data_5J2Q
# 
_entry.id   5J2Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5J2Q         
WWPDB D_1000219847 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5J2M unspecified 
PDB . 5J2N unspecified 
PDB . 5J2P unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5J2Q 
_pdbx_database_status.recvd_initial_deposition_date   2016-03-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Salie, Z.L.'      1 
'Kirby, K.A.'      2 
'Sarafianos, S.G.' 3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            113 
_citation.language                  ? 
_citation.page_first                9274 
_citation.page_last                 9279 
_citation.title                     
;Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
;
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1605223113 
_citation.pdbx_database_id_PubMed   27489345 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Salie, Z.L.'      1  ? 
primary 'Kirby, K.A.'      2  ? 
primary 'Michailidis, E.'  3  ? 
primary 'Marchand, B.'     4  ? 
primary 'Singh, K.'        5  ? 
primary 'Rohan, L.C.'      6  ? 
primary 'Kodama, E.N.'     7  ? 
primary 'Mitsuya, H.'      8  ? 
primary 'Parniak, M.A.'    9  ? 
primary 'Sarafianos, S.G.' 10 ? 
# 
_cell.length_a           165.557 
_cell.length_b           170.512 
_cell.length_c           102.235 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           5J2Q 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.entry_id                         5J2Q 
_symmetry.Int_Tables_number                20 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HIV-1 reverse transcriptase p66 subunit'                                                      64521.895 1 
2.7.7.- 'Q258C, C280S' ? ? 
2 polymer     man 'HIV-1 reverse transcriptase p51 domain'                                                       51382.984 1 
2.7.7.- C280S          ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*CP*AP*GP*TP*CP*CP*CP*TP*GP*TP*TP*CP*GP*GP*(MRG)P*CP*GP*CP*CP*(6FM)P*(6FM))-3')
;
6871.499  1 ?       ?              ? ? 
4 polymer     syn 'DNA (27-MER)'                                                                                 8407.409  1 ? ? ? 
? 
5 non-polymer syn 'MAGNESIUM ION'                                                                                24.305    1 ? ? ? 
? 
6 non-polymer syn 
;2'-deoxy-4'-ethynyl-2-fluoroadenosine 5'-(dihydrogen phosphate)
;
373.234   2 ?       ?              ? ? 
7 water       nat water                                                                                          18.015    3 ? ? ? 
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 Pr160Gag-Pol 
2 Pr160Gag-Pol 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
;
A ? 
2 'polypeptide(L)'        no no  
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
B ? 
3 polydeoxyribonucleotide no yes 
;(DA)(DC)(DA)(DG)(DT)(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DG)(DG)(MRG)(DC)(DG)(DC)
(DC)(6FM)(6FM)
;
ACAGTCCCTGTTCGGGCGCCXX P ? 
4 polydeoxyribonucleotide no no  
;(DA)(DT)(DG)(DG)(DA)(DT)(DG)(DG)(DC)(DG)(DC)(DC)(DC)(DG)(DA)(DA)(DC)(DA)(DG)(DG)
(DG)(DA)(DC)(DT)(DG)(DT)(DG)
;
ATGGATGGCGCCCGAACAGGGACTGTG T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ILE n 
1 3   SER n 
1 4   PRO n 
1 5   ILE n 
1 6   GLU n 
1 7   THR n 
1 8   VAL n 
1 9   PRO n 
1 10  VAL n 
1 11  LYS n 
1 12  LEU n 
1 13  LYS n 
1 14  PRO n 
1 15  GLY n 
1 16  MET n 
1 17  ASP n 
1 18  GLY n 
1 19  PRO n 
1 20  LYS n 
1 21  VAL n 
1 22  LYS n 
1 23  GLN n 
1 24  TRP n 
1 25  PRO n 
1 26  LEU n 
1 27  THR n 
1 28  GLU n 
1 29  GLU n 
1 30  LYS n 
1 31  ILE n 
1 32  LYS n 
1 33  ALA n 
1 34  LEU n 
1 35  VAL n 
1 36  GLU n 
1 37  ILE n 
1 38  CYS n 
1 39  THR n 
1 40  GLU n 
1 41  MET n 
1 42  GLU n 
1 43  LYS n 
1 44  GLU n 
1 45  GLY n 
1 46  LYS n 
1 47  ILE n 
1 48  SER n 
1 49  LYS n 
1 50  ILE n 
1 51  GLY n 
1 52  PRO n 
1 53  GLU n 
1 54  ASN n 
1 55  PRO n 
1 56  TYR n 
1 57  ASN n 
1 58  THR n 
1 59  PRO n 
1 60  VAL n 
1 61  PHE n 
1 62  ALA n 
1 63  ILE n 
1 64  LYS n 
1 65  LYS n 
1 66  LYS n 
1 67  ASP n 
1 68  SER n 
1 69  THR n 
1 70  LYS n 
1 71  TRP n 
1 72  ARG n 
1 73  LYS n 
1 74  LEU n 
1 75  VAL n 
1 76  ASP n 
1 77  PHE n 
1 78  ARG n 
1 79  GLU n 
1 80  LEU n 
1 81  ASN n 
1 82  LYS n 
1 83  ARG n 
1 84  THR n 
1 85  GLN n 
1 86  ASP n 
1 87  PHE n 
1 88  TRP n 
1 89  GLU n 
1 90  VAL n 
1 91  GLN n 
1 92  LEU n 
1 93  GLY n 
1 94  ILE n 
1 95  PRO n 
1 96  HIS n 
1 97  PRO n 
1 98  ALA n 
1 99  GLY n 
1 100 LEU n 
1 101 LYS n 
1 102 LYS n 
1 103 LYS n 
1 104 LYS n 
1 105 SER n 
1 106 VAL n 
1 107 THR n 
1 108 VAL n 
1 109 LEU n 
1 110 ASP n 
1 111 VAL n 
1 112 GLY n 
1 113 ASP n 
1 114 ALA n 
1 115 TYR n 
1 116 PHE n 
1 117 SER n 
1 118 VAL n 
1 119 PRO n 
1 120 LEU n 
1 121 ASP n 
1 122 GLU n 
1 123 ASP n 
1 124 PHE n 
1 125 ARG n 
1 126 LYS n 
1 127 TYR n 
1 128 THR n 
1 129 ALA n 
1 130 PHE n 
1 131 THR n 
1 132 ILE n 
1 133 PRO n 
1 134 SER n 
1 135 ILE n 
1 136 ASN n 
1 137 ASN n 
1 138 GLU n 
1 139 THR n 
1 140 PRO n 
1 141 GLY n 
1 142 ILE n 
1 143 ARG n 
1 144 TYR n 
1 145 GLN n 
1 146 TYR n 
1 147 ASN n 
1 148 VAL n 
1 149 LEU n 
1 150 PRO n 
1 151 GLN n 
1 152 GLY n 
1 153 TRP n 
1 154 LYS n 
1 155 GLY n 
1 156 SER n 
1 157 PRO n 
1 158 ALA n 
1 159 ILE n 
1 160 PHE n 
1 161 GLN n 
1 162 SER n 
1 163 SER n 
1 164 MET n 
1 165 THR n 
1 166 LYS n 
1 167 ILE n 
1 168 LEU n 
1 169 GLU n 
1 170 PRO n 
1 171 PHE n 
1 172 ARG n 
1 173 LYS n 
1 174 GLN n 
1 175 ASN n 
1 176 PRO n 
1 177 ASP n 
1 178 ILE n 
1 179 VAL n 
1 180 ILE n 
1 181 TYR n 
1 182 GLN n 
1 183 TYR n 
1 184 MET n 
1 185 ASP n 
1 186 ASP n 
1 187 LEU n 
1 188 TYR n 
1 189 VAL n 
1 190 GLY n 
1 191 SER n 
1 192 ASP n 
1 193 LEU n 
1 194 GLU n 
1 195 ILE n 
1 196 GLY n 
1 197 GLN n 
1 198 HIS n 
1 199 ARG n 
1 200 THR n 
1 201 LYS n 
1 202 ILE n 
1 203 GLU n 
1 204 GLU n 
1 205 LEU n 
1 206 ARG n 
1 207 GLN n 
1 208 HIS n 
1 209 LEU n 
1 210 LEU n 
1 211 ARG n 
1 212 TRP n 
1 213 GLY n 
1 214 LEU n 
1 215 THR n 
1 216 THR n 
1 217 PRO n 
1 218 ASP n 
1 219 LYS n 
1 220 LYS n 
1 221 HIS n 
1 222 GLN n 
1 223 LYS n 
1 224 GLU n 
1 225 PRO n 
1 226 PRO n 
1 227 PHE n 
1 228 LEU n 
1 229 TRP n 
1 230 MET n 
1 231 GLY n 
1 232 TYR n 
1 233 GLU n 
1 234 LEU n 
1 235 HIS n 
1 236 PRO n 
1 237 ASP n 
1 238 LYS n 
1 239 TRP n 
1 240 THR n 
1 241 VAL n 
1 242 GLN n 
1 243 PRO n 
1 244 ILE n 
1 245 VAL n 
1 246 LEU n 
1 247 PRO n 
1 248 GLU n 
1 249 LYS n 
1 250 ASP n 
1 251 SER n 
1 252 TRP n 
1 253 THR n 
1 254 VAL n 
1 255 ASN n 
1 256 ASP n 
1 257 ILE n 
1 258 CYS n 
1 259 LYS n 
1 260 LEU n 
1 261 VAL n 
1 262 GLY n 
1 263 LYS n 
1 264 LEU n 
1 265 ASN n 
1 266 TRP n 
1 267 ALA n 
1 268 SER n 
1 269 GLN n 
1 270 ILE n 
1 271 TYR n 
1 272 PRO n 
1 273 GLY n 
1 274 ILE n 
1 275 LYS n 
1 276 VAL n 
1 277 ARG n 
1 278 GLN n 
1 279 LEU n 
1 280 SER n 
1 281 LYS n 
1 282 LEU n 
1 283 LEU n 
1 284 ARG n 
1 285 GLY n 
1 286 THR n 
1 287 LYS n 
1 288 ALA n 
1 289 LEU n 
1 290 THR n 
1 291 GLU n 
1 292 VAL n 
1 293 ILE n 
1 294 PRO n 
1 295 LEU n 
1 296 THR n 
1 297 GLU n 
1 298 GLU n 
1 299 ALA n 
1 300 GLU n 
1 301 LEU n 
1 302 GLU n 
1 303 LEU n 
1 304 ALA n 
1 305 GLU n 
1 306 ASN n 
1 307 ARG n 
1 308 GLU n 
1 309 ILE n 
1 310 LEU n 
1 311 LYS n 
1 312 GLU n 
1 313 PRO n 
1 314 VAL n 
1 315 HIS n 
1 316 GLY n 
1 317 VAL n 
1 318 TYR n 
1 319 TYR n 
1 320 ASP n 
1 321 PRO n 
1 322 SER n 
1 323 LYS n 
1 324 ASP n 
1 325 LEU n 
1 326 ILE n 
1 327 ALA n 
1 328 GLU n 
1 329 ILE n 
1 330 GLN n 
1 331 LYS n 
1 332 GLN n 
1 333 GLY n 
1 334 GLN n 
1 335 GLY n 
1 336 GLN n 
1 337 TRP n 
1 338 THR n 
1 339 TYR n 
1 340 GLN n 
1 341 ILE n 
1 342 TYR n 
1 343 GLN n 
1 344 GLU n 
1 345 PRO n 
1 346 PHE n 
1 347 LYS n 
1 348 ASN n 
1 349 LEU n 
1 350 LYS n 
1 351 THR n 
1 352 GLY n 
1 353 LYS n 
1 354 TYR n 
1 355 ALA n 
1 356 ARG n 
1 357 MET n 
1 358 ARG n 
1 359 GLY n 
1 360 ALA n 
1 361 HIS n 
1 362 THR n 
1 363 ASN n 
1 364 ASP n 
1 365 VAL n 
1 366 LYS n 
1 367 GLN n 
1 368 LEU n 
1 369 THR n 
1 370 GLU n 
1 371 ALA n 
1 372 VAL n 
1 373 GLN n 
1 374 LYS n 
1 375 ILE n 
1 376 THR n 
1 377 THR n 
1 378 GLU n 
1 379 SER n 
1 380 ILE n 
1 381 VAL n 
1 382 ILE n 
1 383 TRP n 
1 384 GLY n 
1 385 LYS n 
1 386 THR n 
1 387 PRO n 
1 388 LYS n 
1 389 PHE n 
1 390 LYS n 
1 391 LEU n 
1 392 PRO n 
1 393 ILE n 
1 394 GLN n 
1 395 LYS n 
1 396 GLU n 
1 397 THR n 
1 398 TRP n 
1 399 GLU n 
1 400 THR n 
1 401 TRP n 
1 402 TRP n 
1 403 THR n 
1 404 GLU n 
1 405 TYR n 
1 406 TRP n 
1 407 GLN n 
1 408 ALA n 
1 409 THR n 
1 410 TRP n 
1 411 ILE n 
1 412 PRO n 
1 413 GLU n 
1 414 TRP n 
1 415 GLU n 
1 416 PHE n 
1 417 VAL n 
1 418 ASN n 
1 419 THR n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 VAL n 
1 424 LYS n 
1 425 LEU n 
1 426 TRP n 
1 427 TYR n 
1 428 GLN n 
1 429 LEU n 
1 430 GLU n 
1 431 LYS n 
1 432 GLU n 
1 433 PRO n 
1 434 ILE n 
1 435 VAL n 
1 436 GLY n 
1 437 ALA n 
1 438 GLU n 
1 439 THR n 
1 440 PHE n 
1 441 TYR n 
1 442 VAL n 
1 443 ASP n 
1 444 GLY n 
1 445 ALA n 
1 446 ALA n 
1 447 ASN n 
1 448 ARG n 
1 449 GLU n 
1 450 THR n 
1 451 LYS n 
1 452 LEU n 
1 453 GLY n 
1 454 LYS n 
1 455 ALA n 
1 456 GLY n 
1 457 TYR n 
1 458 VAL n 
1 459 THR n 
1 460 ASN n 
1 461 ARG n 
1 462 GLY n 
1 463 ARG n 
1 464 GLN n 
1 465 LYS n 
1 466 VAL n 
1 467 VAL n 
1 468 THR n 
1 469 LEU n 
1 470 THR n 
1 471 ASP n 
1 472 THR n 
1 473 THR n 
1 474 ASN n 
1 475 GLN n 
1 476 LYS n 
1 477 THR n 
1 478 GLU n 
1 479 LEU n 
1 480 GLN n 
1 481 ALA n 
1 482 ILE n 
1 483 TYR n 
1 484 LEU n 
1 485 ALA n 
1 486 LEU n 
1 487 GLN n 
1 488 ASP n 
1 489 SER n 
1 490 GLY n 
1 491 LEU n 
1 492 GLU n 
1 493 VAL n 
1 494 ASN n 
1 495 ILE n 
1 496 VAL n 
1 497 THR n 
1 498 ASP n 
1 499 SER n 
1 500 GLN n 
1 501 TYR n 
1 502 ALA n 
1 503 LEU n 
1 504 GLY n 
1 505 ILE n 
1 506 ILE n 
1 507 GLN n 
1 508 ALA n 
1 509 GLN n 
1 510 PRO n 
1 511 ASP n 
1 512 GLN n 
1 513 SER n 
1 514 GLU n 
1 515 SER n 
1 516 GLU n 
1 517 LEU n 
1 518 VAL n 
1 519 ASN n 
1 520 GLN n 
1 521 ILE n 
1 522 ILE n 
1 523 GLU n 
1 524 GLN n 
1 525 LEU n 
1 526 ILE n 
1 527 LYS n 
1 528 LYS n 
1 529 GLU n 
1 530 LYS n 
1 531 VAL n 
1 532 TYR n 
1 533 LEU n 
1 534 ALA n 
1 535 TRP n 
1 536 VAL n 
1 537 PRO n 
1 538 ALA n 
1 539 HIS n 
1 540 LYS n 
1 541 GLY n 
1 542 ILE n 
1 543 GLY n 
1 544 GLY n 
1 545 ASN n 
1 546 GLU n 
1 547 GLN n 
1 548 VAL n 
1 549 ASP n 
1 550 LYS n 
1 551 LEU n 
1 552 VAL n 
1 553 SER n 
1 554 ALA n 
1 555 GLY n 
1 556 ILE n 
1 557 ARG n 
1 558 LYS n 
1 559 VAL n 
1 560 LEU n 
2 1   PRO n 
2 2   ILE n 
2 3   SER n 
2 4   PRO n 
2 5   ILE n 
2 6   GLU n 
2 7   THR n 
2 8   VAL n 
2 9   PRO n 
2 10  VAL n 
2 11  LYS n 
2 12  LEU n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  MET n 
2 17  ASP n 
2 18  GLY n 
2 19  PRO n 
2 20  LYS n 
2 21  VAL n 
2 22  LYS n 
2 23  GLN n 
2 24  TRP n 
2 25  PRO n 
2 26  LEU n 
2 27  THR n 
2 28  GLU n 
2 29  GLU n 
2 30  LYS n 
2 31  ILE n 
2 32  LYS n 
2 33  ALA n 
2 34  LEU n 
2 35  VAL n 
2 36  GLU n 
2 37  ILE n 
2 38  CYS n 
2 39  THR n 
2 40  GLU n 
2 41  MET n 
2 42  GLU n 
2 43  LYS n 
2 44  GLU n 
2 45  GLY n 
2 46  LYS n 
2 47  ILE n 
2 48  SER n 
2 49  LYS n 
2 50  ILE n 
2 51  GLY n 
2 52  PRO n 
2 53  GLU n 
2 54  ASN n 
2 55  PRO n 
2 56  TYR n 
2 57  ASN n 
2 58  THR n 
2 59  PRO n 
2 60  VAL n 
2 61  PHE n 
2 62  ALA n 
2 63  ILE n 
2 64  LYS n 
2 65  LYS n 
2 66  LYS n 
2 67  ASP n 
2 68  SER n 
2 69  THR n 
2 70  LYS n 
2 71  TRP n 
2 72  ARG n 
2 73  LYS n 
2 74  LEU n 
2 75  VAL n 
2 76  ASP n 
2 77  PHE n 
2 78  ARG n 
2 79  GLU n 
2 80  LEU n 
2 81  ASN n 
2 82  LYS n 
2 83  ARG n 
2 84  THR n 
2 85  GLN n 
2 86  ASP n 
2 87  PHE n 
2 88  TRP n 
2 89  GLU n 
2 90  VAL n 
2 91  GLN n 
2 92  LEU n 
2 93  GLY n 
2 94  ILE n 
2 95  PRO n 
2 96  HIS n 
2 97  PRO n 
2 98  ALA n 
2 99  GLY n 
2 100 LEU n 
2 101 LYS n 
2 102 LYS n 
2 103 LYS n 
2 104 LYS n 
2 105 SER n 
2 106 VAL n 
2 107 THR n 
2 108 VAL n 
2 109 LEU n 
2 110 ASP n 
2 111 VAL n 
2 112 GLY n 
2 113 ASP n 
2 114 ALA n 
2 115 TYR n 
2 116 PHE n 
2 117 SER n 
2 118 VAL n 
2 119 PRO n 
2 120 LEU n 
2 121 ASP n 
2 122 GLU n 
2 123 ASP n 
2 124 PHE n 
2 125 ARG n 
2 126 LYS n 
2 127 TYR n 
2 128 THR n 
2 129 ALA n 
2 130 PHE n 
2 131 THR n 
2 132 ILE n 
2 133 PRO n 
2 134 SER n 
2 135 ILE n 
2 136 ASN n 
2 137 ASN n 
2 138 GLU n 
2 139 THR n 
2 140 PRO n 
2 141 GLY n 
2 142 ILE n 
2 143 ARG n 
2 144 TYR n 
2 145 GLN n 
2 146 TYR n 
2 147 ASN n 
2 148 VAL n 
2 149 LEU n 
2 150 PRO n 
2 151 GLN n 
2 152 GLY n 
2 153 TRP n 
2 154 LYS n 
2 155 GLY n 
2 156 SER n 
2 157 PRO n 
2 158 ALA n 
2 159 ILE n 
2 160 PHE n 
2 161 GLN n 
2 162 SER n 
2 163 SER n 
2 164 MET n 
2 165 THR n 
2 166 LYS n 
2 167 ILE n 
2 168 LEU n 
2 169 GLU n 
2 170 PRO n 
2 171 PHE n 
2 172 ARG n 
2 173 LYS n 
2 174 GLN n 
2 175 ASN n 
2 176 PRO n 
2 177 ASP n 
2 178 ILE n 
2 179 VAL n 
2 180 ILE n 
2 181 TYR n 
2 182 GLN n 
2 183 TYR n 
2 184 MET n 
2 185 ASP n 
2 186 ASP n 
2 187 LEU n 
2 188 TYR n 
2 189 VAL n 
2 190 GLY n 
2 191 SER n 
2 192 ASP n 
2 193 LEU n 
2 194 GLU n 
2 195 ILE n 
2 196 GLY n 
2 197 GLN n 
2 198 HIS n 
2 199 ARG n 
2 200 THR n 
2 201 LYS n 
2 202 ILE n 
2 203 GLU n 
2 204 GLU n 
2 205 LEU n 
2 206 ARG n 
2 207 GLN n 
2 208 HIS n 
2 209 LEU n 
2 210 LEU n 
2 211 ARG n 
2 212 TRP n 
2 213 GLY n 
2 214 LEU n 
2 215 THR n 
2 216 THR n 
2 217 PRO n 
2 218 ASP n 
2 219 LYS n 
2 220 LYS n 
2 221 HIS n 
2 222 GLN n 
2 223 LYS n 
2 224 GLU n 
2 225 PRO n 
2 226 PRO n 
2 227 PHE n 
2 228 LEU n 
2 229 TRP n 
2 230 MET n 
2 231 GLY n 
2 232 TYR n 
2 233 GLU n 
2 234 LEU n 
2 235 HIS n 
2 236 PRO n 
2 237 ASP n 
2 238 LYS n 
2 239 TRP n 
2 240 THR n 
2 241 VAL n 
2 242 GLN n 
2 243 PRO n 
2 244 ILE n 
2 245 VAL n 
2 246 LEU n 
2 247 PRO n 
2 248 GLU n 
2 249 LYS n 
2 250 ASP n 
2 251 SER n 
2 252 TRP n 
2 253 THR n 
2 254 VAL n 
2 255 ASN n 
2 256 ASP n 
2 257 ILE n 
2 258 GLN n 
2 259 LYS n 
2 260 LEU n 
2 261 VAL n 
2 262 GLY n 
2 263 LYS n 
2 264 LEU n 
2 265 ASN n 
2 266 TRP n 
2 267 ALA n 
2 268 SER n 
2 269 GLN n 
2 270 ILE n 
2 271 TYR n 
2 272 PRO n 
2 273 GLY n 
2 274 ILE n 
2 275 LYS n 
2 276 VAL n 
2 277 ARG n 
2 278 GLN n 
2 279 LEU n 
2 280 SER n 
2 281 LYS n 
2 282 LEU n 
2 283 LEU n 
2 284 ARG n 
2 285 GLY n 
2 286 THR n 
2 287 LYS n 
2 288 ALA n 
2 289 LEU n 
2 290 THR n 
2 291 GLU n 
2 292 VAL n 
2 293 ILE n 
2 294 PRO n 
2 295 LEU n 
2 296 THR n 
2 297 GLU n 
2 298 GLU n 
2 299 ALA n 
2 300 GLU n 
2 301 LEU n 
2 302 GLU n 
2 303 LEU n 
2 304 ALA n 
2 305 GLU n 
2 306 ASN n 
2 307 ARG n 
2 308 GLU n 
2 309 ILE n 
2 310 LEU n 
2 311 LYS n 
2 312 GLU n 
2 313 PRO n 
2 314 VAL n 
2 315 HIS n 
2 316 GLY n 
2 317 VAL n 
2 318 TYR n 
2 319 TYR n 
2 320 ASP n 
2 321 PRO n 
2 322 SER n 
2 323 LYS n 
2 324 ASP n 
2 325 LEU n 
2 326 ILE n 
2 327 ALA n 
2 328 GLU n 
2 329 ILE n 
2 330 GLN n 
2 331 LYS n 
2 332 GLN n 
2 333 GLY n 
2 334 GLN n 
2 335 GLY n 
2 336 GLN n 
2 337 TRP n 
2 338 THR n 
2 339 TYR n 
2 340 GLN n 
2 341 ILE n 
2 342 TYR n 
2 343 GLN n 
2 344 GLU n 
2 345 PRO n 
2 346 PHE n 
2 347 LYS n 
2 348 ASN n 
2 349 LEU n 
2 350 LYS n 
2 351 THR n 
2 352 GLY n 
2 353 LYS n 
2 354 TYR n 
2 355 ALA n 
2 356 ARG n 
2 357 MET n 
2 358 ARG n 
2 359 GLY n 
2 360 ALA n 
2 361 HIS n 
2 362 THR n 
2 363 ASN n 
2 364 ASP n 
2 365 VAL n 
2 366 LYS n 
2 367 GLN n 
2 368 LEU n 
2 369 THR n 
2 370 GLU n 
2 371 ALA n 
2 372 VAL n 
2 373 GLN n 
2 374 LYS n 
2 375 ILE n 
2 376 THR n 
2 377 THR n 
2 378 GLU n 
2 379 SER n 
2 380 ILE n 
2 381 VAL n 
2 382 ILE n 
2 383 TRP n 
2 384 GLY n 
2 385 LYS n 
2 386 THR n 
2 387 PRO n 
2 388 LYS n 
2 389 PHE n 
2 390 LYS n 
2 391 LEU n 
2 392 PRO n 
2 393 ILE n 
2 394 GLN n 
2 395 LYS n 
2 396 GLU n 
2 397 THR n 
2 398 TRP n 
2 399 GLU n 
2 400 THR n 
2 401 TRP n 
2 402 TRP n 
2 403 THR n 
2 404 GLU n 
2 405 TYR n 
2 406 TRP n 
2 407 GLN n 
2 408 ALA n 
2 409 THR n 
2 410 TRP n 
2 411 ILE n 
2 412 PRO n 
2 413 GLU n 
2 414 TRP n 
2 415 GLU n 
2 416 PHE n 
2 417 VAL n 
2 418 ASN n 
2 419 THR n 
2 420 PRO n 
2 421 PRO n 
2 422 LEU n 
2 423 VAL n 
2 424 LYS n 
2 425 LEU n 
2 426 TRP n 
2 427 TYR n 
2 428 GLN n 
2 429 LEU n 
2 430 GLU n 
2 431 LYS n 
2 432 GLU n 
2 433 PRO n 
2 434 ILE n 
2 435 VAL n 
2 436 GLY n 
2 437 ALA n 
2 438 GLU n 
2 439 THR n 
2 440 PHE n 
3 1   DA  n 
3 2   DC  n 
3 3   DA  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DC  n 
3 8   DC  n 
3 9   DT  n 
3 10  DG  n 
3 11  DT  n 
3 12  DT  n 
3 13  DC  n 
3 14  DG  n 
3 15  DG  n 
3 16  MRG n 
3 17  DC  n 
3 18  DG  n 
3 19  DC  n 
3 20  DC  n 
3 21  6FM n 
3 22  6FM n 
4 1   DA  n 
4 2   DT  n 
4 3   DG  n 
4 4   DG  n 
4 5   DA  n 
4 6   DT  n 
4 7   DG  n 
4 8   DG  n 
4 9   DC  n 
4 10  DG  n 
4 11  DC  n 
4 12  DC  n 
4 13  DC  n 
4 14  DG  n 
4 15  DA  n 
4 16  DA  n 
4 17  DC  n 
4 18  DA  n 
4 19  DG  n 
4 20  DG  n 
4 21  DG  n 
4 22  DA  n 
4 23  DC  n 
4 24  DT  n 
4 25  DG  n 
4 26  DT  n 
4 27  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 560 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 
'BL21(DE3)-RIL' ? ? ? ? ? ? ? plasmid ? ? ? pCDFDuet1 ? ? 
2 1 sample 'Biological sequence' 1 440 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 
'BL21(DE3)-RIL' ? ? ? ? ? ? ? plasmid ? ? ? pRSFDuet1 ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 22 'Human immunodeficiency virus 1' ? 11676 ? 
4 1 sample 1 27 'Human immunodeficiency virus 1' ? 11676 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POL_HV1H2 P04585 ? 1 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL

;
588 
2 UNP POL_HV1H2 P04585 ? 2 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
588 
3 PDB 5J2Q      5J2Q   ? 3 ? 1   
4 PDB 5J2Q      5J2Q   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5J2Q A 1 ? 560 ? P04585 588 ? 1147 ? 1   560 
2 2 5J2Q B 1 ? 440 ? P04585 588 ? 1027 ? 1   440 
3 3 5J2Q P 1 ? 22  ? 5J2Q   802 ? 823  ? 802 823 
4 4 5J2Q T 1 ? 27  ? 5J2Q   701 ? 727  ? 701 727 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5J2Q CYS A 258 ? UNP P04585 GLN 845 'engineered mutation' 258 1 
1 5J2Q SER A 280 ? UNP P04585 CYS 867 'engineered mutation' 280 2 
2 5J2Q SER B 280 ? UNP P04585 CYS 867 'engineered mutation' 280 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
6FM 'DNA linking'       . 
;2'-deoxy-4'-ethynyl-2-fluoroadenosine 5'-(dihydrogen phosphate)
;
? 'C12 H13 F N5 O6 P' 373.234 
ALA 'L-peptide linking' y ALANINE                                                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                   ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                          ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                              ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                               ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                              ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                      ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                         ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                             ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                        ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                   ? 'Mg 2'              24.305  
MRG 'DNA linking'       n "N2-(3-MERCAPTOPROPYL)-2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"        ? 'C13 H20 N5 O7 P S' 421.366 
PHE 'L-peptide linking' y PHENYLALANINE                                                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                            ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                            ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5J2Q 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.77 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.53 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291.1 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '8% PEG4000, 25mM MES pH 6.0, 5mM magnesium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CMOS 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RDI CMOS_8M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-30 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0001 1.0 
2 1.000  1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 4.2.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   4.2.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.d_resolution_high            2.790 
_reflns.d_resolution_low             64.330 
_reflns.pdbx_number_measured_all     269604 
_reflns.number_obs                   36351 
_reflns.pdbx_Rmerge_I_obs            0.079 
_reflns.pdbx_netI_over_sigmaI        21.500 
_reflns.pdbx_redundancy              7.400 
_reflns.percent_possible_obs         99.700 
_reflns.pdbx_Rrim_I_all              0.085 
_reflns.pdbx_Rpim_I_all              0.031 
_reflns.pdbx_CC_half                 0.999 
_reflns.B_iso_Wilson_estimate        62.200 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5J2Q 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1 2.790 2.910  ? 31561 ? 0 0.992 ? ? ? 7.300 ? 1.900  ? 4329 ? ? ? ? 97.800 1.067 0.390 0.812 
1 2 9.660 64.330 ? 6337  ? 0 0.022 ? ? ? 6.700 ? 73.300 ? 951  ? ? ? ? 98.000 0.023 0.009 1.000 
# 
_refine.entry_id                                 5J2Q 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            2.7890 
_refine.ls_d_res_low                             64.330 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.6800 
_refine.ls_number_reflns_obs                     36311 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2138 
_refine.ls_R_factor_R_work                       0.2117 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2520 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  1817 
_refine.ls_number_reflns_R_work                  34494 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               70.5522 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.3800 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'pdbid 5J2M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                175.730 
_refine.B_iso_min                                32.000 
_refine.pdbx_overall_phase_error                 29.0500 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.7890 
_refine_hist.d_res_low                        64.330 
_refine_hist.pdbx_number_atoms_ligand         49 
_refine_hist.number_atoms_solvent             3 
_refine_hist.number_atoms_total               8595 
_refine_hist.pdbx_number_residues_total       985 
_refine_hist.pdbx_B_iso_mean_ligand           82.38 
_refine_hist.pdbx_B_iso_mean_solvent          59.58 
_refine_hist.pdbx_number_atoms_protein        7759 
_refine_hist.pdbx_number_atoms_nucleic_acid   784 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           8901  0.002  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          12234 0.467  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     1333  0.039  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      1399  0.003  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 5187  14.579 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_obs 
2.7887 2.8641  13 97.0000  2556 . 0.3205 0.3733 . 115 . 2671 . 'X-RAY DIFFRACTION' . 
2.8641 2.9483  13 100.0000 2646 . 0.2708 0.3684 . 129 . 2775 . 'X-RAY DIFFRACTION' . 
2.9483 3.0435  13 100.0000 2622 . 0.2726 0.3361 . 151 . 2773 . 'X-RAY DIFFRACTION' . 
3.0435 3.1522  13 100.0000 2617 . 0.2624 0.3493 . 138 . 2755 . 'X-RAY DIFFRACTION' . 
3.1522 3.2784  13 100.0000 2654 . 0.2523 0.3321 . 138 . 2792 . 'X-RAY DIFFRACTION' . 
3.2784 3.4276  13 100.0000 2652 . 0.2368 0.2448 . 125 . 2777 . 'X-RAY DIFFRACTION' . 
3.4276 3.6083  13 100.0000 2641 . 0.2215 0.2987 . 136 . 2777 . 'X-RAY DIFFRACTION' . 
3.6083 3.8343  13 100.0000 2646 . 0.2153 0.2908 . 140 . 2786 . 'X-RAY DIFFRACTION' . 
3.8343 4.1303  13 100.0000 2648 . 0.1918 0.2353 . 154 . 2802 . 'X-RAY DIFFRACTION' . 
4.1303 4.5457  13 100.0000 2632 . 0.1752 0.2073 . 164 . 2796 . 'X-RAY DIFFRACTION' . 
4.5457 5.2030  13 100.0000 2688 . 0.1757 0.1949 . 132 . 2820 . 'X-RAY DIFFRACTION' . 
5.2030 6.5534  13 100.0000 2708 . 0.2075 0.2385 . 153 . 2861 . 'X-RAY DIFFRACTION' . 
6.5534 53.7675 13 99.0000  2784 . 0.1983 0.2164 . 142 . 2926 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                     5J2Q 
_struct.title                        
'HIV-1 reverse transcriptase in complex with DNA that has incorporated a mismatched EFdA-MP at the N-(pre-translocation) site' 
_struct.pdbx_descriptor              'HIV-1 reverse transcriptase p66 subunit, Gag-Pol polyprotein/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5J2Q 
_struct_keywords.text            
;HIV-1, reverse transcriptase, RT, DNA, double stranded DNA, dsDNA, mismatch, EFdA, 4'-ethynyl-2-fluoro-2'-deoxyadenosine, EFdA-monophosphate, EFdA-MP, inhibitors, NRTI, TDRTI, translocation defective, P site, N site, pre-translocation, post-translocation, transferase-dna complex
;
_struct_keywords.pdbx_keywords   transferase/dna 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 27  ? GLU A 44  ? THR A 27  GLU A 44  1 ? 18 
HELX_P HELX_P2  AA2 PHE A 77  ? THR A 84  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P3  AA3 HIS A 96  ? LEU A 100 ? HIS A 96  LEU A 100 5 ? 5  
HELX_P HELX_P4  AA4 ALA A 114 ? VAL A 118 ? ALA A 114 VAL A 118 5 ? 5  
HELX_P HELX_P5  AA5 ASP A 121 ? TYR A 127 ? ASP A 121 TYR A 127 5 ? 7  
HELX_P HELX_P6  AA6 GLY A 155 ? ASN A 175 ? GLY A 155 ASN A 175 1 ? 21 
HELX_P HELX_P7  AA7 GLU A 194 ? TRP A 212 ? GLU A 194 TRP A 212 1 ? 19 
HELX_P HELX_P8  AA8 PRO A 217 ? LYS A 219 ? PRO A 217 LYS A 219 5 ? 3  
HELX_P HELX_P9  AA9 THR A 253 ? SER A 268 ? THR A 253 SER A 268 1 ? 16 
HELX_P HELX_P10 AB1 VAL A 276 ? LEU A 282 ? VAL A 276 LEU A 282 1 ? 7  
HELX_P HELX_P11 AB2 THR A 296 ? GLU A 312 ? THR A 296 GLU A 312 1 ? 17 
HELX_P HELX_P12 AB3 ASN A 363 ? GLY A 384 ? ASN A 363 GLY A 384 1 ? 22 
HELX_P HELX_P13 AB4 GLN A 394 ? TYR A 405 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P14 AB5 THR A 473 ? ASP A 488 ? THR A 473 ASP A 488 1 ? 16 
HELX_P HELX_P15 AB6 SER A 499 ? ALA A 508 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P16 AB7 SER A 515 ? LYS A 528 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P17 AB8 GLY A 544 ? ALA A 554 ? GLY A 544 ALA A 554 1 ? 11 
HELX_P HELX_P18 AB9 THR B 27  ? GLU B 44  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P19 AC1 PHE B 77  ? THR B 84  ? PHE B 77  THR B 84  1 ? 8  
HELX_P HELX_P20 AC2 GLY B 99  ? LYS B 103 ? GLY B 99  LYS B 103 5 ? 5  
HELX_P HELX_P21 AC3 GLY B 112 ? VAL B 118 ? GLY B 112 VAL B 118 5 ? 7  
HELX_P HELX_P22 AC4 ASP B 121 ? LYS B 126 ? ASP B 121 LYS B 126 1 ? 6  
HELX_P HELX_P23 AC5 TYR B 127 ? ALA B 129 ? TYR B 127 ALA B 129 5 ? 3  
HELX_P HELX_P24 AC6 SER B 134 ? GLU B 138 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P25 AC7 LYS B 154 ? PHE B 160 ? LYS B 154 PHE B 160 1 ? 7  
HELX_P HELX_P26 AC8 PHE B 160 ? ASN B 175 ? PHE B 160 ASN B 175 1 ? 16 
HELX_P HELX_P27 AC9 GLY B 196 ? LEU B 210 ? GLY B 196 LEU B 210 1 ? 15 
HELX_P HELX_P28 AD1 HIS B 235 ? TRP B 239 ? HIS B 235 TRP B 239 5 ? 5  
HELX_P HELX_P29 AD2 VAL B 254 ? SER B 268 ? VAL B 254 SER B 268 1 ? 15 
HELX_P HELX_P30 AD3 VAL B 276 ? LYS B 281 ? VAL B 276 LYS B 281 1 ? 6  
HELX_P HELX_P31 AD4 LEU B 282 ? ARG B 284 ? LEU B 282 ARG B 284 5 ? 3  
HELX_P HELX_P32 AD5 THR B 296 ? GLU B 312 ? THR B 296 GLU B 312 1 ? 17 
HELX_P HELX_P33 AD6 ASN B 363 ? TRP B 383 ? ASN B 363 TRP B 383 1 ? 21 
HELX_P HELX_P34 AD7 GLN B 394 ? TRP B 406 ? GLN B 394 TRP B 406 1 ? 13 
HELX_P HELX_P35 AD8 LEU B 422 ? TYR B 427 ? LEU B 422 TYR B 427 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ?    ? A CYS 258 SG    ? ? ? 1_555 C MRG 16 S24 ? ? A CYS 258 P MRG 817 1_555 ? ? ? ? ? ? ?                2.050 ? 
metalc1  metalc ?    ? A ASP 443 OD1   ? ? ? 1_555 E MG  .  MG  ? ? A ASP 443 A MG  601 1_555 ? ? ? ? ? ? ?                2.091 ? 
metalc2  metalc ?    ? A GLU 478 OE2   ? ? ? 1_555 E MG  .  MG  ? ? A GLU 478 A MG  601 1_555 ? ? ? ? ? ? ?                2.090 ? 
metalc3  metalc ?    ? A ASP 498 OD1   ? ? ? 1_555 E MG  .  MG  ? ? A ASP 498 A MG  601 1_555 ? ? ? ? ? ? ?                2.106 ? 
metalc4  metalc ?    ? A ASP 498 OD2   ? ? ? 1_555 E MG  .  MG  ? ? A ASP 498 A MG  601 1_555 ? ? ? ? ? ? ?                2.075 ? 
covale1  covale both ? C DG  15  "O3'" ? ? ? 1_555 C MRG 16 P   ? ? P DG  816 P MRG 817 1_555 ? ? ? ? ? ? ?                1.605 ? 
covale2  covale both ? C MRG 16  "O3'" ? ? ? 1_555 C DC  17 P   ? ? P MRG 817 P DC  818 1_555 ? ? ? ? ? ? ?                1.607 ? 
covale3  covale both ? C DC  20  "O3'" ? ? ? 1_555 F 6FM .  PA  ? ? P DC  821 P 6FM 901 1_555 ? ? ? ? ? ? ?                1.558 ? 
metalc5  metalc ?    ? E MG  .   MG    ? ? ? 1_555 H HOH .  O   ? ? A MG  601 A HOH 701 1_555 ? ? ? ? ? ? ?                2.072 ? 
metalc6  metalc ?    ? E MG  .   MG    ? ? ? 1_555 H HOH .  O   ? ? A MG  601 A HOH 702 1_555 ? ? ? ? ? ? ?                2.072 ? 
covale4  covale one  ? F 6FM .   "O3'" ? ? ? 1_555 G 6FM .  PA  ? ? P 6FM 901 T 6FM 801 1_555 ? ? ? ? ? ? ?                1.560 ? 
hydrog1  hydrog ?    ? C DG  4   N1    ? ? ? 1_555 D DC  23 N3  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog2  hydrog ?    ? C DG  4   N2    ? ? ? 1_555 D DC  23 O2  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog3  hydrog ?    ? C DG  4   O6    ? ? ? 1_555 D DC  23 N4  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog4  hydrog ?    ? C DT  5   N3    ? ? ? 1_555 D DA  22 N1  ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog5  hydrog ?    ? C DT  5   O4    ? ? ? 1_555 D DA  22 N6  ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog6  hydrog ?    ? C DC  6   N3    ? ? ? 1_555 D DG  21 N1  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog7  hydrog ?    ? C DC  6   N4    ? ? ? 1_555 D DG  21 O6  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog8  hydrog ?    ? C DC  6   O2    ? ? ? 1_555 D DG  21 N2  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog9  hydrog ?    ? C DC  7   N3    ? ? ? 1_555 D DG  20 N1  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog10 hydrog ?    ? C DC  7   N4    ? ? ? 1_555 D DG  20 O6  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog11 hydrog ?    ? C DC  7   O2    ? ? ? 1_555 D DG  20 N2  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog12 hydrog ?    ? C DC  8   N3    ? ? ? 1_555 D DG  19 N1  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog13 hydrog ?    ? C DC  8   N4    ? ? ? 1_555 D DG  19 O6  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog14 hydrog ?    ? C DC  8   O2    ? ? ? 1_555 D DG  19 N2  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog15 hydrog ?    ? C DT  9   N3    ? ? ? 1_555 D DA  18 N1  ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog16 hydrog ?    ? C DT  9   O4    ? ? ? 1_555 D DA  18 N6  ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog17 hydrog ?    ? C DG  10  N1    ? ? ? 1_555 D DC  17 N3  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog18 hydrog ?    ? C DG  10  N2    ? ? ? 1_555 D DC  17 O2  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog19 hydrog ?    ? C DG  10  O6    ? ? ? 1_555 D DC  17 N4  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog20 hydrog ?    ? C DT  11  N3    ? ? ? 1_555 D DA  16 N1  ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog21 hydrog ?    ? C DT  11  O4    ? ? ? 1_555 D DA  16 N6  ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog22 hydrog ?    ? C DT  12  N3    ? ? ? 1_555 D DA  15 N1  ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog23 hydrog ?    ? C DT  12  O4    ? ? ? 1_555 D DA  15 N6  ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog24 hydrog ?    ? C DC  13  O2    ? ? ? 1_555 D DG  14 N1  ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? 'DC-DG PAIR'     ?     ? 
hydrog25 hydrog ?    ? C DG  14  N1    ? ? ? 1_555 D DC  13 N3  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog26 hydrog ?    ? C DG  14  N2    ? ? ? 1_555 D DC  13 O2  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog27 hydrog ?    ? C DG  14  O6    ? ? ? 1_555 D DC  13 N4  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog28 hydrog ?    ? C DG  15  N1    ? ? ? 1_555 D DC  12 N3  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog29 hydrog ?    ? C DG  15  N2    ? ? ? 1_555 D DC  12 O2  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog30 hydrog ?    ? C DG  15  O6    ? ? ? 1_555 D DC  12 N4  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog31 hydrog ?    ? C MRG 16  N1    ? ? ? 1_555 D DC  11 N3  ? ? P MRG 817 T DC  711 1_555 ? ? ? ? ? ? 'MRG-DC MISPAIR' ?     ? 
hydrog32 hydrog ?    ? C DC  17  N3    ? ? ? 1_555 D DG  10 N1  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog33 hydrog ?    ? C DC  17  N4    ? ? ? 1_555 D DG  10 O6  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog34 hydrog ?    ? C DC  17  O2    ? ? ? 1_555 D DG  10 N2  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog35 hydrog ?    ? C DG  18  N1    ? ? ? 1_555 D DC  9  N3  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog36 hydrog ?    ? C DG  18  N2    ? ? ? 1_555 D DC  9  O2  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog37 hydrog ?    ? C DG  18  O6    ? ? ? 1_555 D DC  9  N4  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog38 hydrog ?    ? C DC  19  N3    ? ? ? 1_555 D DG  8  N1  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog39 hydrog ?    ? C DC  19  N4    ? ? ? 1_555 D DG  8  O6  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog40 hydrog ?    ? C DC  19  O2    ? ? ? 1_555 D DG  8  N2  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog41 hydrog ?    ? C DC  20  N3    ? ? ? 1_555 D DG  7  N1  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog42 hydrog ?    ? C DC  20  N4    ? ? ? 1_555 D DG  7  O6  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog43 hydrog ?    ? C DC  20  O2    ? ? ? 1_555 D DG  7  N2  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 225 A . ? PRO 225 A PRO 226 A ? PRO 226 A 1 -0.54 
2 PRO 420 A . ? PRO 420 A PRO 421 A ? PRO 421 A 1 -1.32 
3 GLY 543 A . ? GLY 543 A GLY 544 A ? GLY 544 A 1 -1.02 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 4 ? 
AA4 ? 3 ? 
AA5 ? 5 ? 
AA6 ? 2 ? 
AA7 ? 5 ? 
AA8 ? 3 ? 
AA9 ? 2 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
AB3 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB3 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 47  ? LYS A 49  ? ILE A 47  LYS A 49  
AA1 2 TYR A 144 ? TYR A 146 ? TYR A 144 TYR A 146 
AA1 3 ALA A 129 ? PHE A 130 ? ALA A 129 PHE A 130 
AA2 1 VAL A 60  ? LYS A 64  ? VAL A 60  LYS A 64  
AA2 2 TRP A 71  ? VAL A 75  ? TRP A 71  VAL A 75  
AA3 1 VAL A 179 ? TYR A 183 ? VAL A 179 TYR A 183 
AA3 2 ASP A 186 ? SER A 191 ? ASP A 186 SER A 191 
AA3 3 SER A 105 ? ASP A 110 ? SER A 105 ASP A 110 
AA3 4 HIS A 221 ? GLN A 222 ? HIS A 221 GLN A 222 
AA4 1 PHE A 227 ? TRP A 229 ? PHE A 227 TRP A 229 
AA4 2 TYR A 232 ? LEU A 234 ? TYR A 232 LEU A 234 
AA4 3 TRP A 239 ? VAL A 241 ? TRP A 239 VAL A 241 
AA5 1 LYS A 347 ? TYR A 354 ? LYS A 347 TYR A 354 
AA5 2 GLN A 336 ? GLU A 344 ? GLN A 336 GLU A 344 
AA5 3 ILE A 326 ? GLN A 332 ? ILE A 326 GLN A 332 
AA5 4 LYS A 388 ? LEU A 391 ? LYS A 388 LEU A 391 
AA5 5 TRP A 414 ? PHE A 416 ? TRP A 414 PHE A 416 
AA6 1 HIS A 361 ? THR A 362 ? HIS A 361 THR A 362 
AA6 2 GLN A 512 ? SER A 513 ? GLN A 512 SER A 513 
AA7 1 GLN A 464 ? LEU A 469 ? GLN A 464 LEU A 469 
AA7 2 GLY A 453 ? THR A 459 ? GLY A 453 THR A 459 
AA7 3 GLU A 438 ? ALA A 446 ? GLU A 438 ALA A 446 
AA7 4 GLU A 492 ? THR A 497 ? GLU A 492 THR A 497 
AA7 5 LYS A 530 ? TRP A 535 ? LYS A 530 TRP A 535 
AA8 1 ILE B 47  ? ILE B 50  ? ILE B 47  ILE B 50  
AA8 2 ILE B 142 ? TYR B 146 ? ILE B 142 TYR B 146 
AA8 3 PHE B 130 ? ILE B 132 ? PHE B 130 ILE B 132 
AA9 1 VAL B 60  ? LYS B 64  ? VAL B 60  LYS B 64  
AA9 2 TRP B 71  ? VAL B 75  ? TRP B 71  VAL B 75  
AB1 1 SER B 105 ? ASP B 110 ? SER B 105 ASP B 110 
AB1 2 ASP B 186 ? SER B 191 ? ASP B 186 SER B 191 
AB1 3 VAL B 179 ? TYR B 183 ? VAL B 179 TYR B 183 
AB2 1 TRP B 252 ? THR B 253 ? TRP B 252 THR B 253 
AB2 2 VAL B 292 ? ILE B 293 ? VAL B 292 ILE B 293 
AB3 1 ASN B 348 ? TYR B 354 ? ASN B 348 TYR B 354 
AB3 2 GLN B 336 ? TYR B 342 ? GLN B 336 TYR B 342 
AB3 3 LEU B 325 ? GLY B 333 ? LEU B 325 GLY B 333 
AB3 4 PRO B 387 ? LEU B 391 ? PRO B 387 LEU B 391 
AB3 5 TRP B 414 ? PHE B 416 ? TRP B 414 PHE B 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 48  ? N SER A 48  O GLN A 145 ? O GLN A 145 
AA1 2 3 O TYR A 144 ? O TYR A 144 N PHE A 130 ? N PHE A 130 
AA2 1 2 N ILE A 63  ? N ILE A 63  O ARG A 72  ? O ARG A 72  
AA3 1 2 N TYR A 181 ? N TYR A 181 O TYR A 188 ? O TYR A 188 
AA3 2 3 O VAL A 189 ? O VAL A 189 N THR A 107 ? N THR A 107 
AA3 3 4 N VAL A 108 ? N VAL A 108 O GLN A 222 ? O GLN A 222 
AA4 1 2 N PHE A 227 ? N PHE A 227 O LEU A 234 ? O LEU A 234 
AA4 2 3 N GLU A 233 ? N GLU A 233 O THR A 240 ? O THR A 240 
AA5 1 2 O LYS A 350 ? O LYS A 350 N ILE A 341 ? N ILE A 341 
AA5 2 3 O THR A 338 ? O THR A 338 N GLN A 330 ? N GLN A 330 
AA5 3 4 N ALA A 327 ? N ALA A 327 O LYS A 388 ? O LYS A 388 
AA5 4 5 N LEU A 391 ? N LEU A 391 O GLU A 415 ? O GLU A 415 
AA6 1 2 N THR A 362 ? N THR A 362 O GLN A 512 ? O GLN A 512 
AA7 1 2 O VAL A 467 ? O VAL A 467 N ALA A 455 ? N ALA A 455 
AA7 2 3 O VAL A 458 ? O VAL A 458 N TYR A 441 ? N TYR A 441 
AA7 3 4 N PHE A 440 ? N PHE A 440 O ASN A 494 ? O ASN A 494 
AA7 4 5 N ILE A 495 ? N ILE A 495 O TYR A 532 ? O TYR A 532 
AA8 1 2 N SER B 48  ? N SER B 48  O GLN B 145 ? O GLN B 145 
AA8 2 3 O TYR B 144 ? O TYR B 144 N PHE B 130 ? N PHE B 130 
AA9 1 2 N PHE B 61  ? N PHE B 61  O LEU B 74  ? O LEU B 74  
AB1 1 2 N LEU B 109 ? N LEU B 109 O LEU B 187 ? O LEU B 187 
AB1 2 3 O TYR B 188 ? O TYR B 188 N TYR B 181 ? N TYR B 181 
AB2 1 2 N TRP B 252 ? N TRP B 252 O ILE B 293 ? O ILE B 293 
AB3 1 2 O TYR B 354 ? O TYR B 354 N TRP B 337 ? N TRP B 337 
AB3 2 3 O TYR B 342 ? O TYR B 342 N ILE B 326 ? N ILE B 326 
AB3 3 4 N LEU B 325 ? N LEU B 325 O LYS B 388 ? O LYS B 388 
AB3 4 5 N LEU B 391 ? N LEU B 391 O GLU B 415 ? O GLU B 415 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    MG 
_struct_site.pdbx_auth_seq_id     601 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'binding site for residue MG A 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 ASP A 443 ? ASP A 443 . ? 1_555 ? 
2 AC1 5 GLU A 478 ? GLU A 478 . ? 1_555 ? 
3 AC1 5 ASP A 498 ? ASP A 498 . ? 1_555 ? 
4 AC1 5 HOH H .   ? HOH A 701 . ? 1_555 ? 
5 AC1 5 HOH H .   ? HOH A 702 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5J2Q 
_atom_sites.fract_transf_matrix[1][1]   0.006040 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005865 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009781 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
F  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 1   ? 43.695 -10.133 -15.794 1.00 88.27  ? 1   PRO A N     1 
ATOM   2    C  CA    . PRO A 1 1   ? 42.455 -10.847 -15.465 1.00 94.49  ? 1   PRO A CA    1 
ATOM   3    C  C     . PRO A 1 1   ? 41.222 -9.962  -15.633 1.00 90.82  ? 1   PRO A C     1 
ATOM   4    O  O     . PRO A 1 1   ? 41.187 -9.123  -16.533 1.00 89.17  ? 1   PRO A O     1 
ATOM   5    C  CB    . PRO A 1 1   ? 42.650 -11.237 -13.995 1.00 92.63  ? 1   PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 1   ? 44.126 -11.169 -13.766 1.00 86.74  ? 1   PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 1   ? 44.615 -10.067 -14.647 1.00 84.50  ? 1   PRO A CD    1 
ATOM   8    N  N     . ILE A 1 2   ? 40.225 -10.152 -14.773 1.00 81.80  ? 2   ILE A N     1 
ATOM   9    C  CA    . ILE A 1 2   ? 39.009 -9.347  -14.773 1.00 74.76  ? 2   ILE A CA    1 
ATOM   10   C  C     . ILE A 1 2   ? 38.883 -8.676  -13.412 1.00 70.98  ? 2   ILE A C     1 
ATOM   11   O  O     . ILE A 1 2   ? 39.079 -9.322  -12.376 1.00 71.79  ? 2   ILE A O     1 
ATOM   12   C  CB    . ILE A 1 2   ? 37.762 -10.194 -15.088 1.00 65.16  ? 2   ILE A CB    1 
ATOM   13   C  CG1   . ILE A 1 2   ? 37.873 -10.807 -16.487 1.00 69.65  ? 2   ILE A CG1   1 
ATOM   14   C  CG2   . ILE A 1 2   ? 36.498 -9.354  -14.977 1.00 49.95  ? 2   ILE A CG2   1 
ATOM   15   C  CD1   . ILE A 1 2   ? 36.671 -11.634 -16.890 1.00 71.41  ? 2   ILE A CD1   1 
ATOM   16   N  N     . SER A 1 3   ? 38.556 -7.387  -13.417 1.00 69.19  ? 3   SER A N     1 
ATOM   17   C  CA    . SER A 1 3   ? 38.504 -6.619  -12.177 1.00 66.31  ? 3   SER A CA    1 
ATOM   18   C  C     . SER A 1 3   ? 37.325 -7.064  -11.320 1.00 57.15  ? 3   SER A C     1 
ATOM   19   O  O     . SER A 1 3   ? 36.209 -7.207  -11.834 1.00 51.34  ? 3   SER A O     1 
ATOM   20   C  CB    . SER A 1 3   ? 38.390 -5.129  -12.483 1.00 63.62  ? 3   SER A CB    1 
ATOM   21   O  OG    . SER A 1 3   ? 38.429 -4.367  -11.290 1.00 43.75  ? 3   SER A OG    1 
ATOM   22   N  N     . PRO A 1 4   ? 37.522 -7.287  -10.018 1.00 62.29  ? 4   PRO A N     1 
ATOM   23   C  CA    . PRO A 1 4   ? 36.389 -7.631  -9.147  1.00 59.21  ? 4   PRO A CA    1 
ATOM   24   C  C     . PRO A 1 4   ? 35.557 -6.418  -8.754  1.00 55.40  ? 4   PRO A C     1 
ATOM   25   O  O     . PRO A 1 4   ? 34.731 -6.498  -7.840  1.00 63.60  ? 4   PRO A O     1 
ATOM   26   C  CB    . PRO A 1 4   ? 37.070 -8.266  -7.929  1.00 47.47  ? 4   PRO A CB    1 
ATOM   27   C  CG    . PRO A 1 4   ? 38.417 -7.629  -7.885  1.00 62.79  ? 4   PRO A CG    1 
ATOM   28   C  CD    . PRO A 1 4   ? 38.815 -7.417  -9.323  1.00 63.79  ? 4   PRO A CD    1 
ATOM   29   N  N     . ILE A 1 5   ? 35.764 -5.291  -9.438  1.00 48.78  ? 5   ILE A N     1 
ATOM   30   C  CA    . ILE A 1 5   ? 34.978 -4.097  -9.163  1.00 54.41  ? 5   ILE A CA    1 
ATOM   31   C  C     . ILE A 1 5   ? 33.534 -4.326  -9.596  1.00 58.68  ? 5   ILE A C     1 
ATOM   32   O  O     . ILE A 1 5   ? 33.249 -5.113  -10.510 1.00 62.10  ? 5   ILE A O     1 
ATOM   33   C  CB    . ILE A 1 5   ? 35.590 -2.871  -9.868  0.63 53.43  ? 5   ILE A CB    1 
ATOM   34   C  CG1   . ILE A 1 5   ? 34.929 -1.577  -9.387  0.81 56.55  ? 5   ILE A CG1   1 
ATOM   35   C  CG2   . ILE A 1 5   ? 35.466 -2.999  -11.378 1.00 44.38  ? 5   ILE A CG2   1 
ATOM   36   C  CD1   . ILE A 1 5   ? 35.426 -0.330  -10.093 1.00 58.55  ? 5   ILE A CD1   1 
ATOM   37   N  N     . GLU A 1 6   ? 32.609 -3.651  -8.918  1.00 60.52  ? 6   GLU A N     1 
ATOM   38   C  CA    . GLU A 1 6   ? 31.205 -3.738  -9.288  1.00 58.34  ? 6   GLU A CA    1 
ATOM   39   C  C     . GLU A 1 6   ? 30.990 -3.174  -10.688 1.00 53.27  ? 6   GLU A C     1 
ATOM   40   O  O     . GLU A 1 6   ? 31.681 -2.250  -11.125 1.00 58.35  ? 6   GLU A O     1 
ATOM   41   C  CB    . GLU A 1 6   ? 30.334 -2.980  -8.283  1.00 73.26  ? 6   GLU A CB    1 
ATOM   42   C  CG    . GLU A 1 6   ? 30.280 -3.591  -6.890  1.00 89.72  ? 6   GLU A CG    1 
ATOM   43   C  CD    . GLU A 1 6   ? 31.508 -3.272  -6.058  1.00 106.21 ? 6   GLU A CD    1 
ATOM   44   O  OE1   . GLU A 1 6   ? 31.625 -3.817  -4.940  1.00 111.62 ? 6   GLU A OE1   1 
ATOM   45   O  OE2   . GLU A 1 6   ? 32.354 -2.476  -6.520  1.00 107.47 ? 6   GLU A OE2   1 
ATOM   46   N  N     . THR A 1 7   ? 30.021 -3.746  -11.395 1.00 51.08  ? 7   THR A N     1 
ATOM   47   C  CA    . THR A 1 7   ? 29.691 -3.270  -12.726 1.00 50.52  ? 7   THR A CA    1 
ATOM   48   C  C     . THR A 1 7   ? 28.831 -2.012  -12.645 1.00 53.35  ? 7   THR A C     1 
ATOM   49   O  O     . THR A 1 7   ? 28.219 -1.709  -11.619 1.00 58.75  ? 7   THR A O     1 
ATOM   50   C  CB    . THR A 1 7   ? 28.960 -4.353  -13.523 1.00 56.90  ? 7   THR A CB    1 
ATOM   51   O  OG1   . THR A 1 7   ? 27.794 -4.775  -12.803 1.00 52.64  ? 7   THR A OG1   1 
ATOM   52   C  CG2   . THR A 1 7   ? 29.867 -5.549  -13.751 1.00 59.77  ? 7   THR A CG2   1 
ATOM   53   N  N     . VAL A 1 8   ? 28.796 -1.273  -13.748 1.00 53.22  ? 8   VAL A N     1 
ATOM   54   C  CA    . VAL A 1 8   ? 28.001 -0.053  -13.853 1.00 54.15  ? 8   VAL A CA    1 
ATOM   55   C  C     . VAL A 1 8   ? 26.659 -0.422  -14.479 1.00 55.09  ? 8   VAL A C     1 
ATOM   56   O  O     . VAL A 1 8   ? 26.639 -0.942  -15.606 1.00 59.10  ? 8   VAL A O     1 
ATOM   57   C  CB    . VAL A 1 8   ? 28.720 1.017   -14.684 1.00 55.74  ? 8   VAL A CB    1 
ATOM   58   C  CG1   . VAL A 1 8   ? 27.805 2.205   -14.921 1.00 53.61  ? 8   VAL A CG1   1 
ATOM   59   C  CG2   . VAL A 1 8   ? 30.000 1.455   -13.983 1.00 45.07  ? 8   VAL A CG2   1 
ATOM   60   N  N     . PRO A 1 9   ? 25.534 -0.181  -13.802 1.00 64.66  ? 9   PRO A N     1 
ATOM   61   C  CA    . PRO A 1 9   ? 24.230 -0.579  -14.357 1.00 61.30  ? 9   PRO A CA    1 
ATOM   62   C  C     . PRO A 1 9   ? 23.878 0.260   -15.577 1.00 60.15  ? 9   PRO A C     1 
ATOM   63   O  O     . PRO A 1 9   ? 23.720 1.480   -15.485 1.00 64.45  ? 9   PRO A O     1 
ATOM   64   C  CB    . PRO A 1 9   ? 23.260 -0.334  -13.195 1.00 54.75  ? 9   PRO A CB    1 
ATOM   65   C  CG    . PRO A 1 9   ? 23.925 0.718   -12.368 1.00 64.12  ? 9   PRO A CG    1 
ATOM   66   C  CD    . PRO A 1 9   ? 25.406 0.469   -12.486 1.00 69.07  ? 9   PRO A CD    1 
ATOM   67   N  N     . VAL A 1 10  ? 23.754 -0.402  -16.723 1.00 60.82  ? 10  VAL A N     1 
ATOM   68   C  CA    . VAL A 1 10  ? 23.488 0.251   -17.999 1.00 66.85  ? 10  VAL A CA    1 
ATOM   69   C  C     . VAL A 1 10  ? 22.173 -0.282  -18.550 1.00 70.93  ? 10  VAL A C     1 
ATOM   70   O  O     . VAL A 1 10  ? 21.943 -1.497  -18.554 1.00 73.87  ? 10  VAL A O     1 
ATOM   71   C  CB    . VAL A 1 10  ? 24.634 0.023   -19.001 1.00 79.49  ? 10  VAL A CB    1 
ATOM   72   C  CG1   . VAL A 1 10  ? 24.309 0.662   -20.342 1.00 90.69  ? 10  VAL A CG1   1 
ATOM   73   C  CG2   . VAL A 1 10  ? 25.937 0.575   -18.447 1.00 78.77  ? 10  VAL A CG2   1 
ATOM   74   N  N     . LYS A 1 11  ? 21.316 0.625   -19.008 1.00 76.16  ? 11  LYS A N     1 
ATOM   75   C  CA    . LYS A 1 11  ? 20.044 0.282   -19.625 1.00 75.33  ? 11  LYS A CA    1 
ATOM   76   C  C     . LYS A 1 11  ? 20.011 0.804   -21.055 1.00 70.89  ? 11  LYS A C     1 
ATOM   77   O  O     . LYS A 1 11  ? 20.854 1.601   -21.474 1.00 61.28  ? 11  LYS A O     1 
ATOM   78   C  CB    . LYS A 1 11  ? 18.866 0.858   -18.829 1.00 78.94  ? 11  LYS A CB    1 
ATOM   79   C  CG    . LYS A 1 11  ? 18.789 0.395   -17.383 1.00 90.78  ? 11  LYS A CG    1 
ATOM   80   C  CD    . LYS A 1 11  ? 17.548 0.941   -16.678 1.00 98.96  ? 11  LYS A CD    1 
ATOM   81   C  CE    . LYS A 1 11  ? 17.754 2.361   -16.153 1.00 89.79  ? 11  LYS A CE    1 
ATOM   82   N  NZ    . LYS A 1 11  ? 17.841 3.395   -17.223 1.00 80.31  ? 11  LYS A NZ    1 
ATOM   83   N  N     . LEU A 1 12  ? 19.023 0.337   -21.809 1.00 74.43  ? 12  LEU A N     1 
ATOM   84   C  CA    . LEU A 1 12  ? 18.777 0.840   -23.150 1.00 73.67  ? 12  LEU A CA    1 
ATOM   85   C  C     . LEU A 1 12  ? 17.808 2.018   -23.098 1.00 75.19  ? 12  LEU A C     1 
ATOM   86   O  O     . LEU A 1 12  ? 17.256 2.359   -22.050 1.00 84.38  ? 12  LEU A O     1 
ATOM   87   C  CB    . LEU A 1 12  ? 18.221 -0.266  -24.047 1.00 83.92  ? 12  LEU A CB    1 
ATOM   88   C  CG    . LEU A 1 12  ? 19.136 -1.453  -24.346 1.00 90.78  ? 12  LEU A CG    1 
ATOM   89   C  CD1   . LEU A 1 12  ? 18.387 -2.512  -25.136 1.00 85.14  ? 12  LEU A CD1   1 
ATOM   90   C  CD2   . LEU A 1 12  ? 20.367 -0.992  -25.105 1.00 98.33  ? 12  LEU A CD2   1 
ATOM   91   N  N     . LYS A 1 13  ? 17.613 2.652   -24.249 1.00 74.69  ? 13  LYS A N     1 
ATOM   92   C  CA    . LYS A 1 13  ? 16.578 3.664   -24.356 1.00 80.82  ? 13  LYS A CA    1 
ATOM   93   C  C     . LYS A 1 13  ? 15.206 2.991   -24.418 1.00 101.83 ? 13  LYS A C     1 
ATOM   94   O  O     . LYS A 1 13  ? 15.069 1.898   -24.975 1.00 101.06 ? 13  LYS A O     1 
ATOM   95   C  CB    . LYS A 1 13  ? 16.800 4.533   -25.590 1.00 80.10  ? 13  LYS A CB    1 
ATOM   96   C  CG    . LYS A 1 13  ? 18.069 5.374   -25.530 1.00 86.07  ? 13  LYS A CG    1 
ATOM   97   C  CD    . LYS A 1 13  ? 18.182 6.307   -26.726 1.00 84.32  ? 13  LYS A CD    1 
ATOM   98   C  CE    . LYS A 1 13  ? 19.388 7.223   -26.595 1.00 83.60  ? 13  LYS A CE    1 
ATOM   99   N  NZ    . LYS A 1 13  ? 19.524 8.143   -27.759 1.00 90.45  ? 13  LYS A NZ    1 
ATOM   100  N  N     . PRO A 1 14  ? 14.180 3.615   -23.838 1.00 113.59 ? 14  PRO A N     1 
ATOM   101  C  CA    . PRO A 1 14  ? 12.867 2.961   -23.763 1.00 113.57 ? 14  PRO A CA    1 
ATOM   102  C  C     . PRO A 1 14  ? 12.301 2.654   -25.141 1.00 112.45 ? 14  PRO A C     1 
ATOM   103  O  O     . PRO A 1 14  ? 12.519 3.387   -26.108 1.00 105.93 ? 14  PRO A O     1 
ATOM   104  C  CB    . PRO A 1 14  ? 12.001 3.986   -23.022 1.00 114.56 ? 14  PRO A CB    1 
ATOM   105  C  CG    . PRO A 1 14  ? 12.974 4.838   -22.273 1.00 116.86 ? 14  PRO A CG    1 
ATOM   106  C  CD    . PRO A 1 14  ? 14.196 4.910   -23.137 1.00 115.01 ? 14  PRO A CD    1 
ATOM   107  N  N     . GLY A 1 15  ? 11.570 1.544   -25.219 1.00 123.65 ? 15  GLY A N     1 
ATOM   108  C  CA    . GLY A 1 15  ? 10.926 1.141   -26.453 1.00 132.30 ? 15  GLY A CA    1 
ATOM   109  C  C     . GLY A 1 15  ? 11.850 0.618   -27.528 1.00 133.31 ? 15  GLY A C     1 
ATOM   110  O  O     . GLY A 1 15  ? 11.429 0.510   -28.683 1.00 135.16 ? 15  GLY A O     1 
ATOM   111  N  N     . MET A 1 16  ? 13.095 0.291   -27.190 1.00 126.48 ? 16  MET A N     1 
ATOM   112  C  CA    . MET A 1 16  ? 14.064 -0.198  -28.157 1.00 112.33 ? 16  MET A CA    1 
ATOM   113  C  C     . MET A 1 16  ? 14.665 -1.505  -27.656 1.00 105.46 ? 16  MET A C     1 
ATOM   114  O  O     . MET A 1 16  ? 14.545 -1.858  -26.480 1.00 101.34 ? 16  MET A O     1 
ATOM   115  C  CB    . MET A 1 16  ? 15.168 0.838   -28.415 1.00 102.18 ? 16  MET A CB    1 
ATOM   116  C  CG    . MET A 1 16  ? 14.644 2.193   -28.872 1.00 98.08  ? 16  MET A CG    1 
ATOM   117  S  SD    . MET A 1 16  ? 15.953 3.379   -29.231 1.00 109.08 ? 16  MET A SD    1 
ATOM   118  C  CE    . MET A 1 16  ? 14.993 4.843   -29.612 1.00 106.84 ? 16  MET A CE    1 
ATOM   119  N  N     . ASP A 1 17  ? 15.317 -2.224  -28.566 1.00 110.10 ? 17  ASP A N     1 
ATOM   120  C  CA    . ASP A 1 17  ? 15.873 -3.537  -28.261 1.00 111.65 ? 17  ASP A CA    1 
ATOM   121  C  C     . ASP A 1 17  ? 17.269 -3.622  -28.873 1.00 109.99 ? 17  ASP A C     1 
ATOM   122  O  O     . ASP A 1 17  ? 17.805 -2.636  -29.387 1.00 109.70 ? 17  ASP A O     1 
ATOM   123  C  CB    . ASP A 1 17  ? 14.933 -4.642  -28.762 1.00 115.22 ? 17  ASP A CB    1 
ATOM   124  C  CG    . ASP A 1 17  ? 15.035 -5.911  -27.941 1.00 121.39 ? 17  ASP A CG    1 
ATOM   125  O  OD1   . ASP A 1 17  ? 14.358 -6.003  -26.895 1.00 123.37 ? 17  ASP A OD1   1 
ATOM   126  O  OD2   . ASP A 1 17  ? 15.790 -6.819  -28.343 1.00 123.53 ? 17  ASP A OD2   1 
ATOM   127  N  N     . GLY A 1 18  ? 17.864 -4.812  -28.820 1.00 116.48 ? 18  GLY A N     1 
ATOM   128  C  CA    . GLY A 1 18  ? 19.222 -5.012  -29.270 1.00 124.02 ? 18  GLY A CA    1 
ATOM   129  C  C     . GLY A 1 18  ? 19.386 -4.908  -30.774 1.00 131.51 ? 18  GLY A C     1 
ATOM   130  O  O     . GLY A 1 18  ? 18.416 -4.962  -31.536 1.00 135.71 ? 18  GLY A O     1 
ATOM   131  N  N     . PRO A 1 19  ? 20.627 -4.752  -31.228 1.00 131.72 ? 19  PRO A N     1 
ATOM   132  C  CA    . PRO A 1 19  ? 20.886 -4.651  -32.667 1.00 129.30 ? 19  PRO A CA    1 
ATOM   133  C  C     . PRO A 1 19  ? 20.956 -6.017  -33.331 1.00 123.66 ? 19  PRO A C     1 
ATOM   134  O  O     . PRO A 1 19  ? 21.347 -7.016  -32.724 1.00 119.97 ? 19  PRO A O     1 
ATOM   135  C  CB    . PRO A 1 19  ? 22.243 -3.942  -32.726 1.00 126.17 ? 19  PRO A CB    1 
ATOM   136  C  CG    . PRO A 1 19  ? 22.932 -4.396  -31.481 1.00 123.99 ? 19  PRO A CG    1 
ATOM   137  C  CD    . PRO A 1 19  ? 21.854 -4.563  -30.432 1.00 125.73 ? 19  PRO A CD    1 
ATOM   138  N  N     . LYS A 1 20  ? 20.559 -6.047  -34.618 1.00 117.32 ? 20  LYS A N     1 
ATOM   139  C  CA    . LYS A 1 20  ? 20.512 -7.284  -35.408 1.00 118.65 ? 20  LYS A CA    1 
ATOM   140  C  C     . LYS A 1 20  ? 21.090 -6.981  -36.794 1.00 125.70 ? 20  LYS A C     1 
ATOM   141  O  O     . LYS A 1 20  ? 20.361 -6.737  -37.759 1.00 125.86 ? 20  LYS A O     1 
ATOM   142  C  CB    . LYS A 1 20  ? 19.088 -7.839  -35.492 1.00 108.70 ? 20  LYS A CB    1 
ATOM   143  C  CG    . LYS A 1 20  ? 18.292 -7.676  -34.203 1.00 100.27 ? 20  LYS A CG    1 
ATOM   144  C  CD    . LYS A 1 20  ? 17.071 -8.570  -34.144 1.00 97.63  ? 20  LYS A CD    1 
ATOM   145  C  CE    . LYS A 1 20  ? 16.336 -8.370  -32.825 1.00 91.60  ? 20  LYS A CE    1 
ATOM   146  N  NZ    . LYS A 1 20  ? 15.248 -9.362  -32.616 1.00 93.03  ? 20  LYS A NZ    1 
ATOM   147  N  N     . VAL A 1 21  ? 22.419 -6.999  -36.890 1.00 133.79 ? 21  VAL A N     1 
ATOM   148  C  CA    . VAL A 1 21  ? 23.134 -6.730  -38.132 1.00 136.05 ? 21  VAL A CA    1 
ATOM   149  C  C     . VAL A 1 21  ? 24.089 -7.884  -38.403 1.00 137.38 ? 21  VAL A C     1 
ATOM   150  O  O     . VAL A 1 21  ? 24.751 -8.381  -37.485 0.10 135.65 ? 21  VAL A O     1 
ATOM   151  C  CB    . VAL A 1 21  ? 23.901 -5.391  -38.072 0.10 132.94 ? 21  VAL A CB    1 
ATOM   152  C  CG1   . VAL A 1 21  ? 24.602 -5.113  -39.394 0.00 133.80 ? 21  VAL A CG1   1 
ATOM   153  C  CG2   . VAL A 1 21  ? 22.960 -4.250  -37.714 0.00 131.51 ? 21  VAL A CG2   1 
ATOM   154  N  N     . LYS A 1 22  ? 24.161 -8.310  -39.663 1.00 138.94 ? 22  LYS A N     1 
ATOM   155  C  CA    . LYS A 1 22  ? 25.021 -9.418  -40.048 1.00 136.91 ? 22  LYS A CA    1 
ATOM   156  C  C     . LYS A 1 22  ? 26.454 -8.934  -40.272 1.00 131.99 ? 22  LYS A C     1 
ATOM   157  O  O     . LYS A 1 22  ? 26.762 -7.742  -40.193 0.10 129.25 ? 22  LYS A O     1 
ATOM   158  C  CB    . LYS A 1 22  ? 24.471 -10.109 -41.295 1.00 138.36 ? 22  LYS A CB    1 
ATOM   159  C  CG    . LYS A 1 22  ? 23.172 -10.865 -41.060 0.10 139.66 ? 22  LYS A CG    1 
ATOM   160  C  CD    . LYS A 1 22  ? 23.364 -11.985 -40.049 1.00 137.89 ? 22  LYS A CD    1 
ATOM   161  C  CE    . LYS A 1 22  ? 22.059 -12.715 -39.774 1.00 140.57 ? 22  LYS A CE    1 
ATOM   162  N  NZ    . LYS A 1 22  ? 21.025 -11.812 -39.194 1.00 139.87 ? 22  LYS A NZ    1 
ATOM   163  N  N     . GLN A 1 23  ? 27.342 -9.882  -40.561 1.00 132.14 ? 23  GLN A N     1 
ATOM   164  C  CA    . GLN A 1 23  ? 28.767 -9.619  -40.708 1.00 127.97 ? 23  GLN A CA    1 
ATOM   165  C  C     . GLN A 1 23  ? 29.137 -9.502  -42.182 1.00 127.77 ? 23  GLN A C     1 
ATOM   166  O  O     . GLN A 1 23  ? 28.570 -10.194 -43.034 1.00 137.02 ? 23  GLN A O     1 
ATOM   167  C  CB    . GLN A 1 23  ? 29.585 -10.732 -40.047 1.00 126.99 ? 23  GLN A CB    1 
ATOM   168  C  CG    . GLN A 1 23  ? 31.093 -10.543 -40.115 1.00 125.30 ? 23  GLN A CG    1 
ATOM   169  C  CD    . GLN A 1 23  ? 31.569 -9.349  -39.314 0.00 122.00 ? 23  GLN A CD    1 
ATOM   170  O  OE1   . GLN A 1 23  ? 31.584 -9.379  -38.084 0.99 120.69 ? 23  GLN A OE1   1 
ATOM   171  N  NE2   . GLN A 1 23  ? 31.960 -8.288  -40.009 0.95 119.78 ? 23  GLN A NE2   1 
ATOM   172  N  N     . TRP A 1 24  ? 30.091 -8.618  -42.478 0.10 110.03 ? 24  TRP A N     1 
ATOM   173  C  CA    . TRP A 1 24  ? 30.625 -8.438  -43.819 0.10 101.32 ? 24  TRP A CA    1 
ATOM   174  C  C     . TRP A 1 24  ? 31.904 -9.246  -43.997 0.00 96.69  ? 24  TRP A C     1 
ATOM   175  O  O     . TRP A 1 24  ? 32.555 -9.622  -43.018 0.10 89.31  ? 24  TRP A O     1 
ATOM   176  C  CB    . TRP A 1 24  ? 30.897 -6.951  -44.091 0.00 93.78  ? 24  TRP A CB    1 
ATOM   177  C  CG    . TRP A 1 24  ? 31.779 -6.280  -43.079 0.00 84.31  ? 24  TRP A CG    1 
ATOM   178  C  CD1   . TRP A 1 24  ? 33.100 -6.531  -42.844 0.00 82.48  ? 24  TRP A CD1   1 
ATOM   179  C  CD2   . TRP A 1 24  ? 31.406 -5.228  -42.182 0.00 80.21  ? 24  TRP A CD2   1 
ATOM   180  N  NE1   . TRP A 1 24  ? 33.568 -5.711  -41.847 0.00 78.94  ? 24  TRP A NE1   1 
ATOM   181  C  CE2   . TRP A 1 24  ? 32.548 -4.900  -41.425 0.00 77.51  ? 24  TRP A CE2   1 
ATOM   182  C  CE3   . TRP A 1 24  ? 30.215 -4.535  -41.941 0.00 79.45  ? 24  TRP A CE3   1 
ATOM   183  C  CZ2   . TRP A 1 24  ? 32.535 -3.910  -40.445 0.00 74.26  ? 24  TRP A CZ2   1 
ATOM   184  C  CZ3   . TRP A 1 24  ? 30.205 -3.552  -40.968 0.00 76.18  ? 24  TRP A CZ3   1 
ATOM   185  C  CH2   . TRP A 1 24  ? 31.357 -3.249  -40.232 0.00 73.65  ? 24  TRP A CH2   1 
ATOM   186  N  N     . PRO A 1 25  ? 32.292 -9.545  -45.240 0.10 92.81  ? 25  PRO A N     1 
ATOM   187  C  CA    . PRO A 1 25  ? 33.520 -10.321 -45.454 0.10 119.27 ? 25  PRO A CA    1 
ATOM   188  C  C     . PRO A 1 25  ? 34.759 -9.560  -45.000 0.10 122.33 ? 25  PRO A C     1 
ATOM   189  O  O     . PRO A 1 25  ? 34.785 -8.327  -44.970 0.10 123.08 ? 25  PRO A O     1 
ATOM   190  C  CB    . PRO A 1 25  ? 33.533 -10.559 -46.969 0.00 107.57 ? 25  PRO A CB    1 
ATOM   191  C  CG    . PRO A 1 25  ? 32.654 -9.488  -47.532 0.00 99.26  ? 25  PRO A CG    1 
ATOM   192  C  CD    . PRO A 1 25  ? 31.584 -9.284  -46.505 0.00 95.81  ? 25  PRO A CD    1 
ATOM   193  N  N     . LEU A 1 26  ? 35.794 -10.319 -44.643 1.00 133.18 ? 26  LEU A N     1 
ATOM   194  C  CA    . LEU A 1 26  ? 37.044 -9.760  -44.151 1.00 139.69 ? 26  LEU A CA    1 
ATOM   195  C  C     . LEU A 1 26  ? 38.214 -10.520 -44.760 1.00 148.73 ? 26  LEU A C     1 
ATOM   196  O  O     . LEU A 1 26  ? 38.071 -11.651 -45.231 1.00 149.85 ? 26  LEU A O     1 
ATOM   197  C  CB    . LEU A 1 26  ? 37.125 -9.814  -42.618 0.00 135.70 ? 26  LEU A CB    1 
ATOM   198  C  CG    . LEU A 1 26  ? 36.151 -8.932  -41.836 0.00 132.20 ? 26  LEU A CG    1 
ATOM   199  C  CD1   . LEU A 1 26  ? 36.252 -9.215  -40.346 0.00 129.32 ? 26  LEU A CD1   1 
ATOM   200  C  CD2   . LEU A 1 26  ? 36.422 -7.465  -42.123 0.00 130.25 ? 26  LEU A CD2   1 
ATOM   201  N  N     . THR A 1 27  ? 39.381 -9.881  -44.740 1.00 152.11 ? 27  THR A N     1 
ATOM   202  C  CA    . THR A 1 27  ? 40.590 -10.501 -45.261 1.00 155.68 ? 27  THR A CA    1 
ATOM   203  C  C     . THR A 1 27  ? 41.042 -11.637 -44.347 1.00 154.04 ? 27  THR A C     1 
ATOM   204  O  O     . THR A 1 27  ? 40.800 -11.624 -43.137 1.00 159.60 ? 27  THR A O     1 
ATOM   205  C  CB    . THR A 1 27  ? 41.703 -9.459  -45.400 0.69 158.34 ? 27  THR A CB    1 
ATOM   206  O  OG1   . THR A 1 27  ? 41.172 -8.274  -46.008 1.00 156.59 ? 27  THR A OG1   1 
ATOM   207  C  CG2   . THR A 1 27  ? 42.840 -9.987  -46.267 0.49 163.22 ? 27  THR A CG2   1 
ATOM   208  N  N     . GLU A 1 28  ? 41.700 -12.635 -44.946 0.52 145.48 ? 28  GLU A N     1 
ATOM   209  C  CA    . GLU A 1 28  ? 42.176 -13.785 -44.181 0.93 134.73 ? 28  GLU A CA    1 
ATOM   210  C  C     . GLU A 1 28  ? 43.132 -13.371 -43.069 1.00 137.42 ? 28  GLU A C     1 
ATOM   211  O  O     . GLU A 1 28  ? 43.160 -14.006 -42.008 0.60 135.39 ? 28  GLU A O     1 
ATOM   212  C  CB    . GLU A 1 28  ? 42.848 -14.792 -45.117 0.50 133.74 ? 28  GLU A CB    1 
ATOM   213  C  CG    . GLU A 1 28  ? 43.434 -16.014 -44.420 0.50 127.07 ? 28  GLU A CG    1 
ATOM   214  C  CD    . GLU A 1 28  ? 42.377 -16.880 -43.760 1.00 119.87 ? 28  GLU A CD    1 
ATOM   215  O  OE1   . GLU A 1 28  ? 41.224 -16.888 -44.240 1.00 120.22 ? 28  GLU A OE1   1 
ATOM   216  O  OE2   . GLU A 1 28  ? 42.701 -17.552 -42.758 1.00 116.48 ? 28  GLU A OE2   1 
ATOM   217  N  N     . GLU A 1 29  ? 43.915 -12.310 -43.284 1.00 143.48 ? 29  GLU A N     1 
ATOM   218  C  CA    . GLU A 1 29  ? 44.808 -11.834 -42.233 0.50 142.67 ? 29  GLU A CA    1 
ATOM   219  C  C     . GLU A 1 29  ? 44.029 -11.304 -41.035 0.50 137.22 ? 29  GLU A C     1 
ATOM   220  O  O     . GLU A 1 29  ? 44.475 -11.457 -39.892 0.83 136.62 ? 29  GLU A O     1 
ATOM   221  C  CB    . GLU A 1 29  ? 45.744 -10.755 -42.782 0.70 145.43 ? 29  GLU A CB    1 
ATOM   222  C  CG    . GLU A 1 29  ? 46.794 -10.279 -41.788 1.00 143.91 ? 29  GLU A CG    1 
ATOM   223  C  CD    . GLU A 1 29  ? 47.746 -9.258  -42.382 1.00 141.32 ? 29  GLU A CD    1 
ATOM   224  O  OE1   . GLU A 1 29  ? 47.668 -9.009  -43.604 1.00 141.52 ? 29  GLU A OE1   1 
ATOM   225  O  OE2   . GLU A 1 29  ? 48.571 -8.704  -41.626 1.00 137.46 ? 29  GLU A OE2   1 
ATOM   226  N  N     . LYS A 1 30  ? 42.868 -10.687 -41.271 1.00 130.73 ? 30  LYS A N     1 
ATOM   227  C  CA    . LYS A 1 30  ? 42.042 -10.214 -40.166 1.00 124.77 ? 30  LYS A CA    1 
ATOM   228  C  C     . LYS A 1 30  ? 41.293 -11.352 -39.486 0.50 123.35 ? 30  LYS A C     1 
ATOM   229  O  O     . LYS A 1 30  ? 41.055 -11.292 -38.274 0.82 116.70 ? 30  LYS A O     1 
ATOM   230  C  CB    . LYS A 1 30  ? 41.049 -9.159  -40.656 0.75 122.14 ? 30  LYS A CB    1 
ATOM   231  C  CG    . LYS A 1 30  ? 41.686 -7.859  -41.121 0.75 116.61 ? 30  LYS A CG    1 
ATOM   232  C  CD    . LYS A 1 30  ? 40.627 -6.796  -41.374 1.00 113.42 ? 30  LYS A CD    1 
ATOM   233  C  CE    . LYS A 1 30  ? 41.237 -5.515  -41.920 1.00 113.36 ? 30  LYS A CE    1 
ATOM   234  N  NZ    . LYS A 1 30  ? 41.853 -5.724  -43.259 1.00 116.33 ? 30  LYS A NZ    1 
ATOM   235  N  N     . ILE A 1 31  ? 40.912 -12.386 -40.240 1.00 125.72 ? 31  ILE A N     1 
ATOM   236  C  CA    . ILE A 1 31  ? 40.212 -13.519 -39.644 1.00 124.13 ? 31  ILE A CA    1 
ATOM   237  C  C     . ILE A 1 31  ? 41.144 -14.297 -38.724 1.00 130.79 ? 31  ILE A C     1 
ATOM   238  O  O     . ILE A 1 31  ? 40.733 -14.771 -37.657 1.00 131.76 ? 31  ILE A O     1 
ATOM   239  C  CB    . ILE A 1 31  ? 39.618 -14.417 -40.745 1.00 123.17 ? 31  ILE A CB    1 
ATOM   240  C  CG1   . ILE A 1 31  ? 38.667 -13.611 -41.631 1.00 123.52 ? 31  ILE A CG1   1 
ATOM   241  C  CG2   . ILE A 1 31  ? 38.894 -15.607 -40.134 1.00 121.17 ? 31  ILE A CG2   1 
ATOM   242  C  CD1   . ILE A 1 31  ? 38.037 -14.417 -42.746 1.00 129.25 ? 31  ILE A CD1   1 
ATOM   243  N  N     . LYS A 1 32  ? 42.414 -14.437 -39.115 1.00 136.11 ? 32  LYS A N     1 
ATOM   244  C  CA    . LYS A 1 32  ? 43.380 -15.113 -38.256 1.00 133.70 ? 32  LYS A CA    1 
ATOM   245  C  C     . LYS A 1 32  ? 43.619 -14.329 -36.972 1.00 123.82 ? 32  LYS A C     1 
ATOM   246  O  O     . LYS A 1 32  ? 43.763 -14.917 -35.893 1.00 122.11 ? 32  LYS A O     1 
ATOM   247  C  CB    . LYS A 1 32  ? 44.695 -15.327 -39.008 1.00 140.92 ? 32  LYS A CB    1 
ATOM   248  C  CG    . LYS A 1 32  ? 45.869 -15.669 -38.104 1.00 142.12 ? 32  LYS A CG    1 
ATOM   249  C  CD    . LYS A 1 32  ? 47.039 -16.245 -38.881 1.00 142.09 ? 32  LYS A CD    1 
ATOM   250  C  CE    . LYS A 1 32  ? 48.208 -16.533 -37.954 1.00 137.83 ? 32  LYS A CE    1 
ATOM   251  N  NZ    . LYS A 1 32  ? 47.775 -17.279 -36.739 1.00 135.07 ? 32  LYS A NZ    1 
ATOM   252  N  N     . ALA A 1 33  ? 43.655 -12.998 -37.066 0.50 115.78 ? 33  ALA A N     1 
ATOM   253  C  CA    . ALA A 1 33  ? 43.883 -12.182 -35.880 0.50 107.96 ? 33  ALA A CA    1 
ATOM   254  C  C     . ALA A 1 33  ? 42.707 -12.246 -34.915 0.50 105.84 ? 33  ALA A C     1 
ATOM   255  O  O     . ALA A 1 33  ? 42.901 -12.144 -33.699 0.85 99.82  ? 33  ALA A O     1 
ATOM   256  C  CB    . ALA A 1 33  ? 44.160 -10.734 -36.283 0.50 100.49 ? 33  ALA A CB    1 
ATOM   257  N  N     . LEU A 1 34  ? 41.487 -12.417 -35.428 1.00 113.22 ? 34  LEU A N     1 
ATOM   258  C  CA    . LEU A 1 34  ? 40.322 -12.463 -34.552 1.00 118.05 ? 34  LEU A CA    1 
ATOM   259  C  C     . LEU A 1 34  ? 40.196 -13.809 -33.846 1.00 125.38 ? 34  LEU A C     1 
ATOM   260  O  O     . LEU A 1 34  ? 39.899 -13.854 -32.647 1.00 128.94 ? 34  LEU A O     1 
ATOM   261  C  CB    . LEU A 1 34  ? 39.051 -12.154 -35.344 1.00 119.55 ? 34  LEU A CB    1 
ATOM   262  C  CG    . LEU A 1 34  ? 38.889 -10.713 -35.837 1.00 112.35 ? 34  LEU A CG    1 
ATOM   263  C  CD1   . LEU A 1 34  ? 37.551 -10.532 -36.537 1.00 112.60 ? 34  LEU A CD1   1 
ATOM   264  C  CD2   . LEU A 1 34  ? 39.031 -9.729  -34.684 1.00 104.56 ? 34  LEU A CD2   1 
ATOM   265  N  N     . VAL A 1 35  ? 40.417 -14.914 -34.566 1.00 127.84 ? 35  VAL A N     1 
ATOM   266  C  CA    . VAL A 1 35  ? 40.297 -16.226 -33.938 1.00 131.78 ? 35  VAL A CA    1 
ATOM   267  C  C     . VAL A 1 35  ? 41.411 -16.443 -32.921 1.00 131.36 ? 35  VAL A C     1 
ATOM   268  O  O     . VAL A 1 35  ? 41.235 -17.188 -31.950 1.00 131.34 ? 35  VAL A O     1 
ATOM   269  C  CB    . VAL A 1 35  ? 40.277 -17.342 -35.000 1.00 136.70 ? 35  VAL A CB    1 
ATOM   270  C  CG1   . VAL A 1 35  ? 39.081 -17.174 -35.926 1.00 137.25 ? 35  VAL A CG1   1 
ATOM   271  C  CG2   . VAL A 1 35  ? 41.577 -17.361 -35.791 1.00 139.50 ? 35  VAL A CG2   1 
ATOM   272  N  N     . GLU A 1 36  ? 42.568 -15.804 -33.116 1.00 129.91 ? 36  GLU A N     1 
ATOM   273  C  CA    . GLU A 1 36  ? 43.627 -15.868 -32.116 1.00 126.97 ? 36  GLU A CA    1 
ATOM   274  C  C     . GLU A 1 36  ? 43.264 -15.090 -30.858 0.30 116.43 ? 36  GLU A C     1 
ATOM   275  O  O     . GLU A 1 36  ? 43.771 -15.406 -29.776 1.00 110.87 ? 36  GLU A O     1 
ATOM   276  C  CB    . GLU A 1 36  ? 44.939 -15.339 -32.705 1.00 133.36 ? 36  GLU A CB    1 
ATOM   277  C  CG    . GLU A 1 36  ? 46.150 -15.501 -31.795 1.00 133.90 ? 36  GLU A CG    1 
ATOM   278  C  CD    . GLU A 1 36  ? 47.397 -14.848 -32.361 0.10 136.23 ? 36  GLU A CD    1 
ATOM   279  O  OE1   . GLU A 1 36  ? 47.334 -14.330 -33.495 0.83 142.21 ? 36  GLU A OE1   1 
ATOM   280  O  OE2   . GLU A 1 36  ? 48.438 -14.851 -31.669 0.69 132.23 ? 36  GLU A OE2   1 
ATOM   281  N  N     . ILE A 1 37  ? 42.395 -14.090 -30.975 0.14 111.19 ? 37  ILE A N     1 
ATOM   282  C  CA    . ILE A 1 37  ? 41.976 -13.297 -29.825 1.00 104.21 ? 37  ILE A CA    1 
ATOM   283  C  C     . ILE A 1 37  ? 40.722 -13.873 -29.177 1.00 101.59 ? 37  ILE A C     1 
ATOM   284  O  O     . ILE A 1 37  ? 40.628 -13.940 -27.950 1.00 96.36  ? 37  ILE A O     1 
ATOM   285  C  CB    . ILE A 1 37  ? 41.769 -11.830 -30.257 1.00 105.44 ? 37  ILE A CB    1 
ATOM   286  C  CG1   . ILE A 1 37  ? 43.094 -11.215 -30.711 1.00 106.65 ? 37  ILE A CG1   1 
ATOM   287  C  CG2   . ILE A 1 37  ? 41.168 -11.009 -29.126 1.00 109.13 ? 37  ILE A CG2   1 
ATOM   288  C  CD1   . ILE A 1 37  ? 42.967 -9.793  -31.214 1.00 101.57 ? 37  ILE A CD1   1 
ATOM   289  N  N     . CYS A 1 38  ? 39.751 -14.309 -29.985 1.00 105.52 ? 38  CYS A N     1 
ATOM   290  C  CA    . CYS A 1 38  ? 38.481 -14.776 -29.435 1.00 103.37 ? 38  CYS A CA    1 
ATOM   291  C  C     . CYS A 1 38  ? 38.646 -16.078 -28.658 1.00 99.84  ? 38  CYS A C     1 
ATOM   292  O  O     . CYS A 1 38  ? 37.972 -16.287 -27.642 1.00 103.52 ? 38  CYS A O     1 
ATOM   293  C  CB    . CYS A 1 38  ? 37.455 -14.945 -30.554 1.00 108.09 ? 38  CYS A CB    1 
ATOM   294  S  SG    . CYS A 1 38  ? 36.904 -13.393 -31.299 1.00 109.94 ? 38  CYS A SG    1 
ATOM   295  N  N     . THR A 1 39  ? 39.528 -16.968 -29.117 1.00 91.46  ? 39  THR A N     1 
ATOM   296  C  CA    . THR A 1 39  ? 39.726 -18.224 -28.400 1.00 96.13  ? 39  THR A CA    1 
ATOM   297  C  C     . THR A 1 39  ? 40.422 -17.992 -27.064 1.00 88.89  ? 39  THR A C     1 
ATOM   298  O  O     . THR A 1 39  ? 40.107 -18.659 -26.071 1.00 85.39  ? 39  THR A O     1 
ATOM   299  C  CB    . THR A 1 39  ? 40.521 -19.211 -29.256 1.00 104.94 ? 39  THR A CB    1 
ATOM   300  O  OG1   . THR A 1 39  ? 41.736 -18.597 -29.704 1.00 116.08 ? 39  THR A OG1   1 
ATOM   301  C  CG2   . THR A 1 39  ? 39.701 -19.654 -30.461 1.00 102.43 ? 39  THR A CG2   1 
ATOM   302  N  N     . GLU A 1 40  ? 41.361 -17.046 -27.013 1.00 91.90  ? 40  GLU A N     1 
ATOM   303  C  CA    . GLU A 1 40  ? 42.048 -16.768 -25.757 1.00 99.59  ? 40  GLU A CA    1 
ATOM   304  C  C     . GLU A 1 40  ? 41.172 -15.955 -24.809 1.00 98.34  ? 40  GLU A C     1 
ATOM   305  O  O     . GLU A 1 40  ? 41.206 -16.171 -23.593 1.00 94.59  ? 40  GLU A O     1 
ATOM   306  C  CB    . GLU A 1 40  ? 43.371 -16.047 -26.027 1.00 106.48 ? 40  GLU A CB    1 
ATOM   307  C  CG    . GLU A 1 40  ? 44.327 -16.020 -24.837 1.00 109.93 ? 40  GLU A CG    1 
ATOM   308  C  CD    . GLU A 1 40  ? 44.875 -17.395 -24.483 1.00 113.74 ? 40  GLU A CD    1 
ATOM   309  O  OE1   . GLU A 1 40  ? 44.840 -18.299 -25.347 1.00 106.07 ? 40  GLU A OE1   1 
ATOM   310  O  OE2   . GLU A 1 40  ? 45.345 -17.571 -23.338 1.00 115.39 ? 40  GLU A OE2   1 
ATOM   311  N  N     . MET A 1 41  ? 40.377 -15.023 -25.345 1.00 100.51 ? 41  MET A N     1 
ATOM   312  C  CA    . MET A 1 41  ? 39.458 -14.264 -24.499 1.00 94.43  ? 41  MET A CA    1 
ATOM   313  C  C     . MET A 1 41  ? 38.388 -15.165 -23.896 1.00 90.55  ? 41  MET A C     1 
ATOM   314  O  O     . MET A 1 41  ? 37.968 -14.957 -22.751 1.00 84.30  ? 41  MET A O     1 
ATOM   315  C  CB    . MET A 1 41  ? 38.804 -13.135 -25.297 1.00 97.59  ? 41  MET A CB    1 
ATOM   316  C  CG    . MET A 1 41  ? 39.722 -11.977 -25.641 1.00 108.89 ? 41  MET A CG    1 
ATOM   317  S  SD    . MET A 1 41  ? 38.838 -10.623 -26.446 1.00 115.28 ? 41  MET A SD    1 
ATOM   318  C  CE    . MET A 1 41  ? 37.821 -10.027 -25.098 1.00 107.70 ? 41  MET A CE    1 
ATOM   319  N  N     . GLU A 1 42  ? 37.931 -16.167 -24.653 1.00 95.40  ? 42  GLU A N     1 
ATOM   320  C  CA    . GLU A 1 42  ? 36.876 -17.047 -24.161 1.00 88.27  ? 42  GLU A CA    1 
ATOM   321  C  C     . GLU A 1 42  ? 37.339 -17.857 -22.957 1.00 81.10  ? 42  GLU A C     1 
ATOM   322  O  O     . GLU A 1 42  ? 36.535 -18.158 -22.066 1.00 77.22  ? 42  GLU A O     1 
ATOM   323  C  CB    . GLU A 1 42  ? 36.401 -17.972 -25.285 1.00 84.31  ? 42  GLU A CB    1 
ATOM   324  C  CG    . GLU A 1 42  ? 35.079 -18.680 -25.013 1.00 89.83  ? 42  GLU A CG    1 
ATOM   325  C  CD    . GLU A 1 42  ? 35.238 -19.929 -24.166 1.00 91.51  ? 42  GLU A CD    1 
ATOM   326  O  OE1   . GLU A 1 42  ? 36.345 -20.508 -24.159 1.00 90.55  ? 42  GLU A OE1   1 
ATOM   327  O  OE2   . GLU A 1 42  ? 34.257 -20.327 -23.502 1.00 90.81  ? 42  GLU A OE2   1 
ATOM   328  N  N     . LYS A 1 43  ? 38.623 -18.214 -22.907 1.00 85.91  ? 43  LYS A N     1 
ATOM   329  C  CA    . LYS A 1 43  ? 39.141 -18.952 -21.761 1.00 94.38  ? 43  LYS A CA    1 
ATOM   330  C  C     . LYS A 1 43  ? 39.307 -18.057 -20.538 1.00 90.49  ? 43  LYS A C     1 
ATOM   331  O  O     . LYS A 1 43  ? 39.197 -18.537 -19.404 1.00 92.63  ? 43  LYS A O     1 
ATOM   332  C  CB    . LYS A 1 43  ? 40.472 -19.615 -22.120 1.00 104.37 ? 43  LYS A CB    1 
ATOM   333  C  CG    . LYS A 1 43  ? 41.033 -20.524 -21.034 1.00 107.57 ? 43  LYS A CG    1 
ATOM   334  C  CD    . LYS A 1 43  ? 40.044 -21.617 -20.657 1.00 110.11 ? 43  LYS A CD    1 
ATOM   335  C  CE    . LYS A 1 43  ? 40.603 -22.509 -19.559 1.00 108.06 ? 43  LYS A CE    1 
ATOM   336  N  NZ    . LYS A 1 43  ? 39.654 -23.591 -19.180 1.00 101.57 ? 43  LYS A NZ    1 
ATOM   337  N  N     . GLU A 1 44  ? 39.563 -16.765 -20.743 1.00 88.13  ? 44  GLU A N     1 
ATOM   338  C  CA    . GLU A 1 44  ? 39.687 -15.812 -19.647 1.00 81.09  ? 44  GLU A CA    1 
ATOM   339  C  C     . GLU A 1 44  ? 38.341 -15.302 -19.149 1.00 78.13  ? 44  GLU A C     1 
ATOM   340  O  O     . GLU A 1 44  ? 38.311 -14.372 -18.336 1.00 80.91  ? 44  GLU A O     1 
ATOM   341  C  CB    . GLU A 1 44  ? 40.552 -14.622 -20.071 1.00 76.54  ? 44  GLU A CB    1 
ATOM   342  C  CG    . GLU A 1 44  ? 41.912 -14.992 -20.629 1.00 75.20  ? 44  GLU A CG    1 
ATOM   343  C  CD    . GLU A 1 44  ? 42.724 -13.775 -21.025 1.00 79.19  ? 44  GLU A CD    1 
ATOM   344  O  OE1   . GLU A 1 44  ? 43.033 -12.949 -20.139 1.00 81.15  ? 44  GLU A OE1   1 
ATOM   345  O  OE2   . GLU A 1 44  ? 43.046 -13.638 -22.224 1.00 79.84  ? 44  GLU A OE2   1 
ATOM   346  N  N     . GLY A 1 45  ? 37.235 -15.875 -19.620 1.00 69.04  ? 45  GLY A N     1 
ATOM   347  C  CA    . GLY A 1 45  ? 35.924 -15.399 -19.227 1.00 69.78  ? 45  GLY A CA    1 
ATOM   348  C  C     . GLY A 1 45  ? 35.581 -14.005 -19.697 1.00 70.85  ? 45  GLY A C     1 
ATOM   349  O  O     . GLY A 1 45  ? 34.585 -13.439 -19.235 1.00 72.48  ? 45  GLY A O     1 
ATOM   350  N  N     . LYS A 1 46  ? 36.378 -13.428 -20.599 1.00 63.43  ? 46  LYS A N     1 
ATOM   351  C  CA    . LYS A 1 46  ? 36.094 -12.089 -21.100 1.00 60.96  ? 46  LYS A CA    1 
ATOM   352  C  C     . LYS A 1 46  ? 34.968 -12.094 -22.125 1.00 63.94  ? 46  LYS A C     1 
ATOM   353  O  O     . LYS A 1 46  ? 34.209 -11.124 -22.209 1.00 65.29  ? 46  LYS A O     1 
ATOM   354  C  CB    . LYS A 1 46  ? 37.359 -11.475 -21.700 1.00 61.06  ? 46  LYS A CB    1 
ATOM   355  C  CG    . LYS A 1 46  ? 38.491 -11.324 -20.699 1.00 65.33  ? 46  LYS A CG    1 
ATOM   356  C  CD    . LYS A 1 46  ? 39.752 -10.786 -21.352 1.00 70.77  ? 46  LYS A CD    1 
ATOM   357  C  CE    . LYS A 1 46  ? 40.862 -10.619 -20.327 1.00 74.19  ? 46  LYS A CE    1 
ATOM   358  N  NZ    . LYS A 1 46  ? 42.146 -10.198 -20.955 1.00 81.25  ? 46  LYS A NZ    1 
ATOM   359  N  N     . ILE A 1 47  ? 34.847 -13.162 -22.908 1.00 73.42  ? 47  ILE A N     1 
ATOM   360  C  CA    . ILE A 1 47  ? 33.721 -13.353 -23.812 1.00 75.84  ? 47  ILE A CA    1 
ATOM   361  C  C     . ILE A 1 47  ? 33.162 -14.750 -23.590 1.00 72.65  ? 47  ILE A C     1 
ATOM   362  O  O     . ILE A 1 47  ? 33.917 -15.718 -23.442 1.00 65.30  ? 47  ILE A O     1 
ATOM   363  C  CB    . ILE A 1 47  ? 34.114 -13.145 -25.291 1.00 80.47  ? 47  ILE A CB    1 
ATOM   364  C  CG1   . ILE A 1 47  ? 35.290 -14.044 -25.680 1.00 85.50  ? 47  ILE A CG1   1 
ATOM   365  C  CG2   . ILE A 1 47  ? 34.443 -11.682 -25.555 1.00 67.92  ? 47  ILE A CG2   1 
ATOM   366  C  CD1   . ILE A 1 47  ? 35.687 -13.926 -27.136 1.00 84.00  ? 47  ILE A CD1   1 
ATOM   367  N  N     . SER A 1 48  ? 31.838 -14.851 -23.550 1.00 71.32  ? 48  SER A N     1 
ATOM   368  C  CA    . SER A 1 48  ? 31.150 -16.116 -23.344 1.00 70.90  ? 48  SER A CA    1 
ATOM   369  C  C     . SER A 1 48  ? 30.423 -16.521 -24.617 1.00 79.11  ? 48  SER A C     1 
ATOM   370  O  O     . SER A 1 48  ? 29.824 -15.681 -25.296 1.00 71.21  ? 48  SER A O     1 
ATOM   371  C  CB    . SER A 1 48  ? 30.159 -16.022 -22.182 1.00 68.19  ? 48  SER A CB    1 
ATOM   372  O  OG    . SER A 1 48  ? 30.833 -15.810 -20.954 1.00 67.74  ? 48  SER A OG    1 
ATOM   373  N  N     . LYS A 1 49  ? 30.484 -17.810 -24.936 1.00 86.52  ? 49  LYS A N     1 
ATOM   374  C  CA    . LYS A 1 49  ? 29.790 -18.326 -26.105 1.00 87.63  ? 49  LYS A CA    1 
ATOM   375  C  C     . LYS A 1 49  ? 28.283 -18.319 -25.876 1.00 85.93  ? 49  LYS A C     1 
ATOM   376  O  O     . LYS A 1 49  ? 27.800 -18.494 -24.754 1.00 84.97  ? 49  LYS A O     1 
ATOM   377  C  CB    . LYS A 1 49  ? 30.271 -19.741 -26.427 1.00 94.12  ? 49  LYS A CB    1 
ATOM   378  C  CG    . LYS A 1 49  ? 31.750 -19.823 -26.770 1.00 97.43  ? 49  LYS A CG    1 
ATOM   379  C  CD    . LYS A 1 49  ? 32.224 -21.265 -26.873 1.00 105.74 ? 49  LYS A CD    1 
ATOM   380  C  CE    . LYS A 1 49  ? 32.154 -21.966 -25.527 1.00 107.98 ? 49  LYS A CE    1 
ATOM   381  N  NZ    . LYS A 1 49  ? 32.723 -23.341 -25.586 1.00 108.90 ? 49  LYS A NZ    1 
ATOM   382  N  N     . ILE A 1 50  ? 27.538 -18.103 -26.959 1.00 89.72  ? 50  ILE A N     1 
ATOM   383  C  CA    . ILE A 1 50  ? 26.081 -18.065 -26.901 1.00 102.84 ? 50  ILE A CA    1 
ATOM   384  C  C     . ILE A 1 50  ? 25.513 -19.113 -27.848 1.00 113.36 ? 50  ILE A C     1 
ATOM   385  O  O     . ILE A 1 50  ? 26.245 -19.971 -28.354 1.00 108.38 ? 50  ILE A O     1 
ATOM   386  C  CB    . ILE A 1 50  ? 25.545 -16.663 -27.244 1.00 101.10 ? 50  ILE A CB    1 
ATOM   387  C  CG1   . ILE A 1 50  ? 26.024 -16.238 -28.634 1.00 91.83  ? 50  ILE A CG1   1 
ATOM   388  C  CG2   . ILE A 1 50  ? 25.978 -15.651 -26.192 1.00 97.65  ? 50  ILE A CG2   1 
ATOM   389  C  CD1   . ILE A 1 50  ? 25.561 -14.863 -29.045 1.00 79.49  ? 50  ILE A CD1   1 
ATOM   390  N  N     . GLY A 1 51  ? 24.207 -19.050 -28.094 1.00 124.12 ? 51  GLY A N     1 
ATOM   391  C  CA    . GLY A 1 51  ? 23.553 -19.972 -28.991 1.00 134.63 ? 51  GLY A CA    1 
ATOM   392  C  C     . GLY A 1 51  ? 22.458 -19.303 -29.796 1.00 132.26 ? 51  GLY A C     1 
ATOM   393  O  O     . GLY A 1 51  ? 22.442 -18.080 -29.969 0.10 131.21 ? 51  GLY A O     1 
ATOM   394  N  N     . PRO A 1 52  ? 21.513 -20.098 -30.310 1.00 119.85 ? 52  PRO A N     1 
ATOM   395  C  CA    . PRO A 1 52  ? 20.391 -19.515 -31.062 1.00 119.35 ? 52  PRO A CA    1 
ATOM   396  C  C     . PRO A 1 52  ? 19.426 -18.719 -30.200 1.00 118.66 ? 52  PRO A C     1 
ATOM   397  O  O     . PRO A 1 52  ? 18.538 -18.055 -30.751 0.10 112.88 ? 52  PRO A O     1 
ATOM   398  C  CB    . PRO A 1 52  ? 19.704 -20.742 -31.675 0.00 113.11 ? 52  PRO A CB    1 
ATOM   399  C  CG    . PRO A 1 52  ? 20.052 -21.861 -30.752 0.00 111.77 ? 52  PRO A CG    1 
ATOM   400  C  CD    . PRO A 1 52  ? 21.442 -21.568 -30.256 0.00 113.98 ? 52  PRO A CD    1 
ATOM   401  N  N     . GLU A 1 53  ? 19.570 -18.759 -28.876 1.00 129.19 ? 53  GLU A N     1 
ATOM   402  C  CA    . GLU A 1 53  ? 18.724 -17.997 -27.967 1.00 134.28 ? 53  GLU A CA    1 
ATOM   403  C  C     . GLU A 1 53  ? 19.124 -16.529 -27.875 1.00 136.75 ? 53  GLU A C     1 
ATOM   404  O  O     . GLU A 1 53  ? 18.573 -15.803 -27.040 1.00 137.70 ? 53  GLU A O     1 
ATOM   405  C  CB    . GLU A 1 53  ? 18.749 -18.628 -26.570 1.00 134.03 ? 53  GLU A CB    1 
ATOM   406  C  CG    . GLU A 1 53  ? 20.096 -18.549 -25.859 1.00 131.66 ? 53  GLU A CG    1 
ATOM   407  C  CD    . GLU A 1 53  ? 21.093 -19.581 -26.357 1.00 133.26 ? 53  GLU A CD    1 
ATOM   408  O  OE1   . GLU A 1 53  ? 20.701 -20.452 -27.162 1.00 133.43 ? 53  GLU A OE1   1 
ATOM   409  O  OE2   . GLU A 1 53  ? 22.269 -19.521 -25.941 1.00 132.44 ? 53  GLU A OE2   1 
ATOM   410  N  N     . ASN A 1 54  ? 20.064 -16.079 -28.702 1.00 133.09 ? 54  ASN A N     1 
ATOM   411  C  CA    . ASN A 1 54  ? 20.495 -14.681 -28.728 1.00 124.28 ? 54  ASN A CA    1 
ATOM   412  C  C     . ASN A 1 54  ? 20.277 -14.134 -30.131 1.00 121.05 ? 54  ASN A C     1 
ATOM   413  O  O     . ASN A 1 54  ? 21.133 -14.322 -31.015 1.00 126.39 ? 54  ASN A O     1 
ATOM   414  C  CB    . ASN A 1 54  ? 21.961 -14.554 -28.316 0.39 116.67 ? 54  ASN A CB    1 
ATOM   415  C  CG    . ASN A 1 54  ? 22.347 -13.132 -27.950 0.49 108.60 ? 54  ASN A CG    1 
ATOM   416  O  OD1   . ASN A 1 54  ? 21.763 -12.168 -28.444 0.46 108.96 ? 54  ASN A OD1   1 
ATOM   417  N  ND2   . ASN A 1 54  ? 23.338 -12.997 -27.075 0.93 103.73 ? 54  ASN A ND2   1 
ATOM   418  N  N     . PRO A 1 55  ? 19.156 -13.454 -30.389 0.67 113.31 ? 55  PRO A N     1 
ATOM   419  C  CA    . PRO A 1 55  ? 18.878 -12.973 -31.753 0.94 111.67 ? 55  PRO A CA    1 
ATOM   420  C  C     . PRO A 1 55  ? 19.772 -11.827 -32.197 0.19 102.05 ? 55  PRO A C     1 
ATOM   421  O  O     . PRO A 1 55  ? 19.706 -11.437 -33.370 0.61 102.64 ? 55  PRO A O     1 
ATOM   422  C  CB    . PRO A 1 55  ? 17.410 -12.522 -31.676 1.00 118.39 ? 55  PRO A CB    1 
ATOM   423  C  CG    . PRO A 1 55  ? 16.880 -13.075 -30.373 1.00 122.51 ? 55  PRO A CG    1 
ATOM   424  C  CD    . PRO A 1 55  ? 18.057 -13.152 -29.461 1.00 113.26 ? 55  PRO A CD    1 
ATOM   425  N  N     . TYR A 1 56  ? 20.603 -11.286 -31.312 1.00 95.49  ? 56  TYR A N     1 
ATOM   426  C  CA    . TYR A 1 56  ? 21.380 -10.095 -31.610 1.00 100.82 ? 56  TYR A CA    1 
ATOM   427  C  C     . TYR A 1 56  ? 22.680 -10.453 -32.328 1.00 110.61 ? 56  TYR A C     1 
ATOM   428  O  O     . TYR A 1 56  ? 23.184 -11.576 -32.239 1.00 120.86 ? 56  TYR A O     1 
ATOM   429  C  CB    . TYR A 1 56  ? 21.687 -9.331  -30.323 1.00 108.70 ? 56  TYR A CB    1 
ATOM   430  C  CG    . TYR A 1 56  ? 20.470 -9.088  -29.456 1.00 110.04 ? 56  TYR A CG    1 
ATOM   431  C  CD1   . TYR A 1 56  ? 19.272 -8.663  -30.012 1.00 105.93 ? 56  TYR A CD1   1 
ATOM   432  C  CD2   . TYR A 1 56  ? 20.517 -9.296  -28.083 1.00 102.93 ? 56  TYR A CD2   1 
ATOM   433  C  CE1   . TYR A 1 56  ? 18.160 -8.445  -29.227 1.00 97.50  ? 56  TYR A CE1   1 
ATOM   434  C  CE2   . TYR A 1 56  ? 19.407 -9.080  -27.288 1.00 90.85  ? 56  TYR A CE2   1 
ATOM   435  C  CZ    . TYR A 1 56  ? 18.231 -8.654  -27.866 1.00 94.50  ? 56  TYR A CZ    1 
ATOM   436  O  OH    . TYR A 1 56  ? 17.121 -8.436  -27.081 1.00 79.71  ? 56  TYR A OH    1 
ATOM   437  N  N     . ASN A 1 57  ? 23.219 -9.472  -33.050 1.00 113.42 ? 57  ASN A N     1 
ATOM   438  C  CA    . ASN A 1 57  ? 24.505 -9.621  -33.718 1.00 114.57 ? 57  ASN A CA    1 
