -48.242 -42.204 1.00 32.76  ? 518 VAL A CB    1 
ATOM   4226 C  CG1   . VAL A 1 518 ? -31.147 -48.667 -40.860 1.00 28.66  ? 518 VAL A CG1   1 
ATOM   4227 C  CG2   . VAL A 1 518 ? -29.064 -48.085 -42.109 1.00 29.15  ? 518 VAL A CG2   1 
ATOM   4228 N  N     . ASN A 1 519 ? -33.206 -48.726 -44.031 1.00 40.25  ? 519 ASN A N     1 
ATOM   4229 C  CA    . ASN A 1 519 ? -34.638 -48.978 -44.162 1.00 39.33  ? 519 ASN A CA    1 
ATOM   4230 C  C     . ASN A 1 519 ? -34.903 -50.301 -44.870 1.00 30.93  ? 519 ASN A C     1 
ATOM   4231 O  O     . ASN A 1 519 ? -35.816 -51.045 -44.491 1.00 37.39  ? 519 ASN A O     1 
ATOM   4232 C  CB    . ASN A 1 519 ? -35.313 -47.827 -44.909 1.00 28.44  ? 519 ASN A CB    1 
ATOM   4233 C  CG    . ASN A 1 519 ? -35.623 -46.649 -44.007 1.00 42.85  ? 519 ASN A CG    1 
ATOM   4234 O  OD1   . ASN A 1 519 ? -35.981 -46.822 -42.841 1.00 36.44  ? 519 ASN A OD1   1 
ATOM   4235 N  ND2   . ASN A 1 519 ? -35.488 -45.441 -44.542 1.00 36.80  ? 519 ASN A ND2   1 
ATOM   4236 N  N     . GLN A 1 520 ? -34.115 -50.611 -45.903 1.00 32.06  ? 520 GLN A N     1 
ATOM   4237 C  CA    . GLN A 1 520 ? -34.251 -51.898 -46.576 1.00 33.90  ? 520 GLN A CA    1 
ATOM   4238 C  C     . GLN A 1 520 ? -33.925 -53.047 -45.631 1.00 29.16  ? 520 GLN A C     1 
ATOM   4239 O  O     . GLN A 1 520 ? -34.573 -54.099 -45.672 1.00 38.27  ? 520 GLN A O     1 
ATOM   4240 C  CB    . GLN A 1 520 ? -33.346 -51.944 -47.808 1.00 32.12  ? 520 GLN A CB    1 
ATOM   4241 C  CG    . GLN A 1 520 ? -33.734 -50.971 -48.908 1.00 48.25  ? 520 GLN A CG    1 
ATOM   4242 C  CD    . GLN A 1 520 ? -32.699 -50.906 -50.014 1.00 57.91  ? 520 GLN A CD    1 
ATOM   4243 O  OE1   . GLN A 1 520 ? -31.542 -51.281 -49.818 1.00 48.03  ? 520 GLN A OE1   1 
ATOM   4244 N  NE2   . GLN A 1 520 ? -33.111 -50.433 -51.185 1.00 60.92  ? 520 GLN A NE2   1 
ATOM   4245 N  N     . ILE A 1 521 ? -32.922 -52.863 -44.770 1.00 28.91  ? 521 ILE A N     1 
ATOM   4246 C  CA    . ILE A 1 521 ? -32.583 -53.884 -43.784 1.00 26.14  ? 521 ILE A CA    1 
ATOM   4247 C  C     . ILE A 1 521 ? -33.716 -54.054 -42.780 1.00 32.30  ? 521 ILE A C     1 
ATOM   4248 O  O     . ILE A 1 521 ? -34.062 -55.180 -42.399 1.00 32.82  ? 521 ILE A O     1 
ATOM   4249 C  CB    . ILE A 1 521 ? -31.256 -53.530 -43.088 1.00 23.80  ? 521 ILE A CB    1 
ATOM   4250 C  CG1   . ILE A 1 521 ? -30.094 -53.628 -44.077 1.00 21.60  ? 521 ILE A CG1   1 
ATOM   4251 C  CG2   . ILE A 1 521 ? -31.020 -54.425 -41.880 1.00 25.40  ? 521 ILE A CG2   1 
ATOM   4252 C  CD1   . ILE A 1 521 ? -28.744 -53.316 -43.468 1.00 27.94  ? 521 ILE A CD1   1 
ATOM   4253 N  N     . ILE A 1 522 ? -34.313 -52.944 -42.339 1.00 28.90  ? 522 ILE A N     1 
ATOM   4254 C  CA    . ILE A 1 522 ? -35.410 -53.012 -41.376 1.00 33.26  ? 522 ILE A CA    1 
ATOM   4255 C  C     . ILE A 1 522 ? -36.578 -53.803 -41.950 1.00 32.86  ? 522 ILE A C     1 
ATOM   4256 O  O     . ILE A 1 522 ? -37.163 -54.655 -41.269 1.00 34.43  ? 522 ILE A O     1 
ATOM   4257 C  CB    . ILE A 1 522 ? -35.839 -51.594 -40.956 1.00 36.16  ? 522 ILE A CB    1 
ATOM   4258 C  CG1   . ILE A 1 522 ? -34.733 -50.921 -40.141 1.00 33.18  ? 522 ILE A CG1   1 
ATOM   4259 C  CG2   . ILE A 1 522 ? -37.142 -51.638 -40.171 1.00 29.41  ? 522 ILE A CG2   1 
ATOM   4260 C  CD1   . ILE A 1 522 ? -34.981 -49.453 -39.872 1.00 36.30  ? 522 ILE A CD1   1 
ATOM   4261 N  N     . GLU A 1 523 ? -36.933 -53.541 -43.211 1.00 31.33  ? 523 GLU A N     1 
ATOM   4262 C  CA    . GLU A 1 523 ? -38.026 -54.275 -43.840 1.00 32.12  ? 523 GLU A CA    1 
ATOM   4263 C  C     . GLU A 1 523 ? -37.730 -55.767 -43.914 1.00 41.53  ? 523 GLU A C     1 
ATOM   4264 O  O     . GLU A 1 523 ? -38.648 -56.588 -43.804 1.00 35.99  ? 523 GLU A O     1 
ATOM   4265 C  CB    . GLU A 1 523 ? -38.299 -53.707 -45.235 1.00 35.89  ? 523 GLU A CB    1 
ATOM   4266 C  CG    . GLU A 1 523 ? -39.382 -54.437 -46.015 1.00 61.30  ? 523 GLU A CG    1 
ATOM   4267 C  CD    . GLU A 1 523 ? -39.883 -53.635 -47.199 1.00 71.44  ? 523 GLU A CD    1 
ATOM   4268 O  OE1   . GLU A 1 523 ? -40.595 -52.633 -46.977 1.00 82.07  ? 523 GLU A OE1   1 
ATOM   4269 O  OE2   . GLU A 1 523 ? -39.556 -53.998 -48.348 1.00 72.49  ? 523 GLU A OE2   1 
ATOM   4270 N  N     . GLN A 1 524 ? -36.460 -56.138 -44.088 1.00 37.37  ? 524 GLN A N     1 
ATOM   4271 C  CA    . GLN A 1 524 ? -36.098 -57.552 -44.075 1.00 35.92  ? 524 GLN A CA    1 
ATOM   4272 C  C     . GLN A 1 524 ? -36.227 -58.141 -42.676 1.00 30.24  ? 524 GLN A C     1 
ATOM   4273 O  O     . GLN A 1 524 ? -36.735 -59.256 -42.511 1.00 40.67  ? 524 GLN A O     1 
ATOM   4274 C  CB    . GLN A 1 524 ? -34.675 -57.734 -44.603 1.00 30.53  ? 524 GLN A CB    1 
ATOM   4275 C  CG    . GLN A 1 524 ? -34.509 -57.393 -46.074 1.00 33.46  ? 524 GLN A CG    1 
ATOM   4276 C  CD    . GLN A 1 524 ? -35.261 -58.348 -46.980 1.00 45.94  ? 524 GLN A CD    1 
ATOM   4277 O  OE1   . GLN A 1 524 ? -35.344 -59.545 -46.706 1.00 37.19  ? 524 GLN A OE1   1 
ATOM   4278 N  NE2   . GLN A 1 524 ? -35.818 -57.820 -48.064 1.00 47.55  ? 524 GLN A NE2   1 
ATOM   4279 N  N     . LEU A 1 525 ? -35.777 -57.403 -41.657 1.00 32.15  ? 525 LEU A N     1 
ATOM   4280 C  CA    . LEU A 1 525 ? -35.823 -57.912 -40.289 1.00 31.83  ? 525 LEU A CA    1 
ATOM   4281 C  C     . LEU A 1 525 ? -37.257 -58.131 -39.822 1.00 31.28  ? 525 LEU A C     1 
ATOM   4282 O  O     . LEU A 1 525 ? -37.537 -59.077 -39.077 1.00 39.22  ? 525 LEU A O     1 
ATOM   4283 C  CB    . LEU A 1 525 ? -35.095 -56.952 -39.349 1.00 25.34  ? 525 LEU A CB    1 
ATOM   4284 C  CG    . LEU A 1 525 ? -33.580 -56.829 -39.525 1.00 41.36  ? 525 LEU A CG    1 
ATOM   4285 C  CD1   . LEU A 1 525 ? -33.045 -55.653 -38.726 1.00 29.55  ? 525 LEU A CD1   1 
ATOM   4286 C  CD2   . LEU A 1 525 ? -32.886 -58.119 -39.114 1.00 32.24  ? 525 LEU A CD2   1 
ATOM   4287 N  N     . ILE A 1 526 ? -38.178 -57.263 -40.244 1.00 35.76  ? 526 ILE A N     1 
ATOM   4288 C  CA    . ILE A 1 526 ? -39.574 -57.410 -39.842 1.00 38.25  ? 526 ILE A CA    1 
ATOM   4289 C  C     . ILE A 1 526 ? -40.169 -58.683 -40.432 1.00 38.84  ? 526 ILE A C     1 
ATOM   4290 O  O     . ILE A 1 526 ? -40.958 -59.377 -39.779 1.00 36.31  ? 526 ILE A O     1 
ATOM   4291 C  CB    . ILE A 1 526 ? -40.378 -56.160 -40.249 1.00 38.73  ? 526 ILE A CB    1 
ATOM   4292 C  CG1   . ILE A 1 526 ? -39.838 -54.922 -39.528 1.00 38.02  ? 526 ILE A CG1   1 
ATOM   4293 C  CG2   . ILE A 1 526 ? -41.859 -56.347 -39.950 1.00 36.72  ? 526 ILE A CG2   1 
ATOM   4294 C  CD1   . ILE A 1 526 ? -40.476 -53.622 -39.974 1.00 30.46  ? 526 ILE A CD1   1 
ATOM   4295 N  N     . LYS A 1 527 ? -39.790 -59.022 -41.667 1.00 34.99  ? 527 LYS A N     1 
ATOM   4296 C  CA    . LYS A 1 527 ? -40.348 -60.200 -42.322 1.00 42.34  ? 527 LYS A CA    1 
ATOM   4297 C  C     . LYS A 1 527 ? -39.799 -61.504 -41.756 1.00 37.34  ? 527 LYS A C     1 
ATOM   4298 O  O     . LYS A 1 527 ? -40.450 -62.545 -41.896 1.00 42.91  ? 527 LYS A O     1 
ATOM   4299 C  CB    . LYS A 1 527 ? -40.089 -60.136 -43.829 1.00 32.07  ? 527 LYS A CB    1 
ATOM   4300 C  CG    . LYS A 1 527 ? -40.815 -59.001 -44.530 1.00 51.97  ? 527 LYS A CG    1 
ATOM   4301 C  CD    . LYS A 1 527 ? -40.520 -58.983 -46.021 1.00 58.58  ? 527 LYS A CD    1 
ATOM   4302 C  CE    . LYS A 1 527 ? -41.218 -57.814 -46.700 1.00 66.66  ? 527 LYS A CE    1 
ATOM   4303 N  NZ    . LYS A 1 527 ? -40.908 -57.743 -48.154 1.00 71.76  ? 527 LYS A NZ    1 
ATOM   4304 N  N     . LYS A 1 528 ? -38.627 -61.477 -41.128 1.00 34.80  ? 528 LYS A N     1 
ATOM   4305 C  CA    . LYS A 1 528 ? -38.062 -62.689 -40.558 1.00 32.80  ? 528 LYS A CA    1 
ATOM   4306 C  C     . LYS A 1 528 ? -38.814 -63.091 -39.293 1.00 31.38  ? 528 LYS A C     1 
ATOM   4307 O  O     . LYS A 1 528 ? -39.452 -62.272 -38.625 1.00 37.20  ? 528 LYS A O     1 
ATOM   4308 C  CB    . LYS A 1 528 ? -36.581 -62.495 -40.231 1.00 28.12  ? 528 LYS A CB    1 
ATOM   4309 C  CG    . LYS A 1 528 ? -35.705 -62.133 -41.418 1.00 25.37  ? 528 LYS A CG    1 
ATOM   4310 C  CD    . LYS A 1 528 ? -35.538 -63.304 -42.372 1.00 24.69  ? 528 LYS A CD    1 
ATOM   4311 C  CE    . LYS A 1 528 ? -34.532 -62.973 -43.462 1.00 30.17  ? 528 LYS A CE    1 
ATOM   4312 N  NZ    . LYS A 1 528 ? -34.351 -64.093 -44.422 1.00 32.04  ? 528 LYS A NZ    1 
ATOM   4313 N  N     . GLU A 1 529 ? -38.732 -64.379 -38.965 1.00 32.36  ? 529 GLU A N     1 
ATOM   4314 C  CA    . GLU A 1 529 ? -39.292 -64.893 -37.723 1.00 35.78  ? 529 GLU A CA    1 
ATOM   4315 C  C     . GLU A 1 529 ? -38.264 -64.998 -36.608 1.00 38.71  ? 529 GLU A C     1 
ATOM   4316 O  O     . GLU A 1 529 ? -38.613 -64.804 -35.438 1.00 39.46  ? 529 GLU A O     1 
ATOM   4317 C  CB    . GLU A 1 529 ? -39.928 -66.268 -37.954 1.00 43.57  ? 529 GLU A CB    1 
ATOM   4318 C  CG    . GLU A 1 529 ? -41.182 -66.229 -38.811 1.00 46.42  ? 529 GLU A CG    1 
ATOM   4319 C  CD    . GLU A 1 529 ? -41.804 -67.597 -39.000 1.00 56.35  ? 529 GLU A CD    1 
ATOM   4320 O  OE1   . GLU A 1 529 ? -42.581 -67.767 -39.964 1.00 57.00  ? 529 GLU A OE1   1 
ATOM   4321 O  OE2   . GLU A 1 529 ? -41.514 -68.500 -38.187 1.00 67.03  ? 529 GLU A OE2   1 
ATOM   4322 N  N     . LYS A 1 530 ? -37.010 -65.298 -36.941 1.00 31.16  ? 530 LYS A N     1 
ATOM   4323 C  CA    . LYS A 1 530 ? -35.936 -65.358 -35.959 1.00 39.28  ? 530 LYS A CA    1 
ATOM   4324 C  C     . LYS A 1 530 ? -34.650 -64.864 -36.603 1.00 38.55  ? 530 LYS A C     1 
ATOM   4325 O  O     . LYS A 1 530 ? -34.284 -65.323 -37.689 1.00 37.20  ? 530 LYS A O     1 
ATOM   4326 C  CB    . LYS A 1 530 ? -35.741 -66.780 -35.423 1.00 35.03  ? 530 LYS A CB    1 
ATOM   4327 C  CG    . LYS A 1 530 ? -36.774 -67.226 -34.411 1.00 34.36  ? 530 LYS A CG    1 
ATOM   4328 C  CD    . LYS A 1 530 ? -36.310 -68.482 -33.697 1.00 37.88  ? 530 LYS A CD    1 
ATOM   4329 C  CE    . LYS A 1 530 ? -37.357 -68.977 -32.721 1.00 34.96  ? 530 LYS A CE    1 
ATOM   4330 N  NZ    . LYS A 1 530 ? -38.617 -69.353 -33.420 1.00 61.85  ? 530 LYS A NZ    1 
ATOM   4331 N  N     . VAL A 1 531 ? -33.973 -63.933 -35.936 1.00 39.63  ? 531 VAL A N     1 
ATOM   4332 C  CA    . VAL A 1 531 ? -32.674 -63.434 -36.371 1.00 31.90  ? 531 VAL A CA    1 
ATOM   4333 C  C     . VAL A 1 531 ? -31.749 -63.396 -35.164 1.00 30.86  ? 531 VAL A C     1 
ATOM   4334 O  O     . VAL A 1 531 ? -32.105 -62.837 -34.121 1.00 37.75  ? 531 VAL A O     1 
ATOM   4335 C  CB    . VAL A 1 531 ? -32.772 -62.039 -37.018 1.00 34.91  ? 531 VAL A CB    1 
ATOM   4336 C  CG1   . VAL A 1 531 ? -31.381 -61.480 -37.284 1.00 26.90  ? 531 VAL A CG1   1 
ATOM   4337 C  CG2   . VAL A 1 531 ? -33.569 -62.101 -38.307 1.00 42.90  ? 531 VAL A CG2   1 
ATOM   4338 N  N     . TYR A 1 532 ? -30.571 -63.998 -35.303 1.00 31.14  ? 532 TYR A N     1 
ATOM   4339 C  CA    . TYR A 1 532 ? -29.521 -63.922 -34.296 1.00 33.63  ? 532 TYR A CA    1 
ATOM   4340 C  C     . TYR A 1 532 ? -28.312 -63.245 -34.920 1.00 35.26  ? 532 TYR A C     1 
ATOM   4341 O  O     . TYR A 1 532 ? -27.816 -63.689 -35.961 1.00 31.87  ? 532 TYR A O     1 
ATOM   4342 C  CB    . TYR A 1 532 ? -29.150 -65.308 -33.765 1.00 37.47  ? 532 TYR A CB    1 
ATOM   4343 C  CG    . TYR A 1 532 ? -28.031 -65.278 -32.751 1.00 29.61  ? 532 TYR A CG    1 
ATOM   4344 C  CD1   . TYR A 1 532 ? -28.256 -64.833 -31.454 1.00 29.48  ? 532 TYR A CD1   1 
ATOM   4345 C  CD2   . TYR A 1 532 ? -26.750 -65.691 -33.089 1.00 29.87  ? 532 TYR A CD2   1 
ATOM   4346 C  CE1   . TYR A 1 532 ? -27.235 -64.800 -30.522 1.00 34.23  ? 532 TYR A CE1   1 
ATOM   4347 C  CE2   . TYR A 1 532 ? -25.723 -65.662 -32.165 1.00 35.23  ? 532 TYR A CE2   1 
ATOM   4348 C  CZ    . TYR A 1 532 ? -25.971 -65.215 -30.884 1.00 31.90  ? 532 TYR A CZ    1 
ATOM   4349 O  OH    . TYR A 1 532 ? -24.951 -65.185 -29.962 1.00 29.53  ? 532 TYR A OH    1 
ATOM   4350 N  N     . LEU A 1 533 ? -27.846 -62.169 -34.291 1.00 33.65  ? 533 LEU A N     1 
ATOM   4351 C  CA    . LEU A 1 533 ? -26.707 -61.401 -34.773 1.00 35.84  ? 533 LEU A CA    1 
ATOM   4352 C  C     . LEU A 1 533 ? -25.594 -61.488 -33.740 1.00 38.43  ? 533 LEU A C     1 
ATOM   4353 O  O     . LEU A 1 533 ? -25.793 -61.124 -32.577 1.00 40.47  ? 533 LEU A O     1 
ATOM   4354 C  CB    . LEU A 1 533 ? -27.100 -59.945 -35.034 1.00 32.21  ? 533 LEU A CB    1 
ATOM   4355 C  CG    . LEU A 1 533 ? -26.070 -59.052 -35.728 1.00 37.28  ? 533 LEU A CG    1 
ATOM   4356 C  CD1   . LEU A 1 533 ? -25.657 -59.652 -37.064 1.00 34.37  ? 533 LEU A CD1   1 
ATOM   4357 C  CD2   . LEU A 1 533 ? -26.629 -57.653 -35.921 1.00 43.26  ? 533 LEU A CD2   1 
ATOM   4358 N  N     . ALA A 1 534 ? -24.432 -61.980 -34.163 1.00 35.64  ? 534 ALA A N     1 
ATOM   4359 C  CA    . ALA A 1 534 ? -23.275 -62.126 -33.296 1.00 33.38  ? 534 ALA A CA    1 
ATOM   4360 C  C     . ALA A 1 534 ? -22.092 -61.367 -33.882 1.00 25.87  ? 534 ALA A C     1 
ATOM   4361 O  O     . ALA A 1 534 ? -22.052 -61.059 -35.077 1.00 32.47  ? 534 ALA A O     1 
ATOM   4362 C  CB    . ALA A 1 534 ? -22.909 -63.603 -33.096 1.00 33.51  ? 534 ALA A CB    1 
ATOM   4363 N  N     . TRP A 1 535 ? -21.119 -61.074 -33.024 1.00 32.37  ? 535 TRP A N     1 
ATOM   4364 C  CA    . TRP A 1 535 ? -19.956 -60.284 -33.396 1.00 34.82  ? 535 TRP A CA    1 
ATOM   4365 C  C     . TRP A 1 535 ? -18.677 -61.059 -33.109 1.00 33.51  ? 535 TRP A C     1 
ATOM   4366 O  O     . TRP A 1 535 ? -18.584 -61.774 -32.106 1.00 37.91  ? 535 TRP A O     1 
ATOM   4367 C  CB    . TRP A 1 535 ? -19.937 -58.948 -32.644 1.00 34.32  ? 535 TRP A CB    1 
ATOM   4368 C  CG    . TRP A 1 535 ? -18.777 -58.073 -33.009 1.00 36.56  ? 535 TRP A CG    1 
ATOM   4369 C  CD1   . TRP A 1 535 ? -18.722 -57.165 -34.026 1.00 40.45  ? 535 TRP A CD1   1 
ATOM   4370 C  CD2   . TRP A 1 535 ? -17.503 -58.021 -32.356 1.00 30.14  ? 535 TRP A CD2   1 
ATOM   4371 N  NE1   . TRP A 1 535 ? -17.492 -56.552 -34.048 1.00 34.66  ? 535 TRP A NE1   1 
ATOM   4372 C  CE2   . TRP A 1 535 ? -16.725 -57.060 -33.033 1.00 37.67  ? 535 TRP A CE2   1 
ATOM   4373 C  CE3   . TRP A 1 535 ? -16.944 -58.695 -31.266 1.00 36.79  ? 535 TRP A CE3   1 
ATOM   4374 C  CZ2   . TRP A 1 535 ? -15.417 -56.757 -32.655 1.00 33.01  ? 535 TRP A CZ2   1 
ATOM   4375 C  CZ3   . TRP A 1 535 ? -15.647 -58.393 -30.893 1.00 40.14  ? 535 TRP A CZ3   1 
ATOM   4376 C  CH2   . TRP A 1 535 ? -14.898 -57.432 -31.585 1.00 36.63  ? 535 TRP A CH2   1 
ATOM   4377 N  N     . VAL A 1 536 ? -17.699 -60.915 -33.998 1.00 27.08  ? 536 VAL A N     1 
ATOM   4378 C  CA    . VAL A 1 536 ? -16.371 -61.497 -33.818 1.00 38.75  ? 536 VAL A CA    1 
ATOM   4379 C  C     . VAL A 1 536 ? -15.333 -60.433 -34.157 1.00 32.94  ? 536 VAL A C     1 
ATOM   4380 O  O     . VAL A 1 536 ? -15.605 -59.546 -34.978 1.00 34.99  ? 536 VAL A O     1 
ATOM   4381 C  CB    . VAL A 1 536 ? -16.179 -62.756 -34.682 1.00 38.22  ? 536 VAL A CB    1 
ATOM   4382 C  CG1   . VAL A 1 536 ? -17.089 -63.880 -34.208 1.00 39.18  ? 536 VAL A CG1   1 
ATOM   4383 C  CG2   . VAL A 1 536 ? -16.427 -62.440 -36.151 1.00 36.00  ? 536 VAL A CG2   1 
ATOM   4384 N  N     . PRO A 1 537 ? -14.148 -60.466 -33.550 1.00 38.84  ? 537 PRO A N     1 
ATOM   4385 C  CA    . PRO A 1 537 ? -13.114 -59.493 -33.916 1.00 37.09  ? 537 PRO A CA    1 
ATOM   4386 C  C     . PRO A 1 537 ? -12.578 -59.760 -35.313 1.00 35.59  ? 537 PRO A C     1 
ATOM   4387 O  O     . PRO A 1 537 ? -12.333 -60.906 -35.698 1.00 41.97  ? 537 PRO A O     1 
ATOM   4388 C  CB    . PRO A 1 537 ? -12.033 -59.702 -32.849 1.00 40.05  ? 537 PRO A CB    1 
ATOM   4389 C  CG    . PRO A 1 537 ? -12.231 -61.108 -32.391 1.00 34.15  ? 537 PRO A CG    1 
ATOM   4390 C  CD    . PRO A 1 537 ? -13.712 -61.352 -32.456 1.00 35.07  ? 537 PRO A CD    1 
ATOM   4391 N  N     . ALA A 1 538 ? -12.401 -58.684 -36.074 1.00 38.60  ? 538 ALA A N     1 
ATOM   4392 C  CA    . ALA A 1 538 ? -11.948 -58.797 -37.451 1.00 41.12  ? 538 ALA A CA    1 
ATOM   4393 C  C     . ALA A 1 538 ? -10.454 -59.092 -37.512 1.00 47.07  ? 538 ALA A C     1 
ATOM   4394 O  O     . ALA A 1 538 ? -9.692  -58.752 -36.602 1.00 52.72  ? 538 ALA A O     1 
ATOM   4395 C  CB    . ALA A 1 538 ? -12.254 -57.513 -38.224 1.00 42.68  ? 538 ALA A CB    1 
ATOM   4396 N  N     . HIS A 1 539 ? -10.047 -59.748 -38.601 1.00 48.84  ? 539 HIS A N     1 
ATOM   4397 C  CA    . HIS A 1 539 ? -8.636  -60.007 -38.900 1.00 48.43  ? 539 HIS A CA    1 
ATOM   4398 C  C     . HIS A 1 539 ? -7.959  -60.809 -37.788 1.00 45.73  ? 539 HIS A C     1 
ATOM   4399 O  O     . HIS A 1 539 ? -6.836  -60.508 -37.376 1.00 51.89  ? 539 HIS A O     1 
ATOM   4400 C  CB    . HIS A 1 539 ? -7.883  -58.701 -39.164 1.00 49.09  ? 539 HIS A CB    1 
ATOM   4401 C  CG    . HIS A 1 539 ? -8.602  -57.764 -40.086 1.00 50.22  ? 539 HIS A CG    1 
ATOM   4402 N  ND1   . HIS A 1 539 ? -8.794  -58.038 -41.423 1.00 51.93  ? 539 HIS A ND1   1 
ATOM   4403 C  CD2   . HIS A 1 539 ? -9.172  -56.556 -39.864 1.00 56.12  ? 539 HIS A CD2   1 
ATOM   4404 C  CE1   . HIS A 1 539 ? -9.454  -57.040 -41.984 1.00 61.12  ? 539 HIS A CE1   1 
ATOM   4405 N  NE2   . HIS A 1 539 ? -9.695  -56.128 -41.060 1.00 51.26  ? 539 HIS A NE2   1 
ATOM   4406 N  N     . LYS A 1 540 ? -8.644  -61.844 -37.299 1.00 49.83  ? 540 LYS A N     1 
ATOM   4407 C  CA    . LYS A 1 540 ? -8.115  -62.702 -36.245 1.00 40.02  ? 540 LYS A CA    1 
ATOM   4408 C  C     . LYS A 1 540 ? -8.127  -64.173 -36.645 1.00 46.62  ? 540 LYS A C     1 
ATOM   4409 O  O     . LYS A 1 540 ? -7.966  -65.049 -35.789 1.00 47.94  ? 540 LYS A O     1 
ATOM   4410 C  CB    . LYS A 1 540 ? -8.892  -62.497 -34.943 1.00 47.02  ? 540 LYS A CB    1 
ATOM   4411 C  CG    . LYS A 1 540 ? -8.743  -61.104 -34.346 1.00 46.10  ? 540 LYS A CG    1 
ATOM   4412 C  CD    . LYS A 1 540 ? -7.283  -60.767 -34.079 1.00 55.85  ? 540 LYS A CD    1 
ATOM   4413 C  CE    . LYS A 1 540 ? -7.133  -59.357 -33.535 1.00 59.25  ? 540 LYS A CE    1 
ATOM   4414 N  NZ    . LYS A 1 540 ? -5.707  -59.011 -33.293 1.00 67.98  ? 540 LYS A NZ    1 
ATOM   4415 N  N     . GLY A 1 541 ? -8.315  -64.462 -37.929 1.00 45.40  ? 541 GLY A N     1 
ATOM   4416 C  CA    . GLY A 1 541 ? -8.299  -65.828 -38.403 1.00 48.71  ? 541 GLY A CA    1 
ATOM   4417 C  C     . GLY A 1 541 ? -9.474  -66.671 -37.970 1.00 52.76  ? 541 GLY A C     1 
ATOM   4418 O  O     . GLY A 1 541 ? -9.433  -67.893 -38.140 1.00 58.64  ? 541 GLY A O     1 
ATOM   4419 N  N     . ILE A 1 542 ? -10.518 -66.064 -37.415 1.00 48.34  ? 542 ILE A N     1 
ATOM   4420 C  CA    . ILE A 1 542 ? -11.698 -66.807 -36.986 1.00 46.86  ? 542 ILE A CA    1 
ATOM   4421 C  C     . ILE A 1 542 ? -12.517 -67.188 -38.212 1.00 51.11  ? 542 ILE A C     1 
ATOM   4422 O  O     . ILE A 1 542 ? -12.790 -66.350 -39.079 1.00 48.44  ? 542 ILE A O     1 
ATOM   4423 C  CB    . ILE A 1 542 ? -12.533 -65.979 -35.996 1.00 46.78  ? 542 ILE A CB    1 
ATOM   4424 C  CG1   . ILE A 1 542 ? -11.699 -65.616 -34.766 1.00 38.93  ? 542 ILE A CG1   1 
ATOM   4425 C  CG2   . ILE A 1 542 ? -13.792 -66.735 -35.592 1.00 48.44  ? 542 ILE A CG2   1 
ATOM   4426 C  CD1   . ILE A 1 542 ? -12.421 -64.719 -33.788 1.00 47.46  ? 542 ILE A CD1   1 
ATOM   4427 N  N     . GLY A 1 543 ? -12.908 -68.456 -38.289 1.00 51.50  ? 543 GLY A N     1 
ATOM   4428 C  CA    . GLY A 1 543 ? -13.761 -68.922 -39.369 1.00 44.30  ? 543 GLY A CA    1 
ATOM   4429 C  C     . GLY A 1 543 ? -15.225 -68.930 -38.971 1.00 47.66  ? 543 GLY A C     1 
ATOM   4430 O  O     . GLY A 1 543 ? -15.550 -69.121 -37.798 1.00 63.94  ? 543 GLY A O     1 
ATOM   4431 N  N     . GLY A 1 544 ? -16.114 -68.717 -39.937 1.00 53.07  ? 544 GLY A N     1 
ATOM   4432 C  CA    . GLY A 1 544 ? -15.729 -68.483 -41.316 1.00 41.35  ? 544 GLY A CA    1 
ATOM   4433 C  C     . GLY A 1 544 ? -15.614 -67.012 -41.668 1.00 38.57  ? 544 GLY A C     1 
ATOM   4434 O  O     . GLY A 1 544 ? -15.771 -66.628 -42.827 1.00 39.26  ? 544 GLY A O     1 
ATOM   4435 N  N     . ASN A 1 545 ? -15.347 -66.183 -40.656 1.00 38.86  ? 545 ASN A N     1 
ATOM   4436 C  CA    . ASN A 1 545 ? -15.079 -64.772 -40.913 1.00 37.88  ? 545 ASN A CA    1 
ATOM   4437 C  C     . ASN A 1 545 ? -13.826 -64.595 -41.759 1.00 38.89  ? 545 ASN A C     1 
ATOM   4438 O  O     . ASN A 1 545 ? -13.747 -63.664 -42.568 1.00 38.48  ? 545 ASN A O     1 
ATOM   4439 C  CB    . ASN A 1 545 ? -14.947 -64.012 -39.591 1.00 37.65  ? 545 ASN A CB    1 
ATOM   4440 C  CG    . ASN A 1 545 ? -14.451 -62.589 -39.780 1.00 42.43  ? 545 ASN A CG    1 
ATOM   4441 O  OD1   . ASN A 1 545 ? -13.252 -62.319 -39.696 1.00 33.80  ? 545 ASN A OD1   1 
ATOM   4442 N  ND2   . ASN A 1 545 ? -15.374 -61.672 -40.039 1.00 36.55  ? 545 ASN A ND2   1 
ATOM   4443 N  N     . GLU A 1 546 ? -12.842 -65.481 -41.590 1.00 37.81  ? 546 GLU A N     1 
ATOM   4444 C  CA    . GLU A 1 546 ? -11.639 -65.426 -42.413 1.00 49.08  ? 546 GLU A CA    1 
ATOM   4445 C  C     . GLU A 1 546 ? -11.954 -65.719 -43.875 1.00 47.66  ? 546 GLU A C     1 
ATOM   4446 O  O     . GLU A 1 546 ? -11.372 -65.104 -44.777 1.00 50.20  ? 546 GLU A O     1 
ATOM   4447 C  CB    . GLU A 1 546 ? -10.599 -66.411 -41.879 1.00 49.82  ? 546 GLU A CB    1 
ATOM   4448 C  CG    . GLU A 1 546 ? -9.436  -66.672 -42.824 1.00 61.16  ? 546 GLU A CG    1 
ATOM   4449 C  CD    . GLU A 1 546 ? -8.457  -67.693 -42.281 1.00 72.45  ? 546 GLU A CD    1 
ATOM   4450 O  OE1   . GLU A 1 546 ? -7.235  -67.491 -42.444 1.00 68.16  ? 546 GLU A OE1   1 
ATOM   4451 O  OE2   . GLU A 1 546 ? -8.908  -68.694 -41.686 1.00 68.39  ? 546 GLU A OE2   1 
ATOM   4452 N  N     . GLN A 1 547 ? -12.879 -66.647 -44.130 1.00 36.04  ? 547 GLN A N     1 
ATOM   4453 C  CA    . GLN A 1 547 ? -13.209 -67.006 -45.506 1.00 44.73  ? 547 GLN A CA    1 
ATOM   4454 C  C     . GLN A 1 547 ? -13.886 -65.850 -46.233 1.00 43.94  ? 547 GLN A C     1 
ATOM   4455 O  O     . GLN A 1 547 ? -13.528 -65.526 -47.371 1.00 46.16  ? 547 GLN A O     1 
ATOM   4456 C  CB    . GLN A 1 547 ? -14.096 -68.253 -45.528 1.00 41.71  ? 547 GLN A CB    1 
ATOM   4457 C  CG    . GLN A 1 547 ? -13.333 -69.565 -45.420 1.00 49.18  ? 547 GLN A CG    1 
ATOM   4458 C  CD    . GLN A 1 547 ? -12.601 -69.714 -44.102 1.00 47.29  ? 547 GLN A CD    1 
ATOM   4459 O  OE1   . GLN A 1 547 ? -13.217 -69.759 -43.037 1.00 57.56  ? 547 GLN A OE1   1 
ATOM   4460 N  NE2   . GLN A 1 547 ? -11.277 -69.784 -44.166 1.00 50.34  ? 547 GLN A NE2   1 
ATOM   4461 N  N     . VAL A 1 548 ? -14.869 -65.214 -45.591 1.00 34.82  ? 548 VAL A N     1 
ATOM   4462 C  CA    . VAL A 1 548 ? -15.579 -64.121 -46.247 1.00 41.75  ? 548 VAL A CA    1 
ATOM   4463 C  C     . VAL A 1 548 ? -14.696 -62.882 -46.348 1.00 37.30  ? 548 VAL A C     1 
ATOM   4464 O  O     . VAL A 1 548 ? -14.793 -62.123 -47.321 1.00 33.59  ? 548 VAL A O     1 
ATOM   4465 C  CB    . VAL A 1 548 ? -16.905 -63.827 -45.517 1.00 35.67  ? 548 VAL A CB    1 
ATOM   4466 C  CG1   . VAL A 1 548 ? -16.653 -63.395 -44.081 1.00 34.50  ? 548 VAL A CG1   1 
ATOM   4467 C  CG2   . VAL A 1 548 ? -17.708 -62.776 -46.271 1.00 33.53  ? 548 VAL A CG2   1 
ATOM   4468 N  N     . ASP A 1 549 ? -13.815 -62.661 -45.367 1.00 43.18  ? 549 ASP A N     1 
ATOM   4469 C  CA    . ASP A 1 549 ? -12.899 -61.526 -45.440 1.00 46.33  ? 549 ASP A CA    1 
ATOM   4470 C  C     . ASP A 1 549 ? -11.964 -61.653 -46.633 1.00 42.59  ? 549 ASP A C     1 
ATOM   4471 O  O     . ASP A 1 549 ? -11.738 -60.680 -47.361 1.00 45.35  ? 549 ASP A O     1 
ATOM   4472 C  CB    . ASP A 1 549 ? -12.096 -61.408 -44.144 1.00 39.64  ? 549 ASP A CB    1 
ATOM   4473 C  CG    . ASP A 1 549 ? -10.973 -60.394 -44.248 1.00 49.05  ? 549 ASP A CG    1 
ATOM   4474 O  OD1   . ASP A 1 549 ? -9.823  -60.800 -44.516 1.00 60.68  ? 549 ASP A OD1   1 
ATOM   4475 O  OD2   . ASP A 1 549 ? -11.242 -59.188 -44.071 1.00 57.38  ? 549 ASP A OD2   1 
ATOM   4476 N  N     . LYS A 1 550 ? -11.410 -62.849 -46.851 1.00 41.70  ? 550 LYS A N     1 
ATOM   4477 C  CA    . LYS A 1 550 ? -10.585 -63.096 -48.027 1.00 47.41  ? 550 LYS A CA    1 
ATOM   4478 C  C     . LYS A 1 550 ? -11.372 -62.956 -49.323 1.00 49.48  ? 550 LYS A C     1 
ATOM   4479 O  O     . LYS A 1 550 ? -10.775 -62.668 -50.367 1.00 51.69  ? 550 LYS A O     1 
ATOM   4480 C  CB    . LYS A 1 550 ? -9.965  -64.492 -47.943 1.00 49.73  ? 550 LYS A CB    1 
ATOM   4481 C  CG    . LYS A 1 550 ? -8.608  -64.616 -48.613 1.00 57.53  ? 550 LYS A CG    1 
ATOM   4482 C  CD    . LYS A 1 550 ? -8.085  -66.040 -48.534 1.00 81.28  ? 550 LYS A CD    1 
ATOM   4483 C  CE    . LYS A 1 550 ? -8.180  -66.590 -47.117 1.00 82.76  ? 550 LYS A CE    1 
ATOM   4484 N  NZ    . LYS A 1 550 ? -7.395  -65.782 -46.141 1.00 79.29  ? 550 LYS A NZ    1 
ATOM   4485 N  N     . LEU A 1 551 ? -12.692 -63.157 -49.279 1.00 44.27  ? 551 LEU A N     1 
ATOM   4486 C  CA    . LEU A 1 551 ? -13.516 -63.065 -50.479 1.00 41.62  ? 551 LEU A CA    1 
ATOM   4487 C  C     . LEU A 1 551 ? -13.760 -61.615 -50.882 1.00 49.69  ? 551 LEU A C     1 
ATOM   4488 O  O     . LEU A 1 551 ? -13.621 -61.260 -52.057 1.00 48.40  ? 551 LEU A O     1 
ATOM   4489 C  CB    . LEU A 1 551 ? -14.846 -63.787 -50.249 1.00 45.94  ? 551 LEU A CB    1 
ATOM   4490 C  CG    . LEU A 1 551 ? -15.340 -64.740 -51.342 1.00 53.35  ? 551 LEU A CG    1 
ATOM   4491 C  CD1   . LEU A 1 551 ? -14.306 -65.823 -51.614 1.00 44.66  ? 551 LEU A CD1   1 
ATOM   4492 C  CD2   . LEU A 1 551 ? -16.672 -65.358 -50.945 1.00 49.13  ? 551 LEU A CD2   1 
ATOM   4493 N  N     . VAL A 1 552 ? -14.135 -60.763 -49.921 1.00 42.95  ? 552 VAL A N     1 
ATOM   4494 C  CA    . VAL A 1 552 ? -14.477 -59.376 -50.230 1.00 45.56  ? 552 VAL A CA    1 
ATOM   4495 C  C     . VAL A 1 552 ? -13.267 -58.454 -50.277 1.00 43.66  ? 552 VAL A C     1 
ATOM   4496 O  O     . VAL A 1 552 ? -13.383 -57.329 -50.786 1.00 43.08  ? 552 VAL A O     1 
ATOM   4497 C  CB    . VAL A 1 552 ? -15.496 -58.817 -49.216 1.00 37.87  ? 552 VAL A CB    1 
ATOM   4498 C  CG1   . VAL A 1 552 ? -16.759 -59.666 -49.208 1.00 31.52  ? 552 VAL A CG1   1 
ATOM   4499 C  CG2   . VAL A 1 552 ? -14.883 -58.743 -47.826 1.00 32.81  ? 552 VAL A CG2   1 
ATOM   4500 N  N     . SER A 1 553 ? -12.112 -58.885 -49.765 1.00 43.26  ? 553 SER A N     1 
ATOM   4501 C  CA    . SER A 1 553 ? -10.917 -58.050 -49.820 1.00 52.23  ? 553 SER A CA    1 
ATOM   4502 C  C     . SER A 1 553 ? -10.178 -58.169 -51.145 1.00 53.28  ? 553 SER A C     1 
ATOM   4503 O  O     . SER A 1 553 ? -9.407  -57.267 -51.491 1.00 53.79  ? 553 SER A O     1 
ATOM   4504 C  CB    . SER A 1 553 ? -9.963  -58.405 -48.677 1.00 48.65  ? 553 SER A CB    1 
ATOM   4505 O  OG    . SER A 1 553 ? -10.557 -58.149 -47.416 1.00 67.96  ? 553 SER A OG    1 
ATOM   4506 N  N     . ALA A 1 554 ? -10.393 -59.252 -51.888 1.00 45.29  ? 554 ALA A N     1 
ATOM   4507 C  CA    . ALA A 1 554 ? -9.681  -59.466 -53.140 1.00 49.56  ? 554 ALA A CA    1 
ATOM   4508 C  C     . ALA A 1 554 ? -10.051 -58.394 -54.155 1.00 50.19  ? 554 ALA A C     1 
ATOM   4509 O  O     . ALA A 1 554 ? -11.230 -58.200 -54.468 1.00 48.72  ? 554 ALA A O     1 
ATOM   4510 C  CB    . ALA A 1 554 ? -9.998  -60.855 -53.691 1.00 34.75  ? 554 ALA A CB    1 
ATOM   4511 N  N     . GLY A 1 555 ? -9.039  -57.693 -54.665 1.00 55.54  ? 555 GLY A N     1 
ATOM   4512 C  CA    . GLY A 1 555 ? -9.234  -56.689 -55.686 1.00 47.96  ? 555 GLY A CA    1 
ATOM   4513 C  C     . GLY A 1 555 ? -9.495  -55.287 -55.180 1.00 58.27  ? 555 GLY A C     1 
ATOM   4514 O  O     . GLY A 1 555 ? -9.564  -54.358 -55.995 1.00 62.92  ? 555 GLY A O     1 
ATOM   4515 N  N     . ILE A 1 556 ? -9.647  -55.098 -53.870 1.00 55.28  ? 556 ILE A N     1 
ATOM   4516 C  CA    . ILE A 1 556 ? -9.896  -53.769 -53.321 1.00 60.73  ? 556 ILE A CA    1 
ATOM   4517 C  C     . ILE A 1 556 ? -8.942  -53.498 -52.164 1.00 62.04  ? 556 ILE A C     1 
ATOM   4518 O  O     . ILE A 1 556 ? -8.826  -52.360 -51.696 1.00 63.58  ? 556 ILE A O     1 
ATOM   4519 C  CB    . ILE A 1 556 ? -11.366 -53.610 -52.883 1.00 65.21  ? 556 ILE A CB    1 
ATOM   4520 C  CG1   . ILE A 1 556 ? -11.719 -54.613 -51.784 1.00 59.08  ? 556 ILE A CG1   1 
ATOM   4521 C  CG2   . ILE A 1 556 ? -12.307 -53.761 -54.072 1.00 59.63  ? 556 ILE A CG2   1 
ATOM   4522 C  CD1   . ILE A 1 556 ? -11.696 -54.016 -50.399 1.00 66.79  ? 556 ILE A CD1   1 
ATOM   4523 N  N     . ARG A 1 557 ? -8.259  -54.539 -51.689 1.00 61.94  ? 557 ARG A N     1 
ATOM   4524 C  CA    . ARG A 1 557 ? -7.273  -54.402 -50.628 1.00 66.26  ? 557 ARG A CA    1 
ATOM   4525 C  C     . ARG A 1 557 ? -6.020  -55.192 -50.980 1.00 77.28  ? 557 ARG A C     1 
ATOM   4526 O  O     . ARG A 1 557 ? -6.034  -56.068 -51.849 1.00 76.87  ? 557 ARG A O     1 
ATOM   4527 C  CB    . ARG A 1 557 ? -7.823  -54.864 -49.268 1.00 66.43  ? 557 ARG A CB    1 
ATOM   4528 C  CG    . ARG A 1 557 ? -8.562  -53.772 -48.508 1.00 74.01  ? 557 ARG A CG    1 
ATOM   4529 C  CD    . ARG A 1 557 ? -8.590  -54.032 -47.006 1.00 74.78  ? 557 ARG A CD    1 
ATOM   4530 N  NE    . ARG A 1 557 ? -9.678  -54.920 -46.607 1.00 84.15  ? 557 ARG A NE    1 
ATOM   4531 C  CZ    . ARG A 1 557 ? -10.035 -55.139 -45.346 1.00 81.21  ? 557 ARG A CZ    1 
ATOM   4532 N  NH1   . ARG A 1 557 ? -9.389  -54.534 -44.358 1.00 75.54  ? 557 ARG A NH1   1 
ATOM   4533 N  NH2   . ARG A 1 557 ? -11.038 -55.962 -45.070 1.00 73.37  ? 557 ARG A NH2   1 
ATOM   4534 N  N     . LYS A 1 558 ? -4.933  -54.862 -50.285 1.00 85.20  ? 558 LYS A N     1 
ATOM   4535 C  CA    . LYS A 1 558 ? -3.618  -55.459 -50.515 1.00 84.64  ? 558 LYS A CA    1 
ATOM   4536 C  C     . LYS A 1 558 ? -3.185  -55.316 -51.971 1.00 86.09  ? 558 LYS A C     1 
ATOM   4537 O  O     . LYS A 1 558 ? -2.443  -56.148 -52.493 1.00 85.29  ? 558 LYS A O     1 
ATOM   4538 C  CB    . LYS A 1 558 ? -3.606  -56.937 -50.111 1.00 76.07  ? 558 LYS A CB    1 
ATOM   4539 C  CG    . LYS A 1 558 ? -3.894  -57.194 -48.639 1.00 70.54  ? 558 LYS A CG    1 
ATOM   4540 C  CD    . LYS A 1 558 ? -5.357  -57.539 -48.411 1.00 78.45  ? 558 LYS A CD    1 
ATOM   4541 C  CE    . LYS A 1 558 ? -5.617  -57.914 -46.962 1.00 81.80  ? 558 LYS A CE    1 
ATOM   4542 N  NZ    . LYS A 1 558 ? -7.022  -58.363 -46.751 1.00 64.63  ? 558 LYS A NZ    1 
ATOM   4543 N  N     . PRO B 2 4   ? -15.068 -7.142  9.112   1.00 75.19  ? 4   PRO B N     1 
ATOM   4544 C  CA    . PRO B 2 4   ? -14.222 -7.517  10.249  1.00 88.95  ? 4   PRO B CA    1 
ATOM   4545 C  C     . PRO B 2 4   ? -13.016 -8.354  9.833   1.00 97.65  ? 4   PRO B C     1 
ATOM   4546 O  O     . PRO B 2 4   ? -11.878 -7.904  9.967   1.00 93.64  ? 4   PRO B O     1 
ATOM   4547 C  CB    . PRO B 2 4   ? -15.169 -8.330  11.136  1.00 75.87  ? 4   PRO B CB    1 
ATOM   4548 N  N     . ILE B 2 5   ? -13.270 -9.559  9.333   1.00 102.93 ? 5   ILE B N     1 
ATOM   4549 C  CA    . ILE B 2 5   ? -12.200 -10.460 8.920   1.00 88.53  ? 5   ILE B CA    1 
ATOM   4550 C  C     . ILE B 2 5   ? -11.635 -9.995  7.585   1.00 92.09  ? 5   ILE B C     1 
ATOM   4551 O  O     . ILE B 2 5   ? -12.375 -9.562  6.693   1.00 82.12  ? 5   ILE B O     1 
ATOM   4552 C  CB    . ILE B 2 5   ? -12.717 -11.907 8.839   1.00 89.81  ? 5   ILE B CB    1 
ATOM   4553 C  CG1   . ILE B 2 5   ? -13.513 -12.259 10.097  1.00 90.35  ? 5   ILE B CG1   1 
ATOM   4554 C  CG2   . ILE B 2 5   ? -11.561 -12.879 8.663   1.00 76.03  ? 5   ILE B CG2   1 
ATOM   4555 C  CD1   . ILE B 2 5   ? -14.085 -13.660 10.086  1.00 68.07  ? 5   ILE B CD1   1 
ATOM   4556 N  N     . GLU B 2 6   ? -10.314 -10.080 7.446   1.00 90.87  ? 6   GLU B N     1 
ATOM   4557 C  CA    . GLU B 2 6   ? -9.657  -9.651  6.220   1.00 90.05  ? 6   GLU B CA    1 
ATOM   4558 C  C     . GLU B 2 6   ? -9.922  -10.642 5.093   1.00 88.42  ? 6   GLU B C     1 
ATOM   4559 O  O     . GLU B 2 6   ? -9.861  -11.859 5.286   1.00 83.01  ? 6   GLU B O     1 
ATOM   4560 C  CB    . GLU B 2 6   ? -8.153  -9.503  6.453   1.00 97.27  ? 6   GLU B CB    1 
ATOM   4561 C  CG    . GLU B 2 6   ? -7.362  -9.047  5.237   1.00 94.06  ? 6   GLU B CG    1 
ATOM   4562 C  CD    . GLU B 2 6   ? -7.871  -7.738  4.664   1.00 108.55 ? 6   GLU B CD    1 
ATOM   4563 O  OE1   . GLU B 2 6   ? -8.334  -7.736  3.504   1.00 103.80 ? 6   GLU B OE1   1 
ATOM   4564 O  OE2   . GLU B 2 6   ? -7.816  -6.714  5.377   1.00 115.71 ? 6   GLU B OE2   1 
ATOM   4565 N  N     . THR B 2 7   ? -10.215 -10.113 3.910   1.00 88.47  ? 7   THR B N     1 
ATOM   4566 C  CA    . THR B 2 7   ? -10.513 -10.937 2.750   1.00 79.78  ? 7   THR B CA    1 
ATOM   4567 C  C     . THR B 2 7   ? -9.237  -11.268 1.980   1.00 81.70  ? 7   THR B C     1 
ATOM   4568 O  O     . THR B 2 7   ? -8.224  -10.570 2.070   1.00 84.68  ? 7   THR B O     1 
ATOM   4569 C  CB    . THR B 2 7   ? -11.513 -10.235 1.830   1.00 74.03  ? 7   THR B CB    1 
ATOM   4570 O  OG1   . THR B 2 7   ? -11.859 -11.105 0.746   1.00 79.51  ? 7   THR B OG1   1 
ATOM   4571 C  CG2   . THR B 2 7   ? -10.918 -8.949  1.271   1.00 79.23  ? 7   THR B CG2   1 
ATOM   4572 N  N     . VAL B 2 8   ? -9.302  -12.349 1.218   1.00 77.87  ? 8   VAL B N     1 
ATOM   4573 C  CA    . VAL B 2 8   ? -8.176  -12.850 0.432   1.00 82.14  ? 8   VAL B CA    1 
ATOM   4574 C  C     . VAL B 2 8   ? -8.503  -12.657 -1.042  1.00 71.55  ? 8   VAL B C     1 
ATOM   4575 O  O     . VAL B 2 8   ? -9.560  -13.113 -1.493  1.00 64.55  ? 8   VAL B O     1 
ATOM   4576 C  CB    . VAL B 2 8   ? -7.884  -14.333 0.733   1.00 70.47  ? 8   VAL B CB    1 
ATOM   4577 C  CG1   . VAL B 2 8   ? -6.749  -14.840 -0.144  1.00 64.88  ? 8   VAL B CG1   1 
ATOM   4578 C  CG2   . VAL B 2 8   ? -7.552  -14.519 2.206   1.00 77.56  ? 8   VAL B CG2   1 
ATOM   4579 N  N     . PRO B 2 9   ? -7.642  -11.999 -1.818  1.00 72.79  ? 9   PRO B N     1 
ATOM   4580 C  CA    . PRO B 2 9   ? -7.938  -11.796 -3.243  1.00 70.92  ? 9   PRO B CA    1 
ATOM   4581 C  C     . PRO B 2 9   ? -7.915  -13.113 -4.005  1.00 66.54  ? 9   PRO B C     1 
ATOM   4582 O  O     . PRO B 2 9   ? -6.961  -13.889 -3.909  1.00 70.85  ? 9   PRO B O     1 
ATOM   4583 C  CB    . PRO B 2 9   ? -6.821  -10.853 -3.707  1.00 63.42  ? 9   PRO B CB    1 
ATOM   4584 C  CG    . PRO B 2 9   ? -5.705  -11.090 -2.741  1.00 65.17  ? 9   PRO B CG    1 
ATOM   4585 C  CD    . PRO B 2 9   ? -6.364  -11.382 -1.422  1.00 68.32  ? 9   PRO B CD    1 
ATOM   4586 N  N     . VAL B 2 10  ? -8.982  -13.362 -4.760  1.00 64.40  ? 10  VAL B N     1 
ATOM   4587 C  CA    . VAL B 2 10  ? -9.116  -14.551 -5.592  1.00 57.08  ? 10  VAL B CA    1 
ATOM   4588 C  C     . VAL B 2 10  ? -9.390  -14.102 -7.020  1.00 56.88  ? 10  VAL B C     1 
ATOM   4589 O  O     . VAL B 2 10  ? -10.173 -13.173 -7.248  1.00 69.88  ? 10  VAL B O     1 
ATOM   4590 C  CB    . VAL B 2 10  ? -10.240 -15.481 -5.086  1.00 61.66  ? 10  VAL B CB    1 
ATOM   4591 C  CG1   . VAL B 2 10  ? -10.213 -16.807 -5.831  1.00 53.78  ? 10  VAL B CG1   1 
ATOM   4592 C  CG2   . VAL B 2 10  ? -10.121 -15.700 -3.585  1.00 61.92  ? 10  VAL B CG2   1 
ATOM   4593 N  N     . LYS B 2 11  ? -8.743  -14.759 -7.979  1.00 53.27  ? 11  LYS B N     1 
ATOM   4594 C  CA    . LYS B 2 11  ? -8.882  -14.418 -9.386  1.00 63.10  ? 11  LYS B CA    1 
ATOM   4595 C  C     . LYS B 2 11  ? -9.141  -15.680 -10.199 1.00 69.68  ? 11  LYS B C     1 
ATOM   4596 O  O     . LYS B 2 11  ? -9.075  -16.802 -9.690  1.00 64.39  ? 11  LYS B O     1 
ATOM   4597 C  CB    . LYS B 2 11  ? -7.636  -13.691 -9.911  1.00 66.75  ? 11  LYS B CB    1 
ATOM   4598 C  CG    . LYS B 2 11  ? -6.339  -14.455 -9.712  1.00 76.91  ? 11  LYS B CG    1 
ATOM   4599 C  CD    . LYS B 2 11  ? -5.147  -13.653 -10.213 1.00 80.15  ? 11  LYS B CD    1 
ATOM   4600 C  CE    . LYS B 2 11  ? -3.839  -14.381 -9.944  1.00 88.05  ? 11  LYS B CE    1 
ATOM   4601 N  NZ    . LYS B 2 11  ? -3.622  -14.605 -8.487  1.00 85.49  ? 11  LYS B NZ    1 
ATOM   4602 N  N     . LEU B 2 12  ? -9.441  -15.479 -11.478 1.00 67.23  ? 12  LEU B N     1 
ATOM   4603 C  CA    . LEU B 2 12  ? -9.699  -16.573 -12.399 1.00 59.39  ? 12  LEU B CA    1 
ATOM   4604 C  C     . LEU B 2 12  ? -8.412  -16.989 -13.106 1.00 66.99  ? 12  LEU B C     1 
ATOM   4605 O  O     . LEU B 2 12  ? -7.366  -16.348 -12.985 1.00 65.57  ? 12  LEU B O     1 
ATOM   4606 C  CB    . LEU B 2 12  ? -10.759 -16.170 -13.426 1.00 57.64  ? 12  LEU B CB    1 
ATOM   4607 C  CG    . LEU B 2 12  ? -12.125 -15.729 -12.899 1.00 60.34  ? 12  LEU B CG    1 
ATOM   4608 C  CD1   . LEU B 2 12  ? -12.997 -15.230 -14.040 1.00 54.87  ? 12  LEU B CD1   1 
ATOM   4609 C  CD2   . LEU B 2 12  ? -12.809 -16.869 -12.161 1.00 53.55  ? 12  LEU B CD2   1 
ATOM   4610 N  N     . LYS B 2 13  ? -8.501  -18.085 -13.855 1.00 59.22  ? 13  LYS B N     1 
ATOM   4611 C  CA    . LYS B 2 13  ? -7.376  -18.521 -14.662 1.00 58.09  ? 13  LYS B CA    1 
ATOM   4612 C  C     . LYS B 2 13  ? -7.160  -17.549 -15.822 1.00 74.90  ? 13  LYS B C     1 
ATOM   4613 O  O     . LYS B 2 13  ? -8.102  -16.895 -16.277 1.00 67.60  ? 13  LYS B O     1 
ATOM   4614 C  CB    . LYS B 2 13  ? -7.612  -19.934 -15.191 1.00 66.29  ? 13  LYS B CB    1 
ATOM   4615 C  CG    . LYS B 2 13  ? -7.665  -20.997 -14.103 1.00 63.93  ? 13  LYS B CG    1 
ATOM   4616 C  CD    . LYS B 2 13  ? -7.791  -22.393 -14.692 1.00 62.42  ? 13  LYS B CD    1 
ATOM   4617 C  CE    . LYS B 2 13  ? -7.771  -23.453 -13.601 1.00 66.76  ? 13  LYS B CE    1 
ATOM   4618 N  NZ    . LYS B 2 13  ? -7.907  -24.828 -14.155 1.00 75.64  ? 13  LYS B NZ    1 
ATOM   4619 N  N     . PRO B 2 14  ? -5.924  -17.423 -16.304 1.00 79.74  ? 14  PRO B N     1 
ATOM   4620 C  CA    . PRO B 2 14  ? -5.646  -16.457 -17.376 1.00 72.47  ? 14  PRO B CA    1 
ATOM   4621 C  C     . PRO B 2 14  ? -6.427  -16.778 -18.643 1.00 69.63  ? 14  PRO B C     1 
ATOM   4622 O  O     . PRO B 2 14  ? -6.421  -17.911 -19.129 1.00 73.69  ? 14  PRO B O     1 
ATOM   4623 C  CB    . PRO B 2 14  ? -4.134  -16.597 -17.594 1.00 75.14  ? 14  PRO B CB    1 
ATOM   4624 C  CG    . PRO B 2 14  ? -3.615  -17.137 -16.304 1.00 59.89  ? 14  PRO B CG    1 
ATOM   4625 C  CD    . PRO B 2 14  ? -4.692  -18.048 -15.792 1.00 79.11  ? 14  PRO B CD    1 
ATOM   4626 N  N     . GLY B 2 15  ? -7.103  -15.763 -19.175 1.00 65.17  ? 15  GLY B N     1 
ATOM   4627 C  CA    . GLY B 2 15  ? -7.843  -15.916 -20.410 1.00 71.11  ? 15  GLY B CA    1 
ATOM   4628 C  C     . GLY B 2 15  ? -9.191  -16.585 -20.279 1.00 68.98  ? 15  GLY B C     1 
ATOM   4629 O  O     . GLY B 2 15  ? -9.752  -17.020 -21.289 1.00 77.31  ? 15  GLY B O     1 
ATOM   4630 N  N     . MET B 2 16  ? -9.732  -16.684 -19.067 1.00 65.14  ? 16  MET B N     1 
ATOM   4631 C  CA    . MET B 2 16  ? -11.028 -17.305 -18.831 1.00 63.65  ? 16  MET B CA    1 
ATOM   4632 C  C     . MET B 2 16  ? -11.974 -16.290 -18.207 1.00 56.41  ? 16  MET B C     1 
ATOM   4633 O  O     . MET B 2 16  ? -11.600 -15.584 -17.264 1.00 50.92  ? 16  MET B O     1 
ATOM   4634 C  CB    . MET B 2 16  ? -10.903 -18.530 -17.922 1.00 58.24  ? 16  MET B CB    1 
ATOM   4635 C  CG    . MET B 2 16  ? -10.169 -19.704 -18.545 1.00 59.18  ? 16  MET B CG    1 
ATOM   4636 S  SD    . MET B 2 16  ? -10.168 -21.152 -17.469 1.00 72.10  ? 16  MET B SD    1 
ATOM   4637 C  CE    . MET B 2 16  ? -9.185  -22.295 -18.435 1.00 77.02  ? 16  MET B CE    1 
ATOM   4638 N  N     . ASP B 2 17  ? -13.193 -16.220 -18.735 1.00 53.75  ? 17  ASP B N     1 
ATOM   4639 C  CA    . ASP B 2 17  ? -14.230 -15.370 -18.178 1.00 44.33  ? 17  ASP B CA    1 
ATOM   4640 C  C     . ASP B 2 17  ? -15.048 -16.167 -17.163 1.00 43.47  ? 17  ASP B C     1 
ATOM   4641 O  O     . ASP B 2 17  ? -14.829 -17.362 -16.952 1.00 42.95  ? 17  ASP B O     1 
ATOM   4642 C  CB    . ASP B 2 17  ? -15.112 -14.807 -19.292 1.00 49.86  ? 17  ASP B CB    1 
ATOM   4643 C  CG    . ASP B 2 17  ? -15.758 -13.488 -18.916 1.00 54.30  ? 17  ASP B CG    1 
ATOM   4644 O  OD1   . ASP B 2 17  ? -15.629 -13.075 -17.744 1.00 44.31  ? 17  ASP B OD1   1 
ATOM   4645 O  OD2   . ASP B 2 17  ? -16.399 -12.867 -19.791 1.00 59.17  ? 17  ASP B OD2   1 
ATOM   4646 N  N     . GLY B 2 18  ? -16.006 -15.502 -16.523 1.00 46.99  ? 18  GLY B N     1 
ATOM   4647 C  CA    . GLY B 2 18  ? -16.850 -16.145 -15.545 1.00 34.89  ? 18  GLY B CA    1 
ATOM   4648 C  C     . GLY B 2 18  ? -17.873 -17.066 -16.179 1.00 34.40  ? 18  GLY B C     1 
ATOM   4649 O  O     . GLY B 2 18  ? -18.022 -17.117 -17.404 1.00 39.61  ? 18  GLY B O     1 
ATOM   4650 N  N     . PRO B 2 19  ? -18.600 -17.814 -15.352 1.00 30.68  ? 19  PRO B N     1 
ATOM   4651 C  CA    . PRO B 2 19  ? -19.606 -18.741 -15.884 1.00 36.20  ? 19  PRO B CA    1 
ATOM   4652 C  C     . PRO B 2 19  ? -20.847 -18.015 -16.381 1.00 41.98  ? 19  PRO B C     1 
ATOM   4653 O  O     . PRO B 2 19  ? -21.276 -17.008 -15.812 1.00 40.41  ? 19  PRO B O     1 
ATOM   4654 C  CB    . PRO B 2 19  ? -19.932 -19.632 -14.680 1.00 38.50  ? 19  PRO B CB    1 
ATOM   4655 C  CG    . PRO B 2 19  ? -19.656 -18.765 -13.496 1.00 39.99  ? 19  PRO B CG    1 
ATOM   4656 C  CD    . PRO B 2 19  ? -18.488 -17.896 -13.885 1.00 39.80  ? 19  PRO B CD    1 
ATOM   4657 N  N     . LYS B 2 20  ? -21.424 -18.546 -17.459 1.00 36.89  ? 20  LYS B N     1 
ATOM   4658 C  CA    . LYS B 2 20  ? -22.650 -18.017 -18.046 1.00 39.04  ? 20  LYS B CA    1 
ATOM   4659 C  C     . LYS B 2 20  ? -23.575 -19.188 -18.392 1.00 38.78  ? 20  LYS B C     1 
ATOM   4660 O  O     . LYS B 2 20  ? -23.907 -19.443 -19.546 1.00 39.94  ? 20  LYS B O     1 
ATOM   4661 C  CB    . LYS B 2 20  ? -22.347 -17.163 -19.277 1.00 40.90  ? 20  LYS B CB    1 
ATOM   4662 C  CG    . LYS B 2 20  ? -21.479 -15.946 -18.999 1.00 35.87  ? 20  LYS B CG    1 
ATOM   4663 C  CD    . LYS B 2 20  ? -21.208 -15.154 -20.268 1.00 36.79  ? 20  LYS B CD    1 
ATOM   4664 C  CE    . LYS B 2 20  ? -20.399 -13.898 -19.970 1.00 38.53  ? 20  LYS B CE    1 
ATOM   4665 N  NZ    . LYS B 2 20  ? -20.194 -13.068 -21.188 1.00 44.77  ? 20  LYS B NZ    1 
ATOM   4666 N  N     . VAL B 2 21  ? -23.996 -19.924 -17.366 1.00 41.59  ? 21  VAL B N     1 
ATOM   4667 C  CA    . VAL B 2 21  ? -24.806 -21.125 -17.533 1.00 40.22  ? 21  VAL B CA    1 
ATOM   4668 C  C     . VAL B 2 21  ? -26.248 -20.799 -17.168 1.00 40.67  ? 21  VAL B C     1 
ATOM   4669 O  O     . VAL B 2 21  ? -26.512 -20.211 -16.111 1.00 30.61  ? 21  VAL B O     1 
ATOM   4670 C  CB    . VAL B 2 21  ? -24.267 -22.283 -16.675 1.00 38.73  ? 21  VAL B CB    1 
ATOM   4671 C  CG1   . VAL B 2 21  ? -24.973 -23.576 -17.033 1.00 31.26  ? 21  VAL B CG1   1 
ATOM   4672 C  CG2   . VAL B 2 21  ? -22.764 -22.423 -16.860 1.00 37.27  ? 21  VAL B CG2   1 
ATOM   4673 N  N     . LYS B 2 22  ? -27.180 -21.184 -18.037 1.00 32.40  ? 22  LYS B N     1 
ATOM   4674 C  CA    . LYS B 2 22  ? -28.578 -20.836 -17.837 1.00 38.69  ? 22  LYS B CA    1 
ATOM   4675 C  C     . LYS B 2 22  ? -29.209 -21.694 -16.746 1.00 38.65  ? 22  LYS B C     1 
ATOM   4676 O  O     . LYS B 2 22  ? -28.787 -22.824 -16.485 1.00 38.45  ? 22  LYS B O     1 
ATOM   4677 C  CB    . LYS B 2 22  ? -29.363 -20.995 -19.140 1.00 34.47  ? 22  LYS B CB    1 
ATOM   4678 C  CG    . LYS B 2 22  ? -28.863 -20.122 -20.279 1.00 41.96  ? 22  LYS B CG    1 
ATOM   4679 C  CD    . LYS B 2 22  ? -30.008 -19.685 -21.178 1.00 49.42  ? 22  LYS B CD    1 
ATOM   4680 C  CE    . LYS B 2 22  ? -30.757 -20.875 -21.756 1.00 64.07  ? 22  LYS B CE    1 
ATOM   4681 N  NZ    . LYS B 2 22  ? -31.910 -20.442 -22.596 1.00 55.84  ? 22  LYS B NZ    1 
ATOM   4682 N  N     . GLN B 2 23  ? -30.236 -21.138 -16.109 1.00 37.25  ? 23  GLN B N     1 
ATOM   4683 C  CA    . GLN B 2 23  ? -30.982 -21.850 -15.082 1.00 37.22  ? 23  GLN B CA    1 
ATOM   4684 C  C     . GLN B 2 23  ? -31.981 -22.807 -15.722 1.00 32.45  ? 23  GLN B C     1 
ATOM   4685 O  O     . GLN B 2 23  ? -32.685 -22.450 -16.671 1.00 33.76  ? 23  GLN B O     1 
ATOM   4686 C  CB    . GLN B 2 23  ? -31.712 -20.858 -14.174 1.00 29.59  ? 23  GLN B CB    1 
ATOM   4687 C  CG    . GLN B 2 23  ? -32.598 -21.503 -13.121 1.00 27.87  ? 23  GLN B CG    1 
ATOM   4688 C  CD    . GLN B 2 23  ? -31.804 -22.231 -12.058 1.00 34.70  ? 23  GLN B CD    1 
ATOM   4689 O  OE1   . GLN B 2 23  ? -30.766 -21.749 -11.604 1.00 35.93  ? 23  GLN B OE1   1 
ATOM   4690 N  NE2   . GLN B 2 23  ? -32.285 -23.402 -11.656 1.00 35.01  ? 23  GLN B NE2   1 
ATOM   4691 N  N     . TRP B 2 24  ? -32.037 -24.033 -15.198 1.00 34.49  ? 24  TRP B N     1 
ATOM   4692 C  CA    . TRP B 2 24  ? -32.966 -25.019 -15.725 1.00 31.88  ? 24  TRP B CA    1 
ATOM   4693 C  C     . TRP B 2 24  ? -34.269 -25.008 -14.933 1.00 30.37  ? 24  TRP B C     1 
ATOM   4694 O  O     . TRP B 2 24  ? -34.327 -24.471 -13.823 1.00 30.05  ? 24  TRP B O     1 
ATOM   4695 C  CB    . TRP B 2 24  ? -32.325 -26.410 -15.703 1.00 40.14  ? 24  TRP B CB    1 
ATOM   4696 C  CG    . TRP B 2 24  ? -31.825 -26.875 -14.369 1.00 38.72  ? 24  TRP B CG    1 
ATOM   4697 C  CD1   . TRP B 2 24  ? -32.574 -27.177 -13.268 1.00 38.32  ? 24  TRP B CD1   1 
ATOM   4698 C  CD2   . TRP B 2 24  ? -30.462 -27.131 -14.009 1.00 38.32  ? 24  TRP B CD2   1 
ATOM   4699 N  NE1   . TRP B 2 24  ? -31.759 -27.587 -12.240 1.00 46.71  ? 24  TRP B NE1   1 
ATOM   4700 C  CE2   . TRP B 2 24  ? -30.458 -27.569 -12.669 1.00 42.70  ? 24  TRP B CE2   1 
ATOM   4701 C  CE3   . TRP B 2 24  ? -29.244 -27.025 -14.688 1.00 35.45  ? 24  TRP B CE3   1 
ATOM   4702 C  CZ2   . TRP B 2 24  ? -29.284 -27.901 -11.994 1.00 38.10  ? 24  TRP B CZ2   1 
ATOM   4703 C  CZ3   . TRP B 2 24  ? -28.078 -27.357 -14.017 1.00 32.36  ? 24  TRP B CZ3   1 
ATOM   4704 C  CH2   . TRP B 2 24  ? -28.107 -27.788 -12.683 1.00 33.12  ? 24  TRP B CH2   1 
ATOM   4705 N  N     . PRO B 2 25  ? -35.346 -25.566 -15.491 1.00 35.59  ? 25  PRO B N     1 
ATOM   4706 C  CA    . PRO B 2 25  ? -36.639 -25.531 -14.791 1.00 33.23  ? 25  PRO B CA    1 
ATOM   4707 C  C     . PRO B 2 25  ? -36.573 -26.205 -13.427 1.00 38.83  ? 25  PRO B C     1 
ATOM   4708 O  O     . PRO B 2 25  ? -35.869 -27.199 -13.235 1.00 41.16  ? 25  PRO B O     1 
ATOM   4709 C  CB    . PRO B 2 25  ? -37.574 -26.284 -15.743 1.00 31.11  ? 25  PRO B CB    1 
ATOM   4710 C  CG    . PRO B 2 25  ? -36.955 -26.114 -17.083 1.00 31.98  ? 25  PRO B CG    1 
ATOM   4711 C  CD    . PRO B 2 25  ? -35.477 -26.109 -16.856 1.00 30.95  ? 25  PRO B CD    1 
ATOM   4712 N  N     . LEU B 2 26  ? -37.323 -25.650 -12.477 1.00 31.71  ? 26  LEU B N     1 
ATOM   4713 C  CA    . LEU B 2 26  ? -37.366 -26.146 -11.109 1.00 29.22  ? 26  LEU B CA    1 
ATOM   4714 C  C     . LEU B 2 26  ? -38.810 -26.380 -10.692 1.00 36.65  ? 26  LEU B C     1 
ATOM   4715 O  O     . LEU B 2 26  ? -39.701 -25.602 -11.046 1.00 29.62  ? 26  LEU B O     1 
ATOM   4716 C  CB    . LEU B 2 26  ? -36.698 -25.165 -10.136 1.00 35.15  ? 26  LEU B CB    1 
ATOM   4717 C  CG    . LEU B 2 26  ? -35.202 -24.915 -10.327 1.00 41.23  ? 26  LEU B CG    1 
ATOM   4718 C  CD1   . LEU B 2 26  ? -34.694 -23.915 -9.302  1.00 36.83  ? 26  LEU B CD1   1 
ATOM   4719 C  CD2   . LEU B 2 26  ? -34.430 -26.219 -10.232 1.00 32.87  ? 26  LEU B CD2   1 
ATOM   4720 N  N     . THR B 2 27  ? -39.035 -27.451 -9.934  1.00 24.82  ? 27  THR B N     1 
ATOM   4721 C  CA    . THR B 2 27  ? -40.369 -27.755 -9.441  1.00 28.03  ? 27  THR B CA    1 
ATOM   4722 C  C     . THR B 2 27  ? -40.811 -26.712 -8.414  1.00 32.22  ? 27  THR B C     1 
ATOM   4723 O  O     . THR B 2 27  ? -40.019 -25.906 -7.917  1.00 26.73  ? 27  THR B O     1 
ATOM   4724 C  CB    . THR B 2 27  ? -40.411 -29.153 -8.823  1.00 35.56  ? 27  THR B CB    1 
ATOM   4725 O  OG1   . THR B 2 27  ? -39.486 -29.223 -7.730  1.00 34.04  ? 27  THR B OG1   1 
ATOM   4726 C  CG2   . THR B 2 27  ? -40.048 -30.206 -9.858  1.00 30.60  ? 27  THR B CG2   1 
ATOM   4727 N  N     . GLU B 2 28  ? -42.107 -26.742 -8.096  1.00 31.91  ? 28  GLU B N     1 
ATOM   4728 C  CA    . GLU B 2 28  ? -42.663 -25.763 -7.167  1.00 33.41  ? 28  GLU B CA    1 
ATOM   4729 C  C     . GLU B 2 28  ? -42.046 -25.894 -5.780  1.00 38.17  ? 28  GLU B C     1 
ATOM   4730 O  O     . GLU B 2 28  ? -41.707 -24.887 -5.147  1.00 38.03  ? 28  GLU B O     1 
ATOM   4731 C  CB    . GLU B 2 28  ? -44.184 -25.912 -7.097  1.00 37.81  ? 28  GLU B CB    1 
ATOM   4732 C  CG    . GLU B 2 28  ? -44.836 -25.161 -5.944  1.00 46.14  ? 28  GLU B CG    1 
ATOM   4733 C  CD    . GLU B 2 28  ? -46.253 -24.716 -6.260  1.00 44.43  ? 28  GLU B CD    1 
ATOM   4734 O  OE1   . GLU B 2 28  ? -46.532 -23.503 -6.156  1.00 53.34  ? 28  GLU B OE1   1 
ATOM   4735 O  OE2   . GLU B 2 28  ? -47.083 -25.574 -6.624  1.00 40.06  ? 28  GLU B OE2   1 
ATOM   4736 N  N     . GLU B 2 29  ? -41.881 -27.127 -5.292  1.00 29.42  ? 29  GLU B N     1 
ATOM   4737 C  CA    . GLU B 2 29  ? -41.347 -27.321 -3.948  1.00 38.77  ? 29  GLU B CA    1 
ATOM   4738 C  C     . GLU B 2 29  ? -39.903 -26.847 -3.834  1.00 36.15  ? 29  GLU B C     1 
ATOM   4739 O  O     . GLU B 2 29  ? -39.500 -26.349 -2.776  1.00 45.22  ? 29  GLU B O     1 
ATOM   4740 C  CB    . GLU B 2 29  ? -41.460 -28.792 -3.542  1.00 39.07  ? 29  GLU B CB    1 
ATOM   4741 C  CG    . GLU B 2 29  ? -40.766 -29.763 -4.483  1.00 55.95  ? 29  GLU B CG    1 
ATOM   4742 C  CD    . GLU B 2 29  ? -40.858 -31.199 -4.006  1.00 70.33  ? 29  GLU B CD    1 
ATOM   4743 O  OE1   . GLU B 2 29  ? -41.519 -31.442 -2.973  1.00 61.00  ? 29  GLU B OE1   1 
ATOM   4744 O  OE2   . GLU B 2 29  ? -40.268 -32.083 -4.662  1.00 67.55  ? 29  GLU B OE2   1 
ATOM   4745 N  N     . LYS B 2 30  ? -39.112 -26.988 -4.900  1.00 33.77  ? 30  LYS B N     1 
ATOM   4746 C  CA    . LYS B 2 30  ? -37.738 -26.497 -4.860  1.00 38.73  ? 30  LYS B CA    1 
ATOM   4747 C  C     . LYS B 2 30  ? -37.696 -24.974 -4.884  1.00 35.49  ? 30  LYS B C     1 
ATOM   4748 O  O     . LYS B 2 30  ? -36.887 -24.359 -4.179  1.00 40.22  ? 30  LYS B O     1 
ATOM   4749 C  CB    . LYS B 2 30  ? -36.936 -27.070 -6.027  1.00 35.63  ? 30  LYS B CB    1 
ATOM   4750 C  CG    . LYS B 2 30  ? -36.689 -28.568 -5.950  1.00 33.61  ? 30  LYS B CG    1 
ATOM   4751 C  CD    . LYS B 2 30  ? -35.710 -29.015 -7.026  1.00 36.73  ? 30  LYS B CD    1 
ATOM   4752 C  CE    . LYS B 2 30  ? -35.482 -30.516 -6.983  1.00 46.36  ? 30  LYS B CE    1 
ATOM   4753 N  NZ    . LYS B 2 30  ? -36.728 -31.276 -7.283  1.00 60.38  ? 30  LYS B NZ    1 
ATOM   4754 N  N     . ILE B 2 31  ? -38.556 -24.350 -5.692  1.00 34.62  ? 31  ILE B N     1 
ATOM   4755 C  CA    . ILE B 2 31  ? -38.578 -22.892 -5.774  1.00 36.96  ? 31  ILE B CA    1 
ATOM   4756 C  C     . ILE B 2 31  ? -39.006 -22.292 -4.442  1.00 34.08  ? 31  ILE B C     1 
ATOM   4757 O  O     . ILE B 2 31  ? -38.396 -21.337 -3.946  1.00 31.22  ? 31  ILE B O     1 
ATOM   4758 C  CB    . ILE B 2 31  ? -39.492 -22.432 -6.924  1.00 39.12  ? 31  ILE B CB    1 
ATOM   4759 C  CG1   . ILE B 2 31  ? -38.887 -22.835 -8.269  1.00 28.58  ? 31  ILE B CG1   1 
ATOM   4760 C  CG2   . ILE B 2 31  ? -39.713 -20.927 -6.866  1.00 20.33  ? 31  ILE B CG2   1 
ATOM   4761 C  CD1   . ILE B 2 31  ? -39.707 -22.387 -9.465  1.00 32.87  ? 31  ILE B CD1   1 
ATOM   4762 N  N     . LYS B 2 32  ? -40.060 -22.848 -3.838  1.00 28.79  ? 32  LYS B N     1 
ATOM   4763 C  CA    . LYS B 2 32  ? -40.508 -22.361 -2.537  1.00 36.08  ? 32  LYS B CA    1 
ATOM   4764 C  C     . LYS B 2 32  ? -39.422 -22.529 -1.482  1.00 39.45  ? 32  LYS B C     1 
ATOM   4765 O  O     . LYS B 2 32  ? -39.250 -21.667 -0.611  1.00 42.36  ? 32  LYS B O     1 
ATOM   4766 C  CB    . LYS B 2 32  ? -41.786 -23.087 -2.114  1.00 36.81  ? 32  LYS B CB    1 
ATOM   4767 C  CG    . LYS B 2 32  ? -42.979 -22.826 -3.022  1.00 52.12  ? 32  LYS B CG    1 
ATOM   4768 C  CD    . LYS B 2 32  ? -44.165 -23.704 -2.649  1.00 56.66  ? 32  LYS B CD    1 
ATOM   4769 C  CE    . LYS B 2 32  ? -44.842 -23.227 -1.375  1.00 77.75  ? 32  LYS B CE    1 
ATOM   4770 N  NZ    . LYS B 2 32  ? -45.507 -21.908 -1.561  1.00 86.29  ? 32  LYS B NZ    1 
ATOM   4771 N  N     . ALA B 2 33  ? -38.672 -23.632 -1.548  1.00 33.56  ? 33  ALA B N     1 
ATOM   4772 C  CA    . ALA B 2 33  ? -37.578 -23.838 -0.606  1.00 34.09  ? 33  ALA B CA    1 
ATOM   4773 C  C     . ALA B 2 33  ? -36.447 -22.846 -0.848  1.00 34.98  ? 33  ALA B C     1 
ATOM   4774 O  O     . ALA B 2 33  ? -35.871 -22.309 0.105   1.00 35.22  ? 33  ALA B O     1 
ATOM   4775 C  CB    . ALA B 2 33  ? -37.063 -25.273 -0.704  1.00 27.80  ? 33  ALA B CB    1 
ATOM   4776 N  N     . LEU B 2 34  ? -36.119 -22.586 -2.116  1.00 37.25  ? 34  LEU B N     1 
ATOM   4777 C  CA    . LEU B 2 34  ? -35.043 -21.648 -2.424  1.00 33.36  ? 34  LEU B CA    1 
ATOM   4778 C  C     . LEU B 2 34  ? -35.415 -20.224 -2.030  1.00 33.98  ? 34  LEU B C     1 
ATOM   4779 O  O     . LEU B 2 34  ? -34.566 -19.471 -1.538  1.00 38.69  ? 34  LEU B O     1 
ATOM   4780 C  CB    . LEU B 2 34  ? -34.690 -21.722 -3.910  1.00 27.56  ? 34  LEU B CB    1 
ATOM   4781 C  CG    . LEU B 2 34  ? -33.884 -22.947 -4.343  1.00 32.80  ? 34  LEU B CG    1 
ATOM   4782 C  CD1   . LEU B 2 34  ? -33.667 -22.942 -5.848  1.00 37.30  ? 34  LEU B CD1   1 
ATOM   4783 C  CD2   . LEU B 2 34  ? -32.554 -22.992 -3.607  1.00 29.89  ? 34  LEU B CD2   1 
ATOM   4784 N  N     . VAL B 2 35  ? -36.676 -19.835 -2.237  1.00 32.10  ? 35  VAL B N     1 
ATOM   4785 C  CA    . VAL B 2 35  ? -37.109 -18.492 -1.856  1.00 38.44  ? 35  VAL B CA    1 
ATOM   4786 C  C     . VAL B 2 35  ? -37.028 -18.314 -0.346  1.00 35.93  ? 35  VAL B C     1 
ATOM   4787 O  O     . VAL B 2 35  ? -36.561 -17.281 0.149   1.00 34.65  ? 35  VAL B O     1 
ATOM   4788 C  CB    . VAL B 2 35  ? -38.528 -18.213 -2.388  1.00 40.57  ? 35  VAL B CB    1 
ATOM   4789 C  CG1   . VAL B 2 35  ? -39.066 -16.912 -1.814  1.00 32.33  ? 35  VAL B CG1   1 
ATOM   4790 C  CG2   . VAL B 2 35  ? -38.518 -18.157 -3.905  1.00 31.09  ? 35  VAL B CG2   1 
ATOM   4791 N  N     . GLU B 2 36  ? -37.471 -19.321 0.411   1.00 37.90  ? 36  GLU B N     1 
ATOM   4792 C  CA    . GLU B 2 36  ? -37.390 -19.240 1.866   1.00 47.03  ? 36  GLU B CA    1 
ATOM   4793 C  C     . GLU B 2 36  ? -35.942 -19.190 2.335   1.00 43.32  ? 36  GLU B C     1 
ATOM   4794 O  O     . GLU B 2 36  ? -35.608 -18.452 3.270   1.00 48.75  ? 36  GLU B O     1 
ATOM   4795 C  CB    . GLU B 2 36  ? -38.112 -20.429 2.499   1.00 50.54  ? 36  GLU B CB    1 
ATOM   4796 C  CG    . GLU B 2 36  ? -38.151 -20.393 4.018   1.00 57.87  ? 36  GLU B CG    1 
ATOM   4797 C  CD    . GLU B 2 36  ? -38.309 -21.770 4.630   1.00 65.26  ? 36  GLU B CD    1 
ATOM   4798 O  OE1   . GLU B 2 36  ? -37.710 -22.018 5.698   1.00 62.14  ? 36  GLU B OE1   1 
ATOM   4799 O  OE2   . GLU B 2 36  ? -39.025 -22.606 4.037   1.00 70.85  ? 36  GLU B OE2   1 
ATOM   4800 N  N     . ILE B 2 37  ? -35.067 -19.969 1.698   1.00 38.46  ? 37  ILE B N     1 
ATOM   4801 C  CA    . ILE B 2 37  ? -33.664 -19.995 2.097   1.00 36.65  ? 37  ILE B CA    1 
ATOM   4802 C  C     . ILE B 2 37  ? -32.980 -18.681 1.741   1.00 43.78  ? 37  ILE B C     1 
ATOM   4803 O  O     . ILE B 2 37  ? -32.212 -18.130 2.539   1.00 38.20  ? 37  ILE B O     1 
ATOM   4804 C  CB    . ILE B 2 37  ? -32.953 -21.202 1.459   1.00 37.07  ? 37  ILE B CB    1 
ATOM   4805 C  CG1   . ILE B 2 37  ? -33.408 -22.501 2.127   1.00 41.00  ? 37  ILE B CG1   1 
ATOM   4806 C  CG2   . ILE B 2 37  ? -31.442 -21.050 1.549   1.00 35.29  ? 37  ILE B CG2   1 
ATOM   4807 C  CD1   . ILE B 2 37  ? -32.812 -23.751 1.510   1.00 41.94  ? 37  ILE B CD1   1 
ATOM   4808 N  N     . CYS B 2 38  ? -33.254 -18.150 0.547   1.00 40.00  ? 38  CYS B N     1 
ATOM   4809 C  CA    . CYS B 2 38  ? -32.575 -16.935 0.107   1.00 50.43  ? 38  CYS B CA    1 
ATOM   4810 C  C     . CYS B 2 38  ? -32.988 -15.718 0.926   1.00 39.58  ? 38  CYS B C     1 
ATOM   4811 O  O     . CYS B 2 38  ? -32.170 -14.816 1.139   1.00 42.06  ? 38  CYS B O     1 
ATOM   4812 C  CB    . CYS B 2 38  ? -32.838 -16.690 -1.379  1.00 36.99  ? 38  CYS B CB    1 
ATOM   4813 S  SG    . CYS B 2 38  ? -31.927 -17.800 -2.483  1.00 41.81  ? 38  CYS B SG    1 
ATOM   4814 N  N     . THR B 2 39  ? -34.242 -15.665 1.385   1.00 43.85  ? 39  THR B N     1 
ATOM   4815 C  CA    . THR B 2 39  ? -34.661 -14.555 2.237   1.00 41.40  ? 39  THR B CA    1 
ATOM   4816 C  C     . THR B 2 39  ? -33.887 -14.549 3.548   1.00 48.28  ? 39  THR B C     1 
ATOM   4817 O  O     . THR B 2 39  ? -33.482 -13.487 4.035   1.00 50.31  ? 39  THR B O     1 
ATOM   4818 C  CB    . THR B 2 39  ? -36.165 -14.622 2.511   1.00 44.39  ? 39  THR B CB    1 
ATOM   4819 O  OG1   . THR B 2 39  ? -36.510 -15.924 3.001   1.00 67.61  ? 39  THR B OG1   1 
ATOM   4820 C  CG2   . THR B 2 39  ? -36.959 -14.320 1.251   1.00 45.92  ? 39  THR B CG2   1 
ATOM   4821 N  N     . GLU B 2 40  ? -33.668 -15.729 4.133   1.00 48.81  ? 40  GLU B N     1 
ATOM   4822 C  CA    . GLU B 2 40  ? -32.916 -15.800 5.381   1.00 55.02  ? 40  GLU B CA    1 
ATOM   4823 C  C     . GLU B 2 40  ? -31.430 -15.558 5.142   1.00 51.93  ? 40  GLU B C     1 
ATOM   4824 O  O     . GLU B 2 40  ? -30.754 -14.947 5.977   1.00 59.31  ? 40  GLU B O     1 
ATOM   4825 C  CB    . GLU B 2 40  ? -33.147 -17.151 6.056   1.00 52.72  ? 40  GLU B CB    1 
ATOM   4826 C  CG    . GLU B 2 40  ? -32.814 -17.168 7.539   1.00 76.78  ? 40  GLU B CG    1 
ATOM   4827 C  CD    . GLU B 2 40  ? -33.349 -18.401 8.242   1.00 100.65 ? 40  GLU B CD    1 
ATOM   4828 O  OE1   . GLU B 2 40  ? -33.682 -19.386 7.550   1.00 102.68 ? 40  GLU B OE1   1 
ATOM   4829 O  OE2   . GLU B 2 40  ? -33.442 -18.381 9.488   1.00 102.49 ? 40  GLU B OE2   1 
ATOM   4830 N  N     . MET B 2 41  ? -30.905 -16.029 4.007   1.00 40.56  ? 41  MET B N     1 
ATOM   4831 C  CA    . MET B 2 41  ? -29.515 -15.742 3.667   1.00 44.27  ? 41  MET B CA    1 
ATOM   4832 C  C     . MET B 2 41  ? -29.310 -14.256 3.400   1.00 41.37  ? 41  MET B C     1 
ATOM   4833 O  O     . MET B 2 41  ? -28.260 -13.697 3.738   1.00 47.59  ? 41  MET B O     1 
ATOM   4834 C  CB    . MET B 2 41  ? -29.083 -16.565 2.453   1.00 39.75  ? 41  MET B CB    1 
ATOM   4835 C  CG    . MET B 2 41  ? -29.001 -18.063 2.701   1.00 42.76  ? 41  MET B CG    1 
ATOM   4836 S  SD    . MET B 2 41  ? -28.346 -18.962 1.280   1.00 49.94  ? 41  MET B SD    1 
ATOM   4837 C  CE    . MET B 2 41  ? -26.654 -18.374 1.256   1.00 32.13  ? 41  MET B CE    1 
ATOM   4838 N  N     . GLU B 2 42  ? -30.301 -13.601 2.790   1.00 40.34  ? 42  GLU B N     1 
ATOM   4839 C  CA    . GLU B 2 42  ? -30.194 -12.168 2.540   1.00 45.06  ? 42  GLU B CA    1 
ATOM   4840 C  C     . GLU B 2 42  ? -30.317 -11.372 3.833   1.00 47.46  ? 42  GLU B C     1 
ATOM   4841 O  O     . GLU B 2 42  ? -29.599 -10.384 4.030   1.00 43.40  ? 42  GLU B O     1 
ATOM   4842 C  CB    . GLU B 2 42  ? -31.259 -11.731 1.534   1.00 42.66  ? 42  GLU B CB    1 
ATOM   4843 C  CG    . GLU B 2 42  ? -31.281 -10.237 1.254   1.00 49.09  ? 42  GLU B CG    1 
ATOM   4844 C  CD    . GLU B 2 42  ? -32.341 -9.851  0.242   1.00 50.81  ? 42  GLU B CD    1 
ATOM   4845 O  OE1   . GLU B 2 42  ? -32.094 -8.920  -0.554  1.00 58.16  ? 42  GLU B OE1   1 
ATOM   4846 O  OE2   . GLU B 2 42  ? -33.418 -10.484 0.237   1.00 42.25  ? 42  GLU B OE2   1 
ATOM   4847 N  N     . LYS B 2 43  ? -31.220 -11.788 4.727   1.00 43.50  ? 43  LYS B N     1 
ATOM   4848 C  CA    . LYS B 2 43  ? -31.374 -11.104 6.007   1.00 47.81  ? 43  LYS B CA    1 
ATOM   4849 C  C     . LYS B 2 43  ? -30.087 -11.146 6.820   1.00 47.62  ? 43  LYS B C     1 
ATOM   4850 O  O     . LYS B 2 43  ? -29.799 -10.212 7.577   1.00 56.94  ? 43  LYS B O     1 
ATOM   4851 C  CB    . LYS B 2 43  ? -32.530 -11.727 6.796   1.00 49.88  ? 43  LYS B CB    1 
ATOM   4852 C  CG    . LYS B 2 43  ? -32.954 -10.955 8.045   1.00 56.12  ? 43  LYS B CG    1 
ATOM   4853 C  CD    . LYS B 2 43  ? -32.261 -11.464 9.306   1.00 62.40  ? 43  LYS B CD    1 
ATOM   4854 C  CE    . LYS B 2 43  ? -32.667 -12.894 9.637   1.00 65.56  ? 43  LYS B CE    1 
ATOM   4855 N  NZ    . LYS B 2 43  ? -34.099 -12.996 10.034  1.00 59.10  ? 43  LYS B NZ    1 
ATOM   4856 N  N     . GLU B 2 44  ? -29.302 -12.211 6.674   1.00 44.31  ? 44  GLU B N     1 
ATOM   4857 C  CA    . GLU B 2 44  ? -28.066 -12.387 7.421   1.00 40.86  ? 44  GLU B CA    1 
ATOM   4858 C  C     . GLU B 2 44  ? -26.840 -11.917 6.647   1.00 36.99  ? 44  GLU B C     1 
ATOM   4859 O  O     . GLU B 2 44  ? -25.712 -12.230 7.040   1.00 52.67  ? 44  GLU B O     1 
ATOM   4860 C  CB    . GLU B 2 44  ? -27.916 -13.854 7.831   1.00 43.08  ? 44  GLU B CB    1 
ATOM   4861 C  CG    . GLU B 2 44  ? -29.039 -14.330 8.745   1.00 54.21  ? 44  GLU B CG    1 
ATOM   4862 C  CD    . GLU B 2 44  ? -29.155 -15.841 8.814   1.00 74.96  ? 44  GLU B CD    1 
ATOM   4863 O  OE1   . GLU B 2 44  ? -28.251 -16.534 8.307   1.00 73.42  ? 44  GLU B OE1   1 
ATOM   4864 O  OE2   . GLU B 2 44  ? -30.157 -16.334 9.374   1.00 77.64  ? 44  GLU B OE2   1 
ATOM   4865 N  N     . GLY B 2 45  ? -27.036 -11.171 5.560   1.00 37.71  ? 45  GLY B N     1 
ATOM   4866 C  CA    . GLY B 2 45  ? -25.935 -10.594 4.815   1.00 35.59  ? 45  GLY B CA    1 
ATOM   4867 C  C     . GLY B 2 45  ? -25.136 -11.560 3.971   1.00 44.18  ? 45  GLY B C     1 
ATOM   4868 O  O     . GLY B 2 45  ? -24.117 -11.162 3.399   1.00 41.57  ? 45  GLY B O     1 
ATOM   4869 N  N     . LYS B 2 46  ? -25.568 -12.818 3.865   1.00 40.78  ? 46  LYS B N     1 
ATOM   4870 C  CA    . LYS B 2 46  ? -24.794 -13.803 3.118   1.00 38.35  ? 46  LYS B CA    1 
ATOM   4871 C  C     . LYS B 2 46  ? -24.895 -13.581 1.614   1.00 33.95  ? 46  LYS B C     1 
ATOM   4872 O  O     . LYS B 2 46  ? -23.938 -13.863 0.884   1.00 37.30  ? 46  LYS B O     1 
ATOM   4873 C  CB    . LYS B 2 46  ? -25.252 -15.213 3.488   1.00 42.98  ? 46  LYS B CB    1 
ATOM   4874 C  CG    . LYS B 2 46  ? -25.091 -15.536 4.966   1.00 46.16  ? 46  LYS B CG    1 
ATOM   4875 C  CD    . LYS B 2 46  ? -25.742 -16.857 5.331   1.00 62.49  ? 46  LYS B CD    1 
ATOM   4876 C  CE    . LYS B 2 46  ? -25.554 -17.168 6.807   1.00 72.38  ? 46  LYS B CE    1 
ATOM   4877 N  NZ    . LYS B 2 46  ? -26.286 -18.401 7.212   1.00 59.66  ? 46  LYS B NZ    1 
ATOM   4878 N  N     . ILE B 2 47  ? -26.034 -13.079 1.132   1.00 34.70  ? 47  ILE B N     1 
ATOM   4879 C  CA    . ILE B 2 47  ? -26.236 -12.812 -0.285  1.00 37.83  ? 47  ILE B CA    1 
ATOM   4880 C  C     . ILE B 2 47  ? -26.884 -11.443 -0.445  1.00 45.32  ? 47  ILE B C     1 
ATOM   4881 O  O     . ILE B 2 47  ? -27.487 -10.900 0.483   1.00 45.24  ? 47  ILE B O     1 
ATOM   4882 C  CB    . ILE B 2 47  ? -27.097 -13.895 -0.973  1.00 41.39  ? 47  ILE B CB    1 
ATOM   4883 C  CG1   . ILE B 2 47  ? -28.468 -13.995 -0.303  1.00 37.85  ? 47  ILE B CG1   1 
ATOM   4884 C  CG2   . ILE B 2 47  ? -26.385 -15.241 -0.961  1.00 28.15  ? 47  ILE B CG2   1 
ATOM   4885 C  CD1   . ILE B 2 47  ? -29.385 -15.014 -0.938  1.00 34.81  ? 47  ILE B CD1   1 
ATOM   4886 N  N     . SER B 2 48  ? -26.756 -10.892 -1.651  1.00 36.70  ? 48  SER B N     1 
ATOM   4887 C  CA    . SER B 2 48  ? -27.348 -9.607  -1.989  1.00 44.23  ? 48  SER B CA    1 
ATOM   4888 C  C     . SER B 2 48  ? -27.949 -9.677  -3.385  1.00 37.75  ? 48  SER B C     1 
ATOM   4889 O  O     . SER B 2 48  ? -27.424 -10.358 -4.269  1.00 34.00  ? 48  SER B O     1 
ATOM   4890 C  CB    . SER B 2 48  ? -26.320 -8.467  -1.924  1.00 39.06  ? 48  SER B CB    1 
ATOM   4891 O  OG    . SER B 2 48  ? -25.872 -8.253  -0.597  1.00 46.58  ? 48  SER B OG    1 
ATOM   4892 N  N     . LYS B 2 49  ? -29.054 -8.959  -3.573  1.00 39.70  ? 49  LYS B N     1 
ATOM   4893 C  CA    . LYS B 2 49  ? -29.689 -8.894  -4.881  1.00 37.98  ? 49  LYS B CA    1 
ATOM   4894 C  C     . LYS B 2 49  ? -28.809 -8.135  -5.866  1.00 32.21  ? 49  LYS B C     1 
ATOM   4895 O  O     . LYS B 2 49  ? -28.133 -7.169  -5.504  1.00 35.14  ? 49  LYS B O     1 
ATOM   4896 C  CB    . LYS B 2 49  ? -31.059 -8.221  -4.779  1.00 30.13  ? 49  LYS B CB    1 
ATOM   4897 C  CG    . LYS B 2 49  ? -32.144 -9.081  -4.152  1.00 36.57  ? 49  LYS B CG    1 
ATOM   4898 C  CD    . LYS B 2 49  ? -33.485 -8.362  -4.167  1.00 37.62  ? 49  LYS B CD    1 
ATOM   4899 C  CE    . LYS B 2 49  ? -34.610 -9.269  -3.690  1.00 38.73  ? 49  LYS B CE    1 
ATOM   4900 N  NZ    . LYS B 2 49  ? -34.393 -9.742  -2.295  1.00 44.82  ? 49  LYS B NZ    1 
ATOM   4901 N  N     . ILE B 2 50  ? -28.820 -8.582  -7.122  1.00 37.19  ? 50  ILE B N     1 
ATOM   4902 C  CA    . ILE B 2 50  ? -28.065 -7.950  -8.194  1.00 40.89  ? 50  ILE B CA    1 
ATOM   4903 C  C     . ILE B 2 50  ? -28.983 -7.778  -9.398  1.00 36.11  ? 50  ILE B C     1 
ATOM   4904 O  O     . ILE B 2 50  ? -30.099 -8.294  -9.439  1.00 34.62  ? 50  ILE B O     1 
ATOM   4905 C  CB    . ILE B 2 50  ? -26.808 -8.754  -8.585  1.00 40.13  ? 50  ILE B CB    1 
ATOM   4906 C  CG1   . ILE B 2 50  ? -27.195 -10.170 -9.012  1.00 41.31  ? 50  ILE B CG1   1 
ATOM   4907 C  CG2   . ILE B 2 50  ? -25.814 -8.787  -7.435  1.00 38.28  ? 50  ILE B CG2   1 
ATOM   4908 C  CD1   . ILE B 2 50  ? -26.021 -11.019 -9.416  1.00 40.84  ? 50  ILE B CD1   1 
ATOM   4909 N  N     . GLY B 2 51  ? -28.487 -7.043  -10.391 1.00 36.85  ? 51  GLY B N     1 
ATOM   4910 C  CA    . GLY B 2 51  ? -29.252 -6.754  -11.580 1.00 31.38  ? 51  GLY B CA    1 
ATOM   4911 C  C     . GLY B 2 51  ? -28.716 -7.460  -12.808 1.00 38.25  ? 51  GLY B C     1 
ATOM   4912 O  O     . GLY B 2 51  ? -27.823 -8.310  -12.729 1.00 36.80  ? 51  GLY B O     1 
ATOM   4913 N  N     . PRO B 2 52  ? -29.260 -7.117  -13.980 1.00 34.93  ? 52  PRO B N     1 
ATOM   4914 C  CA    . PRO B 2 52  ? -28.831 -7.779  -15.219 1.00 30.70  ? 52  PRO B CA    1 
ATOM   4915 C  C     . PRO B 2 52  ? -27.515 -7.264  -15.777 1.00 45.30  ? 52  PRO B C     1 
ATOM   4916 O  O     . PRO B 2 52  ? -26.997 -7.863  -16.730 1.00 37.90  ? 52  PRO B O     1 
ATOM   4917 C  CB    . PRO B 2 52  ? -29.986 -7.484  -16.182 1.00 39.55  ? 52  PRO B CB    1 