ATOM   439  C  C     . ASN A 1 57  ? 25.021 -8.242  -34.103 1.00 108.11 ? 57  ASN A C     1 
ATOM   440  O  O     . ASN A 1 57  ? 24.243 -7.299  -34.274 1.00 103.94 ? 57  ASN A O     1 
ATOM   441  C  CB    . ASN A 1 57  ? 24.406 -10.518 -34.957 1.00 117.05 ? 57  ASN A CB    1 
ATOM   442  C  CG    . ASN A 1 57  ? 25.764 -10.842 -35.548 1.00 111.82 ? 57  ASN A CG    1 
ATOM   443  O  OD1   . ASN A 1 57  ? 26.454 -11.748 -35.083 1.00 108.48 ? 57  ASN A OD1   1 
ATOM   444  N  ND2   . ASN A 1 57  ? 26.157 -10.096 -36.575 1.00 111.65 ? 57  ASN A ND2   1 
ATOM   445  N  N     . THR A 1 58  ? 26.346 -8.136  -34.233 1.00 103.70 ? 58  THR A N     1 
ATOM   446  C  CA    . THR A 1 58  ? 26.994 -6.881  -34.572 1.00 95.46  ? 58  THR A CA    1 
ATOM   447  C  C     . THR A 1 58  ? 28.291 -7.189  -35.310 1.00 91.24  ? 58  THR A C     1 
ATOM   448  O  O     . THR A 1 58  ? 29.082 -8.015  -34.826 0.57 91.61  ? 58  THR A O     1 
ATOM   449  C  CB    . THR A 1 58  ? 27.286 -6.040  -33.327 1.00 88.86  ? 58  THR A CB    1 
ATOM   450  O  OG1   . THR A 1 58  ? 26.123 -6.001  -32.488 1.00 79.85  ? 58  THR A OG1   1 
ATOM   451  C  CG2   . THR A 1 58  ? 27.655 -4.623  -33.718 1.00 87.58  ? 58  THR A CG2   1 
ATOM   452  N  N     . PRO A 1 59  ? 28.537 -6.565  -36.460 0.10 86.19  ? 59  PRO A N     1 
ATOM   453  C  CA    . PRO A 1 59  ? 29.765 -6.850  -37.209 0.10 79.43  ? 59  PRO A CA    1 
ATOM   454  C  C     . PRO A 1 59  ? 31.002 -6.317  -36.500 0.10 73.47  ? 59  PRO A C     1 
ATOM   455  O  O     . PRO A 1 59  ? 30.942 -5.396  -35.683 0.10 71.90  ? 59  PRO A O     1 
ATOM   456  C  CB    . PRO A 1 59  ? 29.541 -6.134  -38.546 0.10 76.14  ? 59  PRO A CB    1 
ATOM   457  C  CG    . PRO A 1 59  ? 28.559 -5.056  -38.232 0.10 74.82  ? 59  PRO A CG    1 
ATOM   458  C  CD    . PRO A 1 59  ? 27.658 -5.622  -37.174 0.10 74.70  ? 59  PRO A CD    1 
ATOM   459  N  N     . VAL A 1 60  ? 32.145 -6.919  -36.834 0.10 72.81  ? 60  VAL A N     1 
ATOM   460  C  CA    . VAL A 1 60  ? 33.423 -6.594  -36.216 0.10 70.14  ? 60  VAL A CA    1 
ATOM   461  C  C     . VAL A 1 60  ? 34.475 -6.409  -37.304 0.10 71.11  ? 60  VAL A C     1 
ATOM   462  O  O     . VAL A 1 60  ? 34.244 -6.681  -38.482 0.10 73.66  ? 60  VAL A O     1 
ATOM   463  C  CB    . VAL A 1 60  ? 33.882 -7.673  -35.212 0.00 69.73  ? 60  VAL A CB    1 
ATOM   464  C  CG1   . VAL A 1 60  ? 32.854 -7.858  -34.109 0.00 68.92  ? 60  VAL A CG1   1 
ATOM   465  C  CG2   . VAL A 1 60  ? 34.145 -8.988  -35.931 0.00 72.58  ? 60  VAL A CG2   1 
ATOM   466  N  N     . PHE A 1 61  ? 35.647 -5.940  -36.881 0.10 69.19  ? 61  PHE A N     1 
ATOM   467  C  CA    . PHE A 1 61  ? 36.813 -5.799  -37.746 0.10 70.00  ? 61  PHE A CA    1 
ATOM   468  C  C     . PHE A 1 61  ? 38.037 -5.618  -36.855 0.10 67.82  ? 61  PHE A C     1 
ATOM   469  O  O     . PHE A 1 61  ? 37.947 -5.683  -35.626 0.10 65.90  ? 61  PHE A O     1 
ATOM   470  C  CB    . PHE A 1 61  ? 36.647 -4.640  -38.735 0.00 71.72  ? 61  PHE A CB    1 
ATOM   471  C  CG    . PHE A 1 61  ? 36.386 -3.312  -38.083 0.00 68.81  ? 61  PHE A CG    1 
ATOM   472  C  CD1   . PHE A 1 61  ? 37.428 -2.439  -37.821 0.00 67.03  ? 61  PHE A CD1   1 
ATOM   473  C  CD2   . PHE A 1 61  ? 35.098 -2.932  -37.742 0.00 68.31  ? 61  PHE A CD2   1 
ATOM   474  C  CE1   . PHE A 1 61  ? 37.192 -1.215  -37.226 0.00 64.98  ? 61  PHE A CE1   1 
ATOM   475  C  CE2   . PHE A 1 61  ? 34.856 -1.709  -37.145 0.00 66.23  ? 61  PHE A CE2   1 
ATOM   476  C  CZ    . PHE A 1 61  ? 35.904 -0.849  -36.887 0.00 64.45  ? 61  PHE A CZ    1 
ATOM   477  N  N     . ALA A 1 62  ? 39.189 -5.390  -37.484 0.10 75.61  ? 62  ALA A N     1 
ATOM   478  C  CA    . ALA A 1 62  ? 40.434 -5.249  -36.741 0.10 80.42  ? 62  ALA A CA    1 
ATOM   479  C  C     . ALA A 1 62  ? 41.395 -4.356  -37.511 0.10 90.93  ? 62  ALA A C     1 
ATOM   480  O  O     . ALA A 1 62  ? 41.411 -4.352  -38.745 0.10 93.39  ? 62  ALA A O     1 
ATOM   481  C  CB    . ALA A 1 62  ? 41.082 -6.612  -36.468 0.10 75.39  ? 62  ALA A CB    1 
ATOM   482  N  N     . ILE A 1 63  ? 42.200 -3.598  -36.766 1.00 104.27 ? 63  ILE A N     1 
ATOM   483  C  CA    . ILE A 1 63  ? 43.199 -2.696  -37.320 1.00 115.70 ? 63  ILE A CA    1 
ATOM   484  C  C     . ILE A 1 63  ? 44.511 -2.893  -36.565 0.12 127.50 ? 63  ILE A C     1 
ATOM   485  O  O     . ILE A 1 63  ? 44.599 -3.686  -35.628 0.53 126.39 ? 63  ILE A O     1 
ATOM   486  C  CB    . ILE A 1 63  ? 42.755 -1.219  -37.262 1.00 103.75 ? 63  ILE A CB    1 
ATOM   487  C  CG1   . ILE A 1 63  ? 42.582 -0.773  -35.808 0.86 98.05  ? 63  ILE A CG1   1 
ATOM   488  C  CG2   . ILE A 1 63  ? 41.470 -1.008  -38.051 0.00 105.39 ? 63  ILE A CG2   1 
ATOM   489  C  CD1   . ILE A 1 63  ? 42.369 0.715   -35.649 0.00 96.81  ? 63  ILE A CD1   1 
ATOM   490  N  N     . LYS A 1 64  ? 45.533 -2.148  -36.980 1.00 138.64 ? 64  LYS A N     1 
ATOM   491  C  CA    . LYS A 1 64  ? 46.855 -2.236  -36.374 1.00 140.58 ? 64  LYS A CA    1 
ATOM   492  C  C     . LYS A 1 64  ? 47.010 -1.196  -35.272 1.00 133.83 ? 64  LYS A C     1 
ATOM   493  O  O     . LYS A 1 64  ? 46.586 -0.046  -35.420 1.00 132.67 ? 64  LYS A O     1 
ATOM   494  C  CB    . LYS A 1 64  ? 47.946 -2.044  -37.430 1.00 147.53 ? 64  LYS A CB    1 
ATOM   495  C  CG    . LYS A 1 64  ? 47.918 -3.069  -38.553 1.00 148.46 ? 64  LYS A CG    1 
ATOM   496  C  CD    . LYS A 1 64  ? 48.172 -4.475  -38.031 1.00 147.65 ? 64  LYS A CD    1 
ATOM   497  C  CE    . LYS A 1 64  ? 49.532 -4.580  -37.357 1.00 145.35 ? 64  LYS A CE    1 
ATOM   498  N  NZ    . LYS A 1 64  ? 50.640 -4.196  -38.275 1.00 144.68 ? 64  LYS A NZ    1 
ATOM   499  N  N     . LYS A 1 65  ? 47.630 -1.608  -34.167 1.00 127.97 ? 65  LYS A N     1 
ATOM   500  C  CA    . LYS A 1 65  ? 47.831 -0.732  -33.024 1.00 116.42 ? 65  LYS A CA    1 
ATOM   501  C  C     . LYS A 1 65  ? 48.979 0.242   -33.289 0.13 110.08 ? 65  LYS A C     1 
ATOM   502  O  O     . LYS A 1 65  ? 49.616 0.229   -34.346 1.00 108.59 ? 65  LYS A O     1 
ATOM   503  C  CB    . LYS A 1 65  ? 48.099 -1.552  -31.763 1.00 113.77 ? 65  LYS A CB    1 
ATOM   504  C  CG    . LYS A 1 65  ? 46.954 -2.456  -31.334 1.00 108.38 ? 65  LYS A CG    1 
ATOM   505  C  CD    . LYS A 1 65  ? 47.263 -3.122  -30.000 1.00 102.83 ? 65  LYS A CD    1 
ATOM   506  C  CE    . LYS A 1 65  ? 46.100 -3.974  -29.517 1.00 99.13  ? 65  LYS A CE    1 
ATOM   507  N  NZ    . LYS A 1 65  ? 46.368 -4.567  -28.175 1.00 94.67  ? 65  LYS A NZ    1 
ATOM   508  N  N     . LYS A 1 66  ? 49.248 1.101   -32.301 1.00 106.14 ? 66  LYS A N     1 
ATOM   509  C  CA    . LYS A 1 66  ? 50.340 2.062   -32.424 1.00 105.16 ? 66  LYS A CA    1 
ATOM   510  C  C     . LYS A 1 66  ? 51.691 1.363   -32.495 0.10 115.05 ? 66  LYS A C     1 
ATOM   511  O  O     . LYS A 1 66  ? 52.643 1.908   -33.066 0.10 111.60 ? 66  LYS A O     1 
ATOM   512  C  CB    . LYS A 1 66  ? 50.300 3.046   -31.253 0.10 88.75  ? 66  LYS A CB    1 
ATOM   513  C  CG    . LYS A 1 66  ? 51.051 4.352   -31.481 0.10 81.14  ? 66  LYS A CG    1 
ATOM   514  C  CD    . LYS A 1 66  ? 50.846 5.308   -30.311 0.10 73.71  ? 66  LYS A CD    1 
ATOM   515  C  CE    . LYS A 1 66  ? 51.474 6.670   -30.572 1.00 68.67  ? 66  LYS A CE    1 
ATOM   516  N  NZ    . LYS A 1 66  ? 50.853 7.360   -31.737 1.00 66.84  ? 66  LYS A NZ    1 
ATOM   517  N  N     . ASP A 1 67  ? 51.795 0.161   -31.927 1.00 129.83 ? 67  ASP A N     1 
ATOM   518  C  CA    . ASP A 1 67  ? 53.013 -0.632  -32.031 1.00 142.43 ? 67  ASP A CA    1 
ATOM   519  C  C     . ASP A 1 67  ? 53.124 -1.364  -33.363 1.00 157.19 ? 67  ASP A C     1 
ATOM   520  O  O     . ASP A 1 67  ? 54.188 -1.921  -33.657 1.00 166.59 ? 67  ASP A O     1 
ATOM   521  C  CB    . ASP A 1 67  ? 53.084 -1.639  -30.878 1.00 139.48 ? 67  ASP A CB    1 
ATOM   522  C  CG    . ASP A 1 67  ? 54.493 -2.140  -30.627 0.00 140.26 ? 67  ASP A CG    1 
ATOM   523  O  OD1   . ASP A 1 67  ? 55.446 -1.349  -30.792 0.00 140.37 ? 67  ASP A OD1   1 
ATOM   524  O  OD2   . ASP A 1 67  ? 54.649 -3.325  -30.266 0.00 140.51 ? 67  ASP A OD2   1 
ATOM   525  N  N     . SER A 1 68  ? 52.052 -1.381  -34.160 1.00 148.98 ? 68  SER A N     1 
ATOM   526  C  CA    . SER A 1 68  ? 52.061 -1.924  -35.520 0.11 134.52 ? 68  SER A CA    1 
ATOM   527  C  C     . SER A 1 68  ? 52.417 -3.409  -35.552 0.10 132.82 ? 68  SER A C     1 
ATOM   528  O  O     . SER A 1 68  ? 52.914 -3.915  -36.561 1.00 136.82 ? 68  SER A O     1 
ATOM   529  C  CB    . SER A 1 68  ? 53.009 -1.131  -36.425 1.00 122.43 ? 68  SER A CB    1 
ATOM   530  O  OG    . SER A 1 68  ? 52.976 -1.619  -37.754 1.00 122.73 ? 68  SER A OG    1 
ATOM   531  N  N     . THR A 1 69  ? 52.158 -4.124  -34.458 1.00 132.15 ? 69  THR A N     1 
ATOM   532  C  CA    . THR A 1 69  ? 52.430 -5.556  -34.421 0.40 135.58 ? 69  THR A CA    1 
ATOM   533  C  C     . THR A 1 69  ? 51.198 -6.329  -33.968 0.08 132.93 ? 69  THR A C     1 
ATOM   534  O  O     . THR A 1 69  ? 50.825 -7.331  -34.588 1.00 126.95 ? 69  THR A O     1 
ATOM   535  C  CB    . THR A 1 69  ? 53.616 -5.858  -33.502 1.00 139.72 ? 69  THR A CB    1 
ATOM   536  O  OG1   . THR A 1 69  ? 54.738 -5.055  -33.888 1.00 143.12 ? 69  THR A OG1   1 
ATOM   537  C  CG2   . THR A 1 69  ? 54.000 -7.327  -33.600 1.00 139.60 ? 69  THR A CG2   1 
ATOM   538  N  N     . LYS A 1 70  ? 50.560 -5.876  -32.895 1.00 134.65 ? 70  LYS A N     1 
ATOM   539  C  CA    . LYS A 1 70  ? 49.355 -6.513  -32.389 1.00 134.39 ? 70  LYS A CA    1 
ATOM   540  C  C     . LYS A 1 70  ? 48.116 -5.910  -33.045 1.00 137.81 ? 70  LYS A C     1 
ATOM   541  O  O     . LYS A 1 70  ? 48.124 -4.772  -33.521 1.00 137.44 ? 70  LYS A O     1 
ATOM   542  C  CB    . LYS A 1 70  ? 49.269 -6.373  -30.868 0.00 126.96 ? 70  LYS A CB    1 
ATOM   543  C  CG    . LYS A 1 70  ? 50.432 -7.009  -30.121 0.00 122.91 ? 70  LYS A CG    1 
ATOM   544  C  CD    . LYS A 1 70  ? 50.291 -6.826  -28.618 0.00 117.53 ? 70  LYS A CD    1 
ATOM   545  C  CE    . LYS A 1 70  ? 51.468 -7.439  -27.877 0.00 115.10 ? 70  LYS A CE    1 
ATOM   546  N  NZ    . LYS A 1 70  ? 51.355 -7.257  -26.404 0.00 111.49 ? 70  LYS A NZ    1 
ATOM   547  N  N     . TRP A 1 71  ? 47.041 -6.694  -33.065 1.00 141.61 ? 71  TRP A N     1 
ATOM   548  C  CA    . TRP A 1 71  ? 45.788 -6.295  -33.692 1.00 140.04 ? 71  TRP A CA    1 
ATOM   549  C  C     . TRP A 1 71  ? 44.799 -5.826  -32.633 1.00 135.11 ? 71  TRP A C     1 
ATOM   550  O  O     . TRP A 1 71  ? 44.616 -6.491  -31.607 1.00 135.45 ? 71  TRP A O     1 
ATOM   551  C  CB    . TRP A 1 71  ? 45.186 -7.451  -34.494 1.00 144.45 ? 71  TRP A CB    1 
ATOM   552  C  CG    . TRP A 1 71  ? 45.861 -7.701  -35.811 1.00 146.60 ? 71  TRP A CG    1 
ATOM   553  C  CD1   . TRP A 1 71  ? 46.900 -8.552  -36.053 1.00 144.85 ? 71  TRP A CD1   1 
ATOM   554  C  CD2   . TRP A 1 71  ? 45.533 -7.100  -37.071 1.00 150.10 ? 71  TRP A CD2   1 
ATOM   555  N  NE1   . TRP A 1 71  ? 47.242 -8.516  -37.384 1.00 147.98 ? 71  TRP A NE1   1 
ATOM   556  C  CE2   . TRP A 1 71  ? 46.418 -7.632  -38.030 1.00 149.42 ? 71  TRP A CE2   1 
ATOM   557  C  CE3   . TRP A 1 71  ? 44.579 -6.163  -37.480 1.00 149.61 ? 71  TRP A CE3   1 
ATOM   558  C  CZ2   . TRP A 1 71  ? 46.378 -7.257  -39.372 1.00 149.46 ? 71  TRP A CZ2   1 
ATOM   559  C  CZ3   . TRP A 1 71  ? 44.541 -5.791  -38.812 1.00 148.21 ? 71  TRP A CZ3   1 
ATOM   560  C  CH2   . TRP A 1 71  ? 45.435 -6.337  -39.742 1.00 149.32 ? 71  TRP A CH2   1 
ATOM   561  N  N     . ARG A 1 72  ? 44.165 -4.684  -32.886 1.00 123.14 ? 72  ARG A N     1 
ATOM   562  C  CA    . ARG A 1 72  ? 43.113 -4.154  -32.028 1.00 110.09 ? 72  ARG A CA    1 
ATOM   563  C  C     . ARG A 1 72  ? 41.762 -4.565  -32.599 1.00 106.06 ? 72  ARG A C     1 
ATOM   564  O  O     . ARG A 1 72  ? 41.458 -4.270  -33.760 1.00 116.22 ? 72  ARG A O     1 
ATOM   565  C  CB    . ARG A 1 72  ? 43.211 -2.632  -31.913 1.00 101.49 ? 72  ARG A CB    1 
ATOM   566  C  CG    . ARG A 1 72  ? 41.895 -1.949  -31.563 1.00 92.14  ? 72  ARG A CG    1 
ATOM   567  C  CD    . ARG A 1 72  ? 42.087 -0.477  -31.223 1.00 81.63  ? 72  ARG A CD    1 
ATOM   568  N  NE    . ARG A 1 72  ? 42.651 -0.294  -29.888 1.00 77.48  ? 72  ARG A NE    1 
ATOM   569  C  CZ    . ARG A 1 72  ? 43.936 -0.062  -29.641 1.00 74.81  ? 72  ARG A CZ    1 
ATOM   570  N  NH1   . ARG A 1 72  ? 44.801 0.024   -30.642 1.00 80.79  ? 72  ARG A NH1   1 
ATOM   571  N  NH2   . ARG A 1 72  ? 44.355 0.088   -28.392 1.00 71.24  ? 72  ARG A NH2   1 
ATOM   572  N  N     . LYS A 1 73  ? 40.957 -5.243  -31.786 1.00 92.25  ? 73  LYS A N     1 
ATOM   573  C  CA    . LYS A 1 73  ? 39.651 -5.724  -32.213 1.00 88.52  ? 73  LYS A CA    1 
ATOM   574  C  C     . LYS A 1 73  ? 38.601 -4.651  -31.952 0.02 83.66  ? 73  LYS A C     1 
ATOM   575  O  O     . LYS A 1 73  ? 38.335 -4.303  -30.796 0.63 78.52  ? 73  LYS A O     1 
ATOM   576  C  CB    . LYS A 1 73  ? 39.287 -7.017  -31.488 1.00 87.68  ? 73  LYS A CB    1 
ATOM   577  C  CG    . LYS A 1 73  ? 37.911 -7.544  -31.836 1.00 84.09  ? 73  LYS A CG    1 
ATOM   578  C  CD    . LYS A 1 73  ? 37.536 -8.702  -30.938 0.12 75.50  ? 73  LYS A CD    1 
ATOM   579  C  CE    . LYS A 1 73  ? 36.103 -9.133  -31.169 1.00 70.11  ? 73  LYS A CE    1 
ATOM   580  N  NZ    . LYS A 1 73  ? 35.688 -10.136 -30.158 1.00 70.98  ? 73  LYS A NZ    1 
ATOM   581  N  N     . LEU A 1 74  ? 38.005 -4.136  -33.022 1.00 86.43  ? 74  LEU A N     1 
ATOM   582  C  CA    . LEU A 1 74  ? 36.976 -3.111  -32.941 1.00 86.51  ? 74  LEU A CA    1 
ATOM   583  C  C     . LEU A 1 74  ? 35.652 -3.664  -33.448 0.27 93.99  ? 74  LEU A C     1 
ATOM   584  O  O     . LEU A 1 74  ? 35.614 -4.406  -34.435 0.97 101.21 ? 74  LEU A O     1 
ATOM   585  C  CB    . LEU A 1 74  ? 37.370 -1.875  -33.752 0.83 87.70  ? 74  LEU A CB    1 
ATOM   586  C  CG    . LEU A 1 74  ? 38.635 -1.142  -33.304 0.61 82.84  ? 74  LEU A CG    1 
ATOM   587  C  CD1   . LEU A 1 74  ? 39.053 -0.122  -34.347 0.69 81.82  ? 74  LEU A CD1   1 
ATOM   588  C  CD2   . LEU A 1 74  ? 38.415 -0.475  -31.955 0.72 77.06  ? 74  LEU A CD2   1 
ATOM   589  N  N     . VAL A 1 75  ? 34.569 -3.300  -32.768 1.00 92.18  ? 75  VAL A N     1 
ATOM   590  C  CA    . VAL A 1 75  ? 33.222 -3.718  -33.134 1.00 94.65  ? 75  VAL A CA    1 
ATOM   591  C  C     . VAL A 1 75  ? 32.439 -2.488  -33.569 1.00 96.01  ? 75  VAL A C     1 
ATOM   592  O  O     . VAL A 1 75  ? 32.570 -1.413  -32.971 1.00 90.62  ? 75  VAL A O     1 
ATOM   593  C  CB    . VAL A 1 75  ? 32.517 -4.437  -31.966 1.00 86.10  ? 75  VAL A CB    1 
ATOM   594  C  CG1   . VAL A 1 75  ? 31.203 -5.053  -32.428 1.00 90.84  ? 75  VAL A CG1   1 
ATOM   595  C  CG2   . VAL A 1 75  ? 33.431 -5.494  -31.364 1.00 78.56  ? 75  VAL A CG2   1 
ATOM   596  N  N     . ASP A 1 76  ? 31.632 -2.645  -34.618 1.00 101.53 ? 76  ASP A N     1 
ATOM   597  C  CA    . ASP A 1 76  ? 30.828 -1.542  -35.147 1.00 108.34 ? 76  ASP A CA    1 
ATOM   598  C  C     . ASP A 1 76  ? 29.478 -1.503  -34.428 1.00 107.35 ? 76  ASP A C     1 
ATOM   599  O  O     . ASP A 1 76  ? 28.423 -1.825  -34.977 1.00 110.19 ? 76  ASP A O     1 
ATOM   600  C  CB    . ASP A 1 76  ? 30.666 -1.680  -36.656 1.00 117.27 ? 76  ASP A CB    1 
ATOM   601  C  CG    . ASP A 1 76  ? 29.859 -0.546  -37.265 1.00 121.95 ? 76  ASP A CG    1 
ATOM   602  O  OD1   . ASP A 1 76  ? 29.790 0.539   -36.650 1.00 117.49 ? 76  ASP A OD1   1 
ATOM   603  O  OD2   . ASP A 1 76  ? 29.293 -0.740  -38.362 1.00 126.99 ? 76  ASP A OD2   1 
ATOM   604  N  N     . PHE A 1 77  ? 29.533 -1.081  -33.164 1.00 100.32 ? 77  PHE A N     1 
ATOM   605  C  CA    . PHE A 1 77  ? 28.334 -0.948  -32.344 1.00 87.39  ? 77  PHE A CA    1 
ATOM   606  C  C     . PHE A 1 77  ? 27.569 0.330   -32.667 1.00 81.40  ? 77  PHE A C     1 
ATOM   607  O  O     . PHE A 1 77  ? 26.905 0.892   -31.791 1.00 73.20  ? 77  PHE A O     1 
ATOM   608  C  CB    . PHE A 1 77  ? 28.688 -0.960  -30.854 1.00 72.67  ? 77  PHE A CB    1 
ATOM   609  C  CG    . PHE A 1 77  ? 28.971 -2.326  -30.300 0.34 65.39  ? 77  PHE A CG    1 
ATOM   610  C  CD1   . PHE A 1 77  ? 28.013 -3.324  -30.354 1.00 72.65  ? 77  PHE A CD1   1 
ATOM   611  C  CD2   . PHE A 1 77  ? 30.185 -2.603  -29.696 1.00 58.24  ? 77  PHE A CD2   1 
ATOM   612  C  CE1   . PHE A 1 77  ? 28.269 -4.580  -29.835 1.00 73.98  ? 77  PHE A CE1   1 
ATOM   613  C  CE2   . PHE A 1 77  ? 30.446 -3.855  -29.172 0.26 60.64  ? 77  PHE A CE2   1 
ATOM   614  C  CZ    . PHE A 1 77  ? 29.488 -4.845  -29.243 1.00 64.83  ? 77  PHE A CZ    1 
ATOM   615  N  N     . ARG A 1 78  ? 27.651 0.799   -33.915 1.00 83.47  ? 78  ARG A N     1 
ATOM   616  C  CA    . ARG A 1 78  ? 26.981 2.044   -34.276 1.00 87.34  ? 78  ARG A CA    1 
ATOM   617  C  C     . ARG A 1 78  ? 25.467 1.925   -34.150 1.00 96.45  ? 78  ARG A C     1 
ATOM   618  O  O     . ARG A 1 78  ? 24.783 2.931   -33.927 1.00 96.91  ? 78  ARG A O     1 
ATOM   619  C  CB    . ARG A 1 78  ? 27.375 2.461   -35.695 1.00 92.03  ? 78  ARG A CB    1 
ATOM   620  C  CG    . ARG A 1 78  ? 27.034 3.905   -36.040 1.00 100.26 ? 78  ARG A CG    1 
ATOM   621  C  CD    . ARG A 1 78  ? 27.746 4.367   -37.305 1.00 105.88 ? 78  ARG A CD    1 
ATOM   622  N  NE    . ARG A 1 78  ? 27.442 3.520   -38.455 1.00 113.31 ? 78  ARG A NE    1 
ATOM   623  C  CZ    . ARG A 1 78  ? 27.889 3.742   -39.688 1.00 112.85 ? 78  ARG A CZ    1 
ATOM   624  N  NH1   . ARG A 1 78  ? 28.662 4.791   -39.937 1.00 111.18 ? 78  ARG A NH1   1 
ATOM   625  N  NH2   . ARG A 1 78  ? 27.561 2.917   -40.673 1.00 110.93 ? 78  ARG A NH2   1 
ATOM   626  N  N     . GLU A 1 79  ? 24.928 0.711   -34.275 1.00 102.67 ? 79  GLU A N     1 
ATOM   627  C  CA    . GLU A 1 79  ? 23.493 0.514   -34.102 1.00 98.20  ? 79  GLU A CA    1 
ATOM   628  C  C     . GLU A 1 79  ? 23.122 0.375   -32.631 1.00 94.29  ? 79  GLU A C     1 
ATOM   629  O  O     . GLU A 1 79  ? 22.054 0.835   -32.212 1.00 100.90 ? 79  GLU A O     1 
ATOM   630  C  CB    . GLU A 1 79  ? 23.033 -0.713  -34.891 1.00 98.67  ? 79  GLU A CB    1 
ATOM   631  C  CG    . GLU A 1 79  ? 21.528 -0.930  -34.890 1.00 102.63 ? 79  GLU A CG    1 
ATOM   632  C  CD    . GLU A 1 79  ? 20.769 0.216   -35.532 1.00 100.03 ? 79  GLU A CD    1 
ATOM   633  O  OE1   . GLU A 1 79  ? 21.351 0.916   -36.389 1.00 100.28 ? 79  GLU A OE1   1 
ATOM   634  O  OE2   . GLU A 1 79  ? 19.590 0.419   -35.176 1.00 97.78  ? 79  GLU A OE2   1 
ATOM   635  N  N     . LEU A 1 80  ? 23.990 -0.251  -31.833 1.00 85.34  ? 80  LEU A N     1 
ATOM   636  C  CA    . LEU A 1 80  ? 23.720 -0.380  -30.405 1.00 77.59  ? 80  LEU A CA    1 
ATOM   637  C  C     . LEU A 1 80  ? 23.822 0.967   -29.698 1.00 89.73  ? 80  LEU A C     1 
ATOM   638  O  O     . LEU A 1 80  ? 23.044 1.252   -28.780 1.00 94.14  ? 80  LEU A O     1 
ATOM   639  C  CB    . LEU A 1 80  ? 24.681 -1.392  -29.779 1.00 70.55  ? 80  LEU A CB    1 
ATOM   640  C  CG    . LEU A 1 80  ? 24.579 -1.614  -28.268 1.00 67.08  ? 80  LEU A CG    1 
ATOM   641  C  CD1   . LEU A 1 80  ? 23.178 -2.054  -27.874 1.00 74.61  ? 80  LEU A CD1   1 
ATOM   642  C  CD2   . LEU A 1 80  ? 25.612 -2.631  -27.804 1.00 60.51  ? 80  LEU A CD2   1 
ATOM   643  N  N     . ASN A 1 81  ? 24.769 1.812   -30.116 1.00 85.76  ? 81  ASN A N     1 
ATOM   644  C  CA    . ASN A 1 81  ? 24.939 3.111   -29.473 1.00 92.16  ? 81  ASN A CA    1 
ATOM   645  C  C     . ASN A 1 81  ? 23.728 4.010   -29.683 1.00 99.91  ? 81  ASN A C     1 
ATOM   646  O  O     . ASN A 1 81  ? 23.410 4.830   -28.814 1.00 101.29 ? 81  ASN A O     1 
ATOM   647  C  CB    . ASN A 1 81  ? 26.200 3.799   -29.994 1.00 92.58  ? 81  ASN A CB    1 
ATOM   648  C  CG    . ASN A 1 81  ? 27.456 2.996   -29.724 1.00 89.68  ? 81  ASN A CG    1 
ATOM   649  O  OD1   . ASN A 1 81  ? 27.514 2.208   -28.779 1.00 83.82  ? 81  ASN A OD1   1 
ATOM   650  N  ND2   . ASN A 1 81  ? 28.470 3.190   -30.556 1.00 85.32  ? 81  ASN A ND2   1 
ATOM   651  N  N     . LYS A 1 82  ? 23.047 3.880   -30.824 1.00 104.33 ? 82  LYS A N     1 
ATOM   652  C  CA    . LYS A 1 82  ? 21.839 4.667   -31.053 1.00 96.49  ? 82  LYS A CA    1 
ATOM   653  C  C     . LYS A 1 82  ? 20.751 4.303   -30.052 1.00 92.27  ? 82  LYS A C     1 
ATOM   654  O  O     . LYS A 1 82  ? 19.979 5.168   -29.620 1.00 86.87  ? 82  LYS A O     1 
ATOM   655  C  CB    . LYS A 1 82  ? 21.339 4.466   -32.483 1.00 103.29 ? 82  LYS A CB    1 
ATOM   656  C  CG    . LYS A 1 82  ? 22.234 5.070   -33.554 1.00 109.95 ? 82  LYS A CG    1 
ATOM   657  C  CD    . LYS A 1 82  ? 21.692 4.781   -34.949 1.00 115.16 ? 82  LYS A CD    1 
ATOM   658  C  CE    . LYS A 1 82  ? 22.452 5.557   -36.015 1.00 117.39 ? 82  LYS A CE    1 
ATOM   659  N  NZ    . LYS A 1 82  ? 23.901 5.215   -36.035 1.00 119.51 ? 82  LYS A NZ    1 
ATOM   660  N  N     . ARG A 1 83  ? 20.683 3.032   -29.663 1.00 82.70  ? 83  ARG A N     1 
ATOM   661  C  CA    . ARG A 1 83  ? 19.648 2.534   -28.770 1.00 87.98  ? 83  ARG A CA    1 
ATOM   662  C  C     . ARG A 1 83  ? 20.116 2.408   -27.326 1.00 82.50  ? 83  ARG A C     1 
ATOM   663  O  O     . ARG A 1 83  ? 19.312 2.059   -26.456 1.00 78.40  ? 83  ARG A O     1 
ATOM   664  C  CB    . ARG A 1 83  ? 19.139 1.180   -29.273 1.00 99.92  ? 83  ARG A CB    1 
ATOM   665  C  CG    . ARG A 1 83  ? 18.700 1.205   -30.731 1.00 101.73 ? 83  ARG A CG    1 
ATOM   666  C  CD    . ARG A 1 83  ? 18.338 -0.181  -31.234 1.00 95.02  ? 83  ARG A CD    1 
ATOM   667  N  NE    . ARG A 1 83  ? 17.950 -0.166  -32.641 1.00 98.95  ? 83  ARG A NE    1 
ATOM   668  C  CZ    . ARG A 1 83  ? 17.587 -1.243  -33.330 1.00 102.77 ? 83  ARG A CZ    1 
ATOM   669  N  NH1   . ARG A 1 83  ? 17.559 -2.432  -32.743 1.00 104.28 ? 83  ARG A NH1   1 
ATOM   670  N  NH2   . ARG A 1 83  ? 17.251 -1.131  -34.608 1.00 103.57 ? 83  ARG A NH2   1 
ATOM   671  N  N     . THR A 1 84  ? 21.389 2.678   -27.052 1.00 83.84  ? 84  THR A N     1 
ATOM   672  C  CA    . THR A 1 84  ? 21.900 2.644   -25.690 1.00 76.72  ? 84  THR A CA    1 
ATOM   673  C  C     . THR A 1 84  ? 21.623 3.974   -24.996 1.00 61.51  ? 84  THR A C     1 
ATOM   674  O  O     . THR A 1 84  ? 21.513 5.021   -25.640 1.00 63.34  ? 84  THR A O     1 
ATOM   675  C  CB    . THR A 1 84  ? 23.401 2.339   -25.693 1.00 75.07  ? 84  THR A CB    1 
ATOM   676  O  OG1   . THR A 1 84  ? 23.654 1.212   -26.541 1.00 82.67  ? 84  THR A OG1   1 
ATOM   677  C  CG2   . THR A 1 84  ? 23.901 2.015   -24.291 1.00 65.94  ? 84  THR A CG2   1 
ATOM   678  N  N     . GLN A 1 85  ? 21.496 3.921   -23.671 1.00 55.31  ? 85  GLN A N     1 
ATOM   679  C  CA    . GLN A 1 85  ? 21.197 5.108   -22.887 1.00 59.45  ? 85  GLN A CA    1 
ATOM   680  C  C     . GLN A 1 85  ? 22.280 6.171   -23.070 1.00 54.71  ? 85  GLN A C     1 
ATOM   681  O  O     . GLN A 1 85  ? 23.376 5.914   -23.573 1.00 51.62  ? 85  GLN A O     1 
ATOM   682  C  CB    . GLN A 1 85  ? 21.081 4.760   -21.404 1.00 59.85  ? 85  GLN A CB    1 
ATOM   683  C  CG    . GLN A 1 85  ? 22.407 4.352   -20.774 1.00 59.26  ? 85  GLN A CG    1 
ATOM   684  C  CD    . GLN A 1 85  ? 22.360 4.341   -19.260 1.00 59.61  ? 85  GLN A CD    1 
ATOM   685  O  OE1   . GLN A 1 85  ? 22.008 3.334   -18.644 1.00 62.17  ? 85  GLN A OE1   1 
ATOM   686  N  NE2   . GLN A 1 85  ? 22.720 5.465   -18.649 1.00 51.61  ? 85  GLN A NE2   1 
ATOM   687  N  N     . ASP A 1 86  ? 21.954 7.384   -22.641 1.00 53.68  ? 86  ASP A N     1 
ATOM   688  C  CA    . ASP A 1 86  ? 22.910 8.478   -22.636 1.00 59.69  ? 86  ASP A CA    1 
ATOM   689  C  C     . ASP A 1 86  ? 23.723 8.446   -21.351 1.00 63.87  ? 86  ASP A C     1 
ATOM   690  O  O     . ASP A 1 86  ? 23.199 8.149   -20.274 1.00 72.51  ? 86  ASP A O     1 
ATOM   691  C  CB    . ASP A 1 86  ? 22.199 9.825   -22.773 1.00 55.01  ? 86  ASP A CB    1 
ATOM   692  C  CG    . ASP A 1 86  ? 21.566 10.013  -24.136 1.00 64.95  ? 86  ASP A CG    1 
ATOM   693  O  OD1   . ASP A 1 86  ? 22.201 9.636   -25.144 1.00 66.91  ? 86  ASP A OD1   1 
ATOM   694  O  OD2   . ASP A 1 86  ? 20.432 10.533  -24.199 1.00 70.62  ? 86  ASP A OD2   1 
ATOM   695  N  N     . PHE A 1 87  ? 25.011 8.736   -21.476 1.00 56.83  ? 87  PHE A N     1 
ATOM   696  C  CA    . PHE A 1 87  ? 25.906 8.856   -20.339 1.00 53.82  ? 87  PHE A CA    1 
ATOM   697  C  C     . PHE A 1 87  ? 26.348 10.303  -20.195 1.00 65.29  ? 87  PHE A C     1 
ATOM   698  O  O     . PHE A 1 87  ? 26.300 11.089  -21.145 1.00 69.66  ? 87  PHE A O     1 
ATOM   699  C  CB    . PHE A 1 87  ? 27.139 7.959   -20.501 1.00 44.40  ? 87  PHE A CB    1 
ATOM   700  C  CG    . PHE A 1 87  ? 26.818 6.503   -20.665 1.00 50.64  ? 87  PHE A CG    1 
ATOM   701  C  CD1   . PHE A 1 87  ? 26.728 5.673   -19.562 1.00 55.91  ? 87  PHE A CD1   1 
ATOM   702  C  CD2   . PHE A 1 87  ? 26.616 5.962   -21.924 1.00 47.24  ? 87  PHE A CD2   1 
ATOM   703  C  CE1   . PHE A 1 87  ? 26.435 4.332   -19.709 1.00 65.40  ? 87  PHE A CE1   1 
ATOM   704  C  CE2   . PHE A 1 87  ? 26.323 4.624   -22.079 1.00 52.38  ? 87  PHE A CE2   1 
ATOM   705  C  CZ    . PHE A 1 87  ? 26.233 3.806   -20.970 1.00 66.15  ? 87  PHE A CZ    1 
ATOM   706  N  N     . TRP A 1 88  ? 26.779 10.655  -18.990 1.00 67.41  ? 88  TRP A N     1 
ATOM   707  C  CA    . TRP A 1 88  ? 27.494 11.903  -18.773 1.00 54.98  ? 88  TRP A CA    1 
ATOM   708  C  C     . TRP A 1 88  ? 28.983 11.592  -18.774 1.00 47.87  ? 88  TRP A C     1 
ATOM   709  O  O     . TRP A 1 88  ? 29.466 10.838  -17.922 1.00 44.03  ? 88  TRP A O     1 
ATOM   710  C  CB    . TRP A 1 88  ? 27.086 12.585  -17.469 1.00 43.42  ? 88  TRP A CB    1 
ATOM   711  C  CG    . TRP A 1 88  ? 27.675 13.960  -17.363 1.00 49.54  ? 88  TRP A CG    1 
ATOM   712  C  CD1   . TRP A 1 88  ? 28.815 14.316  -16.702 1.00 44.07  ? 88  TRP A CD1   1 
ATOM   713  C  CD2   . TRP A 1 88  ? 27.174 15.158  -17.970 1.00 52.66  ? 88  TRP A CD2   1 
ATOM   714  N  NE1   . TRP A 1 88  ? 29.044 15.663  -16.844 1.00 44.72  ? 88  TRP A NE1   1 
ATOM   715  C  CE2   . TRP A 1 88  ? 28.051 16.203  -17.619 1.00 48.10  ? 88  TRP A CE2   1 
ATOM   716  C  CE3   . TRP A 1 88  ? 26.063 15.449  -18.768 1.00 55.11  ? 88  TRP A CE3   1 
ATOM   717  C  CZ2   . TRP A 1 88  ? 27.853 17.517  -18.040 1.00 47.68  ? 88  TRP A CZ2   1 
ATOM   718  C  CZ3   . TRP A 1 88  ? 25.868 16.752  -19.184 1.00 54.37  ? 88  TRP A CZ3   1 
ATOM   719  C  CH2   . TRP A 1 88  ? 26.758 17.770  -18.818 1.00 52.66  ? 88  TRP A CH2   1 
ATOM   720  N  N     . GLU A 1 89  ? 29.698 12.154  -19.741 1.00 41.59  ? 89  GLU A N     1 
ATOM   721  C  CA    . GLU A 1 89  ? 31.131 11.927  -19.835 1.00 52.33  ? 89  GLU A CA    1 
ATOM   722  C  C     . GLU A 1 89  ? 31.844 12.553  -18.645 1.00 52.34  ? 89  GLU A C     1 
ATOM   723  O  O     . GLU A 1 89  ? 31.494 13.648  -18.196 1.00 57.61  ? 89  GLU A O     1 
ATOM   724  C  CB    . GLU A 1 89  ? 31.670 12.502  -21.144 1.00 37.55  ? 89  GLU A CB    1 
ATOM   725  C  CG    . GLU A 1 89  ? 30.959 11.980  -22.381 1.00 38.65  ? 89  GLU A CG    1 
ATOM   726  C  CD    . GLU A 1 89  ? 31.168 10.491  -22.595 1.00 63.93  ? 89  GLU A CD    1 
ATOM   727  O  OE1   . GLU A 1 89  ? 32.145 9.935   -22.048 1.00 52.23  ? 89  GLU A OE1   1 
ATOM   728  O  OE2   . GLU A 1 89  ? 30.354 9.874   -23.313 1.00 66.65  ? 89  GLU A OE2   1 
ATOM   729  N  N     . VAL A 1 90  ? 32.845 11.842  -18.123 1.00 44.97  ? 90  VAL A N     1 
ATOM   730  C  CA    . VAL A 1 90  ? 33.607 12.327  -16.977 1.00 43.04  ? 90  VAL A CA    1 
ATOM   731  C  C     . VAL A 1 90  ? 34.952 12.920  -17.374 1.00 39.10  ? 90  VAL A C     1 
ATOM   732  O  O     . VAL A 1 90  ? 35.618 13.534  -16.524 1.00 39.36  ? 90  VAL A O     1 
ATOM   733  C  CB    . VAL A 1 90  ? 33.816 11.211  -15.931 1.00 41.65  ? 90  VAL A CB    1 
ATOM   734  C  CG1   . VAL A 1 90  ? 32.480 10.779  -15.345 1.00 37.30  ? 90  VAL A CG1   1 
ATOM   735  C  CG2   . VAL A 1 90  ? 34.541 10.028  -16.552 1.00 57.99  ? 90  VAL A CG2   1 
ATOM   736  N  N     . GLN A 1 91  ? 35.371 12.767  -18.628 1.00 35.61  ? 91  GLN A N     1 
ATOM   737  C  CA    . GLN A 1 91  ? 36.638 13.323  -19.100 1.00 43.10  ? 91  GLN A CA    1 
ATOM   738  C  C     . GLN A 1 91  ? 36.401 14.773  -19.503 1.00 43.04  ? 91  GLN A C     1 
ATOM   739  O  O     . GLN A 1 91  ? 35.983 15.060  -20.627 1.00 47.18  ? 91  GLN A O     1 
ATOM   740  C  CB    . GLN A 1 91  ? 37.187 12.503  -20.260 1.00 42.68  ? 91  GLN A CB    1 
ATOM   741  C  CG    . GLN A 1 91  ? 38.655 12.758  -20.547 1.00 51.09  ? 91  GLN A CG    1 
ATOM   742  C  CD    . GLN A 1 91  ? 39.548 12.330  -19.399 1.00 53.61  ? 91  GLN A CD    1 
ATOM   743  O  OE1   . GLN A 1 91  ? 39.398 11.235  -18.856 1.00 51.37  ? 91  GLN A OE1   1 
ATOM   744  N  NE2   . GLN A 1 91  ? 40.480 13.198  -19.018 1.00 45.23  ? 91  GLN A NE2   1 
ATOM   745  N  N     . LEU A 1 92  ? 36.677 15.695  -18.584 1.00 42.43  ? 92  LEU A N     1 
ATOM   746  C  CA    . LEU A 1 92  ? 36.342 17.103  -18.761 1.00 47.29  ? 92  LEU A CA    1 
ATOM   747  C  C     . LEU A 1 92  ? 37.408 17.891  -19.512 1.00 53.48  ? 92  LEU A C     1 
ATOM   748  O  O     . LEU A 1 92  ? 37.263 19.108  -19.660 1.00 59.87  ? 92  LEU A O     1 
ATOM   749  C  CB    . LEU A 1 92  ? 36.095 17.756  -17.398 1.00 33.26  ? 92  LEU A CB    1 
ATOM   750  C  CG    . LEU A 1 92  ? 35.137 17.020  -16.460 1.00 44.72  ? 92  LEU A CG    1 
ATOM   751  C  CD1   . LEU A 1 92  ? 34.899 17.823  -15.191 1.00 33.60  ? 92  LEU A CD1   1 
ATOM   752  C  CD2   . LEU A 1 92  ? 33.823 16.714  -17.163 1.00 42.85  ? 92  LEU A CD2   1 
ATOM   753  N  N     . GLY A 1 93  ? 38.464 17.241  -19.987 1.00 51.38  ? 93  GLY A N     1 
ATOM   754  C  CA    . GLY A 1 93  ? 39.509 17.951  -20.692 1.00 45.12  ? 93  GLY A CA    1 
ATOM   755  C  C     . GLY A 1 93  ? 40.725 17.071  -20.891 1.00 64.92  ? 93  GLY A C     1 
ATOM   756  O  O     . GLY A 1 93  ? 40.707 15.874  -20.593 1.00 54.67  ? 93  GLY A O     1 
ATOM   757  N  N     . ILE A 1 94  ? 41.782 17.696  -21.396 1.00 71.99  ? 94  ILE A N     1 
ATOM   758  C  CA    . ILE A 1 94  ? 43.029 17.023  -21.733 1.00 50.62  ? 94  ILE A CA    1 
ATOM   759  C  C     . ILE A 1 94  ? 44.133 17.609  -20.861 1.00 38.67  ? 94  ILE A C     1 
ATOM   760  O  O     . ILE A 1 94  ? 44.344 18.825  -20.870 1.00 39.11  ? 94  ILE A O     1 
ATOM   761  C  CB    . ILE A 1 94  ? 43.378 17.178  -23.223 1.00 42.16  ? 94  ILE A CB    1 
ATOM   762  C  CG1   . ILE A 1 94  ? 42.190 16.764  -24.100 1.00 40.37  ? 94  ILE A CG1   1 
ATOM   763  C  CG2   . ILE A 1 94  ? 44.625 16.381  -23.571 1.00 36.38  ? 94  ILE A CG2   1 
ATOM   764  C  CD1   . ILE A 1 94  ? 41.655 15.375  -23.811 1.00 43.89  ? 94  ILE A CD1   1 
ATOM   765  N  N     . PRO A 1 95  ? 44.864 16.799  -20.095 1.00 50.77  ? 95  PRO A N     1 
ATOM   766  C  CA    . PRO A 1 95  ? 45.951 17.351  -19.276 1.00 42.38  ? 95  PRO A CA    1 
ATOM   767  C  C     . PRO A 1 95  ? 47.065 17.921  -20.140 1.00 42.44  ? 95  PRO A C     1 
ATOM   768  O  O     . PRO A 1 95  ? 47.371 17.404  -21.217 1.00 40.89  ? 95  PRO A O     1 
ATOM   769  C  CB    . PRO A 1 95  ? 46.431 16.145  -18.460 1.00 38.83  ? 95  PRO A CB    1 
ATOM   770  C  CG    . PRO A 1 95  ? 46.001 14.953  -19.251 1.00 36.04  ? 95  PRO A CG    1 
ATOM   771  C  CD    . PRO A 1 95  ? 44.714 15.345  -19.913 1.00 45.24  ? 95  PRO A CD    1 
ATOM   772  N  N     . HIS A 1 96  ? 47.668 19.007  -19.655 1.00 36.02  ? 96  HIS A N     1 
ATOM   773  C  CA    . HIS A 1 96  ? 48.740 19.666  -20.377 1.00 43.28  ? 96  HIS A CA    1 
ATOM   774  C  C     . HIS A 1 96  ? 50.016 19.674  -19.542 1.00 43.61  ? 96  HIS A C     1 
ATOM   775  O  O     . HIS A 1 96  ? 49.963 19.935  -18.335 1.00 37.98  ? 96  HIS A O     1 
ATOM   776  C  CB    . HIS A 1 96  ? 48.356 21.109  -20.740 1.00 45.43  ? 96  HIS A CB    1 
ATOM   777  C  CG    . HIS A 1 96  ? 49.187 21.692  -21.840 1.00 43.74  ? 96  HIS A CG    1 
ATOM   778  N  ND1   . HIS A 1 96  ? 50.395 22.316  -21.611 1.00 44.71  ? 96  HIS A ND1   1 
ATOM   779  C  CD2   . HIS A 1 96  ? 48.992 21.732  -23.179 1.00 37.81  ? 96  HIS A CD2   1 
ATOM   780  C  CE1   . HIS A 1 96  ? 50.904 22.721  -22.761 1.00 53.18  ? 96  HIS A CE1   1 
ATOM   781  N  NE2   . HIS A 1 96  ? 50.072 22.379  -23.728 1.00 52.49  ? 96  HIS A NE2   1 
ATOM   782  N  N     . PRO A 1 97  ? 51.172 19.400  -20.152 1.00 38.63  ? 97  PRO A N     1 
ATOM   783  C  CA    . PRO A 1 97  ? 52.414 19.317  -19.367 1.00 55.27  ? 97  PRO A CA    1 
ATOM   784  C  C     . PRO A 1 97  ? 52.803 20.619  -18.690 1.00 54.87  ? 97  PRO A C     1 
ATOM   785  O  O     . PRO A 1 97  ? 53.548 20.583  -17.703 1.00 49.75  ? 97  PRO A O     1 
ATOM   786  C  CB    . PRO A 1 97  ? 53.459 18.890  -20.407 1.00 40.76  ? 97  PRO A CB    1 
ATOM   787  C  CG    . PRO A 1 97  ? 52.890 19.323  -21.717 1.00 40.67  ? 97  PRO A CG    1 
ATOM   788  C  CD    . PRO A 1 97  ? 51.405 19.150  -21.584 1.00 39.30  ? 97  PRO A CD    1 
ATOM   789  N  N     . ALA A 1 98  ? 52.322 21.767  -19.179 1.00 52.35  ? 98  ALA A N     1 
ATOM   790  C  CA    . ALA A 1 98  ? 52.629 23.036  -18.529 1.00 48.99  ? 98  ALA A CA    1 
ATOM   791  C  C     . ALA A 1 98  ? 52.011 23.136  -17.141 1.00 48.29  ? 98  ALA A C     1 
ATOM   792  O  O     . ALA A 1 98  ? 52.452 23.966  -16.339 1.00 39.73  ? 98  ALA A O     1 
ATOM   793  C  CB    . ALA A 1 98  ? 52.156 24.204  -19.393 1.00 46.32  ? 98  ALA A CB    1 
ATOM   794  N  N     . GLY A 1 99  ? 51.003 22.319  -16.844 1.00 38.16  ? 99  GLY A N     1 
ATOM   795  C  CA    . GLY A 1 99  ? 50.390 22.258  -15.538 1.00 37.69  ? 99  GLY A CA    1 
ATOM   796  C  C     . GLY A 1 99  ? 51.023 21.279  -14.579 1.00 38.16  ? 99  GLY A C     1 
ATOM   797  O  O     . GLY A 1 99  ? 50.613 21.212  -13.416 1.00 52.94  ? 99  GLY A O     1 
ATOM   798  N  N     . LEU A 1 100 ? 52.008 20.507  -15.028 1.00 41.04  ? 100 LEU A N     1 
ATOM   799  C  CA    . LEU A 1 100 ? 52.729 19.611  -14.139 1.00 39.41  ? 100 LEU A CA    1 
ATOM   800  C  C     . LEU A 1 100 ? 53.722 20.401  -13.299 1.00 40.96  ? 100 LEU A C     1 
ATOM   801  O  O     . LEU A 1 100 ? 54.440 21.264  -13.810 1.00 49.20  ? 100 LEU A O     1 
ATOM   802  C  CB    . LEU A 1 100 ? 53.466 18.533  -14.935 1.00 39.90  ? 100 LEU A CB    1 
ATOM   803  C  CG    . LEU A 1 100 ? 52.650 17.639  -15.870 1.00 44.48  ? 100 LEU A CG    1 
ATOM   804  C  CD1   . LEU A 1 100 ? 53.572 16.752  -16.688 1.00 48.64  ? 100 LEU A CD1   1 
ATOM   805  C  CD2   . LEU A 1 100 ? 51.657 16.797  -15.090 1.00 38.29  ? 100 LEU A CD2   1 
ATOM   806  N  N     . LYS A 1 101 ? 53.751 20.110  -12.006 1.00 43.04  ? 101 LYS A N     1 
ATOM   807  C  CA    . LYS A 1 101 ? 54.722 20.720  -11.114 1.00 47.83  ? 101 LYS A CA    1 
ATOM   808  C  C     . LYS A 1 101 ? 55.994 19.879  -11.076 1.00 51.51  ? 101 LYS A C     1 
ATOM   809  O  O     . LYS A 1 101 ? 56.007 18.708  -11.460 1.00 50.36  ? 101 LYS A O     1 
ATOM   810  C  CB    . LYS A 1 101 ? 54.139 20.874  -9.709  1.00 47.98  ? 101 LYS A CB    1 
ATOM   811  C  CG    . LYS A 1 101 ? 52.838 21.662  -9.672  1.00 61.56  ? 101 LYS A CG    1 
ATOM   812  C  CD    . LYS A 1 101 ? 52.247 21.703  -8.272  1.00 62.16  ? 101 LYS A CD    1 
ATOM   813  C  CE    . LYS A 1 101 ? 50.879 22.365  -8.272  1.00 52.10  ? 101 LYS A CE    1 
ATOM   814  N  NZ    . LYS A 1 101 ? 50.293 22.429  -6.905  1.00 55.49  ? 101 LYS A NZ    1 
ATOM   815  N  N     . LYS A 1 102 ? 57.076 20.501  -10.616 1.00 62.72  ? 102 LYS A N     1 
ATOM   816  C  CA    . LYS A 1 102 ? 58.352 19.805  -10.527 1.00 65.07  ? 102 LYS A CA    1 
ATOM   817  C  C     . LYS A 1 102 ? 58.289 18.728  -9.451  1.00 54.57  ? 102 LYS A C     1 
ATOM   818  O  O     . LYS A 1 102 ? 57.909 18.996  -8.307  1.00 50.33  ? 102 LYS A O     1 
ATOM   819  C  CB    . LYS A 1 102 ? 59.475 20.796  -10.226 1.00 77.46  ? 102 LYS A CB    1 
ATOM   820  C  CG    . LYS A 1 102 ? 60.829 20.149  -9.966  1.00 91.67  ? 102 LYS A CG    1 
ATOM   821  C  CD    . LYS A 1 102 ? 61.310 19.335  -11.160 1.00 99.67  ? 102 LYS A CD    1 
ATOM   822  C  CE    . LYS A 1 102 ? 62.657 18.688  -10.870 1.00 101.69 ? 102 LYS A CE    1 
ATOM   823  N  NZ    . LYS A 1 102 ? 63.118 17.816  -11.986 1.00 98.94  ? 102 LYS A NZ    1 
ATOM   824  N  N     . LYS A 1 103 ? 58.649 17.503  -9.827  1.00 52.30  ? 103 LYS A N     1 
ATOM   825  C  CA    . LYS A 1 103 ? 58.720 16.381  -8.905  1.00 54.36  ? 103 LYS A CA    1 
ATOM   826  C  C     . LYS A 1 103 ? 60.108 15.761  -8.975  1.00 61.75  ? 103 LYS A C     1 
ATOM   827  O  O     . LYS A 1 103 ? 60.758 15.773  -10.025 1.00 76.97  ? 103 LYS A O     1 
ATOM   828  C  CB    . LYS A 1 103 ? 57.661 15.314  -9.221  1.00 46.13  ? 103 LYS A CB    1 
ATOM   829  C  CG    . LYS A 1 103 ? 56.281 15.860  -9.571  1.00 54.55  ? 103 LYS A CG    1 
ATOM   830  C  CD    . LYS A 1 103 ? 55.672 16.673  -8.437  1.00 57.79  ? 103 LYS A CD    1 
ATOM   831  C  CE    . LYS A 1 103 ? 55.329 15.810  -7.235  1.00 65.11  ? 103 LYS A CE    1 
ATOM   832  N  NZ    . LYS A 1 103 ? 54.693 16.613  -6.151  1.00 62.30  ? 103 LYS A NZ    1 
ATOM   833  N  N     . LYS A 1 104 ? 60.560 15.217  -7.843  1.00 51.20  ? 104 LYS A N     1 
ATOM   834  C  CA    . LYS A 1 104 ? 61.877 14.590  -7.805  1.00 55.01  ? 104 LYS A CA    1 
ATOM   835  C  C     . LYS A 1 104 ? 61.918 13.324  -8.650  1.00 56.32  ? 104 LYS A C     1 
ATOM   836  O  O     . LYS A 1 104 ? 62.900 13.075  -9.360  1.00 49.91  ? 104 LYS A O     1 
ATOM   837  C  CB    . LYS A 1 104 ? 62.273 14.274  -6.364  1.00 58.08  ? 104 LYS A CB    1 
ATOM   838  C  CG    . LYS A 1 104 ? 62.683 15.478  -5.542  1.00 76.27  ? 104 LYS A CG    1 
ATOM   839  C  CD    . LYS A 1 104 ? 63.394 15.037  -4.276  1.00 79.26  ? 104 LYS A CD    1 
ATOM   840  C  CE    . LYS A 1 104 ? 64.578 14.142  -4.604  1.00 66.97  ? 104 LYS A CE    1 
ATOM   841  N  NZ    . LYS A 1 104 ? 65.314 13.726  -3.381  1.00 61.37  ? 104 LYS A NZ    1 
ATOM   842  N  N     . SER A 1 105 ? 60.867 12.511  -8.586  1.00 47.40  ? 105 SER A N     1 
ATOM   843  C  CA    . SER A 1 105 ? 60.839 11.220  -9.258  1.00 47.00  ? 105 SER A CA    1 
ATOM   844  C  C     . SER A 1 105 ? 59.527 11.071  -10.011 1.00 45.41  ? 105 SER A C     1 
ATOM   845  O  O     . SER A 1 105 ? 58.458 11.369  -9.468  1.00 44.41  ? 105 SER A O     1 
ATOM   846  C  CB    . SER A 1 105 ? 61.015 10.082  -8.253  1.00 47.20  ? 105 SER A CB    1 
ATOM   847  O  OG    . SER A 1 105 ? 62.141 10.305  -7.421  1.00 48.74  ? 105 SER A OG    1 
ATOM   848  N  N     . VAL A 1 106 ? 59.612 10.605  -11.253 1.00 48.71  ? 106 VAL A N     1 
ATOM   849  C  CA    . VAL A 1 106 ? 58.465 10.496  -12.144 1.00 44.14  ? 106 VAL A CA    1 
ATOM   850  C  C     . VAL A 1 106 ? 58.437 9.097   -12.744 1.00 46.42  ? 106 VAL A C     1 
ATOM   851  O  O     . VAL A 1 106 ? 59.482 8.542   -13.100 1.00 45.84  ? 106 VAL A O     1 
ATOM   852  C  CB    . VAL A 1 106 ? 58.515 11.571  -13.253 1.00 44.28  ? 106 VAL A CB    1 
ATOM   853  C  CG1   . VAL A 1 106 ? 57.537 11.251  -14.372 1.00 46.69  ? 106 VAL A CG1   1 
ATOM   854  C  CG2   . VAL A 1 106 ? 58.229 12.946  -12.671 1.00 44.06  ? 106 VAL A CG2   1 
ATOM   855  N  N     . THR A 1 107 ? 57.238 8.523   -12.842 1.00 51.89  ? 107 THR A N     1 
ATOM   856  C  CA    . THR A 1 107 ? 57.029 7.245   -13.507 1.00 42.99  ? 107 THR A CA    1 
ATOM   857  C  C     . THR A 1 107 ? 55.808 7.353   -14.407 1.00 55.24  ? 107 THR A C     1 
ATOM   858  O  O     . THR A 1 107 ? 54.788 7.924   -14.012 1.00 43.99  ? 107 THR A O     1 
ATOM   859  C  CB    . THR A 1 107 ? 56.832 6.102   -12.500 1.00 42.81  ? 107 THR A CB    1 
ATOM   860  O  OG1   . THR A 1 107 ? 57.939 6.063   -11.592 1.00 45.87  ? 107 THR A OG1   1 
ATOM   861  C  CG2   . THR A 1 107 ? 56.731 4.768   -13.220 1.00 43.02  ? 107 THR A CG2   1 
ATOM   862  N  N     . VAL A 1 108 ? 55.920 6.812   -15.617 1.00 62.94  ? 108 VAL A N     1 
ATOM   863  C  CA    . VAL A 1 108 ? 54.826 6.787   -16.581 1.00 51.64  ? 108 VAL A CA    1 
ATOM   864  C  C     . VAL A 1 108 ? 54.588 5.333   -16.961 1.00 51.78  ? 108 VAL A C     1 
ATOM   865  O  O     . VAL A 1 108 ? 55.410 4.722   -17.656 1.00 57.89  ? 108 VAL A O     1 
ATOM   866  C  CB    . VAL A 1 108 ? 55.125 7.642   -17.820 1.00 46.79  ? 108 VAL A CB    1 
ATOM   867  C  CG1   . VAL A 1 108 ? 54.017 7.490   -18.849 1.00 42.09  ? 108 VAL A CG1   1 
ATOM   868  C  CG2   . VAL A 1 108 ? 55.294 9.101   -17.426 1.00 42.20  ? 108 VAL A CG2   1 
ATOM   869  N  N     . LEU A 1 109 ? 53.466 4.776   -16.508 1.00 55.66  ? 109 LEU A N     1 
ATOM   870  C  CA    . LEU A 1 109 ? 53.125 3.385   -16.756 1.00 44.48  ? 109 LEU A CA    1 
ATOM   871  C  C     . LEU A 1 109 ? 51.698 3.288   -17.278 1.00 44.48  ? 109 LEU A C     1 
ATOM   872  O  O     . LEU A 1 109 ? 50.828 4.084   -16.914 1.00 46.72  ? 109 LEU A O     1 
ATOM   873  C  CB    . LEU A 1 109 ? 53.285 2.535   -15.484 1.00 47.96  ? 109 LEU A CB    1 
ATOM   874  C  CG    . LEU A 1 109 ? 52.653 3.065   -14.193 1.00 60.86  ? 109 LEU A CG    1 
ATOM   875  C  CD1   . LEU A 1 109 ? 51.201 2.626   -14.045 1.00 72.67  ? 109 LEU A CD1   1 
ATOM   876  C  CD2   . LEU A 1 109 ? 53.467 2.635   -12.985 1.00 65.80  ? 109 LEU A CD2   1 
ATOM   877  N  N     . ASP A 1 110 ? 51.468 2.299   -18.135 1.00 49.38  ? 110 ASP A N     1 
ATOM   878  C  CA    . ASP A 1 110 ? 50.161 2.055   -18.724 1.00 56.92  ? 110 ASP A CA    1 
ATOM   879  C  C     . ASP A 1 110 ? 49.572 0.755   -18.190 1.00 61.10  ? 110 ASP A C     1 
ATOM   880  O  O     . ASP A 1 110 ? 50.287 -0.134  -17.718 1.00 58.75  ? 110 ASP A O     1 
ATOM   881  C  CB    . ASP A 1 110 ? 50.249 2.000   -20.253 1.00 64.43  ? 110 ASP A CB    1 
ATOM   882  C  CG    . ASP A 1 110 ? 50.548 3.351   -20.870 1.00 69.88  ? 110 ASP A CG    1 
ATOM   883  O  OD1   . ASP A 1 110 ? 51.740 3.697   -21.002 1.00 77.15  ? 110 ASP A OD1   1 
ATOM   884  O  OD2   . ASP A 1 110 ? 49.590 4.065   -21.230 1.00 80.62  ? 110 ASP A OD2   1 
ATOM   885  N  N     . VAL A 1 111 ? 48.250 0.661   -18.273 1.00 62.23  ? 111 VAL A N     1 
ATOM   886  C  CA    . VAL A 1 111 ? 47.521 -0.535  -17.870 1.00 51.27  ? 111 VAL A CA    1 
ATOM   887  C  C     . VAL A 1 111 ? 47.322 -1.421  -19.094 1.00 46.43  ? 111 VAL A C     1 
ATOM   888  O  O     . VAL A 1 111 ? 46.903 -0.946  -20.157 1.00 52.55  ? 111 VAL A O     1 
ATOM   889  C  CB    . VAL A 1 111 ? 46.174 -0.166  -17.226 1.00 51.92  ? 111 VAL A CB    1 
ATOM   890  C  CG1   . VAL A 1 111 ? 45.279 -1.391  -17.109 1.00 63.89  ? 111 VAL A CG1   1 
ATOM   891  C  CG2   . VAL A 1 111 ? 46.400 0.465   -15.859 1.00 48.05  ? 111 VAL A CG2   1 
ATOM   892  N  N     . GLY A 1 112 ? 47.629 -2.709  -18.949 1.00 44.75  ? 112 GLY A N     1 
ATOM   893  C  CA    . GLY A 1 112 ? 47.478 -3.652  -20.041 1.00 45.38  ? 112 GLY A CA    1 
ATOM   894  C  C     . GLY A 1 112 ? 46.056 -4.170  -20.126 1.00 51.80  ? 112 GLY A C     1 
ATOM   895  O  O     . GLY A 1 112 ? 45.461 -4.551  -19.114 1.00 54.90  ? 112 GLY A O     1 
ATOM   896  N  N     . ASP A 1 113 ? 45.517 -4.190  -21.346 1.00 58.70  ? 113 ASP A N     1 
ATOM   897  C  CA    . ASP A 1 113 ? 44.150 -4.635  -21.618 1.00 68.71  ? 113 ASP A CA    1 
ATOM   898  C  C     . ASP A 1 113 ? 43.149 -3.892  -20.730 1.00 67.88  ? 113 ASP A C     1 
ATOM   899  O  O     . ASP A 1 113 ? 42.515 -4.454  -19.838 1.00 74.38  ? 113 ASP A O     1 
ATOM   900  C  CB    . ASP A 1 113 ? 44.027 -6.152  -21.445 1.00 77.04  ? 113 ASP A CB    1 
ATOM   901  C  CG    . ASP A 1 113 ? 44.521 -6.919  -22.656 1.00 86.06  ? 113 ASP A CG    1 
ATOM   902  O  OD1   . ASP A 1 113 ? 44.176 -6.525  -23.790 1.00 82.65  ? 113 ASP A OD1   1 
ATOM   903  O  OD2   . ASP A 1 113 ? 45.255 -7.913  -22.474 1.00 97.88  ? 113 ASP A OD2   1 
ATOM   904  N  N     . ALA A 1 114 ? 43.032 -2.595  -21.011 1.00 65.91  ? 114 ALA A N     1 
ATOM   905  C  CA    . ALA A 1 114 ? 42.176 -1.707  -20.234 1.00 64.77  ? 114 ALA A CA    1 
ATOM   906  C  C     . ALA A 1 114 ? 40.718 -2.150  -20.268 1.00 60.86  ? 114 ALA A C     1 
ATOM   907  O  O     . ALA A 1 114 ? 40.198 -2.660  -19.270 1.00 47.24  ? 114 ALA A O     1 
ATOM   908  C  CB    . ALA A 1 114 ? 42.303 -0.271  -20.744 1.00 66.57  ? 114 ALA A CB    1 
ATOM   909  N  N     . TYR A 1 115 ? 40.055 -1.958  -21.414 1.00 54.97  ? 115 TYR A N     1 
ATOM   910  C  CA    . TYR A 1 115 ? 38.636 -2.288  -21.525 1.00 49.50  ? 115 TYR A CA    1 
ATOM   911  C  C     . TYR A 1 115 ? 38.365 -3.739  -21.148 1.00 53.90  ? 115 TYR A C     1 
ATOM   912  O  O     . TYR A 1 115 ? 37.405 -4.032  -20.425 1.00 53.99  ? 115 TYR A O     1 
ATOM   913  C  CB    . TYR A 1 115 ? 38.137 -2.026  -22.946 1.00 50.41  ? 115 TYR A CB    1 
ATOM   914  C  CG    . TYR A 1 115 ? 37.912 -0.572  -23.298 1.00 49.39  ? 115 TYR A CG    1 
ATOM   915  C  CD1   . TYR A 1 115 ? 38.002 0.426   -22.337 1.00 48.32  ? 115 TYR A CD1   1 
ATOM   916  C  CD2   . TYR A 1 115 ? 37.594 -0.203  -24.597 1.00 51.86  ? 115 TYR A CD2   1 
ATOM   917  C  CE1   . TYR A 1 115 ? 37.788 1.752   -22.667 1.00 54.72  ? 115 TYR A CE1   1 
ATOM   918  C  CE2   . TYR A 1 115 ? 37.381 1.116   -24.936 1.00 53.09  ? 115 TYR A CE2   1 
ATOM   919  C  CZ    . TYR A 1 115 ? 37.480 2.090   -23.969 1.00 57.25  ? 115 TYR A CZ    1 
ATOM   920  O  OH    . TYR A 1 115 ? 37.266 3.406   -24.309 1.00 55.42  ? 115 TYR A OH    1 
ATOM   921  N  N     . PHE A 1 116 ? 39.198 -4.660  -21.624 1.00 53.25  ? 116 PHE A N     1 
ATOM   922  C  CA    . PHE A 1 116 ? 38.939 -6.085  -21.467 1.00 54.21  ? 116 PHE A CA    1 
ATOM   923  C  C     . PHE A 1 116 ? 39.240 -6.598  -20.062 1.00 55.43  ? 116 PHE A C     1 
ATOM   924  O  O     . PHE A 1 116 ? 39.226 -7.815  -19.847 1.00 58.88  ? 116 PHE A O     1 
ATOM   925  C  CB    . PHE A 1 116 ? 39.739 -6.879  -22.505 1.00 60.70  ? 116 PHE A CB    1 
ATOM   926  C  CG    . PHE A 1 116 ? 39.414 -6.513  -23.931 1.00 73.50  ? 116 PHE A CG    1 
ATOM   927  C  CD1   . PHE A 1 116 ? 38.220 -5.880  -24.245 1.00 76.45  ? 116 PHE A CD1   1 
ATOM   928  C  CD2   . PHE A 1 116 ? 40.302 -6.800  -24.956 1.00 82.24  ? 116 PHE A CD2   1 
ATOM   929  C  CE1   . PHE A 1 116 ? 37.919 -5.538  -25.550 1.00 78.67  ? 116 PHE A CE1   1 
ATOM   930  C  CE2   . PHE A 1 116 ? 40.005 -6.461  -26.266 1.00 85.11  ? 116 PHE A CE2   1 
ATOM   931  C  CZ    . PHE A 1 116 ? 38.812 -5.829  -26.562 1.00 82.86  ? 116 PHE A CZ    1 
ATOM   932  N  N     . SER A 1 117 ? 39.502 -5.706  -19.105 1.00 49.11  ? 117 SER A N     1 
ATOM   933  C  CA    . SER A 1 117 ? 39.705 -6.087  -17.716 1.00 49.95  ? 117 SER A CA    1 
ATOM   934  C  C     . SER A 1 117 ? 38.596 -5.606  -16.791 1.00 51.75  ? 117 SER A C     1 
ATOM   935  O  O     . SER A 1 117 ? 38.603 -5.965  -15.609 1.00 58.62  ? 117 SER A O     1 
ATOM   936  C  CB    . SER A 1 117 ? 41.049 -5.549  -17.202 1.00 57.64  ? 117 SER A CB    1 
ATOM   937  O  OG    . SER A 1 117 ? 42.137 -6.138  -17.893 1.00 74.57  ? 117 SER A OG    1 
ATOM   938  N  N     . VAL A 1 118 ? 37.657 -4.812  -17.288 1.00 49.38  ? 118 VAL A N     1 
ATOM   939  C  CA    . VAL A 1 118 ? 36.590 -4.223  -16.485 1.00 51.70  ? 118 VAL A CA    1 
ATOM   940  C  C     . VAL A 1 118 ? 35.294 -4.957  -16.809 1.00 56.89  ? 118 VAL A C     1 
ATOM   941  O  O     . VAL A 1 118 ? 34.891 -4.999  -17.979 1.00 62.97  ? 118 VAL A O     1 
ATOM   942  C  CB    . VAL A 1 118 ? 36.452 -2.715  -16.748 1.00 51.55  ? 118 VAL A CB    1 
ATOM   943  C  CG1   . VAL A 1 118 ? 35.307 -2.138  -15.935 1.00 46.46  ? 118 VAL A CG1   1 
ATOM   944  C  CG2   . VAL A 1 118 ? 37.758 -2.002  -16.425 1.00 52.00  ? 118 VAL A CG2   1 
ATOM   945  N  N     . PRO A 1 119 ? 34.609 -5.533  -15.823 1.00 54.47  ? 119 PRO A N     1 
ATOM   946  C  CA    . PRO A 1 119 ? 33.410 -6.320  -16.124 1.00 55.89  ? 119 PRO A CA    1 
ATOM   947  C  C     . PRO A 1 119 ? 32.277 -5.450  -16.645 1.00 61.66  ? 119 PRO A C     1 
ATOM   948  O  O     . PRO A 1 119 ? 32.155 -4.270  -16.309 1.00 52.65  ? 119 PRO A O     1 
ATOM   949  C  CB    . PRO A 1 119 ? 33.050 -6.947  -14.773 1.00 50.09  ? 119 PRO A CB    1 
ATOM   950  C  CG    . PRO A 1 119 ? 33.596 -5.987  -13.770 1.00 56.69  ? 119 PRO A CG    1 
ATOM   951  C  CD    . PRO A 1 119 ? 34.867 -5.449  -14.375 1.00 52.78  ? 119 PRO A CD    1 
ATOM   952  N  N     . LEU A 1 120 ? 31.447 -6.059  -17.484 1.00 72.44  ? 120 LEU A N     1 
ATOM   953  C  CA    . LEU A 1 120 ? 30.277 -5.415  -18.057 1.00 61.50  ? 120 LEU A CA    1 
ATOM   954  C  C     . LEU A 1 120 ? 29.023 -5.877  -17.325 1.00 64.40  ? 120 LEU A C     1 
ATOM   955  O  O     . LEU A 1 120 ? 28.965 -6.994  -16.805 1.00 67.23  ? 120 LEU A O     1 
ATOM   956  C  CB    . LEU A 1 120 ? 30.166 -5.732  -19.551 1.00 60.26  ? 120 LEU A CB    1 
ATOM   957  C  CG    . LEU A 1 120 ? 29.030 -5.091  -20.350 1.00 65.96  ? 120 LEU A CG    1 
ATOM   958  C  CD1   . LEU A 1 120 ? 29.176 -3.578  -20.377 1.00 62.73  ? 120 LEU A CD1   1 
ATOM   959  C  CD2   . LEU A 1 120 ? 28.983 -5.658  -21.761 1.00 74.90  ? 120 LEU A CD2   1 
ATOM   960  N  N     . ASP A 1 121 ? 28.023 -4.996  -17.281 1.00 65.11  ? 121 ASP A N     1 
ATOM   961  C  CA    . ASP A 1 121 ? 26.749 -5.315  -16.646 1.00 68.41  ? 121 ASP A CA    1 
ATOM   962  C  C     . ASP A 1 121 ? 26.162 -6.590  -17.237 1.00 71.29  ? 121 ASP A C     1 
ATOM   963  O  O     . ASP A 1 121 ? 26.066 -6.736  -18.459 1.00 78.01  ? 121 ASP A O     1 
ATOM   964  C  CB    . ASP A 1 121 ? 25.776 -4.147  -16.822 1.00 68.75  ? 121 ASP A CB    1 
ATOM   965  C  CG    . ASP A 1 121 ? 24.466 -4.362  -16.090 1.00 76.30  ? 121 ASP A CG    1 
ATOM   966  O  OD1   . ASP A 1 121 ? 24.346 -3.902  -14.935 1.00 72.95  ? 121 ASP A OD1   1 
ATOM   967  O  OD2   . ASP A 1 121 ? 23.554 -4.987  -16.671 1.00 88.96  ? 121 ASP A OD2   1 
ATOM   968  N  N     . GLU A 1 122 ? 25.771 -7.518  -16.358 1.00 73.78  ? 122 GLU A N     1 
ATOM   969  C  CA    . GLU A 1 122 ? 25.318 -8.830  -16.813 1.00 84.51  ? 122 GLU A CA    1 
ATOM   970  C  C     . GLU A 1 122 ? 24.039 -8.729  -17.637 1.00 90.42  ? 122 GLU A C     1 
ATOM   971  O  O     . GLU A 1 122 ? 23.900 -9.405  -18.663 1.00 95.91  ? 122 GLU A O     1 
ATOM   972  C  CB    . GLU A 1 122 ? 25.112 -9.761  -15.618 1.00 83.56  ? 122 GLU A CB    1 
ATOM   973  C  CG    . GLU A 1 122 ? 26.391 -10.102 -14.868 1.00 88.72  ? 122 GLU A CG    1 
ATOM   974  C  CD    . GLU A 1 122 ? 26.169 -11.117 -13.763 1.00 85.47  ? 122 GLU A CD    1 
ATOM   975  O  OE1   . GLU A 1 122 ? 25.030 -11.612 -13.628 1.00 94.63  ? 122 GLU A OE1   1 
ATOM   976  O  OE2   . GLU A 1 122 ? 27.134 -11.419 -13.029 1.00 74.68  ? 122 GLU A OE2   1 
ATOM   977  N  N     . ASP A 1 123 ? 23.094 -7.890  -17.208 1.00 85.83  ? 123 ASP A N     1 
ATOM   978  C  CA    . ASP A 1 123 ? 21.837 -7.751  -17.934 1.00 86.43  ? 123 ASP A CA    1 
ATOM   979  C  C     . ASP A 1 123 ? 22.008 -7.078  -19.289 1.00 80.68  ? 123 ASP A C     1 
ATOM   980  O  O     . ASP A 1 123 ? 21.075 -7.110  -20.098 1.00 80.94  ? 123 ASP A O     1 
ATOM   981  C  CB    . ASP A 1 123 ? 20.828 -6.967  -17.093 1.00 93.72  ? 123 ASP A CB    1 
ATOM   982  C  CG    . ASP A 1 123 ? 20.449 -7.689  -15.815 1.00 101.79 ? 123 ASP A CG    1 
ATOM   983  O  OD1   . ASP A 1 123 ? 20.399 -8.937  -15.827 1.00 105.81 ? 123 ASP A OD1   1 
ATOM   984  O  OD2   . ASP A 1 123 ? 20.200 -7.007  -14.799 1.00 101.13 ? 123 ASP A OD2   1 
ATOM   985  N  N     . PHE A 1 124 ? 23.169 -6.479  -19.556 1.00 72.86  ? 124 PHE A N     1 
ATOM   986  C  CA    . PHE A 1 124 ? 23.439 -5.798  -20.813 1.00 74.40  ? 124 PHE A CA    1 
ATOM   987  C  C     . PHE A 1 124 ? 24.262 -6.640  -21.781 1.00 72.54  ? 124 PHE A C     1 
ATOM   988  O  O     . PHE A 1 124 ? 24.352 -6.288  -22.962 1.00 81.11  ? 124 PHE A O     1 
ATOM   989  C  CB    . PHE A 1 124 ? 24.164 -4.471  -20.538 1.00 59.00  ? 124 PHE A CB    1 
ATOM   990  C  CG    . PHE A 1 124 ? 24.090 -3.483  -21.669 1.00 68.18  ? 124 PHE A CG    1 
ATOM   991  C  CD1   . PHE A 1 124 ? 22.990 -2.654  -21.811 1.00 74.44  ? 124 PHE A CD1   1 
ATOM   992  C  CD2   . PHE A 1 124 ? 25.131 -3.366  -22.575 1.00 73.82  ? 124 PHE A CD2   1 
ATOM   993  C  CE1   . PHE A 1 124 ? 22.923 -1.738  -22.844 1.00 71.06  ? 124 PHE A CE1   1 
ATOM   994  C  CE2   . PHE A 1 124 ? 25.069 -2.452  -23.612 1.00 71.59  ? 124 PHE A CE2   1 
ATOM   995  C  CZ    . PHE A 1 124 ? 23.964 -1.637  -23.746 1.00 65.95  ? 124 PHE A CZ    1 
ATOM   996  N  N     . ARG A 1 125 ? 24.848 -7.747  -21.315 1.00 62.65  ? 125 ARG A N     1 
ATOM   997  C  CA    . ARG A 1 125 ? 25.707 -8.566  -22.166 1.00 73.81  ? 125 ARG A CA    1 
ATOM   998  C  C     . ARG A 1 125 ? 24.951 -9.198  -23.328 1.00 83.51  ? 125 ARG A C     1 
ATOM   999  O  O     . ARG A 1 125 ? 25.582 -9.614  -24.305 1.00 91.32  ? 125 ARG A O     1 
ATOM   1000 C  CB    . ARG A 1 125 ? 26.383 -9.658  -21.332 1.00 76.26  ? 125 ARG A CB    1 
ATOM   1001 C  CG    . ARG A 1 125 ? 27.266 -9.130  -20.211 1.00 74.04  ? 125 ARG A CG    1 
ATOM   1002 C  CD    . ARG A 1 125 ? 27.839 -10.254 -19.358 1.00 66.21  ? 125 ARG A CD    1 
ATOM   1003 N  NE    . ARG A 1 125 ? 28.603 -9.736  -18.225 1.00 63.84  ? 125 ARG A NE    1 
ATOM   1004 C  CZ    . ARG A 1 125 ? 29.163 -10.492 -17.286 1.00 66.16  ? 125 ARG A CZ    1 
ATOM   1005 N  NH1   . ARG A 1 125 ? 29.051 -11.813 -17.337 1.00 60.39  ? 125 ARG A NH1   1 
ATOM   1006 N  NH2   . ARG A 1 125 ? 29.837 -9.927  -16.294 1.00 56.80  ? 125 ARG A NH2   1 
ATOM   1007 N  N     . LYS A 1 126 ? 23.620 -9.283  -23.243 1.00 87.73  ? 126 LYS A N     1 
ATOM   1008 C  CA    . LYS A 1 126 ? 22.842 -9.881  -24.325 1.00 96.37  ? 126 LYS A CA    1 
ATOM   1009 C  C     . LYS A 1 126 ? 23.044 -9.130  -25.635 1.00 97.15  ? 126 LYS A C     1 
ATOM   1010 O  O     . LYS A 1 126 ? 23.248 -9.744  -26.689 1.00 104.80 ? 126 LYS A O     1 
ATOM   1011 C  CB    . LYS A 1 126 ? 21.358 -9.900  -23.956 1.00 97.77  ? 126 LYS A CB    1 
ATOM   1012 C  CG    . LYS A 1 126 ? 21.068 -10.278 -22.517 1.00 91.80  ? 126 LYS A CG    1 
ATOM   1013 C  CD    . LYS A 1 126 ? 19.625 -9.965  -22.160 1.00 88.78  ? 126 LYS A CD    1 
ATOM   1014 C  CE    . LYS A 1 126 ? 19.369 -10.170 -20.677 1.00 92.76  ? 126 LYS A CE    1 
ATOM   1015 N  NZ    . LYS A 1 126 ? 18.013 -9.704  -20.275 1.00 102.81 ? 126 LYS A NZ    1 
ATOM   1016 N  N     . TYR A 1 127 ? 22.998 -7.800  -25.586 1.00 84.99  ? 127 TYR A N     1 
ATOM   1017 C  CA    . TYR A 1 127 ? 23.054 -6.980  -26.788 1.00 89.74  ? 127 TYR A CA    1 
ATOM   1018 C  C     . TYR A 1 127 ? 24.450 -6.887  -27.389 1.00 88.52  ? 127 TYR A C     1 
ATOM   1019 O  O     . TYR A 1 127 ? 24.583 -6.434  -28.531 1.00 94.22  ? 127 TYR A O     1 
ATOM   1020 C  CB    . TYR A 1 127 ? 22.526 -5.577  -26.475 1.00 93.23  ? 127 TYR A CB    1 
ATOM   1021 C  CG    . TYR A 1 127 ? 21.357 -5.587  -25.516 1.00 97.96  ? 127 TYR A CG    1 
ATOM   1022 C  CD1   . TYR A 1 127 ? 20.093 -5.979  -25.936 1.00 105.34 ? 127 TYR A CD1   1 
ATOM   1023 C  CD2   . TYR A 1 127 ? 21.520 -5.217  -24.188 1.00 95.26  ? 127 TYR A CD2   1 
ATOM   1024 C  CE1   . TYR A 1 127 ? 19.023 -5.998  -25.062 1.00 108.87 ? 127 TYR A CE1   1 
ATOM   1025 C  CE2   . TYR A 1 127 ? 20.456 -5.230  -23.306 1.00 98.02  ? 127 TYR A CE2   1 
ATOM   1026 C  CZ    . TYR A 1 127 ? 19.210 -5.622  -23.749 1.00 105.56 ? 127 TYR A CZ    1 
ATOM   1027 O  OH    . TYR A 1 127 ? 18.146 -5.637  -22.875 1.00 109.89 ? 127 TYR A OH    1 
ATOM   1028 N  N     . THR A 1 128 ? 25.486 -7.305  -26.663 1.00 80.99  ? 128 THR A N     1 
ATOM   1029 C  CA    . THR A 1 128 ? 26.855 -7.267  -27.157 1.00 77.87  ? 128 THR A CA    1 
ATOM   1030 C  C     . THR A 1 128 ? 27.229 -8.516  -27.948 1.00 87.09  ? 128 THR A C     1 
ATOM   1031 O  O     . THR A 1 128 ? 28.419 -8.835  -28.060 1.00 91.08  ? 128 THR A O     1 
ATOM   1032 C  CB    . THR A 1 128 ? 27.832 -7.074  -25.995 1.00 65.45  ? 128 THR A CB    1 
ATOM   1033 O  OG1   . THR A 1 128 ? 27.757 -8.202  -25.114 1.00 68.00  ? 128 THR A OG1   1 
ATOM   1034 C  CG2   . THR A 1 128 ? 27.492 -5.812  -25.217 1.00 60.15  ? 128 THR A CG2   1 
ATOM   1035 N  N     . ALA A 1 129 ? 26.246 -9.222  -28.500 1.00 93.06  ? 129 ALA A N     1 
ATOM   1036 C  CA    . ALA A 1 129 ? 26.501 -10.467 -29.207 1.00 92.14  ? 129 ALA A CA    1 
ATOM   1037 C  C     . ALA A 1 129 ? 27.119 -10.205 -30.577 1.00 91.18  ? 129 ALA A C     1 
ATOM   1038 O  O     . ALA A 1 129 ? 26.818 -9.210  -31.242 1.00 83.14  ? 129 ALA A O     1 
ATOM   1039 C  CB    . ALA A 1 129 ? 25.208 -11.265 -29.367 1.00 74.71  ? 129 ALA A CB    1 
ATOM   1040 N  N     . PHE A 1 130 ? 27.990 -11.122 -30.995 1.00 93.19  ? 130 PHE A N     1 
ATOM   1041 C  CA    . PHE A 1 130 ? 28.634 -11.044 -32.298 1.00 97.67  ? 130 PHE A CA    1 
ATOM   1042 C  C     . PHE A 1 130 ? 28.989 -12.451 -32.756 0.46 99.94  ? 130 PHE A C     1 
ATOM   1043 O  O     . PHE A 1 130 ? 29.289 -13.327 -31.940 0.63 93.41  ? 130 PHE A O     1 
ATOM   1044 C  CB    . PHE A 1 130 ? 29.889 -10.160 -32.259 1.00 88.52  ? 130 PHE A CB    1 
ATOM   1045 C  CG    . PHE A 1 130 ? 30.983 -10.692 -31.376 0.34 78.86  ? 130 PHE A CG    1 
ATOM   1046 C  CD1   . PHE A 1 130 ? 30.983 -10.430 -30.015 0.84 73.66  ? 130 PHE A CD1   1 
ATOM   1047 C  CD2   . PHE A 1 130 ? 32.016 -11.449 -31.907 0.82 78.59  ? 130 PHE A CD2   1 
ATOM   1048 C  CE1   . PHE A 1 130 ? 31.988 -10.917 -29.201 0.88 77.30  ? 130 PHE A CE1   1 
ATOM   1049 C  CE2   . PHE A 1 130 ? 33.023 -11.939 -31.097 0.47 77.89  ? 130 PHE A CE2   1 
ATOM   1050 C  CZ    . PHE A 1 130 ? 33.008 -11.673 -29.743 0.93 77.39  ? 130 PHE A CZ    1 
ATOM   1051 N  N     . THR A 1 131 ? 28.951 -12.659 -34.068 0.95 109.35 ? 131 THR A N     1 
ATOM   1052 C  CA    . THR A 1 131 ? 29.296 -13.954 -34.645 1.00 125.98 ? 131 THR A CA    1 
ATOM   1053 C  C     . THR A 1 131 ? 30.702 -13.929 -35.235 0.95 131.40 ? 131 THR A C     1 
ATOM   1054 O  O     . THR A 1 131 ? 30.974 -13.191 -36.182 0.95 134.58 ? 131 THR A O     1 
ATOM   1055 C  CB    . THR A 1 131 ? 28.297 -14.376 -35.740 0.95 129.15 ? 131 THR A CB    1 
ATOM   1056 O  OG1   . THR A 1 131 ? 26.983 -14.479 -35.179 0.95 129.79 ? 131 THR A OG1   1 
ATOM   1057 C  CG2   . THR A 1 131 ? 28.696 -15.719 -36.335 0.95 128.17 ? 131 THR A CG2   1 
ATOM   1058 N  N     . ARG A 1 143 ? 30.011 -17.848 -32.316 1.00 93.79  ? 143 ARG A N     1 
ATOM   1059 C  CA    . ARG A 1 143 ? 29.266 -16.759 -31.695 1.00 96.19  ? 143 ARG A CA    1 
ATOM   1060 C  C     . ARG A 1 143 ? 29.654 -16.582 -30.231 1.00 104.93 ? 143 ARG A C     1 
ATOM   1061 O  O     . ARG A 1 143 ? 29.659 -17.542 -29.460 1.00 115.21 ? 143 ARG A O     1 
ATOM   1062 C  CB    . ARG A 1 143 ? 27.760 -17.006 -31.801 1.00 97.87  ? 143 ARG A CB    1 
ATOM   1063 C  CG    . ARG A 1 143 ? 27.233 -17.148 -33.217 1.00 98.73  ? 143 ARG A CG    1 
ATOM   1064 C  CD    . ARG A 1 143 ? 25.715 -17.106 -33.220 1.00 102.15 ? 143 ARG A CD    1 
ATOM   1065 N  NE    . ARG A 1 143 ? 25.215 -15.813 -32.764 1.00 109.44 ? 143 ARG A NE    1 
ATOM   1066 C  CZ    . ARG A 1 143 ? 23.960 -15.582 -32.389 1.00 107.18 ? 143 ARG A CZ    1 
ATOM   1067 N  NH1   . ARG A 1 143 ? 23.069 -16.565 -32.406 1.00 108.06 ? 143 ARG A NH1   1 
ATOM   1068 N  NH2   . ARG A 1 143 ? 23.600 -14.369 -31.989 1.00 88.59  ? 143 ARG A NH2   1 
ATOM   1069 N  N     . TYR A 1 144 ? 29.972 -15.347 -29.851 1.00 101.70 ? 144 TYR A N     1 
ATOM   1070 C  CA    . TYR A 1 144 ? 30.313 -15.003 -28.478 1.00 98.79  ? 144 TYR A CA    1 
ATOM   1071 C  C     . TYR A 1 144 ? 29.453 -13.826 -28.029 1.00 100.57 ? 144 TYR A C     1 
ATOM   1072 O  O     . TYR A 1 144 ? 28.616 -13.313 -28.779 1.00 102.74 ? 144 TYR A O     1 
ATOM   1073 C  CB    . TYR A 1 144 ? 31.800 -14.649 -28.337 1.00 99.76  ? 144 TYR A CB    1 
ATOM   1074 C  CG    . TYR A 1 144 ? 32.772 -15.700 -28.829 0.10 96.13  ? 144 TYR A CG    1 
ATOM   1075 C  CD1   . TYR A 1 144 ? 33.191 -16.731 -27.999 0.76 98.96  ? 144 TYR A CD1   1 
ATOM   1076 C  CD2   . TYR A 1 144 ? 33.293 -15.645 -30.116 1.00 91.62  ? 144 TYR A CD2   1 
ATOM   1077 C  CE1   . TYR A 1 144 ? 34.089 -17.687 -28.441 1.00 102.70 ? 144 TYR A CE1   1 
ATOM   1078 C  CE2   . TYR A 1 144 ? 34.190 -16.596 -30.567 1.00 93.08  ? 144 TYR A CE2   1 
ATOM   1079 C  CZ    . TYR A 1 144 ? 34.585 -17.615 -29.726 1.00 102.11 ? 144 TYR A CZ    1 
ATOM   1080 O  OH    . TYR A 1 144 ? 35.478 -18.564 -30.170 1.00 103.88 ? 144 TYR A OH    1 
ATOM   1081 N  N     . GLN A 1 145 ? 29.665 -13.402 -26.784 1.00 96.34  ? 145 GLN A N     1 
ATOM   1082 C  CA    . GLN A 1 145 ? 29.121 -12.148 -26.285 1.00 82.44  ? 145 GLN A CA    1 
ATOM   1083 C  C     . GLN A 1 145 ? 30.088 -11.598 -25.247 1.00 81.28  ? 145 GLN A C     1 
ATOM   1084 O  O     . GLN A 1 145 ? 30.769 -12.356 -24.551 1.00 79.36  ? 145 GLN A O     1 
ATOM   1085 C  CB    . GLN A 1 145 ? 27.716 -12.313 -25.687 1.00 80.55  ? 145 GLN A CB    1 
ATOM   1086 C  CG    . GLN A 1 145 ? 27.684 -12.792 -24.244 1.00 78.22  ? 145 GLN A CG    1 
ATOM   1087 C  CD    . GLN A 1 145 ? 26.271 -12.931 -23.707 1.00 78.09  ? 145 GLN A CD    1 
ATOM   1088 O  OE1   . GLN A 1 145 ? 25.299 -12.847 -24.458 1.00 86.22  ? 145 GLN A OE1   1 
ATOM   1089 N  NE2   . GLN A 1 145 ? 26.152 -13.145 -22.402 1.00 69.09  ? 145 GLN A NE2   1 
ATOM   1090 N  N     . TYR A 1 146 ? 30.152 -10.273 -25.159 1.00 80.18  ? 146 TYR A N     1 
ATOM   1091 C  CA    . TYR A 1 146 ? 31.116 -9.632  -24.275 1.00 69.77  ? 146 TYR A CA    1 
ATOM   1092 C  C     . TYR A 1 146 ? 30.694 -9.763  -22.817 1.00 69.15  ? 146 TYR A C     1 
ATOM   1093 O  O     . TYR A 1 146 ? 29.560 -9.438  -22.454 1.00 77.83  ? 146 TYR A O     1 
ATOM   1094 C  CB    . TYR A 1 146 ? 31.276 -8.158  -24.645 1.00 75.42  ? 146 TYR A CB    1 
ATOM   1095 C  CG    . TYR A 1 146 ? 32.312 -7.902  -25.715 1.00 82.79  ? 146 TYR A CG    1 
ATOM   1096 C  CD1   . TYR A 1 146 ? 33.643 -7.692  -25.380 1.00 82.13  ? 146 TYR A CD1   1 
ATOM   1097 C  CD2   . TYR A 1 146 ? 31.960 -7.870  -27.057 1.00 89.69  ? 146 TYR A CD2   1 
ATOM   1098 C  CE1   . TYR A 1 146 ? 34.595 -7.457  -26.352 1.00 83.70  ? 146 TYR A CE1   1 
ATOM   1099 C  CE2   . TYR A 1 146 ? 32.906 -7.636  -28.038 1.00 92.06  ? 146 TYR A CE2   1 
ATOM   1100 C  CZ    . TYR A 1 146 ? 34.222 -7.430  -27.679 1.00 89.35  ? 146 TYR A CZ    1 
ATOM   1101 O  OH    . TYR A 1 146 ? 35.169 -7.196  -28.649 1.00 91.16  ? 146 TYR A OH    1 
ATOM   1102 N  N     . ASN A 1 147 ? 31.612 -10.254 -21.983 1.00 64.56  ? 147 ASN A N     1 
ATOM   1103 C  CA    . ASN A 1 147 ? 31.474 -10.189 -20.535 1.00 63.74  ? 147 ASN A CA    1 
ATOM   1104 C  C     . ASN A 1 147 ? 32.207 -8.997  -19.939 1.00 56.78  ? 147 ASN A C     1 
ATOM   1105 O  O     . ASN A 1 147 ? 32.038 -8.713  -18.748 1.00 57.17  ? 147 ASN A O     1 
ATOM   1106 C  CB    . ASN A 1 147 ? 31.995 -11.477 -19.885 1.00 66.36  ? 147 ASN A CB    1 
ATOM   1107 C  CG    . ASN A 1 147 ? 31.288 -12.716 -20.392 1.00 68.50  ? 147 ASN A CG    1 
ATOM   1108 O  OD1   . ASN A 1 147 ? 30.081 -12.703 -20.629 1.00 84.59  ? 147 ASN A OD1   1 
ATOM   1109 N  ND2   . ASN A 1 147 ? 32.040 -13.796 -20.564 1.00 69.62  ? 147 ASN A ND2   1 
ATOM   1110 N  N     . VAL A 1 148 ? 33.018 -8.306  -20.738 1.00 57.33  ? 148 VAL A N     1 
ATOM   1111 C  CA    . VAL A 1 148 ? 33.767 -7.136  -20.296 1.00 52.36  ? 148 VAL A CA    1 
ATOM   1112 C  C     . VAL A 1 148 ? 33.410 -5.963  -21.197 1.00 61.94  ? 148 VAL A C     1 
ATOM   1113 O  O     . VAL A 1 148 ? 32.529 -6.076  -22.058 1.00 68.58  ? 148 VAL A O     1 
ATOM   1114 C  CB    . VAL A 1 148 ? 35.282 -7.408  -20.310 1.00 51.62  ? 148 VAL A CB    1 
ATOM   1115 C  CG1   . VAL A 1 148 ? 35.652 -8.396  -19.217 1.00 51.70  ? 148 VAL A CG1   1 
ATOM   1116 C  CG2   . VAL A 1 148 ? 35.708 -7.933  -21.672 1.00 52.90  ? 148 VAL A CG2   1 
ATOM   1117 N  N     . LEU A 1 149 ? 34.086 -4.839  -21.011 1.00 58.05  ? 149 LEU A N     1 
ATOM   1118 C  CA    . LEU A 1 149 ? 33.808 -3.648  -21.807 1.00 52.12  ? 149 LEU A CA    1 
ATOM   1119 C  C     . LEU A 1 149 ? 34.314 -3.834  -23.232 1.00 66.53  ? 149 LEU A C     1 
ATOM   1120 O  O     . LEU A 1 149 ? 35.518 -4.048  -23.429 1.00 69.36  ? 149 LEU A O     1 
ATOM   1121 C  CB    . LEU A 1 149 ? 34.457 -2.423  -21.174 1.00 47.71  ? 149 LEU A CB    1 
ATOM   1122 C  CG    . LEU A 1 149 ? 33.892 -1.954  -19.832 1.00 52.11  ? 149 LEU A CG    1 
ATOM   1123 C  CD1   . LEU A 1 149 ? 34.670 -0.752  -19.325 1.00 52.70  ? 149 LEU A CD1   1 
ATOM   1124 C  CD2   . LEU A 1 149 ? 32.415 -1.622  -19.962 1.00 47.59  ? 149 LEU A CD2   1 
ATOM   1125 N  N     . PRO A 1 150 ? 33.452 -3.766  -24.242 1.00 67.80  ? 150 PRO A N     1 
ATOM   1126 C  CA    . PRO A 1 150 ? 33.909 -3.874  -25.628 1.00 65.46  ? 150 PRO A CA    1 
ATOM   1127 C  C     . PRO A 1 150 ? 34.354 -2.529  -26.186 1.00 54.98  ? 150 PRO A C     1 
ATOM   1128 O  O     . PRO A 1 150 ? 34.040 -1.463  -25.654 1.00 51.28  ? 150 PRO A O     1 
ATOM   1129 C  CB    . PRO A 1 150 ? 32.658 -4.378  -26.360 1.00 65.50  ? 150 PRO A CB    1 
ATOM   1130 C  CG    . PRO A 1 150 ? 31.534 -3.754  -25.597 1.00 66.82  ? 150 PRO A CG    1 
ATOM   1131 C  CD    . PRO A 1 150 ? 31.983 -3.677  -24.152 1.00 65.80  ? 150 PRO A CD    1 
ATOM   1132 N  N     . GLN A 1 151 ? 35.100 -2.600  -27.284 1.00 66.16  ? 151 GLN A N     1 
ATOM   1133 C  CA    . GLN A 1 151 ? 35.547 -1.405  -27.985 1.00 67.00  ? 151 GLN A CA    1 
ATOM   1134 C  C     . GLN A 1 151 ? 34.565 -1.061  -29.096 1.00 68.99  ? 151 GLN A C     1 
ATOM   1135 O  O     . GLN A 1 151 ? 34.004 -1.949  -29.745 1.00 70.30  ? 151 GLN A O     1 
ATOM   1136 C  CB    . GLN A 1 151 ? 36.951 -1.601  -28.559 1.00 75.18  ? 151 GLN A CB    1 
ATOM   1137 C  CG    . GLN A 1 151 ? 37.975 -2.057  -27.531 1.00 76.11  ? 151 GLN A CG    1 
ATOM   1138 C  CD    . GLN A 1 151 ? 39.403 -1.806  -27.971 1.00 78.06  ? 151 GLN A CD    1 
ATOM   1139 O  OE1   . GLN A 1 151 ? 39.653 -1.032  -28.896 1.00 84.87  ? 151 GLN A OE1   1 
ATOM   1140 N  NE2   . GLN A 1 151 ? 40.350 -2.458  -27.307 1.00 77.11  ? 151 GLN A NE2   1 
ATOM   1141 N  N     . GLY A 1 152 ? 34.360 0.236   -29.309 1.00 68.86  ? 152 GLY A N     1 
ATOM   1142 C  CA    . GLY A 1 152 ? 33.348 0.708   -30.229 1.00 73.31  ? 152 GLY A CA    1 
ATOM   1143 C  C     . GLY A 1 152 ? 31.994 0.957   -29.604 1.00 73.48  ? 152 GLY A C     1 
ATOM   1144 O  O     . GLY A 1 152 ? 31.067 1.368   -30.316 1.00 65.55  ? 152 GLY A O     1 
ATOM   1145 N  N     . TRP A 1 153 ? 31.847 0.716   -28.304 1.00 78.43  ? 153 TRP A N     1 
ATOM   1146 C  CA    . TRP A 1 153 ? 30.604 0.982   -27.596 1.00 74.26  ? 153 TRP A CA    1 
ATOM   1147 C  C     . TRP A 1 153 ? 30.633 2.387   -27.009 1.00 64.12  ? 153 TRP A C     1 
ATOM   1148 O  O     . TRP A 1 153 ? 31.685 2.875   -26.584 1.00 67.73  ? 153 TRP A O     1 
ATOM   1149 C  CB    . TRP A 1 153 ? 30.384 -0.048  -26.487 1.00 78.86  ? 153 TRP A CB    1 
ATOM   1150 C  CG    . TRP A 1 153 ? 29.106 0.146   -25.724 1.00 76.56  ? 153 TRP A CG    1 
ATOM   1151 C  CD1   . TRP A 1 153 ? 27.890 0.496   -26.234 1.00 69.07  ? 153 TRP A CD1   1 
ATOM   1152 C  CD2   . TRP A 1 153 ? 28.924 0.015   -24.308 1.00 78.04  ? 153 TRP A CD2   1 
ATOM   1153 N  NE1   . TRP A 1 153 ? 26.961 0.584   -25.227 1.00 69.56  ? 153 TRP A NE1   1 
ATOM   1154 C  CE2   . TRP A 1 153 ? 27.570 0.294   -24.034 1.00 72.73  ? 153 TRP A CE2   1 
ATOM   1155 C  CE3   . TRP A 1 153 ? 29.773 -0.313  -23.247 1.00 78.71  ? 153 TRP A CE3   1 
ATOM   1156 C  CZ2   . TRP A 1 153 ? 27.046 0.255   -22.744 1.00 74.40  ? 153 TRP A CZ2   1 
ATOM   1157 C  CZ3   . TRP A 1 153 ? 29.251 -0.352  -21.967 1.00 76.67  ? 153 TRP A CZ3   1 
ATOM   1158 C  CH2   . TRP A 1 153 ? 27.900 -0.070  -21.727 1.00 76.70  ? 153 TRP A CH2   1 
ATOM   1159 N  N     . LYS A 1 154 ? 29.465 3.032   -26.989 1.00 60.54  ? 154 LYS A N     1 
ATOM   1160 C  CA    . LYS A 1 154 ? 29.375 4.412   -26.524 1.00 54.35  ? 154 LYS A CA    1 
ATOM   1161 C  C     . LYS A 1 154 ? 29.816 4.548   -25.072 1.00 52.56  ? 154 LYS A C     1 
ATOM   1162 O  O     . LYS A 1 154 ? 30.501 5.513   -24.712 1.00 56.57  ? 154 LYS A O     1 
ATOM   1163 C  CB    . LYS A 1 154 ? 27.943 4.922   -26.695 1.00 63.14  ? 154 LYS A CB    1 
ATOM   1164 C  CG    . LYS A 1 154 ? 27.661 6.238   -25.990 1.00 64.95  ? 154 LYS A CG    1 
ATOM   1165 C  CD    . LYS A 1 154 ? 26.174 6.412   -25.715 1.00 61.04  ? 154 LYS A CD    1 
ATOM   1166 C  CE    . LYS A 1 154 ? 25.378 6.533   -27.001 1.00 70.71  ? 154 LYS A CE    1 
ATOM   1167 N  NZ    . LYS A 1 154 ? 23.919 6.687   -26.733 1.00 77.12  ? 154 LYS A NZ    1 
ATOM   1168 N  N     . GLY A 1 155 ? 29.437 3.593   -24.224 1.00 53.26  ? 155 GLY A N     1 
ATOM   1169 C  CA    . GLY A 1 155 ? 29.688 3.719   -22.801 1.00 54.44  ? 155 GLY A CA    1 
ATOM   1170 C  C     . GLY A 1 155 ? 31.039 3.235   -22.320 1.00 54.46  ? 155 GLY A C     1 
ATOM   1171 O  O     . GLY A 1 155 ? 31.384 3.486   -21.161 1.00 52.95  ? 155 GLY A O     1 
ATOM   1172 N  N     . SER A 1 156 ? 31.808 2.557   -23.170 1.00 54.95  ? 156 SER A N     1 
ATOM   1173 C  CA    . SER A 1 156 ? 33.084 1.999   -22.724 1.00 50.32  ? 156 SER A CA    1 
ATOM   1174 C  C     . SER A 1 156 ? 34.060 3.056   -22.220 1.00 51.65  ? 156 SER A C     1 
ATOM   1175 O  O     . SER A 1 156 ? 34.637 2.856   -21.136 1.00 59.20  ? 156 SER A O     1 
ATOM   1176 C  CB    . SER A 1 156 ? 33.703 1.158   -23.847 1.00 48.48  ? 156 SER A CB    1 
ATOM   1177 O  OG    . SER A 1 156 ? 33.003 -0.061  -24.018 1.00 60.15  ? 156 SER A OG    1 
ATOM   1178 N  N     . PRO A 1 157 ? 34.305 4.172   -22.922 1.00 56.21  ? 157 PRO A N     1 
ATOM   1179 C  CA    . PRO A 1 157 ? 35.238 5.170   -22.363 1.00 52.18  ? 157 PRO A CA    1 
ATOM   1180 C  C     . PRO A 1 157 ? 34.807 5.713   -21.010 1.00 48.76  ? 157 PRO A C     1 
ATOM   1181 O  O     . PRO A 1 157 ? 35.622 5.768   -20.081 1.00 44.98  ? 157 PRO A O     1 
ATOM   1182 C  CB    . PRO A 1 157 ? 35.265 6.262   -23.442 1.00 45.34  ? 157 PRO A CB    1 
ATOM   1183 C  CG    . PRO A 1 157 ? 34.912 5.553   -24.696 1.00 50.54  ? 157 PRO A CG    1 
ATOM   1184 C  CD    . PRO A 1 157 ? 33.889 4.537   -24.290 1.00 53.89  ? 157 PRO A CD    1 
ATOM   1185 N  N     . ALA A 1 158 ? 33.539 6.104   -20.867 1.00 51.58  ? 158 ALA A N     1 
ATOM   1186 C  CA    . ALA A 1 158 ? 33.089 6.694   -19.610 1.00 41.71  ? 158 ALA A CA    1 
ATOM   1187 C  C     . ALA A 1 158 ? 33.094 5.675   -18.476 1.00 45.30  ? 158 ALA A C     1 
ATOM   1188 O  O     . ALA A 1 158 ? 33.424 6.015   -17.334 1.00 55.05  ? 158 ALA A O     1 
ATOM   1189 C  CB    . ALA A 1 158 ? 31.697 7.301   -19.781 1.00 40.56  ? 158 ALA A CB    1 
ATOM   1190 N  N     . ILE A 1 159 ? 32.729 4.423   -18.764 1.00 41.75  ? 159 ILE A N     1 
ATOM   1191 C  CA    . ILE A 1 159 ? 32.685 3.415   -17.709 1.00 51.37  ? 159 ILE A CA    1 
ATOM   1192 C  C     . ILE A 1 159 ? 34.093 3.048   -17.256 1.00 47.50  ? 159 ILE A C     1 
ATOM   1193 O  O     . ILE A 1 159 ? 34.334 2.819   -16.064 1.00 51.64  ? 159 ILE A O     1 
ATOM   1194 C  CB    . ILE A 1 159 ? 31.892 2.177   -18.170 1.00 50.28  ? 159 ILE A CB    1 
ATOM   1195 C  CG1   . ILE A 1 159 ? 30.408 2.516   -18.314 1.00 55.90  ? 159 ILE A CG1   1 
ATOM   1196 C  CG2   . ILE A 1 159 ? 32.062 1.030   -17.186 1.00 44.38  ? 159 ILE A CG2   1 
ATOM   1197 C  CD1   . ILE A 1 159 ? 29.561 1.349   -18.769 1.00 46.52  ? 159 ILE A CD1   1 
ATOM   1198 N  N     . PHE A 1 160 ? 35.049 2.992   -18.186 1.00 41.40  ? 160 PHE A N     1 
ATOM   1199 C  CA    . PHE A 1 160 ? 36.420 2.704   -17.780 1.00 45.04  ? 160 PHE A CA    1 
ATOM   1200 C  C     . PHE A 1 160 ? 37.017 3.860   -16.987 1.00 43.20  ? 160 PHE A C     1 
ATOM   1201 O  O     . PHE A 1 160 ? 37.683 3.641   -15.968 1.00 45.96  ? 160 PHE A O     1 
ATOM   1202 C  CB    . PHE A 1 160 ? 37.298 2.394   -18.990 1.00 48.21  ? 160 PHE A CB    1 
ATOM   1203 C  CG    . PHE A 1 160 ? 38.737 2.148   -18.630 1.00 55.40  ? 160 PHE A CG    1 
ATOM   1204 C  CD1   . PHE A 1 160 ? 39.150 0.900   -18.194 1.00 53.67  ? 160 PHE A CD1   1 
ATOM   1205 C  CD2   . PHE A 1 160 ? 39.672 3.171   -18.701 1.00 47.75  ? 160 PHE A CD2   1 
ATOM   1206 C  CE1   . PHE A 1 160 ? 40.470 0.671   -17.847 1.00 41.10  ? 160 PHE A CE1   1 
ATOM   1207 C  CE2   . PHE A 1 160 ? 40.992 2.948   -18.354 1.00 48.77  ? 160 PHE A CE2   1 
ATOM   1208 C  CZ    . PHE A 1 160 ? 41.391 1.696   -17.928 1.00 54.82  ? 160 PHE A CZ    1 
ATOM   1209 N  N     . GLN A 1 161 ? 36.801 5.096   -17.444 1.00 39.04  ? 161 GLN A N     1 
ATOM   1210 C  CA    . GLN A 1 161 ? 37.369 6.250   -16.753 1.00 38.00  ? 161 GLN A CA    1 
ATOM   1211 C  C     . GLN A 1 161 ? 36.839 6.359   -15.329 1.00 37.88  ? 161 GLN A C     1 
ATOM   1212 O  O     . GLN A 1 161 ? 37.591 6.683   -14.402 1.00 37.51  ? 161 GLN A O     1 
ATOM   1213 C  CB    . GLN A 1 161 ? 37.075 7.526   -17.542 1.00 37.53  ? 161 GLN A CB    1 
ATOM   1214 C  CG    . GLN A 1 161 ? 37.829 7.619   -18.861 1.00 41.94  ? 161 GLN A CG    1 
ATOM   1215 C  CD    . GLN A 1 161 ? 37.140 8.521   -19.867 1.00 41.61  ? 161 GLN A CD    1 
ATOM   1216 O  OE1   . GLN A 1 161 ? 36.083 9.086   -19.589 1.00 50.38  ? 161 GLN A OE1   1 
ATOM   1217 N  NE2   . GLN A 1 161 ? 37.736 8.656   -21.046 1.00 45.92  ? 161 GLN A NE2   1 
ATOM   1218 N  N     . SER A 1 162 ? 35.548 6.080   -15.130 1.00 43.05  ? 162 SER A N     1 
ATOM   1219 C  CA    . SER A 1 162 ? 34.984 6.141   -13.785 1.00 44.47  ? 162 SER A CA    1 
ATOM   1220 C  C     . SER A 1 162 ? 35.435 4.958   -12.938 1.00 44.10  ? 162 SER A C     1 
ATOM   1221 O  O     . SER A 1 162 ? 35.733 5.121   -11.748 1.00 43.94  ? 162 SER A O     1 
ATOM   1222 C  CB    . SER A 1 162 ? 33.460 6.193   -13.855 1.00 39.38  ? 162 SER A CB    1 
ATOM   1223 O  OG    . SER A 1 162 ? 32.889 6.102   -12.561 1.00 43.97  ? 162 SER A OG    1 
ATOM   1224 N  N     . SER A 1 163 ? 35.478 3.759   -13.525 1.00 48.04  ? 163 SER A N     1 
ATOM   1225 C  CA    . SER A 1 163 ? 35.938 2.593   -12.778 1.00 52.10  ? 163 SER A CA    1 
ATOM   1226 C  C     . SER A 1 163 ? 37.389 2.759   -12.347 1.00 48.01  ? 163 SER A C     1 
ATOM   1227 O  O     . SER A 1 163 ? 37.763 2.369   -11.234 1.00 39.69  ? 163 SER A O     1 
ATOM   1228 C  CB    . SER A 1 163 ? 35.769 1.327   -13.618 1.00 54.07  ? 163 SER A CB    1 
ATOM   1229 O  OG    . SER A 1 163 ? 34.413 1.130   -13.978 1.00 68.15  ? 163 SER A OG    1 
ATOM   1230 N  N     . MET A 1 164 ? 38.217 3.347   -13.212 1.00 44.32  ? 164 MET A N     1 
ATOM   1231 C  CA    . MET A 1 164 ? 39.609 3.601   -12.856 1.00 38.43  ? 164 MET A CA    1 
ATOM   1232 C  C     . MET A 1 164 ? 39.709 4.561   -11.678 1.00 40.72  ? 164 MET A C     1 
ATOM   1233 O  O     . MET A 1 164 ? 40.544 4.374   -10.785 1.00 37.93  ? 164 MET A O     1 
ATOM   1234 C  CB    . MET A 1 164 ? 40.363 4.154   -14.065 1.00 38.06  ? 164 MET A CB    1 
ATOM   1235 C  CG    . MET A 1 164 ? 41.857 4.306   -13.851 1.00 52.16  ? 164 MET A CG    1 
ATOM   1236 S  SD    . MET A 1 164 ? 42.734 2.740   -13.990 1.00 67.07  ? 164 MET A SD    1 
ATOM   1237 C  CE    . MET A 1 164 ? 44.391 3.243   -13.540 1.00 52.11  ? 164 MET A CE    1 
ATOM   1238 N  N     . THR A 1 165 ? 38.866 5.597   -11.660 1.00 37.65  ? 165 THR A N     1 
ATOM   1239 C  CA    . THR A 1 165 ? 38.855 6.520   -10.529 1.00 44.11  ? 165 THR A CA    1 
ATOM   1240 C  C     . THR A 1 165 ? 38.443 5.807   -9.249  1.00 43.91  ? 165 THR A C     1 
ATOM   1241 O  O     . THR A 1 165 ? 39.034 6.030   -8.186  1.00 52.09  ? 165 THR A O     1 
ATOM   1242 C  CB    . THR A 1 165 ? 37.917 7.694   -10.813 1.00 47.15  ? 165 THR A CB    1 
ATOM   1243 O  OG1   . THR A 1 165 ? 38.340 8.370   -12.002 1.00 36.54  ? 165 THR A OG1   1 
ATOM   1244 C  CG2   . THR A 1 165 ? 37.923 8.675   -9.650  1.00 37.01  ? 165 THR A CG2   1 
ATOM   1245 N  N     . LYS A 1 166 ? 37.428 4.943   -9.334  1.00 46.75  ? 166 LYS A N     1 
ATOM   1246 C  CA    . LYS A 1 166 ? 37.028 4.147   -8.179  1.00 51.42  ? 166 LYS A CA    1 
ATOM   1247 C  C     . LYS A 1 166 ? 38.188 3.299   -7.670  1.00 46.67  ? 166 LYS A C     1 
ATOM   1248 O  O     . LYS A 1 166 ? 38.387 3.167   -6.457  1.00 43.63  ? 166 LYS A O     1 
ATOM   1249 C  CB    . LYS A 1 166 ? 35.838 3.260   -8.547  1.00 63.43  ? 166 LYS A CB    1 
ATOM   1250 C  CG    . LYS A 1 166 ? 34.949 2.863   -7.379  1.00 77.27  ? 166 LYS A CG    1 
ATOM   1251 C  CD    . LYS A 1 166 ? 33.856 3.896   -7.144  1.00 76.77  ? 166 LYS A CD    1 
ATOM   1252 C  CE    . LYS A 1 166 ? 32.932 4.002   -8.349  1.00 58.81  ? 166 LYS A CE    1 
ATOM   1253 N  NZ    . LYS A 1 166 ? 31.885 5.045   -8.162  1.00 59.32  ? 166 LYS A NZ    1 
ATOM   1254 N  N     . ILE A 1 167 ? 38.976 2.734   -8.587  1.00 51.23  ? 167 ILE A N     1 
ATOM   1255 C  CA    . ILE A 1 167 ? 40.073 1.853   -8.195  1.00 49.29  ? 167 ILE A CA    1 
ATOM   1256 C  C     . ILE A 1 167 ? 41.207 2.649   -7.560  1.00 51.24  ? 167 ILE A C     1 
ATOM   1257 O  O     . ILE A 1 167 ? 41.785 2.232   -6.549  1.00 55.92  ? 167 ILE A O     1 
ATOM   1258 C  CB    . ILE A 1 167 ? 40.560 1.040   -9.408  1.00 39.67  ? 167 ILE A CB    1 
ATOM   1259 C  CG1   . ILE A 1 167 ? 39.465 0.084   -9.882  1.00 41.67  ? 167 ILE A CG1   1 
ATOM   1260 C  CG2   . ILE A 1 167 ? 41.827 0.273   -9.066  1.00 45.23  ? 167 ILE A CG2   1 
ATOM   1261 C  CD1   . ILE A 1 167 ? 39.772 -0.592  -11.196 1.00 40.71  ? 167 ILE A CD1   1 
ATOM   1262 N  N     . LEU A 1 168 ? 41.549 3.802   -8.136  1.00 45.93  ? 168 LEU A N     1 
ATOM   1263 C  CA    . LEU A 1 168 ? 42.644 4.598   -7.596  1.00 49.51  ? 168 LEU A CA    1 
ATOM   1264 C  C     . LEU A 1 168 ? 42.274 5.323   -6.309  1.00 47.37  ? 168 LEU A C     1 
ATOM   1265 O  O     . LEU A 1 168 ? 43.175 5.809   -5.617  1.00 49.87  ? 168 LEU A O     1 
ATOM   1266 C  CB    . LEU A 1 168 ? 43.123 5.610   -8.639  1.00 37.57  ? 168 LEU A CB    1 
ATOM   1267 C  CG    . LEU A 1 168 ? 43.851 5.029   -9.852  1.00 37.52  ? 168 LEU A CG    1 
ATOM   1268 C  CD1   . LEU A 1 168 ? 44.093 6.102   -10.899 1.00 37.04  ? 168 LEU A CD1   1 
ATOM   1269 C  CD2   . LEU A 1 168 ? 45.163 4.388   -9.427  1.00 37.87  ? 168 LEU A CD2   1 
ATOM   1270 N  N     . GLU A 1 169 ? 40.986 5.392   -5.968  1.00 46.42  ? 169 GLU A N     1 
ATOM   1271 C  CA    . GLU A 1 169 ? 40.558 6.181   -4.813  1.00 47.75  ? 169 GLU A CA    1 
ATOM   1272 C  C     . GLU A 1 169 ? 41.179 5.708   -3.503  1.00 55.59  ? 169 GLU A C     1 
ATOM   1273 O  O     . GLU A 1 169 ? 41.641 6.563   -2.727  1.00 56.15  ? 169 GLU A O     1 
ATOM   1274 C  CB    . GLU A 1 169 ? 39.025 6.193   -4.744  1.00 39.71  ? 169 GLU A CB    1 
ATOM   1275 C  CG    . GLU A 1 169 ? 38.426 7.355   -3.959  1.00 44.13  ? 169 GLU A CG    1 
ATOM   1276 C  CD    . GLU A 1 169 ? 38.485 7.153   -2.458  1.00 62.07  ? 169 GLU A CD    1 
ATOM   1277 O  OE1   . GLU A 1 169 ? 38.491 8.163   -1.723  1.00 73.53  ? 169 GLU A OE1   1 
ATOM   1278 O  OE2   . GLU A 1 169 ? 38.522 5.987   -2.011  1.00 69.05  ? 169 GLU A OE2   1 
ATOM   1279 N  N     . PRO A 1 170 ? 41.219 4.409   -3.178  1.00 58.87  ? 170 PRO A N     1 
ATOM   1280 C  CA    . PRO A 1 170 ? 41.922 4.006   -1.947  1.00 55.05  ? 170 PRO A CA    1 
ATOM   1281 C  C     . PRO A 1 170 ? 43.402 4.346   -1.959  1.00 54.15  ? 170 PRO A C     1 
ATOM   1282 O  O     . PRO A 1 170 ? 43.959 4.678   -0.905  1.00 51.28  ? 170 PRO A O     1 
ATOM   1283 C  CB    . PRO A 1 170 ? 41.691 2.489   -1.891  1.00 41.59  ? 170 PRO A CB    1 
ATOM   1284 C  CG    . PRO A 1 170 ? 40.453 2.269   -2.675  1.00 41.52  ? 170 PRO A CG    1 
ATOM   1285 C  CD    . PRO A 1 170 ? 40.515 3.266   -3.789  1.00 57.18  ? 170 PRO A CD    1 
ATOM   1286 N  N     . PHE A 1 171 ? 44.059 4.279   -3.120  1.00 53.66  ? 171 PHE A N     1 
ATOM   1287 C  CA    . PHE A 1 171 ? 45.483 4.594   -3.172  1.00 53.50  ? 171 PHE A CA    1 
ATOM   1288 C  C     . PHE A 1 171 ? 45.725 6.091   -3.025  1.00 53.15  ? 171 PHE A C     1 
ATOM   1289 O  O     . PHE A 1 171 ? 46.682 6.506   -2.361  1.00 53.62  ? 171 PHE A O     1 
ATOM   1290 C  CB    . PHE A 1 171 ? 46.095 4.077   -4.475  1.00 45.57  ? 171 PHE A CB    1 
ATOM   1291 C  CG    . PHE A 1 171 ? 47.592 4.212   -4.535  1.00 48.07  ? 171 PHE A CG    1 
ATOM   1292 C  CD1   . PHE A 1 171 ? 48.412 3.172   -4.124  1.00 51.33  ? 171 PHE A CD1   1 
ATOM   1293 C  CD2   . PHE A 1 171 ? 48.182 5.379   -4.997  1.00 40.85  ? 171 PHE A CD2   1 