ATOM   4918 C  CG    . PRO B 2 52  ? -30.510 -6.168  -15.719 1.00 26.10  ? 52  PRO B CG    1 
ATOM   4919 C  CD    . PRO B 2 52  ? -30.344 -6.147  -14.217 1.00 32.59  ? 52  PRO B CD    1 
ATOM   4920 N  N     . GLU B 2 53  ? -26.961 -6.178  -15.231 1.00 34.30  ? 53  GLU B N     1 
ATOM   4921 C  CA    . GLU B 2 53  ? -25.671 -5.696  -15.711 1.00 40.43  ? 53  GLU B CA    1 
ATOM   4922 C  C     . GLU B 2 53  ? -24.535 -6.632  -15.321 1.00 42.24  ? 53  GLU B C     1 
ATOM   4923 O  O     . GLU B 2 53  ? -23.437 -6.522  -15.876 1.00 42.47  ? 53  GLU B O     1 
ATOM   4924 C  CB    . GLU B 2 53  ? -25.398 -4.283  -15.189 1.00 35.62  ? 53  GLU B CB    1 
ATOM   4925 C  CG    . GLU B 2 53  ? -24.944 -4.209  -13.739 1.00 31.02  ? 53  GLU B CG    1 
ATOM   4926 C  CD    . GLU B 2 53  ? -26.091 -4.249  -12.747 1.00 35.93  ? 53  GLU B CD    1 
ATOM   4927 O  OE1   . GLU B 2 53  ? -27.214 -4.629  -13.138 1.00 40.48  ? 53  GLU B OE1   1 
ATOM   4928 O  OE2   . GLU B 2 53  ? -25.866 -3.894  -11.571 1.00 52.52  ? 53  GLU B OE2   1 
ATOM   4929 N  N     . ASN B 2 54  ? -24.775 -7.540  -14.376 1.00 37.28  ? 54  ASN B N     1 
ATOM   4930 C  CA    . ASN B 2 54  ? -23.871 -8.642  -14.078 1.00 39.50  ? 54  ASN B CA    1 
ATOM   4931 C  C     . ASN B 2 54  ? -24.111 -9.732  -15.116 1.00 36.76  ? 54  ASN B C     1 
ATOM   4932 O  O     . ASN B 2 54  ? -25.179 -10.357 -15.121 1.00 40.11  ? 54  ASN B O     1 
ATOM   4933 C  CB    . ASN B 2 54  ? -24.103 -9.163  -12.657 1.00 35.86  ? 54  ASN B CB    1 
ATOM   4934 C  CG    . ASN B 2 54  ? -23.076 -10.198 -12.228 1.00 41.13  ? 54  ASN B CG    1 
ATOM   4935 O  OD1   . ASN B 2 54  ? -22.683 -11.069 -13.004 1.00 36.83  ? 54  ASN B OD1   1 
ATOM   4936 N  ND2   . ASN B 2 54  ? -22.641 -10.107 -10.977 1.00 35.66  ? 54  ASN B ND2   1 
ATOM   4937 N  N     . PRO B 2 55  ? -23.154 -9.986  -16.011 1.00 37.69  ? 55  PRO B N     1 
ATOM   4938 C  CA    . PRO B 2 55  ? -23.402 -10.908 -17.127 1.00 38.21  ? 55  PRO B CA    1 
ATOM   4939 C  C     . PRO B 2 55  ? -23.225 -12.379 -16.788 1.00 34.39  ? 55  PRO B C     1 
ATOM   4940 O  O     . PRO B 2 55  ? -23.391 -13.220 -17.678 1.00 42.87  ? 55  PRO B O     1 
ATOM   4941 C  CB    . PRO B 2 55  ? -22.360 -10.461 -18.159 1.00 36.70  ? 55  PRO B CB    1 
ATOM   4942 C  CG    . PRO B 2 55  ? -21.210 -10.009 -17.321 1.00 37.66  ? 55  PRO B CG    1 
ATOM   4943 C  CD    . PRO B 2 55  ? -21.813 -9.379  -16.085 1.00 32.38  ? 55  PRO B CD    1 
ATOM   4944 N  N     . TYR B 2 56  ? -22.903 -12.718 -15.546 1.00 33.23  ? 56  TYR B N     1 
ATOM   4945 C  CA    . TYR B 2 56  ? -22.610 -14.091 -15.168 1.00 37.70  ? 56  TYR B CA    1 
ATOM   4946 C  C     . TYR B 2 56  ? -23.819 -14.743 -14.508 1.00 34.27  ? 56  TYR B C     1 
ATOM   4947 O  O     . TYR B 2 56  ? -24.722 -14.068 -14.007 1.00 38.50  ? 56  TYR B O     1 
ATOM   4948 C  CB    . TYR B 2 56  ? -21.404 -14.137 -14.227 1.00 32.20  ? 56  TYR B CB    1 
ATOM   4949 C  CG    . TYR B 2 56  ? -20.231 -13.326 -14.726 1.00 40.22  ? 56  TYR B CG    1 
ATOM   4950 C  CD1   . TYR B 2 56  ? -19.451 -13.778 -15.782 1.00 34.17  ? 56  TYR B CD1   1 
ATOM   4951 C  CD2   . TYR B 2 56  ? -19.906 -12.105 -14.146 1.00 40.90  ? 56  TYR B CD2   1 
ATOM   4952 C  CE1   . TYR B 2 56  ? -18.381 -13.039 -16.247 1.00 38.42  ? 56  TYR B CE1   1 
ATOM   4953 C  CE2   . TYR B 2 56  ? -18.836 -11.359 -14.602 1.00 35.04  ? 56  TYR B CE2   1 
ATOM   4954 C  CZ    . TYR B 2 56  ? -18.077 -11.832 -15.653 1.00 45.09  ? 56  TYR B CZ    1 
ATOM   4955 O  OH    . TYR B 2 56  ? -17.010 -11.098 -16.115 1.00 46.26  ? 56  TYR B OH    1 
ATOM   4956 N  N     . ASN B 2 57  ? -23.826 -16.075 -14.515 1.00 29.78  ? 57  ASN B N     1 
ATOM   4957 C  CA    . ASN B 2 57  ? -24.903 -16.821 -13.879 1.00 34.90  ? 57  ASN B CA    1 
ATOM   4958 C  C     . ASN B 2 57  ? -24.484 -18.269 -13.685 1.00 37.71  ? 57  ASN B C     1 
ATOM   4959 O  O     . ASN B 2 57  ? -23.751 -18.836 -14.501 1.00 37.58  ? 57  ASN B O     1 
ATOM   4960 C  CB    . ASN B 2 57  ? -26.197 -16.756 -14.694 1.00 31.84  ? 57  ASN B CB    1 
ATOM   4961 C  CG    . ASN B 2 57  ? -27.381 -17.344 -13.952 1.00 38.63  ? 57  ASN B CG    1 
ATOM   4962 O  OD1   . ASN B 2 57  ? -27.930 -16.721 -13.043 1.00 36.91  ? 57  ASN B OD1   1 
ATOM   4963 N  ND2   . ASN B 2 57  ? -27.783 -18.550 -14.338 1.00 36.69  ? 57  ASN B ND2   1 
ATOM   4964 N  N     . THR B 2 58  ? -24.974 -18.859 -12.596 1.00 40.21  ? 58  THR B N     1 
ATOM   4965 C  CA    . THR B 2 58  ? -24.718 -20.245 -12.243 1.00 32.56  ? 58  THR B CA    1 
ATOM   4966 C  C     . THR B 2 58  ? -26.037 -20.884 -11.823 1.00 33.94  ? 58  THR B C     1 
ATOM   4967 O  O     . THR B 2 58  ? -26.787 -20.287 -11.033 1.00 36.25  ? 58  THR B O     1 
ATOM   4968 C  CB    . THR B 2 58  ? -23.687 -20.339 -11.109 1.00 33.05  ? 58  THR B CB    1 
ATOM   4969 O  OG1   . THR B 2 58  ? -22.389 -19.995 -11.611 1.00 36.88  ? 58  THR B OG1   1 
ATOM   4970 C  CG2   . THR B 2 58  ? -23.650 -21.734 -10.527 1.00 30.68  ? 58  THR B CG2   1 
ATOM   4971 N  N     . PRO B 2 59  ? -26.367 -22.069 -12.332 1.00 37.55  ? 59  PRO B N     1 
ATOM   4972 C  CA    . PRO B 2 59  ? -27.640 -22.698 -11.962 1.00 29.01  ? 59  PRO B CA    1 
ATOM   4973 C  C     . PRO B 2 59  ? -27.676 -23.084 -10.492 1.00 34.80  ? 59  PRO B C     1 
ATOM   4974 O  O     . PRO B 2 59  ? -26.646 -23.327 -9.859  1.00 33.30  ? 59  PRO B O     1 
ATOM   4975 C  CB    . PRO B 2 59  ? -27.700 -23.940 -12.860 1.00 38.09  ? 59  PRO B CB    1 
ATOM   4976 C  CG    . PRO B 2 59  ? -26.756 -23.656 -13.975 1.00 41.61  ? 59  PRO B CG    1 
ATOM   4977 C  CD    . PRO B 2 59  ? -25.663 -22.825 -13.379 1.00 37.92  ? 59  PRO B CD    1 
ATOM   4978 N  N     . VAL B 2 60  ? -28.893 -23.137 -9.952  1.00 28.69  ? 60  VAL B N     1 
ATOM   4979 C  CA    . VAL B 2 60  ? -29.122 -23.458 -8.550  1.00 34.54  ? 60  VAL B CA    1 
ATOM   4980 C  C     . VAL B 2 60  ? -30.364 -24.334 -8.451  1.00 28.38  ? 60  VAL B C     1 
ATOM   4981 O  O     . VAL B 2 60  ? -31.288 -24.231 -9.264  1.00 34.20  ? 60  VAL B O     1 
ATOM   4982 C  CB    . VAL B 2 60  ? -29.273 -22.178 -7.692  1.00 38.25  ? 60  VAL B CB    1 
ATOM   4983 C  CG1   . VAL B 2 60  ? -30.518 -21.399 -8.100  1.00 33.44  ? 60  VAL B CG1   1 
ATOM   4984 C  CG2   . VAL B 2 60  ? -29.297 -22.510 -6.204  1.00 41.94  ? 60  VAL B CG2   1 
ATOM   4985 N  N     . PHE B 2 61  ? -30.367 -25.221 -7.461  1.00 35.68  ? 61  PHE B N     1 
ATOM   4986 C  CA    . PHE B 2 61  ? -31.538 -26.028 -7.145  1.00 37.75  ? 61  PHE B CA    1 
ATOM   4987 C  C     . PHE B 2 61  ? -31.478 -26.382 -5.663  1.00 36.40  ? 61  PHE B C     1 
ATOM   4988 O  O     . PHE B 2 61  ? -30.705 -25.796 -4.899  1.00 38.34  ? 61  PHE B O     1 
ATOM   4989 C  CB    . PHE B 2 61  ? -31.624 -27.262 -8.056  1.00 28.51  ? 61  PHE B CB    1 
ATOM   4990 C  CG    . PHE B 2 61  ? -30.503 -28.248 -7.870  1.00 39.34  ? 61  PHE B CG    1 
ATOM   4991 C  CD1   . PHE B 2 61  ? -29.240 -27.993 -8.380  1.00 41.35  ? 61  PHE B CD1   1 
ATOM   4992 C  CD2   . PHE B 2 61  ? -30.723 -29.447 -7.211  1.00 44.89  ? 61  PHE B CD2   1 
ATOM   4993 C  CE1   . PHE B 2 61  ? -28.213 -28.905 -8.217  1.00 48.84  ? 61  PHE B CE1   1 
ATOM   4994 C  CE2   . PHE B 2 61  ? -29.701 -30.364 -7.048  1.00 43.74  ? 61  PHE B CE2   1 
ATOM   4995 C  CZ    . PHE B 2 61  ? -28.445 -30.093 -7.552  1.00 39.76  ? 61  PHE B CZ    1 
ATOM   4996 N  N     . ALA B 2 62  ? -32.307 -27.337 -5.251  1.00 39.09  ? 62  ALA B N     1 
ATOM   4997 C  CA    . ALA B 2 62  ? -32.397 -27.699 -3.846  1.00 39.04  ? 62  ALA B CA    1 
ATOM   4998 C  C     . ALA B 2 62  ? -32.689 -29.186 -3.721  1.00 43.26  ? 62  ALA B C     1 
ATOM   4999 O  O     . ALA B 2 62  ? -33.396 -29.768 -4.546  1.00 51.62  ? 62  ALA B O     1 
ATOM   5000 C  CB    . ALA B 2 62  ? -33.479 -26.886 -3.124  1.00 32.80  ? 62  ALA B CB    1 
ATOM   5001 N  N     . ILE B 2 63  ? -32.134 -29.791 -2.674  1.00 42.39  ? 63  ILE B N     1 
ATOM   5002 C  CA    . ILE B 2 63  ? -32.379 -31.190 -2.353  1.00 42.19  ? 63  ILE B CA    1 
ATOM   5003 C  C     . ILE B 2 63  ? -32.956 -31.269 -0.948  1.00 46.46  ? 63  ILE B C     1 
ATOM   5004 O  O     . ILE B 2 63  ? -32.607 -30.480 -0.063  1.00 47.53  ? 63  ILE B O     1 
ATOM   5005 C  CB    . ILE B 2 63  ? -31.100 -32.051 -2.467  1.00 39.74  ? 63  ILE B CB    1 
ATOM   5006 C  CG1   . ILE B 2 63  ? -30.014 -31.527 -1.526  1.00 41.26  ? 63  ILE B CG1   1 
ATOM   5007 C  CG2   . ILE B 2 63  ? -30.602 -32.076 -3.903  1.00 41.95  ? 63  ILE B CG2   1 
ATOM   5008 C  CD1   . ILE B 2 63  ? -28.798 -32.421 -1.437  1.00 35.90  ? 63  ILE B CD1   1 
ATOM   5009 N  N     . LYS B 2 64  ? -33.859 -32.225 -0.751  1.00 51.68  ? 64  LYS B N     1 
ATOM   5010 C  CA    . LYS B 2 64  ? -34.463 -32.489 0.551   1.00 58.29  ? 64  LYS B CA    1 
ATOM   5011 C  C     . LYS B 2 64  ? -34.036 -33.883 0.986   1.00 61.71  ? 64  LYS B C     1 
ATOM   5012 O  O     . LYS B 2 64  ? -34.407 -34.877 0.353   1.00 53.50  ? 64  LYS B O     1 
ATOM   5013 C  CB    . LYS B 2 64  ? -35.985 -32.370 0.491   1.00 55.05  ? 64  LYS B CB    1 
ATOM   5014 C  CG    . LYS B 2 64  ? -36.676 -32.514 1.838   1.00 61.06  ? 64  LYS B CG    1 
ATOM   5015 C  CD    . LYS B 2 64  ? -38.174 -32.300 1.708   1.00 61.83  ? 64  LYS B CD    1 
ATOM   5016 C  CE    . LYS B 2 64  ? -38.858 -32.339 3.063   1.00 73.61  ? 64  LYS B CE    1 
ATOM   5017 N  NZ    . LYS B 2 64  ? -40.316 -32.061 2.959   1.00 74.17  ? 64  LYS B NZ    1 
ATOM   5018 N  N     . LYS B 2 65  ? -33.249 -33.956 2.056   1.00 63.37  ? 65  LYS B N     1 
ATOM   5019 C  CA    . LYS B 2 65  ? -32.802 -35.245 2.554   1.00 87.34  ? 65  LYS B CA    1 
ATOM   5020 C  C     . LYS B 2 65  ? -33.984 -36.025 3.126   1.00 89.52  ? 65  LYS B C     1 
ATOM   5021 O  O     . LYS B 2 65  ? -35.029 -35.460 3.464   1.00 94.56  ? 65  LYS B O     1 
ATOM   5022 C  CB    . LYS B 2 65  ? -31.694 -35.055 3.589   1.00 94.65  ? 65  LYS B CB    1 
ATOM   5023 C  CG    . LYS B 2 65  ? -30.593 -34.126 3.091   1.00 95.87  ? 65  LYS B CG    1 
ATOM   5024 C  CD    . LYS B 2 65  ? -29.319 -34.222 3.911   1.00 100.12 ? 65  LYS B CD    1 
ATOM   5025 C  CE    . LYS B 2 65  ? -28.224 -33.363 3.292   1.00 76.71  ? 65  LYS B CE    1 
ATOM   5026 N  NZ    . LYS B 2 65  ? -26.924 -33.495 4.005   1.00 85.92  ? 65  LYS B NZ    1 
ATOM   5027 N  N     . LYS B 2 66  ? -33.804 -37.344 3.229   1.00 92.32  ? 66  LYS B N     1 
ATOM   5028 C  CA    . LYS B 2 66  ? -34.907 -38.292 3.370   1.00 102.43 ? 66  LYS B CA    1 
ATOM   5029 C  C     . LYS B 2 66  ? -35.923 -37.924 4.450   1.00 106.18 ? 66  LYS B C     1 
ATOM   5030 O  O     . LYS B 2 66  ? -37.076 -37.620 4.132   1.00 103.43 ? 66  LYS B O     1 
ATOM   5031 C  CB    . LYS B 2 66  ? -34.359 -39.702 3.625   1.00 108.24 ? 66  LYS B CB    1 
ATOM   5032 C  CG    . LYS B 2 66  ? -33.227 -39.794 4.638   1.00 114.00 ? 66  LYS B CG    1 
ATOM   5033 C  CD    . LYS B 2 66  ? -32.863 -41.247 4.903   1.00 100.29 ? 66  LYS B CD    1 
ATOM   5034 C  CE    . LYS B 2 66  ? -31.819 -41.372 6.000   1.00 93.78  ? 66  LYS B CE    1 
ATOM   5035 N  NZ    . LYS B 2 66  ? -31.477 -42.794 6.277   1.00 102.78 ? 66  LYS B NZ    1 
ATOM   5036 N  N     . ASP B 2 67  ? -35.521 -37.943 5.716   1.00 100.28 ? 67  ASP B N     1 
ATOM   5037 C  CA    . ASP B 2 67  ? -36.445 -37.762 6.836   1.00 111.98 ? 67  ASP B CA    1 
ATOM   5038 C  C     . ASP B 2 67  ? -36.097 -36.474 7.579   1.00 110.72 ? 67  ASP B C     1 
ATOM   5039 O  O     . ASP B 2 67  ? -35.562 -36.510 8.691   1.00 106.10 ? 67  ASP B O     1 
ATOM   5040 C  CB    . ASP B 2 67  ? -36.411 -38.979 7.767   1.00 117.41 ? 67  ASP B CB    1 
ATOM   5041 C  CG    . ASP B 2 67  ? -37.180 -40.160 7.206   1.00 115.20 ? 67  ASP B CG    1 
ATOM   5042 O  OD1   . ASP B 2 67  ? -38.250 -39.938 6.601   1.00 107.73 ? 67  ASP B OD1   1 
ATOM   5043 O  OD2   . ASP B 2 67  ? -36.714 -41.307 7.367   1.00 112.16 ? 67  ASP B OD2   1 
ATOM   5044 N  N     . SER B 2 68  ? -36.419 -35.338 6.961   1.00 105.90 ? 68  SER B N     1 
ATOM   5045 C  CA    . SER B 2 68  ? -36.284 -34.028 7.583   1.00 100.51 ? 68  SER B CA    1 
ATOM   5046 C  C     . SER B 2 68  ? -36.921 -32.991 6.673   1.00 87.21  ? 68  SER B C     1 
ATOM   5047 O  O     . SER B 2 68  ? -36.731 -33.032 5.454   1.00 86.56  ? 68  SER B O     1 
ATOM   5048 C  CB    . SER B 2 68  ? -34.814 -33.667 7.842   1.00 100.17 ? 68  SER B CB    1 
ATOM   5049 O  OG    . SER B 2 68  ? -34.707 -32.438 8.540   1.00 91.01  ? 68  SER B OG    1 
ATOM   5050 N  N     . THR B 2 69  ? -37.672 -32.064 7.269   1.00 83.71  ? 69  THR B N     1 
ATOM   5051 C  CA    . THR B 2 69  ? -38.273 -30.973 6.510   1.00 83.46  ? 69  THR B CA    1 
ATOM   5052 C  C     . THR B 2 69  ? -37.257 -29.922 6.082   1.00 80.40  ? 69  THR B C     1 
ATOM   5053 O  O     . THR B 2 69  ? -37.648 -28.926 5.463   1.00 73.27  ? 69  THR B O     1 
ATOM   5054 C  CB    . THR B 2 69  ? -39.385 -30.310 7.326   1.00 80.80  ? 69  THR B CB    1 
ATOM   5055 O  OG1   . THR B 2 69  ? -38.886 -29.953 8.621   1.00 87.63  ? 69  THR B OG1   1 
ATOM   5056 C  CG2   . THR B 2 69  ? -40.567 -31.255 7.483   1.00 71.28  ? 69  THR B CG2   1 
ATOM   5057 N  N     . LYS B 2 70  ? -35.979 -30.115 6.394   1.00 78.78  ? 70  LYS B N     1 
ATOM   5058 C  CA    . LYS B 2 70  ? -34.943 -29.185 5.976   1.00 70.36  ? 70  LYS B CA    1 
ATOM   5059 C  C     . LYS B 2 70  ? -34.619 -29.377 4.500   1.00 66.75  ? 70  LYS B C     1 
ATOM   5060 O  O     . LYS B 2 70  ? -34.526 -30.507 4.011   1.00 57.68  ? 70  LYS B O     1 
ATOM   5061 C  CB    . LYS B 2 70  ? -33.676 -29.382 6.810   1.00 65.13  ? 70  LYS B CB    1 
ATOM   5062 C  CG    . LYS B 2 70  ? -33.859 -29.178 8.305   1.00 87.73  ? 70  LYS B CG    1 
ATOM   5063 C  CD    . LYS B 2 70  ? -32.593 -29.558 9.060   1.00 101.69 ? 70  LYS B CD    1 
ATOM   5064 C  CE    . LYS B 2 70  ? -32.737 -29.324 10.555  1.00 96.22  ? 70  LYS B CE    1 
ATOM   5065 N  NZ    . LYS B 2 70  ? -32.872 -27.878 10.885  1.00 93.06  ? 70  LYS B NZ    1 
ATOM   5066 N  N     . TRP B 2 71  ? -34.453 -28.265 3.792   1.00 57.82  ? 71  TRP B N     1 
ATOM   5067 C  CA    . TRP B 2 71  ? -33.984 -28.271 2.416   1.00 43.16  ? 71  TRP B CA    1 
ATOM   5068 C  C     . TRP B 2 71  ? -32.546 -27.772 2.366   1.00 40.73  ? 71  TRP B C     1 
ATOM   5069 O  O     . TRP B 2 71  ? -32.126 -26.950 3.186   1.00 49.97  ? 71  TRP B O     1 
ATOM   5070 C  CB    . TRP B 2 71  ? -34.870 -27.403 1.518   1.00 45.78  ? 71  TRP B CB    1 
ATOM   5071 C  CG    . TRP B 2 71  ? -36.175 -28.042 1.157   1.00 48.57  ? 71  TRP B CG    1 
ATOM   5072 C  CD1   . TRP B 2 71  ? -37.331 -28.010 1.880   1.00 43.97  ? 71  TRP B CD1   1 
ATOM   5073 C  CD2   . TRP B 2 71  ? -36.461 -28.801 -0.025  1.00 43.49  ? 71  TRP B CD2   1 
ATOM   5074 N  NE1   . TRP B 2 71  ? -38.319 -28.706 1.225   1.00 41.76  ? 71  TRP B NE1   1 
ATOM   5075 C  CE2   . TRP B 2 71  ? -37.811 -29.201 0.052   1.00 48.47  ? 71  TRP B CE2   1 
ATOM   5076 C  CE3   . TRP B 2 71  ? -35.707 -29.182 -1.139  1.00 49.39  ? 71  TRP B CE3   1 
ATOM   5077 C  CZ2   . TRP B 2 71  ? -38.422 -29.964 -0.941  1.00 47.86  ? 71  TRP B CZ2   1 
ATOM   5078 C  CZ3   . TRP B 2 71  ? -36.317 -29.941 -2.126  1.00 45.54  ? 71  TRP B CZ3   1 
ATOM   5079 C  CH2   . TRP B 2 71  ? -37.660 -30.324 -2.019  1.00 45.24  ? 71  TRP B CH2   1 
ATOM   5080 N  N     . ARG B 2 72  ? -31.792 -28.282 1.396   1.00 47.24  ? 72  ARG B N     1 
ATOM   5081 C  CA    . ARG B 2 72  ? -30.385 -27.942 1.229   1.00 46.35  ? 72  ARG B CA    1 
ATOM   5082 C  C     . ARG B 2 72  ? -30.206 -27.257 -0.118  1.00 49.50  ? 72  ARG B C     1 
ATOM   5083 O  O     . ARG B 2 72  ? -30.454 -27.863 -1.166  1.00 44.55  ? 72  ARG B O     1 
ATOM   5084 C  CB    . ARG B 2 72  ? -29.505 -29.190 1.329   1.00 52.05  ? 72  ARG B CB    1 
ATOM   5085 C  CG    . ARG B 2 72  ? -28.176 -28.979 2.042   1.00 56.74  ? 72  ARG B CG    1 
ATOM   5086 C  CD    . ARG B 2 72  ? -27.172 -28.237 1.174   1.00 59.91  ? 72  ARG B CD    1 
ATOM   5087 N  NE    . ARG B 2 72  ? -25.842 -28.224 1.779   1.00 65.47  ? 72  ARG B NE    1 
ATOM   5088 C  CZ    . ARG B 2 72  ? -24.758 -27.728 1.192   1.00 59.74  ? 72  ARG B CZ    1 
ATOM   5089 N  NH1   . ARG B 2 72  ? -24.841 -27.201 -0.022  1.00 54.47  ? 72  ARG B NH1   1 
ATOM   5090 N  NH2   . ARG B 2 72  ? -23.588 -27.760 1.817   1.00 49.43  ? 72  ARG B NH2   1 
ATOM   5091 N  N     . LYS B 2 73  ? -29.784 -25.996 -0.085  1.00 46.83  ? 73  LYS B N     1 
ATOM   5092 C  CA    . LYS B 2 73  ? -29.521 -25.256 -1.310  1.00 45.14  ? 73  LYS B CA    1 
ATOM   5093 C  C     . LYS B 2 73  ? -28.245 -25.769 -1.965  1.00 43.10  ? 73  LYS B C     1 
ATOM   5094 O  O     . LYS B 2 73  ? -27.198 -25.865 -1.318  1.00 47.49  ? 73  LYS B O     1 
ATOM   5095 C  CB    . LYS B 2 73  ? -29.401 -23.764 -1.000  1.00 34.08  ? 73  LYS B CB    1 
ATOM   5096 C  CG    . LYS B 2 73  ? -29.148 -22.869 -2.202  1.00 34.43  ? 73  LYS B CG    1 
ATOM   5097 C  CD    . LYS B 2 73  ? -29.037 -21.415 -1.759  1.00 50.70  ? 73  LYS B CD    1 
ATOM   5098 C  CE    . LYS B 2 73  ? -29.059 -20.454 -2.935  1.00 51.15  ? 73  LYS B CE    1 
ATOM   5099 N  NZ    . LYS B 2 73  ? -27.847 -20.561 -3.786  1.00 67.36  ? 73  LYS B NZ    1 
ATOM   5100 N  N     . LEU B 2 74  ? -28.333 -26.107 -3.249  1.00 43.16  ? 74  LEU B N     1 
ATOM   5101 C  CA    . LEU B 2 74  ? -27.198 -26.609 -4.014  1.00 47.65  ? 74  LEU B CA    1 
ATOM   5102 C  C     . LEU B 2 74  ? -26.948 -25.689 -5.199  1.00 41.87  ? 74  LEU B C     1 
ATOM   5103 O  O     . LEU B 2 74  ? -27.853 -25.453 -6.007  1.00 47.30  ? 74  LEU B O     1 
ATOM   5104 C  CB    . LEU B 2 74  ? -27.441 -28.042 -4.491  1.00 43.08  ? 74  LEU B CB    1 
ATOM   5105 C  CG    . LEU B 2 74  ? -27.012 -29.162 -3.541  1.00 52.50  ? 74  LEU B CG    1 
ATOM   5106 C  CD1   . LEU B 2 74  ? -27.216 -30.520 -4.192  1.00 52.85  ? 74  LEU B CD1   1 
ATOM   5107 C  CD2   . LEU B 2 74  ? -25.563 -28.979 -3.120  1.00 53.24  ? 74  LEU B CD2   1 
ATOM   5108 N  N     . VAL B 2 75  ? -25.725 -25.176 -5.301  1.00 46.20  ? 75  VAL B N     1 
ATOM   5109 C  CA    . VAL B 2 75  ? -25.301 -24.334 -6.413  1.00 30.74  ? 75  VAL B CA    1 
ATOM   5110 C  C     . VAL B 2 75  ? -24.340 -25.141 -7.273  1.00 44.92  ? 75  VAL B C     1 
ATOM   5111 O  O     . VAL B 2 75  ? -23.358 -25.695 -6.764  1.00 44.04  ? 75  VAL B O     1 
ATOM   5112 C  CB    . VAL B 2 75  ? -24.641 -23.035 -5.919  1.00 40.04  ? 75  VAL B CB    1 
ATOM   5113 C  CG1   . VAL B 2 75  ? -24.568 -22.019 -7.042  1.00 36.55  ? 75  VAL B CG1   1 
ATOM   5114 C  CG2   . VAL B 2 75  ? -25.399 -22.473 -4.729  1.00 43.45  ? 75  VAL B CG2   1 
ATOM   5115 N  N     . ASP B 2 76  ? -24.622 -25.208 -8.575  1.00 42.02  ? 76  ASP B N     1 
ATOM   5116 C  CA    . ASP B 2 76  ? -23.810 -25.986 -9.511  1.00 39.49  ? 76  ASP B CA    1 
ATOM   5117 C  C     . ASP B 2 76  ? -22.607 -25.148 -9.935  1.00 39.72  ? 76  ASP B C     1 
ATOM   5118 O  O     . ASP B 2 76  ? -22.552 -24.575 -11.026 1.00 34.93  ? 76  ASP B O     1 
ATOM   5119 C  CB    . ASP B 2 76  ? -24.646 -26.423 -10.707 1.00 38.96  ? 76  ASP B CB    1 
ATOM   5120 C  CG    . ASP B 2 76  ? -23.861 -27.271 -11.685 1.00 41.14  ? 76  ASP B CG    1 
ATOM   5121 O  OD1   . ASP B 2 76  ? -22.810 -27.813 -11.286 1.00 41.72  ? 76  ASP B OD1   1 
ATOM   5122 O  OD2   . ASP B 2 76  ? -24.297 -27.399 -12.848 1.00 38.95  ? 76  ASP B OD2   1 
ATOM   5123 N  N     . PHE B 2 77  ? -21.610 -25.103 -9.054  1.00 35.74  ? 77  PHE B N     1 
ATOM   5124 C  CA    . PHE B 2 77  ? -20.435 -24.258 -9.225  1.00 38.32  ? 77  PHE B CA    1 
ATOM   5125 C  C     . PHE B 2 77  ? -19.309 -24.925 -10.006 1.00 41.48  ? 77  PHE B C     1 
ATOM   5126 O  O     . PHE B 2 77  ? -18.211 -24.363 -10.073 1.00 47.81  ? 77  PHE B O     1 
ATOM   5127 C  CB    . PHE B 2 77  ? -19.902 -23.821 -7.859  1.00 38.12  ? 77  PHE B CB    1 
ATOM   5128 C  CG    . PHE B 2 77  ? -20.507 -22.549 -7.346  1.00 45.87  ? 77  PHE B CG    1 
ATOM   5129 C  CD1   . PHE B 2 77  ? -20.777 -21.496 -8.204  1.00 38.27  ? 77  PHE B CD1   1 
ATOM   5130 C  CD2   . PHE B 2 77  ? -20.799 -22.404 -6.001  1.00 42.84  ? 77  PHE B CD2   1 
ATOM   5131 C  CE1   . PHE B 2 77  ? -21.329 -20.322 -7.728  1.00 44.19  ? 77  PHE B CE1   1 
ATOM   5132 C  CE2   . PHE B 2 77  ? -21.352 -21.236 -5.520  1.00 40.77  ? 77  PHE B CE2   1 
ATOM   5133 C  CZ    . PHE B 2 77  ? -21.616 -20.192 -6.383  1.00 43.44  ? 77  PHE B CZ    1 
ATOM   5134 N  N     . ARG B 2 78  ? -19.543 -26.099 -10.598 1.00 35.96  ? 78  ARG B N     1 
ATOM   5135 C  CA    . ARG B 2 78  ? -18.449 -26.818 -11.245 1.00 45.71  ? 78  ARG B CA    1 
ATOM   5136 C  C     . ARG B 2 78  ? -17.896 -26.078 -12.457 1.00 43.36  ? 78  ARG B C     1 
ATOM   5137 O  O     . ARG B 2 78  ? -16.733 -26.293 -12.816 1.00 44.21  ? 78  ARG B O     1 
ATOM   5138 C  CB    . ARG B 2 78  ? -18.895 -28.225 -11.643 1.00 43.86  ? 78  ARG B CB    1 
ATOM   5139 C  CG    . ARG B 2 78  ? -20.033 -28.262 -12.634 1.00 55.17  ? 78  ARG B CG    1 
ATOM   5140 C  CD    . ARG B 2 78  ? -20.603 -29.668 -12.772 1.00 45.23  ? 78  ARG B CD    1 
ATOM   5141 N  NE    . ARG B 2 78  ? -22.005 -29.630 -13.175 1.00 52.21  ? 78  ARG B NE    1 
ATOM   5142 C  CZ    . ARG B 2 78  ? -22.687 -30.677 -13.624 1.00 39.85  ? 78  ARG B CZ    1 
ATOM   5143 N  NH1   . ARG B 2 78  ? -22.094 -31.858 -13.740 1.00 40.14  ? 78  ARG B NH1   1 
ATOM   5144 N  NH2   . ARG B 2 78  ? -23.960 -30.539 -13.966 1.00 46.28  ? 78  ARG B NH2   1 
ATOM   5145 N  N     . GLU B 2 79  ? -18.688 -25.211 -13.092 1.00 42.76  ? 79  GLU B N     1 
ATOM   5146 C  CA    . GLU B 2 79  ? -18.144 -24.387 -14.168 1.00 39.84  ? 79  GLU B CA    1 
ATOM   5147 C  C     . GLU B 2 79  ? -17.245 -23.290 -13.612 1.00 42.27  ? 79  GLU B C     1 
ATOM   5148 O  O     . GLU B 2 79  ? -16.193 -22.989 -14.187 1.00 39.50  ? 79  GLU B O     1 
ATOM   5149 C  CB    . GLU B 2 79  ? -19.274 -23.785 -15.003 1.00 44.53  ? 79  GLU B CB    1 
ATOM   5150 C  CG    . GLU B 2 79  ? -18.808 -23.159 -16.311 1.00 47.56  ? 79  GLU B CG    1 
ATOM   5151 C  CD    . GLU B 2 79  ? -18.192 -24.176 -17.253 1.00 58.74  ? 79  GLU B CD    1 
ATOM   5152 O  OE1   . GLU B 2 79  ? -18.676 -25.327 -17.287 1.00 47.21  ? 79  GLU B OE1   1 
ATOM   5153 O  OE2   . GLU B 2 79  ? -17.217 -23.830 -17.953 1.00 63.17  ? 79  GLU B OE2   1 
ATOM   5154 N  N     . LEU B 2 80  ? -17.643 -22.683 -12.492 1.00 39.47  ? 80  LEU B N     1 
ATOM   5155 C  CA    . LEU B 2 80  ? -16.791 -21.691 -11.844 1.00 40.25  ? 80  LEU B CA    1 
ATOM   5156 C  C     . LEU B 2 80  ? -15.541 -22.336 -11.260 1.00 39.68  ? 80  LEU B C     1 
ATOM   5157 O  O     . LEU B 2 80  ? -14.461 -21.732 -11.271 1.00 43.62  ? 80  LEU B O     1 
ATOM   5158 C  CB    . LEU B 2 80  ? -17.573 -20.958 -10.754 1.00 33.82  ? 80  LEU B CB    1 
ATOM   5159 C  CG    . LEU B 2 80  ? -16.800 -19.926 -9.928  1.00 42.61  ? 80  LEU B CG    1 
ATOM   5160 C  CD1   . LEU B 2 80  ? -16.376 -18.747 -10.790 1.00 43.42  ? 80  LEU B CD1   1 
ATOM   5161 C  CD2   . LEU B 2 80  ? -17.621 -19.457 -8.735  1.00 39.20  ? 80  LEU B CD2   1 
ATOM   5162 N  N     . ASN B 2 81  ? -15.668 -23.562 -10.745 1.00 43.27  ? 81  ASN B N     1 
ATOM   5163 C  CA    . ASN B 2 81  ? -14.518 -24.241 -10.154 1.00 45.74  ? 81  ASN B CA    1 
ATOM   5164 C  C     . ASN B 2 81  ? -13.449 -24.530 -11.201 1.00 45.41  ? 81  ASN B C     1 
ATOM   5165 O  O     . ASN B 2 81  ? -12.250 -24.409 -10.923 1.00 49.70  ? 81  ASN B O     1 
ATOM   5166 C  CB    . ASN B 2 81  ? -14.965 -25.533 -9.470  1.00 38.61  ? 81  ASN B CB    1 
ATOM   5167 C  CG    . ASN B 2 81  ? -15.895 -25.280 -8.299  1.00 41.10  ? 81  ASN B CG    1 
ATOM   5168 O  OD1   . ASN B 2 81  ? -15.843 -24.223 -7.666  1.00 41.65  ? 81  ASN B OD1   1 
ATOM   5169 N  ND2   . ASN B 2 81  ? -16.752 -26.250 -8.003  1.00 38.34  ? 81  ASN B ND2   1 
ATOM   5170 N  N     . LYS B 2 82  ? -13.863 -24.916 -12.411 1.00 43.88  ? 82  LYS B N     1 
ATOM   5171 C  CA    . LYS B 2 82  ? -12.903 -25.119 -13.491 1.00 49.26  ? 82  LYS B CA    1 
ATOM   5172 C  C     . LYS B 2 82  ? -12.188 -23.825 -13.853 1.00 49.09  ? 82  LYS B C     1 
ATOM   5173 O  O     . LYS B 2 82  ? -11.012 -23.850 -14.233 1.00 60.51  ? 82  LYS B O     1 
ATOM   5174 C  CB    . LYS B 2 82  ? -13.606 -25.689 -14.724 1.00 44.85  ? 82  LYS B CB    1 
ATOM   5175 C  CG    . LYS B 2 82  ? -14.142 -27.097 -14.551 1.00 55.67  ? 82  LYS B CG    1 
ATOM   5176 C  CD    . LYS B 2 82  ? -15.121 -27.447 -15.662 1.00 63.44  ? 82  LYS B CD    1 
ATOM   5177 C  CE    . LYS B 2 82  ? -14.472 -27.343 -17.033 1.00 73.52  ? 82  LYS B CE    1 
ATOM   5178 N  NZ    . LYS B 2 82  ? -15.435 -27.671 -18.122 1.00 70.25  ? 82  LYS B NZ    1 
ATOM   5179 N  N     . ARG B 2 83  ? -12.875 -22.691 -13.737 1.00 48.61  ? 83  ARG B N     1 
ATOM   5180 C  CA    . ARG B 2 83  ? -12.324 -21.400 -14.118 1.00 46.22  ? 83  ARG B CA    1 
ATOM   5181 C  C     . ARG B 2 83  ? -11.654 -20.667 -12.962 1.00 48.88  ? 83  ARG B C     1 
ATOM   5182 O  O     . ARG B 2 83  ? -11.013 -19.637 -13.193 1.00 57.02  ? 83  ARG B O     1 
ATOM   5183 C  CB    . ARG B 2 83  ? -13.428 -20.518 -14.710 1.00 36.49  ? 83  ARG B CB    1 
ATOM   5184 C  CG    . ARG B 2 83  ? -14.148 -21.157 -15.888 1.00 41.02  ? 83  ARG B CG    1 
ATOM   5185 C  CD    . ARG B 2 83  ? -15.469 -20.466 -16.179 1.00 45.23  ? 83  ARG B CD    1 
ATOM   5186 N  NE    . ARG B 2 83  ? -16.233 -21.168 -17.207 1.00 43.15  ? 83  ARG B NE    1 
ATOM   5187 C  CZ    . ARG B 2 83  ? -16.232 -20.842 -18.495 1.00 52.62  ? 83  ARG B CZ    1 
ATOM   5188 N  NH1   . ARG B 2 83  ? -15.508 -19.815 -18.921 1.00 55.17  ? 83  ARG B NH1   1 
ATOM   5189 N  NH2   . ARG B 2 83  ? -16.957 -21.540 -19.357 1.00 51.13  ? 83  ARG B NH2   1 
ATOM   5190 N  N     . THR B 2 84  ? -11.783 -21.167 -11.738 1.00 48.05  ? 84  THR B N     1 
ATOM   5191 C  CA    . THR B 2 84  ? -11.176 -20.521 -10.579 1.00 46.89  ? 84  THR B CA    1 
ATOM   5192 C  C     . THR B 2 84  ? -9.675  -20.789 -10.523 1.00 53.44  ? 84  THR B C     1 
ATOM   5193 O  O     . THR B 2 84  ? -9.211  -21.859 -10.916 1.00 61.24  ? 84  THR B O     1 
ATOM   5194 C  CB    . THR B 2 84  ? -11.823 -20.994 -9.264  1.00 45.93  ? 84  THR B CB    1 
ATOM   5195 O  OG1   . THR B 2 84  ? -13.215 -20.653 -9.263  1.00 53.36  ? 84  THR B OG1   1 
ATOM   5196 C  CG2   . THR B 2 84  ? -11.144 -20.340 -8.070  1.00 45.58  ? 84  THR B CG2   1 
ATOM   5197 N  N     . HIS B 2 96  ? -2.997  -36.565 0.500   1.00 58.29  ? 96  HIS B N     1 
ATOM   5198 C  CA    . HIS B 2 96  ? -4.258  -37.273 0.685   1.00 62.79  ? 96  HIS B CA    1 
ATOM   5199 C  C     . HIS B 2 96  ? -4.096  -38.438 1.656   1.00 63.88  ? 96  HIS B C     1 
ATOM   5200 O  O     . HIS B 2 96  ? -3.224  -39.287 1.472   1.00 68.32  ? 96  HIS B O     1 
ATOM   5201 C  CB    . HIS B 2 96  ? -4.792  -37.775 -0.658  1.00 56.43  ? 96  HIS B CB    1 
ATOM   5202 C  CG    . HIS B 2 96  ? -6.081  -38.529 -0.553  1.00 59.67  ? 96  HIS B CG    1 
ATOM   5203 N  ND1   . HIS B 2 96  ? -7.280  -37.916 -0.256  1.00 47.00  ? 96  HIS B ND1   1 
ATOM   5204 C  CD2   . HIS B 2 96  ? -6.358  -39.845 -0.705  1.00 55.87  ? 96  HIS B CD2   1 
ATOM   5205 C  CE1   . HIS B 2 96  ? -8.240  -38.824 -0.229  1.00 55.32  ? 96  HIS B CE1   1 
ATOM   5206 N  NE2   . HIS B 2 96  ? -7.707  -40.002 -0.499  1.00 52.00  ? 96  HIS B NE2   1 
ATOM   5207 N  N     . PRO B 2 97  ? -4.939  -38.476 2.691   1.00 58.57  ? 97  PRO B N     1 
ATOM   5208 C  CA    . PRO B 2 97  ? -4.834  -39.544 3.696   1.00 55.44  ? 97  PRO B CA    1 
ATOM   5209 C  C     . PRO B 2 97  ? -5.110  -40.924 3.120   1.00 64.14  ? 97  PRO B C     1 
ATOM   5210 O  O     . PRO B 2 97  ? -6.263  -41.275 2.853   1.00 62.03  ? 97  PRO B O     1 
ATOM   5211 C  CB    . PRO B 2 97  ? -5.892  -39.154 4.738   1.00 53.10  ? 97  PRO B CB    1 
ATOM   5212 C  CG    . PRO B 2 97  ? -6.138  -37.695 4.516   1.00 65.95  ? 97  PRO B CG    1 
ATOM   5213 C  CD    . PRO B 2 97  ? -5.967  -37.484 3.044   1.00 61.99  ? 97  PRO B CD    1 
ATOM   5214 N  N     . ALA B 2 98  ? -4.053  -41.717 2.931   1.00 63.89  ? 98  ALA B N     1 
ATOM   5215 C  CA    . ALA B 2 98  ? -4.219  -43.067 2.406   1.00 55.55  ? 98  ALA B CA    1 
ATOM   5216 C  C     . ALA B 2 98  ? -4.895  -43.998 3.404   1.00 66.10  ? 98  ALA B C     1 
ATOM   5217 O  O     . ALA B 2 98  ? -5.481  -45.006 2.991   1.00 60.45  ? 98  ALA B O     1 
ATOM   5218 C  CB    . ALA B 2 98  ? -2.864  -43.643 1.993   1.00 47.18  ? 98  ALA B CB    1 
ATOM   5219 N  N     . GLY B 2 99  ? -4.829  -43.689 4.699   1.00 59.19  ? 99  GLY B N     1 
ATOM   5220 C  CA    . GLY B 2 99  ? -5.462  -44.526 5.701   1.00 59.31  ? 99  GLY B CA    1 
ATOM   5221 C  C     . GLY B 2 99  ? -6.957  -44.350 5.840   1.00 70.76  ? 99  GLY B C     1 
ATOM   5222 O  O     . GLY B 2 99  ? -7.584  -45.087 6.607   1.00 74.69  ? 99  GLY B O     1 
ATOM   5223 N  N     . LEU B 2 100 ? -7.543  -43.389 5.118   1.00 59.96  ? 100 LEU B N     1 
ATOM   5224 C  CA    . LEU B 2 100 ? -8.981  -43.166 5.213   1.00 66.24  ? 100 LEU B CA    1 
ATOM   5225 C  C     . LEU B 2 100 ? -9.763  -44.329 4.614   1.00 74.08  ? 100 LEU B C     1 
ATOM   5226 O  O     . LEU B 2 100 ? -10.831 -44.694 5.122   1.00 69.17  ? 100 LEU B O     1 
ATOM   5227 C  CB    . LEU B 2 100 ? -9.355  -41.855 4.522   1.00 59.43  ? 100 LEU B CB    1 
ATOM   5228 C  CG    . LEU B 2 100 ? -10.834 -41.467 4.545   1.00 61.78  ? 100 LEU B CG    1 
ATOM   5229 C  CD1   . LEU B 2 100 ? -11.334 -41.325 5.976   1.00 57.26  ? 100 LEU B CD1   1 
ATOM   5230 C  CD2   . LEU B 2 100 ? -11.066 -40.182 3.767   1.00 59.82  ? 100 LEU B CD2   1 
ATOM   5231 N  N     . LYS B 2 101 ? -9.251  -44.924 3.540   1.00 70.59  ? 101 LYS B N     1 
ATOM   5232 C  CA    . LYS B 2 101 ? -9.903  -46.054 2.891   1.00 73.25  ? 101 LYS B CA    1 
ATOM   5233 C  C     . LYS B 2 101 ? -9.658  -47.375 3.612   1.00 77.45  ? 101 LYS B C     1 
ATOM   5234 O  O     . LYS B 2 101 ? -9.941  -48.435 3.045   1.00 77.08  ? 101 LYS B O     1 
ATOM   5235 C  CB    . LYS B 2 101 ? -9.440  -46.167 1.436   1.00 64.17  ? 101 LYS B CB    1 
ATOM   5236 C  CG    . LYS B 2 101 ? -7.942  -46.366 1.270   1.00 64.51  ? 101 LYS B CG    1 
ATOM   5237 C  CD    . LYS B 2 101 ? -7.568  -46.549 -0.193  1.00 63.12  ? 101 LYS B CD    1 
ATOM   5238 C  CE    . LYS B 2 101 ? -6.068  -46.724 -0.368  1.00 43.02  ? 101 LYS B CE    1 
ATOM   5239 N  NZ    . LYS B 2 101 ? -5.311  -45.519 0.064   1.00 55.81  ? 101 LYS B NZ    1 
ATOM   5240 N  N     . LYS B 2 102 ? -9.143  -47.335 4.842   1.00 77.80  ? 102 LYS B N     1 
ATOM   5241 C  CA    . LYS B 2 102 ? -8.840  -48.539 5.605   1.00 72.03  ? 102 LYS B CA    1 
ATOM   5242 C  C     . LYS B 2 102 ? -9.558  -48.575 6.948   1.00 76.06  ? 102 LYS B C     1 
ATOM   5243 O  O     . LYS B 2 102 ? -9.207  -49.394 7.806   1.00 83.89  ? 102 LYS B O     1 
ATOM   5244 C  CB    . LYS B 2 102 ? -7.328  -48.663 5.817   1.00 69.80  ? 102 LYS B CB    1 
ATOM   5245 C  CG    . LYS B 2 102 ? -6.516  -48.558 4.537   1.00 72.19  ? 102 LYS B CG    1 
ATOM   5246 C  CD    . LYS B 2 102 ? -5.033  -48.414 4.830   1.00 70.59  ? 102 LYS B CD    1 
ATOM   5247 C  CE    . LYS B 2 102 ? -4.240  -48.203 3.551   1.00 62.63  ? 102 LYS B CE    1 
ATOM   5248 N  NZ    . LYS B 2 102 ? -2.790  -48.000 3.823   1.00 87.68  ? 102 LYS B NZ    1 
ATOM   5249 N  N     . LYS B 2 103 ? -10.551 -47.715 7.155   1.00 73.93  ? 103 LYS B N     1 
ATOM   5250 C  CA    . LYS B 2 103 ? -11.291 -47.654 8.406   1.00 71.45  ? 103 LYS B CA    1 
ATOM   5251 C  C     . LYS B 2 103 ? -12.572 -48.474 8.310   1.00 63.13  ? 103 LYS B C     1 
ATOM   5252 O  O     . LYS B 2 103 ? -13.143 -48.646 7.230   1.00 67.40  ? 103 LYS B O     1 
ATOM   5253 C  CB    . LYS B 2 103 ? -11.627 -46.206 8.770   1.00 67.75  ? 103 LYS B CB    1 
ATOM   5254 C  CG    . LYS B 2 103 ? -10.419 -45.359 9.141   1.00 69.14  ? 103 LYS B CG    1 
ATOM   5255 C  CD    . LYS B 2 103 ? -9.734  -45.900 10.387  1.00 69.40  ? 103 LYS B CD    1 
ATOM   5256 C  CE    . LYS B 2 103 ? -8.639  -44.963 10.874  1.00 66.51  ? 103 LYS B CE    1 
ATOM   5257 N  NZ    . LYS B 2 103 ? -7.557  -44.795 9.865   1.00 68.84  ? 103 LYS B NZ    1 
ATOM   5258 N  N     . LYS B 2 104 ? -13.018 -48.982 9.461   1.00 60.77  ? 104 LYS B N     1 
ATOM   5259 C  CA    . LYS B 2 104 ? -14.244 -49.774 9.498   1.00 67.32  ? 104 LYS B CA    1 
ATOM   5260 C  C     . LYS B 2 104 ? -15.459 -48.923 9.153   1.00 73.57  ? 104 LYS B C     1 
ATOM   5261 O  O     . LYS B 2 104 ? -16.290 -49.314 8.325   1.00 69.45  ? 104 LYS B O     1 
ATOM   5262 C  CB    . LYS B 2 104 ? -14.416 -50.421 10.875  1.00 79.13  ? 104 LYS B CB    1 
ATOM   5263 C  CG    . LYS B 2 104 ? -13.631 -51.711 11.085  1.00 81.17  ? 104 LYS B CG    1 
ATOM   5264 C  CD    . LYS B 2 104 ? -12.159 -51.446 11.355  1.00 79.79  ? 104 LYS B CD    1 
ATOM   5265 C  CE    . LYS B 2 104 ? -11.429 -52.725 11.733  1.00 86.38  ? 104 LYS B CE    1 
ATOM   5266 N  NZ    . LYS B 2 104 ? -11.997 -53.340 12.966  1.00 81.77  ? 104 LYS B NZ    1 
ATOM   5267 N  N     . SER B 2 105 ? -15.580 -47.754 9.779   1.00 57.36  ? 105 SER B N     1 
ATOM   5268 C  CA    . SER B 2 105 ? -16.700 -46.853 9.553   1.00 67.27  ? 105 SER B CA    1 
ATOM   5269 C  C     . SER B 2 105 ? -16.181 -45.452 9.270   1.00 66.17  ? 105 SER B C     1 
ATOM   5270 O  O     . SER B 2 105 ? -15.256 -44.977 9.935   1.00 67.55  ? 105 SER B O     1 
ATOM   5271 C  CB    . SER B 2 105 ? -17.646 -46.823 10.759  1.00 69.22  ? 105 SER B CB    1 
ATOM   5272 O  OG    . SER B 2 105 ? -18.153 -48.115 11.042  1.00 65.86  ? 105 SER B OG    1 
ATOM   5273 N  N     . VAL B 2 106 ? -16.780 -44.797 8.278   1.00 69.85  ? 106 VAL B N     1 
ATOM   5274 C  CA    . VAL B 2 106 ? -16.457 -43.419 7.924   1.00 60.19  ? 106 VAL B CA    1 
ATOM   5275 C  C     . VAL B 2 106 ? -17.764 -42.649 7.807   1.00 57.65  ? 106 VAL B C     1 
ATOM   5276 O  O     . VAL B 2 106 ? -18.639 -43.021 7.015   1.00 67.99  ? 106 VAL B O     1 
ATOM   5277 C  CB    . VAL B 2 106 ? -15.656 -43.323 6.614   1.00 54.98  ? 106 VAL B CB    1 
ATOM   5278 C  CG1   . VAL B 2 106 ? -15.446 -41.867 6.231   1.00 49.35  ? 106 VAL B CG1   1 
ATOM   5279 C  CG2   . VAL B 2 106 ? -14.319 -44.035 6.751   1.00 40.32  ? 106 VAL B CG2   1 
ATOM   5280 N  N     . THR B 2 107 ? -17.899 -41.585 8.591   1.00 49.33  ? 107 THR B N     1 
ATOM   5281 C  CA    . THR B 2 107 ? -19.089 -40.747 8.579   1.00 56.32  ? 107 THR B CA    1 
ATOM   5282 C  C     . THR B 2 107 ? -18.806 -39.457 7.819   1.00 56.99  ? 107 THR B C     1 
ATOM   5283 O  O     . THR B 2 107 ? -17.735 -38.862 7.963   1.00 64.59  ? 107 THR B O     1 
ATOM   5284 C  CB    . THR B 2 107 ? -19.548 -40.427 10.004  1.00 54.29  ? 107 THR B CB    1 
ATOM   5285 O  OG1   . THR B 2 107 ? -19.793 -41.647 10.712  1.00 46.48  ? 107 THR B OG1   1 
ATOM   5286 C  CG2   . THR B 2 107 ? -20.826 -39.598 9.989   1.00 52.45  ? 107 THR B CG2   1 
ATOM   5287 N  N     . VAL B 2 108 ? -19.770 -39.035 7.006   1.00 57.55  ? 108 VAL B N     1 
ATOM   5288 C  CA    . VAL B 2 108 ? -19.659 -37.821 6.207   1.00 55.46  ? 108 VAL B CA    1 
ATOM   5289 C  C     . VAL B 2 108 ? -20.494 -36.734 6.870   1.00 54.96  ? 108 VAL B C     1 
ATOM   5290 O  O     . VAL B 2 108 ? -21.719 -36.860 6.980   1.00 56.67  ? 108 VAL B O     1 
ATOM   5291 C  CB    . VAL B 2 108 ? -20.113 -38.060 4.758   1.00 54.10  ? 108 VAL B CB    1 
ATOM   5292 C  CG1   . VAL B 2 108 ? -19.849 -36.825 3.907   1.00 53.86  ? 108 VAL B CG1   1 
ATOM   5293 C  CG2   . VAL B 2 108 ? -19.415 -39.280 4.177   1.00 47.77  ? 108 VAL B CG2   1 
ATOM   5294 N  N     . LEU B 2 109 ? -19.834 -35.667 7.312   1.00 53.99  ? 109 LEU B N     1 
ATOM   5295 C  CA    . LEU B 2 109 ? -20.501 -34.534 7.938   1.00 53.31  ? 109 LEU B CA    1 
ATOM   5296 C  C     . LEU B 2 109 ? -20.570 -33.368 6.960   1.00 56.56  ? 109 LEU B C     1 
ATOM   5297 O  O     . LEU B 2 109 ? -19.617 -33.108 6.220   1.00 58.85  ? 109 LEU B O     1 
ATOM   5298 C  CB    . LEU B 2 109 ? -19.775 -34.096 9.214   1.00 55.83  ? 109 LEU B CB    1 
ATOM   5299 C  CG    . LEU B 2 109 ? -19.798 -35.020 10.437  1.00 58.39  ? 109 LEU B CG    1 
ATOM   5300 C  CD1   . LEU B 2 109 ? -21.191 -35.597 10.661  1.00 62.07  ? 109 LEU B CD1   1 
ATOM   5301 C  CD2   . LEU B 2 109 ? -18.753 -36.125 10.336  1.00 69.99  ? 109 LEU B CD2   1 
ATOM   5302 N  N     . ASP B 2 110 ? -21.702 -32.669 6.964   1.00 53.13  ? 110 ASP B N     1 
ATOM   5303 C  CA    . ASP B 2 110 ? -21.917 -31.505 6.108   1.00 51.95  ? 110 ASP B CA    1 
ATOM   5304 C  C     . ASP B 2 110 ? -21.571 -30.258 6.915   1.00 55.30  ? 110 ASP B C     1 
ATOM   5305 O  O     . ASP B 2 110 ? -22.347 -29.822 7.770   1.00 57.76  ? 110 ASP B O     1 
ATOM   5306 C  CB    . ASP B 2 110 ? -23.353 -31.467 5.596   1.00 51.60  ? 110 ASP B CB    1 
ATOM   5307 C  CG    . ASP B 2 110 ? -23.616 -30.287 4.680   1.00 61.28  ? 110 ASP B CG    1 
ATOM   5308 O  OD1   . ASP B 2 110 ? -22.648 -29.746 4.105   1.00 53.93  ? 110 ASP B OD1   1 
ATOM   5309 O  OD2   . ASP B 2 110 ? -24.795 -29.903 4.530   1.00 70.49  ? 110 ASP B OD2   1 
ATOM   5310 N  N     . VAL B 2 111 ? -20.400 -29.683 6.641   1.00 50.73  ? 111 VAL B N     1 
ATOM   5311 C  CA    . VAL B 2 111 ? -19.920 -28.516 7.372   1.00 48.00  ? 111 VAL B CA    1 
ATOM   5312 C  C     . VAL B 2 111 ? -19.957 -27.294 6.464   1.00 57.55  ? 111 VAL B C     1 
ATOM   5313 O  O     . VAL B 2 111 ? -19.158 -26.363 6.623   1.00 57.04  ? 111 VAL B O     1 
ATOM   5314 C  CB    . VAL B 2 111 ? -18.503 -28.754 7.926   1.00 49.74  ? 111 VAL B CB    1 
ATOM   5315 C  CG1   . VAL B 2 111 ? -18.519 -29.875 8.952   1.00 51.69  ? 111 VAL B CG1   1 
ATOM   5316 C  CG2   . VAL B 2 111 ? -17.534 -29.078 6.795   1.00 49.53  ? 111 VAL B CG2   1 
ATOM   5317 N  N     . GLY B 2 112 ? -20.891 -27.284 5.510   1.00 56.10  ? 112 GLY B N     1 
ATOM   5318 C  CA    . GLY B 2 112 ? -20.976 -26.173 4.578   1.00 61.50  ? 112 GLY B CA    1 
ATOM   5319 C  C     . GLY B 2 112 ? -21.362 -24.861 5.231   1.00 62.73  ? 112 GLY B C     1 
ATOM   5320 O  O     . GLY B 2 112 ? -20.965 -23.791 4.758   1.00 57.96  ? 112 GLY B O     1 
ATOM   5321 N  N     . ASP B 2 113 ? -22.130 -24.917 6.321   1.00 54.18  ? 113 ASP B N     1 
ATOM   5322 C  CA    . ASP B 2 113 ? -22.548 -23.699 7.006   1.00 70.34  ? 113 ASP B CA    1 
ATOM   5323 C  C     . ASP B 2 113 ? -21.377 -22.943 7.621   1.00 62.06  ? 113 ASP B C     1 
ATOM   5324 O  O     . ASP B 2 113 ? -21.512 -21.748 7.909   1.00 67.27  ? 113 ASP B O     1 
ATOM   5325 C  CB    . ASP B 2 113 ? -23.576 -24.029 8.090   1.00 76.45  ? 113 ASP B CB    1 
ATOM   5326 C  CG    . ASP B 2 113 ? -24.899 -24.500 7.515   1.00 77.74  ? 113 ASP B CG    1 
ATOM   5327 O  OD1   . ASP B 2 113 ? -25.277 -24.025 6.424   1.00 81.24  ? 113 ASP B OD1   1 
ATOM   5328 O  OD2   . ASP B 2 113 ? -25.560 -25.344 8.156   1.00 82.63  ? 113 ASP B OD2   1 
ATOM   5329 N  N     . ALA B 2 114 ? -20.236 -23.605 7.825   1.00 61.08  ? 114 ALA B N     1 
ATOM   5330 C  CA    . ALA B 2 114 ? -19.079 -22.938 8.411   1.00 55.64  ? 114 ALA B CA    1 
ATOM   5331 C  C     . ALA B 2 114 ? -18.448 -21.924 7.466   1.00 52.18  ? 114 ALA B C     1 
ATOM   5332 O  O     . ALA B 2 114 ? -17.697 -21.056 7.923   1.00 59.79  ? 114 ALA B O     1 
ATOM   5333 C  CB    . ALA B 2 114 ? -18.035 -23.973 8.832   1.00 51.10  ? 114 ALA B CB    1 
ATOM   5334 N  N     . TYR B 2 115 ? -18.733 -22.012 6.165   1.00 55.17  ? 115 TYR B N     1 
ATOM   5335 C  CA    . TYR B 2 115 ? -18.160 -21.079 5.203   1.00 50.75  ? 115 TYR B CA    1 
ATOM   5336 C  C     . TYR B 2 115 ? -18.820 -19.706 5.243   1.00 55.41  ? 115 TYR B C     1 
ATOM   5337 O  O     . TYR B 2 115 ? -18.232 -18.738 4.752   1.00 50.80  ? 115 TYR B O     1 
ATOM   5338 C  CB    . TYR B 2 115 ? -18.265 -21.649 3.787   1.00 55.48  ? 115 TYR B CB    1 
ATOM   5339 C  CG    . TYR B 2 115 ? -17.434 -22.891 3.555   1.00 58.22  ? 115 TYR B CG    1 
ATOM   5340 C  CD1   . TYR B 2 115 ? -17.884 -23.902 2.716   1.00 59.47  ? 115 TYR B CD1   1 
ATOM   5341 C  CD2   . TYR B 2 115 ? -16.197 -23.048 4.165   1.00 52.01  ? 115 TYR B CD2   1 
ATOM   5342 C  CE1   . TYR B 2 115 ? -17.129 -25.039 2.497   1.00 55.29  ? 115 TYR B CE1   1 
ATOM   5343 C  CE2   . TYR B 2 115 ? -15.434 -24.181 3.952   1.00 55.46  ? 115 TYR B CE2   1 
ATOM   5344 C  CZ    . TYR B 2 115 ? -15.905 -25.173 3.117   1.00 59.20  ? 115 TYR B CZ    1 
ATOM   5345 O  OH    . TYR B 2 115 ? -15.151 -26.303 2.900   1.00 57.13  ? 115 TYR B OH    1 
ATOM   5346 N  N     . PHE B 2 116 ? -20.021 -19.600 5.813   1.00 60.99  ? 116 PHE B N     1 
ATOM   5347 C  CA    . PHE B 2 116 ? -20.746 -18.334 5.832   1.00 60.01  ? 116 PHE B CA    1 
ATOM   5348 C  C     . PHE B 2 116 ? -20.179 -17.331 6.828   1.00 66.78  ? 116 PHE B C     1 
ATOM   5349 O  O     . PHE B 2 116 ? -20.677 -16.201 6.887   1.00 65.83  ? 116 PHE B O     1 
ATOM   5350 C  CB    . PHE B 2 116 ? -22.225 -18.586 6.137   1.00 59.43  ? 116 PHE B CB    1 
ATOM   5351 C  CG    . PHE B 2 116 ? -22.939 -19.368 5.071   1.00 69.28  ? 116 PHE B CG    1 
ATOM   5352 C  CD1   . PHE B 2 116 ? -22.451 -19.403 3.774   1.00 62.42  ? 116 PHE B CD1   1 
ATOM   5353 C  CD2   . PHE B 2 116 ? -24.098 -20.068 5.364   1.00 71.38  ? 116 PHE B CD2   1 
ATOM   5354 C  CE1   . PHE B 2 116 ? -23.104 -20.122 2.791   1.00 68.60  ? 116 PHE B CE1   1 
ATOM   5355 C  CE2   . PHE B 2 116 ? -24.756 -20.788 4.385   1.00 80.00  ? 116 PHE B CE2   1 
ATOM   5356 C  CZ    . PHE B 2 116 ? -24.258 -20.815 3.097   1.00 73.92  ? 116 PHE B CZ    1 
ATOM   5357 N  N     . SER B 2 117 ? -19.163 -17.705 7.604   1.00 58.52  ? 117 SER B N     1 
ATOM   5358 C  CA    . SER B 2 117 ? -18.554 -16.804 8.572   1.00 58.97  ? 117 SER B CA    1 
ATOM   5359 C  C     . SER B 2 117 ? -17.365 -16.036 8.009   1.00 60.49  ? 117 SER B C     1 
ATOM   5360 O  O     . SER B 2 117 ? -16.859 -15.133 8.684   1.00 67.81  ? 117 SER B O     1 
ATOM   5361 C  CB    . SER B 2 117 ? -18.109 -17.587 9.812   1.00 59.31  ? 117 SER B CB    1 
ATOM   5362 O  OG    . SER B 2 117 ? -17.172 -18.593 9.469   1.00 62.56  ? 117 SER B OG    1 
ATOM   5363 N  N     . VAL B 2 118 ? -16.915 -16.362 6.807   1.00 54.09  ? 118 VAL B N     1 
ATOM   5364 C  CA    . VAL B 2 118 ? -15.748 -15.738 6.187   1.00 52.55  ? 118 VAL B CA    1 
ATOM   5365 C  C     . VAL B 2 118 ? -16.223 -14.924 4.991   1.00 53.97  ? 118 VAL B C     1 
ATOM   5366 O  O     . VAL B 2 118 ? -16.915 -15.468 4.123   1.00 58.97  ? 118 VAL B O     1 
ATOM   5367 C  CB    . VAL B 2 118 ? -14.705 -16.784 5.749   1.00 46.78  ? 118 VAL B CB    1 
ATOM   5368 C  CG1   . VAL B 2 118 ? -13.528 -16.106 5.064   1.00 46.84  ? 118 VAL B CG1   1 
ATOM   5369 C  CG2   . VAL B 2 118 ? -14.238 -17.599 6.944   1.00 44.06  ? 118 VAL B CG2   1 
ATOM   5370 N  N     . PRO B 2 119 ? -15.883 -13.641 4.903   1.00 55.71  ? 119 PRO B N     1 
ATOM   5371 C  CA    . PRO B 2 119 ? -16.299 -12.843 3.745   1.00 53.76  ? 119 PRO B CA    1 
ATOM   5372 C  C     . PRO B 2 119 ? -15.566 -13.263 2.480   1.00 54.81  ? 119 PRO B C     1 
ATOM   5373 O  O     . PRO B 2 119 ? -14.510 -13.899 2.515   1.00 57.19  ? 119 PRO B O     1 
ATOM   5374 C  CB    . PRO B 2 119 ? -15.933 -11.411 4.149   1.00 60.54  ? 119 PRO B CB    1 
ATOM   5375 C  CG    . PRO B 2 119 ? -14.825 -11.577 5.136   1.00 63.81  ? 119 PRO B CG    1 
ATOM   5376 C  CD    . PRO B 2 119 ? -15.128 -12.844 5.886   1.00 56.89  ? 119 PRO B CD    1 
ATOM   5377 N  N     . LEU B 2 120 ? -16.149 -12.887 1.346   1.00 59.52  ? 120 LEU B N     1 
ATOM   5378 C  CA    . LEU B 2 120 ? -15.614 -13.208 0.032   1.00 55.08  ? 120 LEU B CA    1 
ATOM   5379 C  C     . LEU B 2 120 ? -15.027 -11.957 -0.610  1.00 54.82  ? 120 LEU B C     1 
ATOM   5380 O  O     . LEU B 2 120 ? -15.503 -10.841 -0.381  1.00 56.47  ? 120 LEU B O     1 
ATOM   5381 C  CB    . LEU B 2 120 ? -16.703 -13.802 -0.869  1.00 48.60  ? 120 LEU B CB    1 
ATOM   5382 C  CG    . LEU B 2 120 ? -16.330 -14.177 -2.305  1.00 47.21  ? 120 LEU B CG    1 
ATOM   5383 C  CD1   . LEU B 2 120 ? -15.231 -15.228 -2.320  1.00 40.61  ? 120 LEU B CD1   1 
ATOM   5384 C  CD2   . LEU B 2 120 ? -17.551 -14.661 -3.071  1.00 52.07  ? 120 LEU B CD2   1 
ATOM   5385 N  N     . ASP B 2 121 ? -13.978 -12.157 -1.409  1.00 59.37  ? 121 ASP B N     1 
ATOM   5386 C  CA    . ASP B 2 121 ? -13.338 -11.055 -2.118  1.00 56.61  ? 121 ASP B CA    1 
ATOM   5387 C  C     . ASP B 2 121 ? -14.357 -10.281 -2.943  1.00 58.77  ? 121 ASP B C     1 
ATOM   5388 O  O     . ASP B 2 121 ? -15.130 -10.866 -3.706  1.00 58.35  ? 121 ASP B O     1 
ATOM   5389 C  CB    . ASP B 2 121 ? -12.222 -11.592 -3.017  1.00 57.74  ? 121 ASP B CB    1 
ATOM   5390 C  CG    . ASP B 2 121 ? -11.547 -10.500 -3.825  1.00 68.92  ? 121 ASP B CG    1 
ATOM   5391 O  OD1   . ASP B 2 121 ? -11.430 -9.366  -3.317  1.00 71.43  ? 121 ASP B OD1   1 
ATOM   5392 O  OD2   . ASP B 2 121 ? -11.133 -10.778 -4.970  1.00 75.63  ? 121 ASP B OD2   1 
ATOM   5393 N  N     . GLU B 2 122 ? -14.347 -8.955  -2.784  1.00 57.02  ? 122 GLU B N     1 
ATOM   5394 C  CA    . GLU B 2 122 ? -15.377 -8.119  -3.394  1.00 59.61  ? 122 GLU B CA    1 
ATOM   5395 C  C     . GLU B 2 122 ? -15.336 -8.199  -4.916  1.00 58.72  ? 122 GLU B C     1 
ATOM   5396 O  O     . GLU B 2 122 ? -16.384 -8.207  -5.571  1.00 56.90  ? 122 GLU B O     1 
ATOM   5397 C  CB    . GLU B 2 122 ? -15.214 -6.673  -2.927  1.00 61.81  ? 122 GLU B CB    1 
ATOM   5398 C  CG    . GLU B 2 122 ? -16.521 -5.959  -2.614  1.00 68.46  ? 122 GLU B CG    1 
ATOM   5399 C  CD    . GLU B 2 122 ? -17.437 -5.847  -3.818  1.00 79.50  ? 122 GLU B CD    1 
ATOM   5400 O  OE1   . GLU B 2 122 ? -18.580 -6.348  -3.746  1.00 71.82  ? 122 GLU B OE1   1 
ATOM   5401 O  OE2   . GLU B 2 122 ? -17.011 -5.262  -4.836  1.00 79.86  ? 122 GLU B OE2   1 
ATOM   5402 N  N     . ASP B 2 123 ? -14.137 -8.260  -5.496  1.00 58.26  ? 123 ASP B N     1 
ATOM   5403 C  CA    . ASP B 2 123 ? -14.001 -8.329  -6.946  1.00 58.33  ? 123 ASP B CA    1 
ATOM   5404 C  C     . ASP B 2 123 ? -14.336 -9.701  -7.514  1.00 56.20  ? 123 ASP B C     1 
ATOM   5405 O  O     . ASP B 2 123 ? -14.372 -9.851  -8.740  1.00 55.89  ? 123 ASP B O     1 
ATOM   5406 C  CB    . ASP B 2 123 ? -12.582 -7.939  -7.363  1.00 59.18  ? 123 ASP B CB    1 
ATOM   5407 C  CG    . ASP B 2 123 ? -12.279 -6.478  -7.101  1.00 72.72  ? 123 ASP B CG    1 
ATOM   5408 O  OD1   . ASP B 2 123 ? -13.228 -5.665  -7.093  1.00 66.71  ? 123 ASP B OD1   1 
ATOM   5409 O  OD2   . ASP B 2 123 ? -11.092 -6.141  -6.904  1.00 81.23  ? 123 ASP B OD2   1 
ATOM   5410 N  N     . PHE B 2 124 ? -14.581 -10.699 -6.665  1.00 49.18  ? 124 PHE B N     1 
ATOM   5411 C  CA    . PHE B 2 124 ? -14.924 -12.039 -7.120  1.00 50.22  ? 124 PHE B CA    1 
ATOM   5412 C  C     . PHE B 2 124 ? -16.405 -12.358 -6.966  1.00 44.54  ? 124 PHE B C     1 
ATOM   5413 O  O     . PHE B 2 124 ? -16.876 -13.334 -7.560  1.00 45.64  ? 124 PHE B O     1 
ATOM   5414 C  CB    . PHE B 2 124 ? -14.096 -13.083 -6.357  1.00 47.55  ? 124 PHE B CB    1 
ATOM   5415 C  CG    . PHE B 2 124 ? -14.079 -14.439 -7.005  1.00 43.38  ? 124 PHE B CG    1 
ATOM   5416 C  CD1   . PHE B 2 124 ? -13.206 -14.709 -8.045  1.00 45.65  ? 124 PHE B CD1   1 
ATOM   5417 C  CD2   . PHE B 2 124 ? -14.926 -15.444 -6.569  1.00 40.15  ? 124 PHE B CD2   1 
ATOM   5418 C  CE1   . PHE B 2 124 ? -13.184 -15.951 -8.645  1.00 47.49  ? 124 PHE B CE1   1 
ATOM   5419 C  CE2   . PHE B 2 124 ? -14.910 -16.689 -7.165  1.00 46.07  ? 124 PHE B CE2   1 
ATOM   5420 C  CZ    . PHE B 2 124 ? -14.035 -16.944 -8.204  1.00 45.65  ? 124 PHE B CZ    1 
ATOM   5421 N  N     . ARG B 2 125 ? -17.149 -11.552 -6.203  1.00 44.47  ? 125 ARG B N     1 
ATOM   5422 C  CA    . ARG B 2 125 ? -18.542 -11.872 -5.906  1.00 45.61  ? 125 ARG B CA    1 
ATOM   5423 C  C     . ARG B 2 125 ? -19.402 -11.918 -7.162  1.00 39.85  ? 125 ARG B C     1 
ATOM   5424 O  O     . ARG B 2 125 ? -20.381 -12.672 -7.215  1.00 41.16  ? 125 ARG B O     1 
ATOM   5425 C  CB    . ARG B 2 125 ? -19.107 -10.855 -4.914  1.00 44.33  ? 125 ARG B CB    1 
ATOM   5426 C  CG    . ARG B 2 125 ? -18.323 -10.772 -3.614  1.00 48.06  ? 125 ARG B CG    1 
ATOM   5427 C  CD    . ARG B 2 125 ? -18.957 -9.807  -2.629  1.00 41.83  ? 125 ARG B CD    1 
ATOM   5428 N  NE    . ARG B 2 125 ? -18.197 -9.740  -1.384  1.00 53.33  ? 125 ARG B NE    1 
ATOM   5429 C  CZ    . ARG B 2 125 ? -18.527 -8.979  -0.346  1.00 55.23  ? 125 ARG B CZ    1 
ATOM   5430 N  NH1   . ARG B 2 125 ? -19.609 -8.215  -0.398  1.00 50.13  ? 125 ARG B NH1   1 
ATOM   5431 N  NH2   . ARG B 2 125 ? -17.775 -8.984  0.746   1.00 53.92  ? 125 ARG B NH2   1 
ATOM   5432 N  N     . LYS B 2 126 ? -19.057 -11.129 -8.183  1.00 35.63  ? 126 LYS B N     1 
ATOM   5433 C  CA    . LYS B 2 126 ? -19.861 -11.093 -9.399  1.00 35.36  ? 126 LYS B CA    1 
ATOM   5434 C  C     . LYS B 2 126 ? -19.873 -12.429 -10.133 1.00 37.40  ? 126 LYS B C     1 
ATOM   5435 O  O     . LYS B 2 126 ? -20.772 -12.666 -10.947 1.00 40.95  ? 126 LYS B O     1 
ATOM   5436 C  CB    . LYS B 2 126 ? -19.354 -9.990  -10.331 1.00 34.31  ? 126 LYS B CB    1 
ATOM   5437 C  CG    . LYS B 2 126 ? -17.879 -10.092 -10.680 1.00 39.17  ? 126 LYS B CG    1 
ATOM   5438 C  CD    . LYS B 2 126 ? -17.430 -8.900  -11.511 1.00 47.93  ? 126 LYS B CD    1 
ATOM   5439 C  CE    . LYS B 2 126 ? -15.923 -8.896  -11.702 1.00 57.71  ? 126 LYS B CE    1 
ATOM   5440 N  NZ    . LYS B 2 126 ? -15.470 -7.703  -12.469 1.00 67.40  ? 126 LYS B NZ    1 
ATOM   5441 N  N     . TYR B 2 127 ? -18.903 -13.304 -9.867  1.00 40.08  ? 127 TYR B N     1 
ATOM   5442 C  CA    . TYR B 2 127 ? -18.854 -14.602 -10.526 1.00 42.86  ? 127 TYR B CA    1 
ATOM   5443 C  C     . TYR B 2 127 ? -19.734 -15.646 -9.851  1.00 43.29  ? 127 TYR B C     1 
ATOM   5444 O  O     . TYR B 2 127 ? -19.940 -16.721 -10.425 1.00 41.17  ? 127 TYR B O     1 
ATOM   5445 C  CB    . TYR B 2 127 ? -17.411 -15.109 -10.585 1.00 39.15  ? 127 TYR B CB    1 
ATOM   5446 C  CG    . TYR B 2 127 ? -16.456 -14.147 -11.253 1.00 44.07  ? 127 TYR B CG    1 
ATOM   5447 C  CD1   . TYR B 2 127 ? -16.597 -13.821 -12.597 1.00 42.30  ? 127 TYR B CD1   1 
ATOM   5448 C  CD2   . TYR B 2 127 ? -15.410 -13.570 -10.543 1.00 44.17  ? 127 TYR B CD2   1 
ATOM   5449 C  CE1   . TYR B 2 127 ? -15.726 -12.942 -13.214 1.00 47.56  ? 127 TYR B CE1   1 
ATOM   5450 C  CE2   . TYR B 2 127 ? -14.533 -12.690 -11.152 1.00 43.11  ? 127 TYR B CE2   1 
ATOM   5451 C  CZ    . TYR B 2 127 ? -14.696 -12.381 -12.487 1.00 47.05  ? 127 TYR B CZ    1 
ATOM   5452 O  OH    . TYR B 2 127 ? -13.826 -11.507 -13.096 1.00 54.90  ? 127 TYR B OH    1 
ATOM   5453 N  N     . THR B 2 128 ? -20.255 -15.365 -8.658  1.00 33.18  ? 128 THR B N     1 
ATOM   5454 C  CA    . THR B 2 128 ? -21.120 -16.292 -7.942  1.00 38.36  ? 128 THR B CA    1 
ATOM   5455 C  C     . THR B 2 128 ? -22.600 -16.041 -8.208  1.00 36.38  ? 128 THR B C     1 
ATOM   5456 O  O     . THR B 2 128 ? -23.447 -16.550 -7.466  1.00 29.03  ? 128 THR B O     1 
ATOM   5457 C  CB    . THR B 2 128 ? -20.851 -16.210 -6.437  1.00 42.24  ? 128 THR B CB    1 
ATOM   5458 O  OG1   . THR B 2 128 ? -21.208 -14.909 -5.953  1.00 40.43  ? 128 THR B OG1   1 
ATOM   5459 C  CG2   . THR B 2 128 ? -19.382 -16.468 -6.144  1.00 33.35  ? 128 THR B CG2   1 
ATOM   5460 N  N     . ALA B 2 129 ? -22.924 -15.275 -9.247  1.00 34.19  ? 129 ALA B N     1 
ATOM   5461 C  CA    . ALA B 2 129 ? -24.307 -14.910 -9.516  1.00 34.49  ? 129 ALA B CA    1 
ATOM   5462 C  C     . ALA B 2 129 ? -25.152 -16.139 -9.830  1.00 33.62  ? 129 ALA B C     1 
ATOM   5463 O  O     . ALA B 2 129 ? -24.708 -17.062 -10.519 1.00 27.76  ? 129 ALA B O     1 
ATOM   5464 C  CB    . ALA B 2 129 ? -24.369 -13.923 -10.680 1.00 34.72  ? 129 ALA B CB    1 
ATOM   5465 N  N     . PHE B 2 130 ? -26.381 -16.145 -9.315  1.00 32.48  ? 130 PHE B N     1 
ATOM   5466 C  CA    . PHE B 2 130 ? -27.357 -17.180 -9.625  1.00 29.26  ? 130 PHE B CA    1 
ATOM   5467 C  C     . PHE B 2 130 ? -28.738 -16.543 -9.702  1.00 36.91  ? 130 PHE B C     1 
ATOM   5468 O  O     . PHE B 2 130 ? -28.940 -15.397 -9.292  1.00 32.75  ? 130 PHE B O     1 
ATOM   5469 C  CB    . PHE B 2 130 ? -27.326 -18.323 -8.598  1.00 24.66  ? 130 PHE B CB    1 
ATOM   5470 C  CG    . PHE B 2 130 ? -27.664 -17.902 -7.195  1.00 26.37  ? 130 PHE B CG    1 
ATOM   5471 C  CD1   . PHE B 2 130 ? -26.673 -17.476 -6.328  1.00 32.93  ? 130 PHE B CD1   1 
ATOM   5472 C  CD2   . PHE B 2 130 ? -28.970 -17.957 -6.736  1.00 32.02  ? 130 PHE B CD2   1 
ATOM   5473 C  CE1   . PHE B 2 130 ? -26.981 -17.097 -5.035  1.00 40.40  ? 130 PHE B CE1   1 
ATOM   5474 C  CE2   . PHE B 2 130 ? -29.283 -17.580 -5.443  1.00 26.26  ? 130 PHE B CE2   1 
ATOM   5475 C  CZ    . PHE B 2 130 ? -28.287 -17.151 -4.592  1.00 32.88  ? 130 PHE B CZ    1 
ATOM   5476 N  N     . THR B 2 131 ? -29.698 -17.301 -10.232 1.00 33.00  ? 131 THR B N     1 
ATOM   5477 C  CA    . THR B 2 131 ? -31.033 -16.787 -10.515 1.00 30.96  ? 131 THR B CA    1 
ATOM   5478 C  C     . THR B 2 131 ? -32.087 -17.744 -9.978  1.00 33.59  ? 131 THR B C     1 
ATOM   5479 O  O     . THR B 2 131 ? -32.017 -18.952 -10.225 1.00 39.32  ? 131 THR B O     1 
ATOM   5480 C  CB    . THR B 2 131 ? -31.236 -16.584 -12.021 1.00 34.77  ? 131 THR B CB    1 
ATOM   5481 O  OG1   . THR B 2 131 ? -30.119 -15.873 -12.565 1.00 26.68  ? 131 THR B OG1   1 
ATOM   5482 C  CG2   . THR B 2 131 ? -32.504 -15.789 -12.283 1.00 32.30  ? 131 THR B CG2   1 
ATOM   5483 N  N     . ILE B 2 132 ? -33.063 -17.199 -9.258  1.00 33.03  ? 132 ILE B N     1 
ATOM   5484 C  CA    . ILE B 2 132 ? -34.191 -17.971 -8.748  1.00 33.98  ? 132 ILE B CA    1 
ATOM   5485 C  C     . ILE B 2 132 ? -35.342 -17.829 -9.741  1.00 38.35  ? 132 ILE B C     1 
ATOM   5486 O  O     . ILE B 2 132 ? -35.834 -16.707 -9.940  1.00 39.37  ? 132 ILE B O     1 
ATOM   5487 C  CB    . ILE B 2 132 ? -34.615 -17.498 -7.353  1.00 34.06  ? 132 ILE B CB    1 
ATOM   5488 C  CG1   . ILE B 2 132 ? -33.444 -17.599 -6.372  1.00 27.96  ? 132 ILE B CG1   1 
ATOM   5489 C  CG2   . ILE B 2 132 ? -35.810 -18.309 -6.858  1.00 40.07  ? 132 ILE B CG2   1 
ATOM   5490 C  CD1   . ILE B 2 132 ? -32.968 -19.012 -6.133  1.00 37.04  ? 132 ILE B CD1   1 
ATOM   5491 N  N     . PRO B 2 133 ? -35.786 -18.905 -10.375 1.00 32.29  ? 133 PRO B N     1 
ATOM   5492 C  CA    . PRO B 2 133 ? -36.876 -18.810 -11.349 1.00 32.34  ? 133 PRO B CA    1 
ATOM   5493 C  C     . PRO B 2 133 ? -38.226 -18.707 -10.645 1.00 23.65  ? 133 PRO B C     1 
ATOM   5494 O  O     . PRO B 2 133 ? -38.330 -18.798 -9.424  1.00 29.44  ? 133 PRO B O     1 
ATOM   5495 C  CB    . PRO B 2 133 ? -36.747 -20.116 -12.134 1.00 33.66  ? 133 PRO B CB    1 
ATOM   5496 C  CG    . PRO B 2 133 ? -36.202 -21.078 -11.124 1.00 29.45  ? 133 PRO B CG    1 
ATOM   5497 C  CD    . PRO B 2 133 ? -35.260 -20.277 -10.261 1.00 26.60  ? 133 PRO B CD    1 
ATOM   5498 N  N     . SER B 2 134 ? -39.269 -18.503 -11.445 1.00 33.89  ? 134 SER B N     1 
ATOM   5499 C  CA    . SER B 2 134 ? -40.634 -18.429 -10.950 1.00 29.00  ? 134 SER B CA    1 
ATOM   5500 C  C     . SER B 2 134 ? -41.504 -19.411 -11.720 1.00 26.39  ? 134 SER B C     1 
ATOM   5501 O  O     . SER B 2 134 ? -41.251 -19.706 -12.891 1.00 29.51  ? 134 SER B O     1 
ATOM   5502 C  CB    . SER B 2 134 ? -41.214 -17.013 -11.077 1.00 28.64  ? 134 SER B CB    1 
ATOM   5503 O  OG    . SER B 2 134 ? -41.412 -16.666 -12.436 1.00 32.26  ? 134 SER B OG    1 
ATOM   5504 N  N     . ILE B 2 135 ? -42.535 -19.917 -11.044 1.00 26.58  ? 135 ILE B N     1 
ATOM   5505 C  CA    . ILE B 2 135 ? -43.442 -20.878 -11.661 1.00 27.93  ? 135 ILE B CA    1 
ATOM   5506 C  C     . ILE B 2 135 ? -44.245 -20.189 -12.756 1.00 33.11  ? 135 ILE B C     1 
ATOM   5507 O  O     . ILE B 2 135 ? -44.785 -19.093 -12.555 1.00 33.65  ? 135 ILE B O     1 
ATOM   5508 C  CB    . ILE B 2 135 ? -44.364 -21.497 -10.601 1.00 31.19  ? 135 ILE B CB    1 
ATOM   5509 C  CG1   . ILE B 2 135 ? -43.532 -22.090 -9.466  1.00 31.21  ? 135 ILE B CG1   1 
ATOM   5510 C  CG2   . ILE B 2 135 ? -45.262 -22.558 -11.222 1.00 26.24  ? 135 ILE B CG2   1 
ATOM   5511 C  CD1   . ILE B 2 135 ? -44.342 -22.436 -8.249  1.00 44.69  ? 135 ILE B CD1   1 
ATOM   5512 N  N     . ASN B 2 136 ? -44.321 -20.829 -13.925 1.00 29.02  ? 136 ASN B N     1 
ATOM   5513 C  CA    . ASN B 2 136 ? -45.079 -20.333 -15.075 1.00 29.08  ? 136 ASN B CA    1 
ATOM   5514 C  C     . ASN B 2 136 ? -44.626 -18.942 -15.514 1.00 27.22  ? 136 ASN B C     1 
ATOM   5515 O  O     . ASN B 2 136 ? -45.395 -18.204 -16.138 1.00 26.51  ? 136 ASN B O     1 
ATOM   5516 C  CB    . ASN B 2 136 ? -46.586 -20.338 -14.785 1.00 25.59  ? 136 ASN B CB    1 
ATOM   5517 C  CG    . ASN B 2 136 ? -47.425 -20.234 -16.044 1.00 31.49  ? 136 ASN B CG    1 
ATOM   5518 O  OD1   . ASN B 2 136 ? -46.966 -20.566 -17.138 1.00 24.92  ? 136 ASN B OD1   1 
ATOM   5519 N  ND2   . ASN B 2 136 ? -48.660 -19.765 -15.896 1.00 25.00  ? 136 ASN B ND2   1 
ATOM   5520 N  N     . ASN B 2 137 ? -43.384 -18.574 -15.194 1.00 27.29  ? 137 ASN B N     1 
ATOM   5521 C  CA    . ASN B 2 137 ? -42.814 -17.281 -15.580 1.00 31.54  ? 137 ASN B CA    1 
ATOM   5522 C  C     . ASN B 2 137 ? -43.722 -16.125 -15.164 1.00 25.73  ? 137 ASN B C     1 
ATOM   5523 O  O     . ASN B 2 137 ? -43.934 -15.169 -15.911 1.00 21.83  ? 137 ASN B O     1 
ATOM   5524 C  CB    . ASN B 2 137 ? -42.518 -17.239 -17.079 1.00 22.37  ? 137 ASN B CB    1 
ATOM   5525 C  CG    . ASN B 2 137 ? -41.393 -18.175 -17.471 1.00 32.62  ? 137 ASN B CG    1 
ATOM   5526 O  OD1   . ASN B 2 137 ? -40.215 -17.848 -17.317 1.00 29.79  ? 137 ASN B OD1   1 
ATOM   5527 N  ND2   . ASN B 2 137 ? -41.750 -19.352 -17.972 1.00 30.46  ? 137 ASN B ND2   1 
ATOM   5528 N  N     . GLU B 2 138 ? -44.275 -16.231 -13.953 1.00 25.92  ? 138 GLU B N     1 
ATOM   5529 C  CA    . GLU B 2 138 ? -45.063 -15.141 -13.389 1.00 26.16  ? 138 GLU B CA    1 
ATOM   5530 C  C     . GLU B 2 138 ? -44.220 -13.886 -13.202 1.00 26.36  ? 138 GLU B C     1 
ATOM   5531 O  O     . GLU B 2 138 ? -44.733 -12.766 -13.312 1.00 28.01  ? 138 GLU B O     1 
ATOM   5532 C  CB    . GLU B 2 138 ? -45.663 -15.588 -12.055 1.00 22.78  ? 138 GLU B CB    1 
ATOM   5533 C  CG    . GLU B 2 138 ? -46.464 -14.533 -11.316 1.00 30.21  ? 138 GLU B CG    1 
ATOM   5534 C  CD    . GLU B 2 138 ? -46.770 -14.946 -9.889  1.00 39.05  ? 138 GLU B CD    1 
ATOM   5535 O  OE1   . GLU B 2 138 ? -46.638 -14.100 -8.979  1.00 40.45  ? 138 GLU B OE1   1 
ATOM   5536 O  OE2   . GLU B 2 138 ? -47.131 -16.123 -9.676  1.00 36.29  ? 138 GLU B OE2   1 
ATOM   5537 N  N     . THR B 2 139 ? -42.930 -14.059 -12.942 1.00 23.19  ? 139 THR B N     1 
ATOM   5538 C  CA    . THR B 2 139 ? -41.992 -12.996 -12.629 1.00 31.91  ? 139 THR B CA    1 
ATOM   5539 C  C     . THR B 2 139 ? -40.708 -13.256 -13.400 1.00 32.91  ? 139 THR B C     1 
ATOM   5540 O  O     . THR B 2 139 ? -40.365 -14.417 -13.654 1.00 30.99  ? 139 THR B O     1 
ATOM   5541 C  CB    . THR B 2 139 ? -41.704 -12.953 -11.117 1.00 27.02  ? 139 THR B CB    1 
ATOM   5542 O  OG1   . THR B 2 139 ? -42.935 -12.774 -10.404 1.00 41.12  ? 139 THR B OG1   1 
ATOM   5543 C  CG2   . THR B 2 139 ? -40.747 -11.827 -10.747 1.00 50.41  ? 139 THR B CG2   1 
ATOM   5544 N  N     . PRO B 2 140 ? -39.999 -12.207 -13.818 1.00 39.93  ? 140 PRO B N     1 
ATOM   5545 C  CA    . PRO B 2 140 ? -38.628 -12.403 -14.296 1.00 25.89  ? 140 PRO B CA    1 
ATOM   5546 C  C     . PRO B 2 140 ? -37.776 -13.065 -13.224 1.00 28.25  ? 140 PRO B C     1 
ATOM   5547 O  O     . PRO B 2 140 ? -38.103 -13.052 -12.035 1.00 34.01  ? 140 PRO B O     1 
ATOM   5548 C  CB    . PRO B 2 140 ? -38.143 -10.979 -14.591 1.00 30.93  ? 140 PRO B CB    1 
ATOM   5549 C  CG    . PRO B 2 140 ? -39.384 -10.217 -14.884 1.00 34.57  ? 140 PRO B CG    1 
ATOM   5550 C  CD    . PRO B 2 140 ? -40.468 -10.825 -14.033 1.00 35.39  ? 140 PRO B CD    1 
ATOM   5551 N  N     . GLY B 2 141 ? -36.669 -13.658 -13.660 1.00 32.01  ? 141 GLY B N     1 
ATOM   5552 C  CA    . GLY B 2 141 ? -35.753 -14.263 -12.710 1.00 29.19  ? 141 GLY B CA    1 
ATOM   5553 C  C     . GLY B 2 141 ? -35.186 -13.222 -11.759 1.00 30.10  ? 141 GLY B C     1 
ATOM   5554 O  O     . GLY B 2 141 ? -34.897 -12.088 -12.148 1.00 35.80  ? 141 GLY B O     1 
ATOM   5555 N  N     . ILE B 2 142 ? -35.042 -13.611 -10.496 1.00 32.30  ? 142 ILE B N     1 
ATOM   5556 C  CA    . ILE B 2 142 ? -34.526 -12.733 -9.452  1.00 32.24  ? 142 ILE B CA    1 
ATOM   5557 C  C     . ILE B 2 142 ? -33.138 -13.229 -9.072  1.00 29.76  ? 142 ILE B C     1 
ATOM   5558 O  O     . ILE B 2 142 ? -32.978 -14.373 -8.627  1.00 31.29  ? 142 ILE B O     1 
ATOM   5559 C  CB    . ILE B 2 142 ? -35.465 -12.684 -8.237  1.00 40.82  ? 142 ILE B CB    1 
ATOM   5560 C  CG1   . ILE B 2 142 ? -36.859 -12.224 -8.672  1.00 34.11  ? 142 ILE B CG1   1 
ATOM   5561 C  CG2   . ILE B 2 142 ? -34.906 -11.756 -7.171  1.00 36.15  ? 142 ILE B CG2   1 
ATOM   5562 C  CD1   . ILE B 2 142 ? -37.830 -12.034 -7.526  1.00 39.42  ? 142 ILE B CD1   1 
ATOM   5563 N  N     . ARG B 2 143 ? -32.139 -12.369 -9.244  1.00 37.10  ? 143 ARG B N     1 
ATOM   5564 C  CA    . ARG B 2 143 ? -30.739 -12.759 -9.173  1.00 33.67  ? 143 ARG B CA    1 
ATOM   5565 C  C     . ARG B 2 143 ? -30.098 -12.331 -7.857  1.00 43.77  ? 143 ARG B C     1 
ATOM   5566 O  O     . ARG B 2 143 ? -30.481 -11.326 -7.251  1.00 35.35  ? 143 ARG B O     1 
ATOM   5567 C  CB    . ARG B 2 143 ? -29.961 -12.159 -10.347 1.00 34.35  ? 143 ARG B CB    1 
ATOM   5568 C  CG    . ARG B 2 143 ? -30.314 -12.775 -11.692 1.00 36.08  ? 143 ARG B CG    1 
ATOM   5569 C  CD    . ARG B 2 143 ? -29.816 -11.933 -12.858 1.00 40.28  ? 143 ARG B CD    1 
ATOM   5570 N  NE    . ARG B 2 143 ? -28.405 -11.575 -12.740 1.00 41.95  ? 143 ARG B NE    1 
ATOM   5571 C  CZ    . ARG B 2 143 ? -27.396 -12.399 -13.003 1.00 36.88  ? 143 ARG B CZ    1 
ATOM   5572 N  NH1   . ARG B 2 143 ? -27.633 -13.646 -13.387 1.00 43.38  ? 143 ARG B NH1   1 
ATOM   5573 N  NH2   . ARG B 2 143 ? -26.145 -11.979 -12.873 1.00 41.52  ? 143 ARG B NH2   1 
ATOM   5574 N  N     . TYR B 2 144 ? -29.107 -13.111 -7.428  1.00 39.31  ? 144 TYR B N     1 
ATOM   5575 C  CA    . TYR B 2 144 ? -28.341 -12.836 -6.221  1.00 36.62  ? 144 TYR B CA    1 
ATOM   5576 C  C     . TYR B 2 144 ? -26.865 -13.082 -6.501  1.00 40.85  ? 144 TYR B C     1 
ATOM   5577 O  O     . TYR B 2 144 ? -26.489 -13.661 -7.524  1.00 42.61  ? 144 TYR B O     1 
ATOM   5578 C  CB    . TYR B 2 144 ? -28.789 -13.714 -5.044  1.00 29.78  ? 144 TYR B CB    1 
ATOM   5579 C  CG    . TYR B 2 144 ? -30.211 -13.497 -4.583  1.00 37.89  ? 144 TYR B CG    1 
ATOM   5580 C  CD1   . TYR B 2 144 ? -30.495 -12.649 -3.521  1.00 36.54  ? 144 TYR B CD1   1 
ATOM   5581 C  CD2   . TYR B 2 144 ? -31.268 -14.155 -5.196  1.00 34.28  ? 144 TYR B CD2   1 
ATOM   5582 C  CE1   . TYR B 2 144 ? -31.792 -12.454 -3.089  1.00 38.95  ? 144 TYR B CE1   1 
ATOM   5583 C  CE2   . TYR B 2 144 ? -32.569 -13.966 -4.772  1.00 41.56  ? 144 TYR B CE2   1 
ATOM   5584 C  CZ    . TYR B 2 144 ? -32.825 -13.115 -3.718  1.00 46.03  ? 144 TYR B CZ    1 
ATOM   5585 O  OH    . TYR B 2 144 ? -34.120 -12.923 -3.292  1.00 49.44  ? 144 TYR B OH    1 
ATOM   5586 N  N     . GLN B 2 145 ? -26.024 -12.634 -5.571  1.00 40.08  ? 145 GLN B N     1 
ATOM   5587 C  CA    . GLN B 2 145 ? -24.609 -12.975 -5.565  1.00 39.06  ? 145 GLN B CA    1 
ATOM   5588 C  C     . GLN B 2 145 ? -24.171 -13.172 -4.122  1.00 39.63  ? 145 GLN B C     1 
ATOM   5589 O  O     . GLN B 2 145 ? -24.823 -12.705 -3.185  1.00 40.31  ? 145 GLN B O     1 
ATOM   5590 C  CB    . GLN B 2 145 ? -23.749 -11.903 -6.251  1.00 33.08  ? 145 GLN B CB    1 
ATOM   5591 C  CG    . GLN B 2 145 ? -23.479 -10.668 -5.408  1.00 37.19  ? 145 GLN B CG    1 
ATOM   5592 C  CD    . GLN B 2 145 ? -22.623 -9.646  -6.134  1.00 41.85  ? 145 GLN B CD    1 
ATOM   5593 O  OE1   . GLN B 2 145 ? -22.369 -9.772  -7.332  1.00 42.50  ? 145 GLN B OE1   1 
ATOM   5594 N  NE2   . GLN B 2 145 ? -22.172 -8.628  -5.410  1.00 37.72  ? 145 GLN B NE2   1 
ATOM   5595 N  N     . TYR B 2 146 ? -23.060 -13.880 -3.947  1.00 38.16  ? 146 TYR B N     1 
ATOM   5596 C  CA    . TYR B 2 146 ? -22.581 -14.233 -2.618  1.00 39.28  ? 146 TYR B CA    1 
ATOM   5597 C  C     . TYR B 2 146 ? -21.680 -13.144 -2.049  1.00 46.60  ? 146 TYR B C     1 
ATOM   5598 O  O     . TYR B 2 146 ? -20.869 -12.550 -2.765  1.00 40.85  ? 146 TYR B O     1 
ATOM   5599 C  CB    . TYR B 2 146 ? -21.827 -15.563 -2.653  1.00 41.01  ? 146 TYR B CB    1 
ATOM   5600 C  CG    . TYR B 2 146 ? -22.705 -16.767 -2.398  1.00 42.06  ? 146 TYR B CG    1 
ATOM   5601 C  CD1   . TYR B 2 146 ? -23.340 -17.424 -3.443  1.00 37.96  ? 146 TYR B CD1   1 
ATOM   5602 C  CD2   . TYR B 2 146 ? -22.899 -17.245 -1.108  1.00 45.42  ? 146 TYR B CD2   1 
ATOM   5603 C  CE1   . TYR B 2 146 ? -24.145 -18.523 -3.211  1.00 35.32  ? 146 TYR B CE1   1 
ATOM   5604 C  CE2   . TYR B 2 146 ? -23.701 -18.342 -0.866  1.00 45.62  ? 146 TYR B CE2   1 
ATOM   5605 C  CZ    . TYR B 2 146 ? -24.322 -18.977 -1.921  1.00 39.23  ? 146 TYR B CZ    1 
ATOM   5606 O  OH    . TYR B 2 146 ? -25.123 -20.071 -1.684  1.00 50.48  ? 146 TYR B OH    1 
ATOM   5607 N  N     . ASN B 2 147 ? -21.837 -12.885 -0.750  1.00 43.75  ? 147 ASN B N     1 
ATOM   5608 C  CA    . ASN B 2 147 ? -20.949 -11.996 -0.014  1.00 50.14  ? 147 ASN B CA    1 
ATOM   5609 C  C     . ASN B 2 147 ? -19.945 -12.746 0.848   1.00 59.52  ? 147 ASN B C     1 