ATOM   1294 C  CE1   . PHE A 1 171 ? 49.790 3.294   -4.175  1.00 44.23  ? 171 PHE A CE1   1 
ATOM   1295 C  CE2   . PHE A 1 171 ? 49.556 5.507   -5.049  1.00 39.74  ? 171 PHE A CE2   1 
ATOM   1296 C  CZ    . PHE A 1 171 ? 50.361 4.463   -4.638  1.00 48.86  ? 171 PHE A CZ    1 
ATOM   1297 N  N     . ARG A 1 172 ? 44.880 6.917   -3.648  1.00 43.98  ? 172 ARG A N     1 
ATOM   1298 C  CA    . ARG A 1 172 ? 45.026 8.362   -3.504  1.00 44.57  ? 172 ARG A CA    1 
ATOM   1299 C  C     . ARG A 1 172 ? 44.767 8.797   -2.068  1.00 45.84  ? 172 ARG A C     1 
ATOM   1300 O  O     . ARG A 1 172 ? 45.476 9.659   -1.534  1.00 41.99  ? 172 ARG A O     1 
ATOM   1301 C  CB    . ARG A 1 172 ? 44.084 9.091   -4.463  1.00 38.48  ? 172 ARG A CB    1 
ATOM   1302 C  CG    . ARG A 1 172 ? 44.429 8.920   -5.934  1.00 37.78  ? 172 ARG A CG    1 
ATOM   1303 C  CD    . ARG A 1 172 ? 43.642 9.893   -6.796  1.00 37.17  ? 172 ARG A CD    1 
ATOM   1304 N  NE    . ARG A 1 172 ? 44.174 9.982   -8.153  1.00 37.71  ? 172 ARG A NE    1 
ATOM   1305 C  CZ    . ARG A 1 172 ? 43.565 9.506   -9.234  1.00 43.51  ? 172 ARG A CZ    1 
ATOM   1306 N  NH1   . ARG A 1 172 ? 42.387 8.907   -9.129  1.00 51.77  ? 172 ARG A NH1   1 
ATOM   1307 N  NH2   . ARG A 1 172 ? 44.133 9.637   -10.425 1.00 36.12  ? 172 ARG A NH2   1 
ATOM   1308 N  N     . LYS A 1 173 ? 43.755 8.209   -1.426  1.00 49.16  ? 173 LYS A N     1 
ATOM   1309 C  CA    . LYS A 1 173 ? 43.468 8.534   -0.033  1.00 50.85  ? 173 LYS A CA    1 
ATOM   1310 C  C     . LYS A 1 173 ? 44.629 8.139   0.872   1.00 54.02  ? 173 LYS A C     1 
ATOM   1311 O  O     . LYS A 1 173 ? 44.970 8.864   1.814   1.00 54.35  ? 173 LYS A O     1 
ATOM   1312 C  CB    . LYS A 1 173 ? 42.183 7.836   0.412   1.00 52.75  ? 173 LYS A CB    1 
ATOM   1313 C  CG    . LYS A 1 173 ? 41.219 8.722   1.180   1.00 63.25  ? 173 LYS A CG    1 
ATOM   1314 C  CD    . LYS A 1 173 ? 40.563 9.742   0.263   1.00 63.40  ? 173 LYS A CD    1 
ATOM   1315 C  CE    . LYS A 1 173 ? 39.516 10.558  1.001   1.00 63.06  ? 173 LYS A CE    1 
ATOM   1316 N  NZ    . LYS A 1 173 ? 38.758 11.448  0.078   1.00 80.11  ? 173 LYS A NZ    1 
ATOM   1317 N  N     . GLN A 1 174 ? 45.249 6.990   0.598   1.00 54.38  ? 174 GLN A N     1 
ATOM   1318 C  CA    . GLN A 1 174 ? 46.379 6.533   1.397   1.00 66.27  ? 174 GLN A CA    1 
ATOM   1319 C  C     . GLN A 1 174 ? 47.650 7.315   1.086   1.00 57.95  ? 174 GLN A C     1 
ATOM   1320 O  O     . GLN A 1 174 ? 48.528 7.433   1.949   1.00 47.12  ? 174 GLN A O     1 
ATOM   1321 C  CB    . GLN A 1 174 ? 46.605 5.036   1.165   1.00 70.04  ? 174 GLN A CB    1 
ATOM   1322 C  CG    . GLN A 1 174 ? 47.717 4.417   1.995   1.00 71.44  ? 174 GLN A CG    1 
ATOM   1323 C  CD    . GLN A 1 174 ? 47.896 2.938   1.713   1.00 80.72  ? 174 GLN A CD    1 
ATOM   1324 O  OE1   . GLN A 1 174 ? 46.985 2.275   1.217   1.00 91.36  ? 174 GLN A OE1   1 
ATOM   1325 N  NE2   . GLN A 1 174 ? 49.077 2.414   2.023   1.00 75.82  ? 174 GLN A NE2   1 
ATOM   1326 N  N     . ASN A 1 175 ? 47.764 7.860   -0.124  1.00 50.73  ? 175 ASN A N     1 
ATOM   1327 C  CA    . ASN A 1 175 ? 48.956 8.584   -0.563  1.00 47.40  ? 175 ASN A CA    1 
ATOM   1328 C  C     . ASN A 1 175 ? 48.525 9.895   -1.205  1.00 57.58  ? 175 ASN A C     1 
ATOM   1329 O  O     . ASN A 1 175 ? 48.470 10.012  -2.437  1.00 56.43  ? 175 ASN A O     1 
ATOM   1330 C  CB    . ASN A 1 175 ? 49.788 7.736   -1.524  1.00 44.41  ? 175 ASN A CB    1 
ATOM   1331 C  CG    . ASN A 1 175 ? 50.159 6.392   -0.934  1.00 50.18  ? 175 ASN A CG    1 
ATOM   1332 O  OD1   . ASN A 1 175 ? 50.918 6.316   0.031   1.00 57.67  ? 175 ASN A OD1   1 
ATOM   1333 N  ND2   . ASN A 1 175 ? 49.621 5.323   -1.509  1.00 60.64  ? 175 ASN A ND2   1 
ATOM   1334 N  N     . PRO A 1 176 ? 48.213 10.910  -0.394  1.00 59.23  ? 176 PRO A N     1 
ATOM   1335 C  CA    . PRO A 1 176 ? 47.773 12.193  -0.961  1.00 48.87  ? 176 PRO A CA    1 
ATOM   1336 C  C     . PRO A 1 176 ? 48.894 12.998  -1.589  1.00 46.10  ? 176 PRO A C     1 
ATOM   1337 O  O     . PRO A 1 176 ? 48.611 13.934  -2.347  1.00 53.51  ? 176 PRO A O     1 
ATOM   1338 C  CB    . PRO A 1 176 ? 47.179 12.921  0.250   1.00 42.48  ? 176 PRO A CB    1 
ATOM   1339 C  CG    . PRO A 1 176 ? 47.951 12.376  1.408   1.00 43.71  ? 176 PRO A CG    1 
ATOM   1340 C  CD    . PRO A 1 176 ? 48.239 10.933  1.080   1.00 49.99  ? 176 PRO A CD    1 
ATOM   1341 N  N     . ASP A 1 177 ? 50.153 12.666  -1.308  1.00 53.12  ? 177 ASP A N     1 
ATOM   1342 C  CA    . ASP A 1 177 ? 51.284 13.440  -1.796  1.00 57.51  ? 177 ASP A CA    1 
ATOM   1343 C  C     . ASP A 1 177 ? 51.919 12.852  -3.049  1.00 55.42  ? 177 ASP A C     1 
ATOM   1344 O  O     . ASP A 1 177 ? 52.815 13.481  -3.623  1.00 63.57  ? 177 ASP A O     1 
ATOM   1345 C  CB    . ASP A 1 177 ? 52.334 13.574  -0.689  1.00 70.95  ? 177 ASP A CB    1 
ATOM   1346 C  CG    . ASP A 1 177 ? 51.741 14.099  0.607   1.00 75.16  ? 177 ASP A CG    1 
ATOM   1347 O  OD1   . ASP A 1 177 ? 50.945 15.061  0.551   1.00 67.82  ? 177 ASP A OD1   1 
ATOM   1348 O  OD2   . ASP A 1 177 ? 52.060 13.543  1.680   1.00 82.11  ? 177 ASP A OD2   1 
ATOM   1349 N  N     . ILE A 1 178 ? 51.484 11.674  -3.484  1.00 45.94  ? 178 ILE A N     1 
ATOM   1350 C  CA    . ILE A 1 178 ? 51.880 11.125  -4.775  1.00 40.76  ? 178 ILE A CA    1 
ATOM   1351 C  C     . ILE A 1 178 ? 50.837 11.554  -5.801  1.00 39.71  ? 178 ILE A C     1 
ATOM   1352 O  O     . ILE A 1 178 ? 49.654 11.221  -5.671  1.00 39.18  ? 178 ILE A O     1 
ATOM   1353 C  CB    . ILE A 1 178 ? 52.008 9.594   -4.721  1.00 40.78  ? 178 ILE A CB    1 
ATOM   1354 C  CG1   . ILE A 1 178 ? 53.327 9.174   -4.062  1.00 47.26  ? 178 ILE A CG1   1 
ATOM   1355 C  CG2   . ILE A 1 178 ? 51.901 8.997   -6.113  1.00 40.10  ? 178 ILE A CG2   1 
ATOM   1356 C  CD1   . ILE A 1 178 ? 53.279 9.112   -2.549  1.00 52.83  ? 178 ILE A CD1   1 
ATOM   1357 N  N     . VAL A 1 179 ? 51.267 12.305  -6.811  1.00 42.63  ? 179 VAL A N     1 
ATOM   1358 C  CA    . VAL A 1 179 ? 50.364 12.809  -7.840  1.00 45.24  ? 179 VAL A CA    1 
ATOM   1359 C  C     . VAL A 1 179 ? 50.252 11.776  -8.954  1.00 44.70  ? 179 VAL A C     1 
ATOM   1360 O  O     . VAL A 1 179 ? 51.265 11.305  -9.485  1.00 45.96  ? 179 VAL A O     1 
ATOM   1361 C  CB    . VAL A 1 179 ? 50.841 14.169  -8.382  1.00 38.78  ? 179 VAL A CB    1 
ATOM   1362 C  CG1   . VAL A 1 179 ? 52.337 14.159  -8.643  1.00 45.18  ? 179 VAL A CG1   1 
ATOM   1363 C  CG2   . VAL A 1 179 ? 50.078 14.535  -9.647  1.00 47.08  ? 179 VAL A CG2   1 
ATOM   1364 N  N     . ILE A 1 180 ? 49.017 11.422  -9.305  1.00 46.62  ? 180 ILE A N     1 
ATOM   1365 C  CA    . ILE A 1 180 ? 48.730 10.411  -10.318 1.00 42.65  ? 180 ILE A CA    1 
ATOM   1366 C  C     . ILE A 1 180 ? 47.861 11.072  -11.381 1.00 46.02  ? 180 ILE A C     1 
ATOM   1367 O  O     . ILE A 1 180 ? 46.663 11.294  -11.166 1.00 47.34  ? 180 ILE A O     1 
ATOM   1368 C  CB    . ILE A 1 180 ? 48.038 9.177   -9.729  1.00 37.53  ? 180 ILE A CB    1 
ATOM   1369 C  CG1   . ILE A 1 180 ? 48.880 8.569   -8.606  1.00 39.28  ? 180 ILE A CG1   1 
ATOM   1370 C  CG2   . ILE A 1 180 ? 47.766 8.146   -10.815 1.00 37.21  ? 180 ILE A CG2   1 
ATOM   1371 C  CD1   . ILE A 1 180 ? 48.211 7.402   -7.917  1.00 38.05  ? 180 ILE A CD1   1 
ATOM   1372 N  N     . TYR A 1 181 ? 48.453 11.385  -12.532 1.00 44.88  ? 181 TYR A N     1 
ATOM   1373 C  CA    . TYR A 1 181 ? 47.703 11.941  -13.655 1.00 38.68  ? 181 TYR A CA    1 
ATOM   1374 C  C     . TYR A 1 181 ? 47.078 10.794  -14.440 1.00 36.30  ? 181 TYR A C     1 
ATOM   1375 O  O     . TYR A 1 181 ? 47.774 10.068  -15.158 1.00 46.01  ? 181 TYR A O     1 
ATOM   1376 C  CB    . TYR A 1 181 ? 48.607 12.796  -14.537 1.00 37.17  ? 181 TYR A CB    1 
ATOM   1377 C  CG    . TYR A 1 181 ? 48.524 14.275  -14.232 1.00 42.63  ? 181 TYR A CG    1 
ATOM   1378 C  CD1   . TYR A 1 181 ? 49.146 14.811  -13.112 1.00 42.95  ? 181 TYR A CD1   1 
ATOM   1379 C  CD2   . TYR A 1 181 ? 47.819 15.137  -15.065 1.00 50.14  ? 181 TYR A CD2   1 
ATOM   1380 C  CE1   . TYR A 1 181 ? 49.068 16.162  -12.828 1.00 40.73  ? 181 TYR A CE1   1 
ATOM   1381 C  CE2   . TYR A 1 181 ? 47.737 16.491  -14.789 1.00 46.15  ? 181 TYR A CE2   1 
ATOM   1382 C  CZ    . TYR A 1 181 ? 48.363 16.998  -13.671 1.00 42.48  ? 181 TYR A CZ    1 
ATOM   1383 O  OH    . TYR A 1 181 ? 48.286 18.344  -13.394 1.00 38.41  ? 181 TYR A OH    1 
ATOM   1384 N  N     . GLN A 1 182 ? 45.764 10.637  -14.308 1.00 40.59  ? 182 GLN A N     1 
ATOM   1385 C  CA    . GLN A 1 182 ? 45.031 9.501   -14.858 1.00 43.44  ? 182 GLN A CA    1 
ATOM   1386 C  C     . GLN A 1 182 ? 44.327 9.931   -16.140 1.00 37.91  ? 182 GLN A C     1 
ATOM   1387 O  O     . GLN A 1 182 ? 43.387 10.732  -16.102 1.00 42.17  ? 182 GLN A O     1 
ATOM   1388 C  CB    . GLN A 1 182 ? 44.034 8.975   -13.827 1.00 35.99  ? 182 GLN A CB    1 
ATOM   1389 C  CG    . GLN A 1 182 ? 42.963 8.050   -14.374 1.00 48.57  ? 182 GLN A CG    1 
ATOM   1390 C  CD    . GLN A 1 182 ? 41.762 7.957   -13.451 1.00 51.24  ? 182 GLN A CD    1 
ATOM   1391 O  OE1   . GLN A 1 182 ? 41.830 8.348   -12.284 1.00 41.63  ? 182 GLN A OE1   1 
ATOM   1392 N  NE2   . GLN A 1 182 ? 40.650 7.450   -13.974 1.00 49.02  ? 182 GLN A NE2   1 
ATOM   1393 N  N     . TYR A 1 183 ? 44.780 9.400   -17.275 1.00 36.43  ? 183 TYR A N     1 
ATOM   1394 C  CA    . TYR A 1 183 ? 44.136 9.628   -18.567 1.00 39.44  ? 183 TYR A CA    1 
ATOM   1395 C  C     . TYR A 1 183 ? 43.985 8.283   -19.262 1.00 40.77  ? 183 TYR A C     1 
ATOM   1396 O  O     . TYR A 1 183 ? 44.984 7.678   -19.665 1.00 41.51  ? 183 TYR A O     1 
ATOM   1397 C  CB    . TYR A 1 183 ? 44.935 10.600  -19.434 1.00 40.66  ? 183 TYR A CB    1 
ATOM   1398 C  CG    . TYR A 1 183 ? 44.239 10.944  -20.733 1.00 41.65  ? 183 TYR A CG    1 
ATOM   1399 C  CD1   . TYR A 1 183 ? 43.256 11.925  -20.774 1.00 44.99  ? 183 TYR A CD1   1 
ATOM   1400 C  CD2   . TYR A 1 183 ? 44.554 10.283  -21.912 1.00 37.75  ? 183 TYR A CD2   1 
ATOM   1401 C  CE1   . TYR A 1 183 ? 42.612 12.240  -21.953 1.00 51.09  ? 183 TYR A CE1   1 
ATOM   1402 C  CE2   . TYR A 1 183 ? 43.916 10.594  -23.097 1.00 38.09  ? 183 TYR A CE2   1 
ATOM   1403 C  CZ    . TYR A 1 183 ? 42.946 11.572  -23.112 1.00 46.52  ? 183 TYR A CZ    1 
ATOM   1404 O  OH    . TYR A 1 183 ? 42.304 11.887  -24.288 1.00 44.64  ? 183 TYR A OH    1 
ATOM   1405 N  N     . MET A 1 184 ? 42.738 7.832   -19.415 1.00 51.98  ? 184 MET A N     1 
ATOM   1406 C  CA    . MET A 1 184 ? 42.443 6.495   -19.918 1.00 39.48  ? 184 MET A CA    1 
ATOM   1407 C  C     . MET A 1 184 ? 43.175 5.455   -19.081 1.00 45.61  ? 184 MET A C     1 
ATOM   1408 O  O     . MET A 1 184 ? 42.963 5.367   -17.867 1.00 43.69  ? 184 MET A O     1 
ATOM   1409 C  CB    . MET A 1 184 ? 42.821 6.366   -21.395 1.00 48.66  ? 184 MET A CB    1 
ATOM   1410 C  CG    . MET A 1 184 ? 41.958 7.187   -22.341 1.00 59.02  ? 184 MET A CG    1 
ATOM   1411 S  SD    . MET A 1 184 ? 40.272 6.559   -22.464 1.00 68.86  ? 184 MET A SD    1 
ATOM   1412 C  CE    . MET A 1 184 ? 39.611 7.613   -23.750 1.00 66.46  ? 184 MET A CE    1 
ATOM   1413 N  N     . ASP A 1 185 ? 44.046 4.674   -19.714 1.00 49.04  ? 185 ASP A N     1 
ATOM   1414 C  CA    . ASP A 1 185 ? 44.818 3.652   -19.024 1.00 54.59  ? 185 ASP A CA    1 
ATOM   1415 C  C     . ASP A 1 185 ? 46.233 4.103   -18.688 1.00 53.17  ? 185 ASP A C     1 
ATOM   1416 O  O     . ASP A 1 185 ? 46.963 3.360   -18.024 1.00 52.80  ? 185 ASP A O     1 
ATOM   1417 C  CB    . ASP A 1 185 ? 44.868 2.372   -19.866 1.00 59.12  ? 185 ASP A CB    1 
ATOM   1418 C  CG    . ASP A 1 185 ? 45.541 2.582   -21.208 1.00 65.46  ? 185 ASP A CG    1 
ATOM   1419 O  OD1   . ASP A 1 185 ? 45.624 3.744   -21.661 1.00 61.94  ? 185 ASP A OD1   1 
ATOM   1420 O  OD2   . ASP A 1 185 ? 45.983 1.582   -21.812 1.00 66.65  ? 185 ASP A OD2   1 
ATOM   1421 N  N     . ASP A 1 186 ? 46.635 5.294   -19.123 1.00 39.22  ? 186 ASP A N     1 
ATOM   1422 C  CA    . ASP A 1 186 ? 47.975 5.790   -18.846 1.00 45.69  ? 186 ASP A CA    1 
ATOM   1423 C  C     . ASP A 1 186 ? 48.023 6.453   -17.476 1.00 46.43  ? 186 ASP A C     1 
ATOM   1424 O  O     . ASP A 1 186 ? 47.084 7.145   -17.070 1.00 50.36  ? 186 ASP A O     1 
ATOM   1425 C  CB    . ASP A 1 186 ? 48.410 6.783   -19.924 1.00 51.54  ? 186 ASP A CB    1 
ATOM   1426 C  CG    . ASP A 1 186 ? 49.848 7.232   -19.757 1.00 61.75  ? 186 ASP A CG    1 
ATOM   1427 O  OD1   . ASP A 1 186 ? 50.749 6.555   -20.295 1.00 73.20  ? 186 ASP A OD1   1 
ATOM   1428 O  OD2   . ASP A 1 186 ? 50.078 8.259   -19.088 1.00 57.75  ? 186 ASP A OD2   1 
ATOM   1429 N  N     . LEU A 1 187 ? 49.126 6.238   -16.763 1.00 46.06  ? 187 LEU A N     1 
ATOM   1430 C  CA    . LEU A 1 187 ? 49.311 6.789   -15.426 1.00 46.51  ? 187 LEU A CA    1 
ATOM   1431 C  C     . LEU A 1 187 ? 50.656 7.494   -15.348 1.00 50.40  ? 187 LEU A C     1 
ATOM   1432 O  O     . LEU A 1 187 ? 51.705 6.860   -15.505 1.00 50.23  ? 187 LEU A O     1 
ATOM   1433 C  CB    . LEU A 1 187 ? 49.222 5.697   -14.358 1.00 44.98  ? 187 LEU A CB    1 
ATOM   1434 C  CG    . LEU A 1 187 ? 47.862 5.024   -14.177 1.00 42.57  ? 187 LEU A CG    1 
ATOM   1435 C  CD1   . LEU A 1 187 ? 47.919 4.018   -13.041 1.00 44.02  ? 187 LEU A CD1   1 
ATOM   1436 C  CD2   . LEU A 1 187 ? 46.776 6.061   -13.931 1.00 50.31  ? 187 LEU A CD2   1 
ATOM   1437 N  N     . TYR A 1 188 ? 50.618 8.801   -15.114 1.00 39.65  ? 188 TYR A N     1 
ATOM   1438 C  CA    . TYR A 1 188 ? 51.794 9.588   -14.770 1.00 38.90  ? 188 TYR A CA    1 
ATOM   1439 C  C     . TYR A 1 188 ? 51.833 9.706   -13.251 1.00 47.40  ? 188 TYR A C     1 
ATOM   1440 O  O     . TYR A 1 188 ? 50.892 10.229  -12.644 1.00 50.42  ? 188 TYR A O     1 
ATOM   1441 C  CB    . TYR A 1 188 ? 51.731 10.962  -15.441 1.00 38.75  ? 188 TYR A CB    1 
ATOM   1442 C  CG    . TYR A 1 188 ? 52.723 11.995  -14.939 1.00 39.25  ? 188 TYR A CG    1 
ATOM   1443 C  CD1   . TYR A 1 188 ? 52.472 12.725  -13.782 1.00 38.94  ? 188 TYR A CD1   1 
ATOM   1444 C  CD2   . TYR A 1 188 ? 53.889 12.269  -15.642 1.00 41.12  ? 188 TYR A CD2   1 
ATOM   1445 C  CE1   . TYR A 1 188 ? 53.364 13.670  -13.324 1.00 48.14  ? 188 TYR A CE1   1 
ATOM   1446 C  CE2   . TYR A 1 188 ? 54.786 13.221  -15.192 1.00 40.88  ? 188 TYR A CE2   1 
ATOM   1447 C  CZ    . TYR A 1 188 ? 54.517 13.918  -14.032 1.00 49.14  ? 188 TYR A CZ    1 
ATOM   1448 O  OH    . TYR A 1 188 ? 55.402 14.866  -13.573 1.00 64.47  ? 188 TYR A OH    1 
ATOM   1449 N  N     . VAL A 1 189 ? 52.908 9.215   -12.639 1.00 46.31  ? 189 VAL A N     1 
ATOM   1450 C  CA    . VAL A 1 189 ? 53.041 9.180   -11.186 1.00 44.35  ? 189 VAL A CA    1 
ATOM   1451 C  C     . VAL A 1 189 ? 54.257 10.007  -10.792 1.00 40.47  ? 189 VAL A C     1 
ATOM   1452 O  O     . VAL A 1 189 ? 55.384 9.692   -11.193 1.00 41.33  ? 189 VAL A O     1 
ATOM   1453 C  CB    . VAL A 1 189 ? 53.165 7.742   -10.657 1.00 48.64  ? 189 VAL A CB    1 
ATOM   1454 C  CG1   . VAL A 1 189 ? 53.289 7.748   -9.145  1.00 40.14  ? 189 VAL A CG1   1 
ATOM   1455 C  CG2   . VAL A 1 189 ? 51.969 6.911   -11.094 1.00 51.41  ? 189 VAL A CG2   1 
ATOM   1456 N  N     . GLY A 1 190 ? 54.029 11.053  -10.003 1.00 43.18  ? 190 GLY A N     1 
ATOM   1457 C  CA    . GLY A 1 190 ? 55.098 11.907  -9.524  1.00 41.36  ? 190 GLY A CA    1 
ATOM   1458 C  C     . GLY A 1 190 ? 55.125 11.950  -8.009  1.00 41.77  ? 190 GLY A C     1 
ATOM   1459 O  O     . GLY A 1 190 ? 54.086 11.875  -7.351  1.00 41.17  ? 190 GLY A O     1 
ATOM   1460 N  N     . SER A 1 191 ? 56.329 12.075  -7.456  1.00 44.94  ? 191 SER A N     1 
ATOM   1461 C  CA    . SER A 1 191 ? 56.508 12.061  -6.012  1.00 47.54  ? 191 SER A CA    1 
ATOM   1462 C  C     . SER A 1 191 ? 57.710 12.913  -5.638  1.00 54.62  ? 191 SER A C     1 
ATOM   1463 O  O     . SER A 1 191 ? 58.649 13.071  -6.424  1.00 56.79  ? 191 SER A O     1 
ATOM   1464 C  CB    . SER A 1 191 ? 56.703 10.637  -5.484  1.00 49.83  ? 191 SER A CB    1 
ATOM   1465 O  OG    . SER A 1 191 ? 57.960 10.120  -5.886  1.00 44.73  ? 191 SER A OG    1 
ATOM   1466 N  N     . ASP A 1 192 ? 57.675 13.455  -4.418  1.00 53.21  ? 192 ASP A N     1 
ATOM   1467 C  CA    . ASP A 1 192 ? 58.795 14.197  -3.853  1.00 52.56  ? 192 ASP A CA    1 
ATOM   1468 C  C     . ASP A 1 192 ? 59.773 13.296  -3.107  1.00 57.72  ? 192 ASP A C     1 
ATOM   1469 O  O     . ASP A 1 192 ? 60.456 13.757  -2.183  1.00 54.10  ? 192 ASP A O     1 
ATOM   1470 C  CB    . ASP A 1 192 ? 58.278 15.302  -2.930  1.00 57.45  ? 192 ASP A CB    1 
ATOM   1471 C  CG    . ASP A 1 192 ? 57.379 16.291  -3.649  1.00 63.67  ? 192 ASP A CG    1 
ATOM   1472 O  OD1   . ASP A 1 192 ? 57.653 16.595  -4.829  1.00 62.60  ? 192 ASP A OD1   1 
ATOM   1473 O  OD2   . ASP A 1 192 ? 56.398 16.760  -3.035  1.00 60.69  ? 192 ASP A OD2   1 
ATOM   1474 N  N     . LEU A 1 193 ? 59.858 12.025  -3.486  1.00 62.98  ? 193 LEU A N     1 
ATOM   1475 C  CA    . LEU A 1 193 ? 60.687 11.044  -2.802  1.00 57.69  ? 193 LEU A CA    1 
ATOM   1476 C  C     . LEU A 1 193 ? 61.954 10.753  -3.597  1.00 55.33  ? 193 LEU A C     1 
ATOM   1477 O  O     . LEU A 1 193 ? 62.056 11.056  -4.789  1.00 49.69  ? 193 LEU A O     1 
ATOM   1478 C  CB    . LEU A 1 193 ? 59.908 9.745   -2.582  1.00 48.08  ? 193 LEU A CB    1 
ATOM   1479 C  CG    . LEU A 1 193 ? 58.562 9.866   -1.868  1.00 48.89  ? 193 LEU A CG    1 
ATOM   1480 C  CD1   . LEU A 1 193 ? 57.747 8.595   -2.043  1.00 46.14  ? 193 LEU A CD1   1 
ATOM   1481 C  CD2   . LEU A 1 193 ? 58.767 10.172  -0.396  1.00 48.46  ? 193 LEU A CD2   1 
ATOM   1482 N  N     . GLU A 1 194 ? 62.925 10.150  -2.913  1.00 59.62  ? 194 GLU A N     1 
ATOM   1483 C  CA    . GLU A 1 194 ? 64.134 9.691   -3.578  1.00 64.01  ? 194 GLU A CA    1 
ATOM   1484 C  C     . GLU A 1 194 ? 63.800 8.583   -4.573  1.00 66.20  ? 194 GLU A C     1 
ATOM   1485 O  O     . GLU A 1 194 ? 62.722 7.983   -4.540  1.00 71.52  ? 194 GLU A O     1 
ATOM   1486 C  CB    . GLU A 1 194 ? 65.154 9.189   -2.555  1.00 78.83  ? 194 GLU A CB    1 
ATOM   1487 C  CG    . GLU A 1 194 ? 65.700 10.265  -1.630  1.00 93.81  ? 194 GLU A CG    1 
ATOM   1488 C  CD    . GLU A 1 194 ? 66.696 11.184  -2.317  1.00 108.73 ? 194 GLU A CD    1 
ATOM   1489 O  OE1   . GLU A 1 194 ? 67.082 10.898  -3.470  1.00 114.17 ? 194 GLU A OE1   1 
ATOM   1490 O  OE2   . GLU A 1 194 ? 67.092 12.196  -1.701  1.00 110.04 ? 194 GLU A OE2   1 
ATOM   1491 N  N     . ILE A 1 195 ? 64.753 8.310   -5.467  1.00 71.91  ? 195 ILE A N     1 
ATOM   1492 C  CA    . ILE A 1 195 ? 64.512 7.362   -6.554  1.00 62.93  ? 195 ILE A CA    1 
ATOM   1493 C  C     . ILE A 1 195 ? 64.144 5.992   -5.996  1.00 59.66  ? 195 ILE A C     1 
ATOM   1494 O  O     . ILE A 1 195 ? 63.172 5.365   -6.432  1.00 49.40  ? 195 ILE A O     1 
ATOM   1495 C  CB    . ILE A 1 195 ? 65.739 7.283   -7.481  1.00 62.59  ? 195 ILE A CB    1 
ATOM   1496 C  CG1   . ILE A 1 195 ? 66.290 8.683   -7.757  1.00 92.71  ? 195 ILE A CG1   1 
ATOM   1497 C  CG2   . ILE A 1 195 ? 65.372 6.591   -8.785  1.00 51.98  ? 195 ILE A CG2   1 
ATOM   1498 C  CD1   . ILE A 1 195 ? 65.311 9.606   -8.461  1.00 93.14  ? 195 ILE A CD1   1 
ATOM   1499 N  N     . GLY A 1 196 ? 64.909 5.516   -5.011  1.00 64.77  ? 196 GLY A N     1 
ATOM   1500 C  CA    . GLY A 1 196 ? 64.636 4.205   -4.444  1.00 51.46  ? 196 GLY A CA    1 
ATOM   1501 C  C     . GLY A 1 196 ? 63.297 4.133   -3.735  1.00 56.04  ? 196 GLY A C     1 
ATOM   1502 O  O     . GLY A 1 196 ? 62.545 3.171   -3.905  1.00 52.85  ? 196 GLY A O     1 
ATOM   1503 N  N     . GLN A 1 197 ? 62.981 5.148   -2.926  1.00 71.64  ? 197 GLN A N     1 
ATOM   1504 C  CA    . GLN A 1 197 ? 61.697 5.170   -2.236  1.00 65.40  ? 197 GLN A CA    1 
ATOM   1505 C  C     . GLN A 1 197 ? 60.536 5.402   -3.195  1.00 58.38  ? 197 GLN A C     1 
ATOM   1506 O  O     . GLN A 1 197 ? 59.402 5.024   -2.882  1.00 47.82  ? 197 GLN A O     1 
ATOM   1507 C  CB    . GLN A 1 197 ? 61.705 6.242   -1.144  1.00 62.36  ? 197 GLN A CB    1 
ATOM   1508 C  CG    . GLN A 1 197 ? 60.544 6.141   -0.167  1.00 67.54  ? 197 GLN A CG    1 
ATOM   1509 C  CD    . GLN A 1 197 ? 60.697 7.068   1.020   1.00 79.86  ? 197 GLN A CD    1 
ATOM   1510 O  OE1   . GLN A 1 197 ? 61.745 7.688   1.208   1.00 87.49  ? 197 GLN A OE1   1 
ATOM   1511 N  NE2   . GLN A 1 197 ? 59.650 7.167   1.832   1.00 81.53  ? 197 GLN A NE2   1 
ATOM   1512 N  N     . HIS A 1 198 ? 60.797 6.008   -4.354  1.00 58.29  ? 198 HIS A N     1 
ATOM   1513 C  CA    . HIS A 1 198 ? 59.755 6.155   -5.364  1.00 47.23  ? 198 HIS A CA    1 
ATOM   1514 C  C     . HIS A 1 198 ? 59.434 4.818   -6.019  1.00 50.82  ? 198 HIS A C     1 
ATOM   1515 O  O     . HIS A 1 198 ? 58.262 4.508   -6.263  1.00 47.83  ? 198 HIS A O     1 
ATOM   1516 C  CB    . HIS A 1 198 ? 60.190 7.180   -6.410  1.00 46.37  ? 198 HIS A CB    1 
ATOM   1517 C  CG    . HIS A 1 198 ? 59.206 7.374   -7.521  1.00 45.16  ? 198 HIS A CG    1 
ATOM   1518 N  ND1   . HIS A 1 198 ? 58.108 8.200   -7.408  1.00 44.21  ? 198 HIS A ND1   1 
ATOM   1519 C  CD2   . HIS A 1 198 ? 59.165 6.864   -8.774  1.00 44.89  ? 198 HIS A CD2   1 
ATOM   1520 C  CE1   . HIS A 1 198 ? 57.429 8.183   -8.540  1.00 45.63  ? 198 HIS A CE1   1 
ATOM   1521 N  NE2   . HIS A 1 198 ? 58.048 7.380   -9.386  1.00 43.79  ? 198 HIS A NE2   1 
ATOM   1522 N  N     . ARG A 1 199 ? 60.464 4.014   -6.311  1.00 51.55  ? 199 ARG A N     1 
ATOM   1523 C  CA    . ARG A 1 199 ? 60.244 2.697   -6.905  1.00 46.17  ? 199 ARG A CA    1 
ATOM   1524 C  C     . ARG A 1 199 ? 59.356 1.834   -6.020  1.00 45.56  ? 199 ARG A C     1 
ATOM   1525 O  O     . ARG A 1 199 ? 58.515 1.078   -6.518  1.00 44.84  ? 199 ARG A O     1 
ATOM   1526 C  CB    . ARG A 1 199 ? 61.582 1.997   -7.146  1.00 49.84  ? 199 ARG A CB    1 
ATOM   1527 C  CG    . ARG A 1 199 ? 62.517 2.732   -8.084  1.00 61.55  ? 199 ARG A CG    1 
ATOM   1528 C  CD    . ARG A 1 199 ? 61.979 2.755   -9.502  1.00 77.30  ? 199 ARG A CD    1 
ATOM   1529 N  NE    . ARG A 1 199 ? 62.772 3.628   -10.361 1.00 79.91  ? 199 ARG A NE    1 
ATOM   1530 C  CZ    . ARG A 1 199 ? 63.888 3.256   -10.980 1.00 75.72  ? 199 ARG A CZ    1 
ATOM   1531 N  NH1   . ARG A 1 199 ? 64.349 2.020   -10.838 1.00 81.83  ? 199 ARG A NH1   1 
ATOM   1532 N  NH2   . ARG A 1 199 ? 64.544 4.122   -11.742 1.00 62.58  ? 199 ARG A NH2   1 
ATOM   1533 N  N     . THR A 1 200 ? 59.539 1.928   -4.701  1.00 47.63  ? 200 THR A N     1 
ATOM   1534 C  CA    . THR A 1 200 ? 58.695 1.180   -3.777  1.00 48.07  ? 200 THR A CA    1 
ATOM   1535 C  C     . THR A 1 200 ? 57.234 1.593   -3.906  1.00 58.14  ? 200 THR A C     1 
ATOM   1536 O  O     . THR A 1 200 ? 56.340 0.739   -3.943  1.00 57.49  ? 200 THR A O     1 
ATOM   1537 C  CB    . THR A 1 200 ? 59.189 1.385   -2.345  1.00 49.79  ? 200 THR A CB    1 
ATOM   1538 O  OG1   . THR A 1 200 ? 60.300 0.516   -2.090  1.00 51.65  ? 200 THR A OG1   1 
ATOM   1539 C  CG2   . THR A 1 200 ? 58.082 1.102   -1.349  1.00 61.13  ? 200 THR A CG2   1 
ATOM   1540 N  N     . LYS A 1 201 ? 56.973 2.900   -3.986  1.00 58.46  ? 201 LYS A N     1 
ATOM   1541 C  CA    . LYS A 1 201 ? 55.599 3.373   -4.108  1.00 52.91  ? 201 LYS A CA    1 
ATOM   1542 C  C     . LYS A 1 201 ? 54.969 2.939   -5.425  1.00 52.45  ? 201 LYS A C     1 
ATOM   1543 O  O     . LYS A 1 201 ? 53.757 2.704   -5.481  1.00 53.20  ? 201 LYS A O     1 
ATOM   1544 C  CB    . LYS A 1 201 ? 55.553 4.895   -3.974  1.00 43.20  ? 201 LYS A CB    1 
ATOM   1545 C  CG    . LYS A 1 201 ? 54.547 5.384   -2.950  1.00 43.02  ? 201 LYS A CG    1 
ATOM   1546 C  CD    . LYS A 1 201 ? 54.892 4.869   -1.563  1.00 50.55  ? 201 LYS A CD    1 
ATOM   1547 C  CE    . LYS A 1 201 ? 53.785 5.175   -0.572  1.00 52.77  ? 201 LYS A CE    1 
ATOM   1548 N  NZ    . LYS A 1 201 ? 54.107 4.699   0.801   1.00 60.20  ? 201 LYS A NZ    1 
ATOM   1549 N  N     . ILE A 1 202 ? 55.768 2.829   -6.488  1.00 54.36  ? 202 ILE A N     1 
ATOM   1550 C  CA    . ILE A 1 202 ? 55.241 2.348   -7.761  1.00 50.11  ? 202 ILE A CA    1 
ATOM   1551 C  C     . ILE A 1 202 ? 54.780 0.903   -7.631  1.00 47.24  ? 202 ILE A C     1 
ATOM   1552 O  O     . ILE A 1 202 ? 53.717 0.528   -8.139  1.00 49.44  ? 202 ILE A O     1 
ATOM   1553 C  CB    . ILE A 1 202 ? 56.293 2.511   -8.872  1.00 55.46  ? 202 ILE A CB    1 
ATOM   1554 C  CG1   . ILE A 1 202 ? 56.696 3.980   -9.012  1.00 60.99  ? 202 ILE A CG1   1 
ATOM   1555 C  CG2   . ILE A 1 202 ? 55.766 1.974   -10.194 1.00 42.48  ? 202 ILE A CG2   1 
ATOM   1556 C  CD1   . ILE A 1 202 ? 55.529 4.915   -9.218  1.00 41.89  ? 202 ILE A CD1   1 
ATOM   1557 N  N     . GLU A 1 203 ? 55.563 0.071   -6.938  1.00 44.06  ? 203 GLU A N     1 
ATOM   1558 C  CA    . GLU A 1 203 ? 55.168 -1.319  -6.739  1.00 42.97  ? 203 GLU A CA    1 
ATOM   1559 C  C     . GLU A 1 203 ? 53.923 -1.422  -5.869  1.00 44.49  ? 203 GLU A C     1 
ATOM   1560 O  O     . GLU A 1 203 ? 53.063 -2.279  -6.103  1.00 49.36  ? 203 GLU A O     1 
ATOM   1561 C  CB    . GLU A 1 203 ? 56.321 -2.113  -6.129  1.00 47.35  ? 203 GLU A CB    1 
ATOM   1562 C  CG    . GLU A 1 203 ? 57.484 -2.305  -7.079  1.00 58.29  ? 203 GLU A CG    1 
ATOM   1563 C  CD    . GLU A 1 203 ? 57.041 -2.835  -8.430  1.00 62.25  ? 203 GLU A CD    1 
ATOM   1564 O  OE1   . GLU A 1 203 ? 56.185 -3.745  -8.465  1.00 47.29  ? 203 GLU A OE1   1 
ATOM   1565 O  OE2   . GLU A 1 203 ? 57.543 -2.331  -9.458  1.00 64.86  ? 203 GLU A OE2   1 
ATOM   1566 N  N     . GLU A 1 204 ? 53.812 -0.561  -4.855  1.00 44.58  ? 204 GLU A N     1 
ATOM   1567 C  CA    . GLU A 1 204 ? 52.584 -0.507  -4.070  1.00 46.01  ? 204 GLU A CA    1 
ATOM   1568 C  C     . GLU A 1 204 ? 51.393 -0.159  -4.953  1.00 60.90  ? 204 GLU A C     1 
ATOM   1569 O  O     . GLU A 1 204 ? 50.287 -0.676  -4.755  1.00 63.98  ? 204 GLU A O     1 
ATOM   1570 C  CB    . GLU A 1 204 ? 52.731 0.505   -2.935  1.00 42.47  ? 204 GLU A CB    1 
ATOM   1571 C  CG    . GLU A 1 204 ? 51.501 0.639   -2.054  1.00 60.04  ? 204 GLU A CG    1 
ATOM   1572 C  CD    . GLU A 1 204 ? 51.706 1.619   -0.918  1.00 69.92  ? 204 GLU A CD    1 
ATOM   1573 O  OE1   . GLU A 1 204 ? 52.875 1.914   -0.591  1.00 71.95  ? 204 GLU A OE1   1 
ATOM   1574 O  OE2   . GLU A 1 204 ? 50.698 2.098   -0.355  1.00 76.59  ? 204 GLU A OE2   1 
ATOM   1575 N  N     . LEU A 1 205 ? 51.607 0.707   -5.947  1.00 64.32  ? 205 LEU A N     1 
ATOM   1576 C  CA    . LEU A 1 205 ? 50.542 1.044   -6.884  1.00 51.64  ? 205 LEU A CA    1 
ATOM   1577 C  C     . LEU A 1 205 ? 50.267 -0.106  -7.843  1.00 47.17  ? 205 LEU A C     1 
ATOM   1578 O  O     . LEU A 1 205 ? 49.107 -0.389  -8.165  1.00 52.32  ? 205 LEU A O     1 
ATOM   1579 C  CB    . LEU A 1 205 ? 50.909 2.312   -7.654  1.00 44.92  ? 205 LEU A CB    1 
ATOM   1580 C  CG    . LEU A 1 205 ? 49.884 2.842   -8.657  1.00 39.40  ? 205 LEU A CG    1 
ATOM   1581 C  CD1   . LEU A 1 205 ? 48.597 3.254   -7.957  1.00 39.03  ? 205 LEU A CD1   1 
ATOM   1582 C  CD2   . LEU A 1 205 ? 50.470 4.002   -9.438  1.00 39.23  ? 205 LEU A CD2   1 
ATOM   1583 N  N     . ARG A 1 206 ? 51.321 -0.780  -8.314  1.00 45.78  ? 206 ARG A N     1 
ATOM   1584 C  CA    . ARG A 1 206 ? 51.125 -1.919  -9.205  1.00 45.87  ? 206 ARG A CA    1 
ATOM   1585 C  C     . ARG A 1 206 ? 50.462 -3.081  -8.475  1.00 49.92  ? 206 ARG A C     1 
ATOM   1586 O  O     . ARG A 1 206 ? 49.647 -3.803  -9.061  1.00 51.82  ? 206 ARG A O     1 
ATOM   1587 C  CB    . ARG A 1 206 ? 52.461 -2.349  -9.813  1.00 41.94  ? 206 ARG A CB    1 
ATOM   1588 C  CG    . ARG A 1 206 ? 53.087 -1.294  -10.712 1.00 51.39  ? 206 ARG A CG    1 
ATOM   1589 C  CD    . ARG A 1 206 ? 54.361 -1.786  -11.387 1.00 50.26  ? 206 ARG A CD    1 
ATOM   1590 N  NE    . ARG A 1 206 ? 54.109 -2.881  -12.320 1.00 54.41  ? 206 ARG A NE    1 
ATOM   1591 C  CZ    . ARG A 1 206 ? 54.589 -4.112  -12.177 1.00 49.02  ? 206 ARG A CZ    1 
ATOM   1592 N  NH1   . ARG A 1 206 ? 55.363 -4.408  -11.141 1.00 44.26  ? 206 ARG A NH1   1 
ATOM   1593 N  NH2   . ARG A 1 206 ? 54.306 -5.044  -13.076 1.00 44.55  ? 206 ARG A NH2   1 
ATOM   1594 N  N     . GLN A 1 207 ? 50.793 -3.272  -7.196  1.00 48.55  ? 207 GLN A N     1 
ATOM   1595 C  CA    . GLN A 1 207 ? 50.105 -4.285  -6.403  1.00 42.11  ? 207 GLN A CA    1 
ATOM   1596 C  C     . GLN A 1 207 ? 48.674 -3.871  -6.088  1.00 55.82  ? 207 GLN A C     1 
ATOM   1597 O  O     . GLN A 1 207 ? 47.794 -4.731  -5.975  1.00 49.66  ? 207 GLN A O     1 
ATOM   1598 C  CB    . GLN A 1 207 ? 50.873 -4.559  -5.111  1.00 46.82  ? 207 GLN A CB    1 
ATOM   1599 C  CG    . GLN A 1 207 ? 52.018 -5.541  -5.276  1.00 52.91  ? 207 GLN A CG    1 
ATOM   1600 C  CD    . GLN A 1 207 ? 51.536 -6.932  -5.641  1.00 67.15  ? 207 GLN A CD    1 
ATOM   1601 O  OE1   . GLN A 1 207 ? 51.976 -7.514  -6.632  1.00 61.62  ? 207 GLN A OE1   1 
ATOM   1602 N  NE2   . GLN A 1 207 ? 50.628 -7.473  -4.837  1.00 82.22  ? 207 GLN A NE2   1 
ATOM   1603 N  N     . HIS A 1 208 ? 48.423 -2.568  -5.940  1.00 63.91  ? 208 HIS A N     1 
ATOM   1604 C  CA    . HIS A 1 208 ? 47.058 -2.107  -5.715  1.00 41.04  ? 208 HIS A CA    1 
ATOM   1605 C  C     . HIS A 1 208 ? 46.198 -2.309  -6.956  1.00 44.43  ? 208 HIS A C     1 
ATOM   1606 O  O     . HIS A 1 208 ? 45.048 -2.751  -6.856  1.00 42.86  ? 208 HIS A O     1 
ATOM   1607 C  CB    . HIS A 1 208 ? 47.056 -0.637  -5.300  1.00 48.53  ? 208 HIS A CB    1 
ATOM   1608 C  CG    . HIS A 1 208 ? 45.684 -0.056  -5.161  1.00 43.45  ? 208 HIS A CG    1 
ATOM   1609 N  ND1   . HIS A 1 208 ? 44.914 -0.228  -4.031  1.00 40.91  ? 208 HIS A ND1   1 
ATOM   1610 C  CD2   . HIS A 1 208 ? 44.937 0.681   -6.017  1.00 39.90  ? 208 HIS A CD2   1 
ATOM   1611 C  CE1   . HIS A 1 208 ? 43.756 0.385   -4.193  1.00 45.03  ? 208 HIS A CE1   1 
ATOM   1612 N  NE2   . HIS A 1 208 ? 43.744 0.944   -5.389  1.00 42.23  ? 208 HIS A NE2   1 
ATOM   1613 N  N     . LEU A 1 209 ? 46.737 -1.983  -8.134  1.00 46.33  ? 209 LEU A N     1 
ATOM   1614 C  CA    . LEU A 1 209 ? 45.993 -2.191  -9.372  1.00 46.13  ? 209 LEU A CA    1 
ATOM   1615 C  C     . LEU A 1 209 ? 45.768 -3.673  -9.636  1.00 48.77  ? 209 LEU A C     1 
ATOM   1616 O  O     . LEU A 1 209 ? 44.666 -4.080  -10.023 1.00 41.67  ? 209 LEU A O     1 
ATOM   1617 C  CB    . LEU A 1 209 ? 46.734 -1.544  -10.542 1.00 40.32  ? 209 LEU A CB    1 
ATOM   1618 C  CG    . LEU A 1 209 ? 46.830 -0.018  -10.522 1.00 45.79  ? 209 LEU A CG    1 
ATOM   1619 C  CD1   . LEU A 1 209 ? 47.742 0.476   -11.632 1.00 39.61  ? 209 LEU A CD1   1 
ATOM   1620 C  CD2   . LEU A 1 209 ? 45.445 0.594   -10.653 1.00 46.04  ? 209 LEU A CD2   1 
ATOM   1621 N  N     . LEU A 1 210 ? 46.804 -4.493  -9.431  1.00 50.23  ? 210 LEU A N     1 
ATOM   1622 C  CA    . LEU A 1 210 ? 46.679 -5.930  -9.649  1.00 42.57  ? 210 LEU A CA    1 
ATOM   1623 C  C     . LEU A 1 210 ? 45.641 -6.549  -8.724  1.00 51.33  ? 210 LEU A C     1 
ATOM   1624 O  O     . LEU A 1 210 ? 44.958 -7.506  -9.109  1.00 51.27  ? 210 LEU A O     1 
ATOM   1625 C  CB    . LEU A 1 210 ? 48.037 -6.602  -9.453  1.00 55.27  ? 210 LEU A CB    1 
ATOM   1626 C  CG    . LEU A 1 210 ? 48.148 -8.090  -9.781  1.00 43.86  ? 210 LEU A CG    1 
ATOM   1627 C  CD1   . LEU A 1 210 ? 48.025 -8.320  -11.279 1.00 44.29  ? 210 LEU A CD1   1 
ATOM   1628 C  CD2   . LEU A 1 210 ? 49.460 -8.640  -9.249  1.00 68.24  ? 210 LEU A CD2   1 
ATOM   1629 N  N     . ARG A 1 211 ? 45.517 -6.025  -7.501  1.00 42.69  ? 211 ARG A N     1 
ATOM   1630 C  CA    . ARG A 1 211 ? 44.441 -6.448  -6.611  1.00 43.18  ? 211 ARG A CA    1 
ATOM   1631 C  C     . ARG A 1 211 ? 43.082 -6.260  -7.271  1.00 52.25  ? 211 ARG A C     1 
ATOM   1632 O  O     . ARG A 1 211 ? 42.178 -7.088  -7.104  1.00 49.88  ? 211 ARG A O     1 
ATOM   1633 C  CB    . ARG A 1 211 ? 44.525 -5.669  -5.296  1.00 48.23  ? 211 ARG A CB    1 
ATOM   1634 C  CG    . ARG A 1 211 ? 43.185 -5.254  -4.694  1.00 58.37  ? 211 ARG A CG    1 
ATOM   1635 C  CD    . ARG A 1 211 ? 42.579 -6.358  -3.848  1.00 71.98  ? 211 ARG A CD    1 
ATOM   1636 N  NE    . ARG A 1 211 ? 41.344 -5.931  -3.194  1.00 73.49  ? 211 ARG A NE    1 
ATOM   1637 C  CZ    . ARG A 1 211 ? 40.130 -6.091  -3.712  1.00 70.66  ? 211 ARG A CZ    1 
ATOM   1638 N  NH1   . ARG A 1 211 ? 39.982 -6.667  -4.897  1.00 68.35  ? 211 ARG A NH1   1 
ATOM   1639 N  NH2   . ARG A 1 211 ? 39.063 -5.675  -3.043  1.00 64.81  ? 211 ARG A NH2   1 
ATOM   1640 N  N     . TRP A 1 212 ? 42.926 -5.183  -8.043  1.00 53.22  ? 212 TRP A N     1 
ATOM   1641 C  CA    . TRP A 1 212 ? 41.698 -4.902  -8.774  1.00 52.49  ? 212 TRP A CA    1 
ATOM   1642 C  C     . TRP A 1 212 ? 41.779 -5.340  -10.233 1.00 51.01  ? 212 TRP A C     1 
ATOM   1643 O  O     . TRP A 1 212 ? 41.144 -4.731  -11.100 1.00 50.87  ? 212 TRP A O     1 
ATOM   1644 C  CB    . TRP A 1 212 ? 41.354 -3.416  -8.678  1.00 45.06  ? 212 TRP A CB    1 
ATOM   1645 C  CG    . TRP A 1 212 ? 41.046 -2.975  -7.282  1.00 47.20  ? 212 TRP A CG    1 
ATOM   1646 C  CD1   . TRP A 1 212 ? 41.876 -2.308  -6.428  1.00 53.84  ? 212 TRP A CD1   1 
ATOM   1647 C  CD2   . TRP A 1 212 ? 39.820 -3.180  -6.571  1.00 46.46  ? 212 TRP A CD2   1 
ATOM   1648 N  NE1   . TRP A 1 212 ? 41.240 -2.081  -5.231  1.00 60.67  ? 212 TRP A NE1   1 
ATOM   1649 C  CE2   . TRP A 1 212 ? 39.977 -2.607  -5.293  1.00 42.67  ? 212 TRP A CE2   1 
ATOM   1650 C  CE3   . TRP A 1 212 ? 38.603 -3.790  -6.891  1.00 43.55  ? 212 TRP A CE3   1 
ATOM   1651 C  CZ2   . TRP A 1 212 ? 38.965 -2.627  -4.338  1.00 43.46  ? 212 TRP A CZ2   1 
ATOM   1652 C  CZ3   . TRP A 1 212 ? 37.600 -3.808  -5.942  1.00 44.32  ? 212 TRP A CZ3   1 
ATOM   1653 C  CH2   . TRP A 1 212 ? 37.786 -3.230  -4.681  1.00 44.27  ? 212 TRP A CH2   1 
ATOM   1654 N  N     . GLY A 1 213 ? 42.561 -6.379  -10.523 1.00 43.56  ? 213 GLY A N     1 
ATOM   1655 C  CA    . GLY A 1 213 ? 42.573 -6.970  -11.847 1.00 48.07  ? 213 GLY A CA    1 
ATOM   1656 C  C     . GLY A 1 213 ? 43.199 -6.134  -12.939 1.00 45.12  ? 213 GLY A C     1 
ATOM   1657 O  O     . GLY A 1 213 ? 42.946 -6.390  -14.119 1.00 49.85  ? 213 GLY A O     1 
ATOM   1658 N  N     . LEU A 1 214 ? 44.015 -5.145  -12.589 1.00 42.76  ? 214 LEU A N     1 
ATOM   1659 C  CA    . LEU A 1 214 ? 44.673 -4.284  -13.564 1.00 42.80  ? 214 LEU A CA    1 
ATOM   1660 C  C     . LEU A 1 214 ? 46.167 -4.575  -13.556 1.00 52.85  ? 214 LEU A C     1 
ATOM   1661 O  O     . LEU A 1 214 ? 46.831 -4.408  -12.527 1.00 61.94  ? 214 LEU A O     1 
ATOM   1662 C  CB    . LEU A 1 214 ? 44.408 -2.810  -13.263 1.00 41.38  ? 214 LEU A CB    1 
ATOM   1663 C  CG    . LEU A 1 214 ? 42.958 -2.349  -13.423 1.00 41.29  ? 214 LEU A CG    1 
ATOM   1664 C  CD1   . LEU A 1 214 ? 42.835 -0.866  -13.120 1.00 44.70  ? 214 LEU A CD1   1 
ATOM   1665 C  CD2   . LEU A 1 214 ? 42.445 -2.659  -14.821 1.00 45.24  ? 214 LEU A CD2   1 
ATOM   1666 N  N     . THR A 1 215 ? 46.689 -5.007  -14.697 1.00 43.16  ? 215 THR A N     1 
ATOM   1667 C  CA    . THR A 1 215 ? 48.102 -5.310  -14.846 1.00 50.83  ? 215 THR A CA    1 
ATOM   1668 C  C     . THR A 1 215 ? 48.837 -4.125  -15.460 1.00 60.91  ? 215 THR A C     1 
ATOM   1669 O  O     . THR A 1 215 ? 48.257 -3.300  -16.171 1.00 66.62  ? 215 THR A O     1 
ATOM   1670 C  CB    . THR A 1 215 ? 48.305 -6.559  -15.710 1.00 44.75  ? 215 THR A CB    1 
ATOM   1671 O  OG1   . THR A 1 215 ? 47.757 -6.337  -17.015 1.00 45.21  ? 215 THR A OG1   1 
ATOM   1672 C  CG2   . THR A 1 215 ? 47.621 -7.761  -15.074 1.00 45.23  ? 215 THR A CG2   1 
ATOM   1673 N  N     . THR A 1 216 ? 50.133 -4.045  -15.166 1.00 55.86  ? 216 THR A N     1 
ATOM   1674 C  CA    . THR A 1 216 ? 51.006 -2.998  -15.691 1.00 43.79  ? 216 THR A CA    1 
ATOM   1675 C  C     . THR A 1 216 ? 52.234 -3.672  -16.286 1.00 47.19  ? 216 THR A C     1 
ATOM   1676 O  O     . THR A 1 216 ? 53.244 -3.870  -15.596 1.00 47.87  ? 216 THR A O     1 
ATOM   1677 C  CB    . THR A 1 216 ? 51.390 -1.995  -14.606 1.00 44.26  ? 216 THR A CB    1 
ATOM   1678 O  OG1   . THR A 1 216 ? 51.830 -2.696  -13.436 1.00 42.51  ? 216 THR A OG1   1 
ATOM   1679 C  CG2   . THR A 1 216 ? 50.200 -1.117  -14.247 1.00 41.44  ? 216 THR A CG2   1 
ATOM   1680 N  N     . PRO A 1 217 ? 52.181 -4.045  -17.563 1.00 45.16  ? 217 PRO A N     1 
ATOM   1681 C  CA    . PRO A 1 217 ? 53.318 -4.743  -18.172 1.00 46.44  ? 217 PRO A CA    1 
ATOM   1682 C  C     . PRO A 1 217 ? 54.556 -3.860  -18.222 1.00 51.56  ? 217 PRO A C     1 
ATOM   1683 O  O     . PRO A 1 217 ? 54.471 -2.647  -18.424 1.00 59.24  ? 217 PRO A O     1 
ATOM   1684 C  CB    . PRO A 1 217 ? 52.812 -5.091  -19.577 1.00 47.39  ? 217 PRO A CB    1 
ATOM   1685 C  CG    . PRO A 1 217 ? 51.712 -4.119  -19.839 1.00 46.50  ? 217 PRO A CG    1 
ATOM   1686 C  CD    . PRO A 1 217 ? 51.069 -3.861  -18.510 1.00 45.20  ? 217 PRO A CD    1 
ATOM   1687 N  N     . ASP A 1 218 ? 55.716 -4.492  -18.032 1.00 56.27  ? 218 ASP A N     1 
ATOM   1688 C  CA    . ASP A 1 218 ? 56.981 -3.767  -18.011 1.00 56.35  ? 218 ASP A CA    1 
ATOM   1689 C  C     . ASP A 1 218 ? 57.299 -3.118  -19.352 1.00 59.98  ? 218 ASP A C     1 
ATOM   1690 O  O     . ASP A 1 218 ? 58.075 -2.156  -19.393 1.00 64.71  ? 218 ASP A O     1 
ATOM   1691 C  CB    . ASP A 1 218 ? 58.108 -4.718  -17.600 1.00 48.97  ? 218 ASP A CB    1 
ATOM   1692 C  CG    . ASP A 1 218 ? 59.325 -3.990  -17.071 1.00 56.30  ? 218 ASP A CG    1 
ATOM   1693 O  OD1   . ASP A 1 218 ? 60.360 -3.973  -17.769 1.00 58.11  ? 218 ASP A OD1   1 
ATOM   1694 O  OD2   . ASP A 1 218 ? 59.245 -3.434  -15.956 1.00 61.17  ? 218 ASP A OD2   1 
ATOM   1695 N  N     . LYS A 1 219 ? 56.712 -3.616  -20.445 1.00 55.68  ? 219 LYS A N     1 
ATOM   1696 C  CA    . LYS A 1 219 ? 56.960 -3.038  -21.762 1.00 55.18  ? 219 LYS A CA    1 
ATOM   1697 C  C     . LYS A 1 219 ? 56.473 -1.596  -21.846 1.00 58.65  ? 219 LYS A C     1 
ATOM   1698 O  O     . LYS A 1 219 ? 56.996 -0.811  -22.645 1.00 66.06  ? 219 LYS A O     1 
ATOM   1699 C  CB    . LYS A 1 219 ? 56.289 -3.895  -22.838 1.00 58.02  ? 219 LYS A CB    1 
ATOM   1700 C  CG    . LYS A 1 219 ? 56.543 -3.447  -24.271 1.00 77.20  ? 219 LYS A CG    1 
ATOM   1701 C  CD    . LYS A 1 219 ? 58.012 -3.572  -24.648 1.00 92.97  ? 219 LYS A CD    1 
ATOM   1702 C  CE    . LYS A 1 219 ? 58.247 -3.159  -26.094 1.00 93.10  ? 219 LYS A CE    1 
ATOM   1703 N  NZ    . LYS A 1 219 ? 57.471 -3.997  -27.052 1.00 91.03  ? 219 LYS A NZ    1 
ATOM   1704 N  N     . LYS A 1 220 ? 55.484 -1.229  -21.031 1.00 59.99  ? 220 LYS A N     1 
ATOM   1705 C  CA    . LYS A 1 220 ? 54.948 0.125   -20.989 1.00 57.90  ? 220 LYS A CA    1 
ATOM   1706 C  C     . LYS A 1 220 ? 55.231 0.808   -19.653 1.00 55.28  ? 220 LYS A C     1 
ATOM   1707 O  O     . LYS A 1 220 ? 54.463 1.666   -19.212 1.00 46.27  ? 220 LYS A O     1 
ATOM   1708 C  CB    . LYS A 1 220 ? 53.448 0.112   -21.275 1.00 56.61  ? 220 LYS A CB    1 
ATOM   1709 C  CG    . LYS A 1 220 ? 53.095 -0.228  -22.714 1.00 65.08  ? 220 LYS A CG    1 
ATOM   1710 C  CD    . LYS A 1 220 ? 51.684 -0.785  -22.820 1.00 78.54  ? 220 LYS A CD    1 
ATOM   1711 C  CE    . LYS A 1 220 ? 51.195 -0.778  -24.258 1.00 90.23  ? 220 LYS A CE    1 
ATOM   1712 N  NZ    . LYS A 1 220 ? 51.018 0.613   -24.761 1.00 95.43  ? 220 LYS A NZ    1 
ATOM   1713 N  N     . HIS A 1 221 ? 56.330 0.435   -19.001 1.00 46.25  ? 221 HIS A N     1 
ATOM   1714 C  CA    . HIS A 1 221 ? 56.735 1.007   -17.720 1.00 45.60  ? 221 HIS A CA    1 
ATOM   1715 C  C     . HIS A 1 221 ? 58.010 1.813   -17.952 1.00 47.84  ? 221 HIS A C     1 
ATOM   1716 O  O     . HIS A 1 221 ? 59.110 1.255   -18.000 1.00 58.87  ? 221 HIS A O     1 
ATOM   1717 C  CB    . HIS A 1 221 ? 56.942 -0.088  -16.676 1.00 45.62  ? 221 HIS A CB    1 
ATOM   1718 C  CG    . HIS A 1 221 ? 57.215 0.429   -15.298 1.00 49.91  ? 221 HIS A CG    1 
ATOM   1719 N  ND1   . HIS A 1 221 ? 57.370 -0.402  -14.210 1.00 57.91  ? 221 HIS A ND1   1 
ATOM   1720 C  CD2   . HIS A 1 221 ? 57.359 1.691   -14.828 1.00 52.13  ? 221 HIS A CD2   1 
ATOM   1721 C  CE1   . HIS A 1 221 ? 57.599 0.324   -13.131 1.00 44.65  ? 221 HIS A CE1   1 
ATOM   1722 N  NE2   . HIS A 1 221 ? 57.599 1.598   -13.479 1.00 44.42  ? 221 HIS A NE2   1 
ATOM   1723 N  N     . GLN A 1 222 ? 57.857 3.126   -18.094 1.00 46.06  ? 222 GLN A N     1 
ATOM   1724 C  CA    . GLN A 1 222 ? 58.981 4.016   -18.346 1.00 52.16  ? 222 GLN A CA    1 
ATOM   1725 C  C     . GLN A 1 222 ? 59.620 4.421   -17.024 1.00 60.91  ? 222 GLN A C     1 
ATOM   1726 O  O     . GLN A 1 222 ? 58.925 4.851   -16.097 1.00 76.54  ? 222 GLN A O     1 
ATOM   1727 C  CB    . GLN A 1 222 ? 58.523 5.252   -19.119 1.00 49.93  ? 222 GLN A CB    1 
ATOM   1728 C  CG    . GLN A 1 222 ? 57.585 4.938   -20.272 1.00 46.55  ? 222 GLN A CG    1 
ATOM   1729 C  CD    . GLN A 1 222 ? 57.348 6.133   -21.173 1.00 54.31  ? 222 GLN A CD    1 
ATOM   1730 O  OE1   . GLN A 1 222 ? 58.244 6.949   -21.389 1.00 58.20  ? 222 GLN A OE1   1 
ATOM   1731 N  NE2   . GLN A 1 222 ? 56.137 6.243   -21.705 1.00 46.08  ? 222 GLN A NE2   1 
ATOM   1732 N  N     . LYS A 1 223 ? 60.945 4.287   -16.942 1.00 59.30  ? 223 LYS A N     1 
ATOM   1733 C  CA    . LYS A 1 223 ? 61.673 4.562   -15.713 1.00 60.65  ? 223 LYS A CA    1 
ATOM   1734 C  C     . LYS A 1 223 ? 62.722 5.655   -15.847 1.00 66.85  ? 223 LYS A C     1 
ATOM   1735 O  O     . LYS A 1 223 ? 63.235 6.120   -14.822 1.00 77.31  ? 223 LYS A O     1 
ATOM   1736 C  CB    . LYS A 1 223 ? 62.353 3.283   -15.199 1.00 69.15  ? 223 LYS A CB    1 
ATOM   1737 C  CG    . LYS A 1 223 ? 61.407 2.103   -15.036 1.00 65.92  ? 223 LYS A CG    1 
ATOM   1738 C  CD    . LYS A 1 223 ? 62.155 0.850   -14.610 1.00 74.46  ? 223 LYS A CD    1 
ATOM   1739 C  CE    . LYS A 1 223 ? 61.232 -0.359  -14.563 1.00 76.97  ? 223 LYS A CE    1 
ATOM   1740 N  NZ    . LYS A 1 223 ? 60.668 -0.683  -15.903 1.00 75.50  ? 223 LYS A NZ    1 
ATOM   1741 N  N     . GLU A 1 224 ? 63.060 6.077   -17.061 1.00 71.94  ? 224 GLU A N     1 
ATOM   1742 C  CA    . GLU A 1 224 ? 64.058 7.111   -17.267 1.00 75.65  ? 224 GLU A CA    1 
ATOM   1743 C  C     . GLU A 1 224 ? 63.539 8.150   -18.247 1.00 72.10  ? 224 GLU A C     1 
ATOM   1744 O  O     . GLU A 1 224 ? 62.786 7.820   -19.170 1.00 69.61  ? 224 GLU A O     1 
ATOM   1745 C  CB    . GLU A 1 224 ? 65.373 6.520   -17.800 1.00 85.68  ? 224 GLU A CB    1 
ATOM   1746 C  CG    . GLU A 1 224 ? 66.002 5.457   -16.908 1.00 95.86  ? 224 GLU A CG    1 
ATOM   1747 C  CD    . GLU A 1 224 ? 66.504 6.010   -15.585 1.00 108.99 ? 224 GLU A CD    1 
ATOM   1748 O  OE1   . GLU A 1 224 ? 66.640 7.246   -15.460 1.00 117.41 ? 224 GLU A OE1   1 
ATOM   1749 O  OE2   . GLU A 1 224 ? 66.766 5.204   -14.667 1.00 109.48 ? 224 GLU A OE2   1 
ATOM   1750 N  N     . PRO A 1 225 ? 63.921 9.423   -18.068 1.00 64.22  ? 225 PRO A N     1 
ATOM   1751 C  CA    . PRO A 1 225 ? 63.561 10.468  -19.030 1.00 63.80  ? 225 PRO A CA    1 
ATOM   1752 C  C     . PRO A 1 225 ? 64.300 10.283  -20.356 1.00 57.26  ? 225 PRO A C     1 
ATOM   1753 O  O     . PRO A 1 225 ? 65.379 9.695   -20.366 1.00 62.96  ? 225 PRO A O     1 
ATOM   1754 C  CB    . PRO A 1 225 ? 63.994 11.757  -18.326 1.00 65.19  ? 225 PRO A CB    1 
ATOM   1755 C  CG    . PRO A 1 225 ? 65.076 11.332  -17.401 1.00 70.36  ? 225 PRO A CG    1 
ATOM   1756 C  CD    . PRO A 1 225 ? 64.700 9.957   -16.937 1.00 60.78  ? 225 PRO A CD    1 
ATOM   1757 N  N     . PRO A 1 226 ? 63.721 10.770  -21.464 1.00 62.84  ? 226 PRO A N     1 
ATOM   1758 C  CA    . PRO A 1 226 ? 62.426 11.459  -21.511 1.00 73.05  ? 226 PRO A CA    1 
ATOM   1759 C  C     . PRO A 1 226 ? 61.233 10.505  -21.516 1.00 61.91  ? 226 PRO A C     1 
ATOM   1760 O  O     . PRO A 1 226 ? 61.250 9.485   -22.207 1.00 61.79  ? 226 PRO A O     1 
ATOM   1761 C  CB    . PRO A 1 226 ? 62.500 12.240  -22.823 1.00 80.21  ? 226 PRO A CB    1 
ATOM   1762 C  CG    . PRO A 1 226 ? 63.375 11.406  -23.691 1.00 76.11  ? 226 PRO A CG    1 
ATOM   1763 C  CD    . PRO A 1 226 ? 64.380 10.746  -22.782 1.00 62.38  ? 226 PRO A CD    1 
ATOM   1764 N  N     . PHE A 1 227 ? 60.207 10.845  -20.741 1.00 50.73  ? 227 PHE A N     1 
ATOM   1765 C  CA    . PHE A 1 227 ? 58.994 10.044  -20.697 1.00 53.12  ? 227 PHE A CA    1 
ATOM   1766 C  C     . PHE A 1 227 ? 58.069 10.425  -21.844 1.00 58.15  ? 227 PHE A C     1 
ATOM   1767 O  O     . PHE A 1 227 ? 57.925 11.604  -22.179 1.00 75.20  ? 227 PHE A O     1 
ATOM   1768 C  CB    . PHE A 1 227 ? 58.274 10.234  -19.362 1.00 45.69  ? 227 PHE A CB    1 
ATOM   1769 C  CG    . PHE A 1 227 ? 59.126 9.930   -18.165 1.00 50.45  ? 227 PHE A CG    1 
ATOM   1770 C  CD1   . PHE A 1 227 ? 59.313 8.623   -17.743 1.00 47.73  ? 227 PHE A CD1   1 
ATOM   1771 C  CD2   . PHE A 1 227 ? 59.735 10.951  -17.455 1.00 63.24  ? 227 PHE A CD2   1 
ATOM   1772 C  CE1   . PHE A 1 227 ? 60.097 8.342   -16.640 1.00 46.74  ? 227 PHE A CE1   1 
ATOM   1773 C  CE2   . PHE A 1 227 ? 60.519 10.676  -16.350 1.00 47.05  ? 227 PHE A CE2   1 
ATOM   1774 C  CZ    . PHE A 1 227 ? 60.700 9.371   -15.943 1.00 47.16  ? 227 PHE A CZ    1 
ATOM   1775 N  N     . LEU A 1 228 ? 57.445 9.419   -22.448 1.00 46.71  ? 228 LEU A N     1 
ATOM   1776 C  CA    . LEU A 1 228 ? 56.472 9.634   -23.513 1.00 46.97  ? 228 LEU A CA    1 
ATOM   1777 C  C     . LEU A 1 228 ? 55.083 9.687   -22.888 1.00 44.67  ? 228 LEU A C     1 
ATOM   1778 O  O     . LEU A 1 228 ? 54.590 8.683   -22.364 1.00 56.72  ? 228 LEU A O     1 
ATOM   1779 C  CB    . LEU A 1 228 ? 56.575 8.535   -24.567 1.00 47.62  ? 228 LEU A CB    1 
ATOM   1780 C  CG    . LEU A 1 228 ? 57.928 8.487   -25.278 1.00 60.49  ? 228 LEU A CG    1 
ATOM   1781 C  CD1   . LEU A 1 228 ? 57.922 7.457   -26.394 1.00 60.32  ? 228 LEU A CD1   1 
ATOM   1782 C  CD2   . LEU A 1 228 ? 58.296 9.864   -25.810 1.00 65.79  ? 228 LEU A CD2   1 
ATOM   1783 N  N     . TRP A 1 229 ? 54.455 10.859  -22.942 1.00 43.85  ? 229 TRP A N     1 
ATOM   1784 C  CA    . TRP A 1 229 ? 53.210 11.094  -22.218 1.00 47.95  ? 229 TRP A CA    1 
ATOM   1785 C  C     . TRP A 1 229 ? 52.361 12.091  -22.989 1.00 47.37  ? 229 TRP A C     1 
ATOM   1786 O  O     . TRP A 1 229 ? 52.788 13.229  -23.208 1.00 42.05  ? 229 TRP A O     1 
ATOM   1787 C  CB    . TRP A 1 229 ? 53.505 11.606  -20.805 1.00 45.48  ? 229 TRP A CB    1 
ATOM   1788 C  CG    . TRP A 1 229 ? 52.292 11.945  -19.998 1.00 48.02  ? 229 TRP A CG    1 
ATOM   1789 C  CD1   . TRP A 1 229 ? 51.442 11.071  -19.387 1.00 43.21  ? 229 TRP A CD1   1 
ATOM   1790 C  CD2   . TRP A 1 229 ? 51.804 13.258  -19.693 1.00 53.82  ? 229 TRP A CD2   1 
ATOM   1791 N  NE1   . TRP A 1 229 ? 50.449 11.756  -18.730 1.00 38.58  ? 229 TRP A NE1   1 
ATOM   1792 C  CE2   . TRP A 1 229 ? 50.651 13.100  -18.899 1.00 42.20  ? 229 TRP A CE2   1 
ATOM   1793 C  CE3   . TRP A 1 229 ? 52.229 14.550  -20.016 1.00 56.53  ? 229 TRP A CE3   1 
ATOM   1794 C  CZ2   . TRP A 1 229 ? 49.914 14.185  -18.429 1.00 37.71  ? 229 TRP A CZ2   1 
ATOM   1795 C  CZ3   . TRP A 1 229 ? 51.498 15.626  -19.547 1.00 52.70  ? 229 TRP A CZ3   1 
ATOM   1796 C  CH2   . TRP A 1 229 ? 50.354 15.437  -18.762 1.00 48.92  ? 229 TRP A CH2   1 
ATOM   1797 N  N     . MET A 1 230 ? 51.173 11.653  -23.412 1.00 49.10  ? 230 MET A N     1 
ATOM   1798 C  CA    . MET A 1 230 ? 50.153 12.526  -23.998 1.00 49.61  ? 230 MET A CA    1 
ATOM   1799 C  C     . MET A 1 230 ? 50.640 13.230  -25.262 1.00 51.23  ? 230 MET A C     1 
ATOM   1800 O  O     . MET A 1 230 ? 50.143 14.302  -25.616 1.00 61.04  ? 230 MET A O     1 
ATOM   1801 C  CB    . MET A 1 230 ? 49.658 13.555  -22.978 1.00 39.52  ? 230 MET A CB    1 
ATOM   1802 C  CG    . MET A 1 230 ? 48.989 12.940  -21.767 1.00 38.65  ? 230 MET A CG    1 
ATOM   1803 S  SD    . MET A 1 230 ? 47.505 12.022  -22.204 1.00 54.57  ? 230 MET A SD    1 
ATOM   1804 C  CE    . MET A 1 230 ? 46.454 13.355  -22.770 1.00 53.14  ? 230 MET A CE    1 
ATOM   1805 N  N     . GLY A 1 231 ? 51.602 12.636  -25.961 1.00 46.40  ? 231 GLY A N     1 
ATOM   1806 C  CA    . GLY A 1 231 ? 52.156 13.245  -27.151 1.00 51.27  ? 231 GLY A CA    1 
ATOM   1807 C  C     . GLY A 1 231 ? 53.296 14.206  -26.909 1.00 52.63  ? 231 GLY A C     1 
ATOM   1808 O  O     . GLY A 1 231 ? 53.651 14.962  -27.822 1.00 54.10  ? 231 GLY A O     1 
ATOM   1809 N  N     . TYR A 1 232 ? 53.879 14.203  -25.716 1.00 50.25  ? 232 TYR A N     1 
ATOM   1810 C  CA    . TYR A 1 232 ? 54.994 15.067  -25.361 1.00 50.40  ? 232 TYR A CA    1 
ATOM   1811 C  C     . TYR A 1 232 ? 56.201 14.214  -24.985 1.00 59.30  ? 232 TYR A C     1 
ATOM   1812 O  O     . TYR A 1 232 ? 56.148 12.982  -24.984 1.00 46.44  ? 232 TYR A O     1 
ATOM   1813 C  CB    . TYR A 1 232 ? 54.613 16.003  -24.209 1.00 48.67  ? 232 TYR A CB    1 
ATOM   1814 C  CG    . TYR A 1 232 ? 53.345 16.790  -24.446 1.00 59.48  ? 232 TYR A CG    1 
ATOM   1815 C  CD1   . TYR A 1 232 ? 52.108 16.280  -24.071 1.00 57.13  ? 232 TYR A CD1   1 
ATOM   1816 C  CD2   . TYR A 1 232 ? 53.384 18.044  -25.040 1.00 49.91  ? 232 TYR A CD2   1 
ATOM   1817 C  CE1   . TYR A 1 232 ? 50.947 16.995  -24.286 1.00 50.22  ? 232 TYR A CE1   1 
ATOM   1818 C  CE2   . TYR A 1 232 ? 52.229 18.766  -25.258 1.00 45.39  ? 232 TYR A CE2   1 
ATOM   1819 C  CZ    . TYR A 1 232 ? 51.013 18.237  -24.879 1.00 52.66  ? 232 TYR A CZ    1 
ATOM   1820 O  OH    . TYR A 1 232 ? 49.858 18.953  -25.093 1.00 59.48  ? 232 TYR A OH    1 
ATOM   1821 N  N     . GLU A 1 233 ? 57.303 14.889  -24.664 1.00 59.75  ? 233 GLU A N     1 
ATOM   1822 C  CA    . GLU A 1 233 ? 58.511 14.242  -24.151 1.00 53.71  ? 233 GLU A CA    1 
ATOM   1823 C  C     . GLU A 1 233 ? 58.880 14.947  -22.851 1.00 54.90  ? 233 GLU A C     1 
ATOM   1824 O  O     . GLU A 1 233 ? 59.380 16.075  -22.871 1.00 67.65  ? 233 GLU A O     1 
ATOM   1825 C  CB    . GLU A 1 233 ? 59.650 14.295  -25.164 1.00 57.79  ? 233 GLU A CB    1 
ATOM   1826 C  CG    . GLU A 1 233 ? 59.378 13.511  -26.440 1.00 73.45  ? 233 GLU A CG    1 
ATOM   1827 C  CD    . GLU A 1 233 ? 60.635 12.901  -27.033 1.00 83.83  ? 233 GLU A CD    1 
ATOM   1828 O  OE1   . GLU A 1 233 ? 61.732 13.138  -26.484 1.00 85.99  ? 233 GLU A OE1   1 
ATOM   1829 O  OE2   . GLU A 1 233 ? 60.525 12.176  -28.045 1.00 82.65  ? 233 GLU A OE2   1 
ATOM   1830 N  N     . LEU A 1 234 ? 58.629 14.284  -21.726 1.00 47.85  ? 234 LEU A N     1 
ATOM   1831 C  CA    . LEU A 1 234 ? 58.820 14.880  -20.408 1.00 48.20  ? 234 LEU A CA    1 
ATOM   1832 C  C     . LEU A 1 234 ? 60.254 14.642  -19.950 1.00 60.70  ? 234 LEU A C     1 
ATOM   1833 O  O     . LEU A 1 234 ? 60.646 13.505  -19.669 1.00 56.95  ? 234 LEU A O     1 
ATOM   1834 C  CB    . LEU A 1 234 ? 57.824 14.302  -19.405 1.00 44.96  ? 234 LEU A CB    1 
ATOM   1835 C  CG    . LEU A 1 234 ? 56.344 14.311  -19.794 1.00 43.52  ? 234 LEU A CG    1 
ATOM   1836 C  CD1   . LEU A 1 234 ? 55.487 13.877  -18.616 1.00 42.26  ? 234 LEU A CD1   1 
ATOM   1837 C  CD2   . LEU A 1 234 ? 55.917 15.679  -20.302 1.00 46.53  ? 234 LEU A CD2   1 
ATOM   1838 N  N     . HIS A 1 235 ? 61.030 15.709  -19.877 1.00 63.95  ? 235 HIS A N     1 
ATOM   1839 C  CA    . HIS A 1 235 ? 62.367 15.711  -19.307 1.00 50.76  ? 235 HIS A CA    1 
ATOM   1840 C  C     . HIS A 1 235 ? 62.305 16.158  -17.851 1.00 55.52  ? 235 HIS A C     1 
ATOM   1841 O  O     . HIS A 1 235 ? 61.254 16.586  -17.366 1.00 53.52  ? 235 HIS A O     1 
ATOM   1842 C  CB    . HIS A 1 235 ? 63.277 16.627  -20.130 1.00 64.76  ? 235 HIS A CB    1 
ATOM   1843 C  CG    . HIS A 1 235 ? 63.506 16.147  -21.530 1.00 64.52  ? 235 HIS A CG    1 
ATOM   1844 N  ND1   . HIS A 1 235 ? 62.651 16.447  -22.569 1.00 52.83  ? 235 HIS A ND1   1 
ATOM   1845 C  CD2   . HIS A 1 235 ? 64.489 15.381  -22.061 1.00 60.84  ? 235 HIS A CD2   1 
ATOM   1846 C  CE1   . HIS A 1 235 ? 63.100 15.892  -23.680 1.00 57.51  ? 235 HIS A CE1   1 
ATOM   1847 N  NE2   . HIS A 1 235 ? 64.214 15.239  -23.399 1.00 62.49  ? 235 HIS A NE2   1 
ATOM   1848 N  N     . PRO A 1 236 ? 63.410 16.040  -17.102 1.00 64.98  ? 236 PRO A N     1 
ATOM   1849 C  CA    . PRO A 1 236 ? 63.363 16.468  -15.691 1.00 63.05  ? 236 PRO A CA    1 
ATOM   1850 C  C     . PRO A 1 236 ? 62.992 17.929  -15.496 1.00 63.09  ? 236 PRO A C     1 
ATOM   1851 O  O     . PRO A 1 236 ? 62.188 18.243  -14.609 1.00 57.08  ? 236 PRO A O     1 
ATOM   1852 C  CB    . PRO A 1 236 ? 64.784 16.171  -15.195 1.00 57.87  ? 236 PRO A CB    1 
ATOM   1853 C  CG    . PRO A 1 236 ? 65.232 15.037  -16.036 1.00 54.84  ? 236 PRO A CG    1 
ATOM   1854 C  CD    . PRO A 1 236 ? 64.647 15.292  -17.397 1.00 63.40  ? 236 PRO A CD    1 
ATOM   1855 N  N     . ASP A 1 237 ? 63.549 18.836  -16.299 1.00 69.62  ? 237 ASP A N     1 
ATOM   1856 C  CA    . ASP A 1 237 ? 63.325 20.263  -16.120 1.00 66.78  ? 237 ASP A CA    1 
ATOM   1857 C  C     . ASP A 1 237 ? 62.622 20.927  -17.294 1.00 60.09  ? 237 ASP A C     1 
ATOM   1858 O  O     . ASP A 1 237 ? 62.433 22.149  -17.269 1.00 58.15  ? 237 ASP A O     1 
ATOM   1859 C  CB    . ASP A 1 237 ? 64.657 20.981  -15.862 1.00 78.56  ? 237 ASP A CB    1 
ATOM   1860 C  CG    . ASP A 1 237 ? 65.337 20.508  -14.594 1.00 91.84  ? 237 ASP A CG    1 
ATOM   1861 O  OD1   . ASP A 1 237 ? 64.638 20.336  -13.572 1.00 96.37  ? 237 ASP A OD1   1 
ATOM   1862 O  OD2   . ASP A 1 237 ? 66.568 20.302  -14.620 1.00 97.62  ? 237 ASP A OD2   1 
ATOM   1863 N  N     . LYS A 1 238 ? 62.230 20.172  -18.317 1.00 53.28  ? 238 LYS A N     1 
ATOM   1864 C  CA    . LYS A 1 238 ? 61.592 20.753  -19.488 1.00 55.32  ? 238 LYS A CA    1 
ATOM   1865 C  C     . LYS A 1 238 ? 60.703 19.706  -20.141 1.00 54.19  ? 238 LYS A C     1 
ATOM   1866 O  O     . LYS A 1 238 ? 60.706 18.532  -19.765 1.00 54.35  ? 238 LYS A O     1 
ATOM   1867 C  CB    . LYS A 1 238 ? 62.626 21.276  -20.490 1.00 52.58  ? 238 LYS A CB    1 
ATOM   1868 C  CG    . LYS A 1 238 ? 63.394 20.175  -21.203 1.00 65.98  ? 238 LYS A CG    1 
ATOM   1869 C  CD    . LYS A 1 238 ? 64.428 20.739  -22.163 1.00 74.60  ? 238 LYS A CD    1 
ATOM   1870 C  CE    . LYS A 1 238 ? 65.202 19.619  -22.843 1.00 84.62  ? 238 LYS A CE    1 
ATOM   1871 N  NZ    . LYS A 1 238 ? 66.241 20.138  -23.774 1.00 95.70  ? 238 LYS A NZ    1 
ATOM   1872 N  N     . TRP A 1 239 ? 59.934 20.152  -21.131 1.00 56.68  ? 239 TRP A N     1 
ATOM   1873 C  CA    . TRP A 1 239 ? 59.104 19.260  -21.923 1.00 54.14  ? 239 TRP A CA    1 
ATOM   1874 C  C     . TRP A 1 239 ? 59.053 19.787  -23.347 1.00 54.85  ? 239 TRP A C     1 
ATOM   1875 O  O     . TRP A 1 239 ? 59.221 20.985  -23.587 1.00 65.74  ? 239 TRP A O     1 
ATOM   1876 C  CB    . TRP A 1 239 ? 57.686 19.129  -21.350 1.00 52.29  ? 239 TRP A CB    1 
ATOM   1877 C  CG    . TRP A 1 239 ? 56.898 20.409  -21.355 1.00 52.52  ? 239 TRP A CG    1 
ATOM   1878 C  CD1   . TRP A 1 239 ? 56.802 21.316  -20.340 1.00 55.91  ? 239 TRP A CD1   1 
ATOM   1879 C  CD2   . TRP A 1 239 ? 56.086 20.915  -22.422 1.00 52.23  ? 239 TRP A CD2   1 
ATOM   1880 N  NE1   . TRP A 1 239 ? 55.985 22.357  -20.709 1.00 43.79  ? 239 TRP A NE1   1 
ATOM   1881 C  CE2   . TRP A 1 239 ? 55.534 22.136  -21.984 1.00 43.66  ? 239 TRP A CE2   1 
ATOM   1882 C  CE3   . TRP A 1 239 ? 55.775 20.457  -23.707 1.00 44.60  ? 239 TRP A CE3   1 
ATOM   1883 C  CZ2   . TRP A 1 239 ? 54.688 22.904  -22.783 1.00 48.43  ? 239 TRP A CZ2   1 
ATOM   1884 C  CZ3   . TRP A 1 239 ? 54.937 21.221  -24.499 1.00 53.02  ? 239 TRP A CZ3   1 
ATOM   1885 C  CH2   . TRP A 1 239 ? 54.403 22.431  -24.034 1.00 49.32  ? 239 TRP A CH2   1 
ATOM   1886 N  N     . THR A 1 240 ? 58.827 18.879  -24.291 1.00 51.25  ? 240 THR A N     1 
ATOM   1887 C  CA    . THR A 1 240 ? 58.710 19.252  -25.691 1.00 68.47  ? 240 THR A CA    1 
ATOM   1888 C  C     . THR A 1 240 ? 57.650 18.379  -26.345 1.00 65.80  ? 240 THR A C     1 
ATOM   1889 O  O     . THR A 1 240 ? 57.298 17.309  -25.843 1.00 64.98  ? 240 THR A O     1 
ATOM   1890 C  CB    . THR A 1 240 ? 60.050 19.124  -26.431 1.00 80.61  ? 240 THR A CB    1 
ATOM   1891 O  OG1   . THR A 1 240 ? 59.956 19.771  -27.707 1.00 100.99 ? 240 THR A OG1   1 
ATOM   1892 C  CG2   . THR A 1 240 ? 60.416 17.661  -26.635 1.00 71.37  ? 240 THR A CG2   1 
ATOM   1893 N  N     . VAL A 1 241 ? 57.135 18.857  -27.462 1.00 71.45  ? 241 VAL A N     1 
ATOM   1894 C  CA    . VAL A 1 241 ? 56.112 18.142  -28.213 1.00 68.11  ? 241 VAL A CA    1 
ATOM   1895 C  C     . VAL A 1 241 ? 56.797 17.266  -29.251 1.00 68.49  ? 241 VAL A C     1 
ATOM   1896 O  O     . VAL A 1 241 ? 57.857 17.610  -29.786 1.00 80.25  ? 241 VAL A O     1 
ATOM   1897 C  CB    . VAL A 1 241 ? 55.111 19.128  -28.856 1.00 65.03  ? 241 VAL A CB    1 
ATOM   1898 C  CG1   . VAL A 1 241 ? 55.792 19.975  -29.923 1.00 60.03  ? 241 VAL A CG1   1 
ATOM   1899 C  CG2   . VAL A 1 241 ? 53.907 18.388  -29.425 1.00 72.89  ? 241 VAL A CG2   1 
ATOM   1900 N  N     . GLN A 1 242 ? 56.202 16.106  -29.518 1.00 72.20  ? 242 GLN A N     1 
ATOM   1901 C  CA    . GLN A 1 242 ? 56.741 15.210  -30.526 1.00 80.72  ? 242 GLN A CA    1 
ATOM   1902 C  C     . GLN A 1 242 ? 56.726 15.900  -31.892 1.00 81.13  ? 242 GLN A C     1 
ATOM   1903 O  O     . GLN A 1 242 ? 55.900 16.786  -32.136 1.00 80.99  ? 242 GLN A O     1 
ATOM   1904 C  CB    . GLN A 1 242 ? 55.938 13.910  -30.558 1.00 92.84  ? 242 GLN A CB    1 
ATOM   1905 C  CG    . GLN A 1 242 ? 56.025 13.121  -29.256 1.00 99.48  ? 242 GLN A CG    1 
ATOM   1906 C  CD    . GLN A 1 242 ? 55.229 11.831  -29.289 1.00 97.14  ? 242 GLN A CD    1 
ATOM   1907 O  OE1   . GLN A 1 242 ? 54.625 11.485  -30.304 1.00 101.21 ? 242 GLN A OE1   1 
ATOM   1908 N  NE2   . GLN A 1 242 ? 55.224 11.110  -28.172 1.00 89.37  ? 242 GLN A NE2   1 
ATOM   1909 N  N     . PRO A 1 243 ? 57.643 15.528  -32.790 1.00 72.05  ? 243 PRO A N     1 
ATOM   1910 C  CA    . PRO A 1 243 ? 57.806 16.285  -34.040 1.00 77.20  ? 243 PRO A CA    1 
ATOM   1911 C  C     . PRO A 1 243 ? 56.513 16.387  -34.835 1.00 83.02  ? 243 PRO A C     1 
ATOM   1912 O  O     . PRO A 1 243 ? 55.696 15.464  -34.859 1.00 83.94  ? 243 PRO A O     1 
ATOM   1913 C  CB    . PRO A 1 243 ? 58.868 15.484  -34.800 1.00 80.74  ? 243 PRO A CB    1 
ATOM   1914 C  CG    . PRO A 1 243 ? 59.642 14.793  -33.734 1.00 80.65  ? 243 PRO A CG    1 
ATOM   1915 C  CD    . PRO A 1 243 ? 58.647 14.458  -32.661 1.00 67.34  ? 243 PRO A CD    1 
ATOM   1916 N  N     . ILE A 1 244 ? 56.336 17.533  -35.488 1.00 84.36  ? 244 ILE A N     1 
ATOM   1917 C  CA    . ILE A 1 244 ? 55.154 17.825  -36.288 1.00 82.17  ? 244 ILE A CA    1 
ATOM   1918 C  C     . ILE A 1 244 ? 55.611 18.082  -37.716 1.00 87.76  ? 244 ILE A C     1 
ATOM   1919 O  O     . ILE A 1 244 ? 56.334 19.052  -37.977 1.00 96.96  ? 244 ILE A O     1 
ATOM   1920 C  CB    . ILE A 1 244 ? 54.374 19.028  -35.736 1.00 79.84  ? 244 ILE A CB    1 
ATOM   1921 C  CG1   . ILE A 1 244 ? 54.008 18.792  -34.269 1.00 75.25  ? 244 ILE A CG1   1 
ATOM   1922 C  CG2   . ILE A 1 244 ? 53.126 19.283  -36.569 1.00 84.04  ? 244 ILE A CG2   1 
ATOM   1923 C  CD1   . ILE A 1 244 ? 53.303 19.956  -33.618 1.00 64.75  ? 244 ILE A CD1   1 
ATOM   1924 N  N     . VAL A 1 245 ? 55.196 17.216  -38.633 1.00 88.53  ? 245 VAL A N     1 
ATOM   1925 C  CA    . VAL A 1 245 ? 55.581 17.305  -40.036 1.00 88.63  ? 245 VAL A CA    1 
ATOM   1926 C  C     . VAL A 1 245 ? 54.416 17.900  -40.814 1.00 88.49  ? 245 VAL A C     1 
ATOM   1927 O  O     . VAL A 1 245 ? 53.312 17.342  -40.818 1.00 83.78  ? 245 VAL A O     1 
ATOM   1928 C  CB    . VAL A 1 245 ? 55.978 15.931  -40.598 1.00 82.13  ? 245 VAL A CB    1 
ATOM   1929 C  CG1   . VAL A 1 245 ? 56.421 16.058  -42.047 1.00 83.94  ? 245 VAL A CG1   1 
ATOM   1930 C  CG2   . VAL A 1 245 ? 57.077 15.309  -39.748 1.00 74.86  ? 245 VAL A CG2   1 
ATOM   1931 N  N     . LEU A 1 246 ? 54.658 19.034  -41.467 1.00 92.19  ? 246 LEU A N     1 
ATOM   1932 C  CA    . LEU A 1 246 ? 53.615 19.652  -42.273 1.00 101.19 ? 246 LEU A CA    1 
ATOM   1933 C  C     . LEU A 1 246 ? 53.563 19.002  -43.654 1.00 115.84 ? 246 LEU A C     1 
ATOM   1934 O  O     . LEU A 1 246 ? 54.607 18.756  -44.265 1.00 106.30 ? 246 LEU A O     1 
ATOM   1935 C  CB    . LEU A 1 246 ? 53.856 21.152  -42.416 1.00 98.96  ? 246 LEU A CB    1 
ATOM   1936 C  CG    . LEU A 1 246 ? 53.729 21.991  -41.144 1.00 95.10  ? 246 LEU A CG    1 
ATOM   1937 C  CD1   . LEU A 1 246 ? 53.811 23.473  -41.478 1.00 94.87  ? 246 LEU A CD1   1 
ATOM   1938 C  CD2   . LEU A 1 246 ? 52.433 21.672  -40.412 1.00 95.44  ? 246 LEU A CD2   1 
ATOM   1939 N  N     . PRO A 1 247 ? 52.365 18.715  -44.166 1.00 136.09 ? 247 PRO A N     1 
ATOM   1940 C  CA    . PRO A 1 247 ? 52.256 18.047  -45.470 1.00 140.08 ? 247 PRO A CA    1 
ATOM   1941 C  C     . PRO A 1 247 ? 52.785 18.901  -46.611 1.00 138.92 ? 247 PRO A C     1 
ATOM   1942 O  O     . PRO A 1 247 ? 52.188 19.925  -46.957 1.00 142.89 ? 247 PRO A O     1 
ATOM   1943 C  CB    . PRO A 1 247 ? 50.747 17.799  -45.615 1.00 142.69 ? 247 PRO A CB    1 
ATOM   1944 C  CG    . PRO A 1 247 ? 50.191 17.926  -44.228 1.00 138.67 ? 247 PRO A CG    1 
ATOM   1945 C  CD    . PRO A 1 247 ? 51.051 18.935  -43.541 1.00 135.00 ? 247 PRO A CD    1 
ATOM   1946 N  N     . GLU A 1 248 ? 53.905 18.488  -47.202 1.00 132.24 ? 248 GLU A N     1 
ATOM   1947 C  CA    . GLU A 1 248 ? 54.489 19.205  -48.331 1.00 123.43 ? 248 GLU A CA    1 
ATOM   1948 C  C     . GLU A 1 248 ? 53.794 18.751  -49.609 1.00 125.36 ? 248 GLU A C     1 
ATOM   1949 O  O     . GLU A 1 248 ? 54.033 17.642  -50.096 1.00 124.15 ? 248 GLU A O     1 
ATOM   1950 C  CB    . GLU A 1 248 ? 55.994 18.963  -48.396 1.00 120.16 ? 248 GLU A CB    1 
ATOM   1951 C  CG    . GLU A 1 248 ? 56.725 19.780  -49.454 1.00 127.89 ? 248 GLU A CG    1 
ATOM   1952 C  CD    . GLU A 1 248 ? 56.523 21.277  -49.289 1.00 123.34 ? 248 GLU A CD    1 
ATOM   1953 O  OE1   . GLU A 1 248 ? 55.544 21.814  -49.851 1.00 118.66 ? 248 GLU A OE1   1 
ATOM   1954 O  OE2   . GLU A 1 248 ? 57.341 21.916  -48.593 1.00 117.84 ? 248 GLU A OE2   1 
ATOM   1955 N  N     . LYS A 1 249 ? 52.928 19.606  -50.149 1.00 131.22 ? 249 LYS A N     1 
ATOM   1956 C  CA    . LYS A 1 249 ? 52.131 19.298  -51.328 1.00 136.04 ? 249 LYS A CA    1 
ATOM   1957 C  C     . LYS A 1 249 ? 52.249 20.452  -52.320 1.00 136.24 ? 249 LYS A C     1 
ATOM   1958 O  O     . LYS A 1 249 ? 52.893 21.470  -52.048 1.00 138.23 ? 249 LYS A O     1 
ATOM   1959 C  CB    . LYS A 1 249 ? 50.667 19.040  -50.944 1.00 139.56 ? 249 LYS A CB    1 
ATOM   1960 C  CG    . LYS A 1 249 ? 49.906 18.142  -51.907 1.00 147.64 ? 249 LYS A CG    1 
ATOM   1961 C  CD    . LYS A 1 249 ? 48.446 18.027  -51.510 1.00 147.89 ? 249 LYS A CD    1 
ATOM   1962 C  CE    . LYS A 1 249 ? 47.689 17.103  -52.449 1.00 154.11 ? 249 LYS A CE    1 
ATOM   1963 N  NZ    . LYS A 1 249 ? 46.262 16.957  -52.052 1.00 154.93 ? 249 LYS A NZ    1 
ATOM   1964 N  N     . ASP A 1 250 ? 51.621 20.288  -53.483 1.00 133.35 ? 250 ASP A N     1 
ATOM   1965 C  CA    . ASP A 1 250 ? 51.638 21.291  -54.541 1.00 137.78 ? 250 ASP A CA    1 
ATOM   1966 C  C     . ASP A 1 250 ? 50.288 21.948  -54.774 1.00 150.14 ? 250 ASP A C     1 
ATOM   1967 O  O     . ASP A 1 250 ? 50.233 23.141  -55.080 1.00 150.19 ? 250 ASP A O     1 
ATOM   1968 C  CB    . ASP A 1 250 ? 52.125 20.666  -55.853 1.00 132.60 ? 250 ASP A CB    1 
ATOM   1969 C  CG    . ASP A 1 250 ? 53.528 20.102  -55.744 1.00 128.93 ? 250 ASP A CG    1 
ATOM   1970 O  OD1   . ASP A 1 250 ? 54.494 20.866  -55.953 1.00 123.30 ? 250 ASP A OD1   1 
ATOM   1971 O  OD2   . ASP A 1 250 ? 53.665 18.896  -55.449 1.00 132.72 ? 250 ASP A OD2   1 
ATOM   1972 N  N     . SER A 1 251 ? 49.194 21.198  -54.644 1.00 159.26 ? 251 SER A N     1 
ATOM   1973 C  CA    . SER A 1 251 ? 47.843 21.740  -54.791 1.00 157.64 ? 251 SER A CA    1 
ATOM   1974 C  C     . SER A 1 251 ? 46.992 21.143  -53.675 1.00 152.51 ? 251 SER A C     1 
ATOM   1975 O  O     . SER A 1 251 ? 46.549 19.994  -53.771 1.00 156.79 ? 251 SER A O     1 
ATOM   1976 C  CB    . SER A 1 251 ? 47.262 21.429  -56.165 1.00 161.21 ? 251 SER A CB    1 
ATOM   1977 O  OG    . SER A 1 251 ? 47.208 20.032  -56.392 1.00 162.28 ? 251 SER A OG    1 
ATOM   1978 N  N     . TRP A 1 252 ? 46.769 21.923  -52.621 1.00 138.97 ? 252 TRP A N     1 
ATOM   1979 C  CA    . TRP A 1 252 ? 46.037 21.428  -51.467 1.00 125.76 ? 252 TRP A CA    1 
ATOM   1980 C  C     . TRP A 1 252 ? 44.542 21.336  -51.764 1.00 122.13 ? 252 TRP A C     1 
ATOM   1981 O  O     . TRP A 1 252 ? 44.007 22.019  -52.643 1.00 117.84 ? 252 TRP A O     1 
ATOM   1982 C  CB    . TRP A 1 252 ? 46.279 22.327  -50.255 1.00 113.11 ? 252 TRP A CB    1 
ATOM   1983 C  CG    . TRP A 1 252 ? 47.633 22.150  -49.640 1.00 105.66 ? 252 TRP A CG    1 
ATOM   1984 C  CD1   . TRP A 1 252 ? 47.958 21.329  -48.599 1.00 104.34 ? 252 TRP A CD1   1 
ATOM   1985 C  CD2   . TRP A 1 252 ? 48.847 22.804  -50.029 1.00 103.09 ? 252 TRP A CD2   1 
ATOM   1986 N  NE1   . TRP A 1 252 ? 49.297 21.433  -48.314 1.00 105.72 ? 252 TRP A NE1   1 
ATOM   1987 C  CE2   . TRP A 1 252 ? 49.867 22.332  -49.177 1.00 107.91 ? 252 TRP A CE2   1 
ATOM   1988 C  CE3   . TRP A 1 252 ? 49.171 23.744  -51.012 1.00 105.81 ? 252 TRP A CE3   1 
ATOM   1989 C  CZ2   . TRP A 1 252 ? 51.187 22.767  -49.279 1.00 111.38 ? 252 TRP A CZ2   1 
ATOM   1990 C  CZ3   . TRP A 1 252 ? 50.484 24.175  -51.112 1.00 110.90 ? 252 TRP A CZ3   1 
ATOM   1991 C  CH2   . TRP A 1 252 ? 51.474 23.686  -50.251 1.00 112.12 ? 252 TRP A CH2   1 
ATOM   1992 N  N     . THR A 1 253 ? 43.870 20.471  -51.012 1.00 126.86 ? 253 THR A N     1 
ATOM   1993 C  CA    . THR A 1 253 ? 42.433 20.258  -51.102 1.00 126.27 ? 253 THR A CA    1 
ATOM   1994 C  C     . THR A 1 253 ? 41.768 20.696  -49.800 1.00 125.35 ? 253 THR A C     1 
ATOM   1995 O  O     . THR A 1 253 ? 42.428 21.128  -48.851 1.00 128.79 ? 253 THR A O     1 
ATOM   1996 C  CB    . THR A 1 253 ? 42.121 18.791  -51.408 1.00 127.50 ? 253 THR A CB    1 
ATOM   1997 O  OG1   . THR A 1 253 ? 42.557 17.971  -50.316 1.00 127.06 ? 253 THR A OG1   1 
ATOM   1998 C  CG2   . THR A 1 253 ? 42.827 18.348  -52.681 1.00 128.92 ? 253 THR A CG2   1 
ATOM   1999 N  N     . VAL A 1 254 ? 40.438 20.577  -49.761 1.00 121.08 ? 254 VAL A N     1 
ATOM   2000 C  CA    . VAL A 1 254 ? 39.695 20.932  -48.554 1.00 109.38 ? 254 VAL A CA    1 
ATOM   2001 C  C     . VAL A 1 254 ? 40.121 20.051  -47.387 1.00 112.84 ? 254 VAL A C     1 
ATOM   2002 O  O     . VAL A 1 254 ? 40.294 20.528  -46.259 1.00 112.61 ? 254 VAL A O     1 
ATOM   2003 C  CB    . VAL A 1 254 ? 38.178 20.839  -48.811 1.00 95.67  ? 254 VAL A CB    1 
ATOM   2004 C  CG1   . VAL A 1 254 ? 37.404 21.024  -47.515 1.00 92.05  ? 254 VAL A CG1   1 
ATOM   2005 C  CG2   . VAL A 1 254 ? 37.750 21.875  -49.836 1.00 89.21  ? 254 VAL A CG2   1 
ATOM   2006 N  N     . ASN A 1 255 ? 40.307 18.753  -47.641 1.00 116.65 ? 255 ASN A N     1 
ATOM   2007 C  CA    . ASN A 1 255 ? 40.736 17.850  -46.579 1.00 119.72 ? 255 ASN A CA    1 
ATOM   2008 C  C     . ASN A 1 255 ? 42.192 18.083  -46.199 1.00 123.04 ? 255 ASN A C     1 
ATOM   2009 O  O     . ASN A 1 255 ? 42.567 17.885  -45.037 1.00 122.10 ? 255 ASN A O     1 
ATOM   2010 C  CB    . ASN A 1 255 ? 40.523 16.398  -47.008 1.00 125.97 ? 255 ASN A CB    1 
ATOM   2011 C  CG    . ASN A 1 255 ? 40.689 15.419  -45.862 1.00 122.27 ? 255 ASN A CG    1 
ATOM   2012 O  OD1   . ASN A 1 255 ? 39.717 15.046  -45.205 1.00 124.21 ? 255 ASN A OD1   1 
ATOM   2013 N  ND2   . ASN A 1 255 ? 41.924 14.995  -45.618 1.00 115.85 ? 255 ASN A ND2   1 
ATOM   2014 N  N     . ASP A 1 256 ? 43.025 18.501  -47.155 1.00 127.92 ? 256 ASP A N     1 
ATOM   2015 C  CA    . ASP A 1 256 ? 44.433 18.740  -46.861 1.00 127.89 ? 256 ASP A CA    1 
ATOM   2016 C  C     . ASP A 1 256 ? 44.648 20.044  -46.104 1.00 123.56 ? 256 ASP A C     1 
ATOM   2017 O  O     . ASP A 1 256 ? 45.623 20.163  -45.353 1.00 123.44 ? 256 ASP A O     1 
ATOM   2018 C  CB    . ASP A 1 256 ? 45.248 18.742  -48.155 1.00 134.34 ? 256 ASP A CB    1 
ATOM   2019 C  CG    . ASP A 1 256 ? 45.259 17.388  -48.839 1.00 141.58 ? 256 ASP A CG    1 
ATOM   2020 O  OD1   . ASP A 1 256 ? 44.216 16.700  -48.818 1.00 143.94 ? 256 ASP A OD1   1 
ATOM   2021 O  OD2   . ASP A 1 256 ? 46.312 17.009  -49.391 1.00 145.58 ? 256 ASP A OD2   1 
ATOM   2022 N  N     . ILE A 1 257 ? 43.763 21.026  -46.287 1.00 118.18 ? 257 ILE A N     1 
ATOM   2023 C  CA    . ILE A 1 257 ? 43.878 22.274  -45.540 1.00 111.02 ? 257 ILE A CA    1 
ATOM   2024 C  C     . ILE A 1 257 ? 43.564 22.044  -44.067 1.00 103.86 ? 257 ILE A C     1 
ATOM   2025 O  O     . ILE A 1 257 ? 44.256 22.562  -43.182 1.00 110.98 ? 257 ILE A O     1 
ATOM   2026 C  CB    . ILE A 1 257 ? 42.966 23.351  -46.157 1.00 112.61 ? 257 ILE A CB    1 
ATOM   2027 C  CG1   . ILE A 1 257 ? 43.503 23.789  -47.520 1.00 115.69 ? 257 ILE A CG1   1 
ATOM   2028 C  CG2   . ILE A 1 257 ? 42.838 24.548  -45.227 1.00 110.00 ? 257 ILE A CG2   1 
ATOM   2029 C  CD1   . ILE A 1 257 ? 44.897 24.373  -47.466 1.00 119.28 ? 257 ILE A CD1   1 
ATOM   2030 N  N     . CYS A 1 258 ? 42.521 21.259  -43.781 1.00 90.69  ? 258 CYS A N     1 
ATOM   2031 C  CA    . CYS A 1 258 ? 42.188 20.942  -42.396 1.00 85.05  ? 258 CYS A CA    1 
ATOM   2032 C  C     . CYS A 1 258 ? 43.316 20.172  -41.721 1.00 85.36  ? 258 CYS A C     1 
ATOM   2033 O  O     . CYS A 1 258 ? 43.600 20.381  -40.536 1.00 87.21  ? 258 CYS A O     1 
ATOM   2034 C  CB    . CYS A 1 258 ? 40.888 20.142  -42.341 1.00 84.80  ? 258 CYS A CB    1 
ATOM   2035 S  SG    . CYS A 1 258 ? 39.458 20.973  -43.062 1.00 91.49  ? 258 CYS A SG    1 
ATOM   2036 N  N     . LYS A 1 259 ? 43.968 19.271  -42.460 1.00 89.32  ? 259 LYS A N     1 
ATOM   2037 C  CA    . LYS A 1 259 ? 45.122 18.567  -41.913 1.00 91.72  ? 259 LYS A CA    1 
ATOM   2038 C  C     . LYS A 1 259 ? 46.272 19.526  -41.632 1.00 91.65  ? 259 LYS A C     1 
ATOM   2039 O  O     . LYS A 1 259 ? 47.054 19.302  -40.702 1.00 94.09  ? 259 LYS A O     1 
ATOM   2040 C  CB    . LYS A 1 259 ? 45.563 17.463  -42.876 1.00 91.35  ? 259 LYS A CB    1 
ATOM   2041 C  CG    . LYS A 1 259 ? 46.663 16.561  -42.341 1.00 93.95  ? 259 LYS A CG    1 
ATOM   2042 C  CD    . LYS A 1 259 ? 46.801 15.307  -43.190 1.00 102.87 ? 259 LYS A CD    1 
ATOM   2043 C  CE    . LYS A 1 259 ? 47.935 14.421  -42.699 1.00 106.84 ? 259 LYS A CE    1 
ATOM   2044 N  NZ    . LYS A 1 259 ? 49.266 15.053  -42.907 1.00 107.04 ? 259 LYS A NZ    1 
ATOM   2045 N  N     . LEU A 1 260 ? 46.378 20.601  -42.413 1.00 93.23  ? 260 LEU A N     1 
ATOM   2046 C  CA    . LEU A 1 260 ? 47.430 21.589  -42.205 1.00 86.63  ? 260 LEU A CA    1 
ATOM   2047 C  C     . LEU A 1 260 ? 47.092 22.524  -41.050 1.00 81.63  ? 260 LEU A C     1 
ATOM   2048 O  O     . LEU A 1 260 ? 47.924 22.759  -40.168 1.00 73.27  ? 260 LEU A O     1 
ATOM   2049 C  CB    . LEU A 1 260 ? 47.654 22.378  -43.495 1.00 80.57  ? 260 LEU A CB    1 
ATOM   2050 C  CG    . LEU A 1 260 ? 48.701 23.489  -43.478 1.00 80.64  ? 260 LEU A CG    1 
ATOM   2051 C  CD1   . LEU A 1 260 ? 50.051 22.945  -43.042 1.00 84.68  ? 260 LEU A CD1   1 
ATOM   2052 C  CD2   . LEU A 1 260 ? 48.790 24.118  -44.857 1.00 83.95  ? 260 LEU A CD2   1 
ATOM   2053 N  N     . VAL A 1 261 ? 45.872 23.066  -41.043 1.00 82.15  ? 261 VAL A N     1 
ATOM   2054 C  CA    . VAL A 1 261 ? 45.454 23.952  -39.961 1.00 72.64  ? 261 VAL A CA    1 
ATOM   2055 C  C     . VAL A 1 261 ? 45.367 23.186  -38.647 1.00 74.96  ? 261 VAL A C     1 
ATOM   2056 O  O     . VAL A 1 261 ? 45.758 23.696  -37.589 1.00 81.57  ? 261 VAL A O     1 
ATOM   2057 C  CB    . VAL A 1 261 ? 44.116 24.628  -40.313 1.00 67.95  ? 261 VAL A CB    1 
ATOM   2058 C  CG1   . VAL A 1 261 ? 43.636 25.501  -39.162 1.00 58.54  ? 261 VAL A CG1   1 
ATOM   2059 C  CG2   . VAL A 1 261 ? 44.258 25.449  -41.586 1.00 72.08  ? 261 VAL A CG2   1 
ATOM   2060 N  N     . GLY A 1 262 ? 44.859 21.953  -38.691 1.00 72.92  ? 262 GLY A N     1 
ATOM   2061 C  CA    . GLY A 1 262 ? 44.743 21.167  -37.473 1.00 66.79  ? 262 GLY A CA    1 
ATOM   2062 C  C     . GLY A 1 262 ? 46.086 20.872  -36.834 1.00 68.66  ? 262 GLY A C     1 
ATOM   2063 O  O     . GLY A 1 262 ? 46.208 20.843  -35.607 1.00 64.05  ? 262 GLY A O     1 
ATOM   2064 N  N     . LYS A 1 263 ? 47.114 20.648  -37.655 1.00 71.74  ? 263 LYS A N     1 
ATOM   2065 C  CA    . LYS A 1 263 ? 48.453 20.439  -37.112 1.00 61.98  ? 263 LYS A CA    1 
ATOM   2066 C  C     . LYS A 1 263 ? 49.059 21.749  -36.626 1.00 68.34  ? 263 LYS A C     1 
ATOM   2067 O  O     . LYS A 1 263 ? 49.780 21.770  -35.622 1.00 72.28  ? 263 LYS A O     1 
ATOM   2068 C  CB    . LYS A 1 263 ? 49.353 19.781  -38.156 1.00 64.72  ? 263 LYS A CB    1 
ATOM   2069 C  CG    . LYS A 1 263 ? 49.117 18.288  -38.323 1.00 68.52  ? 263 LYS A CG    1 
ATOM   2070 C  CD    . LYS A 1 263 ? 50.203 17.641  -39.170 1.00 69.58  ? 263 LYS A CD    1 
ATOM   2071 C  CE    . LYS A 1 263 ? 50.072 16.124  -39.159 1.00 74.64  ? 263 LYS A CE    1 
ATOM   2072 N  NZ    . LYS A 1 263 ? 51.105 15.460  -40.003 1.00 77.41  ? 263 LYS A NZ    1 
ATOM   2073 N  N     . LEU A 1 264 ? 48.780 22.852  -37.325 1.00 72.46  ? 264 LEU A N     1 
ATOM   2074 C  CA    . LEU A 1 264 ? 49.296 24.147  -36.892 1.00 68.36  ? 264 LEU A CA    1 
ATOM   2075 C  C     . LEU A 1 264 ? 48.675 24.572  -35.566 1.00 65.89  ? 264 LEU A C     1 
ATOM   2076 O  O     . LEU A 1 264 ? 49.369 25.107  -34.694 1.00 70.04  ? 264 LEU A O     1 
ATOM   2077 C  CB    . LEU A 1 264 ? 49.049 25.201  -37.971 1.00 63.73  ? 264 LEU A CB    1 
ATOM   2078 C  CG    . LEU A 1 264 ? 49.940 25.108  -39.213 1.00 63.46  ? 264 LEU A CG    1 
ATOM   2079 C  CD1   . LEU A 1 264 ? 49.492 26.094  -40.281 1.00 61.04  ? 264 LEU A CD1   1 
ATOM   2080 C  CD2   . LEU A 1 264 ? 51.399 25.341  -38.845 1.00 53.22  ? 264 LEU A CD2   1 
ATOM   2081 N  N     . ASN A 1 265 ? 47.370 24.339  -35.395 1.00 58.54  ? 265 ASN A N     1 
ATOM   2082 C  CA    . ASN A 1 265 ? 46.732 24.625  -34.113 1.00 56.75  ? 265 ASN A CA    1 
ATOM   2083 C  C     . ASN A 1 265 ? 47.363 23.807  -32.994 1.00 60.19  ? 265 ASN A C     1 
ATOM   2084 O  O     . ASN A 1 265 ? 47.581 24.315  -31.888 1.00 68.05  ? 265 ASN A O     1 
ATOM   2085 C  CB    . ASN A 1 265 ? 45.230 24.351  -34.199 1.00 66.32  ? 265 ASN A CB    1 
ATOM   2086 C  CG    . ASN A 1 265 ? 44.530 25.240  -35.209 1.00 67.88  ? 265 ASN A CG    1 
ATOM   2087 O  OD1   . ASN A 1 265 ? 44.942 26.374  -35.443 1.00 67.47  ? 265 ASN A OD1   1 
ATOM   2088 N  ND2   . ASN A 1 265 ? 43.465 24.728  -35.814 1.00 63.09  ? 265 ASN A ND2   1 
ATOM   2089 N  N     . TRP A 1 266 ? 47.667 22.535  -33.266 1.00 65.37  ? 266 TRP A N     1 
ATOM   2090 C  CA    . TRP A 1 266 ? 48.361 21.706  -32.287 1.00 56.35  ? 266 TRP A CA    1 
ATOM   2091 C  C     . TRP A 1 266 ? 49.775 22.210  -32.026 1.00 57.39  ? 266 TRP A C     1 
ATOM   2092 O  O     . TRP A 1 266 ? 50.288 22.063  -30.911 1.00 58.19  ? 266 TRP A O     1 
ATOM   2093 C  CB    . TRP A 1 266 ? 48.388 20.252  -32.764 1.00 44.41  ? 266 TRP A CB    1 
ATOM   2094 C  CG    . TRP A 1 266 ? 49.184 19.321  -31.893 1.00 47.46  ? 266 TRP A CG    1 
ATOM   2095 C  CD1   . TRP A 1 266 ? 50.363 18.708  -32.209 1.00 48.94  ? 266 TRP A CD1   1 
ATOM   2096 C  CD2   . TRP A 1 266 ? 48.854 18.892  -30.565 1.00 45.24  ? 266 TRP A CD2   1 
ATOM   2097 N  NE1   . TRP A 1 266 ? 50.787 17.925  -31.162 1.00 45.48  ? 266 TRP A NE1   1 
ATOM   2098 C  CE2   . TRP A 1 266 ? 49.878 18.021  -30.140 1.00 48.81  ? 266 TRP A CE2   1 
ATOM   2099 C  CE3   . TRP A 1 266 ? 47.792 19.159  -29.695 1.00 41.42  ? 266 TRP A CE3   1 
ATOM   2100 C  CZ2   . TRP A 1 266 ? 49.872 17.417  -28.884 1.00 48.78  ? 266 TRP A CZ2   1 
ATOM   2101 C  CZ3   . TRP A 1 266 ? 47.788 18.559  -28.448 1.00 40.58  ? 266 TRP A CZ3   1 
ATOM   2102 C  CH2   . TRP A 1 266 ? 48.821 17.700  -28.054 1.00 46.97  ? 266 TRP A CH2   1 
ATOM   2103 N  N     . ALA A 1 267 ? 50.415 22.809  -33.031 1.00 58.50  ? 267 ALA A N     1 
ATOM   2104 C  CA    . ALA A 1 267 ? 51.769 23.320  -32.853 1.00 55.53  ? 267 ALA A CA    1 
ATOM   2105 C  C     . ALA A 1 267 ? 51.793 24.644  -32.101 1.00 66.48  ? 267 ALA A C     1 
ATOM   2106 O  O     . ALA A 1 267 ? 52.777 24.942  -31.415 1.00 66.99  ? 267 ALA A O     1 
ATOM   2107 C  CB    . ALA A 1 267 ? 52.454 23.479  -34.211 1.00 51.18  ? 267 ALA A CB    1 
ATOM   2108 N  N     . SER A 1 268 ? 50.727 25.443  -32.204 1.00 65.71  ? 268 SER A N     1 
ATOM   2109 C  CA    . SER A 1 268 ? 50.704 26.762  -31.581 1.00 58.58  ? 268 SER A CA    1 
ATOM   2110 C  C     . SER A 1 268 ? 50.729 26.705  -30.059 1.00 62.68  ? 268 SER A C     1 
ATOM   2111 O  O     . SER A 1 268 ? 50.863 27.756  -29.423 1.00 67.81  ? 268 SER A O     1 
ATOM   2112 C  CB    . SER A 1 268 ? 49.471 27.540  -32.042 1.00 49.42  ? 268 SER A CB    1 
ATOM   2113 O  OG    . SER A 1 268 ? 48.279 26.940  -31.564 1.00 49.81  ? 268 SER A OG    1 
ATOM   2114 N  N     . GLN A 1 269 ? 50.605 25.519  -29.461 1.00 57.43  ? 269 GLN A N     1 
ATOM   2115 C  CA    . GLN A 1 269 ? 50.649 25.403  -28.010 1.00 48.09  ? 269 GLN A CA    1 
ATOM   2116 C  C     . GLN A 1 269 ? 52.046 25.610  -27.441 1.00 49.72  ? 269 GLN A C     1 
ATOM   2117 O  O     . GLN A 1 269 ? 52.175 25.796  -26.226 1.00 49.09  ? 269 GLN A O     1 
ATOM   2118 C  CB    . GLN A 1 269 ? 50.130 24.035  -27.572 1.00 44.74  ? 269 GLN A CB    1 
ATOM   2119 C  CG    . GLN A 1 269 ? 51.066 22.895  -27.927 1.00 51.98  ? 269 GLN A CG    1 
ATOM   2120 C  CD    . GLN A 1 269 ? 50.594 21.564  -27.393 1.00 50.39  ? 269 GLN A CD    1 
ATOM   2121 O  OE1   . GLN A 1 269 ? 50.294 21.428  -26.206 1.00 50.04  ? 269 GLN A OE1   1 
ATOM   2122 N  NE2   . GLN A 1 269 ? 50.520 20.569  -28.268 1.00 42.13  ? 269 GLN A NE2   1 
ATOM   2123 N  N     . ILE A 1 270 ? 53.086 25.576  -28.274 1.00 53.17  ? 270 ILE A N     1 
ATOM   2124 C  CA    . ILE A 1 270 ? 54.456 25.731  -27.797 1.00 51.61  ? 270 ILE A CA    1 
ATOM   2125 C  C     . ILE A 1 270 ? 55.264 26.520  -28.821 1.00 49.34  ? 270 ILE A C     1 
ATOM   2126 O  O     . ILE A 1 270 ? 56.312 27.090  -28.496 1.00 53.57  ? 270 ILE A O     1 
ATOM   2127 C  CB    . ILE A 1 270 ? 55.098 24.362  -27.498 1.00 53.49  ? 270 ILE A CB    1 
ATOM   2128 C  CG1   . ILE A 1 270 ? 56.389 24.531  -26.693 1.00 48.58  ? 270 ILE A CG1   1 
ATOM   2129 C  CG2   . ILE A 1 270 ? 55.360 23.595  -28.787 1.00 54.79  ? 270 ILE A CG2   1 
ATOM   2130 C  CD1   . ILE A 1 270 ? 56.199 25.265  -25.383 1.00 51.19  ? 270 ILE A CD1   1 
ATOM   2131 N  N     . TYR A 1 271 ? 54.779 26.569  -30.064 1.00 60.02  ? 271 TYR A N     1 
ATOM   2132 C  CA    . TYR A 1 271 ? 55.431 27.348  -31.107 1.00 64.71  ? 271 TYR A CA    1 
ATOM   2133 C  C     . TYR A 1 271 ? 54.755 28.705  -31.217 1.00 65.85  ? 271 TYR A C     1 
ATOM   2134 O  O     . TYR A 1 271 ? 53.594 28.773  -31.651 1.00 67.03  ? 271 TYR A O     1 
ATOM   2135 C  CB    . TYR A 1 271 ? 55.376 26.618  -32.449 1.00 68.95  ? 271 TYR A CB    1 
ATOM   2136 C  CG    . TYR A 1 271 ? 56.273 25.402  -32.546 1.00 69.36  ? 271 TYR A CG    1 
ATOM   2137 C  CD1   . TYR A 1 271 ? 57.602 25.524  -32.932 1.00 79.77  ? 271 TYR A CD1   1 
ATOM   2138 C  CD2   . TYR A 1 271 ? 55.786 24.131  -32.270 1.00 67.35  ? 271 TYR A CD2   1 
ATOM   2139 C  CE1   . TYR A 1 271 ? 58.424 24.414  -33.031 1.00 81.07  ? 271 TYR A CE1   1 
ATOM   2140 C  CE2   . TYR A 1 271 ? 56.600 23.016  -32.364 1.00 66.95  ? 271 TYR A CE2   1 
ATOM   2141 C  CZ    . TYR A 1 271 ? 57.917 23.163  -32.745 1.00 73.85  ? 271 TYR A CZ    1 
ATOM   2142 O  OH    . TYR A 1 271 ? 58.728 22.055  -32.840 1.00 73.58  ? 271 TYR A OH    1 
ATOM   2143 N  N     . PRO A 1 272 ? 55.419 29.799  -30.853 1.00 70.70  ? 272 PRO A N     1 
ATOM   2144 C  CA    . PRO A 1 272 ? 54.778 31.114  -30.930 1.00 69.29  ? 272 PRO A CA    1 
ATOM   2145 C  C     . PRO A 1 272 ? 54.802 31.690  -32.338 1.00 61.30  ? 272 PRO A C     1 
ATOM   2146 O  O     . PRO A 1 272 ? 55.725 31.456  -33.122 1.00 68.35  ? 272 PRO A O     1 
ATOM   2147 C  CB    . PRO A 1 272 ? 55.623 31.965  -29.976 1.00 68.01  ? 272 PRO A CB    1 
ATOM   2148 C  CG    . PRO A 1 272 ? 56.984 31.360  -30.076 1.00 65.52  ? 272 PRO A CG    1 
ATOM   2149 C  CD    . PRO A 1 272 ? 56.773 29.876  -30.276 1.00 73.16  ? 272 PRO A CD    1 
ATOM   2150 N  N     . GLY A 1 273 ? 53.763 32.459  -32.645 1.00 52.95  ? 273 GLY A N     1 
ATOM   2151 C  CA    . GLY A 1 273 ? 53.660 33.144  -33.915 1.00 60.37  ? 273 GLY A CA    1 
ATOM   2152 C  C     . GLY A 1 273 ? 52.912 32.414  -35.010 1.00 70.27  ? 273 GLY A C     1 
ATOM   2153 O  O     . GLY A 1 273 ? 53.066 32.778  -36.181 1.00 89.62  ? 273 GLY A O     1 
ATOM   2154 N  N     . ILE A 1 274 ? 52.108 31.410  -34.674 1.00 61.44  ? 274 ILE A N     1 
ATOM   2155 C  CA    . ILE A 1 274 ? 51.393 30.627  -35.677 1.00 62.90  ? 274 ILE A CA    1 
ATOM   2156 C  C     . ILE A 1 274 ? 50.125 31.368  -36.081 1.00 65.76  ? 274 ILE A C     1 
ATOM   2157 O  O     . ILE A 1 274 ? 49.381 31.865  -35.227 1.00 64.49  ? 274 ILE A O     1 
ATOM   2158 C  CB    . ILE A 1 274 ? 51.072 29.222  -35.140 1.00 61.04  ? 274 ILE A CB    1 
ATOM   2159 C  CG1   . ILE A 1 274 ? 52.353 28.520  -34.686 1.00 64.24  ? 274 ILE A CG1   1 
ATOM   2160 C  CG2   . ILE A 1 274 ? 50.349 28.390  -36.193 1.00 59.23  ? 274 ILE A CG2   1 
ATOM   2161 C  CD1   . ILE A 1 274 ? 53.375 28.335  -35.786 1.00 68.36  ? 274 ILE A CD1   1 
ATOM   2162 N  N     . LYS A 1 275 ? 49.875 31.445  -37.389 1.00 65.63  ? 275 LYS A N     1 
ATOM   2163 C  CA    . LYS A 1 275 ? 48.698 32.110  -37.933 1.00 72.41  ? 275 LYS A CA    1 
ATOM   2164 C  C     . LYS A 1 275 ? 48.016 31.190  -38.935 1.00 67.97  ? 275 LYS A C     1 
ATOM   2165 O  O     . LYS A 1 275 ? 48.684 30.534  -39.739 1.00 80.00  ? 275 LYS A O     1 
ATOM   2166 C  CB    . LYS A 1 275 ? 49.069 33.438  -38.610 1.00 78.47  ? 275 LYS A CB    1 
ATOM   2167 C  CG    . LYS A 1 275 ? 49.841 34.399  -37.719 1.00 74.79  ? 275 LYS A CG    1 
ATOM   2168 C  CD    . LYS A 1 275 ? 50.014 35.756  -38.383 1.00 83.47  ? 275 LYS A CD    1 
ATOM   2169 C  CE    . LYS A 1 275 ? 50.823 35.652  -39.664 1.00 88.95  ? 275 LYS A CE    1 
ATOM   2170 N  NZ    . LYS A 1 275 ? 52.204 35.157  -39.406 1.00 95.89  ? 275 LYS A NZ    1 
ATOM   2171 N  N     . VAL A 1 276 ? 46.683 31.145  -38.886 1.00 59.06  ? 276 VAL A N     1 
ATOM   2172 C  CA    . VAL A 1 276 ? 45.911 30.275  -39.769 1.00 70.04  ? 276 VAL A CA    1 
ATOM   2173 C  C     . VAL A 1 276 ? 44.678 31.002  -40.296 1.00 78.85  ? 276 VAL A C     1 
ATOM   2174 O  O     . VAL A 1 276 ? 43.658 30.370  -40.594 1.00 77.02  ? 276 VAL A O     1 
ATOM   2175 C  CB    . VAL A 1 276 ? 45.499 28.973  -39.054 1.00 66.48  ? 276 VAL A CB    1 
ATOM   2176 C  CG1   . VAL A 1 276 ? 46.716 28.105  -38.751 1.00 70.68  ? 276 VAL A CG1   1 
ATOM   2177 C  CG2   . VAL A 1 276 ? 44.728 29.284  -37.780 1.00 55.99  ? 276 VAL A CG2   1 
ATOM   2178 N  N     . ARG A 1 277 ? 44.760 32.328  -40.427 1.00 91.27  ? 277 ARG A N     1 
ATOM   2179 C  CA    . ARG A 1 277 ? 43.602 33.100  -40.873 1.00 99.16  ? 277 ARG A CA    1 
ATOM   2180 C  C     . ARG A 1 277 ? 43.282 32.827  -42.338 1.00 107.94 ? 277 ARG A C     1 
ATOM   2181 O  O     . ARG A 1 277 ? 42.199 32.330  -42.668 1.00 109.23 ? 277 ARG A O     1 
ATOM   2182 C  CB    . ARG A 1 277 ? 43.840 34.594  -40.644 1.00 102.12 ? 277 ARG A CB    1 
ATOM   2183 C  CG    . ARG A 1 277 ? 42.844 35.505  -41.352 1.00 108.75 ? 277 ARG A CG    1 
ATOM   2184 C  CD    . ARG A 1 277 ? 41.431 35.377  -40.792 1.00 104.87 ? 277 ARG A CD    1 
ATOM   2185 N  NE    . ARG A 1 277 ? 41.253 36.119  -39.546 1.00 100.42 ? 277 ARG A NE    1 
ATOM   2186 C  CZ    . ARG A 1 277 ? 41.114 35.556  -38.350 1.00 96.09  ? 277 ARG A CZ    1 
ATOM   2187 N  NH1   . ARG A 1 277 ? 41.126 34.236  -38.230 1.00 97.08  ? 277 ARG A NH1   1 
ATOM   2188 N  NH2   . ARG A 1 277 ? 40.956 36.314  -37.273 1.00 91.75  ? 277 ARG A NH2   1 
ATOM   2189 N  N     . GLN A 1 278 ? 44.215 33.153  -43.238 1.00 120.34 ? 278 GLN A N     1 
ATOM   2190 C  CA    . GLN A 1 278 ? 43.937 33.014  -44.664 1.00 129.92 ? 278 GLN A CA    1 
ATOM   2191 C  C     . GLN A 1 278 ? 43.772 31.556  -45.071 1.00 131.89 ? 278 GLN A C     1 
ATOM   2192 O  O     . GLN A 1 278 ? 43.008 31.257  -45.995 1.00 141.28 ? 278 GLN A O     1 
ATOM   2193 C  CB    . GLN A 1 278 ? 45.043 33.676  -45.486 1.00 138.00 ? 278 GLN A CB    1 
ATOM   2194 C  CG    . GLN A 1 278 ? 45.220 35.161  -45.205 1.00 140.64 ? 278 GLN A CG    1 
ATOM   2195 C  CD    . GLN A 1 278 ? 43.972 35.971  -45.511 1.00 139.82 ? 278 GLN A CD    1 
ATOM   2196 O  OE1   . GLN A 1 278 ? 43.163 35.596  -46.360 1.00 143.60 ? 278 GLN A OE1   1 
ATOM   2197 N  NE2   . GLN A 1 278 ? 43.812 37.091  -44.815 1.00 134.80 ? 278 GLN A NE2   1 
ATOM   2198 N  N     . LEU A 1 279 ? 44.473 30.639  -44.401 1.00 108.19 ? 279 LEU A N     1 
ATOM   2199 C  CA    . LEU A 1 279 ? 44.287 29.220  -44.684 1.00 86.82  ? 279 LEU A CA    1 
ATOM   2200 C  C     . LEU A 1 279 ? 42.868 28.779  -44.346 1.00 83.24  ? 279 LEU A C     1 
ATOM   2201 O  O     . LEU A 1 279 ? 42.212 28.093  -45.139 1.00 95.44  ? 279 LEU A O     1 
ATOM   2202 C  CB    . LEU A 1 279 ? 45.314 28.392  -43.909 1.00 77.13  ? 279 LEU A CB    1 
ATOM   2203 C  CG    . LEU A 1 279 ? 46.775 28.577  -44.326 1.00 74.25  ? 279 LEU A CG    1 
ATOM   2204 C  CD1   . LEU A 1 279 ? 47.709 27.856  -43.367 1.00 78.38  ? 279 LEU A CD1   1 
ATOM   2205 C  CD2   . LEU A 1 279 ? 46.991 28.092  -45.753 1.00 71.07  ? 279 LEU A CD2   1 
ATOM   2206 N  N     . SER A 1 280 ? 42.370 29.177  -43.172 1.00 70.51  ? 280 SER A N     1 
ATOM   2207 C  CA    . SER A 1 280 ? 41.011 28.821  -42.781 1.00 74.46  ? 280 SER A CA    1 
ATOM   2208 C  C     . SER A 1 280 ? 39.959 29.578  -43.580 1.00 94.87  ? 280 SER A C     1 
ATOM   2209 O  O     . SER A 1 280 ? 38.824 29.103  -43.691 1.00 105.12 ? 280 SER A O     1 
ATOM   2210 C  CB    . SER A 1 280 ? 40.808 29.074  -41.287 0.10 63.94  ? 280 SER A CB    1 
ATOM   2211 O  OG    . SER A 1 280 ? 41.715 28.311  -40.511 0.10 60.96  ? 280 SER A OG    1 
ATOM   2212 N  N     . LYS A 1 281 ? 40.305 30.742  -44.136 1.00 98.36  ? 281 LYS A N     1 
ATOM   2213 C  CA    . LYS A 1 281 ? 39.344 31.513  -44.918 1.00 102.29 ? 281 LYS A CA    1 
ATOM   2214 C  C     . LYS A 1 281 ? 39.007 30.841  -46.243 1.00 104.24 ? 281 LYS A C     1 
ATOM   2215 O  O     . LYS A 1 281 ? 37.941 31.108  -46.806 1.00 107.45 ? 281 LYS A O     1 
ATOM   2216 C  CB    . LYS A 1 281 ? 39.888 32.924  -45.162 1.00 110.38 ? 281 LYS A CB    1 
ATOM   2217 C  CG    . LYS A 1 281 ? 38.873 33.912  -45.722 1.00 114.23 ? 281 LYS A CG    1 
ATOM   2218 C  CD    . LYS A 1 281 ? 39.458 35.314  -45.813 1.00 112.19 ? 281 LYS A CD    1 
ATOM   2219 C  CE    . LYS A 1 281 ? 38.423 36.314  -46.304 1.00 109.90 ? 281 LYS A CE    1 
ATOM   2220 N  NZ    . LYS A 1 281 ? 38.957 37.703  -46.330 1.00 106.89 ? 281 LYS A NZ    1 
ATOM   2221 N  N     . LEU A 1 282 ? 39.883 29.967  -46.743 1.00 107.16 ? 282 LEU A N     1 
ATOM   2222 C  CA    . LEU A 1 282 ? 39.669 29.320  -48.032 1.00 109.07 ? 282 LEU A CA    1 
ATOM   2223 C  C     . LEU A 1 282 ? 38.619 28.217  -47.986 1.00 109.06 ? 282 LEU A C     1 
ATOM   2224 O  O     . LEU A 1 282 ? 38.283 27.667  -49.041 1.00 112.72 ? 282 LEU A O     1 
ATOM   2225 C  CB    . LEU A 1 282 ? 40.988 28.745  -48.552 1.00 111.98 ? 282 LEU A CB    1 
ATOM   2226 C  CG    . LEU A 1 282 ? 41.772 29.584  -49.562 1.00 116.79 ? 282 LEU A CG    1 
ATOM   2227 C  CD1   . LEU A 1 282 ? 42.034 30.984  -49.032 1.00 119.96 ? 282 LEU A CD1   1 
ATOM   2228 C  CD2   . LEU A 1 282 ? 43.075 28.893  -49.918 1.00 114.86 ? 282 LEU A CD2   1 
ATOM   2229 N  N     . LEU A 1 283 ? 38.095 27.879  -46.808 1.00 106.02 ? 283 LEU A N     1 
ATOM   2230 C  CA    . LEU A 1 283 ? 37.123 26.803  -46.661 1.00 102.59 ? 283 LEU A CA    1 
ATOM   2231 C  C     . LEU A 1 283 ? 35.694 27.323  -46.546 0.02 103.10 ? 283 LEU A C     1 
ATOM   2232 O  O     . LEU A 1 283 ? 34.865 26.712  -45.863 0.76 99.96  ? 283 LEU A O     1 
ATOM   2233 C  CB    . LEU A 1 283 ? 37.475 25.939  -45.451 1.00 88.64  ? 283 LEU A CB    1 
ATOM   2234 C  CG    . LEU A 1 283 ? 38.853 25.276  -45.487 0.50 83.92  ? 283 LEU A CG    1 
ATOM   2235 C  CD1   . LEU A 1 283 ? 39.113 24.501  -44.207 0.69 81.20  ? 283 LEU A CD1   1 
ATOM   2236 C  CD2   . LEU A 1 283 ? 38.978 24.369  -46.702 0.10 85.20  ? 283 LEU A CD2   1 
ATOM   2237 N  N     . ARG A 1 284 ? 35.387 28.434  -47.208 1.00 109.30 ? 284 ARG A N     1 
ATOM   2238 C  CA    . ARG A 1 284 ? 34.077 29.066  -47.121 1.00 119.21 ? 284 ARG A CA    1 
ATOM   2239 C  C     . ARG A 1 284 ? 33.271 28.742  -48.373 1.00 125.96 ? 284 ARG A C     1 
ATOM   2240 O  O     . ARG A 1 284 ? 33.720 29.011  -49.493 1.00 124.41 ? 284 ARG A O     1 
ATOM   2241 C  CB    . ARG A 1 284 ? 34.214 30.579  -46.947 1.00 120.48 ? 284 ARG A CB    1 
ATOM   2242 C  CG    . ARG A 1 284 ? 34.923 30.998  -45.668 1.00 120.42 ? 284 ARG A CG    1 
ATOM   2243 C  CD    . ARG A 1 284 ? 34.991 32.513  -45.549 1.00 124.79 ? 284 ARG A CD    1 
ATOM   2244 N  NE    . ARG A 1 284 ? 35.679 32.941  -44.333 1.00 126.61 ? 284 ARG A NE    1 
ATOM   2245 C  CZ    . ARG A 1 284 ? 35.843 34.211  -43.977 1.00 124.83 ? 284 ARG A CZ    1 
ATOM   2246 N  NH1   . ARG A 1 284 ? 35.367 35.184  -44.742 1.00 124.99 ? 284 ARG A NH1   1 
ATOM   2247 N  NH2   . ARG A 1 284 ? 36.482 34.510  -42.854 1.00 121.29 ? 284 ARG A NH2   1 
ATOM   2248 N  N     . GLY A 1 285 ? 32.082 28.169  -48.181 0.80 128.93 ? 285 GLY A N     1 
ATOM   2249 C  CA    . GLY A 1 285 ? 31.187 27.860  -49.273 0.80 134.17 ? 285 GLY A CA    1 
ATOM   2250 C  C     . GLY A 1 285 ? 31.361 26.487  -49.887 0.80 139.91 ? 285 GLY A C     1 
ATOM   2251 O  O     . GLY A 1 285 ? 30.566 26.113  -50.760 0.80 139.91 ? 285 GLY A O     1 
ATOM   2252 N  N     . THR A 1 286 ? 32.364 25.725  -49.463 1.00 143.17 ? 286 THR A N     1 
ATOM   2253 C  CA    . THR A 1 286 ? 32.609 24.410  -50.034 1.00 142.53 ? 286 THR A CA    1 
ATOM   2254 C  C     . THR A 1 286 ? 31.679 23.372  -49.416 1.00 140.87 ? 286 THR A C     1 
ATOM   2255 O  O     . THR A 1 286 ? 31.238 23.503  -48.271 1.00 139.92 ? 286 THR A O     1 
ATOM   2256 C  CB    . THR A 1 286 ? 34.063 23.994  -49.817 1.00 141.78 ? 286 THR A CB    1 
ATOM   2257 O  OG1   . THR A 1 286 ? 34.266 23.670  -48.436 1.00 142.65 ? 286 THR A OG1   1 
ATOM   2258 C  CG2   . THR A 1 286 ? 34.991 25.130  -50.199 1.00 137.55 ? 286 THR A CG2   1 
ATOM   2259 N  N     . LYS A 1 287 ? 31.380 22.327  -50.196 0.85 138.48 ? 287 LYS A N     1 
ATOM   2260 C  CA    . LYS A 1 287 ? 30.496 21.258  -49.746 0.87 136.46 ? 287 LYS A CA    1 
ATOM   2261 C  C     . LYS A 1 287 ? 31.057 19.875  -50.061 1.00 135.71 ? 287 LYS A C     1 
ATOM   2262 O  O     . LYS A 1 287 ? 30.306 18.894  -50.052 0.70 136.72 ? 287 LYS A O     1 
ATOM   2263 C  CB    . LYS A 1 287 ? 29.102 21.403  -50.363 0.54 135.91 ? 287 LYS A CB    1 
ATOM   2264 C  CG    . LYS A 1 287 ? 28.396 22.709  -50.037 1.00 129.64 ? 287 LYS A CG    1 
ATOM   2265 C  CD    . LYS A 1 287 ? 26.901 22.639  -50.337 1.00 126.30 ? 287 LYS A CD    1 
ATOM   2266 C  CE    . LYS A 1 287 ? 26.618 22.245  -51.783 1.00 127.26 ? 287 LYS A CE    1 
ATOM   2267 N  NZ    . LYS A 1 287 ? 26.441 20.774  -51.957 1.00 126.20 ? 287 LYS A NZ    1 
ATOM   2268 N  N     . ALA A 1 288 ? 32.354 19.771  -50.339 1.00 131.27 ? 288 ALA A N     1 
ATOM   2269 C  CA    . ALA A 1 288 ? 32.982 18.496  -50.662 0.10 128.01 ? 288 ALA A CA    1 
ATOM   2270 C  C     . ALA A 1 288 ? 34.280 18.363  -49.883 1.00 122.57 ? 288 ALA A C     1 
ATOM   2271 O  O     . ALA A 1 288 ? 35.084 19.300  -49.843 1.00 121.95 ? 288 ALA A O     1 
ATOM   2272 C  CB    . ALA A 1 288 ? 33.245 18.370  -52.165 0.10 129.41 ? 288 ALA A CB    1 
ATOM   2273 N  N     . LEU A 1 289 ? 34.483 17.194  -49.269 1.00 119.59 ? 289 LEU A N     1 
ATOM   2274 C  CA    . LEU A 1 289 ? 35.682 16.976  -48.465 1.00 111.83 ? 289 LEU A CA    1 
ATOM   2275 C  C     . LEU A 1 289 ? 36.924 16.850  -49.339 1.00 106.07 ? 289 LEU A C     1 
ATOM   2276 O  O     . LEU A 1 289 ? 37.965 17.444  -49.037 0.10 106.44 ? 289 LEU A O     1 
ATOM   2277 C  CB    . LEU A 1 289 ? 35.506 15.730  -47.596 0.10 110.35 ? 289 LEU A CB    1 
ATOM   2278 C  CG    . LEU A 1 289 ? 36.627 15.410  -46.607 0.10 106.82 ? 289 LEU A CG    1 
ATOM   2279 C  CD1   . LEU A 1 289 ? 36.780 16.533  -45.592 0.10 103.35 ? 289 LEU A CD1   1 
ATOM   2280 C  CD2   . LEU A 1 289 ? 36.363 14.085  -45.910 0.00 107.13 ? 289 LEU A CD2   1 
ATOM   2281 N  N     . THR A 1 290 ? 36.834 16.084  -50.425 0.10 108.68 ? 290 THR A N     1 
ATOM   2282 C  CA    . THR A 1 290 ? 37.955 15.868  -51.330 0.10 116.61 ? 290 THR A CA    1 
ATOM   2283 C  C     . THR A 1 290 ? 38.079 16.956  -52.390 0.10 130.95 ? 290 THR A C     1 
ATOM   2284 O  O     . THR A 1 290 ? 38.826 16.780  -53.357 0.10 138.00 ? 290 THR A O     1 
ATOM   2285 C  CB    . THR A 1 290 ? 37.828 14.501  -52.007 0.00 94.55  ? 290 THR A CB    1 
ATOM   2286 O  OG1   . THR A 1 290 ? 36.651 14.479  -52.825 0.00 79.78  ? 290 THR A OG1   1 
ATOM   2287 C  CG2   . THR A 1 290 ? 37.732 13.398  -50.964 0.00 76.94  ? 290 THR A CG2   1 
ATOM   2288 N  N     . GLU A 1 291 ? 37.370 18.070  -52.230 1.00 139.65 ? 291 GLU A N     1 
ATOM   2289 C  CA    . GLU A 1 291 ? 37.416 19.143  -53.213 1.00 145.40 ? 291 GLU A CA    1 
ATOM   2290 C  C     . GLU A 1 291 ? 38.752 19.873  -53.156 1.00 146.93 ? 291 GLU A C     1 
ATOM   2291 O  O     . GLU A 1 291 ? 39.281 20.151  -52.077 1.00 156.29 ? 291 GLU A O     1 
ATOM   2292 C  CB    . GLU A 1 291 ? 36.270 20.125  -52.969 1.00 147.67 ? 291 GLU A CB    1 
ATOM   2293 C  CG    . GLU A 1 291 ? 36.277 21.349  -53.866 1.00 150.19 ? 291 GLU A CG    1 
ATOM   2294 C  CD    . GLU A 1 291 ? 35.165 22.321  -53.524 1.00 151.74 ? 291 GLU A CD    1 
ATOM   2295 O  OE1   . GLU A 1 291 ? 34.260 21.940  -52.752 1.00 151.09 ? 291 GLU A OE1   1 
ATOM   2296 O  OE2   . GLU A 1 291 ? 35.197 23.466  -54.023 1.00 152.20 ? 291 GLU A OE2   1 
ATOM   2297 N  N     . VAL A 1 292 ? 39.298 20.182  -54.329 1.00 138.06 ? 292 VAL A N     1 
ATOM   2298 C  CA    . VAL A 1 292 ? 40.554 20.916  -54.439 1.00 126.43 ? 292 VAL A CA    1 
ATOM   2299 C  C     . VAL A 1 292 ? 40.244 22.398  -54.595 1.00 125.45 ? 292 VAL A C     1 
ATOM   2300 O  O     . VAL A 1 292 ? 39.223 22.787  -55.174 1.00 127.19 ? 292 VAL A O     1 
ATOM   2301 C  CB    . VAL A 1 292 ? 41.406 20.379  -55.611 1.00 118.87 ? 292 VAL A CB    1 
ATOM   2302 C  CG1   . VAL A 1 292 ? 40.741 20.679  -56.948 1.00 117.72 ? 292 VAL A CG1   1 
ATOM   2303 C  CG2   . VAL A 1 292 ? 42.818 20.950  -55.561 1.00 118.73 ? 292 VAL A CG2   1 
ATOM   2304 N  N     . ILE A 1 293 ? 41.122 23.239  -54.057 1.00 127.24 ? 293 ILE A N     1 
ATOM   2305 C  CA    . ILE A 1 293 ? 40.932 24.687  -54.086 0.98 131.01 ? 293 ILE A CA    1 
ATOM   2306 C  C     . ILE A 1 293 ? 42.247 25.364  -54.458 0.10 137.39 ? 293 ILE A C     1 
ATOM   2307 O  O     . ILE A 1 293 ? 43.304 24.998  -53.923 1.00 133.51 ? 293 ILE A O     1 
ATOM   2308 C  CB    . ILE A 1 293 ? 40.411 25.206  -52.736 0.12 126.01 ? 293 ILE A CB    1 
ATOM   2309 C  CG1   . ILE A 1 293 ? 38.985 24.716  -52.485 1.00 124.37 ? 293 ILE A CG1   1 
ATOM   2310 C  CG2   . ILE A 1 293 ? 40.464 26.728  -52.679 1.00 126.39 ? 293 ILE A CG2   1 
ATOM   2311 C  CD1   . ILE A 1 293 ? 38.404 25.213  -51.191 1.00 122.93 ? 293 ILE A CD1   1 
ATOM   2312 N  N     . PRO A 1 294 ? 42.235 26.339  -55.367 1.00 147.57 ? 294 PRO A N     1 
ATOM   2313 C  CA    . PRO A 1 294 ? 43.462 27.097  -55.650 1.00 147.90 ? 294 PRO A CA    1 
ATOM   2314 C  C     . PRO A 1 294 ? 43.878 27.926  -54.443 1.00 139.98 ? 294 PRO A C     1 
ATOM   2315 O  O     . PRO A 1 294 ? 43.088 28.703  -53.901 1.00 136.46 ? 294 PRO A O     1 
ATOM   2316 C  CB    . PRO A 1 294 ? 43.068 27.983  -56.838 1.00 153.16 ? 294 PRO A CB    1 
ATOM   2317 C  CG    . PRO A 1 294 ? 41.578 28.090  -56.752 1.00 151.94 ? 294 PRO A CG    1 
ATOM   2318 C  CD    . PRO A 1 294 ? 41.110 26.769  -56.215 1.00 149.79 ? 294 PRO A CD    1 
ATOM   2319 N  N     . LEU A 1 295 ? 45.128 27.750  -54.024 1.00 132.73 ? 295 LEU A N     1 
ATOM   2320 C  CA    . LEU A 1 295 ? 45.651 28.441  -52.854 1.00 125.16 ? 295 LEU A CA    1 
ATOM   2321 C  C     . LEU A 1 295 ? 45.947 29.898  -53.192 1.00 126.42 ? 295 LEU A C     1 
ATOM   2322 O  O     . LEU A 1 295 ? 46.622 30.189  -54.184 1.00 134.42 ? 295 LEU A O     1 
ATOM   2323 C  CB    . LEU A 1 295 ? 46.915 27.740  -52.356 1.00 120.44 ? 295 LEU A CB    1 
ATOM   2324 C  CG    . LEU A 1 295 ? 47.561 28.226  -51.058 0.36 115.01 ? 295 LEU A CG    1 
ATOM   2325 C  CD1   . LEU A 1 295 ? 46.596 28.093  -49.895 0.43 110.97 ? 295 LEU A CD1   1 
ATOM   2326 C  CD2   . LEU A 1 295 ? 48.838 27.448  -50.782 1.00 114.04 ? 295 LEU A CD2   1 
ATOM   2327 N  N     . THR A 1 296 ? 45.440 30.813  -52.368 1.00 122.83 ? 296 THR A N     1 
ATOM   2328 C  CA    . THR A 1 296 ? 45.652 32.233  -52.609 1.00 125.14 ? 296 THR A CA    1 
ATOM   2329 C  C     . THR A 1 296 ? 47.093 32.624  -52.290 1.00 128.37 ? 296 THR A C     1 
ATOM   2330 O  O     . THR A 1 296 ? 47.832 31.897  -51.622 1.00 130.72 ? 296 THR A O     1 
ATOM   2331 C  CB    . THR A 1 296 ? 44.687 33.077  -51.775 1.00 122.11 ? 296 THR A CB    1 
ATOM   2332 O  OG1   . THR A 1 296 ? 44.940 32.863  -50.380 1.00 123.74 ? 296 THR A OG1   1 
ATOM   2333 C  CG2   . THR A 1 296 ? 43.245 32.705  -52.088 1.00 116.92 ? 296 THR A CG2   1 
ATOM   2334 N  N     . GLU A 1 297 ? 47.489 33.802  -52.781 1.00 128.06 ? 297 GLU A N     1 
ATOM   2335 C  CA    . GLU A 1 297 ? 48.863 34.256  -52.597 1.00 133.57 ? 297 GLU A CA    1 
ATOM   2336 C  C     . GLU A 1 297 ? 49.129 34.730  -51.173 1.00 132.68 ? 297 GLU A C     1 
ATOM   2337 O  O     . GLU A 1 297 ? 50.237 34.535  -50.660 1.00 127.05 ? 297 GLU A O     1 
ATOM   2338 C  CB    . GLU A 1 297 ? 49.194 35.371  -53.594 1.00 136.43 ? 297 GLU A CB    1 
ATOM   2339 C  CG    . GLU A 1 297 ? 48.330 36.616  -53.472 1.00 128.94 ? 297 GLU A CG    1 
ATOM   2340 C  CD    . GLU A 1 297 ? 48.839 37.763  -54.324 1.00 124.67 ? 297 GLU A CD    1 
ATOM   2341 O  OE1   . GLU A 1 297 ? 49.716 37.528  -55.183 1.00 123.52 ? 297 GLU A OE1   1 
ATOM   2342 O  OE2   . GLU A 1 297 ? 48.365 38.901  -54.129 1.00 123.99 ? 297 GLU A OE2   1 
ATOM   2343 N  N     . GLU A 1 298 ? 48.140 35.346  -50.521 1.00 143.19 ? 298 GLU A N     1 
ATOM   2344 C  CA    . GLU A 1 298 ? 48.319 35.769  -49.137 1.00 150.91 ? 298 GLU A CA    1 
ATOM   2345 C  C     . GLU A 1 298 ? 48.402 34.585  -48.183 1.00 148.79 ? 298 GLU A C     1 
ATOM   2346 O  O     . GLU A 1 298 ? 48.955 34.725  -47.087 1.00 151.03 ? 298 GLU A O     1 
ATOM   2347 C  CB    . GLU A 1 298 ? 47.184 36.705  -48.712 1.00 159.05 ? 298 GLU A CB    1 
ATOM   2348 C  CG    . GLU A 1 298 ? 45.787 36.122  -48.875 1.00 167.81 ? 298 GLU A CG    1 
ATOM   2349 C  CD    . GLU A 1 298 ? 45.200 36.377  -50.252 1.00 174.20 ? 298 GLU A CD    1 
ATOM   2350 O  OE1   . GLU A 1 298 ? 43.975 36.196  -50.418 1.00 174.44 ? 298 GLU A OE1   1 
ATOM   2351 O  OE2   . GLU A 1 298 ? 45.960 36.761  -51.166 1.00 175.73 ? 298 GLU A OE2   1 
ATOM   2352 N  N     . ALA A 1 299 ? 47.868 33.426  -48.574 1.00 138.20 ? 299 ALA A N     1 
ATOM   2353 C  CA    . ALA A 1 299 ? 48.000 32.230  -47.753 1.00 129.97 ? 299 ALA A CA    1 
ATOM   2354 C  C     . ALA A 1 299 ? 49.322 31.514  -48.001 1.00 129.57 ? 299 ALA A C     1 
ATOM   2355 O  O     . ALA A 1 299 ? 49.814 30.809  -47.113 1.00 129.24 ? 299 ALA A O     1 
ATOM   2356 C  CB    . ALA A 1 299 ? 46.829 31.280  -48.011 1.00 122.78 ? 299 ALA A CB    1 
ATOM   2357 N  N     . GLU A 1 300 ? 49.906 31.678  -49.192 1.00 130.96 ? 300 GLU A N     1 
ATOM   2358 C  CA    . GLU A 1 300 ? 51.209 31.079  -49.463 1.00 135.78 ? 300 GLU A CA    1 
ATOM   2359 C  C     . GLU A 1 300 ? 52.290 31.696  -48.586 1.00 131.17 ? 300 GLU A C     1 
ATOM   2360 O  O     . GLU A 1 300 ? 53.186 30.992  -48.107 1.00 130.90 ? 300 GLU A O     1 
ATOM   2361 C  CB    . GLU A 1 300 ? 51.564 31.233  -50.942 1.00 146.19 ? 300 GLU A CB    1 
ATOM   2362 C  CG    . GLU A 1 300 ? 50.696 30.414  -51.883 1.00 149.98 ? 300 GLU A CG    1 
ATOM   2363 C  CD    . GLU A 1 300 ? 51.146 30.513  -53.328 1.00 155.11 ? 300 GLU A CD    1 
ATOM   2364 O  OE1   . GLU A 1 300 ? 52.106 31.264  -53.604 1.00 156.91 ? 300 GLU A OE1   1 
ATOM   2365 O  OE2   . GLU A 1 300 ? 50.542 29.838  -54.189 1.00 156.82 ? 300 GLU A OE2   1 
ATOM   2366 N  N     . LEU A 1 301 ? 52.225 33.011  -48.368 1.00 126.90 ? 301 LEU A N     1 
ATOM   2367 C  CA    . LEU A 1 301 ? 53.168 33.656  -47.460 1.00 123.05 ? 301 LEU A CA    1 
ATOM   2368 C  C     . LEU A 1 301 ? 52.908 33.235  -46.018 1.00 115.76 ? 301 LEU A C     1 
ATOM   2369 O  O     . LEU A 1 301 ? 53.850 33.055  -45.238 1.00 110.76 ? 301 LEU A O     1 
ATOM   2370 C  CB    . LEU A 1 301 ? 53.078 35.177  -47.612 1.00 120.04 ? 301 LEU A CB    1 
ATOM   2371 C  CG    . LEU A 1 301 ? 54.263 36.050  -47.184 1.00 114.63 ? 301 LEU A CG    1 
ATOM   2372 C  CD1   . LEU A 1 301 ? 54.223 37.380  -47.922 1.00 115.65 ? 301 LEU A CD1   1 
ATOM   2373 C  CD2   . LEU A 1 301 ? 54.275 36.287  -45.680 1.00 108.24 ? 301 LEU A CD2   1 
ATOM   2374 N  N     . GLU A 1 302 ? 51.634 33.064  -45.653 1.00 112.86 ? 302 GLU A N     1 
ATOM   2375 C  CA    . GLU A 1 302 ? 51.294 32.654  -44.293 1.00 106.29 ? 302 GLU A CA    1 
ATOM   2376 C  C     . GLU A 1 302 ? 51.824 31.258  -43.987 1.00 96.11  ? 302 GLU A C     1 
ATOM   2377 O  O     . GLU A 1 302 ? 52.324 31.002  -42.885 1.00 89.31  ? 302 GLU A O     1 
ATOM   2378 C  CB    . GLU A 1 302 ? 49.778 32.710  -44.096 1.00 103.11 ? 302 GLU A CB    1 
ATOM   2379 C  CG    . GLU A 1 302 ? 49.311 32.420  -42.676 1.00 97.10  ? 302 GLU A CG    1 
ATOM   2380 C  CD    . GLU A 1 302 ? 47.798 32.468  -42.539 1.00 97.10  ? 302 GLU A CD    1 
ATOM   2381 O  OE1   . GLU A 1 302 ? 47.100 32.175  -43.531 1.00 97.49  ? 302 GLU A OE1   1 
ATOM   2382 O  OE2   . GLU A 1 302 ? 47.307 32.805  -41.442 1.00 99.47  ? 302 GLU A OE2   1 
ATOM   2383 N  N     . LEU A 1 303 ? 51.725 30.341  -44.952 1.00 95.70  ? 303 LEU A N     1 
ATOM   2384 C  CA    . LEU A 1 303 ? 52.224 28.987  -44.735 1.00 102.51 ? 303 LEU A CA    1 
ATOM   2385 C  C     . LEU A 1 303 ? 53.746 28.947  -44.699 1.00 100.42 ? 303 LEU A C     1 
ATOM   2386 O  O     . LEU A 1 303 ? 54.326 28.122  -43.983 1.00 90.08  ? 303 LEU A O     1 
ATOM   2387 C  CB    . LEU A 1 303 ? 51.691 28.051  -45.820 1.00 107.82 ? 303 LEU A CB    1 
ATOM   2388 C  CG    . LEU A 1 303 ? 52.119 26.584  -45.737 1.00 104.47 ? 303 LEU A CG    1 
ATOM   2389 C  CD1   . LEU A 1 303 ? 51.810 26.011  -44.363 1.00 96.53  ? 303 LEU A CD1   1 
ATOM   2390 C  CD2   . LEU A 1 303 ? 51.446 25.765  -46.828 1.00 101.88 ? 303 LEU A CD2   1 
ATOM   2391 N  N     . ALA A 1 304 ? 54.408 29.829  -45.451 1.00 113.65 ? 304 ALA A N     1 
ATOM   2392 C  CA    . ALA A 1 304 ? 55.867 29.825  -45.489 1.00 121.06 ? 304 ALA A CA    1 
ATOM   2393 C  C     . ALA A 1 304 ? 56.456 30.267  -44.155 1.00 122.65 ? 304 ALA A C     1 
ATOM   2394 O  O     . ALA A 1 304 ? 57.388 29.638  -43.639 1.00 121.15 ? 304 ALA A O     1 
ATOM   2395 C  CB    . ALA A 1 304 ? 56.364 30.722  -46.623 1.00 125.44 ? 304 ALA A CB    1 
ATOM   2396 N  N     . GLU A 1 305 ? 55.926 31.349  -43.579 1.00 122.28 ? 305 GLU A N     1 
ATOM   2397 C  CA    . GLU A 1 305 ? 56.460 31.838  -42.312 1.00 120.23 ? 305 GLU A CA    1 
ATOM   2398 C  C     . GLU A 1 305 ? 56.139 30.891  -41.162 1.00 114.30 ? 305 GLU A C     1 
ATOM   2399 O  O     . GLU A 1 305 ? 56.912 30.807  -40.200 1.00 118.94 ? 305 GLU A O     1 
ATOM   2400 C  CB    . GLU A 1 305 ? 55.930 33.243  -42.021 1.00 125.20 ? 305 GLU A CB    1 
ATOM   2401 C  CG    . GLU A 1 305 ? 54.420 33.375  -42.079 1.00 134.06 ? 305 GLU A CG    1 
ATOM   2402 C  CD    . GLU A 1 305 ? 53.963 34.819  -42.016 1.00 141.11 ? 305 GLU A CD    1 
ATOM   2403 O  OE1   . GLU A 1 305 ? 54.817 35.703  -41.791 1.00 143.73 ? 305 GLU A OE1   1 
ATOM   2404 O  OE2   . GLU A 1 305 ? 52.753 35.071  -42.197 1.00 139.72 ? 305 GLU A OE2   1 
ATOM   2405 N  N     . ASN A 1 306 ? 55.014 30.175  -41.239 1.00 101.61 ? 306 ASN A N     1 
ATOM   2406 C  CA    . ASN A 1 306 ? 54.740 29.132  -40.255 1.00 86.33  ? 306 ASN A CA    1 
ATOM   2407 C  C     . ASN A 1 306 ? 55.792 28.032  -40.317 1.00 81.58  ? 306 ASN A C     1 
ATOM   2408 O  O     . ASN A 1 306 ? 56.246 27.536  -39.279 1.00 78.58  ? 306 ASN A O     1 
ATOM   2409 C  CB    . ASN A 1 306 ? 53.345 28.544  -40.477 1.00 83.63  ? 306 ASN A CB    1 
ATOM   2410 C  CG    . ASN A 1 306 ? 52.257 29.337  -39.780 1.00 89.18  ? 306 ASN A CG    1 
ATOM   2411 O  OD1   . ASN A 1 306 ? 52.495 29.970  -38.752 1.00 97.90  ? 306 ASN A OD1   1 
ATOM   2412 N  ND2   . ASN A 1 306 ? 51.051 29.298  -40.334 1.00 84.26  ? 306 ASN A ND2   1 
ATOM   2413 N  N     . ARG A 1 307 ? 56.195 27.641  -41.529 1.00 78.52  ? 307 ARG A N     1 
ATOM   2414 C  CA    . ARG A 1 307 ? 57.208 26.601  -41.672 1.00 86.67  ? 307 ARG A CA    1 
ATOM   2415 C  C     . ARG A 1 307 ? 58.546 27.032  -41.088 1.00 90.38  ? 307 ARG A C     1 
ATOM   2416 O  O     . ARG A 1 307 ? 59.301 26.192  -40.586 1.00 82.03  ? 307 ARG A O     1 
ATOM   2417 C  CB    . ARG A 1 307 ? 57.376 26.225  -43.143 1.00 90.68  ? 307 ARG A CB    1 
ATOM   2418 C  CG    . ARG A 1 307 ? 56.282 25.324  -43.675 1.00 96.05  ? 307 ARG A CG    1 
ATOM   2419 C  CD    . ARG A 1 307 ? 56.869 24.162  -44.458 1.00 102.29 ? 307 ARG A CD    1 
ATOM   2420 N  NE    . ARG A 1 307 ? 55.836 23.230  -44.894 1.00 102.61 ? 307 ARG A NE    1 
ATOM   2421 C  CZ    . ARG A 1 307 ? 55.075 23.412  -45.967 1.00 104.03 ? 307 ARG A CZ    1 
ATOM   2422 N  NH1   . ARG A 1 307 ? 55.231 24.497  -46.715 1.00 102.58 ? 307 ARG A NH1   1 
ATOM   2423 N  NH2   . ARG A 1 307 ? 54.156 22.513  -46.292 1.00 100.94 ? 307 ARG A NH2   1 
ATOM   2424 N  N     . GLU A 1 308 ? 58.858 28.328  -41.144 1.00 98.65  ? 308 GLU A N     1 
ATOM   2425 C  CA    . GLU A 1 308 ? 60.136 28.793  -40.617 1.00 104.83 ? 308 GLU A CA    1 
ATOM   2426 C  C     . GLU A 1 308 ? 60.188 28.697  -39.098 1.00 92.68  ? 308 GLU A C     1 
ATOM   2427 O  O     . GLU A 1 308 ? 61.262 28.470  -38.530 1.00 87.65  ? 308 GLU A O     1 
ATOM   2428 C  CB    . GLU A 1 308 ? 60.401 30.227  -41.076 1.00 111.40 ? 308 GLU A CB    1 
ATOM   2429 C  CG    . GLU A 1 308 ? 60.348 30.404  -42.586 1.00 116.82 ? 308 GLU A CG    1 
ATOM   2430 C  CD    . GLU A 1 308 ? 61.263 29.440  -43.319 1.00 118.55 ? 308 GLU A CD    1 
ATOM   2431 O  OE1   . GLU A 1 308 ? 62.383 29.187  -42.827 1.00 116.67 ? 308 GLU A OE1   1 
ATOM   2432 O  OE2   . GLU A 1 308 ? 60.858 28.930  -44.385 1.00 120.12 ? 308 GLU A OE2   1 
ATOM   2433 N  N     . ILE A 1 309 ? 59.045 28.856  -38.428 1.00 78.48  ? 309 ILE A N     1 
ATOM   2434 C  CA    . ILE A 1 309 ? 59.025 28.767  -36.972 1.00 76.03  ? 309 ILE A CA    1 
ATOM   2435 C  C     . ILE A 1 309 ? 59.213 27.323  -36.520 1.00 79.15  ? 309 ILE A C     1 
ATOM   2436 O  O     . ILE A 1 309 ? 59.929 27.052  -35.549 1.00 75.55  ? 309 ILE A O     1 
ATOM   2437 C  CB    . ILE A 1 309 ? 57.719 29.368  -36.420 1.00 77.98  ? 309 ILE A CB    1 
ATOM   2438 C  CG1   . ILE A 1 309 ? 57.528 30.795  -36.939 1.00 74.87  ? 309 ILE A CG1   1 
ATOM   2439 C  CG2   . ILE A 1 309 ? 57.723 29.351  -34.898 1.00 78.10  ? 309 ILE A CG2   1 
ATOM   2440 C  CD1   . ILE A 1 309 ? 56.256 31.458  -36.455 1.00 59.69  ? 309 ILE A CD1   1 
ATOM   2441 N  N     . LEU A 1 310 ? 58.584 26.374  -37.221 1.00 79.62  ? 310 LEU A N     1 
ATOM   2442 C  CA    . LEU A 1 310 ? 58.643 24.979  -36.796 1.00 79.53  ? 310 LEU A CA    1 
ATOM   2443 C  C     . LEU A 1 310 ? 60.040 24.391  -36.952 1.00 85.59  ? 310 LEU A C     1 
ATOM   2444 O  O     . LEU A 1 310 ? 60.396 23.451  -36.232 1.00 83.27  ? 310 LEU A O     1 
ATOM   2445 C  CB    . LEU A 1 310 ? 57.626 24.146  -37.579 1.00 79.29  ? 310 LEU A CB    1 
ATOM   2446 C  CG    . LEU A 1 310 ? 56.150 24.515  -37.408 1.00 76.22  ? 310 LEU A CG    1 
ATOM   2447 C  CD1   . LEU A 1 310 ? 55.264 23.515  -38.132 1.00 75.36  ? 310 LEU A CD1   1 
ATOM   2448 C  CD2   . LEU A 1 310 ? 55.774 24.597  -35.937 1.00 65.89  ? 310 LEU A CD2   1 
ATOM   2449 N  N     . LYS A 1 311 ? 60.842 24.919  -37.881 1.00 85.71  ? 311 LYS A N     1 
ATOM   2450 C  CA    . LYS A 1 311 ? 62.214 24.442  -38.023 1.00 83.97  ? 311 LYS A CA    1 
ATOM   2451 C  C     . LYS A 1 311 ? 63.056 24.792  -36.802 1.00 83.43  ? 311 LYS A C     1 
ATOM   2452 O  O     . LYS A 1 311 ? 64.009 24.072  -36.480 1.00 76.24  ? 311 LYS A O     1 
ATOM   2453 C  CB    . LYS A 1 311 ? 62.848 25.020  -39.289 1.00 81.99  ? 311 LYS A CB    1 
ATOM   2454 C  CG    . LYS A 1 311 ? 62.130 24.639  -40.575 1.00 90.43  ? 311 LYS A CG    1 
ATOM   2455 C  CD    . LYS A 1 311 ? 62.684 25.403  -41.771 1.00 97.44  ? 311 LYS A CD    1 
ATOM   2456 C  CE    . LYS A 1 311 ? 61.899 25.093  -43.037 1.00 92.97  ? 311 LYS A CE    1 
ATOM   2457 N  NZ    . LYS A 1 311 ? 62.400 25.859  -44.212 1.00 87.51  ? 311 LYS A NZ    1 
ATOM   2458 N  N     . GLU A 1 312 ? 62.722 25.882  -36.111 1.00 92.50  ? 312 GLU A N     1 
ATOM   2459 C  CA    . GLU A 1 312 ? 63.455 26.280  -34.923 1.00 92.01  ? 312 GLU A CA    1 
ATOM   2460 C  C     . GLU A 1 312 ? 63.052 25.413  -33.730 1.00 81.45  ? 312 GLU A C     1 
ATOM   2461 O  O     . GLU A 1 312 ? 61.900 24.985  -33.626 1.00 84.00  ? 312 GLU A O     1 
ATOM   2462 C  CB    . GLU A 1 312 ? 63.195 27.749  -34.603 1.00 94.00  ? 312 GLU A CB    1 
ATOM   2463 C  CG    . GLU A 1 312 ? 63.372 28.694  -35.786 1.00 102.13 ? 312 GLU A CG    1 
ATOM   2464 C  CD    . GLU A 1 312 ? 64.808 28.780  -36.269 1.00 114.77 ? 312 GLU A CD    1 
ATOM   2465 O  OE1   . GLU A 1 312 ? 65.727 28.465  -35.483 1.00 116.71 ? 312 GLU A OE1   1 
ATOM   2466 O  OE2   . GLU A 1 312 ? 65.018 29.163  -37.439 1.00 120.55 ? 312 GLU A OE2   1 
ATOM   2467 N  N     . PRO A 1 313 ? 63.984 25.135  -32.823 1.00 76.08  ? 313 PRO A N     1 
ATOM   2468 C  CA    . PRO A 1 313 ? 63.650 24.339  -31.640 1.00 73.74  ? 313 PRO A CA    1 
ATOM   2469 C  C     . PRO A 1 313 ? 63.013 25.187  -30.551 1.00 70.65  ? 313 PRO A C     1 
ATOM   2470 O  O     . PRO A 1 313 ? 63.285 26.382  -30.416 1.00 75.21  ? 313 PRO A O     1 
ATOM   2471 C  CB    . PRO A 1 313 ? 65.011 23.797  -31.191 1.00 83.62  ? 313 PRO A CB    1 
ATOM   2472 C  CG    . PRO A 1 313 ? 65.969 24.865  -31.605 1.00 83.62  ? 313 PRO A CG    1 
ATOM   2473 C  CD    . PRO A 1 313 ? 65.422 25.452  -32.888 1.00 81.66  ? 313 PRO A CD    1 
ATOM   2474 N  N     . VAL A 1 314 ? 62.151 24.543  -29.764 1.00 75.98  ? 314 VAL A N     1 
ATOM   2475 C  CA    . VAL A 1 314 ? 61.434 25.219  -28.689 1.00 74.97  ? 314 VAL A CA    1 
ATOM   2476 C  C     . VAL A 1 314 ? 60.983 24.167  -27.686 1.00 67.60  ? 314 VAL A C     1 
ATOM   2477 O  O     . VAL A 1 314 ? 60.839 22.990  -28.019 1.00 55.50  ? 314 VAL A O     1 
ATOM   2478 C  CB    . VAL A 1 314 ? 60.238 26.038  -29.239 1.00 82.59  ? 314 VAL A CB    1 
ATOM   2479 C  CG1   . VAL A 1 314 ? 59.074 25.120  -29.592 1.00 86.95  ? 314 VAL A CG1   1 
ATOM   2480 C  CG2   . VAL A 1 314 ? 59.813 27.111  -28.245 1.00 90.36  ? 314 VAL A CG2   1 
ATOM   2481 N  N     . HIS A 1 315 ? 60.764 24.595  -26.445 1.00 67.43  ? 315 HIS A N     1 
ATOM   2482 C  CA    . HIS A 1 315 ? 60.371 23.689  -25.377 1.00 58.79  ? 315 HIS A CA    1 
ATOM   2483 C  C     . HIS A 1 315 ? 59.662 24.488  -24.295 1.00 63.12  ? 315 HIS A C     1 
ATOM   2484 O  O     . HIS A 1 315 ? 59.817 25.708  -24.196 1.00 76.34  ? 315 HIS A O     1 
ATOM   2485 C  CB    . HIS A 1 315 ? 61.581 22.954  -24.792 1.00 53.34  ? 315 HIS A CB    1 
ATOM   2486 C  CG    . HIS A 1 315 ? 62.577 23.861  -24.141 1.00 60.57  ? 315 HIS A CG    1 
ATOM   2487 N  ND1   . HIS A 1 315 ? 62.425 24.334  -22.855 1.00 61.50  ? 315 HIS A ND1   1 
ATOM   2488 C  CD2   . HIS A 1 315 ? 63.735 24.392  -24.602 1.00 60.71  ? 315 HIS A CD2   1 
ATOM   2489 C  CE1   . HIS A 1 315 ? 63.449 25.111  -22.549 1.00 55.80  ? 315 HIS A CE1   1 
ATOM   2490 N  NE2   . HIS A 1 315 ? 64.258 25.163  -23.592 1.00 57.68  ? 315 HIS A NE2   1 
ATOM   2491 N  N     . GLY A 1 316 ? 58.885 23.778  -23.477 1.00 54.77  ? 316 GLY A N     1 
ATOM   2492 C  CA    . GLY A 1 316 ? 58.198 24.365  -22.351 1.00 47.49  ? 316 GLY A CA    1 
ATOM   2493 C  C     . GLY A 1 316 ? 58.834 23.954  -21.030 1.00 56.19  ? 316 GLY A C     1 
ATOM   2494 O  O     . GLY A 1 316 ? 59.697 23.080  -20.963 1.00 56.12  ? 316 GLY A O     1 
ATOM   2495 N  N     . VAL A 1 317 ? 58.386 24.617  -19.966 1.00 55.29  ? 317 VAL A N     1 
ATOM   2496 C  CA    . VAL A 1 317 ? 58.850 24.307  -18.618 1.00 53.98  ? 317 VAL A CA    1 
ATOM   2497 C  C     . VAL A 1 317 ? 57.664 23.846  -17.782 1.00 48.47  ? 317 VAL A C     1 
ATOM   2498 O  O     . VAL A 1 317 ? 56.547 23.710  -18.292 1.00 44.21  ? 317 VAL A O     1 
ATOM   2499 C  CB    . VAL A 1 317 ? 59.552 25.512  -17.969 1.00 56.18  ? 317 VAL A CB    1 
ATOM   2500 C  CG1   . VAL A 1 317 ? 60.818 25.863  -18.733 1.00 50.76  ? 317 VAL A CG1   1 
ATOM   2501 C  CG2   . VAL A 1 317 ? 58.612 26.704  -17.910 1.00 64.02  ? 317 VAL A CG2   1 
ATOM   2502 N  N     . TYR A 1 318 ? 57.897 23.605  -16.498 1.00 54.33  ? 318 TYR A N     1 
ATOM   2503 C  CA    . TYR A 1 318 ? 56.866 23.122  -15.594 1.00 48.19  ? 318 TYR A CA    1 
ATOM   2504 C  C     . TYR A 1 318 ? 56.425 24.237  -14.653 1.00 50.96  ? 318 TYR A C     1 
ATOM   2505 O  O     . TYR A 1 318 ? 57.064 25.287  -14.543 1.00 50.40  ? 318 TYR A O     1 
ATOM   2506 C  CB    . TYR A 1 318 ? 57.364 21.899  -14.815 1.00 44.63  ? 318 TYR A CB    1 
ATOM   2507 C  CG    . TYR A 1 318 ? 57.681 20.721  -15.710 1.00 48.30  ? 318 TYR A CG    1 
ATOM   2508 C  CD1   . TYR A 1 318 ? 56.692 20.125  -16.480 1.00 43.47  ? 318 TYR A CD1   1 
ATOM   2509 C  CD2   . TYR A 1 318 ? 58.969 20.209  -15.789 1.00 51.40  ? 318 TYR A CD2   1 
ATOM   2510 C  CE1   . TYR A 1 318 ? 56.974 19.052  -17.302 1.00 48.44  ? 318 TYR A CE1   1 
ATOM   2511 C  CE2   . TYR A 1 318 ? 59.261 19.134  -16.609 1.00 51.31  ? 318 TYR A CE2   1 
ATOM   2512 C  CZ    . TYR A 1 318 ? 58.260 18.560  -17.363 1.00 57.16  ? 318 TYR A CZ    1 
ATOM   2513 O  OH    . TYR A 1 318 ? 58.543 17.488  -18.181 1.00 52.47  ? 318 TYR A OH    1 
ATOM   2514 N  N     . TYR A 1 319 ? 55.310 23.994  -13.969 1.00 46.38  ? 319 TYR A N     1 
ATOM   2515 C  CA    . TYR A 1 319 ? 54.629 25.028  -13.201 1.00 42.68  ? 319 TYR A CA    1 
ATOM   2516 C  C     . TYR A 1 319 ? 55.192 25.118  -11.788 1.00 43.72  ? 319 TYR A C     1 
ATOM   2517 O  O     . TYR A 1 319 ? 55.290 24.109  -11.083 1.00 51.91  ? 319 TYR A O     1 
ATOM   2518 C  CB    . TYR A 1 319 ? 53.126 24.750  -13.156 1.00 41.73  ? 319 TYR A CB    1 
ATOM   2519 C  CG    . TYR A 1 319 ? 52.334 25.743  -12.334 1.00 44.13  ? 319 TYR A CG    1 
ATOM   2520 C  CD1   . TYR A 1 319 ? 52.349 27.099  -12.642 1.00 58.12  ? 319 TYR A CD1   1 
ATOM   2521 C  CD2   . TYR A 1 319 ? 51.558 25.324  -11.262 1.00 42.00  ? 319 TYR A CD2   1 
ATOM   2522 C  CE1   . TYR A 1 319 ? 51.621 28.009  -11.897 1.00 65.18  ? 319 TYR A CE1   1 
ATOM   2523 C  CE2   . TYR A 1 319 ? 50.827 26.226  -10.511 1.00 55.26  ? 319 TYR A CE2   1 
ATOM   2524 C  CZ    . TYR A 1 319 ? 50.861 27.567  -10.833 1.00 60.40  ? 319 TYR A CZ    1 
ATOM   2525 O  OH    . TYR A 1 319 ? 50.133 28.467  -10.088 1.00 52.27  ? 319 TYR A OH    1 
ATOM   2526 N  N     . ASP A 1 320 ? 55.555 26.332  -11.384 1.00 47.77  ? 320 ASP A N     1 
ATOM   2527 C  CA    . ASP A 1 320 ? 55.997 26.619  -10.025 1.00 53.86  ? 320 ASP A CA    1 
ATOM   2528 C  C     . ASP A 1 320 ? 54.889 27.376  -9.306  1.00 63.57  ? 320 ASP A C     1 
ATOM   2529 O  O     . ASP A 1 320 ? 54.640 28.549  -9.630  1.00 60.66  ? 320 ASP A O     1 
ATOM   2530 C  CB    . ASP A 1 320 ? 57.288 27.442  -10.039 1.00 57.45  ? 320 ASP A CB    1 
ATOM   2531 C  CG    . ASP A 1 320 ? 57.917 27.581  -8.662  1.00 62.80  ? 320 ASP A CG    1 
ATOM   2532 O  OD1   . ASP A 1 320 ? 57.273 27.213  -7.657  1.00 63.90  ? 320 ASP A OD1   1 
ATOM   2533 O  OD2   . ASP A 1 320 ? 59.064 28.070  -8.585  1.00 68.39  ? 320 ASP A OD2   1 
ATOM   2534 N  N     . PRO A 1 321 ? 54.197 26.762  -8.344  1.00 61.92  ? 321 PRO A N     1 
ATOM   2535 C  CA    . PRO A 1 321 ? 53.089 27.468  -7.678  1.00 53.44  ? 321 PRO A CA    1 
ATOM   2536 C  C     . PRO A 1 321 ? 53.531 28.696  -6.904  1.00 67.73  ? 321 PRO A C     1 
ATOM   2537 O  O     . PRO A 1 321 ? 52.723 29.613  -6.705  1.00 80.64  ? 321 PRO A O     1 
ATOM   2538 C  CB    . PRO A 1 321 ? 52.502 26.400  -6.745  1.00 44.06  ? 321 PRO A CB    1 
ATOM   2539 C  CG    . PRO A 1 321 ? 52.975 25.096  -7.299  1.00 53.73  ? 321 PRO A CG    1 
ATOM   2540 C  CD    . PRO A 1 321 ? 54.320 25.368  -7.891  1.00 58.30  ? 321 PRO A CD    1 
ATOM   2541 N  N     . SER A 1 322 ? 54.789 28.745  -6.460  1.00 69.70  ? 322 SER A N     1 
ATOM   2542 C  CA    . SER A 1 322 ? 55.253 29.883  -5.675  1.00 74.52  ? 322 SER A CA    1 
ATOM   2543 C  C     . SER A 1 322 ? 55.356 31.149  -6.515  1.00 77.12  ? 322 SER A C     1 
ATOM   2544 O  O     . SER A 1 322 ? 55.223 32.257  -5.982  1.00 90.78  ? 322 SER A O     1 
ATOM   2545 C  CB    . SER A 1 322 ? 56.603 29.561  -5.036  1.00 85.16  ? 322 SER A CB    1 
ATOM   2546 O  OG    . SER A 1 322 ? 57.123 30.684  -4.345  1.00 101.03 ? 322 SER A OG    1 
ATOM   2547 N  N     . LYS A 1 323 ? 55.589 31.011  -7.815  1.00 74.05  ? 323 LYS A N     1 
ATOM   2548 C  CA    . LYS A 1 323 ? 55.713 32.153  -8.707  1.00 67.08  ? 323 LYS A CA    1 
ATOM   2549 C  C     . LYS A 1 323 ? 54.363 32.502  -9.323  1.00 65.67  ? 323 LYS A C     1 
ATOM   2550 O  O     . LYS A 1 323 ? 53.444 31.681  -9.380  1.00 70.72  ? 323 LYS A O     1 
ATOM   2551 C  CB    . LYS A 1 323 ? 56.733 31.864  -9.809  1.00 65.21  ? 323 LYS A CB    1 
ATOM   2552 C  CG    . LYS A 1 323 ? 58.113 31.484  -9.298  1.00 66.86  ? 323 LYS A CG    1 
ATOM   2553 C  CD    . LYS A 1 323 ? 58.762 32.633  -8.546  1.00 89.12  ? 323 LYS A CD    1 
ATOM   2554 C  CE    . LYS A 1 323 ? 60.150 32.255  -8.052  1.00 93.74  ? 323 LYS A CE    1 
ATOM   2555 N  NZ    . LYS A 1 323 ? 60.110 31.126  -7.083  1.00 87.23  ? 323 LYS A NZ    1 
ATOM   2556 N  N     . ASP A 1 324 ? 54.252 33.742  -9.788  1.00 67.45  ? 324 ASP A N     1 
ATOM   2557 C  CA    . ASP A 1 324 ? 53.033 34.195  -10.440 1.00 72.24  ? 324 ASP A CA    1 
ATOM   2558 C  C     . ASP A 1 324 ? 52.999 33.749  -11.896 1.00 63.81  ? 324 ASP A C     1 
ATOM   2559 O  O     . ASP A 1 324 ? 54.035 33.526  -12.528 1.00 69.62  ? 324 ASP A O     1 
ATOM   2560 C  CB    . ASP A 1 324 ? 52.910 35.718  -10.369 1.00 87.46  ? 324 ASP A CB    1 
ATOM   2561 C  CG    . ASP A 1 324 ? 52.338 36.199  -9.050  1.00 89.33  ? 324 ASP A CG    1 
ATOM   2562 O  OD1   . ASP A 1 324 ? 51.564 35.444  -8.424  1.00 83.52  ? 324 ASP A OD1   1 
ATOM   2563 O  OD2   . ASP A 1 324 ? 52.659 37.335  -8.643  1.00 90.79  ? 324 ASP A OD2   1 
ATOM   2564 N  N     . LEU A 1 325 ? 51.785 33.619  -12.424 1.00 51.98  ? 325 LEU A N     1 
ATOM   2565 C  CA    . LEU A 1 325 ? 51.575 33.350  -13.839 1.00 50.17  ? 325 LEU A CA    1 
ATOM   2566 C  C     . LEU A 1 325 ? 51.556 34.666  -14.603 1.00 53.70  ? 325 LEU A C     1 
ATOM   2567 O  O     . LEU A 1 325 ? 50.865 35.609  -14.207 1.00 63.01  ? 325 LEU A O     1 
ATOM   2568 C  CB    . LEU A 1 325 ? 50.264 32.598  -14.061 1.00 54.24  ? 325 LEU A CB    1 
ATOM   2569 C  CG    . LEU A 1 325 ? 50.254 31.088  -13.850 1.00 55.00  ? 325 LEU A CG    1 
ATOM   2570 C  CD1   . LEU A 1 325 ? 48.829 30.580  -13.904 1.00 54.91  ? 325 LEU A CD1   1 
ATOM   2571 C  CD2   . LEU A 1 325 ? 51.108 30.401  -14.902 1.00 54.13  ? 325 LEU A CD2   1 
ATOM   2572 N  N     . ILE A 1 326 ? 52.311 34.725  -15.696 1.00 51.10  ? 326 ILE A N     1 
ATOM   2573 C  CA    . ILE A 1 326 ? 52.390 35.919  -16.529 1.00 46.02  ? 326 ILE A CA    1 
ATOM   2574 C  C     . ILE A 1 326 ? 52.058 35.522  -17.959 1.00 45.42  ? 326 ILE A C     1 
ATOM   2575 O  O     . ILE A 1 326 ? 52.694 34.623  -18.520 1.00 48.81  ? 326 ILE A O     1 
ATOM   2576 C  CB    . ILE A 1 326 ? 53.774 36.585  -16.458 1.00 52.14  ? 326 ILE A CB    1 
ATOM   2577 C  CG1   . ILE A 1 326 ? 54.115 36.945  -15.012 1.00 47.07  ? 326 ILE A CG1   1 
ATOM   2578 C  CG2   . ILE A 1 326 ? 53.810 37.825  -17.337 1.00 59.27  ? 326 ILE A CG2   1 
ATOM   2579 C  CD1   . ILE A 1 326 ? 55.479 37.570  -14.840 1.00 50.64  ? 326 ILE A CD1   1 
ATOM   2580 N  N     . ALA A 1 327 ? 51.064 36.185  -18.541 1.00 51.98  ? 327 ALA A N     1 
ATOM   2581 C  CA    . ALA A 1 327 ? 50.678 35.981  -19.930 1.00 50.80  ? 327 ALA A CA    1 
ATOM   2582 C  C     . ALA A 1 327 ? 50.911 37.273  -20.698 1.00 57.65  ? 327 ALA A C     1 
ATOM   2583 O  O     . ALA A 1 327 ? 50.445 38.339  -20.283 1.00 65.61  ? 327 ALA A O     1 
ATOM   2584 C  CB    . ALA A 1 327 ? 49.215 35.544  -20.042 1.00 39.60  ? 327 ALA A CB    1 
ATOM   2585 N  N     . GLU A 1 328 ? 51.638 37.177  -21.808 1.00 54.14  ? 328 GLU A N     1 
ATOM   2586 C  CA    . GLU A 1 328 ? 51.967 38.322  -22.647 1.00 57.30  ? 328 GLU A CA    1 
ATOM   2587 C  C     . GLU A 1 328 ? 51.378 38.094  -24.030 1.00 56.34  ? 328 GLU A C     1 
ATOM   2588 O  O     . GLU A 1 328 ? 51.585 37.033  -24.626 1.00 61.35  ? 328 GLU A O     1 
ATOM   2589 C  CB    . GLU A 1 328 ? 53.483 38.521  -22.731 1.00 63.58  ? 328 GLU A CB    1 
ATOM   2590 C  CG    . GLU A 1 328 ? 53.920 39.791  -23.443 1.00 74.66  ? 328 GLU A CG    1 
ATOM   2591 C  CD    . GLU A 1 328 ? 55.430 39.950  -23.473 1.00 82.37  ? 328 GLU A CD    1 
ATOM   2592 O  OE1   . GLU A 1 328 ? 55.945 40.584  -24.419 1.00 87.51  ? 328 GLU A OE1   1 
ATOM   2593 O  OE2   . GLU A 1 328 ? 56.103 39.437  -22.552 1.00 74.60  ? 328 GLU A OE2   1 
ATOM   2594 N  N     . ILE A 1 329 ? 50.648 39.084  -24.537 1.00 49.38  ? 329 ILE A N     1 
ATOM   2595 C  CA    . ILE A 1 329 ? 49.916 38.969  -25.794 1.00 49.61  ? 329 ILE A CA    1 
ATOM   2596 C  C     . ILE A 1 329 ? 50.551 39.895  -26.822 1.00 54.35  ? 329 ILE A C     1 
ATOM   2597 O  O     . ILE A 1 329 ? 50.784 41.077  -26.542 1.00 57.05  ? 329 ILE A O     1 
ATOM   2598 C  CB    . ILE A 1 329 ? 48.425 39.301  -25.609 1.00 42.36  ? 329 ILE A CB    1 
ATOM   2599 C  CG1   . ILE A 1 329 ? 47.805 38.413  -24.528 1.00 39.82  ? 329 ILE A CG1   1 
ATOM   2600 C  CG2   . ILE A 1 329 ? 47.674 39.144  -26.921 1.00 42.26  ? 329 ILE A CG2   1 
ATOM   2601 C  CD1   . ILE A 1 329 ? 46.335 38.684  -24.290 1.00 43.30  ? 329 ILE A CD1   1 
ATOM   2602 N  N     . GLN A 1 330 ? 50.836 39.358  -28.003 1.00 52.25  ? 330 GLN A N     1 
ATOM   2603 C  CA    . GLN A 1 330 ? 51.248 40.146  -29.155 1.00 55.72  ? 330 GLN A CA    1 
ATOM   2604 C  C     . GLN A 1 330 ? 50.109 40.199  -30.165 1.00 57.40  ? 330 GLN A C     1 
ATOM   2605 O  O     . GLN A 1 330 ? 49.139 39.442  -30.085 1.00 55.83  ? 330 GLN A O     1 
ATOM   2606 C  CB    . GLN A 1 330 ? 52.514 39.568  -29.801 1.00 65.00  ? 330 GLN A CB    1 
ATOM   2607 C  CG    . GLN A 1 330 ? 53.772 39.718  -28.960 1.00 70.37  ? 330 GLN A CG    1 
ATOM   2608 C  CD    . GLN A 1 330 ? 53.932 38.608  -27.940 1.00 80.76  ? 330 GLN A CD    1 
ATOM   2609 O  OE1   . GLN A 1 330 ? 53.546 37.463  -28.184 1.00 75.30  ? 330 GLN A OE1   1 
ATOM   2610 N  NE2   . GLN A 1 330 ? 54.504 38.941  -26.788 1.00 87.45  ? 330 GLN A NE2   1 
ATOM   2611 N  N     . LYS A 1 331 ? 50.233 41.111  -31.125 1.00 65.76  ? 331 LYS A N     1 
ATOM   2612 C  CA    . LYS A 1 331 ? 49.210 41.317  -32.140 1.00 60.99  ? 331 LYS A CA    1 
ATOM   2613 C  C     . LYS A 1 331 ? 49.797 41.112  -33.528 1.00 63.44  ? 331 LYS A C     1 
ATOM   2614 O  O     . LYS A 1 331 ? 50.870 41.640  -33.838 1.00 73.81  ? 331 LYS A O     1 
ATOM   2615 C  CB    . LYS A 1 331 ? 48.600 42.716  -32.044 1.00 61.44  ? 331 LYS A CB    1 
ATOM   2616 C  CG    . LYS A 1 331 ? 47.636 43.017  -33.178 1.00 61.82  ? 331 LYS A CG    1 
ATOM   2617 C  CD    . LYS A 1 331 ? 47.358 44.498  -33.314 1.00 60.71  ? 331 LYS A CD    1 
ATOM   2618 C  CE    . LYS A 1 331 ? 46.683 44.789  -34.643 1.00 56.33  ? 331 LYS A CE    1 
ATOM   2619 N  NZ    . LYS A 1 331 ? 46.317 46.223  -34.778 1.00 64.50  ? 331 LYS A NZ    1 
ATOM   2620 N  N     . GLN A 1 332 ? 49.091 40.347  -34.353 1.00 61.26  ? 332 GLN A N     1 
ATOM   2621 C  CA    . GLN A 1 332 ? 49.357 40.253  -35.778 1.00 74.62  ? 332 GLN A CA    1 
ATOM   2622 C  C     . GLN A 1 332 ? 48.171 40.817  -36.551 1.00 89.14  ? 332 GLN A C     1 
ATOM   2623 O  O     . GLN A 1 332 ? 47.124 41.141  -35.983 1.00 91.43  ? 332 GLN A O     1 
ATOM   2624 C  CB    . GLN A 1 332 ? 49.635 38.803  -36.195 1.00 82.24  ? 332 GLN A CB    1 
ATOM   2625 C  CG    . GLN A 1 332 ? 50.979 38.265  -35.724 1.00 84.69  ? 332 GLN A CG    1 
ATOM   2626 C  CD    . GLN A 1 332 ? 50.854 37.323  -34.544 1.00 71.66  ? 332 GLN A CD    1 
ATOM   2627 O  OE1   . GLN A 1 332 ? 49.813 36.698  -34.340 1.00 72.72  ? 332 GLN A OE1   1 
ATOM   2628 N  NE2   . GLN A 1 332 ? 51.920 37.214  -33.759 1.00 62.01  ? 332 GLN A NE2   1 
ATOM   2629 N  N     . GLY A 1 333 ? 48.345 40.932  -37.862 1.00 99.62  ? 333 GLY A N     1 
ATOM   2630 C  CA    . GLY A 1 333 ? 47.307 41.469  -38.713 1.00 106.74 ? 333 GLY A CA    1 
ATOM   2631 C  C     . GLY A 1 333 ? 46.095 40.556  -38.793 1.00 108.19 ? 333 GLY A C     1 
ATOM   2632 O  O     . GLY A 1 333 ? 45.996 39.522  -38.131 1.00 111.49 ? 333 GLY A O     1 
ATOM   2633 N  N     . GLN A 1 334 ? 45.139 40.975  -39.624 1.00 108.56 ? 334 GLN A N     1 
ATOM   2634 C  CA    . GLN A 1 334 ? 43.934 40.206  -39.931 1.00 111.75 ? 334 GLN A CA    1 
ATOM   2635 C  C     . GLN A 1 334 ? 43.102 39.891  -38.689 1.00 101.09 ? 334 GLN A C     1 
ATOM   2636 O  O     . GLN A 1 334 ? 42.250 38.998  -38.721 1.00 99.41  ? 334 GLN A O     1 
ATOM   2637 C  CB    . GLN A 1 334 ? 44.282 38.906  -40.668 1.00 120.36 ? 334 GLN A CB    1 
ATOM   2638 C  CG    . GLN A 1 334 ? 45.217 39.094  -41.853 1.00 123.83 ? 334 GLN A CG    1 
ATOM   2639 C  CD    . GLN A 1 334 ? 44.565 39.840  -42.998 1.00 129.45 ? 334 GLN A CD    1 
ATOM   2640 O  OE1   . GLN A 1 334 ? 43.381 39.655  -43.282 1.00 129.12 ? 334 GLN A OE1   1 
ATOM   2641 N  NE2   . GLN A 1 334 ? 45.336 40.694  -43.663 1.00 133.83 ? 334 GLN A NE2   1 
ATOM   2642 N  N     . GLY A 1 335 ? 43.326 40.608  -37.593 1.00 90.75  ? 335 GLY A N     1 
ATOM   2643 C  CA    . GLY A 1 335 ? 42.627 40.313  -36.355 1.00 80.38  ? 335 GLY A CA    1 
ATOM   2644 C  C     . GLY A 1 335 ? 43.101 39.048  -35.672 1.00 79.81  ? 335 GLY A C     1 
ATOM   2645 O  O     . GLY A 1 335 ? 42.277 38.274  -35.166 1.00 79.64  ? 335 GLY A O     1 
ATOM   2646 N  N     . GLN A 1 336 ? 44.411 38.815  -35.648 1.00 77.09  ? 336 GLN A N     1 
ATOM   2647 C  CA    . GLN A 1 336 ? 44.996 37.630  -35.040 1.00 67.29  ? 336 GLN A CA    1 
ATOM   2648 C  C     . GLN A 1 336 ? 45.848 38.027  -33.842 1.00 66.46  ? 336 GLN A C     1 
ATOM   2649 O  O     . GLN A 1 336 ? 46.382 39.139  -33.780 1.00 73.00  ? 336 GLN A O     1 
ATOM   2650 C  CB    . GLN A 1 336 ? 45.848 36.850  -36.046 1.00 62.76  ? 336 GLN A CB    1 
ATOM   2651 C  CG    . GLN A 1 336 ? 45.066 36.283  -37.215 1.00 63.42  ? 336 GLN A CG    1 
ATOM   2652 C  CD    . GLN A 1 336 ? 45.952 35.546  -38.197 1.00 77.56  ? 336 GLN A CD    1 
ATOM   2653 O  OE1   . GLN A 1 336 ? 45.927 34.317  -38.273 1.00 87.29  ? 336 GLN A OE1   1 
ATOM   2654 N  NE2   . GLN A 1 336 ? 46.740 36.295  -38.961 1.00 73.15  ? 336 GLN A NE2   1 
ATOM   2655 N  N     . TRP A 1 337 ? 45.972 37.106  -32.888 1.00 52.00  ? 337 TRP A N     1 
ATOM   2656 C  CA    . TRP A 1 337 ? 46.668 37.375  -31.639 1.00 49.67  ? 337 TRP A CA    1 
ATOM   2657 C  C     . TRP A 1 337 ? 47.438 36.141  -31.197 1.00 50.23  ? 337 TRP A C     1 
ATOM   2658 O  O     . TRP A 1 337 ? 46.942 35.016  -31.307 1.00 58.31  ? 337 TRP A O     1 
ATOM   2659 C  CB    . TRP A 1 337 ? 45.688 37.796  -30.535 1.00 39.68  ? 337 TRP A CB    1 
ATOM   2660 C  CG    . TRP A 1 337 ? 44.784 38.920  -30.936 1.00 46.48  ? 337 TRP A CG    1 
ATOM   2661 C  CD1   . TRP A 1 337 ? 43.630 38.825  -31.659 1.00 54.05  ? 337 TRP A CD1   1 
ATOM   2662 C  CD2   . TRP A 1 337 ? 44.957 40.310  -30.638 1.00 39.87  ? 337 TRP A CD2   1 
ATOM   2663 N  NE1   . TRP A 1 337 ? 43.076 40.069  -31.832 1.00 50.76  ? 337 TRP A NE1   1 
ATOM   2664 C  CE2   . TRP A 1 337 ? 43.871 40.998  -31.213 1.00 45.05  ? 337 TRP A CE2   1 
ATOM   2665 C  CE3   . TRP A 1 337 ? 45.924 41.039  -29.940 1.00 42.27  ? 337 TRP A CE3   1 
ATOM   2666 C  CZ2   . TRP A 1 337 ? 43.725 42.379  -31.112 1.00 40.74  ? 337 TRP A CZ2   1 
ATOM   2667 C  CZ3   . TRP A 1 337 ? 45.777 42.409  -29.840 1.00 48.94  ? 337 TRP A CZ3   1 
ATOM   2668 C  CH2   . TRP A 1 337 ? 44.686 43.065  -30.423 1.00 43.12  ? 337 TRP A CH2   1 
ATOM   2669 N  N     . THR A 1 338 ? 48.649 36.361  -30.693 1.00 48.74  ? 338 THR A N     1 
ATOM   2670 C  CA    . THR A 1 338 ? 49.493 35.309  -30.147 1.00 57.50  ? 338 THR A CA    1 
ATOM   2671 C  C     . THR A 1 338 ? 49.835 35.654  -28.706 1.00 51.82  ? 338 THR A C     1 
ATOM   2672 O  O     . THR A 1 338 ? 50.025 36.827  -28.370 1.00 58.78  ? 338 THR A O     1 
ATOM   2673 C  CB    . THR A 1 338 ? 50.778 35.142  -30.972 1.00 68.96  ? 338 THR A CB    1 
ATOM   2674 O  OG1   . THR A 1 338 ? 50.438 34.895  -32.341 1.00 84.11  ? 338 THR A OG1   1 
ATOM   2675 C  CG2   . THR A 1 338 ? 51.614 33.980  -30.450 1.00 73.72  ? 338 THR A CG2   1 
ATOM   2676 N  N     . TYR A 1 339 ? 49.898 34.637  -27.849 1.00 55.79  ? 339 TYR A N     1 
ATOM   2677 C  CA    . TYR A 1 339 ? 50.226 34.861  -26.451 1.00 61.88  ? 339 TYR A CA    1 
ATOM   2678 C  C     . TYR A 1 339 ? 51.244 33.833  -25.979 1.00 58.41  ? 339 TYR A C     1 
ATOM   2679 O  O     . TYR A 1 339 ? 51.442 32.785  -26.598 1.00 60.91  ? 339 TYR A O     1 
ATOM   2680 C  CB    . TYR A 1 339 ? 48.975 34.827  -25.559 1.00 66.35  ? 339 TYR A CB    1 
ATOM   2681 C  CG    . TYR A 1 339 ? 48.172 33.544  -25.606 1.00 60.05  ? 339 TYR A CG    1 
ATOM   2682 C  CD1   . TYR A 1 339 ? 47.148 33.376  -26.531 1.00 55.93  ? 339 TYR A CD1   1 
ATOM   2683 C  CD2   . TYR A 1 339 ? 48.410 32.518  -24.700 1.00 53.22  ? 339 TYR A CD2   1 
ATOM   2684 C  CE1   . TYR A 1 339 ? 46.400 32.214  -26.565 1.00 53.14  ? 339 TYR A CE1   1 
ATOM   2685 C  CE2   . TYR A 1 339 ? 47.668 31.351  -24.729 1.00 51.82  ? 339 TYR A CE2   1 
ATOM   2686 C  CZ    . TYR A 1 339 ? 46.664 31.206  -25.662 1.00 56.29  ? 339 TYR A CZ    1 
ATOM   2687 O  OH    . TYR A 1 339 ? 45.922 30.047  -25.696 1.00 63.00  ? 339 TYR A OH    1 
ATOM   2688 N  N     . GLN A 1 340 ? 51.902 34.169  -24.872 1.00 44.66  ? 340 GLN A N     1 
ATOM   2689 C  CA    . GLN A 1 340 ? 52.893 33.313  -24.237 1.00 45.92  ? 340 GLN A CA    1 
ATOM   2690 C  C     . GLN A 1 340 ? 52.703 33.407  -22.732 1.00 45.47  ? 340 GLN A C     1 
ATOM   2691 O  O     . GLN A 1 340 ? 52.609 34.510  -22.188 1.00 47.61  ? 340 GLN A O     1 
ATOM   2692 C  CB    . GLN A 1 340 ? 54.320 33.730  -24.618 1.00 61.55  ? 340 GLN A CB    1 
ATOM   2693 C  CG    . GLN A 1 340 ? 54.608 33.700  -26.111 1.00 69.95  ? 340 GLN A CG    1 
ATOM   2694 C  CD    . GLN A 1 340 ? 55.292 34.962  -26.597 1.00 85.57  ? 340 GLN A CD    1 
ATOM   2695 O  OE1   . GLN A 1 340 ? 55.446 35.927  -25.848 1.00 91.73  ? 340 GLN A OE1   1 
ATOM   2696 N  NE2   . GLN A 1 340 ? 55.705 34.962  -27.860 1.00 92.85  ? 340 GLN A NE2   1 
ATOM   2697 N  N     . ILE A 1 341 ? 52.641 32.259  -22.065 1.00 43.42  ? 341 ILE A N     1 
ATOM   2698 C  CA    . ILE A 1 341 ? 52.469 32.198  -20.618 1.00 43.97  ? 341 ILE A CA    1 
ATOM   2699 C  C     . ILE A 1 341 ? 53.767 31.698  -20.003 1.00 46.25  ? 341 ILE A C     1 
ATOM   2700 O  O     . ILE A 1 341 ? 54.272 30.632  -20.377 1.00 56.60  ? 341 ILE A O     1 
ATOM   2701 C  CB    . ILE A 1 341 ? 51.283 31.302  -20.222 1.00 40.36  ? 341 ILE A CB    1 
ATOM   2702 C  CG1   . ILE A 1 341 ? 50.025 31.738  -20.974 1.00 39.22  ? 341 ILE A CG1   1 
ATOM   2703 C  CG2   . ILE A 1 341 ? 51.047 31.372  -18.723 1.00 40.13  ? 341 ILE A CG2   1 
ATOM   2704 C  CD1   . ILE A 1 341 ? 48.778 30.985  -20.573 1.00 37.81  ? 341 ILE A CD1   1 
ATOM   2705 N  N     . TYR A 1 342 ? 54.305 32.469  -19.062 1.00 48.91  ? 342 TYR A N     1 
ATOM   2706 C  CA    . TYR A 1 342 ? 55.576 32.151  -18.432 1.00 45.80  ? 342 TYR A CA    1 
ATOM   2707 C  C     . TYR A 1 342 ? 55.552 32.648  -16.995 1.00 55.51  ? 342 TYR A C     1 
ATOM   2708 O  O     . TYR A 1 342 ? 54.631 33.350  -16.570 1.00 58.08  ? 342 TYR A O     1 
ATOM   2709 C  CB    . TYR A 1 342 ? 56.750 32.769  -19.199 1.00 47.67  ? 342 TYR A CB    1 
ATOM   2710 C  CG    . TYR A 1 342 ? 56.693 34.280  -19.285 1.00 62.00  ? 342 TYR A CG    1 
ATOM   2711 C  CD1   . TYR A 1 342 ? 57.338 35.074  -18.345 1.00 61.26  ? 342 TYR A CD1   1 
ATOM   2712 C  CD2   . TYR A 1 342 ? 55.990 34.911  -20.303 1.00 62.81  ? 342 TYR A CD2   1 
ATOM   2713 C  CE1   . TYR A 1 342 ? 57.285 36.451  -18.417 1.00 50.42  ? 342 TYR A CE1   1 
ATOM   2714 C  CE2   . TYR A 1 342 ? 55.932 36.288  -20.383 1.00 53.11  ? 342 TYR A CE2   1 
ATOM   2715 C  CZ    . TYR A 1 342 ? 56.582 37.054  -19.438 1.00 60.79  ? 342 TYR A CZ    1 
ATOM   2716 O  OH    . TYR A 1 342 ? 56.528 38.428  -19.513 1.00 62.36  ? 342 TYR A OH    1 
ATOM   2717 N  N     . GLN A 1 343 ? 56.582 32.268  -16.246 1.00 55.05  ? 343 GLN A N     1 
ATOM   2718 C  CA    . GLN A 1 343 ? 56.813 32.770  -14.899 1.00 53.42  ? 343 GLN A CA    1 
ATOM   2719 C  C     . GLN A 1 343 ? 58.163 33.450  -14.744 1.00 67.45  ? 343 GLN A C     1 
ATOM   2720 O  O     . GLN A 1 343 ? 58.281 34.389  -13.954 1.00 62.00  ? 343 GLN A O     1 
ATOM   2721 C  CB    . GLN A 1 343 ? 56.700 31.629  -13.874 1.00 52.55  ? 343 GLN A CB    1 
ATOM   2722 C  CG    . GLN A 1 343 ? 55.355 30.911  -13.896 1.00 54.52  ? 343 GLN A CG    1 
ATOM   2723 C  CD    . GLN A 1 343 ? 55.282 29.764  -12.905 1.00 54.55  ? 343 GLN A CD    1 
ATOM   2724 O  OE1   . GLN A 1 343 ? 55.911 28.723  -13.094 1.00 45.64  ? 343 GLN A OE1   1 
ATOM   2725 N  NE2   . GLN A 1 343 ? 54.510 29.951  -11.840 1.00 45.00  ? 343 GLN A NE2   1 
ATOM   2726 N  N     . GLU A 1 344 ? 59.178 33.001  -15.481 1.00 78.57  ? 344 GLU A N     1 
ATOM   2727 C  CA    . GLU A 1 344 ? 60.501 33.583  -15.579 1.00 76.18  ? 344 GLU A CA    1 
ATOM   2728 C  C     . GLU A 1 344 ? 60.738 34.055  -17.010 1.00 78.60  ? 344 GLU A C     1 
ATOM   2729 O  O     . GLU A 1 344 ? 60.348 33.360  -17.955 1.00 72.58  ? 344 GLU A O     1 
ATOM   2730 C  CB    . GLU A 1 344 ? 61.574 32.556  -15.176 1.00 80.00  ? 344 GLU A CB    1 
ATOM   2731 C  CG    . GLU A 1 344 ? 62.987 33.102  -15.053 1.00 99.17  ? 344 GLU A CG    1 
ATOM   2732 C  CD    . GLU A 1 344 ? 63.922 32.138  -14.349 1.00 106.69 ? 344 GLU A CD    1 
ATOM   2733 O  OE1   . GLU A 1 344 ? 63.443 31.089  -13.866 1.00 105.02 ? 344 GLU A OE1   1 
ATOM   2734 O  OE2   . GLU A 1 344 ? 65.135 32.431  -14.277 1.00 101.32 ? 344 GLU A OE2   1 
ATOM   2735 N  N     . PRO A 1 345 ? 61.345 35.226  -17.204 1.00 92.46  ? 345 PRO A N     1 
ATOM   2736 C  CA    . PRO A 1 345 ? 61.493 35.773  -18.560 1.00 92.48  ? 345 PRO A CA    1 
ATOM   2737 C  C     . PRO A 1 345 ? 62.154 34.797  -19.524 1.00 85.63  ? 345 PRO A C     1 
ATOM   2738 O  O     . PRO A 1 345 ? 63.186 34.193  -19.219 1.00 85.48  ? 345 PRO A O     1 
ATOM   2739 C  CB    . PRO A 1 345 ? 62.357 37.024  -18.343 1.00 99.93  ? 345 PRO A CB    1 
ATOM   2740 C  CG    . PRO A 1 345 ? 62.913 36.895  -16.949 1.00 96.75  ? 345 PRO A CG    1 
ATOM   2741 C  CD    . PRO A 1 345 ? 61.872 36.151  -16.188 1.00 92.88  ? 345 PRO A CD    1 
ATOM   2742 N  N     . PHE A 1 346 ? 61.535 34.645  -20.697 1.00 77.53  ? 346 PHE A N     1 
ATOM   2743 C  CA    . PHE A 1 346 ? 62.025 33.778  -21.771 1.00 80.70  ? 346 PHE A CA    1 
ATOM   2744 C  C     . PHE A 1 346 ? 62.093 32.313  -21.343 1.00 79.64  ? 346 PHE A C     1 
ATOM   2745 O  O     . PHE A 1 346 ? 62.931 31.551  -21.831 1.00 86.29  ? 346 PHE A O     1 
ATOM   2746 C  CB    . PHE A 1 346 ? 63.384 34.251  -22.297 1.00 83.94  ? 346 PHE A CB    1 
ATOM   2747 C  CG    . PHE A 1 346 ? 63.307 35.500  -23.129 1.00 96.27  ? 346 PHE A CG    1 
ATOM   2748 C  CD1   . PHE A 1 346 ? 63.036 35.426  -24.485 1.00 98.88  ? 346 PHE A CD1   1 
ATOM   2749 C  CD2   . PHE A 1 346 ? 63.500 36.747  -22.555 1.00 102.70 ? 346 PHE A CD2   1 
ATOM   2750 C  CE1   . PHE A 1 346 ? 62.961 36.572  -25.256 1.00 98.41  ? 346 PHE A CE1   1 
ATOM   2751 C  CE2   . PHE A 1 346 ? 63.427 37.898  -23.321 1.00 95.84  ? 346 PHE A CE2   1 
ATOM   2752 C  CZ    . PHE A 1 346 ? 63.157 37.809  -24.673 1.00 93.70  ? 346 PHE A CZ    1 
ATOM   2753 N  N     . LYS A 1 347 ? 61.203 31.908  -20.433 1.00 70.94  ? 347 LYS A N     1 
ATOM   2754 C  CA    . LYS A 1 347 ? 61.034 30.507  -20.034 1.00 59.64  ? 347 LYS A CA    1 
ATOM   2755 C  C     . LYS A 1 347 ? 59.539 30.206  -20.103 1.00 57.23  ? 347 LYS A C     1 
ATOM   2756 O  O     . LYS A 1 347 ? 58.845 30.183  -19.083 1.00 59.32  ? 347 LYS A O     1 
ATOM   2757 C  CB    . LYS A 1 347 ? 61.610 30.243  -18.647 1.00 57.19  ? 347 LYS A CB    1 
ATOM   2758 C  CG    . LYS A 1 347 ? 63.125 30.299  -18.577 1.00 60.85  ? 347 LYS A CG    1 
ATOM   2759 C  CD    . LYS A 1 347 ? 63.612 29.902  -17.195 1.00 68.95  ? 347 LYS A CD    1 
ATOM   2760 C  CE    . LYS A 1 347 ? 65.121 29.997  -17.083 1.00 77.05  ? 347 LYS A CE    1 
ATOM   2761 N  NZ    . LYS A 1 347 ? 65.585 29.617  -15.721 1.00 83.41  ? 347 LYS A NZ    1 
ATOM   2762 N  N     . ASN A 1 348 ? 59.050 29.975  -21.318 1.00 57.82  ? 348 ASN A N     1 
ATOM   2763 C  CA    . ASN A 1 348 ? 57.623 29.788  -21.540 1.00 47.95  ? 348 ASN A CA    1 
ATOM   2764 C  C     . ASN A 1 348 ? 57.137 28.487  -20.917 1.00 56.20  ? 348 ASN A C     1 
ATOM   2765 O  O     . ASN A 1 348 ? 57.700 27.416  -21.166 1.00 63.17  ? 348 ASN A O     1 
ATOM   2766 C  CB    . ASN A 1 348 ? 57.317 29.785  -23.037 1.00 47.90  ? 348 ASN A CB    1 
ATOM   2767 C  CG    . ASN A 1 348 ? 57.409 31.162  -23.658 1.00 52.81  ? 348 ASN A CG    1 
ATOM   2768 O  OD1   . ASN A 1 348 ? 57.771 32.134  -22.997 1.00 67.22  ? 348 ASN A OD1   1 
ATOM   2769 N  ND2   . ASN A 1 348 ? 57.083 31.251  -24.942 1.00 48.69  ? 348 ASN A ND2   1 
ATOM   2770 N  N     . LEU A 1 349 ? 56.088 28.581  -20.099 1.00 53.73  ? 349 LEU A N     1 
ATOM   2771 C  CA    . LEU A 1 349 ? 55.351 27.380  -19.727 1.00 51.40  ? 349 LEU A CA    1 
ATOM   2772 C  C     . LEU A 1 349 ? 54.555 26.853  -20.911 1.00 47.42  ? 349 LEU A C     1 
ATOM   2773 O  O     . LEU A 1 349 ? 54.441 25.637  -21.101 1.00 48.11  ? 349 LEU A O     1 
ATOM   2774 C  CB    . LEU A 1 349 ? 54.416 27.667  -18.550 1.00 45.53  ? 349 LEU A CB    1 
ATOM   2775 C  CG    . LEU A 1 349 ? 54.984 27.632  -17.131 1.00 63.02  ? 349 LEU A CG    1 
ATOM   2776 C  CD1   . LEU A 1 349 ? 55.869 28.838  -16.854 1.00 85.98  ? 349 LEU A CD1   1 
ATOM   2777 C  CD2   . LEU A 1 349 ? 53.854 27.547  -16.118 1.00 57.50  ? 349 LEU A CD2   1 
ATOM   2778 N  N     . LYS A 1 350 ? 54.024 27.756  -21.730 1.00 42.73  ? 350 LYS A N     1 
ATOM   2779 C  CA    . LYS A 1 350 ? 53.103 27.413  -22.802 1.00 48.26  ? 350 LYS A CA    1 
ATOM   2780 C  C     . LYS A 1 350 ? 52.918 28.639  -23.682 1.00 57.69  ? 350 LYS A C     1 
ATOM   2781 O  O     . LYS A 1 350 ? 53.085 29.773  -23.224 1.00 68.93  ? 350 LYS A O     1 
ATOM   2782 C  CB    . LYS A 1 350 ? 51.754 26.949  -22.234 1.00 46.17  ? 350 LYS A CB    1 
ATOM   2783 C  CG    . LYS A 1 350 ? 50.737 26.505  -23.263 1.00 46.38  ? 350 LYS A CG    1 
ATOM   2784 C  CD    . LYS A 1 350 ? 49.388 26.250  -22.620 1.00 37.97  ? 350 LYS A CD    1 
ATOM   2785 C  CE    . LYS A 1 350 ? 48.400 25.719  -23.638 1.00 48.64  ? 350 LYS A CE    1 
ATOM   2786 N  NZ    . LYS A 1 350 ? 48.322 26.609  -24.829 1.00 51.63  ? 350 LYS A NZ    1 
ATOM   2787 N  N     . THR A 1 351 ? 52.590 28.405  -24.947 1.00 49.40  ? 351 THR A N     1 
ATOM   2788 C  CA    . THR A 1 351 ? 52.182 29.467  -25.855 1.00 46.62  ? 351 THR A CA    1 
ATOM   2789 C  C     . THR A 1 351 ? 50.781 29.167  -26.378 1.00 49.69  ? 351 THR A C     1 
ATOM   2790 O  O     . THR A 1 351 ? 50.154 28.168  -26.016 1.00 46.07  ? 351 THR A O     1 
ATOM   2791 C  CB    . THR A 1 351 ? 53.172 29.631  -27.014 1.00 44.05  ? 351 THR A CB    1 
ATOM   2792 O  OG1   . THR A 1 351 ? 52.991 28.569  -27.957 1.00 44.23  ? 351 THR A OG1   1 
ATOM   2793 C  CG2   . THR A 1 351 ? 54.606 29.618  -26.504 1.00 51.88  ? 351 THR A CG2   1 
ATOM   2794 N  N     . GLY A 1 352 ? 50.289 30.049  -27.237 1.00 49.40  ? 352 GLY A N     1 
ATOM   2795 C  CA    . GLY A 1 352 ? 48.967 29.868  -27.803 1.00 39.92  ? 352 GLY A CA    1 
ATOM   2796 C  C     . GLY A 1 352 ? 48.661 30.980  -28.778 1.00 48.84  ? 352 GLY A C     1 
ATOM   2797 O  O     . GLY A 1 352 ? 49.475 31.879  -29.014 1.00 45.00  ? 352 GLY A O     1 
ATOM   2798 N  N     . LYS A 1 353 ? 47.461 30.904  -29.346 1.00 53.92  ? 353 LYS A N     1 
ATOM   2799 C  CA    . LYS A 1 353 ? 47.011 31.890  -30.314 1.00 57.99  ? 353 LYS A CA    1 
ATOM   2800 C  C     . LYS A 1 353 ? 45.502 32.046  -30.196 1.00 55.84  ? 353 LYS A C     1 
ATOM   2801 O  O     . LYS A 1 353 ? 44.797 31.141  -29.742 1.00 67.57  ? 353 LYS A O     1 
ATOM   2802 C  CB    . LYS A 1 353 ? 47.395 31.492  -31.743 1.00 60.78  ? 353 LYS A CB    1 
ATOM   2803 C  CG    . LYS A 1 353 ? 46.592 30.326  -32.286 1.00 55.92  ? 353 LYS A CG    1 
ATOM   2804 C  CD    . LYS A 1 353 ? 46.937 30.040  -33.732 1.00 60.27  ? 353 LYS A CD    1 
ATOM   2805 C  CE    . LYS A 1 353 ? 45.897 29.137  -34.363 1.00 61.85  ? 353 LYS A CE    1 
ATOM   2806 N  NZ    . LYS A 1 353 ? 44.552 29.779  -34.390 1.00 60.13  ? 353 LYS A NZ    1 
ATOM   2807 N  N     . TYR A 1 354 ? 45.016 33.213  -30.612 1.00 47.12  ? 354 TYR A N     1 
ATOM   2808 C  CA    . TYR A 1 354 ? 43.589 33.502  -30.624 1.00 52.44  ? 354 TYR A CA    1 
ATOM   2809 C  C     . TYR A 1 354 ? 43.264 34.312  -31.868 1.00 57.07  ? 354 TYR A C     1 
ATOM   2810 O  O     . TYR A 1 354 ? 43.880 35.354  -32.111 1.00 54.72  ? 354 TYR A O     1 
ATOM   2811 C  CB    . TYR A 1 354 ? 43.160 34.265  -29.363 1.00 43.85  ? 354 TYR A CB    1 
ATOM   2812 C  CG    . TYR A 1 354 ? 41.721 34.733  -29.383 1.00 45.88  ? 354 TYR A CG    1 
ATOM   2813 C  CD1   . TYR A 1 354 ? 40.681 33.857  -29.106 1.00 44.89  ? 354 TYR A CD1   1 
ATOM   2814 C  CD2   . TYR A 1 354 ? 41.405 36.056  -29.669 1.00 50.64  ? 354 TYR A CD2   1 
ATOM   2815 C  CE1   . TYR A 1 354 ? 39.364 34.282  -29.120 1.00 48.37  ? 354 TYR A CE1   1 
ATOM   2816 C  CE2   . TYR A 1 354 ? 40.093 36.490  -29.686 1.00 51.63  ? 354 TYR A CE2   1 
ATOM   2817 C  CZ    . TYR A 1 354 ? 39.077 35.600  -29.411 1.00 55.29  ? 354 TYR A CZ    1 
ATOM   2818 O  OH    . TYR A 1 354 ? 37.769 36.030  -29.428 1.00 50.60  ? 354 TYR A OH    1 
ATOM   2819 N  N     . ALA A 1 355 ? 42.296 33.827  -32.656 1.00 55.66  ? 355 ALA A N     1 
ATOM   2820 C  CA    . ALA A 1 355 ? 41.920 34.511  -33.888 1.00 57.76  ? 355 ALA A CA    1 
ATOM   2821 C  C     . ALA A 1 355 ? 40.447 34.310  -34.222 1.00 56.09  ? 355 ALA A C     1 
ATOM   2822 O  O     . ALA A 1 355 ? 40.085 34.239  -35.402 1.00 62.22  ? 355 ALA A O     1 
ATOM   2823 C  CB    . ALA A 1 355 ? 42.785 34.038  -35.061 1.00 50.81  ? 355 ALA A CB    1 
ATOM   2824 N  N     . ARG A 1 356 ? 39.589 34.217  -33.210 1.00 42.94  ? 356 ARG A N     1 
ATOM   2825 C  CA    . ARG A 1 356 ? 38.168 33.993  -33.437 1.00 56.10  ? 356 ARG A CA    1 
ATOM   2826 C  C     . ARG A 1 356 ? 37.477 35.321  -33.720 1.00 62.15  ? 356 ARG A C     1 
ATOM   2827 O  O     . ARG A 1 356 ? 37.452 36.211  -32.862 1.00 68.47  ? 356 ARG A O     1 
ATOM   2828 C  CB    . ARG A 1 356 ? 37.531 33.307  -32.232 1.00 56.56  ? 356 ARG A CB    1 
ATOM   2829 C  CG    . ARG A 1 356 ? 36.043 33.051  -32.399 1.00 45.37  ? 356 ARG A CG    1 
ATOM   2830 C  CD    . ARG A 1 356 ? 35.426 32.459  -31.145 1.00 52.09  ? 356 ARG A CD    1 
ATOM   2831 N  NE    . ARG A 1 356 ? 33.990 32.248  -31.302 1.00 65.85  ? 356 ARG A NE    1 
ATOM   2832 C  CZ    . ARG A 1 356 ? 33.190 31.804  -30.337 1.00 78.22  ? 356 ARG A CZ    1 
ATOM   2833 N  NH1   . ARG A 1 356 ? 33.686 31.523  -29.140 1.00 80.31  ? 356 ARG A NH1   1 
ATOM   2834 N  NH2   . ARG A 1 356 ? 31.895 31.642  -30.569 1.00 86.04  ? 356 ARG A NH2   1 
ATOM   2835 N  N     . MET A 1 357 ? 36.915 35.455  -34.919 1.00 63.74  ? 357 MET A N     1 
ATOM   2836 C  CA    . MET A 1 357 ? 36.143 36.643  -35.268 1.00 73.47  ? 357 MET A CA    1 
ATOM   2837 C  C     . MET A 1 357 ? 34.785 36.579  -34.583 1.00 70.02  ? 357 MET A C     1 
ATOM   2838 O  O     . MET A 1 357 ? 33.966 35.707  -34.890 1.00 73.89  ? 357 MET A O     1 
ATOM   2839 C  CB    . MET A 1 357 ? 35.987 36.754  -36.782 1.00 83.63  ? 357 MET A CB    1 
ATOM   2840 C  CG    . MET A 1 357 ? 37.223 37.272  -37.498 1.00 98.85  ? 357 MET A CG    1 
ATOM   2841 S  SD    . MET A 1 357 ? 37.744 38.891  -36.892 1.00 112.53 ? 357 MET A SD    1 
ATOM   2842 C  CE    . MET A 1 357 ? 36.219 39.821  -37.046 1.00 121.24 ? 357 MET A CE    1 
ATOM   2843 N  N     . ARG A 1 358 ? 34.545 37.499  -33.651 1.00 62.04  ? 358 ARG A N     1 
ATOM   2844 C  CA    . ARG A 1 358 ? 33.300 37.561  -32.891 1.00 55.79  ? 358 ARG A CA    1 
ATOM   2845 C  C     . ARG A 1 358 ? 32.597 38.870  -33.226 1.00 60.68  ? 358 ARG A C     1 
ATOM   2846 O  O     . ARG A 1 358 ? 33.063 39.947  -32.839 1.00 68.46  ? 358 ARG A O     1 
ATOM   2847 C  CB    . ARG A 1 358 ? 33.568 37.450  -31.391 1.00 53.42  ? 358 ARG A CB    1 
ATOM   2848 C  CG    . ARG A 1 358 ? 33.912 36.048  -30.917 1.00 59.57  ? 358 ARG A CG    1 
ATOM   2849 C  CD    . ARG A 1 358 ? 32.745 35.418  -30.169 1.00 71.82  ? 358 ARG A CD    1 
ATOM   2850 N  NE    . ARG A 1 358 ? 32.439 36.135  -28.934 1.00 82.22  ? 358 ARG A NE    1 
ATOM   2851 C  CZ    . ARG A 1 358 ? 31.470 35.794  -28.090 1.00 89.57  ? 358 ARG A CZ    1 
ATOM   2852 N  NH1   . ARG A 1 358 ? 30.706 34.741  -28.345 1.00 95.37  ? 358 ARG A NH1   1 
ATOM   2853 N  NH2   . ARG A 1 358 ? 31.265 36.505  -26.989 1.00 90.00  ? 358 ARG A NH2   1 
ATOM   2854 N  N     . GLY A 1 359 ? 31.489 38.777  -33.941 1.00 57.49  ? 359 GLY A N     1 
ATOM   2855 C  CA    . GLY A 1 359 ? 30.710 39.949  -34.282 1.00 47.31  ? 359 GLY A CA    1 
ATOM   2856 C  C     . GLY A 1 359 ? 30.928 40.390  -35.717 1.00 51.28  ? 359 GLY A C     1 
ATOM   2857 O  O     . GLY A 1 359 ? 32.012 40.232  -36.292 1.00 59.03  ? 359 GLY A O     1 
ATOM   2858 N  N     . ALA A 1 360 ? 29.873 40.949  -36.313 1.00 48.98  ? 360 ALA A N     1 
ATOM   2859 C  CA    . ALA A 1 360 ? 29.989 41.497  -37.660 1.00 46.88  ? 360 ALA A CA    1 
ATOM   2860 C  C     . ALA A 1 360 ? 30.900 42.716  -37.688 1.00 49.08  ? 360 ALA A C     1 
ATOM   2861 O  O     . ALA A 1 360 ? 31.580 42.958  -38.692 1.00 50.84  ? 360 ALA A O     1 
ATOM   2862 C  CB    . ALA A 1 360 ? 28.606 41.854  -38.203 1.00 44.60  ? 360 ALA A CB    1 
ATOM   2863 N  N     . HIS A 1 361 ? 30.931 43.485  -36.602 1.00 43.09  ? 361 HIS A N     1 
ATOM   2864 C  CA    . HIS A 1 361 ? 31.748 44.685  -36.504 1.00 42.89  ? 361 HIS A CA    1 
ATOM   2865 C  C     . HIS A 1 361 ? 32.461 44.691  -35.162 1.00 42.09  ? 361 HIS A C     1 
ATOM   2866 O  O     . HIS A 1 361 ? 31.865 44.362  -34.131 1.00 43.80  ? 361 HIS A O     1 
ATOM   2867 C  CB    . HIS A 1 361 ? 30.893 45.946  -36.656 1.00 33.86  ? 361 HIS A CB    1 
ATOM   2868 C  CG    . HIS A 1 361 ? 29.785 45.804  -37.653 1.00 34.23  ? 361 HIS A CG    1 
ATOM   2869 N  ND1   . HIS A 1 361 ? 30.014 45.667  -39.005 1.00 35.84  ? 361 HIS A ND1   1 
ATOM   2870 C  CD2   . HIS A 1 361 ? 28.441 45.767  -37.493 1.00 38.94  ? 361 HIS A CD2   1 
ATOM   2871 C  CE1   . HIS A 1 361 ? 28.859 45.556  -39.636 1.00 37.11  ? 361 HIS A CE1   1 
ATOM   2872 N  NE2   . HIS A 1 361 ? 27.889 45.614  -38.741 1.00 42.29  ? 361 HIS A NE2   1 
ATOM   2873 N  N     . THR A 1 362 ? 33.737 45.068  -35.178 1.00 41.23  ? 362 THR A N     1 
ATOM   2874 C  CA    . THR A 1 362 ? 34.547 45.058  -33.969 1.00 42.87  ? 362 THR A CA    1 
ATOM   2875 C  C     . THR A 1 362 ? 35.796 45.894  -34.204 1.00 41.02  ? 362 THR A C     1 
ATOM   2876 O  O     . THR A 1 362 ? 36.100 46.294  -35.330 1.00 39.70  ? 362 THR A O     1 
ATOM   2877 C  CB    . THR A 1 362 ? 34.925 43.629  -33.561 1.00 40.39  ? 362 THR A CB    1 
ATOM   2878 O  OG1   . THR A 1 362 ? 35.526 43.644  -32.261 1.00 56.94  ? 362 THR A OG1   1 
ATOM   2879 C  CG2   . THR A 1 362 ? 35.908 43.038  -34.558 1.00 34.60  ? 362 THR A CG2   1 
ATOM   2880 N  N     . ASN A 1 363 ? 36.518 46.155  -33.115 1.00 43.72  ? 363 ASN A N     1 
ATOM   2881 C  CA    . ASN A 1 363 ? 37.814 46.814  -33.160 1.00 49.76  ? 363 ASN A CA    1 
ATOM   2882 C  C     . ASN A 1 363 ? 38.833 45.954  -32.418 1.00 53.34  ? 363 ASN A C     1 
ATOM   2883 O  O     . ASN A 1 363 ? 38.515 44.874  -31.910 1.00 58.98  ? 363 ASN A O     1 
ATOM   2884 C  CB    . ASN A 1 363 ? 37.742 48.235  -32.579 1.00 40.09  ? 363 ASN A CB    1 
ATOM   2885 C  CG    . ASN A 1 363 ? 37.192 48.271  -31.163 1.00 40.96  ? 363 ASN A CG    1 
ATOM   2886 O  OD1   . ASN A 1 363 ? 37.590 47.486  -30.303 1.00 47.75  ? 363 ASN A OD1   1 
ATOM   2887 N  ND2   . ASN A 1 363 ? 36.269 49.193  -30.917 1.00 34.22  ? 363 ASN A ND2   1 
ATOM   2888 N  N     . ASP A 1 364 ? 40.071 46.443  -32.353 1.00 47.68  ? 364 ASP A N     1 
ATOM   2889 C  CA    . ASP A 1 364 ? 41.156 45.685  -31.742 1.00 37.13  ? 364 ASP A CA    1 
ATOM   2890 C  C     . ASP A 1 364 ? 41.125 45.706  -30.220 1.00 45.33  ? 364 ASP A C     1 
ATOM   2891 O  O     . ASP A 1 364 ? 41.857 44.932  -29.596 1.00 51.02  ? 364 ASP A O     1 
ATOM   2892 C  CB    . ASP A 1 364 ? 42.505 46.216  -32.229 1.00 38.67  ? 364 ASP A CB    1 
ATOM   2893 C  CG    . ASP A 1 364 ? 42.724 45.977  -33.708 1.00 60.32  ? 364 ASP A CG    1 
ATOM   2894 O  OD1   . ASP A 1 364 ? 41.748 45.640  -34.411 1.00 74.96  ? 364 ASP A OD1   1 
ATOM   2895 O  OD2   . ASP A 1 364 ? 43.872 46.134  -34.169 1.00 66.42  ? 364 ASP A OD2   1 
ATOM   2896 N  N     . VAL A 1 365 ? 40.314 46.568  -29.606 1.00 49.45  ? 365 VAL A N     1 
ATOM   2897 C  CA    . VAL A 1 365 ? 40.213 46.557  -28.151 1.00 51.23  ? 365 VAL A CA    1 
ATOM   2898 C  C     . VAL A 1 365 ? 39.246 45.474  -27.692 1.00 44.64  ? 365 VAL A C     1 
ATOM   2899 O  O     . VAL A 1 365 ? 39.484 44.802  -26.682 1.00 42.74  ? 365 VAL A O     1 
ATOM   2900 C  CB    . VAL A 1 365 ? 39.808 47.947  -27.628 1.00 50.79  ? 365 VAL A CB    1 
ATOM   2901 C  CG1   . VAL A 1 365 ? 39.761 47.947  -26.108 1.00 35.68  ? 365 VAL A CG1   1 
ATOM   2902 C  CG2   . VAL A 1 365 ? 40.781 48.998  -28.127 1.00 37.00  ? 365 VAL A CG2   1 
ATOM   2903 N  N     . LYS A 1 366 ? 38.142 45.288  -28.420 1.00 48.90  ? 366 LYS A N     1 
ATOM   2904 C  CA    . LYS A 1 366 ? 37.271 44.146  -28.163 1.00 33.07  ? 366 LYS A CA    1 
ATOM   2905 C  C     . LYS A 1 366 ? 38.035 42.839  -28.325 1.00 41.02  ? 366 LYS A C     1 
ATOM   2906 O  O     . LYS A 1 366 ? 37.970 41.956  -27.462 1.00 48.56  ? 366 LYS A O     1 
ATOM   2907 C  CB    . LYS A 1 366 ? 36.068 44.172  -29.105 1.00 38.29  ? 366 LYS A CB    1 
ATOM   2908 C  CG    . LYS A 1 366 ? 35.070 45.285  -28.851 1.00 47.47  ? 366 LYS A CG    1 
ATOM   2909 C  CD    . LYS A 1 366 ? 33.875 45.138  -29.781 1.00 44.96  ? 366 LYS A CD    1 
ATOM   2910 C  CE    . LYS A 1 366 ? 32.855 46.239  -29.569 1.00 49.62  ? 366 LYS A CE    1 
ATOM   2911 N  NZ    . LYS A 1 366 ? 31.697 46.093  -30.494 1.00 48.30  ? 366 LYS A NZ    1 
ATOM   2912 N  N     . GLN A 1 367 ? 38.774 42.705  -29.429 1.00 40.36  ? 367 GLN A N     1 
ATOM   2913 C  CA    . GLN A 1 367 ? 39.494 41.464  -29.701 1.00 49.22  ? 367 GLN A CA    1 
ATOM   2914 C  C     . GLN A 1 367 ? 40.547 41.186  -28.638 1.00 49.96  ? 367 GLN A C     1 
ATOM   2915 O  O     . GLN A 1 367 ? 40.798 40.026  -28.292 1.00 62.87  ? 367 GLN A O     1 
ATOM   2916 C  CB    . GLN A 1 367 ? 40.132 41.518  -31.087 1.00 45.28  ? 367 GLN A CB    1 
ATOM   2917 C  CG    . GLN A 1 367 ? 39.130 41.563  -32.225 1.00 39.60  ? 367 GLN A CG    1 
ATOM   2918 C  CD    . GLN A 1 367 ? 39.799 41.567  -33.584 1.00 46.18  ? 367 GLN A CD    1 
ATOM   2919 O  OE1   . GLN A 1 367 ? 41.021 41.671  -33.684 1.00 52.14  ? 367 GLN A OE1   1 
ATOM   2920 N  NE2   . GLN A 1 367 ? 39.001 41.452  -34.637 1.00 55.57  ? 367 GLN A NE2   1 
ATOM   2921 N  N     . LEU A 1 368 ? 41.180 42.235  -28.112 1.00 40.07  ? 368 LEU A N     1 
ATOM   2922 C  CA    . LEU A 1 368 ? 42.122 42.042  -27.015 1.00 40.09  ? 368 LEU A CA    1 
ATOM   2923 C  C     . LEU A 1 368 ? 41.400 41.604  -25.747 1.00 47.41  ? 368 LEU A C     1 
ATOM   2924 O  O     . LEU A 1 368 ? 41.877 40.720  -25.027 1.00 54.05  ? 368 LEU A O     1 
ATOM   2925 C  CB    . LEU A 1 368 ? 42.915 43.324  -26.772 1.00 36.61  ? 368 LEU A CB    1 
ATOM   2926 C  CG    . LEU A 1 368 ? 43.959 43.281  -25.655 1.00 37.39  ? 368 LEU A CG    1 
ATOM   2927 C  CD1   . LEU A 1 368 ? 45.016 42.221  -25.930 1.00 38.03  ? 368 LEU A CD1   1 
ATOM   2928 C  CD2   . LEU A 1 368 ? 44.600 44.643  -25.489 1.00 38.51  ? 368 LEU A CD2   1 
ATOM   2929 N  N     . THR A 1 369 ? 40.242 42.207  -25.464 1.00 54.20  ? 369 THR A N     1 
ATOM   2930 C  CA    . THR A 1 369 ? 39.452 41.795  -24.308 1.00 49.75  ? 369 THR A CA    1 
ATOM   2931 C  C     . THR A 1 369 ? 39.008 40.344  -24.438 1.00 41.53  ? 369 THR A C     1 
ATOM   2932 O  O     . THR A 1 369 ? 38.968 39.607  -23.446 1.00 42.93  ? 369 THR A O     1 
ATOM   2933 C  CB    . THR A 1 369 ? 38.239 42.713  -24.145 1.00 42.07  ? 369 THR A CB    1 
ATOM   2934 O  OG1   . THR A 1 369 ? 38.671 44.079  -24.115 1.00 39.31  ? 369 THR A OG1   1 
ATOM   2935 C  CG2   . THR A 1 369 ? 37.494 42.397  -22.855 1.00 45.15  ? 369 THR A CG2   1 
ATOM   2936 N  N     . GLU A 1 370 ? 38.681 39.913  -25.658 1.00 39.30  ? 370 GLU A N     1 
ATOM   2937 C  CA    . GLU A 1 370 ? 38.255 38.533  -25.871 1.00 34.90  ? 370 GLU A CA    1 
ATOM   2938 C  C     . GLU A 1 370 ? 39.415 37.561  -25.692 1.00 44.40  ? 370 GLU A C     1 
ATOM   2939 O  O     . GLU A 1 370 ? 39.234 36.463  -25.152 1.00 32.46  ? 370 GLU A O     1 
ATOM   2940 C  CB    . GLU A 1 370 ? 37.640 38.388  -27.262 1.00 33.08  ? 370 GLU A CB    1 
ATOM   2941 C  CG    . GLU A 1 370 ? 36.377 39.203  -27.464 1.00 39.87  ? 370 GLU A CG    1 
ATOM   2942 C  CD    . GLU A 1 370 ? 36.042 39.400  -28.928 1.00 58.22  ? 370 GLU A CD    1 
ATOM   2943 O  OE1   . GLU A 1 370 ? 35.252 40.319  -29.237 1.00 71.43  ? 370 GLU A OE1   1 
ATOM   2944 O  OE2   . GLU A 1 370 ? 36.572 38.643  -29.768 1.00 58.97  ? 370 GLU A OE2   1 
ATOM   2945 N  N     . ALA A 1 371 ? 40.612 37.942  -26.142 1.00 53.91  ? 371 ALA A N     1 
ATOM   2946 C  CA    . ALA A 1 371 ? 41.777 37.086  -25.948 1.00 37.71  ? 371 ALA A CA    1 
ATOM   2947 C  C     . ALA A 1 371 ? 42.128 36.960  -24.472 1.00 43.82  ? 371 ALA A C     1 
ATOM   2948 O  O     . ALA A 1 371 ? 42.548 35.890  -24.018 1.00 55.37  ? 371 ALA A O     1 
ATOM   2949 C  CB    . ALA A 1 371 ? 42.966 37.628  -26.740 1.00 35.25  ? 371 ALA A CB    1 
ATOM   2950 N  N     . VAL A 1 372 ? 41.962 38.042  -23.706 1.00 45.84  ? 372 VAL A N     1 
ATOM   2951 C  CA    . VAL A 1 372 ? 42.244 37.987  -22.274 1.00 42.03  ? 372 VAL A CA    1 
ATOM   2952 C  C     . VAL A 1 372 ? 41.286 37.029  -21.579 1.00 45.41  ? 372 VAL A C     1 
ATOM   2953 O  O     . VAL A 1 372 ? 41.681 36.267  -20.688 1.00 50.18  ? 372 VAL A O     1 
ATOM   2954 C  CB    . VAL A 1 372 ? 42.184 39.400  -21.663 1.00 34.71  ? 372 VAL A CB    1 
ATOM   2955 C  CG1   . VAL A 1 372 ? 42.207 39.327  -20.147 1.00 34.93  ? 372 VAL A CG1   1 
ATOM   2956 C  CG2   . VAL A 1 372 ? 43.345 40.245  -22.168 1.00 35.80  ? 372 VAL A CG2   1 
ATOM   2957 N  N     . GLN A 1 373 ? 40.014 37.040  -21.984 1.00 48.07  ? 373 GLN A N     1 
ATOM   2958 C  CA    . GLN A 1 373 ? 39.045 36.126  -21.390 1.00 50.51  ? 373 GLN A CA    1 
ATOM   2959 C  C     . GLN A 1 373 ? 39.350 34.679  -21.759 1.00 47.20  ? 373 GLN A C     1 
ATOM   2960 O  O     . GLN A 1 373 ? 39.279 33.788  -20.904 1.00 32.02  ? 373 GLN A O     1 
ATOM   2961 C  CB    . GLN A 1 373 ? 37.633 36.510  -21.824 1.00 49.96  ? 373 GLN A CB    1 
ATOM   2962 C  CG    . GLN A 1 373 ? 37.219 37.894  -21.365 1.00 71.25  ? 373 GLN A CG    1 
ATOM   2963 C  CD    . GLN A 1 373 ? 36.032 38.434  -22.133 1.00 86.71  ? 373 GLN A CD    1 
ATOM   2964 O  OE1   . GLN A 1 373 ? 35.789 39.640  -22.154 1.00 94.14  ? 373 GLN A OE1   1 
ATOM   2965 N  NE2   . GLN A 1 373 ? 35.282 37.543  -22.769 1.00 92.44  ? 373 GLN A NE2   1 
ATOM   2966 N  N     . LYS A 1 374 ? 39.693 34.425  -23.025 1.00 32.26  ? 374 LYS A N     1 
ATOM   2967 C  CA    . LYS A 1 374 ? 40.021 33.065  -23.441 1.00 36.94  ? 374 LYS A CA    1 
ATOM   2968 C  C     . LYS A 1 374 ? 41.223 32.532  -22.673 1.00 44.35  ? 374 LYS A C     1 
ATOM   2969 O  O     . LYS A 1 374 ? 41.217 31.384  -22.213 1.00 46.94  ? 374 LYS A O     1 
ATOM   2970 C  CB    . LYS A 1 374 ? 40.288 33.026  -24.947 1.00 36.23  ? 374 LYS A CB    1 
ATOM   2971 C  CG    . LYS A 1 374 ? 40.292 31.626  -25.538 1.00 46.27  ? 374 LYS A CG    1 
ATOM   2972 C  CD    . LYS A 1 374 ? 38.911 30.990  -25.439 1.00 56.90  ? 374 LYS A CD    1 
ATOM   2973 C  CE    . LYS A 1 374 ? 38.928 29.538  -25.889 1.00 55.09  ? 374 LYS A CE    1 
ATOM   2974 N  NZ    . LYS A 1 374 ? 39.758 28.688  -24.993 1.00 56.79  ? 374 LYS A NZ    1 
ATOM   2975 N  N     . ILE A 1 375 ? 42.258 33.360  -22.511 1.00 39.71  ? 375 ILE A N     1 
ATOM   2976 C  CA    . ILE A 1 375 ? 43.453 32.938  -21.788 1.00 44.54  ? 375 ILE A CA    1 
ATOM   2977 C  C     . ILE A 1 375 ? 43.145 32.728  -20.311 1.00 47.36  ? 375 ILE A C     1 
ATOM   2978 O  O     . ILE A 1 375 ? 43.668 31.800  -19.680 1.00 48.88  ? 375 ILE A O     1 
ATOM   2979 C  CB    . ILE A 1 375 ? 44.580 33.966  -21.996 1.00 35.06  ? 375 ILE A CB    1 
ATOM   2980 C  CG1   . ILE A 1 375 ? 45.030 33.968  -23.455 1.00 35.53  ? 375 ILE A CG1   1 
ATOM   2981 C  CG2   . ILE A 1 375 ? 45.754 33.687  -21.067 1.00 35.87  ? 375 ILE A CG2   1 
ATOM   2982 C  CD1   . ILE A 1 375 ? 45.837 35.176  -23.821 1.00 36.48  ? 375 ILE A CD1   1 
ATOM   2983 N  N     . THR A 1 376 ? 42.291 33.578  -19.735 1.00 47.20  ? 376 THR A N     1 
ATOM   2984 C  CA    . THR A 1 376 ? 41.963 33.451  -18.318 1.00 40.46  ? 376 THR A CA    1 
ATOM   2985 C  C     . THR A 1 376 ? 41.272 32.124  -18.031 1.00 40.12  ? 376 THR A C     1 
ATOM   2986 O  O     . THR A 1 376 ? 41.669 31.390  -17.120 1.00 38.08  ? 376 THR A O     1 
ATOM   2987 C  CB    . THR A 1 376 ? 41.084 34.621  -17.870 1.00 34.06  ? 376 THR A CB    1 
ATOM   2988 O  OG1   . THR A 1 376 ? 41.829 35.841  -17.958 1.00 38.49  ? 376 THR A OG1   1 
ATOM   2989 C  CG2   . THR A 1 376 ? 40.623 34.420  -16.435 1.00 33.62  ? 376 THR A CG2   1 
ATOM   2990 N  N     . THR A 1 377 ? 40.230 31.801  -18.802 1.00 47.29  ? 377 THR A N     1 
ATOM   2991 C  CA    . THR A 1 377 ? 39.543 30.525  -18.621 1.00 45.96  ? 377 THR A CA    1 
ATOM   2992 C  C     . THR A 1 377 ? 40.480 29.355  -18.895 1.00 42.70  ? 377 THR A C     1 
ATOM   2993 O  O     . THR A 1 377 ? 40.449 28.342  -18.186 1.00 32.28  ? 377 THR A O     1 
ATOM   2994 C  CB    . THR A 1 377 ? 38.317 30.456  -19.532 1.00 37.15  ? 377 THR A CB    1 
ATOM   2995 O  OG1   . THR A 1 377 ? 37.418 31.522  -19.206 1.00 48.30  ? 377 THR A OG1   1 
ATOM   2996 C  CG2   . THR A 1 377 ? 37.598 29.125  -19.367 1.00 39.85  ? 377 THR A CG2   1 
ATOM   2997 N  N     . GLU A 1 378 ? 41.327 29.484  -19.917 1.00 34.64  ? 378 GLU A N     1 
ATOM   2998 C  CA    . GLU A 1 378 ? 42.286 28.433  -20.234 1.00 32.94  ? 378 GLU A CA    1 
ATOM   2999 C  C     . GLU A 1 378 ? 43.294 28.245  -19.106 1.00 42.29  ? 378 GLU A C     1 
ATOM   3000 O  O     . GLU A 1 378 ? 43.685 27.114  -18.794 1.00 48.47  ? 378 GLU A O     1 
ATOM   3001 C  CB    . GLU A 1 378 ? 42.991 28.772  -21.548 1.00 33.40  ? 378 GLU A CB    1 
ATOM   3002 C  CG    . GLU A 1 378 ? 44.007 27.760  -22.029 1.00 70.86  ? 378 GLU A CG    1 
ATOM   3003 C  CD    . GLU A 1 378 ? 44.591 28.152  -23.372 1.00 72.44  ? 378 GLU A CD    1 
ATOM   3004 O  OE1   . GLU A 1 378 ? 43.999 29.032  -24.037 1.00 53.28  ? 378 GLU A OE1   1 