ATOM   5610 O  O     . ASN B 2 147 ? -18.949 -12.151 1.275   1.00 53.94  ? 147 ASN B O     1 
ATOM   5611 C  CB    . ASN B 2 147 ? -21.761 -11.049 0.878   1.00 28.76  ? 147 ASN B CB    1 
ATOM   5612 C  CG    . ASN B 2 147 ? -22.639 -10.105 0.080   1.00 42.11  ? 147 ASN B CG    1 
ATOM   5613 O  OD1   . ASN B 2 147 ? -22.206 -9.527  -0.918  1.00 32.96  ? 147 ASN B OD1   1 
ATOM   5614 N  ND2   . ASN B 2 147 ? -23.884 -9.948  0.516   1.00 34.52  ? 147 ASN B ND2   1 
ATOM   5615 N  N     . VAL B 2 148 ? -20.184 -14.029 1.112   1.00 43.74  ? 148 VAL B N     1 
ATOM   5616 C  CA    . VAL B 2 148 ? -19.293 -14.848 1.925   1.00 43.83  ? 148 VAL B CA    1 
ATOM   5617 C  C     . VAL B 2 148 ? -18.796 -16.014 1.083   1.00 54.75  ? 148 VAL B C     1 
ATOM   5618 O  O     . VAL B 2 148 ? -19.039 -16.065 -0.128  1.00 46.88  ? 148 VAL B O     1 
ATOM   5619 C  CB    . VAL B 2 148 ? -20.002 -15.343 3.199   1.00 51.21  ? 148 VAL B CB    1 
ATOM   5620 C  CG1   . VAL B 2 148 ? -20.348 -14.171 4.102   1.00 43.42  ? 148 VAL B CG1   1 
ATOM   5621 C  CG2   . VAL B 2 148 ? -21.253 -16.126 2.837   1.00 40.08  ? 148 VAL B CG2   1 
ATOM   5622 N  N     . LEU B 2 149 ? -18.097 -16.950 1.711   1.00 54.50  ? 149 LEU B N     1 
ATOM   5623 C  CA    . LEU B 2 149 ? -17.617 -18.131 1.000   1.00 48.17  ? 149 LEU B CA    1 
ATOM   5624 C  C     . LEU B 2 149 ? -18.794 -19.028 0.641   1.00 48.48  ? 149 LEU B C     1 
ATOM   5625 O  O     . LEU B 2 149 ? -19.462 -19.548 1.545   1.00 43.05  ? 149 LEU B O     1 
ATOM   5626 C  CB    . LEU B 2 149 ? -16.607 -18.897 1.849   1.00 42.99  ? 149 LEU B CB    1 
ATOM   5627 C  CG    . LEU B 2 149 ? -15.277 -18.201 2.147   1.00 48.68  ? 149 LEU B CG    1 
ATOM   5628 C  CD1   . LEU B 2 149 ? -14.340 -19.147 2.884   1.00 48.65  ? 149 LEU B CD1   1 
ATOM   5629 C  CD2   . LEU B 2 149 ? -14.634 -17.691 0.868   1.00 42.19  ? 149 LEU B CD2   1 
ATOM   5630 N  N     . PRO B 2 150 ? -19.086 -19.238 -0.639  1.00 39.98  ? 150 PRO B N     1 
ATOM   5631 C  CA    . PRO B 2 150 ? -20.251 -20.044 -1.010  1.00 43.01  ? 150 PRO B CA    1 
ATOM   5632 C  C     . PRO B 2 150 ? -19.989 -21.532 -0.850  1.00 46.76  ? 150 PRO B C     1 
ATOM   5633 O  O     . PRO B 2 150 ? -18.873 -22.021 -1.041  1.00 45.13  ? 150 PRO B O     1 
ATOM   5634 C  CB    . PRO B 2 150 ? -20.477 -19.686 -2.487  1.00 46.31  ? 150 PRO B CB    1 
ATOM   5635 C  CG    . PRO B 2 150 ? -19.537 -18.537 -2.786  1.00 38.33  ? 150 PRO B CG    1 
ATOM   5636 C  CD    . PRO B 2 150 ? -18.411 -18.683 -1.821  1.00 32.22  ? 150 PRO B CD    1 
ATOM   5637 N  N     . GLN B 2 151 ? -21.046 -22.252 -0.490  1.00 47.53  ? 151 GLN B N     1 
ATOM   5638 C  CA    . GLN B 2 151 ? -20.969 -23.703 -0.424  1.00 42.07  ? 151 GLN B CA    1 
ATOM   5639 C  C     . GLN B 2 151 ? -20.810 -24.280 -1.825  1.00 48.64  ? 151 GLN B C     1 
ATOM   5640 O  O     . GLN B 2 151 ? -21.417 -23.800 -2.786  1.00 45.44  ? 151 GLN B O     1 
ATOM   5641 C  CB    . GLN B 2 151 ? -22.221 -24.276 0.241   1.00 48.11  ? 151 GLN B CB    1 
ATOM   5642 C  CG    . GLN B 2 151 ? -22.484 -23.750 1.642   1.00 55.67  ? 151 GLN B CG    1 
ATOM   5643 C  CD    . GLN B 2 151 ? -23.751 -24.322 2.249   1.00 61.10  ? 151 GLN B CD    1 
ATOM   5644 O  OE1   . GLN B 2 151 ? -23.704 -25.266 3.038   1.00 63.88  ? 151 GLN B OE1   1 
ATOM   5645 N  NE2   . GLN B 2 151 ? -24.894 -23.754 1.880   1.00 68.00  ? 151 GLN B NE2   1 
ATOM   5646 N  N     . GLY B 2 152 ? -19.980 -25.314 -1.939  1.00 39.71  ? 152 GLY B N     1 
ATOM   5647 C  CA    . GLY B 2 152 ? -19.761 -25.960 -3.215  1.00 39.53  ? 152 GLY B CA    1 
ATOM   5648 C  C     . GLY B 2 152 ? -18.809 -25.250 -4.149  1.00 36.10  ? 152 GLY B C     1 
ATOM   5649 O  O     . GLY B 2 152 ? -18.718 -25.634 -5.321  1.00 37.85  ? 152 GLY B O     1 
ATOM   5650 N  N     . TRP B 2 153 ? -18.101 -24.226 -3.680  1.00 35.33  ? 153 TRP B N     1 
ATOM   5651 C  CA    . TRP B 2 153 ? -17.110 -23.529 -4.487  1.00 41.29  ? 153 TRP B CA    1 
ATOM   5652 C  C     . TRP B 2 153 ? -15.719 -24.066 -4.174  1.00 40.94  ? 153 TRP B C     1 
ATOM   5653 O  O     . TRP B 2 153 ? -15.417 -24.408 -3.026  1.00 42.89  ? 153 TRP B O     1 
ATOM   5654 C  CB    . TRP B 2 153 ? -17.162 -22.017 -4.247  1.00 41.08  ? 153 TRP B CB    1 
ATOM   5655 C  CG    . TRP B 2 153 ? -16.068 -21.264 -4.951  1.00 40.35  ? 153 TRP B CG    1 
ATOM   5656 C  CD1   . TRP B 2 153 ? -15.738 -21.342 -6.273  1.00 37.00  ? 153 TRP B CD1   1 
ATOM   5657 C  CD2   . TRP B 2 153 ? -15.165 -20.314 -4.369  1.00 39.11  ? 153 TRP B CD2   1 
ATOM   5658 N  NE1   . TRP B 2 153 ? -14.683 -20.506 -6.549  1.00 41.30  ? 153 TRP B NE1   1 
ATOM   5659 C  CE2   . TRP B 2 153 ? -14.314 -19.862 -5.397  1.00 40.96  ? 153 TRP B CE2   1 
ATOM   5660 C  CE3   . TRP B 2 153 ? -14.995 -19.802 -3.079  1.00 41.37  ? 153 TRP B CE3   1 
ATOM   5661 C  CZ2   . TRP B 2 153 ? -13.307 -18.925 -5.175  1.00 45.86  ? 153 TRP B CZ2   1 
ATOM   5662 C  CZ3   . TRP B 2 153 ? -13.995 -18.872 -2.861  1.00 49.88  ? 153 TRP B CZ3   1 
ATOM   5663 C  CH2   . TRP B 2 153 ? -13.165 -18.442 -3.903  1.00 40.01  ? 153 TRP B CH2   1 
ATOM   5664 N  N     . LYS B 2 154 ? -14.880 -24.142 -5.210  1.00 42.01  ? 154 LYS B N     1 
ATOM   5665 C  CA    . LYS B 2 154 ? -13.545 -24.715 -5.063  1.00 52.15  ? 154 LYS B CA    1 
ATOM   5666 C  C     . LYS B 2 154 ? -12.711 -23.949 -4.042  1.00 47.53  ? 154 LYS B C     1 
ATOM   5667 O  O     . LYS B 2 154 ? -11.990 -24.554 -3.240  1.00 50.09  ? 154 LYS B O     1 
ATOM   5668 C  CB    . LYS B 2 154 ? -12.849 -24.737 -6.425  1.00 51.34  ? 154 LYS B CB    1 
ATOM   5669 C  CG    . LYS B 2 154 ? -11.362 -25.043 -6.389  1.00 53.50  ? 154 LYS B CG    1 
ATOM   5670 C  CD    . LYS B 2 154 ? -10.772 -24.935 -7.787  1.00 48.17  ? 154 LYS B CD    1 
ATOM   5671 C  CE    . LYS B 2 154 ? -9.263  -25.086 -7.781  1.00 61.09  ? 154 LYS B CE    1 
ATOM   5672 N  NZ    . LYS B 2 154 ? -8.688  -24.891 -9.143  1.00 70.47  ? 154 LYS B NZ    1 
ATOM   5673 N  N     . GLY B 2 155 ? -12.800 -22.620 -4.051  1.00 44.49  ? 155 GLY B N     1 
ATOM   5674 C  CA    . GLY B 2 155 ? -11.981 -21.810 -3.168  1.00 46.87  ? 155 GLY B CA    1 
ATOM   5675 C  C     . GLY B 2 155 ? -12.423 -21.762 -1.722  1.00 49.10  ? 155 GLY B C     1 
ATOM   5676 O  O     . GLY B 2 155 ? -11.654 -21.300 -0.874  1.00 52.26  ? 155 GLY B O     1 
ATOM   5677 N  N     . SER B 2 156 ? -13.638 -22.232 -1.416  1.00 45.03  ? 156 SER B N     1 
ATOM   5678 C  CA    . SER B 2 156 ? -14.132 -22.132 -0.042  1.00 47.50  ? 156 SER B CA    1 
ATOM   5679 C  C     . SER B 2 156 ? -13.350 -23.009 0.929   1.00 56.11  ? 156 SER B C     1 
ATOM   5680 O  O     . SER B 2 156 ? -12.953 -22.505 1.995   1.00 48.53  ? 156 SER B O     1 
ATOM   5681 C  CB    . SER B 2 156 ? -15.633 -22.433 -0.005  1.00 47.64  ? 156 SER B CB    1 
ATOM   5682 O  OG    . SER B 2 156 ? -16.373 -21.412 -0.651  1.00 47.82  ? 156 SER B OG    1 
ATOM   5683 N  N     . PRO B 2 157 ? -13.099 -24.298 0.659   1.00 51.75  ? 157 PRO B N     1 
ATOM   5684 C  CA    . PRO B 2 157 ? -12.291 -25.076 1.612   1.00 54.39  ? 157 PRO B CA    1 
ATOM   5685 C  C     . PRO B 2 157 ? -10.848 -24.612 1.694   1.00 51.19  ? 157 PRO B C     1 
ATOM   5686 O  O     . PRO B 2 157 ? -10.223 -24.762 2.751   1.00 49.09  ? 157 PRO B O     1 
ATOM   5687 C  CB    . PRO B 2 157 ? -12.394 -26.510 1.075   1.00 50.71  ? 157 PRO B CB    1 
ATOM   5688 C  CG    . PRO B 2 157 ? -12.684 -26.346 -0.370  1.00 50.40  ? 157 PRO B CG    1 
ATOM   5689 C  CD    . PRO B 2 157 ? -13.571 -25.141 -0.455  1.00 49.35  ? 157 PRO B CD    1 
ATOM   5690 N  N     . ALA B 2 158 ? -10.300 -24.049 0.614   1.00 42.34  ? 158 ALA B N     1 
ATOM   5691 C  CA    . ALA B 2 158 ? -8.913  -23.596 0.641   1.00 38.35  ? 158 ALA B CA    1 
ATOM   5692 C  C     . ALA B 2 158 ? -8.744  -22.373 1.535   1.00 53.70  ? 158 ALA B C     1 
ATOM   5693 O  O     . ALA B 2 158 ? -7.798  -22.303 2.328   1.00 58.38  ? 158 ALA B O     1 
ATOM   5694 C  CB    . ALA B 2 158 ? -8.434  -23.294 -0.779  1.00 37.65  ? 158 ALA B CB    1 
ATOM   5695 N  N     . ILE B 2 159 ? -9.649  -21.400 1.421   1.00 47.81  ? 159 ILE B N     1 
ATOM   5696 C  CA    . ILE B 2 159 ? -9.550  -20.197 2.242   1.00 51.53  ? 159 ILE B CA    1 
ATOM   5697 C  C     . ILE B 2 159 ? -9.818  -20.524 3.706   1.00 52.29  ? 159 ILE B C     1 
ATOM   5698 O  O     . ILE B 2 159 ? -9.148  -20.006 4.607   1.00 55.92  ? 159 ILE B O     1 
ATOM   5699 C  CB    . ILE B 2 159 ? -10.508 -19.113 1.715   1.00 50.15  ? 159 ILE B CB    1 
ATOM   5700 C  CG1   . ILE B 2 159 ? -10.141 -18.729 0.281   1.00 38.41  ? 159 ILE B CG1   1 
ATOM   5701 C  CG2   . ILE B 2 159 ? -10.490 -17.890 2.620   1.00 50.20  ? 159 ILE B CG2   1 
ATOM   5702 C  CD1   . ILE B 2 159 ? -8.706  -18.280 0.116   1.00 47.63  ? 159 ILE B CD1   1 
ATOM   5703 N  N     . PHE B 2 160 ? -10.793 -21.394 3.967   1.00 49.75  ? 160 PHE B N     1 
ATOM   5704 C  CA    . PHE B 2 160 ? -11.146 -21.793 5.323   1.00 50.26  ? 160 PHE B CA    1 
ATOM   5705 C  C     . PHE B 2 160 ? -10.212 -22.858 5.889   1.00 56.20  ? 160 PHE B C     1 
ATOM   5706 O  O     . PHE B 2 160 ? -10.400 -23.274 7.037   1.00 54.70  ? 160 PHE B O     1 
ATOM   5707 C  CB    . PHE B 2 160 ? -12.595 -22.298 5.347   1.00 42.54  ? 160 PHE B CB    1 
ATOM   5708 C  CG    . PHE B 2 160 ? -13.212 -22.326 6.718   1.00 47.71  ? 160 PHE B CG    1 
ATOM   5709 C  CD1   . PHE B 2 160 ? -13.629 -21.154 7.327   1.00 52.04  ? 160 PHE B CD1   1 
ATOM   5710 C  CD2   . PHE B 2 160 ? -13.391 -23.525 7.389   1.00 46.65  ? 160 PHE B CD2   1 
ATOM   5711 C  CE1   . PHE B 2 160 ? -14.202 -21.176 8.586   1.00 58.23  ? 160 PHE B CE1   1 
ATOM   5712 C  CE2   . PHE B 2 160 ? -13.964 -23.554 8.647   1.00 53.86  ? 160 PHE B CE2   1 
ATOM   5713 C  CZ    . PHE B 2 160 ? -14.370 -22.379 9.246   1.00 56.76  ? 160 PHE B CZ    1 
ATOM   5714 N  N     . GLN B 2 161 ? -9.207  -23.289 5.122   1.00 51.40  ? 161 GLN B N     1 
ATOM   5715 C  CA    . GLN B 2 161 ? -8.346  -24.387 5.555   1.00 60.74  ? 161 GLN B CA    1 
ATOM   5716 C  C     . GLN B 2 161 ? -7.631  -24.056 6.860   1.00 66.21  ? 161 GLN B C     1 
ATOM   5717 O  O     . GLN B 2 161 ? -7.569  -24.888 7.773   1.00 64.32  ? 161 GLN B O     1 
ATOM   5718 C  CB    . GLN B 2 161 ? -7.334  -24.719 4.457   1.00 48.56  ? 161 GLN B CB    1 
ATOM   5719 C  CG    . GLN B 2 161 ? -6.269  -25.724 4.869   1.00 49.65  ? 161 GLN B CG    1 
ATOM   5720 C  CD    . GLN B 2 161 ? -6.835  -27.105 5.139   1.00 70.48  ? 161 GLN B CD    1 
ATOM   5721 O  OE1   . GLN B 2 161 ? -7.935  -27.439 4.698   1.00 77.12  ? 161 GLN B OE1   1 
ATOM   5722 N  NE2   . GLN B 2 161 ? -6.081  -27.918 5.869   1.00 77.77  ? 161 GLN B NE2   1 
ATOM   5723 N  N     . SER B 2 162 ? -7.084  -22.843 6.965   1.00 58.57  ? 162 SER B N     1 
ATOM   5724 C  CA    . SER B 2 162 ? -6.372  -22.461 8.181   1.00 60.17  ? 162 SER B CA    1 
ATOM   5725 C  C     . SER B 2 162 ? -7.309  -22.423 9.381   1.00 63.74  ? 162 SER B C     1 
ATOM   5726 O  O     . SER B 2 162 ? -6.933  -22.831 10.485  1.00 65.15  ? 162 SER B O     1 
ATOM   5727 C  CB    . SER B 2 162 ? -5.689  -21.107 7.988   1.00 51.86  ? 162 SER B CB    1 
ATOM   5728 O  OG    . SER B 2 162 ? -4.773  -21.148 6.908   1.00 72.67  ? 162 SER B OG    1 
ATOM   5729 N  N     . SER B 2 163 ? -8.539  -21.942 9.182   1.00 63.64  ? 163 SER B N     1 
ATOM   5730 C  CA    . SER B 2 163 ? -9.502  -21.908 10.277  1.00 61.94  ? 163 SER B CA    1 
ATOM   5731 C  C     . SER B 2 163 ? -10.028 -23.299 10.608  1.00 60.75  ? 163 SER B C     1 
ATOM   5732 O  O     . SER B 2 163 ? -10.430 -23.553 11.749  1.00 63.10  ? 163 SER B O     1 
ATOM   5733 C  CB    . SER B 2 163 ? -10.659 -20.971 9.929   1.00 50.68  ? 163 SER B CB    1 
ATOM   5734 O  OG    . SER B 2 163 ? -10.186 -19.678 9.597   1.00 60.38  ? 163 SER B OG    1 
ATOM   5735 N  N     . MET B 2 164 ? -10.035 -24.208 9.630   1.00 59.54  ? 164 MET B N     1 
ATOM   5736 C  CA    . MET B 2 164 ? -10.521 -25.560 9.884   1.00 66.38  ? 164 MET B CA    1 
ATOM   5737 C  C     . MET B 2 164 ? -9.535  -26.352 10.734  1.00 64.30  ? 164 MET B C     1 
ATOM   5738 O  O     . MET B 2 164 ? -9.942  -27.135 11.601  1.00 60.21  ? 164 MET B O     1 
ATOM   5739 C  CB    . MET B 2 164 ? -10.789 -26.278 8.561   1.00 56.67  ? 164 MET B CB    1 
ATOM   5740 C  CG    . MET B 2 164 ? -11.272 -27.713 8.716   1.00 59.38  ? 164 MET B CG    1 
ATOM   5741 S  SD    . MET B 2 164 ? -12.868 -27.839 9.550   1.00 61.62  ? 164 MET B SD    1 
ATOM   5742 C  CE    . MET B 2 164 ? -13.955 -27.114 8.325   1.00 67.15  ? 164 MET B CE    1 
ATOM   5743 N  N     . THR B 2 165 ? -8.233  -26.162 10.502  1.00 63.65  ? 165 THR B N     1 
ATOM   5744 C  CA    . THR B 2 165 ? -7.231  -26.881 11.284  1.00 64.46  ? 165 THR B CA    1 
ATOM   5745 C  C     . THR B 2 165 ? -7.240  -26.449 12.745  1.00 68.19  ? 165 THR B C     1 
ATOM   5746 O  O     . THR B 2 165 ? -6.999  -27.275 13.634  1.00 62.70  ? 165 THR B O     1 
ATOM   5747 C  CB    . THR B 2 165 ? -5.841  -26.674 10.681  1.00 62.83  ? 165 THR B CB    1 
ATOM   5748 O  OG1   . THR B 2 165 ? -5.549  -25.272 10.614  1.00 74.29  ? 165 THR B OG1   1 
ATOM   5749 C  CG2   . THR B 2 165 ? -5.772  -27.270 9.282   1.00 63.23  ? 165 THR B CG2   1 
ATOM   5750 N  N     . LYS B 2 166 ? -7.514  -25.170 13.014  1.00 65.29  ? 166 LYS B N     1 
ATOM   5751 C  CA    . LYS B 2 166 ? -7.591  -24.702 14.394  1.00 63.49  ? 166 LYS B CA    1 
ATOM   5752 C  C     . LYS B 2 166 ? -8.768  -25.326 15.133  1.00 70.15  ? 166 LYS B C     1 
ATOM   5753 O  O     . LYS B 2 166 ? -8.671  -25.596 16.336  1.00 69.15  ? 166 LYS B O     1 
ATOM   5754 C  CB    . LYS B 2 166 ? -7.701  -23.177 14.429  1.00 68.12  ? 166 LYS B CB    1 
ATOM   5755 C  CG    . LYS B 2 166 ? -6.620  -22.450 13.647  1.00 74.82  ? 166 LYS B CG    1 
ATOM   5756 C  CD    . LYS B 2 166 ? -6.969  -20.980 13.475  1.00 82.68  ? 166 LYS B CD    1 
ATOM   5757 C  CE    . LYS B 2 166 ? -5.994  -20.282 12.540  1.00 94.32  ? 166 LYS B CE    1 
ATOM   5758 N  NZ    . LYS B 2 166 ? -6.401  -18.876 12.262  1.00 73.57  ? 166 LYS B NZ    1 
ATOM   5759 N  N     . ILE B 2 167 ? -9.880  -25.562 14.434  1.00 69.26  ? 167 ILE B N     1 
ATOM   5760 C  CA    . ILE B 2 167 ? -11.059 -26.135 15.074  1.00 67.04  ? 167 ILE B CA    1 
ATOM   5761 C  C     . ILE B 2 167 ? -10.835 -27.607 15.397  1.00 70.11  ? 167 ILE B C     1 
ATOM   5762 O  O     . ILE B 2 167 ? -11.207 -28.084 16.476  1.00 65.47  ? 167 ILE B O     1 
ATOM   5763 C  CB    . ILE B 2 167 ? -12.296 -25.932 14.180  1.00 74.39  ? 167 ILE B CB    1 
ATOM   5764 C  CG1   . ILE B 2 167 ? -12.609 -24.441 14.029  1.00 68.06  ? 167 ILE B CG1   1 
ATOM   5765 C  CG2   . ILE B 2 167 ? -13.496 -26.682 14.740  1.00 78.68  ? 167 ILE B CG2   1 
ATOM   5766 C  CD1   . ILE B 2 167 ? -13.812 -24.154 13.156  1.00 68.87  ? 167 ILE B CD1   1 
ATOM   5767 N  N     . LEU B 2 168 ? -10.221 -28.347 14.476  1.00 65.67  ? 168 LEU B N     1 
ATOM   5768 C  CA    . LEU B 2 168 ? -10.038 -29.783 14.632  1.00 68.75  ? 168 LEU B CA    1 
ATOM   5769 C  C     . LEU B 2 168 ? -8.771  -30.155 15.390  1.00 69.26  ? 168 LEU B C     1 
ATOM   5770 O  O     . LEU B 2 168 ? -8.559  -31.343 15.656  1.00 65.60  ? 168 LEU B O     1 
ATOM   5771 C  CB    . LEU B 2 168 ? -10.020 -30.461 13.257  1.00 61.67  ? 168 LEU B CB    1 
ATOM   5772 C  CG    . LEU B 2 168 ? -11.243 -30.221 12.370  1.00 57.67  ? 168 LEU B CG    1 
ATOM   5773 C  CD1   . LEU B 2 168 ? -11.033 -30.819 10.989  1.00 53.20  ? 168 LEU B CD1   1 
ATOM   5774 C  CD2   . LEU B 2 168 ? -12.494 -30.793 13.021  1.00 51.68  ? 168 LEU B CD2   1 
ATOM   5775 N  N     . GLU B 2 169 ? -7.931  -29.181 15.741  1.00 71.85  ? 169 GLU B N     1 
ATOM   5776 C  CA    . GLU B 2 169 ? -6.662  -29.495 16.397  1.00 72.96  ? 169 GLU B CA    1 
ATOM   5777 C  C     . GLU B 2 169 ? -6.845  -30.221 17.726  1.00 78.09  ? 169 GLU B C     1 
ATOM   5778 O  O     . GLU B 2 169 ? -6.184  -31.254 17.930  1.00 79.45  ? 169 GLU B O     1 
ATOM   5779 C  CB    . GLU B 2 169 ? -5.839  -28.211 16.557  1.00 70.50  ? 169 GLU B CB    1 
ATOM   5780 C  CG    . GLU B 2 169 ? -4.335  -28.416 16.736  1.00 72.25  ? 169 GLU B CG    1 
ATOM   5781 C  CD    . GLU B 2 169 ? -3.972  -29.032 18.074  1.00 86.43  ? 169 GLU B CD    1 
ATOM   5782 O  OE1   . GLU B 2 169 ? -3.335  -30.107 18.083  1.00 85.78  ? 169 GLU B OE1   1 
ATOM   5783 O  OE2   . GLU B 2 169 ? -4.333  -28.446 19.117  1.00 88.79  ? 169 GLU B OE2   1 
ATOM   5784 N  N     . PRO B 2 170 ? -7.688  -29.762 18.662  1.00 75.60  ? 170 PRO B N     1 
ATOM   5785 C  CA    . PRO B 2 170 ? -7.839  -30.525 19.915  1.00 83.18  ? 170 PRO B CA    1 
ATOM   5786 C  C     . PRO B 2 170 ? -8.448  -31.900 19.711  1.00 82.36  ? 170 PRO B C     1 
ATOM   5787 O  O     . PRO B 2 170 ? -8.046  -32.857 20.384  1.00 76.93  ? 170 PRO B O     1 
ATOM   5788 C  CB    . PRO B 2 170 ? -8.744  -29.624 20.769  1.00 79.53  ? 170 PRO B CB    1 
ATOM   5789 C  CG    . PRO B 2 170 ? -8.620  -28.267 20.168  1.00 75.44  ? 170 PRO B CG    1 
ATOM   5790 C  CD    . PRO B 2 170 ? -8.464  -28.509 18.704  1.00 75.79  ? 170 PRO B CD    1 
ATOM   5791 N  N     . PHE B 2 171 ? -9.410  -32.027 18.795  1.00 78.27  ? 171 PHE B N     1 
ATOM   5792 C  CA    . PHE B 2 171 ? -10.045 -33.322 18.567  1.00 75.41  ? 171 PHE B CA    1 
ATOM   5793 C  C     . PHE B 2 171 ? -9.086  -34.296 17.893  1.00 73.58  ? 171 PHE B C     1 
ATOM   5794 O  O     . PHE B 2 171 ? -9.121  -35.501 18.169  1.00 74.35  ? 171 PHE B O     1 
ATOM   5795 C  CB    . PHE B 2 171 ? -11.311 -33.143 17.729  1.00 73.82  ? 171 PHE B CB    1 
ATOM   5796 C  CG    . PHE B 2 171 ? -12.208 -34.349 17.717  1.00 66.91  ? 171 PHE B CG    1 
ATOM   5797 C  CD1   . PHE B 2 171 ? -12.028 -35.357 16.783  1.00 64.14  ? 171 PHE B CD1   1 
ATOM   5798 C  CD2   . PHE B 2 171 ? -13.236 -34.472 18.637  1.00 72.74  ? 171 PHE B CD2   1 
ATOM   5799 C  CE1   . PHE B 2 171 ? -12.853 -36.467 16.771  1.00 68.25  ? 171 PHE B CE1   1 
ATOM   5800 C  CE2   . PHE B 2 171 ? -14.065 -35.579 18.630  1.00 71.49  ? 171 PHE B CE2   1 
ATOM   5801 C  CZ    . PHE B 2 171 ? -13.874 -36.578 17.696  1.00 66.22  ? 171 PHE B CZ    1 
ATOM   5802 N  N     . ARG B 2 172 ? -8.223  -33.795 17.007  1.00 70.65  ? 172 ARG B N     1 
ATOM   5803 C  CA    . ARG B 2 172 ? -7.260  -34.667 16.342  1.00 69.89  ? 172 ARG B CA    1 
ATOM   5804 C  C     . ARG B 2 172 ? -6.165  -35.117 17.301  1.00 73.10  ? 172 ARG B C     1 
ATOM   5805 O  O     . ARG B 2 172 ? -5.702  -36.262 17.230  1.00 76.04  ? 172 ARG B O     1 
ATOM   5806 C  CB    . ARG B 2 172 ? -6.656  -33.959 15.130  1.00 66.72  ? 172 ARG B CB    1 
ATOM   5807 C  CG    . ARG B 2 172 ? -7.582  -33.894 13.928  1.00 62.40  ? 172 ARG B CG    1 
ATOM   5808 C  CD    . ARG B 2 172 ? -6.985  -33.056 12.810  1.00 60.32  ? 172 ARG B CD    1 
ATOM   5809 N  NE    . ARG B 2 172 ? -7.771  -33.147 11.583  1.00 68.82  ? 172 ARG B NE    1 
ATOM   5810 C  CZ    . ARG B 2 172 ? -7.534  -32.432 10.488  1.00 64.95  ? 172 ARG B CZ    1 
ATOM   5811 N  NH1   . ARG B 2 172 ? -6.533  -31.563 10.465  1.00 62.22  ? 172 ARG B NH1   1 
ATOM   5812 N  NH2   . ARG B 2 172 ? -8.301  -32.584 9.417   1.00 59.18  ? 172 ARG B NH2   1 
ATOM   5813 N  N     . LYS B 2 173 ? -5.736  -34.232 18.204  1.00 74.31  ? 173 LYS B N     1 
ATOM   5814 C  CA    . LYS B 2 173 ? -4.727  -34.616 19.186  1.00 80.53  ? 173 LYS B CA    1 
ATOM   5815 C  C     . LYS B 2 173 ? -5.284  -35.629 20.178  1.00 80.25  ? 173 LYS B C     1 
ATOM   5816 O  O     . LYS B 2 173 ? -4.602  -36.596 20.538  1.00 72.90  ? 173 LYS B O     1 
ATOM   5817 C  CB    . LYS B 2 173 ? -4.208  -33.380 19.920  1.00 77.50  ? 173 LYS B CB    1 
ATOM   5818 C  CG    . LYS B 2 173 ? -3.039  -33.661 20.850  1.00 83.84  ? 173 LYS B CG    1 
ATOM   5819 C  CD    . LYS B 2 173 ? -3.226  -32.984 22.197  1.00 89.25  ? 173 LYS B CD    1 
ATOM   5820 C  CE    . LYS B 2 173 ? -4.433  -33.550 22.930  1.00 97.00  ? 173 LYS B CE    1 
ATOM   5821 N  NZ    . LYS B 2 173 ? -4.605  -32.941 24.278  1.00 96.48  ? 173 LYS B NZ    1 
ATOM   5822 N  N     . GLN B 2 174 ? -6.523  -35.424 20.630  1.00 77.48  ? 174 GLN B N     1 
ATOM   5823 C  CA    . GLN B 2 174 ? -7.142  -36.344 21.575  1.00 80.16  ? 174 GLN B CA    1 
ATOM   5824 C  C     . GLN B 2 174 ? -7.453  -37.697 20.946  1.00 81.22  ? 174 GLN B C     1 
ATOM   5825 O  O     . GLN B 2 174 ? -7.560  -38.694 21.669  1.00 78.23  ? 174 GLN B O     1 
ATOM   5826 C  CB    . GLN B 2 174 ? -8.419  -35.722 22.146  1.00 81.87  ? 174 GLN B CB    1 
ATOM   5827 C  CG    . GLN B 2 174 ? -8.967  -36.420 23.382  1.00 88.24  ? 174 GLN B CG    1 
ATOM   5828 C  CD    . GLN B 2 174 ? -8.081  -36.238 24.600  1.00 95.29  ? 174 GLN B CD    1 
ATOM   5829 O  OE1   . GLN B 2 174 ? -7.237  -35.342 24.642  1.00 102.04 ? 174 GLN B OE1   1 
ATOM   5830 N  NE2   . GLN B 2 174 ? -8.270  -37.090 25.601  1.00 97.72  ? 174 GLN B NE2   1 
ATOM   5831 N  N     . ASN B 2 175 ? -7.593  -37.756 19.622  1.00 81.97  ? 175 ASN B N     1 
ATOM   5832 C  CA    . ASN B 2 175 ? -7.896  -38.995 18.907  1.00 74.54  ? 175 ASN B CA    1 
ATOM   5833 C  C     . ASN B 2 175 ? -6.928  -39.125 17.739  1.00 78.47  ? 175 ASN B C     1 
ATOM   5834 O  O     . ASN B 2 175 ? -7.224  -38.686 16.619  1.00 77.53  ? 175 ASN B O     1 
ATOM   5835 C  CB    . ASN B 2 175 ? -9.346  -39.015 18.429  1.00 80.22  ? 175 ASN B CB    1 
ATOM   5836 C  CG    . ASN B 2 175 ? -10.334 -38.790 19.557  1.00 77.58  ? 175 ASN B CG    1 
ATOM   5837 O  OD1   . ASN B 2 175 ? -10.779 -39.736 20.206  1.00 80.54  ? 175 ASN B OD1   1 
ATOM   5838 N  ND2   . ASN B 2 175 ? -10.682 -37.531 19.796  1.00 70.53  ? 175 ASN B ND2   1 
ATOM   5839 N  N     . PRO B 2 176 ? -5.757  -39.728 17.961  1.00 85.27  ? 176 PRO B N     1 
ATOM   5840 C  CA    . PRO B 2 176 ? -4.764  -39.833 16.883  1.00 79.54  ? 176 PRO B CA    1 
ATOM   5841 C  C     . PRO B 2 176 ? -5.113  -40.896 15.853  1.00 82.48  ? 176 PRO B C     1 
ATOM   5842 O  O     . PRO B 2 176 ? -4.715  -40.791 14.688  1.00 81.69  ? 176 PRO B O     1 
ATOM   5843 C  CB    . PRO B 2 176 ? -3.475  -40.183 17.635  1.00 79.56  ? 176 PRO B CB    1 
ATOM   5844 C  CG    . PRO B 2 176 ? -3.949  -40.921 18.841  1.00 85.18  ? 176 PRO B CG    1 
ATOM   5845 C  CD    . PRO B 2 176 ? -5.260  -40.285 19.231  1.00 86.94  ? 176 PRO B CD    1 
ATOM   5846 N  N     . ASP B 2 177 ? -5.853  -41.924 16.268  1.00 84.86  ? 177 ASP B N     1 
ATOM   5847 C  CA    . ASP B 2 177 ? -6.229  -43.023 15.390  1.00 87.02  ? 177 ASP B CA    1 
ATOM   5848 C  C     . ASP B 2 177 ? -7.500  -42.740 14.598  1.00 77.65  ? 177 ASP B C     1 
ATOM   5849 O  O     . ASP B 2 177 ? -8.093  -43.671 14.042  1.00 74.39  ? 177 ASP B O     1 
ATOM   5850 C  CB    . ASP B 2 177 ? -6.391  -44.311 16.200  1.00 89.67  ? 177 ASP B CB    1 
ATOM   5851 C  CG    . ASP B 2 177 ? -5.072  -44.834 16.732  1.00 99.71  ? 177 ASP B CG    1 
ATOM   5852 O  OD1   . ASP B 2 177 ? -4.045  -44.671 16.040  1.00 95.58  ? 177 ASP B OD1   1 
ATOM   5853 O  OD2   . ASP B 2 177 ? -5.062  -45.407 17.842  1.00 101.11 ? 177 ASP B OD2   1 
ATOM   5854 N  N     . ILE B 2 178 ? -7.930  -41.483 14.534  1.00 75.66  ? 178 ILE B N     1 
ATOM   5855 C  CA    . ILE B 2 178 ? -9.115  -41.084 13.785  1.00 72.60  ? 178 ILE B CA    1 
ATOM   5856 C  C     . ILE B 2 178 ? -8.678  -40.107 12.705  1.00 68.11  ? 178 ILE B C     1 
ATOM   5857 O  O     . ILE B 2 178 ? -8.118  -39.046 13.009  1.00 68.57  ? 178 ILE B O     1 
ATOM   5858 C  CB    . ILE B 2 178 ? -10.184 -40.458 14.695  1.00 70.73  ? 178 ILE B CB    1 
ATOM   5859 C  CG1   . ILE B 2 178 ? -10.702 -41.498 15.691  1.00 77.11  ? 178 ILE B CG1   1 
ATOM   5860 C  CG2   . ILE B 2 178 ? -11.323 -39.887 13.866  1.00 58.61  ? 178 ILE B CG2   1 
ATOM   5861 C  CD1   . ILE B 2 178 ? -11.804 -40.987 16.586  1.00 75.72  ? 178 ILE B CD1   1 
ATOM   5862 N  N     . VAL B 2 179 ? -8.929  -40.464 11.450  1.00 63.12  ? 179 VAL B N     1 
ATOM   5863 C  CA    . VAL B 2 179 ? -8.540  -39.640 10.312  1.00 60.93  ? 179 VAL B CA    1 
ATOM   5864 C  C     . VAL B 2 179 ? -9.713  -38.756 9.918   1.00 59.48  ? 179 VAL B C     1 
ATOM   5865 O  O     . VAL B 2 179 ? -10.835 -39.241 9.724   1.00 54.25  ? 179 VAL B O     1 
ATOM   5866 C  CB    . VAL B 2 179 ? -8.087  -40.513 9.130   1.00 60.04  ? 179 VAL B CB    1 
ATOM   5867 C  CG1   . VAL B 2 179 ? -7.700  -39.641 7.946   1.00 57.67  ? 179 VAL B CG1   1 
ATOM   5868 C  CG2   . VAL B 2 179 ? -6.926  -41.403 9.545   1.00 56.39  ? 179 VAL B CG2   1 
ATOM   5869 N  N     . ILE B 2 180 ? -9.457  -37.456 9.802   1.00 58.31  ? 180 ILE B N     1 
ATOM   5870 C  CA    . ILE B 2 180 ? -10.464 -36.479 9.406   1.00 60.78  ? 180 ILE B CA    1 
ATOM   5871 C  C     . ILE B 2 180 ? -9.991  -35.834 8.111   1.00 62.09  ? 180 ILE B C     1 
ATOM   5872 O  O     . ILE B 2 180 ? -8.996  -35.098 8.103   1.00 60.16  ? 180 ILE B O     1 
ATOM   5873 C  CB    . ILE B 2 180 ? -10.708 -35.425 10.494  1.00 56.06  ? 180 ILE B CB    1 
ATOM   5874 C  CG1   . ILE B 2 180 ? -11.242 -36.088 11.765  1.00 54.25  ? 180 ILE B CG1   1 
ATOM   5875 C  CG2   . ILE B 2 180 ? -11.676 -34.363 9.997   1.00 61.05  ? 180 ILE B CG2   1 
ATOM   5876 C  CD1   . ILE B 2 180 ? -11.542 -35.117 12.884  1.00 54.64  ? 180 ILE B CD1   1 
ATOM   5877 N  N     . TYR B 2 181 ? -10.697 -36.111 7.018   1.00 59.21  ? 181 TYR B N     1 
ATOM   5878 C  CA    . TYR B 2 181 ? -10.388 -35.552 5.711   1.00 57.96  ? 181 TYR B CA    1 
ATOM   5879 C  C     . TYR B 2 181 ? -11.532 -34.656 5.260   1.00 58.75  ? 181 TYR B C     1 
ATOM   5880 O  O     . TYR B 2 181 ? -12.706 -34.974 5.480   1.00 55.49  ? 181 TYR B O     1 
ATOM   5881 C  CB    . TYR B 2 181 ? -10.142 -36.656 4.677   1.00 56.74  ? 181 TYR B CB    1 
ATOM   5882 C  CG    . TYR B 2 181 ? -9.921  -36.145 3.271   1.00 55.03  ? 181 TYR B CG    1 
ATOM   5883 C  CD1   . TYR B 2 181 ? -8.826  -35.347 2.966   1.00 46.96  ? 181 TYR B CD1   1 
ATOM   5884 C  CD2   . TYR B 2 181 ? -10.803 -36.466 2.248   1.00 54.90  ? 181 TYR B CD2   1 
ATOM   5885 C  CE1   . TYR B 2 181 ? -8.619  -34.878 1.683   1.00 45.47  ? 181 TYR B CE1   1 
ATOM   5886 C  CE2   . TYR B 2 181 ? -10.604 -36.003 0.960   1.00 48.69  ? 181 TYR B CE2   1 
ATOM   5887 C  CZ    . TYR B 2 181 ? -9.510  -35.210 0.683   1.00 52.63  ? 181 TYR B CZ    1 
ATOM   5888 O  OH    . TYR B 2 181 ? -9.308  -34.746 -0.597  1.00 61.97  ? 181 TYR B OH    1 
ATOM   5889 N  N     . GLN B 2 182 ? -11.186 -33.534 4.635   1.00 40.67  ? 182 GLN B N     1 
ATOM   5890 C  CA    . GLN B 2 182 ? -12.160 -32.550 4.185   1.00 48.02  ? 182 GLN B CA    1 
ATOM   5891 C  C     . GLN B 2 182 ? -12.128 -32.458 2.667   1.00 47.69  ? 182 GLN B C     1 
ATOM   5892 O  O     . GLN B 2 182 ? -11.052 -32.365 2.067   1.00 45.66  ? 182 GLN B O     1 
ATOM   5893 C  CB    . GLN B 2 182 ? -11.883 -31.175 4.798   1.00 44.91  ? 182 GLN B CB    1 
ATOM   5894 C  CG    . GLN B 2 182 ? -12.881 -30.105 4.386   1.00 53.62  ? 182 GLN B CG    1 
ATOM   5895 C  CD    . GLN B 2 182 ? -12.519 -28.732 4.916   1.00 59.55  ? 182 GLN B CD    1 
ATOM   5896 O  OE1   . GLN B 2 182 ? -11.431 -28.528 5.455   1.00 58.64  ? 182 GLN B OE1   1 
ATOM   5897 N  NE2   . GLN B 2 182 ? -13.434 -27.780 4.768   1.00 64.44  ? 182 GLN B NE2   1 
ATOM   5898 N  N     . TYR B 2 183 ? -13.309 -32.486 2.053   1.00 45.55  ? 183 TYR B N     1 
ATOM   5899 C  CA    . TYR B 2 183 ? -13.451 -32.263 0.619   1.00 44.74  ? 183 TYR B CA    1 
ATOM   5900 C  C     . TYR B 2 183 ? -14.740 -31.495 0.380   1.00 43.25  ? 183 TYR B C     1 
ATOM   5901 O  O     . TYR B 2 183 ? -15.818 -31.962 0.761   1.00 45.63  ? 183 TYR B O     1 
ATOM   5902 C  CB    . TYR B 2 183 ? -13.459 -33.582 -0.160  1.00 46.51  ? 183 TYR B CB    1 
ATOM   5903 C  CG    . TYR B 2 183 ? -13.587 -33.388 -1.654  1.00 42.42  ? 183 TYR B CG    1 
ATOM   5904 C  CD1   . TYR B 2 183 ? -12.474 -33.098 -2.432  1.00 41.32  ? 183 TYR B CD1   1 
ATOM   5905 C  CD2   . TYR B 2 183 ? -14.820 -33.485 -2.285  1.00 42.21  ? 183 TYR B CD2   1 
ATOM   5906 C  CE1   . TYR B 2 183 ? -12.585 -32.914 -3.796  1.00 40.57  ? 183 TYR B CE1   1 
ATOM   5907 C  CE2   . TYR B 2 183 ? -14.940 -33.303 -3.649  1.00 40.81  ? 183 TYR B CE2   1 
ATOM   5908 C  CZ    . TYR B 2 183 ? -13.820 -33.017 -4.399  1.00 45.99  ? 183 TYR B CZ    1 
ATOM   5909 O  OH    . TYR B 2 183 ? -13.934 -32.835 -5.757  1.00 57.74  ? 183 TYR B OH    1 
ATOM   5910 N  N     . MET B 2 184 ? -14.624 -30.329 -0.253  1.00 35.84  ? 184 MET B N     1 
ATOM   5911 C  CA    . MET B 2 184 ? -15.759 -29.440 -0.542  1.00 48.93  ? 184 MET B CA    1 
ATOM   5912 C  C     . MET B 2 184 ? -16.433 -29.109 0.788   1.00 44.20  ? 184 MET B C     1 
ATOM   5913 O  O     . MET B 2 184 ? -15.738 -28.715 1.738   1.00 42.34  ? 184 MET B O     1 
ATOM   5914 C  CB    . MET B 2 184 ? -16.658 -30.077 -1.594  1.00 45.12  ? 184 MET B CB    1 
ATOM   5915 C  CG    . MET B 2 184 ? -16.048 -30.147 -2.979  1.00 57.65  ? 184 MET B CG    1 
ATOM   5916 S  SD    . MET B 2 184 ? -15.493 -28.547 -3.588  1.00 75.55  ? 184 MET B SD    1 
ATOM   5917 C  CE    . MET B 2 184 ? -15.145 -28.953 -5.296  1.00 71.36  ? 184 MET B CE    1 
ATOM   5918 N  N     . ASP B 2 185 ? -17.751 -29.252 0.909   1.00 41.14  ? 185 ASP B N     1 
ATOM   5919 C  CA    . ASP B 2 185 ? -18.464 -28.960 2.143   1.00 45.98  ? 185 ASP B CA    1 
ATOM   5920 C  C     . ASP B 2 185 ? -18.572 -30.171 3.062   1.00 48.78  ? 185 ASP B C     1 
ATOM   5921 O  O     . ASP B 2 185 ? -19.334 -30.127 4.034   1.00 50.71  ? 185 ASP B O     1 
ATOM   5922 C  CB    . ASP B 2 185 ? -19.866 -28.430 1.829   1.00 45.52  ? 185 ASP B CB    1 
ATOM   5923 C  CG    . ASP B 2 185 ? -19.883 -27.502 0.632   1.00 46.64  ? 185 ASP B CG    1 
ATOM   5924 O  OD1   . ASP B 2 185 ? -20.933 -27.417 -0.039  1.00 53.60  ? 185 ASP B OD1   1 
ATOM   5925 O  OD2   . ASP B 2 185 ? -18.847 -26.864 0.354   1.00 47.24  ? 185 ASP B OD2   1 
ATOM   5926 N  N     . ASP B 2 186 ? -17.836 -31.242 2.782   1.00 37.99  ? 186 ASP B N     1 
ATOM   5927 C  CA    . ASP B 2 186 ? -17.942 -32.485 3.530   1.00 53.97  ? 186 ASP B CA    1 
ATOM   5928 C  C     . ASP B 2 186 ? -16.716 -32.702 4.408   1.00 52.75  ? 186 ASP B C     1 
ATOM   5929 O  O     . ASP B 2 186 ? -15.605 -32.278 4.076   1.00 44.50  ? 186 ASP B O     1 
ATOM   5930 C  CB    . ASP B 2 186 ? -18.113 -33.682 2.590   1.00 61.25  ? 186 ASP B CB    1 
ATOM   5931 C  CG    . ASP B 2 186 ? -19.429 -33.652 1.842   1.00 56.87  ? 186 ASP B CG    1 
ATOM   5932 O  OD1   . ASP B 2 186 ? -19.478 -34.163 0.703   1.00 53.07  ? 186 ASP B OD1   1 
ATOM   5933 O  OD2   . ASP B 2 186 ? -20.412 -33.116 2.395   1.00 54.72  ? 186 ASP B OD2   1 
ATOM   5934 N  N     . LEU B 2 187 ? -16.936 -33.378 5.534   1.00 54.43  ? 187 LEU B N     1 
ATOM   5935 C  CA    . LEU B 2 187 ? -15.879 -33.758 6.465   1.00 51.38  ? 187 LEU B CA    1 
ATOM   5936 C  C     . LEU B 2 187 ? -15.949 -35.269 6.650   1.00 58.49  ? 187 LEU B C     1 
ATOM   5937 O  O     . LEU B 2 187 ? -16.925 -35.785 7.206   1.00 57.49  ? 187 LEU B O     1 
ATOM   5938 C  CB    . LEU B 2 187 ? -16.033 -33.028 7.799   1.00 58.50  ? 187 LEU B CB    1 
ATOM   5939 C  CG    . LEU B 2 187 ? -14.762 -32.794 8.618   1.00 59.65  ? 187 LEU B CG    1 
ATOM   5940 C  CD1   . LEU B 2 187 ? -13.836 -31.823 7.902   1.00 45.08  ? 187 LEU B CD1   1 
ATOM   5941 C  CD2   . LEU B 2 187 ? -15.104 -32.287 10.010  1.00 55.16  ? 187 LEU B CD2   1 
ATOM   5942 N  N     . TYR B 2 188 ? -14.926 -35.975 6.176   1.00 60.94  ? 188 TYR B N     1 
ATOM   5943 C  CA    . TYR B 2 188 ? -14.887 -37.430 6.247   1.00 55.73  ? 188 TYR B CA    1 
ATOM   5944 C  C     . TYR B 2 188 ? -14.128 -37.852 7.499   1.00 62.85  ? 188 TYR B C     1 
ATOM   5945 O  O     . TYR B 2 188 ? -12.948 -37.520 7.657   1.00 63.43  ? 188 TYR B O     1 
ATOM   5946 C  CB    . TYR B 2 188 ? -14.234 -38.013 4.995   1.00 58.36  ? 188 TYR B CB    1 
ATOM   5947 C  CG    . TYR B 2 188 ? -15.019 -37.762 3.728   1.00 59.87  ? 188 TYR B CG    1 
ATOM   5948 C  CD1   . TYR B 2 188 ? -14.870 -36.577 3.018   1.00 56.19  ? 188 TYR B CD1   1 
ATOM   5949 C  CD2   . TYR B 2 188 ? -15.909 -38.711 3.241   1.00 48.33  ? 188 TYR B CD2   1 
ATOM   5950 C  CE1   . TYR B 2 188 ? -15.587 -36.344 1.859   1.00 52.97  ? 188 TYR B CE1   1 
ATOM   5951 C  CE2   . TYR B 2 188 ? -16.629 -38.486 2.083   1.00 50.86  ? 188 TYR B CE2   1 
ATOM   5952 C  CZ    . TYR B 2 188 ? -16.464 -37.301 1.398   1.00 53.58  ? 188 TYR B CZ    1 
ATOM   5953 O  OH    . TYR B 2 188 ? -17.181 -37.074 0.245   1.00 54.50  ? 188 TYR B OH    1 
ATOM   5954 N  N     . VAL B 2 189 ? -14.802 -38.583 8.382   1.00 53.24  ? 189 VAL B N     1 
ATOM   5955 C  CA    . VAL B 2 189 ? -14.251 -38.976 9.674   1.00 55.64  ? 189 VAL B CA    1 
ATOM   5956 C  C     . VAL B 2 189 ? -14.319 -40.493 9.770   1.00 60.82  ? 189 VAL B C     1 
ATOM   5957 O  O     . VAL B 2 189 ? -15.410 -41.068 9.876   1.00 62.97  ? 189 VAL B O     1 
ATOM   5958 C  CB    . VAL B 2 189 ? -15.000 -38.316 10.837  1.00 54.88  ? 189 VAL B CB    1 
ATOM   5959 C  CG1   . VAL B 2 189 ? -14.377 -38.717 12.164  1.00 55.77  ? 189 VAL B CG1   1 
ATOM   5960 C  CG2   . VAL B 2 189 ? -14.989 -36.811 10.667  1.00 57.34  ? 189 VAL B CG2   1 
ATOM   5961 N  N     . GLY B 2 190 ? -13.159 -41.140 9.744   1.00 57.87  ? 190 GLY B N     1 
ATOM   5962 C  CA    . GLY B 2 190 ? -13.080 -42.585 9.816   1.00 60.45  ? 190 GLY B CA    1 
ATOM   5963 C  C     . GLY B 2 190 ? -12.390 -43.042 11.086  1.00 62.90  ? 190 GLY B C     1 
ATOM   5964 O  O     . GLY B 2 190 ? -11.488 -42.376 11.597  1.00 64.71  ? 190 GLY B O     1 
ATOM   5965 N  N     . SER B 2 191 ? -12.825 -44.194 11.593  1.00 63.55  ? 191 SER B N     1 
ATOM   5966 C  CA    . SER B 2 191 ? -12.246 -44.771 12.796  1.00 71.26  ? 191 SER B CA    1 
ATOM   5967 C  C     . SER B 2 191 ? -12.400 -46.282 12.744  1.00 65.76  ? 191 SER B C     1 
ATOM   5968 O  O     . SER B 2 191 ? -13.251 -46.816 12.027  1.00 63.12  ? 191 SER B O     1 
ATOM   5969 C  CB    . SER B 2 191 ? -12.902 -44.216 14.066  1.00 63.43  ? 191 SER B CB    1 
ATOM   5970 O  OG    . SER B 2 191 ? -14.215 -44.723 14.226  1.00 58.47  ? 191 SER B OG    1 
ATOM   5971 N  N     . ASP B 2 192 ? -11.559 -46.968 13.512  1.00 72.59  ? 192 ASP B N     1 
ATOM   5972 C  CA    . ASP B 2 192 ? -11.656 -48.411 13.678  1.00 74.24  ? 192 ASP B CA    1 
ATOM   5973 C  C     . ASP B 2 192 ? -12.470 -48.801 14.905  1.00 69.08  ? 192 ASP B C     1 
ATOM   5974 O  O     . ASP B 2 192 ? -12.451 -49.971 15.300  1.00 75.00  ? 192 ASP B O     1 
ATOM   5975 C  CB    . ASP B 2 192 ? -10.258 -49.029 13.760  1.00 73.43  ? 192 ASP B CB    1 
ATOM   5976 C  CG    . ASP B 2 192 ? -9.477  -48.879 12.470  1.00 74.11  ? 192 ASP B CG    1 
ATOM   5977 O  OD1   . ASP B 2 192 ? -8.255  -48.636 12.537  1.00 73.85  ? 192 ASP B OD1   1 
ATOM   5978 O  OD2   . ASP B 2 192 ? -10.086 -49.004 11.388  1.00 73.99  ? 192 ASP B OD2   1 
ATOM   5979 N  N     . LEU B 2 193 ? -13.178 -47.852 15.509  1.00 69.23  ? 193 LEU B N     1 
ATOM   5980 C  CA    . LEU B 2 193 ? -13.969 -48.132 16.695  1.00 69.16  ? 193 LEU B CA    1 
ATOM   5981 C  C     . LEU B 2 193 ? -15.169 -49.010 16.351  1.00 75.82  ? 193 LEU B C     1 
ATOM   5982 O  O     . LEU B 2 193 ? -15.600 -49.105 15.198  1.00 76.89  ? 193 LEU B O     1 
ATOM   5983 C  CB    . LEU B 2 193 ? -14.452 -46.832 17.341  1.00 61.21  ? 193 LEU B CB    1 
ATOM   5984 C  CG    . LEU B 2 193 ? -13.399 -45.790 17.722  1.00 62.07  ? 193 LEU B CG    1 
ATOM   5985 C  CD1   . LEU B 2 193 ? -14.066 -44.541 18.278  1.00 48.81  ? 193 LEU B CD1   1 
ATOM   5986 C  CD2   . LEU B 2 193 ? -12.414 -46.368 18.723  1.00 63.12  ? 193 LEU B CD2   1 
ATOM   5987 N  N     . GLU B 2 194 ? -15.710 -49.656 17.378  1.00 62.88  ? 194 GLU B N     1 
ATOM   5988 C  CA    . GLU B 2 194 ? -16.918 -50.449 17.213  1.00 76.43  ? 194 GLU B CA    1 
ATOM   5989 C  C     . GLU B 2 194 ? -18.113 -49.540 16.947  1.00 83.50  ? 194 GLU B C     1 
ATOM   5990 O  O     . GLU B 2 194 ? -18.164 -48.395 17.404  1.00 80.24  ? 194 GLU B O     1 
ATOM   5991 C  CB    . GLU B 2 194 ? -17.168 -51.299 18.460  1.00 85.79  ? 194 GLU B CB    1 
ATOM   5992 C  CG    . GLU B 2 194 ? -18.308 -52.299 18.332  1.00 109.22 ? 194 GLU B CG    1 
ATOM   5993 C  CD    . GLU B 2 194 ? -18.566 -53.057 19.620  1.00 116.18 ? 194 GLU B CD    1 
ATOM   5994 O  OE1   . GLU B 2 194 ? -18.023 -52.650 20.670  1.00 113.83 ? 194 GLU B OE1   1 
ATOM   5995 O  OE2   . GLU B 2 194 ? -19.309 -54.061 19.583  1.00 111.74 ? 194 GLU B OE2   1 
ATOM   5996 N  N     . ILE B 2 195 ? -19.076 -50.058 16.180  1.00 87.31  ? 195 ILE B N     1 
ATOM   5997 C  CA    . ILE B 2 195 ? -20.321 -49.333 15.959  1.00 85.82  ? 195 ILE B CA    1 
ATOM   5998 C  C     . ILE B 2 195 ? -20.982 -49.061 17.302  1.00 89.17  ? 195 ILE B C     1 
ATOM   5999 O  O     . ILE B 2 195 ? -21.098 -49.953 18.152  1.00 103.35 ? 195 ILE B O     1 
ATOM   6000 C  CB    . ILE B 2 195 ? -21.238 -50.121 15.009  1.00 91.56  ? 195 ILE B CB    1 
ATOM   6001 C  CG1   . ILE B 2 195 ? -21.039 -49.648 13.567  1.00 85.91  ? 195 ILE B CG1   1 
ATOM   6002 C  CG2   . ILE B 2 195 ? -22.698 -49.985 15.416  1.00 79.89  ? 195 ILE B CG2   1 
ATOM   6003 C  CD1   . ILE B 2 195 ? -21.426 -48.200 13.342  1.00 72.36  ? 195 ILE B CD1   1 
ATOM   6004 N  N     . GLY B 2 196 ? -21.402 -47.816 17.505  1.00 73.94  ? 196 GLY B N     1 
ATOM   6005 C  CA    . GLY B 2 196 ? -21.861 -47.374 18.806  1.00 78.11  ? 196 GLY B CA    1 
ATOM   6006 C  C     . GLY B 2 196 ? -20.847 -46.444 19.438  1.00 73.89  ? 196 GLY B C     1 
ATOM   6007 O  O     . GLY B 2 196 ? -21.158 -45.293 19.758  1.00 61.98  ? 196 GLY B O     1 
ATOM   6008 N  N     . GLN B 2 197 ? -19.620 -46.940 19.619  1.00 67.50  ? 197 GLN B N     1 
ATOM   6009 C  CA    . GLN B 2 197 ? -18.527 -46.066 20.028  1.00 78.70  ? 197 GLN B CA    1 
ATOM   6010 C  C     . GLN B 2 197 ? -18.146 -45.102 18.913  1.00 72.63  ? 197 GLN B C     1 
ATOM   6011 O  O     . GLN B 2 197 ? -17.682 -43.989 19.186  1.00 67.36  ? 197 GLN B O     1 
ATOM   6012 C  CB    . GLN B 2 197 ? -17.314 -46.897 20.447  1.00 80.08  ? 197 GLN B CB    1 
ATOM   6013 C  CG    . GLN B 2 197 ? -17.570 -47.837 21.613  1.00 91.62  ? 197 GLN B CG    1 
ATOM   6014 C  CD    . GLN B 2 197 ? -16.371 -48.711 21.928  1.00 101.10 ? 197 GLN B CD    1 
ATOM   6015 O  OE1   . GLN B 2 197 ? -15.410 -48.768 21.159  1.00 85.80  ? 197 GLN B OE1   1 
ATOM   6016 N  NE2   . GLN B 2 197 ? -16.421 -49.398 23.063  1.00 108.87 ? 197 GLN B NE2   1 
ATOM   6017 N  N     . HIS B 2 198 ? -18.333 -45.511 17.656  1.00 71.18  ? 198 HIS B N     1 
ATOM   6018 C  CA    . HIS B 2 198 ? -18.051 -44.626 16.532  1.00 63.40  ? 198 HIS B CA    1 
ATOM   6019 C  C     . HIS B 2 198 ? -19.062 -43.488 16.466  1.00 65.07  ? 198 HIS B C     1 
ATOM   6020 O  O     . HIS B 2 198 ? -18.687 -42.319 16.325  1.00 64.29  ? 198 HIS B O     1 
ATOM   6021 C  CB    . HIS B 2 198 ? -18.049 -45.425 15.228  1.00 69.65  ? 198 HIS B CB    1 
ATOM   6022 C  CG    . HIS B 2 198 ? -17.783 -44.597 14.010  1.00 69.35  ? 198 HIS B CG    1 
ATOM   6023 N  ND1   . HIS B 2 198 ? -16.511 -44.245 13.613  1.00 68.26  ? 198 HIS B ND1   1 
ATOM   6024 C  CD2   . HIS B 2 198 ? -18.626 -44.051 13.101  1.00 65.95  ? 198 HIS B CD2   1 
ATOM   6025 C  CE1   . HIS B 2 198 ? -16.582 -43.519 12.511  1.00 60.38  ? 198 HIS B CE1   1 
ATOM   6026 N  NE2   . HIS B 2 198 ? -17.854 -43.386 12.180  1.00 63.59  ? 198 HIS B NE2   1 
ATOM   6027 N  N     . ARG B 2 199 ? -20.354 -43.814 16.572  1.00 69.42  ? 199 ARG B N     1 
ATOM   6028 C  CA    . ARG B 2 199 ? -21.385 -42.781 16.523  1.00 67.58  ? 199 ARG B CA    1 
ATOM   6029 C  C     . ARG B 2 199 ? -21.284 -41.840 17.716  1.00 66.25  ? 199 ARG B C     1 
ATOM   6030 O  O     . ARG B 2 199 ? -21.535 -40.636 17.587  1.00 56.46  ? 199 ARG B O     1 
ATOM   6031 C  CB    . ARG B 2 199 ? -22.772 -43.421 16.462  1.00 59.30  ? 199 ARG B CB    1 
ATOM   6032 C  CG    . ARG B 2 199 ? -23.037 -44.220 15.199  1.00 76.17  ? 199 ARG B CG    1 
ATOM   6033 C  CD    . ARG B 2 199 ? -24.503 -44.606 15.096  1.00 82.03  ? 199 ARG B CD    1 
ATOM   6034 N  NE    . ARG B 2 199 ? -24.806 -45.288 13.842  1.00 72.50  ? 199 ARG B NE    1 
ATOM   6035 C  CZ    . ARG B 2 199 ? -24.865 -46.608 13.705  1.00 75.59  ? 199 ARG B CZ    1 
ATOM   6036 N  NH1   . ARG B 2 199 ? -24.642 -47.395 14.748  1.00 77.07  ? 199 ARG B NH1   1 
ATOM   6037 N  NH2   . ARG B 2 199 ? -25.148 -47.142 12.525  1.00 64.70  ? 199 ARG B NH2   1 
ATOM   6038 N  N     . THR B 2 200 ? -20.926 -42.371 18.888  1.00 70.94  ? 200 THR B N     1 
ATOM   6039 C  CA    . THR B 2 200 ? -20.722 -41.515 20.051  1.00 73.26  ? 200 THR B CA    1 
ATOM   6040 C  C     . THR B 2 200 ? -19.558 -40.559 19.825  1.00 72.08  ? 200 THR B C     1 
ATOM   6041 O  O     . THR B 2 200 ? -19.592 -39.406 20.274  1.00 65.78  ? 200 THR B O     1 
ATOM   6042 C  CB    . THR B 2 200 ? -20.483 -42.369 21.297  1.00 73.03  ? 200 THR B CB    1 
ATOM   6043 O  OG1   . THR B 2 200 ? -21.522 -43.350 21.414  1.00 62.11  ? 200 THR B OG1   1 
ATOM   6044 C  CG2   . THR B 2 200 ? -20.475 -41.502 22.548  1.00 58.06  ? 200 THR B CG2   1 
ATOM   6045 N  N     . LYS B 2 201 ? -18.521 -41.018 19.122  1.00 70.01  ? 201 LYS B N     1 
ATOM   6046 C  CA    . LYS B 2 201 ? -17.389 -40.152 18.817  1.00 70.39  ? 201 LYS B CA    1 
ATOM   6047 C  C     . LYS B 2 201 ? -17.749 -39.107 17.768  1.00 69.33  ? 201 LYS B C     1 
ATOM   6048 O  O     . LYS B 2 201 ? -17.224 -37.988 17.805  1.00 63.90  ? 201 LYS B O     1 
ATOM   6049 C  CB    . LYS B 2 201 ? -16.200 -40.991 18.349  1.00 63.75  ? 201 LYS B CB    1 
ATOM   6050 C  CG    . LYS B 2 201 ? -14.909 -40.209 18.199  1.00 78.06  ? 201 LYS B CG    1 
ATOM   6051 C  CD    . LYS B 2 201 ? -14.444 -39.643 19.532  1.00 77.79  ? 201 LYS B CD    1 
ATOM   6052 C  CE    . LYS B 2 201 ? -14.134 -40.749 20.527  1.00 75.55  ? 201 LYS B CE    1 
ATOM   6053 N  NZ    . LYS B 2 201 ? -13.663 -40.202 21.831  1.00 68.58  ? 201 LYS B NZ    1 
ATOM   6054 N  N     . ILE B 2 202 ? -18.637 -39.448 16.832  1.00 66.84  ? 202 ILE B N     1 
ATOM   6055 C  CA    . ILE B 2 202 ? -19.073 -38.477 15.833  1.00 59.88  ? 202 ILE B CA    1 
ATOM   6056 C  C     . ILE B 2 202 ? -19.891 -37.371 16.489  1.00 65.77  ? 202 ILE B C     1 
ATOM   6057 O  O     . ILE B 2 202 ? -19.765 -36.192 16.134  1.00 55.88  ? 202 ILE B O     1 
ATOM   6058 C  CB    . ILE B 2 202 ? -19.862 -39.180 14.713  1.00 58.37  ? 202 ILE B CB    1 
ATOM   6059 C  CG1   . ILE B 2 202 ? -18.970 -40.187 13.983  1.00 57.04  ? 202 ILE B CG1   1 
ATOM   6060 C  CG2   . ILE B 2 202 ? -20.429 -38.163 13.732  1.00 54.07  ? 202 ILE B CG2   1 
ATOM   6061 C  CD1   . ILE B 2 202 ? -17.727 -39.576 13.382  1.00 48.91  ? 202 ILE B CD1   1 
ATOM   6062 N  N     . GLU B 2 203 ? -20.738 -37.729 17.458  1.00 68.29  ? 203 GLU B N     1 
ATOM   6063 C  CA    . GLU B 2 203 ? -21.510 -36.722 18.178  1.00 68.53  ? 203 GLU B CA    1 
ATOM   6064 C  C     . GLU B 2 203 ? -20.607 -35.796 18.983  1.00 71.17  ? 203 GLU B C     1 
ATOM   6065 O  O     . GLU B 2 203 ? -20.923 -34.611 19.145  1.00 69.60  ? 203 GLU B O     1 
ATOM   6066 C  CB    . GLU B 2 203 ? -22.536 -37.402 19.086  1.00 66.53  ? 203 GLU B CB    1 
ATOM   6067 C  CG    . GLU B 2 203 ? -23.393 -36.449 19.912  1.00 74.32  ? 203 GLU B CG    1 
ATOM   6068 C  CD    . GLU B 2 203 ? -24.222 -35.501 19.062  1.00 75.92  ? 203 GLU B CD    1 
ATOM   6069 O  OE1   . GLU B 2 203 ? -24.565 -34.407 19.558  1.00 67.66  ? 203 GLU B OE1   1 
ATOM   6070 O  OE2   . GLU B 2 203 ? -24.532 -35.845 17.901  1.00 68.64  ? 203 GLU B OE2   1 
ATOM   6071 N  N     . GLU B 2 204 ? -19.484 -36.311 19.490  1.00 69.02  ? 204 GLU B N     1 
ATOM   6072 C  CA    . GLU B 2 204 ? -18.503 -35.446 20.138  1.00 71.54  ? 204 GLU B CA    1 
ATOM   6073 C  C     . GLU B 2 204 ? -17.928 -34.440 19.151  1.00 73.65  ? 204 GLU B C     1 
ATOM   6074 O  O     . GLU B 2 204 ? -17.659 -33.288 19.510  1.00 74.41  ? 204 GLU B O     1 
ATOM   6075 C  CB    . GLU B 2 204 ? -17.385 -36.287 20.754  1.00 73.33  ? 204 GLU B CB    1 
ATOM   6076 C  CG    . GLU B 2 204 ? -17.830 -37.187 21.892  1.00 82.49  ? 204 GLU B CG    1 
ATOM   6077 C  CD    . GLU B 2 204 ? -16.733 -38.126 22.351  1.00 77.10  ? 204 GLU B CD    1 
ATOM   6078 O  OE1   . GLU B 2 204 ? -17.053 -39.263 22.756  1.00 79.36  ? 204 GLU B OE1   1 
ATOM   6079 O  OE2   . GLU B 2 204 ? -15.549 -37.729 22.297  1.00 79.24  ? 204 GLU B OE2   1 
ATOM   6080 N  N     . LEU B 2 205 ? -17.736 -34.859 17.898  1.00 67.03  ? 205 LEU B N     1 
ATOM   6081 C  CA    . LEU B 2 205 ? -17.204 -33.953 16.887  1.00 66.23  ? 205 LEU B CA    1 
ATOM   6082 C  C     . LEU B 2 205 ? -18.222 -32.885 16.510  1.00 69.33  ? 205 LEU B C     1 
ATOM   6083 O  O     . LEU B 2 205 ? -17.860 -31.721 16.303  1.00 62.81  ? 205 LEU B O     1 
ATOM   6084 C  CB    . LEU B 2 205 ? -16.774 -34.743 15.653  1.00 64.72  ? 205 LEU B CB    1 
ATOM   6085 C  CG    . LEU B 2 205 ? -16.239 -33.911 14.489  1.00 62.11  ? 205 LEU B CG    1 
ATOM   6086 C  CD1   . LEU B 2 205 ? -14.936 -33.222 14.862  1.00 65.21  ? 205 LEU B CD1   1 
ATOM   6087 C  CD2   . LEU B 2 205 ? -16.057 -34.785 13.273  1.00 69.20  ? 205 LEU B CD2   1 
ATOM   6088 N  N     . ARG B 2 206 ? -19.501 -33.260 16.409  1.00 59.92  ? 206 ARG B N     1 
ATOM   6089 C  CA    . ARG B 2 206 ? -20.533 -32.269 16.121  1.00 68.11  ? 206 ARG B CA    1 
ATOM   6090 C  C     . ARG B 2 206 ? -20.653 -31.257 17.252  1.00 70.80  ? 206 ARG B C     1 
ATOM   6091 O  O     . ARG B 2 206 ? -20.804 -30.054 17.004  1.00 71.96  ? 206 ARG B O     1 
ATOM   6092 C  CB    . ARG B 2 206 ? -21.876 -32.954 15.866  1.00 74.94  ? 206 ARG B CB    1 
ATOM   6093 C  CG    . ARG B 2 206 ? -22.095 -33.366 14.420  1.00 77.63  ? 206 ARG B CG    1 
ATOM   6094 C  CD    . ARG B 2 206 ? -23.573 -33.563 14.122  1.00 80.31  ? 206 ARG B CD    1 
ATOM   6095 N  NE    . ARG B 2 206 ? -23.827 -33.732 12.694  1.00 98.55  ? 206 ARG B NE    1 
ATOM   6096 C  CZ    . ARG B 2 206 ? -24.016 -32.726 11.845  1.00 87.34  ? 206 ARG B CZ    1 
ATOM   6097 N  NH1   . ARG B 2 206 ? -23.978 -31.474 12.280  1.00 83.78  ? 206 ARG B NH1   1 
ATOM   6098 N  NH2   . ARG B 2 206 ? -24.242 -32.970 10.562  1.00 78.78  ? 206 ARG B NH2   1 
ATOM   6099 N  N     . GLN B 2 207 ? -20.588 -31.722 18.502  1.00 73.41  ? 207 GLN B N     1 
ATOM   6100 C  CA    . GLN B 2 207 ? -20.560 -30.794 19.627  1.00 82.19  ? 207 GLN B CA    1 
ATOM   6101 C  C     . GLN B 2 207 ? -19.279 -29.971 19.636  1.00 82.52  ? 207 GLN B C     1 
ATOM   6102 O  O     . GLN B 2 207 ? -19.275 -28.836 20.125  1.00 82.73  ? 207 GLN B O     1 
ATOM   6103 C  CB    . GLN B 2 207 ? -20.713 -31.555 20.944  1.00 81.00  ? 207 GLN B CB    1 
ATOM   6104 C  CG    . GLN B 2 207 ? -22.056 -32.246 21.113  1.00 82.97  ? 207 GLN B CG    1 
ATOM   6105 C  CD    . GLN B 2 207 ? -23.207 -31.266 21.241  1.00 80.84  ? 207 GLN B CD    1 
ATOM   6106 O  OE1   . GLN B 2 207 ? -23.017 -30.116 21.638  1.00 87.67  ? 207 GLN B OE1   1 
ATOM   6107 N  NE2   . GLN B 2 207 ? -24.408 -31.717 20.901  1.00 84.55  ? 207 GLN B NE2   1 
ATOM   6108 N  N     . HIS B 2 208 ? -18.187 -30.525 19.102  1.00 83.93  ? 208 HIS B N     1 
ATOM   6109 C  CA    . HIS B 2 208 ? -16.945 -29.767 18.999  1.00 81.80  ? 208 HIS B CA    1 
ATOM   6110 C  C     . HIS B 2 208 ? -17.070 -28.650 17.970  1.00 79.40  ? 208 HIS B C     1 
ATOM   6111 O  O     . HIS B 2 208 ? -16.502 -27.566 18.148  1.00 88.03  ? 208 HIS B O     1 
ATOM   6112 C  CB    . HIS B 2 208 ? -15.791 -30.704 18.639  1.00 86.63  ? 208 HIS B CB    1 
ATOM   6113 C  CG    . HIS B 2 208 ? -14.462 -30.260 19.165  1.00 86.00  ? 208 HIS B CG    1 
ATOM   6114 N  ND1   . HIS B 2 208 ? -13.784 -29.172 18.658  1.00 76.15  ? 208 HIS B ND1   1 
ATOM   6115 C  CD2   . HIS B 2 208 ? -13.681 -30.763 20.150  1.00 86.02  ? 208 HIS B CD2   1 
ATOM   6116 C  CE1   . HIS B 2 208 ? -12.645 -29.022 19.310  1.00 90.41  ? 208 HIS B CE1   1 
ATOM   6117 N  NE2   . HIS B 2 208 ? -12.558 -29.975 20.221  1.00 99.39  ? 208 HIS B NE2   1 
ATOM   6118 N  N     . LEU B 2 209 ? -17.813 -28.896 16.888  1.00 76.48  ? 209 LEU B N     1 
ATOM   6119 C  CA    . LEU B 2 209 ? -18.029 -27.878 15.868  1.00 79.45  ? 209 LEU B CA    1 
ATOM   6120 C  C     . LEU B 2 209 ? -19.021 -26.809 16.304  1.00 87.55  ? 209 LEU B C     1 
ATOM   6121 O  O     . LEU B 2 209 ? -18.971 -25.689 15.786  1.00 86.74  ? 209 LEU B O     1 
ATOM   6122 C  CB    . LEU B 2 209 ? -18.516 -28.529 14.570  1.00 76.12  ? 209 LEU B CB    1 
ATOM   6123 C  CG    . LEU B 2 209 ? -17.566 -29.518 13.892  1.00 72.51  ? 209 LEU B CG    1 
ATOM   6124 C  CD1   . LEU B 2 209 ? -18.223 -30.139 12.669  1.00 62.74  ? 209 LEU B CD1   1 
ATOM   6125 C  CD2   . LEU B 2 209 ? -16.260 -28.837 13.513  1.00 71.27  ? 209 LEU B CD2   1 
ATOM   6126 N  N     . LEU B 2 210 ? -19.920 -27.127 17.239  1.00 87.53  ? 210 LEU B N     1 
ATOM   6127 C  CA    . LEU B 2 210 ? -20.891 -26.144 17.704  1.00 87.51  ? 210 LEU B CA    1 
ATOM   6128 C  C     . LEU B 2 210 ? -20.268 -25.096 18.616  1.00 90.74  ? 210 LEU B C     1 
ATOM   6129 O  O     . LEU B 2 210 ? -20.874 -24.041 18.830  1.00 92.90  ? 210 LEU B O     1 
ATOM   6130 C  CB    . LEU B 2 210 ? -22.044 -26.842 18.428  1.00 86.94  ? 210 LEU B CB    1 
ATOM   6131 C  CG    . LEU B 2 210 ? -22.971 -27.698 17.563  1.00 85.29  ? 210 LEU B CG    1 
ATOM   6132 C  CD1   . LEU B 2 210 ? -24.028 -28.380 18.417  1.00 83.45  ? 210 LEU B CD1   1 
ATOM   6133 C  CD2   . LEU B 2 210 ? -23.619 -26.856 16.475  1.00 63.93  ? 210 LEU B CD2   1 
ATOM   6134 N  N     . ARG B 2 211 ? -19.076 -25.360 19.159  1.00 92.48  ? 211 ARG B N     1 
ATOM   6135 C  CA    . ARG B 2 211 ? -18.426 -24.378 20.020  1.00 96.44  ? 211 ARG B CA    1 
ATOM   6136 C  C     . ARG B 2 211 ? -17.950 -23.166 19.229  1.00 97.55  ? 211 ARG B C     1 
ATOM   6137 O  O     . ARG B 2 211 ? -17.846 -22.067 19.785  1.00 101.44 ? 211 ARG B O     1 
ATOM   6138 C  CB    . ARG B 2 211 ? -17.261 -25.024 20.768  1.00 89.78  ? 211 ARG B CB    1 
ATOM   6139 C  CG    . ARG B 2 211 ? -17.684 -26.117 21.738  1.00 84.20  ? 211 ARG B CG    1 
ATOM   6140 C  CD    . ARG B 2 211 ? -16.488 -26.724 22.454  0.00 85.11  ? 211 ARG B CD    1 
ATOM   6141 N  NE    . ARG B 2 211 ? -15.745 -25.729 23.221  0.00 84.90  ? 211 ARG B NE    1 
ATOM   6142 C  CZ    . ARG B 2 211 ? -16.019 -25.398 24.479  0.00 84.32  ? 211 ARG B CZ    1 
ATOM   6143 N  NH1   . ARG B 2 211 ? -17.025 -25.980 25.116  0.00 84.19  ? 211 ARG B NH1   1 
ATOM   6144 N  NH2   . ARG B 2 211 ? -15.287 -24.482 25.100  0.00 84.16  ? 211 ARG B NH2   1 
ATOM   6145 N  N     . TRP B 2 212 ? -17.657 -23.342 17.941  1.00 91.83  ? 212 TRP B N     1 
ATOM   6146 C  CA    . TRP B 2 212 ? -17.308 -22.224 17.072  1.00 85.05  ? 212 TRP B CA    1 
ATOM   6147 C  C     . TRP B 2 212 ? -18.521 -21.700 16.311  1.00 97.16  ? 212 TRP B C     1 
ATOM   6148 O  O     . TRP B 2 212 ? -18.809 -20.500 16.349  1.00 104.88 ? 212 TRP B O     1 
ATOM   6149 C  CB    . TRP B 2 212 ? -16.206 -22.639 16.091  1.00 81.15  ? 212 TRP B CB    1 
ATOM   6150 C  CG    . TRP B 2 212 ? -14.819 -22.499 16.642  0.00 81.22  ? 212 TRP B CG    1 
ATOM   6151 C  CD1   . TRP B 2 212 ? -14.032 -21.384 16.606  0.00 79.54  ? 212 TRP B CD1   1 
ATOM   6152 C  CD2   . TRP B 2 212 ? -14.051 -23.510 17.305  0.00 79.52  ? 212 TRP B CD2   1 
ATOM   6153 N  NE1   . TRP B 2 212 ? -12.823 -21.638 17.208  0.00 77.68  ? 212 TRP B NE1   1 
ATOM   6154 C  CE2   . TRP B 2 212 ? -12.809 -22.936 17.645  0.00 77.45  ? 212 TRP B CE2   1 
ATOM   6155 C  CE3   . TRP B 2 212 ? -14.293 -24.844 17.647  0.00 79.35  ? 212 TRP B CE3   1 
ATOM   6156 C  CZ2   . TRP B 2 212 ? -11.814 -23.650 18.309  0.00 75.69  ? 212 TRP B CZ2   1 
ATOM   6157 C  CZ3   . TRP B 2 212 ? -13.302 -25.551 18.305  0.00 78.24  ? 212 TRP B CZ3   1 
ATOM   6158 C  CH2   . TRP B 2 212 ? -12.079 -24.952 18.629  0.00 75.81  ? 212 TRP B CH2   1 
ATOM   6159 N  N     . GLY B 2 213 ? -19.238 -22.582 15.622  1.00 105.10 ? 213 GLY B N     1 
ATOM   6160 C  CA    . GLY B 2 213 ? -20.421 -22.189 14.878  1.00 102.55 ? 213 GLY B CA    1 
ATOM   6161 C  C     . GLY B 2 213 ? -20.138 -21.863 13.423  1.00 96.81  ? 213 GLY B C     1 
ATOM   6162 O  O     . GLY B 2 213 ? -18.987 -21.895 12.987  1.00 82.24  ? 213 GLY B O     1 
ATOM   6163 N  N     . LEU B 2 214 ? -21.187 -21.545 12.670  1.00 97.93  ? 214 LEU B N     1 
ATOM   6164 C  CA    . LEU B 2 214 ? -22.545 -21.503 13.203  1.00 98.56  ? 214 LEU B CA    1 
ATOM   6165 C  C     . LEU B 2 214 ? -23.390 -22.612 12.584  1.00 96.38  ? 214 LEU B C     1 
ATOM   6166 O  O     . LEU B 2 214 ? -24.126 -22.383 11.624  1.00 89.43  ? 214 LEU B O     1 
ATOM   6167 C  CB    . LEU B 2 214 ? -23.180 -20.132 12.943  1.00 93.42  ? 214 LEU B CB    1 
ATOM   6168 C  CG    . LEU B 2 214 ? -24.240 -19.608 13.919  1.00 94.37  ? 214 LEU B CG    1 
ATOM   6169 C  CD1   . LEU B 2 214 ? -24.467 -18.121 13.694  1.00 80.35  ? 214 LEU B CD1   1 
ATOM   6170 C  CD2   . LEU B 2 214 ? -25.556 -20.365 13.795  1.00 81.38  ? 214 LEU B CD2   1 
ATOM   6171 N  N     . GLU B 2 233 ? -23.133 -42.960 6.220   1.00 82.10  ? 233 GLU B N     1 
ATOM   6172 C  CA    . GLU B 2 233 ? -22.255 -43.874 6.940   1.00 86.68  ? 233 GLU B CA    1 
ATOM   6173 C  C     . GLU B 2 233 ? -21.600 -44.854 5.971   1.00 85.63  ? 233 GLU B C     1 
ATOM   6174 O  O     . GLU B 2 233 ? -22.283 -45.595 5.265   1.00 91.73  ? 233 GLU B O     1 
ATOM   6175 C  CB    . GLU B 2 233 ? -23.035 -44.620 8.025   1.00 79.74  ? 233 GLU B CB    1 
ATOM   6176 C  CG    . GLU B 2 233 ? -22.176 -45.466 8.948   1.00 90.08  ? 233 GLU B CG    1 
ATOM   6177 C  CD    . GLU B 2 233 ? -22.872 -45.781 10.259  1.00 89.68  ? 233 GLU B CD    1 
ATOM   6178 O  OE1   . GLU B 2 233 ? -23.366 -44.837 10.912  1.00 77.33  ? 233 GLU B OE1   1 
ATOM   6179 O  OE2   . GLU B 2 233 ? -22.934 -46.971 10.631  1.00 94.25  ? 233 GLU B OE2   1 
ATOM   6180 N  N     . LEU B 2 234 ? -20.270 -44.848 5.944   1.00 82.58  ? 234 LEU B N     1 
ATOM   6181 C  CA    . LEU B 2 234 ? -19.486 -45.599 4.975   1.00 71.98  ? 234 LEU B CA    1 
ATOM   6182 C  C     . LEU B 2 234 ? -18.737 -46.741 5.649   1.00 67.18  ? 234 LEU B C     1 
ATOM   6183 O  O     . LEU B 2 234 ? -18.573 -46.775 6.872   1.00 59.86  ? 234 LEU B O     1 
ATOM   6184 C  CB    . LEU B 2 234 ? -18.486 -44.687 4.255   1.00 55.32  ? 234 LEU B CB    1 
ATOM   6185 C  CG    . LEU B 2 234 ? -18.905 -43.918 2.999   1.00 66.76  ? 234 LEU B CG    1 
ATOM   6186 C  CD1   . LEU B 2 234 ? -20.272 -43.268 3.144   1.00 69.99  ? 234 LEU B CD1   1 
ATOM   6187 C  CD2   . LEU B 2 234 ? -17.852 -42.868 2.689   1.00 59.64  ? 234 LEU B CD2   1 
ATOM   6188 N  N     . HIS B 2 235 ? -18.277 -47.681 4.824   1.00 68.07  ? 235 HIS B N     1 
ATOM   6189 C  CA    . HIS B 2 235 ? -17.454 -48.805 5.273   1.00 70.70  ? 235 HIS B CA    1 
ATOM   6190 C  C     . HIS B 2 235 ? -16.448 -49.133 4.180   1.00 66.15  ? 235 HIS B C     1 
ATOM   6191 O  O     . HIS B 2 235 ? -16.661 -50.038 3.364   1.00 68.63  ? 235 HIS B O     1 
ATOM   6192 C  CB    . HIS B 2 235 ? -18.317 -50.024 5.612   1.00 69.20  ? 235 HIS B CB    1 
ATOM   6193 C  CG    . HIS B 2 235 ? -19.287 -49.790 6.728   1.00 69.50  ? 235 HIS B CG    1 
ATOM   6194 N  ND1   . HIS B 2 235 ? -18.898 -49.697 8.047   1.00 63.02  ? 235 HIS B ND1   1 
ATOM   6195 C  CD2   . HIS B 2 235 ? -20.631 -49.630 6.720   1.00 72.70  ? 235 HIS B CD2   1 
ATOM   6196 C  CE1   . HIS B 2 235 ? -19.961 -49.488 8.803   1.00 77.65  ? 235 HIS B CE1   1 
ATOM   6197 N  NE2   . HIS B 2 235 ? -21.025 -49.442 8.022   1.00 76.44  ? 235 HIS B NE2   1 
ATOM   6198 N  N     . PRO B 2 236 ? -15.327 -48.409 4.132   1.00 69.37  ? 236 PRO B N     1 
ATOM   6199 C  CA    . PRO B 2 236 ? -14.326 -48.672 3.084   1.00 64.23  ? 236 PRO B CA    1 
ATOM   6200 C  C     . PRO B 2 236 ? -13.675 -50.041 3.184   1.00 65.74  ? 236 PRO B C     1 
ATOM   6201 O  O     . PRO B 2 236 ? -13.068 -50.491 2.204   1.00 69.07  ? 236 PRO B O     1 
ATOM   6202 C  CB    . PRO B 2 236 ? -13.297 -47.550 3.289   1.00 66.03  ? 236 PRO B CB    1 
ATOM   6203 C  CG    . PRO B 2 236 ? -14.028 -46.489 4.054   1.00 61.80  ? 236 PRO B CG    1 
ATOM   6204 C  CD    . PRO B 2 236 ? -14.985 -47.227 4.939   1.00 62.32  ? 236 PRO B CD    1 
ATOM   6205 N  N     . ASP B 2 237 ? -13.773 -50.715 4.332   1.00 71.47  ? 237 ASP B N     1 
ATOM   6206 C  CA    . ASP B 2 237 ? -13.185 -52.044 4.459   1.00 78.58  ? 237 ASP B CA    1 
ATOM   6207 C  C     . ASP B 2 237 ? -13.906 -53.067 3.592   1.00 75.40  ? 237 ASP B C     1 
ATOM   6208 O  O     . ASP B 2 237 ? -13.286 -54.032 3.131   1.00 71.64  ? 237 ASP B O     1 
ATOM   6209 C  CB    . ASP B 2 237 ? -13.196 -52.490 5.921   1.00 72.76  ? 237 ASP B CB    1 
ATOM   6210 C  CG    . ASP B 2 237 ? -12.078 -51.865 6.731   1.00 81.98  ? 237 ASP B CG    1 
ATOM   6211 O  OD1   . ASP B 2 237 ? -11.538 -50.825 6.298   1.00 87.21  ? 237 ASP B OD1   1 
ATOM   6212 O  OD2   . ASP B 2 237 ? -11.738 -52.416 7.799   1.00 87.64  ? 237 ASP B OD2   1 
ATOM   6213 N  N     . LYS B 2 238 ? -15.202 -52.877 3.358   1.00 79.21  ? 238 LYS B N     1 
ATOM   6214 C  CA    . LYS B 2 238 ? -15.997 -53.817 2.581   1.00 81.89  ? 238 LYS B CA    1 
ATOM   6215 C  C     . LYS B 2 238 ? -16.050 -53.473 1.098   1.00 78.25  ? 238 LYS B C     1 
ATOM   6216 O  O     . LYS B 2 238 ? -16.738 -54.167 0.342   1.00 79.67  ? 238 LYS B O     1 
ATOM   6217 C  CB    . LYS B 2 238 ? -17.419 -53.894 3.144   1.00 88.04  ? 238 LYS B CB    1 
ATOM   6218 C  CG    . LYS B 2 238 ? -17.483 -54.400 4.576   1.00 74.74  ? 238 LYS B CG    1 
ATOM   6219 C  CD    . LYS B 2 238 ? -16.873 -55.788 4.695   1.00 97.50  ? 238 LYS B CD    1 
ATOM   6220 C  CE    . LYS B 2 238 ? -16.836 -56.254 6.142   1.00 105.03 ? 238 LYS B CE    1 
ATOM   6221 N  NZ    . LYS B 2 238 ? -16.002 -55.362 6.993   1.00 91.78  ? 238 LYS B NZ    1 
ATOM   6222 N  N     . TRP B 2 239 ? -15.350 -52.427 0.665   1.00 78.00  ? 239 TRP B N     1 
ATOM   6223 C  CA    . TRP B 2 239 ? -15.292 -52.095 -0.753  1.00 81.20  ? 239 TRP B CA    1 
ATOM   6224 C  C     . TRP B 2 239 ? -14.446 -53.130 -1.484  1.00 81.40  ? 239 TRP B C     1 
ATOM   6225 O  O     . TRP B 2 239 ? -13.285 -53.357 -1.126  1.00 77.44  ? 239 TRP B O     1 
ATOM   6226 C  CB    . TRP B 2 239 ? -14.719 -50.693 -0.949  1.00 67.05  ? 239 TRP B CB    1 
ATOM   6227 C  CG    . TRP B 2 239 ? -15.615 -49.599 -0.456  1.00 67.20  ? 239 TRP B CG    1 
ATOM   6228 C  CD1   . TRP B 2 239 ? -16.875 -49.734 0.051   1.00 64.34  ? 239 TRP B CD1   1 
ATOM   6229 C  CD2   . TRP B 2 239 ? -15.318 -48.197 -0.425  1.00 59.12  ? 239 TRP B CD2   1 
ATOM   6230 N  NE1   . TRP B 2 239 ? -17.381 -48.504 0.396   1.00 55.23  ? 239 TRP B NE1   1 
ATOM   6231 C  CE2   . TRP B 2 239 ? -16.445 -47.544 0.114   1.00 63.79  ? 239 TRP B CE2   1 
ATOM   6232 C  CE3   . TRP B 2 239 ? -14.210 -47.432 -0.800  1.00 53.27  ? 239 TRP B CE3   1 
ATOM   6233 C  CZ2   . TRP B 2 239 ? -16.494 -46.162 0.288   1.00 61.81  ? 239 TRP B CZ2   1 
ATOM   6234 C  CZ3   . TRP B 2 239 ? -14.261 -46.061 -0.627  1.00 57.33  ? 239 TRP B CZ3   1 
ATOM   6235 C  CH2   . TRP B 2 239 ? -15.395 -45.440 -0.088  1.00 58.27  ? 239 TRP B CH2   1 
ATOM   6236 N  N     . THR B 2 240 ? -15.023 -53.756 -2.504  1.00 81.09  ? 240 THR B N     1 
ATOM   6237 C  CA    . THR B 2 240 ? -14.368 -54.828 -3.238  1.00 87.68  ? 240 THR B CA    1 
ATOM   6238 C  C     . THR B 2 240 ? -14.226 -54.450 -4.707  1.00 86.25  ? 240 THR B C     1 
ATOM   6239 O  O     . THR B 2 240 ? -14.788 -53.460 -5.182  1.00 75.74  ? 240 THR B O     1 
ATOM   6240 C  CB    . THR B 2 240 ? -15.146 -56.143 -3.106  1.00 83.33  ? 240 THR B CB    1 
ATOM   6241 O  OG1   . THR B 2 240 ? -14.409 -57.202 -3.729  1.00 96.15  ? 240 THR B OG1   1 
ATOM   6242 C  CG2   . THR B 2 240 ? -16.508 -56.023 -3.773  1.00 79.05  ? 240 THR B CG2   1 
ATOM   6243 N  N     . VAL B 2 241 ? -13.457 -55.262 -5.427  1.00 88.22  ? 241 VAL B N     1 
ATOM   6244 C  CA    . VAL B 2 241 ? -13.242 -55.083 -6.856  1.00 80.37  ? 241 VAL B CA    1 
ATOM   6245 C  C     . VAL B 2 241 ? -13.906 -56.236 -7.597  1.00 73.86  ? 241 VAL B C     1 
ATOM   6246 O  O     . VAL B 2 241 ? -13.988 -57.362 -7.095  1.00 76.23  ? 241 VAL B O     1 
ATOM   6247 C  CB    . VAL B 2 241 ? -11.741 -54.995 -7.209  1.00 76.39  ? 241 VAL B CB    1 
ATOM   6248 C  CG1   . VAL B 2 241 ? -11.130 -53.735 -6.612  1.00 73.58  ? 241 VAL B CG1   1 
ATOM   6249 C  CG2   . VAL B 2 241 ? -11.004 -56.231 -6.718  1.00 73.99  ? 241 VAL B CG2   1 
ATOM   6250 N  N     . GLN B 2 242 ? -14.393 -55.942 -8.801  1.00 69.82  ? 242 GLN B N     1 
ATOM   6251 C  CA    . GLN B 2 242 ? -15.049 -56.941 -9.638  1.00 77.96  ? 242 GLN B CA    1 
ATOM   6252 C  C     . GLN B 2 242 ? -14.123 -57.333 -10.782 1.00 69.46  ? 242 GLN B C     1 
ATOM   6253 O  O     . GLN B 2 242 ? -14.026 -56.602 -11.780 1.00 70.66  ? 242 GLN B O     1 
ATOM   6254 C  CB    . GLN B 2 242 ? -16.378 -56.407 -10.180 1.00 63.57  ? 242 GLN B CB    1 
ATOM   6255 C  CG    . GLN B 2 242 ? -17.107 -57.378 -11.097 1.00 70.02  ? 242 GLN B CG    1 
ATOM   6256 C  CD    . GLN B 2 242 ? -17.404 -58.704 -10.423 1.00 81.29  ? 242 GLN B CD    1 
ATOM   6257 O  OE1   . GLN B 2 242 ? -17.120 -59.769 -10.972 1.00 78.43  ? 242 GLN B OE1   1 
ATOM   6258 N  NE2   . GLN B 2 242 ? -17.981 -58.645 -9.228  1.00 83.99  ? 242 GLN B NE2   1 
ATOM   6259 N  N     . PRO B 2 243 ? -13.422 -58.458 -10.691 1.00 68.13  ? 243 PRO B N     1 
ATOM   6260 C  CA    . PRO B 2 243 ? -12.518 -58.859 -11.770 1.00 66.44  ? 243 PRO B CA    1 
ATOM   6261 C  C     . PRO B 2 243 ? -13.272 -59.464 -12.945 1.00 62.05  ? 243 PRO B C     1 
ATOM   6262 O  O     . PRO B 2 243 ? -14.435 -59.857 -12.845 1.00 58.49  ? 243 PRO B O     1 
ATOM   6263 C  CB    . PRO B 2 243 ? -11.619 -59.903 -11.100 1.00 68.03  ? 243 PRO B CB    1 
ATOM   6264 C  CG    . PRO B 2 243 ? -12.497 -60.514 -10.059 1.00 65.25  ? 243 PRO B CG    1 
ATOM   6265 C  CD    . PRO B 2 243 ? -13.387 -59.402 -9.559  1.00 61.58  ? 243 PRO B CD    1 
ATOM   6266 N  N     . ILE B 2 244 ? -12.575 -59.529 -14.079 1.00 68.67  ? 244 ILE B N     1 
ATOM   6267 C  CA    . ILE B 2 244 ? -13.136 -60.153 -15.270 1.00 64.11  ? 244 ILE B CA    1 
ATOM   6268 C  C     . ILE B 2 244 ? -13.170 -61.662 -15.074 1.00 62.09  ? 244 ILE B C     1 
ATOM   6269 O  O     . ILE B 2 244 ? -12.164 -62.279 -14.698 1.00 65.71  ? 244 ILE B O     1 
ATOM   6270 C  CB    . ILE B 2 244 ? -12.322 -59.769 -16.513 1.00 65.84  ? 244 ILE B CB    1 
ATOM   6271 C  CG1   . ILE B 2 244 ? -12.224 -58.247 -16.632 1.00 66.94  ? 244 ILE B CG1   1 
ATOM   6272 C  CG2   . ILE B 2 244 ? -12.947 -60.363 -17.765 1.00 64.03  ? 244 ILE B CG2   1 
ATOM   6273 C  CD1   . ILE B 2 244 ? -11.301 -57.782 -17.736 1.00 59.98  ? 244 ILE B CD1   1 
ATOM   6274 N  N     . VAL B 2 245 ? -14.330 -62.264 -15.323 1.00 60.33  ? 245 VAL B N     1 
ATOM   6275 C  CA    . VAL B 2 245 ? -14.532 -63.692 -15.117 1.00 59.80  ? 245 VAL B CA    1 
ATOM   6276 C  C     . VAL B 2 245 ? -14.930 -64.329 -16.441 1.00 63.62  ? 245 VAL B C     1 
ATOM   6277 O  O     . VAL B 2 245 ? -15.580 -63.704 -17.286 1.00 63.84  ? 245 VAL B O     1 
ATOM   6278 C  CB    . VAL B 2 245 ? -15.592 -63.961 -14.021 1.00 70.84  ? 245 VAL B CB    1 
ATOM   6279 C  CG1   . VAL B 2 245 ? -16.964 -63.458 -14.457 1.00 75.32  ? 245 VAL B CG1   1 
ATOM   6280 C  CG2   . VAL B 2 245 ? -15.639 -65.439 -13.653 1.00 68.86  ? 245 VAL B CG2   1 
ATOM   6281 N  N     . LEU B 2 246 ? -14.512 -65.583 -16.627 1.00 64.62  ? 246 LEU B N     1 
ATOM   6282 C  CA    . LEU B 2 246 ? -14.798 -66.354 -17.825 1.00 61.06  ? 246 LEU B CA    1 
ATOM   6283 C  C     . LEU B 2 246 ? -15.824 -67.444 -17.529 1.00 63.95  ? 246 LEU B C     1 
ATOM   6284 O  O     . LEU B 2 246 ? -15.856 -67.991 -16.422 1.00 67.83  ? 246 LEU B O     1 
ATOM   6285 C  CB    . LEU B 2 246 ? -13.521 -66.994 -18.383 1.00 52.55  ? 246 LEU B CB    1 
ATOM   6286 C  CG    . LEU B 2 246 ? -12.406 -66.022 -18.774 1.00 52.14  ? 246 LEU B CG    1 
ATOM   6287 C  CD1   . LEU B 2 246 ? -11.181 -66.772 -19.267 1.00 49.90  ? 246 LEU B CD1   1 
ATOM   6288 C  CD2   . LEU B 2 246 ? -12.897 -65.038 -19.827 1.00 52.95  ? 246 LEU B CD2   1 
ATOM   6289 N  N     . PRO B 2 247 ? -16.676 -67.784 -18.495 1.00 66.45  ? 247 PRO B N     1 
ATOM   6290 C  CA    . PRO B 2 247 ? -17.719 -68.780 -18.235 1.00 63.53  ? 247 PRO B CA    1 
ATOM   6291 C  C     . PRO B 2 247 ? -17.140 -70.169 -18.021 1.00 65.04  ? 247 PRO B C     1 
ATOM   6292 O  O     . PRO B 2 247 ? -16.055 -70.503 -18.505 1.00 62.26  ? 247 PRO B O     1 
ATOM   6293 C  CB    . PRO B 2 247 ? -18.581 -68.729 -19.501 1.00 65.26  ? 247 PRO B CB    1 
ATOM   6294 C  CG    . PRO B 2 247 ? -17.650 -68.246 -20.561 1.00 56.58  ? 247 PRO B CG    1 
ATOM   6295 C  CD    . PRO B 2 247 ? -16.733 -67.272 -19.875 1.00 66.13  ? 247 PRO B CD    1 
ATOM   6296 N  N     . GLU B 2 248 ? -17.888 -70.984 -17.280 1.00 67.44  ? 248 GLU B N     1 
ATOM   6297 C  CA    . GLU B 2 248 ? -17.524 -72.368 -16.992 1.00 66.60  ? 248 GLU B CA    1 
ATOM   6298 C  C     . GLU B 2 248 ? -18.643 -73.263 -17.508 1.00 60.83  ? 248 GLU B C     1 
ATOM   6299 O  O     . GLU B 2 248 ? -19.763 -73.226 -16.987 1.00 70.32  ? 248 GLU B O     1 
ATOM   6300 C  CB    . GLU B 2 248 ? -17.294 -72.575 -15.496 1.00 68.37  ? 248 GLU B CB    1 
ATOM   6301 C  CG    . GLU B 2 248 ? -16.257 -71.641 -14.894 1.00 80.78  ? 248 GLU B CG    1 
ATOM   6302 C  CD    . GLU B 2 248 ? -16.152 -71.776 -13.387 1.00 91.30  ? 248 GLU B CD    1 
ATOM   6303 O  OE1   . GLU B 2 248 ? -16.800 -72.683 -12.824 1.00 106.13 ? 248 GLU B OE1   1 
ATOM   6304 O  OE2   . GLU B 2 248 ? -15.423 -70.973 -12.766 1.00 84.44  ? 248 GLU B OE2   1 
ATOM   6305 N  N     . LYS B 2 249 ? -18.343 -74.061 -18.530 1.00 63.44  ? 249 LYS B N     1 
ATOM   6306 C  CA    . LYS B 2 249 ? -19.330 -74.914 -19.171 1.00 63.78  ? 249 LYS B CA    1 
ATOM   6307 C  C     . LYS B 2 249 ? -18.766 -76.315 -19.355 1.00 66.68  ? 249 LYS B C     1 
ATOM   6308 O  O     . LYS B 2 249 ? -17.550 -76.525 -19.362 1.00 65.31  ? 249 LYS B O     1 
ATOM   6309 C  CB    . LYS B 2 249 ? -19.763 -74.351 -20.534 1.00 58.13  ? 249 LYS B CB    1 
ATOM   6310 C  CG    . LYS B 2 249 ? -20.444 -72.994 -20.473 1.00 54.63  ? 249 LYS B CG    1 
ATOM   6311 C  CD    . LYS B 2 249 ? -20.707 -72.459 -21.873 1.00 53.63  ? 249 LYS B CD    1 
ATOM   6312 C  CE    . LYS B 2 249 ? -21.483 -71.153 -21.837 1.00 51.85  ? 249 LYS B CE    1 
ATOM   6313 N  NZ    . LYS B 2 249 ? -22.853 -71.336 -21.280 1.00 66.45  ? 249 LYS B NZ    1 
ATOM   6314 N  N     . ASP B 2 250 ? -19.675 -77.278 -19.503 1.00 64.58  ? 250 ASP B N     1 
ATOM   6315 C  CA    . ASP B 2 250 ? -19.297 -78.640 -19.857 1.00 61.68  ? 250 ASP B CA    1 
ATOM   6316 C  C     . ASP B 2 250 ? -19.364 -78.885 -21.356 1.00 60.19  ? 250 ASP B C     1 
ATOM   6317 O  O     . ASP B 2 250 ? -18.575 -79.678 -21.884 1.00 63.33  ? 250 ASP B O     1 
ATOM   6318 C  CB    . ASP B 2 250 ? -20.197 -79.649 -19.136 1.00 73.00  ? 250 ASP B CB    1 
ATOM   6319 C  CG    . ASP B 2 250 ? -20.008 -79.629 -17.631 1.00 93.78  ? 250 ASP B CG    1 
ATOM   6320 O  OD1   . ASP B 2 250 ? -21.022 -79.678 -16.903 1.00 98.13  ? 250 ASP B OD1   1 
ATOM   6321 O  OD2   . ASP B 2 250 ? -18.846 -79.566 -17.178 1.00 86.96  ? 250 ASP B OD2   1 
ATOM   6322 N  N     . SER B 2 251 ? -20.284 -78.222 -22.051 1.00 55.72  ? 251 SER B N     1 
ATOM   6323 C  CA    . SER B 2 251 ? -20.432 -78.336 -23.495 1.00 55.74  ? 251 SER B CA    1 
ATOM   6324 C  C     . SER B 2 251 ? -20.336 -76.949 -24.112 1.00 52.36  ? 251 SER B C     1 
ATOM   6325 O  O     . SER B 2 251 ? -21.062 -76.034 -23.708 1.00 55.98  ? 251 SER B O     1 
ATOM   6326 C  CB    . SER B 2 251 ? -21.764 -78.995 -23.862 1.00 53.46  ? 251 SER B CB    1 
ATOM   6327 O  OG    . SER B 2 251 ? -21.879 -79.170 -25.263 1.00 61.53  ? 251 SER B OG    1 
ATOM   6328 N  N     . TRP B 2 252 ? -19.441 -76.796 -25.083 1.00 42.88  ? 252 TRP B N     1 
ATOM   6329 C  CA    . TRP B 2 252 ? -19.203 -75.523 -25.749 1.00 41.16  ? 252 TRP B CA    1 
ATOM   6330 C  C     . TRP B 2 252 ? -19.644 -75.617 -27.202 1.00 49.04  ? 252 TRP B C     1 
ATOM   6331 O  O     . TRP B 2 252 ? -19.330 -76.594 -27.889 1.00 49.28  ? 252 TRP B O     1 
ATOM   6332 C  CB    . TRP B 2 252 ? -17.724 -75.136 -25.679 1.00 39.18  ? 252 TRP B CB    1 
ATOM   6333 C  CG    . TRP B 2 252 ? -17.214 -74.902 -24.289 1.00 53.56  ? 252 TRP B CG    1 
ATOM   6334 C  CD1   . TRP B 2 252 ? -16.875 -75.852 -23.369 1.00 49.17  ? 252 TRP B CD1   1 
ATOM   6335 C  CD2   . TRP B 2 252 ? -16.969 -73.635 -23.667 1.00 48.32  ? 252 TRP B CD2   1 
ATOM   6336 N  NE1   . TRP B 2 252 ? -16.442 -75.255 -22.211 1.00 53.60  ? 252 TRP B NE1   1 
ATOM   6337 C  CE2   . TRP B 2 252 ? -16.489 -73.894 -22.367 1.00 47.64  ? 252 TRP B CE2   1 
ATOM   6338 C  CE3   . TRP B 2 252 ? -17.111 -72.307 -24.081 1.00 45.31  ? 252 TRP B CE3   1 
ATOM   6339 C  CZ2   . TRP B 2 252 ? -16.152 -72.875 -21.478 1.00 54.28  ? 252 TRP B CZ2   1 
ATOM   6340 C  CZ3   . TRP B 2 252 ? -16.776 -71.296 -23.197 1.00 43.31  ? 252 TRP B CZ3   1 
ATOM   6341 C  CH2   . TRP B 2 252 ? -16.302 -71.585 -21.911 1.00 46.65  ? 252 TRP B CH2   1 
ATOM   6342 N  N     . THR B 2 253 ? -20.370 -74.604 -27.665 1.00 35.53  ? 253 THR B N     1 
ATOM   6343 C  CA    . THR B 2 253 ? -20.740 -74.490 -29.067 1.00 41.52  ? 253 THR B CA    1 
ATOM   6344 C  C     . THR B 2 253 ? -19.797 -73.525 -29.775 1.00 32.08  ? 253 THR B C     1 
ATOM   6345 O  O     . THR B 2 253 ? -18.992 -72.829 -29.151 1.00 33.30  ? 253 THR B O     1 
ATOM   6346 C  CB    . THR B 2 253 ? -22.191 -74.017 -29.216 1.00 44.48  ? 253 THR B CB    1 
ATOM   6347 O  OG1   . THR B 2 253 ? -22.300 -72.653 -28.788 1.00 34.67  ? 253 THR B OG1   1 
ATOM   6348 C  CG2   . THR B 2 253 ? -23.124 -74.883 -28.385 1.00 29.86  ? 253 THR B CG2   1 
ATOM   6349 N  N     . VAL B 2 254 ? -19.901 -73.500 -31.106 1.00 30.72  ? 254 VAL B N     1 
ATOM   6350 C  CA    . VAL B 2 254 ? -19.138 -72.536 -31.894 1.00 33.92  ? 254 VAL B CA    1 
ATOM   6351 C  C     . VAL B 2 254 ? -19.438 -71.117 -31.430 1.00 35.24  ? 254 VAL B C     1 
ATOM   6352 O  O     . VAL B 2 254 ? -18.539 -70.274 -31.329 1.00 37.68  ? 254 VAL B O     1 
ATOM   6353 C  CB    . VAL B 2 254 ? -19.438 -72.717 -33.394 1.00 35.92  ? 254 VAL B CB    1 
ATOM   6354 C  CG1   . VAL B 2 254 ? -18.824 -71.585 -34.206 1.00 33.25  ? 254 VAL B CG1   1 
ATOM   6355 C  CG2   . VAL B 2 254 ? -18.926 -74.062 -33.879 1.00 35.78  ? 254 VAL B CG2   1 
ATOM   6356 N  N     . ASN B 2 255 ? -20.708 -70.837 -31.126 1.00 28.91  ? 255 ASN B N     1 
ATOM   6357 C  CA    . ASN B 2 255 ? -21.084 -69.506 -30.661 1.00 38.65  ? 255 ASN B CA    1 
ATOM   6358 C  C     . ASN B 2 255 ? -20.459 -69.196 -29.306 1.00 38.46  ? 255 ASN B C     1 
ATOM   6359 O  O     . ASN B 2 255 ? -20.001 -68.072 -29.070 1.00 37.51  ? 255 ASN B O     1 
ATOM   6360 C  CB    . ASN B 2 255 ? -22.606 -69.390 -30.594 1.00 32.87  ? 255 ASN B CB    1 
ATOM   6361 C  CG    . ASN B 2 255 ? -23.065 -68.045 -30.067 1.00 41.13  ? 255 ASN B CG    1 
ATOM   6362 O  OD1   . ASN B 2 255 ? -23.030 -67.042 -30.781 1.00 39.59  ? 255 ASN B OD1   1 
ATOM   6363 N  ND2   . ASN B 2 255 ? -23.507 -68.019 -28.814 1.00 35.94  ? 255 ASN B ND2   1 
ATOM   6364 N  N     . ASP B 2 256 ? -20.433 -70.180 -28.403 1.00 30.01  ? 256 ASP B N     1 
ATOM   6365 C  CA    . ASP B 2 256 ? -19.805 -69.976 -27.101 1.00 35.39  ? 256 ASP B CA    1 
ATOM   6366 C  C     . ASP B 2 256 ? -18.330 -69.630 -27.255 1.00 35.57  ? 256 ASP B C     1 
ATOM   6367 O  O     . ASP B 2 256 ? -17.825 -68.703 -26.610 1.00 41.76  ? 256 ASP B O     1 
ATOM   6368 C  CB    . ASP B 2 256 ? -19.969 -71.226 -26.234 1.00 32.06  ? 256 ASP B CB    1 
ATOM   6369 C  CG    . ASP B 2 256 ? -21.420 -71.554 -25.947 1.00 44.17  ? 256 ASP B CG    1 
ATOM   6370 O  OD1   . ASP B 2 256 ? -21.761 -72.757 -25.924 1.00 42.40  ? 256 ASP B OD1   1 
ATOM   6371 O  OD2   . ASP B 2 256 ? -22.217 -70.615 -25.737 1.00 35.75  ? 256 ASP B OD2   1 
ATOM   6372 N  N     . ILE B 2 257 ? -17.623 -70.366 -28.115 1.00 36.69  ? 257 ILE B N     1 
ATOM   6373 C  CA    . ILE B 2 257 ? -16.196 -70.131 -28.297 1.00 34.83  ? 257 ILE B CA    1 
ATOM   6374 C  C     . ILE B 2 257 ? -15.955 -68.790 -28.979 1.00 39.47  ? 257 ILE B C     1 
ATOM   6375 O  O     . ILE B 2 257 ? -15.015 -68.065 -28.632 1.00 38.31  ? 257 ILE B O     1 
ATOM   6376 C  CB    . ILE B 2 257 ? -15.562 -71.294 -29.083 1.00 41.04  ? 257 ILE B CB    1 
ATOM   6377 C  CG1   . ILE B 2 257 ? -15.812 -72.619 -28.361 1.00 43.51  ? 257 ILE B CG1   1 
ATOM   6378 C  CG2   . ILE B 2 257 ? -14.071 -71.066 -29.269 1.00 37.46  ? 257 ILE B CG2   1 
ATOM   6379 C  CD1   . ILE B 2 257 ? -15.218 -73.821 -29.068 1.00 50.38  ? 257 ILE B CD1   1 
ATOM   6380 N  N     . GLN B 2 258 ? -16.799 -68.434 -29.953 1.00 42.35  ? 258 GLN B N     1 
ATOM   6381 C  CA    . GLN B 2 258 ? -16.641 -67.149 -30.630 1.00 35.92  ? 258 GLN B CA    1 
ATOM   6382 C  C     . GLN B 2 258 ? -16.827 -65.988 -29.661 1.00 35.18  ? 258 GLN B C     1 
ATOM   6383 O  O     . GLN B 2 258 ? -16.084 -65.000 -29.715 1.00 31.90  ? 258 GLN B O     1 
ATOM   6384 C  CB    . GLN B 2 258 ? -17.625 -67.041 -31.795 1.00 37.27  ? 258 GLN B CB    1 
ATOM   6385 C  CG    . GLN B 2 258 ? -17.220 -67.839 -33.026 1.00 38.91  ? 258 GLN B CG    1 
ATOM   6386 C  CD    . GLN B 2 258 ? -18.213 -67.700 -34.163 1.00 40.07  ? 258 GLN B CD    1 
ATOM   6387 O  OE1   . GLN B 2 258 ? -19.247 -67.047 -34.022 1.00 45.29  ? 258 GLN B OE1   1 
ATOM   6388 N  NE2   . GLN B 2 258 ? -17.905 -68.318 -35.298 1.00 39.98  ? 258 GLN B NE2   1 
ATOM   6389 N  N     . LYS B 2 259 ? -17.814 -66.087 -28.768 1.00 26.88  ? 259 LYS B N     1 
ATOM   6390 C  CA    . LYS B 2 259 ? -18.004 -65.048 -27.761 1.00 36.43  ? 259 LYS B CA    1 
ATOM   6391 C  C     . LYS B 2 259 ? -16.849 -65.026 -26.768 1.00 40.35  ? 259 LYS B C     1 
ATOM   6392 O  O     . LYS B 2 259 ? -16.437 -63.953 -26.310 1.00 38.70  ? 259 LYS B O     1 
ATOM   6393 C  CB    . LYS B 2 259 ? -19.334 -65.256 -27.037 1.00 37.44  ? 259 LYS B CB    1 
ATOM   6394 C  CG    . LYS B 2 259 ? -20.558 -65.026 -27.907 1.00 42.92  ? 259 LYS B CG    1 
ATOM   6395 C  CD    . LYS B 2 259 ? -21.830 -65.476 -27.207 1.00 48.67  ? 259 LYS B CD    1 
ATOM   6396 C  CE    . LYS B 2 259 ? -22.018 -64.762 -25.879 1.00 64.40  ? 259 LYS B CE    1 
ATOM   6397 N  NZ    . LYS B 2 259 ? -23.245 -65.228 -25.174 1.00 69.69  ? 259 LYS B NZ    1 
ATOM   6398 N  N     . LEU B 2 260 ? -16.312 -66.200 -26.426 1.00 37.19  ? 260 LEU B N     1 
ATOM   6399 C  CA    . LEU B 2 260 ? -15.184 -66.260 -25.503 1.00 32.92  ? 260 LEU B CA    1 
ATOM   6400 C  C     . LEU B 2 260 ? -13.916 -65.703 -26.140 1.00 42.64  ? 260 LEU B C     1 
ATOM   6401 O  O     . LEU B 2 260 ? -13.137 -65.006 -25.479 1.00 42.07  ? 260 LEU B O     1 
ATOM   6402 C  CB    . LEU B 2 260 ? -14.966 -67.700 -25.040 1.00 34.59  ? 260 LEU B CB    1 
ATOM   6403 C  CG    . LEU B 2 260 ? -13.805 -67.959 -24.077 1.00 42.76  ? 260 LEU B CG    1 
ATOM   6404 C  CD1   . LEU B 2 260 ? -14.024 -67.238 -22.756 1.00 42.37  ? 260 LEU B CD1   1 
ATOM   6405 C  CD2   . LEU B 2 260 ? -13.623 -69.455 -23.854 1.00 41.94  ? 260 LEU B CD2   1 
ATOM   6406 N  N     . VAL B 2 261 ? -13.694 -66.000 -27.423 1.00 34.94  ? 261 VAL B N     1 
ATOM   6407 C  CA    . VAL B 2 261 ? -12.507 -65.496 -28.109 1.00 37.52  ? 261 VAL B CA    1 
ATOM   6408 C  C     . VAL B 2 261 ? -12.554 -63.977 -28.218 1.00 41.28  ? 261 VAL B C     1 
ATOM   6409 O  O     . VAL B 2 261 ? -11.545 -63.295 -28.000 1.00 36.49  ? 261 VAL B O     1 
ATOM   6410 C  CB    . VAL B 2 261 ? -12.365 -66.162 -29.490 1.00 41.80  ? 261 VAL B CB    1 
ATOM   6411 C  CG1   . VAL B 2 261 ? -11.355 -65.413 -30.344 1.00 35.24  ? 261 VAL B CG1   1 
ATOM   6412 C  CG2   . VAL B 2 261 ? -11.950 -67.616 -29.336 1.00 43.28  ? 261 VAL B CG2   1 
ATOM   6413 N  N     . GLY B 2 262 ? -13.722 -63.422 -28.550 1.00 39.83  ? 262 GLY B N     1 
ATOM   6414 C  CA    . GLY B 2 262 ? -13.843 -61.976 -28.631 1.00 38.95  ? 262 GLY B CA    1 
ATOM   6415 C  C     . GLY B 2 262 ? -13.607 -61.294 -27.297 1.00 43.98  ? 262 GLY B C     1 
ATOM   6416 O  O     . GLY B 2 262 ? -13.027 -60.207 -27.237 1.00 35.35  ? 262 GLY B O     1 
ATOM   6417 N  N     . LYS B 2 263 ? -14.045 -61.928 -26.207 1.00 38.22  ? 263 LYS B N     1 
ATOM   6418 C  CA    . LYS B 2 263 ? -13.845 -61.350 -24.882 1.00 43.07  ? 263 LYS B CA    1 
ATOM   6419 C  C     . LYS B 2 263 ? -12.379 -61.400 -24.472 1.00 45.63  ? 263 LYS B C     1 
ATOM   6420 O  O     . LYS B 2 263 ? -11.853 -60.436 -23.902 1.00 43.46  ? 263 LYS B O     1 
ATOM   6421 C  CB    . LYS B 2 263 ? -14.718 -62.078 -23.860 1.00 41.96  ? 263 LYS B CB    1 
ATOM   6422 C  CG    . LYS B 2 263 ? -14.671 -61.488 -22.459 1.00 41.93  ? 263 LYS B CG    1 
ATOM   6423 C  CD    . LYS B 2 263 ? -15.639 -62.212 -21.538 1.00 50.38  ? 263 LYS B CD    1 
ATOM   6424 C  CE    . LYS B 2 263 ? -15.621 -61.628 -20.137 1.00 57.11  ? 263 LYS B CE    1 
ATOM   6425 N  NZ    . LYS B 2 263 ? -16.635 -62.276 -19.259 1.00 56.42  ? 263 LYS B NZ    1 
ATOM   6426 N  N     . LEU B 2 264 ? -11.704 -62.517 -24.749 1.00 45.07  ? 264 LEU B N     1 
ATOM   6427 C  CA    . LEU B 2 264 ? -10.286 -62.624 -24.424 1.00 47.90  ? 264 LEU B CA    1 
ATOM   6428 C  C     . LEU B 2 264 ? -9.450  -61.690 -25.289 1.00 41.73  ? 264 LEU B C     1 
ATOM   6429 O  O     . LEU B 2 264 ? -8.456  -61.124 -24.819 1.00 43.88  ? 264 LEU B O     1 
ATOM   6430 C  CB    . LEU B 2 264 ? -9.820  -64.069 -24.586 1.00 42.22  ? 264 LEU B CB    1 
ATOM   6431 C  CG    . LEU B 2 264 ? -10.379 -65.078 -23.583 1.00 38.58  ? 264 LEU B CG    1 
ATOM   6432 C  CD1   . LEU B 2 264 ? -9.942  -66.487 -23.944 1.00 42.56  ? 264 LEU B CD1   1 
ATOM   6433 C  CD2   . LEU B 2 264 ? -9.941  -64.724 -22.171 1.00 45.53  ? 264 LEU B CD2   1 
ATOM   6434 N  N     . ASN B 2 265 ? -9.836  -61.519 -26.555 1.00 42.32  ? 265 ASN B N     1 
ATOM   6435 C  CA    . ASN B 2 265 ? -9.116  -60.604 -27.434 1.00 43.46  ? 265 ASN B CA    1 
ATOM   6436 C  C     . ASN B 2 265 ? -9.177  -59.176 -26.908 1.00 52.06  ? 265 ASN B C     1 
ATOM   6437 O  O     . ASN B 2 265 ? -8.186  -58.439 -26.971 1.00 54.25  ? 265 ASN B O     1 
ATOM   6438 C  CB    . ASN B 2 265 ? -9.686  -60.685 -28.851 1.00 42.02  ? 265 ASN B CB    1 
ATOM   6439 C  CG    . ASN B 2 265 ? -9.004  -59.730 -29.811 1.00 49.43  ? 265 ASN B CG    1 
ATOM   6440 O  OD1   . ASN B 2 265 ? -7.867  -59.955 -30.225 1.00 48.82  ? 265 ASN B OD1   1 
ATOM   6441 N  ND2   . ASN B 2 265 ? -9.704  -58.662 -30.181 1.00 38.66  ? 265 ASN B ND2   1 
ATOM   6442 N  N     . TRP B 2 266 ? -10.333 -58.769 -26.381 1.00 43.68  ? 266 TRP B N     1 
ATOM   6443 C  CA    . TRP B 2 266 ? -10.441 -57.454 -25.758 1.00 49.32  ? 266 TRP B CA    1 
ATOM   6444 C  C     . TRP B 2 266 ? -9.673  -57.404 -24.443 1.00 49.74  ? 266 TRP B C     1 
ATOM   6445 O  O     . TRP B 2 266 ? -9.048  -56.386 -24.121 1.00 51.64  ? 266 TRP B O     1 
ATOM   6446 C  CB    . TRP B 2 266 ? -11.911 -57.100 -25.537 1.00 48.34  ? 266 TRP B CB    1 
ATOM   6447 C  CG    . TRP B 2 266 ? -12.129 -55.987 -24.557 1.00 56.57  ? 266 TRP B CG    1 
ATOM   6448 C  CD1   . TRP B 2 266 ? -12.197 -54.652 -24.832 1.00 60.23  ? 266 TRP B CD1   1 
ATOM   6449 C  CD2   . TRP B 2 266 ? -12.313 -56.115 -23.142 1.00 55.14  ? 266 TRP B CD2   1 
ATOM   6450 N  NE1   . TRP B 2 266 ? -12.410 -53.941 -23.676 1.00 65.01  ? 266 TRP B NE1   1 
ATOM   6451 C  CE2   . TRP B 2 266 ? -12.484 -54.816 -22.624 1.00 56.08  ? 266 TRP B CE2   1 
ATOM   6452 C  CE3   . TRP B 2 266 ? -12.347 -57.202 -22.263 1.00 48.82  ? 266 TRP B CE3   1 
ATOM   6453 C  CZ2   . TRP B 2 266 ? -12.687 -54.574 -21.266 1.00 56.13  ? 266 TRP B CZ2   1 
ATOM   6454 C  CZ3   . TRP B 2 266 ? -12.547 -56.961 -20.916 1.00 49.08  ? 266 TRP B CZ3   1 
ATOM   6455 C  CH2   . TRP B 2 266 ? -12.715 -55.658 -20.431 1.00 56.63  ? 266 TRP B CH2   1 
ATOM   6456 N  N     . ALA B 2 267 ? -9.709  -58.491 -23.668 1.00 42.45  ? 267 ALA B N     1 
ATOM   6457 C  CA    . ALA B 2 267 ? -9.025  -58.519 -22.381 1.00 46.87  ? 267 ALA B CA    1 
ATOM   6458 C  C     . ALA B 2 267 ? -7.510  -58.486 -22.526 1.00 48.69  ? 267 ALA B C     1 
ATOM   6459 O  O     . ALA B 2 267 ? -6.822  -58.069 -21.587 1.00 58.20  ? 267 ALA B O     1 
ATOM   6460 C  CB    . ALA B 2 267 ? -9.444  -59.758 -21.588 1.00 41.10  ? 267 ALA B CB    1 
ATOM   6461 N  N     . SER B 2 268 ? -6.977  -58.916 -23.671 1.00 49.54  ? 268 SER B N     1 
ATOM   6462 C  CA    . SER B 2 268 ? -5.535  -58.869 -23.882 1.00 56.97  ? 268 SER B CA    1 
ATOM   6463 C  C     . SER B 2 268 ? -5.007  -57.442 -23.918 1.00 53.49  ? 268 SER B C     1 
ATOM   6464 O  O     . SER B 2 268 ? -3.818  -57.224 -23.657 1.00 51.90  ? 268 SER B O     1 
ATOM   6465 C  CB    . SER B 2 268 ? -5.167  -59.598 -25.175 1.00 48.43  ? 268 SER B CB    1 
ATOM   6466 O  OG    . SER B 2 268 ? -5.804  -59.006 -26.293 1.00 56.06  ? 268 SER B OG    1 
ATOM   6467 N  N     . GLN B 2 269 ? -5.860  -56.466 -24.237 1.00 41.47  ? 269 GLN B N     1 
ATOM   6468 C  CA    . GLN B 2 269 ? -5.453  -55.068 -24.185 1.00 54.65  ? 269 GLN B CA    1 
ATOM   6469 C  C     . GLN B 2 269 ? -5.206  -54.596 -22.759 1.00 52.94  ? 269 GLN B C     1 
ATOM   6470 O  O     . GLN B 2 269 ? -4.450  -53.640 -22.557 1.00 65.96  ? 269 GLN B O     1 
ATOM   6471 C  CB    . GLN B 2 269 ? -6.510  -54.188 -24.853 1.00 55.34  ? 269 GLN B CB    1 
ATOM   6472 C  CG    . GLN B 2 269 ? -6.711  -54.476 -26.332 1.00 49.64  ? 269 GLN B CG    1 
ATOM   6473 C  CD    . GLN B 2 269 ? -7.884  -53.716 -26.917 1.00 59.68  ? 269 GLN B CD    1 
ATOM   6474 O  OE1   . GLN B 2 269 ? -9.001  -53.785 -26.405 1.00 59.12  ? 269 GLN B OE1   1 
ATOM   6475 N  NE2   . GLN B 2 269 ? -7.634  -52.981 -27.995 1.00 58.30  ? 269 GLN B NE2   1 
ATOM   6476 N  N     . ILE B 2 270 ? -5.826  -55.238 -21.775 1.00 52.94  ? 270 ILE B N     1 
ATOM   6477 C  CA    . ILE B 2 270 ? -5.600  -54.934 -20.366 1.00 51.71  ? 270 ILE B CA    1 
ATOM   6478 C  C     . ILE B 2 270 ? -4.574  -55.878 -19.754 1.00 57.35  ? 270 ILE B C     1 
ATOM   6479 O  O     . ILE B 2 270 ? -3.655  -55.445 -19.059 1.00 57.29  ? 270 ILE B O     1 
ATOM   6480 C  CB    . ILE B 2 270 ? -6.935  -54.980 -19.589 1.00 52.86  ? 270 ILE B CB    1 
ATOM   6481 C  CG1   . ILE B 2 270 ? -7.935  -53.989 -20.189 1.00 53.05  ? 270 ILE B CG1   1 
ATOM   6482 C  CG2   . ILE B 2 270 ? -6.708  -54.691 -18.114 1.00 55.24  ? 270 ILE B CG2   1 
ATOM   6483 C  CD1   . ILE B 2 270 ? -9.311  -54.057 -19.561 1.00 43.67  ? 270 ILE B CD1   1 
ATOM   6484 N  N     . TYR B 2 271 ? -4.719  -57.177 -20.009 1.00 53.87  ? 271 TYR B N     1 
ATOM   6485 C  CA    . TYR B 2 271 ? -3.782  -58.187 -19.527 1.00 52.41  ? 271 TYR B CA    1 
ATOM   6486 C  C     . TYR B 2 271 ? -3.036  -58.778 -20.716 1.00 57.17  ? 271 TYR B C     1 
ATOM   6487 O  O     . TYR B 2 271 ? -3.565  -59.672 -21.396 1.00 59.62  ? 271 TYR B O     1 
ATOM   6488 C  CB    . TYR B 2 271 ? -4.519  -59.284 -18.753 1.00 61.82  ? 271 TYR B CB    1 
ATOM   6489 C  CG    . TYR B 2 271 ? -5.341  -58.773 -17.590 1.00 66.47  ? 271 TYR B CG    1 
ATOM   6490 C  CD1   . TYR B 2 271 ? -6.666  -58.394 -17.764 1.00 61.33  ? 271 TYR B CD1   1 
ATOM   6491 C  CD2   . TYR B 2 271 ? -4.792  -58.672 -16.318 1.00 71.14  ? 271 TYR B CD2   1 
ATOM   6492 C  CE1   . TYR B 2 271 ? -7.421  -57.927 -16.703 1.00 60.72  ? 271 TYR B CE1   1 
ATOM   6493 C  CE2   . TYR B 2 271 ? -5.539  -58.206 -15.252 1.00 70.96  ? 271 TYR B CE2   1 
ATOM   6494 C  CZ    . TYR B 2 271 ? -6.852  -57.835 -15.451 1.00 71.40  ? 271 TYR B CZ    1 
ATOM   6495 O  OH    . TYR B 2 271 ? -7.600  -57.372 -14.393 1.00 70.70  ? 271 TYR B OH    1 
ATOM   6496 N  N     . PRO B 2 272 ? -1.817  -58.320 -21.011 1.00 60.44  ? 272 PRO B N     1 
ATOM   6497 C  CA    . PRO B 2 272 ? -1.109  -58.824 -22.201 1.00 57.83  ? 272 PRO B CA    1 
ATOM   6498 C  C     . PRO B 2 272 ? -0.820  -60.314 -22.165 1.00 55.58  ? 272 PRO B C     1 
ATOM   6499 O  O     . PRO B 2 272 ? -0.528  -60.896 -23.217 1.00 59.86  ? 272 PRO B O     1 
ATOM   6500 C  CB    . PRO B 2 272 ? 0.190   -58.005 -22.210 1.00 62.61  ? 272 PRO B CB    1 
ATOM   6501 C  CG    . PRO B 2 272 ? -0.121  -56.783 -21.400 1.00 54.57  ? 272 PRO B CG    1 
ATOM   6502 C  CD    . PRO B 2 272 ? -1.075  -57.240 -20.340 1.00 53.76  ? 272 PRO B CD    1 
ATOM   6503 N  N     . GLY B 2 273 ? -0.891  -60.953 -20.996 1.00 56.26  ? 273 GLY B N     1 
ATOM   6504 C  CA    . GLY B 2 273 ? -0.638  -62.380 -20.909 1.00 60.71  ? 273 GLY B CA    1 
ATOM   6505 C  C     . GLY B 2 273 ? -1.722  -63.254 -21.506 1.00 64.10  ? 273 GLY B C     1 
ATOM   6506 O  O     . GLY B 2 273 ? -1.482  -64.450 -21.710 1.00 61.99  ? 273 GLY B O     1 
ATOM   6507 N  N     . ILE B 2 274 ? -2.898  -62.693 -21.788 1.00 59.23  ? 274 ILE B N     1 
ATOM   6508 C  CA    . ILE B 2 274 ? -3.999  -63.478 -22.333 1.00 60.82  ? 274 ILE B CA    1 
ATOM   6509 C  C     . ILE B 2 274 ? -3.642  -63.955 -23.734 1.00 60.13  ? 274 ILE B C     1 
ATOM   6510 O  O     . ILE B 2 274 ? -3.210  -63.167 -24.586 1.00 55.60  ? 274 ILE B O     1 
ATOM   6511 C  CB    . ILE B 2 274 ? -5.294  -62.652 -22.341 1.00 58.83  ? 274 ILE B CB    1 
ATOM   6512 C  CG1   . ILE B 2 274 ? -5.665  -62.221 -20.921 1.00 61.37  ? 274 ILE B CG1   1 
ATOM   6513 C  CG2   . ILE B 2 274 ? -6.429  -63.442 -22.975 1.00 59.70  ? 274 ILE B CG2   1 
ATOM   6514 C  CD1   . ILE B 2 274 ? -5.997  -63.373 -19.998 1.00 57.65  ? 274 ILE B CD1   1 
ATOM   6515 N  N     . LYS B 2 275 ? -3.814  -65.253 -23.977 1.00 60.18  ? 275 LYS B N     1 
ATOM   6516 C  CA    . LYS B 2 275 ? -3.604  -65.844 -25.290 1.00 65.81  ? 275 LYS B CA    1 
ATOM   6517 C  C     . LYS B 2 275 ? -4.879  -66.542 -25.747 1.00 70.43  ? 275 LYS B C     1 
ATOM   6518 O  O     . LYS B 2 275 ? -5.698  -66.972 -24.929 1.00 67.70  ? 275 LYS B O     1 
ATOM   6519 C  CB    . LYS B 2 275 ? -2.434  -66.838 -25.283 1.00 66.51  ? 275 LYS B CB    1 
ATOM   6520 C  CG    . LYS B 2 275 ? -2.642  -68.057 -24.400 0.80 79.11  ? 275 LYS B CG    1 
ATOM   6521 C  CD    . LYS B 2 275 ? -1.612  -69.132 -24.713 0.85 85.63  ? 275 LYS B CD    1 
ATOM   6522 C  CE    . LYS B 2 275 ? -1.790  -70.357 -23.833 0.80 94.23  ? 275 LYS B CE    1 
ATOM   6523 N  NZ    . LYS B 2 275 ? -0.943  -71.496 -24.284 0.80 76.69  ? 275 LYS B NZ    1 
ATOM   6524 N  N     . VAL B 2 276 ? -5.038  -66.654 -27.065 1.00 57.49  ? 276 VAL B N     1 
ATOM   6525 C  CA    . VAL B 2 276 ? -6.267  -67.184 -27.645 1.00 66.10  ? 276 VAL B CA    1 
ATOM   6526 C  C     . VAL B 2 276 ? -5.926  -68.062 -28.846 1.00 68.70  ? 276 VAL B C     1 
ATOM   6527 O  O     . VAL B 2 276 ? -6.793  -68.386 -29.666 1.00 66.39  ? 276 VAL B O     1 
ATOM   6528 C  CB    . VAL B 2 276 ? -7.223  -66.033 -28.022 1.00 56.04  ? 276 VAL B CB    1 
ATOM   6529 C  CG1   . VAL B 2 276 ? -6.772  -65.335 -29.307 1.00 41.12  ? 276 VAL B CG1   1 
ATOM   6530 C  CG2   . VAL B 2 276 ? -8.668  -66.521 -28.109 1.00 62.95  ? 276 VAL B CG2   1 
ATOM   6531 N  N     . ARG B 2 277 ? -4.660  -68.476 -28.939 1.00 75.84  ? 277 ARG B N     1 
ATOM   6532 C  CA    . ARG B 2 277 ? -4.214  -69.268 -30.083 1.00 70.57  ? 277 ARG B CA    1 
ATOM   6533 C  C     . ARG B 2 277 ? -4.938  -70.609 -30.154 1.00 67.44  ? 277 ARG B C     1 
ATOM   6534 O  O     . ARG B 2 277 ? -5.496  -70.971 -31.196 1.00 66.90  ? 277 ARG B O     1 
ATOM   6535 C  CB    . ARG B 2 277 ? -2.701  -69.479 -30.015 1.00 73.70  ? 277 ARG B CB    1 
ATOM   6536 C  CG    . ARG B 2 277 ? -1.887  -68.419 -30.736 1.00 94.73  ? 277 ARG B CG    1 
ATOM   6537 C  CD    . ARG B 2 277 ? -2.284  -68.332 -32.200 1.00 95.87  ? 277 ARG B CD    1 
ATOM   6538 N  NE    . ARG B 2 277 ? -1.241  -67.723 -33.019 1.00 102.11 ? 277 ARG B NE    1 
ATOM   6539 C  CZ    . ARG B 2 277 ? -0.305  -68.411 -33.666 1.00 98.56  ? 277 ARG B CZ    1 
ATOM   6540 N  NH1   . ARG B 2 277 ? -0.284  -69.735 -33.589 1.00 85.95  ? 277 ARG B NH1   1 
ATOM   6541 N  NH2   . ARG B 2 277 ? 0.607   -67.778 -34.390 1.00 80.91  ? 277 ARG B NH2   1 
ATOM   6542 N  N     . GLN B 2 278 ? -4.939  -71.363 -29.052 1.00 59.02  ? 278 GLN B N     1 
ATOM   6543 C  CA    . GLN B 2 278 ? -5.508  -72.707 -29.084 1.00 68.50  ? 278 GLN B CA    1 
ATOM   6544 C  C     . GLN B 2 278 ? -7.031  -72.683 -29.149 1.00 67.34  ? 278 GLN B C     1 
ATOM   6545 O  O     . GLN B 2 278 ? -7.641  -73.634 -29.649 1.00 66.75  ? 278 GLN B O     1 
ATOM   6546 C  CB    . GLN B 2 278 ? -5.039  -73.507 -27.869 1.00 75.29  ? 278 GLN B CB    1 
ATOM   6547 C  CG    . GLN B 2 278 ? -3.534  -73.713 -27.822 1.00 79.36  ? 278 GLN B CG    1 
ATOM   6548 C  CD    . GLN B 2 278 ? -3.003  -74.392 -29.069 1.00 83.49  ? 278 GLN B CD    1 
ATOM   6549 O  OE1   . GLN B 2 278 ? -3.555  -75.392 -29.529 1.00 85.75  ? 278 GLN B OE1   1 
ATOM   6550 N  NE2   . GLN B 2 278 ? -1.930  -73.845 -29.630 1.00 81.97  ? 278 GLN B NE2   1 
ATOM   6551 N  N     . LEU B 2 279 ? -7.661  -71.618 -28.652 1.00 64.14  ? 279 LEU B N     1 
ATOM   6552 C  CA    . LEU B 2 279 ? -9.112  -71.510 -28.749 1.00 51.60  ? 279 LEU B CA    1 
ATOM   6553 C  C     . LEU B 2 279 ? -9.563  -71.095 -30.143 1.00 53.45  ? 279 LEU B C     1 
ATOM   6554 O  O     . LEU B 2 279 ? -10.674 -71.442 -30.558 1.00 53.29  ? 279 LEU B O     1 
ATOM   6555 C  CB    . LEU B 2 279 ? -9.638  -70.519 -27.710 1.00 50.77  ? 279 LEU B CB    1 
ATOM   6556 C  CG    . LEU B 2 279 ? -9.727  -71.035 -26.272 1.00 51.99  ? 279 LEU B CG    1 
ATOM   6557 C  CD1   . LEU B 2 279 ? -9.984  -69.893 -25.305 1.00 55.60  ? 279 LEU B CD1   1 
ATOM   6558 C  CD2   . LEU B 2 279 ? -10.815 -72.092 -26.154 1.00 48.29  ? 279 LEU B CD2   1 
ATOM   6559 N  N     . SER B 2 280 ? -8.721  -70.364 -30.876 1.00 56.62  ? 280 SER B N     1 
ATOM   6560 C  CA    . SER B 2 280 ? -9.103  -69.894 -32.203 1.00 57.84  ? 280 SER B CA    1 
ATOM   6561 C  C     . SER B 2 280 ? -9.055  -71.012 -33.237 1.00 57.65  ? 280 SER B C     1 
ATOM   6562 O  O     . SER B 2 280 ? -9.899  -71.062 -34.138 1.00 63.69  ? 280 SER B O     1 
ATOM   6563 C  CB    . SER B 2 280 ? -8.200  -68.737 -32.631 1.00 54.29  ? 280 SER B CB    1 
ATOM   6564 O  OG    . SER B 2 280 ? -8.303  -67.648 -31.729 1.00 52.52  ? 280 SER B OG    1 
ATOM   6565 N  N     . LYS B 2 281 ? -8.078  -71.917 -33.127 1.00 65.02  ? 281 LYS B N     1 
ATOM   6566 C  CA    . LYS B 2 281 ? -7.952  -72.992 -34.105 1.00 66.51  ? 281 LYS B CA    1 
ATOM   6567 C  C     . LYS B 2 281 ? -9.082  -74.009 -34.001 1.00 59.87  ? 281 LYS B C     1 
ATOM   6568 O  O     . LYS B 2 281 ? -9.276  -74.796 -34.934 1.00 60.49  ? 281 LYS B O     1 
ATOM   6569 C  CB    . LYS B 2 281 ? -6.598  -73.688 -33.958 1.00 64.35  ? 281 LYS B CB    1 
ATOM   6570 C  CG    . LYS B 2 281 ? -6.235  -74.084 -32.540 1.00 66.40  ? 281 LYS B CG    1 
ATOM   6571 C  CD    . LYS B 2 281 ? -4.858  -74.726 -32.496 1.00 77.70  ? 281 LYS B CD    1 
ATOM   6572 C  CE    . LYS B 2 281 ? -3.807  -73.818 -33.115 1.00 89.89  ? 281 LYS B CE    1 
ATOM   6573 N  NZ    . LYS B 2 281 ? -2.455  -74.445 -33.111 1.00 99.54  ? 281 LYS B NZ    1 
ATOM   6574 N  N     . LEU B 2 282 ? -9.827  -74.014 -32.894 1.00 52.60  ? 282 LEU B N     1 
ATOM   6575 C  CA    . LEU B 2 282 ? -11.032 -74.830 -32.818 1.00 49.70  ? 282 LEU B CA    1 
ATOM   6576 C  C     . LEU B 2 282 ? -12.122 -74.322 -33.750 1.00 55.67  ? 282 LEU B C     1 
ATOM   6577 O  O     . LEU B 2 282 ? -13.035 -75.082 -34.092 1.00 52.56  ? 282 LEU B O     1 
ATOM   6578 C  CB    . LEU B 2 282 ? -11.560 -74.865 -31.383 1.00 46.79  ? 282 LEU B CB    1 
ATOM   6579 C  CG    . LEU B 2 282 ? -10.625 -75.387 -30.293 1.00 51.11  ? 282 LEU B CG    1 
ATOM   6580 C  CD1   . LEU B 2 282 ? -11.280 -75.249 -28.929 1.00 53.97  ? 282 LEU B CD1   1 
ATOM   6581 C  CD2   . LEU B 2 282 ? -10.239 -76.834 -30.560 1.00 63.28  ? 282 LEU B CD2   1 
ATOM   6582 N  N     . LEU B 2 283 ? -12.044 -73.059 -34.167 1.00 62.78  ? 283 LEU B N     1 
ATOM   6583 C  CA    . LEU B 2 283 ? -13.056 -72.435 -35.005 1.00 55.20  ? 283 LEU B CA    1 
ATOM   6584 C  C     . LEU B 2 283 ? -12.684 -72.434 -36.482 1.00 55.79  ? 283 LEU B C     1 
ATOM   6585 O  O     . LEU B 2 283 ? -13.313 -71.715 -37.265 1.00 65.59  ? 283 LEU B O     1 
ATOM   6586 C  CB    . LEU B 2 283 ? -13.314 -71.003 -34.532 1.00 50.64  ? 283 LEU B CB    1 
ATOM   6587 C  CG    . LEU B 2 283 ? -13.777 -70.841 -33.084 1.00 45.40  ? 283 LEU B CG    1 
ATOM   6588 C  CD1   . LEU B 2 283 ? -13.868 -69.371 -32.713 1.00 52.03  ? 283 LEU B CD1   1 
ATOM   6589 C  CD2   . LEU B 2 283 ? -15.111 -71.537 -32.867 1.00 43.86  ? 283 LEU B CD2   1 
ATOM   6590 N  N     . ARG B 2 284 ? -11.677 -73.210 -36.879 1.00 53.66  ? 284 ARG B N     1 
ATOM   6591 C  CA    . ARG B 2 284 ? -11.317 -73.287 -38.288 1.00 53.27  ? 284 ARG B CA    1 
ATOM   6592 C  C     . ARG B 2 284 ? -12.461 -73.890 -39.094 1.00 40.31  ? 284 ARG B C     1 
ATOM   6593 O  O     . ARG B 2 284 ? -13.149 -74.808 -38.639 1.00 47.52  ? 284 ARG B O     1 
ATOM   6594 C  CB    . ARG B 2 284 ? -10.043 -74.112 -38.477 1.00 55.34  ? 284 ARG B CB    1 
ATOM   6595 C  CG    . ARG B 2 284 ? -8.761  -73.366 -38.142 1.00 67.93  ? 284 ARG B CG    1 
ATOM   6596 C  CD    . ARG B 2 284 ? -7.557  -74.032 -38.791 1.00 69.95  ? 284 ARG B CD    1 
ATOM   6597 N  NE    . ARG B 2 284 ? -6.333  -73.257 -38.609 1.00 94.00  ? 284 ARG B NE    1 
ATOM   6598 C  CZ    . ARG B 2 284 ? -5.388  -73.547 -37.720 1.00 96.75  ? 284 ARG B CZ    1 
ATOM   6599 N  NH1   . ARG B 2 284 ? -5.521  -74.604 -36.932 1.00 89.08  ? 284 ARG B NH1   1 
ATOM   6600 N  NH2   . ARG B 2 284 ? -4.307  -72.784 -37.624 1.00 97.29  ? 284 ARG B NH2   1 
ATOM   6601 N  N     . GLY B 2 285 ? -12.660 -73.364 -40.295 1.00 48.31  ? 285 GLY B N     1 
ATOM   6602 C  CA    . GLY B 2 285 ? -13.771 -73.764 -41.134 1.00 40.25  ? 285 GLY B CA    1 
ATOM   6603 C  C     . GLY B 2 285 ? -14.925 -72.787 -41.049 1.00 49.69  ? 285 GLY B C     1 
ATOM   6604 O  O     . GLY B 2 285 ? -14.835 -71.703 -40.466 1.00 40.98  ? 285 GLY B O     1 
ATOM   6605 N  N     . THR B 2 286 ? -16.038 -73.193 -41.653 1.00 44.45  ? 286 THR B N     1 
ATOM   6606 C  CA    . THR B 2 286 ? -17.269 -72.406 -41.676 1.00 35.00  ? 286 THR B CA    1 
ATOM   6607 C  C     . THR B 2 286 ? -18.353 -73.253 -41.016 1.00 34.35  ? 286 THR B C     1 
ATOM   6608 O  O     . THR B 2 286 ? -19.081 -73.985 -41.690 1.00 35.54  ? 286 THR B O     1 
ATOM   6609 C  CB    . THR B 2 286 ? -17.644 -72.011 -43.106 1.00 40.98  ? 286 THR B CB    1 
ATOM   6610 O  OG1   . THR B 2 286 ? -16.513 -71.408 -43.747 1.00 46.10  ? 286 THR B OG1   1 
ATOM   6611 C  CG2   . THR B 2 286 ? -18.796 -71.020 -43.098 1.00 33.49  ? 286 THR B CG2   1 
ATOM   6612 N  N     . LYS B 2 287 ? -18.459 -73.149 -39.696 1.00 32.35  ? 287 LYS B N     1 
ATOM   6613 C  CA    . LYS B 2 287 ? -19.313 -74.025 -38.908 1.00 37.00  ? 287 LYS B CA    1 
ATOM   6614 C  C     . LYS B 2 287 ? -20.598 -73.324 -38.482 1.00 44.62  ? 287 LYS B C     1 
ATOM   6615 O  O     . LYS B 2 287 ? -20.697 -72.094 -38.476 1.00 33.23  ? 287 LYS B O     1 
ATOM   6616 C  CB    . LYS B 2 287 ? -18.568 -74.530 -37.669 1.00 36.94  ? 287 LYS B CB    1 
ATOM   6617 C  CG    . LYS B 2 287 ? -17.340 -75.365 -37.980 1.00 37.40  ? 287 LYS B CG    1 
ATOM   6618 C  CD    . LYS B 2 287 ? -16.651 -75.817 -36.706 1.00 52.08  ? 287 LYS B CD    1 
ATOM   6619 C  CE    . LYS B 2 287 ? -15.474 -76.727 -37.011 1.00 45.92  ? 287 LYS B CE    1 
ATOM   6620 N  NZ    . LYS B 2 287 ? -15.898 -77.953 -37.742 1.00 50.51  ? 287 LYS B NZ    1 
ATOM   6621 N  N     . ALA B 2 288 ? -21.587 -74.137 -38.122 1.00 34.81  ? 288 ALA B N     1 
ATOM   6622 C  CA    . ALA B 2 288 ? -22.831 -73.621 -37.574 1.00 32.08  ? 288 ALA B CA    1 
ATOM   6623 C  C     . ALA B 2 288 ? -22.625 -73.166 -36.134 1.00 35.61  ? 288 ALA B C     1 
ATOM   6624 O  O     . ALA B 2 288 ? -21.814 -73.726 -35.391 1.00 35.25  ? 288 ALA B O     1 
ATOM   6625 C  CB    . ALA B 2 288 ? -23.924 -74.686 -37.636 1.00 28.30  ? 288 ALA B CB    1 
ATOM   6626 N  N     . LEU B 2 289 ? -23.381 -72.139 -35.737 1.00 33.36  ? 289 LEU B N     1 
ATOM   6627 C  CA    . LEU B 2 289 ? -23.187 -71.548 -34.417 1.00 28.99  ? 289 LEU B CA    1 
ATOM   6628 C  C     . LEU B 2 289 ? -23.573 -72.504 -33.295 1.00 30.97  ? 289 LEU B C     1 
ATOM   6629 O  O     . LEU B 2 289 ? -23.010 -72.423 -32.197 1.00 37.26  ? 289 LEU B O     1 
ATOM   6630 C  CB    . LEU B 2 289 ? -23.984 -70.249 -34.298 1.00 37.06  ? 289 LEU B CB    1 
ATOM   6631 C  CG    . LEU B 2 289 ? -23.550 -69.093 -35.202 1.00 39.84  ? 289 LEU B CG    1 
ATOM   6632 C  CD1   . LEU B 2 289 ? -24.320 -67.827 -34.855 1.00 24.45  ? 289 LEU B CD1   1 
ATOM   6633 C  CD2   . LEU B 2 289 ? -22.052 -68.858 -35.101 1.00 27.88  ? 289 LEU B CD2   1 
ATOM   6634 N  N     . THR B 2 290 ? -24.518 -73.409 -33.541 1.00 30.86  ? 290 THR B N     1 
ATOM   6635 C  CA    . THR B 2 290 ? -24.987 -74.333 -32.518 1.00 30.09  ? 290 THR B CA    1 
ATOM   6636 C  C     . THR B 2 290 ? -24.261 -75.674 -32.547 1.00 36.06  ? 290 THR B C     1 
ATOM   6637 O  O     . THR B 2 290 ? -24.662 -76.596 -31.830 1.00 45.49  ? 290 THR B O     1 
ATOM   6638 C  CB    . THR B 2 290 ? -26.495 -74.559 -32.658 1.00 34.84  ? 290 THR B CB    1 
ATOM   6639 O  OG1   . THR B 2 290 ? -26.785 -75.093 -33.957 1.00 34.54  ? 290 THR B OG1   1 
ATOM   6640 C  CG2   . THR B 2 290 ? -27.246 -73.248 -32.472 1.00 29.79  ? 290 THR B CG2   1 
ATOM   6641 N  N     . GLU B 2 291 ? -23.208 -75.802 -33.350 1.00 33.59  ? 291 GLU B N     1 
ATOM   6642 C  CA    . GLU B 2 291 ? -22.437 -77.037 -33.383 1.00 39.03  ? 291 GLU B CA    1 
ATOM   6643 C  C     . GLU B 2 291 ? -21.583 -77.150 -32.126 1.00 41.85  ? 291 GLU B C     1 
ATOM   6644 O  O     . GLU B 2 291 ? -20.860 -76.215 -31.770 1.00 42.62  ? 291 GLU B O     1 
ATOM   6645 C  CB    . GLU B 2 291 ? -21.555 -77.077 -34.631 1.00 33.09  ? 291 GLU B CB    1 
ATOM   6646 C  CG    . GLU B 2 291 ? -20.889 -78.418 -34.885 1.00 48.59  ? 291 GLU B CG    1 
ATOM   6647 C  CD    . GLU B 2 291 ? -19.962 -78.386 -36.085 1.00 54.77  ? 291 GLU B CD    1 
ATOM   6648 O  OE1   . GLU B 2 291 ? -18.733 -78.279 -35.888 1.00 65.54  ? 291 GLU B OE1   1 
ATOM   6649 O  OE2   . GLU B 2 291 ? -20.463 -78.455 -37.227 1.00 61.72  ? 291 GLU B OE2   1 
ATOM   6650 N  N     . VAL B 2 292 ? -21.670 -78.293 -31.452 1.00 41.59  ? 292 VAL B N     1 
ATOM   6651 C  CA    . VAL B 2 292 ? -20.914 -78.511 -30.222 1.00 42.84  ? 292 VAL B CA    1 
ATOM   6652 C  C     . VAL B 2 292 ? -19.468 -78.836 -30.574 1.00 51.08  ? 292 VAL B C     1 
ATOM   6653 O  O     . VAL B 2 292 ? -19.197 -79.674 -31.443 1.00 48.70  ? 292 VAL B O     1 
ATOM   6654 C  CB    . VAL B 2 292 ? -21.555 -79.624 -29.375 1.00 36.69  ? 292 VAL B CB    1 
ATOM   6655 C  CG1   . VAL B 2 292 ? -21.842 -80.856 -30.220 1.00 56.80  ? 292 VAL B CG1   1 
ATOM   6656 C  CG2   . VAL B 2 292 ? -20.661 -79.978 -28.196 1.00 37.48  ? 292 VAL B CG2   1 
ATOM   6657 N  N     . ILE B 2 293 ? -18.535 -78.164 -29.908 1.00 52.50  ? 293 ILE B N     1 
ATOM   6658 C  CA    . ILE B 2 293 ? -17.108 -78.306 -30.165 1.00 49.88  ? 293 ILE B CA    1 
ATOM   6659 C  C     . ILE B 2 293 ? -16.439 -78.822 -28.896 1.00 49.04  ? 293 ILE B C     1 
ATOM   6660 O  O     . ILE B 2 293 ? -16.490 -78.157 -27.857 1.00 50.54  ? 293 ILE B O     1 
ATOM   6661 C  CB    . ILE B 2 293 ? -16.468 -76.982 -30.610 1.00 53.13  ? 293 ILE B CB    1 
ATOM   6662 C  CG1   . ILE B 2 293 ? -17.113 -76.485 -31.904 1.00 51.42  ? 293 ILE B CG1   1 
ATOM   6663 C  CG2   . ILE B 2 293 ? -14.965 -77.147 -30.785 1.00 51.25  ? 293 ILE B CG2   1 
ATOM   6664 C  CD1   . ILE B 2 293 ? -16.932 -77.424 -33.076 1.00 58.02  ? 293 ILE B CD1   1 
ATOM   6665 N  N     . PRO B 2 294 ? -15.806 -79.994 -28.924 1.00 51.73  ? 294 PRO B N     1 
ATOM   6666 C  CA    . PRO B 2 294 ? -15.063 -80.455 -27.745 1.00 52.73  ? 294 PRO B CA    1 
ATOM   6667 C  C     . PRO B 2 294 ? -13.764 -79.682 -27.585 1.00 52.42  ? 294 PRO B C     1 
ATOM   6668 O  O     . PRO B 2 294 ? -13.050 -79.420 -28.556 1.00 41.90  ? 294 PRO B O     1 
ATOM   6669 C  CB    . PRO B 2 294 ? -14.798 -81.938 -28.043 1.00 45.95  ? 294 PRO B CB    1 
ATOM   6670 C  CG    . PRO B 2 294 ? -15.693 -82.284 -29.209 1.00 54.25  ? 294 PRO B CG    1 
ATOM   6671 C  CD    . PRO B 2 294 ? -15.857 -81.015 -29.980 1.00 48.64  ? 294 PRO B CD    1 
ATOM   6672 N  N     . LEU B 2 295 ? -13.462 -79.314 -26.343 1.00 52.94  ? 295 LEU B N     1 
ATOM   6673 C  CA    . LEU B 2 295 ? -12.243 -78.577 -26.043 1.00 56.54  ? 295 LEU B CA    1 
ATOM   6674 C  C     . LEU B 2 295 ? -11.068 -79.545 -25.961 1.00 62.93  ? 295 LEU B C     1 
ATOM   6675 O  O     . LEU B 2 295 ? -11.105 -80.514 -25.194 1.00 62.14  ? 295 LEU B O     1 
ATOM   6676 C  CB    . LEU B 2 295 ? -12.393 -77.800 -24.737 1.00 61.60  ? 295 LEU B CB    1 
ATOM   6677 C  CG    . LEU B 2 295 ? -13.436 -76.681 -24.705 1.00 57.80  ? 295 LEU B CG    1 
ATOM   6678 C  CD1   . LEU B 2 295 ? -13.329 -75.894 -23.407 1.00 48.49  ? 295 LEU B CD1   1 
ATOM   6679 C  CD2   . LEU B 2 295 ? -13.284 -75.764 -25.907 1.00 51.58  ? 295 LEU B CD2   1 
ATOM   6680 N  N     . THR B 2 296 ? -10.028 -79.283 -26.749 1.00 67.26  ? 296 THR B N     1 
ATOM   6681 C  CA    . THR B 2 296 ? -8.825  -80.097 -26.702 1.00 66.05  ? 296 THR B CA    1 
ATOM   6682 C  C     . THR B 2 296 ? -8.083  -79.867 -25.386 1.00 72.19  ? 296 THR B C     1 
ATOM   6683 O  O     . THR B 2 296 ? -8.449  -79.014 -24.573 1.00 75.81  ? 296 THR B O     1 
ATOM   6684 C  CB    . THR B 2 296 ? -7.911  -79.775 -27.884 1.00 61.59  ? 296 THR B CB    1 
ATOM   6685 O  OG1   . THR B 2 296 ? -7.481  -78.411 -27.800 1.00 57.79  ? 296 THR B OG1   1 
ATOM   6686 C  CG2   . THR B 2 296 ? -8.644  -79.988 -29.198 1.00 55.16  ? 296 THR B CG2   1 
ATOM   6687 N  N     . GLU B 2 297 ? -7.019  -80.647 -25.181 1.00 74.45  ? 297 GLU B N     1 
ATOM   6688 C  CA    . GLU B 2 297 ? -6.237  -80.514 -23.954 1.00 71.95  ? 297 GLU B CA    1 
ATOM   6689 C  C     . GLU B 2 297 ? -5.538  -79.162 -23.886 1.00 66.06  ? 297 GLU B C     1 
ATOM   6690 O  O     . GLU B 2 297 ? -5.531  -78.513 -22.833 1.00 65.99  ? 297 GLU B O     1 
ATOM   6691 C  CB    . GLU B 2 297 ? -5.220  -81.650 -23.853 1.00 87.32  ? 297 GLU B CB    1 
ATOM   6692 C  CG    . GLU B 2 297 ? -4.376  -81.615 -22.589 1.00 96.21  ? 297 GLU B CG    1 
ATOM   6693 C  CD    . GLU B 2 297 ? -3.394  -82.767 -22.509 1.00 106.25 ? 297 GLU B CD    1 
ATOM   6694 O  OE1   . GLU B 2 297 ? -3.341  -83.571 -23.464 1.00 105.69 ? 297 GLU B OE1   1 
ATOM   6695 O  OE2   . GLU B 2 297 ? -2.677  -82.869 -21.492 1.00 102.31 ? 297 GLU B OE2   1 
ATOM   6696 N  N     . GLU B 2 298 ? -4.946  -78.722 -24.998 1.00 65.90  ? 298 GLU B N     1 
ATOM   6697 C  CA    . GLU B 2 298 ? -4.265  -77.430 -25.018 1.00 67.88  ? 298 GLU B CA    1 
ATOM   6698 C  C     . GLU B 2 298 ? -5.253  -76.285 -24.830 1.00 70.63  ? 298 GLU B C     1 
ATOM   6699 O  O     . GLU B 2 298 ? -5.004  -75.360 -24.048 1.00 63.84  ? 298 GLU B O     1 
ATOM   6700 C  CB    . GLU B 2 298 ? -3.487  -77.266 -26.325 1.00 70.12  ? 298 GLU B CB    1 
ATOM   6701 C  CG    . GLU B 2 298 ? -4.132  -77.936 -27.528 1.00 80.94  ? 298 GLU B CG    1 
ATOM   6702 C  CD    . GLU B 2 298 ? -3.687  -79.377 -27.702 1.00 84.30  ? 298 GLU B CD    1 
ATOM   6703 O  OE1   . GLU B 2 298 ? -2.462  -79.619 -27.753 1.00 85.44  ? 298 GLU B OE1   1 
ATOM   6704 O  OE2   . GLU B 2 298 ? -4.560  -80.267 -27.780 1.00 80.62  ? 298 GLU B OE2   1 
ATOM   6705 N  N     . ALA B 2 299 ? -6.384  -76.330 -25.540 1.00 69.42  ? 299 ALA B N     1 
ATOM   6706 C  CA    . ALA B 2 299 ? -7.391  -75.285 -25.389 1.00 63.26  ? 299 ALA B CA    1 
ATOM   6707 C  C     . ALA B 2 299 ? -8.005  -75.295 -23.996 1.00 63.90  ? 299 ALA B C     1 
ATOM   6708 O  O     . ALA B 2 299 ? -8.366  -74.236 -23.469 1.00 61.35  ? 299 ALA B O     1 
ATOM   6709 C  CB    . ALA B 2 299 ? -8.479  -75.445 -26.452 1.00 56.73  ? 299 ALA B CB    1 
ATOM   6710 N  N     . GLU B 2 300 ? -8.129  -76.476 -23.384 1.00 62.41  ? 300 GLU B N     1 
ATOM   6711 C  CA    . GLU B 2 300 ? -8.673  -76.555 -22.032 1.00 66.96  ? 300 GLU B CA    1 
ATOM   6712 C  C     . GLU B 2 300 ? -7.741  -75.896 -21.023 1.00 71.06  ? 300 GLU B C     1 
ATOM   6713 O  O     . GLU B 2 300 ? -8.195  -75.174 -20.128 1.00 67.87  ? 300 GLU B O     1 
ATOM   6714 C  CB    . GLU B 2 300 ? -8.929  -78.014 -21.653 1.00 67.89  ? 300 GLU B CB    1 
ATOM   6715 C  CG    . GLU B 2 300 ? -9.809  -78.204 -20.428 1.00 82.07  ? 300 GLU B CG    1 
ATOM   6716 C  CD    . GLU B 2 300 ? -11.241 -77.757 -20.660 1.00 82.30  ? 300 GLU B CD    1 
ATOM   6717 O  OE1   . GLU B 2 300 ? -11.522 -76.547 -20.517 1.00 84.34  ? 300 GLU B OE1   1 
ATOM   6718 O  OE2   . GLU B 2 300 ? -12.085 -78.615 -20.995 1.00 72.86  ? 300 GLU B OE2   1 
ATOM   6719 N  N     . LEU B 2 301 ? -6.432  -76.129 -21.153 1.00 75.42  ? 301 LEU B N     1 
ATOM   6720 C  CA    . LEU B 2 301 ? -5.469  -75.500 -20.256 1.00 77.02  ? 301 LEU B CA    1 
ATOM   6721 C  C     . LEU B 2 301 ? -5.271  -74.024 -20.575 1.00 72.43  ? 301 LEU B C     1 
ATOM   6722 O  O     . LEU B 2 301 ? -5.055  -73.223 -19.657 1.00 69.86  ? 301 LEU B O     1 
ATOM   6723 C  CB    . LEU B 2 301 ? -4.127  -76.232 -20.320 1.00 78.70  ? 301 LEU B CB    1 
ATOM   6724 C  CG    . LEU B 2 301 ? -3.148  -75.926 -19.183 1.00 79.99  ? 301 LEU B CG    1 
ATOM   6725 C  CD1   . LEU B 2 301 ? -3.670  -76.478 -17.862 1.00 68.85  ? 301 LEU B CD1   1 
ATOM   6726 C  CD2   . LEU B 2 301 ? -1.771  -76.482 -19.494 1.00 78.22  ? 301 LEU B CD2   1 
ATOM   6727 N  N     . GLU B 2 302 ? -5.330  -73.649 -21.857 1.00 67.31  ? 302 GLU B N     1 
ATOM   6728 C  CA    . GLU B 2 302 ? -5.250  -72.238 -22.223 1.00 59.26  ? 302 GLU B CA    1 
ATOM   6729 C  C     . GLU B 2 302 ? -6.364  -71.437 -21.562 1.00 63.46  ? 302 GLU B C     1 
ATOM   6730 O  O     . GLU B 2 302 ? -6.149  -70.299 -21.129 1.00 57.01  ? 302 GLU B O     1 
ATOM   6731 C  CB    . GLU B 2 302 ? -5.315  -72.086 -23.743 1.00 56.44  ? 302 GLU B CB    1 
ATOM   6732 C  CG    . GLU B 2 302 ? -5.302  -70.643 -24.227 1.00 65.36  ? 302 GLU B CG    1 
ATOM   6733 C  CD    . GLU B 2 302 ? -5.435  -70.530 -25.733 1.00 68.35  ? 302 GLU B CD    1 
ATOM   6734 O  OE1   . GLU B 2 302 ? -6.433  -71.041 -26.284 1.00 72.03  ? 302 GLU B OE1   1 
ATOM   6735 O  OE2   . GLU B 2 302 ? -4.536  -69.940 -26.368 1.00 68.17  ? 302 GLU B OE2   1 
ATOM   6736 N  N     . LEU B 2 303 ? -7.562  -72.018 -21.476 1.00 60.33  ? 303 LEU B N     1 
ATOM   6737 C  CA    . LEU B 2 303 ? -8.660  -71.355 -20.782 1.00 58.75  ? 303 LEU B CA    1 
ATOM   6738 C  C     . LEU B 2 303 ? -8.398  -71.280 -19.283 1.00 58.72  ? 303 LEU B C     1 
ATOM   6739 O  O     . LEU B 2 303 ? -8.711  -70.270 -18.642 1.00 57.39  ? 303 LEU B O     1 
ATOM   6740 C  CB    . LEU B 2 303 ? -9.971  -72.088 -21.065 1.00 59.36  ? 303 LEU B CB    1 
ATOM   6741 C  CG    . LEU B 2 303 ? -11.225 -71.572 -20.358 1.00 55.56  ? 303 LEU B CG    1 
ATOM   6742 C  CD1   . LEU B 2 303 ? -11.504 -70.130 -20.742 1.00 57.70  ? 303 LEU B CD1   1 
ATOM   6743 C  CD2   . LEU B 2 303 ? -12.420 -72.457 -20.678 1.00 58.80  ? 303 LEU B CD2   1 
ATOM   6744 N  N     . ALA B 2 304 ? -7.819  -72.338 -18.708 1.00 59.05  ? 304 ALA B N     1 
ATOM   6745 C  CA    . ALA B 2 304 ? -7.536  -72.340 -17.276 1.00 62.53  ? 304 ALA B CA    1 
ATOM   6746 C  C     . ALA B 2 304 ? -6.426  -71.357 -16.930 1.00 64.58  ? 304 ALA B C     1 
ATOM   6747 O  O     . ALA B 2 304 ? -6.465  -70.715 -15.873 1.00 62.29  ? 304 ALA B O     1 
ATOM   6748 C  CB    . ALA B 2 304 ? -7.171  -73.750 -16.814 1.00 55.19  ? 304 ALA B CB    1 
ATOM   6749 N  N     . GLU B 2 305 ? -5.426  -71.225 -17.804 1.00 58.81  ? 305 GLU B N     1 
ATOM   6750 C  CA    . GLU B 2 305 ? -4.358  -70.261 -17.559 1.00 63.90  ? 305 GLU B CA    1 
ATOM   6751 C  C     . GLU B 2 305 ? -4.868  -68.831 -17.682 1.00 63.95  ? 305 GLU B C     1 
ATOM   6752 O  O     . GLU B 2 305 ? -4.434  -67.946 -16.936 1.00 63.46  ? 305 GLU B O     1 
ATOM   6753 C  CB    . GLU B 2 305 ? -3.198  -70.504 -18.525 1.00 70.31  ? 305 GLU B CB    1 
ATOM   6754 C  CG    . GLU B 2 305 ? -2.465  -71.817 -18.298 1.00 78.67  ? 305 GLU B CG    1 
ATOM   6755 C  CD    . GLU B 2 305 ? -1.361  -72.052 -19.311 1.00 91.68  ? 305 GLU B CD    1 
ATOM   6756 O  OE1   . GLU B 2 305 ? -1.270  -71.273 -20.285 1.00 90.21  ? 305 GLU B OE1   1 
ATOM   6757 O  OE2   . GLU B 2 305 ? -0.586  -73.015 -19.132 1.00 92.99  ? 305 GLU B OE2   1 
ATOM   6758 N  N     . ASN B 2 306 ? -5.791  -68.587 -18.617 1.00 57.62  ? 306 ASN B N     1 
ATOM   6759 C  CA    . ASN B 2 306 ? -6.349  -67.247 -18.772 1.00 60.07  ? 306 ASN B CA    1 
ATOM   6760 C  C     . ASN B 2 306 ? -7.149  -66.828 -17.547 1.00 60.16  ? 306 ASN B C     1 
ATOM   6761 O  O     . ASN B 2 306 ? -7.198  -65.638 -17.216 1.00 58.87  ? 306 ASN B O     1 
ATOM   6762 C  CB    . ASN B 2 306 ? -7.222  -67.181 -20.026 1.00 51.84  ? 306 ASN B CB    1 
ATOM   6763 C  CG    . ASN B 2 306 ? -6.406  -67.186 -21.306 1.00 53.24  ? 306 ASN B CG    1 
ATOM   6764 O  OD1   . ASN B 2 306 ? -5.316  -66.615 -21.363 1.00 58.91  ? 306 ASN B OD1   1 
ATOM   6765 N  ND2   . ASN B 2 306 ? -6.932  -67.830 -22.341 1.00 54.29  ? 306 ASN B ND2   1 
ATOM   6766 N  N     . ARG B 2 307 ? -7.779  -67.787 -16.860 1.00 61.57  ? 307 ARG B N     1 
ATOM   6767 C  CA    . ARG B 2 307 ? -8.508  -67.458 -15.640 1.00 66.24  ? 307 ARG B CA    1 
ATOM   6768 C  C     . ARG B 2 307 ? -7.572  -66.972 -14.542 1.00 64.52  ? 307 ARG B C     1 
ATOM   6769 O  O     . ARG B 2 307 ? -7.948  -66.106 -13.744 1.00 63.98  ? 307 ARG B O     1 
ATOM   6770 C  CB    . ARG B 2 307 ? -9.306  -68.669 -15.153 1.00 66.26  ? 307 ARG B CB    1 
ATOM   6771 C  CG    . ARG B 2 307 ? -10.491 -69.038 -16.028 1.00 69.47  ? 307 ARG B CG    1 
ATOM   6772 C  CD    . ARG B 2 307 ? -11.363 -70.078 -15.341 1.00 63.99  ? 307 ARG B CD    1 
ATOM   6773 N  NE    . ARG B 2 307 ? -12.563 -70.392 -16.111 1.00 71.81  ? 307 ARG B NE    1 
ATOM   6774 C  CZ    . ARG B 2 307 ? -12.682 -71.445 -16.912 1.00 73.49  ? 307 ARG B CZ    1 
ATOM   6775 N  NH1   . ARG B 2 307 ? -11.673 -72.295 -17.048 1.00 65.01  ? 307 ARG B NH1   1 
ATOM   6776 N  NH2   . ARG B 2 307 ? -13.813 -71.651 -17.574 1.00 58.36  ? 307 ARG B NH2   1 
ATOM   6777 N  N     . GLU B 2 308 ? -6.352  -67.511 -14.486 1.00 63.90  ? 308 GLU B N     1 
ATOM   6778 C  CA    . GLU B 2 308 ? -5.392  -67.076 -13.478 1.00 71.69  ? 308 GLU B CA    1 
ATOM   6779 C  C     . GLU B 2 308 ? -4.812  -65.704 -13.795 1.00 71.65  ? 308 GLU B C     1 
ATOM   6780 O  O     . GLU B 2 308 ? -4.529  -64.930 -12.874 1.00 74.23  ? 308 GLU B O     1 
ATOM   6781 C  CB    . GLU B 2 308 ? -4.265  -68.102 -13.345 1.00 69.02  ? 308 GLU B CB    1 
ATOM   6782 C  CG    . GLU B 2 308 ? -4.727  -69.512 -12.992 1.00 81.76  ? 308 GLU B CG    1 
ATOM   6783 C  CD    . GLU B 2 308 ? -5.420  -69.588 -11.642 1.00 87.82  ? 308 GLU B CD    1 
ATOM   6784 O  OE1   . GLU B 2 308 ? -6.629  -69.277 -11.568 1.00 85.70  ? 308 GLU B OE1   1 
ATOM   6785 O  OE2   . GLU B 2 308 ? -4.754  -69.959 -10.652 1.00 80.05  ? 308 GLU B OE2   1 
ATOM   6786 N  N     . ILE B 2 309 ? -4.630  -65.386 -15.079 1.00 61.20  ? 309 ILE B N     1 
ATOM   6787 C  CA    . ILE B 2 309 ? -4.098  -64.081 -15.456 1.00 61.86  ? 309 ILE B CA    1 
ATOM   6788 C  C     . ILE B 2 309 ? -5.090  -62.975 -15.118 1.00 70.55  ? 309 ILE B C     1 
ATOM   6789 O  O     . ILE B 2 309 ? -4.691  -61.870 -14.729 1.00 74.41  ? 309 ILE B O     1 
ATOM   6790 C  CB    . ILE B 2 309 ? -3.724  -64.077 -16.949 1.00 61.07  ? 309 ILE B CB    1 
ATOM   6791 C  CG1   . ILE B 2 309 ? -2.692  -65.169 -17.235 1.00 62.87  ? 309 ILE B CG1   1 
ATOM   6792 C  CG2   . ILE B 2 309 ? -3.190  -62.715 -17.375 1.00 64.81  ? 309 ILE B CG2   1 
ATOM   6793 C  CD1   . ILE B 2 309 ? -2.262  -65.247 -18.679 1.00 68.22  ? 309 ILE B CD1   1 
ATOM   6794 N  N     . LEU B 2 310 ? -6.390  -63.248 -15.247 1.00 59.38  ? 310 LEU B N     1 
ATOM   6795 C  CA    . LEU B 2 310 ? -7.401  -62.259 -14.891 1.00 64.22  ? 310 LEU B CA    1 
ATOM   6796 C  C     . LEU B 2 310 ? -7.455  -62.001 -13.392 1.00 68.01  ? 310 LEU B C     1 
ATOM   6797 O  O     . LEU B 2 310 ? -7.929  -60.939 -12.976 1.00 68.41  ? 310 LEU B O     1 
ATOM   6798 C  CB    . LEU B 2 310 ? -8.773  -62.707 -15.396 1.00 62.30  ? 310 LEU B CB    1 
ATOM   6799 C  CG    . LEU B 2 310 ? -8.913  -62.808 -16.916 1.00 55.51  ? 310 LEU B CG    1 
ATOM   6800 C  CD1   . LEU B 2 310 ? -10.258 -63.401 -17.294 1.00 60.14  ? 310 LEU B CD1   1 
ATOM   6801 C  CD2   . LEU B 2 310 ? -8.726  -61.444 -17.563 1.00 55.79  ? 310 LEU B CD2   1 
ATOM   6802 N  N     . LYS B 2 311 ? -6.981  -62.942 -12.573 1.00 72.25  ? 311 LYS B N     1 
ATOM   6803 C  CA    . LYS B 2 311 ? -6.932  -62.736 -11.132 1.00 79.49  ? 311 LYS B CA    1 
ATOM   6804 C  C     . LYS B 2 311 ? -5.753  -61.874 -10.705 1.00 78.50  ? 311 LYS B C     1 
ATOM   6805 O  O     . LYS B 2 311 ? -5.811  -61.251 -9.639  1.00 92.00  ? 311 LYS B O     1 
ATOM   6806 C  CB    . LYS B 2 311 ? -6.869  -64.084 -10.410 1.00 82.02  ? 311 LYS B CB    1 
ATOM   6807 C  CG    . LYS B 2 311 ? -8.052  -64.995 -10.690 1.00 74.71  ? 311 LYS B CG    1 
ATOM   6808 C  CD    . LYS B 2 311 ? -7.837  -66.377 -10.094 1.00 80.73  ? 311 LYS B CD    1 
ATOM   6809 C  CE    . LYS B 2 311 ? -8.988  -67.310 -10.431 1.00 79.80  ? 311 LYS B CE    1 
ATOM   6810 N  NZ    . LYS B 2 311 ? -8.746  -68.692 -9.934  1.00 93.99  ? 311 LYS B NZ    1 
ATOM   6811 N  N     . GLU B 2 312 ? -4.692  -61.825 -11.507 1.00 76.94  ? 312 GLU B N     1 
ATOM   6812 C  CA    . GLU B 2 312 ? -3.536  -61.014 -11.173 1.00 77.22  ? 312 GLU B CA    1 
ATOM   6813 C  C     . GLU B 2 312 ? -3.880  -59.529 -11.286 1.00 80.20  ? 312 GLU B C     1 
ATOM   6814 O  O     . GLU B 2 312 ? -4.733  -59.139 -12.089 1.00 80.34  ? 312 GLU B O     1 
ATOM   6815 C  CB    . GLU B 2 312 ? -2.367  -61.351 -12.095 1.00 74.25  ? 312 GLU B CB    1 
ATOM   6816 C  CG    . GLU B 2 312 ? -1.991  -62.824 -12.104 1.00 82.93  ? 312 GLU B CG    1 
ATOM   6817 C  CD    . GLU B 2 312 ? -0.922  -63.147 -13.130 1.00 89.65  ? 312 GLU B CD    1 
ATOM   6818 O  OE1   . GLU B 2 312 ? -0.412  -62.207 -13.776 1.00 86.90  ? 312 GLU B OE1   1 
ATOM   6819 O  OE2   . GLU B 2 312 ? -0.594  -64.342 -13.292 1.00 92.08  ? 312 GLU B OE2   1 
ATOM   6820 N  N     . PRO B 2 313 ? -3.237  -58.680 -10.488 1.00 81.58  ? 313 PRO B N     1 
ATOM   6821 C  CA    . PRO B 2 313 ? -3.517  -57.243 -10.571 1.00 83.63  ? 313 PRO B CA    1 
ATOM   6822 C  C     . PRO B 2 313 ? -2.964  -56.637 -11.851 1.00 74.46  ? 313 PRO B C     1 
ATOM   6823 O  O     . PRO B 2 313 ? -1.996  -57.130 -12.437 1.00 71.66  ? 313 PRO B O     1 
ATOM   6824 C  CB    . PRO B 2 313 ? -2.812  -56.673 -9.336  1.00 81.52  ? 313 PRO B CB    1 
ATOM   6825 C  CG    . PRO B 2 313 ? -1.713  -57.642 -9.059  1.00 84.55  ? 313 PRO B CG    1 
ATOM   6826 C  CD    . PRO B 2 313 ? -2.260  -58.994 -9.430  1.00 73.68  ? 313 PRO B CD    1 
ATOM   6827 N  N     . VAL B 2 314 ? -3.601  -55.550 -12.285 1.00 74.84  ? 314 VAL B N     1 
ATOM   6828 C  CA    . VAL B 2 314 ? -3.163  -54.854 -13.489 1.00 75.03  ? 314 VAL B CA    1 
ATOM   6829 C  C     . VAL B 2 314 ? -1.815  -54.198 -13.227 1.00 72.22  ? 314 VAL B C     1 
ATOM   6830 O  O     . VAL B 2 314 ? -1.614  -53.539 -12.198 1.00 66.44  ? 314 VAL B O     1 
ATOM   6831 C  CB    . VAL B 2 314 ? -4.214  -53.823 -13.928 1.00 78.63  ? 314 VAL B CB    1 
ATOM   6832 C  CG1   . VAL B 2 314 ? -3.872  -53.271 -15.304 1.00 60.51  ? 314 VAL B CG1   1 
ATOM   6833 C  CG2   . VAL B 2 314 ? -5.601  -54.446 -13.927 1.00 73.73  ? 314 VAL B CG2   1 
ATOM   6834 N  N     . HIS B 2 315 ? -0.884  -54.372 -14.161 1.00 71.92  ? 315 HIS B N     1 
ATOM   6835 C  CA    . HIS B 2 315 ? 0.486   -53.913 -13.982 1.00 75.49  ? 315 HIS B CA    1 
ATOM   6836 C  C     . HIS B 2 315 ? 0.691   -52.536 -14.600 1.00 73.02  ? 315 HIS B C     1 
ATOM   6837 O  O     . HIS B 2 315 ? 0.138   -52.226 -15.660 1.00 64.63  ? 315 HIS B O     1 
ATOM   6838 C  CB    . HIS B 2 315 ? 1.466   -54.912 -14.601 1.00 79.90  ? 315 HIS B CB    1 
ATOM   6839 C  CG    . HIS B 2 315 ? 2.877   -54.414 -14.666 1.00 83.04  ? 315 HIS B CG    1 
ATOM   6840 N  ND1   . HIS B 2 315 ? 3.419   -53.862 -15.807 1.00 78.08  ? 315 HIS B ND1   1 
ATOM   6841 C  CD2   . HIS B 2 315 ? 3.856   -54.383 -13.732 1.00 71.92  ? 315 HIS B CD2   1 
ATOM   6842 C  CE1   . HIS B 2 315 ? 4.671   -53.513 -15.573 1.00 74.71  ? 315 HIS B CE1   1 
ATOM   6843 N  NE2   . HIS B 2 315 ? 4.961   -53.818 -14.321 1.00 93.81  ? 315 HIS B NE2   1 
ATOM   6844 N  N     . GLY B 2 316 ? 1.490   -51.714 -13.927 1.00 64.99  ? 316 GLY B N     1 
ATOM   6845 C  CA    . GLY B 2 316 ? 1.888   -50.422 -14.461 1.00 63.51  ? 316 GLY B CA    1 
ATOM   6846 C  C     . GLY B 2 316 ? 0.801   -49.369 -14.488 1.00 60.13  ? 316 GLY B C     1 
ATOM   6847 O  O     . GLY B 2 316 ? 0.679   -48.638 -15.479 1.00 60.81  ? 316 GLY B O     1 
ATOM   6848 N  N     . VAL B 2 317 ? 0.011   -49.266 -13.422 1.00 50.79  ? 317 VAL B N     1 
ATOM   6849 C  CA    . VAL B 2 317 ? -1.065  -48.287 -13.324 1.00 54.22  ? 317 VAL B CA    1 
ATOM   6850 C  C     . VAL B 2 317 ? -0.759  -47.389 -12.133 1.00 55.77  ? 317 VAL B C     1 
ATOM   6851 O  O     . VAL B 2 317 ? -0.904  -47.807 -10.977 1.00 54.50  ? 317 VAL B O     1 
ATOM   6852 C  CB    . VAL B 2 317 ? -2.439  -48.953 -13.177 1.00 55.86  ? 317 VAL B CB    1 
ATOM   6853 C  CG1   . VAL B 2 317 ? -3.542  -47.907 -13.212 1.00 54.70  ? 317 VAL B CG1   1 
ATOM   6854 C  CG2   . VAL B 2 317 ? -2.646  -49.986 -14.272 1.00 55.77  ? 317 VAL B CG2   1 
ATOM   6855 N  N     . TYR B 2 318 ? -0.343  -46.157 -12.411 1.00 51.26  ? 318 TYR B N     1 
ATOM   6856 C  CA    . TYR B 2 318 ? 0.048   -45.204 -11.383 1.00 47.62  ? 318 TYR B CA    1 
ATOM   6857 C  C     . TYR B 2 318 ? -0.843  -43.974 -11.466 1.00 41.88  ? 318 TYR B C     1 
ATOM   6858 O  O     . TYR B 2 318 ? -1.025  -43.406 -12.548 1.00 44.20  ? 318 TYR B O     1 
ATOM   6859 C  CB    . TYR B 2 318 ? 1.524   -44.820 -11.530 1.00 57.01  ? 318 TYR B CB    1 
ATOM   6860 C  CG    . TYR B 2 318 ? 2.455   -45.998 -11.364 1.00 53.95  ? 318 TYR B CG    1 
ATOM   6861 C  CD1   . TYR B 2 318 ? 2.897   -46.383 -10.104 1.00 51.96  ? 318 TYR B CD1   1 
ATOM   6862 C  CD2   . TYR B 2 318 ? 2.877   -46.737 -12.462 1.00 53.05  ? 318 TYR B CD2   1 
ATOM   6863 C  CE1   . TYR B 2 318 ? 3.741   -47.463 -9.943  1.00 53.80  ? 318 TYR B CE1   1 
ATOM   6864 C  CE2   . TYR B 2 318 ? 3.720   -47.820 -12.311 1.00 56.11  ? 318 TYR B CE2   1 
ATOM   6865 C  CZ    . TYR B 2 318 ? 4.148   -48.178 -11.049 1.00 62.63  ? 318 TYR B CZ    1 
ATOM   6866 O  OH    . TYR B 2 318 ? 4.987   -49.256 -10.890 1.00 58.29  ? 318 TYR B OH    1 
ATOM   6867 N  N     . TYR B 2 319 ? -1.391  -43.570 -10.323 1.00 45.43  ? 319 TYR B N     1 
ATOM   6868 C  CA    . TYR B 2 319 ? -2.336  -42.463 -10.284 1.00 39.00  ? 319 TYR B CA    1 
ATOM   6869 C  C     . TYR B 2 319 ? -1.644  -41.146 -10.617 1.00 52.77  ? 319 TYR B C     1 
ATOM   6870 O  O     . TYR B 2 319 ? -0.558  -40.855 -10.107 1.00 56.56  ? 319 TYR B O     1 
ATOM   6871 C  CB    . TYR B 2 319 ? -2.995  -42.384 -8.908  1.00 49.11  ? 319 TYR B CB    1 
ATOM   6872 C  CG    . TYR B 2 319 ? -3.822  -41.138 -8.691  1.00 55.32  ? 319 TYR B CG    1 
ATOM   6873 C  CD1   . TYR B 2 319 ? -4.968  -40.903 -9.438  1.00 52.65  ? 319 TYR B CD1   1 
ATOM   6874 C  CD2   . TYR B 2 319 ? -3.461  -40.200 -7.731  1.00 59.38  ? 319 TYR B CD2   1 
ATOM   6875 C  CE1   . TYR B 2 319 ? -5.727  -39.765 -9.243  1.00 56.15  ? 319 TYR B CE1   1 
ATOM   6876 C  CE2   . TYR B 2 319 ? -4.215  -39.060 -7.527  1.00 55.61  ? 319 TYR B CE2   1 
ATOM   6877 C  CZ    . TYR B 2 319 ? -5.347  -38.848 -8.286  1.00 55.01  ? 319 TYR B CZ    1 
ATOM   6878 O  OH    . TYR B 2 319 ? -6.101  -37.715 -8.087  1.00 51.94  ? 319 TYR B OH    1 
ATOM   6879 N  N     . ASP B 2 320 ? -2.281  -40.350 -11.474 1.00 46.99  ? 320 ASP B N     1 
ATOM   6880 C  CA    . ASP B 2 320 ? -1.756  -39.053 -11.888 1.00 51.15  ? 320 ASP B CA    1 
ATOM   6881 C  C     . ASP B 2 320 ? -2.664  -37.956 -11.353 1.00 59.42  ? 320 ASP B C     1 
ATOM   6882 O  O     . ASP B 2 320 ? -3.785  -37.787 -11.859 1.00 50.16  ? 320 ASP B O     1 
ATOM   6883 C  CB    . ASP B 2 320 ? -1.660  -38.973 -13.413 1.00 58.43  ? 320 ASP B CB    1 
ATOM   6884 C  CG    . ASP B 2 320 ? -0.906  -37.742 -13.899 1.00 54.00  ? 320 ASP B CG    1 
ATOM   6885 O  OD1   . ASP B 2 320 ? -0.891  -36.710 -13.196 1.00 57.31  ? 320 ASP B OD1   1 
ATOM   6886 O  OD2   . ASP B 2 320 ? -0.323  -37.807 -15.002 1.00 60.35  ? 320 ASP B OD2   1 
ATOM   6887 N  N     . PRO B 2 321 ? -2.240  -37.191 -10.344 1.00 57.93  ? 321 PRO B N     1 
ATOM   6888 C  CA    . PRO B 2 321 ? -3.112  -36.123 -9.832  1.00 60.86  ? 321 PRO B CA    1 
ATOM   6889 C  C     . PRO B 2 321 ? -3.325  -34.996 -10.826 1.00 56.88  ? 321 PRO B C     1 
ATOM   6890 O  O     . PRO B 2 321 ? -4.345  -34.301 -10.743 1.00 54.13  ? 321 PRO B O     1 
ATOM   6891 C  CB    . PRO B 2 321 ? -2.377  -35.635 -8.574  1.00 61.68  ? 321 PRO B CB    1 
ATOM   6892 C  CG    . PRO B 2 321 ? -1.412  -36.739 -8.232  1.00 62.65  ? 321 PRO B CG    1 
ATOM   6893 C  CD    . PRO B 2 321 ? -1.019  -37.348 -9.538  1.00 54.71  ? 321 PRO B CD    1 
ATOM   6894 N  N     . SER B 2 322 ? -2.399  -34.794 -11.764 1.00 60.06  ? 322 SER B N     1 
ATOM   6895 C  CA    . SER B 2 322 ? -2.548  -33.732 -12.750 1.00 58.02  ? 322 SER B CA    1 
ATOM   6896 C  C     . SER B 2 322 ? -3.557  -34.077 -13.836 1.00 63.06  ? 322 SER B C     1 
ATOM   6897 O  O     . SER B 2 322 ? -4.012  -33.177 -14.550 1.00 69.60  ? 322 SER B O     1 
ATOM   6898 C  CB    . SER B 2 322 ? -1.194  -33.411 -13.387 1.00 58.41  ? 322 SER B CB    1 
ATOM   6899 O  OG    . SER B 2 322 ? -0.675  -34.534 -14.079 1.00 66.12  ? 322 SER B OG    1 
ATOM   6900 N  N     . LYS B 2 323 ? -3.911  -35.349 -13.980 1.00 59.85  ? 323 LYS B N     1 
ATOM   6901 C  CA    . LYS B 2 323 ? -4.913  -35.784 -14.940 1.00 54.45  ? 323 LYS B CA    1 
ATOM   6902 C  C     . LYS B 2 323 ? -6.237  -36.056 -14.235 1.00 56.82  ? 323 LYS B C     1 
ATOM   6903 O  O     . LYS B 2 323 ? -6.298  -36.233 -13.016 1.00 59.64  ? 323 LYS B O     1 
ATOM   6904 C  CB    . LYS B 2 323 ? -4.448  -37.038 -15.685 1.00 63.65  ? 323 LYS B CB    1 
ATOM   6905 C  CG    . LYS B 2 323 ? -3.231  -36.825 -16.570 1.00 60.99  ? 323 LYS B CG    1 
ATOM   6906 C  CD    . LYS B 2 323 ? -2.906  -38.085 -17.358 1.00 65.65  ? 323 LYS B CD    1 
ATOM   6907 C  CE    . LYS B 2 323 ? -1.700  -37.883 -18.259 1.00 65.62  ? 323 LYS B CE    1 
ATOM   6908 N  NZ    . LYS B 2 323 ? -1.406  -39.097 -19.069 0.00 71.49  ? 323 LYS B NZ    1 
ATOM   6909 N  N     . ASP B 2 324 ? -7.304  -36.089 -15.025 1.00 50.97  ? 324 ASP B N     1 
ATOM   6910 C  CA    . ASP B 2 324 ? -8.641  -36.309 -14.500 1.00 48.23  ? 324 ASP B CA    1 
ATOM   6911 C  C     . ASP B 2 324 ? -8.962  -37.796 -14.433 1.00 51.13  ? 324 ASP B C     1 
ATOM   6912 O  O     . ASP B 2 324 ? -8.533  -38.586 -15.278 1.00 45.46  ? 324 ASP B O     1 
ATOM   6913 C  CB    . ASP B 2 324 ? -9.686  -35.595 -15.359 1.00 60.39  ? 324 ASP B CB    1 
ATOM   6914 C  CG    . ASP B 2 324 ? -9.606  -34.088 -15.238 1.00 73.69  ? 324 ASP B CG    1 
ATOM   6915 O  OD1   . ASP B 2 324 ? -9.258  -33.597 -14.144 1.00 77.63  ? 324 ASP B OD1   1 
ATOM   6916 O  OD2   . ASP B 2 324 ? -9.891  -33.394 -16.237 1.00 81.97  ? 324 ASP B OD2   1 
ATOM   6917 N  N     . LEU B 2 325 ? -9.724  -38.169 -13.410 1.00 42.76  ? 325 LEU B N     1 
ATOM   6918 C  CA    . LEU B 2 325 ? -10.235 -39.526 -13.301 1.00 41.88  ? 325 LEU B CA    1 
ATOM   6919 C  C     . LEU B 2 325 ? -11.448 -39.694 -14.206 1.00 50.11  ? 325 LEU B C     1 
ATOM   6920 O  O     . LEU B 2 325 ? -12.332 -38.834 -14.251 1.00 51.13  ? 325 LEU B O     1 
ATOM   6921 C  CB    . LEU B 2 325 ? -10.609 -39.844 -11.853 1.00 48.25  ? 325 LEU B CB    1 
ATOM   6922 C  CG    . LEU B 2 325 ? -9.461  -39.869 -10.842 1.00 52.18  ? 325 LEU B CG    1 
ATOM   6923 C  CD1   . LEU B 2 325 ? -9.996  -39.992 -9.425  1.00 48.15  ? 325 LEU B CD1   1 
ATOM   6924 C  CD2   . LEU B 2 325 ? -8.505  -41.008 -11.153 1.00 50.02  ? 325 LEU B CD2   1 
ATOM   6925 N  N     . ILE B 2 326 ? -11.482 -40.805 -14.935 1.00 39.80  ? 326 ILE B N     1 
ATOM   6926 C  CA    . ILE B 2 326 ? -12.561 -41.110 -15.867 1.00 31.97  ? 326 ILE B CA    1 
ATOM   6927 C  C     . ILE B 2 326 ? -13.297 -42.340 -15.358 1.00 43.20  ? 326 ILE B C     1 
ATOM   6928 O  O     . ILE B 2 326 ? -12.673 -43.362 -15.050 1.00 43.23  ? 326 ILE B O     1 
ATOM   6929 C  CB    . ILE B 2 326 ? -12.029 -41.334 -17.293 1.00 39.31  ? 326 ILE B CB    1 
ATOM   6930 C  CG1   . ILE B 2 326 ? -11.289 -40.090 -17.785 1.00 38.64  ? 326 ILE B CG1   1 
ATOM   6931 C  CG2   . ILE B 2 326 ? -13.169 -41.689 -18.236 1.00 39.80  ? 326 ILE B CG2   1 
ATOM   6932 C  CD1   . ILE B 2 326 ? -10.743 -40.218 -19.191 1.00 45.26  ? 326 ILE B CD1   1 
ATOM   6933 N  N     . ALA B 2 327 ? -14.621 -42.239 -15.266 1.00 38.97  ? 327 ALA B N     1 
ATOM   6934 C  CA    . ALA B 2 327 ? -15.468 -43.328 -14.798 1.00 28.44  ? 327 ALA B CA    1 
ATOM   6935 C  C     . ALA B 2 327 ? -16.470 -43.677 -15.887 1.00 32.08  ? 327 ALA B C     1 
ATOM   6936 O  O     . ALA B 2 327 ? -17.294 -42.839 -16.269 1.00 37.78  ? 327 ALA B O     1 
ATOM   6937 C  CB    . ALA B 2 327 ? -16.190 -42.949 -13.503 1.00 26.13  ? 327 ALA B CB    1 
ATOM   6938 N  N     . GLU B 2 328 ? -16.393 -44.906 -16.389 1.00 37.85  ? 328 GLU B N     1 
ATOM   6939 C  CA    . GLU B 2 328 ? -17.368 -45.432 -17.332 1.00 40.90  ? 328 GLU B CA    1 
ATOM   6940 C  C     . GLU B 2 328 ? -18.334 -46.352 -16.602 1.00 39.17  ? 328 GLU B C     1 
ATOM   6941 O  O     . GLU B 2 328 ? -17.924 -47.156 -15.761 1.00 37.15  ? 328 GLU B O     1 
ATOM   6942 C  CB    . GLU B 2 328 ? -16.689 -46.196 -18.470 1.00 40.34  ? 328 GLU B CB    1 
ATOM   6943 C  CG    . GLU B 2 328 ? -15.845 -45.342 -19.396 1.00 46.95  ? 328 GLU B CG    1 
ATOM   6944 C  CD    . GLU B 2 328 ? -15.471 -46.074 -20.670 1.00 52.38  ? 328 GLU B CD    1 
ATOM   6945 O  OE1   . GLU B 2 328 ? -16.188 -47.030 -21.035 1.00 48.05  ? 328 GLU B OE1   1 
ATOM   6946 O  OE2   . GLU B 2 328 ? -14.463 -45.699 -21.304 1.00 60.92  ? 328 GLU B OE2   1 
ATOM   6947 N  N     . ILE B 2 329 ? -19.619 -46.227 -16.923 1.00 39.11  ? 329 ILE B N     1 
ATOM   6948 C  CA    . ILE B 2 329 ? -20.666 -47.052 -16.335 1.00 35.73  ? 329 ILE B CA    1 
ATOM   6949 C  C     . ILE B 2 329 ? -21.395 -47.775 -17.457 1.00 33.66  ? 329 ILE B C     1 
ATOM   6950 O  O     . ILE B 2 329 ? -21.669 -47.189 -18.510 1.00 35.92  ? 329 ILE B O     1 
ATOM   6951 C  CB    . ILE B 2 329 ? -21.651 -46.214 -15.493 1.00 36.29  ? 329 ILE B CB    1 
ATOM   6952 C  CG1   . ILE B 2 329 ? -20.899 -45.411 -14.432 1.00 31.75  ? 329 ILE B CG1   1 
ATOM   6953 C  CG2   . ILE B 2 329 ? -22.694 -47.107 -14.837 1.00 35.03  ? 329 ILE B CG2   1 
ATOM   6954 C  CD1   . ILE B 2 329 ? -21.802 -44.585 -13.545 1.00 34.30  ? 329 ILE B CD1   1 
ATOM   6955 N  N     . GLN B 2 330 ? -21.698 -49.051 -17.236 1.00 37.42  ? 330 GLN B N     1 
ATOM   6956 C  CA    . GLN B 2 330 ? -22.466 -49.852 -18.178 1.00 41.72  ? 330 GLN B CA    1 
ATOM   6957 C  C     . GLN B 2 330 ? -23.678 -50.435 -17.469 1.00 41.29  ? 330 GLN B C     1 
ATOM   6958 O  O     . GLN B 2 330 ? -23.545 -51.039 -16.399 1.00 41.27  ? 330 GLN B O     1 
ATOM   6959 C  CB    . GLN B 2 330 ? -21.623 -50.980 -18.782 1.00 35.60  ? 330 GLN B CB    1 
ATOM   6960 C  CG    . GLN B 2 330 ? -20.343 -50.520 -19.455 1.00 34.96  ? 330 GLN B CG    1 
ATOM   6961 C  CD    . GLN B 2 330 ? -19.162 -50.501 -18.507 1.00 41.71  ? 330 GLN B CD    1 
ATOM   6962 O  OE1   . GLN B 2 330 ? -19.174 -51.163 -17.469 1.00 40.28  ? 330 GLN B OE1   1 
ATOM   6963 N  NE2   . GLN B 2 330 ? -18.131 -49.742 -18.862 1.00 37.50  ? 330 GLN B NE2   1 
ATOM   6964 N  N     . LYS B 2 331 ? -24.853 -50.247 -18.062 1.00 37.87  ? 331 LYS B N     1 
ATOM   6965 C  CA    . LYS B 2 331 ? -26.070 -50.872 -17.566 1.00 45.82  ? 331 LYS B CA    1 
ATOM   6966 C  C     . LYS B 2 331 ? -26.078 -52.339 -17.976 1.00 39.08  ? 331 LYS B C     1 
ATOM   6967 O  O     . LYS B 2 331 ? -26.040 -52.655 -19.170 1.00 47.61  ? 331 LYS B O     1 
ATOM   6968 C  CB    . LYS B 2 331 ? -27.300 -50.151 -18.110 1.00 46.18  ? 331 LYS B CB    1 
ATOM   6969 C  CG    . LYS B 2 331 ? -28.602 -50.904 -17.909 1.00 44.93  ? 331 LYS B CG    1 
ATOM   6970 C  CD    . LYS B 2 331 ? -29.751 -50.189 -18.595 1.00 46.02  ? 331 LYS B CD    1 
ATOM   6971 C  CE    . LYS B 2 331 ? -31.014 -51.030 -18.576 1.00 46.07  ? 331 LYS B CE    1 
ATOM   6972 N  NZ    . LYS B 2 331 ? -32.137 -50.346 -19.277 1.00 44.41  ? 331 LYS B NZ    1 
ATOM   6973 N  N     . GLN B 2 332 ? -26.118 -53.235 -16.991 1.00 47.40  ? 332 GLN B N     1 
ATOM   6974 C  CA    . GLN B 2 332 ? -26.095 -54.667 -17.252 1.00 48.83  ? 332 GLN B CA    1 
ATOM   6975 C  C     . GLN B 2 332 ? -27.472 -55.313 -17.192 1.00 52.74  ? 332 GLN B C     1 
ATOM   6976 O  O     . GLN B 2 332 ? -27.594 -56.501 -17.510 1.00 62.60  ? 332 GLN B O     1 
ATOM   6977 C  CB    . GLN B 2 332 ? -25.163 -55.374 -16.258 1.00 42.66  ? 332 GLN B CB    1 
ATOM   6978 C  CG    . GLN B 2 332 ? -23.723 -54.870 -16.266 1.00 50.49  ? 332 GLN B CG    1 
ATOM   6979 C  CD    . GLN B 2 332 ? -22.935 -55.319 -17.487 1.00 48.30  ? 332 GLN B CD    1 
ATOM   6980 O  OE1   . GLN B 2 332 ? -23.492 -55.861 -18.440 1.00 54.46  ? 332 GLN B OE1   1 
ATOM   6981 N  NE2   . GLN B 2 332 ? -21.627 -55.094 -17.458 1.00 51.66  ? 332 GLN B NE2   1 
ATOM   6982 N  N     . GLY B 2 333 ? -28.500 -54.572 -16.801 1.00 59.07  ? 333 GLY B N     1 
ATOM   6983 C  CA    . GLY B 2 333 ? -29.821 -55.134 -16.635 1.00 54.81  ? 333 GLY B CA    1 
ATOM   6984 C  C     . GLY B 2 333 ? -29.998 -55.792 -15.277 1.00 51.35  ? 333 GLY B C     1 
ATOM   6985 O  O     . GLY B 2 333 ? -29.043 -56.088 -14.561 1.00 50.13  ? 333 GLY B O     1 
ATOM   6986 N  N     . GLN B 2 334 ? -31.265 -56.016 -14.922 1.00 61.42  ? 334 GLN B N     1 
ATOM   6987 C  CA    . GLN B 2 334 ? -31.639 -56.635 -13.649 1.00 62.97  ? 334 GLN B CA    1 
ATOM   6988 C  C     . GLN B 2 334 ? -31.079 -55.864 -12.457 1.00 71.76  ? 334 GLN B C     1 
ATOM   6989 O  O     . GLN B 2 334 ? -30.752 -56.450 -11.422 1.00 73.67  ? 334 GLN B O     1 
ATOM   6990 C  CB    . GLN B 2 334 ? -31.196 -58.101 -13.591 1.00 78.37  ? 334 GLN B CB    1 
ATOM   6991 C  CG    . GLN B 2 334 ? -31.725 -58.954 -14.732 1.00 83.13  ? 334 GLN B CG    1 
ATOM   6992 C  CD    . GLN B 2 334 ? -33.229 -59.133 -14.679 1.00 94.06  ? 334 GLN B CD    1 
ATOM   6993 O  OE1   . GLN B 2 334 ? -33.799 -59.376 -13.615 1.00 100.43 ? 334 GLN B OE1   1 