ATOM   3005 O  OE2   . GLU A 1 378 ? 45.638 27.591  -23.760 1.00 65.11  ? 378 GLU A OE2   1 
ATOM   3006 N  N     . SER A 1 379 ? 43.718 29.344  -18.477 1.00 42.40  ? 379 SER A N     1 
ATOM   3007 C  CA    . SER A 1 379 ? 44.668 29.248  -17.373 1.00 40.08  ? 379 SER A CA    1 
ATOM   3008 C  C     . SER A 1 379 ? 44.035 28.632  -16.133 1.00 44.69  ? 379 SER A C     1 
ATOM   3009 O  O     . SER A 1 379 ? 44.713 27.923  -15.381 1.00 50.26  ? 379 SER A O     1 
ATOM   3010 C  CB    . SER A 1 379 ? 45.232 30.629  -17.037 1.00 35.17  ? 379 SER A CB    1 
ATOM   3011 O  OG    . SER A 1 379 ? 45.876 31.211  -18.156 1.00 58.54  ? 379 SER A OG    1 
ATOM   3012 N  N     . ILE A 1 380 ? 42.747 28.898  -15.895 1.00 35.92  ? 380 ILE A N     1 
ATOM   3013 C  CA    . ILE A 1 380 ? 42.081 28.320  -14.732 1.00 33.65  ? 380 ILE A CA    1 
ATOM   3014 C  C     . ILE A 1 380 ? 41.995 26.806  -14.862 1.00 49.00  ? 380 ILE A C     1 
ATOM   3015 O  O     . ILE A 1 380 ? 42.099 26.081  -13.865 1.00 53.77  ? 380 ILE A O     1 
ATOM   3016 C  CB    . ILE A 1 380 ? 40.692 28.963  -14.539 1.00 38.68  ? 380 ILE A CB    1 
ATOM   3017 C  CG1   . ILE A 1 380 ? 40.842 30.440  -14.168 1.00 41.82  ? 380 ILE A CG1   1 
ATOM   3018 C  CG2   . ILE A 1 380 ? 39.897 28.231  -13.467 1.00 35.49  ? 380 ILE A CG2   1 
ATOM   3019 C  CD1   . ILE A 1 380 ? 39.527 31.174  -14.025 1.00 41.07  ? 380 ILE A CD1   1 
ATOM   3020 N  N     . VAL A 1 381 ? 41.829 26.300  -16.085 1.00 46.80  ? 381 VAL A N     1 
ATOM   3021 C  CA    . VAL A 1 381 ? 41.782 24.856  -16.287 1.00 36.35  ? 381 VAL A CA    1 
ATOM   3022 C  C     . VAL A 1 381 ? 43.138 24.230  -15.981 1.00 43.57  ? 381 VAL A C     1 
ATOM   3023 O  O     . VAL A 1 381 ? 43.226 23.210  -15.288 1.00 45.90  ? 381 VAL A O     1 
ATOM   3024 C  CB    . VAL A 1 381 ? 41.322 24.526  -17.719 1.00 33.44  ? 381 VAL A CB    1 
ATOM   3025 C  CG1   . VAL A 1 381 ? 41.455 23.037  -17.988 1.00 32.70  ? 381 VAL A CG1   1 
ATOM   3026 C  CG2   . VAL A 1 381 ? 39.890 24.979  -17.931 1.00 32.16  ? 381 VAL A CG2   1 
ATOM   3027 N  N     . ILE A 1 382 ? 44.215 24.840  -16.478 1.00 39.67  ? 382 ILE A N     1 
ATOM   3028 C  CA    . ILE A 1 382 ? 45.530 24.213  -16.384 1.00 35.58  ? 382 ILE A CA    1 
ATOM   3029 C  C     . ILE A 1 382 ? 46.157 24.442  -15.013 1.00 35.10  ? 382 ILE A C     1 
ATOM   3030 O  O     . ILE A 1 382 ? 46.734 23.522  -14.423 1.00 47.56  ? 382 ILE A O     1 
ATOM   3031 C  CB    . ILE A 1 382 ? 46.437 24.721  -17.519 1.00 35.02  ? 382 ILE A CB    1 
ATOM   3032 C  CG1   . ILE A 1 382 ? 45.835 24.361  -18.879 1.00 34.64  ? 382 ILE A CG1   1 
ATOM   3033 C  CG2   . ILE A 1 382 ? 47.839 24.149  -17.385 1.00 35.90  ? 382 ILE A CG2   1 
ATOM   3034 C  CD1   . ILE A 1 382 ? 46.700 24.751  -20.056 1.00 51.62  ? 382 ILE A CD1   1 
ATOM   3035 N  N     . TRP A 1 383 ? 46.054 25.660  -14.478 1.00 40.43  ? 383 TRP A N     1 
ATOM   3036 C  CA    . TRP A 1 383 ? 46.739 26.013  -13.243 1.00 36.16  ? 383 TRP A CA    1 
ATOM   3037 C  C     . TRP A 1 383 ? 45.817 26.398  -12.096 1.00 42.59  ? 383 TRP A C     1 
ATOM   3038 O  O     . TRP A 1 383 ? 46.302 26.568  -10.972 1.00 46.00  ? 383 TRP A O     1 
ATOM   3039 C  CB    . TRP A 1 383 ? 47.722 27.168  -13.491 1.00 41.10  ? 383 TRP A CB    1 
ATOM   3040 C  CG    . TRP A 1 383 ? 48.738 26.874  -14.551 1.00 44.98  ? 383 TRP A CG    1 
ATOM   3041 C  CD1   . TRP A 1 383 ? 49.803 26.028  -14.453 1.00 41.33  ? 383 TRP A CD1   1 
ATOM   3042 C  CD2   . TRP A 1 383 ? 48.791 27.434  -15.868 1.00 37.29  ? 383 TRP A CD2   1 
ATOM   3043 N  NE1   . TRP A 1 383 ? 50.514 26.022  -15.628 1.00 42.34  ? 383 TRP A NE1   1 
ATOM   3044 C  CE2   . TRP A 1 383 ? 49.913 26.877  -16.513 1.00 45.46  ? 383 TRP A CE2   1 
ATOM   3045 C  CE3   . TRP A 1 383 ? 47.997 28.348  -16.565 1.00 36.75  ? 383 TRP A CE3   1 
ATOM   3046 C  CZ2   . TRP A 1 383 ? 50.261 27.206  -17.822 1.00 44.30  ? 383 TRP A CZ2   1 
ATOM   3047 C  CZ3   . TRP A 1 383 ? 48.344 28.672  -17.864 1.00 36.95  ? 383 TRP A CZ3   1 
ATOM   3048 C  CH2   . TRP A 1 383 ? 49.466 28.104  -18.478 1.00 37.76  ? 383 TRP A CH2   1 
ATOM   3049 N  N     . GLY A 1 384 ? 44.516 26.547  -12.335 1.00 54.89  ? 384 GLY A N     1 
ATOM   3050 C  CA    . GLY A 1 384 ? 43.611 26.879  -11.254 1.00 51.17  ? 384 GLY A CA    1 
ATOM   3051 C  C     . GLY A 1 384 ? 43.669 28.309  -10.772 1.00 44.73  ? 384 GLY A C     1 
ATOM   3052 O  O     . GLY A 1 384 ? 43.061 28.625  -9.745  1.00 49.27  ? 384 GLY A O     1 
ATOM   3053 N  N     . LYS A 1 385 ? 44.382 29.188  -11.473 1.00 36.28  ? 385 LYS A N     1 
ATOM   3054 C  CA    . LYS A 1 385 ? 44.444 30.590  -11.091 1.00 36.94  ? 385 LYS A CA    1 
ATOM   3055 C  C     . LYS A 1 385 ? 44.527 31.441  -12.348 1.00 51.54  ? 385 LYS A C     1 
ATOM   3056 O  O     . LYS A 1 385 ? 44.666 30.934  -13.465 1.00 61.30  ? 385 LYS A O     1 
ATOM   3057 C  CB    . LYS A 1 385 ? 45.629 30.872  -10.158 1.00 41.35  ? 385 LYS A CB    1 
ATOM   3058 C  CG    . LYS A 1 385 ? 46.986 30.500  -10.730 1.00 38.74  ? 385 LYS A CG    1 
ATOM   3059 C  CD    . LYS A 1 385 ? 48.120 31.024  -9.859  1.00 40.31  ? 385 LYS A CD    1 
ATOM   3060 C  CE    . LYS A 1 385 ? 48.231 32.539  -9.937  1.00 74.02  ? 385 LYS A CE    1 
ATOM   3061 N  NZ    . LYS A 1 385 ? 49.391 33.055  -9.157  1.00 80.14  ? 385 LYS A NZ    1 
ATOM   3062 N  N     . THR A 1 386 ? 44.444 32.728  -12.152 1.00 51.38  ? 386 THR A N     1 
ATOM   3063 C  CA    . THR A 1 386 ? 44.453 33.727  -13.209 1.00 43.41  ? 386 THR A CA    1 
ATOM   3064 C  C     . THR A 1 386 ? 45.847 34.322  -13.368 1.00 45.03  ? 386 THR A C     1 
ATOM   3065 O  O     . THR A 1 386 ? 46.514 34.614  -12.370 1.00 53.11  ? 386 THR A O     1 
ATOM   3066 C  CB    . THR A 1 386 ? 43.455 34.844  -12.889 1.00 48.59  ? 386 THR A CB    1 
ATOM   3067 O  OG1   . THR A 1 386 ? 42.143 34.284  -12.754 1.00 37.59  ? 386 THR A OG1   1 
ATOM   3068 C  CG2   . THR A 1 386 ? 43.440 35.890  -13.991 1.00 59.80  ? 386 THR A CG2   1 
ATOM   3069 N  N     . PRO A 1 387 ? 46.323 34.496  -14.598 1.00 39.99  ? 387 PRO A N     1 
ATOM   3070 C  CA    . PRO A 1 387 ? 47.643 35.096  -14.806 1.00 39.14  ? 387 PRO A CA    1 
ATOM   3071 C  C     . PRO A 1 387 ? 47.605 36.614  -14.861 1.00 45.55  ? 387 PRO A C     1 
ATOM   3072 O  O     . PRO A 1 387 ? 46.615 37.233  -15.255 1.00 44.75  ? 387 PRO A O     1 
ATOM   3073 C  CB    . PRO A 1 387 ? 48.065 34.520  -16.164 1.00 45.44  ? 387 PRO A CB    1 
ATOM   3074 C  CG    . PRO A 1 387 ? 46.779 34.366  -16.894 1.00 43.50  ? 387 PRO A CG    1 
ATOM   3075 C  CD    . PRO A 1 387 ? 45.755 33.973  -15.854 1.00 42.22  ? 387 PRO A CD    1 
ATOM   3076 N  N     . LYS A 1 388 ? 48.720 37.211  -14.445 1.00 47.35  ? 388 LYS A N     1 
ATOM   3077 C  CA    . LYS A 1 388 ? 48.934 38.632  -14.674 1.00 42.16  ? 388 LYS A CA    1 
ATOM   3078 C  C     . LYS A 1 388 ? 49.306 38.855  -16.134 1.00 43.80  ? 388 LYS A C     1 
ATOM   3079 O  O     . LYS A 1 388 ? 50.040 38.064  -16.730 1.00 63.72  ? 388 LYS A O     1 
ATOM   3080 C  CB    . LYS A 1 388 ? 50.032 39.164  -13.756 1.00 47.65  ? 388 LYS A CB    1 
ATOM   3081 C  CG    . LYS A 1 388 ? 49.758 38.946  -12.279 1.00 55.48  ? 388 LYS A CG    1 
ATOM   3082 C  CD    . LYS A 1 388 ? 50.815 39.612  -11.417 1.00 63.59  ? 388 LYS A CD    1 
ATOM   3083 C  CE    . LYS A 1 388 ? 50.472 39.499  -9.943  1.00 74.67  ? 388 LYS A CE    1 
ATOM   3084 N  NZ    . LYS A 1 388 ? 51.421 40.268  -9.092  1.00 87.84  ? 388 LYS A NZ    1 
ATOM   3085 N  N     . PHE A 1 389 ? 48.792 39.930  -16.716 1.00 43.98  ? 389 PHE A N     1 
ATOM   3086 C  CA    . PHE A 1 389 ? 48.891 40.134  -18.151 1.00 48.18  ? 389 PHE A CA    1 
ATOM   3087 C  C     . PHE A 1 389 ? 49.918 41.205  -18.498 1.00 47.53  ? 389 PHE A C     1 
ATOM   3088 O  O     . PHE A 1 389 ? 50.243 42.085  -17.694 1.00 44.41  ? 389 PHE A O     1 
ATOM   3089 C  CB    . PHE A 1 389 ? 47.526 40.499  -18.744 1.00 43.22  ? 389 PHE A CB    1 
ATOM   3090 C  CG    . PHE A 1 389 ? 46.604 39.322  -18.905 1.00 42.16  ? 389 PHE A CG    1 
ATOM   3091 C  CD1   . PHE A 1 389 ? 45.825 38.885  -17.848 1.00 42.00  ? 389 PHE A CD1   1 
ATOM   3092 C  CD2   . PHE A 1 389 ? 46.521 38.650  -20.114 1.00 38.16  ? 389 PHE A CD2   1 
ATOM   3093 C  CE1   . PHE A 1 389 ? 44.978 37.799  -17.993 1.00 44.01  ? 389 PHE A CE1   1 
ATOM   3094 C  CE2   . PHE A 1 389 ? 45.675 37.566  -20.265 1.00 48.10  ? 389 PHE A CE2   1 
ATOM   3095 C  CZ    . PHE A 1 389 ? 44.903 37.140  -19.203 1.00 36.36  ? 389 PHE A CZ    1 
ATOM   3096 N  N     . LYS A 1 390 ? 50.435 41.098  -19.720 1.00 43.55  ? 390 LYS A N     1 
ATOM   3097 C  CA    . LYS A 1 390 ? 51.342 42.078  -20.315 1.00 48.33  ? 390 LYS A CA    1 
ATOM   3098 C  C     . LYS A 1 390 ? 50.738 42.450  -21.666 1.00 59.11  ? 390 LYS A C     1 
ATOM   3099 O  O     . LYS A 1 390 ? 50.954 41.749  -22.659 1.00 70.13  ? 390 LYS A O     1 
ATOM   3100 C  CB    . LYS A 1 390 ? 52.752 41.514  -20.468 1.00 51.49  ? 390 LYS A CB    1 
ATOM   3101 C  CG    . LYS A 1 390 ? 53.773 42.045  -19.474 1.00 54.75  ? 390 LYS A CG    1 
ATOM   3102 C  CD    . LYS A 1 390 ? 53.437 41.666  -18.044 1.00 60.34  ? 390 LYS A CD    1 
ATOM   3103 C  CE    . LYS A 1 390 ? 54.511 42.162  -17.089 1.00 71.43  ? 390 LYS A CE    1 
ATOM   3104 N  NZ    . LYS A 1 390 ? 54.099 42.041  -15.663 1.00 82.83  ? 390 LYS A NZ    1 
ATOM   3105 N  N     . LEU A 1 391 ? 49.979 43.548  -21.704 1.00 54.50  ? 391 LEU A N     1 
ATOM   3106 C  CA    . LEU A 1 391 ? 49.213 43.852  -22.902 1.00 53.54  ? 391 LEU A CA    1 
ATOM   3107 C  C     . LEU A 1 391 ? 49.828 45.013  -23.674 1.00 62.78  ? 391 LEU A C     1 
ATOM   3108 O  O     . LEU A 1 391 ? 50.280 45.991  -23.070 1.00 74.78  ? 391 LEU A O     1 
ATOM   3109 C  CB    . LEU A 1 391 ? 47.762 44.197  -22.551 1.00 53.49  ? 391 LEU A CB    1 
ATOM   3110 C  CG    . LEU A 1 391 ? 46.976 43.138  -21.776 1.00 49.53  ? 391 LEU A CG    1 
ATOM   3111 C  CD1   . LEU A 1 391 ? 45.533 43.580  -21.598 1.00 39.16  ? 391 LEU A CD1   1 
ATOM   3112 C  CD2   . LEU A 1 391 ? 47.049 41.787  -22.472 1.00 39.76  ? 391 LEU A CD2   1 
ATOM   3113 N  N     . PRO A 1 392 ? 49.848 44.935  -25.010 1.00 49.07  ? 392 PRO A N     1 
ATOM   3114 C  CA    . PRO A 1 392 ? 50.386 46.011  -25.851 1.00 45.93  ? 392 PRO A CA    1 
ATOM   3115 C  C     . PRO A 1 392 ? 49.397 47.153  -26.082 1.00 56.35  ? 392 PRO A C     1 
ATOM   3116 O  O     . PRO A 1 392 ? 49.199 47.611  -27.208 1.00 60.57  ? 392 PRO A O     1 
ATOM   3117 C  CB    . PRO A 1 392 ? 50.722 45.281  -27.155 1.00 61.84  ? 392 PRO A CB    1 
ATOM   3118 C  CG    . PRO A 1 392 ? 49.696 44.201  -27.230 1.00 44.31  ? 392 PRO A CG    1 
ATOM   3119 C  CD    . PRO A 1 392 ? 49.419 43.774  -25.808 1.00 43.51  ? 392 PRO A CD    1 
ATOM   3120 N  N     . ILE A 1 393 ? 48.767 47.612  -25.004 1.00 54.25  ? 393 ILE A N     1 
ATOM   3121 C  CA    . ILE A 1 393 ? 47.801 48.702  -25.057 1.00 51.83  ? 393 ILE A CA    1 
ATOM   3122 C  C     . ILE A 1 393 ? 48.107 49.663  -23.917 1.00 57.61  ? 393 ILE A C     1 
ATOM   3123 O  O     . ILE A 1 393 ? 48.410 49.238  -22.797 1.00 64.38  ? 393 ILE A O     1 
ATOM   3124 C  CB    . ILE A 1 393 ? 46.349 48.178  -24.982 1.00 52.87  ? 393 ILE A CB    1 
ATOM   3125 C  CG1   . ILE A 1 393 ? 45.346 49.329  -25.068 1.00 55.68  ? 393 ILE A CG1   1 
ATOM   3126 C  CG2   . ILE A 1 393 ? 46.128 47.359  -23.717 1.00 41.45  ? 393 ILE A CG2   1 
ATOM   3127 C  CD1   . ILE A 1 393 ? 43.902 48.876  -25.061 1.00 39.80  ? 393 ILE A CD1   1 
ATOM   3128 N  N     . GLN A 1 394 ? 48.054 50.961  -24.206 1.00 63.65  ? 394 GLN A N     1 
ATOM   3129 C  CA    . GLN A 1 394 ? 48.383 51.951  -23.192 1.00 65.72  ? 394 GLN A CA    1 
ATOM   3130 C  C     . GLN A 1 394 ? 47.262 52.067  -22.167 1.00 55.47  ? 394 GLN A C     1 
ATOM   3131 O  O     . GLN A 1 394 ? 46.081 51.892  -22.480 1.00 53.70  ? 394 GLN A O     1 
ATOM   3132 C  CB    . GLN A 1 394 ? 48.655 53.311  -23.835 1.00 73.19  ? 394 GLN A CB    1 
ATOM   3133 C  CG    . GLN A 1 394 ? 49.895 53.336  -24.716 1.00 87.17  ? 394 GLN A CG    1 
ATOM   3134 C  CD    . GLN A 1 394 ? 50.273 54.736  -25.158 1.00 103.95 ? 394 GLN A CD    1 
ATOM   3135 O  OE1   . GLN A 1 394 ? 49.848 55.725  -24.561 1.00 114.19 ? 394 GLN A OE1   1 
ATOM   3136 N  NE2   . GLN A 1 394 ? 51.077 54.826  -26.211 1.00 103.36 ? 394 GLN A NE2   1 
ATOM   3137 N  N     . LYS A 1 395 ? 47.654 52.354  -20.922 1.00 50.44  ? 395 LYS A N     1 
ATOM   3138 C  CA    . LYS A 1 395 ? 46.678 52.526  -19.850 1.00 52.85  ? 395 LYS A CA    1 
ATOM   3139 C  C     . LYS A 1 395 ? 45.654 53.596  -20.201 1.00 70.52  ? 395 LYS A C     1 
ATOM   3140 O  O     . LYS A 1 395 ? 44.474 53.476  -19.851 1.00 72.35  ? 395 LYS A O     1 
ATOM   3141 C  CB    . LYS A 1 395 ? 47.392 52.878  -18.544 1.00 48.38  ? 395 LYS A CB    1 
ATOM   3142 C  CG    . LYS A 1 395 ? 48.053 51.701  -17.848 1.00 58.72  ? 395 LYS A CG    1 
ATOM   3143 C  CD    . LYS A 1 395 ? 47.011 50.738  -17.306 1.00 63.27  ? 395 LYS A CD    1 
ATOM   3144 C  CE    . LYS A 1 395 ? 47.629 49.706  -16.379 1.00 55.46  ? 395 LYS A CE    1 
ATOM   3145 N  NZ    . LYS A 1 395 ? 46.584 48.905  -15.682 1.00 59.12  ? 395 LYS A NZ    1 
ATOM   3146 N  N     . GLU A 1 396 ? 46.086 54.645  -20.904 1.00 77.91  ? 396 GLU A N     1 
ATOM   3147 C  CA    . GLU A 1 396 ? 45.161 55.702  -21.301 1.00 79.89  ? 396 GLU A CA    1 
ATOM   3148 C  C     . GLU A 1 396 ? 44.177 55.206  -22.353 1.00 67.61  ? 396 GLU A C     1 
ATOM   3149 O  O     . GLU A 1 396 ? 42.991 55.556  -22.314 1.00 66.44  ? 396 GLU A O     1 
ATOM   3150 C  CB    . GLU A 1 396 ? 45.936 56.912  -21.822 1.00 98.60  ? 396 GLU A CB    1 
ATOM   3151 C  CG    . GLU A 1 396 ? 47.310 57.100  -21.191 1.00 122.27 ? 396 GLU A CG    1 
ATOM   3152 C  CD    . GLU A 1 396 ? 47.251 57.354  -19.696 1.00 131.06 ? 396 GLU A CD    1 
ATOM   3153 O  OE1   . GLU A 1 396 ? 46.284 57.994  -19.230 1.00 135.88 ? 396 GLU A OE1   1 
ATOM   3154 O  OE2   . GLU A 1 396 ? 48.179 56.910  -18.986 1.00 125.19 ? 396 GLU A OE2   1 
ATOM   3155 N  N     . THR A 1 397 ? 44.649 54.394  -23.304 1.00 46.10  ? 397 THR A N     1 
ATOM   3156 C  CA    . THR A 1 397 ? 43.755 53.860  -24.327 1.00 47.61  ? 397 THR A CA    1 
ATOM   3157 C  C     . THR A 1 397 ? 42.676 52.983  -23.706 1.00 61.25  ? 397 THR A C     1 
ATOM   3158 O  O     . THR A 1 397 ? 41.511 53.029  -24.118 1.00 67.62  ? 397 THR A O     1 
ATOM   3159 C  CB    . THR A 1 397 ? 44.550 53.072  -25.369 1.00 42.90  ? 397 THR A CB    1 
ATOM   3160 O  OG1   . THR A 1 397 ? 45.582 53.902  -25.914 1.00 64.80  ? 397 THR A OG1   1 
ATOM   3161 C  CG2   . THR A 1 397 ? 43.638 52.606  -26.497 1.00 41.51  ? 397 THR A CG2   1 
ATOM   3162 N  N     . TRP A 1 398 ? 43.044 52.183  -22.703 1.00 55.75  ? 398 TRP A N     1 
ATOM   3163 C  CA    . TRP A 1 398 ? 42.055 51.344  -22.037 1.00 51.85  ? 398 TRP A CA    1 
ATOM   3164 C  C     . TRP A 1 398 ? 41.079 52.182  -21.220 1.00 47.18  ? 398 TRP A C     1 
ATOM   3165 O  O     . TRP A 1 398 ? 39.876 51.896  -21.201 1.00 53.79  ? 398 TRP A O     1 
ATOM   3166 C  CB    . TRP A 1 398 ? 42.751 50.312  -21.152 1.00 63.04  ? 398 TRP A CB    1 
ATOM   3167 C  CG    . TRP A 1 398 ? 41.792 49.473  -20.375 1.00 59.13  ? 398 TRP A CG    1 
ATOM   3168 C  CD1   . TRP A 1 398 ? 41.610 49.474  -19.024 1.00 65.70  ? 398 TRP A CD1   1 
ATOM   3169 C  CD2   . TRP A 1 398 ? 40.862 48.523  -20.906 1.00 52.87  ? 398 TRP A CD2   1 
ATOM   3170 N  NE1   . TRP A 1 398 ? 40.632 48.574  -18.678 1.00 69.02  ? 398 TRP A NE1   1 
ATOM   3171 C  CE2   . TRP A 1 398 ? 40.156 47.977  -19.816 1.00 65.33  ? 398 TRP A CE2   1 
ATOM   3172 C  CE3   . TRP A 1 398 ? 40.563 48.075  -22.196 1.00 49.73  ? 398 TRP A CE3   1 
ATOM   3173 C  CZ2   . TRP A 1 398 ? 39.168 47.008  -19.977 1.00 65.95  ? 398 TRP A CZ2   1 
ATOM   3174 C  CZ3   . TRP A 1 398 ? 39.582 47.114  -22.354 1.00 49.98  ? 398 TRP A CZ3   1 
ATOM   3175 C  CH2   . TRP A 1 398 ? 38.897 46.591  -21.251 1.00 59.35  ? 398 TRP A CH2   1 
ATOM   3176 N  N     . GLU A 1 399 ? 41.575 53.219  -20.540 1.00 65.14  ? 399 GLU A N     1 
ATOM   3177 C  CA    . GLU A 1 399 ? 40.692 54.083  -19.761 1.00 70.26  ? 399 GLU A CA    1 
ATOM   3178 C  C     . GLU A 1 399 ? 39.696 54.807  -20.658 1.00 63.85  ? 399 GLU A C     1 
ATOM   3179 O  O     . GLU A 1 399 ? 38.536 55.002  -20.278 1.00 59.90  ? 399 GLU A O     1 
ATOM   3180 C  CB    . GLU A 1 399 ? 41.513 55.087  -18.953 1.00 83.13  ? 399 GLU A CB    1 
ATOM   3181 C  CG    . GLU A 1 399 ? 42.240 54.482  -17.763 1.00 102.99 ? 399 GLU A CG    1 
ATOM   3182 C  CD    . GLU A 1 399 ? 41.293 54.028  -16.669 1.00 109.57 ? 399 GLU A CD    1 
ATOM   3183 O  OE1   . GLU A 1 399 ? 40.264 54.704  -16.453 1.00 110.62 ? 399 GLU A OE1   1 
ATOM   3184 O  OE2   . GLU A 1 399 ? 41.576 52.993  -16.028 1.00 104.62 ? 399 GLU A OE2   1 
ATOM   3185 N  N     . THR A 1 400 ? 40.131 55.213  -21.853 1.00 60.55  ? 400 THR A N     1 
ATOM   3186 C  CA    . THR A 1 400 ? 39.223 55.865  -22.792 1.00 54.61  ? 400 THR A CA    1 
ATOM   3187 C  C     . THR A 1 400 ? 38.118 54.916  -23.241 1.00 65.43  ? 400 THR A C     1 
ATOM   3188 O  O     . THR A 1 400 ? 36.956 55.319  -23.370 1.00 60.19  ? 400 THR A O     1 
ATOM   3189 C  CB    . THR A 1 400 ? 40.007 56.381  -24.000 1.00 54.22  ? 400 THR A CB    1 
ATOM   3190 O  OG1   . THR A 1 400 ? 40.923 57.401  -23.581 1.00 71.81  ? 400 THR A OG1   1 
ATOM   3191 C  CG2   . THR A 1 400 ? 39.069 56.948  -25.057 1.00 45.34  ? 400 THR A CG2   1 
ATOM   3192 N  N     . TRP A 1 401 ? 38.458 53.646  -23.466 1.00 71.71  ? 401 TRP A N     1 
ATOM   3193 C  CA    . TRP A 1 401 ? 37.494 52.705  -24.027 1.00 53.79  ? 401 TRP A CA    1 
ATOM   3194 C  C     . TRP A 1 401 ? 36.441 52.302  -23.000 1.00 50.31  ? 401 TRP A C     1 
ATOM   3195 O  O     . TRP A 1 401 ? 35.238 52.450  -23.239 1.00 49.20  ? 401 TRP A O     1 
ATOM   3196 C  CB    . TRP A 1 401 ? 38.218 51.472  -24.570 1.00 42.33  ? 401 TRP A CB    1 
ATOM   3197 C  CG    . TRP A 1 401 ? 37.287 50.361  -24.941 1.00 43.93  ? 401 TRP A CG    1 
ATOM   3198 C  CD1   . TRP A 1 401 ? 37.069 49.208  -24.247 1.00 35.93  ? 401 TRP A CD1   1 
ATOM   3199 C  CD2   . TRP A 1 401 ? 36.433 50.304  -26.091 1.00 42.93  ? 401 TRP A CD2   1 
ATOM   3200 N  NE1   . TRP A 1 401 ? 36.141 48.432  -24.896 1.00 40.68  ? 401 TRP A NE1   1 
ATOM   3201 C  CE2   . TRP A 1 401 ? 35.733 49.083  -26.030 1.00 36.63  ? 401 TRP A CE2   1 
ATOM   3202 C  CE3   . TRP A 1 401 ? 36.195 51.165  -27.167 1.00 44.13  ? 401 TRP A CE3   1 
ATOM   3203 C  CZ2   . TRP A 1 401 ? 34.812 48.700  -27.004 1.00 41.77  ? 401 TRP A CZ2   1 
ATOM   3204 C  CZ3   . TRP A 1 401 ? 35.280 50.784  -28.133 1.00 35.19  ? 401 TRP A CZ3   1 
ATOM   3205 C  CH2   . TRP A 1 401 ? 34.600 49.563  -28.045 1.00 39.66  ? 401 TRP A CH2   1 
ATOM   3206 N  N     . TRP A 1 402 ? 36.875 51.785  -21.846 1.00 49.42  ? 402 TRP A N     1 
ATOM   3207 C  CA    . TRP A 1 402 ? 35.917 51.245  -20.886 1.00 62.21  ? 402 TRP A CA    1 
ATOM   3208 C  C     . TRP A 1 402 ? 35.088 52.331  -20.213 1.00 63.80  ? 402 TRP A C     1 
ATOM   3209 O  O     . TRP A 1 402 ? 34.006 52.033  -19.697 1.00 69.82  ? 402 TRP A O     1 
ATOM   3210 C  CB    . TRP A 1 402 ? 36.636 50.400  -19.829 1.00 75.01  ? 402 TRP A CB    1 
ATOM   3211 C  CG    . TRP A 1 402 ? 37.160 51.171  -18.653 1.00 86.91  ? 402 TRP A CG    1 
ATOM   3212 C  CD1   . TRP A 1 402 ? 38.397 51.730  -18.524 1.00 100.67 ? 402 TRP A CD1   1 
ATOM   3213 C  CD2   . TRP A 1 402 ? 36.466 51.449  -17.429 1.00 90.44  ? 402 TRP A CD2   1 
ATOM   3214 N  NE1   . TRP A 1 402 ? 38.514 52.347  -17.302 1.00 107.96 ? 402 TRP A NE1   1 
ATOM   3215 C  CE2   . TRP A 1 402 ? 37.342 52.190  -16.611 1.00 101.68 ? 402 TRP A CE2   1 
ATOM   3216 C  CE3   . TRP A 1 402 ? 35.187 51.149  -16.949 1.00 80.96  ? 402 TRP A CE3   1 
ATOM   3217 C  CZ2   . TRP A 1 402 ? 36.982 52.634  -15.340 1.00 96.71  ? 402 TRP A CZ2   1 
ATOM   3218 C  CZ3   . TRP A 1 402 ? 34.831 51.592  -15.687 1.00 85.48  ? 402 TRP A CZ3   1 
ATOM   3219 C  CH2   . TRP A 1 402 ? 35.725 52.325  -14.897 1.00 90.53  ? 402 TRP A CH2   1 
ATOM   3220 N  N     . THR A 1 403 ? 35.562 53.578  -20.209 1.00 66.72  ? 403 THR A N     1 
ATOM   3221 C  CA    . THR A 1 403 ? 34.774 54.659  -19.626 1.00 74.24  ? 403 THR A CA    1 
ATOM   3222 C  C     . THR A 1 403 ? 33.603 55.034  -20.528 1.00 73.12  ? 403 THR A C     1 
ATOM   3223 O  O     . THR A 1 403 ? 32.512 55.352  -20.039 1.00 77.47  ? 403 THR A O     1 
ATOM   3224 C  CB    . THR A 1 403 ? 35.666 55.874  -19.361 1.00 81.00  ? 403 THR A CB    1 
ATOM   3225 O  OG1   . THR A 1 403 ? 36.710 55.510  -18.448 1.00 73.48  ? 403 THR A OG1   1 
ATOM   3226 C  CG2   . THR A 1 403 ? 34.864 57.023  -18.766 1.00 88.04  ? 403 THR A CG2   1 
ATOM   3227 N  N     . GLU A 1 404 ? 33.800 54.978  -21.845 1.00 66.15  ? 404 GLU A N     1 
ATOM   3228 C  CA    . GLU A 1 404 ? 32.785 55.393  -22.803 1.00 66.22  ? 404 GLU A CA    1 
ATOM   3229 C  C     . GLU A 1 404 ? 31.995 54.234  -23.401 1.00 65.33  ? 404 GLU A C     1 
ATOM   3230 O  O     . GLU A 1 404 ? 30.939 54.471  -23.996 1.00 72.54  ? 404 GLU A O     1 
ATOM   3231 C  CB    . GLU A 1 404 ? 33.433 56.205  -23.933 1.00 78.73  ? 404 GLU A CB    1 
ATOM   3232 C  CG    . GLU A 1 404 ? 34.252 57.393  -23.442 1.00 95.10  ? 404 GLU A CG    1 
ATOM   3233 C  CD    . GLU A 1 404 ? 34.972 58.118  -24.564 1.00 99.51  ? 404 GLU A CD    1 
ATOM   3234 O  OE1   . GLU A 1 404 ? 34.610 57.905  -25.741 1.00 105.92 ? 404 GLU A OE1   1 
ATOM   3235 O  OE2   . GLU A 1 404 ? 35.901 58.899  -24.269 1.00 89.13  ? 404 GLU A OE2   1 
ATOM   3236 N  N     . TYR A 1 405 ? 32.470 52.998  -23.263 1.00 60.85  ? 405 TYR A N     1 
ATOM   3237 C  CA    . TYR A 1 405 ? 31.766 51.849  -23.817 1.00 58.41  ? 405 TYR A CA    1 
ATOM   3238 C  C     . TYR A 1 405 ? 30.575 51.487  -22.938 1.00 62.13  ? 405 TYR A C     1 
ATOM   3239 O  O     . TYR A 1 405 ? 30.682 51.437  -21.709 1.00 68.02  ? 405 TYR A O     1 
ATOM   3240 C  CB    . TYR A 1 405 ? 32.714 50.657  -23.951 1.00 63.11  ? 405 TYR A CB    1 
ATOM   3241 C  CG    . TYR A 1 405 ? 32.184 49.528  -24.809 1.00 64.12  ? 405 TYR A CG    1 
ATOM   3242 C  CD1   . TYR A 1 405 ? 31.571 49.784  -26.029 1.00 56.46  ? 405 TYR A CD1   1 
ATOM   3243 C  CD2   . TYR A 1 405 ? 32.318 48.205  -24.409 1.00 68.27  ? 405 TYR A CD2   1 
ATOM   3244 C  CE1   . TYR A 1 405 ? 31.091 48.754  -26.819 1.00 55.04  ? 405 TYR A CE1   1 
ATOM   3245 C  CE2   . TYR A 1 405 ? 31.844 47.169  -25.193 1.00 64.76  ? 405 TYR A CE2   1 
ATOM   3246 C  CZ    . TYR A 1 405 ? 31.230 47.449  -26.395 1.00 61.40  ? 405 TYR A CZ    1 
ATOM   3247 O  OH    . TYR A 1 405 ? 30.757 46.418  -27.175 1.00 63.11  ? 405 TYR A OH    1 
ATOM   3248 N  N     . TRP A 1 406 ? 29.431 51.234  -23.580 1.00 57.72  ? 406 TRP A N     1 
ATOM   3249 C  CA    . TRP A 1 406 ? 28.190 51.019  -22.844 1.00 49.74  ? 406 TRP A CA    1 
ATOM   3250 C  C     . TRP A 1 406 ? 28.143 49.668  -22.143 1.00 47.43  ? 406 TRP A C     1 
ATOM   3251 O  O     . TRP A 1 406 ? 27.384 49.514  -21.180 1.00 45.03  ? 406 TRP A O     1 
ATOM   3252 C  CB    . TRP A 1 406 ? 26.993 51.159  -23.786 1.00 51.88  ? 406 TRP A CB    1 
ATOM   3253 C  CG    . TRP A 1 406 ? 27.045 50.234  -24.958 1.00 65.34  ? 406 TRP A CG    1 
ATOM   3254 C  CD1   . TRP A 1 406 ? 26.568 48.959  -25.016 1.00 67.10  ? 406 TRP A CD1   1 
ATOM   3255 C  CD2   . TRP A 1 406 ? 27.607 50.511  -26.246 1.00 78.85  ? 406 TRP A CD2   1 
ATOM   3256 N  NE1   . TRP A 1 406 ? 26.797 48.422  -26.260 1.00 67.72  ? 406 TRP A NE1   1 
ATOM   3257 C  CE2   . TRP A 1 406 ? 27.434 49.356  -27.034 1.00 77.59  ? 406 TRP A CE2   1 
ATOM   3258 C  CE3   . TRP A 1 406 ? 28.241 51.624  -26.808 0.80 80.22  ? 406 TRP A CE3   1 
ATOM   3259 C  CZ2   . TRP A 1 406 ? 27.871 49.281  -28.354 1.00 78.64  ? 406 TRP A CZ2   1 
ATOM   3260 C  CZ3   . TRP A 1 406 ? 28.673 51.548  -28.118 0.80 81.92  ? 406 TRP A CZ3   1 
ATOM   3261 C  CH2   . TRP A 1 406 ? 28.484 50.386  -28.876 0.80 82.20  ? 406 TRP A CH2   1 
ATOM   3262 N  N     . GLN A 1 407 ? 28.923 48.691  -22.598 1.00 51.49  ? 407 GLN A N     1 
ATOM   3263 C  CA    . GLN A 1 407 ? 28.953 47.387  -21.958 1.00 46.16  ? 407 GLN A CA    1 
ATOM   3264 C  C     . GLN A 1 407 ? 29.914 47.385  -20.774 1.00 44.05  ? 407 GLN A C     1 
ATOM   3265 O  O     . GLN A 1 407 ? 30.831 48.205  -20.678 1.00 51.22  ? 407 GLN A O     1 
ATOM   3266 C  CB    . GLN A 1 407 ? 29.367 46.300  -22.951 1.00 55.20  ? 407 GLN A CB    1 
ATOM   3267 C  CG    . GLN A 1 407 ? 28.217 45.555  -23.607 1.00 69.91  ? 407 GLN A CG    1 
ATOM   3268 C  CD    . GLN A 1 407 ? 28.698 44.436  -24.516 1.00 83.11  ? 407 GLN A CD    1 
ATOM   3269 O  OE1   . GLN A 1 407 ? 29.893 44.309  -24.784 1.00 89.61  ? 407 GLN A OE1   1 
ATOM   3270 N  NE2   . GLN A 1 407 ? 27.766 43.618  -24.992 1.00 79.76  ? 407 GLN A NE2   1 
ATOM   3271 N  N     . ALA A 1 408 ? 29.692 46.439  -19.864 1.00 40.05  ? 408 ALA A N     1 
ATOM   3272 C  CA    . ALA A 1 408 ? 30.600 46.222  -18.744 1.00 41.15  ? 408 ALA A CA    1 
ATOM   3273 C  C     . ALA A 1 408 ? 31.756 45.354  -19.221 1.00 48.67  ? 408 ALA A C     1 
ATOM   3274 O  O     . ALA A 1 408 ? 31.582 44.157  -19.470 1.00 65.93  ? 408 ALA A O     1 
ATOM   3275 C  CB    . ALA A 1 408 ? 29.866 45.571  -17.575 1.00 43.84  ? 408 ALA A CB    1 
ATOM   3276 N  N     . THR A 1 409 ? 32.934 45.955  -19.363 1.00 50.15  ? 409 THR A N     1 
ATOM   3277 C  CA    . THR A 1 409 ? 34.132 45.253  -19.799 1.00 36.41  ? 409 THR A CA    1 
ATOM   3278 C  C     . THR A 1 409 ? 35.223 45.425  -18.750 1.00 41.51  ? 409 THR A C     1 
ATOM   3279 O  O     . THR A 1 409 ? 35.256 46.425  -18.027 1.00 51.39  ? 409 THR A O     1 
ATOM   3280 C  CB    . THR A 1 409 ? 34.613 45.768  -21.168 1.00 36.77  ? 409 THR A CB    1 
ATOM   3281 O  OG1   . THR A 1 409 ? 35.730 44.989  -21.616 1.00 49.14  ? 409 THR A OG1   1 
ATOM   3282 C  CG2   . THR A 1 409 ? 35.018 47.236  -21.085 1.00 36.86  ? 409 THR A CG2   1 
ATOM   3283 N  N     . TRP A 1 410 ? 36.110 44.436  -18.656 1.00 51.07  ? 410 TRP A N     1 
ATOM   3284 C  CA    . TRP A 1 410 ? 37.156 44.486  -17.645 1.00 56.11  ? 410 TRP A CA    1 
ATOM   3285 C  C     . TRP A 1 410 ? 38.292 43.550  -18.030 1.00 56.33  ? 410 TRP A C     1 
ATOM   3286 O  O     . TRP A 1 410 ? 38.078 42.518  -18.671 1.00 64.85  ? 410 TRP A O     1 
ATOM   3287 C  CB    . TRP A 1 410 ? 36.617 44.119  -16.256 1.00 56.93  ? 410 TRP A CB    1 
ATOM   3288 C  CG    . TRP A 1 410 ? 37.616 44.307  -15.147 1.00 61.31  ? 410 TRP A CG    1 
ATOM   3289 C  CD1   . TRP A 1 410 ? 38.127 45.490  -14.695 1.00 60.01  ? 410 TRP A CD1   1 
ATOM   3290 C  CD2   . TRP A 1 410 ? 38.213 43.280  -14.343 1.00 55.94  ? 410 TRP A CD2   1 
ATOM   3291 N  NE1   . TRP A 1 410 ? 39.009 45.263  -13.665 1.00 46.63  ? 410 TRP A NE1   1 
ATOM   3292 C  CE2   . TRP A 1 410 ? 39.080 43.915  -13.430 1.00 45.88  ? 410 TRP A CE2   1 
ATOM   3293 C  CE3   . TRP A 1 410 ? 38.101 41.886  -14.308 1.00 49.87  ? 410 TRP A CE3   1 
ATOM   3294 C  CZ2   . TRP A 1 410 ? 39.828 43.205  -12.494 1.00 46.72  ? 410 TRP A CZ2   1 
ATOM   3295 C  CZ3   . TRP A 1 410 ? 38.846 41.183  -13.378 1.00 42.78  ? 410 TRP A CZ3   1 
ATOM   3296 C  CH2   . TRP A 1 410 ? 39.698 41.843  -12.483 1.00 48.44  ? 410 TRP A CH2   1 
ATOM   3297 N  N     . ILE A 1 411 ? 39.499 43.933  -17.628 1.00 55.44  ? 411 ILE A N     1 
ATOM   3298 C  CA    . ILE A 1 411 ? 40.704 43.129  -17.813 1.00 49.21  ? 411 ILE A CA    1 
ATOM   3299 C  C     . ILE A 1 411 ? 41.374 42.975  -16.453 1.00 48.51  ? 411 ILE A C     1 
ATOM   3300 O  O     . ILE A 1 411 ? 41.519 43.967  -15.725 1.00 58.99  ? 411 ILE A O     1 
ATOM   3301 C  CB    . ILE A 1 411 ? 41.655 43.772  -18.835 1.00 50.87  ? 411 ILE A CB    1 
ATOM   3302 C  CG1   . ILE A 1 411 ? 41.006 43.821  -20.220 1.00 49.58  ? 411 ILE A CG1   1 
ATOM   3303 C  CG2   . ILE A 1 411 ? 42.982 43.024  -18.886 1.00 51.18  ? 411 ILE A CG2   1 
ATOM   3304 C  CD1   . ILE A 1 411 ? 41.859 44.510  -21.266 1.00 51.52  ? 411 ILE A CD1   1 
ATOM   3305 N  N     . PRO A 1 412 ? 41.792 41.766  -16.061 1.00 49.56  ? 412 PRO A N     1 
ATOM   3306 C  CA    . PRO A 1 412 ? 42.487 41.610  -14.774 1.00 48.08  ? 412 PRO A CA    1 
ATOM   3307 C  C     . PRO A 1 412 ? 43.822 42.341  -14.746 1.00 49.18  ? 412 PRO A C     1 
ATOM   3308 O  O     . PRO A 1 412 ? 44.214 42.949  -15.747 1.00 54.82  ? 412 PRO A O     1 
ATOM   3309 C  CB    . PRO A 1 412 ? 42.666 40.090  -14.649 1.00 45.02  ? 412 PRO A CB    1 
ATOM   3310 C  CG    . PRO A 1 412 ? 42.552 39.570  -16.045 1.00 44.51  ? 412 PRO A CG    1 
ATOM   3311 C  CD    . PRO A 1 412 ? 41.589 40.477  -16.744 1.00 52.86  ? 412 PRO A CD    1 
ATOM   3312 N  N     . GLU A 1 413 ? 44.517 42.286  -13.608 1.00 61.72  ? 413 GLU A N     1 
ATOM   3313 C  CA    . GLU A 1 413 ? 45.742 43.053  -13.393 1.00 56.76  ? 413 GLU A CA    1 
ATOM   3314 C  C     . GLU A 1 413 ? 46.717 42.878  -14.547 1.00 49.41  ? 413 GLU A C     1 
ATOM   3315 O  O     . GLU A 1 413 ? 47.127 41.758  -14.865 1.00 58.10  ? 413 GLU A O     1 
ATOM   3316 C  CB    . GLU A 1 413 ? 46.399 42.623  -12.079 1.00 55.13  ? 413 GLU A CB    1 
ATOM   3317 C  CG    . GLU A 1 413 ? 47.743 43.281  -11.815 1.00 76.78  ? 413 GLU A CG    1 
ATOM   3318 C  CD    . GLU A 1 413 ? 48.481 42.648  -10.652 1.00 91.98  ? 413 GLU A CD    1 
ATOM   3319 O  OE1   . GLU A 1 413 ? 49.683 42.943  -10.474 1.00 97.64  ? 413 GLU A OE1   1 
ATOM   3320 O  OE2   . GLU A 1 413 ? 47.860 41.850  -9.918  1.00 91.39  ? 413 GLU A OE2   1 
ATOM   3321 N  N     . TRP A 1 414 ? 47.088 43.992  -15.177 1.00 43.23  ? 414 TRP A N     1 
ATOM   3322 C  CA    . TRP A 1 414 ? 47.909 43.952  -16.376 1.00 53.31  ? 414 TRP A CA    1 
ATOM   3323 C  C     . TRP A 1 414 ? 48.872 45.130  -16.390 1.00 62.18  ? 414 TRP A C     1 
ATOM   3324 O  O     . TRP A 1 414 ? 48.805 46.036  -15.553 1.00 54.80  ? 414 TRP A O     1 
ATOM   3325 C  CB    . TRP A 1 414 ? 47.047 43.951  -17.644 1.00 54.40  ? 414 TRP A CB    1 
ATOM   3326 C  CG    . TRP A 1 414 ? 46.207 45.179  -17.807 1.00 63.28  ? 414 TRP A CG    1 
ATOM   3327 C  CD1   . TRP A 1 414 ? 45.067 45.489  -17.124 1.00 74.91  ? 414 TRP A CD1   1 
ATOM   3328 C  CD2   . TRP A 1 414 ? 46.432 46.259  -18.721 1.00 62.00  ? 414 TRP A CD2   1 
ATOM   3329 N  NE1   . TRP A 1 414 ? 44.571 46.696  -17.552 1.00 74.50  ? 414 TRP A NE1   1 
ATOM   3330 C  CE2   . TRP A 1 414 ? 45.391 47.190  -18.532 1.00 59.55  ? 414 TRP A CE2   1 
ATOM   3331 C  CE3   . TRP A 1 414 ? 47.412 46.530  -19.679 1.00 63.27  ? 414 TRP A CE3   1 
ATOM   3332 C  CZ2   . TRP A 1 414 ? 45.303 48.370  -19.265 1.00 52.80  ? 414 TRP A CZ2   1 
ATOM   3333 C  CZ3   . TRP A 1 414 ? 47.324 47.702  -20.403 1.00 58.59  ? 414 TRP A CZ3   1 
ATOM   3334 C  CH2   . TRP A 1 414 ? 46.277 48.607  -20.194 1.00 56.66  ? 414 TRP A CH2   1 
ATOM   3335 N  N     . GLU A 1 415 ? 49.774 45.103  -17.368 1.00 68.87  ? 415 GLU A N     1 
ATOM   3336 C  CA    . GLU A 1 415 ? 50.811 46.111  -17.519 1.00 59.01  ? 415 GLU A CA    1 
ATOM   3337 C  C     . GLU A 1 415 ? 51.102 46.286  -19.003 1.00 55.90  ? 415 GLU A C     1 
ATOM   3338 O  O     . GLU A 1 415 ? 51.032 45.332  -19.781 1.00 55.62  ? 415 GLU A O     1 
ATOM   3339 C  CB    . GLU A 1 415 ? 52.080 45.715  -16.753 1.00 62.16  ? 415 GLU A CB    1 
ATOM   3340 C  CG    . GLU A 1 415 ? 53.214 46.722  -16.821 1.00 78.82  ? 415 GLU A CG    1 
ATOM   3341 C  CD    . GLU A 1 415 ? 54.405 46.309  -15.977 1.00 87.89  ? 415 GLU A CD    1 
ATOM   3342 O  OE1   . GLU A 1 415 ? 55.101 47.201  -15.448 1.00 96.42  ? 415 GLU A OE1   1 
ATOM   3343 O  OE2   . GLU A 1 415 ? 54.639 45.090  -15.836 1.00 76.65  ? 415 GLU A OE2   1 
ATOM   3344 N  N     . PHE A 1 416 ? 51.422 47.517  -19.386 1.00 56.03  ? 416 PHE A N     1 
ATOM   3345 C  CA    . PHE A 1 416 ? 51.679 47.842  -20.780 1.00 55.46  ? 416 PHE A CA    1 
ATOM   3346 C  C     . PHE A 1 416 ? 53.086 47.418  -21.189 1.00 57.47  ? 416 PHE A C     1 
ATOM   3347 O  O     . PHE A 1 416 ? 54.029 47.467  -20.394 1.00 57.82  ? 416 PHE A O     1 
ATOM   3348 C  CB    . PHE A 1 416 ? 51.486 49.342  -21.011 1.00 50.04  ? 416 PHE A CB    1 
ATOM   3349 C  CG    . PHE A 1 416 ? 52.017 49.830  -22.323 1.00 50.90  ? 416 PHE A CG    1 
ATOM   3350 C  CD1   . PHE A 1 416 ? 51.421 49.449  -23.512 1.00 54.75  ? 416 PHE A CD1   1 
ATOM   3351 C  CD2   . PHE A 1 416 ? 53.109 50.678  -22.368 1.00 60.14  ? 416 PHE A CD2   1 
ATOM   3352 C  CE1   . PHE A 1 416 ? 51.907 49.899  -24.723 1.00 60.53  ? 416 PHE A CE1   1 
ATOM   3353 C  CE2   . PHE A 1 416 ? 53.600 51.132  -23.574 1.00 69.59  ? 416 PHE A CE2   1 
ATOM   3354 C  CZ    . PHE A 1 416 ? 52.998 50.742  -24.754 1.00 69.69  ? 416 PHE A CZ    1 
ATOM   3355 N  N     . VAL A 1 417 ? 53.219 46.991  -22.445 1.00 50.61  ? 417 VAL A N     1 
ATOM   3356 C  CA    . VAL A 1 417 ? 54.502 46.600  -23.020 1.00 68.37  ? 417 VAL A CA    1 
ATOM   3357 C  C     . VAL A 1 417 ? 54.680 47.313  -24.353 1.00 71.52  ? 417 VAL A C     1 
ATOM   3358 O  O     . VAL A 1 417 ? 53.770 47.314  -25.190 1.00 69.92  ? 417 VAL A O     1 
ATOM   3359 C  CB    . VAL A 1 417 ? 54.617 45.074  -23.201 1.00 68.27  ? 417 VAL A CB    1 
ATOM   3360 C  CG1   . VAL A 1 417 ? 54.971 44.412  -21.881 1.00 64.97  ? 417 VAL A CG1   1 
ATOM   3361 C  CG2   . VAL A 1 417 ? 53.322 44.498  -23.759 1.00 55.14  ? 417 VAL A CG2   1 
ATOM   3362 N  N     . ASN A 1 418 ? 55.857 47.908  -24.552 1.00 80.64  ? 418 ASN A N     1 
ATOM   3363 C  CA    . ASN A 1 418 ? 56.166 48.663  -25.766 1.00 93.58  ? 418 ASN A CA    1 
ATOM   3364 C  C     . ASN A 1 418 ? 56.610 47.729  -26.896 1.00 94.17  ? 418 ASN A C     1 
ATOM   3365 O  O     . ASN A 1 418 ? 57.701 47.847  -27.454 1.00 108.14 ? 418 ASN A O     1 
ATOM   3366 C  CB    . ASN A 1 418 ? 57.235 49.710  -25.477 1.00 111.07 ? 418 ASN A CB    1 
ATOM   3367 C  CG    . ASN A 1 418 ? 56.763 50.785  -24.518 1.00 117.08 ? 418 ASN A CG    1 
ATOM   3368 O  OD1   . ASN A 1 418 ? 56.382 51.879  -24.934 1.00 112.43 ? 418 ASN A OD1   1 
ATOM   3369 N  ND2   . ASN A 1 418 ? 56.792 50.480  -23.224 1.00 122.86 ? 418 ASN A ND2   1 
ATOM   3370 N  N     . THR A 1 419 ? 55.737 46.784  -27.234 1.00 79.15  ? 419 THR A N     1 
ATOM   3371 C  CA    . THR A 1 419 ? 55.983 45.862  -28.344 1.00 84.53  ? 419 THR A CA    1 
ATOM   3372 C  C     . THR A 1 419 ? 54.918 46.065  -29.411 1.00 81.04  ? 419 THR A C     1 
ATOM   3373 O  O     . THR A 1 419 ? 53.815 45.500  -29.308 1.00 82.68  ? 419 THR A O     1 
ATOM   3374 C  CB    . THR A 1 419 ? 55.996 44.408  -27.872 1.00 82.90  ? 419 THR A CB    1 
ATOM   3375 O  OG1   . THR A 1 419 ? 54.688 44.034  -27.422 1.00 89.55  ? 419 THR A OG1   1 
ATOM   3376 C  CG2   . THR A 1 419 ? 56.992 44.224  -26.738 1.00 70.48  ? 419 THR A CG2   1 
ATOM   3377 N  N     . PRO A 1 420 ? 55.197 46.857  -30.457 1.00 80.02  ? 420 PRO A N     1 
ATOM   3378 C  CA    . PRO A 1 420 ? 54.265 47.128  -31.558 1.00 72.93  ? 420 PRO A CA    1 
ATOM   3379 C  C     . PRO A 1 420 ? 53.893 45.862  -32.333 1.00 61.91  ? 420 PRO A C     1 
ATOM   3380 O  O     . PRO A 1 420 ? 54.615 44.870  -32.240 1.00 71.49  ? 420 PRO A O     1 
ATOM   3381 C  CB    . PRO A 1 420 ? 55.047 48.108  -32.443 1.00 72.18  ? 420 PRO A CB    1 
ATOM   3382 C  CG    . PRO A 1 420 ? 56.470 47.858  -32.118 1.00 81.66  ? 420 PRO A CG    1 
ATOM   3383 C  CD    . PRO A 1 420 ? 56.491 47.527  -30.659 1.00 81.91  ? 420 PRO A CD    1 
ATOM   3384 N  N     . PRO A 1 421 ? 52.776 45.889  -33.081 1.00 54.34  ? 421 PRO A N     1 
ATOM   3385 C  CA    . PRO A 1 421 ? 51.839 47.012  -33.220 1.00 60.72  ? 421 PRO A CA    1 
ATOM   3386 C  C     . PRO A 1 421 ? 50.980 47.239  -31.979 1.00 64.84  ? 421 PRO A C     1 
ATOM   3387 O  O     . PRO A 1 421 ? 50.359 46.306  -31.471 1.00 67.92  ? 421 PRO A O     1 
ATOM   3388 C  CB    . PRO A 1 421 ? 50.971 46.597  -34.411 1.00 60.32  ? 421 PRO A CB    1 
ATOM   3389 C  CG    . PRO A 1 421 ? 51.025 45.115  -34.413 1.00 60.15  ? 421 PRO A CG    1 
ATOM   3390 C  CD    . PRO A 1 421 ? 52.408 44.759  -33.953 1.00 57.49  ? 421 PRO A CD    1 
ATOM   3391 N  N     . LEU A 1 422 ? 50.961 48.479  -31.497 1.00 66.98  ? 422 LEU A N     1 
ATOM   3392 C  CA    . LEU A 1 422 ? 50.152 48.816  -30.337 1.00 61.34  ? 422 LEU A CA    1 
ATOM   3393 C  C     . LEU A 1 422 ? 48.670 48.798  -30.692 1.00 56.43  ? 422 LEU A C     1 
ATOM   3394 O  O     . LEU A 1 422 ? 48.278 48.997  -31.845 1.00 51.55  ? 422 LEU A O     1 
ATOM   3395 C  CB    . LEU A 1 422 ? 50.538 50.192  -29.793 1.00 50.99  ? 422 LEU A CB    1 
ATOM   3396 C  CG    . LEU A 1 422 ? 51.985 50.393  -29.338 1.00 55.17  ? 422 LEU A CG    1 
ATOM   3397 C  CD1   . LEU A 1 422 ? 52.182 51.804  -28.802 1.00 61.70  ? 422 LEU A CD1   1 
ATOM   3398 C  CD2   . LEU A 1 422 ? 52.374 49.358  -28.294 1.00 56.81  ? 422 LEU A CD2   1 
ATOM   3399 N  N     . VAL A 1 423 ? 47.845 48.551  -29.682 1.00 61.60  ? 423 VAL A N     1 
ATOM   3400 C  CA    . VAL A 1 423 ? 46.396 48.564  -29.833 1.00 57.13  ? 423 VAL A CA    1 
ATOM   3401 C  C     . VAL A 1 423 ? 45.894 49.970  -29.541 1.00 57.03  ? 423 VAL A C     1 
ATOM   3402 O  O     . VAL A 1 423 ? 46.194 50.540  -28.484 1.00 60.54  ? 423 VAL A O     1 
ATOM   3403 C  CB    . VAL A 1 423 ? 45.736 47.536  -28.898 1.00 55.13  ? 423 VAL A CB    1 
ATOM   3404 C  CG1   . VAL A 1 423 ? 44.221 47.611  -29.008 1.00 43.12  ? 423 VAL A CG1   1 
ATOM   3405 C  CG2   . VAL A 1 423 ? 46.232 46.135  -29.218 1.00 57.71  ? 423 VAL A CG2   1 
ATOM   3406 N  N     . LYS A 1 424 ? 45.135 50.536  -30.476 1.00 55.39  ? 424 LYS A N     1 
ATOM   3407 C  CA    . LYS A 1 424 ? 44.616 51.884  -30.302 1.00 60.20  ? 424 LYS A CA    1 
ATOM   3408 C  C     . LYS A 1 424 ? 43.262 52.000  -30.984 1.00 61.09  ? 424 LYS A C     1 
ATOM   3409 O  O     . LYS A 1 424 ? 42.883 51.167  -31.812 1.00 55.26  ? 424 LYS A O     1 
ATOM   3410 C  CB    . LYS A 1 424 ? 45.579 52.938  -30.860 1.00 62.37  ? 424 LYS A CB    1 
ATOM   3411 C  CG    . LYS A 1 424 ? 45.632 52.979  -32.379 1.00 71.99  ? 424 LYS A CG    1 
ATOM   3412 C  CD    . LYS A 1 424 ? 46.522 54.106  -32.877 1.00 76.41  ? 424 LYS A CD    1 
ATOM   3413 C  CE    . LYS A 1 424 ? 46.421 54.253  -34.386 1.00 75.49  ? 424 LYS A CE    1 
ATOM   3414 N  NZ    . LYS A 1 424 ? 46.701 52.966  -35.078 1.00 77.04  ? 424 LYS A NZ    1 
ATOM   3415 N  N     . LEU A 1 425 ? 42.536 53.052  -30.619 1.00 67.61  ? 425 LEU A N     1 
ATOM   3416 C  CA    . LEU A 1 425 ? 41.286 53.404  -31.273 1.00 52.04  ? 425 LEU A CA    1 
ATOM   3417 C  C     . LEU A 1 425 ? 41.581 54.377  -32.406 1.00 54.57  ? 425 LEU A C     1 
ATOM   3418 O  O     . LEU A 1 425 ? 42.216 55.415  -32.190 1.00 72.64  ? 425 LEU A O     1 
ATOM   3419 C  CB    . LEU A 1 425 ? 40.311 54.019  -30.270 1.00 49.69  ? 425 LEU A CB    1 
ATOM   3420 C  CG    . LEU A 1 425 ? 39.935 53.096  -29.111 1.00 45.86  ? 425 LEU A CG    1 
ATOM   3421 C  CD1   . LEU A 1 425 ? 39.183 53.854  -28.030 1.00 59.19  ? 425 LEU A CD1   1 
ATOM   3422 C  CD2   . LEU A 1 425 ? 39.111 51.925  -29.620 1.00 36.97  ? 425 LEU A CD2   1 
ATOM   3423 N  N     . TRP A 1 426 ? 41.127 54.039  -33.611 1.00 44.93  ? 426 TRP A N     1 
ATOM   3424 C  CA    . TRP A 1 426 ? 41.506 54.801  -34.792 1.00 50.81  ? 426 TRP A CA    1 
ATOM   3425 C  C     . TRP A 1 426 ? 40.740 56.109  -34.945 1.00 52.17  ? 426 TRP A C     1 
ATOM   3426 O  O     . TRP A 1 426 ? 41.120 56.929  -35.788 1.00 54.27  ? 426 TRP A O     1 
ATOM   3427 C  CB    . TRP A 1 426 ? 41.325 53.939  -36.044 1.00 59.70  ? 426 TRP A CB    1 
ATOM   3428 C  CG    . TRP A 1 426 ? 42.272 52.774  -36.098 1.00 78.55  ? 426 TRP A CG    1 
ATOM   3429 C  CD1   . TRP A 1 426 ? 42.141 51.580  -35.448 1.00 82.26  ? 426 TRP A CD1   1 
ATOM   3430 C  CD2   . TRP A 1 426 ? 43.496 52.693  -36.840 1.00 88.65  ? 426 TRP A CD2   1 
ATOM   3431 N  NE1   . TRP A 1 426 ? 43.206 50.762  -35.740 1.00 82.88  ? 426 TRP A NE1   1 
ATOM   3432 C  CE2   . TRP A 1 426 ? 44.052 51.421  -36.593 1.00 86.86  ? 426 TRP A CE2   1 
ATOM   3433 C  CE3   . TRP A 1 426 ? 44.175 53.572  -37.690 1.00 96.77  ? 426 TRP A CE3   1 
ATOM   3434 C  CZ2   . TRP A 1 426 ? 45.253 51.008  -37.165 1.00 89.48  ? 426 TRP A CZ2   1 
ATOM   3435 C  CZ3   . TRP A 1 426 ? 45.368 53.159  -38.257 1.00 95.96  ? 426 TRP A CZ3   1 
ATOM   3436 C  CH2   . TRP A 1 426 ? 45.895 51.889  -37.992 1.00 92.35  ? 426 TRP A CH2   1 
ATOM   3437 N  N     . TYR A 1 427 ? 39.688 56.331  -34.160 1.00 43.22  ? 427 TYR A N     1 
ATOM   3438 C  CA    . TYR A 1 427 ? 38.934 57.577  -34.221 1.00 40.29  ? 427 TYR A CA    1 
ATOM   3439 C  C     . TYR A 1 427 ? 38.038 57.664  -32.995 1.00 52.72  ? 427 TYR A C     1 
ATOM   3440 O  O     . TYR A 1 427 ? 37.725 56.652  -32.360 1.00 50.79  ? 427 TYR A O     1 
ATOM   3441 C  CB    . TYR A 1 427 ? 38.104 57.679  -35.504 1.00 42.03  ? 427 TYR A CB    1 
ATOM   3442 C  CG    . TYR A 1 427 ? 37.071 56.586  -35.657 1.00 49.71  ? 427 TYR A CG    1 
ATOM   3443 C  CD1   . TYR A 1 427 ? 37.401 55.368  -36.238 1.00 48.45  ? 427 TYR A CD1   1 
ATOM   3444 C  CD2   . TYR A 1 427 ? 35.765 56.774  -35.228 1.00 42.85  ? 427 TYR A CD2   1 
ATOM   3445 C  CE1   . TYR A 1 427 ? 36.461 54.369  -36.382 1.00 39.34  ? 427 TYR A CE1   1 
ATOM   3446 C  CE2   . TYR A 1 427 ? 34.818 55.780  -35.366 1.00 44.93  ? 427 TYR A CE2   1 
ATOM   3447 C  CZ    . TYR A 1 427 ? 35.172 54.581  -35.944 1.00 49.01  ? 427 TYR A CZ    1 
ATOM   3448 O  OH    . TYR A 1 427 ? 34.230 53.589  -36.084 1.00 48.27  ? 427 TYR A OH    1 
ATOM   3449 N  N     . GLN A 1 428 ? 37.626 58.889  -32.674 1.00 58.54  ? 428 GLN A N     1 
ATOM   3450 C  CA    . GLN A 1 428 ? 36.755 59.155  -31.538 1.00 59.49  ? 428 GLN A CA    1 
ATOM   3451 C  C     . GLN A 1 428 ? 35.609 60.049  -31.982 1.00 54.08  ? 428 GLN A C     1 
ATOM   3452 O  O     . GLN A 1 428 ? 35.831 61.060  -32.655 1.00 62.65  ? 428 GLN A O     1 
ATOM   3453 C  CB    . GLN A 1 428 ? 37.520 59.822  -30.387 1.00 68.33  ? 428 GLN A CB    1 
ATOM   3454 C  CG    . GLN A 1 428 ? 38.650 58.987  -29.812 1.00 88.20  ? 428 GLN A CG    1 
ATOM   3455 C  CD    . GLN A 1 428 ? 39.294 59.637  -28.603 1.00 100.46 ? 428 GLN A CD    1 
ATOM   3456 O  OE1   . GLN A 1 428 ? 38.671 60.444  -27.911 1.00 96.23  ? 428 GLN A OE1   1 
ATOM   3457 N  NE2   . GLN A 1 428 ? 40.550 59.292  -28.343 1.00 105.74 ? 428 GLN A NE2   1 
ATOM   3458 N  N     . LEU A 1 429 ? 34.389 59.675  -31.608 1.00 41.44  ? 429 LEU A N     1 
ATOM   3459 C  CA    . LEU A 1 429 ? 33.234 60.524  -31.855 1.00 40.16  ? 429 LEU A CA    1 
ATOM   3460 C  C     . LEU A 1 429 ? 33.159 61.617  -30.798 1.00 42.12  ? 429 LEU A C     1 
ATOM   3461 O  O     . LEU A 1 429 ? 33.441 61.382  -29.619 1.00 46.27  ? 429 LEU A O     1 
ATOM   3462 C  CB    . LEU A 1 429 ? 31.949 59.697  -31.849 1.00 35.51  ? 429 LEU A CB    1 
ATOM   3463 C  CG    . LEU A 1 429 ? 31.876 58.556  -32.865 1.00 39.31  ? 429 LEU A CG    1 
ATOM   3464 C  CD1   . LEU A 1 429 ? 30.524 57.864  -32.802 1.00 34.15  ? 429 LEU A CD1   1 
ATOM   3465 C  CD2   . LEU A 1 429 ? 32.160 59.068  -34.268 1.00 44.62  ? 429 LEU A CD2   1 
ATOM   3466 N  N     . GLU A 1 430 ? 32.786 62.819  -31.227 1.00 45.60  ? 430 GLU A N     1 
ATOM   3467 C  CA    . GLU A 1 430 ? 32.674 63.936  -30.302 1.00 46.74  ? 430 GLU A CA    1 
ATOM   3468 C  C     . GLU A 1 430 ? 31.507 63.724  -29.344 1.00 44.90  ? 430 GLU A C     1 
ATOM   3469 O  O     . GLU A 1 430 ? 30.526 63.045  -29.660 1.00 41.59  ? 430 GLU A O     1 
ATOM   3470 C  CB    . GLU A 1 430 ? 32.485 65.251  -31.061 1.00 45.10  ? 430 GLU A CB    1 
ATOM   3471 C  CG    . GLU A 1 430 ? 33.631 65.623  -31.989 1.00 40.45  ? 430 GLU A CG    1 
ATOM   3472 C  CD    . GLU A 1 430 ? 34.961 65.720  -31.271 1.00 51.14  ? 430 GLU A CD    1 
ATOM   3473 O  OE1   . GLU A 1 430 ? 35.847 64.884  -31.548 1.00 62.17  ? 430 GLU A OE1   1 
ATOM   3474 O  OE2   . GLU A 1 430 ? 35.119 66.625  -30.425 1.00 52.00  ? 430 GLU A OE2   1 
ATOM   3475 N  N     . LYS A 1 431 ? 31.626 64.318  -28.157 1.00 41.10  ? 431 LYS A N     1 
ATOM   3476 C  CA    . LYS A 1 431 ? 30.538 64.269  -27.189 1.00 42.88  ? 431 LYS A CA    1 
ATOM   3477 C  C     . LYS A 1 431 ? 29.532 65.389  -27.412 1.00 45.32  ? 431 LYS A C     1 
ATOM   3478 O  O     . LYS A 1 431 ? 28.337 65.203  -27.159 1.00 52.20  ? 431 LYS A O     1 
ATOM   3479 C  CB    . LYS A 1 431 ? 31.096 64.341  -25.767 1.00 55.24  ? 431 LYS A CB    1 
ATOM   3480 C  CG    . LYS A 1 431 ? 32.263 63.401  -25.509 1.00 70.02  ? 431 LYS A CG    1 
ATOM   3481 C  CD    . LYS A 1 431 ? 32.798 63.557  -24.094 1.00 83.38  ? 431 LYS A CD    1 
ATOM   3482 C  CE    . LYS A 1 431 ? 34.047 62.716  -23.884 1.00 84.25  ? 431 LYS A CE    1 
ATOM   3483 N  NZ    . LYS A 1 431 ? 33.800 61.277  -24.174 1.00 76.07  ? 431 LYS A NZ    1 
ATOM   3484 N  N     . GLU A 1 432 ? 29.992 66.544  -27.889 1.00 51.44  ? 432 GLU A N     1 
ATOM   3485 C  CA    . GLU A 1 432 ? 29.183 67.725  -28.122 1.00 39.08  ? 432 GLU A CA    1 
ATOM   3486 C  C     . GLU A 1 432 ? 29.203 68.089  -29.603 1.00 40.98  ? 432 GLU A C     1 
ATOM   3487 O  O     . GLU A 1 432 ? 30.146 67.732  -30.317 1.00 51.91  ? 432 GLU A O     1 
ATOM   3488 C  CB    . GLU A 1 432 ? 29.704 68.909  -27.296 1.00 40.54  ? 432 GLU A CB    1 
ATOM   3489 C  CG    . GLU A 1 432 ? 29.892 68.607  -25.816 1.00 46.52  ? 432 GLU A CG    1 
ATOM   3490 C  CD    . GLU A 1 432 ? 28.584 68.312  -25.103 1.00 64.86  ? 432 GLU A CD    1 
ATOM   3491 O  OE1   . GLU A 1 432 ? 27.526 68.786  -25.570 1.00 62.69  ? 432 GLU A OE1   1 
ATOM   3492 O  OE2   . GLU A 1 432 ? 28.615 67.604  -24.075 1.00 78.64  ? 432 GLU A OE2   1 
ATOM   3493 N  N     . PRO A 1 433 ? 28.177 68.785  -30.098 1.00 38.63  ? 433 PRO A N     1 
ATOM   3494 C  CA    . PRO A 1 433 ? 28.183 69.188  -31.508 1.00 38.55  ? 433 PRO A CA    1 
ATOM   3495 C  C     . PRO A 1 433 ? 29.333 70.136  -31.806 1.00 39.76  ? 433 PRO A C     1 
ATOM   3496 O  O     . PRO A 1 433 ? 29.788 70.891  -30.944 1.00 49.23  ? 433 PRO A O     1 
ATOM   3497 C  CB    . PRO A 1 433 ? 26.823 69.874  -31.690 1.00 38.27  ? 433 PRO A CB    1 
ATOM   3498 C  CG    . PRO A 1 433 ? 26.418 70.290  -30.317 1.00 38.71  ? 433 PRO A CG    1 
ATOM   3499 C  CD    . PRO A 1 433 ? 26.955 69.227  -29.405 1.00 49.10  ? 433 PRO A CD    1 
ATOM   3500 N  N     . ILE A 1 434 ? 29.801 70.090  -33.048 1.00 39.85  ? 434 ILE A N     1 
ATOM   3501 C  CA    . ILE A 1 434 ? 30.990 70.825  -33.463 1.00 47.24  ? 434 ILE A CA    1 
ATOM   3502 C  C     . ILE A 1 434 ? 30.568 72.194  -33.983 1.00 52.29  ? 434 ILE A C     1 
ATOM   3503 O  O     . ILE A 1 434 ? 29.742 72.293  -34.896 1.00 52.03  ? 434 ILE A O     1 
ATOM   3504 C  CB    . ILE A 1 434 ? 31.774 70.049  -34.529 1.00 43.72  ? 434 ILE A CB    1 
ATOM   3505 C  CG1   . ILE A 1 434 ? 31.939 68.589  -34.101 1.00 45.87  ? 434 ILE A CG1   1 
ATOM   3506 C  CG2   . ILE A 1 434 ? 33.130 70.691  -34.760 1.00 42.73  ? 434 ILE A CG2   1 
ATOM   3507 C  CD1   . ILE A 1 434 ? 32.365 67.667  -35.221 1.00 40.49  ? 434 ILE A CD1   1 
ATOM   3508 N  N     . VAL A 1 435 ? 31.134 73.247  -33.401 1.00 55.18  ? 435 VAL A N     1 
ATOM   3509 C  CA    . VAL A 1 435 ? 30.881 74.608  -33.860 1.00 50.09  ? 435 VAL A CA    1 
ATOM   3510 C  C     . VAL A 1 435 ? 31.657 74.847  -35.148 1.00 44.49  ? 435 VAL A C     1 
ATOM   3511 O  O     . VAL A 1 435 ? 32.833 74.480  -35.258 1.00 50.87  ? 435 VAL A O     1 
ATOM   3512 C  CB    . VAL A 1 435 ? 31.272 75.631  -32.781 1.00 50.09  ? 435 VAL A CB    1 
ATOM   3513 C  CG1   . VAL A 1 435 ? 31.003 77.048  -33.269 1.00 50.48  ? 435 VAL A CG1   1 
ATOM   3514 C  CG2   . VAL A 1 435 ? 30.530 75.355  -31.484 1.00 50.83  ? 435 VAL A CG2   1 
ATOM   3515 N  N     . GLY A 1 436 ? 31.002 75.469  -36.125 1.00 47.20  ? 436 GLY A N     1 
ATOM   3516 C  CA    . GLY A 1 436 ? 31.625 75.751  -37.398 1.00 46.87  ? 436 GLY A CA    1 
ATOM   3517 C  C     . GLY A 1 436 ? 31.665 74.589  -38.362 1.00 44.47  ? 436 GLY A C     1 
ATOM   3518 O  O     . GLY A 1 436 ? 32.237 74.730  -39.450 1.00 49.69  ? 436 GLY A O     1 
ATOM   3519 N  N     . ALA A 1 437 ? 31.087 73.448  -38.000 1.00 50.88  ? 437 ALA A N     1 
ATOM   3520 C  CA    . ALA A 1 437 ? 31.022 72.289  -38.874 1.00 43.31  ? 437 ALA A CA    1 
ATOM   3521 C  C     . ALA A 1 437 ? 29.635 72.188  -39.491 1.00 41.51  ? 437 ALA A C     1 
ATOM   3522 O  O     . ALA A 1 437 ? 28.624 72.376  -38.808 1.00 50.49  ? 437 ALA A O     1 
ATOM   3523 C  CB    . ALA A 1 437 ? 31.351 71.005  -38.111 1.00 41.81  ? 437 ALA A CB    1 
ATOM   3524 N  N     . GLU A 1 438 ? 29.599 71.893  -40.787 1.00 41.70  ? 438 GLU A N     1 
ATOM   3525 C  CA    . GLU A 1 438 ? 28.334 71.759  -41.495 1.00 40.99  ? 438 GLU A CA    1 
ATOM   3526 C  C     . GLU A 1 438 ? 27.515 70.617  -40.907 1.00 39.71  ? 438 GLU A C     1 
ATOM   3527 O  O     . GLU A 1 438 ? 28.045 69.547  -40.594 1.00 39.42  ? 438 GLU A O     1 
ATOM   3528 C  CB    . GLU A 1 438 ? 28.600 71.518  -42.979 1.00 41.69  ? 438 GLU A CB    1 
ATOM   3529 C  CG    . GLU A 1 438 ? 27.383 71.606  -43.870 1.00 41.37  ? 438 GLU A CG    1 
ATOM   3530 C  CD    . GLU A 1 438 ? 27.752 71.522  -45.335 1.00 42.40  ? 438 GLU A CD    1 
ATOM   3531 O  OE1   . GLU A 1 438 ? 28.889 71.102  -45.637 1.00 44.14  ? 438 GLU A OE1   1 
ATOM   3532 O  OE2   . GLU A 1 438 ? 26.914 71.884  -46.184 1.00 42.83  ? 438 GLU A OE2   1 
ATOM   3533 N  N     . THR A 1 439 ? 26.214 70.850  -40.749 1.00 50.24  ? 439 THR A N     1 
ATOM   3534 C  CA    . THR A 1 439 ? 25.307 69.869  -40.165 1.00 51.21  ? 439 THR A CA    1 
ATOM   3535 C  C     . THR A 1 439 ? 24.600 69.106  -41.277 1.00 52.20  ? 439 THR A C     1 
ATOM   3536 O  O     . THR A 1 439 ? 23.831 69.692  -42.047 1.00 51.11  ? 439 THR A O     1 
ATOM   3537 C  CB    . THR A 1 439 ? 24.280 70.535  -39.250 1.00 40.82  ? 439 THR A CB    1 
ATOM   3538 O  OG1   . THR A 1 439 ? 24.948 71.164  -38.150 1.00 41.42  ? 439 THR A OG1   1 
ATOM   3539 C  CG2   . THR A 1 439 ? 23.307 69.496  -38.714 1.00 39.90  ? 439 THR A CG2   1 
ATOM   3540 N  N     . PHE A 1 440 ? 24.854 67.804  -41.351 1.00 52.67  ? 440 PHE A N     1 
ATOM   3541 C  CA    . PHE A 1 440 ? 24.216 66.929  -42.324 1.00 49.16  ? 440 PHE A CA    1 
ATOM   3542 C  C     . PHE A 1 440 ? 23.067 66.184  -41.662 1.00 36.56  ? 440 PHE A C     1 
ATOM   3543 O  O     . PHE A 1 440 ? 23.244 65.572  -40.603 1.00 49.06  ? 440 PHE A O     1 
ATOM   3544 C  CB    . PHE A 1 440 ? 25.219 65.929  -42.903 1.00 37.79  ? 440 PHE A CB    1 
ATOM   3545 C  CG    . PHE A 1 440 ? 26.124 66.509  -43.951 1.00 38.94  ? 440 PHE A CG    1 
ATOM   3546 C  CD1   . PHE A 1 440 ? 27.040 67.494  -43.627 1.00 39.49  ? 440 PHE A CD1   1 
ATOM   3547 C  CD2   . PHE A 1 440 ? 26.068 66.057  -45.259 1.00 39.66  ? 440 PHE A CD2   1 
ATOM   3548 C  CE1   . PHE A 1 440 ? 27.877 68.025  -44.589 1.00 43.15  ? 440 PHE A CE1   1 
ATOM   3549 C  CE2   . PHE A 1 440 ? 26.903 66.582  -46.226 1.00 40.90  ? 440 PHE A CE2   1 
ATOM   3550 C  CZ    . PHE A 1 440 ? 27.808 67.569  -45.890 1.00 46.45  ? 440 PHE A CZ    1 
ATOM   3551 N  N     . TYR A 1 441 ? 21.893 66.240  -42.283 1.00 39.25  ? 441 TYR A N     1 
ATOM   3552 C  CA    . TYR A 1 441 ? 20.744 65.441  -41.864 1.00 36.09  ? 441 TYR A CA    1 
ATOM   3553 C  C     . TYR A 1 441 ? 20.604 64.296  -42.860 1.00 44.06  ? 441 TYR A C     1 
ATOM   3554 O  O     . TYR A 1 441 ? 20.136 64.488  -43.984 1.00 42.02  ? 441 TYR A O     1 
ATOM   3555 C  CB    . TYR A 1 441 ? 19.480 66.288  -41.790 1.00 36.13  ? 441 TYR A CB    1 
ATOM   3556 C  CG    . TYR A 1 441 ? 19.498 67.291  -40.661 1.00 43.27  ? 441 TYR A CG    1 
ATOM   3557 C  CD1   . TYR A 1 441 ? 19.041 66.947  -39.397 1.00 40.12  ? 441 TYR A CD1   1 
ATOM   3558 C  CD2   . TYR A 1 441 ? 19.980 68.577  -40.857 1.00 44.47  ? 441 TYR A CD2   1 
ATOM   3559 C  CE1   . TYR A 1 441 ? 19.060 67.858  -38.360 1.00 41.52  ? 441 TYR A CE1   1 
ATOM   3560 C  CE2   . TYR A 1 441 ? 20.001 69.495  -39.827 1.00 36.29  ? 441 TYR A CE2   1 
ATOM   3561 C  CZ    . TYR A 1 441 ? 19.541 69.130  -38.581 1.00 36.85  ? 441 TYR A CZ    1 
ATOM   3562 O  OH    . TYR A 1 441 ? 19.561 70.040  -37.550 1.00 52.90  ? 441 TYR A OH    1 
ATOM   3563 N  N     . VAL A 1 442 ? 21.023 63.106  -42.444 1.00 47.67  ? 442 VAL A N     1 
ATOM   3564 C  CA    . VAL A 1 442 ? 21.003 61.934  -43.300 1.00 46.29  ? 442 VAL A CA    1 
ATOM   3565 C  C     . VAL A 1 442 ? 19.737 61.136  -43.024 1.00 45.75  ? 442 VAL A C     1 
ATOM   3566 O  O     . VAL A 1 442 ? 19.103 61.259  -41.972 1.00 51.43  ? 442 VAL A O     1 
ATOM   3567 C  CB    . VAL A 1 442 ? 22.259 61.055  -43.102 1.00 36.39  ? 442 VAL A CB    1 
ATOM   3568 C  CG1   . VAL A 1 442 ? 23.515 61.855  -43.391 1.00 36.84  ? 442 VAL A CG1   1 
ATOM   3569 C  CG2   . VAL A 1 442 ? 22.293 60.485  -41.693 1.00 35.51  ? 442 VAL A CG2   1 
ATOM   3570 N  N     . ASP A 1 443 ? 19.364 60.306  -43.995 1.00 40.16  ? 443 ASP A N     1 
ATOM   3571 C  CA    . ASP A 1 443 ? 18.255 59.371  -43.871 1.00 52.44  ? 443 ASP A CA    1 
ATOM   3572 C  C     . ASP A 1 443 ? 18.294 58.423  -45.058 1.00 47.31  ? 443 ASP A C     1 
ATOM   3573 O  O     . ASP A 1 443 ? 18.768 58.783  -46.139 1.00 46.73  ? 443 ASP A O     1 
ATOM   3574 C  CB    . ASP A 1 443 ? 16.898 60.087  -43.812 1.00 55.50  ? 443 ASP A CB    1 
ATOM   3575 C  CG    . ASP A 1 443 ? 15.743 59.126  -43.592 1.00 52.24  ? 443 ASP A CG    1 
ATOM   3576 O  OD1   . ASP A 1 443 ? 15.955 58.079  -42.944 1.00 53.89  ? 443 ASP A OD1   1 
ATOM   3577 O  OD2   . ASP A 1 443 ? 14.625 59.415  -44.068 1.00 58.60  ? 443 ASP A OD2   1 
ATOM   3578 N  N     . GLY A 1 444 ? 17.800 57.213  -44.839 1.00 54.67  ? 444 GLY A N     1 
ATOM   3579 C  CA    . GLY A 1 444 ? 17.674 56.240  -45.903 1.00 54.20  ? 444 GLY A CA    1 
ATOM   3580 C  C     . GLY A 1 444 ? 16.321 55.563  -45.850 1.00 57.70  ? 444 GLY A C     1 
ATOM   3581 O  O     . GLY A 1 444 ? 15.696 55.455  -44.795 1.00 64.88  ? 444 GLY A O     1 
ATOM   3582 N  N     . ALA A 1 445 ? 15.871 55.110  -47.016 1.00 55.60  ? 445 ALA A N     1 
ATOM   3583 C  CA    . ALA A 1 445 ? 14.607 54.399  -47.117 1.00 58.30  ? 445 ALA A CA    1 
ATOM   3584 C  C     . ALA A 1 445 ? 14.712 53.365  -48.227 1.00 62.29  ? 445 ALA A C     1 
ATOM   3585 O  O     . ALA A 1 445 ? 15.406 53.574  -49.225 1.00 58.85  ? 445 ALA A O     1 
ATOM   3586 C  CB    . ALA A 1 445 ? 13.440 55.357  -47.377 1.00 42.20  ? 445 ALA A CB    1 
ATOM   3587 N  N     . ALA A 1 446 ? 14.019 52.243  -48.039 1.00 65.60  ? 446 ALA A N     1 
ATOM   3588 C  CA    . ALA A 1 446 ? 14.010 51.165  -49.015 1.00 59.27  ? 446 ALA A CA    1 
ATOM   3589 C  C     . ALA A 1 446 ? 12.601 50.602  -49.132 1.00 57.38  ? 446 ALA A C     1 
ATOM   3590 O  O     . ALA A 1 446 ? 11.786 50.713  -48.213 1.00 56.65  ? 446 ALA A O     1 
ATOM   3591 C  CB    . ALA A 1 446 ? 14.997 50.052  -48.641 1.00 44.92  ? 446 ALA A CB    1 
ATOM   3592 N  N     . ASN A 1 447 ? 12.324 49.993  -50.282 1.00 56.31  ? 447 ASN A N     1 
ATOM   3593 C  CA    . ASN A 1 447 ? 11.032 49.378  -50.558 1.00 67.32  ? 447 ASN A CA    1 
ATOM   3594 C  C     . ASN A 1 447 ? 11.157 47.865  -50.441 1.00 78.82  ? 447 ASN A C     1 
ATOM   3595 O  O     . ASN A 1 447 ? 12.071 47.266  -51.016 1.00 80.86  ? 447 ASN A O     1 
ATOM   3596 C  CB    . ASN A 1 447 ? 10.530 49.765  -51.950 1.00 78.62  ? 447 ASN A CB    1 
ATOM   3597 C  CG    . ASN A 1 447 ? 9.112  49.297  -52.208 1.00 76.51  ? 447 ASN A CG    1 
ATOM   3598 O  OD1   . ASN A 1 447 ? 8.881  48.136  -52.546 1.00 80.88  ? 447 ASN A OD1   1 
ATOM   3599 N  ND2   . ASN A 1 447 ? 8.153  50.202  -52.054 1.00 73.83  ? 447 ASN A ND2   1 
ATOM   3600 N  N     . ARG A 1 448 ? 10.229 47.253  -49.701 1.00 88.37  ? 448 ARG A N     1 
ATOM   3601 C  CA    . ARG A 1 448 ? 10.324 45.824  -49.419 1.00 86.33  ? 448 ARG A CA    1 
ATOM   3602 C  C     . ARG A 1 448 ? 10.091 44.984  -50.671 1.00 85.86  ? 448 ARG A C     1 
ATOM   3603 O  O     . ARG A 1 448 ? 10.754 43.959  -50.868 1.00 80.78  ? 448 ARG A O     1 
ATOM   3604 C  CB    . ARG A 1 448 ? 9.326  45.445  -48.324 1.00 93.10  ? 448 ARG A CB    1 
ATOM   3605 C  CG    . ARG A 1 448 ? 9.137  43.948  -48.139 1.00 105.78 ? 448 ARG A CG    1 
ATOM   3606 C  CD    . ARG A 1 448 ? 8.153  43.634  -47.021 1.00 113.23 ? 448 ARG A CD    1 
ATOM   3607 N  NE    . ARG A 1 448 ? 8.722  43.879  -45.698 1.00 113.76 ? 448 ARG A NE    1 
ATOM   3608 C  CZ    . ARG A 1 448 ? 8.497  44.971  -44.975 1.00 112.76 ? 448 ARG A CZ    1 
ATOM   3609 N  NH1   . ARG A 1 448 ? 7.707  45.928  -45.442 1.00 114.52 ? 448 ARG A NH1   1 
ATOM   3610 N  NH2   . ARG A 1 448 ? 9.059  45.104  -43.781 1.00 109.44 ? 448 ARG A NH2   1 
ATOM   3611 N  N     . GLU A 1 449 ? 9.159  45.398  -51.528 1.00 82.20  ? 449 GLU A N     1 
ATOM   3612 C  CA    . GLU A 1 449 ? 8.827  44.611  -52.710 1.00 87.93  ? 449 GLU A CA    1 
ATOM   3613 C  C     . GLU A 1 449 ? 9.906  44.728  -53.780 1.00 89.15  ? 449 GLU A C     1 
ATOM   3614 O  O     . GLU A 1 449 ? 10.575 43.742  -54.106 1.00 89.27  ? 449 GLU A O     1 
ATOM   3615 C  CB    . GLU A 1 449 ? 7.468  45.042  -53.273 1.00 94.33  ? 449 GLU A CB    1 
ATOM   3616 C  CG    . GLU A 1 449 ? 6.294  44.770  -52.345 1.00 97.56  ? 449 GLU A CG    1 
ATOM   3617 C  CD    . GLU A 1 449 ? 4.958  45.139  -52.962 1.00 107.24 ? 449 GLU A CD    1 
ATOM   3618 O  OE1   . GLU A 1 449 ? 4.928  45.499  -54.158 1.00 107.17 ? 449 GLU A OE1   1 
ATOM   3619 O  OE2   . GLU A 1 449 ? 3.935  45.070  -52.249 1.00 112.91 ? 449 GLU A OE2   1 
ATOM   3620 N  N     . THR A 1 450 ? 10.087 45.933  -54.327 1.00 81.39  ? 450 THR A N     1 
ATOM   3621 C  CA    . THR A 1 450 ? 10.986 46.135  -55.458 1.00 72.55  ? 450 THR A CA    1 
ATOM   3622 C  C     . THR A 1 450 ? 12.460 46.116  -55.076 1.00 65.85  ? 450 THR A C     1 
ATOM   3623 O  O     . THR A 1 450 ? 13.308 46.094  -55.975 1.00 70.16  ? 450 THR A O     1 
ATOM   3624 C  CB    . THR A 1 450 ? 10.669 47.463  -56.148 1.00 76.69  ? 450 THR A CB    1 
ATOM   3625 O  OG1   . THR A 1 450 ? 10.829 48.537  -55.213 1.00 74.52  ? 450 THR A OG1   1 
ATOM   3626 C  CG2   . THR A 1 450 ? 9.243  47.466  -56.677 1.00 78.85  ? 450 THR A CG2   1 
ATOM   3627 N  N     . LYS A 1 451 ? 12.783 46.140  -53.781 1.00 61.74  ? 451 LYS A N     1 
ATOM   3628 C  CA    . LYS A 1 451 ? 14.158 46.183  -53.281 1.00 66.41  ? 451 LYS A CA    1 
ATOM   3629 C  C     . LYS A 1 451 ? 14.895 47.452  -53.702 1.00 66.33  ? 451 LYS A C     1 
ATOM   3630 O  O     . LYS A 1 451 ? 16.126 47.515  -53.623 1.00 60.03  ? 451 LYS A O     1 
ATOM   3631 C  CB    . LYS A 1 451 ? 14.956 44.944  -53.712 1.00 75.72  ? 451 LYS A CB    1 
ATOM   3632 C  CG    . LYS A 1 451 ? 15.011 43.837  -52.670 1.00 83.75  ? 451 LYS A CG    1 
ATOM   3633 C  CD    . LYS A 1 451 ? 13.623 43.339  -52.304 1.00 90.86  ? 451 LYS A CD    1 
ATOM   3634 C  CE    . LYS A 1 451 ? 13.691 42.288  -51.208 1.00 95.86  ? 451 LYS A CE    1 
ATOM   3635 N  NZ    . LYS A 1 451 ? 12.341 41.809  -50.800 1.00 105.07 ? 451 LYS A NZ    1 
ATOM   3636 N  N     . LEU A 1 452 ? 14.167 48.471  -54.147 1.00 65.56  ? 452 LEU A N     1 
ATOM   3637 C  CA    . LEU A 1 452 ? 14.769 49.746  -54.501 1.00 68.06  ? 452 LEU A CA    1 
ATOM   3638 C  C     . LEU A 1 452 ? 14.800 50.664  -53.287 1.00 69.08  ? 452 LEU A C     1 
ATOM   3639 O  O     . LEU A 1 452 ? 13.949 50.582  -52.397 1.00 74.40  ? 452 LEU A O     1 
ATOM   3640 C  CB    . LEU A 1 452 ? 14.001 50.415  -55.642 1.00 54.60  ? 452 LEU A CB    1 
ATOM   3641 C  CG    . LEU A 1 452 ? 13.893 49.616  -56.942 1.00 57.25  ? 452 LEU A CG    1 
ATOM   3642 C  CD1   . LEU A 1 452 ? 13.235 50.444  -58.036 1.00 58.85  ? 452 LEU A CD1   1 
ATOM   3643 C  CD2   . LEU A 1 452 ? 15.261 49.119  -57.386 1.00 70.17  ? 452 LEU A CD2   1 
ATOM   3644 N  N     . GLY A 1 453 ? 15.799 51.544  -53.257 1.00 59.61  ? 453 GLY A N     1 
ATOM   3645 C  CA    . GLY A 1 453 ? 15.952 52.456  -52.143 1.00 55.16  ? 453 GLY A CA    1 
ATOM   3646 C  C     . GLY A 1 453 ? 16.642 53.731  -52.571 1.00 57.75  ? 453 GLY A C     1 
ATOM   3647 O  O     . GLY A 1 453 ? 17.126 53.858  -53.699 1.00 48.79  ? 453 GLY A O     1 
ATOM   3648 N  N     . LYS A 1 454 ? 16.675 54.686  -51.645 1.00 45.86  ? 454 LYS A N     1 
ATOM   3649 C  CA    . LYS A 1 454 ? 17.353 55.957  -51.860 1.00 45.51  ? 454 LYS A CA    1 
ATOM   3650 C  C     . LYS A 1 454 ? 18.020 56.390  -50.566 1.00 53.73  ? 454 LYS A C     1 
ATOM   3651 O  O     . LYS A 1 454 ? 17.389 56.383  -49.505 1.00 60.22  ? 454 LYS A O     1 
ATOM   3652 C  CB    . LYS A 1 454 ? 16.380 57.041  -52.341 1.00 45.96  ? 454 LYS A CB    1 
ATOM   3653 C  CG    . LYS A 1 454 ? 15.898 56.860  -53.772 1.00 47.98  ? 454 LYS A CG    1 
ATOM   3654 C  CD    . LYS A 1 454 ? 14.973 57.988  -54.193 1.00 50.02  ? 454 LYS A CD    1 
ATOM   3655 C  CE    . LYS A 1 454 ? 14.475 57.792  -55.615 1.00 59.29  ? 454 LYS A CE    1 
ATOM   3656 N  NZ    . LYS A 1 454 ? 13.594 58.909  -56.053 1.00 78.01  ? 454 LYS A NZ    1 
ATOM   3657 N  N     . ALA A 1 455 ? 19.295 56.754  -50.656 1.00 54.67  ? 455 ALA A N     1 
ATOM   3658 C  CA    . ALA A 1 455 ? 20.038 57.323  -49.544 1.00 49.50  ? 455 ALA A CA    1 
ATOM   3659 C  C     . ALA A 1 455 ? 20.443 58.746  -49.897 1.00 48.64  ? 455 ALA A C     1 
ATOM   3660 O  O     . ALA A 1 455 ? 20.729 59.054  -51.059 1.00 51.59  ? 455 ALA A O     1 
ATOM   3661 C  CB    . ALA A 1 455 ? 21.278 56.490  -49.209 1.00 50.01  ? 455 ALA A CB    1 
ATOM   3662 N  N     . GLY A 1 456 ? 20.458 59.615  -48.894 1.00 41.74  ? 456 GLY A N     1 
ATOM   3663 C  CA    . GLY A 1 456 ? 20.783 61.004  -49.157 1.00 48.75  ? 456 GLY A CA    1 
ATOM   3664 C  C     . GLY A 1 456 ? 20.872 61.802  -47.877 1.00 52.38  ? 456 GLY A C     1 
ATOM   3665 O  O     . GLY A 1 456 ? 20.697 61.278  -46.773 1.00 38.98  ? 456 GLY A O     1 
ATOM   3666 N  N     . TYR A 1 457 ? 21.148 63.094  -48.045 1.00 50.64  ? 457 TYR A N     1 
ATOM   3667 C  CA    . TYR A 1 457 ? 21.317 63.994  -46.916 1.00 43.73  ? 457 TYR A CA    1 
ATOM   3668 C  C     . TYR A 1 457 ? 20.803 65.378  -47.279 1.00 41.85  ? 457 TYR A C     1 
ATOM   3669 O  O     . TYR A 1 457 ? 20.600 65.704  -48.452 1.00 41.70  ? 457 TYR A O     1 
ATOM   3670 C  CB    . TYR A 1 457 ? 22.785 64.078  -46.477 1.00 39.12  ? 457 TYR A CB    1 
ATOM   3671 C  CG    . TYR A 1 457 ? 23.734 64.524  -47.572 1.00 47.81  ? 457 TYR A CG    1 
ATOM   3672 C  CD1   . TYR A 1 457 ? 23.872 65.869  -47.900 1.00 48.38  ? 457 TYR A CD1   1 
ATOM   3673 C  CD2   . TYR A 1 457 ? 24.498 63.600  -48.271 1.00 54.85  ? 457 TYR A CD2   1 
ATOM   3674 C  CE1   . TYR A 1 457 ? 24.735 66.278  -48.898 1.00 53.40  ? 457 TYR A CE1   1 
ATOM   3675 C  CE2   . TYR A 1 457 ? 25.367 64.001  -49.269 1.00 55.47  ? 457 TYR A CE2   1 
ATOM   3676 C  CZ    . TYR A 1 457 ? 25.481 65.339  -49.577 1.00 58.49  ? 457 TYR A CZ    1 
ATOM   3677 O  OH    . TYR A 1 457 ? 26.344 65.740  -50.570 1.00 68.19  ? 457 TYR A OH    1 
ATOM   3678 N  N     . VAL A 1 458 ? 20.605 66.194  -46.246 1.00 48.39  ? 458 VAL A N     1 
ATOM   3679 C  CA    . VAL A 1 458 ? 20.289 67.611  -46.382 1.00 51.30  ? 458 VAL A CA    1 
ATOM   3680 C  C     . VAL A 1 458 ? 21.147 68.372  -45.382 1.00 53.86  ? 458 VAL A C     1 
ATOM   3681 O  O     . VAL A 1 458 ? 21.198 68.009  -44.201 1.00 59.39  ? 458 VAL A O     1 
ATOM   3682 C  CB    . VAL A 1 458 ? 18.794 67.898  -46.143 1.00 49.83  ? 458 VAL A CB    1 
ATOM   3683 C  CG1   . VAL A 1 458 ? 18.549 69.396  -46.035 1.00 59.52  ? 458 VAL A CG1   1 
ATOM   3684 C  CG2   . VAL A 1 458 ? 17.950 67.304  -47.258 1.00 50.56  ? 458 VAL A CG2   1 
ATOM   3685 N  N     . THR A 1 459 ? 21.827 69.414  -45.850 1.00 40.10  ? 459 THR A N     1 
ATOM   3686 C  CA    . THR A 1 459 ? 22.693 70.218  -45.000 1.00 39.23  ? 459 THR A CA    1 
ATOM   3687 C  C     . THR A 1 459 ? 22.026 71.540  -44.644 1.00 46.28  ? 459 THR A C     1 
ATOM   3688 O  O     . THR A 1 459 ? 21.139 72.030  -45.347 1.00 53.42  ? 459 THR A O     1 
ATOM   3689 C  CB    . THR A 1 459 ? 24.035 70.494  -45.683 1.00 44.58  ? 459 THR A CB    1 
ATOM   3690 O  OG1   . THR A 1 459 ? 23.844 71.419  -46.759 1.00 46.45  ? 459 THR A OG1   1 
ATOM   3691 C  CG2   . THR A 1 459 ? 24.631 69.209  -46.227 1.00 44.28  ? 459 THR A CG2   1 
ATOM   3692 N  N     . ASN A 1 460 ? 22.482 72.122  -43.534 1.00 50.82  ? 460 ASN A N     1 
ATOM   3693 C  CA    . ASN A 1 460 ? 22.004 73.429  -43.099 1.00 46.83  ? 460 ASN A CA    1 
ATOM   3694 C  C     . ASN A 1 460 ? 22.549 74.570  -43.944 1.00 45.74  ? 460 ASN A C     1 
ATOM   3695 O  O     . ASN A 1 460 ? 22.274 75.733  -43.631 1.00 54.60  ? 460 ASN A O     1 
ATOM   3696 C  CB    . ASN A 1 460 ? 22.374 73.664  -41.635 1.00 50.78  ? 460 ASN A CB    1 
ATOM   3697 C  CG    . ASN A 1 460 ? 23.854 73.924  -41.448 1.00 48.31  ? 460 ASN A CG    1 
ATOM   3698 O  OD1   . ASN A 1 460 ? 24.695 73.239  -42.028 1.00 58.15  ? 460 ASN A OD1   1 
ATOM   3699 N  ND2   . ASN A 1 460 ? 24.181 74.927  -40.645 1.00 43.19  ? 460 ASN A ND2   1 
ATOM   3700 N  N     . ARG A 1 461 ? 23.319 74.274  -44.989 1.00 40.85  ? 461 ARG A N     1 
ATOM   3701 C  CA    . ARG A 1 461 ? 23.855 75.290  -45.883 1.00 41.99  ? 461 ARG A CA    1 
ATOM   3702 C  C     . ARG A 1 461 ? 23.282 75.183  -47.290 1.00 47.33  ? 461 ARG A C     1 
ATOM   3703 O  O     . ARG A 1 461 ? 23.809 75.812  -48.214 1.00 43.60  ? 461 ARG A O     1 
ATOM   3704 C  CB    . ARG A 1 461 ? 25.381 75.206  -45.921 1.00 42.82  ? 461 ARG A CB    1 
ATOM   3705 C  CG    . ARG A 1 461 ? 26.032 75.316  -44.552 1.00 42.57  ? 461 ARG A CG    1 
ATOM   3706 C  CD    . ARG A 1 461 ? 27.544 75.262  -44.653 1.00 43.60  ? 461 ARG A CD    1 
ATOM   3707 N  NE    . ARG A 1 461 ? 28.184 75.380  -43.346 1.00 43.54  ? 461 ARG A NE    1 
ATOM   3708 C  CZ    . ARG A 1 461 ? 29.477 75.162  -43.128 1.00 51.89  ? 461 ARG A CZ    1 
ATOM   3709 N  NH1   . ARG A 1 461 ? 30.268 74.808  -44.132 1.00 49.48  ? 461 ARG A NH1   1 
ATOM   3710 N  NH2   . ARG A 1 461 ? 29.978 75.292  -41.907 1.00 44.36  ? 461 ARG A NH2   1 
ATOM   3711 N  N     . GLY A 1 462 ? 22.222 74.396  -47.476 1.00 41.85  ? 462 GLY A N     1 
ATOM   3712 C  CA    . GLY A 1 462 ? 21.513 74.331  -48.734 1.00 42.41  ? 462 GLY A CA    1 
ATOM   3713 C  C     . GLY A 1 462 ? 21.880 73.168  -49.631 1.00 46.02  ? 462 GLY A C     1 
ATOM   3714 O  O     . GLY A 1 462 ? 21.243 72.993  -50.677 1.00 57.73  ? 462 GLY A O     1 
ATOM   3715 N  N     . ARG A 1 463 ? 22.880 72.372  -49.266 1.00 44.17  ? 463 ARG A N     1 
ATOM   3716 C  CA    . ARG A 1 463 ? 23.293 71.260  -50.108 1.00 48.78  ? 463 ARG A CA    1 
ATOM   3717 C  C     . ARG A 1 463 ? 22.327 70.091  -49.967 1.00 47.44  ? 463 ARG A C     1 
ATOM   3718 O  O     . ARG A 1 463 ? 21.848 69.787  -48.871 1.00 41.56  ? 463 ARG A O     1 
ATOM   3719 C  CB    . ARG A 1 463 ? 24.712 70.818  -49.753 1.00 45.87  ? 463 ARG A CB    1 
ATOM   3720 C  CG    . ARG A 1 463 ? 25.763 71.883  -50.009 1.00 49.16  ? 463 ARG A CG    1 
ATOM   3721 C  CD    . ARG A 1 463 ? 27.082 71.508  -49.365 1.00 56.43  ? 463 ARG A CD    1 
ATOM   3722 N  NE    . ARG A 1 463 ? 27.655 70.302  -49.954 1.00 56.11  ? 463 ARG A NE    1 
ATOM   3723 C  CZ    . ARG A 1 463 ? 28.556 69.536  -49.349 1.00 50.58  ? 463 ARG A CZ    1 
ATOM   3724 N  NH1   . ARG A 1 463 ? 28.982 69.847  -48.132 1.00 44.66  ? 463 ARG A NH1   1 
ATOM   3725 N  NH2   . ARG A 1 463 ? 29.030 68.460  -49.959 1.00 60.72  ? 463 ARG A NH2   1 
ATOM   3726 N  N     . GLN A 1 464 ? 22.036 69.443  -51.094 1.00 51.93  ? 464 GLN A N     1 
ATOM   3727 C  CA    . GLN A 1 464 ? 21.153 68.287  -51.137 1.00 50.17  ? 464 GLN A CA    1 
ATOM   3728 C  C     . GLN A 1 464 ? 21.694 67.280  -52.138 1.00 49.19  ? 464 GLN A C     1 
ATOM   3729 O  O     . GLN A 1 464 ? 22.141 67.655  -53.227 1.00 45.94  ? 464 GLN A O     1 
ATOM   3730 C  CB    . GLN A 1 464 ? 19.723 68.673  -51.534 1.00 60.87  ? 464 GLN A CB    1 
ATOM   3731 C  CG    . GLN A 1 464 ? 18.956 69.468  -50.496 1.00 77.30  ? 464 GLN A CG    1 
ATOM   3732 C  CD    . GLN A 1 464 ? 17.500 69.644  -50.876 1.00 78.79  ? 464 GLN A CD    1 
ATOM   3733 O  OE1   . GLN A 1 464 ? 17.090 69.290  -51.983 1.00 68.87  ? 464 GLN A OE1   1 
ATOM   3734 N  NE2   . GLN A 1 464 ? 16.708 70.186  -49.958 1.00 80.68  ? 464 GLN A NE2   1 
ATOM   3735 N  N     . LYS A 1 465 ? 21.644 66.002  -51.769 1.00 43.88  ? 465 LYS A N     1 
ATOM   3736 C  CA    . LYS A 1 465 ? 22.018 64.932  -52.680 1.00 50.21  ? 465 LYS A CA    1 
ATOM   3737 C  C     . LYS A 1 465 ? 21.199 63.694  -52.344 1.00 52.18  ? 465 LYS A C     1 
ATOM   3738 O  O     . LYS A 1 465 ? 21.023 63.358  -51.171 1.00 44.24  ? 465 LYS A O     1 
ATOM   3739 C  CB    . LYS A 1 465 ? 23.517 64.614  -52.607 1.00 45.35  ? 465 LYS A CB    1 
ATOM   3740 C  CG    . LYS A 1 465 ? 23.962 63.554  -53.608 1.00 55.93  ? 465 LYS A CG    1 
ATOM   3741 C  CD    . LYS A 1 465 ? 25.461 63.299  -53.550 1.00 58.06  ? 465 LYS A CD    1 
ATOM   3742 C  CE    . LYS A 1 465 ? 26.251 64.469  -54.116 1.00 63.67  ? 465 LYS A CE    1 
ATOM   3743 N  NZ    . LYS A 1 465 ? 27.720 64.218  -54.070 1.00 64.37  ? 465 LYS A NZ    1 
ATOM   3744 N  N     . VAL A 1 466 ? 20.693 63.032  -53.382 1.00 54.54  ? 466 VAL A N     1 
ATOM   3745 C  CA    . VAL A 1 466 ? 19.936 61.794  -53.245 1.00 53.39  ? 466 VAL A CA    1 
ATOM   3746 C  C     . VAL A 1 466 ? 20.543 60.760  -54.182 1.00 52.07  ? 466 VAL A C     1 
ATOM   3747 O  O     . VAL A 1 466 ? 20.698 61.018  -55.381 1.00 57.30  ? 466 VAL A O     1 
ATOM   3748 C  CB    . VAL A 1 466 ? 18.440 61.994  -53.554 1.00 49.91  ? 466 VAL A CB    1 
ATOM   3749 C  CG1   . VAL A 1 466 ? 17.733 60.651  -53.652 1.00 46.34  ? 466 VAL A CG1   1 
ATOM   3750 C  CG2   . VAL A 1 466 ? 17.790 62.864  -52.488 1.00 47.06  ? 466 VAL A CG2   1 
ATOM   3751 N  N     . VAL A 1 467 ? 20.886 59.597  -53.637 1.00 52.61  ? 467 VAL A N     1 
ATOM   3752 C  CA    . VAL A 1 467 ? 21.494 58.508  -54.393 1.00 56.36  ? 467 VAL A CA    1 
ATOM   3753 C  C     . VAL A 1 467 ? 20.502 57.356  -54.458 1.00 53.53  ? 467 VAL A C     1 
ATOM   3754 O  O     . VAL A 1 467 ? 19.995 56.906  -53.424 1.00 52.56  ? 467 VAL A O     1 
ATOM   3755 C  CB    . VAL A 1 467 ? 22.821 58.058  -53.758 1.00 54.81  ? 467 VAL A CB    1 
ATOM   3756 C  CG1   . VAL A 1 467 ? 23.245 56.709  -54.312 1.00 54.62  ? 467 VAL A CG1   1 
ATOM   3757 C  CG2   . VAL A 1 467 ? 23.901 59.099  -53.999 1.00 51.70  ? 467 VAL A CG2   1 
ATOM   3758 N  N     . THR A 1 468 ? 20.226 56.883  -55.670 1.00 56.31  ? 468 THR A N     1 
ATOM   3759 C  CA    . THR A 1 468 ? 19.341 55.744  -55.869 1.00 58.98  ? 468 THR A CA    1 
ATOM   3760 C  C     . THR A 1 468 ? 20.129 54.446  -55.752 1.00 58.49  ? 468 THR A C     1 
ATOM   3761 O  O     . THR A 1 468 ? 21.252 54.337  -56.253 1.00 61.65  ? 468 THR A O     1 
ATOM   3762 C  CB    . THR A 1 468 ? 18.654 55.815  -57.234 1.00 58.70  ? 468 THR A CB    1 
ATOM   3763 O  OG1   . THR A 1 468 ? 19.637 55.727  -58.273 1.00 61.32  ? 468 THR A OG1   1 
ATOM   3764 C  CG2   . THR A 1 468 ? 17.885 57.121  -57.378 1.00 52.72  ? 468 THR A CG2   1 
ATOM   3765 N  N     . LEU A 1 469 ? 19.531 53.463  -55.085 1.00 58.65  ? 469 LEU A N     1 
ATOM   3766 C  CA    . LEU A 1 469 ? 20.160 52.171  -54.864 1.00 63.20  ? 469 LEU A CA    1 
ATOM   3767 C  C     . LEU A 1 469 ? 19.223 51.062  -55.319 1.00 69.01  ? 469 LEU A C     1 
ATOM   3768 O  O     . LEU A 1 469 ? 17.998 51.206  -55.282 1.00 67.33  ? 469 LEU A O     1 
ATOM   3769 C  CB    . LEU A 1 469 ? 20.523 51.971  -53.388 1.00 57.77  ? 469 LEU A CB    1 
ATOM   3770 C  CG    . LEU A 1 469 ? 21.428 53.038  -52.772 1.00 55.06  ? 469 LEU A CG    1 
ATOM   3771 C  CD1   . LEU A 1 469 ? 21.584 52.807  -51.279 1.00 45.34  ? 469 LEU A CD1   1 
ATOM   3772 C  CD2   . LEU A 1 469 ? 22.782 53.050  -53.464 1.00 60.69  ? 469 LEU A CD2   1 
ATOM   3773 N  N     . THR A 1 470 ? 19.814 49.949  -55.748 1.00 77.05  ? 470 THR A N     1 
ATOM   3774 C  CA    . THR A 1 470 ? 19.060 48.788  -56.195 1.00 76.01  ? 470 THR A CA    1 
ATOM   3775 C  C     . THR A 1 470 ? 19.528 47.554  -55.437 1.00 71.54  ? 470 THR A C     1 
ATOM   3776 O  O     . THR A 1 470 ? 20.703 47.434  -55.078 1.00 72.07  ? 470 THR A O     1 
ATOM   3777 C  CB    . THR A 1 470 ? 19.202 48.567  -57.711 1.00 78.74  ? 470 THR A CB    1 
ATOM   3778 O  OG1   . THR A 1 470 ? 18.449 47.412  -58.100 1.00 95.07  ? 470 THR A OG1   1 
ATOM   3779 C  CG2   . THR A 1 470 ? 20.663 48.376  -58.101 1.00 75.25  ? 470 THR A CG2   1 
ATOM   3780 N  N     . ASP A 1 471 ? 18.589 46.638  -55.199 1.00 73.05  ? 471 ASP A N     1 
ATOM   3781 C  CA    . ASP A 1 471 ? 18.824 45.430  -54.408 1.00 72.11  ? 471 ASP A CA    1 
ATOM   3782 C  C     . ASP A 1 471 ? 19.469 45.776  -53.067 1.00 64.31  ? 471 ASP A C     1 
ATOM   3783 O  O     . ASP A 1 471 ? 20.600 45.391  -52.764 1.00 67.74  ? 471 ASP A O     1 
ATOM   3784 C  CB    . ASP A 1 471 ? 19.674 44.419  -55.183 1.00 81.30  ? 471 ASP A CB    1 
ATOM   3785 C  CG    . ASP A 1 471 ? 18.915 43.770  -56.324 1.00 97.67  ? 471 ASP A CG    1 
ATOM   3786 O  OD1   . ASP A 1 471 ? 17.688 43.576  -56.192 1.00 104.46 ? 471 ASP A OD1   1 
ATOM   3787 O  OD2   . ASP A 1 471 ? 19.547 43.453  -57.353 1.00 104.22 ? 471 ASP A OD2   1 
ATOM   3788 N  N     . THR A 1 472 ? 18.723 46.525  -52.260 1.00 61.84  ? 472 THR A N     1 
ATOM   3789 C  CA    . THR A 1 472 ? 19.206 47.003  -50.975 1.00 55.86  ? 472 THR A CA    1 
ATOM   3790 C  C     . THR A 1 472 ? 18.143 46.771  -49.910 1.00 60.92  ? 472 THR A C     1 
ATOM   3791 O  O     . THR A 1 472 ? 17.015 46.363  -50.197 1.00 66.90  ? 472 THR A O     1 
ATOM   3792 C  CB    . THR A 1 472 ? 19.579 48.491  -51.035 1.00 51.81  ? 472 THR A CB    1 
ATOM   3793 O  OG1   . THR A 1 472 ? 20.271 48.860  -49.837 1.00 58.31  ? 472 THR A OG1   1 
ATOM   3794 C  CG2   . THR A 1 472 ? 18.328 49.347  -51.173 1.00 52.63  ? 472 THR A CG2   1 
ATOM   3795 N  N     . THR A 1 473 ? 18.524 47.034  -48.664 1.00 52.96  ? 473 THR A N     1 
ATOM   3796 C  CA    . THR A 1 473 ? 17.635 46.925  -47.519 1.00 43.96  ? 473 THR A CA    1 
ATOM   3797 C  C     . THR A 1 473 ? 17.506 48.286  -46.848 1.00 57.16  ? 473 THR A C     1 
ATOM   3798 O  O     . THR A 1 473 ? 18.245 49.227  -47.148 1.00 75.46  ? 473 THR A O     1 
ATOM   3799 C  CB    . THR A 1 473 ? 18.144 45.883  -46.516 1.00 43.13  ? 473 THR A CB    1 
ATOM   3800 O  OG1   . THR A 1 473 ? 19.356 46.351  -45.911 1.00 45.74  ? 473 THR A OG1   1 
ATOM   3801 C  CG2   . THR A 1 473 ? 18.413 44.559  -47.213 1.00 44.49  ? 473 THR A CG2   1 
ATOM   3802 N  N     . ASN A 1 474 ? 16.549 48.379  -45.923 1.00 60.96  ? 474 ASN A N     1 
ATOM   3803 C  CA    . ASN A 1 474 ? 16.306 49.646  -45.241 1.00 59.69  ? 474 ASN A CA    1 
ATOM   3804 C  C     . ASN A 1 474 ? 17.495 50.046  -44.376 1.00 57.19  ? 474 ASN A C     1 
ATOM   3805 O  O     . ASN A 1 474 ? 17.837 51.231  -44.291 1.00 61.86  ? 474 ASN A O     1 
ATOM   3806 C  CB    . ASN A 1 474 ? 15.033 49.551  -44.400 1.00 70.31  ? 474 ASN A CB    1 
ATOM   3807 C  CG    . ASN A 1 474 ? 14.576 50.899  -43.885 1.00 85.43  ? 474 ASN A CG    1 
ATOM   3808 O  OD1   . ASN A 1 474 ? 13.803 51.597  -44.541 1.00 88.06  ? 474 ASN A OD1   1 
ATOM   3809 N  ND2   . ASN A 1 474 ? 15.055 51.274  -42.704 1.00 88.72  ? 474 ASN A ND2   1 
ATOM   3810 N  N     . GLN A 1 475 ? 18.142 49.072  -43.732 1.00 53.64  ? 475 GLN A N     1 
ATOM   3811 C  CA    . GLN A 1 475 ? 19.293 49.384  -42.894 1.00 50.04  ? 475 GLN A CA    1 
ATOM   3812 C  C     . GLN A 1 475 ? 20.518 49.739  -43.729 1.00 53.27  ? 475 GLN A C     1 
ATOM   3813 O  O     . GLN A 1 475 ? 21.357 50.533  -43.288 1.00 41.52  ? 475 GLN A O     1 
ATOM   3814 C  CB    . GLN A 1 475 ? 19.603 48.210  -41.963 1.00 50.16  ? 475 GLN A CB    1 
ATOM   3815 C  CG    . GLN A 1 475 ? 18.502 47.894  -40.957 1.00 58.34  ? 475 GLN A CG    1 
ATOM   3816 C  CD    . GLN A 1 475 ? 17.371 47.076  -41.556 1.00 83.15  ? 475 GLN A CD    1 
ATOM   3817 O  OE1   . GLN A 1 475 ? 17.542 46.417  -42.582 1.00 87.18  ? 475 GLN A OE1   1 
ATOM   3818 N  NE2   . GLN A 1 475 ? 16.207 47.119  -40.918 1.00 95.27  ? 475 GLN A NE2   1 
ATOM   3819 N  N     . LYS A 1 476 ? 20.641 49.163  -44.928 1.00 58.30  ? 476 LYS A N     1 
ATOM   3820 C  CA    . LYS A 1 476 ? 21.764 49.504  -45.795 1.00 54.81  ? 476 LYS A CA    1 
ATOM   3821 C  C     . LYS A 1 476 ? 21.639 50.917  -46.349 1.00 62.59  ? 476 LYS A C     1 
ATOM   3822 O  O     . LYS A 1 476 ? 22.653 51.596  -46.543 1.00 59.11  ? 476 LYS A O     1 
ATOM   3823 C  CB    . LYS A 1 476 ? 21.880 48.494  -46.936 1.00 49.62  ? 476 LYS A CB    1 
ATOM   3824 C  CG    . LYS A 1 476 ? 22.431 47.144  -46.513 1.00 53.40  ? 476 LYS A CG    1 
ATOM   3825 C  CD    . LYS A 1 476 ? 22.560 46.201  -47.697 1.00 56.29  ? 476 LYS A CD    1 
ATOM   3826 C  CE    . LYS A 1 476 ? 23.151 44.868  -47.271 1.00 62.35  ? 476 LYS A CE    1 
ATOM   3827 N  NZ    . LYS A 1 476 ? 23.345 43.947  -48.426 1.00 70.36  ? 476 LYS A NZ    1 
ATOM   3828 N  N     . THR A 1 477 ? 20.413 51.376  -46.612 1.00 58.13  ? 477 THR A N     1 
ATOM   3829 C  CA    . THR A 1 477 ? 20.229 52.749  -47.069 1.00 49.29  ? 477 THR A CA    1 
ATOM   3830 C  C     . THR A 1 477 ? 20.599 53.752  -45.984 1.00 42.96  ? 477 THR A C     1 
ATOM   3831 O  O     . THR A 1 477 ? 21.111 54.833  -46.292 1.00 46.14  ? 477 THR A O     1 
ATOM   3832 C  CB    . THR A 1 477 ? 18.786 52.968  -47.527 1.00 41.23  ? 477 THR A CB    1 
ATOM   3833 O  OG1   . THR A 1 477 ? 17.887 52.672  -46.450 1.00 40.46  ? 477 THR A OG1   1 
ATOM   3834 C  CG2   . THR A 1 477 ? 18.460 52.075  -48.714 1.00 42.89  ? 477 THR A CG2   1 
ATOM   3835 N  N     . GLU A 1 478 ? 20.354 53.413  -44.715 1.00 38.16  ? 478 GLU A N     1 
ATOM   3836 C  CA    . GLU A 1 478 ? 20.737 54.305  -43.625 1.00 42.77  ? 478 GLU A CA    1 
ATOM   3837 C  C     . GLU A 1 478 ? 22.253 54.427  -43.518 1.00 50.50  ? 478 GLU A C     1 
ATOM   3838 O  O     . GLU A 1 478 ? 22.778 55.521  -43.286 1.00 50.45  ? 478 GLU A O     1 
ATOM   3839 C  CB    . GLU A 1 478 ? 20.141 53.812  -42.305 1.00 40.76  ? 478 GLU A CB    1 
ATOM   3840 C  CG    . GLU A 1 478 ? 18.616 53.795  -42.259 1.00 41.57  ? 478 GLU A CG    1 
ATOM   3841 C  CD    . GLU A 1 478 ? 18.008 55.177  -42.086 1.00 60.92  ? 478 GLU A CD    1 
ATOM   3842 O  OE1   . GLU A 1 478 ? 18.768 56.160  -41.957 1.00 78.45  ? 478 GLU A OE1   1 
ATOM   3843 O  OE2   . GLU A 1 478 ? 16.762 55.281  -42.075 1.00 61.09  ? 478 GLU A OE2   1 
ATOM   3844 N  N     . LEU A 1 479 ? 22.972 53.314  -43.685 1.00 56.43  ? 479 LEU A N     1 
ATOM   3845 C  CA    . LEU A 1 479 ? 24.431 53.368  -43.671 1.00 49.29  ? 479 LEU A CA    1 
ATOM   3846 C  C     . LEU A 1 479 ? 24.968 54.071  -44.912 1.00 44.37  ? 479 LEU A C     1 
ATOM   3847 O  O     . LEU A 1 479 ? 25.962 54.803  -44.836 1.00 54.65  ? 479 LEU A O     1 
ATOM   3848 C  CB    . LEU A 1 479 ? 25.011 51.958  -43.559 1.00 42.07  ? 479 LEU A CB    1 
ATOM   3849 C  CG    . LEU A 1 479 ? 24.977 51.284  -42.186 1.00 45.21  ? 479 LEU A CG    1 
ATOM   3850 C  CD1   . LEU A 1 479 ? 25.342 49.813  -42.303 1.00 36.59  ? 479 LEU A CD1   1 
ATOM   3851 C  CD2   . LEU A 1 479 ? 25.916 51.992  -41.223 1.00 42.41  ? 479 LEU A CD2   1 
ATOM   3852 N  N     . GLN A 1 480 ? 24.328 53.856  -46.064 1.00 39.29  ? 480 GLN A N     1 
ATOM   3853 C  CA    . GLN A 1 480 ? 24.749 54.535  -47.286 1.00 49.48  ? 480 GLN A CA    1 
ATOM   3854 C  C     . GLN A 1 480 ? 24.602 56.046  -47.168 1.00 53.00  ? 480 GLN A C     1 
ATOM   3855 O  O     . GLN A 1 480 ? 25.385 56.793  -47.765 1.00 52.52  ? 480 GLN A O     1 
ATOM   3856 C  CB    . GLN A 1 480 ? 23.945 54.016  -48.479 1.00 46.54  ? 480 GLN A CB    1 
ATOM   3857 C  CG    . GLN A 1 480 ? 24.400 52.664  -49.005 1.00 49.31  ? 480 GLN A CG    1 
ATOM   3858 C  CD    . GLN A 1 480 ? 25.609 52.770  -49.912 1.00 56.78  ? 480 GLN A CD    1 
ATOM   3859 O  OE1   . GLN A 1 480 ? 26.029 53.867  -50.281 1.00 67.26  ? 480 GLN A OE1   1 
ATOM   3860 N  NE2   . GLN A 1 480 ? 26.173 51.626  -50.281 1.00 44.85  ? 480 GLN A NE2   1 
ATOM   3861 N  N     . ALA A 1 481 ? 23.611 56.514  -46.407 1.00 52.42  ? 481 ALA A N     1 
ATOM   3862 C  CA    . ALA A 1 481 ? 23.430 57.951  -46.225 1.00 45.90  ? 481 ALA A CA    1 
ATOM   3863 C  C     . ALA A 1 481 ? 24.546 58.537  -45.368 1.00 46.82  ? 481 ALA A C     1 
ATOM   3864 O  O     . ALA A 1 481 ? 25.114 59.584  -45.703 1.00 56.01  ? 481 ALA A O     1 
ATOM   3865 C  CB    . ALA A 1 481 ? 22.063 58.234  -45.604 1.00 38.22  ? 481 ALA A CB    1 
ATOM   3866 N  N     . ILE A 1 482 ? 24.870 57.877  -44.253 1.00 37.52  ? 482 ILE A N     1 
ATOM   3867 C  CA    . ILE A 1 482 ? 25.978 58.329  -43.415 1.00 45.60  ? 482 ILE A CA    1 
ATOM   3868 C  C     . ILE A 1 482 ? 27.280 58.313  -44.204 1.00 50.06  ? 482 ILE A C     1 
ATOM   3869 O  O     . ILE A 1 482 ? 28.087 59.247  -44.120 1.00 54.37  ? 482 ILE A O     1 
ATOM   3870 C  CB    . ILE A 1 482 ? 26.077 57.468  -42.142 1.00 42.88  ? 482 ILE A CB    1 
ATOM   3871 C  CG1   . ILE A 1 482 ? 24.777 57.536  -41.339 1.00 35.44  ? 482 ILE A CG1   1 
ATOM   3872 C  CG2   . ILE A 1 482 ? 27.253 57.912  -41.284 1.00 48.77  ? 482 ILE A CG2   1 
ATOM   3873 C  CD1   . ILE A 1 482 ? 24.843 56.812  -40.010 1.00 34.63  ? 482 ILE A CD1   1 
ATOM   3874 N  N     . TYR A 1 483 ? 27.502 57.254  -44.991 1.00 50.01  ? 483 TYR A N     1 
ATOM   3875 C  CA    . TYR A 1 483 ? 28.694 57.185  -45.832 1.00 47.62  ? 483 TYR A CA    1 
ATOM   3876 C  C     . TYR A 1 483 ? 28.710 58.295  -46.873 1.00 53.54  ? 483 TYR A C     1 
ATOM   3877 O  O     . TYR A 1 483 ? 29.783 58.785  -47.243 1.00 49.38  ? 483 TYR A O     1 
ATOM   3878 C  CB    . TYR A 1 483 ? 28.776 55.816  -46.510 1.00 46.33  ? 483 TYR A CB    1 
ATOM   3879 C  CG    . TYR A 1 483 ? 29.906 55.669  -47.508 1.00 47.51  ? 483 TYR A CG    1 
ATOM   3880 C  CD1   . TYR A 1 483 ? 31.224 55.909  -47.141 1.00 52.75  ? 483 TYR A CD1   1 
ATOM   3881 C  CD2   . TYR A 1 483 ? 29.655 55.267  -48.813 1.00 45.16  ? 483 TYR A CD2   1 
ATOM   3882 C  CE1   . TYR A 1 483 ? 32.258 55.768  -48.051 1.00 49.11  ? 483 TYR A CE1   1 
ATOM   3883 C  CE2   . TYR A 1 483 ? 30.682 55.122  -49.730 1.00 45.69  ? 483 TYR A CE2   1 
ATOM   3884 C  CZ    . TYR A 1 483 ? 31.981 55.373  -49.343 1.00 50.08  ? 483 TYR A CZ    1 
ATOM   3885 O  OH    . TYR A 1 483 ? 33.004 55.230  -50.253 1.00 54.52  ? 483 TYR A OH    1 
ATOM   3886 N  N     . LEU A 1 484 ? 27.535 58.705  -47.354 1.00 59.93  ? 484 LEU A N     1 
ATOM   3887 C  CA    . LEU A 1 484 ? 27.474 59.775  -48.343 1.00 51.38  ? 484 LEU A CA    1 
ATOM   3888 C  C     . LEU A 1 484 ? 27.794 61.124  -47.712 1.00 55.46  ? 484 LEU A C     1 
ATOM   3889 O  O     . LEU A 1 484 ? 28.475 61.956  -48.323 1.00 57.12  ? 484 LEU A O     1 
ATOM   3890 C  CB    . LEU A 1 484 ? 26.094 59.795  -48.999 1.00 42.27  ? 484 LEU A CB    1 
ATOM   3891 C  CG    . LEU A 1 484 ? 25.921 60.638  -50.262 1.00 47.66  ? 484 LEU A CG    1 
ATOM   3892 C  CD1   . LEU A 1 484 ? 26.788 60.109  -51.393 1.00 45.26  ? 484 LEU A CD1   1 
ATOM   3893 C  CD2   . LEU A 1 484 ? 24.457 60.671  -50.670 1.00 59.34  ? 484 LEU A CD2   1 
ATOM   3894 N  N     . ALA A 1 485 ? 27.312 61.358  -46.488 1.00 53.88  ? 485 ALA A N     1 
ATOM   3895 C  CA    . ALA A 1 485 ? 27.632 62.600  -45.792 1.00 40.13  ? 485 ALA A CA    1 
ATOM   3896 C  C     . ALA A 1 485 ? 29.123 62.702  -45.505 1.00 44.68  ? 485 ALA A C     1 
ATOM   3897 O  O     . ALA A 1 485 ? 29.726 63.767  -45.681 1.00 55.94  ? 485 ALA A O     1 
ATOM   3898 C  CB    . ALA A 1 485 ? 26.831 62.698  -44.495 1.00 38.77  ? 485 ALA A CB    1 
ATOM   3899 N  N     . LEU A 1 486 ? 29.737 61.601  -45.064 1.00 40.49  ? 486 LEU A N     1 
ATOM   3900 C  CA    . LEU A 1 486 ? 31.171 61.609  -44.794 1.00 41.17  ? 486 LEU A CA    1 
ATOM   3901 C  C     . LEU A 1 486 ? 31.980 61.888  -46.054 1.00 42.87  ? 486 LEU A C     1 
ATOM   3902 O  O     . LEU A 1 486 ? 33.017 62.558  -45.990 1.00 56.77  ? 486 LEU A O     1 
ATOM   3903 C  CB    . LEU A 1 486 ? 31.593 60.277  -44.175 1.00 40.67  ? 486 LEU A CB    1 
ATOM   3904 C  CG    . LEU A 1 486 ? 31.045 59.970  -42.779 1.00 44.66  ? 486 LEU A CG    1 
ATOM   3905 C  CD1   . LEU A 1 486 ? 31.332 58.526  -42.395 1.00 43.39  ? 486 LEU A CD1   1 
ATOM   3906 C  CD2   . LEU A 1 486 ? 31.631 60.926  -41.752 1.00 39.12  ? 486 LEU A CD2   1 
ATOM   3907 N  N     . GLN A 1 487 ? 31.526 61.389  -47.206 1.00 43.51  ? 487 GLN A N     1 
ATOM   3908 C  CA    . GLN A 1 487 ? 32.265 61.602  -48.446 1.00 45.33  ? 487 GLN A CA    1 
ATOM   3909 C  C     . GLN A 1 487 ? 32.217 63.056  -48.897 1.00 46.04  ? 487 GLN A C     1 
ATOM   3910 O  O     . GLN A 1 487 ? 33.198 63.560  -49.454 1.00 62.42  ? 487 GLN A O     1 
ATOM   3911 C  CB    . GLN A 1 487 ? 31.718 60.701  -49.552 1.00 46.00  ? 487 GLN A CB    1 
ATOM   3912 C  CG    . GLN A 1 487 ? 32.167 59.258  -49.468 1.00 58.48  ? 487 GLN A CG    1 
ATOM   3913 C  CD    . GLN A 1 487 ? 31.654 58.432  -50.628 1.00 65.63  ? 487 GLN A CD    1 
ATOM   3914 O  OE1   . GLN A 1 487 ? 30.453 58.190  -50.748 1.00 65.91  ? 487 GLN A OE1   1 
ATOM   3915 N  NE2   . GLN A 1 487 ? 32.562 58.003  -51.496 1.00 64.02  ? 487 GLN A NE2   1 
ATOM   3916 N  N     . ASP A 1 488 ? 31.096 63.742  -48.671 1.00 51.94  ? 488 ASP A N     1 
ATOM   3917 C  CA    . ASP A 1 488 ? 30.880 65.082  -49.203 1.00 51.27  ? 488 ASP A CA    1 
ATOM   3918 C  C     . ASP A 1 488 ? 31.002 66.167  -48.137 1.00 45.07  ? 488 ASP A C     1 
ATOM   3919 O  O     . ASP A 1 488 ? 30.423 67.247  -48.289 1.00 47.85  ? 488 ASP A O     1 
ATOM   3920 C  CB    . ASP A 1 488 ? 29.513 65.162  -49.883 1.00 45.47  ? 488 ASP A CB    1 
ATOM   3921 C  CG    . ASP A 1 488 ? 29.364 64.157  -51.003 1.00 49.97  ? 488 ASP A CG    1 
ATOM   3922 O  OD1   . ASP A 1 488 ? 30.395 63.640  -51.479 1.00 53.33  ? 488 ASP A OD1   1 
ATOM   3923 O  OD2   . ASP A 1 488 ? 28.215 63.889  -51.412 1.00 46.13  ? 488 ASP A OD2   1 
ATOM   3924 N  N     . SER A 1 489 ? 31.744 65.908  -47.065 1.00 44.62  ? 489 SER A N     1 
ATOM   3925 C  CA    . SER A 1 489 ? 31.930 66.878  -45.997 1.00 44.21  ? 489 SER A CA    1 
ATOM   3926 C  C     . SER A 1 489 ? 33.416 67.113  -45.774 1.00 52.55  ? 489 SER A C     1 
ATOM   3927 O  O     . SER A 1 489 ? 34.267 66.355  -46.247 1.00 47.51  ? 489 SER A O     1 
ATOM   3928 C  CB    . SER A 1 489 ? 31.263 66.418  -44.694 1.00 49.04  ? 489 SER A CB    1 
ATOM   3929 O  OG    . SER A 1 489 ? 31.806 65.187  -44.250 1.00 69.76  ? 489 SER A OG    1 
ATOM   3930 N  N     . GLY A 1 490 ? 33.721 68.184  -45.048 1.00 45.62  ? 490 GLY A N     1 
ATOM   3931 C  CA    . GLY A 1 490 ? 35.085 68.517  -44.707 1.00 46.89  ? 490 GLY A CA    1 
ATOM   3932 C  C     . GLY A 1 490 ? 35.592 67.695  -43.539 1.00 58.11  ? 490 GLY A C     1 
ATOM   3933 O  O     . GLY A 1 490 ? 34.959 66.744  -43.078 1.00 54.01  ? 490 GLY A O     1 
ATOM   3934 N  N     . LEU A 1 491 ? 36.767 68.091  -43.044 1.00 47.39  ? 491 LEU A N     1 
ATOM   3935 C  CA    . LEU A 1 491 ? 37.413 67.348  -41.967 1.00 47.07  ? 491 LEU A CA    1 
ATOM   3936 C  C     . LEU A 1 491 ? 36.602 67.363  -40.677 1.00 55.33  ? 491 LEU A C     1 
ATOM   3937 O  O     . LEU A 1 491 ? 36.854 66.540  -39.791 1.00 57.99  ? 491 LEU A O     1 
ATOM   3938 C  CB    . LEU A 1 491 ? 38.815 67.905  -41.717 1.00 52.87  ? 491 LEU A CB    1 
ATOM   3939 C  CG    . LEU A 1 491 ? 39.783 67.867  -42.903 1.00 50.80  ? 491 LEU A CG    1 
ATOM   3940 C  CD1   . LEU A 1 491 ? 41.157 68.375  -42.494 1.00 52.69  ? 491 LEU A CD1   1 
ATOM   3941 C  CD2   . LEU A 1 491 ? 39.876 66.465  -43.487 1.00 50.51  ? 491 LEU A CD2   1 
ATOM   3942 N  N     . GLU A 1 492 ? 35.635 68.269  -40.551 1.00 54.41  ? 492 GLU A N     1 
ATOM   3943 C  CA    . GLU A 1 492 ? 34.756 68.322  -39.389 1.00 52.81  ? 492 GLU A CA    1 
ATOM   3944 C  C     . GLU A 1 492 ? 33.314 68.383  -39.867 1.00 49.74  ? 492 GLU A C     1 
ATOM   3945 O  O     . GLU A 1 492 ? 32.995 69.141  -40.789 1.00 68.53  ? 492 GLU A O     1 
ATOM   3946 C  CB    . GLU A 1 492 ? 35.099 69.518  -38.495 1.00 44.38  ? 492 GLU A CB    1 
ATOM   3947 C  CG    . GLU A 1 492 ? 36.461 69.381  -37.822 1.00 45.52  ? 492 GLU A CG    1 
ATOM   3948 C  CD    . GLU A 1 492 ? 36.842 70.579  -36.975 1.00 46.58  ? 492 GLU A CD    1 
ATOM   3949 O  OE1   . GLU A 1 492 ? 38.031 70.961  -36.995 1.00 63.38  ? 492 GLU A OE1   1 
ATOM   3950 O  OE2   . GLU A 1 492 ? 35.962 71.135  -36.287 1.00 58.37  ? 492 GLU A OE2   1 
ATOM   3951 N  N     . VAL A 1 493 ? 32.449 67.581  -39.250 1.00 41.10  ? 493 VAL A N     1 
ATOM   3952 C  CA    . VAL A 1 493 ? 31.079 67.425  -39.725 1.00 40.14  ? 493 VAL A CA    1 
ATOM   3953 C  C     . VAL A 1 493 ? 30.202 66.983  -38.560 1.00 48.95  ? 493 VAL A C     1 
ATOM   3954 O  O     . VAL A 1 493 ? 30.638 66.229  -37.685 1.00 39.64  ? 493 VAL A O     1 
ATOM   3955 C  CB    . VAL A 1 493 ? 31.012 66.423  -40.905 1.00 40.14  ? 493 VAL A CB    1 
ATOM   3956 C  CG1   . VAL A 1 493 ? 31.533 65.053  -40.480 1.00 39.74  ? 493 VAL A CG1   1 
ATOM   3957 C  CG2   . VAL A 1 493 ? 29.597 66.321  -41.452 1.00 43.26  ? 493 VAL A CG2   1 
ATOM   3958 N  N     . ASN A 1 494 ? 28.966 67.475  -38.549 1.00 48.89  ? 494 ASN A N     1 
ATOM   3959 C  CA    . ASN A 1 494 ? 27.914 66.987  -37.667 1.00 38.54  ? 494 ASN A CA    1 
ATOM   3960 C  C     . ASN A 1 494 ? 26.915 66.197  -38.500 1.00 42.14  ? 494 ASN A C     1 
ATOM   3961 O  O     . ASN A 1 494 ? 26.483 66.663  -39.560 1.00 41.33  ? 494 ASN A O     1 
ATOM   3962 C  CB    . ASN A 1 494 ? 27.195 68.136  -36.956 1.00 40.01  ? 494 ASN A CB    1 
ATOM   3963 C  CG    . ASN A 1 494 ? 28.122 68.963  -36.095 1.00 43.66  ? 494 ASN A CG    1 
ATOM   3964 O  OD1   . ASN A 1 494 ? 28.523 68.540  -35.010 1.00 38.78  ? 494 ASN A OD1   1 
ATOM   3965 N  ND2   . ASN A 1 494 ? 28.454 70.160  -36.567 1.00 40.06  ? 494 ASN A ND2   1 
ATOM   3966 N  N     . ILE A 1 495 ? 26.550 65.009  -38.026 1.00 46.93  ? 495 ILE A N     1 
ATOM   3967 C  CA    . ILE A 1 495 ? 25.599 64.148  -38.719 1.00 42.16  ? 495 ILE A CA    1 
ATOM   3968 C  C     . ILE A 1 495 ? 24.460 63.818  -37.767 1.00 40.46  ? 495 ILE A C     1 
ATOM   3969 O  O     . ILE A 1 495 ? 24.695 63.456  -36.607 1.00 34.55  ? 495 ILE A O     1 
ATOM   3970 C  CB    . ILE A 1 495 ? 26.267 62.863  -39.243 1.00 35.64  ? 495 ILE A CB    1 
ATOM   3971 C  CG1   . ILE A 1 495 ? 27.459 63.212  -40.136 1.00 36.59  ? 495 ILE A CG1   1 
ATOM   3972 C  CG2   . ILE A 1 495 ? 25.264 62.021  -40.016 1.00 35.45  ? 495 ILE A CG2   1 
ATOM   3973 C  CD1   . ILE A 1 495 ? 28.172 62.010  -40.700 1.00 36.86  ? 495 ILE A CD1   1 
ATOM   3974 N  N     . VAL A 1 496 ? 23.230 63.959  -38.254 1.00 34.78  ? 496 VAL A N     1 
ATOM   3975 C  CA    . VAL A 1 496 ? 22.028 63.598  -37.512 1.00 34.33  ? 496 VAL A CA    1 
ATOM   3976 C  C     . VAL A 1 496 ? 21.329 62.491  -38.284 1.00 37.00  ? 496 VAL A C     1 
ATOM   3977 O  O     . VAL A 1 496 ? 21.022 62.653  -39.473 1.00 41.96  ? 496 VAL A O     1 
ATOM   3978 C  CB    . VAL A 1 496 ? 21.093 64.799  -37.308 1.00 39.61  ? 496 VAL A CB    1 
ATOM   3979 C  CG1   . VAL A 1 496 ? 19.805 64.355  -36.631 1.00 39.64  ? 496 VAL A CG1   1 
ATOM   3980 C  CG2   . VAL A 1 496 ? 21.785 65.874  -36.489 1.00 34.75  ? 496 VAL A CG2   1 
ATOM   3981 N  N     . THR A 1 497 ? 21.084 61.369  -37.615 1.00 38.97  ? 497 THR A N     1 
ATOM   3982 C  CA    . THR A 1 497 ? 20.445 60.219  -38.233 1.00 43.27  ? 497 THR A CA    1 
ATOM   3983 C  C     . THR A 1 497 ? 19.263 59.777  -37.385 1.00 38.66  ? 497 THR A C     1 
ATOM   3984 O  O     . THR A 1 497 ? 19.210 60.030  -36.178 1.00 42.65  ? 497 THR A O     1 
ATOM   3985 C  CB    . THR A 1 497 ? 21.428 59.052  -38.406 1.00 37.90  ? 497 THR A CB    1 
ATOM   3986 O  OG1   . THR A 1 497 ? 20.765 57.958  -39.050 1.00 42.70  ? 497 THR A OG1   1 
ATOM   3987 C  CG2   . THR A 1 497 ? 21.957 58.595  -37.055 1.00 35.12  ? 497 THR A CG2   1 
ATOM   3988 N  N     . ASP A 1 498 ? 18.303 59.121  -38.035 1.00 44.07  ? 498 ASP A N     1 
ATOM   3989 C  CA    . ASP A 1 498 ? 17.152 58.542  -37.360 1.00 49.08  ? 498 ASP A CA    1 
ATOM   3990 C  C     . ASP A 1 498 ? 17.270 57.030  -37.218 1.00 48.45  ? 498 ASP A C     1 
ATOM   3991 O  O     . ASP A 1 498 ? 16.260 56.349  -37.009 1.00 60.58  ? 498 ASP A O     1 
ATOM   3992 C  CB    . ASP A 1 498 ? 15.866 58.908  -38.103 1.00 47.43  ? 498 ASP A CB    1 
ATOM   3993 C  CG    . ASP A 1 498 ? 15.843 58.382  -39.525 1.00 55.09  ? 498 ASP A CG    1 
ATOM   3994 O  OD1   . ASP A 1 498 ? 16.917 58.027  -40.053 1.00 68.87  ? 498 ASP A OD1   1 
ATOM   3995 O  OD2   . ASP A 1 498 ? 14.748 58.331  -40.122 1.00 77.76  ? 498 ASP A OD2   1 
ATOM   3996 N  N     . SER A 1 499 ? 18.484 56.496  -37.323 1.00 34.09  ? 499 SER A N     1 
ATOM   3997 C  CA    . SER A 1 499 ? 18.728 55.056  -37.369 1.00 39.68  ? 499 SER A CA    1 
ATOM   3998 C  C     . SER A 1 499 ? 19.592 54.660  -36.176 1.00 40.26  ? 499 SER A C     1 
ATOM   3999 O  O     . SER A 1 499 ? 20.816 54.821  -36.208 1.00 35.87  ? 499 SER A O     1 
ATOM   4000 C  CB    . SER A 1 499 ? 19.396 54.667  -38.683 1.00 43.54  ? 499 SER A CB    1 
ATOM   4001 O  OG    . SER A 1 499 ? 19.937 53.361  -38.610 1.00 59.76  ? 499 SER A OG    1 
ATOM   4002 N  N     . GLN A 1 500 ? 18.959 54.128  -35.128 1.00 47.59  ? 500 GLN A N     1 
ATOM   4003 C  CA    . GLN A 1 500 ? 19.728 53.622  -33.999 1.00 56.61  ? 500 GLN A CA    1 
ATOM   4004 C  C     . GLN A 1 500 ? 20.532 52.383  -34.367 1.00 50.79  ? 500 GLN A C     1 
ATOM   4005 O  O     . GLN A 1 500 ? 21.480 52.041  -33.651 1.00 57.40  ? 500 GLN A O     1 
ATOM   4006 C  CB    . GLN A 1 500 ? 18.807 53.324  -32.816 1.00 64.03  ? 500 GLN A CB    1 
ATOM   4007 C  CG    . GLN A 1 500 ? 17.678 52.363  -33.120 1.00 63.84  ? 500 GLN A CG    1 
ATOM   4008 C  CD    . GLN A 1 500 ? 16.708 52.242  -31.964 1.00 63.30  ? 500 GLN A CD    1 
ATOM   4009 O  OE1   . GLN A 1 500 ? 16.904 51.434  -31.055 1.00 64.52  ? 500 GLN A OE1   1 
ATOM   4010 N  NE2   . GLN A 1 500 ? 15.657 53.055  -31.986 1.00 56.80  ? 500 GLN A NE2   1 
ATOM   4011 N  N     . TYR A 1 501 ? 20.178 51.707  -35.462 1.00 40.88  ? 501 TYR A N     1 
ATOM   4012 C  CA    . TYR A 1 501 ? 21.017 50.632  -35.978 1.00 35.69  ? 501 TYR A CA    1 
ATOM   4013 C  C     . TYR A 1 501 ? 22.386 51.166  -36.384 1.00 46.13  ? 501 TYR A C     1 
ATOM   4014 O  O     . TYR A 1 501 ? 23.423 50.689  -35.908 1.00 61.13  ? 501 TYR A O     1 
ATOM   4015 C  CB    . TYR A 1 501 ? 20.326 49.950  -37.161 1.00 47.36  ? 501 TYR A CB    1 
ATOM   4016 C  CG    . TYR A 1 501 ? 21.255 49.130  -38.031 1.00 51.33  ? 501 TYR A CG    1 
ATOM   4017 C  CD1   . TYR A 1 501 ? 21.671 47.864  -37.638 1.00 56.43  ? 501 TYR A CD1   1 
ATOM   4018 C  CD2   . TYR A 1 501 ? 21.710 49.620  -39.250 1.00 48.86  ? 501 TYR A CD2   1 
ATOM   4019 C  CE1   . TYR A 1 501 ? 22.519 47.112  -38.432 1.00 59.35  ? 501 TYR A CE1   1 
ATOM   4020 C  CE2   . TYR A 1 501 ? 22.558 48.876  -40.049 1.00 49.52  ? 501 TYR A CE2   1 
ATOM   4021 C  CZ    . TYR A 1 501 ? 22.959 47.623  -39.636 1.00 52.80  ? 501 TYR A CZ    1 
ATOM   4022 O  OH    . TYR A 1 501 ? 23.803 46.879  -40.429 1.00 43.51  ? 501 TYR A OH    1 
ATOM   4023 N  N     . ALA A 1 502 ? 22.404 52.171  -37.262 1.00 45.01  ? 502 ALA A N     1 
ATOM   4024 C  CA    . ALA A 1 502 ? 23.670 52.723  -37.731 1.00 40.81  ? 502 ALA A CA    1 
ATOM   4025 C  C     . ALA A 1 502 ? 24.404 53.472  -36.628 1.00 34.70  ? 502 ALA A C     1 
ATOM   4026 O  O     . ALA A 1 502 ? 25.639 53.444  -36.581 1.00 37.27  ? 502 ALA A O     1 
ATOM   4027 C  CB    . ALA A 1 502 ? 23.430 53.640  -38.929 1.00 33.87  ? 502 ALA A CB    1 
ATOM   4028 N  N     . LEU A 1 503 ? 23.671 54.146  -35.740 1.00 42.07  ? 503 LEU A N     1 
ATOM   4029 C  CA    . LEU A 1 503 ? 24.306 54.826  -34.615 1.00 40.76  ? 503 LEU A CA    1 
ATOM   4030 C  C     . LEU A 1 503 ? 25.030 53.835  -33.715 1.00 43.04  ? 503 LEU A C     1 
ATOM   4031 O  O     . LEU A 1 503 ? 26.191 54.048  -33.343 1.00 41.56  ? 503 LEU A O     1 
ATOM   4032 C  CB    . LEU A 1 503 ? 23.261 55.607  -33.817 1.00 45.27  ? 503 LEU A CB    1 
ATOM   4033 C  CG    . LEU A 1 503 ? 23.716 56.167  -32.467 1.00 46.33  ? 503 LEU A CG    1 
ATOM   4034 C  CD1   . LEU A 1 503 ? 24.653 57.351  -32.647 1.00 32.38  ? 503 LEU A CD1   1 
ATOM   4035 C  CD2   . LEU A 1 503 ? 22.518 56.548  -31.611 1.00 64.00  ? 503 LEU A CD2   1 
ATOM   4036 N  N     . GLY A 1 504 ? 24.357 52.739  -33.354 1.00 37.25  ? 504 GLY A N     1 
ATOM   4037 C  CA    . GLY A 1 504 ? 24.968 51.768  -32.459 1.00 37.44  ? 504 GLY A CA    1 
ATOM   4038 C  C     . GLY A 1 504 ? 26.225 51.146  -33.034 1.00 34.55  ? 504 GLY A C     1 
ATOM   4039 O  O     . GLY A 1 504 ? 27.174 50.853  -32.303 1.00 43.04  ? 504 GLY A O     1 
ATOM   4040 N  N     . ILE A 1 505 ? 26.252 50.941  -34.351 1.00 32.00  ? 505 ILE A N     1 
ATOM   4041 C  CA    . ILE A 1 505 ? 27.438 50.381  -34.991 1.00 32.33  ? 505 ILE A CA    1 
ATOM   4042 C  C     . ILE A 1 505 ? 28.602 51.361  -34.905 1.00 40.98  ? 505 ILE A C     1 
ATOM   4043 O  O     . ILE A 1 505 ? 29.695 51.015  -34.442 1.00 48.02  ? 505 ILE A O     1 
ATOM   4044 C  CB    . ILE A 1 505 ? 27.134 50.001  -36.451 1.00 37.80  ? 505 ILE A CB    1 
ATOM   4045 C  CG1   . ILE A 1 505 ? 26.174 48.811  -36.506 1.00 32.88  ? 505 ILE A CG1   1 
ATOM   4046 C  CG2   . ILE A 1 505 ? 28.422 49.700  -37.204 1.00 33.51  ? 505 ILE A CG2   1 
ATOM   4047 C  CD1   . ILE A 1 505 ? 25.884 48.329  -37.910 1.00 44.78  ? 505 ILE A CD1   1 
ATOM   4048 N  N     . ILE A 1 506 ? 28.379 52.602  -35.343 1.00 41.64  ? 506 ILE A N     1 
ATOM   4049 C  CA    . ILE A 1 506 ? 29.463 53.575  -35.421 1.00 41.40  ? 506 ILE A CA    1 
ATOM   4050 C  C     . ILE A 1 506 ? 29.934 53.987  -34.032 1.00 43.69  ? 506 ILE A C     1 
ATOM   4051 O  O     . ILE A 1 506 ? 31.127 54.241  -33.824 1.00 45.15  ? 506 ILE A O     1 
ATOM   4052 C  CB    . ILE A 1 506 ? 29.009 54.785  -36.257 1.00 39.97  ? 506 ILE A CB    1 
ATOM   4053 C  CG1   . ILE A 1 506 ? 28.577 54.323  -37.650 1.00 37.27  ? 506 ILE A CG1   1 
ATOM   4054 C  CG2   . ILE A 1 506 ? 30.117 55.821  -36.359 1.00 43.13  ? 506 ILE A CG2   1 
ATOM   4055 C  CD1   . ILE A 1 506 ? 28.051 55.430  -38.530 1.00 39.74  ? 506 ILE A CD1   1 
ATOM   4056 N  N     . GLN A 1 507 ? 29.023 54.046  -33.058 1.00 50.63  ? 507 GLN A N     1 
ATOM   4057 C  CA    . GLN A 1 507 ? 29.396 54.461  -31.710 1.00 47.65  ? 507 GLN A CA    1 
ATOM   4058 C  C     . GLN A 1 507 ? 30.323 53.461  -31.029 1.00 43.09  ? 507 GLN A C     1 
ATOM   4059 O  O     . GLN A 1 507 ? 31.016 53.828  -30.074 1.00 43.71  ? 507 GLN A O     1 
ATOM   4060 C  CB    . GLN A 1 507 ? 28.137 54.676  -30.866 1.00 53.77  ? 507 GLN A CB    1 
ATOM   4061 C  CG    . GLN A 1 507 ? 28.350 55.523  -29.623 1.00 71.80  ? 507 GLN A CG    1 
ATOM   4062 C  CD    . GLN A 1 507 ? 27.051 56.064  -29.059 1.00 80.64  ? 507 GLN A CD    1 
ATOM   4063 O  OE1   . GLN A 1 507 ? 25.997 55.959  -29.689 1.00 82.82  ? 507 GLN A OE1   1 
ATOM   4064 N  NE2   . GLN A 1 507 ? 27.119 56.649  -27.868 1.00 76.48  ? 507 GLN A NE2   1 
ATOM   4065 N  N     . ALA A 1 508 ? 30.361 52.215  -31.500 1.00 53.63  ? 508 ALA A N     1 
ATOM   4066 C  CA    . ALA A 1 508 ? 31.250 51.199  -30.949 1.00 53.92  ? 508 ALA A CA    1 
ATOM   4067 C  C     . ALA A 1 508 ? 32.699 51.377  -31.381 1.00 53.18  ? 508 ALA A C     1 
ATOM   4068 O  O     . ALA A 1 508 ? 33.559 50.617  -30.921 1.00 55.49  ? 508 ALA A O     1 
ATOM   4069 C  CB    . ALA A 1 508 ? 30.769 49.803  -31.352 1.00 55.54  ? 508 ALA A CB    1 
ATOM   4070 N  N     . GLN A 1 509 ? 32.983 52.350  -32.240 1.00 47.07  ? 509 GLN A N     1 
ATOM   4071 C  CA    . GLN A 1 509 ? 34.316 52.576  -32.789 1.00 56.52  ? 509 GLN A CA    1 
ATOM   4072 C  C     . GLN A 1 509 ? 34.933 51.319  -33.412 1.00 52.50  ? 509 GLN A C     1 
ATOM   4073 O  O     . GLN A 1 509 ? 36.007 50.880  -32.991 1.00 60.47  ? 509 GLN A O     1 
ATOM   4074 C  CB    . GLN A 1 509 ? 35.241 53.145  -31.721 1.00 49.39  ? 509 GLN A CB    1 
ATOM   4075 C  CG    . GLN A 1 509 ? 34.672 54.316  -30.939 1.00 50.44  ? 509 GLN A CG    1 
ATOM   4076 C  CD    . GLN A 1 509 ? 35.636 54.826  -29.884 1.00 57.50  ? 509 GLN A CD    1 
ATOM   4077 O  OE1   . GLN A 1 509 ? 35.401 54.671  -28.684 1.00 58.59  ? 509 GLN A OE1   1 
ATOM   4078 N  NE2   . GLN A 1 509 ? 36.727 55.440  -30.327 1.00 62.09  ? 509 GLN A NE2   1 
ATOM   4079 N  N     . PRO A 1 510 ? 34.287 50.725  -34.415 1.00 39.93  ? 510 PRO A N     1 
ATOM   4080 C  CA    . PRO A 1 510 ? 34.913 49.595  -35.106 1.00 40.99  ? 510 PRO A CA    1 
ATOM   4081 C  C     . PRO A 1 510 ? 35.996 50.050  -36.070 1.00 46.53  ? 510 PRO A C     1 
ATOM   4082 O  O     . PRO A 1 510 ? 35.955 51.154  -36.619 1.00 51.37  ? 510 PRO A O     1 
ATOM   4083 C  CB    . PRO A 1 510 ? 33.743 48.953  -35.861 1.00 34.63  ? 510 PRO A CB    1 
ATOM   4084 C  CG    . PRO A 1 510 ? 32.826 50.083  -36.127 1.00 40.56  ? 510 PRO A CG    1 
ATOM   4085 C  CD    . PRO A 1 510 ? 32.922 50.973  -34.916 1.00 40.74  ? 510 PRO A CD    1 
ATOM   4086 N  N     . ASP A 1 511 ? 36.983 49.175  -36.263 1.00 47.06  ? 511 ASP A N     1 
ATOM   4087 C  CA    . ASP A 1 511 ? 38.014 49.375  -37.270 1.00 38.23  ? 511 ASP A CA    1 
ATOM   4088 C  C     . ASP A 1 511 ? 38.015 48.283  -38.329 1.00 47.13  ? 511 ASP A C     1 
ATOM   4089 O  O     . ASP A 1 511 ? 38.838 48.333  -39.252 1.00 48.24  ? 511 ASP A O     1 
ATOM   4090 C  CB    . ASP A 1 511 ? 39.401 49.469  -36.616 1.00 38.97  ? 511 ASP A CB    1 
ATOM   4091 C  CG    . ASP A 1 511 ? 39.685 48.319  -35.666 1.00 57.98  ? 511 ASP A CG    1 
ATOM   4092 O  OD1   . ASP A 1 511 ? 39.282 47.175  -35.961 1.00 66.94  ? 511 ASP A OD1   1 
ATOM   4093 O  OD2   . ASP A 1 511 ? 40.320 48.562  -34.618 1.00 60.07  ? 511 ASP A OD2   1 
ATOM   4094 N  N     . GLN A 1 512 ? 37.124 47.302  -38.223 1.00 51.47  ? 512 GLN A N     1 
ATOM   4095 C  CA    . GLN A 1 512 ? 37.016 46.238  -39.208 1.00 51.18  ? 512 GLN A CA    1 
ATOM   4096 C  C     . GLN A 1 512 ? 35.601 45.687  -39.164 1.00 37.65  ? 512 GLN A C     1 
ATOM   4097 O  O     . GLN A 1 512 ? 34.955 45.683  -38.113 1.00 36.83  ? 512 GLN A O     1 
ATOM   4098 C  CB    . GLN A 1 512 ? 38.041 45.126  -38.957 1.00 49.60  ? 512 GLN A CB    1 
ATOM   4099 C  CG    . GLN A 1 512 ? 38.059 44.606  -37.531 1.00 60.50  ? 512 GLN A CG    1 
ATOM   4100 C  CD    . GLN A 1 512 ? 39.134 43.560  -37.308 1.00 71.19  ? 512 GLN A CD    1 
ATOM   4101 O  OE1   . GLN A 1 512 ? 39.851 43.592  -36.307 1.00 78.15  ? 512 GLN A OE1   1 
ATOM   4102 N  NE2   . GLN A 1 512 ? 39.251 42.621  -38.242 1.00 62.39  ? 512 GLN A NE2   1 
ATOM   4103 N  N     . SER A 1 513 ? 35.127 45.227  -40.319 1.00 38.37  ? 513 SER A N     1 
ATOM   4104 C  CA    . SER A 1 513 ? 33.759 44.753  -40.444 1.00 37.82  ? 513 SER A CA    1 
ATOM   4105 C  C     . SER A 1 513 ? 33.672 43.737  -41.571 1.00 45.49  ? 513 SER A C     1 
ATOM   4106 O  O     . SER A 1 513 ? 34.437 43.792  -42.538 1.00 40.28  ? 513 SER A O     1 
ATOM   4107 C  CB    . SER A 1 513 ? 32.789 45.909  -40.712 1.00 47.86  ? 513 SER A CB    1 
ATOM   4108 O  OG    . SER A 1 513 ? 31.604 45.447  -41.338 1.00 42.04  ? 513 SER A OG    1 
ATOM   4109 N  N     . GLU A 1 514 ? 32.725 42.807  -41.435 1.00 42.26  ? 514 GLU A N     1 
ATOM   4110 C  CA    . GLU A 1 514 ? 32.396 41.919  -42.541 1.00 46.17  ? 514 GLU A CA    1 
ATOM   4111 C  C     . GLU A 1 514 ? 31.768 42.672  -43.705 1.00 44.72  ? 514 GLU A C     1 
ATOM   4112 O  O     . GLU A 1 514 ? 31.775 42.167  -44.833 1.00 42.10  ? 514 GLU A O     1 
ATOM   4113 C  CB    . GLU A 1 514 ? 31.451 40.813  -42.067 1.00 53.62  ? 514 GLU A CB    1 
ATOM   4114 C  CG    . GLU A 1 514 ? 32.072 39.850  -41.069 1.00 70.10  ? 514 GLU A CG    1 
ATOM   4115 C  CD    . GLU A 1 514 ? 31.034 39.033  -40.325 1.00 73.99  ? 514 GLU A CD    1 
ATOM   4116 O  OE1   . GLU A 1 514 ? 31.237 38.769  -39.120 1.00 70.80  ? 514 GLU A OE1   1 
ATOM   4117 O  OE2   . GLU A 1 514 ? 30.013 38.661  -40.940 1.00 74.09  ? 514 GLU A OE2   1 
ATOM   4118 N  N     . SER A 1 515 ? 31.230 43.864  -43.456 1.00 42.49  ? 515 SER A N     1 
ATOM   4119 C  CA    . SER A 1 515 ? 30.587 44.666  -44.485 1.00 43.90  ? 515 SER A CA    1 
ATOM   4120 C  C     . SER A 1 515 ? 31.580 45.661  -45.070 1.00 47.35  ? 515 SER A C     1 
ATOM   4121 O  O     . SER A 1 515 ? 32.210 46.426  -44.333 1.00 50.56  ? 515 SER A O     1 
ATOM   4122 C  CB    . SER A 1 515 ? 29.378 45.404  -43.908 1.00 39.56  ? 515 SER A CB    1 
ATOM   4123 O  OG    . SER A 1 515 ? 28.825 46.301  -44.855 1.00 42.17  ? 515 SER A OG    1 
ATOM   4124 N  N     . GLU A 1 516 ? 31.718 45.646  -46.398 1.00 44.46  ? 516 GLU A N     1 
ATOM   4125 C  CA    . GLU A 1 516 ? 32.570 46.631  -47.055 1.00 58.26  ? 516 GLU A CA    1 
ATOM   4126 C  C     . GLU A 1 516 ? 31.991 48.033  -46.944 1.00 58.91  ? 516 GLU A C     1 
ATOM   4127 O  O     . GLU A 1 516 ? 32.745 49.012  -46.921 1.00 57.50  ? 516 GLU A O     1 
ATOM   4128 C  CB    . GLU A 1 516 ? 32.781 46.254  -48.522 1.00 67.42  ? 516 GLU A CB    1 
ATOM   4129 C  CG    . GLU A 1 516 ? 33.778 45.128  -48.721 1.00 85.29  ? 516 GLU A CG    1 
ATOM   4130 C  CD    . GLU A 1 516 ? 35.146 45.462  -48.154 1.00 90.06  ? 516 GLU A CD    1 
ATOM   4131 O  OE1   . GLU A 1 516 ? 35.589 46.621  -48.308 1.00 90.05  ? 516 GLU A OE1   1 
ATOM   4132 O  OE2   . GLU A 1 516 ? 35.772 44.568  -47.547 1.00 87.55  ? 516 GLU A OE2   1 
ATOM   4133 N  N     . LEU A 1 517 ? 30.662 48.151  -46.879 1.00 56.06  ? 517 LEU A N     1 
ATOM   4134 C  CA    . LEU A 1 517 ? 30.047 49.454  -46.653 1.00 49.75  ? 517 LEU A CA    1 
ATOM   4135 C  C     . LEU A 1 517 ? 30.503 50.050  -45.328 1.00 48.29  ? 517 LEU A C     1 
ATOM   4136 O  O     . LEU A 1 517 ? 30.842 51.237  -45.257 1.00 46.92  ? 517 LEU A O     1 
ATOM   4137 C  CB    . LEU A 1 517 ? 28.524 49.326  -46.694 1.00 42.39  ? 517 LEU A CB    1 
ATOM   4138 C  CG    . LEU A 1 517 ? 27.699 50.587  -46.432 1.00 46.64  ? 517 LEU A CG    1 
ATOM   4139 C  CD1   . LEU A 1 517 ? 28.056 51.684  -47.422 1.00 51.38  ? 517 LEU A CD1   1 
ATOM   4140 C  CD2   . LEU A 1 517 ? 26.216 50.264  -46.500 1.00 40.65  ? 517 LEU A CD2   1 
ATOM   4141 N  N     . VAL A 1 518 ? 30.530 49.238  -44.270 1.00 42.91  ? 518 VAL A N     1 
ATOM   4142 C  CA    . VAL A 1 518 ? 31.014 49.720  -42.981 1.00 39.26  ? 518 VAL A CA    1 
ATOM   4143 C  C     . VAL A 1 518 ? 32.511 49.996  -43.043 1.00 49.86  ? 518 VAL A C     1 
ATOM   4144 O  O     . VAL A 1 518 ? 32.998 50.971  -42.461 1.00 62.94  ? 518 VAL A O     1 
ATOM   4145 C  CB    . VAL A 1 518 ? 30.666 48.716  -41.867 1.00 41.15  ? 518 VAL A CB    1 
ATOM   4146 C  CG1   . VAL A 1 518 ? 31.118 49.243  -40.514 1.00 36.51  ? 518 VAL A CG1   1 
ATOM   4147 C  CG2   . VAL A 1 518 ? 29.172 48.432  -41.857 1.00 43.33  ? 518 VAL A CG2   1 
ATOM   4148 N  N     . ASN A 1 519 ? 33.264 49.150  -43.754 1.00 48.06  ? 519 ASN A N     1 
ATOM   4149 C  CA    . ASN A 1 519 ? 34.699 49.382  -43.899 1.00 49.09  ? 519 ASN A CA    1 
ATOM   4150 C  C     . ASN A 1 519 ? 34.977 50.705  -44.602 1.00 51.15  ? 519 ASN A C     1 
ATOM   4151 O  O     . ASN A 1 519 ? 35.900 51.435  -44.222 1.00 50.36  ? 519 ASN A O     1 
ATOM   4152 C  CB    . ASN A 1 519 ? 35.351 48.226  -44.658 1.00 47.98  ? 519 ASN A CB    1 
ATOM   4153 C  CG    . ASN A 1 519 ? 35.712 47.062  -43.754 1.00 49.13  ? 519 ASN A CG    1 
ATOM   4154 O  OD1   . ASN A 1 519 ? 35.947 47.240  -42.559 1.00 55.91  ? 519 ASN A OD1   1 
ATOM   4155 N  ND2   . ASN A 1 519 ? 35.765 45.864  -44.323 1.00 42.72  ? 519 ASN A ND2   1 
ATOM   4156 N  N     . GLN A 1 520 ? 34.190 51.030  -45.631 1.00 52.96  ? 520 GLN A N     1 
ATOM   4157 C  CA    . GLN A 1 520 ? 34.334 52.323  -46.291 1.00 53.01  ? 520 GLN A CA    1 
ATOM   4158 C  C     . GLN A 1 520 ? 33.956 53.463  -45.352 1.00 56.85  ? 520 GLN A C     1 
ATOM   4159 O  O     . GLN A 1 520 ? 34.580 54.530  -45.378 1.00 56.27  ? 520 GLN A O     1 
ATOM   4160 C  CB    . GLN A 1 520 ? 33.481 52.362  -47.559 1.00 47.70  ? 520 GLN A CB    1 
ATOM   4161 C  CG    . GLN A 1 520 ? 33.959 51.425  -48.656 1.00 52.03  ? 520 GLN A CG    1 
ATOM   4162 C  CD    . GLN A 1 520 ? 32.962 51.299  -49.792 1.00 64.03  ? 520 GLN A CD    1 
ATOM   4163 O  OE1   . GLN A 1 520 ? 31.812 51.724  -49.675 1.00 64.82  ? 520 GLN A OE1   1 
ATOM   4164 N  NE2   . GLN A 1 520 ? 33.398 50.711  -50.900 1.00 79.34  ? 520 GLN A NE2   1 
ATOM   4165 N  N     . ILE A 1 521 ? 32.935 53.255  -44.517 1.00 49.55  ? 521 ILE A N     1 
ATOM   4166 C  CA    . ILE A 1 521 ? 32.588 54.248  -43.505 1.00 46.34  ? 521 ILE A CA    1 
ATOM   4167 C  C     . ILE A 1 521 ? 33.723 54.398  -42.501 1.00 46.94  ? 521 ILE A C     1 
ATOM   4168 O  O     . ILE A 1 521 ? 34.057 55.512  -42.080 1.00 62.80  ? 521 ILE A O     1 
ATOM   4169 C  CB    . ILE A 1 521 ? 31.264 53.867  -42.816 1.00 38.52  ? 521 ILE A CB    1 
ATOM   4170 C  CG1   . ILE A 1 521 ? 30.093 54.023  -43.787 1.00 38.80  ? 521 ILE A CG1   1 
ATOM   4171 C  CG2   . ILE A 1 521 ? 31.043 54.703  -41.564 1.00 37.49  ? 521 ILE A CG2   1 
ATOM   4172 C  CD1   . ILE A 1 521 ? 28.736 53.749  -43.171 1.00 46.49  ? 521 ILE A CD1   1 
ATOM   4173 N  N     . ILE A 1 522 ? 34.340 53.279  -42.110 1.00 51.23  ? 522 ILE A N     1 
ATOM   4174 C  CA    . ILE A 1 522 ? 35.447 53.329  -41.158 1.00 42.71  ? 522 ILE A CA    1 
ATOM   4175 C  C     . ILE A 1 522 ? 36.622 54.101  -41.743 1.00 47.05  ? 522 ILE A C     1 
ATOM   4176 O  O     . ILE A 1 522 ? 37.257 54.908  -41.055 1.00 61.76  ? 522 ILE A O     1 
ATOM   4177 C  CB    . ILE A 1 522 ? 35.857 51.904  -40.738 1.00 44.58  ? 522 ILE A CB    1 
ATOM   4178 C  CG1   . ILE A 1 522 ? 34.746 51.241  -39.923 1.00 43.41  ? 522 ILE A CG1   1 
ATOM   4179 C  CG2   . ILE A 1 522 ? 37.150 51.931  -39.937 1.00 39.85  ? 522 ILE A CG2   1 
ATOM   4180 C  CD1   . ILE A 1 522 ? 35.023 49.792  -39.585 1.00 48.40  ? 522 ILE A CD1   1 
ATOM   4181 N  N     . GLU A 1 523 ? 36.922 53.876  -43.025 1.00 42.53  ? 523 GLU A N     1 
ATOM   4182 C  CA    . GLU A 1 523 ? 38.029 54.586  -43.659 1.00 54.40  ? 523 GLU A CA    1 
ATOM   4183 C  C     . GLU A 1 523 ? 37.777 56.089  -43.691 1.00 59.24  ? 523 GLU A C     1 
ATOM   4184 O  O     . GLU A 1 523 ? 38.708 56.886  -43.522 1.00 62.82  ? 523 GLU A O     1 
ATOM   4185 C  CB    . GLU A 1 523 ? 38.259 54.044  -45.070 1.00 62.93  ? 523 GLU A CB    1 
ATOM   4186 C  CG    . GLU A 1 523 ? 39.361 54.755  -45.843 1.00 77.77  ? 523 GLU A CG    1 
ATOM   4187 C  CD    . GLU A 1 523 ? 39.733 54.034  -47.125 1.00 93.34  ? 523 GLU A CD    1 
ATOM   4188 O  OE1   . GLU A 1 523 ? 40.808 54.334  -47.686 1.00 103.59 ? 523 GLU A OE1   1 
ATOM   4189 O  OE2   . GLU A 1 523 ? 38.954 53.164  -47.568 1.00 93.05  ? 523 GLU A OE2   1 
ATOM   4190 N  N     . GLN A 1 524 ? 36.521 56.496  -43.895 1.00 49.53  ? 524 GLN A N     1 
ATOM   4191 C  CA    . GLN A 1 524 ? 36.196 57.918  -43.900 1.00 43.49  ? 524 GLN A CA    1 
ATOM   4192 C  C     . GLN A 1 524 ? 36.324 58.523  -42.507 1.00 45.03  ? 524 GLN A C     1 
ATOM   4193 O  O     . GLN A 1 524 ? 36.835 59.638  -42.355 1.00 45.00  ? 524 GLN A O     1 
ATOM   4194 C  CB    . GLN A 1 524 ? 34.784 58.133  -44.446 1.00 49.98  ? 524 GLN A CB    1 
ATOM   4195 C  CG    . GLN A 1 524 ? 34.645 57.875  -45.935 1.00 52.80  ? 524 GLN A CG    1 
ATOM   4196 C  CD    . GLN A 1 524 ? 35.403 58.884  -46.774 1.00 59.84  ? 524 GLN A CD    1 
ATOM   4197 O  OE1   . GLN A 1 524 ? 35.562 60.042  -46.383 1.00 60.54  ? 524 GLN A OE1   1 
ATOM   4198 N  NE2   . GLN A 1 524 ? 35.880 58.448  -47.934 1.00 58.28  ? 524 GLN A NE2   1 
ATOM   4199 N  N     . LEU A 1 525 ? 35.864 57.805  -41.479 1.00 41.26  ? 525 LEU A N     1 
ATOM   4200 C  CA    . LEU A 1 525 ? 35.918 58.321  -40.115 1.00 43.80  ? 525 LEU A CA    1 
ATOM   4201 C  C     . LEU A 1 525 ? 37.343 58.486  -39.606 1.00 48.25  ? 525 LEU A C     1 
ATOM   4202 O  O     . LEU A 1 525 ? 37.579 59.312  -38.717 1.00 52.77  ? 525 LEU A O     1 
ATOM   4203 C  CB    . LEU A 1 525 ? 35.139 57.403  -39.174 1.00 41.21  ? 525 LEU A CB    1 
ATOM   4204 C  CG    . LEU A 1 525 ? 33.619 57.407  -39.333 1.00 42.62  ? 525 LEU A CG    1 
ATOM   4205 C  CD1   . LEU A 1 525 ? 33.009 56.257  -38.556 1.00 46.06  ? 525 LEU A CD1   1 
ATOM   4206 C  CD2   . LEU A 1 525 ? 33.037 58.737  -38.876 1.00 46.78  ? 525 LEU A CD2   1 
ATOM   4207 N  N     . ILE A 1 526 ? 38.292 57.712  -40.131 1.00 46.87  ? 526 ILE A N     1 
ATOM   4208 C  CA    . ILE A 1 526 ? 39.680 57.867  -39.712 1.00 51.43  ? 526 ILE A CA    1 
ATOM   4209 C  C     . ILE A 1 526 ? 40.307 59.098  -40.363 1.00 52.73  ? 526 ILE A C     1 
ATOM   4210 O  O     . ILE A 1 526 ? 41.167 59.752  -39.763 1.00 53.84  ? 526 ILE A O     1 
ATOM   4211 C  CB    . ILE A 1 526 ? 40.466 56.582  -40.026 1.00 44.30  ? 526 ILE A CB    1 
ATOM   4212 C  CG1   . ILE A 1 526 ? 39.807 55.386  -39.337 1.00 48.37  ? 526 ILE A CG1   1 
ATOM   4213 C  CG2   . ILE A 1 526 ? 41.913 56.703  -39.576 1.00 45.67  ? 526 ILE A CG2   1 
ATOM   4214 C  CD1   . ILE A 1 526 ? 40.374 54.046  -39.746 1.00 43.16  ? 526 ILE A CD1   1 
ATOM   4215 N  N     . LYS A 1 527 ? 39.879 59.444  -41.582 1.00 54.51  ? 527 LYS A N     1 
ATOM   4216 C  CA    . LYS A 1 527 ? 40.390 60.644  -42.238 1.00 47.40  ? 527 LYS A CA    1 
ATOM   4217 C  C     . LYS A 1 527 ? 39.888 61.915  -41.565 1.00 46.90  ? 527 LYS A C     1 
ATOM   4218 O  O     . LYS A 1 527 ? 40.591 62.932  -41.564 1.00 56.93  ? 527 LYS A O     1 
ATOM   4219 C  CB    . LYS A 1 527 ? 39.993 60.649  -43.714 1.00 48.42  ? 527 LYS A CB    1 
ATOM   4220 C  CG    . LYS A 1 527 ? 40.524 59.478  -44.521 1.00 56.08  ? 527 LYS A CG    1 
ATOM   4221 C  CD    . LYS A 1 527 ? 40.150 59.620  -45.989 1.00 62.39  ? 527 LYS A CD    1 
ATOM   4222 C  CE    . LYS A 1 527 ? 40.720 58.482  -46.819 1.00 78.61  ? 527 LYS A CE    1 
ATOM   4223 N  NZ    . LYS A 1 527 ? 40.335 58.594  -48.253 1.00 81.72  ? 527 LYS A NZ    1 
ATOM   4224 N  N     . LYS A 1 528 ? 38.684 61.882  -41.000 1.00 45.16  ? 528 LYS A N     1 
ATOM   4225 C  CA    . LYS A 1 528 ? 38.110 63.066  -40.379 1.00 47.19  ? 528 LYS A CA    1 
ATOM   4226 C  C     . LYS A 1 528 ? 38.861 63.428  -39.104 1.00 45.06  ? 528 LYS A C     1 
ATOM   4227 O  O     . LYS A 1 528 ? 39.440 62.572  -38.430 1.00 44.93  ? 528 LYS A O     1 
ATOM   4228 C  CB    . LYS A 1 528 ? 36.634 62.839  -40.056 1.00 42.92  ? 528 LYS A CB    1 
ATOM   4229 C  CG    . LYS A 1 528 ? 35.768 62.485  -41.251 1.00 42.62  ? 528 LYS A CG    1 
ATOM   4230 C  CD    . LYS A 1 528 ? 35.677 63.634  -42.236 1.00 44.41  ? 528 LYS A CD    1 
ATOM   4231 C  CE    . LYS A 1 528 ? 34.711 63.311  -43.363 1.00 46.80  ? 528 LYS A CE    1 
ATOM   4232 N  NZ    . LYS A 1 528 ? 34.595 64.426  -44.340 1.00 46.82  ? 528 LYS A NZ    1 
ATOM   4233 N  N     . GLU A 1 529 ? 38.844 64.719  -38.773 1.00 45.60  ? 529 GLU A N     1 
ATOM   4234 C  CA    . GLU A 1 529 ? 39.450 65.193  -37.537 1.00 48.80  ? 529 GLU A CA    1 
ATOM   4235 C  C     . GLU A 1 529 ? 38.448 65.286  -36.395 1.00 48.28  ? 529 GLU A C     1 
ATOM   4236 O  O     . GLU A 1 529 ? 38.820 65.066  -35.237 1.00 52.35  ? 529 GLU A O     1 
ATOM   4237 C  CB    . GLU A 1 529 ? 40.109 66.558  -37.758 1.00 53.76  ? 529 GLU A CB    1 
ATOM   4238 C  CG    . GLU A 1 529 ? 41.342 66.509  -38.650 1.00 74.65  ? 529 GLU A CG    1 
ATOM   4239 C  CD    . GLU A 1 529 ? 41.946 67.879  -38.889 1.00 87.97  ? 529 GLU A CD    1 
ATOM   4240 O  OE1   . GLU A 1 529 ? 41.374 68.876  -38.400 1.00 89.96  ? 529 GLU A OE1   1 
ATOM   4241 O  OE2   . GLU A 1 529 ? 42.993 67.959  -39.566 1.00 85.81  ? 529 GLU A OE2   1 
ATOM   4242 N  N     . LYS A 1 530 ? 37.189 65.602  -36.695 1.00 51.62  ? 530 LYS A N     1 
ATOM   4243 C  CA    . LYS A 1 530 ? 36.135 65.643  -35.690 1.00 58.04  ? 530 LYS A CA    1 
ATOM   4244 C  C     . LYS A 1 530 ? 34.823 65.213  -36.328 1.00 52.21  ? 530 LYS A C     1 
ATOM   4245 O  O     . LYS A 1 530 ? 34.464 65.705  -37.403 1.00 55.57  ? 530 LYS A O     1 
ATOM   4246 C  CB    . LYS A 1 530 ? 35.992 67.045  -35.083 1.00 60.71  ? 530 LYS A CB    1 
ATOM   4247 C  CG    . LYS A 1 530 ? 37.089 67.422  -34.104 1.00 69.32  ? 530 LYS A CG    1 
ATOM   4248 C  CD    . LYS A 1 530 ? 36.896 68.833  -33.578 1.00 71.24  ? 530 LYS A CD    1 
ATOM   4249 C  CE    . LYS A 1 530 ? 38.021 69.228  -32.639 1.00 82.74  ? 530 LYS A CE    1 
ATOM   4250 N  NZ    . LYS A 1 530 ? 37.845 70.612  -32.125 1.00 96.82  ? 530 LYS A NZ    1 
ATOM   4251 N  N     . VAL A 1 531 ? 34.118 64.296  -35.669 1.00 42.32  ? 531 VAL A N     1 
ATOM   4252 C  CA    . VAL A 1 531 ? 32.811 63.826  -36.115 1.00 38.58  ? 531 VAL A CA    1 
ATOM   4253 C  C     . VAL A 1 531 ? 31.885 63.789  -34.909 1.00 37.68  ? 531 VAL A C     1 
ATOM   4254 O  O     . VAL A 1 531 ? 32.269 63.298  -33.843 1.00 37.56  ? 531 VAL A O     1 
ATOM   4255 C  CB    . VAL A 1 531 ? 32.886 62.432  -36.774 1.00 38.18  ? 531 VAL A CB    1 
ATOM   4256 C  CG1   . VAL A 1 531 ? 31.497 61.949  -37.165 1.00 37.16  ? 531 VAL A CG1   1 
ATOM   4257 C  CG2   . VAL A 1 531 ? 33.794 62.460  -37.989 1.00 39.29  ? 531 VAL A CG2   1 
ATOM   4258 N  N     . TYR A 1 532 ? 30.673 64.316  -35.070 1.00 37.18  ? 532 TYR A N     1 
ATOM   4259 C  CA    . TYR A 1 532 ? 29.648 64.250  -34.035 1.00 36.45  ? 532 TYR A CA    1 
ATOM   4260 C  C     . TYR A 1 532 ? 28.397 63.634  -34.638 1.00 44.02  ? 532 TYR A C     1 
ATOM   4261 O  O     . TYR A 1 532 ? 27.866 64.146  -35.629 1.00 52.48  ? 532 TYR A O     1 
ATOM   4262 C  CB    . TYR A 1 532 ? 29.342 65.633  -33.451 1.00 36.95  ? 532 TYR A CB    1 
ATOM   4263 C  CG    . TYR A 1 532 ? 28.210 65.625  -32.447 1.00 36.41  ? 532 TYR A CG    1 
ATOM   4264 C  CD1   . TYR A 1 532 ? 28.414 65.198  -31.141 1.00 44.25  ? 532 TYR A CD1   1 
ATOM   4265 C  CD2   . TYR A 1 532 ? 26.935 66.043  -32.806 1.00 36.05  ? 532 TYR A CD2   1 
ATOM   4266 C  CE1   . TYR A 1 532 ? 27.381 65.188  -30.220 1.00 36.13  ? 532 TYR A CE1   1 
ATOM   4267 C  CE2   . TYR A 1 532 ? 25.896 66.037  -31.892 1.00 35.75  ? 532 TYR A CE2   1 
ATOM   4268 C  CZ    . TYR A 1 532 ? 26.125 65.609  -30.602 1.00 44.01  ? 532 TYR A CZ    1 
ATOM   4269 O  OH    . TYR A 1 532 ? 25.093 65.601  -29.691 1.00 50.71  ? 532 TYR A OH    1 
ATOM   4270 N  N     . LEU A 1 533 ? 27.930 62.541  -34.040 1.00 44.39  ? 533 LEU A N     1 
ATOM   4271 C  CA    . LEU A 1 533 ? 26.791 61.783  -34.540 1.00 38.69  ? 533 LEU A CA    1 
ATOM   4272 C  C     . LEU A 1 533 ? 25.662 61.871  -33.524 1.00 36.51  ? 533 LEU A C     1 
ATOM   4273 O  O     . LEU A 1 533 ? 25.832 61.475  -32.366 1.00 44.57  ? 533 LEU A O     1 
ATOM   4274 C  CB    . LEU A 1 533 ? 27.183 60.327  -34.795 1.00 47.06  ? 533 LEU A CB    1 
ATOM   4275 C  CG    . LEU A 1 533 ? 26.197 59.453  -35.568 1.00 58.19  ? 533 LEU A CG    1 
ATOM   4276 C  CD1   . LEU A 1 533 ? 26.011 59.985  -36.978 1.00 64.07  ? 533 LEU A CD1   1 
ATOM   4277 C  CD2   . LEU A 1 533 ? 26.682 58.015  -35.596 1.00 66.02  ? 533 LEU A CD2   1 
ATOM   4278 N  N     . ALA A 1 534 ? 24.517 62.393  -33.955 1.00 40.24  ? 534 ALA A N     1 
ATOM   4279 C  CA    . ALA A 1 534 ? 23.353 62.557  -33.099 1.00 38.65  ? 534 ALA A CA    1 
ATOM   4280 C  C     . ALA A 1 534 ? 22.185 61.753  -33.656 1.00 34.79  ? 534 ALA A C     1 
ATOM   4281 O  O     . ALA A 1 534 ? 22.192 61.332  -34.816 1.00 35.30  ? 534 ALA A O     1 
ATOM   4282 C  CB    . ALA A 1 534 ? 22.963 64.034  -32.966 1.00 34.14  ? 534 ALA A CB    1 
ATOM   4283 N  N     . TRP A 1 535 ? 21.172 61.546  -32.816 1.00 33.60  ? 535 TRP A N     1 
ATOM   4284 C  CA    . TRP A 1 535 ? 20.029 60.720  -33.176 1.00 38.97  ? 535 TRP A CA    1 
ATOM   4285 C  C     . TRP A 1 535 ? 18.725 61.441  -32.867 1.00 41.34  ? 535 TRP A C     1 
ATOM   4286 O  O     . TRP A 1 535 ? 18.577 62.051  -31.805 1.00 56.72  ? 535 TRP A O     1 
ATOM   4287 C  CB    . TRP A 1 535 ? 20.060 59.376  -32.439 1.00 41.59  ? 535 TRP A CB    1 
ATOM   4288 C  CG    . TRP A 1 535 ? 18.904 58.500  -32.790 1.00 35.76  ? 535 TRP A CG    1 
ATOM   4289 C  CD1   . TRP A 1 535 ? 18.824 57.631  -33.838 1.00 40.32  ? 535 TRP A CD1   1 
ATOM   4290 C  CD2   . TRP A 1 535 ? 17.651 58.416  -32.102 1.00 35.96  ? 535 TRP A CD2   1 
ATOM   4291 N  NE1   . TRP A 1 535 ? 17.601 57.007  -33.843 1.00 43.13  ? 535 TRP A NE1   1 
ATOM   4292 C  CE2   . TRP A 1 535 ? 16.861 57.471  -32.787 1.00 44.31  ? 535 TRP A CE2   1 
ATOM   4293 C  CE3   . TRP A 1 535 ? 17.121 59.046  -30.972 1.00 40.57  ? 535 TRP A CE3   1 
ATOM   4294 C  CZ2   . TRP A 1 535 ? 15.570 57.140  -32.379 1.00 34.01  ? 535 TRP A CZ2   1 
ATOM   4295 C  CZ3   . TRP A 1 535 ? 15.838 58.716  -30.568 1.00 45.76  ? 535 TRP A CZ3   1 
ATOM   4296 C  CH2   . TRP A 1 535 ? 15.078 57.772  -31.271 1.00 42.14  ? 535 TRP A CH2   1 
ATOM   4297 N  N     . VAL A 1 536 ? 17.782 61.359  -33.802 1.00 34.74  ? 536 VAL A N     1 
ATOM   4298 C  CA    . VAL A 1 536 ? 16.444 61.923  -33.629 1.00 49.50  ? 536 VAL A CA    1 
ATOM   4299 C  C     . VAL A 1 536 ? 15.412 60.883  -34.052 1.00 52.05  ? 536 VAL A C     1 
ATOM   4300 O  O     . VAL A 1 536 ? 15.705 60.032  -34.905 1.00 39.41  ? 536 VAL A O     1 
ATOM   4301 C  CB    . VAL A 1 536 ? 16.274 63.229  -34.424 1.00 34.41  ? 536 VAL A CB    1 
ATOM   4302 C  CG1   . VAL A 1 536 ? 17.254 64.288  -33.939 1.00 34.40  ? 536 VAL A CG1   1 
ATOM   4303 C  CG2   . VAL A 1 536 ? 16.438 62.976  -35.916 1.00 34.40  ? 536 VAL A CG2   1 
ATOM   4304 N  N     . PRO A 1 537 ? 14.206 60.902  -33.485 1.00 48.94  ? 537 PRO A N     1 
ATOM   4305 C  CA    . PRO A 1 537 ? 13.189 59.924  -33.890 1.00 40.37  ? 537 PRO A CA    1 
ATOM   4306 C  C     . PRO A 1 537 ? 12.708 60.174  -35.311 1.00 40.94  ? 537 PRO A C     1 
ATOM   4307 O  O     . PRO A 1 537 ? 12.563 61.318  -35.747 1.00 51.45  ? 537 PRO A O     1 
ATOM   4308 C  CB    . PRO A 1 537 ? 12.059 60.140  -32.875 1.00 39.81  ? 537 PRO A CB    1 
ATOM   4309 C  CG    . PRO A 1 537 ? 12.686 60.885  -31.739 1.00 48.06  ? 537 PRO A CG    1 
ATOM   4310 C  CD    . PRO A 1 537 ? 13.759 61.725  -32.350 1.00 46.34  ? 537 PRO A CD    1 
ATOM   4311 N  N     . ALA A 1 538 ? 12.453 59.085  -36.029 1.00 45.57  ? 538 ALA A N     1 
ATOM   4312 C  CA    . ALA A 1 538 ? 11.989 59.170  -37.404 1.00 49.38  ? 538 ALA A CA    1 
ATOM   4313 C  C     . ALA A 1 538 ? 10.494 59.464  -37.458 1.00 53.85  ? 538 ALA A C     1 
ATOM   4314 O  O     . ALA A 1 538 ? 9.724  59.054  -36.584 1.00 54.69  ? 538 ALA A O     1 
ATOM   4315 C  CB    . ALA A 1 538 ? 12.287 57.870  -38.151 1.00 36.54  ? 538 ALA A CB    1 
ATOM   4316 N  N     . HIS A 1 539 ? 10.092 60.189  -38.505 1.00 56.47  ? 539 HIS A N     1 
ATOM   4317 C  CA    . HIS A 1 539 ? 8.685  60.475  -38.791 1.00 58.40  ? 539 HIS A CA    1 
ATOM   4318 C  C     . HIS A 1 539 ? 8.020  61.225  -37.636 1.00 57.26  ? 539 HIS A C     1 
ATOM   4319 O  O     . HIS A 1 539 ? 6.928  60.875  -37.182 1.00 51.81  ? 539 HIS A O     1 
ATOM   4320 C  CB    . HIS A 1 539 ? 7.922  59.190  -39.124 1.00 51.37  ? 539 HIS A CB    1 
ATOM   4321 C  CG    . HIS A 1 539 ? 8.632  58.298  -40.095 1.00 46.03  ? 539 HIS A CG    1 
ATOM   4322 N  ND1   . HIS A 1 539 ? 9.215  57.106  -39.721 1.00 39.31  ? 539 HIS A ND1   1 
ATOM   4323 C  CD2   . HIS A 1 539 ? 8.856  58.426  -41.425 1.00 51.75  ? 539 HIS A CD2   1 
ATOM   4324 C  CE1   . HIS A 1 539 ? 9.765  56.536  -40.779 1.00 42.08  ? 539 HIS A CE1   1 
ATOM   4325 N  NE2   . HIS A 1 539 ? 9.562  57.317  -41.825 1.00 53.40  ? 539 HIS A NE2   1 
ATOM   4326 N  N     . LYS A 1 540 ? 8.692  62.275  -37.160 1.00 62.04  ? 540 LYS A N     1 
ATOM   4327 C  CA    . LYS A 1 540 ? 8.173  63.096  -36.072 1.00 53.73  ? 540 LYS A CA    1 
ATOM   4328 C  C     . LYS A 1 540 ? 8.224  64.587  -36.387 1.00 55.64  ? 540 LYS A C     1 
ATOM   4329 O  O     . LYS A 1 540 ? 8.030  65.405  -35.480 1.00 59.99  ? 540 LYS A O     1 
ATOM   4330 C  CB    . LYS A 1 540 ? 8.935  62.809  -34.772 1.00 53.30  ? 540 LYS A CB    1 
ATOM   4331 C  CG    . LYS A 1 540 ? 8.723  61.406  -34.224 1.00 47.20  ? 540 LYS A CG    1 
ATOM   4332 C  CD    . LYS A 1 540 ? 7.283  61.202  -33.785 1.00 66.99  ? 540 LYS A CD    1 
ATOM   4333 C  CE    . LYS A 1 540 ? 7.035  59.774  -33.325 1.00 72.90  ? 540 LYS A CE    1 
ATOM   4334 N  NZ    . LYS A 1 540 ? 5.622  59.577  -32.898 1.00 74.03  ? 540 LYS A NZ    1 
ATOM   4335 N  N     . GLY A 1 541 ? 8.479  64.964  -37.639 1.00 46.42  ? 541 GLY A N     1 
ATOM   4336 C  CA    . GLY A 1 541 ? 8.475  66.360  -38.023 1.00 52.35  ? 541 GLY A CA    1 
ATOM   4337 C  C     . GLY A 1 541 ? 9.679  67.160  -37.584 1.00 63.74  ? 541 GLY A C     1 
ATOM   4338 O  O     . GLY A 1 541 ? 9.698  68.380  -37.785 1.00 76.05  ? 541 GLY A O     1 
ATOM   4339 N  N     . ILE A 1 542 ? 10.684 66.519  -36.989 1.00 55.81  ? 542 ILE A N     1 
ATOM   4340 C  CA    . ILE A 1 542 ? 11.892 67.225  -36.586 1.00 49.78  ? 542 ILE A CA    1 
ATOM   4341 C  C     . ILE A 1 542 ? 12.697 67.603  -37.822 1.00 59.31  ? 542 ILE A C     1 
ATOM   4342 O  O     . ILE A 1 542 ? 12.870 66.795  -38.745 1.00 72.74  ? 542 ILE A O     1 
ATOM   4343 C  CB    . ILE A 1 542 ? 12.715 66.355  -35.621 1.00 45.44  ? 542 ILE A CB    1 
ATOM   4344 C  CG1   . ILE A 1 542 ? 11.861 65.957  -34.416 1.00 43.15  ? 542 ILE A CG1   1 
ATOM   4345 C  CG2   . ILE A 1 542 ? 13.973 67.084  -35.171 1.00 59.22  ? 542 ILE A CG2   1 
ATOM   4346 C  CD1   . ILE A 1 542 ? 12.553 65.017  -33.459 1.00 44.33  ? 542 ILE A CD1   1 
ATOM   4347 N  N     . GLY A 1 543 ? 13.179 68.841  -37.855 1.00 54.35  ? 543 GLY A N     1 
ATOM   4348 C  CA    . GLY A 1 543 ? 13.993 69.309  -38.964 1.00 51.92  ? 543 GLY A CA    1 
ATOM   4349 C  C     . GLY A 1 543 ? 15.472 69.289  -38.630 1.00 67.98  ? 543 GLY A C     1 
ATOM   4350 O  O     . GLY A 1 543 ? 15.847 69.445  -37.468 1.00 83.50  ? 543 GLY A O     1 
ATOM   4351 N  N     . GLY A 1 544 ? 16.319 69.090  -39.637 1.00 65.23  ? 544 GLY A N     1 
ATOM   4352 C  CA    . GLY A 1 544 ? 15.877 68.876  -41.001 1.00 54.72  ? 544 GLY A CA    1 
ATOM   4353 C  C     . GLY A 1 544 ? 15.766 67.408  -41.361 1.00 55.00  ? 544 GLY A C     1 
ATOM   4354 O  O     . GLY A 1 544 ? 15.897 67.031  -42.526 1.00 48.54  ? 544 GLY A O     1 
ATOM   4355 N  N     . ASN A 1 545 ? 15.536 66.570  -40.346 1.00 52.56  ? 545 ASN A N     1 
ATOM   4356 C  CA    . ASN A 1 545 ? 15.231 65.168  -40.606 1.00 44.72  ? 545 ASN A CA    1 
ATOM   4357 C  C     . ASN A 1 545 ? 13.954 65.027  -41.421 1.00 52.32  ? 545 ASN A C     1 
ATOM   4358 O  O     . ASN A 1 545 ? 13.795 64.055  -42.169 1.00 52.21  ? 545 ASN A O     1 
ATOM   4359 C  CB    . ASN A 1 545 ? 15.110 64.401  -39.289 1.00 45.19  ? 545 ASN A CB    1 
ATOM   4360 C  CG    . ASN A 1 545 ? 14.526 63.012  -39.473 1.00 44.09  ? 545 ASN A CG    1 
ATOM   4361 O  OD1   . ASN A 1 545 ? 13.331 62.796  -39.268 1.00 40.17  ? 545 ASN A OD1   1 
ATOM   4362 N  ND2   . ASN A 1 545 ? 15.367 62.064  -39.868 1.00 46.19  ? 545 ASN A ND2   1 
ATOM   4363 N  N     . GLU A 1 546 ? 13.039 65.990  -41.293 1.00 54.23  ? 546 GLU A N     1 
ATOM   4364 C  CA    . GLU A 1 546 ? 11.813 65.966  -42.081 1.00 54.28  ? 546 GLU A CA    1 
ATOM   4365 C  C     . GLU A 1 546 ? 12.098 66.230  -43.555 1.00 52.41  ? 546 GLU A C     1 
ATOM   4366 O  O     . GLU A 1 546 ? 11.454 65.644  -44.432 1.00 59.27  ? 546 GLU A O     1 
ATOM   4367 C  CB    . GLU A 1 546 ? 10.827 66.991  -41.526 1.00 73.65  ? 546 GLU A CB    1 
ATOM   4368 C  CG    . GLU A 1 546 ? 9.517  67.083  -42.279 1.00 86.13  ? 546 GLU A CG    1 
ATOM   4369 C  CD    . GLU A 1 546 ? 8.622  68.178  -41.739 1.00 89.48  ? 546 GLU A CD    1 
ATOM   4370 O  OE1   . GLU A 1 546 ? 7.428  68.203  -42.102 1.00 99.73  ? 546 GLU A OE1   1 
ATOM   4371 O  OE2   . GLU A 1 546 ? 9.115  69.012  -40.950 1.00 77.06  ? 546 GLU A OE2   1 
ATOM   4372 N  N     . GLN A 1 547 ? 13.068 67.101  -43.847 1.00 41.64  ? 547 GLN A N     1 
ATOM   4373 C  CA    . GLN A 1 547 ? 13.373 67.433  -45.236 1.00 53.22  ? 547 GLN A CA    1 
ATOM   4374 C  C     . GLN A 1 547 ? 14.033 66.265  -45.961 1.00 60.12  ? 547 GLN A C     1 
ATOM   4375 O  O     . GLN A 1 547 ? 13.665 65.948  -47.098 1.00 66.69  ? 547 GLN A O     1 
ATOM   4376 C  CB    . GLN A 1 547 ? 14.265 68.674  -45.298 1.00 53.84  ? 547 GLN A CB    1 
ATOM   4377 C  CG    . GLN A 1 547 ? 13.504 69.992  -45.319 1.00 54.23  ? 547 GLN A CG    1 
ATOM   4378 C  CD    . GLN A 1 547 ? 12.751 70.257  -44.031 1.00 59.57  ? 547 GLN A CD    1 
ATOM   4379 O  OE1   . GLN A 1 547 ? 13.354 70.484  -42.981 1.00 62.80  ? 547 GLN A OE1   1 
ATOM   4380 N  NE2   . GLN A 1 547 ? 11.424 70.230  -44.103 1.00 60.43  ? 547 GLN A NE2   1 
ATOM   4381 N  N     . VAL A 1 548 ? 15.014 65.618  -45.326 1.00 56.86  ? 548 VAL A N     1 
ATOM   4382 C  CA    . VAL A 1 548 ? 15.697 64.506  -45.981 1.00 50.73  ? 548 VAL A CA    1 
ATOM   4383 C  C     . VAL A 1 548 ? 14.774 63.300  -46.100 1.00 51.72  ? 548 VAL A C     1 
ATOM   4384 O  O     . VAL A 1 548 ? 14.887 62.513  -47.049 1.00 44.06  ? 548 VAL A O     1 
ATOM   4385 C  CB    . VAL A 1 548 ? 16.999 64.161  -45.231 1.00 44.57  ? 548 VAL A CB    1 
ATOM   4386 C  CG1   . VAL A 1 548 ? 16.710 63.798  -43.783 1.00 40.88  ? 548 VAL A CG1   1 
ATOM   4387 C  CG2   . VAL A 1 548 ? 17.749 63.033  -45.935 1.00 49.45  ? 548 VAL A CG2   1 
ATOM   4388 N  N     . ASP A 1 549 ? 13.837 63.142  -45.161 1.00 47.77  ? 549 ASP A N     1 
ATOM   4389 C  CA    . ASP A 1 549 ? 12.920 62.008  -45.216 1.00 49.49  ? 549 ASP A CA    1 
ATOM   4390 C  C     . ASP A 1 549 ? 12.013 62.087  -46.437 1.00 50.28  ? 549 ASP A C     1 
ATOM   4391 O  O     . ASP A 1 549 ? 11.713 61.065  -47.062 1.00 45.75  ? 549 ASP A O     1 
ATOM   4392 C  CB    . ASP A 1 549 ? 12.091 61.941  -43.934 1.00 48.88  ? 549 ASP A CB    1 
ATOM   4393 C  CG    . ASP A 1 549 ? 11.005 60.889  -43.998 1.00 53.90  ? 549 ASP A CG    1 
ATOM   4394 O  OD1   . ASP A 1 549 ? 11.297 59.712  -43.701 1.00 69.84  ? 549 ASP A OD1   1 
ATOM   4395 O  OD2   . ASP A 1 549 ? 9.856  61.240  -44.343 1.00 54.63  ? 549 ASP A OD2   1 
ATOM   4396 N  N     . LYS A 1 550 ? 11.567 63.294  -46.795 1.00 52.52  ? 550 LYS A N     1 
ATOM   4397 C  CA    . LYS A 1 550 ? 10.718 63.438  -47.972 1.00 58.46  ? 550 LYS A CA    1 
ATOM   4398 C  C     . LYS A 1 550 ? 11.503 63.235  -49.261 1.00 62.07  ? 550 LYS A C     1 
ATOM   4399 O  O     . LYS A 1 550 ? 10.929 62.815  -50.273 1.00 70.67  ? 550 LYS A O     1 
ATOM   4400 C  CB    . LYS A 1 550 ? 10.039 64.809  -47.974 1.00 67.42  ? 550 LYS A CB    1 
ATOM   4401 C  CG    . LYS A 1 550 ? 8.866  64.924  -47.011 1.00 85.22  ? 550 LYS A CG    1 
ATOM   4402 C  CD    . LYS A 1 550 ? 8.008  66.144  -47.324 1.00 90.85  ? 550 LYS A CD    1 
ATOM   4403 C  CE    . LYS A 1 550 ? 8.722  67.441  -46.979 1.00 85.43  ? 550 LYS A CE    1 
ATOM   4404 N  NZ    . LYS A 1 550 ? 8.890  67.606  -45.508 1.00 80.43  ? 550 LYS A NZ    1 
ATOM   4405 N  N     . LEU A 1 551 ? 12.807 63.519  -49.249 1.00 58.44  ? 551 LEU A N     1 
ATOM   4406 C  CA    . LEU A 1 551 ? 13.610 63.351  -50.456 1.00 51.50  ? 551 LEU A CA    1 
ATOM   4407 C  C     . LEU A 1 551 ? 13.843 61.876  -50.766 1.00 56.60  ? 551 LEU A C     1 
ATOM   4408 O  O     . LEU A 1 551 ? 13.664 61.437  -51.908 1.00 54.45  ? 551 LEU A O     1 
ATOM   4409 C  CB    . LEU A 1 551 ? 14.941 64.089  -50.313 1.00 47.21  ? 551 LEU A CB    1 
ATOM   4410 C  CG    . LEU A 1 551 ? 14.903 65.611  -50.473 1.00 55.99  ? 551 LEU A CG    1 
ATOM   4411 C  CD1   . LEU A 1 551 ? 16.299 66.197  -50.347 1.00 48.51  ? 551 LEU A CD1   1 
ATOM   4412 C  CD2   . LEU A 1 551 ? 14.281 65.993  -51.807 1.00 60.94  ? 551 LEU A CD2   1 
ATOM   4413 N  N     . VAL A 1 552 ? 14.243 61.092  -49.761 1.00 46.08  ? 552 VAL A N     1 
ATOM   4414 C  CA    . VAL A 1 552 ? 14.542 59.684  -50.004 1.00 56.29  ? 552 VAL A CA    1 
ATOM   4415 C  C     . VAL A 1 552 ? 13.285 58.829  -50.104 1.00 60.17  ? 552 VAL A C     1 
ATOM   4416 O  O     . VAL A 1 552 ? 13.335 57.740  -50.689 1.00 59.96  ? 552 VAL A O     1 
ATOM   4417 C  CB    . VAL A 1 552 ? 15.470 59.117  -48.916 1.00 52.67  ? 552 VAL A CB    1 
ATOM   4418 C  CG1   . VAL A 1 552 ? 16.754 59.929  -48.836 1.00 41.26  ? 552 VAL A CG1   1 
ATOM   4419 C  CG2   . VAL A 1 552 ? 14.763 59.079  -47.569 1.00 40.79  ? 552 VAL A CG2   1 
ATOM   4420 N  N     . SER A 1 553 ? 12.157 59.285  -49.553 1.00 56.23  ? 553 SER A N     1 
ATOM   4421 C  CA    . SER A 1 553 ? 10.916 58.526  -49.663 1.00 56.68  ? 553 SER A CA    1 
ATOM   4422 C  C     . SER A 1 553 ? 10.228 58.718  -51.006 1.00 61.53  ? 553 SER A C     1 
ATOM   4423 O  O     . SER A 1 553 ? 9.372  57.904  -51.369 1.00 74.85  ? 553 SER A O     1 
ATOM   4424 C  CB    . SER A 1 553 ? 9.950  58.911  -48.541 1.00 60.65  ? 553 SER A CB    1 
ATOM   4425 O  OG    . SER A 1 553 ? 10.428 58.479  -47.279 1.00 77.40  ? 553 SER A OG    1 
ATOM   4426 N  N     . ALA A 1 554 ? 10.579 59.767  -51.746 1.00 50.07  ? 554 ALA A N     1 
ATOM   4427 C  CA    . ALA A 1 554 ? 9.953  60.040  -53.033 1.00 55.14  ? 554 ALA A CA    1 
ATOM   4428 C  C     . ALA A 1 554 ? 10.242 58.935  -54.041 1.00 65.90  ? 554 ALA A C     1 
ATOM   4429 O  O     . ALA A 1 554 ? 11.391 58.742  -54.455 1.00 72.66  ? 554 ALA A O     1 
ATOM   4430 C  CB    . ALA A 1 554 ? 10.426 61.383  -53.583 1.00 48.14  ? 554 ALA A CB    1 
ATOM   4431 N  N     . GLY A 1 555 ? 9.207  58.199  -54.436 1.00 65.82  ? 555 GLY A N     1 
ATOM   4432 C  CA    . GLY A 1 555 ? 9.322  57.205  -55.474 1.00 67.93  ? 555 GLY A CA    1 
ATOM   4433 C  C     . GLY A 1 555 ? 9.482  55.774  -54.999 1.00 65.84  ? 555 GLY A C     1 
ATOM   4434 O  O     . GLY A 1 555 ? 9.347  54.853  -55.815 1.00 71.15  ? 555 GLY A O     1 
ATOM   4435 N  N     . ILE A 1 556 ? 9.779  55.560  -53.716 1.00 65.31  ? 556 ILE A N     1 
ATOM   4436 C  CA    . ILE A 1 556 ? 9.938  54.222  -53.164 1.00 81.33  ? 556 ILE A CA    1 
ATOM   4437 C  C     . ILE A 1 556 ? 9.070  53.994  -51.940 1.00 88.50  ? 556 ILE A C     1 
ATOM   4438 O  O     . ILE A 1 556 ? 9.184  52.947  -51.308 1.00 83.10  ? 556 ILE A O     1 
ATOM   4439 C  CB    . ILE A 1 556 ? 11.418 53.924  -52.830 1.00 69.60  ? 556 ILE A CB    1 
ATOM   4440 C  CG1   . ILE A 1 556 ? 11.919 54.824  -51.691 1.00 53.02  ? 556 ILE A CG1   1 
ATOM   4441 C  CG2   . ILE A 1 556 ? 12.292 54.122  -54.038 1.00 69.30  ? 556 ILE A CG2   1 
ATOM   4442 C  CD1   . ILE A 1 556 ? 12.112 54.102  -50.383 1.00 57.05  ? 556 ILE A CD1   1 
ATOM   4443 N  N     . ARG A 1 557 ? 8.214  54.949  -51.576 1.00 95.38  ? 557 ARG A N     1 
ATOM   4444 C  CA    . ARG A 1 557 ? 7.395  54.829  -50.374 1.00 98.29  ? 557 ARG A CA    1 
ATOM   4445 C  C     . ARG A 1 557 ? 6.203  55.768  -50.499 1.00 108.09 ? 557 ARG A C     1 
ATOM   4446 O  O     . ARG A 1 557 ? 6.381  56.930  -50.875 1.00 112.02 ? 557 ARG A O     1 
ATOM   4447 C  CB    . ARG A 1 557 ? 8.201  55.166  -49.107 1.00 94.73  ? 557 ARG A CB    1 
ATOM   4448 C  CG    . ARG A 1 557 ? 7.361  55.285  -47.828 1.00 96.26  ? 557 ARG A CG    1 
ATOM   4449 C  CD    . ARG A 1 557 ? 8.236  55.710  -46.676 1.00 100.20 ? 557 ARG A CD    1 
ATOM   4450 N  NE    . ARG A 1 557 ? 9.221  54.688  -46.340 1.00 105.45 ? 557 ARG A NE    1 
ATOM   4451 C  CZ    . ARG A 1 557 ? 10.200 54.867  -45.461 1.00 109.38 ? 557 ARG A CZ    1 
ATOM   4452 N  NH1   . ARG A 1 557 ? 10.327 56.032  -44.841 1.00 107.56 ? 557 ARG A NH1   1 
ATOM   4453 N  NH2   . ARG A 1 557 ? 11.052 53.885  -45.205 1.00 111.33 ? 557 ARG A NH2   1 
ATOM   4454 N  N     . LYS A 1 558 ? 5.000  55.262  -50.205 1.00 108.42 ? 558 LYS A N     1 
ATOM   4455 C  CA    . LYS A 1 558 ? 3.743  56.033  -50.236 1.00 103.22 ? 558 LYS A CA    1 
ATOM   4456 C  C     . LYS A 1 558 ? 3.624  56.987  -51.430 1.00 97.54  ? 558 LYS A C     1 
ATOM   4457 O  O     . LYS A 1 558 ? 2.641  56.948  -52.170 1.00 95.79  ? 558 LYS A O     1 
ATOM   4458 C  CB    . LYS A 1 558 ? 3.565  56.822  -48.929 1.00 104.48 ? 558 LYS A CB    1 
ATOM   4459 C  CG    . LYS A 1 558 ? 4.367  58.107  -48.837 1.00 109.31 ? 558 LYS A CG    1 
ATOM   4460 C  CD    . LYS A 1 558 ? 4.214  58.751  -47.469 1.00 110.27 ? 558 LYS A CD    1 
ATOM   4461 C  CE    . LYS A 1 558 ? 4.989  60.059  -47.379 1.00 107.23 ? 558 LYS A CE    1 
ATOM   4462 N  NZ    . LYS A 1 558 ? 6.455  59.859  -47.558 1.00 101.41 ? 558 LYS A NZ    1 
ATOM   4463 N  N     . PRO B 2 4   ? 14.355 7.897   9.286   1.00 123.43 ? 4   PRO B N     1 
ATOM   4464 C  CA    . PRO B 2 4   ? 13.225 8.136   10.191  1.00 129.41 ? 4   PRO B CA    1 
ATOM   4465 C  C     . PRO B 2 4   ? 12.032 8.770   9.481   1.00 137.74 ? 4   PRO B C     1 
ATOM   4466 O  O     . PRO B 2 4   ? 11.026 8.099   9.248   1.00 138.14 ? 4   PRO B O     1 
ATOM   4467 C  CB    . PRO B 2 4   ? 13.811 9.092   11.233  1.00 124.09 ? 4   PRO B CB    1 
ATOM   4468 N  N     . ILE B 2 5   ? 12.151 10.055  9.146   1.00 143.78 ? 5   ILE B N     1 
ATOM   4469 C  CA    . ILE B 2 5   ? 11.076 10.756  8.455   1.00 148.77 ? 5   ILE B CA    1 
ATOM   4470 C  C     . ILE B 2 5   ? 10.942 10.220  7.036   1.00 145.12 ? 5   ILE B C     1 
ATOM   4471 O  O     . ILE B 2 5   ? 11.940 10.005  6.334   1.00 143.74 ? 5   ILE B O     1 
ATOM   4472 C  CB    . ILE B 2 5   ? 11.340 12.272  8.454   1.00 155.37 ? 5   ILE B CB    1 
ATOM   4473 C  CG1   . ILE B 2 5   ? 11.507 12.787  9.885   1.00 160.25 ? 5   ILE B CG1   1 
ATOM   4474 C  CG2   . ILE B 2 5   ? 10.215 13.014  7.750   1.00 153.50 ? 5   ILE B CG2   1 
ATOM   4475 C  CD1   . ILE B 2 5   ? 11.756 14.277  9.972   1.00 157.87 ? 5   ILE B CD1   1 
ATOM   4476 N  N     . GLU B 2 6   ? 9.702  9.997   6.608   1.00 140.95 ? 6   GLU B N     1 
ATOM   4477 C  CA    . GLU B 2 6   ? 9.452  9.522   5.256   1.00 134.60 ? 6   GLU B CA    1 
ATOM   4478 C  C     . GLU B 2 6   ? 9.650  10.654  4.250   1.00 123.84 ? 6   GLU B C     1 
ATOM   4479 O  O     . GLU B 2 6   ? 9.546  11.840  4.577   1.00 124.34 ? 6   GLU B O     1 
ATOM   4480 C  CB    . GLU B 2 6   ? 8.038  8.951   5.143   1.00 136.71 ? 6   GLU B CB    1 
ATOM   4481 C  CG    . GLU B 2 6   ? 7.857  7.941   4.019   1.00 140.03 ? 6   GLU B CG    1 
ATOM   4482 C  CD    . GLU B 2 6   ? 6.427  7.447   3.901   1.00 144.72 ? 6   GLU B CD    1 
ATOM   4483 O  OE1   . GLU B 2 6   ? 5.513  8.290   3.773   1.00 146.50 ? 6   GLU B OE1   1 
ATOM   4484 O  OE2   . GLU B 2 6   ? 6.216  6.217   3.944   1.00 144.51 ? 6   GLU B OE2   1 
ATOM   4485 N  N     . THR B 2 7   ? 9.944  10.274  3.011   1.00 114.28 ? 7   THR B N     1 
ATOM   4486 C  CA    . THR B 2 7   ? 10.186 11.237  1.948   1.00 102.05 ? 7   THR B CA    1 
ATOM   4487 C  C     . THR B 2 7   ? 8.879  11.628  1.263   1.00 96.47  ? 7   THR B C     1 
ATOM   4488 O  O     . THR B 2 7   ? 7.861  10.941  1.369   1.00 98.69  ? 7   THR B O     1 
ATOM   4489 C  CB    . THR B 2 7   ? 11.161 10.671  0.913   1.00 96.55  ? 7   THR B CB    1 
ATOM   4490 O  OG1   . THR B 2 7   ? 10.550 9.569   0.230   1.00 97.89  ? 7   THR B OG1   1 
ATOM   4491 C  CG2   . THR B 2 7   ? 12.438 10.195  1.588   1.00 89.01  ? 7   THR B CG2   1 
ATOM   4492 N  N     . VAL B 2 8   ? 8.925  12.747  0.552   1.00 91.32  ? 8   VAL B N     1 
ATOM   4493 C  CA    . VAL B 2 8   ? 7.798  13.256  -0.223  1.00 89.45  ? 8   VAL B CA    1 
ATOM   4494 C  C     . VAL B 2 8   ? 8.088  12.994  -1.697  1.00 90.02  ? 8   VAL B C     1 
ATOM   4495 O  O     . VAL B 2 8   ? 9.088  13.502  -2.222  1.00 88.06  ? 8   VAL B O     1 
ATOM   4496 C  CB    . VAL B 2 8   ? 7.559  14.753  0.032   1.00 77.58  ? 8   VAL B CB    1 
ATOM   4497 C  CG1   . VAL B 2 8   ? 6.360  15.241  -0.769  1.00 71.60  ? 8   VAL B CG1   1 
ATOM   4498 C  CG2   . VAL B 2 8   ? 7.361  15.015  1.517   1.00 74.62  ? 8   VAL B CG2   1 
ATOM   4499 N  N     . PRO B 2 9   ? 7.258  12.220  -2.397  1.00 83.08  ? 9   PRO B N     1 
ATOM   4500 C  CA    . PRO B 2 9   ? 7.535  11.932  -3.812  1.00 76.45  ? 9   PRO B CA    1 
ATOM   4501 C  C     . PRO B 2 9   ? 7.387  13.181  -4.669  1.00 76.38  ? 9   PRO B C     1 
ATOM   4502 O  O     . PRO B 2 9   ? 6.348  13.843  -4.657  1.00 82.72  ? 9   PRO B O     1 
ATOM   4503 C  CB    . PRO B 2 9   ? 6.487  10.871  -4.170  1.00 70.32  ? 9   PRO B CB    1 
ATOM   4504 C  CG    . PRO B 2 9   ? 5.379  11.093  -3.191  1.00 73.43  ? 9   PRO B CG    1 
ATOM   4505 C  CD    . PRO B 2 9   ? 6.040  11.544  -1.918  1.00 78.49  ? 9   PRO B CD    1 
ATOM   4506 N  N     . VAL B 2 10  ? 8.445  13.498  -5.414  1.00 75.08  ? 10  VAL B N     1 
ATOM   4507 C  CA    . VAL B 2 10  ? 8.486  14.658  -6.295  1.00 74.19  ? 10  VAL B CA    1 
ATOM   4508 C  C     . VAL B 2 10  ? 8.918  14.195  -7.679  1.00 85.61  ? 10  VAL B C     1 
ATOM   4509 O  O     . VAL B 2 10  ? 9.857  13.402  -7.812  1.00 98.33  ? 10  VAL B O     1 
ATOM   4510 C  CB    . VAL B 2 10  ? 9.445  15.745  -5.762  1.00 71.71  ? 10  VAL B CB    1 
ATOM   4511 C  CG1   . VAL B 2 10  ? 9.495  16.934  -6.712  1.00 82.32  ? 10  VAL B CG1   1 
ATOM   4512 C  CG2   . VAL B 2 10  ? 9.031  16.189  -4.366  1.00 66.88  ? 10  VAL B CG2   1 
ATOM   4513 N  N     . LYS B 2 11  ? 8.232  14.683  -8.707  1.00 83.32  ? 11  LYS B N     1 
ATOM   4514 C  CA    . LYS B 2 11  ? 8.561  14.373  -10.092 1.00 89.23  ? 11  LYS B CA    1 
ATOM   4515 C  C     . LYS B 2 11  ? 8.802  15.667  -10.865 1.00 91.16  ? 11  LYS B C     1 
ATOM   4516 O  O     . LYS B 2 11  ? 8.647  16.771  -10.340 1.00 92.41  ? 11  LYS B O     1 
ATOM   4517 C  CB    . LYS B 2 11  ? 7.455  13.543  -10.750 1.00 94.87  ? 11  LYS B CB    1 
ATOM   4518 C  CG    . LYS B 2 11  ? 6.198  14.331  -11.077 1.00 101.27 ? 11  LYS B CG    1 
ATOM   4519 C  CD    . LYS B 2 11  ? 5.262  13.533  -11.970 1.00 107.81 ? 11  LYS B CD    1 
ATOM   4520 C  CE    . LYS B 2 11  ? 4.068  14.370  -12.401 1.00 103.87 ? 11  LYS B CE    1 
ATOM   4521 N  NZ    . LYS B 2 11  ? 3.221  13.663  -13.401 1.00 94.86  ? 11  LYS B NZ    1 
ATOM   4522 N  N     . LEU B 2 12  ? 9.186  15.517  -12.130 1.00 86.53  ? 12  LEU B N     1 
ATOM   4523 C  CA    . LEU B 2 12  ? 9.452  16.657  -12.993 1.00 72.53  ? 12  LEU B CA    1 
ATOM   4524 C  C     . LEU B 2 12  ? 8.161  17.152  -13.638 1.00 83.28  ? 12  LEU B C     1 
ATOM   4525 O  O     . LEU B 2 12  ? 7.078  16.590  -13.447 1.00 91.72  ? 12  LEU B O     1 
ATOM   4526 C  CB    . LEU B 2 12  ? 10.477 16.288  -14.063 1.00 67.12  ? 12  LEU B CB    1 
ATOM   4527 C  CG    . LEU B 2 12  ? 11.892 15.932  -13.613 1.00 71.08  ? 12  LEU B CG    1 
ATOM   4528 C  CD1   . LEU B 2 12  ? 12.746 15.569  -14.816 1.00 67.95  ? 12  LEU B CD1   1 
ATOM   4529 C  CD2   . LEU B 2 12  ? 12.510 17.087  -12.845 1.00 72.94  ? 12  LEU B CD2   1 
ATOM   4530 N  N     . LYS B 2 13  ? 8.280  18.224  -14.416 1.00 81.98  ? 13  LYS B N     1 
ATOM   4531 C  CA    . LYS B 2 13  ? 7.158  18.701  -15.203 1.00 78.87  ? 13  LYS B CA    1 
ATOM   4532 C  C     . LYS B 2 13  ? 6.899  17.746  -16.369 1.00 93.12  ? 13  LYS B C     1 
ATOM   4533 O  O     . LYS B 2 13  ? 7.805  17.031  -16.808 1.00 90.67  ? 13  LYS B O     1 
ATOM   4534 C  CB    . LYS B 2 13  ? 7.430  20.110  -15.724 1.00 73.18  ? 13  LYS B CB    1 
ATOM   4535 C  CG    . LYS B 2 13  ? 7.433  21.183  -14.643 1.00 76.44  ? 13  LYS B CG    1 
ATOM   4536 C  CD    . LYS B 2 13  ? 7.504  22.581  -15.243 1.00 69.44  ? 13  LYS B CD    1 
ATOM   4537 C  CE    . LYS B 2 13  ? 7.414  23.647  -14.162 1.00 76.43  ? 13  LYS B CE    1 
ATOM   4538 N  NZ    . LYS B 2 13  ? 7.638  25.017  -14.704 1.00 83.16  ? 13  LYS B NZ    1 
ATOM   4539 N  N     . PRO B 2 14  ? 5.666  17.703  -16.880 1.00 101.90 ? 14  PRO B N     1 
ATOM   4540 C  CA    . PRO B 2 14  ? 5.350  16.753  -17.957 1.00 101.59 ? 14  PRO B CA    1 
ATOM   4541 C  C     . PRO B 2 14  ? 6.115  17.079  -19.232 1.00 98.17  ? 14  PRO B C     1 
ATOM   4542 O  O     . PRO B 2 14  ? 6.187  18.236  -19.655 1.00 85.41  ? 14  PRO B O     1 
ATOM   4543 C  CB    . PRO B 2 14  ? 3.838  16.920  -18.147 1.00 98.33  ? 14  PRO B CB    1 
ATOM   4544 C  CG    . PRO B 2 14  ? 3.532  18.276  -17.602 1.00 93.68  ? 14  PRO B CG    1 
ATOM   4545 C  CD    . PRO B 2 14  ? 4.480  18.468  -16.457 1.00 97.74  ? 14  PRO B CD    1 
ATOM   4546 N  N     . GLY B 2 15  ? 6.694  16.045  -19.838 1.00 106.42 ? 15  GLY B N     1 
ATOM   4547 C  CA    . GLY B 2 15  ? 7.357  16.191  -21.118 1.00 108.30 ? 15  GLY B CA    1 
ATOM   4548 C  C     . GLY B 2 15  ? 8.727  16.826  -21.084 1.00 108.35 ? 15  GLY B C     1 
ATOM   4549 O  O     . GLY B 2 15  ? 9.174  17.351  -22.108 1.00 117.89 ? 15  GLY B O     1 
ATOM   4550 N  N     . MET B 2 16  ? 9.415  16.797  -19.944 1.00 95.82  ? 16  MET B N     1 
ATOM   4551 C  CA    . MET B 2 16  ? 10.745 17.382  -19.847 1.00 89.77  ? 16  MET B CA    1 
ATOM   4552 C  C     . MET B 2 16  ? 11.662 16.468  -19.048 1.00 86.66  ? 16  MET B C     1 
ATOM   4553 O  O     . MET B 2 16  ? 11.231 15.817  -18.092 1.00 82.98  ? 16  MET B O     1 
ATOM   4554 C  CB    . MET B 2 16  ? 10.707 18.775  -19.203 1.00 85.18  ? 16  MET B CB    1 
ATOM   4555 C  CG    . MET B 2 16  ? 10.041 19.836  -20.066 1.00 92.01  ? 16  MET B CG    1 
ATOM   4556 S  SD    . MET B 2 16  ? 10.472 21.517  -19.579 1.00 94.63  ? 16  MET B SD    1 
ATOM   4557 C  CE    . MET B 2 16  ? 9.968  21.516  -17.861 1.00 85.45  ? 16  MET B CE    1 
ATOM   4558 N  N     . ASP B 2 17  ? 12.929 16.432  -19.450 1.00 82.81  ? 17  ASP B N     1 
ATOM   4559 C  CA    . ASP B 2 17  ? 13.956 15.637  -18.795 1.00 73.64  ? 17  ASP B CA    1 
ATOM   4560 C  C     . ASP B 2 17  ? 14.772 16.512  -17.845 1.00 67.24  ? 17  ASP B C     1 
ATOM   4561 O  O     . ASP B 2 17  ? 14.641 17.738  -17.817 1.00 62.76  ? 17  ASP B O     1 
ATOM   4562 C  CB    . ASP B 2 17  ? 14.860 14.976  -19.842 1.00 71.93  ? 17  ASP B CB    1 
ATOM   4563 C  CG    . ASP B 2 17  ? 15.658 13.815  -19.279 1.00 77.77  ? 17  ASP B CG    1 
ATOM   4564 O  OD1   . ASP B 2 17  ? 15.244 13.253  -18.242 1.00 80.32  ? 17  ASP B OD1   1 
ATOM   4565 O  OD2   . ASP B 2 17  ? 16.697 13.461  -19.877 1.00 80.04  ? 17  ASP B OD2   1 
ATOM   4566 N  N     . GLY B 2 18  ? 15.630 15.859  -17.055 1.00 60.19  ? 18  GLY B N     1 
ATOM   4567 C  CA    . GLY B 2 18  ? 16.426 16.547  -16.080 1.00 51.11  ? 18  GLY B CA    1 
ATOM   4568 C  C     . GLY B 2 18  ? 17.513 17.397  -16.718 1.00 54.72  ? 18  GLY B C     1 
ATOM   4569 O  O     . GLY B 2 18  ? 17.698 17.404  -17.943 1.00 61.84  ? 18  GLY B O     1 
ATOM   4570 N  N     . PRO B 2 19  ? 18.250 18.124  -15.879 1.00 48.33  ? 19  PRO B N     1 
ATOM   4571 C  CA    . PRO B 2 19  ? 19.273 19.037  -16.402 1.00 44.37  ? 19  PRO B CA    1 
ATOM   4572 C  C     . PRO B 2 19  ? 20.496 18.291  -16.913 1.00 42.99  ? 19  PRO B C     1 
ATOM   4573 O  O     . PRO B 2 19  ? 20.897 17.263  -16.363 1.00 44.48  ? 19  PRO B O     1 
ATOM   4574 C  CB    . PRO B 2 19  ? 19.618 19.908  -15.189 1.00 41.88  ? 19  PRO B CB    1 
ATOM   4575 C  CG    . PRO B 2 19  ? 19.323 19.031  -14.015 1.00 42.66  ? 19  PRO B CG    1 
ATOM   4576 C  CD    . PRO B 2 19  ? 18.136 18.195  -14.412 1.00 50.16  ? 19  PRO B CD    1 
ATOM   4577 N  N     . LYS B 2 20  ? 21.094 18.830  -17.989 1.00 41.56  ? 20  LYS B N     1 
ATOM   4578 C  CA    . LYS B 2 20  ? 22.315 18.295  -18.588 1.00 41.39  ? 20  LYS B CA    1 
ATOM   4579 C  C     . LYS B 2 20  ? 23.226 19.480  -18.928 1.00 44.05  ? 20  LYS B C     1 
ATOM   4580 O  O     . LYS B 2 20  ? 23.498 19.785  -20.088 1.00 41.69  ? 20  LYS B O     1 
ATOM   4581 C  CB    . LYS B 2 20  ? 22.013 17.444  -19.824 1.00 42.02  ? 20  LYS B CB    1 
ATOM   4582 C  CG    . LYS B 2 20  ? 21.150 16.221  -19.545 1.00 43.06  ? 20  LYS B CG    1 
ATOM   4583 C  CD    . LYS B 2 20  ? 20.852 15.445  -20.816 1.00 53.25  ? 20  LYS B CD    1 
ATOM   4584 C  CE    . LYS B 2 20  ? 19.998 14.220  -20.523 1.00 64.04  ? 20  LYS B CE    1 
ATOM   4585 N  NZ    . LYS B 2 20  ? 19.639 13.483  -21.765 1.00 70.04  ? 20  LYS B NZ    1 
ATOM   4586 N  N     . VAL B 2 21  ? 23.709 20.161  -17.890 1.00 46.28  ? 21  VAL B N     1 
ATOM   4587 C  CA    . VAL B 2 21  ? 24.497 21.382  -18.030 1.00 48.09  ? 21  VAL B CA    1 
ATOM   4588 C  C     . VAL B 2 21  ? 25.948 21.074  -17.684 1.00 45.48  ? 21  VAL B C     1 
ATOM   4589 O  O     . VAL B 2 21  ? 26.228 20.446  -16.655 1.00 46.61  ? 21  VAL B O     1 
ATOM   4590 C  CB    . VAL B 2 21  ? 23.951 22.509  -17.137 1.00 47.60  ? 21  VAL B CB    1 
ATOM   4591 C  CG1   . VAL B 2 21  ? 24.732 23.794  -17.369 1.00 41.97  ? 21  VAL B CG1   1 
ATOM   4592 C  CG2   . VAL B 2 21  ? 22.468 22.722  -17.399 1.00 47.42  ? 21  VAL B CG2   1 
ATOM   4593 N  N     . LYS B 2 22  ? 26.865 21.530  -18.533 1.00 45.12  ? 22  LYS B N     1 
ATOM   4594 C  CA    . LYS B 2 22  ? 28.282 21.271  -18.320 1.00 45.89  ? 22  LYS B CA    1 
ATOM   4595 C  C     . LYS B 2 22  ? 28.827 22.098  -17.160 1.00 40.13  ? 22  LYS B C     1 
ATOM   4596 O  O     . LYS B 2 22  ? 28.353 23.199  -16.870 1.00 53.81  ? 22  LYS B O     1 
ATOM   4597 C  CB    . LYS B 2 22  ? 29.080 21.574  -19.588 1.00 41.38  ? 22  LYS B CB    1 
ATOM   4598 C  CG    . LYS B 2 22  ? 28.870 20.572  -20.710 1.00 58.93  ? 22  LYS B CG    1 
ATOM   4599 C  CD    . LYS B 2 22  ? 29.914 20.740  -21.802 1.00 71.50  ? 22  LYS B CD    1 
ATOM   4600 C  CE    . LYS B 2 22  ? 29.849 19.593  -22.798 1.00 82.69  ? 22  LYS B CE    1 
ATOM   4601 N  NZ    . LYS B 2 22  ? 30.959 19.641  -23.791 1.00 83.95  ? 22  LYS B NZ    1 
ATOM   4602 N  N     . GLN B 2 23  ? 29.842 21.547  -16.497 1.00 45.42  ? 23  GLN B N     1 
ATOM   4603 C  CA    . GLN B 2 23  ? 30.530 22.241  -15.418 1.00 38.36  ? 23  GLN B CA    1 
ATOM   4604 C  C     . GLN B 2 23  ? 31.561 23.206  -15.992 1.00 45.24  ? 23  GLN B C     1 
ATOM   4605 O  O     . GLN B 2 23  ? 32.337 22.840  -16.881 1.00 41.55  ? 23  GLN B O     1 
ATOM   4606 C  CB    . GLN B 2 23  ? 31.207 21.231  -14.491 1.00 38.91  ? 23  GLN B CB    1 
ATOM   4607 C  CG    . GLN B 2 23  ? 32.137 21.845  -13.457 1.00 38.95  ? 23  GLN B CG    1 
ATOM   4608 C  CD    . GLN B 2 23  ? 31.391 22.586  -12.367 1.00 49.55  ? 23  GLN B CD    1 
ATOM   4609 O  OE1   . GLN B 2 23  ? 30.349 22.134  -11.894 1.00 48.66  ? 23  GLN B OE1   1 
ATOM   4610 N  NE2   . GLN B 2 23  ? 31.921 23.735  -11.965 1.00 57.29  ? 23  GLN B NE2   1 
ATOM   4611 N  N     . TRP B 2 24  ? 31.569 24.439  -15.488 1.00 52.12  ? 24  TRP B N     1 
ATOM   4612 C  CA    . TRP B 2 24  ? 32.549 25.413  -15.942 1.00 50.96  ? 24  TRP B CA    1 
ATOM   4613 C  C     . TRP B 2 24  ? 33.820 25.321  -15.107 1.00 46.69  ? 24  TRP B C     1 
ATOM   4614 O  O     . TRP B 2 24  ? 33.804 24.796  -13.989 1.00 41.18  ? 24  TRP B O     1 
ATOM   4615 C  CB    . TRP B 2 24  ? 31.960 26.825  -15.879 1.00 47.38  ? 24  TRP B CB    1 
ATOM   4616 C  CG    . TRP B 2 24  ? 31.429 27.237  -14.542 1.00 42.44  ? 24  TRP B CG    1 
ATOM   4617 C  CD1   . TRP B 2 24  ? 32.154 27.527  -13.423 1.00 50.05  ? 24  TRP B CD1   1 
ATOM   4618 C  CD2   . TRP B 2 24  ? 30.055 27.436  -14.193 1.00 44.70  ? 24  TRP B CD2   1 
ATOM   4619 N  NE1   . TRP B 2 24  ? 31.315 27.880  -12.393 1.00 55.43  ? 24  TRP B NE1   1 
ATOM   4620 C  CE2   . TRP B 2 24  ? 30.021 27.833  -12.841 1.00 46.80  ? 24  TRP B CE2   1 
ATOM   4621 C  CE3   . TRP B 2 24  ? 28.850 27.311  -14.890 1.00 36.94  ? 24  TRP B CE3   1 
ATOM   4622 C  CZ2   . TRP B 2 24  ? 28.829 28.105  -12.173 1.00 38.83  ? 24  TRP B CZ2   1 
ATOM   4623 C  CZ3   . TRP B 2 24  ? 27.668 27.584  -14.226 1.00 49.72  ? 24  TRP B CZ3   1 
ATOM   4624 C  CH2   . TRP B 2 24  ? 27.666 27.975  -12.881 1.00 48.40  ? 24  TRP B CH2   1 
ATOM   4625 N  N     . PRO B 2 25  ? 34.948 25.809  -15.632 1.00 41.30  ? 25  PRO B N     1 
ATOM   4626 C  CA    . PRO B 2 25  ? 36.217 25.681  -14.903 1.00 38.00  ? 25  PRO B CA    1 
ATOM   4627 C  C     . PRO B 2 25  ? 36.173 26.374  -13.549 1.00 45.62  ? 25  PRO B C     1 
ATOM   4628 O  O     . PRO B 2 25  ? 35.635 27.474  -13.408 1.00 53.55  ? 25  PRO B O     1 
ATOM   4629 C  CB    . PRO B 2 25  ? 37.231 26.348  -15.838 1.00 37.88  ? 25  PRO B CB    1 
ATOM   4630 C  CG    . PRO B 2 25  ? 36.611 26.273  -17.190 1.00 42.16  ? 25  PRO B CG    1 
ATOM   4631 C  CD    . PRO B 2 25  ? 35.138 26.391  -16.973 1.00 37.21  ? 25  PRO B CD    1 
ATOM   4632 N  N     . LEU B 2 26  ? 36.754 25.716  -12.549 1.00 38.80  ? 26  LEU B N     1 
ATOM   4633 C  CA    . LEU B 2 26  ? 36.811 26.229  -11.189 1.00 41.79  ? 26  LEU B CA    1 
ATOM   4634 C  C     . LEU B 2 26  ? 38.261 26.438  -10.773 1.00 46.24  ? 26  LEU B C     1 
ATOM   4635 O  O     . LEU B 2 26  ? 39.152 25.681  -11.168 1.00 53.57  ? 26  LEU B O     1 
ATOM   4636 C  CB    . LEU B 2 26  ? 36.130 25.275  -10.201 1.00 44.49  ? 26  LEU B CB    1 
ATOM   4637 C  CG    . LEU B 2 26  ? 34.659 24.950  -10.450 1.00 45.33  ? 26  LEU B CG    1 
ATOM   4638 C  CD1   . LEU B 2 26  ? 34.137 24.019  -9.369  1.00 40.88  ? 26  LEU B CD1   1 
ATOM   4639 C  CD2   . LEU B 2 26  ? 33.834 26.223  -10.514 1.00 44.56  ? 26  LEU B CD2   1 
ATOM   4640 N  N     . THR B 2 27  ? 38.489 27.472  -9.967  1.00 43.06  ? 27  THR B N     1 
ATOM   4641 C  CA    . THR B 2 27  ? 39.832 27.752  -9.489  1.00 41.68  ? 27  THR B CA    1 
ATOM   4642 C  C     . THR B 2 27  ? 40.243 26.734  -8.427  1.00 46.12  ? 27  THR B C     1 
ATOM   4643 O  O     . THR B 2 27  ? 39.427 25.967  -7.906  1.00 49.96  ? 27  THR B O     1 
ATOM   4644 C  CB    . THR B 2 27  ? 39.925 29.172  -8.928  1.00 43.25  ? 27  THR B CB    1 
ATOM   4645 O  OG1   . THR B 2 27  ? 38.952 29.347  -7.891  1.00 53.17  ? 27  THR B OG1   1 
ATOM   4646 C  CG2   . THR B 2 27  ? 39.684 30.196  -10.028 1.00 40.14  ? 27  THR B CG2   1 
ATOM   4647 N  N     . GLU B 2 28  ? 41.539 26.738  -8.107  1.00 42.25  ? 28  GLU B N     1 
ATOM   4648 C  CA    . GLU B 2 28  ? 42.074 25.761  -7.164  1.00 43.16  ? 28  GLU B CA    1 
ATOM   4649 C  C     . GLU B 2 28  ? 41.475 25.937  -5.776  1.00 54.28  ? 28  GLU B C     1 
ATOM   4650 O  O     . GLU B 2 28  ? 41.148 24.952  -5.104  1.00 50.30  ? 28  GLU B O     1 
ATOM   4651 C  CB    . GLU B 2 28  ? 43.597 25.871  -7.109  1.00 43.89  ? 28  GLU B CB    1 
ATOM   4652 C  CG    . GLU B 2 28  ? 44.241 25.038  -6.015  1.00 48.61  ? 28  GLU B CG    1 
ATOM   4653 C  CD    . GLU B 2 28  ? 45.710 24.788  -6.274  1.00 65.41  ? 28  GLU B CD    1 
ATOM   4654 O  OE1   . GLU B 2 28  ? 46.176 23.657  -6.019  1.00 69.83  ? 28  GLU B OE1   1 
ATOM   4655 O  OE2   . GLU B 2 28  ? 46.397 25.720  -6.743  1.00 79.14  ? 28  GLU B OE2   1 
ATOM   4656 N  N     . GLU B 2 29  ? 41.322 27.186  -5.327  1.00 53.41  ? 29  GLU B N     1 
ATOM   4657 C  CA    . GLU B 2 29  ? 40.766 27.420  -3.999  1.00 57.26  ? 29  GLU B CA    1 
ATOM   4658 C  C     . GLU B 2 29  ? 39.319 26.955  -3.905  1.00 56.98  ? 29  GLU B C     1 
ATOM   4659 O  O     . GLU B 2 29  ? 38.886 26.494  -2.843  1.00 65.25  ? 29  GLU B O     1 
ATOM   4660 C  CB    . GLU B 2 29  ? 40.877 28.900  -3.632  1.00 63.57  ? 29  GLU B CB    1 
ATOM   4661 C  CG    . GLU B 2 29  ? 40.189 29.839  -4.607  1.00 81.20  ? 29  GLU B CG    1 
ATOM   4662 C  CD    . GLU B 2 29  ? 40.196 31.279  -4.134  1.00 89.61  ? 29  GLU B CD    1 
ATOM   4663 O  OE1   . GLU B 2 29  ? 40.804 31.558  -3.078  1.00 90.17  ? 29  GLU B OE1   1 
ATOM   4664 O  OE2   . GLU B 2 29  ? 39.590 32.132  -4.817  1.00 89.71  ? 29  GLU B OE2   1 
ATOM   4665 N  N     . LYS B 2 30  ? 38.560 27.058  -4.998  1.00 51.58  ? 30  LYS B N     1 
ATOM   4666 C  CA    . LYS B 2 30  ? 37.177 26.592  -4.976  1.00 51.33  ? 30  LYS B CA    1 
ATOM   4667 C  C     . LYS B 2 30  ? 37.107 25.070  -5.014  1.00 51.11  ? 30  LYS B C     1 
ATOM   4668 O  O     . LYS B 2 30  ? 36.274 24.466  -4.328  1.00 48.34  ? 30  LYS B O     1 
ATOM   4669 C  CB    . LYS B 2 30  ? 36.396 27.199  -6.140  1.00 49.26  ? 30  LYS B CB    1 
ATOM   4670 C  CG    . LYS B 2 30  ? 36.109 28.685  -5.990  1.00 46.98  ? 30  LYS B CG    1 
ATOM   4671 C  CD    . LYS B 2 30  ? 35.336 29.228  -7.182  1.00 49.40  ? 30  LYS B CD    1 
ATOM   4672 C  CE    . LYS B 2 30  ? 34.983 30.696  -6.990  1.00 58.30  ? 30  LYS B CE    1 
ATOM   4673 N  NZ    . LYS B 2 30  ? 36.188 31.527  -6.713  1.00 76.29  ? 30  LYS B NZ    1 
ATOM   4674 N  N     . ILE B 2 31  ? 37.972 24.432  -5.806  1.00 45.14  ? 31  ILE B N     1 
ATOM   4675 C  CA    . ILE B 2 31  ? 37.964 22.974  -5.883  1.00 47.93  ? 31  ILE B CA    1 
ATOM   4676 C  C     . ILE B 2 31  ? 38.388 22.364  -4.553  1.00 48.20  ? 31  ILE B C     1 
ATOM   4677 O  O     . ILE B 2 31  ? 37.791 21.387  -4.086  1.00 49.41  ? 31  ILE B O     1 
ATOM   4678 C  CB    . ILE B 2 31  ? 38.858 22.491  -7.040  1.00 42.61  ? 31  ILE B CB    1 
ATOM   4679 C  CG1   . ILE B 2 31  ? 38.296 22.961  -8.383  1.00 41.61  ? 31  ILE B CG1   1 
ATOM   4680 C  CG2   . ILE B 2 31  ? 38.983 20.978  -7.022  1.00 43.03  ? 31  ILE B CG2   1 
ATOM   4681 C  CD1   . ILE B 2 31  ? 39.162 22.595  -9.570  1.00 41.37  ? 31  ILE B CD1   1 
ATOM   4682 N  N     . LYS B 2 32  ? 39.418 22.930  -3.918  1.00 44.73  ? 32  LYS B N     1 
ATOM   4683 C  CA    . LYS B 2 32  ? 39.860 22.414  -2.625  1.00 45.94  ? 32  LYS B CA    1 
ATOM   4684 C  C     . LYS B 2 32  ? 38.772 22.563  -1.570  1.00 59.65  ? 32  LYS B C     1 
ATOM   4685 O  O     . LYS B 2 32  ? 38.590 21.676  -0.727  1.00 77.55  ? 32  LYS B O     1 
ATOM   4686 C  CB    . LYS B 2 32  ? 41.140 23.121  -2.179  1.00 46.64  ? 32  LYS B CB    1 
ATOM   4687 C  CG    . LYS B 2 32  ? 42.385 22.695  -2.936  1.00 58.18  ? 32  LYS B CG    1 
ATOM   4688 C  CD    . LYS B 2 32  ? 43.646 23.203  -2.253  1.00 75.20  ? 32  LYS B CD    1 
ATOM   4689 C  CE    . LYS B 2 32  ? 44.896 22.669  -2.935  1.00 82.90  ? 32  LYS B CE    1 
ATOM   4690 N  NZ    . LYS B 2 32  ? 46.141 23.143  -2.269  1.00 84.44  ? 32  LYS B NZ    1 
ATOM   4691 N  N     . ALA B 2 33  ? 38.038 23.677  -1.599  1.00 57.70  ? 33  ALA B N     1 
ATOM   4692 C  CA    . ALA B 2 33  ? 36.933 23.852  -0.663  1.00 56.41  ? 33  ALA B CA    1 
ATOM   4693 C  C     . ALA B 2 33  ? 35.807 22.868  -0.950  1.00 47.85  ? 33  ALA B C     1 
ATOM   4694 O  O     . ALA B 2 33  ? 35.208 22.314  -0.021  1.00 48.29  ? 33  ALA B O     1 
ATOM   4695 C  CB    . ALA B 2 33  ? 36.418 25.289  -0.719  1.00 63.33  ? 33  ALA B CB    1 
ATOM   4696 N  N     . LEU B 2 34  ? 35.512 22.631  -2.231  1.00 45.08  ? 34  LEU B N     1 
ATOM   4697 C  CA    . LEU B 2 34  ? 34.442 21.704  -2.586  1.00 48.82  ? 34  LEU B CA    1 
ATOM   4698 C  C     . LEU B 2 34  ? 34.797 20.271  -2.210  1.00 50.99  ? 34  LEU B C     1 
ATOM   4699 O  O     . LEU B 2 34  ? 33.942 19.525  -1.718  1.00 55.87  ? 34  LEU B O     1 
ATOM   4700 C  CB    . LEU B 2 34  ? 34.131 21.806  -4.078  1.00 43.67  ? 34  LEU B CB    1 
ATOM   4701 C  CG    . LEU B 2 34  ? 33.371 23.062  -4.504  1.00 42.99  ? 34  LEU B CG    1 
ATOM   4702 C  CD1   . LEU B 2 34  ? 33.045 23.020  -5.987  1.00 60.56  ? 34  LEU B CD1   1 
ATOM   4703 C  CD2   . LEU B 2 34  ? 32.107 23.218  -3.674  1.00 50.67  ? 34  LEU B CD2   1 
ATOM   4704 N  N     . VAL B 2 35  ? 36.049 19.867  -2.435  1.00 45.66  ? 35  VAL B N     1 
ATOM   4705 C  CA    . VAL B 2 35  ? 36.470 18.517  -2.068  1.00 54.08  ? 35  VAL B CA    1 
ATOM   4706 C  C     . VAL B 2 35  ? 36.343 18.311  -0.564  1.00 52.44  ? 35  VAL B C     1 
ATOM   4707 O  O     . VAL B 2 35  ? 35.908 17.249  -0.102  1.00 62.25  ? 35  VAL B O     1 
ATOM   4708 C  CB    . VAL B 2 35  ? 37.905 18.250  -2.562  1.00 46.40  ? 35  VAL B CB    1 
ATOM   4709 C  CG1   . VAL B 2 35  ? 38.458 16.978  -1.939  1.00 47.38  ? 35  VAL B CG1   1 
ATOM   4710 C  CG2   . VAL B 2 35  ? 37.930 18.152  -4.079  1.00 45.36  ? 35  VAL B CG2   1 
ATOM   4711 N  N     . GLU B 2 36  ? 36.705 19.327  0.223   1.00 49.06  ? 36  GLU B N     1 
ATOM   4712 C  CA    . GLU B 2 36  ? 36.589 19.209  1.672   1.00 57.62  ? 36  GLU B CA    1 
ATOM   4713 C  C     . GLU B 2 36  ? 35.130 19.147  2.108   1.00 59.58  ? 36  GLU B C     1 
ATOM   4714 O  O     . GLU B 2 36  ? 34.770 18.341  2.974   1.00 63.79  ? 36  GLU B O     1 
ATOM   4715 C  CB    . GLU B 2 36  ? 37.299 20.375  2.356   1.00 65.34  ? 36  GLU B CB    1 