ATOM   6994 N  NE2   . GLN B 2 334 ? -33.882 -59.008 -15.830 1.00 78.81  ? 334 GLN B NE2   1 
ATOM   6995 N  N     . GLY B 2 335 ? -30.959 -54.545 -12.593 1.00 53.20  ? 335 GLY B N     1 
ATOM   6996 C  CA    . GLY B 2 335 ? -30.439 -53.729 -11.515 1.00 50.78  ? 335 GLY B CA    1 
ATOM   6997 C  C     . GLY B 2 335 ? -28.950 -53.839 -11.291 1.00 46.99  ? 335 GLY B C     1 
ATOM   6998 O  O     . GLY B 2 335 ? -28.462 -53.431 -10.234 1.00 55.16  ? 335 GLY B O     1 
ATOM   6999 N  N     . GLN B 2 336 ? -28.208 -54.377 -12.255 1.00 42.65  ? 336 GLN B N     1 
ATOM   7000 C  CA    . GLN B 2 336 ? -26.765 -54.525 -12.143 1.00 50.27  ? 336 GLN B CA    1 
ATOM   7001 C  C     . GLN B 2 336 ? -26.067 -53.419 -12.923 1.00 46.71  ? 336 GLN B C     1 
ATOM   7002 O  O     . GLN B 2 336 ? -26.442 -53.113 -14.059 1.00 43.09  ? 336 GLN B O     1 
ATOM   7003 C  CB    . GLN B 2 336 ? -26.312 -55.893 -12.658 1.00 50.31  ? 336 GLN B CB    1 
ATOM   7004 C  CG    . GLN B 2 336 ? -27.155 -57.056 -12.161 1.00 59.02  ? 336 GLN B CG    1 
ATOM   7005 C  CD    . GLN B 2 336 ? -27.194 -57.149 -10.649 1.00 67.00  ? 336 GLN B CD    1 
ATOM   7006 O  OE1   . GLN B 2 336 ? -26.154 -57.200 -9.992  1.00 69.31  ? 336 GLN B OE1   1 
ATOM   7007 N  NE2   . GLN B 2 336 ? -28.399 -57.167 -10.088 1.00 65.83  ? 336 GLN B NE2   1 
ATOM   7008 N  N     . TRP B 2 337 ? -25.048 -52.822 -12.306 1.00 48.17  ? 337 TRP B N     1 
ATOM   7009 C  CA    . TRP B 2 337 ? -24.288 -51.740 -12.923 1.00 47.42  ? 337 TRP B CA    1 
ATOM   7010 C  C     . TRP B 2 337 ? -22.808 -51.981 -12.673 1.00 45.34  ? 337 TRP B C     1 
ATOM   7011 O  O     . TRP B 2 337 ? -22.387 -52.104 -11.519 1.00 51.25  ? 337 TRP B O     1 
ATOM   7012 C  CB    . TRP B 2 337 ? -24.706 -50.376 -12.363 1.00 42.06  ? 337 TRP B CB    1 
ATOM   7013 C  CG    . TRP B 2 337 ? -26.163 -50.074 -12.520 1.00 43.51  ? 337 TRP B CG    1 
ATOM   7014 C  CD1   . TRP B 2 337 ? -27.181 -50.510 -11.723 1.00 49.29  ? 337 TRP B CD1   1 
ATOM   7015 C  CD2   . TRP B 2 337 ? -26.767 -49.260 -13.533 1.00 41.96  ? 337 TRP B CD2   1 
ATOM   7016 N  NE1   . TRP B 2 337 ? -28.381 -50.024 -12.179 1.00 51.60  ? 337 TRP B NE1   1 
ATOM   7017 C  CE2   . TRP B 2 337 ? -28.155 -49.253 -13.289 1.00 41.95  ? 337 TRP B CE2   1 
ATOM   7018 C  CE3   . TRP B 2 337 ? -26.270 -48.538 -14.623 1.00 38.99  ? 337 TRP B CE3   1 
ATOM   7019 C  CZ2   . TRP B 2 337 ? -29.051 -48.553 -14.094 1.00 38.25  ? 337 TRP B CZ2   1 
ATOM   7020 C  CZ3   . TRP B 2 337 ? -27.162 -47.843 -15.421 1.00 36.42  ? 337 TRP B CZ3   1 
ATOM   7021 C  CH2   . TRP B 2 337 ? -28.537 -47.856 -15.152 1.00 45.79  ? 337 TRP B CH2   1 
ATOM   7022 N  N     . THR B 2 338 ? -22.027 -52.046 -13.745 1.00 36.80  ? 338 THR B N     1 
ATOM   7023 C  CA    . THR B 2 338 ? -20.581 -52.180 -13.659 1.00 40.26  ? 338 THR B CA    1 
ATOM   7024 C  C     . THR B 2 338 ? -19.918 -50.842 -13.958 1.00 37.75  ? 338 THR B C     1 
ATOM   7025 O  O     . THR B 2 338 ? -20.455 -50.015 -14.700 1.00 38.73  ? 338 THR B O     1 
ATOM   7026 C  CB    . THR B 2 338 ? -20.066 -53.244 -14.632 1.00 44.68  ? 338 THR B CB    1 
ATOM   7027 O  OG1   . THR B 2 338 ? -20.518 -52.940 -15.958 1.00 38.69  ? 338 THR B OG1   1 
ATOM   7028 C  CG2   . THR B 2 338 ? -20.573 -54.621 -14.232 1.00 41.75  ? 338 THR B CG2   1 
ATOM   7029 N  N     . TYR B 2 339 ? -18.744 -50.629 -13.367 1.00 32.03  ? 339 TYR B N     1 
ATOM   7030 C  CA    . TYR B 2 339 ? -18.032 -49.377 -13.570 1.00 34.78  ? 339 TYR B CA    1 
ATOM   7031 C  C     . TYR B 2 339 ? -16.532 -49.610 -13.488 1.00 40.55  ? 339 TYR B C     1 
ATOM   7032 O  O     . TYR B 2 339 ? -16.063 -50.528 -12.809 1.00 35.44  ? 339 TYR B O     1 
ATOM   7033 C  CB    . TYR B 2 339 ? -18.461 -48.308 -12.555 1.00 39.40  ? 339 TYR B CB    1 
ATOM   7034 C  CG    . TYR B 2 339 ? -18.142 -48.632 -11.111 1.00 41.46  ? 339 TYR B CG    1 
ATOM   7035 C  CD1   . TYR B 2 339 ? -19.029 -49.363 -10.331 1.00 37.83  ? 339 TYR B CD1   1 
ATOM   7036 C  CD2   . TYR B 2 339 ? -16.964 -48.190 -10.522 1.00 38.13  ? 339 TYR B CD2   1 
ATOM   7037 C  CE1   . TYR B 2 339 ? -18.746 -49.654 -9.010  1.00 39.10  ? 339 TYR B CE1   1 
ATOM   7038 C  CE2   . TYR B 2 339 ? -16.671 -48.477 -9.202  1.00 43.05  ? 339 TYR B CE2   1 
ATOM   7039 C  CZ    . TYR B 2 339 ? -17.566 -49.209 -8.451  1.00 51.83  ? 339 TYR B CZ    1 
ATOM   7040 O  OH    . TYR B 2 339 ? -17.281 -49.497 -7.135  1.00 51.93  ? 339 TYR B OH    1 
ATOM   7041 N  N     . GLN B 2 340 ? -15.787 -48.763 -14.195 1.00 34.45  ? 340 GLN B N     1 
ATOM   7042 C  CA    . GLN B 2 340 ? -14.332 -48.784 -14.197 1.00 37.64  ? 340 GLN B CA    1 
ATOM   7043 C  C     . GLN B 2 340 ? -13.820 -47.363 -14.020 1.00 39.05  ? 340 GLN B C     1 
ATOM   7044 O  O     . GLN B 2 340 ? -14.406 -46.414 -14.549 1.00 42.61  ? 340 GLN B O     1 
ATOM   7045 C  CB    . GLN B 2 340 ? -13.772 -49.379 -15.500 1.00 44.36  ? 340 GLN B CB    1 
ATOM   7046 C  CG    . GLN B 2 340 ? -14.331 -50.747 -15.870 1.00 43.58  ? 340 GLN B CG    1 
ATOM   7047 C  CD    . GLN B 2 340 ? -15.683 -50.664 -16.556 1.00 32.79  ? 340 GLN B CD    1 
ATOM   7048 O  OE1   . GLN B 2 340 ? -15.873 -49.882 -17.485 1.00 35.71  ? 340 GLN B OE1   1 
ATOM   7049 N  NE2   . GLN B 2 340 ? -16.632 -51.468 -16.092 1.00 37.14  ? 340 GLN B NE2   1 
ATOM   7050 N  N     . ILE B 2 341 ? -12.728 -47.222 -13.274 1.00 40.51  ? 341 ILE B N     1 
ATOM   7051 C  CA    . ILE B 2 341 ? -12.092 -45.931 -13.036 1.00 34.65  ? 341 ILE B CA    1 
ATOM   7052 C  C     . ILE B 2 341 ? -10.687 -45.990 -13.614 1.00 45.32  ? 341 ILE B C     1 
ATOM   7053 O  O     . ILE B 2 341 ? -9.896  -46.868 -13.248 1.00 44.87  ? 341 ILE B O     1 
ATOM   7054 C  CB    . ILE B 2 341 ? -12.055 -45.574 -11.542 1.00 41.05  ? 341 ILE B CB    1 
ATOM   7055 C  CG1   . ILE B 2 341 ? -13.475 -45.428 -10.994 1.00 36.60  ? 341 ILE B CG1   1 
ATOM   7056 C  CG2   . ILE B 2 341 ? -11.262 -44.294 -11.321 1.00 41.79  ? 341 ILE B CG2   1 
ATOM   7057 C  CD1   . ILE B 2 341 ? -13.527 -45.081 -9.523  1.00 43.28  ? 341 ILE B CD1   1 
ATOM   7058 N  N     . TYR B 2 342 ? -10.377 -45.058 -14.512 1.00 38.42  ? 342 TYR B N     1 
ATOM   7059 C  CA    . TYR B 2 342 ? -9.080  -45.035 -15.170 1.00 45.15  ? 342 TYR B CA    1 
ATOM   7060 C  C     . TYR B 2 342 ? -8.743  -43.603 -15.560 1.00 45.82  ? 342 TYR B C     1 
ATOM   7061 O  O     . TYR B 2 342 ? -9.595  -42.712 -15.543 1.00 45.31  ? 342 TYR B O     1 
ATOM   7062 C  CB    . TYR B 2 342 ? -9.062  -45.949 -16.401 1.00 41.03  ? 342 TYR B CB    1 
ATOM   7063 C  CG    . TYR B 2 342 ? -10.019 -45.521 -17.494 1.00 42.04  ? 342 TYR B CG    1 
ATOM   7064 C  CD1   . TYR B 2 342 ? -9.601  -44.688 -18.526 1.00 45.29  ? 342 TYR B CD1   1 
ATOM   7065 C  CD2   . TYR B 2 342 ? -11.340 -45.950 -17.493 1.00 42.44  ? 342 TYR B CD2   1 
ATOM   7066 C  CE1   . TYR B 2 342 ? -10.471 -44.295 -19.524 1.00 43.99  ? 342 TYR B CE1   1 
ATOM   7067 C  CE2   . TYR B 2 342 ? -12.217 -45.562 -18.489 1.00 46.47  ? 342 TYR B CE2   1 
ATOM   7068 C  CZ    . TYR B 2 342 ? -11.777 -44.734 -19.501 1.00 44.37  ? 342 TYR B CZ    1 
ATOM   7069 O  OH    . TYR B 2 342 ? -12.647 -44.344 -20.493 1.00 47.51  ? 342 TYR B OH    1 
ATOM   7070 N  N     . GLN B 2 343 ? -7.477  -43.395 -15.909 1.00 48.66  ? 343 GLN B N     1 
ATOM   7071 C  CA    . GLN B 2 343 ? -7.007  -42.138 -16.471 1.00 41.63  ? 343 GLN B CA    1 
ATOM   7072 C  C     . GLN B 2 343 ? -6.456  -42.283 -17.879 1.00 42.64  ? 343 GLN B C     1 
ATOM   7073 O  O     . GLN B 2 343 ? -6.535  -41.333 -18.661 1.00 42.71  ? 343 GLN B O     1 
ATOM   7074 C  CB    . GLN B 2 343 ? -5.928  -41.516 -15.570 1.00 41.12  ? 343 GLN B CB    1 
ATOM   7075 C  CG    . GLN B 2 343 ? -6.439  -41.098 -14.202 1.00 53.64  ? 343 GLN B CG    1 
ATOM   7076 C  CD    . GLN B 2 343 ? -5.343  -40.546 -13.313 1.00 52.37  ? 343 GLN B CD    1 
ATOM   7077 O  OE1   . GLN B 2 343 ? -4.212  -41.030 -13.329 1.00 57.47  ? 343 GLN B OE1   1 
ATOM   7078 N  NE2   . GLN B 2 343 ? -5.674  -39.523 -12.534 1.00 49.64  ? 343 GLN B NE2   1 
ATOM   7079 N  N     . GLU B 2 344 ? -5.900  -43.444 -18.217 1.00 48.62  ? 344 GLU B N     1 
ATOM   7080 C  CA    . GLU B 2 344 ? -5.457  -43.821 -19.546 1.00 58.12  ? 344 GLU B CA    1 
ATOM   7081 C  C     . GLU B 2 344 ? -6.224  -45.059 -19.998 1.00 55.97  ? 344 GLU B C     1 
ATOM   7082 O  O     . GLU B 2 344 ? -6.694  -45.834 -19.159 1.00 52.27  ? 344 GLU B O     1 
ATOM   7083 C  CB    . GLU B 2 344 ? -3.950  -44.109 -19.565 1.00 62.93  ? 344 GLU B CB    1 
ATOM   7084 C  CG    . GLU B 2 344 ? -3.091  -42.935 -19.121 1.00 68.74  ? 344 GLU B CG    1 
ATOM   7085 C  CD    . GLU B 2 344 ? -3.091  -41.798 -20.126 1.00 89.38  ? 344 GLU B CD    1 
ATOM   7086 O  OE1   . GLU B 2 344 ? -2.713  -42.034 -21.293 1.00 94.52  ? 344 GLU B OE1   1 
ATOM   7087 O  OE2   . GLU B 2 344 ? -3.476  -40.670 -19.750 1.00 88.47  ? 344 GLU B OE2   1 
ATOM   7088 N  N     . PRO B 2 345 ? -6.385  -45.265 -21.305 1.00 58.17  ? 345 PRO B N     1 
ATOM   7089 C  CA    . PRO B 2 345 ? -7.141  -46.434 -21.772 1.00 62.54  ? 345 PRO B CA    1 
ATOM   7090 C  C     . PRO B 2 345 ? -6.503  -47.738 -21.314 1.00 54.28  ? 345 PRO B C     1 
ATOM   7091 O  O     . PRO B 2 345 ? -5.282  -47.906 -21.359 1.00 53.18  ? 345 PRO B O     1 
ATOM   7092 C  CB    . PRO B 2 345 ? -7.108  -46.294 -23.300 1.00 60.53  ? 345 PRO B CB    1 
ATOM   7093 C  CG    . PRO B 2 345 ? -5.965  -45.371 -23.582 1.00 65.21  ? 345 PRO B CG    1 
ATOM   7094 C  CD    . PRO B 2 345 ? -5.926  -44.426 -22.425 1.00 65.80  ? 345 PRO B CD    1 
ATOM   7095 N  N     . PHE B 2 346 ? -7.352  -48.655 -20.847 1.00 51.30  ? 346 PHE B N     1 
ATOM   7096 C  CA    . PHE B 2 346 ? -6.959  -49.987 -20.386 1.00 54.40  ? 346 PHE B CA    1 
ATOM   7097 C  C     . PHE B 2 346 ? -6.037  -49.941 -19.172 1.00 55.43  ? 346 PHE B C     1 
ATOM   7098 O  O     . PHE B 2 346 ? -5.387  -50.940 -18.844 1.00 63.46  ? 346 PHE B O     1 
ATOM   7099 C  CB    . PHE B 2 346 ? -6.310  -50.796 -21.516 1.00 53.29  ? 346 PHE B CB    1 
ATOM   7100 C  CG    . PHE B 2 346 ? -7.111  -50.808 -22.785 1.00 58.94  ? 346 PHE B CG    1 
ATOM   7101 C  CD1   . PHE B 2 346 ? -8.248  -51.593 -22.894 1.00 58.20  ? 346 PHE B CD1   1 
ATOM   7102 C  CD2   . PHE B 2 346 ? -6.729  -50.035 -23.869 1.00 56.83  ? 346 PHE B CD2   1 
ATOM   7103 C  CE1   . PHE B 2 346 ? -8.990  -51.606 -24.060 1.00 63.19  ? 346 PHE B CE1   1 
ATOM   7104 C  CE2   . PHE B 2 346 ? -7.465  -50.043 -25.039 1.00 55.90  ? 346 PHE B CE2   1 
ATOM   7105 C  CZ    . PHE B 2 346 ? -8.597  -50.830 -25.135 1.00 65.82  ? 346 PHE B CZ    1 
ATOM   7106 N  N     . LYS B 2 347 ? -5.972  -48.802 -18.489 1.00 50.77  ? 347 LYS B N     1 
ATOM   7107 C  CA    . LYS B 2 347 ? -5.184  -48.650 -17.270 1.00 51.54  ? 347 LYS B CA    1 
ATOM   7108 C  C     . LYS B 2 347 ? -6.130  -48.401 -16.098 1.00 52.83  ? 347 LYS B C     1 
ATOM   7109 O  O     . LYS B 2 347 ? -6.166  -47.317 -15.511 1.00 52.62  ? 347 LYS B O     1 
ATOM   7110 C  CB    . LYS B 2 347 ? -4.166  -47.511 -17.424 1.00 62.01  ? 347 LYS B CB    1 
ATOM   7111 C  CG    . LYS B 2 347 ? -2.772  -47.960 -17.845 1.00 59.04  ? 347 LYS B CG    1 
ATOM   7112 C  CD    . LYS B 2 347 ? -2.767  -48.574 -19.234 1.00 65.31  ? 347 LYS B CD    1 
ATOM   7113 C  CE    . LYS B 2 347 ? -1.359  -48.967 -19.653 1.00 71.83  ? 347 LYS B CE    1 
ATOM   7114 N  NZ    . LYS B 2 347 ? -0.756  -49.960 -18.721 1.00 69.50  ? 347 LYS B NZ    1 
ATOM   7115 N  N     . ASN B 2 348 ? -6.901  -49.429 -15.758 1.00 47.88  ? 348 ASN B N     1 
ATOM   7116 C  CA    . ASN B 2 348 ? -7.925  -49.293 -14.731 1.00 48.95  ? 348 ASN B CA    1 
ATOM   7117 C  C     . ASN B 2 348 ? -7.298  -49.172 -13.347 1.00 45.12  ? 348 ASN B C     1 
ATOM   7118 O  O     . ASN B 2 348 ? -6.448  -49.982 -12.963 1.00 50.11  ? 348 ASN B O     1 
ATOM   7119 C  CB    . ASN B 2 348 ? -8.879  -50.485 -14.772 1.00 41.97  ? 348 ASN B CB    1 
ATOM   7120 C  CG    . ASN B 2 348 ? -9.713  -50.520 -16.035 1.00 48.24  ? 348 ASN B CG    1 
ATOM   7121 O  OD1   . ASN B 2 348 ? -10.022 -49.479 -16.617 1.00 43.02  ? 348 ASN B OD1   1 
ATOM   7122 N  ND2   . ASN B 2 348 ? -10.086 -51.720 -16.465 1.00 47.54  ? 348 ASN B ND2   1 
ATOM   7123 N  N     . LEU B 2 349 ? -7.719  -48.150 -12.603 1.00 48.67  ? 349 LEU B N     1 
ATOM   7124 C  CA    . LEU B 2 349 ? -7.363  -48.020 -11.198 1.00 41.87  ? 349 LEU B CA    1 
ATOM   7125 C  C     . LEU B 2 349 ? -8.310  -48.783 -10.284 1.00 50.66  ? 349 LEU B C     1 
ATOM   7126 O  O     . LEU B 2 349 ? -7.915  -49.152 -9.172  1.00 46.12  ? 349 LEU B O     1 
ATOM   7127 C  CB    . LEU B 2 349 ? -7.347  -46.542 -10.791 1.00 38.84  ? 349 LEU B CB    1 
ATOM   7128 C  CG    . LEU B 2 349 ? -6.223  -45.683 -11.370 1.00 50.16  ? 349 LEU B CG    1 
ATOM   7129 C  CD1   . LEU B 2 349 ? -6.625  -44.220 -11.377 1.00 47.34  ? 349 LEU B CD1   1 
ATOM   7130 C  CD2   . LEU B 2 349 ? -4.948  -45.878 -10.567 1.00 51.23  ? 349 LEU B CD2   1 
ATOM   7131 N  N     . LYS B 2 350 ? -9.541  -49.026 -10.729 1.00 40.89  ? 350 LYS B N     1 
ATOM   7132 C  CA    . LYS B 2 350 ? -10.522 -49.760 -9.945  1.00 50.84  ? 350 LYS B CA    1 
ATOM   7133 C  C     . LYS B 2 350 ? -11.643 -50.215 -10.867 1.00 49.72  ? 350 LYS B C     1 
ATOM   7134 O  O     . LYS B 2 350 ? -12.065 -49.469 -11.755 1.00 48.18  ? 350 LYS B O     1 
ATOM   7135 C  CB    . LYS B 2 350 ? -11.088 -48.902 -8.806  1.00 47.50  ? 350 LYS B CB    1 
ATOM   7136 C  CG    . LYS B 2 350 ? -11.974 -49.665 -7.835  1.00 60.92  ? 350 LYS B CG    1 
ATOM   7137 C  CD    . LYS B 2 350 ? -12.546 -48.743 -6.770  1.00 64.85  ? 350 LYS B CD    1 
ATOM   7138 C  CE    . LYS B 2 350 ? -13.297 -49.530 -5.707  1.00 70.41  ? 350 LYS B CE    1 
ATOM   7139 N  NZ    . LYS B 2 350 ? -14.393 -50.353 -6.289  1.00 72.65  ? 350 LYS B NZ    1 
ATOM   7140 N  N     . THR B 2 351 ? -12.109 -51.444 -10.657 1.00 41.77  ? 351 THR B N     1 
ATOM   7141 C  CA    . THR B 2 351 ? -13.255 -51.992 -11.372 1.00 51.67  ? 351 THR B CA    1 
ATOM   7142 C  C     . THR B 2 351 ? -14.206 -52.589 -10.348 1.00 57.38  ? 351 THR B C     1 
ATOM   7143 O  O     . THR B 2 351 ? -13.805 -53.448 -9.557  1.00 68.04  ? 351 THR B O     1 
ATOM   7144 C  CB    . THR B 2 351 ? -12.832 -53.057 -12.391 1.00 46.24  ? 351 THR B CB    1 
ATOM   7145 O  OG1   . THR B 2 351 ? -12.116 -54.103 -11.723 1.00 58.55  ? 351 THR B OG1   1 
ATOM   7146 C  CG2   . THR B 2 351 ? -11.948 -52.449 -13.470 1.00 40.73  ? 351 THR B CG2   1 
ATOM   7147 N  N     . GLY B 2 352 ? -15.458 -52.131 -10.355 1.00 45.35  ? 352 GLY B N     1 
ATOM   7148 C  CA    . GLY B 2 352 ? -16.447 -52.605 -9.410  1.00 42.60  ? 352 GLY B CA    1 
ATOM   7149 C  C     . GLY B 2 352 ? -17.797 -52.786 -10.073 1.00 42.58  ? 352 GLY B C     1 
ATOM   7150 O  O     . GLY B 2 352 ? -17.957 -52.561 -11.274 1.00 47.02  ? 352 GLY B O     1 
ATOM   7151 N  N     . LYS B 2 353 ? -18.766 -53.208 -9.264  1.00 49.88  ? 353 LYS B N     1 
ATOM   7152 C  CA    . LYS B 2 353 ? -20.141 -53.349 -9.716  1.00 58.19  ? 353 LYS B CA    1 
ATOM   7153 C  C     . LYS B 2 353 ? -21.071 -52.786 -8.652  1.00 61.09  ? 353 LYS B C     1 
ATOM   7154 O  O     . LYS B 2 353 ? -20.689 -52.610 -7.493  1.00 59.34  ? 353 LYS B O     1 
ATOM   7155 C  CB    . LYS B 2 353 ? -20.502 -54.809 -10.025 1.00 58.06  ? 353 LYS B CB    1 
ATOM   7156 C  CG    . LYS B 2 353 ? -20.890 -55.634 -8.813  1.00 72.39  ? 353 LYS B CG    1 
ATOM   7157 C  CD    . LYS B 2 353 ? -21.491 -56.965 -9.237  1.00 77.86  ? 353 LYS B CD    1 
ATOM   7158 C  CE    . LYS B 2 353 ? -22.033 -57.737 -8.045  1.00 81.25  ? 353 LYS B CE    1 
ATOM   7159 N  NZ    . LYS B 2 353 ? -22.687 -59.008 -8.461  1.00 87.51  ? 353 LYS B NZ    1 
ATOM   7160 N  N     . TYR B 2 354 ? -22.306 -52.505 -9.063  1.00 64.29  ? 354 TYR B N     1 
ATOM   7161 C  CA    . TYR B 2 354 ? -23.296 -51.872 -8.194  1.00 60.09  ? 354 TYR B CA    1 
ATOM   7162 C  C     . TYR B 2 354 ? -24.646 -52.525 -8.454  1.00 60.70  ? 354 TYR B C     1 
ATOM   7163 O  O     . TYR B 2 354 ? -25.257 -52.297 -9.503  1.00 64.95  ? 354 TYR B O     1 
ATOM   7164 C  CB    . TYR B 2 354 ? -23.352 -50.365 -8.442  1.00 59.81  ? 354 TYR B CB    1 
ATOM   7165 C  CG    . TYR B 2 354 ? -24.351 -49.618 -7.589  1.00 64.79  ? 354 TYR B CG    1 
ATOM   7166 C  CD1   . TYR B 2 354 ? -24.154 -49.467 -6.222  1.00 71.84  ? 354 TYR B CD1   1 
ATOM   7167 C  CD2   . TYR B 2 354 ? -25.483 -49.046 -8.155  1.00 61.50  ? 354 TYR B CD2   1 
ATOM   7168 C  CE1   . TYR B 2 354 ? -25.063 -48.777 -5.441  1.00 60.48  ? 354 TYR B CE1   1 
ATOM   7169 C  CE2   . TYR B 2 354 ? -26.395 -48.353 -7.383  1.00 61.74  ? 354 TYR B CE2   1 
ATOM   7170 C  CZ    . TYR B 2 354 ? -26.182 -48.223 -6.028  1.00 62.48  ? 354 TYR B CZ    1 
ATOM   7171 O  OH    . TYR B 2 354 ? -27.089 -47.534 -5.256  1.00 76.12  ? 354 TYR B OH    1 
ATOM   7172 N  N     . ALA B 2 355 ? -25.106 -53.335 -7.505  1.00 64.40  ? 355 ALA B N     1 
ATOM   7173 C  CA    . ALA B 2 355 ? -26.370 -54.046 -7.611  1.00 64.75  ? 355 ALA B CA    1 
ATOM   7174 C  C     . ALA B 2 355 ? -27.415 -53.402 -6.708  1.00 78.25  ? 355 ALA B C     1 
ATOM   7175 O  O     . ALA B 2 355 ? -27.098 -52.893 -5.629  1.00 83.85  ? 355 ALA B O     1 
ATOM   7176 C  CB    . ALA B 2 355 ? -26.204 -55.523 -7.240  1.00 61.04  ? 355 ALA B CB    1 
ATOM   7177 N  N     . ARG B 2 356 ? -28.664 -53.429 -7.159  1.00 85.13  ? 356 ARG B N     1 
ATOM   7178 C  CA    . ARG B 2 356 ? -29.772 -52.836 -6.416  1.00 91.80  ? 356 ARG B CA    1 
ATOM   7179 C  C     . ARG B 2 356 ? -30.971 -53.772 -6.514  1.00 97.15  ? 356 ARG B C     1 
ATOM   7180 O  O     . ARG B 2 356 ? -30.837 -54.967 -6.799  1.00 85.22  ? 356 ARG B O     1 
ATOM   7181 C  CB    . ARG B 2 356 ? -30.082 -51.424 -6.936  1.00 91.78  ? 356 ARG B CB    1 
ATOM   7182 C  CG    . ARG B 2 356 ? -29.025 -50.393 -6.597  1.00 93.68  ? 356 ARG B CG    1 
ATOM   7183 C  CD    . ARG B 2 356 ? -28.883 -50.214 -5.094  1.00 102.49 ? 356 ARG B CD    1 
ATOM   7184 N  NE    . ARG B 2 356 ? -30.054 -49.572 -4.504  1.00 112.55 ? 356 ARG B NE    1 
ATOM   7185 C  CZ    . ARG B 2 356 ? -30.140 -49.206 -3.229  1.00 104.79 ? 356 ARG B CZ    1 
ATOM   7186 N  NH1   . ARG B 2 356 ? -29.121 -49.415 -2.407  1.00 91.17  ? 356 ARG B NH1   1 
ATOM   7187 N  NH2   . ARG B 2 356 ? -31.243 -48.627 -2.777  1.00 104.57 ? 356 ARG B NH2   1 
ATOM   7188 N  N     . MET B 2 357 ? -32.161 -53.225 -6.277  1.00 104.85 ? 357 MET B N     1 
ATOM   7189 C  CA    . MET B 2 357 ? -33.378 -54.025 -6.300  1.00 99.33  ? 357 MET B CA    1 
ATOM   7190 C  C     . MET B 2 357 ? -33.662 -54.531 -7.709  1.00 97.73  ? 357 MET B C     1 
ATOM   7191 O  O     . MET B 2 357 ? -33.413 -53.840 -8.701  1.00 94.78  ? 357 MET B O     1 
ATOM   7192 C  CB    . MET B 2 357 ? -34.562 -53.206 -5.783  1.00 97.17  ? 357 MET B CB    1 
ATOM   7193 C  CG    . MET B 2 357 ? -34.916 -51.998 -6.639  1.00 108.54 ? 357 MET B CG    1 
ATOM   7194 S  SD    . MET B 2 357 ? -36.331 -51.075 -6.008  1.00 125.29 ? 357 MET B SD    1 
ATOM   7195 C  CE    . MET B 2 357 ? -37.529 -52.388 -5.798  1.00 96.88  ? 357 MET B CE    1 
ATOM   7196 N  N     . ARG B 2 358 ? -34.183 -55.755 -7.792  1.00 89.00  ? 358 ARG B N     1 
ATOM   7197 C  CA    . ARG B 2 358 ? -34.486 -56.401 -9.062  1.00 90.20  ? 358 ARG B CA    1 
ATOM   7198 C  C     . ARG B 2 358 ? -35.989 -56.512 -9.301  1.00 93.59  ? 358 ARG B C     1 
ATOM   7199 O  O     . ARG B 2 358 ? -36.446 -57.403 -10.021 1.00 102.87 ? 358 ARG B O     1 
ATOM   7200 C  CB    . ARG B 2 358 ? -33.837 -57.782 -9.124  1.00 91.61  ? 358 ARG B CB    1 
ATOM   7201 C  CG    . ARG B 2 358 ? -32.332 -57.776 -8.910  1.00 96.63  ? 358 ARG B CG    1 
ATOM   7202 C  CD    . ARG B 2 358 ? -31.744 -59.179 -9.007  1.00 97.78  ? 358 ARG B CD    1 
ATOM   7203 N  NE    . ARG B 2 358 ? -31.923 -59.766 -10.333 1.00 100.94 ? 358 ARG B NE    1 
ATOM   7204 C  CZ    . ARG B 2 358 ? -32.870 -60.646 -10.642 1.00 106.34 ? 358 ARG B CZ    1 
ATOM   7205 N  NH1   . ARG B 2 358 ? -33.730 -61.049 -9.717  1.00 105.91 ? 358 ARG B NH1   1 
ATOM   7206 N  NH2   . ARG B 2 358 ? -32.956 -61.125 -11.875 1.00 96.77  ? 358 ARG B NH2   1 
ATOM   7207 N  N     . GLY B 2 359 ? -36.768 -55.613 -8.705  1.00 92.83  ? 359 GLY B N     1 
ATOM   7208 C  CA    . GLY B 2 359 ? -38.207 -55.639 -8.839  1.00 96.53  ? 359 GLY B CA    1 
ATOM   7209 C  C     . GLY B 2 359 ? -38.673 -55.115 -10.184 1.00 94.39  ? 359 GLY B C     1 
ATOM   7210 O  O     . GLY B 2 359 ? -37.904 -54.943 -11.132 1.00 91.91  ? 359 GLY B O     1 
ATOM   7211 N  N     . ALA B 2 360 ? -39.979 -54.855 -10.257 1.00 95.94  ? 360 ALA B N     1 
ATOM   7212 C  CA    . ALA B 2 360 ? -40.592 -54.351 -11.478 1.00 101.83 ? 360 ALA B CA    1 
ATOM   7213 C  C     . ALA B 2 360 ? -40.695 -52.833 -11.512 1.00 96.76  ? 360 ALA B C     1 
ATOM   7214 O  O     . ALA B 2 360 ? -40.818 -52.260 -12.601 1.00 91.67  ? 360 ALA B O     1 
ATOM   7215 C  CB    . ALA B 2 360 ? -41.988 -54.957 -11.658 1.00 93.92  ? 360 ALA B CB    1 
ATOM   7216 N  N     . HIS B 2 361 ? -40.649 -52.171 -10.354 1.00 95.79  ? 361 HIS B N     1 
ATOM   7217 C  CA    . HIS B 2 361 ? -40.727 -50.717 -10.273 1.00 95.02  ? 361 HIS B CA    1 
ATOM   7218 C  C     . HIS B 2 361 ? -39.360 -50.052 -10.371 1.00 85.10  ? 361 HIS B C     1 
ATOM   7219 O  O     . HIS B 2 361 ? -39.153 -48.977 -9.791  1.00 84.35  ? 361 HIS B O     1 
ATOM   7220 C  CB    . HIS B 2 361 ? -41.424 -50.301 -8.976  1.00 92.70  ? 361 HIS B CB    1 
ATOM   7221 C  CG    . HIS B 2 361 ? -42.501 -51.243 -8.538  1.00 110.14 ? 361 HIS B CG    1 
ATOM   7222 N  ND1   . HIS B 2 361 ? -42.238 -52.400 -7.837  1.00 107.18 ? 361 HIS B ND1   1 
ATOM   7223 C  CD2   . HIS B 2 361 ? -43.845 -51.201 -8.702  1.00 114.06 ? 361 HIS B CD2   1 
ATOM   7224 C  CE1   . HIS B 2 361 ? -43.372 -53.029 -7.587  1.00 107.87 ? 361 HIS B CE1   1 
ATOM   7225 N  NE2   . HIS B 2 361 ? -44.362 -52.323 -8.102  1.00 118.70 ? 361 HIS B NE2   1 
ATOM   7226 N  N     . THR B 2 362 ? -38.422 -50.661 -11.093 1.00 75.11  ? 362 THR B N     1 
ATOM   7227 C  CA    . THR B 2 362 ? -37.061 -50.147 -11.149 1.00 76.70  ? 362 THR B CA    1 
ATOM   7228 C  C     . THR B 2 362 ? -37.005 -48.845 -11.938 1.00 64.42  ? 362 THR B C     1 
ATOM   7229 O  O     . THR B 2 362 ? -37.565 -48.742 -13.034 1.00 60.84  ? 362 THR B O     1 
ATOM   7230 C  CB    . THR B 2 362 ? -36.132 -51.186 -11.777 1.00 78.27  ? 362 THR B CB    1 
ATOM   7231 O  OG1   . THR B 2 362 ? -36.084 -52.352 -10.947 1.00 83.07  ? 362 THR B OG1   1 
ATOM   7232 C  CG2   . THR B 2 362 ? -34.726 -50.625 -11.938 1.00 70.04  ? 362 THR B CG2   1 
ATOM   7233 N  N     . ASN B 2 363 ? -36.330 -47.848 -11.372 1.00 51.34  ? 363 ASN B N     1 
ATOM   7234 C  CA    . ASN B 2 363 ? -36.075 -46.572 -12.031 1.00 40.60  ? 363 ASN B CA    1 
ATOM   7235 C  C     . ASN B 2 363 ? -34.610 -46.561 -12.450 1.00 46.67  ? 363 ASN B C     1 
ATOM   7236 O  O     . ASN B 2 363 ? -33.718 -46.435 -11.603 1.00 49.13  ? 363 ASN B O     1 
ATOM   7237 C  CB    . ASN B 2 363 ? -36.402 -45.404 -11.101 1.00 47.14  ? 363 ASN B CB    1 
ATOM   7238 C  CG    . ASN B 2 363 ? -36.358 -44.056 -11.806 1.00 49.96  ? 363 ASN B CG    1 
ATOM   7239 O  OD1   . ASN B 2 363 ? -35.646 -43.876 -12.795 1.00 46.49  ? 363 ASN B OD1   1 
ATOM   7240 N  ND2   . ASN B 2 363 ? -37.120 -43.098 -11.290 1.00 41.78  ? 363 ASN B ND2   1 
ATOM   7241 N  N     . ASP B 2 364 ? -34.367 -46.696 -13.757 1.00 44.15  ? 364 ASP B N     1 
ATOM   7242 C  CA    . ASP B 2 364 ? -32.998 -46.728 -14.263 1.00 45.02  ? 364 ASP B CA    1 
ATOM   7243 C  C     . ASP B 2 364 ? -32.259 -45.433 -13.955 1.00 44.03  ? 364 ASP B C     1 
ATOM   7244 O  O     . ASP B 2 364 ? -31.082 -45.457 -13.575 1.00 41.77  ? 364 ASP B O     1 
ATOM   7245 C  CB    . ASP B 2 364 ? -33.002 -46.993 -15.768 1.00 53.31  ? 364 ASP B CB    1 
ATOM   7246 C  CG    . ASP B 2 364 ? -32.998 -48.470 -16.102 1.00 45.67  ? 364 ASP B CG    1 
ATOM   7247 O  OD1   . ASP B 2 364 ? -32.912 -48.804 -17.302 1.00 44.05  ? 364 ASP B OD1   1 
ATOM   7248 O  OD2   . ASP B 2 364 ? -33.070 -49.294 -15.166 1.00 55.56  ? 364 ASP B OD2   1 
ATOM   7249 N  N     . VAL B 2 365 ? -32.931 -44.292 -14.117 1.00 41.79  ? 365 VAL B N     1 
ATOM   7250 C  CA    . VAL B 2 365 ? -32.282 -43.009 -13.865 1.00 40.51  ? 365 VAL B CA    1 
ATOM   7251 C  C     . VAL B 2 365 ? -31.957 -42.856 -12.384 1.00 40.33  ? 365 VAL B C     1 
ATOM   7252 O  O     . VAL B 2 365 ? -30.863 -42.407 -12.021 1.00 46.07  ? 365 VAL B O     1 
ATOM   7253 C  CB    . VAL B 2 365 ? -33.162 -41.856 -14.378 1.00 38.04  ? 365 VAL B CB    1 
ATOM   7254 C  CG1   . VAL B 2 365 ? -32.493 -40.518 -14.107 1.00 39.63  ? 365 VAL B CG1   1 
ATOM   7255 C  CG2   . VAL B 2 365 ? -33.441 -42.027 -15.865 1.00 36.99  ? 365 VAL B CG2   1 
ATOM   7256 N  N     . LYS B 2 366 ? -32.891 -43.237 -11.509 1.00 41.32  ? 366 LYS B N     1 
ATOM   7257 C  CA    . LYS B 2 366 ? -32.640 -43.159 -10.072 1.00 41.21  ? 366 LYS B CA    1 
ATOM   7258 C  C     . LYS B 2 366 ? -31.458 -44.036 -9.675  1.00 47.80  ? 366 LYS B C     1 
ATOM   7259 O  O     . LYS B 2 366 ? -30.579 -43.607 -8.919  1.00 36.87  ? 366 LYS B O     1 
ATOM   7260 C  CB    . LYS B 2 366 ? -33.895 -43.563 -9.299  1.00 44.32  ? 366 LYS B CB    1 
ATOM   7261 C  CG    . LYS B 2 366 ? -33.718 -43.595 -7.790  1.00 40.14  ? 366 LYS B CG    1 
ATOM   7262 C  CD    . LYS B 2 366 ? -34.970 -44.115 -7.103  1.00 47.04  ? 366 LYS B CD    1 
ATOM   7263 C  CE    . LYS B 2 366 ? -34.812 -44.127 -5.592  1.00 50.07  ? 366 LYS B CE    1 
ATOM   7264 N  NZ    . LYS B 2 366 ? -34.655 -42.755 -5.036  1.00 67.87  ? 366 LYS B NZ    1 
ATOM   7265 N  N     . GLN B 2 367 ? -31.420 -45.270 -10.184 1.00 42.96  ? 367 GLN B N     1 
ATOM   7266 C  CA    . GLN B 2 367 ? -30.299 -46.157 -9.889  1.00 46.92  ? 367 GLN B CA    1 
ATOM   7267 C  C     . GLN B 2 367 ? -28.989 -45.588 -10.419 1.00 37.76  ? 367 GLN B C     1 
ATOM   7268 O  O     . GLN B 2 367 ? -27.951 -45.676 -9.752  1.00 42.42  ? 367 GLN B O     1 
ATOM   7269 C  CB    . GLN B 2 367 ? -30.554 -47.545 -10.476 1.00 43.92  ? 367 GLN B CB    1 
ATOM   7270 C  CG    . GLN B 2 367 ? -31.635 -48.338 -9.761  1.00 47.99  ? 367 GLN B CG    1 
ATOM   7271 C  CD    . GLN B 2 367 ? -31.751 -49.757 -10.280 1.00 60.19  ? 367 GLN B CD    1 
ATOM   7272 O  OE1   . GLN B 2 367 ? -31.276 -50.072 -11.372 1.00 54.25  ? 367 GLN B OE1   1 
ATOM   7273 N  NE2   . GLN B 2 367 ? -32.382 -50.625 -9.496  1.00 71.15  ? 367 GLN B NE2   1 
ATOM   7274 N  N     . LEU B 2 368 ? -29.020 -44.994 -11.615 1.00 33.25  ? 368 LEU B N     1 
ATOM   7275 C  CA    . LEU B 2 368 ? -27.802 -44.431 -12.190 1.00 38.51  ? 368 LEU B CA    1 
ATOM   7276 C  C     . LEU B 2 368 ? -27.287 -43.263 -11.358 1.00 35.02  ? 368 LEU B C     1 
ATOM   7277 O  O     . LEU B 2 368 ? -26.073 -43.109 -11.181 1.00 40.23  ? 368 LEU B O     1 
ATOM   7278 C  CB    . LEU B 2 368 ? -28.055 -43.996 -13.634 1.00 39.28  ? 368 LEU B CB    1 
ATOM   7279 C  CG    . LEU B 2 368 ? -26.851 -43.430 -14.392 1.00 38.83  ? 368 LEU B CG    1 
ATOM   7280 C  CD1   . LEU B 2 368 ? -25.709 -44.436 -14.419 1.00 35.12  ? 368 LEU B CD1   1 
ATOM   7281 C  CD2   . LEU B 2 368 ? -27.248 -43.023 -15.804 1.00 34.79  ? 368 LEU B CD2   1 
ATOM   7282 N  N     . THR B 2 369 ? -28.192 -42.430 -10.834 1.00 33.16  ? 369 THR B N     1 
ATOM   7283 C  CA    . THR B 2 369 ? -27.764 -41.326 -9.980  1.00 41.91  ? 369 THR B CA    1 
ATOM   7284 C  C     . THR B 2 369 ? -27.178 -41.839 -8.671  1.00 39.31  ? 369 THR B C     1 
ATOM   7285 O  O     . THR B 2 369 ? -26.172 -41.309 -8.185  1.00 40.85  ? 369 THR B O     1 
ATOM   7286 C  CB    . THR B 2 369 ? -28.931 -40.380 -9.699  1.00 43.96  ? 369 THR B CB    1 
ATOM   7287 O  OG1   . THR B 2 369 ? -29.978 -41.094 -9.031  1.00 77.12  ? 369 THR B OG1   1 
ATOM   7288 C  CG2   . THR B 2 369 ? -29.467 -39.786 -10.993 1.00 30.96  ? 369 THR B CG2   1 
ATOM   7289 N  N     . GLU B 2 370 ? -27.797 -42.863 -8.080  1.00 35.93  ? 370 GLU B N     1 
ATOM   7290 C  CA    . GLU B 2 370 ? -27.225 -43.475 -6.885  1.00 43.17  ? 370 GLU B CA    1 
ATOM   7291 C  C     . GLU B 2 370 ? -25.866 -44.093 -7.179  1.00 44.80  ? 370 GLU B C     1 
ATOM   7292 O  O     . GLU B 2 370 ? -24.983 -44.093 -6.314  1.00 47.85  ? 370 GLU B O     1 
ATOM   7293 C  CB    . GLU B 2 370 ? -28.178 -44.531 -6.327  1.00 46.11  ? 370 GLU B CB    1 
ATOM   7294 C  CG    . GLU B 2 370 ? -29.520 -43.982 -5.871  1.00 45.44  ? 370 GLU B CG    1 
ATOM   7295 C  CD    . GLU B 2 370 ? -30.511 -45.078 -5.528  1.00 62.30  ? 370 GLU B CD    1 
ATOM   7296 O  OE1   . GLU B 2 370 ? -30.274 -46.240 -5.921  1.00 64.04  ? 370 GLU B OE1   1 
ATOM   7297 O  OE2   . GLU B 2 370 ? -31.526 -44.777 -4.863  1.00 62.73  ? 370 GLU B OE2   1 
ATOM   7298 N  N     . ALA B 2 371 ? -25.677 -44.610 -8.395  1.00 48.15  ? 371 ALA B N     1 
ATOM   7299 C  CA    . ALA B 2 371 ? -24.403 -45.223 -8.753  1.00 43.48  ? 371 ALA B CA    1 
ATOM   7300 C  C     . ALA B 2 371 ? -23.297 -44.180 -8.852  1.00 40.98  ? 371 ALA B C     1 
ATOM   7301 O  O     . ALA B 2 371 ? -22.201 -44.376 -8.315  1.00 38.53  ? 371 ALA B O     1 
ATOM   7302 C  CB    . ALA B 2 371 ? -24.543 -45.992 -10.067 1.00 38.24  ? 371 ALA B CB    1 
ATOM   7303 N  N     . VAL B 2 372 ? -23.565 -43.058 -9.526  1.00 36.02  ? 372 VAL B N     1 
ATOM   7304 C  CA    . VAL B 2 372 ? -22.525 -42.047 -9.696  1.00 38.93  ? 372 VAL B CA    1 
ATOM   7305 C  C     . VAL B 2 372 ? -22.164 -41.408 -8.361  1.00 35.31  ? 372 VAL B C     1 
ATOM   7306 O  O     . VAL B 2 372 ? -21.016 -40.998 -8.155  1.00 41.08  ? 372 VAL B O     1 
ATOM   7307 C  CB    . VAL B 2 372 ? -22.948 -40.989 -10.735 1.00 39.95  ? 372 VAL B CB    1 
ATOM   7308 C  CG1   . VAL B 2 372 ? -23.329 -41.656 -12.043 1.00 34.86  ? 372 VAL B CG1   1 
ATOM   7309 C  CG2   . VAL B 2 372 ? -24.088 -40.129 -10.214 1.00 48.56  ? 372 VAL B CG2   1 
ATOM   7310 N  N     . GLN B 2 373 ? -23.120 -41.318 -7.433  1.00 35.66  ? 373 GLN B N     1 
ATOM   7311 C  CA    . GLN B 2 373 ? -22.816 -40.760 -6.120  1.00 37.94  ? 373 GLN B CA    1 
ATOM   7312 C  C     . GLN B 2 373 ? -21.920 -41.697 -5.320  1.00 44.56  ? 373 GLN B C     1 
ATOM   7313 O  O     . GLN B 2 373 ? -21.000 -41.246 -4.629  1.00 43.55  ? 373 GLN B O     1 
ATOM   7314 C  CB    . GLN B 2 373 ? -24.109 -40.469 -5.358  1.00 40.03  ? 373 GLN B CB    1 
ATOM   7315 C  CG    . GLN B 2 373 ? -24.906 -39.299 -5.909  1.00 40.41  ? 373 GLN B CG    1 
ATOM   7316 C  CD    . GLN B 2 373 ? -26.244 -39.130 -5.217  1.00 35.82  ? 373 GLN B CD    1 
ATOM   7317 O  OE1   . GLN B 2 373 ? -26.384 -38.320 -4.302  1.00 37.76  ? 373 GLN B OE1   1 
ATOM   7318 N  NE2   . GLN B 2 373 ? -27.237 -39.899 -5.654  1.00 38.31  ? 373 GLN B NE2   1 
ATOM   7319 N  N     . LYS B 2 374 ? -22.174 -43.005 -5.401  1.00 39.51  ? 374 LYS B N     1 
ATOM   7320 C  CA    . LYS B 2 374 ? -21.323 -43.963 -4.704  1.00 33.74  ? 374 LYS B CA    1 
ATOM   7321 C  C     . LYS B 2 374 ? -19.938 -44.029 -5.337  1.00 40.47  ? 374 LYS B C     1 
ATOM   7322 O  O     . LYS B 2 374 ? -18.929 -44.122 -4.628  1.00 46.22  ? 374 LYS B O     1 
ATOM   7323 C  CB    . LYS B 2 374 ? -21.980 -45.343 -4.697  1.00 49.16  ? 374 LYS B CB    1 
ATOM   7324 C  CG    . LYS B 2 374 ? -21.205 -46.391 -3.917  1.00 72.03  ? 374 LYS B CG    1 
ATOM   7325 C  CD    . LYS B 2 374 ? -21.050 -45.983 -2.460  1.00 69.98  ? 374 LYS B CD    1 
ATOM   7326 C  CE    . LYS B 2 374 ? -20.198 -46.982 -1.693  1.00 67.37  ? 374 LYS B CE    1 
ATOM   7327 N  NZ    . LYS B 2 374 ? -20.785 -48.351 -1.718  1.00 67.33  ? 374 LYS B NZ    1 
ATOM   7328 N  N     . ILE B 2 375 ? -19.869 -43.976 -6.670  1.00 37.39  ? 375 ILE B N     1 
ATOM   7329 C  CA    . ILE B 2 375 ? -18.578 -44.013 -7.350  1.00 36.75  ? 375 ILE B CA    1 
ATOM   7330 C  C     . ILE B 2 375 ? -17.769 -42.761 -7.031  1.00 40.13  ? 375 ILE B C     1 
ATOM   7331 O  O     . ILE B 2 375 ? -16.563 -42.836 -6.769  1.00 44.41  ? 375 ILE B O     1 
ATOM   7332 C  CB    . ILE B 2 375 ? -18.781 -44.188 -8.866  1.00 38.40  ? 375 ILE B CB    1 
ATOM   7333 C  CG1   . ILE B 2 375 ? -19.406 -45.551 -9.164  1.00 45.87  ? 375 ILE B CG1   1 
ATOM   7334 C  CG2   . ILE B 2 375 ? -17.460 -44.035 -9.606  1.00 28.55  ? 375 ILE B CG2   1 
ATOM   7335 C  CD1   . ILE B 2 375 ? -19.926 -45.679 -10.574 1.00 35.73  ? 375 ILE B CD1   1 
ATOM   7336 N  N     . THR B 2 376 ? -18.417 -41.593 -7.045  1.00 34.45  ? 376 THR B N     1 
ATOM   7337 C  CA    . THR B 2 376 ? -17.720 -40.361 -6.693  1.00 36.68  ? 376 THR B CA    1 
ATOM   7338 C  C     . THR B 2 376 ? -17.231 -40.401 -5.252  1.00 34.80  ? 376 THR B C     1 
ATOM   7339 O  O     . THR B 2 376 ? -16.095 -40.007 -4.962  1.00 35.49  ? 376 THR B O     1 
ATOM   7340 C  CB    . THR B 2 376 ? -18.632 -39.153 -6.907  1.00 44.88  ? 376 THR B CB    1 
ATOM   7341 O  OG1   . THR B 2 376 ? -19.172 -39.187 -8.233  1.00 42.33  ? 376 THR B OG1   1 
ATOM   7342 C  CG2   . THR B 2 376 ? -17.853 -37.859 -6.719  1.00 35.83  ? 376 THR B CG2   1 
ATOM   7343 N  N     . THR B 2 377 ? -18.077 -40.878 -4.335  1.00 39.67  ? 377 THR B N     1 
ATOM   7344 C  CA    . THR B 2 377 ? -17.682 -40.974 -2.934  1.00 46.29  ? 377 THR B CA    1 
ATOM   7345 C  C     . THR B 2 377 ? -16.452 -41.857 -2.765  1.00 47.66  ? 377 THR B C     1 
ATOM   7346 O  O     . THR B 2 377 ? -15.531 -41.515 -2.013  1.00 47.22  ? 377 THR B O     1 
ATOM   7347 C  CB    . THR B 2 377 ? -18.848 -41.506 -2.099  1.00 46.31  ? 377 THR B CB    1 
ATOM   7348 O  OG1   . THR B 2 377 ? -19.898 -40.530 -2.065  1.00 39.55  ? 377 THR B OG1   1 
ATOM   7349 C  CG2   . THR B 2 377 ? -18.399 -41.807 -0.682  1.00 44.35  ? 377 THR B CG2   1 
ATOM   7350 N  N     . GLU B 2 378 ? -16.413 -42.993 -3.465  1.00 48.93  ? 378 GLU B N     1 
ATOM   7351 C  CA    . GLU B 2 378 ? -15.241 -43.860 -3.395  1.00 45.63  ? 378 GLU B CA    1 
ATOM   7352 C  C     . GLU B 2 378 ? -14.012 -43.171 -3.975  1.00 44.43  ? 378 GLU B C     1 
ATOM   7353 O  O     . GLU B 2 378 ? -12.903 -43.319 -3.450  1.00 44.45  ? 378 GLU B O     1 
ATOM   7354 C  CB    . GLU B 2 378 ? -15.514 -45.177 -4.121  1.00 41.50  ? 378 GLU B CB    1 
ATOM   7355 C  CG    . GLU B 2 378 ? -16.595 -46.029 -3.474  1.00 53.63  ? 378 GLU B CG    1 
ATOM   7356 C  CD    . GLU B 2 378 ? -16.779 -47.365 -4.168  1.00 57.76  ? 378 GLU B CD    1 
ATOM   7357 O  OE1   . GLU B 2 378 ? -16.024 -47.649 -5.122  1.00 56.53  ? 378 GLU B OE1   1 
ATOM   7358 O  OE2   . GLU B 2 378 ? -17.678 -48.130 -3.760  1.00 62.92  ? 378 GLU B OE2   1 
ATOM   7359 N  N     . SER B 2 379 ? -14.190 -42.407 -5.057  1.00 44.96  ? 379 SER B N     1 
ATOM   7360 C  CA    . SER B 2 379 ? -13.065 -41.687 -5.645  1.00 46.72  ? 379 SER B CA    1 
ATOM   7361 C  C     . SER B 2 379 ? -12.542 -40.603 -4.711  1.00 45.58  ? 379 SER B C     1 
ATOM   7362 O  O     . SER B 2 379 ? -11.335 -40.335 -4.691  1.00 43.85  ? 379 SER B O     1 
ATOM   7363 C  CB    . SER B 2 379 ? -13.473 -41.078 -6.987  1.00 44.50  ? 379 SER B CB    1 
ATOM   7364 O  OG    . SER B 2 379 ? -13.894 -42.082 -7.894  1.00 58.80  ? 379 SER B OG    1 
ATOM   7365 N  N     . ILE B 2 380 ? -13.426 -39.973 -3.936  1.00 44.42  ? 380 ILE B N     1 
ATOM   7366 C  CA    . ILE B 2 380 ? -12.988 -38.964 -2.978  1.00 44.92  ? 380 ILE B CA    1 
ATOM   7367 C  C     . ILE B 2 380 ? -12.228 -39.614 -1.828  1.00 49.46  ? 380 ILE B C     1 
ATOM   7368 O  O     . ILE B 2 380 ? -11.227 -39.075 -1.342  1.00 40.20  ? 380 ILE B O     1 
ATOM   7369 C  CB    . ILE B 2 380 ? -14.196 -38.150 -2.477  1.00 44.94  ? 380 ILE B CB    1 
ATOM   7370 C  CG1   . ILE B 2 380 ? -14.840 -37.387 -3.637  1.00 46.89  ? 380 ILE B CG1   1 
ATOM   7371 C  CG2   . ILE B 2 380 ? -13.781 -37.191 -1.371  1.00 45.17  ? 380 ILE B CG2   1 
ATOM   7372 C  CD1   . ILE B 2 380 ? -16.124 -36.680 -3.265  1.00 39.43  ? 380 ILE B CD1   1 
ATOM   7373 N  N     . VAL B 2 381 ? -12.681 -40.787 -1.382  1.00 44.40  ? 381 VAL B N     1 
ATOM   7374 C  CA    . VAL B 2 381 ? -12.006 -41.470 -0.283  1.00 41.82  ? 381 VAL B CA    1 
ATOM   7375 C  C     . VAL B 2 381 ? -10.638 -41.978 -0.724  1.00 50.96  ? 381 VAL B C     1 
ATOM   7376 O  O     . VAL B 2 381 ? -9.649  -41.849 0.007   1.00 47.31  ? 381 VAL B O     1 
ATOM   7377 C  CB    . VAL B 2 381 ? -12.889 -42.610 0.256   1.00 48.97  ? 381 VAL B CB    1 
ATOM   7378 C  CG1   . VAL B 2 381 ? -12.127 -43.437 1.280   1.00 52.33  ? 381 VAL B CG1   1 
ATOM   7379 C  CG2   . VAL B 2 381 ? -14.163 -42.049 0.868   1.00 41.34  ? 381 VAL B CG2   1 
ATOM   7380 N  N     . ILE B 2 382 ? -10.553 -42.545 -1.928  1.00 50.20  ? 382 ILE B N     1 
ATOM   7381 C  CA    . ILE B 2 382 ? -9.317  -43.189 -2.359  1.00 49.73  ? 382 ILE B CA    1 
ATOM   7382 C  C     . ILE B 2 382 ? -8.303  -42.159 -2.843  1.00 46.30  ? 382 ILE B C     1 
ATOM   7383 O  O     . ILE B 2 382 ? -7.123  -42.213 -2.478  1.00 58.49  ? 382 ILE B O     1 
ATOM   7384 C  CB    . ILE B 2 382 ? -9.611  -44.243 -3.442  1.00 51.06  ? 382 ILE B CB    1 
ATOM   7385 C  CG1   . ILE B 2 382 ? -10.537 -45.330 -2.894  1.00 43.24  ? 382 ILE B CG1   1 
ATOM   7386 C  CG2   . ILE B 2 382 ? -8.319  -44.864 -3.942  1.00 44.31  ? 382 ILE B CG2   1 
ATOM   7387 C  CD1   . ILE B 2 382 ? -10.934 -46.370 -3.924  1.00 46.24  ? 382 ILE B CD1   1 
ATOM   7388 N  N     . TRP B 2 383 ? -8.737  -41.206 -3.671  1.00 44.95  ? 383 TRP B N     1 
ATOM   7389 C  CA    . TRP B 2 383 ? -7.820  -40.261 -4.293  1.00 48.04  ? 383 TRP B CA    1 
ATOM   7390 C  C     . TRP B 2 383 ? -8.069  -38.804 -3.931  1.00 54.73  ? 383 TRP B C     1 
ATOM   7391 O  O     . TRP B 2 383 ? -7.226  -37.958 -4.253  1.00 48.59  ? 383 TRP B O     1 
ATOM   7392 C  CB    . TRP B 2 383 ? -7.865  -40.395 -5.824  1.00 46.85  ? 383 TRP B CB    1 
ATOM   7393 C  CG    . TRP B 2 383 ? -7.538  -41.768 -6.321  1.00 54.63  ? 383 TRP B CG    1 
ATOM   7394 C  CD1   . TRP B 2 383 ? -6.300  -42.332 -6.418  1.00 53.96  ? 383 TRP B CD1   1 
ATOM   7395 C  CD2   . TRP B 2 383 ? -8.465  -42.748 -6.802  1.00 52.04  ? 383 TRP B CD2   1 
ATOM   7396 N  NE1   . TRP B 2 383 ? -6.398  -43.606 -6.924  1.00 57.69  ? 383 TRP B NE1   1 
ATOM   7397 C  CE2   . TRP B 2 383 ? -7.717  -43.884 -7.170  1.00 53.74  ? 383 TRP B CE2   1 
ATOM   7398 C  CE3   . TRP B 2 383 ? -9.854  -42.775 -6.957  1.00 44.48  ? 383 TRP B CE3   1 
ATOM   7399 C  CZ2   . TRP B 2 383 ? -8.312  -45.036 -7.680  1.00 55.09  ? 383 TRP B CZ2   1 
ATOM   7400 C  CZ3   . TRP B 2 383 ? -10.443 -43.918 -7.464  1.00 53.01  ? 383 TRP B CZ3   1 
ATOM   7401 C  CH2   . TRP B 2 383 ? -9.673  -45.033 -7.819  1.00 52.56  ? 383 TRP B CH2   1 
ATOM   7402 N  N     . GLY B 2 384 ? -9.184  -38.480 -3.283  1.00 46.18  ? 384 GLY B N     1 
ATOM   7403 C  CA    . GLY B 2 384 ? -9.466  -37.093 -2.964  1.00 43.78  ? 384 GLY B CA    1 
ATOM   7404 C  C     . GLY B 2 384 ? -9.806  -36.238 -4.163  1.00 42.88  ? 384 GLY B C     1 
ATOM   7405 O  O     . GLY B 2 384 ? -9.468  -35.051 -4.183  1.00 49.83  ? 384 GLY B O     1 
ATOM   7406 N  N     . LYS B 2 385 ? -10.462 -36.811 -5.169  1.00 49.66  ? 385 LYS B N     1 
ATOM   7407 C  CA    . LYS B 2 385 ? -10.825 -36.078 -6.371  1.00 51.99  ? 385 LYS B CA    1 
ATOM   7408 C  C     . LYS B 2 385 ? -12.054 -36.722 -6.997  1.00 53.27  ? 385 LYS B C     1 
ATOM   7409 O  O     . LYS B 2 385 ? -12.227 -37.943 -6.947  1.00 50.61  ? 385 LYS B O     1 
ATOM   7410 C  CB    . LYS B 2 385 ? -9.666  -36.036 -7.379  1.00 44.14  ? 385 LYS B CB    1 
ATOM   7411 C  CG    . LYS B 2 385 ? -9.982  -35.273 -8.657  1.00 54.77  ? 385 LYS B CG    1 
ATOM   7412 C  CD    . LYS B 2 385 ? -8.750  -34.604 -9.249  1.00 63.86  ? 385 LYS B CD    1 
ATOM   7413 C  CE    . LYS B 2 385 ? -8.131  -35.434 -10.362 1.00 59.79  ? 385 LYS B CE    1 
ATOM   7414 N  NZ    . LYS B 2 385 ? -7.092  -34.659 -11.097 0.00 57.94  ? 385 LYS B NZ    1 
ATOM   7415 N  N     . THR B 2 386 ? -12.910 -35.884 -7.580  1.00 51.24  ? 386 THR B N     1 
ATOM   7416 C  CA    . THR B 2 386 ? -14.104 -36.373 -8.253  1.00 44.92  ? 386 THR B CA    1 
ATOM   7417 C  C     . THR B 2 386 ? -13.776 -36.770 -9.692  1.00 41.51  ? 386 THR B C     1 
ATOM   7418 O  O     . THR B 2 386 ? -13.018 -36.074 -10.372 1.00 46.63  ? 386 THR B O     1 
ATOM   7419 C  CB    . THR B 2 386 ? -15.201 -35.310 -8.242  1.00 36.27  ? 386 THR B CB    1 
ATOM   7420 O  OG1   . THR B 2 386 ? -16.268 -35.719 -9.104  1.00 72.04  ? 386 THR B OG1   1 
ATOM   7421 C  CG2   . THR B 2 386 ? -14.660 -33.964 -8.717  1.00 51.74  ? 386 THR B CG2   1 
ATOM   7422 N  N     . PRO B 2 387 ? -14.314 -37.884 -10.172 1.00 36.44  ? 387 PRO B N     1 
ATOM   7423 C  CA    . PRO B 2 387 ? -14.052 -38.316 -11.545 1.00 45.38  ? 387 PRO B CA    1 
ATOM   7424 C  C     . PRO B 2 387 ? -15.026 -37.683 -12.535 1.00 32.63  ? 387 PRO B C     1 
ATOM   7425 O  O     . PRO B 2 387 ? -16.049 -37.104 -12.166 1.00 39.97  ? 387 PRO B O     1 
ATOM   7426 C  CB    . PRO B 2 387 ? -14.260 -39.833 -11.466 1.00 35.54  ? 387 PRO B CB    1 
ATOM   7427 C  CG    . PRO B 2 387 ? -15.317 -39.988 -10.429 1.00 34.57  ? 387 PRO B CG    1 
ATOM   7428 C  CD    . PRO B 2 387 ? -15.091 -38.885 -9.418  1.00 39.82  ? 387 PRO B CD    1 
ATOM   7429 N  N     . LYS B 2 388 ? -14.674 -37.803 -13.812 1.00 39.61  ? 388 LYS B N     1 
ATOM   7430 C  CA    . LYS B 2 388 ? -15.520 -37.358 -14.912 1.00 30.54  ? 388 LYS B CA    1 
ATOM   7431 C  C     . LYS B 2 388 ? -16.227 -38.575 -15.497 1.00 38.81  ? 388 LYS B C     1 
ATOM   7432 O  O     . LYS B 2 388 ? -15.572 -39.517 -15.956 1.00 40.79  ? 388 LYS B O     1 
ATOM   7433 C  CB    . LYS B 2 388 ? -14.693 -36.637 -15.977 1.00 33.83  ? 388 LYS B CB    1 
ATOM   7434 C  CG    . LYS B 2 388 ? -15.494 -36.135 -17.166 1.00 49.52  ? 388 LYS B CG    1 
ATOM   7435 C  CD    . LYS B 2 388 ? -14.612 -35.340 -18.119 1.00 62.16  ? 388 LYS B CD    1 
ATOM   7436 C  CE    . LYS B 2 388 ? -15.347 -34.981 -19.402 1.00 71.75  ? 388 LYS B CE    1 
ATOM   7437 N  NZ    . LYS B 2 388 ? -16.559 -34.157 -19.146 1.00 66.51  ? 388 LYS B NZ    1 
ATOM   7438 N  N     . PHE B 2 389 ? -17.556 -38.555 -15.475 1.00 33.74  ? 389 PHE B N     1 
ATOM   7439 C  CA    . PHE B 2 389 ? -18.352 -39.725 -15.818 1.00 34.20  ? 389 PHE B CA    1 
ATOM   7440 C  C     . PHE B 2 389 ? -18.727 -39.741 -17.294 1.00 36.71  ? 389 PHE B C     1 
ATOM   7441 O  O     . PHE B 2 389 ? -19.049 -38.703 -17.880 1.00 40.75  ? 389 PHE B O     1 
ATOM   7442 C  CB    . PHE B 2 389 ? -19.626 -39.773 -14.973 1.00 30.62  ? 389 PHE B CB    1 
ATOM   7443 C  CG    . PHE B 2 389 ? -19.396 -40.191 -13.552 1.00 39.15  ? 389 PHE B CG    1 
ATOM   7444 C  CD1   . PHE B 2 389 ? -19.039 -39.259 -12.592 1.00 33.30  ? 389 PHE B CD1   1 
ATOM   7445 C  CD2   . PHE B 2 389 ? -19.544 -41.515 -13.172 1.00 29.23  ? 389 PHE B CD2   1 
ATOM   7446 C  CE1   . PHE B 2 389 ? -18.830 -39.640 -11.283 1.00 41.16  ? 389 PHE B CE1   1 
ATOM   7447 C  CE2   . PHE B 2 389 ? -19.337 -41.903 -11.864 1.00 33.87  ? 389 PHE B CE2   1 
ATOM   7448 C  CZ    . PHE B 2 389 ? -18.980 -40.964 -10.917 1.00 39.99  ? 389 PHE B CZ    1 
ATOM   7449 N  N     . LYS B 2 390 ? -18.687 -40.932 -17.885 1.00 36.75  ? 390 LYS B N     1 
ATOM   7450 C  CA    . LYS B 2 390 ? -19.277 -41.192 -19.195 1.00 39.21  ? 390 LYS B CA    1 
ATOM   7451 C  C     . LYS B 2 390 ? -20.590 -41.923 -18.941 1.00 39.83  ? 390 LYS B C     1 
ATOM   7452 O  O     . LYS B 2 390 ? -20.605 -43.134 -18.707 1.00 37.86  ? 390 LYS B O     1 
ATOM   7453 C  CB    . LYS B 2 390 ? -18.332 -42.002 -20.076 1.00 33.34  ? 390 LYS B CB    1 
ATOM   7454 C  CG    . LYS B 2 390 ? -17.058 -41.267 -20.457 1.00 36.65  ? 390 LYS B CG    1 
ATOM   7455 C  CD    . LYS B 2 390 ? -16.203 -42.088 -21.409 1.00 41.14  ? 390 LYS B CD    1 
ATOM   7456 C  CE    . LYS B 2 390 ? -14.962 -41.317 -21.835 1.00 47.57  ? 390 LYS B CE    1 
ATOM   7457 N  NZ    . LYS B 2 390 ? -14.126 -42.089 -22.795 1.00 54.94  ? 390 LYS B NZ    1 
ATOM   7458 N  N     . LEU B 2 391 ? -21.693 -41.181 -18.974 1.00 35.23  ? 391 LEU B N     1 
ATOM   7459 C  CA    . LEU B 2 391 ? -22.984 -41.727 -18.569 1.00 36.69  ? 391 LEU B CA    1 
ATOM   7460 C  C     . LEU B 2 391 ? -23.689 -42.369 -19.758 1.00 39.33  ? 391 LEU B C     1 
ATOM   7461 O  O     . LEU B 2 391 ? -23.822 -41.732 -20.810 1.00 37.08  ? 391 LEU B O     1 
ATOM   7462 C  CB    . LEU B 2 391 ? -23.867 -40.638 -17.977 1.00 34.39  ? 391 LEU B CB    1 
ATOM   7463 C  CG    . LEU B 2 391 ? -23.321 -39.952 -16.723 1.00 32.60  ? 391 LEU B CG    1 
ATOM   7464 C  CD1   . LEU B 2 391 ? -24.291 -38.893 -16.221 1.00 30.55  ? 391 LEU B CD1   1 
ATOM   7465 C  CD2   . LEU B 2 391 ? -23.033 -40.978 -15.640 1.00 34.19  ? 391 LEU B CD2   1 
ATOM   7466 N  N     . PRO B 2 392 ? -24.170 -43.676 -19.623 1.00 35.64  ? 392 PRO B N     1 
ATOM   7467 C  CA    . PRO B 2 392 ? -24.932 -44.338 -20.702 1.00 40.73  ? 392 PRO B CA    1 
ATOM   7468 C  C     . PRO B 2 392 ? -26.410 -43.966 -20.664 1.00 40.87  ? 392 PRO B C     1 
ATOM   7469 O  O     . PRO B 2 392 ? -27.290 -44.759 -20.311 1.00 40.64  ? 392 PRO B O     1 
ATOM   7470 C  CB    . PRO B 2 392 ? -24.687 -45.821 -20.408 1.00 37.97  ? 392 PRO B CB    1 
ATOM   7471 C  CG    . PRO B 2 392 ? -24.591 -45.874 -18.915 1.00 35.34  ? 392 PRO B CG    1 
ATOM   7472 C  CD    . PRO B 2 392 ? -23.922 -44.583 -18.488 1.00 35.85  ? 392 PRO B CD    1 
ATOM   7473 N  N     . ILE B 2 393 ? -26.703 -42.721 -21.038 1.00 46.60  ? 393 ILE B N     1 
ATOM   7474 C  CA    . ILE B 2 393 ? -28.062 -42.198 -20.969 1.00 33.70  ? 393 ILE B CA    1 
ATOM   7475 C  C     . ILE B 2 393 ? -28.153 -40.996 -21.895 1.00 40.34  ? 393 ILE B C     1 
ATOM   7476 O  O     . ILE B 2 393 ? -27.163 -40.297 -22.127 1.00 43.06  ? 393 ILE B O     1 
ATOM   7477 C  CB    . ILE B 2 393 ? -28.445 -41.837 -19.510 1.00 39.74  ? 393 ILE B CB    1 
ATOM   7478 C  CG1   . ILE B 2 393 ? -29.916 -41.427 -19.413 1.00 36.49  ? 393 ILE B CG1   1 
ATOM   7479 C  CG2   . ILE B 2 393 ? -27.539 -40.738 -18.969 1.00 36.77  ? 393 ILE B CG2   1 
ATOM   7480 C  CD1   . ILE B 2 393 ? -30.376 -41.133 -18.000 1.00 34.15  ? 393 ILE B CD1   1 
ATOM   7481 N  N     . GLN B 2 394 ? -29.345 -40.770 -22.444 1.00 39.68  ? 394 GLN B N     1 
ATOM   7482 C  CA    . GLN B 2 394 ? -29.583 -39.578 -23.245 1.00 38.29  ? 394 GLN B CA    1 
ATOM   7483 C  C     . GLN B 2 394 ? -29.426 -38.330 -22.384 1.00 41.22  ? 394 GLN B C     1 
ATOM   7484 O  O     . GLN B 2 394 ? -29.735 -38.329 -21.189 1.00 42.05  ? 394 GLN B O     1 
ATOM   7485 C  CB    . GLN B 2 394 ? -30.982 -39.622 -23.862 1.00 46.32  ? 394 GLN B CB    1 
ATOM   7486 C  CG    . GLN B 2 394 ? -31.274 -38.497 -24.844 1.00 55.49  ? 394 GLN B CG    1 
ATOM   7487 C  CD    . GLN B 2 394 ? -32.712 -38.499 -25.324 1.00 70.63  ? 394 GLN B CD    1 
ATOM   7488 O  OE1   . GLN B 2 394 ? -33.642 -38.334 -24.534 1.00 65.81  ? 394 GLN B OE1   1 
ATOM   7489 N  NE2   . GLN B 2 394 ? -32.902 -38.694 -26.625 1.00 65.38  ? 394 GLN B NE2   1 
ATOM   7490 N  N     . LYS B 2 395 ? -28.929 -37.258 -23.006 1.00 45.73  ? 395 LYS B N     1 
ATOM   7491 C  CA    . LYS B 2 395 ? -28.708 -36.010 -22.281 1.00 39.62  ? 395 LYS B CA    1 
ATOM   7492 C  C     . LYS B 2 395 ? -30.007 -35.479 -21.689 1.00 43.32  ? 395 LYS B C     1 
ATOM   7493 O  O     . LYS B 2 395 ? -30.051 -35.072 -20.522 1.00 44.43  ? 395 LYS B O     1 
ATOM   7494 C  CB    . LYS B 2 395 ? -28.074 -34.974 -23.211 1.00 46.17  ? 395 LYS B CB    1 
ATOM   7495 C  CG    . LYS B 2 395 ? -27.879 -33.607 -22.582 1.00 48.15  ? 395 LYS B CG    1 
ATOM   7496 C  CD    . LYS B 2 395 ? -27.064 -32.701 -23.488 1.00 56.15  ? 395 LYS B CD    1 
ATOM   7497 C  CE    . LYS B 2 395 ? -26.690 -31.409 -22.781 1.00 64.01  ? 395 LYS B CE    1 
ATOM   7498 N  NZ    . LYS B 2 395 ? -27.882 -30.584 -22.449 1.00 62.59  ? 395 LYS B NZ    1 
ATOM   7499 N  N     . GLU B 2 396 ? -31.083 -35.486 -22.479 1.00 52.33  ? 396 GLU B N     1 
ATOM   7500 C  CA    . GLU B 2 396 ? -32.353 -34.946 -22.006 1.00 54.73  ? 396 GLU B CA    1 
ATOM   7501 C  C     . GLU B 2 396 ? -32.938 -35.800 -20.888 1.00 51.54  ? 396 GLU B C     1 
ATOM   7502 O  O     . GLU B 2 396 ? -33.528 -35.271 -19.939 1.00 52.23  ? 396 GLU B O     1 
ATOM   7503 C  CB    . GLU B 2 396 ? -33.339 -34.837 -23.169 1.00 66.54  ? 396 GLU B CB    1 
ATOM   7504 C  CG    . GLU B 2 396 ? -32.689 -34.555 -24.518 1.00 61.41  ? 396 GLU B CG    1 
ATOM   7505 C  CD    . GLU B 2 396 ? -32.061 -33.176 -24.604 1.00 66.70  ? 396 GLU B CD    1 
ATOM   7506 O  OE1   . GLU B 2 396 ? -32.394 -32.307 -23.769 1.00 78.48  ? 396 GLU B OE1   1 
ATOM   7507 O  OE2   . GLU B 2 396 ? -31.232 -32.960 -25.513 1.00 75.13  ? 396 GLU B OE2   1 
ATOM   7508 N  N     . THR B 2 397 ? -32.787 -37.124 -20.984 1.00 50.39  ? 397 THR B N     1 
ATOM   7509 C  CA    . THR B 2 397 ? -33.315 -38.009 -19.951 1.00 42.22  ? 397 THR B CA    1 
ATOM   7510 C  C     . THR B 2 397 ? -32.645 -37.748 -18.608 1.00 49.25  ? 397 THR B C     1 
ATOM   7511 O  O     . THR B 2 397 ? -33.308 -37.741 -17.564 1.00 47.45  ? 397 THR B O     1 
ATOM   7512 C  CB    . THR B 2 397 ? -33.123 -39.469 -20.361 1.00 57.47  ? 397 THR B CB    1 
ATOM   7513 O  OG1   . THR B 2 397 ? -33.613 -39.666 -21.693 1.00 56.75  ? 397 THR B OG1   1 
ATOM   7514 C  CG2   . THR B 2 397 ? -33.871 -40.390 -19.410 1.00 51.31  ? 397 THR B CG2   1 
ATOM   7515 N  N     . TRP B 2 398 ? -31.330 -37.527 -18.617 1.00 50.36  ? 398 TRP B N     1 
ATOM   7516 C  CA    . TRP B 2 398 ? -30.595 -37.338 -17.372 1.00 42.59  ? 398 TRP B CA    1 
ATOM   7517 C  C     . TRP B 2 398 ? -30.925 -35.995 -16.731 1.00 43.20  ? 398 TRP B C     1 
ATOM   7518 O  O     . TRP B 2 398 ? -31.263 -35.930 -15.543 1.00 53.31  ? 398 TRP B O     1 
ATOM   7519 C  CB    . TRP B 2 398 ? -29.094 -37.461 -17.635 1.00 38.59  ? 398 TRP B CB    1 
ATOM   7520 C  CG    . TRP B 2 398 ? -28.237 -37.094 -16.463 1.00 37.23  ? 398 TRP B CG    1 
ATOM   7521 C  CD1   . TRP B 2 398 ? -27.688 -35.872 -16.201 1.00 40.02  ? 398 TRP B CD1   1 
ATOM   7522 C  CD2   . TRP B 2 398 ? -27.826 -37.956 -15.396 1.00 39.29  ? 398 TRP B CD2   1 
ATOM   7523 N  NE1   . TRP B 2 398 ? -26.963 -35.920 -15.036 1.00 45.12  ? 398 TRP B NE1   1 
ATOM   7524 C  CE2   . TRP B 2 398 ? -27.031 -37.188 -14.522 1.00 35.40  ? 398 TRP B CE2   1 
ATOM   7525 C  CE3   . TRP B 2 398 ? -28.052 -39.303 -15.095 1.00 41.29  ? 398 TRP B CE3   1 
ATOM   7526 C  CZ2   . TRP B 2 398 ? -26.462 -37.722 -13.366 1.00 32.70  ? 398 TRP B CZ2   1 
ATOM   7527 C  CZ3   . TRP B 2 398 ? -27.487 -39.830 -13.947 1.00 35.81  ? 398 TRP B CZ3   1 
ATOM   7528 C  CH2   . TRP B 2 398 ? -26.700 -39.041 -13.098 1.00 38.69  ? 398 TRP B CH2   1 
ATOM   7529 N  N     . GLU B 2 399 ? -30.834 -34.909 -17.503 1.00 46.47  ? 399 GLU B N     1 
ATOM   7530 C  CA    . GLU B 2 399 ? -31.050 -33.577 -16.948 1.00 54.55  ? 399 GLU B CA    1 
ATOM   7531 C  C     . GLU B 2 399 ? -32.469 -33.380 -16.430 1.00 48.95  ? 399 GLU B C     1 
ATOM   7532 O  O     . GLU B 2 399 ? -32.707 -32.454 -15.646 1.00 49.79  ? 399 GLU B O     1 
ATOM   7533 C  CB    . GLU B 2 399 ? -30.735 -32.511 -18.000 1.00 55.36  ? 399 GLU B CB    1 
ATOM   7534 C  CG    . GLU B 2 399 ? -29.345 -32.621 -18.605 1.00 53.23  ? 399 GLU B CG    1 
ATOM   7535 C  CD    . GLU B 2 399 ? -29.056 -31.522 -19.611 1.00 68.69  ? 399 GLU B CD    1 
ATOM   7536 O  OE1   . GLU B 2 399 ? -28.093 -30.756 -19.399 1.00 66.29  ? 399 GLU B OE1   1 
ATOM   7537 O  OE2   . GLU B 2 399 ? -29.798 -31.419 -20.612 1.00 66.66  ? 399 GLU B OE2   1 
ATOM   7538 N  N     . THR B 2 400 ? -33.413 -34.229 -16.840 1.00 52.64  ? 400 THR B N     1 
ATOM   7539 C  CA    . THR B 2 400 ? -34.804 -34.038 -16.444 1.00 48.57  ? 400 THR B CA    1 
ATOM   7540 C  C     . THR B 2 400 ? -35.061 -34.535 -15.024 1.00 57.01  ? 400 THR B C     1 
ATOM   7541 O  O     . THR B 2 400 ? -35.856 -33.936 -14.292 1.00 58.29  ? 400 THR B O     1 
ATOM   7542 C  CB    . THR B 2 400 ? -35.733 -34.745 -17.435 1.00 55.48  ? 400 THR B CB    1 
ATOM   7543 O  OG1   . THR B 2 400 ? -35.468 -34.269 -18.760 1.00 61.46  ? 400 THR B OG1   1 
ATOM   7544 C  CG2   . THR B 2 400 ? -37.194 -34.477 -17.097 1.00 49.35  ? 400 THR B CG2   1 
ATOM   7545 N  N     . TRP B 2 401 ? -34.392 -35.610 -14.605 1.00 42.78  ? 401 TRP B N     1 
ATOM   7546 C  CA    . TRP B 2 401 ? -34.718 -36.261 -13.343 1.00 40.56  ? 401 TRP B CA    1 
ATOM   7547 C  C     . TRP B 2 401 ? -33.556 -36.430 -12.372 1.00 39.87  ? 401 TRP B C     1 
ATOM   7548 O  O     . TRP B 2 401 ? -33.789 -36.881 -11.245 1.00 43.42  ? 401 TRP B O     1 
ATOM   7549 C  CB    . TRP B 2 401 ? -35.330 -37.647 -13.603 1.00 38.66  ? 401 TRP B CB    1 
ATOM   7550 C  CG    . TRP B 2 401 ? -36.729 -37.604 -14.129 1.00 39.17  ? 401 TRP B CG    1 
ATOM   7551 C  CD1   . TRP B 2 401 ? -37.856 -37.270 -13.434 1.00 39.70  ? 401 TRP B CD1   1 
ATOM   7552 C  CD2   . TRP B 2 401 ? -37.158 -37.926 -15.457 1.00 32.42  ? 401 TRP B CD2   1 
ATOM   7553 N  NE1   . TRP B 2 401 ? -38.958 -37.356 -14.250 1.00 35.29  ? 401 TRP B NE1   1 
ATOM   7554 C  CE2   . TRP B 2 401 ? -38.556 -37.757 -15.497 1.00 38.47  ? 401 TRP B CE2   1 
ATOM   7555 C  CE3   . TRP B 2 401 ? -36.494 -38.339 -16.616 1.00 45.22  ? 401 TRP B CE3   1 
ATOM   7556 C  CZ2   . TRP B 2 401 ? -39.303 -37.986 -16.650 1.00 59.75  ? 401 TRP B CZ2   1 
ATOM   7557 C  CZ3   . TRP B 2 401 ? -37.238 -38.566 -17.761 1.00 61.70  ? 401 TRP B CZ3   1 
ATOM   7558 C  CH2   . TRP B 2 401 ? -38.628 -38.388 -17.770 1.00 62.96  ? 401 TRP B CH2   1 
ATOM   7559 N  N     . TRP B 2 402 ? -32.322 -36.085 -12.754 1.00 42.26  ? 402 TRP B N     1 
ATOM   7560 C  CA    . TRP B 2 402 ? -31.189 -36.426 -11.895 1.00 43.59  ? 402 TRP B CA    1 
ATOM   7561 C  C     . TRP B 2 402 ? -31.190 -35.628 -10.596 1.00 40.36  ? 402 TRP B C     1 
ATOM   7562 O  O     . TRP B 2 402 ? -30.762 -36.146 -9.558  1.00 44.34  ? 402 TRP B O     1 
ATOM   7563 C  CB    . TRP B 2 402 ? -29.867 -36.235 -12.643 1.00 43.60  ? 402 TRP B CB    1 
ATOM   7564 C  CG    . TRP B 2 402 ? -29.381 -34.820 -12.725 1.00 45.12  ? 402 TRP B CG    1 
ATOM   7565 C  CD1   . TRP B 2 402 ? -29.659 -33.913 -13.703 1.00 43.77  ? 402 TRP B CD1   1 
ATOM   7566 C  CD2   . TRP B 2 402 ? -28.509 -34.158 -11.799 1.00 39.24  ? 402 TRP B CD2   1 
ATOM   7567 N  NE1   . TRP B 2 402 ? -29.023 -32.723 -13.441 1.00 43.43  ? 402 TRP B NE1   1 
ATOM   7568 C  CE2   . TRP B 2 402 ? -28.310 -32.848 -12.278 1.00 38.80  ? 402 TRP B CE2   1 
ATOM   7569 C  CE3   . TRP B 2 402 ? -27.884 -34.544 -10.610 1.00 41.19  ? 402 TRP B CE3   1 
ATOM   7570 C  CZ2   . TRP B 2 402 ? -27.511 -31.921 -11.608 1.00 37.26  ? 402 TRP B CZ2   1 
ATOM   7571 C  CZ3   . TRP B 2 402 ? -27.091 -33.624 -9.947  1.00 40.67  ? 402 TRP B CZ3   1 
ATOM   7572 C  CH2   . TRP B 2 402 ? -26.912 -32.328 -10.448 1.00 36.23  ? 402 TRP B CH2   1 
ATOM   7573 N  N     . THR B 2 403 ? -31.670 -34.381 -10.619 1.00 35.58  ? 403 THR B N     1 
ATOM   7574 C  CA    . THR B 2 403 ? -31.734 -33.600 -9.388  1.00 41.23  ? 403 THR B CA    1 
ATOM   7575 C  C     . THR B 2 403 ? -32.770 -34.141 -8.413  1.00 46.93  ? 403 THR B C     1 
ATOM   7576 O  O     . THR B 2 403 ? -32.718 -33.805 -7.224  1.00 43.13  ? 403 THR B O     1 
ATOM   7577 C  CB    . THR B 2 403 ? -32.044 -32.133 -9.695  1.00 43.71  ? 403 THR B CB    1 
ATOM   7578 O  OG1   . THR B 2 403 ? -33.275 -32.046 -10.423 1.00 40.61  ? 403 THR B OG1   1 
ATOM   7579 C  CG2   . THR B 2 403 ? -30.927 -31.508 -10.512 1.00 31.17  ? 403 THR B CG2   1 
ATOM   7580 N  N     . GLU B 2 404 ? -33.705 -34.966 -8.883  1.00 45.40  ? 404 GLU B N     1 
ATOM   7581 C  CA    . GLU B 2 404 ? -34.736 -35.526 -8.021  1.00 44.94  ? 404 GLU B CA    1 
ATOM   7582 C  C     . GLU B 2 404 ? -34.220 -36.654 -7.137  1.00 41.36  ? 404 GLU B C     1 
ATOM   7583 O  O     . GLU B 2 404 ? -34.936 -37.082 -6.225  1.00 47.83  ? 404 GLU B O     1 
ATOM   7584 C  CB    . GLU B 2 404 ? -35.910 -36.029 -8.869  1.00 48.21  ? 404 GLU B CB    1 
ATOM   7585 C  CG    . GLU B 2 404 ? -37.259 -36.005 -8.160  1.00 54.96  ? 404 GLU B CG    1 
ATOM   7586 C  CD    . GLU B 2 404 ? -37.945 -34.651 -8.242  1.00 55.46  ? 404 GLU B CD    1 
ATOM   7587 O  OE1   . GLU B 2 404 ? -39.189 -34.608 -8.134  1.00 60.18  ? 404 GLU B OE1   1 
ATOM   7588 O  OE2   . GLU B 2 404 ? -37.247 -33.631 -8.423  1.00 46.53  ? 404 GLU B OE2   1 
ATOM   7589 N  N     . TYR B 2 405 ? -33.001 -37.143 -7.378  1.00 49.49  ? 405 TYR B N     1 
ATOM   7590 C  CA    . TYR B 2 405 ? -32.435 -38.231 -6.592  1.00 46.97  ? 405 TYR B CA    1 
ATOM   7591 C  C     . TYR B 2 405 ? -31.064 -37.888 -6.024  1.00 48.15  ? 405 TYR B C     1 
ATOM   7592 O  O     . TYR B 2 405 ? -30.422 -38.758 -5.423  1.00 54.81  ? 405 TYR B O     1 
ATOM   7593 C  CB    . TYR B 2 405 ? -32.342 -39.508 -7.434  1.00 44.15  ? 405 TYR B CB    1 
ATOM   7594 C  CG    . TYR B 2 405 ? -33.558 -39.752 -8.296  1.00 46.34  ? 405 TYR B CG    1 
ATOM   7595 C  CD1   . TYR B 2 405 ? -34.770 -40.126 -7.729  1.00 43.16  ? 405 TYR B CD1   1 
ATOM   7596 C  CD2   . TYR B 2 405 ? -33.495 -39.608 -9.676  1.00 40.86  ? 405 TYR B CD2   1 
ATOM   7597 C  CE1   . TYR B 2 405 ? -35.886 -40.348 -8.514  1.00 47.97  ? 405 TYR B CE1   1 
ATOM   7598 C  CE2   . TYR B 2 405 ? -34.605 -39.829 -10.469 1.00 40.50  ? 405 TYR B CE2   1 
ATOM   7599 C  CZ    . TYR B 2 405 ? -35.797 -40.198 -9.882  1.00 43.74  ? 405 TYR B CZ    1 
ATOM   7600 O  OH    . TYR B 2 405 ? -36.904 -40.418 -10.666 1.00 46.23  ? 405 TYR B OH    1 
ATOM   7601 N  N     . TRP B 2 406 ? -30.600 -36.654 -6.195  1.00 41.25  ? 406 TRP B N     1 
ATOM   7602 C  CA    . TRP B 2 406 ? -29.283 -36.265 -5.715  1.00 44.05  ? 406 TRP B CA    1 
ATOM   7603 C  C     . TRP B 2 406 ? -29.323 -35.977 -4.219  1.00 43.03  ? 406 TRP B C     1 
ATOM   7604 O  O     . TRP B 2 406 ? -30.256 -35.345 -3.717  1.00 41.54  ? 406 TRP B O     1 
ATOM   7605 C  CB    . TRP B 2 406 ? -28.782 -35.036 -6.473  1.00 43.43  ? 406 TRP B CB    1 
ATOM   7606 C  CG    . TRP B 2 406 ? -27.295 -34.887 -6.442  1.00 40.93  ? 406 TRP B CG    1 
ATOM   7607 C  CD1   . TRP B 2 406 ? -26.569 -34.033 -5.665  1.00 43.21  ? 406 TRP B CD1   1 
ATOM   7608 C  CD2   . TRP B 2 406 ? -26.348 -35.625 -7.221  1.00 38.60  ? 406 TRP B CD2   1 
ATOM   7609 N  NE1   . TRP B 2 406 ? -25.227 -34.191 -5.915  1.00 42.44  ? 406 TRP B NE1   1 
ATOM   7610 C  CE2   . TRP B 2 406 ? -25.066 -35.163 -6.867  1.00 37.63  ? 406 TRP B CE2   1 
ATOM   7611 C  CE3   . TRP B 2 406 ? -26.460 -36.631 -8.185  1.00 40.03  ? 406 TRP B CE3   1 
ATOM   7612 C  CZ2   . TRP B 2 406 ? -23.905 -35.674 -7.442  1.00 38.03  ? 406 TRP B CZ2   1 
ATOM   7613 C  CZ3   . TRP B 2 406 ? -25.307 -37.135 -8.754  1.00 29.95  ? 406 TRP B CZ3   1 
ATOM   7614 C  CH2   . TRP B 2 406 ? -24.047 -36.656 -8.382  1.00 38.78  ? 406 TRP B CH2   1 
ATOM   7615 N  N     . GLN B 2 407 ? -28.300 -36.453 -3.506  1.00 36.74  ? 407 GLN B N     1 
ATOM   7616 C  CA    . GLN B 2 407 ? -28.204 -36.250 -2.067  1.00 38.43  ? 407 GLN B CA    1 
ATOM   7617 C  C     . GLN B 2 407 ? -26.859 -35.710 -1.604  1.00 43.09  ? 407 GLN B C     1 
ATOM   7618 O  O     . GLN B 2 407 ? -26.737 -35.351 -0.428  1.00 53.63  ? 407 GLN B O     1 
ATOM   7619 C  CB    . GLN B 2 407 ? -28.492 -37.561 -1.317  1.00 41.69  ? 407 GLN B CB    1 
ATOM   7620 C  CG    . GLN B 2 407 ? -29.952 -37.974 -1.341  1.00 50.45  ? 407 GLN B CG    1 
ATOM   7621 C  CD    . GLN B 2 407 ? -30.834 -37.023 -0.555  1.00 64.97  ? 407 GLN B CD    1 
ATOM   7622 O  OE1   . GLN B 2 407 ? -30.544 -36.702 0.598   1.00 65.79  ? 407 GLN B OE1   1 
ATOM   7623 N  NE2   . GLN B 2 407 ? -31.912 -36.560 -1.178  1.00 57.95  ? 407 GLN B NE2   1 
ATOM   7624 N  N     . ALA B 2 408 ? -25.858 -35.640 -2.474  1.00 38.47  ? 408 ALA B N     1 
ATOM   7625 C  CA    . ALA B 2 408 ? -24.548 -35.133 -2.101  1.00 40.00  ? 408 ALA B CA    1 
ATOM   7626 C  C     . ALA B 2 408 ? -24.495 -33.616 -2.247  1.00 40.27  ? 408 ALA B C     1 
ATOM   7627 O  O     . ALA B 2 408 ? -25.340 -32.996 -2.898  1.00 37.12  ? 408 ALA B O     1 
ATOM   7628 C  CB    . ALA B 2 408 ? -23.456 -35.780 -2.954  1.00 35.38  ? 408 ALA B CB    1 
ATOM   7629 N  N     . THR B 2 409 ? -23.478 -33.019 -1.626  1.00 43.30  ? 409 THR B N     1 
ATOM   7630 C  CA    . THR B 2 409 ? -23.265 -31.581 -1.720  1.00 40.42  ? 409 THR B CA    1 
ATOM   7631 C  C     . THR B 2 409 ? -22.408 -31.186 -2.913  1.00 40.35  ? 409 THR B C     1 
ATOM   7632 O  O     . THR B 2 409 ? -22.434 -30.017 -3.318  1.00 50.88  ? 409 THR B O     1 
ATOM   7633 C  CB    . THR B 2 409 ? -22.615 -31.053 -0.437  1.00 41.12  ? 409 THR B CB    1 
ATOM   7634 O  OG1   . THR B 2 409 ? -21.312 -31.629 -0.288  1.00 46.88  ? 409 THR B OG1   1 
ATOM   7635 C  CG2   . THR B 2 409 ? -23.463 -31.412 0.776   1.00 38.02  ? 409 THR B CG2   1 
ATOM   7636 N  N     . TRP B 2 410 ? -21.653 -32.122 -3.478  1.00 39.39  ? 410 TRP B N     1 
ATOM   7637 C  CA    . TRP B 2 410 ? -20.849 -31.886 -4.666  1.00 38.79  ? 410 TRP B CA    1 
ATOM   7638 C  C     . TRP B 2 410 ? -21.553 -32.432 -5.905  1.00 42.24  ? 410 TRP B C     1 
ATOM   7639 O  O     . TRP B 2 410 ? -22.511 -33.206 -5.823  1.00 32.21  ? 410 TRP B O     1 
ATOM   7640 C  CB    . TRP B 2 410 ? -19.464 -32.526 -4.521  1.00 36.26  ? 410 TRP B CB    1 
ATOM   7641 C  CG    . TRP B 2 410 ? -19.466 -33.798 -3.724  1.00 43.90  ? 410 TRP B CG    1 
ATOM   7642 C  CD1   . TRP B 2 410 ? -18.991 -33.969 -2.456  1.00 39.79  ? 410 TRP B CD1   1 
ATOM   7643 C  CD2   . TRP B 2 410 ? -19.972 -35.075 -4.137  1.00 35.74  ? 410 TRP B CD2   1 
ATOM   7644 N  NE1   . TRP B 2 410 ? -19.164 -35.271 -2.057  1.00 39.79  ? 410 TRP B NE1   1 
ATOM   7645 C  CE2   . TRP B 2 410 ? -19.765 -35.971 -3.069  1.00 45.82  ? 410 TRP B CE2   1 
ATOM   7646 C  CE3   . TRP B 2 410 ? -20.576 -35.548 -5.306  1.00 33.22  ? 410 TRP B CE3   1 
ATOM   7647 C  CZ2   . TRP B 2 410 ? -20.142 -37.311 -3.134  1.00 33.89  ? 410 TRP B CZ2   1 
ATOM   7648 C  CZ3   . TRP B 2 410 ? -20.952 -36.880 -5.367  1.00 41.99  ? 410 TRP B CZ3   1 
ATOM   7649 C  CH2   . TRP B 2 410 ? -20.732 -37.746 -4.288  1.00 34.03  ? 410 TRP B CH2   1 
ATOM   7650 N  N     . ILE B 2 411 ? -21.071 -31.998 -7.071  1.00 39.92  ? 411 ILE B N     1 
ATOM   7651 C  CA    . ILE B 2 411 ? -21.607 -32.427 -8.353  1.00 35.84  ? 411 ILE B CA    1 
ATOM   7652 C  C     . ILE B 2 411 ? -20.434 -32.743 -9.271  1.00 37.50  ? 411 ILE B C     1 
ATOM   7653 O  O     . ILE B 2 411 ? -19.655 -31.847 -9.608  1.00 34.56  ? 411 ILE B O     1 
ATOM   7654 C  CB    . ILE B 2 411 ? -22.517 -31.367 -9.001  1.00 38.49  ? 411 ILE B CB    1 
ATOM   7655 C  CG1   . ILE B 2 411 ? -23.664 -30.999 -8.061  1.00 34.10  ? 411 ILE B CG1   1 
ATOM   7656 C  CG2   . ILE B 2 411 ? -23.056 -31.876 -10.328 1.00 42.26  ? 411 ILE B CG2   1 
ATOM   7657 C  CD1   . ILE B 2 411 ? -24.468 -29.797 -8.509  1.00 34.27  ? 411 ILE B CD1   1 
ATOM   7658 N  N     . PRO B 2 412 ? -20.265 -33.984 -9.711  1.00 36.60  ? 412 PRO B N     1 
ATOM   7659 C  CA    . PRO B 2 412 ? -19.165 -34.306 -10.619 1.00 34.19  ? 412 PRO B CA    1 
ATOM   7660 C  C     . PRO B 2 412 ? -19.464 -33.860 -12.041 1.00 40.24  ? 412 PRO B C     1 
ATOM   7661 O  O     . PRO B 2 412 ? -20.608 -33.598 -12.417 1.00 39.01  ? 412 PRO B O     1 
ATOM   7662 C  CB    . PRO B 2 412 ? -19.080 -35.834 -10.534 1.00 33.26  ? 412 PRO B CB    1 
ATOM   7663 C  CG    . PRO B 2 412 ? -20.485 -36.248 -10.255 1.00 37.77  ? 412 PRO B CG    1 
ATOM   7664 C  CD    . PRO B 2 412 ? -21.054 -35.174 -9.362  1.00 30.11  ? 412 PRO B CD    1 
ATOM   7665 N  N     . GLU B 2 413 ? -18.402 -33.773 -12.833 1.00 38.37  ? 413 GLU B N     1 
ATOM   7666 C  CA    . GLU B 2 413 ? -18.554 -33.507 -14.253 1.00 37.06  ? 413 GLU B CA    1 
ATOM   7667 C  C     . GLU B 2 413 ? -18.891 -34.798 -14.986 1.00 43.40  ? 413 GLU B C     1 
ATOM   7668 O  O     . GLU B 2 413 ? -18.463 -35.889 -14.595 1.00 41.10  ? 413 GLU B O     1 
ATOM   7669 C  CB    . GLU B 2 413 ? -17.282 -32.887 -14.828 1.00 38.44  ? 413 GLU B CB    1 
ATOM   7670 C  CG    . GLU B 2 413 ? -16.778 -31.688 -14.046 1.00 53.34  ? 413 GLU B CG    1 
ATOM   7671 C  CD    . GLU B 2 413 ? -15.859 -30.804 -14.863 1.00 73.60  ? 413 GLU B CD    1 
ATOM   7672 O  OE1   . GLU B 2 413 ? -16.182 -30.540 -16.041 1.00 80.71  ? 413 GLU B OE1   1 
ATOM   7673 O  OE2   . GLU B 2 413 ? -14.811 -30.379 -14.331 1.00 73.33  ? 413 GLU B OE2   1 
ATOM   7674 N  N     . TRP B 2 414 ? -19.674 -34.671 -16.053 1.00 36.74  ? 414 TRP B N     1 
ATOM   7675 C  CA    . TRP B 2 414 ? -20.118 -35.845 -16.785 1.00 38.31  ? 414 TRP B CA    1 
ATOM   7676 C  C     . TRP B 2 414 ? -20.289 -35.510 -18.258 1.00 39.78  ? 414 TRP B C     1 
ATOM   7677 O  O     . TRP B 2 414 ? -20.439 -34.348 -18.644 1.00 33.38  ? 414 TRP B O     1 
ATOM   7678 C  CB    . TRP B 2 414 ? -21.431 -36.407 -16.215 1.00 35.21  ? 414 TRP B CB    1 
ATOM   7679 C  CG    . TRP B 2 414 ? -22.535 -35.394 -16.073 1.00 34.75  ? 414 TRP B CG    1 
ATOM   7680 C  CD1   . TRP B 2 414 ? -23.091 -34.637 -17.065 1.00 28.94  ? 414 TRP B CD1   1 
ATOM   7681 C  CD2   . TRP B 2 414 ? -23.234 -35.052 -14.870 1.00 32.46  ? 414 TRP B CD2   1 
ATOM   7682 N  NE1   . TRP B 2 414 ? -24.082 -33.836 -16.552 1.00 35.07  ? 414 TRP B NE1   1 
ATOM   7683 C  CE2   . TRP B 2 414 ? -24.190 -34.072 -15.206 1.00 38.09  ? 414 TRP B CE2   1 
ATOM   7684 C  CE3   . TRP B 2 414 ? -23.141 -35.475 -13.540 1.00 30.44  ? 414 TRP B CE3   1 
ATOM   7685 C  CZ2   . TRP B 2 414 ? -25.045 -33.508 -14.261 1.00 32.90  ? 414 TRP B CZ2   1 
ATOM   7686 C  CZ3   . TRP B 2 414 ? -23.991 -34.917 -12.604 1.00 27.49  ? 414 TRP B CZ3   1 
ATOM   7687 C  CH2   . TRP B 2 414 ? -24.931 -33.944 -12.969 1.00 42.44  ? 414 TRP B CH2   1 
ATOM   7688 N  N     . GLU B 2 415 ? -20.254 -36.558 -19.077 1.00 36.32  ? 415 GLU B N     1 
ATOM   7689 C  CA    . GLU B 2 415 ? -20.614 -36.479 -20.483 1.00 36.50  ? 415 GLU B CA    1 
ATOM   7690 C  C     . GLU B 2 415 ? -21.469 -37.690 -20.823 1.00 46.77  ? 415 GLU B C     1 
ATOM   7691 O  O     . GLU B 2 415 ? -21.476 -38.692 -20.103 1.00 42.24  ? 415 GLU B O     1 
ATOM   7692 C  CB    . GLU B 2 415 ? -19.381 -36.413 -21.394 1.00 36.76  ? 415 GLU B CB    1 
ATOM   7693 C  CG    . GLU B 2 415 ? -18.354 -37.502 -21.142 1.00 51.65  ? 415 GLU B CG    1 
ATOM   7694 C  CD    . GLU B 2 415 ? -17.251 -37.509 -22.183 1.00 60.93  ? 415 GLU B CD    1 
ATOM   7695 O  OE1   . GLU B 2 415 ? -17.473 -38.059 -23.282 1.00 67.44  ? 415 GLU B OE1   1 
ATOM   7696 O  OE2   . GLU B 2 415 ? -16.168 -36.953 -21.906 1.00 62.11  ? 415 GLU B OE2   1 
ATOM   7697 N  N     . PHE B 2 416 ? -22.195 -37.587 -21.929 1.00 34.87  ? 416 PHE B N     1 
ATOM   7698 C  CA    . PHE B 2 416 ? -23.132 -38.617 -22.351 1.00 38.82  ? 416 PHE B CA    1 
ATOM   7699 C  C     . PHE B 2 416 ? -22.588 -39.337 -23.576 1.00 48.11  ? 416 PHE B C     1 
ATOM   7700 O  O     . PHE B 2 416 ? -22.082 -38.704 -24.507 1.00 56.11  ? 416 PHE B O     1 
ATOM   7701 C  CB    . PHE B 2 416 ? -24.503 -38.007 -22.643 1.00 36.61  ? 416 PHE B CB    1 
ATOM   7702 C  CG    . PHE B 2 416 ? -25.002 -37.109 -21.546 1.00 37.96  ? 416 PHE B CG    1 
ATOM   7703 C  CD1   . PHE B 2 416 ? -25.600 -37.641 -20.416 1.00 34.70  ? 416 PHE B CD1   1 
ATOM   7704 C  CD2   . PHE B 2 416 ? -24.860 -35.734 -21.638 1.00 40.62  ? 416 PHE B CD2   1 
ATOM   7705 C  CE1   . PHE B 2 416 ? -26.054 -36.818 -19.401 1.00 37.30  ? 416 PHE B CE1   1 
ATOM   7706 C  CE2   . PHE B 2 416 ? -25.310 -34.906 -20.625 1.00 37.09  ? 416 PHE B CE2   1 
ATOM   7707 C  CZ    . PHE B 2 416 ? -25.910 -35.449 -19.507 1.00 35.97  ? 416 PHE B CZ    1 
ATOM   7708 N  N     . VAL B 2 417 ? -22.687 -40.665 -23.565 1.00 40.87  ? 417 VAL B N     1 
ATOM   7709 C  CA    . VAL B 2 417 ? -22.070 -41.503 -24.584 1.00 61.36  ? 417 VAL B CA    1 
ATOM   7710 C  C     . VAL B 2 417 ? -23.072 -42.547 -25.056 1.00 65.02  ? 417 VAL B C     1 
ATOM   7711 O  O     . VAL B 2 417 ? -23.950 -42.984 -24.304 1.00 62.09  ? 417 VAL B O     1 
ATOM   7712 C  CB    . VAL B 2 417 ? -20.777 -42.175 -24.057 1.00 63.52  ? 417 VAL B CB    1 
ATOM   7713 C  CG1   . VAL B 2 417 ? -21.101 -43.230 -23.006 1.00 47.59  ? 417 VAL B CG1   1 
ATOM   7714 C  CG2   . VAL B 2 417 ? -19.963 -42.768 -25.201 1.00 79.76  ? 417 VAL B CG2   1 
ATOM   7715 N  N     . ASN B 2 418 ? -22.948 -42.931 -26.326 1.00 87.09  ? 418 ASN B N     1 
ATOM   7716 C  CA    . ASN B 2 418 ? -23.713 -44.039 -26.897 1.00 82.98  ? 418 ASN B CA    1 
ATOM   7717 C  C     . ASN B 2 418 ? -22.834 -45.279 -26.801 1.00 83.24  ? 418 ASN B C     1 
ATOM   7718 O  O     . ASN B 2 418 ? -22.052 -45.584 -27.702 1.00 78.91  ? 418 ASN B O     1 
ATOM   7719 C  CB    . ASN B 2 418 ? -24.118 -43.738 -28.334 1.00 67.10  ? 418 ASN B CB    1 
ATOM   7720 C  CG    . ASN B 2 418 ? -24.927 -42.461 -28.458 1.00 72.27  ? 418 ASN B CG    1 
ATOM   7721 O  OD1   . ASN B 2 418 ? -26.155 -42.481 -28.378 0.10 69.15  ? 418 ASN B OD1   1 
ATOM   7722 N  ND2   . ASN B 2 418 ? -24.240 -41.342 -28.658 0.10 68.37  ? 418 ASN B ND2   1 
ATOM   7723 N  N     . THR B 2 419 ? -22.960 -45.997 -25.693 1.00 81.81  ? 419 THR B N     1 
ATOM   7724 C  CA    . THR B 2 419 ? -22.026 -47.080 -25.404 1.00 84.34  ? 419 THR B CA    1 
ATOM   7725 C  C     . THR B 2 419 ? -22.251 -48.250 -26.358 1.00 80.55  ? 419 THR B C     1 
ATOM   7726 O  O     . THR B 2 419 ? -23.402 -48.632 -26.610 1.00 79.26  ? 419 THR B O     1 
ATOM   7727 C  CB    . THR B 2 419 ? -22.160 -47.535 -23.947 1.00 89.43  ? 419 THR B CB    1 
ATOM   7728 O  OG1   . THR B 2 419 ? -21.212 -48.576 -23.679 1.00 100.41 ? 419 THR B OG1   1 
ATOM   7729 C  CG2   . THR B 2 419 ? -23.570 -48.039 -23.646 1.00 86.28  ? 419 THR B CG2   1 
ATOM   7730 N  N     . PRO B 2 420 ? -21.192 -48.815 -26.939 1.00 85.09  ? 420 PRO B N     1 
ATOM   7731 C  CA    . PRO B 2 420 ? -21.364 -50.023 -27.740 1.00 92.03  ? 420 PRO B CA    1 
ATOM   7732 C  C     . PRO B 2 420 ? -21.648 -51.215 -26.845 1.00 88.66  ? 420 PRO B C     1 
ATOM   7733 O  O     . PRO B 2 420 ? -21.142 -51.292 -25.712 1.00 80.77  ? 420 PRO B O     1 
ATOM   7734 C  CB    . PRO B 2 420 ? -20.010 -50.168 -28.458 1.00 94.41  ? 420 PRO B CB    1 
ATOM   7735 C  CG    . PRO B 2 420 ? -19.353 -48.825 -28.340 1.00 92.01  ? 420 PRO B CG    1 
ATOM   7736 C  CD    . PRO B 2 420 ? -19.828 -48.274 -27.036 1.00 83.43  ? 420 PRO B CD    1 
ATOM   7737 N  N     . PRO B 2 421 ? -22.444 -52.178 -27.313 1.00 90.13  ? 421 PRO B N     1 
ATOM   7738 C  CA    . PRO B 2 421 ? -22.774 -53.334 -26.467 1.00 87.03  ? 421 PRO B CA    1 
ATOM   7739 C  C     . PRO B 2 421 ? -21.623 -54.319 -26.327 1.00 82.07  ? 421 PRO B C     1 
ATOM   7740 O  O     . PRO B 2 421 ? -21.818 -55.445 -25.858 1.00 86.65  ? 421 PRO B O     1 
ATOM   7741 C  CB    . PRO B 2 421 ? -23.968 -53.964 -27.194 1.00 87.59  ? 421 PRO B CB    1 
ATOM   7742 C  CG    . PRO B 2 421 ? -23.759 -53.596 -28.624 1.00 81.45  ? 421 PRO B CG    1 
ATOM   7743 C  CD    . PRO B 2 421 ? -23.133 -52.226 -28.614 1.00 80.65  ? 421 PRO B CD    1 
ATOM   7744 N  N     . LEU B 2 422 ? -20.419 -53.908 -26.730 1.00 79.01  ? 422 LEU B N     1 
ATOM   7745 C  CA    . LEU B 2 422 ? -19.251 -54.770 -26.595 1.00 77.44  ? 422 LEU B CA    1 
ATOM   7746 C  C     . LEU B 2 422 ? -18.651 -54.673 -25.197 1.00 75.61  ? 422 LEU B C     1 
ATOM   7747 O  O     . LEU B 2 422 ? -18.472 -55.691 -24.520 1.00 76.39  ? 422 LEU B O     1 
ATOM   7748 C  CB    . LEU B 2 422 ? -18.204 -54.414 -27.654 1.00 78.39  ? 422 LEU B CB    1 
ATOM   7749 C  CG    . LEU B 2 422 ? -18.437 -54.913 -29.085 1.00 66.01  ? 422 LEU B CG    1 
ATOM   7750 C  CD1   . LEU B 2 422 ? -18.745 -56.404 -29.088 1.00 62.49  ? 422 LEU B CD1   1 
ATOM   7751 C  CD2   . LEU B 2 422 ? -19.535 -54.128 -29.793 1.00 80.12  ? 422 LEU B CD2   1 
ATOM   7752 N  N     . VAL B 2 423 ? -18.335 -53.453 -24.750 1.00 82.11  ? 423 VAL B N     1 
ATOM   7753 C  CA    . VAL B 2 423 ? -17.804 -53.264 -23.403 1.00 72.02  ? 423 VAL B CA    1 
ATOM   7754 C  C     . VAL B 2 423 ? -18.816 -53.717 -22.361 1.00 68.84  ? 423 VAL B C     1 
ATOM   7755 O  O     . VAL B 2 423 ? -18.441 -54.215 -21.291 1.00 62.27  ? 423 VAL B O     1 
ATOM   7756 C  CB    . VAL B 2 423 ? -17.393 -51.793 -23.193 1.00 71.62  ? 423 VAL B CB    1 
ATOM   7757 C  CG1   . VAL B 2 423 ? -16.709 -51.613 -21.845 1.00 59.49  ? 423 VAL B CG1   1 
ATOM   7758 C  CG2   . VAL B 2 423 ? -16.487 -51.329 -24.323 1.00 69.43  ? 423 VAL B CG2   1 
ATOM   7759 N  N     . LYS B 2 424 ? -20.110 -53.559 -22.653 1.00 70.18  ? 424 LYS B N     1 
ATOM   7760 C  CA    . LYS B 2 424 ? -21.145 -54.079 -21.766 1.00 69.16  ? 424 LYS B CA    1 
ATOM   7761 C  C     . LYS B 2 424 ? -21.028 -55.591 -21.610 1.00 72.95  ? 424 LYS B C     1 
ATOM   7762 O  O     . LYS B 2 424 ? -21.222 -56.127 -20.512 1.00 66.97  ? 424 LYS B O     1 
ATOM   7763 C  CB    . LYS B 2 424 ? -22.526 -53.696 -22.302 1.00 66.00  ? 424 LYS B CB    1 
ATOM   7764 C  CG    . LYS B 2 424 ? -23.695 -54.363 -21.595 1.00 66.23  ? 424 LYS B CG    1 
ATOM   7765 C  CD    . LYS B 2 424 ? -25.010 -54.021 -22.280 1.00 78.34  ? 424 LYS B CD    1 
ATOM   7766 C  CE    . LYS B 2 424 ? -26.171 -54.797 -21.677 1.00 85.56  ? 424 LYS B CE    1 
ATOM   7767 N  NZ    . LYS B 2 424 ? -27.463 -54.462 -22.339 1.00 73.99  ? 424 LYS B NZ    1 
ATOM   7768 N  N     . LEU B 2 425 ? -20.697 -56.293 -22.696 1.00 72.46  ? 425 LEU B N     1 
ATOM   7769 C  CA    . LEU B 2 425 ? -20.570 -57.745 -22.629 1.00 64.53  ? 425 LEU B CA    1 
ATOM   7770 C  C     . LEU B 2 425 ? -19.321 -58.176 -21.873 1.00 64.51  ? 425 LEU B C     1 
ATOM   7771 O  O     . LEU B 2 425 ? -19.335 -59.213 -21.199 1.00 72.80  ? 425 LEU B O     1 
ATOM   7772 C  CB    . LEU B 2 425 ? -20.550 -58.342 -24.036 1.00 79.50  ? 425 LEU B CB    1 
ATOM   7773 C  CG    . LEU B 2 425 ? -21.844 -58.974 -24.550 1.00 88.83  ? 425 LEU B CG    1 
ATOM   7774 C  CD1   . LEU B 2 425 ? -21.571 -59.795 -25.801 1.00 83.21  ? 425 LEU B CD1   1 
ATOM   7775 C  CD2   . LEU B 2 425 ? -22.486 -59.831 -23.471 1.00 88.47  ? 425 LEU B CD2   1 
ATOM   7776 N  N     . TRP B 2 426 ? -18.236 -57.405 -21.971 1.00 61.94  ? 426 TRP B N     1 
ATOM   7777 C  CA    . TRP B 2 426 ? -16.970 -57.854 -21.401 1.00 54.94  ? 426 TRP B CA    1 
ATOM   7778 C  C     . TRP B 2 426 ? -16.987 -57.826 -19.878 1.00 60.10  ? 426 TRP B C     1 
ATOM   7779 O  O     . TRP B 2 426 ? -16.296 -58.629 -19.239 1.00 61.24  ? 426 TRP B O     1 
ATOM   7780 C  CB    . TRP B 2 426 ? -15.816 -57.004 -21.932 1.00 61.26  ? 426 TRP B CB    1 
ATOM   7781 C  CG    . TRP B 2 426 ? -15.785 -56.795 -23.433 1.00 64.27  ? 426 TRP B CG    1 
ATOM   7782 C  CD1   . TRP B 2 426 ? -15.424 -55.649 -24.083 1.00 68.92  ? 426 TRP B CD1   1 
ATOM   7783 C  CD2   . TRP B 2 426 ? -16.119 -57.747 -24.460 1.00 62.93  ? 426 TRP B CD2   1 
ATOM   7784 N  NE1   . TRP B 2 426 ? -15.510 -55.825 -25.442 1.00 73.17  ? 426 TRP B NE1   1 
ATOM   7785 C  CE2   . TRP B 2 426 ? -15.935 -57.101 -25.701 1.00 73.83  ? 426 TRP B CE2   1 
ATOM   7786 C  CE3   . TRP B 2 426 ? -16.554 -59.077 -24.453 1.00 59.58  ? 426 TRP B CE3   1 
ATOM   7787 C  CZ2   . TRP B 2 426 ? -16.172 -57.738 -26.917 1.00 62.09  ? 426 TRP B CZ2   1 
ATOM   7788 C  CZ3   . TRP B 2 426 ? -16.791 -59.706 -25.664 1.00 62.28  ? 426 TRP B CZ3   1 
ATOM   7789 C  CH2   . TRP B 2 426 ? -16.597 -59.037 -26.878 1.00 58.57  ? 426 TRP B CH2   1 
ATOM   7790 N  N     . TYR B 2 427 ? -17.756 -56.921 -19.278 1.00 62.65  ? 427 TYR B N     1 
ATOM   7791 C  CA    . TYR B 2 427 ? -17.872 -56.841 -17.829 1.00 54.62  ? 427 TYR B CA    1 
ATOM   7792 C  C     . TYR B 2 427 ? -19.122 -57.537 -17.302 1.00 63.74  ? 427 TYR B C     1 
ATOM   7793 O  O     . TYR B 2 427 ? -19.477 -57.352 -16.134 1.00 65.63  ? 427 TYR B O     1 
ATOM   7794 C  CB    . TYR B 2 427 ? -17.847 -55.380 -17.376 1.00 52.62  ? 427 TYR B CB    1 
ATOM   7795 C  CG    . TYR B 2 427 ? -16.516 -54.698 -17.604 1.00 46.88  ? 427 TYR B CG    1 
ATOM   7796 C  CD1   . TYR B 2 427 ? -15.447 -54.916 -16.745 1.00 50.08  ? 427 TYR B CD1   1 
ATOM   7797 C  CD2   . TYR B 2 427 ? -16.329 -53.837 -18.678 1.00 49.43  ? 427 TYR B CD2   1 
ATOM   7798 C  CE1   . TYR B 2 427 ? -14.227 -54.298 -16.949 1.00 52.75  ? 427 TYR B CE1   1 
ATOM   7799 C  CE2   . TYR B 2 427 ? -15.113 -53.212 -18.890 1.00 40.91  ? 427 TYR B CE2   1 
ATOM   7800 C  CZ    . TYR B 2 427 ? -14.067 -53.447 -18.023 1.00 52.63  ? 427 TYR B CZ    1 
ATOM   7801 O  OH    . TYR B 2 427 ? -12.855 -52.827 -18.231 1.00 53.83  ? 427 TYR B OH    1 
ATOM   7802 N  N     . GLN B 2 428 ? -19.789 -58.334 -18.134 1.00 78.32  ? 428 GLN B N     1 
ATOM   7803 C  CA    . GLN B 2 428 ? -20.959 -59.081 -17.703 1.00 78.44  ? 428 GLN B CA    1 
ATOM   7804 C  C     . GLN B 2 428 ? -20.568 -60.160 -16.694 1.00 83.88  ? 428 GLN B C     1 
ATOM   7805 O  O     . GLN B 2 428 ? -19.393 -60.489 -16.508 1.00 83.17  ? 428 GLN B O     1 
ATOM   7806 C  CB    . GLN B 2 428 ? -21.662 -59.719 -18.902 1.00 84.82  ? 428 GLN B CB    1 
ATOM   7807 C  CG    . GLN B 2 428 ? -22.702 -58.836 -19.571 1.00 83.85  ? 428 GLN B CG    1 
ATOM   7808 C  CD    . GLN B 2 428 ? -24.009 -58.786 -18.802 1.00 94.65  ? 428 GLN B CD    1 
ATOM   7809 O  OE1   . GLN B 2 428 ? -24.190 -59.497 -17.813 1.00 104.10 ? 428 GLN B OE1   1 
ATOM   7810 N  NE2   . GLN B 2 428 ? -24.929 -57.940 -19.254 1.00 70.62  ? 428 GLN B NE2   1 
ATOM   7811 N  N     . LEU B 2 429 ? -21.583 -60.715 -16.037 1.00 92.17  ? 429 LEU B N     1 
ATOM   7812 C  CA    . LEU B 2 429 ? -21.403 -61.796 -15.082 1.00 97.74  ? 429 LEU B CA    1 
ATOM   7813 C  C     . LEU B 2 429 ? -22.436 -62.882 -15.350 1.00 100.94 ? 429 LEU B C     1 
ATOM   7814 O  O     . LEU B 2 429 ? -23.458 -62.650 -16.001 1.00 100.12 ? 429 LEU B O     1 
ATOM   7815 C  CB    . LEU B 2 429 ? -21.522 -61.306 -13.629 1.00 97.26  ? 429 LEU B CB    1 
ATOM   7816 C  CG    . LEU B 2 429 ? -20.459 -60.335 -13.105 1.00 88.41  ? 429 LEU B CG    1 
ATOM   7817 C  CD1   . LEU B 2 429 ? -20.801 -58.891 -13.449 1.00 71.61  ? 429 LEU B CD1   1 
ATOM   7818 C  CD2   . LEU B 2 429 ? -20.275 -60.503 -11.604 1.00 91.80  ? 429 LEU B CD2   1 
ATOM   7819 N  N     . GLU B 2 430 ? -22.154 -64.076 -14.839 1.00 104.54 ? 430 GLU B N     1 
ATOM   7820 C  CA    . GLU B 2 430 ? -23.048 -65.214 -15.021 1.00 105.07 ? 430 GLU B CA    1 
ATOM   7821 C  C     . GLU B 2 430 ? -24.095 -65.271 -13.913 1.00 103.05 ? 430 GLU B C     1 
ATOM   7822 O  O     . GLU B 2 430 ? -25.013 -66.090 -13.957 1.00 94.16  ? 430 GLU B O     1 
ATOM   7823 C  CB    . GLU B 2 430 ? -22.251 -66.520 -15.061 1.00 75.51  ? 430 GLU B CB    1 
ATOM   7824 P  P     . DG  C 3 4   ? -4.271  -36.606 -35.328 1.00 97.03  ? 805 DG  P P     1 
ATOM   7825 O  OP1   . DG  C 3 4   ? -4.307  -37.664 -34.294 1.00 63.61  ? 805 DG  P OP1   1 
ATOM   7826 O  OP2   . DG  C 3 4   ? -3.552  -35.341 -35.064 1.00 93.11  ? 805 DG  P OP2   1 
ATOM   7827 O  "O5'" . DG  C 3 4   ? -3.699  -37.225 -36.688 1.00 82.10  ? 805 DG  P "O5'" 1 
ATOM   7828 C  "C5'" . DG  C 3 4   ? -2.612  -36.597 -37.355 1.00 70.04  ? 805 DG  P "C5'" 1 
ATOM   7829 C  "C4'" . DG  C 3 4   ? -2.217  -37.380 -38.593 1.00 67.87  ? 805 DG  P "C4'" 1 
ATOM   7830 O  "O4'" . DG  C 3 4   ? -1.773  -38.701 -38.203 1.00 65.08  ? 805 DG  P "O4'" 1 
ATOM   7831 C  "C3'" . DG  C 3 4   ? -3.343  -37.594 -39.592 1.00 74.72  ? 805 DG  P "C3'" 1 
ATOM   7832 O  "O3'" . DG  C 3 4   ? -3.320  -36.547 -40.558 1.00 77.99  ? 805 DG  P "O3'" 1 
ATOM   7833 C  "C2'" . DG  C 3 4   ? -3.001  -38.942 -40.225 1.00 60.11  ? 805 DG  P "C2'" 1 
ATOM   7834 C  "C1'" . DG  C 3 4   ? -2.261  -39.675 -39.103 1.00 62.94  ? 805 DG  P "C1'" 1 
ATOM   7835 N  N9    . DG  C 3 4   ? -3.088  -40.620 -38.352 1.00 61.77  ? 805 DG  P N9    1 
ATOM   7836 C  C8    . DG  C 3 4   ? -3.307  -40.623 -36.996 1.00 64.50  ? 805 DG  P C8    1 
ATOM   7837 N  N7    . DG  C 3 4   ? -4.083  -41.591 -36.596 1.00 57.31  ? 805 DG  P N7    1 
ATOM   7838 C  C5    . DG  C 3 4   ? -4.398  -42.279 -37.760 1.00 51.78  ? 805 DG  P C5    1 
ATOM   7839 C  C6    . DG  C 3 4   ? -5.207  -43.424 -37.951 1.00 57.37  ? 805 DG  P C6    1 
ATOM   7840 O  O6    . DG  C 3 4   ? -5.825  -44.078 -37.099 1.00 55.10  ? 805 DG  P O6    1 
ATOM   7841 N  N1    . DG  C 3 4   ? -5.262  -43.799 -39.291 1.00 52.96  ? 805 DG  P N1    1 
ATOM   7842 C  C2    . DG  C 3 4   ? -4.618  -43.149 -40.317 1.00 54.96  ? 805 DG  P C2    1 
ATOM   7843 N  N2    . DG  C 3 4   ? -4.791  -43.659 -41.544 1.00 63.87  ? 805 DG  P N2    1 
ATOM   7844 N  N3    . DG  C 3 4   ? -3.855  -42.075 -40.152 1.00 58.09  ? 805 DG  P N3    1 
ATOM   7845 C  C4    . DG  C 3 4   ? -3.791  -41.696 -38.852 1.00 55.66  ? 805 DG  P C4    1 
ATOM   7846 P  P     . DT  C 3 5   ? -4.667  -35.754 -40.931 1.00 79.43  ? 806 DT  P P     1 
ATOM   7847 O  OP1   . DT  C 3 5   ? -4.285  -34.551 -41.704 1.00 71.66  ? 806 DT  P OP1   1 
ATOM   7848 O  OP2   . DT  C 3 5   ? -5.464  -35.611 -39.692 1.00 61.16  ? 806 DT  P OP2   1 
ATOM   7849 O  "O5'" . DT  C 3 5   ? -5.440  -36.760 -41.900 1.00 69.29  ? 806 DT  P "O5'" 1 
ATOM   7850 C  "C5'" . DT  C 3 5   ? -4.785  -37.287 -43.046 1.00 69.75  ? 806 DT  P "C5'" 1 
ATOM   7851 C  "C4'" . DT  C 3 5   ? -5.660  -38.314 -43.738 1.00 64.86  ? 806 DT  P "C4'" 1 
ATOM   7852 O  "O4'" . DT  C 3 5   ? -5.814  -39.476 -42.882 1.00 64.59  ? 806 DT  P "O4'" 1 
ATOM   7853 C  "C3'" . DT  C 3 5   ? -7.071  -37.833 -44.066 1.00 64.46  ? 806 DT  P "C3'" 1 
ATOM   7854 O  "O3'" . DT  C 3 5   ? -7.471  -38.319 -45.338 1.00 67.99  ? 806 DT  P "O3'" 1 
ATOM   7855 C  "C2'" . DT  C 3 5   ? -7.916  -38.427 -42.944 1.00 60.54  ? 806 DT  P "C2'" 1 
ATOM   7856 C  "C1'" . DT  C 3 5   ? -7.182  -39.726 -42.644 1.00 55.85  ? 806 DT  P "C1'" 1 
ATOM   7857 N  N1    . DT  C 3 5   ? -7.336  -40.172 -41.233 1.00 55.91  ? 806 DT  P N1    1 
ATOM   7858 C  C2    . DT  C 3 5   ? -7.854  -41.417 -40.970 1.00 48.95  ? 806 DT  P C2    1 
ATOM   7859 O  O2    . DT  C 3 5   ? -8.198  -42.195 -41.841 1.00 47.29  ? 806 DT  P O2    1 
ATOM   7860 N  N3    . DT  C 3 5   ? -7.956  -41.725 -39.639 1.00 46.45  ? 806 DT  P N3    1 
ATOM   7861 C  C4    . DT  C 3 5   ? -7.599  -40.928 -38.566 1.00 49.13  ? 806 DT  P C4    1 
ATOM   7862 O  O4    . DT  C 3 5   ? -7.729  -41.295 -37.402 1.00 55.67  ? 806 DT  P O4    1 
ATOM   7863 C  C5    . DT  C 3 5   ? -7.063  -39.633 -38.913 1.00 52.87  ? 806 DT  P C5    1 
ATOM   7864 C  C7    . DT  C 3 5   ? -6.641  -38.678 -37.835 1.00 62.05  ? 806 DT  P C7    1 
ATOM   7865 C  C6    . DT  C 3 5   ? -6.960  -39.321 -40.213 1.00 55.26  ? 806 DT  P C6    1 
ATOM   7866 P  P     . DC  C 3 6   ? -8.639  -37.572 -46.150 1.00 76.39  ? 807 DC  P P     1 
ATOM   7867 O  OP1   . DC  C 3 6   ? -8.234  -37.517 -47.572 1.00 75.80  ? 807 DC  P OP1   1 
ATOM   7868 O  OP2   . DC  C 3 6   ? -8.960  -36.321 -45.427 1.00 53.68  ? 807 DC  P OP2   1 
ATOM   7869 O  "O5'" . DC  C 3 6   ? -9.891  -38.552 -46.002 1.00 64.27  ? 807 DC  P "O5'" 1 
ATOM   7870 C  "C5'" . DC  C 3 6   ? -9.798  -39.891 -46.457 1.00 55.91  ? 807 DC  P "C5'" 1 
ATOM   7871 C  "C4'" . DC  C 3 6   ? -10.918 -40.733 -45.878 1.00 59.10  ? 807 DC  P "C4'" 1 
ATOM   7872 O  "O4'" . DC  C 3 6   ? -10.678 -40.960 -44.469 1.00 60.11  ? 807 DC  P "O4'" 1 
ATOM   7873 C  "C3'" . DC  C 3 6   ? -12.314 -40.111 -45.984 1.00 52.81  ? 807 DC  P "C3'" 1 
ATOM   7874 O  "O3'" . DC  C 3 6   ? -13.182 -40.991 -46.686 1.00 52.71  ? 807 DC  P "O3'" 1 
ATOM   7875 C  "C2'" . DC  C 3 6   ? -12.756 -39.912 -44.527 1.00 49.12  ? 807 DC  P "C2'" 1 
ATOM   7876 C  "C1'" . DC  C 3 6   ? -11.903 -40.931 -43.787 1.00 48.56  ? 807 DC  P "C1'" 1 
ATOM   7877 N  N1    . DC  C 3 6   ? -11.641 -40.569 -42.365 1.00 50.89  ? 807 DC  P N1    1 
ATOM   7878 C  C2    . DC  C 3 6   ? -11.838 -41.522 -41.360 1.00 46.04  ? 807 DC  P C2    1 
ATOM   7879 O  O2    . DC  C 3 6   ? -12.229 -42.654 -41.670 1.00 51.39  ? 807 DC  P O2    1 
ATOM   7880 N  N3    . DC  C 3 6   ? -11.593 -41.177 -40.071 1.00 46.46  ? 807 DC  P N3    1 
ATOM   7881 C  C4    . DC  C 3 6   ? -11.172 -39.946 -39.777 1.00 53.22  ? 807 DC  P C4    1 
ATOM   7882 N  N4    . DC  C 3 6   ? -10.943 -39.654 -38.490 1.00 41.73  ? 807 DC  P N4    1 
ATOM   7883 C  C5    . DC  C 3 6   ? -10.964 -38.961 -40.788 1.00 40.82  ? 807 DC  P C5    1 
ATOM   7884 C  C6    . DC  C 3 6   ? -11.210 -39.313 -42.056 1.00 48.36  ? 807 DC  P C6    1 
ATOM   7885 P  P     . DC  C 3 7   ? -14.682 -40.540 -47.043 1.00 61.38  ? 808 DC  P P     1 
ATOM   7886 O  OP1   . DC  C 3 7   ? -15.060 -41.223 -48.300 1.00 58.79  ? 808 DC  P OP1   1 
ATOM   7887 O  OP2   . DC  C 3 7   ? -14.754 -39.064 -46.958 1.00 60.49  ? 808 DC  P OP2   1 
ATOM   7888 O  "O5'" . DC  C 3 7   ? -15.552 -41.150 -45.849 1.00 45.42  ? 808 DC  P "O5'" 1 
ATOM   7889 C  "C5'" . DC  C 3 7   ? -15.482 -42.540 -45.567 1.00 45.21  ? 808 DC  P "C5'" 1 
ATOM   7890 C  "C4'" . DC  C 3 7   ? -16.238 -42.873 -44.295 1.00 49.65  ? 808 DC  P "C4'" 1 
ATOM   7891 O  "O4'" . DC  C 3 7   ? -15.522 -42.353 -43.155 1.00 51.98  ? 808 DC  P "O4'" 1 
ATOM   7892 C  "C3'" . DC  C 3 7   ? -17.655 -42.294 -44.215 1.00 48.90  ? 808 DC  P "C3'" 1 
ATOM   7893 O  "O3'" . DC  C 3 7   ? -18.605 -43.349 -44.139 1.00 48.78  ? 808 DC  P "O3'" 1 
ATOM   7894 C  "C2'" . DC  C 3 7   ? -17.652 -41.435 -42.940 1.00 40.67  ? 808 DC  P "C2'" 1 
ATOM   7895 C  "C1'" . DC  C 3 7   ? -16.448 -41.967 -42.176 1.00 42.86  ? 808 DC  P "C1'" 1 
ATOM   7896 N  N1    . DC  C 3 7   ? -15.802 -40.948 -41.300 1.00 46.70  ? 808 DC  P N1    1 
ATOM   7897 C  C2    . DC  C 3 7   ? -15.677 -41.193 -39.927 1.00 46.35  ? 808 DC  P C2    1 
ATOM   7898 O  O2    . DC  C 3 7   ? -16.111 -42.254 -39.460 1.00 52.47  ? 808 DC  P O2    1 
ATOM   7899 N  N3    . DC  C 3 7   ? -15.084 -40.256 -39.146 1.00 47.18  ? 808 DC  P N3    1 
ATOM   7900 C  C4    . DC  C 3 7   ? -14.631 -39.123 -39.687 1.00 50.06  ? 808 DC  P C4    1 
ATOM   7901 N  N4    . DC  C 3 7   ? -14.053 -38.231 -38.875 1.00 36.97  ? 808 DC  P N4    1 
ATOM   7902 C  C5    . DC  C 3 7   ? -14.748 -38.857 -41.083 1.00 39.41  ? 808 DC  P C5    1 
ATOM   7903 C  C6    . DC  C 3 7   ? -15.334 -39.787 -41.844 1.00 49.09  ? 808 DC  P C6    1 
ATOM   7904 P  P     . DC  C 3 8   ? -20.176 -43.036 -44.261 1.00 48.54  ? 809 DC  P P     1 
ATOM   7905 O  OP1   . DC  C 3 8   ? -20.828 -44.248 -44.806 1.00 50.11  ? 809 DC  P OP1   1 
ATOM   7906 O  OP2   . DC  C 3 8   ? -20.333 -41.740 -44.957 1.00 45.04  ? 809 DC  P OP2   1 
ATOM   7907 O  "O5'" . DC  C 3 8   ? -20.639 -42.846 -42.743 1.00 41.66  ? 809 DC  P "O5'" 1 
ATOM   7908 C  "C5'" . DC  C 3 8   ? -20.416 -43.889 -41.807 1.00 42.17  ? 809 DC  P "C5'" 1 
ATOM   7909 C  "C4'" . DC  C 3 8   ? -20.772 -43.443 -40.402 1.00 48.52  ? 809 DC  P "C4'" 1 
ATOM   7910 O  "O4'" . DC  C 3 8   ? -19.774 -42.516 -39.912 1.00 49.64  ? 809 DC  P "O4'" 1 
ATOM   7911 C  "C3'" . DC  C 3 8   ? -22.125 -42.737 -40.267 1.00 49.70  ? 809 DC  P "C3'" 1 
ATOM   7912 O  "O3'" . DC  C 3 8   ? -22.907 -43.394 -39.281 1.00 57.88  ? 809 DC  P "O3'" 1 
ATOM   7913 C  "C2'" . DC  C 3 8   ? -21.760 -41.308 -39.844 1.00 44.95  ? 809 DC  P "C2'" 1 
ATOM   7914 C  "C1'" . DC  C 3 8   ? -20.412 -41.509 -39.172 1.00 44.95  ? 809 DC  P "C1'" 1 
ATOM   7915 N  N1    . DC  C 3 8   ? -19.547 -40.294 -39.189 1.00 48.06  ? 809 DC  P N1    1 
ATOM   7916 C  C2    . DC  C 3 8   ? -18.911 -39.880 -38.013 1.00 41.79  ? 809 DC  P C2    1 
ATOM   7917 O  O2    . DC  C 3 8   ? -19.078 -40.532 -36.976 1.00 49.96  ? 809 DC  P O2    1 
ATOM   7918 N  N3    . DC  C 3 8   ? -18.125 -38.775 -38.046 1.00 44.96  ? 809 DC  P N3    1 
ATOM   7919 C  C4    . DC  C 3 8   ? -17.967 -38.101 -39.187 1.00 54.45  ? 809 DC  P C4    1 
ATOM   7920 N  N4    . DC  C 3 8   ? -17.183 -37.017 -39.169 1.00 52.48  ? 809 DC  P N4    1 
ATOM   7921 C  C5    . DC  C 3 8   ? -18.608 -38.508 -40.394 1.00 47.31  ? 809 DC  P C5    1 
ATOM   7922 C  C6    . DC  C 3 8   ? -19.380 -39.599 -40.350 1.00 53.28  ? 809 DC  P C6    1 
ATOM   7923 P  P     . DT  C 3 9   ? -24.477 -43.082 -39.139 1.00 43.94  ? 810 DT  P P     1 
ATOM   7924 O  OP1   . DT  C 3 9   ? -25.183 -44.381 -39.066 1.00 43.54  ? 810 DT  P OP1   1 
ATOM   7925 O  OP2   . DT  C 3 9   ? -24.854 -42.099 -40.179 1.00 49.58  ? 810 DT  P OP2   1 
ATOM   7926 O  "O5'" . DT  C 3 9   ? -24.582 -42.363 -37.717 1.00 46.32  ? 810 DT  P "O5'" 1 
ATOM   7927 C  "C5'" . DT  C 3 9   ? -23.900 -42.916 -36.599 1.00 55.23  ? 810 DT  P "C5'" 1 
ATOM   7928 C  "C4'" . DT  C 3 9   ? -23.690 -41.867 -35.525 1.00 49.97  ? 810 DT  P "C4'" 1 
ATOM   7929 O  "O4'" . DT  C 3 9   ? -22.611 -40.984 -35.907 1.00 53.51  ? 810 DT  P "O4'" 1 
ATOM   7930 C  "C3'" . DT  C 3 9   ? -24.903 -40.968 -35.264 1.00 57.77  ? 810 DT  P "C3'" 1 
ATOM   7931 O  "O3'" . DT  C 3 9   ? -25.353 -41.125 -33.926 1.00 62.40  ? 810 DT  P "O3'" 1 
ATOM   7932 C  "C2'" . DT  C 3 9   ? -24.390 -39.545 -35.525 1.00 54.22  ? 810 DT  P "C2'" 1 
ATOM   7933 C  "C1'" . DT  C 3 9   ? -22.885 -39.708 -35.398 1.00 52.54  ? 810 DT  P "C1'" 1 
ATOM   7934 N  N1    . DT  C 3 9   ? -22.116 -38.701 -36.183 1.00 48.21  ? 810 DT  P N1    1 
ATOM   7935 C  C2    . DT  C 3 9   ? -21.076 -38.031 -35.584 1.00 46.86  ? 810 DT  P C2    1 
ATOM   7936 O  O2    . DT  C 3 9   ? -20.732 -38.226 -34.432 1.00 49.38  ? 810 DT  P O2    1 
ATOM   7937 N  N3    . DT  C 3 9   ? -20.442 -37.123 -36.389 1.00 43.94  ? 810 DT  P N3    1 
ATOM   7938 C  C4    . DT  C 3 9   ? -20.740 -36.820 -37.705 1.00 48.18  ? 810 DT  P C4    1 
ATOM   7939 O  O4    . DT  C 3 9   ? -20.110 -35.986 -38.346 1.00 54.24  ? 810 DT  P O4    1 
ATOM   7940 C  C5    . DT  C 3 9   ? -21.846 -37.554 -38.271 1.00 48.68  ? 810 DT  P C5    1 
ATOM   7941 C  C7    . DT  C 3 9   ? -22.265 -37.313 -39.691 1.00 37.44  ? 810 DT  P C7    1 
ATOM   7942 C  C6    . DT  C 3 9   ? -22.474 -38.447 -37.491 1.00 46.87  ? 810 DT  P C6    1 
ATOM   7943 P  P     . DG  C 3 10  ? -26.771 -40.516 -33.482 1.00 67.32  ? 811 DG  P P     1 
ATOM   7944 O  OP1   . DG  C 3 10  ? -27.469 -41.537 -32.669 1.00 67.14  ? 811 DG  P OP1   1 
ATOM   7945 O  OP2   . DG  C 3 10  ? -27.419 -39.976 -34.697 1.00 60.79  ? 811 DG  P OP2   1 
ATOM   7946 O  "O5'" . DG  C 3 10  ? -26.381 -39.280 -32.544 1.00 63.56  ? 811 DG  P "O5'" 1 
ATOM   7947 C  "C5'" . DG  C 3 10  ? -25.698 -39.510 -31.318 1.00 65.64  ? 811 DG  P "C5'" 1 
ATOM   7948 C  "C4'" . DG  C 3 10  ? -24.900 -38.288 -30.907 1.00 62.01  ? 811 DG  P "C4'" 1 
ATOM   7949 O  "O4'" . DG  C 3 10  ? -23.962 -37.960 -31.945 1.00 58.64  ? 811 DG  P "O4'" 1 
ATOM   7950 C  "C3'" . DG  C 3 10  ? -25.716 -37.023 -30.720 1.00 62.20  ? 811 DG  P "C3'" 1 
ATOM   7951 O  "O3'" . DG  C 3 10  ? -26.204 -36.959 -29.383 1.00 67.27  ? 811 DG  P "O3'" 1 
ATOM   7952 C  "C2'" . DG  C 3 10  ? -24.699 -35.908 -30.997 1.00 67.85  ? 811 DG  P "C2'" 1 
ATOM   7953 C  "C1'" . DG  C 3 10  ? -23.611 -36.598 -31.830 1.00 62.84  ? 811 DG  P "C1'" 1 
ATOM   7954 N  N9    . DG  C 3 10  ? -23.459 -36.039 -33.170 1.00 61.18  ? 811 DG  P N9    1 
ATOM   7955 C  C8    . DG  C 3 10  ? -24.107 -36.439 -34.313 1.00 55.72  ? 811 DG  P C8    1 
ATOM   7956 N  N7    . DG  C 3 10  ? -23.768 -35.754 -35.369 1.00 51.21  ? 811 DG  P N7    1 
ATOM   7957 C  C5    . DG  C 3 10  ? -22.838 -34.837 -34.896 1.00 51.29  ? 811 DG  P C5    1 
ATOM   7958 C  C6    . DG  C 3 10  ? -22.120 -33.828 -35.581 1.00 52.46  ? 811 DG  P C6    1 
ATOM   7959 O  O6    . DG  C 3 10  ? -22.167 -33.535 -36.783 1.00 54.66  ? 811 DG  P O6    1 
ATOM   7960 N  N1    . DG  C 3 10  ? -21.279 -33.123 -34.724 1.00 57.63  ? 811 DG  P N1    1 
ATOM   7961 C  C2    . DG  C 3 10  ? -21.149 -33.364 -33.376 1.00 55.48  ? 811 DG  P C2    1 
ATOM   7962 N  N2    . DG  C 3 10  ? -20.288 -32.580 -32.712 1.00 60.40  ? 811 DG  P N2    1 
ATOM   7963 N  N3    . DG  C 3 10  ? -21.815 -34.305 -32.724 1.00 49.10  ? 811 DG  P N3    1 
ATOM   7964 C  C4    . DG  C 3 10  ? -22.638 -35.001 -33.543 1.00 53.22  ? 811 DG  P C4    1 
ATOM   7965 P  P     . DT  C 3 11  ? -27.359 -35.914 -28.986 1.00 62.81  ? 812 DT  P P     1 
ATOM   7966 O  OP1   . DT  C 3 11  ? -27.913 -36.332 -27.679 1.00 70.78  ? 812 DT  P OP1   1 
ATOM   7967 O  OP2   . DT  C 3 11  ? -28.253 -35.768 -30.156 1.00 61.06  ? 812 DT  P OP2   1 
ATOM   7968 O  "O5'" . DT  C 3 11  ? -26.578 -34.532 -28.790 1.00 58.81  ? 812 DT  P "O5'" 1 
ATOM   7969 C  "C5'" . DT  C 3 11  ? -25.490 -34.453 -27.878 1.00 63.92  ? 812 DT  P "C5'" 1 
ATOM   7970 C  "C4'" . DT  C 3 11  ? -24.762 -33.130 -28.028 1.00 62.38  ? 812 DT  P "C4'" 1 
ATOM   7971 O  "O4'" . DT  C 3 11  ? -24.222 -33.024 -29.368 1.00 68.86  ? 812 DT  P "O4'" 1 
ATOM   7972 C  "C3'" . DT  C 3 11  ? -25.637 -31.892 -27.812 1.00 68.41  ? 812 DT  P "C3'" 1 
ATOM   7973 O  "O3'" . DT  C 3 11  ? -25.068 -31.064 -26.809 1.00 68.79  ? 812 DT  P "O3'" 1 
ATOM   7974 C  "C2'" . DT  C 3 11  ? -25.661 -31.199 -29.180 1.00 73.07  ? 812 DT  P "C2'" 1 
ATOM   7975 C  "C1'" . DT  C 3 11  ? -24.388 -31.708 -29.833 1.00 66.04  ? 812 DT  P "C1'" 1 
ATOM   7976 N  N1    . DT  C 3 11  ? -24.464 -31.741 -31.322 1.00 58.90  ? 812 DT  P N1    1 
ATOM   7977 C  C2    . DT  C 3 11  ? -23.591 -30.976 -32.060 1.00 55.24  ? 812 DT  P C2    1 
ATOM   7978 O  O2    . DT  C 3 11  ? -22.739 -30.265 -31.559 1.00 57.41  ? 812 DT  P O2    1 
ATOM   7979 N  N3    . DT  C 3 11  ? -23.748 -31.077 -33.417 1.00 49.73  ? 812 DT  P N3    1 
ATOM   7980 C  C4    . DT  C 3 11  ? -24.675 -31.847 -34.096 1.00 57.32  ? 812 DT  P C4    1 
ATOM   7981 O  O4    . DT  C 3 11  ? -24.737 -31.870 -35.322 1.00 54.27  ? 812 DT  P O4    1 
ATOM   7982 C  C5    . DT  C 3 11  ? -25.562 -32.622 -33.262 1.00 61.33  ? 812 DT  P C5    1 
ATOM   7983 C  C7    . DT  C 3 11  ? -26.610 -33.497 -33.885 1.00 48.35  ? 812 DT  P C7    1 
ATOM   7984 C  C6    . DT  C 3 11  ? -25.417 -32.531 -31.931 1.00 59.16  ? 812 DT  P C6    1 
ATOM   7985 P  P     . DT  C 3 12  ? -25.836 -29.737 -26.328 1.00 71.33  ? 813 DT  P P     1 
ATOM   7986 O  OP1   . DT  C 3 12  ? -25.445 -29.469 -24.927 1.00 92.75  ? 813 DT  P OP1   1 
ATOM   7987 O  OP2   . DT  C 3 12  ? -27.265 -29.883 -26.684 1.00 64.60  ? 813 DT  P OP2   1 
ATOM   7988 O  "O5'" . DT  C 3 12  ? -25.212 -28.591 -27.245 1.00 63.32  ? 813 DT  P "O5'" 1 
ATOM   7989 C  "C5'" . DT  C 3 12  ? -23.804 -28.422 -27.296 1.00 71.45  ? 813 DT  P "C5'" 1 
ATOM   7990 C  "C4'" . DT  C 3 12  ? -23.441 -27.200 -28.115 1.00 72.45  ? 813 DT  P "C4'" 1 
ATOM   7991 O  "O4'" . DT  C 3 12  ? -23.519 -27.523 -29.528 1.00 74.76  ? 813 DT  P "O4'" 1 
ATOM   7992 C  "C3'" . DT  C 3 12  ? -24.350 -25.993 -27.897 1.00 73.11  ? 813 DT  P "C3'" 1 
ATOM   7993 O  "O3'" . DT  C 3 12  ? -23.571 -24.810 -27.824 1.00 82.19  ? 813 DT  P "O3'" 1 
ATOM   7994 C  "C2'" . DT  C 3 12  ? -25.256 -26.002 -29.127 1.00 73.35  ? 813 DT  P "C2'" 1 
ATOM   7995 C  "C1'" . DT  C 3 12  ? -24.339 -26.588 -30.190 1.00 64.36  ? 813 DT  P "C1'" 1 
ATOM   7996 N  N1    . DT  C 3 12  ? -25.072 -27.300 -31.274 1.00 57.93  ? 813 DT  P N1    1 
ATOM   7997 C  C2    . DT  C 3 12  ? -24.653 -27.159 -32.576 1.00 58.10  ? 813 DT  P C2    1 
ATOM   7998 O  O2    . DT  C 3 12  ? -23.700 -26.474 -32.900 1.00 66.83  ? 813 DT  P O2    1 
ATOM   7999 N  N3    . DT  C 3 12  ? -25.394 -27.856 -33.494 1.00 50.89  ? 813 DT  P N3    1 
ATOM   8000 C  C4    . DT  C 3 12  ? -26.490 -28.662 -33.245 1.00 58.14  ? 813 DT  P C4    1 
ATOM   8001 O  O4    . DT  C 3 12  ? -27.090 -29.248 -34.140 1.00 55.25  ? 813 DT  P O4    1 
ATOM   8002 C  C5    . DT  C 3 12  ? -26.877 -28.766 -31.858 1.00 58.74  ? 813 DT  P C5    1 
ATOM   8003 C  C7    . DT  C 3 12  ? -28.052 -29.612 -31.465 1.00 56.22  ? 813 DT  P C7    1 
ATOM   8004 C  C6    . DT  C 3 12  ? -26.158 -28.088 -30.950 1.00 62.43  ? 813 DT  P C6    1 
ATOM   8005 P  P     . DC  C 3 13  ? -24.200 -23.461 -27.222 1.00 86.43  ? 814 DC  P P     1 
ATOM   8006 O  OP1   . DC  C 3 13  ? -23.300 -22.987 -26.147 1.00 86.87  ? 814 DC  P OP1   1 
ATOM   8007 O  OP2   . DC  C 3 13  ? -25.630 -23.708 -26.929 1.00 75.83  ? 814 DC  P OP2   1 
ATOM   8008 O  "O5'" . DC  C 3 13  ? -24.119 -22.440 -28.445 1.00 76.64  ? 814 DC  P "O5'" 1 
ATOM   8009 C  "C5'" . DC  C 3 13  ? -22.928 -22.359 -29.214 1.00 73.00  ? 814 DC  P "C5'" 1 
ATOM   8010 C  "C4'" . DC  C 3 13  ? -23.220 -21.810 -30.595 1.00 72.64  ? 814 DC  P "C4'" 1 
ATOM   8011 O  "O4'" . DC  C 3 13  ? -23.854 -22.831 -31.400 1.00 72.59  ? 814 DC  P "O4'" 1 
ATOM   8012 C  "C3'" . DC  C 3 13  ? -24.159 -20.600 -30.616 1.00 75.36  ? 814 DC  P "C3'" 1 
ATOM   8013 O  "O3'" . DC  C 3 13  ? -23.524 -19.505 -31.253 1.00 80.07  ? 814 DC  P "O3'" 1 
ATOM   8014 C  "C2'" . DC  C 3 13  ? -25.387 -21.082 -31.399 1.00 72.78  ? 814 DC  P "C2'" 1 
ATOM   8015 C  "C1'" . DC  C 3 13  ? -24.822 -22.230 -32.218 1.00 68.76  ? 814 DC  P "C1'" 1 
ATOM   8016 N  N1    . DC  C 3 13  ? -25.837 -23.257 -32.581 1.00 61.72  ? 814 DC  P N1    1 
ATOM   8017 C  C2    . DC  C 3 13  ? -26.017 -23.609 -33.923 1.00 67.12  ? 814 DC  P C2    1 
ATOM   8018 O  O2    . DC  C 3 13  ? -25.324 -23.060 -34.788 1.00 69.37  ? 814 DC  P O2    1 
ATOM   8019 N  N3    . DC  C 3 13  ? -26.947 -24.544 -34.238 1.00 53.16  ? 814 DC  P N3    1 
ATOM   8020 C  C4    . DC  C 3 13  ? -27.674 -25.113 -33.274 1.00 59.07  ? 814 DC  P C4    1 
ATOM   8021 N  N4    . DC  C 3 13  ? -28.578 -26.031 -33.633 1.00 64.71  ? 814 DC  P N4    1 
ATOM   8022 C  C5    . DC  C 3 13  ? -27.506 -24.766 -31.901 1.00 62.03  ? 814 DC  P C5    1 
ATOM   8023 C  C6    . DC  C 3 13  ? -26.587 -23.842 -31.604 1.00 60.62  ? 814 DC  P C6    1 
ATOM   8024 P  P     . DG  C 3 14  ? -24.130 -18.026 -31.104 1.00 84.02  ? 815 DG  P P     1 
ATOM   8025 O  OP1   . DG  C 3 14  ? -22.995 -17.091 -30.932 1.00 84.94  ? 815 DG  P OP1   1 
ATOM   8026 O  OP2   . DG  C 3 14  ? -25.201 -18.077 -30.085 1.00 73.58  ? 815 DG  P OP2   1 
ATOM   8027 O  "O5'" . DG  C 3 14  ? -24.814 -17.755 -32.522 1.00 88.66  ? 815 DG  P "O5'" 1 
ATOM   8028 C  "C5'" . DG  C 3 14  ? -24.049 -17.892 -33.713 1.00 84.24  ? 815 DG  P "C5'" 1 
ATOM   8029 C  "C4'" . DG  C 3 14  ? -24.950 -17.916 -34.932 1.00 77.17  ? 815 DG  P "C4'" 1 
ATOM   8030 O  "O4'" . DG  C 3 14  ? -25.691 -19.165 -34.966 1.00 75.12  ? 815 DG  P "O4'" 1 
ATOM   8031 C  "C3'" . DG  C 3 14  ? -25.994 -16.796 -34.983 1.00 76.13  ? 815 DG  P "C3'" 1 
ATOM   8032 O  "O3'" . DG  C 3 14  ? -26.007 -16.200 -36.273 1.00 87.60  ? 815 DG  P "O3'" 1 
ATOM   8033 C  "C2'" . DG  C 3 14  ? -27.309 -17.517 -34.684 1.00 66.32  ? 815 DG  P "C2'" 1 
ATOM   8034 C  "C1'" . DG  C 3 14  ? -27.039 -18.894 -35.261 1.00 73.34  ? 815 DG  P "C1'" 1 
ATOM   8035 N  N9    . DG  C 3 14  ? -27.866 -19.942 -34.671 1.00 67.52  ? 815 DG  P N9    1 
ATOM   8036 C  C8    . DG  C 3 14  ? -28.141 -20.127 -33.337 1.00 65.10  ? 815 DG  P C8    1 
ATOM   8037 N  N7    . DG  C 3 14  ? -28.918 -21.148 -33.104 1.00 60.94  ? 815 DG  P N7    1 
ATOM   8038 C  C5    . DG  C 3 14  ? -29.176 -21.674 -34.363 1.00 64.48  ? 815 DG  P C5    1 
ATOM   8039 C  C6    . DG  C 3 14  ? -29.960 -22.790 -34.743 1.00 55.57  ? 815 DG  P C6    1 
ATOM   8040 O  O6    . DG  C 3 14  ? -30.602 -23.560 -34.015 1.00 58.61  ? 815 DG  P O6    1 
ATOM   8041 N  N1    . DG  C 3 14  ? -29.957 -22.976 -36.123 1.00 52.14  ? 815 DG  P N1    1 
ATOM   8042 C  C2    . DG  C 3 14  ? -29.281 -22.185 -37.022 1.00 58.20  ? 815 DG  P C2    1 
ATOM   8043 N  N2    . DG  C 3 14  ? -29.397 -22.522 -38.315 1.00 57.60  ? 815 DG  P N2    1 
ATOM   8044 N  N3    . DG  C 3 14  ? -28.543 -21.137 -36.680 1.00 57.90  ? 815 DG  P N3    1 
ATOM   8045 C  C4    . DG  C 3 14  ? -28.537 -20.942 -35.339 1.00 62.30  ? 815 DG  P C4    1 
ATOM   8046 P  P     . DG  C 3 15  ? -26.755 -14.798 -36.509 1.00 88.12  ? 816 DG  P P     1 
ATOM   8047 O  OP1   . DG  C 3 15  ? -25.804 -13.905 -37.206 1.00 80.89  ? 816 DG  P OP1   1 
ATOM   8048 O  OP2   . DG  C 3 15  ? -27.352 -14.371 -35.224 1.00 76.54  ? 816 DG  P OP2   1 
ATOM   8049 O  "O5'" . DG  C 3 15  ? -27.944 -15.163 -37.517 1.00 72.02  ? 816 DG  P "O5'" 1 
ATOM   8050 C  "C5'" . DG  C 3 15  ? -27.662 -15.356 -38.897 1.00 66.64  ? 816 DG  P "C5'" 1 
ATOM   8051 C  "C4'" . DG  C 3 15  ? -28.775 -16.128 -39.583 1.00 68.06  ? 816 DG  P "C4'" 1 
ATOM   8052 O  "O4'" . DG  C 3 15  ? -28.827 -17.475 -39.066 1.00 71.71  ? 816 DG  P "O4'" 1 
ATOM   8053 C  "C3'" . DG  C 3 15  ? -30.174 -15.590 -39.358 1.00 66.78  ? 816 DG  P "C3'" 1 
ATOM   8054 O  "O3'" . DG  C 3 15  ? -30.438 -14.517 -40.254 1.00 69.03  ? 816 DG  P "O3'" 1 
ATOM   8055 C  "C2'" . DG  C 3 15  ? -31.024 -16.812 -39.685 1.00 74.00  ? 816 DG  P "C2'" 1 
ATOM   8056 C  "C1'" . DG  C 3 15  ? -30.155 -17.964 -39.167 1.00 68.75  ? 816 DG  P "C1'" 1 
ATOM   8057 N  N9    . DG  C 3 15  ? -30.571 -18.469 -37.861 1.00 68.54  ? 816 DG  P N9    1 
ATOM   8058 C  C8    . DG  C 3 15  ? -30.179 -18.004 -36.629 1.00 60.97  ? 816 DG  P C8    1 
ATOM   8059 N  N7    . DG  C 3 15  ? -30.717 -18.652 -35.633 1.00 56.52  ? 816 DG  P N7    1 
ATOM   8060 C  C5    . DG  C 3 15  ? -31.517 -19.610 -36.242 1.00 59.48  ? 816 DG  P C5    1 
ATOM   8061 C  C6    . DG  C 3 15  ? -32.345 -20.605 -35.670 1.00 58.51  ? 816 DG  P C6    1 
ATOM   8062 O  O6    . DG  C 3 15  ? -32.540 -20.844 -34.470 1.00 62.19  ? 816 DG  P O6    1 
ATOM   8063 N  N1    . DG  C 3 15  ? -32.985 -21.366 -36.645 1.00 52.10  ? 816 DG  P N1    1 
ATOM   8064 C  C2    . DG  C 3 15  ? -32.843 -21.187 -38.001 1.00 56.26  ? 816 DG  P C2    1 
ATOM   8065 N  N2    . DG  C 3 15  ? -33.543 -22.019 -38.786 1.00 56.54  ? 816 DG  P N2    1 
ATOM   8066 N  N3    . DG  C 3 15  ? -32.070 -20.259 -38.551 1.00 52.84  ? 816 DG  P N3    1 
ATOM   8067 C  C4    . DG  C 3 15  ? -31.440 -19.509 -37.614 1.00 59.19  ? 816 DG  P C4    1 
HETATM 8068 P  P     . MRG C 3 16  ? -31.568 -13.429 -39.902 1.00 74.89  ? 817 MRG P P     1 
HETATM 8069 O  OP1   . MRG C 3 16  ? -31.415 -12.189 -40.873 1.00 91.23  ? 817 MRG P OP1   1 
HETATM 8070 O  OP2   . MRG C 3 16  ? -31.473 -13.052 -38.469 1.00 81.34  ? 817 MRG P OP2   1 
HETATM 8071 O  "O5'" . MRG C 3 16  ? -32.967 -14.171 -40.261 1.00 61.92  ? 817 MRG P "O5'" 1 
HETATM 8072 N  N9    . MRG C 3 16  ? -34.838 -17.480 -39.226 1.00 50.21  ? 817 MRG P N9    1 
HETATM 8073 C  C4    . MRG C 3 16  ? -35.368 -18.489 -38.365 1.00 49.56  ? 817 MRG P C4    1 
HETATM 8074 N  N3    . MRG C 3 16  ? -36.181 -19.563 -38.614 1.00 49.78  ? 817 MRG P N3    1 
HETATM 8075 C  C2    . MRG C 3 16  ? -36.485 -20.342 -37.481 1.00 49.50  ? 817 MRG P C2    1 
HETATM 8076 N  N1    . MRG C 3 16  ? -36.028 -20.098 -36.188 1.00 47.62  ? 817 MRG P N1    1 
HETATM 8077 C  C6    . MRG C 3 16  ? -35.230 -19.023 -36.014 1.00 53.04  ? 817 MRG P C6    1 
HETATM 8078 O  O6    . MRG C 3 16  ? -34.774 -18.764 -34.769 1.00 45.17  ? 817 MRG P O6    1 
HETATM 8079 C  C5    . MRG C 3 16  ? -34.847 -18.155 -37.067 1.00 49.62  ? 817 MRG P C5    1 
HETATM 8080 N  N7    . MRG C 3 16  ? -34.042 -17.007 -37.103 1.00 54.38  ? 817 MRG P N7    1 
HETATM 8081 C  C8    . MRG C 3 16  ? -34.070 -16.647 -38.374 1.00 56.85  ? 817 MRG P C8    1 
HETATM 8082 N  N2    . MRG C 3 16  ? -37.315 -21.455 -37.681 1.00 54.98  ? 817 MRG P N2    1 
HETATM 8083 C  C21   . MRG C 3 16  ? -37.643 -22.055 -39.008 1.00 54.66  ? 817 MRG P C21   1 
HETATM 8084 C  C22   . MRG C 3 16  ? -38.634 -21.253 -39.930 1.00 51.58  ? 817 MRG P C22   1 
HETATM 8085 C  C23   . MRG C 3 16  ? -39.561 -22.121 -40.787 1.00 65.19  ? 817 MRG P C23   1 
HETATM 8086 S  S24   . MRG C 3 16  ? -39.679 -21.441 -42.498 1.00 88.50  ? 817 MRG P S24   1 
HETATM 8087 C  "C2'" . MRG C 3 16  ? -36.291 -16.476 -41.060 1.00 61.13  ? 817 MRG P "C2'" 1 
HETATM 8088 C  "C5'" . MRG C 3 16  ? -33.399 -14.226 -41.598 1.00 61.94  ? 817 MRG P "C5'" 1 
HETATM 8089 C  "C4'" . MRG C 3 16  ? -34.407 -15.358 -41.820 1.00 59.82  ? 817 MRG P "C4'" 1 
HETATM 8090 O  "O4'" . MRG C 3 16  ? -33.932 -16.601 -41.279 1.00 61.30  ? 817 MRG P "O4'" 1 
HETATM 8091 C  "C1'" . MRG C 3 16  ? -35.051 -17.318 -40.684 1.00 53.10  ? 817 MRG P "C1'" 1 
HETATM 8092 C  "C3'" . MRG C 3 16  ? -35.722 -15.068 -41.059 1.00 65.40  ? 817 MRG P "C3'" 1 
HETATM 8093 O  "O3'" . MRG C 3 16  ? -36.538 -14.193 -41.776 1.00 70.07  ? 817 MRG P "O3'" 1 
ATOM   8094 P  P     . DC  C 3 17  ? -37.447 -13.125 -40.992 1.00 70.27  ? 818 DC  P P     1 
ATOM   8095 O  OP1   . DC  C 3 17  ? -37.904 -12.110 -41.968 1.00 75.67  ? 818 DC  P OP1   1 
ATOM   8096 O  OP2   . DC  C 3 17  ? -36.695 -12.703 -39.789 1.00 57.48  ? 818 DC  P OP2   1 
ATOM   8097 O  "O5'" . DC  C 3 17  ? -38.710 -13.979 -40.505 1.00 54.93  ? 818 DC  P "O5'" 1 
ATOM   8098 C  "C5'" . DC  C 3 17  ? -39.607 -14.529 -41.460 1.00 57.52  ? 818 DC  P "C5'" 1 
ATOM   8099 C  "C4'" . DC  C 3 17  ? -40.376 -15.699 -40.872 1.00 60.38  ? 818 DC  P "C4'" 1 
ATOM   8100 O  "O4'" . DC  C 3 17  ? -39.444 -16.679 -40.350 1.00 56.19  ? 818 DC  P "O4'" 1 
ATOM   8101 C  "C3'" . DC  C 3 17  ? -41.265 -15.362 -39.690 1.00 64.82  ? 818 DC  P "C3'" 1 
ATOM   8102 O  "O3'" . DC  C 3 17  ? -42.520 -14.868 -40.133 1.00 60.50  ? 818 DC  P "O3'" 1 
ATOM   8103 C  "C2'" . DC  C 3 17  ? -41.401 -16.722 -39.018 1.00 54.06  ? 818 DC  P "C2'" 1 
ATOM   8104 C  "C1'" . DC  C 3 17  ? -39.990 -17.283 -39.185 1.00 55.73  ? 818 DC  P "C1'" 1 
ATOM   8105 N  N1    . DC  C 3 17  ? -39.097 -16.989 -38.023 1.00 54.03  ? 818 DC  P N1    1 
ATOM   8106 C  C2    . DC  C 3 17  ? -39.173 -17.785 -36.874 1.00 41.05  ? 818 DC  P C2    1 
ATOM   8107 O  O2    . DC  C 3 17  ? -39.975 -18.726 -36.845 1.00 48.23  ? 818 DC  P O2    1 
ATOM   8108 N  N3    . DC  C 3 17  ? -38.361 -17.503 -35.825 1.00 49.00  ? 818 DC  P N3    1 
ATOM   8109 C  C4    . DC  C 3 17  ? -37.509 -16.480 -35.896 1.00 49.17  ? 818 DC  P C4    1 
ATOM   8110 N  N4    . DC  C 3 17  ? -36.728 -16.242 -34.837 1.00 54.32  ? 818 DC  P N4    1 
ATOM   8111 C  C5    . DC  C 3 17  ? -37.419 -15.655 -37.055 1.00 47.03  ? 818 DC  P C5    1 
ATOM   8112 C  C6    . DC  C 3 17  ? -38.224 -15.942 -38.083 1.00 49.45  ? 818 DC  P C6    1 
ATOM   8113 P  P     . DG  C 3 18  ? -43.372 -13.892 -39.182 1.00 56.04  ? 819 DG  P P     1 
ATOM   8114 O  OP1   . DG  C 3 18  ? -44.499 -13.350 -39.972 1.00 52.89  ? 819 DG  P OP1   1 
ATOM   8115 O  OP2   . DG  C 3 18  ? -42.414 -12.967 -38.535 1.00 53.58  ? 819 DG  P OP2   1 
ATOM   8116 O  "O5'" . DG  C 3 18  ? -43.952 -14.864 -38.051 1.00 46.56  ? 819 DG  P "O5'" 1 
ATOM   8117 C  "C5'" . DG  C 3 18  ? -44.855 -15.905 -38.402 1.00 44.96  ? 819 DG  P "C5'" 1 
ATOM   8118 C  "C4'" . DG  C 3 18  ? -45.214 -16.741 -37.187 1.00 51.52  ? 819 DG  P "C4'" 1 
ATOM   8119 O  "O4'" . DG  C 3 18  ? -44.041 -17.456 -36.728 1.00 50.48  ? 819 DG  P "O4'" 1 
ATOM   8120 C  "C3'" . DG  C 3 18  ? -45.694 -15.946 -35.986 1.00 44.22  ? 819 DG  P "C3'" 1 
ATOM   8121 O  "O3'" . DG  C 3 18  ? -47.101 -15.754 -36.066 1.00 40.15  ? 819 DG  P "O3'" 1 
ATOM   8122 C  "C2'" . DG  C 3 18  ? -45.317 -16.857 -34.822 1.00 32.82  ? 819 DG  P "C2'" 1 
ATOM   8123 C  "C1'" . DG  C 3 18  ? -44.008 -17.476 -35.312 1.00 48.40  ? 819 DG  P "C1'" 1 
ATOM   8124 N  N9    . DG  C 3 18  ? -42.817 -16.757 -34.869 1.00 49.85  ? 819 DG  P N9    1 
ATOM   8125 C  C8    . DG  C 3 18  ? -42.055 -15.886 -35.610 1.00 41.73  ? 819 DG  P C8    1 
ATOM   8126 N  N7    . DG  C 3 18  ? -41.043 -15.392 -34.952 1.00 45.89  ? 819 DG  P N7    1 
ATOM   8127 C  C5    . DG  C 3 18  ? -41.139 -15.973 -33.695 1.00 37.36  ? 819 DG  P C5    1 
ATOM   8128 C  C6    . DG  C 3 18  ? -40.316 -15.816 -32.554 1.00 42.01  ? 819 DG  P C6    1 
ATOM   8129 O  O6    . DG  C 3 18  ? -39.307 -15.108 -32.428 1.00 42.09  ? 819 DG  P O6    1 
ATOM   8130 N  N1    . DG  C 3 18  ? -40.766 -16.585 -31.484 1.00 38.76  ? 819 DG  P N1    1 
ATOM   8131 C  C2    . DG  C 3 18  ? -41.870 -17.403 -31.513 1.00 43.52  ? 819 DG  P C2    1 
ATOM   8132 N  N2    . DG  C 3 18  ? -42.148 -18.069 -30.383 1.00 39.59  ? 819 DG  P N2    1 
ATOM   8133 N  N3    . DG  C 3 18  ? -42.650 -17.560 -32.576 1.00 46.86  ? 819 DG  P N3    1 
ATOM   8134 C  C4    . DG  C 3 18  ? -42.226 -16.816 -33.626 1.00 39.32  ? 819 DG  P C4    1 
ATOM   8135 P  P     . DC  C 3 19  ? -47.755 -14.376 -35.563 1.00 40.25  ? 820 DC  P P     1 
ATOM   8136 O  OP1   . DC  C 3 19  ? -49.190 -14.395 -35.923 1.00 40.15  ? 820 DC  P OP1   1 
ATOM   8137 O  OP2   . DC  C 3 19  ? -46.894 -13.271 -36.037 1.00 39.02  ? 820 DC  P OP2   1 
ATOM   8138 O  "O5'" . DC  C 3 19  ? -47.624 -14.454 -33.973 1.00 50.79  ? 820 DC  P "O5'" 1 
ATOM   8139 C  "C5'" . DC  C 3 19  ? -48.273 -15.498 -33.262 1.00 34.06  ? 820 DC  P "C5'" 1 
ATOM   8140 C  "C4'" . DC  C 3 19  ? -47.824 -15.522 -31.814 1.00 40.01  ? 820 DC  P "C4'" 1 
ATOM   8141 O  "O4'" . DC  C 3 19  ? -46.454 -15.986 -31.732 1.00 43.13  ? 820 DC  P "O4'" 1 
ATOM   8142 C  "C3'" . DC  C 3 19  ? -47.792 -14.173 -31.129 1.00 31.74  ? 820 DC  P "C3'" 1 
ATOM   8143 O  "O3'" . DC  C 3 19  ? -49.092 -13.809 -30.685 1.00 35.83  ? 820 DC  P "O3'" 1 
ATOM   8144 C  "C2'" . DC  C 3 19  ? -46.853 -14.456 -29.963 1.00 36.31  ? 820 DC  P "C2'" 1 
ATOM   8145 C  "C1'" . DC  C 3 19  ? -45.823 -15.382 -30.610 1.00 44.15  ? 820 DC  P "C1'" 1 
ATOM   8146 N  N1    . DC  C 3 19  ? -44.598 -14.665 -31.067 1.00 41.77  ? 820 DC  P N1    1 
ATOM   8147 C  C2    . DC  C 3 19  ? -43.564 -14.419 -30.157 1.00 41.21  ? 820 DC  P C2    1 
ATOM   8148 O  O2    . DC  C 3 19  ? -43.683 -14.810 -28.989 1.00 39.65  ? 820 DC  P O2    1 
ATOM   8149 N  N3    . DC  C 3 19  ? -42.458 -13.762 -30.583 1.00 41.39  ? 820 DC  P N3    1 
ATOM   8150 C  C4    . DC  C 3 19  ? -42.370 -13.353 -31.850 1.00 42.01  ? 820 DC  P C4    1 
ATOM   8151 N  N4    . DC  C 3 19  ? -41.261 -12.708 -32.223 1.00 39.87  ? 820 DC  P N4    1 
ATOM   8152 C  C5    . DC  C 3 19  ? -43.416 -13.590 -32.791 1.00 39.95  ? 820 DC  P C5    1 
ATOM   8153 C  C6    . DC  C 3 19  ? -44.501 -14.241 -32.360 1.00 35.70  ? 820 DC  P C6    1 
ATOM   8154 P  P     . DC  C 3 20  ? -49.458 -12.259 -30.465 1.00 38.17  ? 821 DC  P P     1 
ATOM   8155 O  OP1   . DC  C 3 20  ? -50.898 -12.176 -30.133 1.00 39.45  ? 821 DC  P OP1   1 
ATOM   8156 O  OP2   . DC  C 3 20  ? -48.920 -11.503 -31.619 1.00 40.40  ? 821 DC  P OP2   1 
ATOM   8157 O  "O5'" . DC  C 3 20  ? -48.605 -11.843 -29.177 1.00 33.22  ? 821 DC  P "O5'" 1 
ATOM   8158 C  "C5'" . DC  C 3 20  ? -48.875 -12.452 -27.925 1.00 29.85  ? 821 DC  P "C5'" 1 
ATOM   8159 C  "C4'" . DC  C 3 20  ? -47.894 -11.978 -26.867 1.00 42.44  ? 821 DC  P "C4'" 1 
ATOM   8160 O  "O4'" . DC  C 3 20  ? -46.564 -12.464 -27.174 1.00 41.79  ? 821 DC  P "O4'" 1 
ATOM   8161 C  "C3'" . DC  C 3 20  ? -47.720 -10.475 -26.774 1.00 37.76  ? 821 DC  P "C3'" 1 
ATOM   8162 O  "O3'" . DC  C 3 20  ? -48.770 -9.902  -26.007 1.00 37.81  ? 821 DC  P "O3'" 1 
ATOM   8163 C  "C2'" . DC  C 3 20  ? -46.380 -10.375 -26.057 1.00 31.19  ? 821 DC  P "C2'" 1 
ATOM   8164 C  "C1'" . DC  C 3 20  ? -45.604 -11.543 -26.676 1.00 38.63  ? 821 DC  P "C1'" 1 
ATOM   8165 N  N1    . DC  C 3 20  ? -44.707 -11.126 -27.792 1.00 41.69  ? 821 DC  P N1    1 
ATOM   8166 C  C2    . DC  C 3 20  ? -43.401 -10.712 -27.507 1.00 34.59  ? 821 DC  P C2    1 
ATOM   8167 O  O2    . DC  C 3 20  ? -43.012 -10.706 -26.332 1.00 34.13  ? 821 DC  P O2    1 
ATOM   8168 N  N3    . DC  C 3 20  ? -42.596 -10.329 -28.530 1.00 34.78  ? 821 DC  P N3    1 
ATOM   8169 C  C4    . DC  C 3 20  ? -43.054 -10.350 -29.783 1.00 35.59  ? 821 DC  P C4    1 
ATOM   8170 N  N4    . DC  C 3 20  ? -42.223 -9.965  -30.758 1.00 34.49  ? 821 DC  P N4    1 
ATOM   8171 C  C5    . DC  C 3 20  ? -44.382 -10.767 -30.092 1.00 30.33  ? 821 DC  P C5    1 
ATOM   8172 C  C6    . DC  C 3 20  ? -45.167 -11.141 -29.076 1.00 35.07  ? 821 DC  P C6    1 
ATOM   8173 P  P     . DG  C 3 21  ? -49.215 -8.388  -26.271 1.00 34.51  ? 822 DG  P P     1 
ATOM   8174 O  OP1   . DG  C 3 21  ? -50.472 -8.144  -25.527 1.00 32.54  ? 822 DG  P OP1   1 
ATOM   8175 O  OP2   . DG  C 3 21  ? -49.136 -8.124  -27.726 1.00 41.45  ? 822 DG  P OP2   1 
ATOM   8176 O  "O5'" . DG  C 3 21  ? -48.044 -7.529  -25.596 1.00 37.56  ? 822 DG  P "O5'" 1 
ATOM   8177 C  "C5'" . DG  C 3 21  ? -47.874 -7.550  -24.176 1.00 36.18  ? 822 DG  P "C5'" 1 
ATOM   8178 C  "C4'" . DG  C 3 21  ? -46.533 -6.973  -23.767 1.00 37.65  ? 822 DG  P "C4'" 1 
ATOM   8179 O  "O4'" . DG  C 3 21  ? -45.504 -7.601  -24.562 1.00 27.60  ? 822 DG  P "O4'" 1 
ATOM   8180 C  "C3'" . DG  C 3 21  ? -46.398 -5.468  -23.990 1.00 38.87  ? 822 DG  P "C3'" 1 
ATOM   8181 C  "C2'" . DG  C 3 21  ? -44.907 -5.297  -24.359 1.00 41.45  ? 822 DG  P "C2'" 1 
ATOM   8182 C  "C1'" . DG  C 3 21  ? -44.455 -6.694  -24.827 1.00 37.64  ? 822 DG  P "C1'" 1 
ATOM   8183 N  N9    . DG  C 3 21  ? -44.127 -6.772  -26.255 1.00 38.35  ? 822 DG  P N9    1 
ATOM   8184 C  C8    . DG  C 3 21  ? -45.000 -6.973  -27.293 1.00 37.38  ? 822 DG  P C8    1 
ATOM   8185 N  N7    . DG  C 3 21  ? -44.424 -6.999  -28.468 1.00 37.30  ? 822 DG  P N7    1 
ATOM   8186 C  C5    . DG  C 3 21  ? -43.081 -6.801  -28.196 1.00 31.45  ? 822 DG  P C5    1 
ATOM   8187 C  C6    . DG  C 3 21  ? -41.974 -6.729  -29.080 1.00 33.27  ? 822 DG  P C6    1 
ATOM   8188 O  O6    . DG  C 3 21  ? -41.961 -6.833  -30.322 1.00 41.38  ? 822 DG  P O6    1 
ATOM   8189 N  N1    . DG  C 3 21  ? -40.785 -6.517  -28.388 1.00 36.51  ? 822 DG  P N1    1 
ATOM   8190 C  C2    . DG  C 3 21  ? -40.680 -6.388  -27.021 1.00 37.55  ? 822 DG  P C2    1 
ATOM   8191 N  N2    . DG  C 3 21  ? -39.449 -6.186  -26.537 1.00 37.05  ? 822 DG  P N2    1 
ATOM   8192 N  N3    . DG  C 3 21  ? -41.708 -6.452  -26.185 1.00 38.18  ? 822 DG  P N3    1 
ATOM   8193 C  C4    . DG  C 3 21  ? -42.875 -6.660  -26.838 1.00 38.24  ? 822 DG  P C4    1 
ATOM   8194 O  "O5'" . DT  D 4 2   ? -46.485 1.912   -45.964 1.00 115.33 ? 702 DT  T "O5'" 1 
ATOM   8195 C  "C5'" . DT  D 4 2   ? -45.507 2.055   -46.988 1.00 119.96 ? 702 DT  T "C5'" 1 
ATOM   8196 C  "C4'" . DT  D 4 2   ? -44.848 0.723   -47.294 1.00 123.77 ? 702 DT  T "C4'" 1 
ATOM   8197 O  "O4'" . DT  D 4 2   ? -43.974 0.869   -48.439 1.00 124.49 ? 702 DT  T "O4'" 1 
ATOM   8198 C  "C3'" . DT  D 4 2   ? -43.980 0.164   -46.175 1.00 126.35 ? 702 DT  T "C3'" 1 
ATOM   8199 O  "O3'" . DT  D 4 2   ? -44.784 -0.671  -45.327 1.00 137.17 ? 702 DT  T "O3'" 1 
ATOM   8200 C  "C2'" . DT  D 4 2   ? -42.924 -0.637  -46.933 1.00 124.27 ? 702 DT  T "C2'" 1 
ATOM   8201 C  "C1'" . DT  D 4 2   ? -42.771 0.154   -48.236 1.00 121.02 ? 702 DT  T "C1'" 1 
ATOM   8202 N  N1    . DT  D 4 2   ? -41.634 1.130   -48.240 1.00 116.39 ? 702 DT  T N1    1 
ATOM   8203 C  C2    . DT  D 4 2   ? -40.337 0.665   -48.242 1.00 113.29 ? 702 DT  T C2    1 
ATOM   8204 O  O2    . DT  D 4 2   ? -40.050 -0.519  -48.226 1.00 102.61 ? 702 DT  T O2    1 
ATOM   8205 N  N3    . DT  D 4 2   ? -39.378 1.644   -48.256 1.00 114.18 ? 702 DT  T N3    1 
ATOM   8206 C  C4    . DT  D 4 2   ? -39.580 3.012   -48.275 1.00 111.72 ? 702 DT  T C4    1 
ATOM   8207 O  O4    . DT  D 4 2   ? -38.650 3.813   -48.287 1.00 103.62 ? 702 DT  T O4    1 
ATOM   8208 C  C5    . DT  D 4 2   ? -40.961 3.433   -48.279 1.00 114.42 ? 702 DT  T C5    1 
ATOM   8209 C  C7    . DT  D 4 2   ? -41.305 4.893   -48.299 1.00 104.35 ? 702 DT  T C7    1 
ATOM   8210 C  C6    . DT  D 4 2   ? -41.909 2.483   -48.265 1.00 114.94 ? 702 DT  T C6    1 
ATOM   8211 P  P     . DG  D 4 3   ? -44.120 -1.718  -44.299 1.00 151.76 ? 703 DG  T P     1 
ATOM   8212 O  OP1   . DG  D 4 3   ? -43.797 -2.956  -45.043 1.00 133.60 ? 703 DG  T OP1   1 
ATOM   8213 O  OP2   . DG  D 4 3   ? -45.021 -1.796  -43.128 1.00 127.90 ? 703 DG  T OP2   1 
ATOM   8214 O  "O5'" . DG  D 4 3   ? -42.772 -1.008  -43.812 1.00 124.28 ? 703 DG  T "O5'" 1 
ATOM   8215 C  "C5'" . DG  D 4 3   ? -41.806 -1.749  -43.067 1.00 105.36 ? 703 DG  T "C5'" 1 
ATOM   8216 C  "C4'" . DG  D 4 3   ? -40.798 -2.403  -43.996 1.00 98.94  ? 703 DG  T "C4'" 1 
ATOM   8217 O  "O4'" . DG  D 4 3   ? -40.413 -1.451  -45.017 1.00 106.37 ? 703 DG  T "O4'" 1 
ATOM   8218 C  "C3'" . DG  D 4 3   ? -39.495 -2.826  -43.336 1.00 100.66 ? 703 DG  T "C3'" 1 
ATOM   8219 O  "O3'" . DG  D 4 3   ? -38.887 -3.881  -44.076 1.00 109.43 ? 703 DG  T "O3'" 1 
ATOM   8220 C  "C2'" . DG  D 4 3   ? -38.674 -1.549  -43.421 1.00 96.51  ? 703 DG  T "C2'" 1 
ATOM   8221 C  "C1'" . DG  D 4 3   ? -39.097 -0.989  -44.773 1.00 98.84  ? 703 DG  T "C1'" 1 
ATOM   8222 N  N9    . DG  D 4 3   ? -39.100 0.468   -44.802 1.00 98.56  ? 703 DG  T N9    1 
ATOM   8223 C  C8    . DG  D 4 3   ? -40.128 1.304   -44.440 1.00 93.63  ? 703 DG  T C8    1 
ATOM   8224 N  N7    . DG  D 4 3   ? -39.836 2.569   -44.563 1.00 93.56  ? 703 DG  T N7    1 
ATOM   8225 C  C5    . DG  D 4 3   ? -38.528 2.571   -45.031 1.00 99.13  ? 703 DG  T C5    1 
ATOM   8226 C  C6    . DG  D 4 3   ? -37.676 3.654   -45.352 1.00 105.71 ? 703 DG  T C6    1 
ATOM   8227 O  O6    . DG  D 4 3   ? -37.917 4.867   -45.284 1.00 107.21 ? 703 DG  T O6    1 
ATOM   8228 N  N1    . DG  D 4 3   ? -36.429 3.215   -45.793 1.00 112.79 ? 703 DG  T N1    1 
ATOM   8229 C  C2    . DG  D 4 3   ? -36.055 1.897   -45.908 1.00 108.88 ? 703 DG  T C2    1 
ATOM   8230 N  N2    . DG  D 4 3   ? -34.810 1.668   -46.350 1.00 99.57  ? 703 DG  T N2    1 
ATOM   8231 N  N3    . DG  D 4 3   ? -36.844 0.874   -45.610 1.00 104.64 ? 703 DG  T N3    1 
ATOM   8232 C  C4    . DG  D 4 3   ? -38.061 1.285   -45.179 1.00 101.91 ? 703 DG  T C4    1 
ATOM   8233 P  P     . DG  D 4 4   ? -37.764 -4.817  -43.402 1.00 118.45 ? 704 DG  T P     1 
ATOM   8234 O  OP1   . DG  D 4 4   ? -36.865 -5.273  -44.485 1.00 103.89 ? 704 DG  T OP1   1 
ATOM   8235 O  OP2   . DG  D 4 4   ? -38.454 -5.813  -42.553 1.00 114.07 ? 704 DG  T OP2   1 
ATOM   8236 O  "O5'" . DG  D 4 4   ? -36.942 -3.832  -42.441 1.00 103.77 ? 704 DG  T "O5'" 1 
ATOM   8237 C  "C5'" . DG  D 4 4   ? -35.521 -3.898  -42.405 1.00 97.91  ? 704 DG  T "C5'" 1 
ATOM   8238 C  "C4'" . DG  D 4 4   ? -34.929 -2.728  -41.632 1.00 82.53  ? 704 DG  T "C4'" 1 
ATOM   8239 O  "O4'" . DG  D 4 4   ? -35.540 -1.499  -42.059 1.00 82.05  ? 704 DG  T "O4'" 1 
ATOM   8240 C  "C3'" . DG  D 4 4   ? -35.166 -2.754  -40.135 1.00 70.49  ? 704 DG  T "C3'" 1 
ATOM   8241 O  "O3'" . DG  D 4 4   ? -34.174 -3.552  -39.505 1.00 69.50  ? 704 DG  T "O3'" 1 
ATOM   8242 C  "C2'" . DG  D 4 4   ? -35.030 -1.275  -39.744 1.00 71.14  ? 704 DG  T "C2'" 1 
ATOM   8243 C  "C1'" . DG  D 4 4   ? -35.338 -0.527  -41.054 1.00 81.09  ? 704 DG  T "C1'" 1 
ATOM   8244 N  N9    . DG  D 4 4   ? -36.517 0.336   -40.985 1.00 73.94  ? 704 DG  T N9    1 
ATOM   8245 C  C8    . DG  D 4 4   ? -36.572 1.678   -41.275 1.00 67.66  ? 704 DG  T C8    1 
ATOM   8246 N  N7    . DG  D 4 4   ? -37.760 2.194   -41.128 1.00 65.22  ? 704 DG  T N7    1 
ATOM   8247 C  C5    . DG  D 4 4   ? -38.545 1.128   -40.712 1.00 65.18  ? 704 DG  T C5    1 
ATOM   8248 C  C6    . DG  D 4 4   ? -39.924 1.082   -40.395 1.00 64.35  ? 704 DG  T C6    1 
ATOM   8249 O  O6    . DG  D 4 4   ? -40.748 2.007   -40.420 1.00 73.46  ? 704 DG  T O6    1 
ATOM   8250 N  N1    . DG  D 4 4   ? -40.323 -0.197  -40.018 1.00 63.63  ? 704 DG  T N1    1 
ATOM   8251 C  C2    . DG  D 4 4   ? -39.496 -1.293  -39.954 1.00 67.66  ? 704 DG  T C2    1 
ATOM   8252 N  N2    . DG  D 4 4   ? -40.064 -2.444  -39.566 1.00 69.86  ? 704 DG  T N2    1 
ATOM   8253 N  N3    . DG  D 4 4   ? -38.202 -1.264  -40.246 1.00 66.69  ? 704 DG  T N3    1 
ATOM   8254 C  C4    . DG  D 4 4   ? -37.796 -0.024  -40.615 1.00 69.04  ? 704 DG  T C4    1 
ATOM   8255 P  P     . DT  D 4 5   ? -34.560 -4.493  -38.261 1.00 60.73  ? 705 DT  T P     1 
ATOM   8256 O  OP1   . DT  D 4 5   ? -33.487 -5.501  -38.113 1.00 60.47  ? 705 DT  T OP1   1 
ATOM   8257 O  OP2   . DT  D 4 5   ? -35.962 -4.930  -38.444 1.00 65.23  ? 705 DT  T OP2   1 
ATOM   8258 O  "O5'" . DT  D 4 5   ? -34.514 -3.505  -37.006 1.00 57.88  ? 705 DT  T "O5'" 1 
ATOM   8259 C  "C5'" . DT  D 4 5   ? -33.349 -2.735  -36.758 1.00 44.71  ? 705 DT  T "C5'" 1 
ATOM   8260 C  "C4'" . DT  D 4 5   ? -33.310 -2.266  -35.316 1.00 51.62  ? 705 DT  T "C4'" 1 
ATOM   8261 O  "O4'" . DT  D 4 5   ? -34.448 -1.408  -35.050 1.00 56.28  ? 705 DT  T "O4'" 1 
ATOM   8262 C  "C3'" . DT  D 4 5   ? -33.427 -3.363  -34.277 1.00 48.39  ? 705 DT  T "C3'" 1 
ATOM   8263 O  "O3'" . DT  D 4 5   ? -32.168 -3.982  -34.057 1.00 50.58  ? 705 DT  T "O3'" 1 
ATOM   8264 C  "C2'" . DT  D 4 5   ? -33.885 -2.566  -33.064 1.00 44.93  ? 705 DT  T "C2'" 1 
ATOM   8265 C  "C1'" . DT  D 4 5   ? -34.874 -1.594  -33.706 1.00 43.63  ? 705 DT  T "C1'" 1 
ATOM   8266 N  N1    . DT  D 4 5   ? -36.276 -2.103  -33.709 1.00 47.70  ? 705 DT  T N1    1 
ATOM   8267 C  C2    . DT  D 4 5   ? -37.019 -2.022  -32.554 1.00 48.57  ? 705 DT  T C2    1 
ATOM   8268 O  O2    . DT  D 4 5   ? -36.594 -1.543  -31.518 1.00 53.85  ? 705 DT  T O2    1 
ATOM   8269 N  N3    . DT  D 4 5   ? -38.289 -2.522  -32.655 1.00 39.92  ? 705 DT  T N3    1 
ATOM   8270 C  C4    . DT  D 4 5   ? -38.878 -3.085  -33.771 1.00 43.67  ? 705 DT  T C4    1 
ATOM   8271 O  O4    . DT  D 4 5   ? -40.031 -3.505  -33.763 1.00 48.28  ? 705 DT  T O4    1 
ATOM   8272 C  C5    . DT  D 4 5   ? -38.044 -3.142  -34.949 1.00 47.67  ? 705 DT  T C5    1 
ATOM   8273 C  C7    . DT  D 4 5   ? -38.575 -3.732  -36.221 1.00 43.18  ? 705 DT  T C7    1 
ATOM   8274 C  C6    . DT  D 4 5   ? -36.797 -2.655  -34.861 1.00 41.51  ? 705 DT  T C6    1 
ATOM   8275 P  P     . DC  D 4 6   ? -32.107 -5.507  -33.553 1.00 45.94  ? 706 DC  T P     1 
ATOM   8276 O  OP1   . DC  D 4 6   ? -30.692 -5.936  -33.576 1.00 42.68  ? 706 DC  T OP1   1 
ATOM   8277 O  OP2   . DC  D 4 6   ? -33.126 -6.269  -34.309 1.00 52.52  ? 706 DC  T OP2   1 
ATOM   8278 O  "O5'" . DC  D 4 6   ? -32.589 -5.428  -32.030 1.00 40.67  ? 706 DC  T "O5'" 1 
ATOM   8279 C  "C5'" . DC  D 4 6   ? -31.850 -4.652  -31.094 1.00 43.27  ? 706 DC  T "C5'" 1 
ATOM   8280 C  "C4'" . DC  D 4 6   ? -32.503 -4.686  -29.725 1.00 36.99  ? 706 DC  T "C4'" 1 
ATOM   8281 O  "O4'" . DC  D 4 6   ? -33.802 -4.049  -29.785 1.00 38.31  ? 706 DC  T "O4'" 1 
ATOM   8282 C  "C3'" . DC  D 4 6   ? -32.782 -6.075  -29.187 1.00 37.11  ? 706 DC  T "C3'" 1 
ATOM   8283 O  "O3'" . DC  D 4 6   ? -31.623 -6.588  -28.549 1.00 38.42  ? 706 DC  T "O3'" 1 
ATOM   8284 C  "C2'" . DC  D 4 6   ? -33.902 -5.803  -28.190 1.00 33.06  ? 706 DC  T "C2'" 1 
ATOM   8285 C  "C1'" . DC  D 4 6   ? -34.701 -4.712  -28.907 1.00 41.12  ? 706 DC  T "C1'" 1 
ATOM   8286 N  N1    . DC  D 4 6   ? -35.847 -5.239  -29.705 1.00 35.67  ? 706 DC  T N1    1 
ATOM   8287 C  C2    . DC  D 4 6   ? -37.027 -5.624  -29.054 1.00 39.24  ? 706 DC  T C2    1 
ATOM   8288 O  O2    . DC  D 4 6   ? -37.099 -5.522  -27.822 1.00 40.70  ? 706 DC  T O2    1 
ATOM   8289 N  N3    . DC  D 4 6   ? -38.059 -6.099  -29.794 1.00 40.62  ? 706 DC  T N3    1 
ATOM   8290 C  C4    . DC  D 4 6   ? -37.942 -6.198  -31.119 1.00 44.06  ? 706 DC  T C4    1 
ATOM   8291 N  N4    . DC  D 4 6   ? -38.987 -6.675  -31.806 1.00 41.55  ? 706 DC  T N4    1 
ATOM   8292 C  C5    . DC  D 4 6   ? -36.750 -5.809  -31.800 1.00 35.89  ? 706 DC  T C5    1 
ATOM   8293 C  C6    . DC  D 4 6   ? -35.738 -5.341  -31.061 1.00 42.91  ? 706 DC  T C6    1 
ATOM   8294 P  P     . DG  D 4 7   ? -31.220 -8.130  -28.745 1.00 37.01  ? 707 DG  T P     1 
ATOM   8295 O  OP1   . DG  D 4 7   ? -29.780 -8.265  -28.426 1.00 35.59  ? 707 DG  T OP1   1 
ATOM   8296 O  OP2   . DG  D 4 7   ? -31.726 -8.556  -30.069 1.00 43.38  ? 707 DG  T OP2   1 
ATOM   8297 O  "O5'" . DG  D 4 7   ? -32.071 -8.888  -27.623 1.00 34.77  ? 707 DG  T "O5'" 1 
ATOM   8298 C  "C5'" . DG  D 4 7   ? -31.777 -8.671  -26.249 1.00 35.48  ? 707 DG  T "C5'" 1 
ATOM   8299 C  "C4'" . DG  D 4 7   ? -32.930 -9.114  -25.367 1.00 41.65  ? 707 DG  T "C4'" 1 
ATOM   8300 O  "O4'" . DG  D 4 7   ? -34.095 -8.300  -25.642 1.00 32.67  ? 707 DG  T "O4'" 1 
ATOM   8301 C  "C3'" . DG  D 4 7   ? -33.403 -10.536 -25.590 1.00 38.01  ? 707 DG  T "C3'" 1 
ATOM   8302 O  "O3'" . DG  D 4 7   ? -32.591 -11.445 -24.858 1.00 37.05  ? 707 DG  T "O3'" 1 
ATOM   8303 C  "C2'" . DG  D 4 7   ? -34.820 -10.473 -25.033 1.00 33.32  ? 707 DG  T "C2'" 1 
ATOM   8304 C  "C1'" . DG  D 4 7   ? -35.269 -9.084  -25.485 1.00 29.36  ? 707 DG  T "C1'" 1 
ATOM   8305 N  N9    . DG  D 4 7   ? -35.993 -9.100  -26.751 1.00 33.07  ? 707 DG  T N9    1 
ATOM   8306 C  C8    . DG  D 4 7   ? -35.464 -8.947  -28.010 1.00 36.38  ? 707 DG  T C8    1 
ATOM   8307 N  N7    . DG  D 4 7   ? -36.356 -9.013  -28.959 1.00 38.50  ? 707 DG  T N7    1 
ATOM   8308 C  C5    . DG  D 4 7   ? -37.553 -9.227  -28.286 1.00 33.46  ? 707 DG  T C5    1 
ATOM   8309 C  C6    . DG  D 4 7   ? -38.866 -9.385  -28.789 1.00 30.36  ? 707 DG  T C6    1 
ATOM   8310 O  O6    . DG  D 4 7   ? -39.244 -9.362  -29.969 1.00 36.99  ? 707 DG  T O6    1 
ATOM   8311 N  N1    . DG  D 4 7   ? -39.790 -9.584  -27.766 1.00 39.04  ? 707 DG  T N1    1 
ATOM   8312 C  C2    . DG  D 4 7   ? -39.483 -9.627  -26.426 1.00 32.43  ? 707 DG  T C2    1 
ATOM   8313 N  N2    . DG  D 4 7   ? -40.508 -9.829  -25.587 1.00 29.11  ? 707 DG  T N2    1 
ATOM   8314 N  N3    . DG  D 4 7   ? -38.257 -9.482  -25.942 1.00 38.11  ? 707 DG  T N3    1 
ATOM   8315 C  C4    . DG  D 4 7   ? -37.345 -9.286  -26.927 1.00 36.47  ? 707 DG  T C4    1 
ATOM   8316 P  P     . DG  D 4 8   ? -32.538 -12.996 -25.278 1.00 35.49  ? 708 DG  T P     1 
ATOM   8317 O  OP1   . DG  D 4 8   ? -31.439 -13.635 -24.521 1.00 34.68  ? 708 DG  T OP1   1 
ATOM   8318 O  OP2   . DG  D 4 8   ? -32.545 -13.062 -26.756 1.00 40.01  ? 708 DG  T OP2   1 
ATOM   8319 O  "O5'" . DG  D 4 8   ? -33.931 -13.582 -24.754 1.00 33.69  ? 708 DG  T "O5'" 1 
ATOM   8320 C  "C5'" . DG  D 4 8   ? -34.240 -13.541 -23.367 1.00 33.43  ? 708 DG  T "C5'" 1 
ATOM   8321 C  "C4'" . DG  D 4 8   ? -35.671 -13.980 -23.119 1.00 35.05  ? 708 DG  T "C4'" 1 
ATOM   8322 O  "O4'" . DG  D 4 8   ? -36.588 -13.005 -23.677 1.00 36.71  ? 708 DG  T "O4'" 1 
ATOM   8323 C  "C3'" . DG  D 4 8   ? -36.062 -15.292 -23.771 1.00 30.38  ? 708 DG  T "C3'" 1 
ATOM   8324 O  "O3'" . DG  D 4 8   ? -35.679 -16.381 -22.944 1.00 35.29  ? 708 DG  T "O3'" 1 
ATOM   8325 C  "C2'" . DG  D 4 8   ? -37.575 -15.150 -23.853 1.00 29.11  ? 708 DG  T "C2'" 1 
ATOM   8326 C  "C1'" . DG  D 4 8   ? -37.722 -13.671 -24.211 1.00 33.49  ? 708 DG  T "C1'" 1 
ATOM   8327 N  N9    . DG  D 4 8   ? -37.766 -13.423 -25.649 1.00 42.94  ? 708 DG  T N9    1 
ATOM   8328 C  C8    . DG  D 4 8   ? -36.699 -13.178 -26.480 1.00 35.63  ? 708 DG  T C8    1 
ATOM   8329 N  N7    . DG  D 4 8   ? -37.041 -12.993 -27.724 1.00 30.89  ? 708 DG  T N7    1 
ATOM   8330 C  C5    . DG  D 4 8   ? -38.423 -13.126 -27.721 1.00 32.31  ? 708 DG  T C5    1 
ATOM   8331 C  C6    . DG  D 4 8   ? -39.350 -13.029 -28.786 1.00 35.05  ? 708 DG  T C6    1 
ATOM   8332 O  O6    . DG  D 4 8   ? -39.122 -12.798 -29.982 1.00 35.03  ? 708 DG  T O6    1 
ATOM   8333 N  N1    . DG  D 4 8   ? -40.658 -13.228 -28.352 1.00 32.33  ? 708 DG  T N1    1 
ATOM   8334 C  C2    . DG  D 4 8   ? -41.023 -13.490 -27.052 1.00 35.37  ? 708 DG  T C2    1 
ATOM   8335 N  N2    . DG  D 4 8   ? -42.334 -13.654 -26.825 1.00 40.65  ? 708 DG  T N2    1 
ATOM   8336 N  N3    . DG  D 4 8   ? -40.164 -13.583 -26.044 1.00 33.51  ? 708 DG  T N3    1 
ATOM   8337 C  C4    . DG  D 4 8   ? -38.886 -13.390 -26.451 1.00 35.05  ? 708 DG  T C4    1 
ATOM   8338 P  P     . DC  D 4 9   ? -34.953 -17.663 -23.585 1.00 32.89  ? 709 DC  T P     1 
ATOM   8339 O  OP1   . DC  D 4 9   ? -34.249 -18.369 -22.492 1.00 46.46  ? 709 DC  T OP1   1 
ATOM   8340 O  OP2   . DC  D 4 9   ? -34.202 -17.210 -24.777 1.00 37.32  ? 709 DC  T OP2   1 
ATOM   8341 O  "O5'" . DC  D 4 9   ? -36.165 -18.575 -24.088 1.00 29.62  ? 709 DC  T "O5'" 1 
ATOM   8342 C  "C5'" . DC  D 4 9   ? -37.135 -19.035 -23.157 1.00 25.62  ? 709 DC  T "C5'" 1 
ATOM   8343 C  "C4'" . DC  D 4 9   ? -38.461 -19.297 -23.846 1.00 34.44  ? 709 DC  T "C4'" 1 
ATOM   8344 O  "O4'" . DC  D 4 9   ? -38.957 -18.066 -24.423 1.00 30.96  ? 709 DC  T "O4'" 1 
ATOM   8345 C  "C3'" . DC  D 4 9   ? -38.398 -20.258 -25.016 1.00 40.87  ? 709 DC  T "C3'" 1 
ATOM   8346 O  "O3'" . DC  D 4 9   ? -38.458 -21.602 -24.558 1.00 45.27  ? 709 DC  T "O3'" 1 
ATOM   8347 C  "C2'" . DC  D 4 9   ? -39.650 -19.871 -25.794 1.00 36.93  ? 709 DC  T "C2'" 1 
ATOM   8348 C  "C1'" . DC  D 4 9   ? -39.670 -18.353 -25.617 1.00 35.20  ? 709 DC  T "C1'" 1 
ATOM   8349 N  N1    . DC  D 4 9   ? -39.035 -17.619 -26.750 1.00 36.94  ? 709 DC  T N1    1 
ATOM   8350 C  C2    . DC  D 4 9   ? -39.803 -17.282 -27.871 1.00 42.61  ? 709 DC  T C2    1 
ATOM   8351 O  O2    . DC  D 4 9   ? -41.000 -17.593 -27.896 1.00 41.96  ? 709 DC  T O2    1 
ATOM   8352 N  N3    . DC  D 4 9   ? -39.214 -16.618 -28.897 1.00 40.30  ? 709 DC  T N3    1 
ATOM   8353 C  C4    . DC  D 4 9   ? -37.920 -16.300 -28.830 1.00 41.01  ? 709 DC  T C4    1 
ATOM   8354 N  N4    . DC  D 4 9   ? -37.383 -15.644 -29.867 1.00 31.39  ? 709 DC  T N4    1 
ATOM   8355 C  C5    . DC  D 4 9   ? -37.119 -16.638 -27.698 1.00 33.52  ? 709 DC  T C5    1 
ATOM   8356 C  C6    . DC  D 4 9   ? -37.711 -17.291 -26.692 1.00 33.91  ? 709 DC  T C6    1 
ATOM   8357 P  P     . DG  D 4 10  ? -37.878 -22.790 -25.473 1.00 39.69  ? 710 DG  T P     1 
ATOM   8358 O  OP1   . DG  D 4 10  ? -37.949 -24.043 -24.688 1.00 49.29  ? 710 DG  T OP1   1 
ATOM   8359 O  OP2   . DG  D 4 10  ? -36.584 -22.336 -26.029 1.00 46.27  ? 710 DG  T OP2   1 
ATOM   8360 O  "O5'" . DG  D 4 10  ? -38.918 -22.887 -26.683 1.00 42.75  ? 710 DG  T "O5'" 1 
ATOM   8361 C  "C5'" . DG  D 4 10  ? -40.255 -23.305 -26.440 1.00 41.70  ? 710 DG  T "C5'" 1 
ATOM   8362 C  "C4'" . DG  D 4 10  ? -41.085 -23.208 -27.706 1.00 43.82  ? 710 DG  T "C4'" 1 
ATOM   8363 O  "O4'" . DG  D 4 10  ? -41.167 -21.826 -28.124 1.00 38.32  ? 710 DG  T "O4'" 1 
ATOM   8364 C  "C3'" . DG  D 4 10  ? -40.511 -23.947 -28.902 1.00 44.10  ? 710 DG  T "C3'" 1 
ATOM   8365 O  "O3'" . DG  D 4 10  ? -40.944 -25.301 -28.882 1.00 53.79  ? 710 DG  T "O3'" 1 
ATOM   8366 C  "C2'" . DG  D 4 10  ? -41.118 -23.181 -30.074 1.00 42.71  ? 710 DG  T "C2'" 1 
ATOM   8367 C  "C1'" . DG  D 4 10  ? -41.161 -21.747 -29.540 1.00 46.18  ? 710 DG  T "C1'" 1 
ATOM   8368 N  N9    . DG  D 4 10  ? -40.024 -20.931 -29.957 1.00 45.70  ? 710 DG  T N9    1 
ATOM   8369 C  C8    . DG  D 4 10  ? -38.927 -20.591 -29.202 1.00 37.87  ? 710 DG  T C8    1 
ATOM   8370 N  N7    . DG  D 4 10  ? -38.066 -19.847 -29.840 1.00 42.19  ? 710 DG  T N7    1 
ATOM   8371 C  C5    . DG  D 4 10  ? -38.627 -19.683 -31.100 1.00 40.02  ? 710 DG  T C5    1 
ATOM   8372 C  C6    . DG  D 4 10  ? -38.148 -18.971 -32.225 1.00 40.82  ? 710 DG  T C6    1 
ATOM   8373 O  O6    . DG  D 4 10  ? -37.098 -18.323 -32.334 1.00 46.37  ? 710 DG  T O6    1 
ATOM   8374 N  N1    . DG  D 4 10  ? -39.026 -19.060 -33.303 1.00 43.29  ? 710 DG  T N1    1 
ATOM   8375 C  C2    . DG  D 4 10  ? -40.214 -19.751 -33.295 1.00 44.94  ? 710 DG  T C2    1 
ATOM   8376 N  N2    . DG  D 4 10  ? -40.927 -19.723 -34.430 1.00 42.64  ? 710 DG  T N2    1 
ATOM   8377 N  N3    . DG  D 4 10  ? -40.675 -20.422 -32.247 1.00 42.90  ? 710 DG  T N3    1 
ATOM   8378 C  C4    . DG  D 4 10  ? -39.832 -20.344 -31.188 1.00 40.27  ? 710 DG  T C4    1 