ATOM   4716 C  CG    . GLU B 2 36  ? 37.319 20.271  3.872   1.00 70.22  ? 36  GLU B CG    1 
ATOM   4717 C  CD    . GLU B 2 36  ? 37.875 21.513  4.534   1.00 66.96  ? 36  GLU B CD    1 
ATOM   4718 O  OE1   . GLU B 2 36  ? 37.289 21.960  5.543   1.00 70.17  ? 36  GLU B OE1   1 
ATOM   4719 O  OE2   . GLU B 2 36  ? 38.893 22.045  4.042   1.00 57.79  ? 36  GLU B OE2   1 
ATOM   4720 N  N     . ILE B 2 37  ? 34.276 19.988  1.520   1.00 51.43  ? 37  ILE B N     1 
ATOM   4721 C  CA    . ILE B 2 37  ? 32.864 19.992  1.891   1.00 53.48  ? 37  ILE B CA    1 
ATOM   4722 C  C     . ILE B 2 37  ? 32.190 18.699  1.450   1.00 56.57  ? 37  ILE B C     1 
ATOM   4723 O  O     . ILE B 2 37  ? 31.382 18.122  2.189   1.00 49.72  ? 37  ILE B O     1 
ATOM   4724 C  CB    . ILE B 2 37  ? 32.162 21.231  1.304   1.00 54.32  ? 37  ILE B CB    1 
ATOM   4725 C  CG1   . ILE B 2 37  ? 32.669 22.506  1.980   1.00 48.48  ? 37  ILE B CG1   1 
ATOM   4726 C  CG2   . ILE B 2 37  ? 30.651 21.115  1.446   1.00 55.50  ? 37  ILE B CG2   1 
ATOM   4727 C  CD1   . ILE B 2 37  ? 32.083 23.779  1.403   1.00 47.64  ? 37  ILE B CD1   1 
ATOM   4728 N  N     . CYS B 2 38  ? 32.516 18.215  0.248   1.00 57.04  ? 38  CYS B N     1 
ATOM   4729 C  CA    . CYS B 2 38  ? 31.876 17.005  -0.261  1.00 59.72  ? 38  CYS B CA    1 
ATOM   4730 C  C     . CYS B 2 38  ? 32.264 15.779  0.556   1.00 67.48  ? 38  CYS B C     1 
ATOM   4731 O  O     . CYS B 2 38  ? 31.425 14.904  0.803   1.00 76.16  ? 38  CYS B O     1 
ATOM   4732 C  CB    . CYS B 2 38  ? 32.228 16.799  -1.734  1.00 56.61  ? 38  CYS B CB    1 
ATOM   4733 S  SG    . CYS B 2 38  ? 31.398 17.935  -2.867  1.00 61.88  ? 38  CYS B SG    1 
ATOM   4734 N  N     . THR B 2 39  ? 33.528 15.689  0.977   1.00 59.16  ? 39  THR B N     1 
ATOM   4735 C  CA    . THR B 2 39  ? 33.942 14.563  1.807   1.00 63.16  ? 39  THR B CA    1 
ATOM   4736 C  C     . THR B 2 39  ? 33.214 14.572  3.145   1.00 63.50  ? 39  THR B C     1 
ATOM   4737 O  O     . THR B 2 39  ? 32.854 13.513  3.673   1.00 68.22  ? 39  THR B O     1 
ATOM   4738 C  CB    . THR B 2 39  ? 35.456 14.584  2.019   1.00 72.51  ? 39  THR B CB    1 
ATOM   4739 O  OG1   . THR B 2 39  ? 35.871 15.902  2.400   1.00 83.39  ? 39  THR B OG1   1 
ATOM   4740 C  CG2   . THR B 2 39  ? 36.180 14.170  0.745   1.00 71.85  ? 39  THR B CG2   1 
ATOM   4741 N  N     . GLU B 2 40  ? 32.979 15.760  3.705   1.00 62.03  ? 40  GLU B N     1 
ATOM   4742 C  CA    . GLU B 2 40  ? 32.226 15.849  4.952   1.00 63.78  ? 40  GLU B CA    1 
ATOM   4743 C  C     . GLU B 2 40  ? 30.756 15.516  4.730   1.00 62.71  ? 40  GLU B C     1 
ATOM   4744 O  O     . GLU B 2 40  ? 30.123 14.877  5.579   1.00 56.12  ? 40  GLU B O     1 
ATOM   4745 C  CB    . GLU B 2 40  ? 32.382 17.243  5.561   1.00 70.38  ? 40  GLU B CB    1 
ATOM   4746 C  CG    . GLU B 2 40  ? 31.788 17.390  6.956   1.00 84.78  ? 40  GLU B CG    1 
ATOM   4747 C  CD    . GLU B 2 40  ? 32.544 16.595  8.007   1.00 102.51 ? 40  GLU B CD    1 
ATOM   4748 O  OE1   . GLU B 2 40  ? 33.708 16.216  7.754   1.00 110.16 ? 40  GLU B OE1   1 
ATOM   4749 O  OE2   . GLU B 2 40  ? 31.973 16.350  9.091   1.00 106.63 ? 40  GLU B OE2   1 
ATOM   4750 N  N     . MET B 2 41  ? 30.195 15.937  3.593   1.00 64.05  ? 41  MET B N     1 
ATOM   4751 C  CA    . MET B 2 41  ? 28.806 15.606  3.290   1.00 57.42  ? 41  MET B CA    1 
ATOM   4752 C  C     . MET B 2 41  ? 28.649 14.126  2.964   1.00 59.80  ? 41  MET B C     1 
ATOM   4753 O  O     . MET B 2 41  ? 27.636 13.511  3.318   1.00 62.96  ? 41  MET B O     1 
ATOM   4754 C  CB    . MET B 2 41  ? 28.299 16.465  2.132   1.00 56.76  ? 41  MET B CB    1 
ATOM   4755 C  CG    . MET B 2 41  ? 28.189 17.946  2.457   1.00 67.75  ? 41  MET B CG    1 
ATOM   4756 S  SD    . MET B 2 41  ? 27.640 18.928  1.047   1.00 64.08  ? 41  MET B SD    1 
ATOM   4757 C  CE    . MET B 2 41  ? 26.022 18.221  0.749   1.00 61.29  ? 41  MET B CE    1 
ATOM   4758 N  N     . GLU B 2 42  ? 29.639 13.538  2.288   1.00 59.22  ? 42  GLU B N     1 
ATOM   4759 C  CA    . GLU B 2 42  ? 29.574 12.115  1.973   1.00 57.07  ? 42  GLU B CA    1 
ATOM   4760 C  C     . GLU B 2 42  ? 29.682 11.265  3.233   1.00 61.89  ? 42  GLU B C     1 
ATOM   4761 O  O     . GLU B 2 42  ? 28.992 10.246  3.361   1.00 62.56  ? 42  GLU B O     1 
ATOM   4762 C  CB    . GLU B 2 42  ? 30.674 11.749  0.978   1.00 55.40  ? 42  GLU B CB    1 
ATOM   4763 C  CG    . GLU B 2 42  ? 30.829 10.258  0.738   1.00 64.65  ? 42  GLU B CG    1 
ATOM   4764 C  CD    . GLU B 2 42  ? 31.940 9.944   -0.240  1.00 71.41  ? 42  GLU B CD    1 
ATOM   4765 O  OE1   . GLU B 2 42  ? 31.667 9.274   -1.258  1.00 81.69  ? 42  GLU B OE1   1 
ATOM   4766 O  OE2   . GLU B 2 42  ? 33.087 10.375  0.006   1.00 62.93  ? 42  GLU B OE2   1 
ATOM   4767 N  N     . LYS B 2 43  ? 30.541 11.669  4.173   1.00 61.62  ? 43  LYS B N     1 
ATOM   4768 C  CA    . LYS B 2 43  ? 30.644 10.953  5.441   1.00 64.82  ? 43  LYS B CA    1 
ATOM   4769 C  C     . LYS B 2 43  ? 29.314 10.949  6.181   1.00 74.66  ? 43  LYS B C     1 
ATOM   4770 O  O     . LYS B 2 43  ? 28.891 9.914   6.710   1.00 89.20  ? 43  LYS B O     1 
ATOM   4771 C  CB    . LYS B 2 43  ? 31.732 11.580  6.314   1.00 67.41  ? 43  LYS B CB    1 
ATOM   4772 C  CG    . LYS B 2 43  ? 31.667 11.153  7.775   1.00 80.64  ? 43  LYS B CG    1 
ATOM   4773 C  CD    . LYS B 2 43  ? 32.499 12.060  8.670   1.00 88.83  ? 43  LYS B CD    1 
ATOM   4774 C  CE    . LYS B 2 43  ? 32.223 11.780  10.141  1.00 88.17  ? 43  LYS B CE    1 
ATOM   4775 N  NZ    . LYS B 2 43  ? 32.969 12.702  11.041  1.00 88.24  ? 43  LYS B NZ    1 
ATOM   4776 N  N     . GLU B 2 44  ? 28.636 12.093  6.223   1.00 78.24  ? 44  GLU B N     1 
ATOM   4777 C  CA    . GLU B 2 44  ? 27.377 12.229  6.942   1.00 75.66  ? 44  GLU B CA    1 
ATOM   4778 C  C     . GLU B 2 44  ? 26.174 11.768  6.127   1.00 66.19  ? 44  GLU B C     1 
ATOM   4779 O  O     . GLU B 2 44  ? 25.037 12.075  6.503   1.00 66.26  ? 44  GLU B O     1 
ATOM   4780 C  CB    . GLU B 2 44  ? 27.188 13.681  7.389   1.00 79.66  ? 44  GLU B CB    1 
ATOM   4781 C  CG    . GLU B 2 44  ? 28.337 14.210  8.236   1.00 89.94  ? 44  GLU B CG    1 
ATOM   4782 C  CD    . GLU B 2 44  ? 28.128 15.641  8.694   1.00 108.64 ? 44  GLU B CD    1 
ATOM   4783 O  OE1   . GLU B 2 44  ? 26.961 16.075  8.787   1.00 119.37 ? 44  GLU B OE1   1 
ATOM   4784 O  OE2   . GLU B 2 44  ? 29.133 16.334  8.960   1.00 111.62 ? 44  GLU B OE2   1 
ATOM   4785 N  N     . GLY B 2 45  ? 26.393 11.043  5.031   1.00 58.66  ? 45  GLY B N     1 
ATOM   4786 C  CA    . GLY B 2 45  ? 25.301 10.515  4.238   1.00 62.91  ? 45  GLY B CA    1 
ATOM   4787 C  C     . GLY B 2 45  ? 24.486 11.542  3.488   1.00 69.56  ? 45  GLY B C     1 
ATOM   4788 O  O     . GLY B 2 45  ? 23.408 11.208  2.986   1.00 68.99  ? 45  GLY B O     1 
ATOM   4789 N  N     . LYS B 2 46  ? 24.962 12.785  3.394   1.00 66.10  ? 46  LYS B N     1 
ATOM   4790 C  CA    . LYS B 2 46  ? 24.202 13.811  2.686   1.00 60.27  ? 46  LYS B CA    1 
ATOM   4791 C  C     . LYS B 2 46  ? 24.271 13.607  1.177   1.00 56.79  ? 46  LYS B C     1 
ATOM   4792 O  O     . LYS B 2 46  ? 23.290 13.854  0.466   1.00 51.18  ? 46  LYS B O     1 
ATOM   4793 C  CB    . LYS B 2 46  ? 24.714 15.198  3.069   1.00 62.41  ? 46  LYS B CB    1 
ATOM   4794 C  CG    . LYS B 2 46  ? 24.625 15.502  4.558   1.00 72.68  ? 46  LYS B CG    1 
ATOM   4795 C  CD    . LYS B 2 46  ? 25.278 16.836  4.889   1.00 87.45  ? 46  LYS B CD    1 
ATOM   4796 C  CE    . LYS B 2 46  ? 25.184 17.146  6.374   1.00 89.71  ? 46  LYS B CE    1 
ATOM   4797 N  NZ    . LYS B 2 46  ? 25.863 18.428  6.718   1.00 90.10  ? 46  LYS B NZ    1 
ATOM   4798 N  N     . ILE B 2 47  ? 25.419 13.155  0.669   1.00 53.18  ? 47  ILE B N     1 
ATOM   4799 C  CA    . ILE B 2 47  ? 25.600 12.893  -0.752  1.00 53.90  ? 47  ILE B CA    1 
ATOM   4800 C  C     . ILE B 2 47  ? 26.303 11.554  -0.926  1.00 55.45  ? 47  ILE B C     1 
ATOM   4801 O  O     . ILE B 2 47  ? 27.010 11.074  -0.037  1.00 66.57  ? 47  ILE B O     1 
ATOM   4802 C  CB    . ILE B 2 47  ? 26.393 14.012  -1.464  1.00 56.39  ? 47  ILE B CB    1 
ATOM   4803 C  CG1   . ILE B 2 47  ? 27.724 14.264  -0.752  1.00 52.66  ? 47  ILE B CG1   1 
ATOM   4804 C  CG2   . ILE B 2 47  ? 25.564 15.286  -1.555  1.00 49.48  ? 47  ILE B CG2   1 
ATOM   4805 C  CD1   . ILE B 2 47  ? 28.585 15.311  -1.422  1.00 47.80  ? 47  ILE B CD1   1 
ATOM   4806 N  N     . SER B 2 48  ? 26.100 10.954  -2.097  1.00 49.85  ? 48  SER B N     1 
ATOM   4807 C  CA    . SER B 2 48  ? 26.689 9.668   -2.440  1.00 50.17  ? 48  SER B CA    1 
ATOM   4808 C  C     . SER B 2 48  ? 27.305 9.742   -3.828  1.00 55.37  ? 48  SER B C     1 
ATOM   4809 O  O     . SER B 2 48  ? 26.753 10.383  -4.727  1.00 62.83  ? 48  SER B O     1 
ATOM   4810 C  CB    . SER B 2 48  ? 25.647 8.543   -2.394  1.00 54.86  ? 48  SER B CB    1 
ATOM   4811 O  OG    . SER B 2 48  ? 25.166 8.341   -1.076  1.00 61.87  ? 48  SER B OG    1 
ATOM   4812 N  N     . LYS B 2 49  ? 28.450 9.082   -3.997  1.00 60.21  ? 49  LYS B N     1 
ATOM   4813 C  CA    . LYS B 2 49  ? 29.101 9.045   -5.298  1.00 48.32  ? 49  LYS B CA    1 
ATOM   4814 C  C     . LYS B 2 49  ? 28.231 8.314   -6.313  1.00 48.40  ? 49  LYS B C     1 
ATOM   4815 O  O     . LYS B 2 49  ? 27.501 7.376   -5.982  1.00 60.77  ? 49  LYS B O     1 
ATOM   4816 C  CB    . LYS B 2 49  ? 30.467 8.364   -5.200  1.00 48.59  ? 49  LYS B CB    1 
ATOM   4817 C  CG    . LYS B 2 49  ? 31.545 9.201   -4.537  1.00 58.05  ? 49  LYS B CG    1 
ATOM   4818 C  CD    . LYS B 2 49  ? 32.915 8.565   -4.714  1.00 56.59  ? 49  LYS B CD    1 
ATOM   4819 C  CE    . LYS B 2 49  ? 34.020 9.456   -4.169  1.00 57.73  ? 49  LYS B CE    1 
ATOM   4820 N  NZ    . LYS B 2 49  ? 33.912 9.641   -2.697  1.00 66.01  ? 49  LYS B NZ    1 
ATOM   4821 N  N     . ILE B 2 50  ? 28.308 8.765   -7.564  1.00 47.55  ? 50  ILE B N     1 
ATOM   4822 C  CA    . ILE B 2 50  ? 27.601 8.152   -8.680  1.00 47.64  ? 50  ILE B CA    1 
ATOM   4823 C  C     . ILE B 2 50  ? 28.557 8.067   -9.862  1.00 52.68  ? 50  ILE B C     1 
ATOM   4824 O  O     . ILE B 2 50  ? 29.648 8.640   -9.853  1.00 49.77  ? 50  ILE B O     1 
ATOM   4825 C  CB    . ILE B 2 50  ? 26.327 8.931   -9.072  1.00 47.31  ? 50  ILE B CB    1 
ATOM   4826 C  CG1   . ILE B 2 50  ? 26.682 10.359  -9.484  1.00 53.43  ? 50  ILE B CG1   1 
ATOM   4827 C  CG2   . ILE B 2 50  ? 25.319 8.933   -7.930  1.00 48.03  ? 50  ILE B CG2   1 
ATOM   4828 C  CD1   . ILE B 2 50  ? 25.488 11.179  -9.894  1.00 51.55  ? 50  ILE B CD1   1 
ATOM   4829 N  N     . GLY B 2 51  ? 28.132 7.341   -10.892 1.00 48.75  ? 51  GLY B N     1 
ATOM   4830 C  CA    . GLY B 2 51  ? 28.950 7.143   -12.063 1.00 47.39  ? 51  GLY B CA    1 
ATOM   4831 C  C     . GLY B 2 51  ? 28.365 7.787   -13.302 1.00 48.76  ? 51  GLY B C     1 
ATOM   4832 O  O     . GLY B 2 51  ? 27.412 8.569   -13.237 1.00 54.85  ? 51  GLY B O     1 
ATOM   4833 N  N     . PRO B 2 52  ? 28.934 7.466   -14.468 1.00 46.48  ? 52  PRO B N     1 
ATOM   4834 C  CA    . PRO B 2 52  ? 28.431 8.046   -15.722 1.00 54.95  ? 52  PRO B CA    1 
ATOM   4835 C  C     . PRO B 2 52  ? 27.091 7.486   -16.169 1.00 51.92  ? 52  PRO B C     1 
ATOM   4836 O  O     . PRO B 2 52  ? 26.526 8.002   -17.142 1.00 47.36  ? 52  PRO B O     1 
ATOM   4837 C  CB    . PRO B 2 52  ? 29.535 7.707   -16.731 1.00 50.98  ? 52  PRO B CB    1 
ATOM   4838 C  CG    . PRO B 2 52  ? 30.163 6.473   -16.185 1.00 46.89  ? 52  PRO B CG    1 
ATOM   4839 C  CD    . PRO B 2 52  ? 30.102 6.598   -14.689 1.00 46.87  ? 52  PRO B CD    1 
ATOM   4840 N  N     . GLU B 2 53  ? 26.565 6.453   -15.505 1.00 51.36  ? 53  GLU B N     1 
ATOM   4841 C  CA    . GLU B 2 53  ? 25.254 5.935   -15.880 1.00 54.56  ? 53  GLU B CA    1 
ATOM   4842 C  C     . GLU B 2 53  ? 24.142 6.927   -15.569 1.00 55.24  ? 53  GLU B C     1 
ATOM   4843 O  O     . GLU B 2 53  ? 23.028 6.771   -16.079 1.00 57.22  ? 53  GLU B O     1 
ATOM   4844 C  CB    . GLU B 2 53  ? 24.984 4.598   -15.181 1.00 49.64  ? 53  GLU B CB    1 
ATOM   4845 C  CG    . GLU B 2 53  ? 24.634 4.702   -13.703 1.00 53.40  ? 53  GLU B CG    1 
ATOM   4846 C  CD    . GLU B 2 53  ? 25.837 4.991   -12.828 1.00 60.46  ? 53  GLU B CD    1 
ATOM   4847 O  OE1   . GLU B 2 53  ? 26.977 4.916   -13.334 1.00 54.86  ? 53  GLU B OE1   1 
ATOM   4848 O  OE2   . GLU B 2 53  ? 25.642 5.293   -11.631 1.00 63.71  ? 53  GLU B OE2   1 
ATOM   4849 N  N     . ASN B 2 54  ? 24.421 7.933   -14.741 1.00 54.76  ? 54  ASN B N     1 
ATOM   4850 C  CA    . ASN B 2 54  ? 23.536 9.065   -14.501 1.00 57.56  ? 54  ASN B CA    1 
ATOM   4851 C  C     . ASN B 2 54  ? 23.795 10.103  -15.585 1.00 52.72  ? 54  ASN B C     1 
ATOM   4852 O  O     . ASN B 2 54  ? 24.877 10.702  -15.624 1.00 59.36  ? 54  ASN B O     1 
ATOM   4853 C  CB    . ASN B 2 54  ? 23.777 9.646   -13.104 1.00 59.06  ? 54  ASN B CB    1 
ATOM   4854 C  CG    . ASN B 2 54  ? 22.842 10.801  -12.764 1.00 50.04  ? 54  ASN B CG    1 
ATOM   4855 O  OD1   . ASN B 2 54  ? 22.532 11.645  -13.605 1.00 51.96  ? 54  ASN B OD1   1 
ATOM   4856 N  ND2   . ASN B 2 54  ? 22.399 10.846  -11.513 1.00 46.65  ? 54  ASN B ND2   1 
ATOM   4857 N  N     . PRO B 2 55  ? 22.838 10.347  -16.480 1.00 51.76  ? 55  PRO B N     1 
ATOM   4858 C  CA    . PRO B 2 55  ? 23.063 11.286  -17.584 1.00 45.45  ? 55  PRO B CA    1 
ATOM   4859 C  C     . PRO B 2 55  ? 22.816 12.747  -17.241 1.00 45.93  ? 55  PRO B C     1 
ATOM   4860 O  O     . PRO B 2 55  ? 22.866 13.587  -18.143 1.00 53.75  ? 55  PRO B O     1 
ATOM   4861 C  CB    . PRO B 2 55  ? 22.054 10.802  -18.634 1.00 46.17  ? 55  PRO B CB    1 
ATOM   4862 C  CG    . PRO B 2 55  ? 20.912 10.305  -17.816 1.00 49.60  ? 55  PRO B CG    1 
ATOM   4863 C  CD    . PRO B 2 55  ? 21.521 9.691   -16.576 1.00 50.28  ? 55  PRO B CD    1 
ATOM   4864 N  N     . TYR B 2 56  ? 22.558 13.079  -15.981 1.00 44.44  ? 56  TYR B N     1 
ATOM   4865 C  CA    . TYR B 2 56  ? 22.205 14.434  -15.588 1.00 51.48  ? 56  TYR B CA    1 
ATOM   4866 C  C     . TYR B 2 56  ? 23.375 15.111  -14.887 1.00 57.51  ? 56  TYR B C     1 
ATOM   4867 O  O     . TYR B 2 56  ? 24.194 14.458  -14.235 1.00 51.98  ? 56  TYR B O     1 
ATOM   4868 C  CB    . TYR B 2 56  ? 20.982 14.436  -14.669 1.00 52.60  ? 56  TYR B CB    1 
ATOM   4869 C  CG    . TYR B 2 56  ? 19.818 13.644  -15.215 1.00 58.20  ? 56  TYR B CG    1 
ATOM   4870 C  CD1   . TYR B 2 56  ? 19.041 14.142  -16.251 1.00 51.83  ? 56  TYR B CD1   1 
ATOM   4871 C  CD2   . TYR B 2 56  ? 19.497 12.398  -14.695 1.00 55.23  ? 56  TYR B CD2   1 
ATOM   4872 C  CE1   . TYR B 2 56  ? 17.977 13.422  -16.754 1.00 55.03  ? 56  TYR B CE1   1 
ATOM   4873 C  CE2   . TYR B 2 56  ? 18.435 11.671  -15.191 1.00 53.98  ? 56  TYR B CE2   1 
ATOM   4874 C  CZ    . TYR B 2 56  ? 17.678 12.187  -16.221 1.00 60.39  ? 56  TYR B CZ    1 
ATOM   4875 O  OH    . TYR B 2 56  ? 16.618 11.467  -16.718 1.00 73.38  ? 56  TYR B OH    1 
ATOM   4876 N  N     . ASN B 2 57  ? 23.441 16.434  -15.026 1.00 56.62  ? 57  ASN B N     1 
ATOM   4877 C  CA    . ASN B 2 57  ? 24.505 17.204  -14.401 1.00 52.03  ? 57  ASN B CA    1 
ATOM   4878 C  C     . ASN B 2 57  ? 24.013 18.614  -14.113 1.00 57.16  ? 57  ASN B C     1 
ATOM   4879 O  O     . ASN B 2 57  ? 23.120 19.130  -14.792 1.00 62.55  ? 57  ASN B O     1 
ATOM   4880 C  CB    . ASN B 2 57  ? 25.756 17.255  -15.281 1.00 47.45  ? 57  ASN B CB    1 
ATOM   4881 C  CG    . ASN B 2 57  ? 26.984 17.706  -14.517 1.00 44.52  ? 57  ASN B CG    1 
ATOM   4882 O  OD1   . ASN B 2 57  ? 27.283 17.188  -13.441 1.00 44.16  ? 57  ASN B OD1   1 
ATOM   4883 N  ND2   . ASN B 2 57  ? 27.695 18.685  -15.062 1.00 50.00  ? 57  ASN B ND2   1 
ATOM   4884 N  N     . THR B 2 58  ? 24.620 19.235  -13.100 1.00 60.45  ? 58  THR B N     1 
ATOM   4885 C  CA    . THR B 2 58  ? 24.277 20.571  -12.656 1.00 50.34  ? 58  THR B CA    1 
ATOM   4886 C  C     . THR B 2 58  ? 25.541 21.233  -12.121 1.00 46.00  ? 58  THR B C     1 
ATOM   4887 O  O     . THR B 2 58  ? 26.244 20.620  -11.303 1.00 50.45  ? 58  THR B O     1 
ATOM   4888 C  CB    . THR B 2 58  ? 23.193 20.544  -11.576 1.00 52.86  ? 58  THR B CB    1 
ATOM   4889 O  OG1   . THR B 2 58  ? 21.945 20.155  -12.163 1.00 45.23  ? 58  THR B OG1   1 
ATOM   4890 C  CG2   . THR B 2 58  ? 23.039 21.905  -10.935 1.00 54.99  ? 58  THR B CG2   1 
ATOM   4891 N  N     . PRO B 2 59  ? 25.856 22.453  -12.560 1.00 39.45  ? 59  PRO B N     1 
ATOM   4892 C  CA    . PRO B 2 59  ? 27.117 23.088  -12.156 1.00 39.15  ? 59  PRO B CA    1 
ATOM   4893 C  C     . PRO B 2 59  ? 27.207 23.303  -10.652 1.00 39.62  ? 59  PRO B C     1 
ATOM   4894 O  O     . PRO B 2 59  ? 26.208 23.313  -9.930  1.00 51.29  ? 59  PRO B O     1 
ATOM   4895 C  CB    . PRO B 2 59  ? 27.095 24.425  -12.904 1.00 41.60  ? 59  PRO B CB    1 
ATOM   4896 C  CG    . PRO B 2 59  ? 26.176 24.203  -14.055 1.00 41.94  ? 59  PRO B CG    1 
ATOM   4897 C  CD    . PRO B 2 59  ? 25.130 23.249  -13.564 1.00 41.80  ? 59  PRO B CD    1 
ATOM   4898 N  N     . VAL B 2 60  ? 28.442 23.488  -10.184 1.00 39.63  ? 60  VAL B N     1 
ATOM   4899 C  CA    . VAL B 2 60  ? 28.724 23.652  -8.764  1.00 40.22  ? 60  VAL B CA    1 
ATOM   4900 C  C     . VAL B 2 60  ? 29.981 24.498  -8.614  1.00 49.07  ? 60  VAL B C     1 
ATOM   4901 O  O     . VAL B 2 60  ? 30.890 24.445  -9.447  1.00 50.57  ? 60  VAL B O     1 
ATOM   4902 C  CB    . VAL B 2 60  ? 28.876 22.280  -8.059  1.00 40.98  ? 60  VAL B CB    1 
ATOM   4903 C  CG1   . VAL B 2 60  ? 30.079 21.521  -8.606  1.00 40.88  ? 60  VAL B CG1   1 
ATOM   4904 C  CG2   . VAL B 2 60  ? 28.974 22.448  -6.548  1.00 47.39  ? 60  VAL B CG2   1 
ATOM   4905 N  N     . PHE B 2 61  ? 30.019 25.295  -7.551  1.00 45.62  ? 61  PHE B N     1 
ATOM   4906 C  CA    . PHE B 2 61  ? 31.194 26.091  -7.212  1.00 40.43  ? 61  PHE B CA    1 
ATOM   4907 C  C     . PHE B 2 61  ? 31.105 26.452  -5.730  1.00 45.97  ? 61  PHE B C     1 
ATOM   4908 O  O     . PHE B 2 61  ? 30.342 25.835  -4.978  1.00 41.89  ? 61  PHE B O     1 
ATOM   4909 C  CB    . PHE B 2 61  ? 31.306 27.318  -8.136  1.00 46.85  ? 61  PHE B CB    1 
ATOM   4910 C  CG    . PHE B 2 61  ? 30.153 28.276  -8.031  1.00 47.32  ? 61  PHE B CG    1 
ATOM   4911 C  CD1   . PHE B 2 61  ? 28.958 28.022  -8.685  1.00 48.53  ? 61  PHE B CD1   1 
ATOM   4912 C  CD2   . PHE B 2 61  ? 30.275 29.446  -7.300  1.00 59.10  ? 61  PHE B CD2   1 
ATOM   4913 C  CE1   . PHE B 2 61  ? 27.901 28.908  -8.595  1.00 58.39  ? 61  PHE B CE1   1 
ATOM   4914 C  CE2   . PHE B 2 61  ? 29.222 30.337  -7.208  1.00 63.65  ? 61  PHE B CE2   1 
ATOM   4915 C  CZ    . PHE B 2 61  ? 28.034 30.068  -7.857  1.00 61.48  ? 61  PHE B CZ    1 
ATOM   4916 N  N     . ALA B 2 62  ? 31.888 27.442  -5.308  1.00 41.45  ? 62  ALA B N     1 
ATOM   4917 C  CA    . ALA B 2 62  ? 31.930 27.829  -3.905  1.00 52.36  ? 62  ALA B CA    1 
ATOM   4918 C  C     . ALA B 2 62  ? 32.267 29.308  -3.800  1.00 60.89  ? 62  ALA B C     1 
ATOM   4919 O  O     . ALA B 2 62  ? 32.843 29.902  -4.715  1.00 76.73  ? 62  ALA B O     1 
ATOM   4920 C  CB    . ALA B 2 62  ? 32.946 26.990  -3.120  1.00 50.51  ? 62  ALA B CB    1 
ATOM   4921 N  N     . ILE B 2 63  ? 31.899 29.897  -2.665  1.00 56.07  ? 63  ILE B N     1 
ATOM   4922 C  CA    . ILE B 2 63  ? 32.133 31.312  -2.401  1.00 57.30  ? 63  ILE B CA    1 
ATOM   4923 C  C     . ILE B 2 63  ? 32.582 31.474  -0.956  1.00 68.67  ? 63  ILE B C     1 
ATOM   4924 O  O     . ILE B 2 63  ? 32.067 30.805  -0.053  1.00 59.37  ? 63  ILE B O     1 
ATOM   4925 C  CB    . ILE B 2 63  ? 30.875 32.162  -2.681  1.00 42.96  ? 63  ILE B CB    1 
ATOM   4926 C  CG1   . ILE B 2 63  ? 29.653 31.561  -1.981  1.00 52.32  ? 63  ILE B CG1   1 
ATOM   4927 C  CG2   . ILE B 2 63  ? 30.636 32.295  -4.179  1.00 47.33  ? 63  ILE B CG2   1 
ATOM   4928 C  CD1   . ILE B 2 63  ? 28.382 32.357  -2.179  1.00 43.30  ? 63  ILE B CD1   1 
ATOM   4929 N  N     . LYS B 2 64  ? 33.551 32.360  -0.740  1.00 79.99  ? 64  LYS B N     1 
ATOM   4930 C  CA    . LYS B 2 64  ? 34.030 32.701  0.593   1.00 86.40  ? 64  LYS B CA    1 
ATOM   4931 C  C     . LYS B 2 64  ? 33.456 34.061  0.970   1.00 89.45  ? 64  LYS B C     1 
ATOM   4932 O  O     . LYS B 2 64  ? 33.742 35.064  0.306   1.00 84.00  ? 64  LYS B O     1 
ATOM   4933 C  CB    . LYS B 2 64  ? 35.558 32.719  0.637   1.00 87.77  ? 64  LYS B CB    1 
ATOM   4934 C  CG    . LYS B 2 64  ? 36.142 32.625  2.037   1.00 96.98  ? 64  LYS B CG    1 
ATOM   4935 C  CD    . LYS B 2 64  ? 37.664 32.632  2.004   1.00 93.37  ? 64  LYS B CD    1 
ATOM   4936 C  CE    . LYS B 2 64  ? 38.202 33.971  1.529   1.00 89.02  ? 64  LYS B CE    1 
ATOM   4937 N  NZ    . LYS B 2 64  ? 37.772 35.088  2.417   1.00 87.27  ? 64  LYS B NZ    1 
ATOM   4938 N  N     . LYS B 2 65  ? 32.650 34.096  2.027   1.00 106.95 ? 65  LYS B N     1 
ATOM   4939 C  CA    . LYS B 2 65  ? 31.862 35.277  2.358   1.00 122.50 ? 65  LYS B CA    1 
ATOM   4940 C  C     . LYS B 2 65  ? 32.647 36.213  3.271   1.00 127.34 ? 65  LYS B C     1 
ATOM   4941 O  O     . LYS B 2 65  ? 32.963 35.858  4.412   1.00 126.69 ? 65  LYS B O     1 
ATOM   4942 C  CB    . LYS B 2 65  ? 30.536 34.875  3.004   1.00 128.98 ? 65  LYS B CB    1 
ATOM   4943 C  CG    . LYS B 2 65  ? 29.525 34.316  2.013   1.00 124.21 ? 65  LYS B CG    1 
ATOM   4944 C  CD    . LYS B 2 65  ? 28.137 34.209  2.622   1.00 119.27 ? 65  LYS B CD    1 
ATOM   4945 C  CE    . LYS B 2 65  ? 28.103 33.186  3.743   1.00 118.93 ? 65  LYS B CE    1 
ATOM   4946 N  NZ    . LYS B 2 65  ? 28.513 31.836  3.270   1.00 121.51 ? 65  LYS B NZ    1 
ATOM   4947 N  N     . LYS B 2 66  ? 32.951 37.404  2.758   1.00 131.05 ? 66  LYS B N     1 
ATOM   4948 C  CA    . LYS B 2 66  ? 33.551 38.521  3.506   1.00 132.59 ? 66  LYS B CA    1 
ATOM   4949 C  C     . LYS B 2 66  ? 34.878 38.052  4.101   1.00 133.43 ? 66  LYS B C     1 
ATOM   4950 O  O     . LYS B 2 66  ? 35.680 37.436  3.381   1.00 137.01 ? 66  LYS B O     1 
ATOM   4951 C  CB    . LYS B 2 66  ? 32.531 39.057  4.506   1.00 133.49 ? 66  LYS B CB    1 
ATOM   4952 C  CG    . LYS B 2 66  ? 32.819 40.481  4.971   1.00 131.91 ? 66  LYS B CG    1 
ATOM   4953 C  CD    . LYS B 2 66  ? 31.800 40.960  5.991   1.00 127.47 ? 66  LYS B CD    1 
ATOM   4954 C  CE    . LYS B 2 66  ? 32.132 42.364  6.476   1.00 124.03 ? 66  LYS B CE    1 
ATOM   4955 N  NZ    . LYS B 2 66  ? 31.177 42.840  7.515   1.00 126.03 ? 66  LYS B NZ    1 
ATOM   4956 N  N     . ASP B 2 67  ? 35.155 38.317  5.375   1.00 132.88 ? 67  ASP B N     1 
ATOM   4957 C  CA    . ASP B 2 67  ? 36.435 38.003  6.003   1.00 127.95 ? 67  ASP B CA    1 
ATOM   4958 C  C     . ASP B 2 67  ? 36.231 36.792  6.909   1.00 122.83 ? 67  ASP B C     1 
ATOM   4959 O  O     . ASP B 2 67  ? 36.039 36.917  8.120   1.00 122.53 ? 67  ASP B O     1 
ATOM   4960 C  CB    . ASP B 2 67  ? 36.963 39.217  6.778   1.00 135.15 ? 67  ASP B CB    1 
ATOM   4961 C  CG    . ASP B 2 67  ? 36.837 40.511  5.994   1.00 135.71 ? 67  ASP B CG    1 
ATOM   4962 O  OD1   . ASP B 2 67  ? 36.964 40.471  4.752   1.00 134.67 ? 67  ASP B OD1   1 
ATOM   4963 O  OD2   . ASP B 2 67  ? 36.605 41.567  6.619   1.00 134.41 ? 67  ASP B OD2   1 
ATOM   4964 N  N     . SER B 2 68  ? 36.275 35.606  6.307   1.00 114.43 ? 68  SER B N     1 
ATOM   4965 C  CA    . SER B 2 68  ? 36.098 34.366  7.047   1.00 105.91 ? 68  SER B CA    1 
ATOM   4966 C  C     . SER B 2 68  ? 36.878 33.256  6.362   1.00 101.25 ? 68  SER B C     1 
ATOM   4967 O  O     . SER B 2 68  ? 37.093 33.283  5.147   1.00 94.74  ? 68  SER B O     1 
ATOM   4968 C  CB    . SER B 2 68  ? 34.619 33.977  7.159   1.00 97.57  ? 68  SER B CB    1 
ATOM   4969 O  OG    . SER B 2 68  ? 34.471 32.717  7.793   1.00 95.22  ? 68  SER B OG    1 
ATOM   4970 N  N     . THR B 2 69  ? 37.302 32.277  7.160   1.00 107.59 ? 69  THR B N     1 
ATOM   4971 C  CA    . THR B 2 69  ? 37.981 31.090  6.661   1.00 113.70 ? 69  THR B CA    1 
ATOM   4972 C  C     . THR B 2 69  ? 37.014 29.951  6.357   1.00 114.77 ? 69  THR B C     1 
ATOM   4973 O  O     . THR B 2 69  ? 37.421 28.783  6.366   1.00 103.80 ? 69  THR B O     1 
ATOM   4974 C  CB    . THR B 2 69  ? 39.039 30.627  7.666   1.00 113.55 ? 69  THR B CB    1 
ATOM   4975 O  OG1   . THR B 2 69  ? 38.446 30.508  8.965   1.00 119.28 ? 69  THR B OG1   1 
ATOM   4976 C  CG2   . THR B 2 69  ? 40.186 31.623  7.726   1.00 108.10 ? 69  THR B CG2   1 
ATOM   4977 N  N     . LYS B 2 70  ? 35.749 30.265  6.091   1.00 119.35 ? 70  LYS B N     1 
ATOM   4978 C  CA    . LYS B 2 70  ? 34.724 29.272  5.806   1.00 114.78 ? 70  LYS B CA    1 
ATOM   4979 C  C     . LYS B 2 70  ? 34.196 29.485  4.395   1.00 108.33 ? 70  LYS B C     1 
ATOM   4980 O  O     . LYS B 2 70  ? 33.887 30.618  4.007   1.00 104.05 ? 70  LYS B O     1 
ATOM   4981 C  CB    . LYS B 2 70  ? 33.576 29.357  6.816   1.00 118.36 ? 70  LYS B CB    1 
ATOM   4982 C  CG    . LYS B 2 70  ? 34.002 29.203  8.270   1.00 126.46 ? 70  LYS B CG    1 
ATOM   4983 C  CD    . LYS B 2 70  ? 32.809 29.338  9.207   1.00 129.97 ? 70  LYS B CD    1 
ATOM   4984 C  CE    . LYS B 2 70  ? 33.231 29.258  10.667  1.00 128.39 ? 70  LYS B CE    1 
ATOM   4985 N  NZ    . LYS B 2 70  ? 33.851 27.948  11.007  1.00 128.55 ? 70  LYS B NZ    1 
ATOM   4986 N  N     . TRP B 2 71  ? 34.103 28.402  3.632   1.00 91.37  ? 71  TRP B N     1 
ATOM   4987 C  CA    . TRP B 2 71  ? 33.527 28.424  2.297   1.00 70.42  ? 71  TRP B CA    1 
ATOM   4988 C  C     . TRP B 2 71  ? 32.123 27.834  2.327   1.00 69.23  ? 71  TRP B C     1 
ATOM   4989 O  O     . TRP B 2 71  ? 31.787 27.030  3.200   1.00 76.05  ? 71  TRP B O     1 
ATOM   4990 C  CB    . TRP B 2 71  ? 34.393 27.639  1.309   1.00 57.35  ? 71  TRP B CB    1 
ATOM   4991 C  CG    . TRP B 2 71  ? 35.700 28.287  0.994   1.00 55.30  ? 71  TRP B CG    1 
ATOM   4992 C  CD1   . TRP B 2 71  ? 36.831 28.262  1.754   1.00 50.00  ? 71  TRP B CD1   1 
ATOM   4993 C  CD2   . TRP B 2 71  ? 36.018 29.049  -0.176  1.00 50.68  ? 71  TRP B CD2   1 
ATOM   4994 N  NE1   . TRP B 2 71  ? 37.833 28.967  1.134   1.00 53.33  ? 71  TRP B NE1   1 
ATOM   4995 C  CE2   . TRP B 2 71  ? 37.360 29.460  -0.054  1.00 52.29  ? 71  TRP B CE2   1 
ATOM   4996 C  CE3   . TRP B 2 71  ? 35.298 29.427  -1.314  1.00 50.40  ? 71  TRP B CE3   1 
ATOM   4997 C  CZ2   . TRP B 2 71  ? 37.996 30.230  -1.025  1.00 45.93  ? 71  TRP B CZ2   1 
ATOM   4998 C  CZ3   . TRP B 2 71  ? 35.932 30.191  -2.277  1.00 49.48  ? 71  TRP B CZ3   1 
ATOM   4999 C  CH2   . TRP B 2 71  ? 37.267 30.583  -2.127  1.00 44.71  ? 71  TRP B CH2   1 
ATOM   5000 N  N     . ARG B 2 72  ? 31.304 28.241  1.363   1.00 61.50  ? 72  ARG B N     1 
ATOM   5001 C  CA    . ARG B 2 72  ? 29.962 27.702  1.203   1.00 55.07  ? 72  ARG B CA    1 
ATOM   5002 C  C     . ARG B 2 72  ? 29.822 27.120  -0.195  1.00 51.45  ? 72  ARG B C     1 
ATOM   5003 O  O     . ARG B 2 72  ? 30.153 27.782  -1.184  1.00 50.98  ? 72  ARG B O     1 
ATOM   5004 C  CB    . ARG B 2 72  ? 28.891 28.769  1.440   1.00 57.84  ? 72  ARG B CB    1 
ATOM   5005 C  CG    . ARG B 2 72  ? 27.620 28.226  2.082   1.00 61.45  ? 72  ARG B CG    1 
ATOM   5006 C  CD    . ARG B 2 72  ? 26.444 29.168  1.886   1.00 75.33  ? 72  ARG B CD    1 
ATOM   5007 N  NE    . ARG B 2 72  ? 25.596 28.754  0.771   1.00 84.92  ? 72  ARG B NE    1 
ATOM   5008 C  CZ    . ARG B 2 72  ? 24.443 28.107  0.910   1.00 82.82  ? 72  ARG B CZ    1 
ATOM   5009 N  NH1   . ARG B 2 72  ? 23.991 27.804  2.120   1.00 75.53  ? 72  ARG B NH1   1 
ATOM   5010 N  NH2   . ARG B 2 72  ? 23.736 27.768  -0.160  1.00 82.99  ? 72  ARG B NH2   1 
ATOM   5011 N  N     . LYS B 2 73  ? 29.337 25.886  -0.269  1.00 50.67  ? 73  LYS B N     1 
ATOM   5012 C  CA    . LYS B 2 73  ? 29.090 25.238  -1.548  1.00 44.66  ? 73  LYS B CA    1 
ATOM   5013 C  C     . LYS B 2 73  ? 27.808 25.777  -2.167  1.00 56.43  ? 73  LYS B C     1 
ATOM   5014 O  O     . LYS B 2 73  ? 26.788 25.923  -1.488  1.00 73.47  ? 73  LYS B O     1 
ATOM   5015 C  CB    . LYS B 2 73  ? 28.994 23.725  -1.355  1.00 51.05  ? 73  LYS B CB    1 
ATOM   5016 C  CG    . LYS B 2 73  ? 28.561 22.943  -2.579  1.00 48.45  ? 73  LYS B CG    1 
ATOM   5017 C  CD    . LYS B 2 73  ? 28.091 21.563  -2.159  1.00 59.48  ? 73  LYS B CD    1 
ATOM   5018 C  CE    . LYS B 2 73  ? 27.585 20.753  -3.333  1.00 70.24  ? 73  LYS B CE    1 
ATOM   5019 N  NZ    . LYS B 2 73  ? 26.828 19.560  -2.865  1.00 81.49  ? 73  LYS B NZ    1 
ATOM   5020 N  N     . LEU B 2 74  ? 27.865 26.076  -3.462  1.00 55.73  ? 74  LEU B N     1 
ATOM   5021 C  CA    . LEU B 2 74  ? 26.735 26.649  -4.183  1.00 51.97  ? 74  LEU B CA    1 
ATOM   5022 C  C     . LEU B 2 74  ? 26.500 25.839  -5.448  1.00 51.13  ? 74  LEU B C     1 
ATOM   5023 O  O     . LEU B 2 74  ? 27.409 25.693  -6.272  1.00 48.63  ? 74  LEU B O     1 
ATOM   5024 C  CB    . LEU B 2 74  ? 26.989 28.120  -4.522  1.00 63.12  ? 74  LEU B CB    1 
ATOM   5025 C  CG    . LEU B 2 74  ? 25.772 29.045  -4.477  1.00 71.41  ? 74  LEU B CG    1 
ATOM   5026 C  CD1   . LEU B 2 74  ? 25.132 29.009  -3.100  1.00 78.47  ? 74  LEU B CD1   1 
ATOM   5027 C  CD2   . LEU B 2 74  ? 26.168 30.465  -4.845  1.00 73.97  ? 74  LEU B CD2   1 
ATOM   5028 N  N     . VAL B 2 75  ? 25.288 25.314  -5.599  1.00 51.06  ? 75  VAL B N     1 
ATOM   5029 C  CA    . VAL B 2 75  ? 24.903 24.517  -6.758  1.00 44.43  ? 75  VAL B CA    1 
ATOM   5030 C  C     . VAL B 2 75  ? 23.954 25.353  -7.605  1.00 41.06  ? 75  VAL B C     1 
ATOM   5031 O  O     . VAL B 2 75  ? 22.929 25.836  -7.108  1.00 54.79  ? 75  VAL B O     1 
ATOM   5032 C  CB    . VAL B 2 75  ? 24.252 23.190  -6.341  1.00 47.58  ? 75  VAL B CB    1 
ATOM   5033 C  CG1   . VAL B 2 75  ? 24.079 22.284  -7.544  1.00 42.02  ? 75  VAL B CG1   1 
ATOM   5034 C  CG2   . VAL B 2 75  ? 25.082 22.504  -5.270  1.00 49.83  ? 75  VAL B CG2   1 
ATOM   5035 N  N     . ASP B 2 76  ? 24.294 25.527  -8.883  1.00 40.48  ? 76  ASP B N     1 
ATOM   5036 C  CA    . ASP B 2 76  ? 23.481 26.321  -9.806  1.00 51.30  ? 76  ASP B CA    1 
ATOM   5037 C  C     . ASP B 2 76  ? 22.275 25.487  -10.231 1.00 49.11  ? 76  ASP B C     1 
ATOM   5038 O  O     . ASP B 2 76  ? 22.215 24.924  -11.327 1.00 58.06  ? 76  ASP B O     1 
ATOM   5039 C  CB    . ASP B 2 76  ? 24.310 26.769  -11.003 1.00 62.21  ? 76  ASP B CB    1 
ATOM   5040 C  CG    . ASP B 2 76  ? 23.538 27.681  -11.934 1.00 57.43  ? 76  ASP B CG    1 
ATOM   5041 O  OD1   . ASP B 2 76  ? 22.574 28.318  -11.468 1.00 60.85  ? 76  ASP B OD1   1 
ATOM   5042 O  OD2   . ASP B 2 76  ? 23.896 27.763  -13.128 1.00 49.79  ? 76  ASP B OD2   1 
ATOM   5043 N  N     . PHE B 2 77  ? 21.287 25.428  -9.343  1.00 48.40  ? 77  PHE B N     1 
ATOM   5044 C  CA    . PHE B 2 77  ? 20.122 24.569  -9.506  1.00 49.98  ? 77  PHE B CA    1 
ATOM   5045 C  C     . PHE B 2 77  ? 18.967 25.235  -10.246 1.00 44.83  ? 77  PHE B C     1 
ATOM   5046 O  O     . PHE B 2 77  ? 17.880 24.653  -10.309 1.00 55.09  ? 77  PHE B O     1 
ATOM   5047 C  CB    . PHE B 2 77  ? 19.630 24.092  -8.137  1.00 53.72  ? 77  PHE B CB    1 
ATOM   5048 C  CG    . PHE B 2 77  ? 20.144 22.740  -7.739  1.00 54.32  ? 77  PHE B CG    1 
ATOM   5049 C  CD1   . PHE B 2 77  ? 20.246 21.718  -8.669  1.00 60.37  ? 77  PHE B CD1   1 
ATOM   5050 C  CD2   . PHE B 2 77  ? 20.521 22.490  -6.431  1.00 54.52  ? 77  PHE B CD2   1 
ATOM   5051 C  CE1   . PHE B 2 77  ? 20.717 20.471  -8.300  1.00 53.60  ? 77  PHE B CE1   1 
ATOM   5052 C  CE2   . PHE B 2 77  ? 20.993 21.246  -6.055  1.00 52.77  ? 77  PHE B CE2   1 
ATOM   5053 C  CZ    . PHE B 2 77  ? 21.091 20.236  -6.991  1.00 51.42  ? 77  PHE B CZ    1 
ATOM   5054 N  N     . ARG B 2 78  ? 19.163 26.431  -10.805 1.00 40.68  ? 78  ARG B N     1 
ATOM   5055 C  CA    . ARG B 2 78  ? 18.038 27.123  -11.428 1.00 65.83  ? 78  ARG B CA    1 
ATOM   5056 C  C     . ARG B 2 78  ? 17.587 26.454  -12.720 1.00 56.74  ? 78  ARG B C     1 
ATOM   5057 O  O     . ARG B 2 78  ? 16.432 26.632  -13.121 1.00 72.45  ? 78  ARG B O     1 
ATOM   5058 C  CB    . ARG B 2 78  ? 18.381 28.594  -11.676 1.00 64.86  ? 78  ARG B CB    1 
ATOM   5059 C  CG    . ARG B 2 78  ? 19.608 28.834  -12.528 1.00 51.58  ? 78  ARG B CG    1 
ATOM   5060 C  CD    . ARG B 2 78  ? 20.158 30.229  -12.287 1.00 38.67  ? 78  ARG B CD    1 
ATOM   5061 N  NE    . ARG B 2 78  ? 21.541 30.345  -12.737 1.00 42.92  ? 78  ARG B NE    1 
ATOM   5062 C  CZ    . ARG B 2 78  ? 21.916 30.956  -13.855 1.00 50.10  ? 78  ARG B CZ    1 
ATOM   5063 N  NH1   . ARG B 2 78  ? 21.008 31.519  -14.641 1.00 67.38  ? 78  ARG B NH1   1 
ATOM   5064 N  NH2   . ARG B 2 78  ? 23.198 31.007  -14.184 1.00 37.68  ? 78  ARG B NH2   1 
ATOM   5065 N  N     . GLU B 2 79  ? 18.461 25.687  -13.375 1.00 50.02  ? 79  GLU B N     1 
ATOM   5066 C  CA    . GLU B 2 79  ? 18.032 24.904  -14.530 1.00 55.39  ? 79  GLU B CA    1 
ATOM   5067 C  C     . GLU B 2 79  ? 17.153 23.732  -14.112 1.00 59.15  ? 79  GLU B C     1 
ATOM   5068 O  O     . GLU B 2 79  ? 16.241 23.345  -14.852 1.00 70.90  ? 79  GLU B O     1 
ATOM   5069 C  CB    . GLU B 2 79  ? 19.250 24.408  -15.311 1.00 57.10  ? 79  GLU B CB    1 
ATOM   5070 C  CG    . GLU B 2 79  ? 18.921 23.623  -16.575 1.00 61.98  ? 79  GLU B CG    1 
ATOM   5071 C  CD    . GLU B 2 79  ? 18.155 24.444  -17.595 1.00 75.69  ? 79  GLU B CD    1 
ATOM   5072 O  OE1   . GLU B 2 79  ? 17.302 23.870  -18.304 1.00 85.06  ? 79  GLU B OE1   1 
ATOM   5073 O  OE2   . GLU B 2 79  ? 18.404 25.665  -17.685 1.00 78.78  ? 79  GLU B OE2   1 
ATOM   5074 N  N     . LEU B 2 80  ? 17.411 23.156  -12.936 1.00 53.46  ? 80  LEU B N     1 
ATOM   5075 C  CA    . LEU B 2 80  ? 16.560 22.090  -12.418 1.00 45.58  ? 80  LEU B CA    1 
ATOM   5076 C  C     . LEU B 2 80  ? 15.263 22.635  -11.835 1.00 57.66  ? 80  LEU B C     1 
ATOM   5077 O  O     . LEU B 2 80  ? 14.229 21.961  -11.900 1.00 65.99  ? 80  LEU B O     1 
ATOM   5078 C  CB    . LEU B 2 80  ? 17.319 21.283  -11.361 1.00 54.04  ? 80  LEU B CB    1 
ATOM   5079 C  CG    . LEU B 2 80  ? 16.561 20.197  -10.591 1.00 49.98  ? 80  LEU B CG    1 
ATOM   5080 C  CD1   . LEU B 2 80  ? 16.098 19.083  -11.518 1.00 47.65  ? 80  LEU B CD1   1 
ATOM   5081 C  CD2   . LEU B 2 80  ? 17.413 19.643  -9.462  1.00 44.72  ? 80  LEU B CD2   1 
ATOM   5082 N  N     . ASN B 2 81  ? 15.295 23.848  -11.275 1.00 66.00  ? 81  ASN B N     1 
ATOM   5083 C  CA    . ASN B 2 81  ? 14.083 24.439  -10.716 1.00 58.21  ? 81  ASN B CA    1 
ATOM   5084 C  C     . ASN B 2 81  ? 13.051 24.717  -11.802 1.00 51.83  ? 81  ASN B C     1 
ATOM   5085 O  O     . ASN B 2 81  ? 11.850 24.507  -11.595 1.00 61.44  ? 81  ASN B O     1 
ATOM   5086 C  CB    . ASN B 2 81  ? 14.426 25.721  -9.958  1.00 54.56  ? 81  ASN B CB    1 
ATOM   5087 C  CG    . ASN B 2 81  ? 15.342 25.470  -8.776  1.00 59.82  ? 81  ASN B CG    1 
ATOM   5088 O  OD1   . ASN B 2 81  ? 15.369 24.371  -8.221  1.00 70.66  ? 81  ASN B OD1   1 
ATOM   5089 N  ND2   . ASN B 2 81  ? 16.097 26.490  -8.383  1.00 56.52  ? 81  ASN B ND2   1 
ATOM   5090 N  N     . LYS B 2 82  ? 13.502 25.190  -12.968 1.00 46.64  ? 82  LYS B N     1 
ATOM   5091 C  CA    . LYS B 2 82  ? 12.586 25.416  -14.082 1.00 54.66  ? 82  LYS B CA    1 
ATOM   5092 C  C     . LYS B 2 82  ? 11.883 24.133  -14.500 1.00 67.13  ? 82  LYS B C     1 
ATOM   5093 O  O     . LYS B 2 82  ? 10.742 24.175  -14.974 1.00 78.40  ? 82  LYS B O     1 
ATOM   5094 C  CB    . LYS B 2 82  ? 13.341 26.007  -15.272 1.00 53.80  ? 82  LYS B CB    1 
ATOM   5095 C  CG    . LYS B 2 82  ? 13.901 27.393  -15.033 1.00 60.23  ? 82  LYS B CG    1 
ATOM   5096 C  CD    . LYS B 2 82  ? 15.054 27.684  -15.979 1.00 68.56  ? 82  LYS B CD    1 
ATOM   5097 C  CE    . LYS B 2 82  ? 14.644 27.513  -17.431 1.00 78.21  ? 82  LYS B CE    1 
ATOM   5098 N  NZ    . LYS B 2 82  ? 15.791 27.756  -18.351 1.00 83.37  ? 82  LYS B NZ    1 
ATOM   5099 N  N     . ARG B 2 83  ? 12.542 22.989  -14.329 1.00 62.52  ? 83  ARG B N     1 
ATOM   5100 C  CA    . ARG B 2 83  ? 11.985 21.702  -14.719 1.00 64.76  ? 83  ARG B CA    1 
ATOM   5101 C  C     . ARG B 2 83  ? 11.270 20.990  -13.578 1.00 63.89  ? 83  ARG B C     1 
ATOM   5102 O  O     . ARG B 2 83  ? 10.520 20.042  -13.836 1.00 69.68  ? 83  ARG B O     1 
ATOM   5103 C  CB    . ARG B 2 83  ? 13.098 20.807  -15.273 1.00 64.40  ? 83  ARG B CB    1 
ATOM   5104 C  CG    . ARG B 2 83  ? 13.877 21.453  -16.408 1.00 59.32  ? 83  ARG B CG    1 
ATOM   5105 C  CD    . ARG B 2 83  ? 15.192 20.741  -16.674 1.00 57.36  ? 83  ARG B CD    1 
ATOM   5106 N  NE    . ARG B 2 83  ? 15.933 21.368  -17.765 1.00 52.57  ? 83  ARG B NE    1 
ATOM   5107 C  CZ    . ARG B 2 83  ? 15.859 20.983  -19.035 1.00 60.96  ? 83  ARG B CZ    1 
ATOM   5108 N  NH1   . ARG B 2 83  ? 15.078 19.968  -19.377 1.00 80.02  ? 83  ARG B NH1   1 
ATOM   5109 N  NH2   . ARG B 2 83  ? 16.567 21.611  -19.963 1.00 58.05  ? 83  ARG B NH2   1 
ATOM   5110 N  N     . THR B 2 84  ? 11.475 21.421  -12.337 1.00 56.52  ? 84  THR B N     1 
ATOM   5111 C  CA    . THR B 2 84  ? 10.841 20.774  -11.199 1.00 63.01  ? 84  THR B CA    1 
ATOM   5112 C  C     . THR B 2 84  ? 9.348  21.089  -11.165 1.00 91.29  ? 84  THR B C     1 
ATOM   5113 O  O     . THR B 2 84  ? 8.908  22.167  -11.576 1.00 88.26  ? 84  THR B O     1 
ATOM   5114 C  CB    . THR B 2 84  ? 11.504 21.226  -9.895  1.00 70.81  ? 84  THR B CB    1 
ATOM   5115 O  OG1   . THR B 2 84  ? 12.928 21.181  -10.044 1.00 85.46  ? 84  THR B OG1   1 
ATOM   5116 C  CG2   . THR B 2 84  ? 11.101 20.321  -8.739  1.00 71.08  ? 84  THR B CG2   1 
ATOM   5117 N  N     . GLN B 2 85  ? 8.568  20.124  -10.680 1.00 118.46 ? 85  GLN B N     1 
ATOM   5118 C  CA    . GLN B 2 85  ? 7.132  20.320  -10.534 1.00 119.89 ? 85  GLN B CA    1 
ATOM   5119 C  C     . GLN B 2 85  ? 6.848  21.497  -9.610  1.00 116.58 ? 85  GLN B C     1 
ATOM   5120 O  O     . GLN B 2 85  ? 7.539  21.704  -8.608  1.00 117.77 ? 85  GLN B O     1 
ATOM   5121 C  CB    . GLN B 2 85  ? 6.478  19.048  -9.987  1.00 128.98 ? 85  GLN B CB    1 
ATOM   5122 C  CG    . GLN B 2 85  ? 4.963  19.114  -9.865  1.00 140.21 ? 85  GLN B CG    1 
ATOM   5123 C  CD    . GLN B 2 85  ? 4.266  19.119  -11.212 1.00 144.47 ? 85  GLN B CD    1 
ATOM   5124 O  OE1   . GLN B 2 85  ? 4.751  18.529  -12.178 1.00 147.67 ? 85  GLN B OE1   1 
ATOM   5125 N  NE2   . GLN B 2 85  ? 3.122  19.790  -11.284 1.00 139.95 ? 85  GLN B NE2   1 
ATOM   5126 N  N     . ASP B 2 86  ? 5.827  22.275  -9.956  1.00 113.13 ? 86  ASP B N     1 
ATOM   5127 C  CA    . ASP B 2 86  ? 5.455  23.449  -9.176  1.00 101.28 ? 86  ASP B CA    1 
ATOM   5128 C  C     . ASP B 2 86  ? 4.855  23.056  -7.829  1.00 85.45  ? 86  ASP B C     1 
ATOM   5129 O  O     . ASP B 2 86  ? 4.567  21.885  -7.584  1.00 76.84  ? 86  ASP B O     1 
ATOM   5130 C  CB    . ASP B 2 86  ? 4.467  24.317  -9.958  1.00 102.06 ? 86  ASP B CB    1 
ATOM   5131 C  CG    . ASP B 2 86  ? 5.087  24.933  -11.197 1.00 107.57 ? 86  ASP B CG    1 
ATOM   5132 O  OD1   . ASP B 2 86  ? 6.229  25.432  -11.107 1.00 106.39 ? 86  ASP B OD1   1 
ATOM   5133 O  OD2   . ASP B 2 86  ? 4.435  24.914  -12.263 1.00 108.96 ? 86  ASP B OD2   1 
ATOM   5134 N  N     . PRO B 2 95  ? 0.783  33.976  1.501   1.00 141.30 ? 95  PRO B N     1 
ATOM   5135 C  CA    . PRO B 2 95  ? 0.822  35.362  1.022   1.00 140.21 ? 95  PRO B CA    1 
ATOM   5136 C  C     . PRO B 2 95  ? 2.170  36.029  1.277   1.00 136.66 ? 95  PRO B C     1 
ATOM   5137 O  O     . PRO B 2 95  ? 2.744  35.856  2.352   1.00 148.83 ? 95  PRO B O     1 
ATOM   5138 C  CB    . PRO B 2 95  ? -0.284 36.043  1.832   1.00 140.00 ? 95  PRO B CB    1 
ATOM   5139 C  CG    . PRO B 2 95  ? -1.232 34.944  2.160   1.00 140.16 ? 95  PRO B CG    1 
ATOM   5140 C  CD    . PRO B 2 95  ? -0.380 33.725  2.370   1.00 141.44 ? 95  PRO B CD    1 
ATOM   5141 N  N     . HIS B 2 96  ? 2.665  36.779  0.299   1.00 116.01 ? 96  HIS B N     1 
ATOM   5142 C  CA    . HIS B 2 96  ? 3.942  37.462  0.463   1.00 94.33  ? 96  HIS B CA    1 
ATOM   5143 C  C     . HIS B 2 96  ? 3.796  38.593  1.474   1.00 91.06  ? 96  HIS B C     1 
ATOM   5144 O  O     . HIS B 2 96  ? 2.862  39.396  1.368   1.00 97.75  ? 96  HIS B O     1 
ATOM   5145 C  CB    . HIS B 2 96  ? 4.438  38.010  -0.872  1.00 85.96  ? 96  HIS B CB    1 
ATOM   5146 C  CG    . HIS B 2 96  ? 5.714  38.786  -0.768  1.00 81.66  ? 96  HIS B CG    1 
ATOM   5147 N  ND1   . HIS B 2 96  ? 6.949  38.182  -0.681  1.00 65.58  ? 96  HIS B ND1   1 
ATOM   5148 C  CD2   . HIS B 2 96  ? 5.944  40.120  -0.727  1.00 83.06  ? 96  HIS B CD2   1 
ATOM   5149 C  CE1   . HIS B 2 96  ? 7.886  39.109  -0.596  1.00 62.12  ? 96  HIS B CE1   1 
ATOM   5150 N  NE2   . HIS B 2 96  ? 7.303  40.294  -0.622  1.00 66.14  ? 96  HIS B NE2   1 
ATOM   5151 N  N     . PRO B 2 97  ? 4.686  38.689  2.464   1.00 89.36  ? 97  PRO B N     1 
ATOM   5152 C  CA    . PRO B 2 97  ? 4.573  39.763  3.461   1.00 85.12  ? 97  PRO B CA    1 
ATOM   5153 C  C     . PRO B 2 97  ? 4.764  41.147  2.862   1.00 82.20  ? 97  PRO B C     1 
ATOM   5154 O  O     . PRO B 2 97  ? 5.886  41.538  2.523   1.00 76.75  ? 97  PRO B O     1 
ATOM   5155 C  CB    . PRO B 2 97  ? 5.687  39.429  4.462   1.00 84.62  ? 97  PRO B CB    1 
ATOM   5156 C  CG    . PRO B 2 97  ? 5.972  37.975  4.255   1.00 88.55  ? 97  PRO B CG    1 
ATOM   5157 C  CD    . PRO B 2 97  ? 5.760  37.739  2.793   1.00 89.18  ? 97  PRO B CD    1 
ATOM   5158 N  N     . ALA B 2 98  ? 3.667  41.897  2.730   1.00 82.33  ? 98  ALA B N     1 
ATOM   5159 C  CA    . ALA B 2 98  ? 3.743  43.245  2.180   1.00 73.69  ? 98  ALA B CA    1 
ATOM   5160 C  C     . ALA B 2 98  ? 4.437  44.219  3.122   1.00 78.04  ? 98  ALA B C     1 
ATOM   5161 O  O     . ALA B 2 98  ? 4.982  45.226  2.658   1.00 80.74  ? 98  ALA B O     1 
ATOM   5162 C  CB    . ALA B 2 98  ? 2.341  43.755  1.847   1.00 63.29  ? 98  ALA B CB    1 
ATOM   5163 N  N     . GLY B 2 99  ? 4.432  43.946  4.425   1.00 80.45  ? 99  GLY B N     1 
ATOM   5164 C  CA    . GLY B 2 99  ? 5.046  44.826  5.396   1.00 83.95  ? 99  GLY B CA    1 
ATOM   5165 C  C     . GLY B 2 99  ? 6.536  44.671  5.577   1.00 81.08  ? 99  GLY B C     1 
ATOM   5166 O  O     . GLY B 2 99  ? 7.135  45.421  6.352   1.00 78.50  ? 99  GLY B O     1 
ATOM   5167 N  N     . LEU B 2 100 ? 7.161  43.717  4.881   1.00 76.95  ? 100 LEU B N     1 
ATOM   5168 C  CA    . LEU B 2 100 ? 8.599  43.517  5.033   1.00 67.97  ? 100 LEU B CA    1 
ATOM   5169 C  C     . LEU B 2 100 ? 9.386  44.678  4.437   1.00 73.42  ? 100 LEU B C     1 
ATOM   5170 O  O     . LEU B 2 100 ? 10.388 45.116  5.014   1.00 75.91  ? 100 LEU B O     1 
ATOM   5171 C  CB    . LEU B 2 100 ? 9.016  42.197  4.384   1.00 65.93  ? 100 LEU B CB    1 
ATOM   5172 C  CG    . LEU B 2 100 ? 10.500 41.837  4.487   1.00 63.69  ? 100 LEU B CG    1 
ATOM   5173 C  CD1   . LEU B 2 100 ? 10.923 41.713  5.943   1.00 72.11  ? 100 LEU B CD1   1 
ATOM   5174 C  CD2   . LEU B 2 100 ? 10.797 40.555  3.726   1.00 61.94  ? 100 LEU B CD2   1 
ATOM   5175 N  N     . LYS B 2 101 ? 8.945  45.193  3.289   1.00 79.61  ? 101 LYS B N     1 
ATOM   5176 C  CA    . LYS B 2 101 ? 9.632  46.296  2.625   1.00 75.03  ? 101 LYS B CA    1 
ATOM   5177 C  C     . LYS B 2 101 ? 9.508  47.618  3.371   1.00 78.46  ? 101 LYS B C     1 
ATOM   5178 O  O     . LYS B 2 101 ? 10.106 48.608  2.933   1.00 80.38  ? 101 LYS B O     1 
ATOM   5179 C  CB    . LYS B 2 101 ? 9.096  46.459  1.201   1.00 63.87  ? 101 LYS B CB    1 
ATOM   5180 C  CG    . LYS B 2 101 ? 7.591  46.663  1.126   1.00 64.40  ? 101 LYS B CG    1 
ATOM   5181 C  CD    . LYS B 2 101 ? 7.132  46.904  -0.303  1.00 57.82  ? 101 LYS B CD    1 
ATOM   5182 C  CE    . LYS B 2 101 ? 5.616  46.939  -0.395  1.00 59.23  ? 101 LYS B CE    1 
ATOM   5183 N  NZ    . LYS B 2 101 ? 5.012  45.627  -0.029  1.00 70.63  ? 101 LYS B NZ    1 
ATOM   5184 N  N     . LYS B 2 102 ? 8.759  47.667  4.472   1.00 79.56  ? 102 LYS B N     1 
ATOM   5185 C  CA    . LYS B 2 102 ? 8.564  48.890  5.241   1.00 83.71  ? 102 LYS B CA    1 
ATOM   5186 C  C     . LYS B 2 102 ? 9.192  48.800  6.629   1.00 89.81  ? 102 LYS B C     1 
ATOM   5187 O  O     . LYS B 2 102 ? 8.760  49.487  7.557   1.00 94.66  ? 102 LYS B O     1 
ATOM   5188 C  CB    . LYS B 2 102 ? 7.076  49.218  5.349   1.00 85.37  ? 102 LYS B CB    1 
ATOM   5189 C  CG    . LYS B 2 102 ? 6.380  49.397  4.008   1.00 86.03  ? 102 LYS B CG    1 
ATOM   5190 C  CD    . LYS B 2 102 ? 4.900  49.692  4.191   1.00 90.25  ? 102 LYS B CD    1 
ATOM   5191 C  CE    . LYS B 2 102 ? 4.209  49.898  2.853   1.00 88.32  ? 102 LYS B CE    1 
ATOM   5192 N  NZ    . LYS B 2 102 ? 2.778  50.279  3.018   0.10 89.12  ? 102 LYS B NZ    1 
ATOM   5193 N  N     . LYS B 2 103 ? 10.209 47.958  6.785   1.00 84.46  ? 103 LYS B N     1 
ATOM   5194 C  CA    . LYS B 2 103 ? 10.899 47.788  8.055   1.00 72.65  ? 103 LYS B CA    1 
ATOM   5195 C  C     . LYS B 2 103 ? 12.217 48.553  8.050   1.00 66.58  ? 103 LYS B C     1 
ATOM   5196 O  O     . LYS B 2 103 ? 12.862 48.711  7.010   1.00 61.54  ? 103 LYS B O     1 
ATOM   5197 C  CB    . LYS B 2 103 ? 11.156 46.307  8.343   1.00 70.65  ? 103 LYS B CB    1 
ATOM   5198 C  CG    . LYS B 2 103 ? 9.896  45.498  8.612   1.00 80.73  ? 103 LYS B CG    1 
ATOM   5199 C  CD    . LYS B 2 103 ? 9.176  45.999  9.855   1.00 93.14  ? 103 LYS B CD    1 
ATOM   5200 C  CE    . LYS B 2 103 ? 7.950  45.154  10.171  1.00 100.29 ? 103 LYS B CE    1 
ATOM   5201 N  NZ    . LYS B 2 103 ? 6.921  45.237  9.098   1.00 99.50  ? 103 LYS B NZ    1 
ATOM   5202 N  N     . LYS B 2 104 ? 12.611 49.029  9.234   1.00 69.64  ? 104 LYS B N     1 
ATOM   5203 C  CA    . LYS B 2 104 ? 13.833 49.820  9.348   1.00 76.78  ? 104 LYS B CA    1 
ATOM   5204 C  C     . LYS B 2 104 ? 15.064 48.990  9.005   1.00 80.63  ? 104 LYS B C     1 
ATOM   5205 O  O     . LYS B 2 104 ? 15.872 49.383  8.155   1.00 81.73  ? 104 LYS B O     1 
ATOM   5206 C  CB    . LYS B 2 104 ? 13.950 50.405  10.757  1.00 84.07  ? 104 LYS B CB    1 
ATOM   5207 C  CG    . LYS B 2 104 ? 12.858 51.405  11.111  1.00 93.22  ? 104 LYS B CG    1 
ATOM   5208 C  CD    . LYS B 2 104 ? 13.055 51.965  12.512  1.00 97.83  ? 104 LYS B CD    1 
ATOM   5209 C  CE    . LYS B 2 104 ? 11.971 52.972  12.867  1.00 96.09  ? 104 LYS B CE    1 
ATOM   5210 N  NZ    . LYS B 2 104 ? 10.612 52.364  12.854  1.00 96.32  ? 104 LYS B NZ    1 
ATOM   5211 N  N     . SER B 2 105 ? 15.226 47.840  9.653   1.00 77.15  ? 105 SER B N     1 
ATOM   5212 C  CA    . SER B 2 105 ? 16.358 46.960  9.406   1.00 76.08  ? 105 SER B CA    1 
ATOM   5213 C  C     . SER B 2 105 ? 15.858 45.564  9.070   1.00 70.98  ? 105 SER B C     1 
ATOM   5214 O  O     . SER B 2 105 ? 14.880 45.088  9.654   1.00 68.76  ? 105 SER B O     1 
ATOM   5215 C  CB    . SER B 2 105 ? 17.298 46.904  10.616  1.00 77.22  ? 105 SER B CB    1 
ATOM   5216 O  OG    . SER B 2 105 ? 17.834 48.184  10.903  1.00 77.62  ? 105 SER B OG    1 
ATOM   5217 N  N     . VAL B 2 106 ? 16.531 44.915  8.122   1.00 69.91  ? 106 VAL B N     1 
ATOM   5218 C  CA    . VAL B 2 106 ? 16.215 43.552  7.710   1.00 65.76  ? 106 VAL B CA    1 
ATOM   5219 C  C     . VAL B 2 106 ? 17.518 42.770  7.629   1.00 64.98  ? 106 VAL B C     1 
ATOM   5220 O  O     . VAL B 2 106 ? 18.412 43.124  6.851   1.00 64.04  ? 106 VAL B O     1 
ATOM   5221 C  CB    . VAL B 2 106 ? 15.473 43.507  6.364   1.00 65.22  ? 106 VAL B CB    1 
ATOM   5222 C  CG1   . VAL B 2 106 ? 15.373 42.073  5.864   1.00 66.62  ? 106 VAL B CG1   1 
ATOM   5223 C  CG2   . VAL B 2 106 ? 14.087 44.118  6.499   1.00 57.06  ? 106 VAL B CG2   1 
ATOM   5224 N  N     . THR B 2 107 ? 17.627 41.714  8.430   1.00 66.87  ? 107 THR B N     1 
ATOM   5225 C  CA    . THR B 2 107 ? 18.797 40.849  8.439   1.00 57.47  ? 107 THR B CA    1 
ATOM   5226 C  C     . THR B 2 107 ? 18.511 39.591  7.629   1.00 65.36  ? 107 THR B C     1 
ATOM   5227 O  O     . THR B 2 107 ? 17.435 38.997  7.744   1.00 69.78  ? 107 THR B O     1 
ATOM   5228 C  CB    . THR B 2 107 ? 19.189 40.472  9.871   1.00 67.47  ? 107 THR B CB    1 
ATOM   5229 O  OG1   . THR B 2 107 ? 19.412 41.663  10.636  1.00 65.69  ? 107 THR B OG1   1 
ATOM   5230 C  CG2   . THR B 2 107 ? 20.457 39.630  9.879   1.00 67.65  ? 107 THR B CG2   1 
ATOM   5231 N  N     . VAL B 2 108 ? 19.477 39.193  6.807   1.00 67.23  ? 108 VAL B N     1 
ATOM   5232 C  CA    . VAL B 2 108 ? 19.348 38.034  5.932   1.00 65.24  ? 108 VAL B CA    1 
ATOM   5233 C  C     . VAL B 2 108 ? 20.112 36.878  6.564   1.00 64.10  ? 108 VAL B C     1 
ATOM   5234 O  O     . VAL B 2 108 ? 21.348 36.859  6.554   1.00 65.74  ? 108 VAL B O     1 
ATOM   5235 C  CB    . VAL B 2 108 ? 19.864 38.334  4.519   1.00 63.42  ? 108 VAL B CB    1 
ATOM   5236 C  CG1   . VAL B 2 108 ? 19.690 37.118  3.621   1.00 57.25  ? 108 VAL B CG1   1 
ATOM   5237 C  CG2   . VAL B 2 108 ? 19.151 39.545  3.937   1.00 64.85  ? 108 VAL B CG2   1 
ATOM   5238 N  N     . LEU B 2 109 ? 19.383 35.910  7.109   1.00 60.58  ? 109 LEU B N     1 
ATOM   5239 C  CA    . LEU B 2 109 ? 19.976 34.718  7.695   1.00 63.55  ? 109 LEU B CA    1 
ATOM   5240 C  C     . LEU B 2 109 ? 19.992 33.582  6.680   1.00 70.21  ? 109 LEU B C     1 
ATOM   5241 O  O     . LEU B 2 109 ? 19.124 33.492  5.808   1.00 82.80  ? 109 LEU B O     1 
ATOM   5242 C  CB    . LEU B 2 109 ? 19.211 34.282  8.947   1.00 68.04  ? 109 LEU B CB    1 
ATOM   5243 C  CG    . LEU B 2 109 ? 19.161 35.268  10.114  1.00 68.04  ? 109 LEU B CG    1 
ATOM   5244 C  CD1   . LEU B 2 109 ? 18.326 34.703  11.253  1.00 65.41  ? 109 LEU B CD1   1 
ATOM   5245 C  CD2   . LEU B 2 109 ? 20.564 35.610  10.593  1.00 74.23  ? 109 LEU B CD2   1 
ATOM   5246 N  N     . ASP B 2 110 ? 20.993 32.715  6.801   1.00 66.80  ? 110 ASP B N     1 
ATOM   5247 C  CA    . ASP B 2 110 ? 21.147 31.548  5.939   1.00 68.56  ? 110 ASP B CA    1 
ATOM   5248 C  C     . ASP B 2 110 ? 20.778 30.307  6.742   1.00 79.88  ? 110 ASP B C     1 
ATOM   5249 O  O     . ASP B 2 110 ? 21.520 29.901  7.644   1.00 88.11  ? 110 ASP B O     1 
ATOM   5250 C  CB    . ASP B 2 110 ? 22.573 31.453  5.399   1.00 74.38  ? 110 ASP B CB    1 
ATOM   5251 C  CG    . ASP B 2 110 ? 22.805 30.199  4.575   1.00 81.34  ? 110 ASP B CG    1 
ATOM   5252 O  OD1   . ASP B 2 110 ? 21.840 29.699  3.958   1.00 84.41  ? 110 ASP B OD1   1 
ATOM   5253 O  OD2   . ASP B 2 110 ? 23.955 29.713  4.542   1.00 82.24  ? 110 ASP B OD2   1 
ATOM   5254 N  N     . VAL B 2 111 ? 19.634 29.709  6.416   1.00 79.02  ? 111 VAL B N     1 
ATOM   5255 C  CA    . VAL B 2 111 ? 19.168 28.508  7.101   1.00 76.72  ? 111 VAL B CA    1 
ATOM   5256 C  C     . VAL B 2 111 ? 19.302 27.311  6.169   1.00 80.82  ? 111 VAL B C     1 
ATOM   5257 O  O     . VAL B 2 111 ? 18.517 26.359  6.243   1.00 91.70  ? 111 VAL B O     1 
ATOM   5258 C  CB    . VAL B 2 111 ? 17.716 28.672  7.591   1.00 67.82  ? 111 VAL B CB    1 
ATOM   5259 C  CG1   . VAL B 2 111 ? 17.636 29.762  8.649   1.00 61.61  ? 111 VAL B CG1   1 
ATOM   5260 C  CG2   . VAL B 2 111 ? 16.789 28.990  6.425   1.00 63.85  ? 111 VAL B CG2   1 
ATOM   5261 N  N     . GLY B 2 112 ? 20.306 27.350  5.289   1.00 70.43  ? 112 GLY B N     1 
ATOM   5262 C  CA    . GLY B 2 112 ? 20.489 26.267  4.339   1.00 69.90  ? 112 GLY B CA    1 
ATOM   5263 C  C     . GLY B 2 112 ? 20.814 24.937  4.991   1.00 86.47  ? 112 GLY B C     1 
ATOM   5264 O  O     . GLY B 2 112 ? 20.449 23.881  4.467   1.00 97.18  ? 112 GLY B O     1 
ATOM   5265 N  N     . ASP B 2 113 ? 21.493 24.965  6.141   1.00 88.23  ? 113 ASP B N     1 
ATOM   5266 C  CA    . ASP B 2 113 ? 21.870 23.729  6.819   1.00 93.32  ? 113 ASP B CA    1 
ATOM   5267 C  C     . ASP B 2 113 ? 20.664 22.930  7.295   1.00 93.19  ? 113 ASP B C     1 
ATOM   5268 O  O     . ASP B 2 113 ? 20.778 21.713  7.482   1.00 95.24  ? 113 ASP B O     1 
ATOM   5269 C  CB    . ASP B 2 113 ? 22.784 24.034  8.008   1.00 99.53  ? 113 ASP B CB    1 
ATOM   5270 C  CG    . ASP B 2 113 ? 24.192 24.401  7.583   1.00 102.80 ? 113 ASP B CG    1 
ATOM   5271 O  OD1   . ASP B 2 113 ? 24.687 23.822  6.594   1.00 102.12 ? 113 ASP B OD1   1 
ATOM   5272 O  OD2   . ASP B 2 113 ? 24.804 25.268  8.242   1.00 105.64 ? 113 ASP B OD2   1 
ATOM   5273 N  N     . ALA B 2 114 ? 19.515 23.580  7.496   1.00 90.33  ? 114 ALA B N     1 
ATOM   5274 C  CA    . ALA B 2 114 ? 18.338 22.879  7.994   1.00 81.53  ? 114 ALA B CA    1 
ATOM   5275 C  C     . ALA B 2 114 ? 17.789 21.872  6.992   1.00 79.33  ? 114 ALA B C     1 
ATOM   5276 O  O     . ALA B 2 114 ? 17.096 20.932  7.396   1.00 85.90  ? 114 ALA B O     1 
ATOM   5277 C  CB    . ALA B 2 114 ? 17.248 23.884  8.369   1.00 76.24  ? 114 ALA B CB    1 
ATOM   5278 N  N     . TYR B 2 115 ? 18.082 22.043  5.700   1.00 78.88  ? 115 TYR B N     1 
ATOM   5279 C  CA    . TYR B 2 115 ? 17.572 21.127  4.687   1.00 80.09  ? 115 TYR B CA    1 
ATOM   5280 C  C     . TYR B 2 115 ? 18.243 19.761  4.742   1.00 80.83  ? 115 TYR B C     1 
ATOM   5281 O  O     . TYR B 2 115 ? 17.688 18.791  4.215   1.00 77.64  ? 115 TYR B O     1 
ATOM   5282 C  CB    . TYR B 2 115 ? 17.752 21.733  3.294   1.00 82.15  ? 115 TYR B CB    1 
ATOM   5283 C  CG    . TYR B 2 115 ? 16.984 23.017  3.077   1.00 83.10  ? 115 TYR B CG    1 
ATOM   5284 C  CD1   . TYR B 2 115 ? 15.766 23.235  3.706   1.00 83.19  ? 115 TYR B CD1   1 
ATOM   5285 C  CD2   . TYR B 2 115 ? 17.480 24.013  2.245   1.00 81.00  ? 115 TYR B CD2   1 
ATOM   5286 C  CE1   . TYR B 2 115 ? 15.060 24.408  3.510   1.00 79.10  ? 115 TYR B CE1   1 
ATOM   5287 C  CE2   . TYR B 2 115 ? 16.781 25.189  2.043   1.00 76.25  ? 115 TYR B CE2   1 
ATOM   5288 C  CZ    . TYR B 2 115 ? 15.572 25.381  2.678   1.00 72.32  ? 115 TYR B CZ    1 
ATOM   5289 O  OH    . TYR B 2 115 ? 14.873 26.549  2.480   1.00 64.56  ? 115 TYR B OH    1 
ATOM   5290 N  N     . PHE B 2 116 ? 19.417 19.661  5.368   1.00 87.79  ? 116 PHE B N     1 
ATOM   5291 C  CA    . PHE B 2 116 ? 20.163 18.408  5.412   1.00 81.81  ? 116 PHE B CA    1 
ATOM   5292 C  C     . PHE B 2 116 ? 19.566 17.386  6.370   1.00 78.35  ? 116 PHE B C     1 
ATOM   5293 O  O     . PHE B 2 116 ? 20.092 16.271  6.457   1.00 81.36  ? 116 PHE B O     1 
ATOM   5294 C  CB    . PHE B 2 116 ? 21.618 18.680  5.796   1.00 80.58  ? 116 PHE B CB    1 
ATOM   5295 C  CG    . PHE B 2 116 ? 22.371 19.489  4.779   1.00 83.18  ? 116 PHE B CG    1 
ATOM   5296 C  CD1   . PHE B 2 116 ? 21.969 19.509  3.453   1.00 82.14  ? 116 PHE B CD1   1 
ATOM   5297 C  CD2   . PHE B 2 116 ? 23.482 20.230  5.150   1.00 91.65  ? 116 PHE B CD2   1 
ATOM   5298 C  CE1   . PHE B 2 116 ? 22.659 20.253  2.516   1.00 85.12  ? 116 PHE B CE1   1 
ATOM   5299 C  CE2   . PHE B 2 116 ? 24.176 20.976  4.217   1.00 99.06  ? 116 PHE B CE2   1 
ATOM   5300 C  CZ    . PHE B 2 116 ? 23.764 20.987  2.898   1.00 97.70  ? 116 PHE B CZ    1 
ATOM   5301 N  N     . SER B 2 117 ? 18.495 17.727  7.085   1.00 71.69  ? 117 SER B N     1 
ATOM   5302 C  CA    . SER B 2 117 ? 17.868 16.794  8.009   1.00 69.88  ? 117 SER B CA    1 
ATOM   5303 C  C     . SER B 2 117 ? 16.739 15.993  7.376   1.00 67.34  ? 117 SER B C     1 
ATOM   5304 O  O     . SER B 2 117 ? 16.384 14.931  7.898   1.00 73.20  ? 117 SER B O     1 
ATOM   5305 C  CB    . SER B 2 117 ? 17.332 17.544  9.233   1.00 73.77  ? 117 SER B CB    1 
ATOM   5306 O  OG    . SER B 2 117 ? 16.434 18.572  8.847   1.00 74.32  ? 117 SER B OG    1 
ATOM   5307 N  N     . VAL B 2 118 ? 16.178 16.467  6.273   1.00 68.66  ? 118 VAL B N     1 
ATOM   5308 C  CA    . VAL B 2 118 ? 15.049 15.818  5.610   1.00 70.36  ? 118 VAL B CA    1 
ATOM   5309 C  C     . VAL B 2 118 ? 15.578 15.033  4.415   1.00 73.18  ? 118 VAL B C     1 
ATOM   5310 O  O     . VAL B 2 118 ? 16.290 15.610  3.581   1.00 79.59  ? 118 VAL B O     1 
ATOM   5311 C  CB    . VAL B 2 118 ? 13.993 16.844  5.162   1.00 72.07  ? 118 VAL B CB    1 
ATOM   5312 C  CG1   . VAL B 2 118 ? 12.783 16.139  4.566   1.00 77.99  ? 118 VAL B CG1   1 
ATOM   5313 C  CG2   . VAL B 2 118 ? 13.587 17.731  6.328   1.00 68.44  ? 118 VAL B CG2   1 
ATOM   5314 N  N     . PRO B 2 119 ? 15.264 13.747  4.293   1.00 74.86  ? 119 PRO B N     1 
ATOM   5315 C  CA    . PRO B 2 119 ? 15.730 12.975  3.135   1.00 72.86  ? 119 PRO B CA    1 
ATOM   5316 C  C     . PRO B 2 119 ? 14.983 13.367  1.868   1.00 67.47  ? 119 PRO B C     1 
ATOM   5317 O  O     . PRO B 2 119 ? 13.957 14.048  1.892   1.00 68.36  ? 119 PRO B O     1 
ATOM   5318 C  CB    . PRO B 2 119 ? 15.439 11.526  3.533   1.00 73.76  ? 119 PRO B CB    1 
ATOM   5319 C  CG    . PRO B 2 119 ? 14.303 11.630  4.497   1.00 75.37  ? 119 PRO B CG    1 
ATOM   5320 C  CD    . PRO B 2 119 ? 14.517 12.914  5.252   1.00 73.72  ? 119 PRO B CD    1 
ATOM   5321 N  N     . LEU B 2 120 ? 15.521 12.912  0.739   1.00 66.91  ? 120 LEU B N     1 
ATOM   5322 C  CA    . LEU B 2 120 ? 14.990 13.225  -0.578  1.00 70.19  ? 120 LEU B CA    1 
ATOM   5323 C  C     . LEU B 2 120 ? 14.444 11.966  -1.242  1.00 75.73  ? 120 LEU B C     1 
ATOM   5324 O  O     . LEU B 2 120 ? 14.939 10.858  -1.013  1.00 77.46  ? 120 LEU B O     1 
ATOM   5325 C  CB    . LEU B 2 120 ? 16.071 13.859  -1.465  1.00 62.72  ? 120 LEU B CB    1 
ATOM   5326 C  CG    . LEU B 2 120 ? 15.674 14.316  -2.872  1.00 63.47  ? 120 LEU B CG    1 
ATOM   5327 C  CD1   . LEU B 2 120 ? 14.609 15.399  -2.805  1.00 53.70  ? 120 LEU B CD1   1 
ATOM   5328 C  CD2   . LEU B 2 120 ? 16.889 14.800  -3.649  1.00 63.40  ? 120 LEU B CD2   1 
ATOM   5329 N  N     . ASP B 2 121 ? 13.411 12.150  -2.065  1.00 78.00  ? 121 ASP B N     1 
ATOM   5330 C  CA    . ASP B 2 121 ? 12.810 11.039  -2.793  1.00 77.40  ? 121 ASP B CA    1 
ATOM   5331 C  C     . ASP B 2 121 ? 13.845 10.367  -3.689  1.00 71.01  ? 121 ASP B C     1 
ATOM   5332 O  O     . ASP B 2 121 ? 14.548 11.034  -4.454  1.00 74.11  ? 121 ASP B O     1 
ATOM   5333 C  CB    . ASP B 2 121 ? 11.625 11.541  -3.621  1.00 79.11  ? 121 ASP B CB    1 
ATOM   5334 C  CG    . ASP B 2 121 ? 10.971 10.443  -4.436  1.00 82.90  ? 121 ASP B CG    1 
ATOM   5335 O  OD1   . ASP B 2 121 ? 10.261 9.603   -3.845  1.00 93.39  ? 121 ASP B OD1   1 
ATOM   5336 O  OD2   . ASP B 2 121 ? 11.156 10.430  -5.672  1.00 77.62  ? 121 ASP B OD2   1 
ATOM   5337 N  N     . GLU B 2 122 ? 13.933 9.037   -3.588  1.00 66.52  ? 122 GLU B N     1 
ATOM   5338 C  CA    . GLU B 2 122 ? 14.994 8.303   -4.273  1.00 74.13  ? 122 GLU B CA    1 
ATOM   5339 C  C     . GLU B 2 122 ? 14.897 8.453   -5.787  1.00 77.56  ? 122 GLU B C     1 
ATOM   5340 O  O     . GLU B 2 122 ? 15.918 8.608   -6.469  1.00 76.27  ? 122 GLU B O     1 
ATOM   5341 C  CB    . GLU B 2 122 ? 14.949 6.826   -3.874  1.00 75.76  ? 122 GLU B CB    1 
ATOM   5342 C  CG    . GLU B 2 122 ? 15.976 5.946   -4.576  1.00 87.18  ? 122 GLU B CG    1 
ATOM   5343 C  CD    . GLU B 2 122 ? 17.404 6.231   -4.141  1.00 98.37  ? 122 GLU B CD    1 
ATOM   5344 O  OE1   . GLU B 2 122 ? 17.599 6.770   -3.030  1.00 111.23 ? 122 GLU B OE1   1 
ATOM   5345 O  OE2   . GLU B 2 122 ? 18.334 5.912   -4.912  1.00 85.87  ? 122 GLU B OE2   1 
ATOM   5346 N  N     . ASP B 2 123 ? 13.678 8.416   -6.333  1.00 74.59  ? 123 ASP B N     1 
ATOM   5347 C  CA    . ASP B 2 123 ? 13.507 8.529   -7.778  1.00 74.81  ? 123 ASP B CA    1 
ATOM   5348 C  C     . ASP B 2 123 ? 13.926 9.893   -8.309  1.00 73.05  ? 123 ASP B C     1 
ATOM   5349 O  O     . ASP B 2 123 ? 14.173 10.027  -9.512  1.00 80.71  ? 123 ASP B O     1 
ATOM   5350 C  CB    . ASP B 2 123 ? 12.053 8.254   -8.163  1.00 80.74  ? 123 ASP B CB    1 
ATOM   5351 C  CG    . ASP B 2 123 ? 11.594 6.871   -7.753  1.00 94.24  ? 123 ASP B CG    1 
ATOM   5352 O  OD1   . ASP B 2 123 ? 12.447 5.962   -7.664  1.00 91.63  ? 123 ASP B OD1   1 
ATOM   5353 O  OD2   . ASP B 2 123 ? 10.379 6.692   -7.521  1.00 102.95 ? 123 ASP B OD2   1 
ATOM   5354 N  N     . PHE B 2 124 ? 14.015 10.904  -7.444  1.00 61.68  ? 124 PHE B N     1 
ATOM   5355 C  CA    . PHE B 2 124 ? 14.381 12.248  -7.866  1.00 59.38  ? 124 PHE B CA    1 
ATOM   5356 C  C     . PHE B 2 124 ? 15.858 12.562  -7.663  1.00 62.32  ? 124 PHE B C     1 
ATOM   5357 O  O     . PHE B 2 124 ? 16.353 13.527  -8.254  1.00 64.42  ? 124 PHE B O     1 
ATOM   5358 C  CB    . PHE B 2 124 ? 13.537 13.284  -7.112  1.00 59.99  ? 124 PHE B CB    1 
ATOM   5359 C  CG    . PHE B 2 124 ? 13.531 14.645  -7.749  1.00 63.51  ? 124 PHE B CG    1 
ATOM   5360 C  CD1   . PHE B 2 124 ? 12.689 14.921  -8.814  1.00 65.30  ? 124 PHE B CD1   1 
ATOM   5361 C  CD2   . PHE B 2 124 ? 14.359 15.652  -7.279  1.00 58.42  ? 124 PHE B CD2   1 
ATOM   5362 C  CE1   . PHE B 2 124 ? 12.677 16.171  -9.403  1.00 53.08  ? 124 PHE B CE1   1 
ATOM   5363 C  CE2   . PHE B 2 124 ? 14.353 16.903  -7.866  1.00 51.40  ? 124 PHE B CE2   1 
ATOM   5364 C  CZ    . PHE B 2 124 ? 13.509 17.163  -8.927  1.00 52.96  ? 124 PHE B CZ    1 
ATOM   5365 N  N     . ARG B 2 125 ? 16.569 11.765  -6.859  1.00 50.68  ? 125 ARG B N     1 
ATOM   5366 C  CA    . ARG B 2 125 ? 17.965 12.064  -6.550  1.00 52.52  ? 125 ARG B CA    1 
ATOM   5367 C  C     . ARG B 2 125 ? 18.834 12.091  -7.800  1.00 56.18  ? 125 ARG B C     1 
ATOM   5368 O  O     . ARG B 2 125 ? 19.816 12.841  -7.856  1.00 57.48  ? 125 ARG B O     1 
ATOM   5369 C  CB    . ARG B 2 125 ? 18.508 11.043  -5.551  1.00 66.89  ? 125 ARG B CB    1 
ATOM   5370 C  CG    . ARG B 2 125 ? 17.743 11.007  -4.241  1.00 73.48  ? 125 ARG B CG    1 
ATOM   5371 C  CD    . ARG B 2 125 ? 18.337 10.008  -3.266  1.00 58.99  ? 125 ARG B CD    1 
ATOM   5372 N  NE    . ARG B 2 125 ? 17.647 10.045  -1.980  1.00 67.38  ? 125 ARG B NE    1 
ATOM   5373 C  CZ    . ARG B 2 125 ? 17.961 9.282   -0.938  1.00 71.87  ? 125 ARG B CZ    1 
ATOM   5374 N  NH1   . ARG B 2 125 ? 18.960 8.414   -1.027  1.00 81.71  ? 125 ARG B NH1   1 
ATOM   5375 N  NH2   . ARG B 2 125 ? 17.276 9.388   0.193   1.00 59.05  ? 125 ARG B NH2   1 
ATOM   5376 N  N     . LYS B 2 126 ? 18.486 11.292  -8.812  1.00 58.09  ? 126 LYS B N     1 
ATOM   5377 C  CA    . LYS B 2 126 ? 19.262 11.245  -10.046 1.00 55.62  ? 126 LYS B CA    1 
ATOM   5378 C  C     . LYS B 2 126 ? 19.362 12.602  -10.733 1.00 60.60  ? 126 LYS B C     1 
ATOM   5379 O  O     . LYS B 2 126 ? 20.298 12.821  -11.510 1.00 57.53  ? 126 LYS B O     1 
ATOM   5380 C  CB    . LYS B 2 126 ? 18.648 10.218  -11.000 1.00 50.65  ? 126 LYS B CB    1 
ATOM   5381 C  CG    . LYS B 2 126 ? 17.129 10.264  -11.052 1.00 66.86  ? 126 LYS B CG    1 
ATOM   5382 C  CD    . LYS B 2 126 ? 16.546 9.086   -11.820 1.00 76.77  ? 126 LYS B CD    1 
ATOM   5383 C  CE    . LYS B 2 126 ? 16.858 9.177   -13.304 1.00 80.61  ? 126 LYS B CE    1 
ATOM   5384 N  NZ    . LYS B 2 126 ? 16.200 8.089   -14.079 1.00 84.72  ? 126 LYS B NZ    1 
ATOM   5385 N  N     . TYR B 2 127 ? 18.432 13.518  -10.463 1.00 61.64  ? 127 TYR B N     1 
ATOM   5386 C  CA    . TYR B 2 127 ? 18.427 14.821  -11.115 1.00 61.83  ? 127 TYR B CA    1 
ATOM   5387 C  C     . TYR B 2 127 ? 19.285 15.860  -10.401 1.00 57.43  ? 127 TYR B C     1 
ATOM   5388 O  O     . TYR B 2 127 ? 19.540 16.926  -10.974 1.00 44.47  ? 127 TYR B O     1 
ATOM   5389 C  CB    . TYR B 2 127 ? 16.991 15.347  -11.237 1.00 58.03  ? 127 TYR B CB    1 
ATOM   5390 C  CG    . TYR B 2 127 ? 16.047 14.410  -11.960 1.00 61.26  ? 127 TYR B CG    1 
ATOM   5391 C  CD1   . TYR B 2 127 ? 16.264 14.062  -13.287 1.00 55.03  ? 127 TYR B CD1   1 
ATOM   5392 C  CD2   . TYR B 2 127 ? 14.931 13.885  -11.320 1.00 63.89  ? 127 TYR B CD2   1 
ATOM   5393 C  CE1   . TYR B 2 127 ? 15.402 13.208  -13.953 1.00 60.40  ? 127 TYR B CE1   1 
ATOM   5394 C  CE2   . TYR B 2 127 ? 14.063 13.033  -11.977 1.00 51.85  ? 127 TYR B CE2   1 
ATOM   5395 C  CZ    . TYR B 2 127 ? 14.303 12.698  -13.293 1.00 57.31  ? 127 TYR B CZ    1 
ATOM   5396 O  OH    . TYR B 2 127 ? 13.443 11.850  -13.951 1.00 56.49  ? 127 TYR B OH    1 
ATOM   5397 N  N     . THR B 2 128 ? 19.738 15.585  -9.178  1.00 54.17  ? 128 THR B N     1 
ATOM   5398 C  CA    . THR B 2 128 ? 20.554 16.519  -8.414  1.00 54.16  ? 128 THR B CA    1 
ATOM   5399 C  C     . THR B 2 128 ? 22.051 16.290  -8.605  1.00 47.00  ? 128 THR B C     1 
ATOM   5400 O  O     . THR B 2 128 ? 22.848 16.750  -7.779  1.00 44.61  ? 128 THR B O     1 
ATOM   5401 C  CB    . THR B 2 128 ? 20.203 16.433  -6.927  1.00 62.28  ? 128 THR B CB    1 
ATOM   5402 O  OG1   . THR B 2 128 ? 20.531 15.129  -6.430  1.00 67.34  ? 128 THR B OG1   1 
ATOM   5403 C  CG2   . THR B 2 128 ? 18.717 16.690  -6.717  1.00 50.73  ? 128 THR B CG2   1 
ATOM   5404 N  N     . ALA B 2 129 ? 22.446 15.606  -9.676  1.00 60.65  ? 129 ALA B N     1 
ATOM   5405 C  CA    . ALA B 2 129 ? 23.839 15.223  -9.860  1.00 44.10  ? 129 ALA B CA    1 
ATOM   5406 C  C     . ALA B 2 129 ? 24.716 16.433  -10.162 1.00 51.99  ? 129 ALA B C     1 
ATOM   5407 O  O     . ALA B 2 129 ? 24.296 17.373  -10.842 1.00 54.38  ? 129 ALA B O     1 
ATOM   5408 C  CB    . ALA B 2 129 ? 23.954 14.204  -10.992 1.00 44.22  ? 129 ALA B CB    1 
ATOM   5409 N  N     . PHE B 2 130 ? 25.949 16.402  -9.652  1.00 43.02  ? 130 PHE B N     1 
ATOM   5410 C  CA    . PHE B 2 130 ? 26.941 17.423  -9.960  1.00 50.48  ? 130 PHE B CA    1 
ATOM   5411 C  C     . PHE B 2 130 ? 28.321 16.782  -10.032 1.00 44.41  ? 130 PHE B C     1 
ATOM   5412 O  O     . PHE B 2 130 ? 28.542 15.677  -9.531  1.00 43.63  ? 130 PHE B O     1 
ATOM   5413 C  CB    . PHE B 2 130 ? 26.926 18.572  -8.935  1.00 56.22  ? 130 PHE B CB    1 
ATOM   5414 C  CG    . PHE B 2 130 ? 27.285 18.158  -7.536  1.00 42.93  ? 130 PHE B CG    1 
ATOM   5415 C  CD1   . PHE B 2 130 ? 26.322 17.650  -6.679  1.00 43.82  ? 130 PHE B CD1   1 
ATOM   5416 C  CD2   . PHE B 2 130 ? 28.580 18.304  -7.066  1.00 42.93  ? 130 PHE B CD2   1 
ATOM   5417 C  CE1   . PHE B 2 130 ? 26.648 17.279  -5.388  1.00 44.59  ? 130 PHE B CE1   1 
ATOM   5418 C  CE2   . PHE B 2 130 ? 28.912 17.935  -5.777  1.00 43.76  ? 130 PHE B CE2   1 
ATOM   5419 C  CZ    . PHE B 2 130 ? 27.946 17.422  -4.937  1.00 44.59  ? 130 PHE B CZ    1 
ATOM   5420 N  N     . THR B 2 131 ? 29.251 17.496  -10.663 1.00 49.54  ? 131 THR B N     1 
ATOM   5421 C  CA    . THR B 2 131 ? 30.586 16.987  -10.956 1.00 51.08  ? 131 THR B CA    1 
ATOM   5422 C  C     . THR B 2 131 ? 31.638 17.931  -10.391 1.00 55.22  ? 131 THR B C     1 
ATOM   5423 O  O     . THR B 2 131 ? 31.568 19.145  -10.609 1.00 56.50  ? 131 THR B O     1 
ATOM   5424 C  CB    . THR B 2 131 ? 30.792 16.827  -12.467 1.00 46.28  ? 131 THR B CB    1 
ATOM   5425 O  OG1   . THR B 2 131 ? 29.719 16.059  -13.023 1.00 41.53  ? 131 THR B OG1   1 
ATOM   5426 C  CG2   . THR B 2 131 ? 32.110 16.129  -12.756 1.00 50.11  ? 131 THR B CG2   1 
ATOM   5427 N  N     . ILE B 2 132 ? 32.613 17.372  -9.679  1.00 59.44  ? 132 ILE B N     1 
ATOM   5428 C  CA    . ILE B 2 132 ? 33.741 18.130  -9.145  1.00 51.31  ? 132 ILE B CA    1 
ATOM   5429 C  C     . ILE B 2 132 ? 34.906 17.975  -10.120 1.00 47.34  ? 132 ILE B C     1 
ATOM   5430 O  O     . ILE B 2 132 ? 35.420 16.855  -10.278 1.00 45.34  ? 132 ILE B O     1 
ATOM   5431 C  CB    . ILE B 2 132 ? 34.131 17.653  -7.740  1.00 49.67  ? 132 ILE B CB    1 
ATOM   5432 C  CG1   . ILE B 2 132 ? 32.985 17.885  -6.755  1.00 50.88  ? 132 ILE B CG1   1 
ATOM   5433 C  CG2   . ILE B 2 132 ? 35.394 18.361  -7.270  1.00 42.90  ? 132 ILE B CG2   1 
ATOM   5434 C  CD1   . ILE B 2 132 ? 32.658 19.345  -6.538  1.00 57.49  ? 132 ILE B CD1   1 
ATOM   5435 N  N     . PRO B 2 133 ? 35.349 19.037  -10.778 1.00 42.76  ? 133 PRO B N     1 
ATOM   5436 C  CA    . PRO B 2 133 ? 36.468 18.932  -11.717 1.00 40.98  ? 133 PRO B CA    1 
ATOM   5437 C  C     . PRO B 2 133 ? 37.797 18.876  -10.971 1.00 49.04  ? 133 PRO B C     1 
ATOM   5438 O  O     . PRO B 2 133 ? 37.862 18.979  -9.748  1.00 41.98  ? 133 PRO B O     1 
ATOM   5439 C  CB    . PRO B 2 133 ? 36.341 20.209  -12.547 1.00 40.70  ? 133 PRO B CB    1 
ATOM   5440 C  CG    . PRO B 2 133 ? 35.749 21.194  -11.598 1.00 43.39  ? 133 PRO B CG    1 
ATOM   5441 C  CD    . PRO B 2 133 ? 34.810 20.407  -10.713 1.00 45.65  ? 133 PRO B CD    1 
ATOM   5442 N  N     . SER B 2 134 ? 38.869 18.705  -11.740 1.00 43.69  ? 134 SER B N     1 
ATOM   5443 C  CA    . SER B 2 134 ? 40.221 18.717  -11.207 1.00 46.99  ? 134 SER B CA    1 
ATOM   5444 C  C     . SER B 2 134 ? 41.052 19.742  -11.965 1.00 53.25  ? 134 SER B C     1 
ATOM   5445 O  O     . SER B 2 134 ? 40.706 20.159  -13.074 1.00 41.27  ? 134 SER B O     1 
ATOM   5446 C  CB    . SER B 2 134 ? 40.880 17.332  -11.295 1.00 42.82  ? 134 SER B CB    1 
ATOM   5447 O  OG    . SER B 2 134 ? 40.984 16.898  -12.640 1.00 42.61  ? 134 SER B OG    1 
ATOM   5448 N  N     . ILE B 2 135 ? 42.156 20.155  -11.344 1.00 42.36  ? 135 ILE B N     1 
ATOM   5449 C  CA    . ILE B 2 135 ? 43.074 21.082  -11.992 1.00 42.26  ? 135 ILE B CA    1 
ATOM   5450 C  C     . ILE B 2 135 ? 43.867 20.334  -13.052 1.00 50.33  ? 135 ILE B C     1 
ATOM   5451 O  O     . ILE B 2 135 ? 44.362 19.226  -12.810 1.00 58.02  ? 135 ILE B O     1 
ATOM   5452 C  CB    . ILE B 2 135 ? 44.006 21.729  -10.959 1.00 42.90  ? 135 ILE B CB    1 
ATOM   5453 C  CG1   . ILE B 2 135 ? 43.198 22.289  -9.791  1.00 54.15  ? 135 ILE B CG1   1 
ATOM   5454 C  CG2   . ILE B 2 135 ? 44.846 22.821  -11.607 1.00 42.83  ? 135 ILE B CG2   1 
ATOM   5455 C  CD1   . ILE B 2 135 ? 44.039 22.599  -8.585  1.00 70.37  ? 135 ILE B CD1   1 
ATOM   5456 N  N     . ASN B 2 136 ? 43.980 20.933  -14.237 1.00 50.57  ? 136 ASN B N     1 
ATOM   5457 C  CA    . ASN B 2 136 ? 44.742 20.372  -15.349 1.00 47.72  ? 136 ASN B CA    1 
ATOM   5458 C  C     . ASN B 2 136 ? 44.229 18.993  -15.761 1.00 46.40  ? 136 ASN B C     1 
ATOM   5459 O  O     . ASN B 2 136 ? 44.938 18.240  -16.435 1.00 47.56  ? 136 ASN B O     1 
ATOM   5460 C  CB    . ASN B 2 136 ? 46.237 20.310  -15.011 1.00 43.23  ? 136 ASN B CB    1 
ATOM   5461 C  CG    . ASN B 2 136 ? 47.114 20.219  -16.242 1.00 43.55  ? 136 ASN B CG    1 
ATOM   5462 O  OD1   . ASN B 2 136 ? 46.730 20.653  -17.327 1.00 50.82  ? 136 ASN B OD1   1 
ATOM   5463 N  ND2   . ASN B 2 136 ? 48.301 19.649  -16.079 1.00 44.45  ? 136 ASN B ND2   1 
ATOM   5464 N  N     . ASN B 2 137 ? 43.003 18.654  -15.361 1.00 42.14  ? 137 ASN B N     1 
ATOM   5465 C  CA    . ASN B 2 137 ? 42.386 17.364  -15.668 1.00 42.32  ? 137 ASN B CA    1 
ATOM   5466 C  C     . ASN B 2 137 ? 43.286 16.204  -15.246 1.00 57.06  ? 137 ASN B C     1 
ATOM   5467 O  O     . ASN B 2 137 ? 43.514 15.250  -15.994 1.00 43.58  ? 137 ASN B O     1 
ATOM   5468 C  CB    . ASN B 2 137 ? 42.019 17.272  -17.148 1.00 42.07  ? 137 ASN B CB    1 
ATOM   5469 C  CG    . ASN B 2 137 ? 40.863 18.181  -17.513 1.00 45.74  ? 137 ASN B CG    1 
ATOM   5470 O  OD1   . ASN B 2 137 ? 39.699 17.821  -17.339 1.00 55.79  ? 137 ASN B OD1   1 
ATOM   5471 N  ND2   . ASN B 2 137 ? 41.177 19.368  -18.017 1.00 40.91  ? 137 ASN B ND2   1 
ATOM   5472 N  N     . GLU B 2 138 ? 43.809 16.301  -14.022 1.00 43.58  ? 138 GLU B N     1 
ATOM   5473 C  CA    . GLU B 2 138 ? 44.565 15.194  -13.448 1.00 44.47  ? 138 GLU B CA    1 
ATOM   5474 C  C     . GLU B 2 138 ? 43.685 13.962  -13.286 1.00 52.75  ? 138 GLU B C     1 
ATOM   5475 O  O     . GLU B 2 138 ? 44.132 12.831  -13.507 1.00 52.81  ? 138 GLU B O     1 
ATOM   5476 C  CB    . GLU B 2 138 ? 45.153 15.613  -12.101 1.00 44.93  ? 138 GLU B CB    1 
ATOM   5477 C  CG    . GLU B 2 138 ? 45.857 14.502  -11.347 1.00 48.15  ? 138 GLU B CG    1 
ATOM   5478 C  CD    . GLU B 2 138 ? 46.250 14.919  -9.945  1.00 64.88  ? 138 GLU B CD    1 
ATOM   5479 O  OE1   . GLU B 2 138 ? 46.080 14.109  -9.010  1.00 85.23  ? 138 GLU B OE1   1 
ATOM   5480 O  OE2   . GLU B 2 138 ? 46.721 16.063  -9.778  1.00 68.77  ? 138 GLU B OE2   1 
ATOM   5481 N  N     . THR B 2 139 ? 42.426 14.168  -12.912 1.00 55.96  ? 139 THR B N     1 
ATOM   5482 C  CA    . THR B 2 139 ? 41.454 13.122  -12.673 1.00 44.34  ? 139 THR B CA    1 
ATOM   5483 C  C     . THR B 2 139 ? 40.187 13.441  -13.452 1.00 50.13  ? 139 THR B C     1 
ATOM   5484 O  O     . THR B 2 139 ? 39.810 14.614  -13.562 1.00 59.10  ? 139 THR B O     1 
ATOM   5485 C  CB    . THR B 2 139 ? 41.140 13.015  -11.170 1.00 44.70  ? 139 THR B CB    1 
ATOM   5486 O  OG1   . THR B 2 139 ? 42.349 12.756  -10.448 1.00 60.94  ? 139 THR B OG1   1 
ATOM   5487 C  CG2   . THR B 2 139 ? 40.143 11.903  -10.884 1.00 61.68  ? 139 THR B CG2   1 
ATOM   5488 N  N     . PRO B 2 140 ? 39.525 12.440  -14.030 1.00 54.31  ? 140 PRO B N     1 
ATOM   5489 C  CA    . PRO B 2 140 ? 38.186 12.676  -14.577 1.00 46.97  ? 140 PRO B CA    1 
ATOM   5490 C  C     . PRO B 2 140 ? 37.240 13.165  -13.490 1.00 43.13  ? 140 PRO B C     1 
ATOM   5491 O  O     . PRO B 2 140 ? 37.514 13.054  -12.292 1.00 53.48  ? 140 PRO B O     1 
ATOM   5492 C  CB    . PRO B 2 140 ? 37.765 11.301  -15.118 1.00 43.95  ? 140 PRO B CB    1 
ATOM   5493 C  CG    . PRO B 2 140 ? 38.730 10.322  -14.519 1.00 44.73  ? 140 PRO B CG    1 
ATOM   5494 C  CD    . PRO B 2 140 ? 40.003 11.077  -14.316 1.00 52.55  ? 140 PRO B CD    1 
ATOM   5495 N  N     . GLY B 2 141 ? 36.115 13.724  -13.926 1.00 42.60  ? 141 GLY B N     1 
ATOM   5496 C  CA    . GLY B 2 141 ? 35.176 14.297  -12.977 1.00 45.93  ? 141 GLY B CA    1 
ATOM   5497 C  C     . GLY B 2 141 ? 34.664 13.256  -11.996 1.00 52.90  ? 141 GLY B C     1 
ATOM   5498 O  O     . GLY B 2 141 ? 34.349 12.122  -12.366 1.00 62.29  ? 141 GLY B O     1 
ATOM   5499 N  N     . ILE B 2 142 ? 34.592 13.648  -10.729 1.00 50.40  ? 142 ILE B N     1 
ATOM   5500 C  CA    . ILE B 2 142 ? 34.076 12.798  -9.662  1.00 54.07  ? 142 ILE B CA    1 
ATOM   5501 C  C     . ILE B 2 142 ? 32.683 13.307  -9.316  1.00 46.36  ? 142 ILE B C     1 
ATOM   5502 O  O     . ILE B 2 142 ? 32.529 14.396  -8.753  1.00 45.13  ? 142 ILE B O     1 
ATOM   5503 C  CB    . ILE B 2 142 ? 35.004 12.799  -8.440  1.00 52.90  ? 142 ILE B CB    1 
ATOM   5504 C  CG1   . ILE B 2 142 ? 36.362 12.197  -8.813  1.00 44.88  ? 142 ILE B CG1   1 
ATOM   5505 C  CG2   . ILE B 2 142 ? 34.370 12.036  -7.287  1.00 45.44  ? 142 ILE B CG2   1 
ATOM   5506 C  CD1   . ILE B 2 142 ? 37.359 12.166  -7.679  1.00 45.53  ? 142 ILE B CD1   1 
ATOM   5507 N  N     . ARG B 2 143 ? 31.666 12.521  -9.657  1.00 47.76  ? 143 ARG B N     1 
ATOM   5508 C  CA    . ARG B 2 143 ? 30.279 12.953  -9.597  1.00 45.04  ? 143 ARG B CA    1 
ATOM   5509 C  C     . ARG B 2 143 ? 29.611 12.506  -8.302  1.00 52.82  ? 143 ARG B C     1 
ATOM   5510 O  O     . ARG B 2 143 ? 29.935 11.457  -7.741  1.00 61.01  ? 143 ARG B O     1 
ATOM   5511 C  CB    . ARG B 2 143 ? 29.500 12.411  -10.797 1.00 48.08  ? 143 ARG B CB    1 
ATOM   5512 C  CG    . ARG B 2 143 ? 29.994 12.932  -12.137 1.00 48.01  ? 143 ARG B CG    1 
ATOM   5513 C  CD    . ARG B 2 143 ? 29.519 12.059  -13.286 1.00 51.28  ? 143 ARG B CD    1 
ATOM   5514 N  NE    . ARG B 2 143 ? 28.099 11.742  -13.184 1.00 53.68  ? 143 ARG B NE    1 
ATOM   5515 C  CZ    . ARG B 2 143 ? 27.121 12.555  -13.565 1.00 45.63  ? 143 ARG B CZ    1 
ATOM   5516 N  NH1   . ARG B 2 143 ? 27.404 13.747  -14.069 1.00 45.33  ? 143 ARG B NH1   1 
ATOM   5517 N  NH2   . ARG B 2 143 ? 25.857 12.180  -13.435 1.00 44.25  ? 143 ARG B NH2   1 
ATOM   5518 N  N     . TYR B 2 144 ? 28.666 13.322  -7.836  1.00 57.04  ? 144 TYR B N     1 
ATOM   5519 C  CA    . TYR B 2 144 ? 27.880 13.042  -6.643  1.00 53.54  ? 144 TYR B CA    1 
ATOM   5520 C  C     . TYR B 2 144 ? 26.403 13.255  -6.945  1.00 51.67  ? 144 TYR B C     1 
ATOM   5521 O  O     . TYR B 2 144 ? 26.030 13.847  -7.960  1.00 59.56  ? 144 TYR B O     1 
ATOM   5522 C  CB    . TYR B 2 144 ? 28.290 13.937  -5.465  1.00 45.76  ? 144 TYR B CB    1 
ATOM   5523 C  CG    . TYR B 2 144 ? 29.688 13.709  -4.945  1.00 45.99  ? 144 TYR B CG    1 
ATOM   5524 C  CD1   . TYR B 2 144 ? 30.764 14.424  -5.452  1.00 48.68  ? 144 TYR B CD1   1 
ATOM   5525 C  CD2   . TYR B 2 144 ? 29.931 12.792  -3.931  1.00 57.69  ? 144 TYR B CD2   1 
ATOM   5526 C  CE1   . TYR B 2 144 ? 32.044 14.225  -4.972  1.00 51.15  ? 144 TYR B CE1   1 
ATOM   5527 C  CE2   . TYR B 2 144 ? 31.207 12.585  -3.445  1.00 51.99  ? 144 TYR B CE2   1 
ATOM   5528 C  CZ    . TYR B 2 144 ? 32.259 13.304  -3.969  1.00 57.79  ? 144 TYR B CZ    1 
ATOM   5529 O  OH    . TYR B 2 144 ? 33.531 13.101  -3.488  1.00 76.82  ? 144 TYR B OH    1 
ATOM   5530 N  N     . GLN B 2 145 ? 25.559 12.762  -6.041  1.00 47.66  ? 145 GLN B N     1 
ATOM   5531 C  CA    . GLN B 2 145 ? 24.135 13.059  -6.055  1.00 52.81  ? 145 GLN B CA    1 
ATOM   5532 C  C     . GLN B 2 145 ? 23.675 13.248  -4.618  1.00 57.52  ? 145 GLN B C     1 
ATOM   5533 O  O     . GLN B 2 145 ? 24.334 12.807  -3.673  1.00 48.61  ? 145 GLN B O     1 
ATOM   5534 C  CB    . GLN B 2 145 ? 23.315 11.959  -6.745  1.00 48.50  ? 145 GLN B CB    1 
ATOM   5535 C  CG    . GLN B 2 145 ? 22.974 10.772  -5.858  1.00 55.35  ? 145 GLN B CG    1 
ATOM   5536 C  CD    . GLN B 2 145 ? 22.081 9.761   -6.557  1.00 55.20  ? 145 GLN B CD    1 
ATOM   5537 O  OE1   . GLN B 2 145 ? 21.809 9.877   -7.753  1.00 52.06  ? 145 GLN B OE1   1 
ATOM   5538 N  NE2   . GLN B 2 145 ? 21.620 8.763   -5.812  1.00 51.15  ? 145 GLN B NE2   1 
ATOM   5539 N  N     . TYR B 2 146 ? 22.535 13.913  -4.458  1.00 54.63  ? 146 TYR B N     1 
ATOM   5540 C  CA    . TYR B 2 146 ? 22.042 14.274  -3.137  1.00 55.70  ? 146 TYR B CA    1 
ATOM   5541 C  C     . TYR B 2 146 ? 21.160 13.176  -2.556  1.00 55.02  ? 146 TYR B C     1 
ATOM   5542 O  O     . TYR B 2 146 ? 20.394 12.528  -3.274  1.00 59.20  ? 146 TYR B O     1 
ATOM   5543 C  CB    . TYR B 2 146 ? 21.266 15.590  -3.195  1.00 54.12  ? 146 TYR B CB    1 
ATOM   5544 C  CG    . TYR B 2 146 ? 22.118 16.806  -2.916  1.00 56.76  ? 146 TYR B CG    1 
ATOM   5545 C  CD1   . TYR B 2 146 ? 22.797 17.455  -3.939  1.00 46.42  ? 146 TYR B CD1   1 
ATOM   5546 C  CD2   . TYR B 2 146 ? 22.248 17.301  -1.626  1.00 48.33  ? 146 TYR B CD2   1 
ATOM   5547 C  CE1   . TYR B 2 146 ? 23.580 18.564  -3.684  1.00 45.89  ? 146 TYR B CE1   1 
ATOM   5548 C  CE2   . TYR B 2 146 ? 23.025 18.409  -1.361  1.00 61.50  ? 146 TYR B CE2   1 
ATOM   5549 C  CZ    . TYR B 2 146 ? 23.690 19.038  -2.392  1.00 60.50  ? 146 TYR B CZ    1 
ATOM   5550 O  OH    . TYR B 2 146 ? 24.466 20.143  -2.128  1.00 61.06  ? 146 TYR B OH    1 
ATOM   5551 N  N     . ASN B 2 147 ? 21.284 12.969  -1.243  1.00 54.51  ? 147 ASN B N     1 
ATOM   5552 C  CA    . ASN B 2 147 ? 20.402 12.080  -0.500  1.00 64.78  ? 147 ASN B CA    1 
ATOM   5553 C  C     . ASN B 2 147 ? 19.407 12.820  0.379   1.00 66.51  ? 147 ASN B C     1 
ATOM   5554 O  O     . ASN B 2 147 ? 18.426 12.213  0.820   1.00 70.22  ? 147 ASN B O     1 
ATOM   5555 C  CB    . ASN B 2 147 ? 21.218 11.123  0.383   1.00 60.80  ? 147 ASN B CB    1 
ATOM   5556 C  CG    . ASN B 2 147 ? 22.171 10.258  -0.417  1.00 60.55  ? 147 ASN B CG    1 
ATOM   5557 O  OD1   . ASN B 2 147 ? 21.803 9.699   -1.451  1.00 57.52  ? 147 ASN B OD1   1 
ATOM   5558 N  ND2   . ASN B 2 147 ? 23.407 10.148  0.055   1.00 52.70  ? 147 ASN B ND2   1 
ATOM   5559 N  N     . VAL B 2 148 ? 19.639 14.104  0.649   1.00 75.32  ? 148 VAL B N     1 
ATOM   5560 C  CA    . VAL B 2 148 ? 18.734 14.918  1.451   1.00 80.52  ? 148 VAL B CA    1 
ATOM   5561 C  C     . VAL B 2 148 ? 18.244 16.081  0.601   1.00 74.31  ? 148 VAL B C     1 
ATOM   5562 O  O     . VAL B 2 148 ? 18.508 16.134  -0.606  1.00 77.34  ? 148 VAL B O     1 
ATOM   5563 C  CB    . VAL B 2 148 ? 19.420 15.419  2.735   1.00 80.81  ? 148 VAL B CB    1 
ATOM   5564 C  CG1   . VAL B 2 148 ? 19.778 14.248  3.636   1.00 77.10  ? 148 VAL B CG1   1 
ATOM   5565 C  CG2   . VAL B 2 148 ? 20.660 16.230  2.390   1.00 72.89  ? 148 VAL B CG2   1 
ATOM   5566 N  N     . LEU B 2 149 ? 17.530 17.014  1.217   1.00 70.77  ? 149 LEU B N     1 
ATOM   5567 C  CA    . LEU B 2 149 ? 17.047 18.187  0.495   1.00 66.27  ? 149 LEU B CA    1 
ATOM   5568 C  C     . LEU B 2 149 ? 18.222 19.078  0.117   1.00 64.94  ? 149 LEU B C     1 
ATOM   5569 O  O     . LEU B 2 149 ? 18.900 19.605  1.008   1.00 76.66  ? 149 LEU B O     1 
ATOM   5570 C  CB    . LEU B 2 149 ? 16.043 18.963  1.340   1.00 65.88  ? 149 LEU B CB    1 
ATOM   5571 C  CG    . LEU B 2 149 ? 14.752 18.237  1.723   1.00 54.37  ? 149 LEU B CG    1 