ATOM   8379 P  P     . DC  D 4 11  ? -39.977 -26.473 -29.405 1.00 47.27  ? 711 DC  T P     1 
ATOM   8380 O  OP1   . DC  D 4 11  ? -40.561 -27.761 -28.971 1.00 56.09  ? 711 DC  T OP1   1 
ATOM   8381 O  OP2   . DC  D 4 11  ? -38.591 -26.125 -29.018 1.00 49.58  ? 711 DC  T OP2   1 
ATOM   8382 O  "O5'" . DC  D 4 11  ? -40.082 -26.372 -30.996 1.00 49.16  ? 711 DC  T "O5'" 1 
ATOM   8383 C  "C5'" . DC  D 4 11  ? -41.348 -26.486 -31.632 1.00 44.97  ? 711 DC  T "C5'" 1 
ATOM   8384 C  "C4'" . DC  D 4 11  ? -41.272 -25.987 -33.063 1.00 58.21  ? 711 DC  T "C4'" 1 
ATOM   8385 O  "O4'" . DC  D 4 11  ? -40.905 -24.595 -33.058 1.00 55.53  ? 711 DC  T "O4'" 1 
ATOM   8386 C  "C3'" . DC  D 4 11  ? -40.227 -26.679 -33.920 1.00 50.63  ? 711 DC  T "C3'" 1 
ATOM   8387 O  "O3'" . DC  D 4 11  ? -40.818 -27.800 -34.571 1.00 65.53  ? 711 DC  T "O3'" 1 
ATOM   8388 C  "C2'" . DC  D 4 11  ? -39.820 -25.600 -34.927 1.00 49.09  ? 711 DC  T "C2'" 1 
ATOM   8389 C  "C1'" . DC  D 4 11  ? -40.156 -24.285 -34.214 1.00 45.14  ? 711 DC  T "C1'" 1 
ATOM   8390 N  N1    . DC  D 4 11  ? -38.960 -23.500 -33.799 1.00 45.98  ? 711 DC  T N1    1 
ATOM   8391 C  C2    . DC  D 4 11  ? -38.390 -22.582 -34.688 1.00 49.10  ? 711 DC  T C2    1 
ATOM   8392 O  O2    . DC  D 4 11  ? -38.885 -22.446 -35.814 1.00 47.06  ? 711 DC  T O2    1 
ATOM   8393 N  N3    . DC  D 4 11  ? -37.308 -21.870 -34.289 1.00 49.15  ? 711 DC  T N3    1 
ATOM   8394 C  C4    . DC  D 4 11  ? -36.803 -22.047 -33.068 1.00 50.12  ? 711 DC  T C4    1 
ATOM   8395 N  N4    . DC  D 4 11  ? -35.733 -21.323 -32.722 1.00 37.58  ? 711 DC  T N4    1 
ATOM   8396 C  C5    . DC  D 4 11  ? -37.373 -22.977 -32.147 1.00 36.46  ? 711 DC  T C5    1 
ATOM   8397 C  C6    . DC  D 4 11  ? -38.441 -23.672 -32.550 1.00 44.28  ? 711 DC  T C6    1 
ATOM   8398 P  P     . DC  D 4 12  ? -39.945 -29.103 -34.920 1.00 73.51  ? 712 DC  T P     1 
ATOM   8399 O  OP1   . DC  D 4 12  ? -40.890 -30.177 -35.302 1.00 59.73  ? 712 DC  T OP1   1 
ATOM   8400 O  OP2   . DC  D 4 12  ? -38.985 -29.325 -33.816 1.00 57.73  ? 712 DC  T OP2   1 
ATOM   8401 O  "O5'" . DC  D 4 12  ? -39.112 -28.668 -36.211 1.00 55.42  ? 712 DC  T "O5'" 1 
ATOM   8402 C  "C5'" . DC  D 4 12  ? -39.786 -28.211 -37.377 1.00 61.24  ? 712 DC  T "C5'" 1 
ATOM   8403 C  "C4'" . DC  D 4 12  ? -38.791 -27.671 -38.385 1.00 62.52  ? 712 DC  T "C4'" 1 
ATOM   8404 O  "O4'" . DC  D 4 12  ? -38.199 -26.448 -37.872 1.00 64.60  ? 712 DC  T "O4'" 1 
ATOM   8405 C  "C3'" . DC  D 4 12  ? -37.626 -28.616 -38.697 1.00 68.10  ? 712 DC  T "C3'" 1 
ATOM   8406 O  "O3'" . DC  D 4 12  ? -37.455 -28.747 -40.100 1.00 79.65  ? 712 DC  T "O3'" 1 
ATOM   8407 C  "C2'" . DC  D 4 12  ? -36.421 -27.940 -38.044 1.00 63.83  ? 712 DC  T "C2'" 1 
ATOM   8408 C  "C1'" . DC  D 4 12  ? -36.812 -26.475 -38.101 1.00 64.28  ? 712 DC  T "C1'" 1 
ATOM   8409 N  N1    . DC  D 4 12  ? -36.139 -25.649 -37.059 1.00 52.91  ? 712 DC  T N1    1 
ATOM   8410 C  C2    . DC  D 4 12  ? -35.372 -24.543 -37.440 1.00 56.78  ? 712 DC  T C2    1 
ATOM   8411 O  O2    . DC  D 4 12  ? -35.276 -24.259 -38.640 1.00 61.38  ? 712 DC  T O2    1 
ATOM   8412 N  N3    . DC  D 4 12  ? -34.759 -23.809 -36.479 1.00 50.38  ? 712 DC  T N3    1 
ATOM   8413 C  C4    . DC  D 4 12  ? -34.888 -24.148 -35.195 1.00 50.09  ? 712 DC  T C4    1 
ATOM   8414 N  N4    . DC  D 4 12  ? -34.263 -23.394 -34.285 1.00 55.86  ? 712 DC  T N4    1 
ATOM   8415 C  C5    . DC  D 4 12  ? -35.661 -25.274 -34.789 1.00 50.11  ? 712 DC  T C5    1 
ATOM   8416 C  C6    . DC  D 4 12  ? -36.261 -25.991 -35.744 1.00 50.09  ? 712 DC  T C6    1 
ATOM   8417 P  P     . DC  D 4 13  ? -36.501 -29.899 -40.688 1.00 77.79  ? 713 DC  T P     1 
ATOM   8418 O  OP1   . DC  D 4 13  ? -37.178 -30.483 -41.867 1.00 67.28  ? 713 DC  T OP1   1 
ATOM   8419 O  OP2   . DC  D 4 13  ? -36.099 -30.772 -39.562 1.00 75.67  ? 713 DC  T OP2   1 
ATOM   8420 O  "O5'" . DC  D 4 13  ? -35.199 -29.105 -41.175 1.00 76.26  ? 713 DC  T "O5'" 1 
ATOM   8421 C  "C5'" . DC  D 4 13  ? -35.297 -28.171 -42.243 1.00 69.86  ? 713 DC  T "C5'" 1 
ATOM   8422 C  "C4'" . DC  D 4 13  ? -34.134 -27.195 -42.220 1.00 71.70  ? 713 DC  T "C4'" 1 
ATOM   8423 O  "O4'" . DC  D 4 13  ? -34.116 -26.500 -40.962 1.00 69.67  ? 713 DC  T "O4'" 1 
ATOM   8424 C  "C3'" . DC  D 4 13  ? -32.760 -27.830 -42.323 1.00 72.57  ? 713 DC  T "C3'" 1 
ATOM   8425 O  "O3'" . DC  D 4 13  ? -32.404 -27.987 -43.694 1.00 81.85  ? 713 DC  T "O3'" 1 
ATOM   8426 C  "C2'" . DC  D 4 13  ? -31.852 -26.810 -41.621 1.00 65.52  ? 713 DC  T "C2'" 1 
ATOM   8427 C  "C1'" . DC  D 4 13  ? -32.814 -26.009 -40.731 1.00 60.99  ? 713 DC  T "C1'" 1 
ATOM   8428 N  N1    . DC  D 4 13  ? -32.514 -26.117 -39.273 1.00 57.67  ? 713 DC  T N1    1 
ATOM   8429 C  C2    . DC  D 4 13  ? -31.648 -25.195 -38.674 1.00 59.31  ? 713 DC  T C2    1 
ATOM   8430 O  O2    . DC  D 4 13  ? -31.139 -24.306 -39.367 1.00 56.62  ? 713 DC  T O2    1 
ATOM   8431 N  N3    . DC  D 4 13  ? -31.388 -25.305 -37.347 1.00 54.73  ? 713 DC  T N3    1 
ATOM   8432 C  C4    . DC  D 4 13  ? -31.956 -26.279 -36.634 1.00 61.38  ? 713 DC  T C4    1 
ATOM   8433 N  N4    . DC  D 4 13  ? -31.670 -26.346 -35.329 1.00 53.71  ? 713 DC  T N4    1 
ATOM   8434 C  C5    . DC  D 4 13  ? -32.842 -27.226 -37.227 1.00 57.84  ? 713 DC  T C5    1 
ATOM   8435 C  C6    . DC  D 4 13  ? -33.089 -27.109 -38.536 1.00 57.28  ? 713 DC  T C6    1 
ATOM   8436 P  P     . DG  D 4 14  ? -31.188 -28.950 -44.116 1.00 82.10  ? 714 DG  T P     1 
ATOM   8437 O  OP1   . DG  D 4 14  ? -31.311 -29.210 -45.567 1.00 88.44  ? 714 DG  T OP1   1 
ATOM   8438 O  OP2   . DG  D 4 14  ? -31.157 -30.082 -43.164 1.00 81.91  ? 714 DG  T OP2   1 
ATOM   8439 O  "O5'" . DG  D 4 14  ? -29.883 -28.060 -43.866 1.00 56.96  ? 714 DG  T "O5'" 1 
ATOM   8440 C  "C5'" . DG  D 4 14  ? -29.724 -26.825 -44.553 1.00 64.25  ? 714 DG  T "C5'" 1 
ATOM   8441 C  "C4'" . DG  D 4 14  ? -28.552 -26.039 -43.992 1.00 59.98  ? 714 DG  T "C4'" 1 
ATOM   8442 O  "O4'" . DG  D 4 14  ? -28.766 -25.786 -42.578 1.00 74.61  ? 714 DG  T "O4'" 1 
ATOM   8443 C  "C3'" . DG  D 4 14  ? -27.194 -26.736 -44.099 1.00 71.90  ? 714 DG  T "C3'" 1 
ATOM   8444 O  "O3'" . DG  D 4 14  ? -26.195 -25.792 -44.458 1.00 79.77  ? 714 DG  T "O3'" 1 
ATOM   8445 C  "C2'" . DG  D 4 14  ? -26.972 -27.278 -42.690 1.00 69.78  ? 714 DG  T "C2'" 1 
ATOM   8446 C  "C1'" . DG  D 4 14  ? -27.637 -26.205 -41.845 1.00 67.63  ? 714 DG  T "C1'" 1 
ATOM   8447 N  N9    . DG  D 4 14  ? -28.084 -26.688 -40.542 1.00 65.16  ? 714 DG  T N9    1 
ATOM   8448 C  C8    . DG  D 4 14  ? -28.879 -27.781 -40.294 1.00 60.66  ? 714 DG  T C8    1 
ATOM   8449 N  N7    . DG  D 4 14  ? -29.119 -27.973 -39.027 1.00 68.54  ? 714 DG  T N7    1 
ATOM   8450 C  C5    . DG  D 4 14  ? -28.437 -26.942 -38.393 1.00 59.93  ? 714 DG  T C5    1 
ATOM   8451 C  C6    . DG  D 4 14  ? -28.331 -26.633 -37.016 1.00 56.66  ? 714 DG  T C6    1 
ATOM   8452 O  O6    . DG  D 4 14  ? -28.834 -27.232 -36.054 1.00 61.96  ? 714 DG  T O6    1 
ATOM   8453 N  N1    . DG  D 4 14  ? -27.545 -25.504 -36.801 1.00 53.42  ? 714 DG  T N1    1 
ATOM   8454 C  C2    . DG  D 4 14  ? -26.941 -24.766 -37.791 1.00 58.40  ? 714 DG  T C2    1 
ATOM   8455 N  N2    . DG  D 4 14  ? -26.222 -23.708 -37.389 1.00 54.51  ? 714 DG  T N2    1 
ATOM   8456 N  N3    . DG  D 4 14  ? -27.034 -25.043 -39.086 1.00 59.02  ? 714 DG  T N3    1 
ATOM   8457 C  C4    . DG  D 4 14  ? -27.796 -26.142 -39.311 1.00 63.10  ? 714 DG  T C4    1 
ATOM   8458 P  P     . DA  D 4 15  ? -24.744 -26.286 -44.943 1.00 80.55  ? 715 DA  T P     1 
ATOM   8459 O  OP1   . DA  D 4 15  ? -24.476 -25.655 -46.254 1.00 80.98  ? 715 DA  T OP1   1 
ATOM   8460 O  OP2   . DA  D 4 15  ? -24.686 -27.759 -44.815 1.00 78.43  ? 715 DA  T OP2   1 
ATOM   8461 O  "O5'" . DA  D 4 15  ? -23.750 -25.657 -43.861 1.00 69.35  ? 715 DA  T "O5'" 1 
ATOM   8462 C  "C5'" . DA  D 4 15  ? -23.696 -24.247 -43.686 1.00 74.96  ? 715 DA  T "C5'" 1 
ATOM   8463 C  "C4'" . DA  D 4 15  ? -22.897 -23.883 -42.448 1.00 80.15  ? 715 DA  T "C4'" 1 
ATOM   8464 O  "O4'" . DA  D 4 15  ? -23.606 -24.329 -41.263 1.00 83.07  ? 715 DA  T "O4'" 1 
ATOM   8465 C  "C3'" . DA  D 4 15  ? -21.503 -24.501 -42.371 1.00 85.40  ? 715 DA  T "C3'" 1 
ATOM   8466 O  "O3'" . DA  D 4 15  ? -20.575 -23.544 -41.878 1.00 84.13  ? 715 DA  T "O3'" 1 
ATOM   8467 C  "C2'" . DA  D 4 15  ? -21.685 -25.665 -41.398 1.00 79.18  ? 715 DA  T "C2'" 1 
ATOM   8468 C  "C1'" . DA  D 4 15  ? -22.756 -25.123 -40.464 1.00 76.41  ? 715 DA  T "C1'" 1 
ATOM   8469 N  N9    . DA  D 4 15  ? -23.563 -26.166 -39.838 1.00 72.06  ? 715 DA  T N9    1 
ATOM   8470 C  C8    . DA  D 4 15  ? -24.236 -27.176 -40.469 1.00 65.59  ? 715 DA  T C8    1 
ATOM   8471 N  N7    . DA  D 4 15  ? -24.887 -27.970 -39.651 1.00 63.37  ? 715 DA  T N7    1 
ATOM   8472 C  C5    . DA  D 4 15  ? -24.624 -27.443 -38.397 1.00 59.48  ? 715 DA  T C5    1 
ATOM   8473 C  C6    . DA  D 4 15  ? -25.027 -27.827 -37.103 1.00 52.77  ? 715 DA  T C6    1 
ATOM   8474 N  N6    . DA  D 4 15  ? -25.812 -28.882 -36.860 1.00 52.04  ? 715 DA  T N6    1 
ATOM   8475 N  N1    . DA  D 4 15  ? -24.587 -27.084 -36.065 1.00 63.77  ? 715 DA  T N1    1 
ATOM   8476 C  C2    . DA  D 4 15  ? -23.801 -26.029 -36.313 1.00 69.02  ? 715 DA  T C2    1 
ATOM   8477 N  N3    . DA  D 4 15  ? -23.359 -25.570 -37.483 1.00 68.55  ? 715 DA  T N3    1 
ATOM   8478 C  C4    . DA  D 4 15  ? -23.810 -26.329 -38.494 1.00 67.26  ? 715 DA  T C4    1 
ATOM   8479 P  P     . DA  D 4 16  ? -18.996 -23.783 -42.050 1.00 101.84 ? 716 DA  T P     1 
ATOM   8480 O  OP1   . DA  D 4 16  ? -18.371 -22.468 -42.319 1.00 83.48  ? 716 DA  T OP1   1 
ATOM   8481 O  OP2   . DA  D 4 16  ? -18.809 -24.894 -43.008 1.00 89.28  ? 716 DA  T OP2   1 
ATOM   8482 O  "O5'" . DA  D 4 16  ? -18.529 -24.291 -40.606 1.00 93.14  ? 716 DA  T "O5'" 1 
ATOM   8483 C  "C5'" . DA  D 4 16  ? -18.678 -23.439 -39.475 1.00 88.11  ? 716 DA  T "C5'" 1 
ATOM   8484 C  "C4'" . DA  D 4 16  ? -18.494 -24.210 -38.180 1.00 82.54  ? 716 DA  T "C4'" 1 
ATOM   8485 O  "O4'" . DA  D 4 16  ? -19.613 -25.111 -37.977 1.00 79.39  ? 716 DA  T "O4'" 1 
ATOM   8486 C  "C3'" . DA  D 4 16  ? -17.229 -25.077 -38.109 1.00 82.63  ? 716 DA  T "C3'" 1 
ATOM   8487 O  "O3'" . DA  D 4 16  ? -16.497 -24.772 -36.927 1.00 93.41  ? 716 DA  T "O3'" 1 
ATOM   8488 C  "C2'" . DA  D 4 16  ? -17.773 -26.508 -38.079 1.00 75.40  ? 716 DA  T "C2'" 1 
ATOM   8489 C  "C1'" . DA  D 4 16  ? -19.123 -26.301 -37.420 1.00 67.92  ? 716 DA  T "C1'" 1 
ATOM   8490 N  N9    . DA  D 4 16  ? -20.074 -27.380 -37.676 1.00 68.16  ? 716 DA  T N9    1 
ATOM   8491 C  C8    . DA  D 4 16  ? -20.368 -27.953 -38.882 1.00 59.95  ? 716 DA  T C8    1 
ATOM   8492 N  N7    . DA  D 4 16  ? -21.262 -28.912 -38.807 1.00 57.96  ? 716 DA  T N7    1 
ATOM   8493 C  C5    . DA  D 4 16  ? -21.573 -28.973 -37.459 1.00 58.89  ? 716 DA  T C5    1 
ATOM   8494 C  C6    . DA  D 4 16  ? -22.457 -29.788 -36.723 1.00 64.15  ? 716 DA  T C6    1 
ATOM   8495 N  N6    . DA  D 4 16  ? -23.221 -30.734 -37.279 1.00 48.96  ? 716 DA  T N6    1 
ATOM   8496 N  N1    . DA  D 4 16  ? -22.527 -29.589 -35.389 1.00 59.71  ? 716 DA  T N1    1 
ATOM   8497 C  C2    . DA  D 4 16  ? -21.762 -28.640 -34.837 1.00 58.28  ? 716 DA  T C2    1 
ATOM   8498 N  N3    . DA  D 4 16  ? -20.894 -27.817 -35.424 1.00 62.68  ? 716 DA  T N3    1 
ATOM   8499 C  C4    . DA  D 4 16  ? -20.847 -28.037 -36.747 1.00 66.11  ? 716 DA  T C4    1 
ATOM   8500 P  P     . DC  D 4 17  ? -14.942 -25.162 -36.808 1.00 129.07 ? 717 DC  T P     1 
ATOM   8501 O  OP1   . DC  D 4 17  ? -14.434 -24.600 -35.537 1.00 112.20 ? 717 DC  T OP1   1 
ATOM   8502 O  OP2   . DC  D 4 17  ? -14.287 -24.800 -38.084 1.00 109.80 ? 717 DC  T OP2   1 
ATOM   8503 O  "O5'" . DC  D 4 17  ? -14.948 -26.758 -36.699 1.00 92.52  ? 717 DC  T "O5'" 1 
ATOM   8504 C  "C5'" . DC  D 4 17  ? -14.423 -27.396 -35.543 1.00 78.42  ? 717 DC  T "C5'" 1 
ATOM   8505 C  "C4'" . DC  D 4 17  ? -15.481 -27.516 -34.460 1.00 77.61  ? 717 DC  T "C4'" 1 
ATOM   8506 O  "O4'" . DC  D 4 17  ? -16.773 -27.701 -35.075 1.00 80.40  ? 717 DC  T "O4'" 1 
ATOM   8507 C  "C3'" . DC  D 4 17  ? -15.289 -28.695 -33.522 1.00 71.14  ? 717 DC  T "C3'" 1 
ATOM   8508 O  "O3'" . DC  D 4 17  ? -14.549 -28.276 -32.379 1.00 78.31  ? 717 DC  T "O3'" 1 
ATOM   8509 C  "C2'" . DC  D 4 17  ? -16.716 -29.097 -33.141 1.00 70.12  ? 717 DC  T "C2'" 1 
ATOM   8510 C  "C1'" . DC  D 4 17  ? -17.575 -28.563 -34.295 1.00 76.68  ? 717 DC  T "C1'" 1 
ATOM   8511 N  N1    . DC  D 4 17  ? -18.129 -29.622 -35.196 1.00 67.14  ? 717 DC  T N1    1 
ATOM   8512 C  C2    . DC  D 4 17  ? -19.081 -30.532 -34.714 1.00 60.47  ? 717 DC  T C2    1 
ATOM   8513 O  O2    . DC  D 4 17  ? -19.449 -30.459 -33.536 1.00 62.50  ? 717 DC  T O2    1 
ATOM   8514 N  N3    . DC  D 4 17  ? -19.573 -31.474 -35.558 1.00 56.70  ? 717 DC  T N3    1 
ATOM   8515 C  C4    . DC  D 4 17  ? -19.155 -31.522 -36.824 1.00 55.51  ? 717 DC  T C4    1 
ATOM   8516 N  N4    . DC  D 4 17  ? -19.668 -32.468 -37.617 1.00 53.34  ? 717 DC  T N4    1 
ATOM   8517 C  C5    . DC  D 4 17  ? -18.192 -30.603 -37.333 1.00 55.86  ? 717 DC  T C5    1 
ATOM   8518 C  C6    . DC  D 4 17  ? -17.714 -29.679 -36.494 1.00 63.33  ? 717 DC  T C6    1 
ATOM   8519 P  P     . DA  D 4 18  ? -13.300 -29.140 -31.854 1.00 79.06  ? 718 DA  T P     1 
ATOM   8520 O  OP1   . DA  D 4 18  ? -12.575 -28.324 -30.854 1.00 73.58  ? 718 DA  T OP1   1 
ATOM   8521 O  OP2   . DA  D 4 18  ? -12.583 -29.659 -33.040 1.00 68.60  ? 718 DA  T OP2   1 
ATOM   8522 O  "O5'" . DA  D 4 18  ? -13.981 -30.379 -31.111 1.00 70.71  ? 718 DA  T "O5'" 1 
ATOM   8523 C  "C5'" . DA  D 4 18  ? -14.893 -30.154 -30.043 1.00 68.78  ? 718 DA  T "C5'" 1 
ATOM   8524 C  "C4'" . DA  D 4 18  ? -15.498 -31.462 -29.568 1.00 66.42  ? 718 DA  T "C4'" 1 
ATOM   8525 O  "O4'" . DA  D 4 18  ? -16.420 -31.961 -30.571 1.00 74.10  ? 718 DA  T "O4'" 1 
ATOM   8526 C  "C3'" . DA  D 4 18  ? -14.492 -32.582 -29.317 1.00 71.26  ? 718 DA  T "C3'" 1 
ATOM   8527 O  "O3'" . DA  D 4 18  ? -14.859 -33.315 -28.159 1.00 74.49  ? 718 DA  T "O3'" 1 
ATOM   8528 C  "C2'" . DA  D 4 18  ? -14.587 -33.433 -30.581 1.00 70.53  ? 718 DA  T "C2'" 1 
ATOM   8529 C  "C1'" . DA  D 4 18  ? -16.050 -33.265 -30.966 1.00 67.92  ? 718 DA  T "C1'" 1 
ATOM   8530 N  N9    . DA  D 4 18  ? -16.287 -33.391 -32.401 1.00 65.27  ? 718 DA  T N9    1 
ATOM   8531 C  C8    . DA  D 4 18  ? -15.681 -32.684 -33.401 1.00 59.51  ? 718 DA  T C8    1 
ATOM   8532 N  N7    . DA  D 4 18  ? -16.092 -33.007 -34.604 1.00 49.12  ? 718 DA  T N7    1 
ATOM   8533 C  C5    . DA  D 4 18  ? -17.035 -33.995 -34.378 1.00 55.13  ? 718 DA  T C5    1 
ATOM   8534 C  C6    . DA  D 4 18  ? -17.843 -34.752 -35.248 1.00 53.80  ? 718 DA  T C6    1 
ATOM   8535 N  N6    . DA  D 4 18  ? -17.819 -34.619 -36.578 1.00 50.01  ? 718 DA  T N6    1 
ATOM   8536 N  N1    . DA  D 4 18  ? -18.678 -35.657 -34.697 1.00 45.52  ? 718 DA  T N1    1 
ATOM   8537 C  C2    . DA  D 4 18  ? -18.698 -35.789 -33.365 1.00 55.79  ? 718 DA  T C2    1 
ATOM   8538 N  N3    . DA  D 4 18  ? -17.988 -35.135 -32.447 1.00 57.46  ? 718 DA  T N3    1 
ATOM   8539 C  C4    . DA  D 4 18  ? -17.169 -34.244 -33.025 1.00 58.18  ? 718 DA  T C4    1 
ATOM   8540 P  P     . DG  D 4 19  ? -13.800 -34.298 -27.459 1.00 78.50  ? 719 DG  T P     1 
ATOM   8541 O  OP1   . DG  D 4 19  ? -13.931 -34.140 -25.994 1.00 73.63  ? 719 DG  T OP1   1 
ATOM   8542 O  OP2   . DG  D 4 19  ? -12.487 -34.086 -28.108 1.00 65.24  ? 719 DG  T OP2   1 
ATOM   8543 O  "O5'" . DG  D 4 19  ? -14.311 -35.755 -27.866 1.00 68.23  ? 719 DG  T "O5'" 1 
ATOM   8544 C  "C5'" . DG  D 4 19  ? -15.627 -36.164 -27.525 1.00 75.70  ? 719 DG  T "C5'" 1 
ATOM   8545 C  "C4'" . DG  D 4 19  ? -15.931 -37.524 -28.118 1.00 75.02  ? 719 DG  T "C4'" 1 
ATOM   8546 O  "O4'" . DG  D 4 19  ? -16.288 -37.374 -29.516 1.00 71.67  ? 719 DG  T "O4'" 1 
ATOM   8547 C  "C3'" . DG  D 4 19  ? -14.768 -38.516 -28.073 1.00 70.16  ? 719 DG  T "C3'" 1 
ATOM   8548 O  "O3'" . DG  D 4 19  ? -15.232 -39.783 -27.638 1.00 76.55  ? 719 DG  T "O3'" 1 
ATOM   8549 C  "C2'" . DG  D 4 19  ? -14.277 -38.558 -29.521 1.00 65.61  ? 719 DG  T "C2'" 1 
ATOM   8550 C  "C1'" . DG  D 4 19  ? -15.562 -38.300 -30.288 1.00 69.91  ? 719 DG  T "C1'" 1 
ATOM   8551 N  N9    . DG  D 4 19  ? -15.345 -37.726 -31.612 1.00 60.72  ? 719 DG  T N9    1 
ATOM   8552 C  C8    . DG  D 4 19  ? -14.463 -36.727 -31.947 1.00 58.79  ? 719 DG  T C8    1 
ATOM   8553 N  N7    . DG  D 4 19  ? -14.487 -36.416 -33.213 1.00 58.82  ? 719 DG  T N7    1 
ATOM   8554 C  C5    . DG  D 4 19  ? -15.449 -37.260 -33.752 1.00 55.86  ? 719 DG  T C5    1 
ATOM   8555 C  C6    . DG  D 4 19  ? -15.914 -37.383 -35.083 1.00 49.65  ? 719 DG  T C6    1 
ATOM   8556 O  O6    . DG  D 4 19  ? -15.555 -36.745 -36.083 1.00 48.15  ? 719 DG  T O6    1 
ATOM   8557 N  N1    . DG  D 4 19  ? -16.897 -38.363 -35.198 1.00 53.78  ? 719 DG  T N1    1 
ATOM   8558 C  C2    . DG  D 4 19  ? -17.370 -39.128 -34.158 1.00 53.42  ? 719 DG  T C2    1 
ATOM   8559 N  N2    . DG  D 4 19  ? -18.321 -40.023 -34.464 1.00 51.75  ? 719 DG  T N2    1 
ATOM   8560 N  N3    . DG  D 4 19  ? -16.944 -39.023 -32.907 1.00 59.69  ? 719 DG  T N3    1 
ATOM   8561 C  C4    . DG  D 4 19  ? -15.986 -38.073 -32.778 1.00 56.09  ? 719 DG  T C4    1 
ATOM   8562 P  P     . DG  D 4 20  ? -14.192 -40.903 -27.144 1.00 80.19  ? 720 DG  T P     1 
ATOM   8563 O  OP1   . DG  D 4 20  ? -14.645 -41.384 -25.820 1.00 68.24  ? 720 DG  T OP1   1 
ATOM   8564 O  OP2   . DG  D 4 20  ? -12.823 -40.362 -27.300 1.00 73.17  ? 720 DG  T OP2   1 
ATOM   8565 O  "O5'" . DG  D 4 20  ? -14.379 -42.078 -28.208 1.00 65.42  ? 720 DG  T "O5'" 1 
ATOM   8566 C  "C5'" . DG  D 4 20  ? -15.682 -42.564 -28.494 1.00 66.54  ? 720 DG  T "C5'" 1 
ATOM   8567 C  "C4'" . DG  D 4 20  ? -15.681 -43.385 -29.768 1.00 68.13  ? 720 DG  T "C4'" 1 
ATOM   8568 O  "O4'" . DG  D 4 20  ? -15.630 -42.504 -30.921 1.00 57.83  ? 720 DG  T "O4'" 1 
ATOM   8569 C  "C3'" . DG  D 4 20  ? -14.500 -44.350 -29.916 1.00 65.52  ? 720 DG  T "C3'" 1 
ATOM   8570 O  "O3'" . DG  D 4 20  ? -14.972 -45.613 -30.348 1.00 66.96  ? 720 DG  T "O3'" 1 
ATOM   8571 C  "C2'" . DG  D 4 20  ? -13.633 -43.683 -30.984 1.00 61.42  ? 720 DG  T "C2'" 1 
ATOM   8572 C  "C1'" . DG  D 4 20  ? -14.691 -43.009 -31.836 1.00 61.21  ? 720 DG  T "C1'" 1 
ATOM   8573 N  N9    . DG  D 4 20  ? -14.182 -41.907 -32.646 1.00 60.72  ? 720 DG  T N9    1 
ATOM   8574 C  C8    . DG  D 4 20  ? -13.332 -40.904 -32.246 1.00 61.40  ? 720 DG  T C8    1 
ATOM   8575 N  N7    . DG  D 4 20  ? -13.048 -40.056 -33.194 1.00 53.64  ? 720 DG  T N7    1 
ATOM   8576 C  C5    . DG  D 4 20  ? -13.755 -40.525 -34.294 1.00 52.24  ? 720 DG  T C5    1 
ATOM   8577 C  C6    . DG  D 4 20  ? -13.839 -40.014 -35.612 1.00 55.11  ? 720 DG  T C6    1 
ATOM   8578 O  O6    . DG  D 4 20  ? -13.285 -39.011 -36.083 1.00 56.12  ? 720 DG  T O6    1 
ATOM   8579 N  N1    . DG  D 4 20  ? -14.666 -40.795 -36.415 1.00 50.01  ? 720 DG  T N1    1 
ATOM   8580 C  C2    . DG  D 4 20  ? -15.329 -41.925 -35.998 1.00 51.76  ? 720 DG  T C2    1 
ATOM   8581 N  N2    . DG  D 4 20  ? -16.082 -42.546 -36.917 1.00 44.37  ? 720 DG  T N2    1 
ATOM   8582 N  N3    . DG  D 4 20  ? -15.260 -42.413 -34.766 1.00 49.72  ? 720 DG  T N3    1 
ATOM   8583 C  C4    . DG  D 4 20  ? -14.457 -41.665 -33.972 1.00 56.66  ? 720 DG  T C4    1 
ATOM   8584 P  P     . DG  D 4 21  ? -14.112 -46.942 -30.078 1.00 70.63  ? 721 DG  T P     1 
ATOM   8585 O  OP1   . DG  D 4 21  ? -14.794 -47.703 -29.008 1.00 74.47  ? 721 DG  T OP1   1 
ATOM   8586 O  OP2   . DG  D 4 21  ? -12.694 -46.552 -29.915 1.00 62.85  ? 721 DG  T OP2   1 
ATOM   8587 O  "O5'" . DG  D 4 21  ? -14.247 -47.751 -31.448 1.00 56.53  ? 721 DG  T "O5'" 1 
ATOM   8588 C  "C5'" . DG  D 4 21  ? -15.526 -47.919 -32.045 1.00 55.28  ? 721 DG  T "C5'" 1 
ATOM   8589 C  "C4'" . DG  D 4 21  ? -15.399 -48.103 -33.545 1.00 59.52  ? 721 DG  T "C4'" 1 
ATOM   8590 O  "O4'" . DG  D 4 21  ? -15.116 -46.825 -34.171 1.00 60.80  ? 721 DG  T "O4'" 1 
ATOM   8591 C  "C3'" . DG  D 4 21  ? -14.283 -49.054 -33.982 1.00 60.16  ? 721 DG  T "C3'" 1 
ATOM   8592 O  "O3'" . DG  D 4 21  ? -14.768 -49.950 -34.969 1.00 68.62  ? 721 DG  T "O3'" 1 
ATOM   8593 C  "C2'" . DG  D 4 21  ? -13.212 -48.120 -34.546 1.00 66.74  ? 721 DG  T "C2'" 1 
ATOM   8594 C  "C1'" . DG  D 4 21  ? -14.052 -46.974 -35.082 1.00 57.73  ? 721 DG  T "C1'" 1 
ATOM   8595 N  N9    . DG  D 4 21  ? -13.328 -45.709 -35.158 1.00 57.65  ? 721 DG  T N9    1 
ATOM   8596 C  C8    . DG  D 4 21  ? -12.689 -45.058 -34.131 1.00 55.61  ? 721 DG  T C8    1 
ATOM   8597 N  N7    . DG  D 4 21  ? -12.124 -43.940 -34.495 1.00 47.92  ? 721 DG  T N7    1 
ATOM   8598 C  C5    . DG  D 4 21  ? -12.404 -43.843 -35.851 1.00 52.50  ? 721 DG  T C5    1 
ATOM   8599 C  C6    . DG  D 4 21  ? -12.050 -42.841 -36.786 1.00 50.44  ? 721 DG  T C6    1 
ATOM   8600 O  O6    . DG  D 4 21  ? -11.396 -41.807 -36.593 1.00 51.49  ? 721 DG  T O6    1 
ATOM   8601 N  N1    . DG  D 4 21  ? -12.537 -43.130 -38.059 1.00 49.99  ? 721 DG  T N1    1 
ATOM   8602 C  C2    . DG  D 4 21  ? -13.274 -44.243 -38.386 1.00 53.76  ? 721 DG  T C2    1 
ATOM   8603 N  N2    . DG  D 4 21  ? -13.657 -44.348 -39.667 1.00 43.86  ? 721 DG  T N2    1 
ATOM   8604 N  N3    . DG  D 4 21  ? -13.613 -45.189 -37.519 1.00 50.12  ? 721 DG  T N3    1 
ATOM   8605 C  C4    . DG  D 4 21  ? -13.146 -44.924 -36.275 1.00 53.13  ? 721 DG  T C4    1 
ATOM   8606 P  P     . DA  D 4 22  ? -13.897 -51.231 -35.393 1.00 73.31  ? 722 DA  T P     1 
ATOM   8607 O  OP1   . DA  D 4 22  ? -14.818 -52.381 -35.524 1.00 77.97  ? 722 DA  T OP1   1 
ATOM   8608 O  OP2   . DA  D 4 22  ? -12.739 -51.318 -34.475 1.00 61.21  ? 722 DA  T OP2   1 
ATOM   8609 O  "O5'" . DA  D 4 22  ? -13.342 -50.845 -36.840 1.00 56.62  ? 722 DA  T "O5'" 1 
ATOM   8610 C  "C5'" . DA  D 4 22  ? -14.248 -50.524 -37.886 1.00 56.87  ? 722 DA  T "C5'" 1 
ATOM   8611 C  "C4'" . DA  D 4 22  ? -13.493 -50.123 -39.138 1.00 58.71  ? 722 DA  T "C4'" 1 
ATOM   8612 O  "O4'" . DA  D 4 22  ? -13.002 -48.765 -38.994 1.00 60.41  ? 722 DA  T "O4'" 1 
ATOM   8613 C  "C3'" . DA  D 4 22  ? -12.275 -50.992 -39.454 1.00 58.35  ? 722 DA  T "C3'" 1 
ATOM   8614 O  "O3'" . DA  D 4 22  ? -12.243 -51.308 -40.839 1.00 67.86  ? 722 DA  T "O3'" 1 
ATOM   8615 C  "C2'" . DA  D 4 22  ? -11.092 -50.116 -39.044 1.00 56.62  ? 722 DA  T "C2'" 1 
ATOM   8616 C  "C1'" . DA  D 4 22  ? -11.628 -48.717 -39.303 1.00 58.77  ? 722 DA  T "C1'" 1 
ATOM   8617 N  N9    . DA  D 4 22  ? -11.004 -47.696 -38.467 1.00 58.81  ? 722 DA  T N9    1 
ATOM   8618 C  C8    . DA  D 4 22  ? -10.810 -47.746 -37.114 1.00 52.10  ? 722 DA  T C8    1 
ATOM   8619 N  N7    . DA  D 4 22  ? -10.219 -46.682 -36.623 1.00 54.76  ? 722 DA  T N7    1 
ATOM   8620 C  C5    . DA  D 4 22  ? -10.011 -45.877 -37.732 1.00 50.48  ? 722 DA  T C5    1 
ATOM   8621 C  C6    . DA  D 4 22  ? -9.425  -44.604 -37.883 1.00 47.90  ? 722 DA  T C6    1 
ATOM   8622 N  N6    . DA  D 4 22  ? -8.922  -43.899 -36.864 1.00 43.21  ? 722 DA  T N6    1 
ATOM   8623 N  N1    . DA  D 4 22  ? -9.376  -44.083 -39.128 1.00 53.62  ? 722 DA  T N1    1 
ATOM   8624 C  C2    . DA  D 4 22  ? -9.881  -44.792 -40.145 1.00 53.83  ? 722 DA  T C2    1 
ATOM   8625 N  N3    . DA  D 4 22  ? -10.455 -45.995 -40.126 1.00 52.80  ? 722 DA  T N3    1 
ATOM   8626 C  C4    . DA  D 4 22  ? -10.489 -46.486 -38.876 1.00 49.77  ? 722 DA  T C4    1 
ATOM   8627 P  P     . DC  D 4 23  ? -11.222 -52.419 -41.392 1.00 62.69  ? 723 DC  T P     1 
ATOM   8628 O  OP1   . DC  D 4 23  ? -11.966 -53.277 -42.341 1.00 71.63  ? 723 DC  T OP1   1 
ATOM   8629 O  OP2   . DC  D 4 23  ? -10.535 -53.033 -40.235 1.00 59.52  ? 723 DC  T OP2   1 
ATOM   8630 O  "O5'" . DC  D 4 23  ? -10.146 -51.566 -42.209 1.00 65.98  ? 723 DC  T "O5'" 1 
ATOM   8631 C  "C5'" . DC  D 4 23  ? -10.580 -50.681 -43.231 1.00 55.85  ? 723 DC  T "C5'" 1 
ATOM   8632 C  "C4'" . DC  D 4 23  ? -9.539  -49.611 -43.494 1.00 58.28  ? 723 DC  T "C4'" 1 
ATOM   8633 O  "O4'" . DC  D 4 23  ? -9.383  -48.795 -42.320 1.00 61.11  ? 723 DC  T "O4'" 1 
ATOM   8634 C  "C3'" . DC  D 4 23  ? -8.142  -50.140 -43.822 1.00 66.43  ? 723 DC  T "C3'" 1 
ATOM   8635 O  "O3'" . DC  D 4 23  ? -7.874  -49.961 -45.205 1.00 66.49  ? 723 DC  T "O3'" 1 
ATOM   8636 C  "C2'" . DC  D 4 23  ? -7.187  -49.309 -42.943 1.00 62.09  ? 723 DC  T "C2'" 1 
ATOM   8637 C  "C1'" . DC  D 4 23  ? -8.095  -48.245 -42.331 1.00 62.28  ? 723 DC  T "C1'" 1 
ATOM   8638 N  N1    . DC  D 4 23  ? -7.729  -47.880 -40.933 1.00 56.75  ? 723 DC  T N1    1 
ATOM   8639 C  C2    . DC  D 4 23  ? -7.115  -46.648 -40.677 1.00 55.87  ? 723 DC  T C2    1 
ATOM   8640 O  O2    . DC  D 4 23  ? -6.885  -45.882 -41.620 1.00 52.56  ? 723 DC  T O2    1 
ATOM   8641 N  N3    . DC  D 4 23  ? -6.790  -46.329 -39.399 1.00 55.13  ? 723 DC  T N3    1 
ATOM   8642 C  C4    . DC  D 4 23  ? -7.055  -47.184 -38.410 1.00 53.68  ? 723 DC  T C4    1 
ATOM   8643 N  N4    . DC  D 4 23  ? -6.716  -46.825 -37.166 1.00 50.56  ? 723 DC  T N4    1 
ATOM   8644 C  C5    . DC  D 4 23  ? -7.680  -48.443 -38.650 1.00 56.74  ? 723 DC  T C5    1 
ATOM   8645 C  C6    . DC  D 4 23  ? -7.997  -48.747 -39.914 1.00 53.76  ? 723 DC  T C6    1 
ATOM   8646 P  P     . DT  D 4 24  ? -6.757  -50.854 -45.937 1.00 81.91  ? 724 DT  T P     1 
ATOM   8647 O  OP1   . DT  D 4 24  ? -7.189  -51.063 -47.337 1.00 75.77  ? 724 DT  T OP1   1 
ATOM   8648 O  OP2   . DT  D 4 24  ? -6.471  -52.017 -45.068 1.00 68.97  ? 724 DT  T OP2   1 
ATOM   8649 O  "O5'" . DT  D 4 24  ? -5.467  -49.914 -45.935 1.00 73.27  ? 724 DT  T "O5'" 1 
ATOM   8650 C  "C5'" . DT  D 4 24  ? -5.584  -48.552 -46.320 1.00 67.56  ? 724 DT  T "C5'" 1 
ATOM   8651 C  "C4'" . DT  D 4 24  ? -4.228  -47.876 -46.316 1.00 70.39  ? 724 DT  T "C4'" 1 
ATOM   8652 O  "O4'" . DT  D 4 24  ? -3.703  -47.854 -44.964 1.00 64.22  ? 724 DT  T "O4'" 1 
ATOM   8653 C  "C3'" . DT  D 4 24  ? -3.168  -48.564 -47.178 1.00 76.73  ? 724 DT  T "C3'" 1 
ATOM   8654 O  "O3'" . DT  D 4 24  ? -2.449  -47.595 -47.929 1.00 83.92  ? 724 DT  T "O3'" 1 
ATOM   8655 C  "C2'" . DT  D 4 24  ? -2.276  -49.269 -46.157 1.00 74.11  ? 724 DT  T "C2'" 1 
ATOM   8656 C  "C1'" . DT  D 4 24  ? -2.382  -48.343 -44.957 1.00 72.78  ? 724 DT  T "C1'" 1 
ATOM   8657 N  N1    . DT  D 4 24  ? -2.140  -49.027 -43.654 1.00 74.96  ? 724 DT  T N1    1 
ATOM   8658 C  C2    . DT  D 4 24  ? -1.137  -48.569 -42.831 1.00 73.11  ? 724 DT  T C2    1 
ATOM   8659 O  O2    . DT  D 4 24  ? -0.427  -47.620 -43.108 1.00 69.31  ? 724 DT  T O2    1 
ATOM   8660 N  N3    . DT  D 4 24  ? -0.996  -49.265 -41.660 1.00 72.65  ? 724 DT  T N3    1 
ATOM   8661 C  C4    . DT  D 4 24  ? -1.740  -50.352 -41.238 1.00 70.52  ? 724 DT  T C4    1 
ATOM   8662 O  O4    . DT  D 4 24  ? -1.536  -50.911 -40.164 1.00 66.89  ? 724 DT  T O4    1 
ATOM   8663 C  C5    . DT  D 4 24  ? -2.775  -50.783 -42.149 1.00 70.51  ? 724 DT  T C5    1 
ATOM   8664 C  C7    . DT  D 4 24  ? -3.647  -51.952 -41.800 1.00 56.49  ? 724 DT  T C7    1 
ATOM   8665 C  C6    . DT  D 4 24  ? -2.923  -50.107 -43.300 1.00 67.01  ? 724 DT  T C6    1 
ATOM   8666 P  P     . DG  D 4 25  ? -1.400  -48.063 -49.053 1.00 89.79  ? 725 DG  T P     1 
ATOM   8667 O  OP1   . DG  D 4 25  ? -1.392  -47.033 -50.116 1.00 96.42  ? 725 DG  T OP1   1 
ATOM   8668 O  OP2   . DG  D 4 25  ? -1.704  -49.471 -49.395 1.00 75.91  ? 725 DG  T OP2   1 
ATOM   8669 O  "O5'" . DG  D 4 25  ? 0.005   -48.035 -48.290 1.00 95.14  ? 725 DG  T "O5'" 1 
ATOM   8670 C  "C5'" . DG  D 4 25  ? 1.015   -48.977 -48.624 1.00 100.58 ? 725 DG  T "C5'" 1 
ATOM   8671 C  "C4'" . DG  D 4 25  ? 1.957   -49.184 -47.452 1.00 102.13 ? 725 DG  T "C4'" 1 
ATOM   8672 O  "O4'" . DG  D 4 25  ? 1.187   -49.363 -46.246 1.00 89.65  ? 725 DG  T "O4'" 1 
ATOM   8673 C  "C3'" . DG  D 4 25  ? 2.827   -50.422 -47.542 1.00 97.32  ? 725 DG  T "C3'" 1 
ATOM   8674 O  "O3'" . DG  D 4 25  ? 4.009   -50.130 -48.278 1.00 81.19  ? 725 DG  T "O3'" 1 
ATOM   8675 C  "C2'" . DG  D 4 25  ? 3.142   -50.715 -46.075 1.00 99.80  ? 725 DG  T "C2'" 1 
ATOM   8676 C  "C1'" . DG  D 4 25  ? 1.908   -50.176 -45.339 1.00 94.45  ? 725 DG  T "C1'" 1 
ATOM   8677 N  N9    . DG  D 4 25  ? 1.015   -51.219 -44.838 1.00 88.27  ? 725 DG  T N9    1 
ATOM   8678 C  C8    . DG  D 4 25  ? 0.062   -51.908 -45.549 1.00 86.55  ? 725 DG  T C8    1 
ATOM   8679 N  N7    . DG  D 4 25  ? -0.589  -52.782 -44.832 1.00 76.49  ? 725 DG  T N7    1 
ATOM   8680 C  C5    . DG  D 4 25  ? -0.033  -52.665 -43.565 1.00 79.07  ? 725 DG  T C5    1 
ATOM   8681 C  C6    . DG  D 4 25  ? -0.336  -53.358 -42.368 1.00 83.04  ? 725 DG  T C6    1 
ATOM   8682 O  O6    . DG  D 4 25  ? -1.183  -54.245 -42.187 1.00 86.31  ? 725 DG  T O6    1 
ATOM   8683 N  N1    . DG  D 4 25  ? 0.464   -52.933 -41.310 1.00 76.83  ? 725 DG  T N1    1 
ATOM   8684 C  C2    . DG  D 4 25  ? 1.432   -51.961 -41.397 1.00 77.97  ? 725 DG  T C2    1 
ATOM   8685 N  N2    . DG  D 4 25  ? 2.102   -51.686 -40.268 1.00 71.49  ? 725 DG  T N2    1 
ATOM   8686 N  N3    . DG  D 4 25  ? 1.724   -51.303 -42.512 1.00 79.47  ? 725 DG  T N3    1 
ATOM   8687 C  C4    . DG  D 4 25  ? 0.954   -51.706 -43.552 1.00 76.86  ? 725 DG  T C4    1 
HETATM 8688 MG MG    . MG  E 5 .   ? -47.573 -0.009  -22.161 1.00 22.31  ? 601 MG  A MG    1 
HETATM 8689 MG MG    . MG  F 5 .   ? -15.218 -56.598 -41.567 1.00 57.03  ? 602 MG  A MG    1 
HETATM 8690 MG MG    . MG  G 5 .   ? -47.488 -4.186  -22.719 1.00 74.28  ? 603 MG  A MG    1 
HETATM 8691 C  C4    . 6FN H 6 .   ? -40.950 -2.806  -27.616 1.00 32.11  ? 604 6FN A C4    1 
HETATM 8692 N  N3    . 6FN H 6 .   ? -39.648 -2.650  -27.705 1.00 35.05  ? 604 6FN A N3    1 
HETATM 8693 C  C2    . 6FN H 6 .   ? -39.052 -2.696  -28.896 1.00 35.68  ? 604 6FN A C2    1 
HETATM 8694 F  F32   . 6FN H 6 .   ? -37.700 -2.534  -28.976 1.00 37.61  ? 604 6FN A F32   1 
HETATM 8695 N  N1    . 6FN H 6 .   ? -39.758 -2.901  -30.017 1.00 34.77  ? 604 6FN A N1    1 
HETATM 8696 C  C6    . 6FN H 6 .   ? -41.079 -3.066  -29.989 1.00 35.37  ? 604 6FN A C6    1 
HETATM 8697 N  N6    . 6FN H 6 .   ? -41.834 -3.285  -31.211 1.00 27.05  ? 604 6FN A N6    1 
HETATM 8698 C  C5    . 6FN H 6 .   ? -41.705 -3.020  -28.765 1.00 34.08  ? 604 6FN A C5    1 
HETATM 8699 N  N7    . 6FN H 6 .   ? -43.056 -3.144  -28.285 1.00 34.82  ? 604 6FN A N7    1 
HETATM 8700 C  C8    . 6FN H 6 .   ? -42.957 -2.995  -26.942 1.00 38.84  ? 604 6FN A C8    1 
HETATM 8701 N  N9    . 6FN H 6 .   ? -41.768 -2.820  -26.715 1.00 38.01  ? 604 6FN A N9    1 
HETATM 8702 C  "C1'" . 6FN H 6 .   ? -41.343 -2.628  -25.380 1.00 42.15  ? 604 6FN A "C1'" 1 
HETATM 8703 C  "C2'" . 6FN H 6 .   ? -41.152 -1.162  -25.124 1.00 31.66  ? 604 6FN A "C2'" 1 
HETATM 8704 C  "C3'" . 6FN H 6 .   ? -42.353 -0.770  -24.411 1.00 40.64  ? 604 6FN A "C3'" 1 
HETATM 8705 O  "O3'" . 6FN H 6 .   ? -42.070 0.320   -23.485 1.00 35.52  ? 604 6FN A "O3'" 1 
HETATM 8706 C  "C4'" . 6FN H 6 .   ? -42.817 -1.972  -23.673 1.00 30.50  ? 604 6FN A "C4'" 1 
HETATM 8707 C  C33   . 6FN H 6 .   ? -42.214 -2.020  -22.287 1.00 33.71  ? 604 6FN A C33   1 
HETATM 8708 C  C34   . 6FN H 6 .   ? -41.754 -2.064  -21.195 1.00 32.55  ? 604 6FN A C34   1 
HETATM 8709 O  "O4'" . 6FN H 6 .   ? -42.388 -3.143  -24.435 1.00 37.37  ? 604 6FN A "O4'" 1 
HETATM 8710 C  "C5'" . 6FN H 6 .   ? -44.339 -1.937  -23.549 1.00 30.91  ? 604 6FN A "C5'" 1 
HETATM 8711 O  "O5'" . 6FN H 6 .   ? -44.927 -2.026  -24.812 1.00 35.87  ? 604 6FN A "O5'" 1 
HETATM 8712 P  PA    . 6FN H 6 .   ? -46.237 -1.071  -25.106 1.00 36.40  ? 604 6FN A PA    1 
HETATM 8713 O  O3A   . 6FN H 6 .   ? -45.739 0.459   -25.457 1.00 42.19  ? 604 6FN A O3A   1 
HETATM 8714 P  PB    . 6FN H 6 .   ? -45.506 1.616   -24.308 1.00 32.21  ? 604 6FN A PB    1 
HETATM 8715 O  O3B   . 6FN H 6 .   ? -46.488 2.900   -24.622 1.00 43.05  ? 604 6FN A O3B   1 
HETATM 8716 P  PG    . 6FN H 6 .   ? -48.121 2.818   -24.414 1.00 40.26  ? 604 6FN A PG    1 
HETATM 8717 O  O3G   . 6FN H 6 .   ? -48.815 2.647   -25.688 1.00 45.05  ? 604 6FN A O3G   1 
HETATM 8718 O  O2G   . 6FN H 6 .   ? -48.657 4.157   -23.617 1.00 34.73  ? 604 6FN A O2G   1 
HETATM 8719 O  O1G   . 6FN H 6 .   ? -48.492 1.589   -23.716 1.00 38.96  ? 604 6FN A O1G   1 
HETATM 8720 O  O2B   . 6FN H 6 .   ? -45.749 1.087   -22.967 1.00 34.94  ? 604 6FN A O2B   1 
HETATM 8721 O  O1B   . 6FN H 6 .   ? -44.104 2.018   -24.218 1.00 39.08  ? 604 6FN A O1B   1 
HETATM 8722 O  O2A   . 6FN H 6 .   ? -47.087 -1.618  -26.160 1.00 40.89  ? 604 6FN A O2A   1 
HETATM 8723 O  O1A   . 6FN H 6 .   ? -47.155 -1.078  -23.970 1.00 29.03  ? 604 6FN A O1A   1 
HETATM 8724 O  O     . HOH I 7 .   ? -44.767 -40.716 -35.266 1.00 50.15  ? 701 HOH A O     1 
HETATM 8725 O  O     . HOH I 7 .   ? -34.791 -73.066 -37.531 1.00 47.58  ? 702 HOH A O     1 
HETATM 8726 O  O     . HOH I 7 .   ? -36.693 -54.724 -17.312 1.00 56.10  ? 703 HOH A O     1 
HETATM 8727 O  O     . HOH I 7 .   ? -53.647 -7.119  -22.906 1.00 38.29  ? 704 HOH A O     1 
HETATM 8728 O  O     . HOH I 7 .   ? -26.239 7.370   -30.921 1.00 43.66  ? 705 HOH A O     1 
HETATM 8729 O  O     . HOH I 7 .   ? -26.492 -72.921 -38.433 1.00 34.39  ? 706 HOH A O     1 
HETATM 8730 O  O     . HOH I 7 .   ? -52.480 -5.214  -21.185 1.00 41.88  ? 707 HOH A O     1 
HETATM 8731 O  O     . HOH I 7 .   ? -24.243 -8.959  -25.631 1.00 46.28  ? 708 HOH A O     1 
HETATM 8732 O  O     . HOH I 7 .   ? -51.470 -8.306  -23.063 1.00 33.74  ? 709 HOH A O     1 
HETATM 8733 O  O     . HOH I 7 .   ? -59.635 4.741   -29.119 1.00 80.74  ? 710 HOH A O     1 
HETATM 8734 O  O     . HOH I 7 .   ? -49.366 0.213   -27.029 1.00 41.01  ? 711 HOH A O     1 
HETATM 8735 O  O     . HOH I 7 .   ? -50.569 5.456   -23.026 1.00 41.71  ? 712 HOH A O     1 
HETATM 8736 O  O     . HOH I 7 .   ? -43.526 7.669   -19.386 1.00 42.59  ? 713 HOH A O     1 
HETATM 8737 O  O     . HOH I 7 .   ? -11.484 -62.540 -37.229 1.00 36.45  ? 714 HOH A O     1 
HETATM 8738 O  O     . HOH I 7 .   ? -35.559 -62.751 -33.911 1.00 39.64  ? 715 HOH A O     1 
HETATM 8739 O  O     . HOH I 7 .   ? -64.428 -24.009 -27.245 1.00 48.68  ? 716 HOH A O     1 
HETATM 8740 O  O     . HOH I 7 .   ? -30.428 -73.950 -46.303 1.00 50.47  ? 717 HOH A O     1 
HETATM 8741 O  O     . HOH I 7 .   ? -8.547  -57.808 -44.947 1.00 64.38  ? 718 HOH A O     1 
HETATM 8742 O  O     . HOH I 7 .   ? -30.651 10.245  -36.110 1.00 35.53  ? 719 HOH A O     1 
HETATM 8743 O  O     . HOH I 7 .   ? -58.306 -27.654 -14.447 1.00 46.18  ? 720 HOH A O     1 
HETATM 8744 O  O     . HOH I 7 .   ? -44.537 -20.285 -18.702 1.00 27.50  ? 721 HOH A O     1 
HETATM 8745 O  O     . HOH I 7 .   ? -26.287 3.888   -12.681 1.00 47.04  ? 722 HOH A O     1 
HETATM 8746 O  O     . HOH I 7 .   ? -14.345 -55.256 -42.894 1.00 49.42  ? 723 HOH A O     1 
HETATM 8747 O  O     . HOH I 7 .   ? -51.565 -31.388 -9.762  1.00 41.26  ? 724 HOH A O     1 
HETATM 8748 O  O     . HOH I 7 .   ? -50.510 -15.980 2.474   1.00 38.82  ? 725 HOH A O     1 
HETATM 8749 O  O     . HOH I 7 .   ? -25.894 -55.746 -50.684 1.00 32.37  ? 726 HOH A O     1 
HETATM 8750 O  O     . HOH I 7 .   ? -49.640 -27.746 -8.045  1.00 36.99  ? 727 HOH A O     1 
HETATM 8751 O  O     . HOH I 7 .   ? -36.343 -32.513 -20.992 1.00 44.99  ? 728 HOH A O     1 
HETATM 8752 O  O     . HOH I 7 .   ? -13.398 -57.456 -42.057 1.00 58.15  ? 729 HOH A O     1 
HETATM 8753 O  O     . HOH I 7 .   ? -29.080 -61.518 -31.667 1.00 38.90  ? 730 HOH A O     1 
HETATM 8754 O  O     . HOH I 7 .   ? -41.307 -24.145 -12.699 1.00 27.81  ? 731 HOH A O     1 
HETATM 8755 O  O     . HOH I 7 .   ? -50.378 -19.498 -11.604 1.00 24.38  ? 732 HOH A O     1 
HETATM 8756 O  O     . HOH I 7 .   ? -36.206 -34.875 -27.586 1.00 50.97  ? 733 HOH A O     1 
HETATM 8757 O  O     . HOH I 7 .   ? -20.354 -63.981 -55.777 1.00 40.28  ? 734 HOH A O     1 
HETATM 8758 O  O     . HOH I 7 .   ? -51.501 3.071   -32.119 1.00 75.17  ? 735 HOH A O     1 
HETATM 8759 O  O     . HOH I 7 .   ? -48.110 5.760   -25.743 1.00 39.40  ? 736 HOH A O     1 
HETATM 8760 O  O     . HOH I 7 .   ? -28.585 -10.418 -24.258 1.00 37.59  ? 737 HOH A O     1 
HETATM 8761 O  O     . HOH I 7 .   ? -14.410 -55.168 -40.303 1.00 58.19  ? 738 HOH A O     1 
HETATM 8762 O  O     . HOH I 7 .   ? -51.592 -29.982 -31.396 1.00 29.10  ? 739 HOH A O     1 
HETATM 8763 O  O     . HOH I 7 .   ? -32.379 0.142   -9.905  1.00 37.77  ? 740 HOH A O     1 
HETATM 8764 O  O     . HOH I 7 .   ? -21.030 -56.759 -41.729 1.00 32.67  ? 741 HOH A O     1 
HETATM 8765 O  O     . HOH I 7 .   ? -57.946 -24.985 -6.223  1.00 50.72  ? 742 HOH A O     1 
HETATM 8766 O  O     . HOH I 7 .   ? -43.375 -45.432 -14.427 1.00 44.38  ? 743 HOH A O     1 
HETATM 8767 O  O     . HOH I 7 .   ? -42.656 -42.338 -35.315 1.00 46.41  ? 744 HOH A O     1 
HETATM 8768 O  O     . HOH I 7 .   ? -31.636 -4.146  -11.803 1.00 33.90  ? 745 HOH A O     1 
HETATM 8769 O  O     . HOH I 7 .   ? -47.391 -51.761 -27.202 1.00 33.53  ? 746 HOH A O     1 
HETATM 8770 O  O     . HOH I 7 .   ? -39.191 -20.590 -18.616 1.00 35.31  ? 747 HOH A O     1 
HETATM 8771 O  O     . HOH I 7 .   ? -44.060 -3.630  1.413   1.00 37.00  ? 748 HOH A O     1 
HETATM 8772 O  O     . HOH I 7 .   ? -26.777 1.310   -35.359 1.00 44.08  ? 749 HOH A O     1 
HETATM 8773 O  O     . HOH I 7 .   ? -12.629 -67.520 -48.785 1.00 43.60  ? 750 HOH A O     1 
HETATM 8774 O  O     . HOH I 7 .   ? -26.193 -5.240  -32.944 1.00 41.42  ? 751 HOH A O     1 
HETATM 8775 O  O     . HOH I 7 .   ? -50.750 -29.713 -6.670  1.00 47.63  ? 752 HOH A O     1 
HETATM 8776 O  O     . HOH I 7 .   ? -25.890 2.361   -32.835 1.00 38.83  ? 753 HOH A O     1 
HETATM 8777 O  O     . HOH I 7 .   ? -34.527 -10.534 -20.109 1.00 38.27  ? 754 HOH A O     1 
HETATM 8778 O  O     . HOH I 7 .   ? -41.553 -9.644  -17.279 1.00 28.22  ? 755 HOH A O     1 
HETATM 8779 O  O     . HOH I 7 .   ? -48.104 -17.611 -23.880 1.00 28.10  ? 756 HOH A O     1 
HETATM 8780 O  O     . HOH I 7 .   ? -34.555 -73.701 -33.367 1.00 40.23  ? 757 HOH A O     1 
HETATM 8781 O  O     . HOH I 7 .   ? -37.509 -6.309  0.414   1.00 53.18  ? 758 HOH A O     1 
HETATM 8782 O  O     . HOH I 7 .   ? -50.325 3.686   -12.050 1.00 29.57  ? 759 HOH A O     1 
HETATM 8783 O  O     . HOH I 7 .   ? -59.238 -23.078 -41.061 1.00 51.84  ? 760 HOH A O     1 
HETATM 8784 O  O     . HOH I 7 .   ? -34.785 -2.045  -26.662 1.00 34.27  ? 761 HOH A O     1 
HETATM 8785 O  O     . HOH I 7 .   ? -36.060 -45.176 -24.239 1.00 44.06  ? 762 HOH A O     1 
HETATM 8786 O  O     . HOH I 7 .   ? -16.899 -62.317 -30.146 1.00 39.18  ? 763 HOH A O     1 
HETATM 8787 O  O     . HOH I 7 .   ? -59.248 -30.556 -16.906 1.00 36.21  ? 764 HOH A O     1 
HETATM 8788 O  O     . HOH I 7 .   ? -27.288 7.445   -13.264 1.00 37.96  ? 765 HOH A O     1 
HETATM 8789 O  O     . HOH I 7 .   ? -52.523 -9.741  -26.522 1.00 30.85  ? 766 HOH A O     1 
HETATM 8790 O  O     . HOH I 7 .   ? -47.956 -35.239 -41.763 1.00 50.04  ? 767 HOH A O     1 
HETATM 8791 O  O     . HOH I 7 .   ? -14.166 -61.834 -54.594 1.00 47.44  ? 768 HOH A O     1 
HETATM 8792 O  O     . HOH I 7 .   ? -41.393 -8.177  -7.263  1.00 35.13  ? 769 HOH A O     1 
HETATM 8793 O  O     . HOH I 7 .   ? -41.118 -7.012  -16.287 1.00 26.33  ? 770 HOH A O     1 
HETATM 8794 O  O     . HOH I 7 .   ? -50.290 -52.848 -21.077 1.00 52.02  ? 771 HOH A O     1 
HETATM 8795 O  O     . HOH I 7 .   ? -37.253 4.769   -28.300 1.00 37.50  ? 772 HOH A O     1 
HETATM 8796 O  O     . HOH I 7 .   ? -51.176 2.725   -26.924 1.00 52.45  ? 773 HOH A O     1 
HETATM 8797 O  O     . HOH I 7 .   ? -38.208 -48.234 -42.111 1.00 37.96  ? 774 HOH A O     1 
HETATM 8798 O  O     . HOH I 7 .   ? -53.413 0.682   -17.344 1.00 33.32  ? 775 HOH A O     1 
HETATM 8799 O  O     . HOH I 7 .   ? -17.437 -51.401 -39.370 1.00 52.66  ? 776 HOH A O     1 
HETATM 8800 O  O     . HOH I 7 .   ? -57.817 -23.082 -9.763  1.00 32.73  ? 777 HOH A O     1 
HETATM 8801 O  O     . HOH I 7 .   ? -46.157 -2.797  3.035   1.00 45.51  ? 778 HOH A O     1 
HETATM 8802 O  O     . HOH I 7 .   ? -31.661 2.204   -15.433 1.00 27.89  ? 779 HOH A O     1 
HETATM 8803 O  O     . HOH I 7 .   ? -35.098 -20.102 -19.949 1.00 33.08  ? 780 HOH A O     1 
HETATM 8804 O  O     . HOH I 7 .   ? -38.759 -60.561 -34.017 1.00 41.26  ? 781 HOH A O     1 
HETATM 8805 O  O     . HOH I 7 .   ? -31.091 -69.580 -44.854 1.00 36.90  ? 782 HOH A O     1 
HETATM 8806 O  O     . HOH I 7 .   ? -54.483 -16.849 -11.673 1.00 29.39  ? 783 HOH A O     1 
HETATM 8807 O  O     . HOH I 7 .   ? -32.845 -72.728 -31.466 1.00 42.75  ? 784 HOH A O     1 
HETATM 8808 O  O     . HOH I 7 .   ? -38.714 20.556  -26.581 1.00 54.85  ? 785 HOH A O     1 
HETATM 8809 O  O     . HOH I 7 .   ? -56.553 -12.670 -2.851  1.00 39.35  ? 786 HOH A O     1 
HETATM 8810 O  O     . HOH I 7 .   ? -18.313 -58.278 -40.968 1.00 52.07  ? 787 HOH A O     1 
HETATM 8811 O  O     . HOH I 7 .   ? -58.001 -19.087 -34.377 1.00 56.92  ? 788 HOH A O     1 
HETATM 8812 O  O     . HOH I 7 .   ? -56.382 -1.429  -0.156  1.00 43.86  ? 789 HOH A O     1 
HETATM 8813 O  O     . HOH I 7 .   ? -27.364 -75.420 -40.784 1.00 47.36  ? 790 HOH A O     1 
HETATM 8814 O  O     . HOH I 7 .   ? -24.053 14.544  -24.549 1.00 47.75  ? 791 HOH A O     1 
HETATM 8815 O  O     . HOH I 7 .   ? -33.599 -16.453 -20.519 1.00 38.79  ? 792 HOH A O     1 
HETATM 8816 O  O     . HOH I 7 .   ? -45.635 -0.815  -32.348 1.00 47.91  ? 793 HOH A O     1 
HETATM 8817 O  O     . HOH I 7 .   ? -15.658 1.521   -31.060 1.00 51.42  ? 794 HOH A O     1 
HETATM 8818 O  O     . HOH I 7 .   ? -44.392 4.192   -26.337 1.00 33.94  ? 795 HOH A O     1 
HETATM 8819 O  O     . HOH I 7 .   ? -24.649 -49.592 -20.873 1.00 45.80  ? 796 HOH A O     1 
HETATM 8820 O  O     . HOH I 7 .   ? -48.978 -22.873 -12.463 1.00 36.28  ? 797 HOH A O     1 
HETATM 8821 O  O     . HOH I 7 .   ? -40.461 4.107   -0.570  1.00 36.76  ? 798 HOH A O     1 
HETATM 8822 O  O     . HOH I 7 .   ? -29.184 -46.410 -29.710 1.00 54.60  ? 799 HOH A O     1 
HETATM 8823 O  O     . HOH I 7 .   ? -51.791 -42.076 -15.538 1.00 51.83  ? 800 HOH A O     1 
HETATM 8824 O  O     . HOH I 7 .   ? -15.711 -52.929 -40.769 1.00 56.10  ? 801 HOH A O     1 
HETATM 8825 O  O     . HOH I 7 .   ? -44.792 -48.687 -33.123 1.00 40.87  ? 802 HOH A O     1 
HETATM 8826 O  O     . HOH I 7 .   ? -32.328 -54.215 -52.978 1.00 51.45  ? 803 HOH A O     1 
HETATM 8827 O  O     . HOH I 7 .   ? -31.924 -6.907  -22.351 1.00 31.73  ? 804 HOH A O     1 
HETATM 8828 O  O     . HOH I 7 .   ? -48.805 -10.246 -17.724 1.00 28.48  ? 805 HOH A O     1 
HETATM 8829 O  O     . HOH I 7 .   ? -19.928 -75.188 -51.260 1.00 46.06  ? 806 HOH A O     1 
HETATM 8830 O  O     . HOH I 7 .   ? -48.644 -24.496 -10.199 1.00 31.41  ? 807 HOH A O     1 
HETATM 8831 O  O     . HOH I 7 .   ? -64.804 -24.346 -17.669 1.00 46.41  ? 808 HOH A O     1 
HETATM 8832 O  O     . HOH I 7 .   ? -51.616 -49.608 -17.936 1.00 46.11  ? 809 HOH A O     1 
HETATM 8833 O  O     . HOH I 7 .   ? -29.394 2.282   -16.926 1.00 33.89  ? 810 HOH A O     1 
HETATM 8834 O  O     . HOH I 7 .   ? -67.317 -2.189  -7.519  1.00 66.60  ? 811 HOH A O     1 
HETATM 8835 O  O     . HOH I 7 .   ? -45.489 5.732   -16.846 1.00 33.59  ? 812 HOH A O     1 
HETATM 8836 O  O     . HOH I 7 .   ? -47.551 6.601   -28.718 1.00 49.56  ? 813 HOH A O     1 
HETATM 8837 O  O     . HOH I 7 .   ? -18.038 -62.472 -40.319 1.00 29.76  ? 814 HOH A O     1 
HETATM 8838 O  O     . HOH I 7 .   ? -25.107 -44.447 -50.002 1.00 43.84  ? 815 HOH A O     1 
HETATM 8839 O  O     . HOH I 7 .   ? -49.466 -4.806  -23.062 1.00 55.76  ? 816 HOH A O     1 
HETATM 8840 O  O     . HOH I 7 .   ? -31.998 -70.766 -42.714 1.00 39.33  ? 817 HOH A O     1 
HETATM 8841 O  O     . HOH I 7 .   ? -45.856 18.103  -29.466 1.00 56.91  ? 818 HOH A O     1 
HETATM 8842 O  O     . HOH I 7 .   ? -48.921 0.467   1.263   1.00 42.65  ? 819 HOH A O     1 
HETATM 8843 O  O     . HOH I 7 .   ? -45.878 -46.068 -14.476 1.00 50.21  ? 820 HOH A O     1 
HETATM 8844 O  O     . HOH I 7 .   ? -60.616 -27.278 -22.495 1.00 44.97  ? 821 HOH A O     1 
HETATM 8845 O  O     . HOH I 7 .   ? -16.077 -45.959 -56.870 1.00 47.83  ? 822 HOH A O     1 
HETATM 8846 O  O     . HOH I 7 .   ? -52.254 6.163   -13.780 1.00 32.16  ? 823 HOH A O     1 
HETATM 8847 O  O     . HOH I 7 .   ? -68.020 -6.283  -3.722  1.00 43.12  ? 824 HOH A O     1 
HETATM 8848 O  O     . HOH I 7 .   ? -61.879 -6.208  -12.800 1.00 43.55  ? 825 HOH A O     1 
HETATM 8849 O  O     . HOH I 7 .   ? -54.777 -3.825  -21.246 1.00 35.60  ? 826 HOH A O     1 
HETATM 8850 O  O     . HOH I 7 .   ? -26.275 -9.287  -23.523 1.00 34.84  ? 827 HOH A O     1 
HETATM 8851 O  O     . HOH I 7 .   ? -41.746 -20.283 -21.841 1.00 38.38  ? 828 HOH A O     1 
HETATM 8852 O  O     . HOH I 7 .   ? -36.111 -54.991 -48.193 1.00 36.22  ? 829 HOH A O     1 
HETATM 8853 O  O     . HOH I 7 .   ? -34.557 -7.535  -10.042 1.00 33.40  ? 830 HOH A O     1 
HETATM 8854 O  O     . HOH I 7 .   ? -42.950 -30.168 -27.657 1.00 40.26  ? 831 HOH A O     1 
HETATM 8855 O  O     . HOH I 7 .   ? -34.384 -41.362 -38.685 1.00 41.85  ? 832 HOH A O     1 
HETATM 8856 O  O     . HOH I 7 .   ? -53.409 -15.541 -32.634 1.00 52.90  ? 833 HOH A O     1 
HETATM 8857 O  O     . HOH I 7 .   ? -52.750 6.789   -2.629  1.00 51.56  ? 834 HOH A O     1 
HETATM 8858 O  O     . HOH I 7 .   ? -33.971 10.432  -16.194 1.00 39.77  ? 835 HOH A O     1 
HETATM 8859 O  O     . HOH I 7 .   ? -45.112 -3.947  -30.129 1.00 52.08  ? 836 HOH A O     1 
HETATM 8860 O  O     . HOH I 7 .   ? -66.336 -6.178  -1.989  1.00 42.60  ? 837 HOH A O     1 
HETATM 8861 O  O     . HOH I 7 .   ? -53.664 -11.368 -32.573 1.00 43.84  ? 838 HOH A O     1 
HETATM 8862 O  O     . HOH I 7 .   ? -56.712 3.257   -14.742 1.00 44.73  ? 839 HOH A O     1 
HETATM 8863 O  O     . HOH I 7 .   ? -42.984 -57.516 -25.910 1.00 48.26  ? 840 HOH A O     1 
HETATM 8864 O  O     . HOH I 7 .   ? -57.862 -32.697 -34.414 1.00 47.38  ? 841 HOH A O     1 
HETATM 8865 O  O     . HOH I 7 .   ? -27.914 -56.589 -52.125 1.00 48.71  ? 842 HOH A O     1 
HETATM 8866 O  O     . HOH I 7 .   ? -14.408 -46.082 -45.424 1.00 31.78  ? 843 HOH A O     1 
HETATM 8867 O  O     . HOH I 7 .   ? -33.253 1.326   -13.434 1.00 29.42  ? 844 HOH A O     1 
HETATM 8868 O  O     . HOH I 7 .   ? -57.995 -16.092 -15.097 1.00 40.89  ? 845 HOH A O     1 
HETATM 8869 O  O     . HOH I 7 .   ? -18.803 -71.800 -47.244 1.00 36.89  ? 846 HOH A O     1 
HETATM 8870 O  O     . HOH I 7 .   ? -36.630 -35.055 -25.057 1.00 38.20  ? 847 HOH A O     1 
HETATM 8871 O  O     . HOH I 7 .   ? -57.094 -40.864 -14.940 1.00 63.48  ? 848 HOH A O     1 
HETATM 8872 O  O     . HOH I 7 .   ? -54.500 -38.690 -27.540 1.00 57.35  ? 849 HOH A O     1 
HETATM 8873 O  O     . HOH I 7 .   ? -46.703 -1.602  -1.030  1.00 43.71  ? 850 HOH A O     1 
HETATM 8874 O  O     . HOH I 7 .   ? -30.435 -47.763 -34.567 1.00 28.69  ? 851 HOH A O     1 
HETATM 8875 O  O     . HOH I 7 .   ? -27.001 -47.566 -31.856 1.00 47.43  ? 852 HOH A O     1 
HETATM 8876 O  O     . HOH I 7 .   ? -36.675 -71.934 -34.244 1.00 48.46  ? 853 HOH A O     1 
HETATM 8877 O  O     . HOH I 7 .   ? -41.944 3.971   -23.432 1.00 40.30  ? 854 HOH A O     1 
HETATM 8878 O  O     . HOH I 7 .   ? -52.715 -10.648 0.049   1.00 41.28  ? 855 HOH A O     1 
HETATM 8879 O  O     . HOH I 7 .   ? -34.220 13.285  -16.435 1.00 39.54  ? 856 HOH A O     1 
HETATM 8880 O  O     . HOH I 7 .   ? -43.131 5.961   -28.646 1.00 43.61  ? 857 HOH A O     1 
HETATM 8881 O  O     . HOH I 7 .   ? -33.279 -1.933  -11.417 1.00 30.15  ? 858 HOH A O     1 
HETATM 8882 O  O     . HOH I 7 .   ? -29.977 -5.252  -7.435  1.00 48.82  ? 859 HOH A O     1 
HETATM 8883 O  O     . HOH I 7 .   ? -31.682 -16.471 -18.862 1.00 36.48  ? 860 HOH A O     1 
HETATM 8884 O  O     . HOH I 7 .   ? -61.822 -27.223 -7.204  1.00 44.15  ? 861 HOH A O     1 
HETATM 8885 O  O     . HOH I 7 .   ? -33.062 -47.505 -32.862 1.00 41.53  ? 862 HOH A O     1 
HETATM 8886 O  O     . HOH I 7 .   ? -52.587 -18.078 -10.623 1.00 34.66  ? 863 HOH A O     1 
HETATM 8887 O  O     . HOH I 7 .   ? -17.593 5.026   -34.173 1.00 49.87  ? 864 HOH A O     1 
HETATM 8888 O  O     . HOH I 7 .   ? -52.464 -49.874 -33.841 1.00 44.76  ? 865 HOH A O     1 
HETATM 8889 O  O     . HOH I 7 .   ? -21.985 -2.640  -15.159 1.00 52.52  ? 866 HOH A O     1 
HETATM 8890 O  O     . HOH I 7 .   ? -51.286 -2.756  -25.387 1.00 59.04  ? 867 HOH A O     1 
HETATM 8891 O  O     . HOH I 7 .   ? -11.220 -2.706  -29.156 1.00 62.57  ? 868 HOH A O     1 
HETATM 8892 O  O     . HOH I 7 .   ? -50.984 -43.544 -13.673 1.00 63.94  ? 869 HOH A O     1 
HETATM 8893 O  O     . HOH I 7 .   ? -57.967 -33.198 -27.537 1.00 47.09  ? 870 HOH A O     1 
HETATM 8894 O  O     . HOH I 7 .   ? -60.233 -14.874 -15.851 1.00 43.85  ? 871 HOH A O     1 
HETATM 8895 O  O     . HOH I 7 .   ? -47.575 -11.936 -5.021  1.00 44.51  ? 872 HOH A O     1 
HETATM 8896 O  O     . HOH I 7 .   ? -42.749 -33.139 -9.868  1.00 49.63  ? 873 HOH A O     1 
HETATM 8897 O  O     . HOH I 7 .   ? -59.031 -34.852 -22.847 1.00 51.37  ? 874 HOH A O     1 
HETATM 8898 O  O     . HOH I 7 .   ? -28.058 -13.846 -20.852 1.00 41.07  ? 875 HOH A O     1 
HETATM 8899 O  O     . HOH I 7 .   ? -50.059 -19.821 -5.605  1.00 50.89  ? 876 HOH A O     1 
HETATM 8900 O  O     . HOH I 7 .   ? -60.356 -0.583  -9.829  1.00 47.55  ? 877 HOH A O     1 
HETATM 8901 O  O     . HOH I 7 .   ? -33.329 -73.125 -42.975 1.00 36.15  ? 878 HOH A O     1 
HETATM 8902 O  O     . HOH I 7 .   ? -42.723 1.371   -1.959  1.00 30.03  ? 879 HOH A O     1 
HETATM 8903 O  O     . HOH I 7 .   ? -39.096 -51.213 -34.067 1.00 46.91  ? 880 HOH A O     1 
HETATM 8904 O  O     . HOH I 7 .   ? -47.769 -15.544 -25.443 1.00 25.54  ? 881 HOH A O     1 
HETATM 8905 O  O     . HOH I 7 .   ? -28.804 -76.049 -38.982 1.00 55.33  ? 882 HOH A O     1 
HETATM 8906 O  O     . HOH I 7 .   ? -36.315 -31.518 -27.773 1.00 47.37  ? 883 HOH A O     1 
HETATM 8907 O  O     . HOH I 7 .   ? -54.580 -7.770  -27.688 1.00 55.19  ? 884 HOH A O     1 
HETATM 8908 O  O     . HOH I 7 .   ? -35.839 -40.837 -40.776 1.00 55.34  ? 885 HOH A O     1 
HETATM 8909 O  O     . HOH I 7 .   ? -23.082 13.259  -35.691 1.00 57.95  ? 886 HOH A O     1 
HETATM 8910 O  O     . HOH I 7 .   ? -43.735 -22.069 -20.538 1.00 28.43  ? 887 HOH A O     1 
HETATM 8911 O  O     . HOH I 7 .   ? -52.711 -18.443 -7.529  1.00 49.90  ? 888 HOH A O     1 
HETATM 8912 O  O     . HOH I 7 .   ? -56.834 7.904   -11.620 1.00 29.46  ? 889 HOH A O     1 
HETATM 8913 O  O     . HOH I 7 .   ? -58.199 6.311   -14.175 1.00 38.91  ? 890 HOH A O     1 
HETATM 8914 O  O     . HOH I 7 .   ? -62.400 -2.719  0.247   1.00 46.77  ? 891 HOH A O     1 
HETATM 8915 O  O     . HOH I 7 .   ? -33.782 -19.077 -45.114 1.00 68.17  ? 892 HOH A O     1 
HETATM 8916 O  O     . HOH I 7 .   ? -22.480 10.213  -12.318 1.00 58.63  ? 893 HOH A O     1 
HETATM 8917 O  O     . HOH I 7 .   ? -55.614 -35.199 -31.716 1.00 55.06  ? 894 HOH A O     1 
HETATM 8918 O  O     . HOH I 7 .   ? -18.627 5.115   -16.634 1.00 62.17  ? 895 HOH A O     1 
HETATM 8919 O  O     . HOH I 7 .   ? -36.389 -33.218 -23.591 1.00 49.93  ? 896 HOH A O     1 
HETATM 8920 O  O     . HOH I 7 .   ? -40.211 25.735  -35.870 1.00 61.02  ? 897 HOH A O     1 
HETATM 8921 O  O     . HOH I 7 .   ? -37.362 -4.079  1.047   1.00 57.42  ? 898 HOH A O     1 
HETATM 8922 O  O     . HOH I 7 .   ? -44.684 0.499   -0.551  0.66 37.24  ? 899 HOH A O     1 
HETATM 8923 O  O     . HOH I 7 .   ? -18.416 -74.477 -46.443 1.00 46.79  ? 900 HOH A O     1 
HETATM 8924 O  O     . HOH I 7 .   ? -29.984 -0.653  -9.198  1.00 45.61  ? 901 HOH A O     1 
HETATM 8925 O  O     . HOH I 7 .   ? -33.234 -60.966 -53.570 1.00 45.93  ? 902 HOH A O     1 
HETATM 8926 O  O     . HOH I 7 .   ? -35.693 -68.988 -48.540 1.00 45.80  ? 903 HOH A O     1 
HETATM 8927 O  O     . HOH I 7 .   ? -38.108 -9.558  4.112   1.00 47.55  ? 904 HOH A O     1 
HETATM 8928 O  O     . HOH I 7 .   ? -51.577 -49.110 -15.267 1.00 48.86  ? 905 HOH A O     1 
HETATM 8929 O  O     . HOH I 7 .   ? -55.766 -10.510 -0.860  1.00 39.61  ? 906 HOH A O     1 
HETATM 8930 O  O     . HOH I 7 .   ? -26.358 -46.014 -48.227 1.00 38.90  ? 907 HOH A O     1 
HETATM 8931 O  O     . HOH I 7 .   ? -48.440 -20.259 -9.694  1.00 34.50  ? 908 HOH A O     1 
HETATM 8932 O  O     . HOH I 7 .   ? -34.751 -21.741 -43.620 1.00 58.73  ? 909 HOH A O     1 
HETATM 8933 O  O     . HOH I 7 .   ? -8.816  -1.489  -27.347 1.00 56.44  ? 910 HOH A O     1 
HETATM 8934 O  O     . HOH I 7 .   ? -48.429 -54.104 -16.161 1.00 54.65  ? 911 HOH A O     1 
HETATM 8935 O  O     . HOH I 7 .   ? -52.818 4.222   -23.445 1.00 70.40  ? 912 HOH A O     1 
HETATM 8936 O  O     . HOH I 7 .   ? -43.316 -13.243 -5.783  1.00 42.84  ? 913 HOH A O     1 
HETATM 8937 O  O     . HOH I 7 .   ? -55.781 -25.579 -4.149  1.00 50.42  ? 914 HOH A O     1 
HETATM 8938 O  O     . HOH I 7 .   ? -57.694 -28.803 -53.750 1.00 53.41  ? 915 HOH A O     1 
HETATM 8939 O  O     . HOH I 7 .   ? -63.727 -12.532 -13.770 1.00 49.76  ? 916 HOH A O     1 
HETATM 8940 O  O     . HOH I 7 .   ? -62.455 -25.693 -14.764 1.00 39.94  ? 917 HOH A O     1 
HETATM 8941 O  O     . HOH I 7 .   ? -40.032 -10.180 -5.626  1.00 36.21  ? 918 HOH A O     1 
HETATM 8942 O  O     . HOH I 7 .   ? -51.040 -53.699 -17.083 1.00 49.30  ? 919 HOH A O     1 
HETATM 8943 O  O     . HOH J 7 .   ? -23.965 -70.758 -24.212 1.00 48.76  ? 501 HOH B O     1 
HETATM 8944 O  O     . HOH J 7 .   ? -30.241 -7.622  -1.090  1.00 41.29  ? 502 HOH B O     1 
HETATM 8945 O  O     . HOH J 7 .   ? -33.324 -20.405 -17.603 1.00 33.88  ? 503 HOH B O     1 
HETATM 8946 O  O     . HOH J 7 .   ? -22.725 -78.598 -37.829 1.00 50.14  ? 504 HOH B O     1 
HETATM 8947 O  O     . HOH J 7 .   ? -7.210  -35.440 6.613   1.00 55.28  ? 505 HOH B O     1 
HETATM 8948 O  O     . HOH J 7 .   ? -21.947 -24.591 -13.397 1.00 36.10  ? 506 HOH B O     1 
HETATM 8949 O  O     . HOH J 7 .   ? -34.732 -12.847 -0.912  1.00 40.40  ? 507 HOH B O     1 
HETATM 8950 O  O     . HOH J 7 .   ? -10.094 -4.032  -6.121  1.00 50.46  ? 508 HOH B O     1 
HETATM 8951 O  O     . HOH J 7 .   ? -14.376 -48.908 -19.183 1.00 49.39  ? 509 HOH B O     1 
HETATM 8952 O  O     . HOH J 7 .   ? -46.969 -27.434 -8.238  1.00 35.58  ? 510 HOH B O     1 
HETATM 8953 O  O     . HOH J 7 .   ? -24.211 -48.842 -28.946 1.00 59.96  ? 511 HOH B O     1 
HETATM 8954 O  O     . HOH J 7 .   ? -49.560 -25.338 -6.849  1.00 42.98  ? 512 HOH B O     1 
HETATM 8955 O  O     . HOH J 7 .   ? -29.012 -19.534 -11.910 1.00 30.26  ? 513 HOH B O     1 
HETATM 8956 O  O     . HOH J 7 .   ? -17.862 -80.573 -33.366 1.00 54.97  ? 514 HOH B O     1 
HETATM 8957 O  O     . HOH J 7 .   ? -37.696 -52.438 -9.004  1.00 97.80  ? 515 HOH B O     1 
HETATM 8958 O  O     . HOH J 7 .   ? -45.003 -14.994 -7.256  1.00 55.34  ? 516 HOH B O     1 
HETATM 8959 O  O     . HOH J 7 .   ? -22.411 -17.411 -11.589 1.00 28.28  ? 517 HOH B O     1 
HETATM 8960 O  O     . HOH J 7 .   ? -25.862 -5.859  -9.925  1.00 49.67  ? 518 HOH B O     1 
HETATM 8961 O  O     . HOH J 7 .   ? -39.229 -31.865 -7.084  1.00 48.42  ? 519 HOH B O     1 
HETATM 8962 O  O     . HOH J 7 .   ? -17.754 -8.642  -7.718  1.00 49.89  ? 520 HOH B O     1 
HETATM 8963 O  O     . HOH J 7 .   ? -15.708 -28.584 -12.135 1.00 42.54  ? 521 HOH B O     1 
HETATM 8964 O  O     . HOH J 7 .   ? -39.361 -19.323 -14.641 1.00 47.04  ? 522 HOH B O     1 
HETATM 8965 O  O     . HOH J 7 .   ? -14.951 -24.505 -19.052 1.00 56.37  ? 523 HOH B O     1 
HETATM 8966 O  O     . HOH J 7 .   ? -12.778 -80.582 -30.876 1.00 51.80  ? 524 HOH B O     1 
HETATM 8967 O  O     . HOH J 7 .   ? -27.153 -73.318 -35.839 1.00 38.71  ? 525 HOH B O     1 
HETATM 8968 O  O     . HOH J 7 .   ? -28.019 -9.114  2.315   1.00 41.34  ? 526 HOH B O     1 
HETATM 8969 O  O     . HOH J 7 .   ? -23.190 -26.411 -15.016 1.00 45.40  ? 527 HOH B O     1 
HETATM 8970 O  O     . HOH J 7 .   ? -17.753 -78.778 -25.635 1.00 42.32  ? 528 HOH B O     1 
HETATM 8971 O  O     . HOH J 7 .   ? -22.740 -27.606 -1.953  1.00 47.20  ? 529 HOH B O     1 
HETATM 8972 O  O     . HOH J 7 .   ? -47.194 -11.693 -8.029  1.00 32.86  ? 530 HOH B O     1 
HETATM 8973 O  O     . HOH J 7 .   ? -11.561 -25.591 4.887   1.00 49.56  ? 531 HOH B O     1 
HETATM 8974 O  O     . HOH J 7 .   ? -11.609 -52.876 -3.130  1.00 62.48  ? 532 HOH B O     1 
HETATM 8975 O  O     . HOH J 7 .   ? -6.050  -29.708 13.142  1.00 65.20  ? 533 HOH B O     1 
HETATM 8976 O  O     . HOH J 7 .   ? -21.937 -35.513 -23.588 1.00 38.59  ? 534 HOH B O     1 
HETATM 8977 O  O     . HOH J 7 .   ? -32.221 -9.065  -8.007  1.00 37.63  ? 535 HOH B O     1 
HETATM 8978 O  O     . HOH J 7 .   ? -16.496 -53.266 -14.116 1.00 45.09  ? 536 HOH B O     1 
HETATM 8979 O  O     . HOH J 7 .   ? -32.720 -34.836 -4.640  1.00 45.40  ? 537 HOH B O     1 
HETATM 8980 O  O     . HOH J 7 .   ? -17.758 -51.973 -6.218  1.00 52.25  ? 538 HOH B O     1 
HETATM 8981 O  O     . HOH J 7 .   ? -21.767 -68.344 -24.370 1.00 49.99  ? 539 HOH B O     1 
HETATM 8982 O  O     . HOH J 7 .   ? -41.310 -20.094 0.105   1.00 47.26  ? 540 HOH B O     1 
HETATM 8983 O  O     . HOH J 7 .   ? -33.734 -29.399 -10.570 1.00 39.37  ? 541 HOH B O     1 
HETATM 8984 O  O     . HOH J 7 .   ? -20.880 -65.995 -32.023 1.00 36.71  ? 542 HOH B O     1 
HETATM 8985 O  O     . HOH J 7 .   ? -18.316 -27.847 -16.396 1.00 65.66  ? 543 HOH B O     1 
HETATM 8986 O  O     . HOH J 7 .   ? -24.279 -70.875 -27.456 1.00 44.27  ? 544 HOH B O     1 
HETATM 8987 O  O     . HOH J 7 .   ? -12.200 -58.468 -29.176 1.00 42.43  ? 545 HOH B O     1 
HETATM 8988 O  O     . HOH J 7 .   ? -34.403 -11.174 2.996   1.00 45.42  ? 546 HOH B O     1 
HETATM 8989 O  O     . HOH J 7 .   ? -11.246 -35.937 -12.402 1.00 47.05  ? 547 HOH B O     1 
HETATM 8990 O  O     . HOH J 7 .   ? -22.838 -7.947  -9.371  1.00 46.23  ? 548 HOH B O     1 
HETATM 8991 O  O     . HOH J 7 .   ? -39.234 -15.519 -16.344 1.00 29.20  ? 549 HOH B O     1 
HETATM 8992 O  O     . HOH J 7 .   ? -16.972 -71.577 -38.046 1.00 43.87  ? 550 HOH B O     1 
HETATM 8993 O  O     . HOH J 7 .   ? -21.157 -5.319  -14.990 1.00 57.09  ? 551 HOH B O     1 
HETATM 8994 O  O     . HOH J 7 .   ? -46.391 -18.683 -10.284 1.00 31.79  ? 552 HOH B O     1 
HETATM 8995 O  O     . HOH J 7 .   ? -23.664 -25.347 -3.027  1.00 44.90  ? 553 HOH B O     1 
HETATM 8996 O  O     . HOH J 7 .   ? -17.633 -16.773 -20.098 1.00 48.52  ? 554 HOH B O     1 
HETATM 8997 O  O     . HOH J 7 .   ? -8.606  -19.693 7.346   1.00 52.89  ? 555 HOH B O     1 
HETATM 8998 O  O     . HOH J 7 .   ? -25.978 -31.925 -18.042 1.00 51.61  ? 556 HOH B O     1 
HETATM 8999 O  O     . HOH J 7 .   ? -27.855 -24.976 -17.966 1.00 46.90  ? 557 HOH B O     1 
HETATM 9000 O  O     . HOH J 7 .   ? -11.812 -14.446 2.168   1.00 57.16  ? 558 HOH B O     1 
HETATM 9001 O  O     . HOH J 7 .   ? -26.910 -77.787 -34.621 1.00 42.41  ? 559 HOH B O     1 
HETATM 9002 O  O     . HOH J 7 .   ? -41.020 -26.415 -0.444  1.00 44.46  ? 560 HOH B O     1 
HETATM 9003 O  O     . HOH J 7 .   ? -6.516  -76.638 -29.718 1.00 56.63  ? 561 HOH B O     1 
HETATM 9004 O  O     . HOH J 7 .   ? -48.777 -23.011 -4.570  1.00 43.42  ? 562 HOH B O     1 
HETATM 9005 O  O     . HOH J 7 .   ? -35.643 -36.654 -1.417  1.00 52.99  ? 563 HOH B O     1 
HETATM 9006 O  O     . HOH J 7 .   ? -20.654 -22.125 -12.135 1.00 39.22  ? 564 HOH B O     1 
HETATM 9007 O  O     . HOH J 7 .   ? -3.306  -65.186 -28.705 1.00 55.82  ? 565 HOH B O     1 
HETATM 9008 O  O     . HOH J 7 .   ? -15.331 -79.795 -24.311 1.00 50.05  ? 566 HOH B O     1 
HETATM 9009 O  O     . HOH J 7 .   ? -10.721 -70.034 -36.628 1.00 45.88  ? 567 HOH B O     1 
HETATM 9010 O  O     . HOH J 7 .   ? -31.201 -18.749 -17.255 1.00 28.87  ? 568 HOH B O     1 
HETATM 9011 O  O     . HOH J 7 .   ? -5.030  -44.705 -15.400 1.00 43.40  ? 569 HOH B O     1 
HETATM 9012 O  O     . HOH J 7 .   ? -22.419 -28.258 -5.530  1.00 37.61  ? 570 HOH B O     1 
HETATM 9013 O  O     . HOH J 7 .   ? -29.097 -24.559 2.254   1.00 42.84  ? 571 HOH B O     1 
HETATM 9014 O  O     . HOH J 7 .   ? -16.701 -26.421 -1.456  1.00 43.55  ? 572 HOH B O     1 
HETATM 9015 O  O     . HOH J 7 .   ? -48.182 -22.606 -8.296  1.00 44.83  ? 573 HOH B O     1 
HETATM 9016 O  O     . HOH J 7 .   ? -39.461 -17.166 -7.372  1.00 40.74  ? 574 HOH B O     1 
HETATM 9017 O  O     . HOH J 7 .   ? -35.962 -15.162 -1.682  1.00 52.08  ? 575 HOH B O     1 
HETATM 9018 O  O     . HOH J 7 .   ? -25.374 -66.318 -26.759 1.00 42.45  ? 576 HOH B O     1 
HETATM 9019 O  O     . HOH J 7 .   ? -21.521 -19.597 16.601  1.00 87.44  ? 577 HOH B O     1 
HETATM 9020 O  O     . HOH J 7 .   ? -20.455 -27.291 -6.895  1.00 35.66  ? 578 HOH B O     1 
HETATM 9021 O  O     . HOH J 7 .   ? -34.640 -54.632 -11.939 1.00 84.13  ? 579 HOH B O     1 
HETATM 9022 O  O     . HOH J 7 .   ? -18.815 -67.797 -24.058 1.00 37.84  ? 580 HOH B O     1 
HETATM 9023 O  O     . HOH J 7 .   ? -10.013 -52.773 14.984  1.00 66.96  ? 581 HOH B O     1 
HETATM 9024 O  O     . HOH J 7 .   ? -16.295 -28.717 -9.439  1.00 41.76  ? 582 HOH B O     1 
HETATM 9025 O  O     . HOH J 7 .   ? -26.776 -22.751 -20.452 1.00 44.45  ? 583 HOH B O     1 
HETATM 9026 O  O     . HOH J 7 .   ? -1.818  -68.447 -20.789 1.00 72.90  ? 584 HOH B O     1 
HETATM 9027 O  O     . HOH J 7 .   ? -36.961 -24.253 2.770   1.00 50.97  ? 585 HOH B O     1 
HETATM 9028 O  O     . HOH J 7 .   ? -16.117 -70.811 -46.593 1.00 39.13  ? 586 HOH B O     1 
HETATM 9029 O  O     . HOH J 7 .   ? -20.206 -6.745  -6.512  1.00 56.65  ? 587 HOH B O     1 
HETATM 9030 O  O     . HOH J 7 .   ? -11.401 -11.136 -8.973  1.00 48.35  ? 588 HOH B O     1 
HETATM 9031 O  O     . HOH J 7 .   ? -19.729 -31.844 -16.931 1.00 44.42  ? 589 HOH B O     1 
HETATM 9032 O  O     . HOH J 7 .   ? -7.198  -36.092 11.165  1.00 55.12  ? 590 HOH B O     1 
HETATM 9033 O  O     . HOH J 7 .   ? -19.831 -20.692 -18.795 1.00 40.36  ? 591 HOH B O     1 
HETATM 9034 O  O     . HOH J 7 .   ? -29.475 -52.766 -14.496 1.00 50.93  ? 592 HOH B O     1 
HETATM 9035 O  O     . HOH J 7 .   ? -8.266  -32.874 5.080   1.00 55.32  ? 593 HOH B O     1 
HETATM 9036 O  O     . HOH J 7 .   ? -5.039  -22.739 1.160   1.00 59.88  ? 594 HOH B O     1 
HETATM 9037 O  O     . HOH J 7 .   ? -24.027 -19.067 9.170   1.00 64.34  ? 595 HOH B O     1 
HETATM 9038 O  O     . HOH J 7 .   ? -33.058 -9.889  -10.956 1.00 41.30  ? 596 HOH B O     1 
HETATM 9039 O  O     . HOH J 7 .   ? -35.504 -48.140 -8.352  1.00 59.91  ? 597 HOH B O     1 
HETATM 9040 O  O     . HOH J 7 .   ? -22.313 -55.072 19.650  1.00 47.89  ? 598 HOH B O     1 
HETATM 9041 O  O     . HOH J 7 .   ? -8.553  -52.426 7.125   1.00 61.40  ? 599 HOH B O     1 
HETATM 9042 O  O     . HOH J 7 .   ? -35.828 -22.529 -17.267 1.00 42.09  ? 600 HOH B O     1 
HETATM 9043 O  O     . HOH J 7 .   ? -35.565 -30.957 11.257  1.00 66.45  ? 601 HOH B O     1 
HETATM 9044 O  O     . HOH J 7 .   ? -36.320 -29.148 -10.681 1.00 30.15  ? 602 HOH B O     1 
HETATM 9045 O  O     . HOH J 7 .   ? -29.573 -30.089 -15.446 1.00 48.03  ? 603 HOH B O     1 
HETATM 9046 O  O     . HOH J 7 .   ? -20.605 -49.896 -5.446  1.00 52.66  ? 604 HOH B O     1 
HETATM 9047 O  O     . HOH J 7 .   ? -44.732 -18.753 -8.693  1.00 49.75  ? 605 HOH B O     1 
HETATM 9048 O  O     . HOH J 7 .   ? -18.105 -67.723 -13.839 1.00 71.14  ? 606 HOH B O     1 
HETATM 9049 O  O     . HOH J 7 .   ? -32.400 -32.914 5.842   1.00 68.67  ? 607 HOH B O     1 
HETATM 9050 O  O     . HOH J 7 .   ? -42.991 -15.891 -8.638  1.00 41.70  ? 608 HOH B O     1 
HETATM 9051 O  O     . HOH J 7 .   ? -40.509 -14.497 -8.388  1.00 36.27  ? 609 HOH B O     1 
HETATM 9052 O  O     . HOH J 7 .   ? -31.255 -20.557 5.161   1.00 57.51  ? 610 HOH B O     1 
HETATM 9053 O  O     . HOH J 7 .   ? -27.986 -21.916 2.407   1.00 44.33  ? 611 HOH B O     1 
HETATM 9054 O  O     . HOH J 7 .   ? -30.653 -37.795 5.043   1.00 96.82  ? 612 HOH B O     1 
HETATM 9055 O  O     . HOH J 7 .   ? -12.077 -55.852 -29.865 1.00 49.88  ? 613 HOH B O     1 
HETATM 9056 O  O     . HOH J 7 .   ? -13.114 -28.067 -10.544 1.00 51.63  ? 614 HOH B O     1 
HETATM 9057 O  O     . HOH J 7 .   ? -18.033 -11.815 10.000  1.00 69.83  ? 615 HOH B O     1 
HETATM 9058 O  O     . HOH J 7 .   ? -35.551 -15.310 7.363   1.00 49.19  ? 616 HOH B O     1 
HETATM 9059 O  O     . HOH J 7 .   ? -23.384 -51.978 -4.375  1.00 65.75  ? 617 HOH B O     1 
HETATM 9060 O  O     . HOH J 7 .   ? -49.905 -18.077 -7.774  1.00 45.27  ? 618 HOH B O     1 
HETATM 9061 O  O     . HOH J 7 .   ? -4.555  -38.571 24.221  1.00 65.03  ? 619 HOH B O     1 
HETATM 9062 O  O     . HOH J 7 .   ? -21.966 -4.029  -12.470 1.00 52.78  ? 620 HOH B O     1 
HETATM 9063 O  O     . HOH J 7 .   ? 8.819   -52.603 -14.498 1.00 63.92  ? 621 HOH B O     1 
HETATM 9064 O  O     . HOH J 7 .   ? -36.034 -10.691 5.633   1.00 44.96  ? 622 HOH B O     1 
HETATM 9065 O  O     . HOH J 7 .   ? -34.077 -29.243 -18.101 1.00 51.26  ? 623 HOH B O     1 
HETATM 9066 O  O     . HOH J 7 .   ? -42.507 -18.858 -1.720  1.00 43.41  ? 624 HOH B O     1 
HETATM 9067 O  O     . HOH J 7 .   ? -13.103 -28.758 -7.771  1.00 60.27  ? 625 HOH B O     1 
HETATM 9068 O  O     . HOH J 7 .   ? -40.969 -12.769 -6.355  1.00 44.61  ? 626 HOH B O     1 
HETATM 9069 O  O     . HOH J 7 .   ? -8.860  -79.437 -34.295 1.00 63.93  ? 627 HOH B O     1 
HETATM 9070 O  O     . HOH J 7 .   ? -3.882  -25.197 2.637   1.00 79.99  ? 628 HOH B O     1 
HETATM 9071 O  O     . HOH J 7 .   ? -34.663 -27.336 -19.873 1.00 61.77  ? 629 HOH B O     1 
HETATM 9072 O  O     . HOH J 7 .   ? -19.904 -5.956  -8.931  1.00 59.59  ? 630 HOH B O     1 
HETATM 9073 O  O     . HOH J 7 .   ? -41.494 -17.372 -6.038  1.00 50.68  ? 631 HOH B O     1 
HETATM 9074 O  O     . HOH K 7 .   ? -19.884 -35.012 -40.402 1.00 54.75  ? 901 HOH P O     1 
HETATM 9075 O  O     . HOH K 7 .   ? -52.248 -10.062 -29.448 1.00 52.15  ? 902 HOH P O     1 
HETATM 9076 O  O     . HOH K 7 .   ? -41.563 -20.460 -38.006 1.00 48.64  ? 903 HOH P O     1 
HETATM 9077 O  O     . HOH K 7 .   ? -34.192 -17.809 -32.272 1.00 55.72  ? 904 HOH P O     1 
HETATM 9078 O  O     . HOH K 7 .   ? -28.606 -43.133 -34.611 1.00 49.61  ? 905 HOH P O     1 
HETATM 9079 O  O     . HOH K 7 .   ? -47.726 -5.765  -28.368 1.00 46.47  ? 906 HOH P O     1 
HETATM 9080 O  O     . HOH K 7 .   ? -29.376 -11.085 -39.259 1.00 63.22  ? 907 HOH P O     1 
HETATM 9081 O  O     . HOH K 7 .   ? -37.838 -12.853 -33.307 1.00 39.54  ? 908 HOH P O     1 
HETATM 9082 O  O     . HOH K 7 .   ? -45.445 -7.352  -31.220 1.00 50.21  ? 909 HOH P O     1 
HETATM 9083 O  O     . HOH K 7 .   ? -23.567 -20.702 -36.338 1.00 57.45  ? 910 HOH P O     1 
HETATM 9084 O  O     . HOH K 7 .   ? -20.894 -39.327 -43.192 1.00 38.67  ? 911 HOH P O     1 
HETATM 9085 O  O     . HOH K 7 .   ? -45.468 -15.666 -26.630 1.00 30.69  ? 912 HOH P O     1 
HETATM 9086 O  O     . HOH K 7 .   ? -49.342 -8.915  -34.881 1.00 52.39  ? 913 HOH P O     1 
HETATM 9087 O  O     . HOH K 7 .   ? -32.408 -18.173 -30.464 1.00 55.58  ? 914 HOH P O     1 
HETATM 9088 O  O     . HOH K 7 .   ? -35.552 -11.624 -33.315 1.00 47.10  ? 915 HOH P O     1 
HETATM 9089 O  O     . HOH L 7 .   ? -28.678 -5.078  -32.183 1.00 39.68  ? 801 HOH T O     1 
HETATM 9090 O  O     . HOH L 7 .   ? -37.252 -3.477  -26.208 1.00 30.43  ? 802 HOH T O     1 
HETATM 9091 O  O     . HOH L 7 .   ? -39.627 -31.719 -41.630 1.00 60.81  ? 803 HOH T O     1 
HETATM 9092 O  O     . HOH L 7 .   ? -32.915 -7.970  -37.026 1.00 49.47  ? 804 HOH T O     1 
HETATM 9093 O  O     . HOH L 7 .   ? -18.532 -39.635 -30.726 1.00 57.42  ? 805 HOH T O     1 
HETATM 9094 O  O     . HOH L 7 .   ? -31.459 -17.231 -24.406 1.00 54.11  ? 806 HOH T O     1 
HETATM 9095 O  O     . HOH L 7 .   ? -35.368 -19.248 -29.367 1.00 50.56  ? 807 HOH T O     1 
HETATM 9096 O  O     . HOH L 7 .   ? -28.340 -10.195 -26.931 1.00 38.97  ? 808 HOH T O     1 
HETATM 9097 O  O     . HOH L 7 .   ? -34.632 -12.517 -29.157 1.00 42.80  ? 809 HOH T O     1 
HETATM 9098 O  O     . HOH L 7 .   ? -36.642 -12.080 -31.239 1.00 39.27  ? 810 HOH T O     1 
HETATM 9099 O  O     . HOH L 7 .   ? -35.725 -9.753  -31.667 1.00 43.16  ? 811 HOH T O     1 
HETATM 9100 O  O     . HOH L 7 .   ? -37.603 -10.318 -23.057 1.00 34.55  ? 812 HOH T O     1 
HETATM 9101 O  O     . HOH L 7 .   ? -38.129 -10.316 -32.558 1.00 40.54  ? 813 HOH T O     1 
HETATM 9102 O  O     . HOH L 7 .   ? -33.521 -16.005 -27.549 1.00 42.75  ? 814 HOH T O     1 
HETATM 9103 O  O     . HOH L 7 .   ? -28.322 -13.406 -23.853 1.00 40.19  ? 815 HOH T O     1 
HETATM 9104 O  O     . HOH L 7 .   ? -35.300 -8.548  -38.978 1.00 67.58  ? 816 HOH T O     1 
HETATM 9105 O  O     . HOH L 7 .   ? -39.724 -21.997 -20.904 1.00 32.77  ? 817 HOH T O     1 
HETATM 9106 O  O     . HOH L 7 .   ? -12.042 -34.898 -36.660 1.00 58.61  ? 818 HOH T O     1 
HETATM 9107 O  O     . HOH L 7 .   ? -9.916  -37.377 -33.862 1.00 58.69  ? 819 HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   1   1   PRO PRO A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  TRP 24  24  24  TRP TRP A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  CYS 38  38  38  CYS CYS A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  MET 41  41  41  MET MET A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  TRP 71  71  71  TRP TRP A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  TRP 88  88  88  TRP TRP A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  HIS 96  96  96  HIS HIS A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 ASN 147 147 147 ASN ASN A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 TRP 153 153 153 TRP TRP A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 MET 164 164 164 MET MET A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 PRO 170 170 170 PRO PRO A . n 
A 1 171 PHE 171 171 171 PHE PHE A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 GLN 174 174 174 GLN GLN A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 PRO 176 176 176 PRO PRO A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 TYR 183 183 183 TYR TYR A . n 
A 1 184 MET 184 184 184 MET MET A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 ASP 186 186 186 ASP ASP A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 ILE 195 195 195 ILE ILE A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 ARG 199 199 199 ARG ARG A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 ILE 202 202 202 ILE ILE A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 HIS 208 208 208 HIS HIS A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 TRP 212 212 212 TRP TRP A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 LYS 220 220 220 LYS LYS A . n 
A 1 221 HIS 221 221 221 HIS HIS A . n 
A 1 222 GLN 222 222 222 GLN GLN A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 PRO 226 226 226 PRO PRO A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 TRP 229 229 229 TRP TRP A . n 
A 1 230 MET 230 230 230 MET MET A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 TYR 232 232 232 TYR TYR A . n 
A 1 233 GLU 233 233 233 GLU GLU A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 HIS 235 235 235 HIS HIS A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 ASP 237 237 237 ASP ASP A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 TRP 239 239 239 TRP TRP A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 GLU 248 248 248 GLU GLU A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 ASP 250 250 250 ASP ASP A . n 
A 1 251 SER 251 251 251 SER SER A . n 
A 1 252 TRP 252 252 252 TRP TRP A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 ASP 256 256 256 ASP ASP A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 CYS 258 258 258 CYS CYS A . n 
A 1 259 LYS 259 259 259 LYS LYS A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 LYS 263 263 263 LYS LYS A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 TRP 266 266 266 TRP TRP A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 SER 268 268 268 SER SER A . n 
A 1 269 GLN 269 269 269 GLN GLN A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 PRO 272 272 272 PRO PRO A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 ILE 274 274 274 ILE ILE A . n 
A 1 275 LYS 275 275 275 LYS LYS A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 GLN 278 278 278 GLN GLN A . n 
A 1 279 LEU 279 279 279 LEU LEU A . n 
A 1 280 SER 280 280 280 SER SER A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 ARG 284 284 284 ARG ARG A . n 
A 1 285 GLY 285 285 285 GLY GLY A . n 
A 1 286 THR 286 286 286 THR THR A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 THR 296 296 296 THR THR A . n 
A 1 297 GLU 297 297 297 GLU GLU A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 GLU 300 300 300 GLU GLU A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 ALA 304 304 304 ALA ALA A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 ASN 306 306 306 ASN ASN A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 GLU 308 308 308 GLU GLU A . n 
A 1 309 ILE 309 309 309 ILE ILE A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 LYS 311 311 311 LYS LYS A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 PRO 313 313 313 PRO PRO A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 HIS 315 315 315 HIS HIS A . n 
A 1 316 GLY 316 316 316 GLY GLY A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 TYR 318 318 318 TYR TYR A . n 
A 1 319 TYR 319 319 319 TYR TYR A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PRO 321 321 321 PRO PRO A . n 
A 1 322 SER 322 322 322 SER SER A . n 
A 1 323 LYS 323 323 323 LYS LYS A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 LEU 325 325 325 LEU LEU A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 ALA 327 327 327 ALA ALA A . n 
A 1 328 GLU 328 328 328 GLU GLU A . n 
A 1 329 ILE 329 329 329 ILE ILE A . n 
A 1 330 GLN 330 330 330 GLN GLN A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 GLN 332 332 332 GLN GLN A . n 
A 1 333 GLY 333 333 333 GLY GLY A . n 
A 1 334 GLN 334 334 334 GLN GLN A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 GLN 336 336 336 GLN GLN A . n 
A 1 337 TRP 337 337 337 TRP TRP A . n 
A 1 338 THR 338 338 338 THR THR A . n 
A 1 339 TYR 339 339 339 TYR TYR A . n 
A 1 340 GLN 340 340 340 GLN GLN A . n 
A 1 341 ILE 341 341 341 ILE ILE A . n 
A 1 342 TYR 342 342 342 TYR TYR A . n 
A 1 343 GLN 343 343 343 GLN GLN A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 PRO 345 345 345 PRO PRO A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 LYS 347 347 347 LYS LYS A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 THR 351 351 351 THR THR A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 ALA 355 355 355 ALA ALA A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 MET 357 357 357 MET MET A . n 
A 1 358 ARG 358 358 358 ARG ARG A . n 
A 1 359 GLY 359 359 359 GLY GLY A . n 
A 1 360 ALA 360 360 360 ALA ALA A . n 
A 1 361 HIS 361 361 361 HIS HIS A . n 
A 1 362 THR 362 362 362 THR THR A . n 
A 1 363 ASN 363 363 363 ASN ASN A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 VAL 365 365 365 VAL VAL A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 GLN 367 367 367 GLN GLN A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 GLU 370 370 370 GLU GLU A . n 
A 1 371 ALA 371 371 371 ALA ALA A . n 
A 1 372 VAL 372 372 372 VAL VAL A . n 
A 1 373 GLN 373 373 373 GLN GLN A . n 
A 1 374 LYS 374 374 374 LYS LYS A . n 
A 1 375 ILE 375 375 375 ILE ILE A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 THR 377 377 377 THR THR A . n 
A 1 378 GLU 378 378 378 GLU GLU A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 ILE 380 380 380 ILE ILE A . n 
A 1 381 VAL 381 381 381 VAL VAL A . n 
A 1 382 ILE 382 382 382 ILE ILE A . n 
A 1 383 TRP 383 383 383 TRP TRP A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 LYS 385 385 385 LYS LYS A . n 
A 1 386 THR 386 386 386 THR THR A . n 
A 1 387 PRO 387 387 387 PRO PRO A . n 
A 1 388 LYS 388 388 388 LYS LYS A . n 
A 1 389 PHE 389 389 389 PHE PHE A . n 
A 1 390 LYS 390 390 390 LYS LYS A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 ILE 393 393 393 ILE ILE A . n 
A 1 394 GLN 394 394 394 GLN GLN A . n 
A 1 395 LYS 395 395 395 LYS LYS A . n 
A 1 396 GLU 396 396 396 GLU GLU A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 TRP 398 398 398 TRP TRP A . n 
A 1 399 GLU 399 399 399 GLU GLU A . n 
A 1 400 THR 400 400 400 THR THR A . n 
A 1 401 TRP 401 401 401 TRP TRP A . n 
A 1 402 TRP 402 402 402 TRP TRP A . n 
A 1 403 THR 403 403 403 THR THR A . n 
A 1 404 GLU 404 404 404 GLU GLU A . n 
A 1 405 TYR 405 405 405 TYR TYR A . n 
A 1 406 TRP 406 406 406 TRP TRP A . n 
A 1 407 GLN 407 407 407 GLN GLN A . n 
A 1 408 ALA 408 408 408 ALA ALA A . n 
A 1 409 THR 409 409 409 THR THR A . n 
A 1 410 TRP 410 410 410 TRP TRP A . n 
A 1 411 ILE 411 411 411 ILE ILE A . n 
A 1 412 PRO 412 412 412 PRO PRO A . n 
A 1 413 GLU 413 413 413 GLU GLU A . n 
A 1 414 TRP 414 414 414 TRP TRP A . n 
A 1 415 GLU 415 415 415 GLU GLU A . n 
A 1 416 PHE 416 416 416 PHE PHE A . n 
A 1 417 VAL 417 417 417 VAL VAL A . n 
A 1 418 ASN 418 418 418 ASN ASN A . n 
A 1 419 THR 419 419 419 THR THR A . n 
A 1 420 PRO 420 420 420 PRO PRO A . n 
A 1 421 PRO 421 421 421 PRO PRO A . n 
A 1 422 LEU 422 422 422 LEU LEU A . n 
A 1 423 VAL 423 423 423 VAL VAL A . n 
A 1 424 LYS 424 424 424 LYS LYS A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 TRP 426 426 426 TRP TRP A . n 
A 1 427 TYR 427 427 427 TYR TYR A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 GLU 430 430 430 GLU GLU A . n 
A 1 431 LYS 431 431 431 LYS LYS A . n 
A 1 432 GLU 432 432 432 GLU GLU A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 ILE 434 434 434 ILE ILE A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ALA 437 437 437 ALA ALA A . n 
A 1 438 GLU 438 438 438 GLU GLU A . n 
A 1 439 THR 439 439 439 THR THR A . n 
A 1 440 PHE 440 440 440 PHE PHE A . n 
A 1 441 TYR 441 441 441 TYR TYR A . n 
A 1 442 VAL 442 442 442 VAL VAL A . n 
A 1 443 ASP 443 443 443 ASP ASP A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 ALA 445 445 445 ALA ALA A . n 
A 1 446 ALA 446 446 446 ALA ALA A . n 
A 1 447 ASN 447 447 447 ASN ASN A . n 
A 1 448 ARG 448 448 448 ARG ARG A . n 
A 1 449 GLU 449 449 449 GLU GLU A . n 
A 1 450 THR 450 450 450 THR THR A . n 
A 1 451 LYS 451 451 451 LYS LYS A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 GLY 453 453 453 GLY GLY A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 ALA 455 455 455 ALA ALA A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 TYR 457 457 457 TYR TYR A . n 
A 1 458 VAL 458 458 458 VAL VAL A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ASN 460 460 460 ASN ASN A . n 
A 1 461 ARG 461 461 461 ARG ARG A . n 
A 1 462 GLY 462 462 462 GLY GLY A . n 
A 1 463 ARG 463 463 463 ARG ARG A . n 
A 1 464 GLN 464 464 464 GLN GLN A . n 
A 1 465 LYS 465 465 465 LYS LYS A . n 
A 1 466 VAL 466 466 466 VAL VAL A . n 
A 1 467 VAL 467 467 467 VAL VAL A . n 
A 1 468 THR 468 468 468 THR THR A . n 
A 1 469 LEU 469 469 469 LEU LEU A . n 
A 1 470 THR 470 470 470 THR THR A . n 
A 1 471 ASP 471 471 471 ASP ASP A . n 
A 1 472 THR 472 472 472 THR THR A . n 
A 1 473 THR 473 473 473 THR THR A . n 
A 1 474 ASN 474 474 474 ASN ASN A . n 
A 1 475 GLN 475 475 475 GLN GLN A . n 
A 1 476 LYS 476 476 476 LYS LYS A . n 
A 1 477 THR 477 477 477 THR THR A . n 
A 1 478 GLU 478 478 478 GLU GLU A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 GLN 480 480 480 GLN GLN A . n 
A 1 481 ALA 481 481 481 ALA ALA A . n 
A 1 482 ILE 482 482 482 ILE ILE A . n 
A 1 483 TYR 483 483 483 TYR TYR A . n 
A 1 484 LEU 484 484 484 LEU LEU A . n 
A 1 485 ALA 485 485 485 ALA ALA A . n 
A 1 486 LEU 486 486 486 LEU LEU A . n 
A 1 487 GLN 487 487 487 GLN GLN A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 SER 489 489 489 SER SER A . n 
A 1 490 GLY 490 490 490 GLY GLY A . n 
A 1 491 LEU 491 491 491 LEU LEU A . n 
A 1 492 GLU 492 492 492 GLU GLU A . n 
A 1 493 VAL 493 493 493 VAL VAL A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 ILE 495 495 495 ILE ILE A . n 
A 1 496 VAL 496 496 496 VAL VAL A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 ASP 498 498 498 ASP ASP A . n 
A 1 499 SER 499 499 499 SER SER A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 TYR 501 501 501 TYR TYR A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 LEU 503 503 503 LEU LEU A . n 
A 1 504 GLY 504 504 504 GLY GLY A . n 
A 1 505 ILE 505 505 505 ILE ILE A . n 
A 1 506 ILE 506 506 506 ILE ILE A . n 
A 1 507 GLN 507 507 507 GLN GLN A . n 
A 1 508 ALA 508 508 508 ALA ALA A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 PRO 510 510 510 PRO PRO A . n 
A 1 511 ASP 511 511 511 ASP ASP A . n 
A 1 512 GLN 512 512 512 GLN GLN A . n 
A 1 513 SER 513 513 513 SER SER A . n 
A 1 514 GLU 514 514 514 GLU GLU A . n 
A 1 515 SER 515 515 515 SER SER A . n 
A 1 516 GLU 516 516 516 GLU GLU A . n 
A 1 517 LEU 517 517 517 LEU LEU A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 ASN 519 519 519 ASN ASN A . n 
A 1 520 GLN 520 520 520 GLN GLN A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 ILE 522 522 522 ILE ILE A . n 
A 1 523 GLU 523 523 523 GLU GLU A . n 
A 1 524 GLN 524 524 524 GLN GLN A . n 
A 1 525 LEU 525 525 525 LEU LEU A . n 
A 1 526 ILE 526 526 526 ILE ILE A . n 
A 1 527 LYS 527 527 527 LYS LYS A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 GLU 529 529 529 GLU GLU A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 VAL 531 531 531 VAL VAL A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 TRP 535 535 535 TRP TRP A . n 
A 1 536 VAL 536 536 536 VAL VAL A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 ALA 538 538 538 ALA ALA A . n 
A 1 539 HIS 539 539 539 HIS HIS A . n 
A 1 540 LYS 540 540 540 LYS LYS A . n 
A 1 541 GLY 541 541 541 GLY GLY A . n 
A 1 542 ILE 542 542 542 ILE ILE A . n 
A 1 543 GLY 543 543 543 GLY GLY A . n 
A 1 544 GLY 544 544 544 GLY GLY A . n 
A 1 545 ASN 545 545 545 ASN ASN A . n 
A 1 546 GLU 546 546 546 GLU GLU A . n 
A 1 547 GLN 547 547 547 GLN GLN A . n 
A 1 548 VAL 548 548 548 VAL VAL A . n 
A 1 549 ASP 549 549 549 ASP ASP A . n 
A 1 550 LYS 550 550 550 LYS LYS A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 VAL 552 552 552 VAL VAL A . n 
A 1 553 SER 553 553 553 SER SER A . n 
A 1 554 ALA 554 554 554 ALA ALA A . n 
A 1 555 GLY 555 555 555 GLY GLY A . n 
A 1 556 ILE 556 556 556 ILE ILE A . n 
A 1 557 ARG 557 557 557 ARG ARG A . n 
A 1 558 LYS 558 558 558 LYS LYS A . n 
A 1 559 VAL 559 559 ?   ?   ?   A . n 
A 1 560 LEU 560 560 ?   ?   ?   A . n 
B 2 1   PRO 1   1   ?   ?   ?   B . n 
B 2 2   ILE 2   2   ?   ?   ?   B . n 
B 2 3   SER 3   3   ?   ?   ?   B . n 
B 2 4   PRO 4   4   4   PRO PRO B . n 
B 2 5   ILE 5   5   5   ILE ILE B . n 
B 2 6   GLU 6   6   6   GLU GLU B . n 
B 2 7   THR 7   7   7   THR THR B . n 
B 2 8   VAL 8   8   8   VAL VAL B . n 
B 2 9   PRO 9   9   9   PRO PRO B . n 
B 2 10  VAL 10  10  10  VAL VAL B . n 
B 2 11  LYS 11  11  11  LYS LYS B . n 
B 2 12  LEU 12  12  12  LEU LEU B . n 
B 2 13  LYS 13  13  13  LYS LYS B . n 
B 2 14  PRO 14  14  14  PRO PRO B . n 
B 2 15  GLY 15  15  15  GLY GLY B . n 
B 2 16  MET 16  16  16  MET MET B . n 
B 2 17  ASP 17  17  17  ASP ASP B . n 
B 2 18  GLY 18  18  18  GLY GLY B . n 
B 2 19  PRO 19  19  19  PRO PRO B . n 
B 2 20  LYS 20  20  20  LYS LYS B . n 
B 2 21  VAL 21  21  21  VAL VAL B . n 
B 2 22  LYS 22  22  22  LYS LYS B . n 
B 2 23  GLN 23  23  23  GLN GLN B . n 
B 2 24  TRP 24  24  24  TRP TRP B . n 
B 2 25  PRO 25  25  25  PRO PRO B . n 
B 2 26  LEU 26  26  26  LEU LEU B . n 
B 2 27  THR 27  27  27  THR THR B . n 
B 2 28  GLU 28  28  28  GLU GLU B . n 
B 2 29  GLU 29  29  29  GLU GLU B . n 
B 2 30  LYS 30  30  30  LYS LYS B . n 
B 2 31  ILE 31  31  31  ILE ILE B . n 
B 2 32  LYS 32  32  32  LYS LYS B . n 
B 2 33  ALA 33  33  33  ALA ALA B . n 
B 2 34  LEU 34  34  34  LEU LEU B . n 
B 2 35  VAL 35  35  35  VAL VAL B . n 
B 2 36  GLU 36  36  36  GLU GLU B . n 
B 2 37  ILE 37  37  37  ILE ILE B . n 
B 2 38  CYS 38  38  38  CYS CYS B . n 
B 2 39  THR 39  39  39  THR THR B . n 
B 2 40  GLU 40  40  40  GLU GLU B . n 
B 2 41  MET 41  41  41  MET MET B . n 
B 2 42  GLU 42  42  42  GLU GLU B . n 
B 2 43  LYS 43  43  43  LYS LYS B . n 
B 2 44  GLU 44  44  44  GLU GLU B . n 
B 2 45  GLY 45  45  45  GLY GLY B . n 
B 2 46  LYS 46  46  46  LYS LYS B . n 
B 2 47  ILE 47  47  47  ILE ILE B . n 
B 2 48  SER 48  48  48  SER SER B . n 
B 2 49  LYS 49  49  49  LYS LYS B . n 
B 2 50  ILE 50  50  50  ILE ILE B . n 
B 2 51  GLY 51  51  51  GLY GLY B . n 
B 2 52  PRO 52  52  52  PRO PRO B . n 
B 2 53  GLU 53  53  53  GLU GLU B . n 
B 2 54  ASN 54  54  54  ASN ASN B . n 
B 2 55  PRO 55  55  55  PRO PRO B . n 
B 2 56  TYR 56  56  56  TYR TYR B . n 
B 2 57  ASN 57  57  57  ASN ASN B . n 
B 2 58  THR 58  58  58  THR THR B . n 
B 2 59  PRO 59  59  59  PRO PRO B . n 
B 2 60  VAL 60  60  60  VAL VAL B . n 
B 2 61  PHE 61  61  61  PHE PHE B . n 
B 2 62  ALA 62  62  62  ALA ALA B . n 
B 2 63  ILE 63  63  63  ILE ILE B . n 
B 2 64  LYS 64  64  64  LYS LYS B . n 
B 2 65  LYS 65  65  65  LYS LYS B . n 
B 2 66  LYS 66  66  66  LYS LYS B . n 
B 2 67  ASP 67  67  67  ASP ASP B . n 
B 2 68  SER 68  68  68  SER SER B . n 
B 2 69  THR 69  69  69  THR THR B . n 
B 2 70  LYS 70  70  70  LYS LYS B . n 
B 2 71  TRP 71  71  71  TRP TRP B . n 
B 2 72  ARG 72  72  72  ARG ARG B . n 
B 2 73  LYS 73  73  73  LYS LYS B . n 
B 2 74  LEU 74  74  74  LEU LEU B . n 
B 2 75  VAL 75  75  75  VAL VAL B . n 
B 2 76  ASP 76  76  76  ASP ASP B . n 
B 2 77  PHE 77  77  77  PHE PHE B . n 
B 2 78  ARG 78  78  78  ARG ARG B . n 
B 2 79  GLU 79  79  79  GLU GLU B . n 
B 2 80  LEU 80  80  80  LEU LEU B . n 
B 2 81  ASN 81  81  81  ASN ASN B . n 
B 2 82  LYS 82  82  82  LYS LYS B . n 
B 2 83  ARG 83  83  83  ARG ARG B . n 
B 2 84  THR 84  84  84  THR THR B . n 
B 2 85  GLN 85  85  ?   ?   ?   B . n 
B 2 86  ASP 86  86  ?   ?   ?   B . n 
B 2 87  PHE 87  87  ?   ?   ?   B . n 
B 2 88  TRP 88  88  ?   ?   ?   B . n 
B 2 89  GLU 89  89  ?   ?   ?   B . n 
B 2 90  VAL 90  90  ?   ?   ?   B . n 
B 2 91  GLN 91  91  ?   ?   ?   B . n 
B 2 92  LEU 92  92  ?   ?   ?   B . n 
B 2 93  GLY 93  93  ?   ?   ?   B . n 
B 2 94  ILE 94  94  ?   ?   ?   B . n 
B 2 95  PRO 95  95  ?   ?   ?   B . n 
B 2 96  HIS 96  96  96  HIS HIS B . n 
B 2 97  PRO 97  97  97  PRO PRO B . n 
B 2 98  ALA 98  98  98  ALA ALA B . n 
B 2 99  GLY 99  99  99  GLY GLY B . n 
B 2 100 LEU 100 100 100 LEU LEU B . n 
B 2 101 LYS 101 101 101 LYS LYS B . n 
B 2 102 LYS 102 102 102 LYS LYS B . n 
B 2 103 LYS 103 103 103 LYS LYS B . n 
B 2 104 LYS 104 104 104 LYS LYS B . n 
B 2 105 SER 105 105 105 SER SER B . n 
B 2 106 VAL 106 106 106 VAL VAL B . n 
B 2 107 THR 107 107 107 THR THR B . n 
B 2 108 VAL 108 108 108 VAL VAL B . n 
B 2 109 LEU 109 109 109 LEU LEU B . n 
B 2 110 ASP 110 110 110 ASP ASP B . n 
B 2 111 VAL 111 111 111 VAL VAL B . n 
B 2 112 GLY 112 112 112 GLY GLY B . n 
B 2 113 ASP 113 113 113 ASP ASP B . n 
B 2 114 ALA 114 114 114 ALA ALA B . n 
B 2 115 TYR 115 115 115 TYR TYR B . n 
B 2 116 PHE 116 116 116 PHE PHE B . n 
B 2 117 SER 117 117 117 SER SER B . n 
B 2 118 VAL 118 118 118 VAL VAL B . n 
B 2 119 PRO 119 119 119 PRO PRO B . n 
B 2 120 LEU 120 120 120 LEU LEU B . n 
B 2 121 ASP 121 121 121 ASP ASP B . n 
B 2 122 GLU 122 122 122 GLU GLU B . n 
B 2 123 ASP 123 123 123 ASP ASP B . n 
B 2 124 PHE 124 124 124 PHE PHE B . n 
B 2 125 ARG 125 125 125 ARG ARG B . n 
B 2 126 LYS 126 126 126 LYS LYS B . n 
B 2 127 TYR 127 127 127 TYR TYR B . n 
B 2 128 THR 128 128 128 THR THR B . n 
B 2 129 ALA 129 129 129 ALA ALA B . n 
B 2 130 PHE 130 130 130 PHE PHE B . n 
B 2 131 THR 131 131 131 THR THR B . n 
B 2 132 ILE 132 132 132 ILE ILE B . n 
B 2 133 PRO 133 133 133 PRO PRO B . n 
B 2 134 SER 134 134 134 SER SER B . n 
B 2 135 ILE 135 135 135 ILE ILE B . n 
B 2 136 ASN 136 136 136 ASN ASN B . n 
B 2 137 ASN 137 137 137 ASN ASN B . n 
B 2 138 GLU 138 138 138 GLU GLU B . n 
B 2 139 THR 139 139 139 THR THR B . n 
B 2 140 PRO 140 140 140 PRO PRO B . n 
B 2 141 GLY 141 141 141 GLY GLY B . n 
B 2 142 ILE 142 142 142 ILE ILE B . n 
B 2 143 ARG 143 143 143 ARG ARG B . n 
B 2 144 TYR 144 144 144 TYR TYR B . n 
B 2 145 GLN 145 145 145 GLN GLN B . n 
B 2 146 TYR 146 146 146 TYR TYR B . n 
B 2 147 ASN 147 147 147 ASN ASN B . n 
B 2 148 VAL 148 148 148 VAL VAL B . n 
B 2 149 LEU 149 149 149 LEU LEU B . n 
B 2 150 PRO 150 150 150 PRO PRO B . n 
B 2 151 GLN 151 151 151 GLN GLN B . n 
B 2 152 GLY 152 152 152 GLY GLY B . n 
B 2 153 TRP 153 153 153 TRP TRP B . n 
B 2 154 LYS 154 154 154 LYS LYS B . n 
B 2 155 GLY 155 155 155 GLY GLY B . n 
B 2 156 SER 156 156 156 SER SER B . n 
B 2 157 PRO 157 157 157 PRO PRO B . n 
B 2 158 ALA 158 158 158 ALA ALA B . n 
B 2 159 ILE 159 159 159 ILE ILE B . n 
B 2 160 PHE 160 160 160 PHE PHE B . n 
B 2 161 GLN 161 161 161 GLN GLN B . n 
B 2 162 SER 162 162 162 SER SER B . n 
B 2 163 SER 163 163 163 SER SER B . n 
B 2 164 MET 164 164 164 MET MET B . n 
B 2 165 THR 165 165 165 THR THR B . n 
B 2 166 LYS 166 166 166 LYS LYS B . n 
B 2 167 ILE 167 167 167 ILE ILE B . n 
B 2 168 LEU 168 168 168 LEU LEU B . n 
B 2 169 GLU 169 169 169 GLU GLU B . n 
B 2 170 PRO 170 170 170 PRO PRO B . n 
B 2 171 PHE 171 171 171 PHE PHE B . n 
B 2 172 ARG 172 172 172 ARG ARG B . n 
B 2 173 LYS 173 173 173 LYS LYS B . n 
B 2 174 GLN 174 174 174 GLN GLN B . n 
B 2 175 ASN 175 175 175 ASN ASN B . n 
B 2 176 PRO 176 176 176 PRO PRO B . n 
B 2 177 ASP 177 177 177 ASP ASP B . n 
B 2 178 ILE 178 178 178 ILE ILE B . n 
B 2 179 VAL 179 179 179 VAL VAL B . n 
B 2 180 ILE 180 180 180 ILE ILE B . n 
B 2 181 TYR 181 181 181 TYR TYR B . n 
B 2 182 GLN 182 182 182 GLN GLN B . n 
B 2 183 TYR 183 183 183 TYR TYR B . n 
B 2 184 MET 184 184 184 MET MET B . n 
B 2 185 ASP 185 185 185 ASP ASP B . n 
B 2 186 ASP 186 186 186 ASP ASP B . n 
B 2 187 LEU 187 187 187 LEU LEU B . n 
B 2 188 TYR 188 188 188 TYR TYR B . n 
B 2 189 VAL 189 189 189 VAL VAL B . n 
B 2 190 GLY 190 190 190 GLY GLY B . n 
B 2 191 SER 191 191 191 SER SER B . n 
B 2 192 ASP 192 192 192 ASP ASP B . n 
B 2 193 LEU 193 193 193 LEU LEU B . n 
B 2 194 GLU 194 194 194 GLU GLU B . n 
B 2 195 ILE 195 195 195 ILE ILE B . n 
B 2 196 GLY 196 196 196 GLY GLY B . n 
B 2 197 GLN 197 197 197 GLN GLN B . n 
B 2 198 HIS 198 198 198 HIS HIS B . n 
B 2 199 ARG 199 199 199 ARG ARG B . n 
B 2 200 THR 200 200 200 THR THR B . n 
B 2 201 LYS 201 201 201 LYS LYS B . n 
B 2 202 ILE 202 202 202 ILE ILE B . n 
B 2 203 GLU 203 203 203 GLU GLU B . n 
B 2 204 GLU 204 204 204 GLU GLU B . n 
B 2 205 LEU 205 205 205 LEU LEU B . n 
B 2 206 ARG 206 206 206 ARG ARG B . n 
B 2 207 GLN 207 207 207 GLN GLN B . n 
B 2 208 HIS 208 208 208 HIS HIS B . n 
B 2 209 LEU 209 209 209 LEU LEU B . n 
B 2 210 LEU 210 210 210 LEU LEU B . n 
B 2 211 ARG 211 211 211 ARG ARG B . n 
B 2 212 TRP 212 212 212 TRP TRP B . n 
B 2 213 GLY 213 213 213 GLY GLY B . n 
B 2 214 LEU 214 214 214 LEU LEU B . n 
B 2 215 THR 215 215 ?   ?   ?   B . n 
B 2 216 THR 216 216 ?   ?   ?   B . n 
B 2 217 PRO 217 217 ?   ?   ?   B . n 
B 2 218 ASP 218 218 ?   ?   ?   B . n 
B 2 219 LYS 219 219 ?   ?   ?   B . n 
B 2 220 LYS 220 220 ?   ?   ?   B . n 
B 2 221 HIS 221 221 ?   ?   ?   B . n 
B 2 222 GLN 222 222 ?   ?   ?   B . n 
B 2 223 LYS 223 223 ?   ?   ?   B . n 
B 2 224 GLU 224 224 ?   ?   ?   B . n 
B 2 225 PRO 225 225 ?   ?   ?   B . n 
B 2 226 PRO 226 226 ?   ?   ?   B . n 
B 2 227 PHE 227 227 ?   ?   ?   B . n 
B 2 228 LEU 228 228 ?   ?   ?   B . n 
B 2 229 TRP 229 229 ?   ?   ?   B . n 
B 2 230 MET 230 230 ?   ?   ?   B . n 
B 2 231 GLY 231 231 ?   ?   ?   B . n 
B 2 232 TYR 232 232 ?   ?   ?   B . n 
B 2 233 GLU 233 233 233 GLU GLU B . n 
B 2 234 LEU 234 234 234 LEU LEU B . n 
B 2 235 HIS 235 235 235 HIS HIS B . n 
B 2 236 PRO 236 236 236 PRO PRO B . n 
B 2 237 ASP 237 237 237 ASP ASP B . n 
B 2 238 LYS 238 238 238 LYS LYS B . n 
B 2 239 TRP 239 239 239 TRP TRP B . n 
B 2 240 THR 240 240 240 THR THR B . n 
B 2 241 VAL 241 241 241 VAL VAL B . n 
B 2 242 GLN 242 242 242 GLN GLN B . n 
B 2 243 PRO 243 243 243 PRO PRO B . n 
B 2 244 ILE 244 244 244 ILE ILE B . n 
B 2 245 VAL 245 245 245 VAL VAL B . n 
B 2 246 LEU 246 246 246 LEU LEU B . n 
B 2 247 PRO 247 247 247 PRO PRO B . n 
B 2 248 GLU 248 248 248 GLU GLU B . n 
B 2 249 LYS 249 249 249 LYS LYS B . n 
B 2 250 ASP 250 250 250 ASP ASP B . n 
B 2 251 SER 251 251 251 SER SER B . n 
B 2 252 TRP 252 252 252 TRP TRP B . n 
B 2 253 THR 253 253 253 THR THR B . n 
B 2 254 VAL 254 254 254 VAL VAL B . n 
B 2 255 ASN 255 255 255 ASN ASN B . n 
B 2 256 ASP 256 256 256 ASP ASP B . n 
B 2 257 ILE 257 257 257 ILE ILE B . n 
B 2 258 GLN 258 258 258 GLN GLN B . n 
B 2 259 LYS 259 259 259 LYS LYS B . n 
B 2 260 LEU 260 260 260 LEU LEU B . n 
B 2 261 VAL 261 261 261 VAL VAL B . n 
B 2 262 GLY 262 262 262 GLY GLY B . n 
B 2 263 LYS 263 263 263 LYS LYS B . n 
B 2 264 LEU 264 264 264 LEU LEU B . n 
B 2 265 ASN 265 265 265 ASN ASN B . n 
B 2 266 TRP 266 266 266 TRP TRP B . n 
B 2 267 ALA 267 267 267 ALA ALA B . n 
B 2 268 SER 268 268 268 SER SER B . n 
B 2 269 GLN 269 269 269 GLN GLN B . n 
B 2 270 ILE 270 270 270 ILE ILE B . n 
B 2 271 TYR 271 271 271 TYR TYR B . n 
B 2 272 PRO 272 272 272 PRO PRO B . n 
B 2 273 GLY 273 273 273 GLY GLY B . n 
B 2 274 ILE 274 274 274 ILE ILE B . n 
B 2 275 LYS 275 275 275 LYS LYS B . n 
B 2 276 VAL 276 276 276 VAL VAL B . n 
B 2 277 ARG 277 277 277 ARG ARG B . n 
B 2 278 GLN 278 278 278 GLN GLN B . n 
B 2 279 LEU 279 279 279 LEU LEU B . n 
B 2 280 SER 280 280 280 SER SER B . n 
B 2 281 LYS 281 281 281 LYS LYS B . n 
B 2 282 LEU 282 282 282 LEU LEU B . n 
B 2 283 LEU 283 283 283 LEU LEU B . n 
B 2 284 ARG 284 284 284 ARG ARG B . n 
B 2 285 GLY 285 285 285 GLY GLY B . n 
B 2 286 THR 286 286 286 THR THR B . n 
B 2 287 LYS 287 287 287 LYS LYS B . n 
B 2 288 ALA 288 288 288 ALA ALA B . n 
B 2 289 LEU 289 289 289 LEU LEU B . n 
B 2 290 THR 290 290 290 THR THR B . n 
B 2 291 GLU 291 291 291 GLU GLU B . n 
B 2 292 VAL 292 292 292 VAL VAL B . n 
B 2 293 ILE 293 293 293 ILE ILE B . n 
B 2 294 PRO 294 294 294 PRO PRO B . n 
B 2 295 LEU 295 295 295 LEU LEU B . n 
B 2 296 THR 296 296 296 THR THR B . n 
B 2 297 GLU 297 297 297 GLU GLU B . n 
B 2 298 GLU 298 298 298 GLU GLU B . n 
B 2 299 ALA 299 299 299 ALA ALA B . n 
B 2 300 GLU 300 300 300 GLU GLU B . n 
B 2 301 LEU 301 301 301 LEU LEU B . n 
B 2 302 GLU 302 302 302 GLU GLU B . n 
B 2 303 LEU 303 303 303 LEU LEU B . n 
B 2 304 ALA 304 304 304 ALA ALA B . n 
B 2 305 GLU 305 305 305 GLU GLU B . n 
B 2 306 ASN 306 306 306 ASN ASN B . n 
B 2 307 ARG 307 307 307 ARG ARG B . n 
B 2 308 GLU 308 308 308 GLU GLU B . n 
B 2 309 ILE 309 309 309 ILE ILE B . n 
B 2 310 LEU 310 310 310 LEU LEU B . n 
B 2 311 LYS 311 311 311 LYS LYS B . n 
B 2 312 GLU 312 312 312 GLU GLU B . n 
B 2 313 PRO 313 313 313 PRO PRO B . n 
B 2 314 VAL 314 314 314 VAL VAL B . n 
B 2 315 HIS 315 315 315 HIS HIS B . n 
B 2 316 GLY 316 316 316 GLY GLY B . n 
B 2 317 VAL 317 317 317 VAL VAL B . n 
B 2 318 TYR 318 318 318 TYR TYR B . n 
B 2 319 TYR 319 319 319 TYR TYR B . n 
B 2 320 ASP 320 320 320 ASP ASP B . n 
B 2 321 PRO 321 321 321 PRO PRO B . n 
B 2 322 SER 322 322 322 SER SER B . n 
B 2 323 LYS 323 323 323 LYS LYS B . n 
B 2 324 ASP 324 324 324 ASP ASP B . n 
B 2 325 LEU 325 325 325 LEU LEU B . n 
B 2 326 ILE 326 326 326 ILE ILE B . n 
B 2 327 ALA 327 327 327 ALA ALA B . n 
B 2 328 GLU 328 328 328 GLU GLU B . n 
B 2 329 ILE 329 329 329 ILE ILE B . n 
B 2 330 GLN 330 330 330 GLN GLN B . n 
B 2 331 LYS 331 331 331 LYS LYS B . n 
B 2 332 GLN 332 332 332 GLN GLN B . n 
B 2 333 GLY 333 333 333 GLY GLY B . n 
B 2 334 GLN 334 334 334 GLN GLN B . n 
B 2 335 GLY 335 335 335 GLY GLY B . n 
B 2 336 GLN 336 336 336 GLN GLN B . n 
B 2 337 TRP 337 337 337 TRP TRP B . n 
B 2 338 THR 338 338 338 THR THR B . n 
B 2 339 TYR 339 339 339 TYR TYR B . n 
B 2 340 GLN 340 340 340 GLN GLN B . n 
B 2 341 ILE 341 341 341 ILE ILE B . n 
B 2 342 TYR 342 342 342 TYR TYR B . n 
B 2 343 GLN 343 343 343 GLN GLN B . n 
B 2 344 GLU 344 344 344 GLU GLU B . n 
B 2 345 PRO 345 345 345 PRO PRO B . n 
B 2 346 PHE 346 346 346 PHE PHE B . n 
B 2 347 LYS 347 347 347 LYS LYS B . n 
B 2 348 ASN 348 348 348 ASN ASN B . n 
B 2 349 LEU 349 349 349 LEU LEU B . n 
B 2 350 LYS 350 350 350 LYS LYS B . n 
B 2 351 THR 351 351 351 THR THR B . n 
B 2 352 GLY 352 352 352 GLY GLY B . n 
B 2 353 LYS 353 353 353 LYS LYS B . n 
B 2 354 TYR 354 354 354 TYR TYR B . n 
B 2 355 ALA 355 355 355 ALA ALA B . n 
B 2 356 ARG 356 356 356 ARG ARG B . n 
B 2 357 MET 357 357 357 MET MET B . n 
B 2 358 ARG 358 358 358 ARG ARG B . n 
B 2 359 GLY 359 359 359 GLY GLY B . n 
B 2 360 ALA 360 360 360 ALA ALA B . n 
B 2 361 HIS 361 361 361 HIS HIS B . n 
B 2 362 THR 362 362 362 THR THR B . n 
B 2 363 ASN 363 363 363 ASN ASN B . n 
B 2 364 ASP 364 364 364 ASP ASP B . n 
B 2 365 VAL 365 365 365 VAL VAL B . n 
B 2 366 LYS 366 366 366 LYS LYS B . n 
B 2 367 GLN 367 367 367 GLN GLN B . n 
B 2 368 LEU 368 368 368 LEU LEU B . n 
B 2 369 THR 369 369 369 THR THR B . n 
B 2 370 GLU 370 370 370 GLU GLU B . n 
B 2 371 ALA 371 371 371 ALA ALA B . n 
B 2 372 VAL 372 372 372 VAL VAL B . n 
B 2 373 GLN 373 373 373 GLN GLN B . n 
B 2 374 LYS 374 374 374 LYS LYS B . n 
B 2 375 ILE 375 375 375 ILE ILE B . n 
B 2 376 THR 376 376 376 THR THR B . n 
B 2 377 THR 377 377 377 THR THR B . n 
B 2 378 GLU 378 378 378 GLU GLU B . n 
B 2 379 SER 379 379 379 SER SER B . n 
B 2 380 ILE 380 380 380 ILE ILE B . n 
B 2 381 VAL 381 381 381 VAL VAL B . n 
B 2 382 ILE 382 382 382 ILE ILE B . n 
B 2 383 TRP 383 383 383 TRP TRP B . n 
B 2 384 GLY 384 384 384 GLY GLY B . n 
B 2 385 LYS 385 385 385 LYS LYS B . n 
B 2 386 THR 386 386 386 THR THR B . n 
B 2 387 PRO 387 387 387 PRO PRO B . n 
B 2 388 LYS 388 388 388 LYS LYS B . n 
B 2 389 PHE 389 389 389 PHE PHE B . n 
B 2 390 LYS 390 390 390 LYS LYS B . n 
B 2 391 LEU 391 391 391 LEU LEU B . n 
B 2 392 PRO 392 392 392 PRO PRO B . n 
B 2 393 ILE 393 393 393 ILE ILE B . n 
B 2 394 GLN 394 394 394 GLN GLN B . n 
B 2 395 LYS 395 395 395 LYS LYS B . n 
B 2 396 GLU 396 396 396 GLU GLU B . n 
B 2 397 THR 397 397 397 THR THR B . n 
B 2 398 TRP 398 398 398 TRP TRP B . n 
B 2 399 GLU 399 399 399 GLU GLU B . n 
B 2 400 THR 400 400 400 THR THR B . n 
B 2 401 TRP 401 401 401 TRP TRP B . n 
B 2 402 TRP 402 402 402 TRP TRP B . n 
B 2 403 THR 403 403 403 THR THR B . n 
B 2 404 GLU 404 404 404 GLU GLU B . n 
B 2 405 TYR 405 405 405 TYR TYR B . n 
B 2 406 TRP 406 406 406 TRP TRP B . n 
B 2 407 GLN 407 407 407 GLN GLN B . n 
B 2 408 ALA 408 408 408 ALA ALA B . n 
B 2 409 THR 409 409 409 THR THR B . n 
B 2 410 TRP 410 410 410 TRP TRP B . n 
B 2 411 ILE 411 411 411 ILE ILE B . n 
B 2 412 PRO 412 412 412 PRO PRO B . n 
B 2 413 GLU 413 413 413 GLU GLU B . n 
B 2 414 TRP 414 414 414 TRP TRP B . n 
B 2 415 GLU 415 415 415 GLU GLU B . n 
B 2 416 PHE 416 416 416 PHE PHE B . n 
B 2 417 VAL 417 417 417 VAL VAL B . n 
B 2 418 ASN 418 418 418 ASN ASN B . n 
B 2 419 THR 419 419 419 THR THR B . n 
B 2 420 PRO 420 420 420 PRO PRO B . n 
B 2 421 PRO 421 421 421 PRO PRO B . n 
B 2 422 LEU 422 422 422 LEU LEU B . n 
B 2 423 VAL 423 423 423 VAL VAL B . n 
B 2 424 LYS 424 424 424 LYS LYS B . n 
B 2 425 LEU 425 425 425 LEU LEU B . n 
B 2 426 TRP 426 426 426 TRP TRP B . n 
B 2 427 TYR 427 427 427 TYR TYR B . n 
B 2 428 GLN 428 428 428 GLN GLN B . n 
B 2 429 LEU 429 429 429 LEU LEU B . n 
B 2 430 GLU 430 430 430 GLU GLU B . n 
B 2 431 LYS 431 431 ?   ?   ?   B . n 
B 2 432 GLU 432 432 ?   ?   ?   B . n 
B 2 433 PRO 433 433 ?   ?   ?   B . n 
B 2 434 ILE 434 434 ?   ?   ?   B . n 
B 2 435 VAL 435 435 ?   ?   ?   B . n 
B 2 436 GLY 436 436 ?   ?   ?   B . n 
B 2 437 ALA 437 437 ?   ?   ?   B . n 
B 2 438 GLU 438 438 ?   ?   ?   B . n 
B 2 439 THR 439 439 ?   ?   ?   B . n 
B 2 440 PHE 440 440 ?   ?   ?   B . n 
C 3 1   DA  1   802 ?   ?   ?   P . n 
C 3 2   DC  2   803 ?   ?   ?   P . n 
C 3 3   DA  3   804 ?   ?   ?   P . n 
C 3 4   DG  4   805 805 DG  DG  P . n 
C 3 5   DT  5   806 806 DT  DT  P . n 
C 3 6   DC  6   807 807 DC  DC  P . n 
C 3 7   DC  7   808 808 DC  DC  P . n 
C 3 8   DC  8   809 809 DC  DC  P . n 
C 3 9   DT  9   810 810 DT  DT  P . n 
C 3 10  DG  10  811 811 DG  DG  P . n 
C 3 11  DT  11  812 812 DT  DT  P . n 
C 3 12  DT  12  813 813 DT  DT  P . n 
C 3 13  DC  13  814 814 DC  DC  P . n 
C 3 14  DG  14  815 815 DG  DG  P . n 
C 3 15  DG  15  816 816 DG  DG  P . n 
C 3 16  MRG 16  817 817 MRG MRG P . n 
C 3 17  DC  17  818 818 DC  DC  P . n 
C 3 18  DG  18  819 819 DG  DG  P . n 
C 3 19  DC  19  820 820 DC  DC  P . n 
C 3 20  DC  20  821 821 DC  DC  P . n 
C 3 21  DG  21  822 822 DG  DG  P . n 
D 4 1   DA  1   701 ?   ?   ?   T . n 
D 4 2   DT  2   702 702 DT  DT  T . n 
D 4 3   DG  3   703 703 DG  DG  T . n 
D 4 4   DG  4   704 704 DG  DG  T . n 
D 4 5   DT  5   705 705 DT  DT  T . n 
D 4 6   DC  6   706 706 DC  DC  T . n 
D 4 7   DG  7   707 707 DG  DG  T . n 
D 4 8   DG  8   708 708 DG  DG  T . n 
D 4 9   DC  9   709 709 DC  DC  T . n 
D 4 10  DG  10  710 710 DG  DG  T . n 
D 4 11  DC  11  711 711 DC  DC  T . n 
D 4 12  DC  12  712 712 DC  DC  T . n 
D 4 13  DC  13  713 713 DC  DC  T . n 
D 4 14  DG  14  714 714 DG  DG  T . n 
D 4 15  DA  15  715 715 DA  DA  T . n 
D 4 16  DA  16  716 716 DA  DA  T . n 
D 4 17  DC  17  717 717 DC  DC  T . n 
D 4 18  DA  18  718 718 DA  DA  T . n 
D 4 19  DG  19  719 719 DG  DG  T . n 
D 4 20  DG  20  720 720 DG  DG  T . n 
D 4 21  DG  21  721 721 DG  DG  T . n 
D 4 22  DA  22  722 722 DA  DA  T . n 
D 4 23  DC  23  723 723 DC  DC  T . n 
D 4 24  DT  24  724 724 DT  DT  T . n 
D 4 25  DG  25  725 725 DG  DG  T . n 
D 4 26  DT  26  726 ?   ?   ?   T . n 
D 4 27  DG  27  727 ?   ?   ?   T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 MG  1   601 559 MG  MG  A . 
F 5 MG  1   602 560 MG  MG  A . 
G 5 MG  1   603 561 MG  MG  A . 
H 6 6FN 1   604 1   6FN E03 A . 
I 7 HOH 1   701 732 HOH HOH A . 
I 7 HOH 2   702 609 HOH HOH A . 
I 7 HOH 3   703 737 HOH HOH A . 
I 7 HOH 4   704 678 HOH HOH A . 
I 7 HOH 5   705 794 HOH HOH A . 
I 7 HOH 6   706 592 HOH HOH A . 
I 7 HOH 7   707 621 HOH HOH A . 
I 7 HOH 8   708 804 HOH HOH A . 
I 7 HOH 9   709 625 HOH HOH A . 
I 7 HOH 10  710 797 HOH HOH A . 
I 7 HOH 11  711 800 HOH HOH A . 
I 7 HOH 12  712 656 HOH HOH A . 
I 7 HOH 13  713 790 HOH HOH A . 
I 7 HOH 14  714 565 HOH HOH A . 
I 7 HOH 15  715 617 HOH HOH A . 
I 7 HOH 16  716 845 HOH HOH A . 
I 7 HOH 17  717 600 HOH HOH A . 
I 7 HOH 18  718 858 HOH HOH A . 
I 7 HOH 19  719 562 HOH HOH A . 
I 7 HOH 20  720 753 HOH HOH A . 
I 7 HOH 21  721 563 HOH HOH A . 
I 7 HOH 22  722 707 HOH HOH A . 
I 7 HOH 23  723 946 HOH HOH A . 
I 7 HOH 24  724 648 HOH HOH A . 
I 7 HOH 25  725 668 HOH HOH A . 
I 7 HOH 26  726 949 HOH HOH A . 
I 7 HOH 27  727 606 HOH HOH A . 
I 7 HOH 28  728 852 HOH HOH A . 
I 7 HOH 29  729 942 HOH HOH A . 
I 7 HOH 30  730 622 HOH HOH A . 
I 7 HOH 31  731 709 HOH HOH A . 
I 7 HOH 32  732 567 HOH HOH A . 
I 7 HOH 33  733 850 HOH HOH A . 
I 7 HOH 34  734 762 HOH HOH A . 
I 7 HOH 35  735 796 HOH HOH A . 
I 7 HOH 36  736 802 HOH HOH A . 
I 7 HOH 37  737 712 HOH HOH A . 
I 7 HOH 38  738 943 HOH HOH A . 
I 7 HOH 39  739 568 HOH HOH A . 
I 7 HOH 40  740 664 HOH HOH A . 
I 7 HOH 41  741 941 HOH HOH A . 
I 7 HOH 42  742 677 HOH HOH A . 
I 7 HOH 43  743 750 HOH HOH A . 
I 7 HOH 44  744 627 HOH HOH A . 
I 7 HOH 45  745 626 HOH HOH A . 
I 7 HOH 46  746 856 HOH HOH A . 
I 7 HOH 47  747 601 HOH HOH A . 
I 7 HOH 48  748 770 HOH HOH A . 
I 7 HOH 49  749 742 HOH HOH A . 
I 7 HOH 50  750 780 HOH HOH A . 
I 7 HOH 51  751 704 HOH HOH A . 
I 7 HOH 52  752 717 HOH HOH A . 
I 7 HOH 53  753 642 HOH HOH A . 
I 7 HOH 54  754 569 HOH HOH A . 
I 7 HOH 55  755 585 HOH HOH A . 
I 7 HOH 56  756 593 HOH HOH A . 
I 7 HOH 57  757 730 HOH HOH A . 
I 7 HOH 58  758 827 HOH HOH A . 
I 7 HOH 59  759 581 HOH HOH A . 
I 7 HOH 60  760 705 HOH HOH A . 
I 7 HOH 61  761 589 HOH HOH A . 
I 7 HOH 62  762 679 HOH HOH A . 
I 7 HOH 63  763 630 HOH HOH A . 
I 7 HOH 64  764 580 HOH HOH A . 
I 7 HOH 65  765 823 HOH HOH A . 
I 7 HOH 66  766 571 HOH HOH A . 
I 7 HOH 67  767 711 HOH HOH A . 
I 7 HOH 68  768 669 HOH HOH A . 
I 7 HOH 69  769 739 HOH HOH A . 
I 7 HOH 70  770 607 HOH HOH A . 
I 7 HOH 71  771 756 HOH HOH A . 
I 7 HOH 72  772 599 HOH HOH A . 
I 7 HOH 73  773 799 HOH HOH A . 
I 7 HOH 74  774 683 HOH HOH A . 
I 7 HOH 75  775 576 HOH HOH A . 
I 7 HOH 76  776 947 HOH HOH A . 
I 7 HOH 77  777 575 HOH HOH A . 
I 7 HOH 78  778 760 HOH HOH A . 
I 7 HOH 79  779 610 HOH HOH A . 
I 7 HOH 80  780 597 HOH HOH A . 
I 7 HOH 81  781 672 HOH HOH A . 
I 7 HOH 82  782 650 HOH HOH A . 
I 7 HOH 83  783 570 HOH HOH A . 
I 7 HOH 84  784 596 HOH HOH A . 
I 7 HOH 85  785 820 HOH HOH A . 
I 7 HOH 86  786 699 HOH HOH A . 
I 7 HOH 87  787 948 HOH HOH A . 
I 7 HOH 88  788 720 HOH HOH A . 
I 7 HOH 89  789 645 HOH HOH A . 
I 7 HOH 90  790 956 HOH HOH A . 
I 7 HOH 91  791 769 HOH HOH A . 
I 7 HOH 92  792 734 HOH HOH A . 
I 7 HOH 93  793 966 HOH HOH A . 
I 7 HOH 94  794 785 HOH HOH A . 
I 7 HOH 95  795 583 HOH HOH A . 
I 7 HOH 96  796 667 HOH HOH A . 
I 7 HOH 97  797 649 HOH HOH A . 
I 7 HOH 98  798 662 HOH HOH A . 
I 7 HOH 99  799 849 HOH HOH A . 
I 7 HOH 100 800 853 HOH HOH A . 
I 7 HOH 101 801 950 HOH HOH A . 
I 7 HOH 102 802 578 HOH HOH A . 
I 7 HOH 103 803 783 HOH HOH A . 
I 7 HOH 104 804 620 HOH HOH A . 
I 7 HOH 105 805 584 HOH HOH A . 
I 7 HOH 106 806 829 HOH HOH A . 
I 7 HOH 107 807 688 HOH HOH A . 
I 7 HOH 108 808 774 HOH HOH A . 
I 7 HOH 109 809 749 HOH HOH A . 
I 7 HOH 110 810 573 HOH HOH A . 
I 7 HOH 111 811 836 HOH HOH A . 
I 7 HOH 112 812 588 HOH HOH A . 
I 7 HOH 113 813 803 HOH HOH A . 
I 7 HOH 114 814 590 HOH HOH A . 
I 7 HOH 115 815 740 HOH HOH A . 
I 7 HOH 116 816 618 HOH HOH A . 
I 7 HOH 117 817 724 HOH HOH A . 
I 7 HOH 118 818 819 HOH HOH A . 
I 7 HOH 119 819 733 HOH HOH A . 
I 7 HOH 120 820 758 HOH HOH A . 
I 7 HOH 121 821 635 HOH HOH A . 
I 7 HOH 122 822 671 HOH HOH A . 
I 7 HOH 123 823 579 HOH HOH A . 
I 7 HOH 124 824 689 HOH HOH A . 
I 7 HOH 125 825 967 HOH HOH A . 
I 7 HOH 126 826 655 HOH HOH A . 
I 7 HOH 127 827 641 HOH HOH A . 
I 7 HOH 128 828 660 HOH HOH A . 
I 7 HOH 129 829 695 HOH HOH A . 
I 7 HOH 130 830 826 HOH HOH A . 
I 7 HOH 131 831 777 HOH HOH A . 
I 7 HOH 132 832 708 HOH HOH A . 
I 7 HOH 133 833 841 HOH HOH A . 
I 7 HOH 134 834 673 HOH HOH A . 
I 7 HOH 135 835 961 HOH HOH A . 
I 7 HOH 136 836 681 HOH HOH A . 
I 7 HOH 137 837 675 HOH HOH A . 
I 7 HOH 138 838 840 HOH HOH A . 
I 7 HOH 139 839 751 HOH HOH A . 
I 7 HOH 140 840 857 HOH HOH A . 
I 7 HOH 141 841 665 HOH HOH A . 
I 7 HOH 142 842 713 HOH HOH A . 
I 7 HOH 143 843 640 HOH HOH A . 
I 7 HOH 144 844 582 HOH HOH A . 
I 7 HOH 145 845 634 HOH HOH A . 
I 7 HOH 146 846 604 HOH HOH A . 
I 7 HOH 147 847 686 HOH HOH A . 
I 7 HOH 148 848 714 HOH HOH A . 
I 7 HOH 149 849 846 HOH HOH A . 
I 7 HOH 150 850 754 HOH HOH A . 
I 7 HOH 151 851 619 HOH HOH A . 
I 7 HOH 152 852 945 HOH HOH A . 
I 7 HOH 153 853 611 HOH HOH A . 
I 7 HOH 154 854 822 HOH HOH A . 
I 7 HOH 155 855 828 HOH HOH A . 
I 7 HOH 156 856 824 HOH HOH A . 
I 7 HOH 157 857 615 HOH HOH A . 
I 7 HOH 158 858 628 HOH HOH A . 
I 7 HOH 159 859 652 HOH HOH A . 
I 7 HOH 160 860 735 HOH HOH A . 
I 7 HOH 161 861 653 HOH HOH A . 
I 7 HOH 162 862 616 HOH HOH A . 
I 7 HOH 163 863 643 HOH HOH A . 
I 7 HOH 164 864 814 HOH HOH A . 
I 7 HOH 165 865 752 HOH HOH A . 
I 7 HOH 166 866 659 HOH HOH A . 
I 7 HOH 167 867 834 HOH HOH A . 
I 7 HOH 168 868 793 HOH HOH A . 
I 7 HOH 169 869 854 HOH HOH A . 
I 7 HOH 170 870 651 HOH HOH A . 
I 7 HOH 171 871 837 HOH HOH A . 
I 7 HOH 172 872 767 HOH HOH A . 
I 7 HOH 173 873 895 HOH HOH A . 
I 7 HOH 174 874 847 HOH HOH A . 
I 7 HOH 175 875 805 HOH HOH A . 
I 7 HOH 176 876 888 HOH HOH A . 
I 7 HOH 177 877 832 HOH HOH A . 
I 7 HOH 178 878 608 HOH HOH A . 
I 7 HOH 179 879 726 HOH HOH A . 
I 7 HOH 180 880 787 HOH HOH A . 
I 7 HOH 181 881 605 HOH HOH A . 
I 7 HOH 182 882 955 HOH HOH A . 
I 7 HOH 183 883 851 HOH HOH A . 
I 7 HOH 184 884 801 HOH HOH A . 
I 7 HOH 185 885 848 HOH HOH A . 
I 7 HOH 186 886 817 HOH HOH A . 
I 7 HOH 187 887 623 HOH HOH A . 
I 7 HOH 188 888 778 HOH HOH A . 
I 7 HOH 189 889 833 HOH HOH A . 
I 7 HOH 190 890 759 HOH HOH A . 
I 7 HOH 191 891 830 HOH HOH A . 
I 7 HOH 192 892 813 HOH HOH A . 
I 7 HOH 193 893 860 HOH HOH A . 
I 7 HOH 194 894 843 HOH HOH A . 
I 7 HOH 195 895 791 HOH HOH A . 
I 7 HOH 196 896 776 HOH HOH A . 
I 7 HOH 197 897 825 HOH HOH A . 
I 7 HOH 198 898 719 HOH HOH A . 
I 7 HOH 199 899 784 HOH HOH A . 
I 7 HOH 200 900 692 HOH HOH A . 
I 7 HOH 201 901 773 HOH HOH A . 
I 7 HOH 202 902 891 HOH HOH A . 
I 7 HOH 203 903 701 HOH HOH A . 
I 7 HOH 204 904 878 HOH HOH A . 
I 7 HOH 205 905 855 HOH HOH A . 
I 7 HOH 206 906 786 HOH HOH A . 
I 7 HOH 207 907 723 HOH HOH A . 
I 7 HOH 208 908 702 HOH HOH A . 
I 7 HOH 209 909 812 HOH HOH A . 
I 7 HOH 210 910 792 HOH HOH A . 
I 7 HOH 211 911 710 HOH HOH A . 
I 7 HOH 212 912 798 HOH HOH A . 
I 7 HOH 213 913 882 HOH HOH A . 
I 7 HOH 214 914 892 HOH HOH A . 
I 7 HOH 215 915 939 HOH HOH A . 
I 7 HOH 216 916 838 HOH HOH A . 
I 7 HOH 217 917 639 HOH HOH A . 
I 7 HOH 218 918 728 HOH HOH A . 
I 7 HOH 219 919 722 HOH HOH A . 
J 7 HOH 1   501 925 HOH HOH B . 
J 7 HOH 2   502 766 HOH HOH B . 
J 7 HOH 3   503 738 HOH HOH B . 
J 7 HOH 4   504 746 HOH HOH B . 
J 7 HOH 5   505 920 HOH HOH B . 
J 7 HOH 6   506 748 HOH HOH B . 
J 7 HOH 7   507 761 HOH HOH B . 
J 7 HOH 8   508 910 HOH HOH B . 
J 7 HOH 9   509 755 HOH HOH B . 
J 7 HOH 10  510 594 HOH HOH B . 
J 7 HOH 11  511 768 HOH HOH B . 
J 7 HOH 12  512 696 HOH HOH B . 
J 7 HOH 13  513 566 HOH HOH B . 
J 7 HOH 14  514 930 HOH HOH B . 
J 7 HOH 15  515 936 HOH HOH B . 
J 7 HOH 16  516 886 HOH HOH B . 
J 7 HOH 17  517 572 HOH HOH B . 
J 7 HOH 18  518 764 HOH HOH B . 
J 7 HOH 19  519 870 HOH HOH B . 
J 7 HOH 20  520 745 HOH HOH B . 
J 7 HOH 21  521 647 HOH HOH B . 
J 7 HOH 22  522 632 HOH HOH B . 
J 7 HOH 23  523 716 HOH HOH B . 
J 7 HOH 24  524 931 HOH HOH B . 
J 7 HOH 25  525 743 HOH HOH B . 
J 7 HOH 26  526 613 HOH HOH B . 
J 7 HOH 27  527 863 HOH HOH B . 
J 7 HOH 28  528 624 HOH HOH B . 
J 7 HOH 29  529 731 HOH HOH B . 
J 7 HOH 30  530 595 HOH HOH B . 
J 7 HOH 31  531 913 HOH HOH B . 
J 7 HOH 32  532 922 HOH HOH B . 
J 7 HOH 33  533 693 HOH HOH B . 
J 7 HOH 34  534 694 HOH HOH B . 
J 7 HOH 35  535 614 HOH HOH B . 
J 7 HOH 36  536 765 HOH HOH B . 
J 7 HOH 37  537 897 HOH HOH B . 
J 7 HOH 38  538 657 HOH HOH B . 
J 7 HOH 39  539 924 HOH HOH B . 
J 7 HOH 40  540 893 HOH HOH B . 
J 7 HOH 41  541 612 HOH HOH B . 
J 7 HOH 42  542 926 HOH HOH B . 
J 7 HOH 43  543 900 HOH HOH B . 
J 7 HOH 44  544 687 HOH HOH B . 
J 7 HOH 45  545 691 HOH HOH B . 
J 7 HOH 46  546 876 HOH HOH B . 
J 7 HOH 47  547 697 HOH HOH B . 
J 7 HOH 48  548 907 HOH HOH B . 
J 7 HOH 49  549 602 HOH HOH B . 
J 7 HOH 50  550 744 HOH HOH B . 
J 7 HOH 51  551 908 HOH HOH B . 
J 7 HOH 52  552 574 HOH HOH B . 
J 7 HOH 53  553 633 HOH HOH B . 
J 7 HOH 54  554 862 HOH HOH B . 
J 7 HOH 55  555 763 HOH HOH B . 
J 7 HOH 56  556 646 HOH HOH B . 
J 7 HOH 57  557 866 HOH HOH B . 
J 7 HOH 58  558 757 HOH HOH B . 
J 7 HOH 59  559 661 HOH HOH B . 
J 7 HOH 60  560 676 HOH HOH B . 
J 7 HOH 61  561 715 HOH HOH B . 
J 7 HOH 62  562 890 HOH HOH B . 
J 7 HOH 63  563 896 HOH HOH B . 
J 7 HOH 64  564 577 HOH HOH B . 
J 7 HOH 65  565 682 HOH HOH B . 
J 7 HOH 66  566 685 HOH HOH B . 
J 7 HOH 67  567 929 HOH HOH B . 
J 7 HOH 68  568 658 HOH HOH B . 
J 7 HOH 69  569 772 HOH HOH B . 
J 7 HOH 70  570 706 HOH HOH B . 
J 7 HOH 71  571 680 HOH HOH B . 
J 7 HOH 72  572 644 HOH HOH B . 
J 7 HOH 73  573 889 HOH HOH B . 
J 7 HOH 74  574 879 HOH HOH B . 
J 7 HOH 75  575 872 HOH HOH B . 
J 7 HOH 76  576 666 HOH HOH B . 
J 7 HOH 77  577 921 HOH HOH B . 
J 7 HOH 78  578 700 HOH HOH B . 
J 7 HOH 79  579 934 HOH HOH B . 
J 7 HOH 80  580 587 HOH HOH B . 
J 7 HOH 81  581 903 HOH HOH B . 
J 7 HOH 82  582 698 HOH HOH B . 
J 7 HOH 83  583 775 HOH HOH B . 
J 7 HOH 84  584 928 HOH HOH B . 
J 7 HOH 85  585 871 HOH HOH B . 
J 7 HOH 86  586 638 HOH HOH B . 
J 7 HOH 87  587 906 HOH HOH B . 
J 7 HOH 88  588 861 HOH HOH B . 
J 7 HOH 89  589 901 HOH HOH B . 
J 7 HOH 90  590 919 HOH HOH B . 
J 7 HOH 91  591 591 HOH HOH B . 
J 7 HOH 92  592 670 HOH HOH B . 
J 7 HOH 93  593 718 HOH HOH B . 
J 7 HOH 94  594 915 HOH HOH B . 
J 7 HOH 95  595 904 HOH HOH B . 
J 7 HOH 96  596 747 HOH HOH B . 
J 7 HOH 97  597 935 HOH HOH B . 
J 7 HOH 98  598 842 HOH HOH B . 
J 7 HOH 99  599 902 HOH HOH B . 
J 7 HOH 100 600 865 HOH HOH B . 
J 7 HOH 101 601 899 HOH HOH B . 
J 7 HOH 102 602 725 HOH HOH B . 
J 7 HOH 103 603 869 HOH HOH B . 
J 7 HOH 104 604 938 HOH HOH B . 
J 7 HOH 105 605 789 HOH HOH B . 
J 7 HOH 106 606 923 HOH HOH B . 
J 7 HOH 107 607 898 HOH HOH B . 
J 7 HOH 108 608 885 HOH HOH B . 
J 7 HOH 109 609 884 HOH HOH B . 
J 7 HOH 110 610 874 HOH HOH B . 
J 7 HOH 111 611 875 HOH HOH B . 
J 7 HOH 112 612 933 HOH HOH B . 
J 7 HOH 113 613 927 HOH HOH B . 
J 7 HOH 114 614 912 HOH HOH B . 
J 7 HOH 115 615 859 HOH HOH B . 
J 7 HOH 116 616 873 HOH HOH B . 
J 7 HOH 117 617 937 HOH HOH B . 
J 7 HOH 118 618 887 HOH HOH B . 
J 7 HOH 119 619 917 HOH HOH B . 
J 7 HOH 120 620 909 HOH HOH B . 
J 7 HOH 121 621 944 HOH HOH B . 
J 7 HOH 122 622 877 HOH HOH B . 
J 7 HOH 123 623 868 HOH HOH B . 
J 7 HOH 124 624 894 HOH HOH B . 
J 7 HOH 125 625 911 HOH HOH B . 
J 7 HOH 126 626 883 HOH HOH B . 
J 7 HOH 127 627 932 HOH HOH B . 
J 7 HOH 128 628 914 HOH HOH B . 
J 7 HOH 129 629 867 HOH HOH B . 
J 7 HOH 130 630 905 HOH HOH B . 
J 7 HOH 131 631 880 HOH HOH B . 
K 7 HOH 1   901 781 HOH HOH P . 
K 7 HOH 2   902 839 HOH HOH P . 
K 7 HOH 3   903 736 HOH HOH P . 
K 7 HOH 4   904 810 HOH HOH P . 
K 7 HOH 5   905 782 HOH HOH P . 
K 7 HOH 6   906 963 HOH HOH P . 
K 7 HOH 7   907 809 HOH HOH P . 
K 7 HOH 8   908 940 HOH HOH P . 
K 7 HOH 9   909 964 HOH HOH P . 
K 7 HOH 10  910 965 HOH HOH P . 
K 7 HOH 11  911 690 HOH HOH P . 
K 7 HOH 12  912 603 HOH HOH P . 
K 7 HOH 13  913 962 HOH HOH P . 
K 7 HOH 14  914 811 HOH HOH P . 
K 7 HOH 15  915 960 HOH HOH P . 
L 7 HOH 1   801 598 HOH HOH T . 
L 7 HOH 2   802 564 HOH HOH T . 
L 7 HOH 3   803 844 HOH HOH T . 
L 7 HOH 4   804 807 HOH HOH T . 
L 7 HOH 5   805 953 HOH HOH T . 
L 7 HOH 6   806 864 HOH HOH T . 
L 7 HOH 7   807 779 HOH HOH T . 
L 7 HOH 8   808 788 HOH HOH T . 
L 7 HOH 9   809 741 HOH HOH T . 
L 7 HOH 10  810 957 HOH HOH T . 
L 7 HOH 11  811 958 HOH HOH T . 
L 7 HOH 12  812 663 HOH HOH T . 
L 7 HOH 13  813 959 HOH HOH T . 
L 7 HOH 14  814 771 HOH HOH T . 
L 7 HOH 15  815 806 HOH HOH T . 
L 7 HOH 16  816 808 HOH HOH T . 
L 7 HOH 17  817 721 HOH HOH T . 
L 7 HOH 18  818 952 HOH HOH T . 
L 7 HOH 19  819 951 HOH HOH T . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 13770 ? 
1 MORE         -73   ? 
1 'SSA (A^2)'  47290 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD2 ? A ASP 110 ? A ASP 110 ? 1_555 52.1  ? 
2  OD1 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O   ? A VAL 111 ? A VAL 111 ? 1_555 115.9 ? 
3  OD2 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O   ? A VAL 111 ? A VAL 111 ? 1_555 80.6  ? 
4  OD1 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 70.4  ? 
5  OD2 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 100.7 ? 
6  O   ? A VAL 111 ? A VAL 111 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 81.2  ? 
7  OD1 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1A ? H 6FN .   ? A 6FN 604 ? 1_555 77.8  ? 
8  OD2 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1A ? H 6FN .   ? A 6FN 604 ? 1_555 110.8 ? 
9  O   ? A VAL 111 ? A VAL 111 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1A ? H 6FN .   ? A 6FN 604 ? 1_555 166.2 ? 
10 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1A ? H 6FN .   ? A 6FN 604 ? 1_555 103.4 ? 
11 OD1 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1G ? H 6FN .   ? A 6FN 604 ? 1_555 120.2 ? 
12 OD2 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1G ? H 6FN .   ? A 6FN 604 ? 1_555 85.9  ? 
13 O   ? A VAL 111 ? A VAL 111 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1G ? H 6FN .   ? A 6FN 604 ? 1_555 91.5  ? 
14 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1G ? H 6FN .   ? A 6FN 604 ? 1_555 169.2 ? 
15 O1A ? H 6FN .   ? A 6FN 604 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1G ? H 6FN .   ? A 6FN 604 ? 1_555 82.0  ? 
16 OD1 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O2B ? H 6FN .   ? A 6FN 604 ? 1_555 147.9 ? 
17 OD2 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O2B ? H 6FN .   ? A 6FN 604 ? 1_555 159.0 ? 
18 O   ? A VAL 111 ? A VAL 111 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O2B ? H 6FN .   ? A 6FN 604 ? 1_555 89.1  ? 
19 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O2B ? H 6FN .   ? A 6FN 604 ? 1_555 95.8  ? 
20 O1A ? H 6FN .   ? A 6FN 604 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O2B ? H 6FN .   ? A 6FN 604 ? 1_555 77.6  ? 
21 O1G ? H 6FN .   ? A 6FN 604 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O2B ? H 6FN .   ? A 6FN 604 ? 1_555 76.0  ? 
22 OD1 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OD2 ? A ASP 185 ? A ASP 185 ? 1_555 74.7  ? 
23 OD1 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 O   ? I HOH .   ? A HOH 816 ? 1_555 75.5  ? 
24 OD2 ? A ASP 185 ? A ASP 185 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 O   ? I HOH .   ? A HOH 816 ? 1_555 141.1 ? 
25 OD1 ? A ASP 443 ? A ASP 443 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 OE2 ? A GLU 478 ? A GLU 478 ? 1_555 83.8  ? 
26 OD1 ? A ASP 443 ? A ASP 443 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 OD1 ? A ASP 498 ? A ASP 498 ? 1_555 115.1 ? 
27 OE2 ? A GLU 478 ? A GLU 478 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 OD1 ? A ASP 498 ? A ASP 498 ? 1_555 86.9  ? 
28 OD1 ? A ASP 443 ? A ASP 443 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 OD2 ? A ASP 498 ? A ASP 498 ? 1_555 92.0  ? 
29 OE2 ? A GLU 478 ? A GLU 478 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 OD2 ? A ASP 498 ? A ASP 498 ? 1_555 143.0 ? 
30 OD1 ? A ASP 498 ? A ASP 498 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 OD2 ? A ASP 498 ? A ASP 498 ? 1_555 61.7  ? 
31 OD1 ? A ASP 443 ? A ASP 443 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 723 ? 1_555 87.8  ? 
32 OE2 ? A GLU 478 ? A GLU 478 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 723 ? 1_555 70.0  ? 
33 OD1 ? A ASP 498 ? A ASP 498 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 723 ? 1_555 145.9 ? 
34 OD2 ? A ASP 498 ? A ASP 498 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 723 ? 1_555 146.8 ? 
35 OD1 ? A ASP 443 ? A ASP 443 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 729 ? 1_555 85.0  ? 
36 OE2 ? A GLU 478 ? A GLU 478 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 729 ? 1_555 143.9 ? 
37 OD1 ? A ASP 498 ? A ASP 498 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 729 ? 1_555 128.8 ? 
38 OD2 ? A ASP 498 ? A ASP 498 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 729 ? 1_555 71.5  ? 
39 O   ? I HOH .   ? A HOH 723 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 729 ? 1_555 75.4  ? 
40 OD1 ? A ASP 443 ? A ASP 443 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 738 ? 1_555 164.6 ? 
41 OE2 ? A GLU 478 ? A GLU 478 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 738 ? 1_555 87.2  ? 
42 OD1 ? A ASP 498 ? A ASP 498 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 738 ? 1_555 76.8  ? 
43 OD2 ? A ASP 498 ? A ASP 498 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 738 ? 1_555 102.7 ? 
44 O   ? I HOH .   ? A HOH 723 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 738 ? 1_555 77.3  ? 
45 O   ? I HOH .   ? A HOH 729 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? I HOH .   ? A HOH 738 ? 1_555 95.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-08-03 
2 'Structure model' 1 1 2016-08-17 
3 'Structure model' 1 2 2016-08-31 
4 'Structure model' 1 3 2017-09-20 
5 'Structure model' 1 4 2019-12-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' Advisory                     
4 4 'Structure model' 'Author supporting evidence' 
5 4 'Structure model' 'Database references'        
6 4 'Structure model' 'Derived calculations'       
7 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation                     
2 4 'Structure model' pdbx_audit_support           
3 4 'Structure model' pdbx_struct_oper_list        
4 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
5 5 'Structure model' pdbx_audit_support           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                  
2 4 'Structure model' '_pdbx_audit_support.funding_organization'  
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 5 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
_pdbx_phasing_MR.entry_id                     5J2M 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          8.800 
_pdbx_phasing_MR.d_res_low_rotation           65.230 
_pdbx_phasing_MR.d_res_high_translation       8.800 
_pdbx_phasing_MR.d_res_low_translation        65.230 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.10.1_2155 1 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .           2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.1.29      3 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? 2.5.2       4 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20        5 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 882 ? ? 1_555 O A HOH 889 ? ? 7_444 2.15 
2 1 O A HOH 790 ? ? 1_555 O A HOH 889 ? ? 7_444 2.16 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 68  ? ? 66.91   -3.79   
2  1 PHE A 77  ? ? -78.12  24.23   
3  1 SER A 134 ? ? -154.66 -149.41 
4  1 ASN A 137 ? ? 65.65   -5.82   
5  1 MET A 184 ? ? 52.03   -116.95 
6  1 ALA A 355 ? ? -140.93 14.44   
7  1 PRO A 412 ? ? -66.47  -172.65 
8  1 ASP B 67  ? ? -115.45 73.35   
9  1 SER B 68  ? ? -172.11 137.11  
10 1 MET B 184 ? ? 57.21   -129.99 
11 1 VAL B 276 ? ? -141.16 17.08   
12 1 LYS B 347 ? ? -114.38 68.07   
13 1 ARG B 356 ? ? -139.01 -159.34 
14 1 HIS B 361 ? ? -88.83  30.51   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B PRO 4   ? CG    ? B PRO 4   CG    
2  1 Y 1 B PRO 4   ? CD    ? B PRO 4   CD    
3  1 Y 1 B GLU 430 ? CG    ? B GLU 430 CG    
4  1 Y 1 B GLU 430 ? CD    ? B GLU 430 CD    
5  1 Y 1 B GLU 430 ? OE1   ? B GLU 430 OE1   
6  1 Y 1 B GLU 430 ? OE2   ? B GLU 430 OE2   
7  1 Y 1 P DG  822 ? "O3'" ? C DG  21  "O3'" 
8  1 Y 1 T DT  702 ? P     ? D DT  2   P     
9  1 Y 1 T DT  702 ? OP1   ? D DT  2   OP1   
10 1 Y 1 T DT  702 ? OP2   ? D DT  2   OP2   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 559 ? A VAL 559 
2  1 Y 1 A LEU 560 ? A LEU 560 
3  1 Y 1 B PRO 1   ? B PRO 1   
4  1 Y 1 B ILE 2   ? B ILE 2   
5  1 Y 1 B SER 3   ? B SER 3   
6  1 Y 1 B GLN 85  ? B GLN 85  
7  1 Y 1 B ASP 86  ? B ASP 86  
8  1 Y 1 B PHE 87  ? B PHE 87  
9  1 Y 1 B TRP 88  ? B TRP 88  
10 1 Y 1 B GLU 89  ? B GLU 89  
11 1 Y 1 B VAL 90  ? B VAL 90  
12 1 Y 1 B GLN 91  ? B GLN 91  
13 1 Y 1 B LEU 92  ? B LEU 92  
14 1 Y 1 B GLY 93  ? B GLY 93  
15 1 Y 1 B ILE 94  ? B ILE 94  
16 1 Y 1 B PRO 95  ? B PRO 95  
17 1 Y 1 B THR 215 ? B THR 215 
18 1 Y 1 B THR 216 ? B THR 216 
19 1 Y 1 B PRO 217 ? B PRO 217 
20 1 Y 1 B ASP 218 ? B ASP 218 
21 1 Y 1 B LYS 219 ? B LYS 219 
22 1 Y 1 B LYS 220 ? B LYS 220 
23 1 Y 1 B HIS 221 ? B HIS 221 
24 1 Y 1 B GLN 222 ? B GLN 222 
25 1 Y 1 B LYS 223 ? B LYS 223 
26 1 Y 1 B GLU 224 ? B GLU 224 
27 1 Y 1 B PRO 225 ? B PRO 225 
28 1 Y 1 B PRO 226 ? B PRO 226 
29 1 Y 1 B PHE 227 ? B PHE 227 
30 1 Y 1 B LEU 228 ? B LEU 228 
31 1 Y 1 B TRP 229 ? B TRP 229 
32 1 Y 1 B MET 230 ? B MET 230 
33 1 Y 1 B GLY 231 ? B GLY 231 
34 1 Y 1 B TYR 232 ? B TYR 232 
35 1 Y 1 B LYS 431 ? B LYS 431 
36 1 Y 1 B GLU 432 ? B GLU 432 
37 1 Y 1 B PRO 433 ? B PRO 433 
38 1 Y 1 B ILE 434 ? B ILE 434 
39 1 Y 1 B VAL 435 ? B VAL 435 
40 1 Y 1 B GLY 436 ? B GLY 436 
41 1 Y 1 B ALA 437 ? B ALA 437 
42 1 Y 1 B GLU 438 ? B GLU 438 
43 1 Y 1 B THR 439 ? B THR 439 
44 1 Y 1 B PHE 440 ? B PHE 440 
45 1 Y 1 P DA  802 ? C DA  1   
46 1 Y 1 P DC  803 ? C DC  2   
47 1 Y 1 P DA  804 ? C DA  3   
48 1 Y 1 T DA  701 ? D DA  1   
49 1 Y 1 T DT  726 ? D DT  26  
50 1 Y 1 T DG  727 ? D DG  27  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5J2M 'double helix'        
5J2M 'a-form double helix' 
5J2M 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG  4  1_555 D DC 23 1_555 -0.565 -0.200 0.050  -5.317  -17.535 -3.846 1  P_DG805:DC723_T  P 805 ? T 723 ? 19 1 
1 C DT  5  1_555 D DA 22 1_555 0.040  -0.193 -0.312 0.463   -7.747  0.179  2  P_DT806:DA722_T  P 806 ? T 722 ? 20 1 
1 C DC  6  1_555 D DG 21 1_555 0.347  -0.134 -0.280 1.860   -14.091 -0.953 3  P_DC807:DG721_T  P 807 ? T 721 ? 19 1 
1 C DC  7  1_555 D DG 20 1_555 0.001  -0.140 0.231  -6.415  -9.328  3.673  4  P_DC808:DG720_T  P 808 ? T 720 ? 19 1 
1 C DC  8  1_555 D DG 19 1_555 0.588  0.139  0.209  -2.612  -8.262  8.579  5  P_DC809:DG719_T  P 809 ? T 719 ? 19 1 
1 C DT  9  1_555 D DA 18 1_555 0.395  -0.113 -0.198 9.511   -11.823 5.433  6  P_DT810:DA718_T  P 810 ? T 718 ? 20 1 
1 C DG  10 1_555 D DC 17 1_555 0.009  -0.463 0.353  -5.206  -25.726 1.990  7  P_DG811:DC717_T  P 811 ? T 717 ? 19 1 
1 C DT  11 1_555 D DA 16 1_555 -0.615 -0.241 -0.242 -0.705  -11.477 -3.717 8  P_DT812:DA716_T  P 812 ? T 716 ? 20 1 
1 C DT  12 1_555 D DA 15 1_555 0.308  -0.197 -0.141 4.858   -15.934 1.897  9  P_DT813:DA715_T  P 813 ? T 715 ? 20 1 
1 C DC  13 1_555 D DG 14 1_555 -0.261 -0.211 0.099  -3.005  -10.497 -3.123 10 P_DC814:DG714_T  P 814 ? T 714 ? 19 1 
1 C DG  14 1_555 D DC 13 1_555 -0.156 0.010  0.613  9.707   -13.155 3.736  11 P_DG815:DC713_T  P 815 ? T 713 ? 19 1 
1 C DG  15 1_555 D DC 12 1_555 0.571  0.040  0.053  -4.655  -3.349  1.244  12 P_DG816:DC712_T  P 816 ? T 712 ? 19 1 
1 C MRG 16 1_555 D DC 11 1_555 -0.093 0.080  -0.001 5.168   -16.869 7.761  13 P_MRG817:DC711_T P 817 ? T 711 ? 19 1 
1 C DC  17 1_555 D DG 10 1_555 0.353  0.061  -0.127 9.235   -15.673 5.272  14 P_DC818:DG710_T  P 818 ? T 710 ? 19 1 
1 C DG  18 1_555 D DC 9  1_555 -0.274 0.062  -0.321 -13.379 -16.810 5.692  15 P_DG819:DC709_T  P 819 ? T 709 ? 19 1 
1 C DC  19 1_555 D DG 8  1_555 0.480  -0.131 -0.138 -13.820 -15.256 5.357  16 P_DC820:DG708_T  P 820 ? T 708 ? 19 1 
1 C DC  20 1_555 D DG 7  1_555 0.236  0.019  0.050  -10.260 -3.100  3.316  17 P_DC821:DG707_T  P 821 ? T 707 ? 19 1 
1 C DG  21 1_555 D DC 6  1_555 -0.063 0.166  0.383  12.268  -5.924  5.286  18 P_DG822:DC706_T  P 822 ? T 706 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG  4  1_555 D DC 23 1_555 C DT  5  1_555 D DA 22 1_555 -0.151 -0.666 3.148 6.436  4.996  38.748 -1.539 0.938  2.981 7.430  
-9.571  39.563 1  PP_DG805DT806:DA722DC723_TT  P 805 ? T 723 ? P 806 ? T 722 ? 
1 C DT  5  1_555 D DA 22 1_555 C DC  6  1_555 D DG 21 1_555 0.114  -0.101 3.330 2.759  3.314  37.083 -0.603 0.193  3.309 5.189  
-4.320  37.324 2  PP_DT806DC807:DG721DA722_TT  P 806 ? T 722 ? P 807 ? T 721 ? 
1 C DC  6  1_555 D DG 21 1_555 C DC  7  1_555 D DG 20 1_555 0.898  -0.267 3.457 1.205  7.203  33.522 -1.645 -1.323 3.358 12.307 
-2.059  34.286 3  PP_DC807DC808:DG720DG721_TT  P 807 ? T 721 ? P 808 ? T 720 ? 
1 C DC  7  1_555 D DG 20 1_555 C DC  8  1_555 D DG 19 1_555 0.487  -0.104 3.280 2.378  8.871  32.780 -1.601 -0.450 3.172 15.346 
-4.115  34.008 4  PP_DC808DC809:DG719DG720_TT  P 808 ? T 720 ? P 809 ? T 719 ? 
1 C DC  8  1_555 D DG 19 1_555 C DT  9  1_555 D DA 18 1_555 0.130  -0.204 2.867 3.995  4.832  30.759 -1.171 0.417  2.797 8.993  
-7.435  31.376 5  PP_DC809DT810:DA718DG719_TT  P 809 ? T 719 ? P 810 ? T 718 ? 
1 C DT  9  1_555 D DA 18 1_555 C DG  10 1_555 D DC 17 1_555 0.069  -0.315 3.650 -6.379 12.455 37.402 -2.052 -0.915 3.329 18.642 
9.548   39.846 6  PP_DT810DG811:DC717DA718_TT  P 810 ? T 718 ? P 811 ? T 717 ? 
1 C DG  10 1_555 D DC 17 1_555 C DT  11 1_555 D DA 16 1_555 -0.696 -0.684 3.182 5.099  -1.449 28.082 -1.071 2.523  3.041 -2.953 
-10.390 28.568 7  PP_DG811DT812:DA716DC717_TT  P 811 ? T 717 ? P 812 ? T 716 ? 
1 C DT  11 1_555 D DA 16 1_555 C DT  12 1_555 D DA 15 1_555 0.113  -0.155 3.250 0.817  2.652  37.671 -0.579 -0.070 3.234 4.101  
-1.263  37.770 8  PP_DT812DT813:DA715DA716_TT  P 812 ? T 716 ? P 813 ? T 715 ? 
1 C DT  12 1_555 D DA 15 1_555 C DC  13 1_555 D DG 14 1_555 0.201  -0.007 3.452 -0.275 3.463  35.585 -0.538 -0.369 3.434 5.649  
0.448   35.748 9  PP_DT813DC814:DG714DA715_TT  P 813 ? T 715 ? P 814 ? T 714 ? 
1 C DC  13 1_555 D DG 14 1_555 C DG  14 1_555 D DC 13 1_555 0.377  0.073  3.061 -3.581 8.175  32.455 -1.121 -1.198 2.935 14.292 
6.260   33.628 10 PP_DC814DG815:DC713DG714_TT  P 814 ? T 714 ? P 815 ? T 713 ? 
1 C DG  14 1_555 D DC 13 1_555 C DG  15 1_555 D DC 12 1_555 -0.467 -0.296 3.669 -0.489 -1.365 40.626 -0.256 0.611  3.682 -1.966 
0.705   40.651 11 PP_DG815DG816:DC712DC713_TT  P 815 ? T 713 ? P 816 ? T 712 ? 
1 C DG  15 1_555 D DC 12 1_555 C MRG 16 1_555 D DC 11 1_555 0.178  -0.513 3.097 0.836  14.028 27.051 -3.544 -0.186 2.533 27.739 
-1.653  30.423 12 PP_DG816MRG817:DC711DC712_TT P 816 ? T 712 ? P 817 ? T 711 ? 
1 C MRG 16 1_555 D DC 11 1_555 C DC  17 1_555 D DG 10 1_555 0.053  -0.810 3.183 -0.473 9.286  32.141 -2.853 -0.166 2.844 16.349 
0.832   33.425 13 PP_MRG817DC818:DG710DC711_TT P 817 ? T 711 ? P 818 ? T 710 ? 
1 C DC  17 1_555 D DG 10 1_555 C DG  18 1_555 D DC 9  1_555 -0.141 -1.311 3.808 1.282  12.188 32.474 -4.254 0.453  3.122 20.889 
-2.197  34.652 14 PP_DC818DG819:DC709DG710_TT  P 818 ? T 710 ? P 819 ? T 709 ? 
1 C DG  18 1_555 D DC 9  1_555 C DC  19 1_555 D DG 8  1_555 -0.062 -0.784 3.294 -1.488 13.944 34.037 -3.082 -0.097 2.773 22.665 
2.418   36.733 15 PP_DG819DC820:DG708DC709_TT  P 819 ? T 709 ? P 820 ? T 708 ? 
1 C DC  19 1_555 D DG 8  1_555 C DC  20 1_555 D DG 7  1_555 0.089  -1.145 3.390 -0.583 7.877  29.142 -3.789 -0.289 2.983 15.303 
1.132   30.171 16 PP_DC820DC821:DG707DG708_TT  P 820 ? T 708 ? P 821 ? T 707 ? 
1 C DC  20 1_555 D DG 7  1_555 C DG  21 1_555 D DC 6  1_555 0.559  -0.767 2.778 0.695  10.021 26.930 -3.376 -1.000 2.360 20.628 
-1.431  28.710 17 PP_DC821DG822:DC706DG707_TT  P 821 ? T 707 ? P 822 ? T 706 ? 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' AI076119 1 
'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' AI099284 2 
'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' AI100890 3 
'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' AI112417 4 
'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' AI120860 5 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)'        'United States' GM103368 6 
'University of Missouri'                                                                          'United States' 
'Mizzou Advantage' 7 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'MAGNESIUM ION'                                                         MG  
6 
;2'-deoxy-4'-ethynyl-2-fluoroadenosine 5'-(tetrahydrogen triphosphate)
;
6FN 
7 water                                                                   HOH 
#