ATOM   5572 C  CD1   . LEU B 2 149 ? 13.777 19.208  2.367   1.00 55.19  ? 149 LEU B CD1   1 
ATOM   5573 C  CD2   . LEU B 2 149 ? 14.126 17.563  0.512   1.00 53.98  ? 149 LEU B CD2   1 
ATOM   5574 N  N     . PRO B 2 150 ? 18.501 19.275  -1.170  1.00 56.65  ? 150 PRO B N     1 
ATOM   5575 C  CA    . PRO B 2 150 ? 19.676 20.062  -1.559  1.00 59.45  ? 150 PRO B CA    1 
ATOM   5576 C  C     . PRO B 2 150 ? 19.431 21.559  -1.443  1.00 57.85  ? 150 PRO B C     1 
ATOM   5577 O  O     . PRO B 2 150 ? 18.334 22.057  -1.708  1.00 56.58  ? 150 PRO B O     1 
ATOM   5578 C  CB    . PRO B 2 150 ? 19.905 19.649  -3.017  1.00 56.46  ? 150 PRO B CB    1 
ATOM   5579 C  CG    . PRO B 2 150 ? 18.543 19.285  -3.510  1.00 54.86  ? 150 PRO B CG    1 
ATOM   5580 C  CD    . PRO B 2 150 ? 17.792 18.715  -2.334  1.00 49.09  ? 150 PRO B CD    1 
ATOM   5581 N  N     . GLN B 2 151 ? 20.477 22.277  -1.042  1.00 55.12  ? 151 GLN B N     1 
ATOM   5582 C  CA    . GLN B 2 151 ? 20.406 23.729  -0.962  1.00 53.38  ? 151 GLN B CA    1 
ATOM   5583 C  C     . GLN B 2 151 ? 20.300 24.332  -2.356  1.00 59.67  ? 151 GLN B C     1 
ATOM   5584 O  O     . GLN B 2 151 ? 20.927 23.855  -3.307  1.00 66.56  ? 151 GLN B O     1 
ATOM   5585 C  CB    . GLN B 2 151 ? 21.637 24.283  -0.245  1.00 48.40  ? 151 GLN B CB    1 
ATOM   5586 C  CG    . GLN B 2 151 ? 21.752 23.881  1.214   1.00 62.15  ? 151 GLN B CG    1 
ATOM   5587 C  CD    . GLN B 2 151 ? 23.075 24.298  1.825   1.00 65.81  ? 151 GLN B CD    1 
ATOM   5588 O  OE1   . GLN B 2 151 ? 23.115 25.061  2.790   1.00 62.74  ? 151 GLN B OE1   1 
ATOM   5589 N  NE2   . GLN B 2 151 ? 24.169 23.795  1.264   1.00 71.83  ? 151 GLN B NE2   1 
ATOM   5590 N  N     . GLY B 2 152 ? 19.500 25.388  -2.476  1.00 59.66  ? 152 GLY B N     1 
ATOM   5591 C  CA    . GLY B 2 152 ? 19.320 26.057  -3.749  1.00 44.82  ? 152 GLY B CA    1 
ATOM   5592 C  C     . GLY B 2 152 ? 18.293 25.435  -4.665  1.00 44.76  ? 152 GLY B C     1 
ATOM   5593 O  O     . GLY B 2 152 ? 18.157 25.882  -5.809  1.00 66.32  ? 152 GLY B O     1 
ATOM   5594 N  N     . TRP B 2 153 ? 17.568 24.423  -4.204  1.00 55.07  ? 153 TRP B N     1 
ATOM   5595 C  CA    . TRP B 2 153 ? 16.545 23.753  -4.992  1.00 59.47  ? 153 TRP B CA    1 
ATOM   5596 C  C     . TRP B 2 153 ? 15.166 24.270  -4.597  1.00 60.69  ? 153 TRP B C     1 
ATOM   5597 O  O     . TRP B 2 153 ? 14.920 24.606  -3.436  1.00 62.58  ? 153 TRP B O     1 
ATOM   5598 C  CB    . TRP B 2 153 ? 16.632 22.236  -4.798  1.00 64.54  ? 153 TRP B CB    1 
ATOM   5599 C  CG    . TRP B 2 153 ? 15.560 21.441  -5.481  1.00 59.75  ? 153 TRP B CG    1 
ATOM   5600 C  CD1   . TRP B 2 153 ? 15.212 21.488  -6.800  1.00 53.07  ? 153 TRP B CD1   1 
ATOM   5601 C  CD2   . TRP B 2 153 ? 14.717 20.451  -4.879  1.00 52.97  ? 153 TRP B CD2   1 
ATOM   5602 N  NE1   . TRP B 2 153 ? 14.193 20.600  -7.053  1.00 50.57  ? 153 TRP B NE1   1 
ATOM   5603 C  CE2   . TRP B 2 153 ? 13.873 19.950  -5.890  1.00 56.44  ? 153 TRP B CE2   1 
ATOM   5604 C  CE3   . TRP B 2 153 ? 14.590 19.946  -3.582  1.00 55.59  ? 153 TRP B CE3   1 
ATOM   5605 C  CZ2   . TRP B 2 153 ? 12.913 18.970  -5.642  1.00 61.44  ? 153 TRP B CZ2   1 
ATOM   5606 C  CZ3   . TRP B 2 153 ? 13.638 18.972  -3.338  1.00 53.80  ? 153 TRP B CZ3   1 
ATOM   5607 C  CH2   . TRP B 2 153 ? 12.813 18.494  -4.364  1.00 55.81  ? 153 TRP B CH2   1 
ATOM   5608 N  N     . LYS B 2 154 ? 14.269 24.346  -5.585  1.00 69.33  ? 154 LYS B N     1 
ATOM   5609 C  CA    . LYS B 2 154 ? 12.942 24.906  -5.343  1.00 64.45  ? 154 LYS B CA    1 
ATOM   5610 C  C     . LYS B 2 154 ? 12.147 24.056  -4.358  1.00 65.09  ? 154 LYS B C     1 
ATOM   5611 O  O     . LYS B 2 154 ? 11.394 24.590  -3.535  1.00 70.87  ? 154 LYS B O     1 
ATOM   5612 C  CB    . LYS B 2 154 ? 12.183 25.049  -6.663  1.00 60.04  ? 154 LYS B CB    1 
ATOM   5613 C  CG    . LYS B 2 154 ? 10.698 25.348  -6.501  1.00 62.04  ? 154 LYS B CG    1 
ATOM   5614 C  CD    . LYS B 2 154 ? 10.039 25.681  -7.832  1.00 65.54  ? 154 LYS B CD    1 
ATOM   5615 C  CE    . LYS B 2 154 ? 10.108 24.514  -8.803  1.00 64.55  ? 154 LYS B CE    1 
ATOM   5616 N  NZ    . LYS B 2 154 ? 9.485  24.855  -10.114 1.00 63.17  ? 154 LYS B NZ    1 
ATOM   5617 N  N     . GLY B 2 155 ? 12.306 22.733  -4.419  1.00 56.97  ? 155 GLY B N     1 
ATOM   5618 C  CA    . GLY B 2 155 ? 11.552 21.860  -3.537  1.00 59.68  ? 155 GLY B CA    1 
ATOM   5619 C  C     . GLY B 2 155 ? 12.006 21.891  -2.093  1.00 67.64  ? 155 GLY B C     1 
ATOM   5620 O  O     . GLY B 2 155 ? 11.240 21.497  -1.208  1.00 75.26  ? 155 GLY B O     1 
ATOM   5621 N  N     . SER B 2 156 ? 13.227 22.359  -1.832  1.00 68.30  ? 156 SER B N     1 
ATOM   5622 C  CA    . SER B 2 156 ? 13.762 22.309  -0.472  1.00 69.94  ? 156 SER B CA    1 
ATOM   5623 C  C     . SER B 2 156 ? 12.979 23.171  0.512   1.00 73.57  ? 156 SER B C     1 
ATOM   5624 O  O     . SER B 2 156 ? 12.627 22.663  1.591   1.00 78.59  ? 156 SER B O     1 
ATOM   5625 C  CB    . SER B 2 156 ? 15.249 22.680  -0.491  1.00 73.77  ? 156 SER B CB    1 
ATOM   5626 O  OG    . SER B 2 156 ? 16.000 21.725  -1.221  1.00 76.40  ? 156 SER B OG    1 
ATOM   5627 N  N     . PRO B 2 157 ? 12.674 24.446  0.236   1.00 72.77  ? 157 PRO B N     1 
ATOM   5628 C  CA    . PRO B 2 157 ? 11.856 25.200  1.200   1.00 69.17  ? 157 PRO B CA    1 
ATOM   5629 C  C     . PRO B 2 157 ? 10.413 24.733  1.253   1.00 70.02  ? 157 PRO B C     1 
ATOM   5630 O  O     . PRO B 2 157 ? 9.760  24.907  2.289   1.00 69.29  ? 157 PRO B O     1 
ATOM   5631 C  CB    . PRO B 2 157 ? 11.963 26.646  0.699   1.00 56.38  ? 157 PRO B CB    1 
ATOM   5632 C  CG    . PRO B 2 157 ? 12.211 26.509  -0.756  1.00 55.29  ? 157 PRO B CG    1 
ATOM   5633 C  CD    . PRO B 2 157 ? 13.090 25.299  -0.894  1.00 66.19  ? 157 PRO B CD    1 
ATOM   5634 N  N     . ALA B 2 158 ? 9.899  24.135  0.175   1.00 69.08  ? 158 ALA B N     1 
ATOM   5635 C  CA    . ALA B 2 158 ? 8.506  23.702  0.158   1.00 55.23  ? 158 ALA B CA    1 
ATOM   5636 C  C     . ALA B 2 158 ? 8.298  22.478  1.042   1.00 73.67  ? 158 ALA B C     1 
ATOM   5637 O  O     . ALA B 2 158 ? 7.390  22.452  1.881   1.00 78.65  ? 158 ALA B O     1 
ATOM   5638 C  CB    . ALA B 2 158 ? 8.065  23.415  -1.277  1.00 54.46  ? 158 ALA B CB    1 
ATOM   5639 N  N     . ILE B 2 159 ? 9.131  21.449  0.863   1.00 66.87  ? 159 ILE B N     1 
ATOM   5640 C  CA    . ILE B 2 159 ? 9.017  20.244  1.681   1.00 64.99  ? 159 ILE B CA    1 
ATOM   5641 C  C     . ILE B 2 159 ? 9.266  20.572  3.147   1.00 69.13  ? 159 ILE B C     1 
ATOM   5642 O  O     . ILE B 2 159 ? 8.621  20.015  4.044   1.00 78.18  ? 159 ILE B O     1 
ATOM   5643 C  CB    . ILE B 2 159 ? 9.987  19.160  1.171   1.00 67.28  ? 159 ILE B CB    1 
ATOM   5644 C  CG1   . ILE B 2 159 ? 9.734  18.861  -0.309  1.00 64.05  ? 159 ILE B CG1   1 
ATOM   5645 C  CG2   . ILE B 2 159 ? 9.865  17.893  2.005   1.00 63.66  ? 159 ILE B CG2   1 
ATOM   5646 C  CD1   . ILE B 2 159 ? 8.350  18.342  -0.603  1.00 69.60  ? 159 ILE B CD1   1 
ATOM   5647 N  N     . PHE B 2 160 ? 10.195 21.485  3.413   1.00 65.94  ? 160 PHE B N     1 
ATOM   5648 C  CA    . PHE B 2 160 ? 10.550 21.875  4.770   1.00 69.44  ? 160 PHE B CA    1 
ATOM   5649 C  C     . PHE B 2 160 ? 9.651  22.973  5.325   1.00 76.30  ? 160 PHE B C     1 
ATOM   5650 O  O     . PHE B 2 160 ? 9.812  23.357  6.488   1.00 74.54  ? 160 PHE B O     1 
ATOM   5651 C  CB    . PHE B 2 160 ? 12.016 22.324  4.810   1.00 57.72  ? 160 PHE B CB    1 
ATOM   5652 C  CG    . PHE B 2 160 ? 12.605 22.360  6.190   1.00 62.91  ? 160 PHE B CG    1 
ATOM   5653 C  CD1   . PHE B 2 160 ? 12.871 21.186  6.873   1.00 61.99  ? 160 PHE B CD1   1 
ATOM   5654 C  CD2   . PHE B 2 160 ? 12.905 23.567  6.799   1.00 67.48  ? 160 PHE B CD2   1 
ATOM   5655 C  CE1   . PHE B 2 160 ? 13.417 21.214  8.141   1.00 69.56  ? 160 PHE B CE1   1 
ATOM   5656 C  CE2   . PHE B 2 160 ? 13.452 23.601  8.068   1.00 68.29  ? 160 PHE B CE2   1 
ATOM   5657 C  CZ    . PHE B 2 160 ? 13.708 22.423  8.739   1.00 70.86  ? 160 PHE B CZ    1 
ATOM   5658 N  N     . GLN B 2 161 ? 8.705  23.477  4.525   1.00 79.49  ? 161 GLN B N     1 
ATOM   5659 C  CA    . GLN B 2 161 ? 7.836  24.559  4.979   1.00 87.72  ? 161 GLN B CA    1 
ATOM   5660 C  C     . GLN B 2 161 ? 7.041  24.157  6.216   1.00 94.43  ? 161 GLN B C     1 
ATOM   5661 O  O     . GLN B 2 161 ? 6.882  24.957  7.146   1.00 98.33  ? 161 GLN B O     1 
ATOM   5662 C  CB    . GLN B 2 161 ? 6.892  24.979  3.851   1.00 91.26  ? 161 GLN B CB    1 
ATOM   5663 C  CG    . GLN B 2 161 ? 5.842  26.007  4.247   1.00 95.83  ? 161 GLN B CG    1 
ATOM   5664 C  CD    . GLN B 2 161 ? 6.419  27.397  4.435   1.00 106.23 ? 161 GLN B CD    1 
ATOM   5665 O  OE1   . GLN B 2 161 ? 7.580  27.652  4.113   1.00 109.81 ? 161 GLN B OE1   1 
ATOM   5666 N  NE2   . GLN B 2 161 ? 5.605  28.308  4.955   1.00 114.85 ? 161 GLN B NE2   1 
ATOM   5667 N  N     . SER B 2 162 ? 6.535  22.922  6.245   1.00 90.13  ? 162 SER B N     1 
ATOM   5668 C  CA    . SER B 2 162 ? 5.757  22.469  7.394   1.00 91.93  ? 162 SER B CA    1 
ATOM   5669 C  C     . SER B 2 162 ? 6.601  22.458  8.661   1.00 91.52  ? 162 SER B C     1 
ATOM   5670 O  O     . SER B 2 162 ? 6.133  22.858  9.733   1.00 82.04  ? 162 SER B O     1 
ATOM   5671 C  CB    . SER B 2 162 ? 5.180  21.081  7.121   1.00 101.11 ? 162 SER B CB    1 
ATOM   5672 O  OG    . SER B 2 162 ? 4.404  21.077  5.936   1.00 107.56 ? 162 SER B OG    1 
ATOM   5673 N  N     . SER B 2 163 ? 7.852  22.008  8.555   1.00 98.45  ? 163 SER B N     1 
ATOM   5674 C  CA    . SER B 2 163 ? 8.749  21.994  9.702   1.00 92.53  ? 163 SER B CA    1 
ATOM   5675 C  C     . SER B 2 163 ? 9.299  23.376  10.031  1.00 85.62  ? 163 SER B C     1 
ATOM   5676 O  O     . SER B 2 163 ? 9.698  23.612  11.176  1.00 79.91  ? 163 SER B O     1 
ATOM   5677 C  CB    . SER B 2 163 ? 9.905  21.025  9.451   1.00 82.48  ? 163 SER B CB    1 
ATOM   5678 O  OG    . SER B 2 163 ? 9.429  19.795  8.933   1.00 74.60  ? 163 SER B OG    1 
ATOM   5679 N  N     . MET B 2 164 ? 9.326  24.291  9.058   1.00 81.00  ? 164 MET B N     1 
ATOM   5680 C  CA    . MET B 2 164 ? 9.838  25.631  9.323   1.00 75.66  ? 164 MET B CA    1 
ATOM   5681 C  C     . MET B 2 164 ? 8.868  26.437  10.179  1.00 73.24  ? 164 MET B C     1 
ATOM   5682 O  O     . MET B 2 164 ? 9.286  27.119  11.122  1.00 73.98  ? 164 MET B O     1 
ATOM   5683 C  CB    . MET B 2 164 ? 10.122 26.357  8.008   1.00 77.00  ? 164 MET B CB    1 
ATOM   5684 C  CG    . MET B 2 164 ? 10.660 27.769  8.188   1.00 82.61  ? 164 MET B CG    1 
ATOM   5685 S  SD    . MET B 2 164 ? 12.283 27.806  8.977   1.00 76.15  ? 164 MET B SD    1 
ATOM   5686 C  CE    . MET B 2 164 ? 13.307 27.125  7.676   1.00 67.12  ? 164 MET B CE    1 
ATOM   5687 N  N     . THR B 2 165 ? 7.570  26.372  9.868   1.00 74.74  ? 165 THR B N     1 
ATOM   5688 C  CA    . THR B 2 165 ? 6.590  27.121  10.646  1.00 86.26  ? 165 THR B CA    1 
ATOM   5689 C  C     . THR B 2 165 ? 6.533  26.639  12.090  1.00 96.14  ? 165 THR B C     1 
ATOM   5690 O  O     . THR B 2 165 ? 6.321  27.444  13.004  1.00 93.99  ? 165 THR B O     1 
ATOM   5691 C  CB    . THR B 2 165 ? 5.205  27.015  10.005  1.00 87.50  ? 165 THR B CB    1 
ATOM   5692 O  OG1   . THR B 2 165 ? 4.742  25.661  10.078  1.00 101.93 ? 165 THR B OG1   1 
ATOM   5693 C  CG2   . THR B 2 165 ? 5.256  27.450  8.548   1.00 81.48  ? 165 THR B CG2   1 
ATOM   5694 N  N     . LYS B 2 166 ? 6.724  25.337  12.316  1.00 108.71 ? 166 LYS B N     1 
ATOM   5695 C  CA    . LYS B 2 166 ? 6.696  24.799  13.672  1.00 113.09 ? 166 LYS B CA    1 
ATOM   5696 C  C     . LYS B 2 166 ? 7.887  25.257  14.504  1.00 110.07 ? 166 LYS B C     1 
ATOM   5697 O  O     . LYS B 2 166 ? 7.831  25.181  15.735  1.00 114.50 ? 166 LYS B O     1 
ATOM   5698 C  CB    . LYS B 2 166 ? 6.648  23.271  13.632  1.00 121.06 ? 166 LYS B CB    1 
ATOM   5699 C  CG    . LYS B 2 166 ? 5.423  22.703  12.933  1.00 129.09 ? 166 LYS B CG    1 
ATOM   5700 C  CD    . LYS B 2 166 ? 5.449  21.183  12.934  1.00 138.05 ? 166 LYS B CD    1 
ATOM   5701 C  CE    . LYS B 2 166 ? 4.229  20.602  12.237  1.00 140.12 ? 166 LYS B CE    1 
ATOM   5702 N  NZ    . LYS B 2 166 ? 4.246  19.113  12.250  1.00 138.47 ? 166 LYS B NZ    1 
ATOM   5703 N  N     . ILE B 2 167 ? 8.956  25.723  13.865  1.00 99.11  ? 167 ILE B N     1 
ATOM   5704 C  CA    . ILE B 2 167 ? 10.117 26.229  14.591  1.00 95.42  ? 167 ILE B CA    1 
ATOM   5705 C  C     . ILE B 2 167 ? 9.973  27.714  14.897  1.00 95.03  ? 167 ILE B C     1 
ATOM   5706 O  O     . ILE B 2 167 ? 10.262 28.156  16.011  1.00 93.17  ? 167 ILE B O     1 
ATOM   5707 C  CB    . ILE B 2 167 ? 11.402 25.941  13.788  1.00 93.81  ? 167 ILE B CB    1 
ATOM   5708 C  CG1   . ILE B 2 167 ? 11.604 24.434  13.625  1.00 96.01  ? 167 ILE B CG1   1 
ATOM   5709 C  CG2   . ILE B 2 167 ? 12.609 26.575  14.462  1.00 96.99  ? 167 ILE B CG2   1 
ATOM   5710 C  CD1   . ILE B 2 167 ? 12.846 24.066  12.841  1.00 94.62  ? 167 ILE B CD1   1 
ATOM   5711 N  N     . LEU B 2 168 ? 9.518  28.499  13.921  1.00 93.15  ? 168 LEU B N     1 
ATOM   5712 C  CA    . LEU B 2 168 ? 9.381  29.941  14.078  1.00 86.24  ? 168 LEU B CA    1 
ATOM   5713 C  C     . LEU B 2 168 ? 8.078  30.351  14.751  1.00 106.59 ? 168 LEU B C     1 
ATOM   5714 O  O     . LEU B 2 168 ? 7.861  31.549  14.960  1.00 104.60 ? 168 LEU B O     1 
ATOM   5715 C  CB    . LEU B 2 168 ? 9.491  30.623  12.713  1.00 77.53  ? 168 LEU B CB    1 
ATOM   5716 C  CG    . LEU B 2 168 ? 10.792 30.377  11.948  1.00 71.42  ? 168 LEU B CG    1 
ATOM   5717 C  CD1   . LEU B 2 168 ? 10.710 30.962  10.548  1.00 65.40  ? 168 LEU B CD1   1 
ATOM   5718 C  CD2   . LEU B 2 168 ? 11.974 30.957  12.708  1.00 66.42  ? 168 LEU B CD2   1 
ATOM   5719 N  N     . GLU B 2 169 ? 7.207  29.395  15.094  1.00 116.15 ? 169 GLU B N     1 
ATOM   5720 C  CA    . GLU B 2 169 ? 5.932  29.762  15.709  1.00 119.76 ? 169 GLU B CA    1 
ATOM   5721 C  C     . GLU B 2 169 ? 6.106  30.350  17.104  1.00 119.47 ? 169 GLU B C     1 
ATOM   5722 O  O     . GLU B 2 169 ? 5.482  31.387  17.393  1.00 124.50 ? 169 GLU B O     1 
ATOM   5723 C  CB    . GLU B 2 169 ? 4.985  28.558  15.710  1.00 126.08 ? 169 GLU B CB    1 
ATOM   5724 C  CG    . GLU B 2 169 ? 3.580  28.881  16.189  1.00 132.39 ? 169 GLU B CG    1 
ATOM   5725 C  CD    . GLU B 2 169 ? 2.628  27.714  16.027  1.00 136.97 ? 169 GLU B CD    1 
ATOM   5726 O  OE1   . GLU B 2 169 ? 3.053  26.669  15.490  1.00 134.60 ? 169 GLU B OE1   1 
ATOM   5727 O  OE2   . GLU B 2 169 ? 1.455  27.842  16.438  1.00 141.88 ? 169 GLU B OE2   1 
ATOM   5728 N  N     . PRO B 2 170 ? 6.903  29.768  18.011  1.00 110.48 ? 170 PRO B N     1 
ATOM   5729 C  CA    . PRO B 2 170 ? 7.102  30.424  19.314  1.00 105.24 ? 170 PRO B CA    1 
ATOM   5730 C  C     . PRO B 2 170 ? 7.815  31.761  19.219  1.00 98.42  ? 170 PRO B C     1 
ATOM   5731 O  O     . PRO B 2 170 ? 7.672  32.585  20.131  1.00 97.21  ? 170 PRO B O     1 
ATOM   5732 C  CB    . PRO B 2 170 ? 7.937  29.404  20.104  1.00 98.55  ? 170 PRO B CB    1 
ATOM   5733 C  CG    . PRO B 2 170 ? 7.697  28.103  19.423  1.00 97.60  ? 170 PRO B CG    1 
ATOM   5734 C  CD    . PRO B 2 170 ? 7.560  28.448  17.975  1.00 103.55 ? 170 PRO B CD    1 
ATOM   5735 N  N     . PHE B 2 171 ? 8.575  32.007  18.150  1.00 94.71  ? 171 PHE B N     1 
ATOM   5736 C  CA    . PHE B 2 171 ? 9.279  33.279  18.022  1.00 94.84  ? 171 PHE B CA    1 
ATOM   5737 C  C     . PHE B 2 171 ? 8.393  34.346  17.390  1.00 91.48  ? 171 PHE B C     1 
ATOM   5738 O  O     . PHE B 2 171 ? 8.448  35.516  17.786  1.00 95.97  ? 171 PHE B O     1 
ATOM   5739 C  CB    . PHE B 2 171 ? 10.559 33.095  17.209  1.00 91.42  ? 171 PHE B CB    1 
ATOM   5740 C  CG    . PHE B 2 171 ? 11.453 34.302  17.206  1.00 85.27  ? 171 PHE B CG    1 
ATOM   5741 C  CD1   . PHE B 2 171 ? 12.354 34.514  18.237  1.00 87.79  ? 171 PHE B CD1   1 
ATOM   5742 C  CD2   . PHE B 2 171 ? 11.398 35.222  16.172  1.00 77.63  ? 171 PHE B CD2   1 
ATOM   5743 C  CE1   . PHE B 2 171 ? 13.181 35.623  18.238  1.00 90.49  ? 171 PHE B CE1   1 
ATOM   5744 C  CE2   . PHE B 2 171 ? 12.222 36.332  16.167  1.00 77.57  ? 171 PHE B CE2   1 
ATOM   5745 C  CZ    . PHE B 2 171 ? 13.115 36.532  17.201  1.00 84.96  ? 171 PHE B CZ    1 
ATOM   5746 N  N     . ARG B 2 172 ? 7.577  33.964  16.405  1.00 85.48  ? 172 ARG B N     1 
ATOM   5747 C  CA    . ARG B 2 172 ? 6.650  34.917  15.806  1.00 86.87  ? 172 ARG B CA    1 
ATOM   5748 C  C     . ARG B 2 172 ? 5.561  35.329  16.787  1.00 95.06  ? 172 ARG B C     1 
ATOM   5749 O  O     . ARG B 2 172 ? 5.086  36.470  16.741  1.00 96.06  ? 172 ARG B O     1 
ATOM   5750 C  CB    . ARG B 2 172 ? 6.026  34.326  14.542  1.00 80.17  ? 172 ARG B CB    1 
ATOM   5751 C  CG    . ARG B 2 172 ? 6.973  34.225  13.358  1.00 76.67  ? 172 ARG B CG    1 
ATOM   5752 C  CD    . ARG B 2 172 ? 6.359  33.391  12.242  1.00 83.41  ? 172 ARG B CD    1 
ATOM   5753 N  NE    . ARG B 2 172 ? 7.192  33.379  11.042  1.00 89.21  ? 172 ARG B NE    1 
ATOM   5754 C  CZ    . ARG B 2 172 ? 6.977  32.595  9.990   1.00 88.18  ? 172 ARG B CZ    1 
ATOM   5755 N  NH1   . ARG B 2 172 ? 5.957  31.748  9.985   1.00 93.14  ? 172 ARG B NH1   1 
ATOM   5756 N  NH2   . ARG B 2 172 ? 7.788  32.655  8.942   1.00 82.79  ? 172 ARG B NH2   1 
ATOM   5757 N  N     . LYS B 2 173 ? 5.157  34.422  17.679  1.00 102.97 ? 173 LYS B N     1 
ATOM   5758 C  CA    . LYS B 2 173 ? 4.119  34.752  18.650  1.00 115.71 ? 173 LYS B CA    1 
ATOM   5759 C  C     . LYS B 2 173 ? 4.621  35.774  19.662  1.00 124.25 ? 173 LYS B C     1 
ATOM   5760 O  O     . LYS B 2 173 ? 3.951  36.778  19.930  1.00 127.46 ? 173 LYS B O     1 
ATOM   5761 C  CB    . LYS B 2 173 ? 3.639  33.483  19.356  1.00 118.61 ? 173 LYS B CB    1 
ATOM   5762 C  CG    . LYS B 2 173 ? 2.483  33.713  20.315  1.00 124.52 ? 173 LYS B CG    1 
ATOM   5763 C  CD    . LYS B 2 173 ? 2.072  32.424  21.004  1.00 130.29 ? 173 LYS B CD    1 
ATOM   5764 C  CE    . LYS B 2 173 ? 3.220  31.845  21.812  1.00 134.17 ? 173 LYS B CE    1 
ATOM   5765 N  NZ    . LYS B 2 173 ? 2.846  30.560  22.464  1.00 140.80 ? 173 LYS B NZ    1 
ATOM   5766 N  N     . GLN B 2 174 ? 5.804  35.538  20.234  1.00 128.30 ? 174 GLN B N     1 
ATOM   5767 C  CA    . GLN B 2 174 ? 6.371  36.473  21.197  1.00 130.00 ? 174 GLN B CA    1 
ATOM   5768 C  C     . GLN B 2 174 ? 6.895  37.745  20.546  1.00 124.58 ? 174 GLN B C     1 
ATOM   5769 O  O     . GLN B 2 174 ? 7.224  38.696  21.263  1.00 128.72 ? 174 GLN B O     1 
ATOM   5770 C  CB    . GLN B 2 174 ? 7.496  35.799  21.987  1.00 136.37 ? 174 GLN B CB    1 
ATOM   5771 C  CG    . GLN B 2 174 ? 7.092  34.501  22.671  1.00 145.05 ? 174 GLN B CG    1 
ATOM   5772 C  CD    . GLN B 2 174 ? 6.029  34.698  23.737  1.00 150.53 ? 174 GLN B CD    1 
ATOM   5773 O  OE1   . GLN B 2 174 ? 5.204  33.816  23.976  1.00 150.02 ? 174 GLN B OE1   1 
ATOM   5774 N  NE2   . GLN B 2 174 ? 6.051  35.856  24.391  1.00 151.40 ? 174 GLN B NE2   1 
ATOM   5775 N  N     . ASN B 2 175 ? 6.982  37.787  19.218  1.00 114.47 ? 175 ASN B N     1 
ATOM   5776 C  CA    . ASN B 2 175 ? 7.441  38.965  18.482  1.00 106.07 ? 175 ASN B CA    1 
ATOM   5777 C  C     . ASN B 2 175 ? 6.497  39.197  17.311  1.00 100.84 ? 175 ASN B C     1 
ATOM   5778 O  O     . ASN B 2 175 ? 6.820  38.872  16.160  1.00 104.19 ? 175 ASN B O     1 
ATOM   5779 C  CB    . ASN B 2 175 ? 8.885  38.794  18.008  1.00 100.47 ? 175 ASN B CB    1 
ATOM   5780 C  CG    . ASN B 2 175 ? 9.862  38.645  19.158  1.00 96.39  ? 175 ASN B CG    1 
ATOM   5781 O  OD1   . ASN B 2 175 ? 10.352 39.634  19.704  1.00 99.26  ? 175 ASN B OD1   1 
ATOM   5782 N  ND2   . ASN B 2 175 ? 10.153 37.404  19.532  1.00 87.12  ? 175 ASN B ND2   1 
ATOM   5783 N  N     . PRO B 2 176 ? 5.312  39.759  17.568  1.00 94.62  ? 176 PRO B N     1 
ATOM   5784 C  CA    . PRO B 2 176 ? 4.358  39.973  16.468  1.00 92.51  ? 176 PRO B CA    1 
ATOM   5785 C  C     . PRO B 2 176 ? 4.755  41.103  15.536  1.00 91.18  ? 176 PRO B C     1 
ATOM   5786 O  O     . PRO B 2 176 ? 4.400  41.063  14.351  1.00 86.53  ? 176 PRO B O     1 
ATOM   5787 C  CB    . PRO B 2 176 ? 3.046  40.278  17.201  1.00 97.93  ? 176 PRO B CB    1 
ATOM   5788 C  CG    . PRO B 2 176 ? 3.480  40.872  18.500  1.00 94.77  ? 176 PRO B CG    1 
ATOM   5789 C  CD    . PRO B 2 176 ? 4.763  40.175  18.871  1.00 94.56  ? 176 PRO B CD    1 
ATOM   5790 N  N     . ASP B 2 177 ? 5.480  42.109  16.028  1.00 106.38 ? 177 ASP B N     1 
ATOM   5791 C  CA    . ASP B 2 177 ? 5.924  43.232  15.210  1.00 109.45 ? 177 ASP B CA    1 
ATOM   5792 C  C     . ASP B 2 177 ? 7.142  42.902  14.356  1.00 103.31 ? 177 ASP B C     1 
ATOM   5793 O  O     . ASP B 2 177 ? 7.788  43.821  13.837  1.00 96.68  ? 177 ASP B O     1 
ATOM   5794 C  CB    . ASP B 2 177 ? 6.225  44.443  16.097  1.00 116.75 ? 177 ASP B CB    1 
ATOM   5795 C  CG    . ASP B 2 177 ? 4.972  45.069  16.673  1.00 123.79 ? 177 ASP B CG    1 
ATOM   5796 O  OD1   . ASP B 2 177 ? 3.930  45.059  15.984  1.00 122.70 ? 177 ASP B OD1   1 
ATOM   5797 O  OD2   . ASP B 2 177 ? 5.029  45.572  17.815  1.00 131.45 ? 177 ASP B OD2   1 
ATOM   5798 N  N     . ILE B 2 178 ? 7.470  41.623  14.198  1.00 101.80 ? 178 ILE B N     1 
ATOM   5799 C  CA    . ILE B 2 178 ? 8.616  41.185  13.414  1.00 91.93  ? 178 ILE B CA    1 
ATOM   5800 C  C     . ILE B 2 178 ? 8.110  40.312  12.276  1.00 82.29  ? 178 ILE B C     1 
ATOM   5801 O  O     . ILE B 2 178 ? 7.327  39.382  12.502  1.00 86.13  ? 178 ILE B O     1 
ATOM   5802 C  CB    . ILE B 2 178 ? 9.637  40.426  14.281  1.00 93.98  ? 178 ILE B CB    1 
ATOM   5803 C  CG1   . ILE B 2 178 ? 10.201 41.350  15.361  1.00 98.45  ? 178 ILE B CG1   1 
ATOM   5804 C  CG2   . ILE B 2 178 ? 10.754 39.856  13.420  1.00 89.14  ? 178 ILE B CG2   1 
ATOM   5805 C  CD1   . ILE B 2 178 ? 11.319 40.738  16.161  1.00 97.16  ? 178 ILE B CD1   1 
ATOM   5806 N  N     . VAL B 2 179 ? 8.553  40.614  11.060  1.00 72.77  ? 179 VAL B N     1 
ATOM   5807 C  CA    . VAL B 2 179 ? 8.153  39.880  9.867   1.00 72.34  ? 179 VAL B CA    1 
ATOM   5808 C  C     . VAL B 2 179 ? 9.299  38.964  9.461   1.00 75.16  ? 179 VAL B C     1 
ATOM   5809 O  O     . VAL B 2 179 ? 10.392 39.435  9.123   1.00 74.28  ? 179 VAL B O     1 
ATOM   5810 C  CB    . VAL B 2 179 ? 7.776  40.833  8.722   1.00 68.77  ? 179 VAL B CB    1 
ATOM   5811 C  CG1   . VAL B 2 179 ? 7.498  40.047  7.456   1.00 66.27  ? 179 VAL B CG1   1 
ATOM   5812 C  CG2   . VAL B 2 179 ? 6.571  41.677  9.107   1.00 64.81  ? 179 VAL B CG2   1 
ATOM   5813 N  N     . ILE B 2 180 ? 9.053  37.657  9.491   1.00 74.41  ? 180 ILE B N     1 
ATOM   5814 C  CA    . ILE B 2 180 ? 10.042 36.653  9.115   1.00 69.11  ? 180 ILE B CA    1 
ATOM   5815 C  C     . ILE B 2 180 ? 9.584  36.017  7.811   1.00 64.40  ? 180 ILE B C     1 
ATOM   5816 O  O     . ILE B 2 180 ? 8.590  35.280  7.782   1.00 65.12  ? 180 ILE B O     1 
ATOM   5817 C  CB    . ILE B 2 180 ? 10.233 35.597  10.211  1.00 72.47  ? 180 ILE B CB    1 
ATOM   5818 C  CG1   . ILE B 2 180 ? 10.763 36.244  11.492  1.00 74.11  ? 180 ILE B CG1   1 
ATOM   5819 C  CG2   . ILE B 2 180 ? 11.179 34.508  9.737   1.00 76.97  ? 180 ILE B CG2   1 
ATOM   5820 C  CD1   . ILE B 2 180 ? 10.988 35.262  12.620  1.00 66.78  ? 180 ILE B CD1   1 
ATOM   5821 N  N     . TYR B 2 181 ? 10.307 36.297  6.731   1.00 62.94  ? 181 TYR B N     1 
ATOM   5822 C  CA    . TYR B 2 181 ? 10.010 35.756  5.414   1.00 63.76  ? 181 TYR B CA    1 
ATOM   5823 C  C     . TYR B 2 181 ? 11.110 34.793  4.985   1.00 74.48  ? 181 TYR B C     1 
ATOM   5824 O  O     . TYR B 2 181 ? 12.278 34.956  5.350   1.00 86.82  ? 181 TYR B O     1 
ATOM   5825 C  CB    . TYR B 2 181 ? 9.860  36.877  4.380   1.00 66.21  ? 181 TYR B CB    1 
ATOM   5826 C  CG    . TYR B 2 181 ? 9.704  36.388  2.958   1.00 61.11  ? 181 TYR B CG    1 
ATOM   5827 C  CD1   . TYR B 2 181 ? 8.610  35.618  2.584   1.00 55.90  ? 181 TYR B CD1   1 
ATOM   5828 C  CD2   . TYR B 2 181 ? 10.647 36.702  1.988   1.00 56.56  ? 181 TYR B CD2   1 
ATOM   5829 C  CE1   . TYR B 2 181 ? 8.462  35.169  1.287   1.00 58.10  ? 181 TYR B CE1   1 
ATOM   5830 C  CE2   . TYR B 2 181 ? 10.507 36.258  0.686   1.00 56.67  ? 181 TYR B CE2   1 
ATOM   5831 C  CZ    . TYR B 2 181 ? 9.412  35.493  0.342   1.00 64.64  ? 181 TYR B CZ    1 
ATOM   5832 O  OH    . TYR B 2 181 ? 9.266  35.047  -0.952  1.00 76.56  ? 181 TYR B OH    1 
ATOM   5833 N  N     . GLN B 2 182 ? 10.725 33.786  4.206   1.00 74.19  ? 182 GLN B N     1 
ATOM   5834 C  CA    . GLN B 2 182 ? 11.640 32.755  3.738   1.00 64.25  ? 182 GLN B CA    1 
ATOM   5835 C  C     . GLN B 2 182 ? 11.631 32.708  2.217   1.00 59.77  ? 182 GLN B C     1 
ATOM   5836 O  O     . GLN B 2 182 ? 10.562 32.691  1.598   1.00 61.57  ? 182 GLN B O     1 
ATOM   5837 C  CB    . GLN B 2 182 ? 11.261 31.384  4.306   1.00 65.32  ? 182 GLN B CB    1 
ATOM   5838 C  CG    . GLN B 2 182 ? 12.100 30.237  3.769   1.00 67.20  ? 182 GLN B CG    1 
ATOM   5839 C  CD    . GLN B 2 182 ? 11.671 28.895  4.321   1.00 77.39  ? 182 GLN B CD    1 
ATOM   5840 O  OE1   . GLN B 2 182 ? 10.637 28.785  4.980   1.00 84.29  ? 182 GLN B OE1   1 
ATOM   5841 N  NE2   . GLN B 2 182 ? 12.465 27.864  4.057   1.00 80.62  ? 182 GLN B NE2   1 
ATOM   5842 N  N     . TYR B 2 183 ? 12.821 32.685  1.623   1.00 61.15  ? 183 TYR B N     1 
ATOM   5843 C  CA    . TYR B 2 183 ? 12.963 32.471  0.187   1.00 57.41  ? 183 TYR B CA    1 
ATOM   5844 C  C     . TYR B 2 183 ? 14.237 31.679  -0.052  1.00 57.11  ? 183 TYR B C     1 
ATOM   5845 O  O     . TYR B 2 183 ? 15.327 32.144  0.295   1.00 54.85  ? 183 TYR B O     1 
ATOM   5846 C  CB    . TYR B 2 183 ? 12.998 33.793  -0.581  1.00 56.44  ? 183 TYR B CB    1 
ATOM   5847 C  CG    . TYR B 2 183 ? 13.182 33.608  -2.070  1.00 57.36  ? 183 TYR B CG    1 
ATOM   5848 C  CD1   . TYR B 2 183 ? 12.107 33.277  -2.884  1.00 47.59  ? 183 TYR B CD1   1 
ATOM   5849 C  CD2   . TYR B 2 183 ? 14.431 33.755  -2.660  1.00 64.47  ? 183 TYR B CD2   1 
ATOM   5850 C  CE1   . TYR B 2 183 ? 12.269 33.100  -4.244  1.00 46.43  ? 183 TYR B CE1   1 
ATOM   5851 C  CE2   . TYR B 2 183 ? 14.602 33.584  -4.020  1.00 65.42  ? 183 TYR B CE2   1 
ATOM   5852 C  CZ    . TYR B 2 183 ? 13.518 33.254  -4.806  1.00 61.54  ? 183 TYR B CZ    1 
ATOM   5853 O  OH    . TYR B 2 183 ? 13.686 33.080  -6.161  1.00 66.27  ? 183 TYR B OH    1 
ATOM   5854 N  N     . MET B 2 184 ? 14.092 30.494  -0.643  1.00 57.74  ? 184 MET B N     1 
ATOM   5855 C  CA    . MET B 2 184 ? 15.207 29.576  -0.923  1.00 60.90  ? 184 MET B CA    1 
ATOM   5856 C  C     . MET B 2 184 ? 15.897 29.278  0.407   1.00 54.85  ? 184 MET B C     1 
ATOM   5857 O  O     . MET B 2 184 ? 15.206 28.974  1.393   1.00 53.48  ? 184 MET B O     1 
ATOM   5858 C  CB    . MET B 2 184 ? 16.097 30.166  -2.010  1.00 75.39  ? 184 MET B CB    1 
ATOM   5859 C  CG    . MET B 2 184 ? 15.412 30.352  -3.350  1.00 83.50  ? 184 MET B CG    1 
ATOM   5860 S  SD    . MET B 2 184 ? 14.972 28.807  -4.164  1.00 90.39  ? 184 MET B SD    1 
ATOM   5861 C  CE    . MET B 2 184 ? 14.228 29.429  -5.671  1.00 87.28  ? 184 MET B CE    1 
ATOM   5862 N  N     . ASP B 2 185 ? 17.223 29.354  0.491   1.00 52.94  ? 185 ASP B N     1 
ATOM   5863 C  CA    . ASP B 2 185 ? 17.939 29.066  1.726   1.00 53.67  ? 185 ASP B CA    1 
ATOM   5864 C  C     . ASP B 2 185 ? 17.947 30.237  2.699   1.00 50.39  ? 185 ASP B C     1 
ATOM   5865 O  O     . ASP B 2 185 ? 18.496 30.102  3.797   1.00 60.29  ? 185 ASP B O     1 
ATOM   5866 C  CB    . ASP B 2 185 ? 19.384 28.663  1.415   1.00 52.32  ? 185 ASP B CB    1 
ATOM   5867 C  CG    . ASP B 2 185 ? 19.486 27.722  0.234   1.00 58.70  ? 185 ASP B CG    1 
ATOM   5868 O  OD1   . ASP B 2 185 ? 18.512 26.985  -0.028  1.00 57.66  ? 185 ASP B OD1   1 
ATOM   5869 O  OD2   . ASP B 2 185 ? 20.542 27.720  -0.433  1.00 71.16  ? 185 ASP B OD2   1 
ATOM   5870 N  N     . ASP B 2 186 ? 17.361 31.372  2.332   1.00 52.44  ? 186 ASP B N     1 
ATOM   5871 C  CA    . ASP B 2 186 ? 17.460 32.587  3.124   1.00 58.40  ? 186 ASP B CA    1 
ATOM   5872 C  C     . ASP B 2 186 ? 16.212 32.802  3.971   1.00 61.09  ? 186 ASP B C     1 
ATOM   5873 O  O     . ASP B 2 186 ? 15.108 32.386  3.611   1.00 58.37  ? 186 ASP B O     1 
ATOM   5874 C  CB    . ASP B 2 186 ? 17.687 33.805  2.227   1.00 65.75  ? 186 ASP B CB    1 
ATOM   5875 C  CG    . ASP B 2 186 ? 19.019 33.757  1.509   1.00 71.16  ? 186 ASP B CG    1 
ATOM   5876 O  OD1   . ASP B 2 186 ? 19.939 33.073  2.008   1.00 61.21  ? 186 ASP B OD1   1 
ATOM   5877 O  OD2   . ASP B 2 186 ? 19.147 34.404  0.449   1.00 83.45  ? 186 ASP B OD2   1 
ATOM   5878 N  N     . LEU B 2 187 ? 16.408 33.470  5.106   1.00 61.86  ? 187 LEU B N     1 
ATOM   5879 C  CA    . LEU B 2 187 ? 15.333 33.834  6.022   1.00 60.85  ? 187 LEU B CA    1 
ATOM   5880 C  C     . LEU B 2 187 ? 15.445 35.330  6.285   1.00 60.27  ? 187 LEU B C     1 
ATOM   5881 O  O     . LEU B 2 187 ? 16.411 35.783  6.907   1.00 55.75  ? 187 LEU B O     1 
ATOM   5882 C  CB    . LEU B 2 187 ? 15.426 33.037  7.324   1.00 67.17  ? 187 LEU B CB    1 
ATOM   5883 C  CG    . LEU B 2 187 ? 14.167 32.943  8.186   1.00 64.37  ? 187 LEU B CG    1 
ATOM   5884 C  CD1   . LEU B 2 187 ? 13.077 32.170  7.458   1.00 66.11  ? 187 LEU B CD1   1 
ATOM   5885 C  CD2   . LEU B 2 187 ? 14.487 32.295  9.522   1.00 60.25  ? 187 LEU B CD2   1 
ATOM   5886 N  N     . TYR B 2 188 ? 14.468 36.094  5.804   1.00 59.12  ? 188 TYR B N     1 
ATOM   5887 C  CA    . TYR B 2 188 ? 14.487 37.547  5.921   1.00 57.63  ? 188 TYR B CA    1 
ATOM   5888 C  C     . TYR B 2 188 ? 13.733 37.967  7.176   1.00 65.11  ? 188 TYR B C     1 
ATOM   5889 O  O     . TYR B 2 188 ? 12.543 37.667  7.320   1.00 81.72  ? 188 TYR B O     1 
ATOM   5890 C  CB    . TYR B 2 188 ? 13.877 38.190  4.678   1.00 57.63  ? 188 TYR B CB    1 
ATOM   5891 C  CG    . TYR B 2 188 ? 14.694 37.969  3.427   1.00 59.31  ? 188 TYR B CG    1 
ATOM   5892 C  CD1   . TYR B 2 188 ? 14.542 36.815  2.668   1.00 65.11  ? 188 TYR B CD1   1 
ATOM   5893 C  CD2   . TYR B 2 188 ? 15.625 38.910  3.011   1.00 52.44  ? 188 TYR B CD2   1 
ATOM   5894 C  CE1   . TYR B 2 188 ? 15.292 36.609  1.527   1.00 63.52  ? 188 TYR B CE1   1 
ATOM   5895 C  CE2   . TYR B 2 188 ? 16.378 38.713  1.872   1.00 54.35  ? 188 TYR B CE2   1 
ATOM   5896 C  CZ    . TYR B 2 188 ? 16.208 37.562  1.134   1.00 64.37  ? 188 TYR B CZ    1 
ATOM   5897 O  OH    . TYR B 2 188 ? 16.958 37.363  -0.001  1.00 73.59  ? 188 TYR B OH    1 
ATOM   5898 N  N     . VAL B 2 189 ? 14.423 38.660  8.078   1.00 58.36  ? 189 VAL B N     1 
ATOM   5899 C  CA    . VAL B 2 189 ? 13.864 39.072  9.361   1.00 65.10  ? 189 VAL B CA    1 
ATOM   5900 C  C     . VAL B 2 189 ? 13.916 40.592  9.426   1.00 66.10  ? 189 VAL B C     1 
ATOM   5901 O  O     . VAL B 2 189 ? 15.003 41.180  9.485   1.00 71.36  ? 189 VAL B O     1 
ATOM   5902 C  CB    . VAL B 2 189 ? 14.617 38.448  10.543  1.00 64.59  ? 189 VAL B CB    1 
ATOM   5903 C  CG1   . VAL B 2 189 ? 13.842 38.663  11.832  1.00 64.18  ? 189 VAL B CG1   1 
ATOM   5904 C  CG2   . VAL B 2 189 ? 14.863 36.967  10.297  1.00 65.49  ? 189 VAL B CG2   1 
ATOM   5905 N  N     . GLY B 2 190 ? 12.748 41.226  9.426   1.00 66.15  ? 190 GLY B N     1 
ATOM   5906 C  CA    . GLY B 2 190 ? 12.655 42.672  9.487   1.00 72.18  ? 190 GLY B CA    1 
ATOM   5907 C  C     . GLY B 2 190 ? 11.931 43.127  10.738  1.00 70.79  ? 190 GLY B C     1 
ATOM   5908 O  O     . GLY B 2 190 ? 11.084 42.414  11.279  1.00 65.26  ? 190 GLY B O     1 
ATOM   5909 N  N     . SER B 2 191 ? 12.273 44.328  11.197  1.00 76.06  ? 191 SER B N     1 
ATOM   5910 C  CA    . SER B 2 191 ? 11.648 44.890  12.386  1.00 85.67  ? 191 SER B CA    1 
ATOM   5911 C  C     . SER B 2 191 ? 11.816 46.402  12.370  1.00 80.00  ? 191 SER B C     1 
ATOM   5912 O  O     . SER B 2 191 ? 12.627 46.951  11.620  1.00 72.18  ? 191 SER B O     1 
ATOM   5913 C  CB    . SER B 2 191 ? 12.244 44.302  13.670  1.00 81.04  ? 191 SER B CB    1 
ATOM   5914 O  OG    . SER B 2 191 ? 13.551 44.800  13.899  1.00 71.68  ? 191 SER B OG    1 
ATOM   5915 N  N     . ASP B 2 192 ? 11.027 47.066  13.214  1.00 81.60  ? 192 ASP B N     1 
ATOM   5916 C  CA    . ASP B 2 192 ? 11.146 48.498  13.449  1.00 89.67  ? 192 ASP B CA    1 
ATOM   5917 C  C     . ASP B 2 192 ? 11.923 48.807  14.724  1.00 93.10  ? 192 ASP B C     1 
ATOM   5918 O  O     . ASP B 2 192 ? 11.807 49.914  15.262  1.00 88.80  ? 192 ASP B O     1 
ATOM   5919 C  CB    . ASP B 2 192 ? 9.759  49.142  13.501  1.00 88.70  ? 192 ASP B CB    1 
ATOM   5920 C  CG    . ASP B 2 192 ? 9.037  49.082  12.170  1.00 80.09  ? 192 ASP B CG    1 
ATOM   5921 O  OD1   . ASP B 2 192 ? 9.689  49.306  11.128  1.00 74.55  ? 192 ASP B OD1   1 
ATOM   5922 O  OD2   . ASP B 2 192 ? 7.818  48.807  12.164  1.00 74.03  ? 192 ASP B OD2   1 
ATOM   5923 N  N     . LEU B 2 193 ? 12.706 47.850  15.216  1.00 91.97  ? 193 LEU B N     1 
ATOM   5924 C  CA    . LEU B 2 193 ? 13.478 48.050  16.430  1.00 87.95  ? 193 LEU B CA    1 
ATOM   5925 C  C     . LEU B 2 193 ? 14.650 48.993  16.182  1.00 97.49  ? 193 LEU B C     1 
ATOM   5926 O  O     . LEU B 2 193 ? 15.088 49.209  15.048  1.00 94.98  ? 193 LEU B O     1 
ATOM   5927 C  CB    . LEU B 2 193 ? 13.999 46.715  16.965  1.00 80.94  ? 193 LEU B CB    1 
ATOM   5928 C  CG    . LEU B 2 193 ? 13.016 45.819  17.717  1.00 81.14  ? 193 LEU B CG    1 
ATOM   5929 C  CD1   . LEU B 2 193 ? 13.680 44.501  18.086  1.00 83.42  ? 193 LEU B CD1   1 
ATOM   5930 C  CD2   . LEU B 2 193 ? 12.502 46.527  18.959  1.00 79.09  ? 193 LEU B CD2   1 
ATOM   5931 N  N     . GLU B 2 194 ? 15.158 49.558  17.274  1.00 111.10 ? 194 GLU B N     1 
ATOM   5932 C  CA    . GLU B 2 194 ? 16.351 50.386  17.208  1.00 117.90 ? 194 GLU B CA    1 
ATOM   5933 C  C     . GLU B 2 194 ? 17.550 49.544  16.786  1.00 124.54 ? 194 GLU B C     1 
ATOM   5934 O  O     . GLU B 2 194 ? 17.653 48.360  17.118  1.00 126.77 ? 194 GLU B O     1 
ATOM   5935 C  CB    . GLU B 2 194 ? 16.609 51.040  18.567  1.00 123.64 ? 194 GLU B CB    1 
ATOM   5936 C  CG    . GLU B 2 194 ? 17.721 52.075  18.584  1.00 131.14 ? 194 GLU B CG    1 
ATOM   5937 C  CD    . GLU B 2 194 ? 17.858 52.749  19.937  1.00 139.83 ? 194 GLU B CD    1 
ATOM   5938 O  OE1   . GLU B 2 194 ? 17.385 52.174  20.941  1.00 143.61 ? 194 GLU B OE1   1 
ATOM   5939 O  OE2   . GLU B 2 194 ? 18.432 53.857  19.997  1.00 139.72 ? 194 GLU B OE2   1 
ATOM   5940 N  N     . ILE B 2 195 ? 18.456 50.161  16.030  1.00 128.89 ? 195 ILE B N     1 
ATOM   5941 C  CA    . ILE B 2 195 ? 19.685 49.482  15.636  1.00 127.02 ? 195 ILE B CA    1 
ATOM   5942 C  C     . ILE B 2 195 ? 20.513 49.215  16.887  1.00 131.56 ? 195 ILE B C     1 
ATOM   5943 O  O     . ILE B 2 195 ? 20.920 50.144  17.595  1.00 141.35 ? 195 ILE B O     1 
ATOM   5944 C  CB    . ILE B 2 195 ? 20.462 50.303  14.598  1.00 124.95 ? 195 ILE B CB    1 
ATOM   5945 C  CG1   . ILE B 2 195 ? 21.884 49.761  14.434  1.00 123.37 ? 195 ILE B CG1   1 
ATOM   5946 C  CG2   . ILE B 2 195 ? 20.461 51.784  14.962  1.00 129.06 ? 195 ILE B CG2   1 
ATOM   5947 C  CD1   . ILE B 2 195 ? 22.690 50.481  13.372  1.00 123.32 ? 195 ILE B CD1   1 
ATOM   5948 N  N     . GLY B 2 196 ? 20.751 47.938  17.173  1.00 116.31 ? 196 GLY B N     1 
ATOM   5949 C  CA    . GLY B 2 196 ? 21.343 47.533  18.432  1.00 105.60 ? 196 GLY B CA    1 
ATOM   5950 C  C     . GLY B 2 196 ? 20.448 46.539  19.142  1.00 104.44 ? 196 GLY B C     1 
ATOM   5951 O  O     . GLY B 2 196 ? 20.869 45.421  19.456  1.00 103.64 ? 196 GLY B O     1 
ATOM   5952 N  N     . GLN B 2 197 ? 19.201 46.942  19.400  1.00 106.59 ? 197 GLN B N     1 
ATOM   5953 C  CA    . GLN B 2 197 ? 18.204 45.990  19.874  1.00 104.55 ? 197 GLN B CA    1 
ATOM   5954 C  C     . GLN B 2 197 ? 17.796 45.027  18.766  1.00 98.91  ? 197 GLN B C     1 
ATOM   5955 O  O     . GLN B 2 197 ? 17.416 43.884  19.046  1.00 92.38  ? 197 GLN B O     1 
ATOM   5956 C  CB    . GLN B 2 197 ? 16.978 46.730  20.412  1.00 105.25 ? 197 GLN B CB    1 
ATOM   5957 C  CG    . GLN B 2 197 ? 17.282 47.714  21.532  1.00 109.89 ? 197 GLN B CG    1 
ATOM   5958 C  CD    . GLN B 2 197 ? 16.061 48.510  21.958  1.00 110.68 ? 197 GLN B CD    1 
ATOM   5959 O  OE1   . GLN B 2 197 ? 14.936 48.206  21.561  1.00 104.75 ? 197 GLN B OE1   1 
ATOM   5960 N  NE2   . GLN B 2 197 ? 16.280 49.540  22.769  1.00 113.44 ? 197 GLN B NE2   1 
ATOM   5961 N  N     . HIS B 2 198 ? 17.870 45.473  17.509  1.00 94.18  ? 198 HIS B N     1 
ATOM   5962 C  CA    . HIS B 2 198 ? 17.557 44.601  16.382  1.00 86.94  ? 198 HIS B CA    1 
ATOM   5963 C  C     . HIS B 2 198 ? 18.517 43.420  16.321  1.00 83.62  ? 198 HIS B C     1 
ATOM   5964 O  O     . HIS B 2 198 ? 18.096 42.270  16.155  1.00 76.63  ? 198 HIS B O     1 
ATOM   5965 C  CB    . HIS B 2 198 ? 17.599 45.404  15.080  1.00 78.95  ? 198 HIS B CB    1 
ATOM   5966 C  CG    . HIS B 2 198 ? 17.364 44.582  13.850  1.00 82.01  ? 198 HIS B CG    1 
ATOM   5967 N  ND1   . HIS B 2 198 ? 16.108 44.174  13.455  1.00 84.42  ? 198 HIS B ND1   1 
ATOM   5968 C  CD2   . HIS B 2 198 ? 18.225 44.096  12.925  1.00 76.02  ? 198 HIS B CD2   1 
ATOM   5969 C  CE1   . HIS B 2 198 ? 16.205 43.472  12.341  1.00 75.33  ? 198 HIS B CE1   1 
ATOM   5970 N  NE2   . HIS B 2 198 ? 17.479 43.409  11.997  1.00 69.09  ? 198 HIS B NE2   1 
ATOM   5971 N  N     . ARG B 2 199 ? 19.819 43.688  16.458  1.00 86.72  ? 199 ARG B N     1 
ATOM   5972 C  CA    . ARG B 2 199 ? 20.801 42.608  16.462  1.00 81.12  ? 199 ARG B CA    1 
ATOM   5973 C  C     . ARG B 2 199 ? 20.605 41.691  17.662  1.00 77.00  ? 199 ARG B C     1 
ATOM   5974 O  O     . ARG B 2 199 ? 20.770 40.470  17.555  1.00 74.77  ? 199 ARG B O     1 
ATOM   5975 C  CB    . ARG B 2 199 ? 22.217 43.182  16.454  1.00 80.61  ? 199 ARG B CB    1 
ATOM   5976 C  CG    . ARG B 2 199 ? 22.532 44.050  15.248  1.00 81.78  ? 199 ARG B CG    1 
ATOM   5977 C  CD    . ARG B 2 199 ? 23.991 44.476  15.250  1.00 88.54  ? 199 ARG B CD    1 
ATOM   5978 N  NE    . ARG B 2 199 ? 24.324 45.300  14.092  1.00 86.10  ? 199 ARG B NE    1 
ATOM   5979 C  CZ    . ARG B 2 199 ? 24.312 46.629  14.092  1.00 86.85  ? 199 ARG B CZ    1 
ATOM   5980 N  NH1   . ARG B 2 199 ? 23.983 47.290  15.193  1.00 92.19  ? 199 ARG B NH1   1 
ATOM   5981 N  NH2   . ARG B 2 199 ? 24.629 47.296  12.992  1.00 82.20  ? 199 ARG B NH2   1 
ATOM   5982 N  N     . THR B 2 200 ? 20.259 42.264  18.819  1.00 78.35  ? 200 THR B N     1 
ATOM   5983 C  CA    . THR B 2 200 ? 19.962 41.449  19.991  1.00 84.43  ? 200 THR B CA    1 
ATOM   5984 C  C     . THR B 2 200 ? 18.819 40.481  19.717  1.00 86.96  ? 200 THR B C     1 
ATOM   5985 O  O     . THR B 2 200 ? 18.814 39.359  20.236  1.00 87.87  ? 200 THR B O     1 
ATOM   5986 C  CB    . THR B 2 200 ? 19.626 42.349  21.183  1.00 90.88  ? 200 THR B CB    1 
ATOM   5987 O  OG1   . THR B 2 200 ? 20.663 43.323  21.355  1.00 93.60  ? 200 THR B OG1   1 
ATOM   5988 C  CG2   . THR B 2 200 ? 19.498 41.530  22.460  1.00 91.99  ? 200 THR B CG2   1 
ATOM   5989 N  N     . LYS B 2 201 ? 17.855 40.889  18.892  1.00 90.60  ? 201 LYS B N     1 
ATOM   5990 C  CA    . LYS B 2 201 ? 16.736 40.015  18.559  1.00 84.09  ? 201 LYS B CA    1 
ATOM   5991 C  C     . LYS B 2 201 ? 17.125 38.992  17.498  1.00 82.41  ? 201 LYS B C     1 
ATOM   5992 O  O     . LYS B 2 201 ? 16.652 37.851  17.531  1.00 79.67  ? 201 LYS B O     1 
ATOM   5993 C  CB    . LYS B 2 201 ? 15.546 40.851  18.089  1.00 76.04  ? 201 LYS B CB    1 
ATOM   5994 C  CG    . LYS B 2 201 ? 14.232 40.099  18.073  1.00 74.90  ? 201 LYS B CG    1 
ATOM   5995 C  CD    . LYS B 2 201 ? 13.825 39.669  19.472  1.00 85.42  ? 201 LYS B CD    1 
ATOM   5996 C  CE    . LYS B 2 201 ? 13.634 40.868  20.386  1.00 89.63  ? 201 LYS B CE    1 
ATOM   5997 N  NZ    . LYS B 2 201 ? 12.589 41.796  19.870  1.00 105.25 ? 201 LYS B NZ    1 
ATOM   5998 N  N     . ILE B 2 202 ? 17.981 39.383  16.551  1.00 83.39  ? 202 ILE B N     1 
ATOM   5999 C  CA    . ILE B 2 202 ? 18.446 38.440  15.538  1.00 78.96  ? 202 ILE B CA    1 
ATOM   6000 C  C     . ILE B 2 202 ? 19.286 37.344  16.180  1.00 77.88  ? 202 ILE B C     1 
ATOM   6001 O  O     . ILE B 2 202 ? 19.161 36.162  15.834  1.00 75.46  ? 202 ILE B O     1 
ATOM   6002 C  CB    . ILE B 2 202 ? 19.223 39.178  14.434  1.00 75.03  ? 202 ILE B CB    1 
ATOM   6003 C  CG1   . ILE B 2 202 ? 18.324 40.203  13.743  1.00 72.19  ? 202 ILE B CG1   1 
ATOM   6004 C  CG2   . ILE B 2 202 ? 19.768 38.189  13.417  1.00 64.41  ? 202 ILE B CG2   1 
ATOM   6005 C  CD1   . ILE B 2 202 ? 17.124 39.596  13.058  1.00 68.57  ? 202 ILE B CD1   1 
ATOM   6006 N  N     . GLU B 2 203 ? 20.155 37.715  17.123  1.00 86.02  ? 203 GLU B N     1 
ATOM   6007 C  CA    . GLU B 2 203 ? 20.877 36.710  17.895  1.00 88.75  ? 203 GLU B CA    1 
ATOM   6008 C  C     . GLU B 2 203 ? 19.922 35.884  18.746  1.00 94.47  ? 203 GLU B C     1 
ATOM   6009 O  O     . GLU B 2 203 ? 20.159 34.691  18.968  1.00 94.31  ? 203 GLU B O     1 
ATOM   6010 C  CB    . GLU B 2 203 ? 21.939 37.384  18.766  1.00 92.78  ? 203 GLU B CB    1 
ATOM   6011 C  CG    . GLU B 2 203 ? 22.754 36.436  19.637  1.00 98.37  ? 203 GLU B CG    1 
ATOM   6012 C  CD    . GLU B 2 203 ? 23.509 35.392  18.834  1.00 91.28  ? 203 GLU B CD    1 
ATOM   6013 O  OE1   . GLU B 2 203 ? 23.710 34.276  19.357  1.00 85.10  ? 203 GLU B OE1   1 
ATOM   6014 O  OE2   . GLU B 2 203 ? 23.902 35.684  17.684  1.00 88.24  ? 203 GLU B OE2   1 
ATOM   6015 N  N     . GLU B 2 204 ? 18.834 36.497  19.220  1.00 93.14  ? 204 GLU B N     1 
ATOM   6016 C  CA    . GLU B 2 204 ? 17.815 35.746  19.944  1.00 92.53  ? 204 GLU B CA    1 
ATOM   6017 C  C     . GLU B 2 204 ? 17.144 34.722  19.036  1.00 91.03  ? 204 GLU B C     1 
ATOM   6018 O  O     . GLU B 2 204 ? 16.803 33.618  19.476  1.00 94.77  ? 204 GLU B O     1 
ATOM   6019 C  CB    . GLU B 2 204 ? 16.782 36.705  20.535  1.00 97.51  ? 204 GLU B CB    1 
ATOM   6020 C  CG    . GLU B 2 204 ? 15.831 36.071  21.535  1.00 103.37 ? 204 GLU B CG    1 
ATOM   6021 C  CD    . GLU B 2 204 ? 14.839 37.068  22.101  1.00 110.49 ? 204 GLU B CD    1 
ATOM   6022 O  OE1   . GLU B 2 204 ? 13.622 36.785  22.066  1.00 118.39 ? 204 GLU B OE1   1 
ATOM   6023 O  OE2   . GLU B 2 204 ? 15.275 38.140  22.572  1.00 105.47 ? 204 GLU B OE2   1 
ATOM   6024 N  N     . LEU B 2 205 ? 16.947 35.070  17.761  1.00 84.43  ? 205 LEU B N     1 
ATOM   6025 C  CA    . LEU B 2 205 ? 16.385 34.116  16.812  1.00 83.82  ? 205 LEU B CA    1 
ATOM   6026 C  C     . LEU B 2 205 ? 17.411 33.064  16.407  1.00 86.73  ? 205 LEU B C     1 
ATOM   6027 O  O     . LEU B 2 205 ? 17.060 31.895  16.209  1.00 90.55  ? 205 LEU B O     1 
ATOM   6028 C  CB    . LEU B 2 205 ? 15.855 34.846  15.576  1.00 77.65  ? 205 LEU B CB    1 
ATOM   6029 C  CG    . LEU B 2 205 ? 15.248 33.958  14.485  1.00 75.71  ? 205 LEU B CG    1 
ATOM   6030 C  CD1   . LEU B 2 205 ? 14.093 33.132  15.035  1.00 80.37  ? 205 LEU B CD1   1 
ATOM   6031 C  CD2   . LEU B 2 205 ? 14.797 34.791  13.297  1.00 73.02  ? 205 LEU B CD2   1 
ATOM   6032 N  N     . ARG B 2 206 ? 18.681 33.459  16.278  1.00 84.02  ? 206 ARG B N     1 
ATOM   6033 C  CA    . ARG B 2 206 ? 19.724 32.493  15.946  1.00 88.02  ? 206 ARG B CA    1 
ATOM   6034 C  C     . ARG B 2 206 ? 19.880 31.454  17.049  1.00 97.23  ? 206 ARG B C     1 
ATOM   6035 O  O     . ARG B 2 206 ? 20.068 30.264  16.768  1.00 92.06  ? 206 ARG B O     1 
ATOM   6036 C  CB    . ARG B 2 206 ? 21.048 33.213  15.692  1.00 88.04  ? 206 ARG B CB    1 
ATOM   6037 C  CG    . ARG B 2 206 ? 22.220 32.278  15.444  1.00 92.01  ? 206 ARG B CG    1 
ATOM   6038 C  CD    . ARG B 2 206 ? 23.473 33.045  15.059  1.00 96.19  ? 206 ARG B CD    1 
ATOM   6039 N  NE    . ARG B 2 206 ? 23.312 33.747  13.789  1.00 99.83  ? 206 ARG B NE    1 
ATOM   6040 C  CZ    . ARG B 2 206 ? 23.541 33.199  12.600  1.00 105.65 ? 206 ARG B CZ    1 
ATOM   6041 N  NH1   . ARG B 2 206 ? 23.941 31.937  12.516  1.00 101.32 ? 206 ARG B NH1   1 
ATOM   6042 N  NH2   . ARG B 2 206 ? 23.370 33.911  11.495  1.00 112.16 ? 206 ARG B NH2   1 
ATOM   6043 N  N     . GLN B 2 207 ? 19.807 31.883  18.311  1.00 106.52 ? 207 GLN B N     1 
ATOM   6044 C  CA    . GLN B 2 207 ? 19.811 30.925  19.412  1.00 110.32 ? 207 GLN B CA    1 
ATOM   6045 C  C     . GLN B 2 207 ? 18.555 30.064  19.401  1.00 116.74 ? 207 GLN B C     1 
ATOM   6046 O  O     . GLN B 2 207 ? 18.605 28.891  19.790  1.00 115.91 ? 207 GLN B O     1 
ATOM   6047 C  CB    . GLN B 2 207 ? 19.942 31.653  20.750  1.00 108.04 ? 207 GLN B CB    1 
ATOM   6048 C  CG    . GLN B 2 207 ? 21.258 32.390  20.935  1.00 110.53 ? 207 GLN B CG    1 
ATOM   6049 C  CD    . GLN B 2 207 ? 22.449 31.454  21.000  1.00 109.52 ? 207 GLN B CD    1 
ATOM   6050 O  OE1   . GLN B 2 207 ? 22.342 30.324  21.478  1.00 113.30 ? 207 GLN B OE1   1 
ATOM   6051 N  NE2   . GLN B 2 207 ? 23.595 31.920  20.516  1.00 103.67 ? 207 GLN B NE2   1 
ATOM   6052 N  N     . HIS B 2 208 ? 17.427 30.625  18.959  1.00 120.49 ? 208 HIS B N     1 
ATOM   6053 C  CA    . HIS B 2 208 ? 16.191 29.853  18.886  1.00 120.64 ? 208 HIS B CA    1 
ATOM   6054 C  C     . HIS B 2 208 ? 16.275 28.762  17.826  1.00 115.95 ? 208 HIS B C     1 
ATOM   6055 O  O     . HIS B 2 208 ? 15.635 27.714  17.966  1.00 120.21 ? 208 HIS B O     1 
ATOM   6056 C  CB    . HIS B 2 208 ? 15.011 30.783  18.601  1.00 125.14 ? 208 HIS B CB    1 
ATOM   6057 C  CG    . HIS B 2 208 ? 13.672 30.154  18.835  1.00 126.09 ? 208 HIS B CG    1 
ATOM   6058 N  ND1   . HIS B 2 208 ? 13.189 29.119  18.065  1.00 122.03 ? 208 HIS B ND1   1 
ATOM   6059 C  CD2   . HIS B 2 208 ? 12.710 30.423  19.749  1.00 128.79 ? 208 HIS B CD2   1 
ATOM   6060 C  CE1   . HIS B 2 208 ? 11.990 28.772  18.498  1.00 124.62 ? 208 HIS B CE1   1 
ATOM   6061 N  NE2   . HIS B 2 208 ? 11.675 29.549  19.519  1.00 130.61 ? 208 HIS B NE2   1 
ATOM   6062 N  N     . LEU B 2 209 ? 17.052 28.987  16.764  1.00 110.94 ? 209 LEU B N     1 
ATOM   6063 C  CA    . LEU B 2 209 ? 17.203 27.988  15.714  1.00 107.66 ? 209 LEU B CA    1 
ATOM   6064 C  C     . LEU B 2 209 ? 18.217 26.909  16.069  1.00 106.89 ? 209 LEU B C     1 
ATOM   6065 O  O     . LEU B 2 209 ? 18.142 25.804  15.521  1.00 100.68 ? 209 LEU B O     1 
ATOM   6066 C  CB    . LEU B 2 209 ? 17.610 28.659  14.400  1.00 96.72  ? 209 LEU B CB    1 
ATOM   6067 C  CG    . LEU B 2 209 ? 16.618 29.659  13.804  1.00 89.22  ? 209 LEU B CG    1 
ATOM   6068 C  CD1   . LEU B 2 209 ? 17.104 30.158  12.451  1.00 73.54  ? 209 LEU B CD1   1 
ATOM   6069 C  CD2   . LEU B 2 209 ? 15.236 29.038  13.684  1.00 93.69  ? 209 LEU B CD2   1 
ATOM   6070 N  N     . LEU B 2 210 ? 19.161 27.200  16.965  1.00 113.22 ? 210 LEU B N     1 
ATOM   6071 C  CA    . LEU B 2 210 ? 20.154 26.211  17.362  1.00 115.73 ? 210 LEU B CA    1 
ATOM   6072 C  C     . LEU B 2 210 ? 19.608 25.180  18.340  1.00 121.82 ? 210 LEU B C     1 
ATOM   6073 O  O     . LEU B 2 210 ? 20.326 24.231  18.676  1.00 124.58 ? 210 LEU B O     1 
ATOM   6074 C  CB    . LEU B 2 210 ? 21.377 26.906  17.967  1.00 112.96 ? 210 LEU B CB    1 
ATOM   6075 C  CG    . LEU B 2 210 ? 22.208 27.745  16.993  1.00 105.65 ? 210 LEU B CG    1 
ATOM   6076 C  CD1   . LEU B 2 210 ? 23.412 28.353  17.693  1.00 106.24 ? 210 LEU B CD1   1 
ATOM   6077 C  CD2   . LEU B 2 210 ? 22.642 26.911  15.796  1.00 101.19 ? 210 LEU B CD2   1 
ATOM   6078 N  N     . ARG B 2 211 ? 18.370 25.338  18.807  1.00 124.30 ? 211 ARG B N     1 
ATOM   6079 C  CA    . ARG B 2 211 ? 17.719 24.312  19.612  1.00 127.73 ? 211 ARG B CA    1 
ATOM   6080 C  C     . ARG B 2 211 ? 17.180 23.163  18.772  1.00 123.32 ? 211 ARG B C     1 
ATOM   6081 O  O     . ARG B 2 211 ? 16.616 22.217  19.333  1.00 130.61 ? 211 ARG B O     1 
ATOM   6082 C  CB    . ARG B 2 211 ? 16.582 24.923  20.439  1.00 131.57 ? 211 ARG B CB    1 
ATOM   6083 C  CG    . ARG B 2 211 ? 17.049 25.764  21.617  1.00 133.54 ? 211 ARG B CG    1 
ATOM   6084 C  CD    . ARG B 2 211 ? 15.881 26.233  22.479  1.00 141.36 ? 211 ARG B CD    1 
ATOM   6085 N  NE    . ARG B 2 211 ? 15.102 25.119  23.016  1.00 147.23 ? 211 ARG B NE    1 
ATOM   6086 C  CZ    . ARG B 2 211 ? 13.878 24.797  22.611  1.00 145.23 ? 211 ARG B CZ    1 
ATOM   6087 N  NH1   . ARG B 2 211 ? 13.282 25.509  21.664  1.00 141.56 ? 211 ARG B NH1   1 
ATOM   6088 N  NH2   . ARG B 2 211 ? 13.246 23.765  23.155  1.00 144.47 ? 211 ARG B NH2   1 
ATOM   6089 N  N     . TRP B 2 212 ? 17.338 23.221  17.450  1.00 112.72 ? 212 TRP B N     1 
ATOM   6090 C  CA    . TRP B 2 212 ? 16.871 22.161  16.567  1.00 106.61 ? 212 TRP B CA    1 
ATOM   6091 C  C     . TRP B 2 212 ? 18.047 21.521  15.841  1.00 108.70 ? 212 TRP B C     1 
ATOM   6092 O  O     . TRP B 2 212 ? 18.574 20.494  16.283  1.00 110.62 ? 212 TRP B O     1 
ATOM   6093 C  CB    . TRP B 2 212 ? 15.853 22.710  15.564  1.00 104.25 ? 212 TRP B CB    1 
ATOM   6094 C  CG    . TRP B 2 212 ? 14.623 23.272  16.209  1.00 104.35 ? 212 TRP B CG    1 
ATOM   6095 C  CD1   . TRP B 2 212 ? 14.514 24.461  16.871  1.00 101.91 ? 212 TRP B CD1   1 
ATOM   6096 C  CD2   . TRP B 2 212 ? 13.323 22.671  16.249  0.00 102.68 ? 212 TRP B CD2   1 
ATOM   6097 N  NE1   . TRP B 2 212 ? 13.230 24.635  17.324  1.00 104.42 ? 212 TRP B NE1   1 
ATOM   6098 C  CE2   . TRP B 2 212 ? 12.478 23.550  16.955  0.00 105.78 ? 212 TRP B CE2   1 
ATOM   6099 C  CE3   . TRP B 2 212 ? 12.792 21.474  15.758  1.00 98.22  ? 212 TRP B CE3   1 
ATOM   6100 C  CZ2   . TRP B 2 212 ? 11.132 23.271  17.182  1.00 110.48 ? 212 TRP B CZ2   1 
ATOM   6101 C  CZ3   . TRP B 2 212 ? 11.456 21.198  15.985  1.00 98.92  ? 212 TRP B CZ3   1 
ATOM   6102 C  CH2   . TRP B 2 212 ? 10.641 22.093  16.690  1.00 107.75 ? 212 TRP B CH2   1 
ATOM   6103 N  N     . GLY B 2 213 ? 18.467 22.120  14.731  1.00 103.01 ? 213 GLY B N     1 
ATOM   6104 C  CA    . GLY B 2 213 ? 19.592 21.607  13.971  1.00 96.34  ? 213 GLY B CA    1 
ATOM   6105 C  C     . GLY B 2 213 ? 19.624 22.095  12.536  1.00 89.43  ? 213 GLY B C     1 
ATOM   6106 O  O     . GLY B 2 213 ? 18.717 21.810  11.755  1.00 89.77  ? 213 GLY B O     1 
ATOM   6107 N  N     . GLU B 2 233 ? 23.112 43.484  6.162   1.00 65.22  ? 233 GLU B N     1 
ATOM   6108 C  CA    . GLU B 2 233 ? 22.059 44.208  6.863   1.00 73.36  ? 233 GLU B CA    1 
ATOM   6109 C  C     . GLU B 2 233 ? 21.349 45.180  5.925   1.00 83.80  ? 233 GLU B C     1 
ATOM   6110 O  O     . GLU B 2 233 ? 21.957 46.119  5.409   1.00 85.03  ? 233 GLU B O     1 
ATOM   6111 C  CB    . GLU B 2 233 ? 22.633 44.953  8.068   1.00 68.26  ? 233 GLU B CB    1 
ATOM   6112 C  CG    . GLU B 2 233 ? 21.849 44.745  9.350   1.00 69.14  ? 233 GLU B CG    1 
ATOM   6113 C  CD    . GLU B 2 233 ? 22.622 45.178  10.579  1.00 76.65  ? 233 GLU B CD    1 
ATOM   6114 O  OE1   . GLU B 2 233 ? 23.377 46.170  10.490  1.00 76.75  ? 233 GLU B OE1   1 
ATOM   6115 O  OE2   . GLU B 2 233 ? 22.483 44.519  11.630  1.00 81.12  ? 233 GLU B OE2   1 
ATOM   6116 N  N     . LEU B 2 234 ? 20.059 44.947  5.713   1.00 83.86  ? 234 LEU B N     1 
ATOM   6117 C  CA    . LEU B 2 234 ? 19.250 45.722  4.785   1.00 72.37  ? 234 LEU B CA    1 
ATOM   6118 C  C     . LEU B 2 234 ? 18.458 46.800  5.515   1.00 69.86  ? 234 LEU B C     1 
ATOM   6119 O  O     . LEU B 2 234 ? 18.194 46.710  6.716   1.00 75.48  ? 234 LEU B O     1 
ATOM   6120 C  CB    . LEU B 2 234 ? 18.286 44.812  4.020   1.00 65.97  ? 234 LEU B CB    1 
ATOM   6121 C  CG    . LEU B 2 234 ? 18.718 44.231  2.674   1.00 68.10  ? 234 LEU B CG    1 
ATOM   6122 C  CD1   . LEU B 2 234 ? 20.051 43.507  2.773   1.00 70.55  ? 234 LEU B CD1   1 
ATOM   6123 C  CD2   . LEU B 2 234 ? 17.635 43.295  2.173   1.00 72.90  ? 234 LEU B CD2   1 
ATOM   6124 N  N     . HIS B 2 235 ? 18.073 47.827  4.760   1.00 67.57  ? 235 HIS B N     1 
ATOM   6125 C  CA    . HIS B 2 235 ? 17.217 48.904  5.262   1.00 73.16  ? 235 HIS B CA    1 
ATOM   6126 C  C     . HIS B 2 235 ? 16.218 49.271  4.175   1.00 70.29  ? 235 HIS B C     1 
ATOM   6127 O  O     . HIS B 2 235 ? 16.364 50.290  3.487   1.00 60.19  ? 235 HIS B O     1 
ATOM   6128 C  CB    . HIS B 2 235 ? 18.046 50.117  5.691   1.00 71.11  ? 235 HIS B CB    1 
ATOM   6129 C  CG    . HIS B 2 235 ? 19.085 49.803  6.722   1.00 76.38  ? 235 HIS B CG    1 
ATOM   6130 N  ND1   . HIS B 2 235 ? 18.820 49.814  8.075   1.00 80.17  ? 235 HIS B ND1   1 
ATOM   6131 C  CD2   . HIS B 2 235 ? 20.390 49.464  6.598   1.00 69.69  ? 235 HIS B CD2   1 
ATOM   6132 C  CE1   . HIS B 2 235 ? 19.917 49.497  8.739   1.00 76.05  ? 235 HIS B CE1   1 
ATOM   6133 N  NE2   . HIS B 2 235 ? 20.884 49.279  7.866   1.00 70.35  ? 235 HIS B NE2   1 
ATOM   6134 N  N     . PRO B 2 236 ? 15.176 48.453  3.989   1.00 67.93  ? 236 PRO B N     1 
ATOM   6135 C  CA    . PRO B 2 236 ? 14.211 48.713  2.908   1.00 72.52  ? 236 PRO B CA    1 
ATOM   6136 C  C     . PRO B 2 236 ? 13.388 49.975  3.105   1.00 77.29  ? 236 PRO B C     1 
ATOM   6137 O  O     . PRO B 2 236 ? 12.741 50.420  2.148   1.00 73.46  ? 236 PRO B O     1 
ATOM   6138 C  CB    . PRO B 2 236 ? 13.315 47.465  2.925   1.00 71.41  ? 236 PRO B CB    1 
ATOM   6139 C  CG    . PRO B 2 236 ? 14.084 46.437  3.699   1.00 71.38  ? 236 PRO B CG    1 
ATOM   6140 C  CD    . PRO B 2 236 ? 14.874 47.206  4.707   1.00 67.96  ? 236 PRO B CD    1 
ATOM   6141 N  N     . ASP B 2 237 ? 13.381 50.560  4.304   1.00 86.57  ? 237 ASP B N     1 
ATOM   6142 C  CA    . ASP B 2 237 ? 12.659 51.806  4.523   1.00 95.91  ? 237 ASP B CA    1 
ATOM   6143 C  C     . ASP B 2 237 ? 13.295 52.985  3.800   1.00 92.81  ? 237 ASP B C     1 
ATOM   6144 O  O     . ASP B 2 237 ? 12.649 54.030  3.667   1.00 93.08  ? 237 ASP B O     1 
ATOM   6145 C  CB    . ASP B 2 237 ? 12.566 52.103  6.023   1.00 104.30 ? 237 ASP B CB    1 
ATOM   6146 C  CG    . ASP B 2 237 ? 13.928 52.250  6.676   1.00 112.22 ? 237 ASP B CG    1 
ATOM   6147 O  OD1   . ASP B 2 237 ? 14.923 51.753  6.107   1.00 119.90 ? 237 ASP B OD1   1 
ATOM   6148 O  OD2   . ASP B 2 237 ? 14.001 52.860  7.764   1.00 112.24 ? 237 ASP B OD2   1 
ATOM   6149 N  N     . LYS B 2 238 ? 14.533 52.842  3.327   1.00 94.71  ? 238 LYS B N     1 
ATOM   6150 C  CA    . LYS B 2 238 ? 15.243 53.910  2.635   1.00 95.97  ? 238 LYS B CA    1 
ATOM   6151 C  C     . LYS B 2 238 ? 15.511 53.588  1.169   1.00 93.54  ? 238 LYS B C     1 
ATOM   6152 O  O     . LYS B 2 238 ? 16.328 54.266  0.536   1.00 88.07  ? 238 LYS B O     1 
ATOM   6153 C  CB    . LYS B 2 238 ? 16.557 54.219  3.357   1.00 98.84  ? 238 LYS B CB    1 
ATOM   6154 C  CG    . LYS B 2 238 ? 16.385 54.689  4.796   1.00 99.59  ? 238 LYS B CG    1 
ATOM   6155 C  CD    . LYS B 2 238 ? 15.675 56.035  4.862   1.00 104.19 ? 238 LYS B CD    1 
ATOM   6156 C  CE    . LYS B 2 238 ? 15.574 56.547  6.294   1.00 103.19 ? 238 LYS B CE    1 
ATOM   6157 N  NZ    . LYS B 2 238 ? 14.722 55.678  7.155   1.00 102.74 ? 238 LYS B NZ    1 
ATOM   6158 N  N     . TRP B 2 239 ? 14.852 52.572  0.615   1.00 92.97  ? 239 TRP B N     1 
ATOM   6159 C  CA    . TRP B 2 239 ? 14.977 52.287  -0.809  1.00 85.83  ? 239 TRP B CA    1 
ATOM   6160 C  C     . TRP B 2 239 ? 14.232 53.344  -1.615  1.00 86.03  ? 239 TRP B C     1 
ATOM   6161 O  O     . TRP B 2 239 ? 13.054 53.616  -1.364  1.00 79.76  ? 239 TRP B O     1 
ATOM   6162 C  CB    . TRP B 2 239 ? 14.433 50.894  -1.127  1.00 78.17  ? 239 TRP B CB    1 
ATOM   6163 C  CG    . TRP B 2 239 ? 15.309 49.774  -0.650  1.00 81.20  ? 239 TRP B CG    1 
ATOM   6164 C  CD1   . TRP B 2 239 ? 16.568 49.880  -0.134  1.00 77.43  ? 239 TRP B CD1   1 
ATOM   6165 C  CD2   . TRP B 2 239 ? 14.990 48.376  -0.646  1.00 72.42  ? 239 TRP B CD2   1 
ATOM   6166 N  NE1   . TRP B 2 239 ? 17.053 48.636  0.191   1.00 62.08  ? 239 TRP B NE1   1 
ATOM   6167 C  CE2   . TRP B 2 239 ? 16.104 47.696  -0.114  1.00 69.16  ? 239 TRP B CE2   1 
ATOM   6168 C  CE3   . TRP B 2 239 ? 13.872 47.635  -1.041  1.00 59.19  ? 239 TRP B CE3   1 
ATOM   6169 C  CZ2   . TRP B 2 239 ? 16.131 46.310  0.034   1.00 67.91  ? 239 TRP B CZ2   1 
ATOM   6170 C  CZ3   . TRP B 2 239 ? 13.901 46.260  -0.892  1.00 60.04  ? 239 TRP B CZ3   1 
ATOM   6171 C  CH2   . TRP B 2 239 ? 15.023 45.612  -0.360  1.00 64.02  ? 239 TRP B CH2   1 
ATOM   6172 N  N     . THR B 2 240 ? 14.918 53.937  -2.586  1.00 93.52  ? 240 THR B N     1 
ATOM   6173 C  CA    . THR B 2 240 ? 14.383 55.043  -3.364  1.00 99.51  ? 240 THR B CA    1 
ATOM   6174 C  C     . THR B 2 240 ? 14.210 54.640  -4.824  1.00 93.84  ? 240 THR B C     1 
ATOM   6175 O  O     . THR B 2 240 ? 14.737 53.625  -5.288  1.00 91.67  ? 240 THR B O     1 
ATOM   6176 C  CB    . THR B 2 240 ? 15.295 56.271  -3.261  1.00 104.72 ? 240 THR B CB    1 
ATOM   6177 O  OG1   . THR B 2 240 ? 14.717 57.364  -3.985  1.00 102.49 ? 240 THR B OG1   1 
ATOM   6178 C  CG2   . THR B 2 240 ? 16.670 55.961  -3.836  1.00 103.72 ? 240 THR B CG2   1 
ATOM   6179 N  N     . VAL B 2 241 ? 13.452 55.461  -5.547  1.00 88.98  ? 241 VAL B N     1 
ATOM   6180 C  CA    . VAL B 2 241 ? 13.239 55.299  -6.980  1.00 79.77  ? 241 VAL B CA    1 
ATOM   6181 C  C     . VAL B 2 241 ? 13.901 56.466  -7.697  1.00 81.14  ? 241 VAL B C     1 
ATOM   6182 O  O     . VAL B 2 241 ? 13.906 57.596  -7.193  1.00 82.78  ? 241 VAL B O     1 
ATOM   6183 C  CB    . VAL B 2 241 ? 11.740 55.212  -7.331  1.00 75.12  ? 241 VAL B CB    1 
ATOM   6184 C  CG1   . VAL B 2 241 ? 11.136 53.933  -6.770  1.00 67.70  ? 241 VAL B CG1   1 
ATOM   6185 C  CG2   . VAL B 2 241 ? 10.993 56.429  -6.802  1.00 82.50  ? 241 VAL B CG2   1 
ATOM   6186 N  N     . GLN B 2 242 ? 14.473 56.189  -8.870  1.00 78.14  ? 242 GLN B N     1 
ATOM   6187 C  CA    . GLN B 2 242 ? 15.137 57.214  -9.663  1.00 73.80  ? 242 GLN B CA    1 
ATOM   6188 C  C     . GLN B 2 242 ? 14.217 57.635  -10.801 1.00 69.90  ? 242 GLN B C     1 
ATOM   6189 O  O     . GLN B 2 242 ? 14.129 56.927  -11.816 1.00 59.90  ? 242 GLN B O     1 
ATOM   6190 C  CB    . GLN B 2 242 ? 16.471 56.698  -10.208 1.00 68.60  ? 242 GLN B CB    1 
ATOM   6191 C  CG    . GLN B 2 242 ? 17.198 57.682  -11.113 1.00 79.45  ? 242 GLN B CG    1 
ATOM   6192 C  CD    . GLN B 2 242 ? 17.449 59.019  -10.442 1.00 91.59  ? 242 GLN B CD    1 
ATOM   6193 O  OE1   . GLN B 2 242 ? 17.841 59.079  -9.276  1.00 89.21  ? 242 GLN B OE1   1 
ATOM   6194 N  NE2   . GLN B 2 242 ? 17.219 60.102  -11.177 1.00 95.19  ? 242 GLN B NE2   1 
ATOM   6195 N  N     . PRO B 2 243 ? 13.514 58.757  -10.690 1.00 73.80  ? 243 PRO B N     1 
ATOM   6196 C  CA    . PRO B 2 243 ? 12.606 59.171  -11.761 1.00 71.46  ? 243 PRO B CA    1 
ATOM   6197 C  C     . PRO B 2 243 ? 13.362 59.770  -12.937 1.00 69.16  ? 243 PRO B C     1 
ATOM   6198 O  O     . PRO B 2 243 ? 14.507 60.212  -12.825 1.00 65.25  ? 243 PRO B O     1 
ATOM   6199 C  CB    . PRO B 2 243 ? 11.722 60.223  -11.084 1.00 70.28  ? 243 PRO B CB    1 
ATOM   6200 C  CG    . PRO B 2 243 ? 12.611 60.824  -10.050 1.00 71.35  ? 243 PRO B CG    1 
ATOM   6201 C  CD    . PRO B 2 243 ? 13.508 59.707  -9.563  1.00 75.16  ? 243 PRO B CD    1 
ATOM   6202 N  N     . ILE B 2 244 ? 12.690 59.769  -14.087 1.00 67.56  ? 244 ILE B N     1 
ATOM   6203 C  CA    . ILE B 2 244 ? 13.236 60.408  -15.276 1.00 57.35  ? 244 ILE B CA    1 
ATOM   6204 C  C     . ILE B 2 244 ? 13.243 61.915  -15.069 1.00 54.04  ? 244 ILE B C     1 
ATOM   6205 O  O     . ILE B 2 244 ? 12.215 62.517  -14.730 1.00 52.62  ? 244 ILE B O     1 
ATOM   6206 C  CB    . ILE B 2 244 ? 12.420 60.019  -16.517 1.00 60.84  ? 244 ILE B CB    1 
ATOM   6207 C  CG1   . ILE B 2 244 ? 12.333 58.496  -16.635 1.00 62.03  ? 244 ILE B CG1   1 
ATOM   6208 C  CG2   . ILE B 2 244 ? 13.034 60.626  -17.769 1.00 53.33  ? 244 ILE B CG2   1 
ATOM   6209 C  CD1   . ILE B 2 244 ? 11.259 58.022  -17.584 1.00 58.44  ? 244 ILE B CD1   1 
ATOM   6210 N  N     . VAL B 2 245 ? 14.403 62.532  -15.264 1.00 64.02  ? 245 VAL B N     1 
ATOM   6211 C  CA    . VAL B 2 245 ? 14.580 63.962  -15.050 1.00 66.32  ? 245 VAL B CA    1 
ATOM   6212 C  C     . VAL B 2 245 ? 15.037 64.595  -16.357 1.00 67.09  ? 245 VAL B C     1 
ATOM   6213 O  O     . VAL B 2 245 ? 15.781 63.981  -17.130 1.00 70.78  ? 245 VAL B O     1 
ATOM   6214 C  CB    . VAL B 2 245 ? 15.582 64.239  -13.906 1.00 65.58  ? 245 VAL B CB    1 
ATOM   6215 C  CG1   . VAL B 2 245 ? 16.940 63.620  -14.211 1.00 65.55  ? 245 VAL B CG1   1 
ATOM   6216 C  CG2   . VAL B 2 245 ? 15.706 65.735  -13.636 1.00 72.69  ? 245 VAL B CG2   1 
ATOM   6217 N  N     . LEU B 2 246 ? 14.565 65.820  -16.615 1.00 61.64  ? 246 LEU B N     1 
ATOM   6218 C  CA    . LEU B 2 246 ? 14.893 66.570  -17.815 1.00 64.62  ? 246 LEU B CA    1 
ATOM   6219 C  C     . LEU B 2 246 ? 15.940 67.636  -17.512 1.00 71.99  ? 246 LEU B C     1 
ATOM   6220 O  O     . LEU B 2 246 ? 15.986 68.174  -16.402 1.00 80.18  ? 246 LEU B O     1 
ATOM   6221 C  CB    . LEU B 2 246 ? 13.640 67.234  -18.394 1.00 59.98  ? 246 LEU B CB    1 
ATOM   6222 C  CG    . LEU B 2 246 ? 12.533 66.282  -18.853 1.00 52.03  ? 246 LEU B CG    1 
ATOM   6223 C  CD1   . LEU B 2 246 ? 11.300 67.057  -19.285 1.00 45.78  ? 246 LEU B CD1   1 
ATOM   6224 C  CD2   . LEU B 2 246 ? 13.030 65.384  -19.976 1.00 51.99  ? 246 LEU B CD2   1 
ATOM   6225 N  N     . PRO B 2 247 ? 16.798 67.960  -18.478 1.00 64.72  ? 247 PRO B N     1 
ATOM   6226 C  CA    . PRO B 2 247 ? 17.832 68.970  -18.229 1.00 60.95  ? 247 PRO B CA    1 
ATOM   6227 C  C     . PRO B 2 247 ? 17.234 70.352  -18.021 1.00 64.41  ? 247 PRO B C     1 
ATOM   6228 O  O     . PRO B 2 247 ? 16.164 70.682  -18.539 1.00 55.29  ? 247 PRO B O     1 
ATOM   6229 C  CB    . PRO B 2 247 ? 18.688 68.920  -19.500 1.00 50.44  ? 247 PRO B CB    1 
ATOM   6230 C  CG    . PRO B 2 247 ? 17.767 68.399  -20.549 1.00 48.92  ? 247 PRO B CG    1 
ATOM   6231 C  CD    . PRO B 2 247 ? 16.879 67.414  -19.843 1.00 60.59  ? 247 PRO B CD    1 
ATOM   6232 N  N     . GLU B 2 248 ? 17.947 71.163  -17.243 1.00 76.34  ? 248 GLU B N     1 
ATOM   6233 C  CA    . GLU B 2 248 ? 17.563 72.540  -16.951 1.00 72.29  ? 248 GLU B CA    1 
ATOM   6234 C  C     . GLU B 2 248 ? 18.683 73.451  -17.434 1.00 73.56  ? 248 GLU B C     1 
ATOM   6235 O  O     . GLU B 2 248 ? 19.795 73.411  -16.897 1.00 78.83  ? 248 GLU B O     1 
ATOM   6236 C  CB    . GLU B 2 248 ? 17.302 72.733  -15.459 1.00 78.50  ? 248 GLU B CB    1 
ATOM   6237 C  CG    . GLU B 2 248 ? 16.166 71.883  -14.913 1.00 89.85  ? 248 GLU B CG    1 
ATOM   6238 C  CD    . GLU B 2 248 ? 16.128 71.868  -13.398 1.00 91.30  ? 248 GLU B CD    1 
ATOM   6239 O  OE1   . GLU B 2 248 ? 17.186 72.095  -12.774 1.00 94.70  ? 248 GLU B OE1   1 
ATOM   6240 O  OE2   . GLU B 2 248 ? 15.040 71.630  -12.831 1.00 82.78  ? 248 GLU B OE2   1 
ATOM   6241 N  N     . LYS B 2 249 ? 18.395 74.266  -18.446 1.00 77.59  ? 249 LYS B N     1 
ATOM   6242 C  CA    . LYS B 2 249 ? 19.384 75.157  -19.030 1.00 63.98  ? 249 LYS B CA    1 
ATOM   6243 C  C     . LYS B 2 249 ? 18.809 76.559  -19.159 1.00 70.81  ? 249 LYS B C     1 
ATOM   6244 O  O     . LYS B 2 249 ? 17.593 76.744  -19.259 1.00 68.69  ? 249 LYS B O     1 
ATOM   6245 C  CB    . LYS B 2 249 ? 19.844 74.666  -20.412 1.00 51.25  ? 249 LYS B CB    1 
ATOM   6246 C  CG    . LYS B 2 249 ? 20.353 73.235  -20.432 1.00 52.84  ? 249 LYS B CG    1 
ATOM   6247 C  CD    . LYS B 2 249 ? 20.826 72.840  -21.822 1.00 56.25  ? 249 LYS B CD    1 
ATOM   6248 C  CE    . LYS B 2 249 ? 21.202 71.368  -21.878 1.00 54.68  ? 249 LYS B CE    1 
ATOM   6249 N  NZ    . LYS B 2 249 ? 22.235 71.022  -20.864 1.00 55.71  ? 249 LYS B NZ    1 
ATOM   6250 N  N     . ASP B 2 250 ? 19.701 77.548  -19.150 1.00 78.82  ? 250 ASP B N     1 
ATOM   6251 C  CA    . ASP B 2 250 ? 19.336 78.925  -19.445 1.00 78.11  ? 250 ASP B CA    1 
ATOM   6252 C  C     . ASP B 2 250 ? 19.498 79.267  -20.918 1.00 73.20  ? 250 ASP B C     1 
ATOM   6253 O  O     . ASP B 2 250 ? 18.984 80.299  -21.362 1.00 77.38  ? 250 ASP B O     1 
ATOM   6254 C  CB    . ASP B 2 250 ? 20.176 79.890  -18.600 1.00 89.60  ? 250 ASP B CB    1 
ATOM   6255 C  CG    . ASP B 2 250 ? 19.916 79.740  -17.114 1.00 107.82 ? 250 ASP B CG    1 
ATOM   6256 O  OD1   . ASP B 2 250 ? 19.512 78.638  -16.687 1.00 109.41 ? 250 ASP B OD1   1 
ATOM   6257 O  OD2   . ASP B 2 250 ? 20.116 80.726  -16.372 1.00 121.79 ? 250 ASP B OD2   1 
ATOM   6258 N  N     . SER B 2 251 ? 20.197 78.425  -21.676 1.00 68.98  ? 251 SER B N     1 
ATOM   6259 C  CA    . SER B 2 251 ? 20.398 78.613  -23.105 1.00 64.91  ? 251 SER B CA    1 
ATOM   6260 C  C     . SER B 2 251 ? 20.329 77.252  -23.778 1.00 63.64  ? 251 SER B C     1 
ATOM   6261 O  O     . SER B 2 251 ? 21.039 76.324  -23.378 1.00 72.33  ? 251 SER B O     1 
ATOM   6262 C  CB    . SER B 2 251 ? 21.745 79.287  -23.393 1.00 65.83  ? 251 SER B CB    1 
ATOM   6263 O  OG    . SER B 2 251 ? 21.925 79.510  -24.780 1.00 69.44  ? 251 SER B OG    1 
ATOM   6264 N  N     . TRP B 2 252 ? 19.473 77.132  -24.787 1.00 56.53  ? 252 TRP B N     1 
ATOM   6265 C  CA    . TRP B 2 252 ? 19.252 75.876  -25.488 1.00 47.19  ? 252 TRP B CA    1 
ATOM   6266 C  C     . TRP B 2 252 ? 19.726 75.989  -26.930 1.00 46.10  ? 252 TRP B C     1 
ATOM   6267 O  O     . TRP B 2 252 ? 19.524 77.018  -27.581 1.00 50.85  ? 252 TRP B O     1 
ATOM   6268 C  CB    . TRP B 2 252 ? 17.771 75.485  -25.463 1.00 48.64  ? 252 TRP B CB    1 
ATOM   6269 C  CG    . TRP B 2 252 ? 17.242 75.190  -24.094 1.00 51.87  ? 252 TRP B CG    1 
ATOM   6270 C  CD1   . TRP B 2 252 ? 16.905 76.097  -23.132 1.00 52.40  ? 252 TRP B CD1   1 
ATOM   6271 C  CD2   . TRP B 2 252 ? 16.979 73.897  -23.536 1.00 52.65  ? 252 TRP B CD2   1 
ATOM   6272 N  NE1   . TRP B 2 252 ? 16.454 75.449  -22.007 1.00 52.03  ? 252 TRP B NE1   1 
ATOM   6273 C  CE2   . TRP B 2 252 ? 16.488 74.098  -22.230 1.00 53.72  ? 252 TRP B CE2   1 
ATOM   6274 C  CE3   . TRP B 2 252 ? 17.111 72.590  -24.013 1.00 50.03  ? 252 TRP B CE3   1 
ATOM   6275 C  CZ2   . TRP B 2 252 ? 16.131 73.041  -21.396 1.00 53.59  ? 252 TRP B CZ2   1 
ATOM   6276 C  CZ3   . TRP B 2 252 ? 16.756 71.542  -23.184 1.00 51.43  ? 252 TRP B CZ3   1 
ATOM   6277 C  CH2   . TRP B 2 252 ? 16.272 71.773  -21.890 1.00 55.60  ? 252 TRP B CH2   1 
ATOM   6278 N  N     . THR B 2 253 ? 20.355 74.929  -27.424 1.00 43.94  ? 253 THR B N     1 
ATOM   6279 C  CA    . THR B 2 253 ? 20.751 74.840  -28.820 1.00 43.84  ? 253 THR B CA    1 
ATOM   6280 C  C     . THR B 2 253 ? 19.835 73.868  -29.552 1.00 43.29  ? 253 THR B C     1 
ATOM   6281 O  O     . THR B 2 253 ? 19.011 73.176  -28.949 1.00 42.92  ? 253 THR B O     1 
ATOM   6282 C  CB    . THR B 2 253 ? 22.215 74.404  -28.957 1.00 48.73  ? 253 THR B CB    1 
ATOM   6283 O  OG1   . THR B 2 253 ? 22.384 73.089  -28.415 1.00 52.31  ? 253 THR B OG1   1 
ATOM   6284 C  CG2   . THR B 2 253 ? 23.131 75.373  -28.222 1.00 44.32  ? 253 THR B CG2   1 
ATOM   6285 N  N     . VAL B 2 254 ? 19.981 73.838  -30.879 1.00 43.37  ? 254 VAL B N     1 
ATOM   6286 C  CA    . VAL B 2 254 ? 19.223 72.886  -31.686 1.00 48.40  ? 254 VAL B CA    1 
ATOM   6287 C  C     . VAL B 2 254 ? 19.535 71.462  -31.249 1.00 52.46  ? 254 VAL B C     1 
ATOM   6288 O  O     . VAL B 2 254 ? 18.642 70.610  -31.161 1.00 58.39  ? 254 VAL B O     1 
ATOM   6289 C  CB    . VAL B 2 254 ? 19.517 73.098  -33.182 1.00 47.35  ? 254 VAL B CB    1 
ATOM   6290 C  CG1   . VAL B 2 254 ? 18.779 72.068  -34.023 1.00 43.08  ? 254 VAL B CG1   1 
ATOM   6291 C  CG2   . VAL B 2 254 ? 19.139 74.509  -33.602 1.00 51.29  ? 254 VAL B CG2   1 
ATOM   6292 N  N     . ASN B 2 255 ? 20.807 71.186  -30.952 1.00 45.17  ? 255 ASN B N     1 
ATOM   6293 C  CA    . ASN B 2 255 ? 21.188 69.864  -30.467 1.00 43.36  ? 255 ASN B CA    1 
ATOM   6294 C  C     . ASN B 2 255 ? 20.545 69.563  -29.118 1.00 40.92  ? 255 ASN B C     1 
ATOM   6295 O  O     . ASN B 2 255 ? 20.034 68.458  -28.901 1.00 42.09  ? 255 ASN B O     1 
ATOM   6296 C  CB    . ASN B 2 255 ? 22.711 69.763  -30.377 1.00 41.13  ? 255 ASN B CB    1 
ATOM   6297 C  CG    . ASN B 2 255 ? 23.175 68.420  -29.855 1.00 40.43  ? 255 ASN B CG    1 
ATOM   6298 O  OD1   . ASN B 2 255 ? 23.171 67.425  -30.580 1.00 50.09  ? 255 ASN B OD1   1 
ATOM   6299 N  ND2   . ASN B 2 255 ? 23.584 68.385  -28.593 1.00 40.35  ? 255 ASN B ND2   1 
ATOM   6300 N  N     . ASP B 2 256 ? 20.556 70.535  -28.201 1.00 41.39  ? 256 ASP B N     1 
ATOM   6301 C  CA    . ASP B 2 256 ? 19.950 70.325  -26.889 1.00 41.33  ? 256 ASP B CA    1 
ATOM   6302 C  C     . ASP B 2 256 ? 18.459 70.034  -27.009 1.00 50.55  ? 256 ASP B C     1 
ATOM   6303 O  O     . ASP B 2 256 ? 17.929 69.175  -26.296 1.00 60.40  ? 256 ASP B O     1 
ATOM   6304 C  CB    . ASP B 2 256 ? 20.180 71.546  -25.997 1.00 42.05  ? 256 ASP B CB    1 
ATOM   6305 C  CG    . ASP B 2 256 ? 21.651 71.811  -25.732 1.00 59.13  ? 256 ASP B CG    1 
ATOM   6306 O  OD1   . ASP B 2 256 ? 22.450 70.850  -25.762 1.00 51.88  ? 256 ASP B OD1   1 
ATOM   6307 O  OD2   . ASP B 2 256 ? 22.006 72.985  -25.487 1.00 56.45  ? 256 ASP B OD2   1 
ATOM   6308 N  N     . ILE B 2 257 ? 17.768 70.738  -27.907 1.00 54.27  ? 257 ILE B N     1 
ATOM   6309 C  CA    . ILE B 2 257 ? 16.334 70.520  -28.074 1.00 48.44  ? 257 ILE B CA    1 
ATOM   6310 C  C     . ILE B 2 257 ? 16.073 69.194  -28.776 1.00 48.39  ? 257 ILE B C     1 
ATOM   6311 O  O     . ILE B 2 257 ? 15.126 68.474  -28.435 1.00 48.93  ? 257 ILE B O     1 
ATOM   6312 C  CB    . ILE B 2 257 ? 15.700 71.701  -28.831 1.00 48.34  ? 257 ILE B CB    1 
ATOM   6313 C  CG1   . ILE B 2 257 ? 15.866 72.994  -28.031 1.00 49.49  ? 257 ILE B CG1   1 
ATOM   6314 C  CG2   . ILE B 2 257 ? 14.229 71.433  -29.111 1.00 42.80  ? 257 ILE B CG2   1 
ATOM   6315 C  CD1   . ILE B 2 257 ? 15.362 74.222  -28.750 1.00 54.06  ? 257 ILE B CD1   1 
ATOM   6316 N  N     . GLN B 2 258 ? 16.904 68.847  -29.763 1.00 50.31  ? 258 GLN B N     1 
ATOM   6317 C  CA    . GLN B 2 258 ? 16.753 67.559  -30.434 1.00 47.93  ? 258 GLN B CA    1 
ATOM   6318 C  C     . GLN B 2 258 ? 16.928 66.404  -29.456 1.00 45.47  ? 258 GLN B C     1 
ATOM   6319 O  O     . GLN B 2 258 ? 16.185 65.417  -29.510 1.00 47.07  ? 258 GLN B O     1 
ATOM   6320 C  CB    . GLN B 2 258 ? 17.748 67.444  -31.590 1.00 40.57  ? 258 GLN B CB    1 
ATOM   6321 C  CG    . GLN B 2 258 ? 17.334 68.204  -32.840 1.00 41.22  ? 258 GLN B CG    1 
ATOM   6322 C  CD    . GLN B 2 258 ? 18.341 68.073  -33.967 1.00 50.16  ? 258 GLN B CD    1 
ATOM   6323 O  OE1   . GLN B 2 258 ? 19.380 67.431  -33.817 1.00 40.89  ? 258 GLN B OE1   1 
ATOM   6324 N  NE2   . GLN B 2 258 ? 18.036 68.685  -35.107 1.00 49.98  ? 258 GLN B NE2   1 
ATOM   6325 N  N     . LYS B 2 259 ? 17.900 66.514  -28.547 1.00 46.85  ? 259 LYS B N     1 
ATOM   6326 C  CA    . LYS B 2 259 ? 18.077 65.482  -27.530 1.00 44.62  ? 259 LYS B CA    1 
ATOM   6327 C  C     . LYS B 2 259 ? 16.918 65.464  -26.543 1.00 52.00  ? 259 LYS B C     1 
ATOM   6328 O  O     . LYS B 2 259 ? 16.601 64.411  -25.978 1.00 72.60  ? 259 LYS B O     1 
ATOM   6329 C  CB    . LYS B 2 259 ? 19.400 65.690  -26.793 1.00 43.78  ? 259 LYS B CB    1 
ATOM   6330 C  CG    . LYS B 2 259 ? 20.631 65.399  -27.635 1.00 49.58  ? 259 LYS B CG    1 
ATOM   6331 C  CD    . LYS B 2 259 ? 21.894 65.943  -26.986 1.00 69.47  ? 259 LYS B CD    1 
ATOM   6332 C  CE    . LYS B 2 259 ? 22.154 65.306  -25.631 1.00 76.70  ? 259 LYS B CE    1 
ATOM   6333 N  NZ    . LYS B 2 259 ? 23.407 65.828  -25.014 1.00 72.33  ? 259 LYS B NZ    1 
ATOM   6334 N  N     . LEU B 2 260 ? 16.275 66.612  -26.325 1.00 40.10  ? 260 LEU B N     1 
ATOM   6335 C  CA    . LEU B 2 260 ? 15.142 66.673  -25.410 1.00 40.45  ? 260 LEU B CA    1 
ATOM   6336 C  C     . LEU B 2 260 ? 13.882 66.095  -26.042 1.00 56.37  ? 260 LEU B C     1 
ATOM   6337 O  O     . LEU B 2 260 ? 13.117 65.391  -25.374 1.00 60.91  ? 260 LEU B O     1 
ATOM   6338 C  CB    . LEU B 2 260 ? 14.903 68.118  -24.972 1.00 49.10  ? 260 LEU B CB    1 
ATOM   6339 C  CG    . LEU B 2 260 ? 13.804 68.367  -23.939 1.00 44.49  ? 260 LEU B CG    1 
ATOM   6340 C  CD1   . LEU B 2 260 ? 14.197 67.800  -22.584 1.00 41.64  ? 260 LEU B CD1   1 
ATOM   6341 C  CD2   . LEU B 2 260 ? 13.496 69.853  -23.839 1.00 42.57  ? 260 LEU B CD2   1 
ATOM   6342 N  N     . VAL B 2 261 ? 13.651 66.384  -27.326 1.00 56.22  ? 261 VAL B N     1 
ATOM   6343 C  CA    . VAL B 2 261 ? 12.468 65.866  -28.008 1.00 51.06  ? 261 VAL B CA    1 
ATOM   6344 C  C     . VAL B 2 261 ? 12.538 64.349  -28.123 1.00 53.92  ? 261 VAL B C     1 
ATOM   6345 O  O     . VAL B 2 261 ? 11.546 63.647  -27.892 1.00 61.47  ? 261 VAL B O     1 
ATOM   6346 C  CB    . VAL B 2 261 ? 12.316 66.532  -29.389 1.00 47.07  ? 261 VAL B CB    1 
ATOM   6347 C  CG1   . VAL B 2 261 ? 11.230 65.842  -30.199 1.00 41.62  ? 261 VAL B CG1   1 
ATOM   6348 C  CG2   . VAL B 2 261 ? 12.013 68.015  -29.232 1.00 42.26  ? 261 VAL B CG2   1 
ATOM   6349 N  N     . GLY B 2 262 ? 13.710 63.818  -28.477 1.00 53.68  ? 262 GLY B N     1 
ATOM   6350 C  CA    . GLY B 2 262 ? 13.855 62.375  -28.574 1.00 49.32  ? 262 GLY B CA    1 
ATOM   6351 C  C     . GLY B 2 262 ? 13.678 61.677  -27.239 1.00 48.21  ? 262 GLY B C     1 
ATOM   6352 O  O     . GLY B 2 262 ? 13.118 60.579  -27.172 1.00 55.78  ? 262 GLY B O     1 
ATOM   6353 N  N     . LYS B 2 263 ? 14.149 62.304  -26.159 1.00 41.50  ? 263 LYS B N     1 
ATOM   6354 C  CA    . LYS B 2 263 ? 13.980 61.723  -24.831 1.00 39.04  ? 263 LYS B CA    1 
ATOM   6355 C  C     . LYS B 2 263 ? 12.526 61.790  -24.381 1.00 49.53  ? 263 LYS B C     1 
ATOM   6356 O  O     . LYS B 2 263 ? 12.022 60.855  -23.749 1.00 51.91  ? 263 LYS B O     1 
ATOM   6357 C  CB    . LYS B 2 263 ? 14.891 62.434  -23.832 1.00 39.07  ? 263 LYS B CB    1 
ATOM   6358 C  CG    . LYS B 2 263 ? 14.800 61.905  -22.413 1.00 39.13  ? 263 LYS B CG    1 
ATOM   6359 C  CD    . LYS B 2 263 ? 15.783 62.621  -21.503 1.00 39.29  ? 263 LYS B CD    1 
ATOM   6360 C  CE    . LYS B 2 263 ? 15.691 62.112  -20.077 1.00 47.55  ? 263 LYS B CE    1 
ATOM   6361 N  NZ    . LYS B 2 263 ? 16.759 62.691  -19.217 1.00 64.19  ? 263 LYS B NZ    1 
ATOM   6362 N  N     . LEU B 2 264 ? 11.837 62.890  -24.693 1.00 49.55  ? 264 LEU B N     1 
ATOM   6363 C  CA    . LEU B 2 264 ? 10.418 62.989  -24.368 1.00 44.02  ? 264 LEU B CA    1 
ATOM   6364 C  C     . LEU B 2 264 ? 9.579  62.067  -25.239 1.00 44.46  ? 264 LEU B C     1 
ATOM   6365 O  O     . LEU B 2 264 ? 8.575  61.517  -24.771 1.00 42.21  ? 264 LEU B O     1 
ATOM   6366 C  CB    . LEU B 2 264 ? 9.945  64.434  -24.520 1.00 45.87  ? 264 LEU B CB    1 
ATOM   6367 C  CG    . LEU B 2 264 ? 10.448 65.424  -23.470 1.00 44.32  ? 264 LEU B CG    1 
ATOM   6368 C  CD1   . LEU B 2 264 ? 10.111 66.845  -23.882 1.00 47.84  ? 264 LEU B CD1   1 
ATOM   6369 C  CD2   . LEU B 2 264 ? 9.852  65.102  -22.109 1.00 48.80  ? 264 LEU B CD2   1 
ATOM   6370 N  N     . ASN B 2 265 ? 9.966  61.894  -26.505 1.00 46.12  ? 265 ASN B N     1 
ATOM   6371 C  CA    . ASN B 2 265 ? 9.241  60.983  -27.384 1.00 49.61  ? 265 ASN B CA    1 
ATOM   6372 C  C     . ASN B 2 265 ? 9.288  59.557  -26.853 1.00 49.77  ? 265 ASN B C     1 
ATOM   6373 O  O     . ASN B 2 265 ? 8.319  58.801  -26.988 1.00 50.44  ? 265 ASN B O     1 
ATOM   6374 C  CB    . ASN B 2 265 ? 9.816  61.055  -28.797 1.00 50.40  ? 265 ASN B CB    1 
ATOM   6375 C  CG    . ASN B 2 265 ? 9.139  60.096  -29.753 1.00 51.66  ? 265 ASN B CG    1 
ATOM   6376 O  OD1   . ASN B 2 265 ? 8.003  60.319  -30.172 1.00 62.17  ? 265 ASN B OD1   1 
ATOM   6377 N  ND2   . ASN B 2 265 ? 9.840  59.028  -30.116 1.00 43.32  ? 265 ASN B ND2   1 
ATOM   6378 N  N     . TRP B 2 266 ? 10.410 59.174  -26.242 1.00 53.17  ? 266 TRP B N     1 
ATOM   6379 C  CA    . TRP B 2 266 ? 10.500 57.861  -25.614 1.00 47.90  ? 266 TRP B CA    1 
ATOM   6380 C  C     . TRP B 2 266 ? 9.709  57.820  -24.312 1.00 47.07  ? 266 TRP B C     1 
ATOM   6381 O  O     . TRP B 2 266 ? 8.982  56.853  -24.051 1.00 49.54  ? 266 TRP B O     1 
ATOM   6382 C  CB    . TRP B 2 266 ? 11.964 57.500  -25.368 1.00 44.12  ? 266 TRP B CB    1 
ATOM   6383 C  CG    . TRP B 2 266 ? 12.156 56.415  -24.357 1.00 53.86  ? 266 TRP B CG    1 
ATOM   6384 C  CD1   . TRP B 2 266 ? 12.171 55.071  -24.589 1.00 61.95  ? 266 TRP B CD1   1 
ATOM   6385 C  CD2   . TRP B 2 266 ? 12.367 56.582  -22.949 1.00 55.05  ? 266 TRP B CD2   1 
ATOM   6386 N  NE1   . TRP B 2 266 ? 12.375 54.390  -23.413 1.00 64.12  ? 266 TRP B NE1   1 
ATOM   6387 C  CE2   . TRP B 2 266 ? 12.498 55.295  -22.391 1.00 58.44  ? 266 TRP B CE2   1 
ATOM   6388 C  CE3   . TRP B 2 266 ? 12.455 57.694  -22.107 1.00 52.47  ? 266 TRP B CE3   1 
ATOM   6389 C  CZ2   . TRP B 2 266 ? 12.713 55.089  -21.030 1.00 63.86  ? 266 TRP B CZ2   1 
ATOM   6390 C  CZ3   . TRP B 2 266 ? 12.665 57.489  -20.756 1.00 60.03  ? 266 TRP B CZ3   1 
ATOM   6391 C  CH2   . TRP B 2 266 ? 12.795 56.197  -20.231 1.00 65.33  ? 266 TRP B CH2   1 
ATOM   6392 N  N     . ALA B 2 267 ? 9.831  58.864  -23.488 1.00 45.39  ? 267 ALA B N     1 
ATOM   6393 C  CA    . ALA B 2 267 ? 9.149  58.877  -22.198 1.00 40.68  ? 267 ALA B CA    1 
ATOM   6394 C  C     . ALA B 2 267 ? 7.636  58.899  -22.356 1.00 46.87  ? 267 ALA B C     1 
ATOM   6395 O  O     . ALA B 2 267 ? 6.917  58.426  -21.468 1.00 50.28  ? 267 ALA B O     1 
ATOM   6396 C  CB    . ALA B 2 267 ? 9.613  60.075  -21.369 1.00 40.89  ? 267 ALA B CB    1 
ATOM   6397 N  N     . SER B 2 268 ? 7.131  59.437  -23.470 1.00 42.13  ? 268 SER B N     1 
ATOM   6398 C  CA    . SER B 2 268 ? 5.692  59.439  -23.701 1.00 50.28  ? 268 SER B CA    1 
ATOM   6399 C  C     . SER B 2 268 ? 5.133  58.030  -23.854 1.00 51.63  ? 268 SER B C     1 
ATOM   6400 O  O     . SER B 2 268 ? 3.926  57.833  -23.675 1.00 51.92  ? 268 SER B O     1 
ATOM   6401 C  CB    . SER B 2 268 ? 5.352  60.278  -24.935 1.00 43.64  ? 268 SER B CB    1 
ATOM   6402 O  OG    . SER B 2 268 ? 5.968  59.755  -26.098 1.00 49.28  ? 268 SER B OG    1 
ATOM   6403 N  N     . GLN B 2 269 ? 5.981  57.051  -24.180 1.00 51.67  ? 269 GLN B N     1 
ATOM   6404 C  CA    . GLN B 2 269 ? 5.531  55.664  -24.234 1.00 51.10  ? 269 GLN B CA    1 
ATOM   6405 C  C     . GLN B 2 269 ? 5.218  55.125  -22.846 1.00 51.07  ? 269 GLN B C     1 
ATOM   6406 O  O     . GLN B 2 269 ? 4.401  54.208  -22.707 1.00 57.57  ? 269 GLN B O     1 
ATOM   6407 C  CB    . GLN B 2 269 ? 6.588  54.796  -24.915 1.00 49.54  ? 269 GLN B CB    1 
ATOM   6408 C  CG    . GLN B 2 269 ? 6.853  55.172  -26.360 1.00 60.37  ? 269 GLN B CG    1 
ATOM   6409 C  CD    . GLN B 2 269 ? 7.999  54.387  -26.964 1.00 65.65  ? 269 GLN B CD    1 
ATOM   6410 O  OE1   . GLN B 2 269 ? 9.014  54.147  -26.312 1.00 73.58  ? 269 GLN B OE1   1 
ATOM   6411 N  NE2   . GLN B 2 269 ? 7.840  53.977  -28.217 1.00 72.81  ? 269 GLN B NE2   1 
ATOM   6412 N  N     . ILE B 2 270 ? 5.858  55.671  -21.816 1.00 49.05  ? 270 ILE B N     1 
ATOM   6413 C  CA    . ILE B 2 270 ? 5.549  55.304  -20.439 1.00 47.88  ? 270 ILE B CA    1 
ATOM   6414 C  C     . ILE B 2 270 ? 4.502  56.236  -19.844 1.00 53.36  ? 270 ILE B C     1 
ATOM   6415 O  O     . ILE B 2 270 ? 3.558  55.784  -19.191 1.00 62.88  ? 270 ILE B O     1 
ATOM   6416 C  CB    . ILE B 2 270 ? 6.842  55.296  -19.599 1.00 47.50  ? 270 ILE B CB    1 
ATOM   6417 C  CG1   . ILE B 2 270 ? 7.862  54.328  -20.201 1.00 50.88  ? 270 ILE B CG1   1 
ATOM   6418 C  CG2   . ILE B 2 270 ? 6.541  54.934  -18.153 1.00 51.41  ? 270 ILE B CG2   1 
ATOM   6419 C  CD1   . ILE B 2 270 ? 9.199  54.325  -19.491 1.00 56.17  ? 270 ILE B CD1   1 
ATOM   6420 N  N     . TYR B 2 271 ? 4.647  57.541  -20.069 1.00 48.46  ? 271 TYR B N     1 
ATOM   6421 C  CA    . TYR B 2 271 ? 3.710  58.538  -19.561 1.00 58.62  ? 271 TYR B CA    1 
ATOM   6422 C  C     . TYR B 2 271 ? 2.947  59.150  -20.729 1.00 71.27  ? 271 TYR B C     1 
ATOM   6423 O  O     . TYR B 2 271 ? 3.464  60.057  -21.401 1.00 61.73  ? 271 TYR B O     1 
ATOM   6424 C  CB    . TYR B 2 271 ? 4.452  59.622  -18.774 1.00 56.49  ? 271 TYR B CB    1 
ATOM   6425 C  CG    . TYR B 2 271 ? 5.249  59.087  -17.605 1.00 62.07  ? 271 TYR B CG    1 
ATOM   6426 C  CD1   . TYR B 2 271 ? 6.554  58.640  -17.774 1.00 56.92  ? 271 TYR B CD1   1 
ATOM   6427 C  CD2   . TYR B 2 271 ? 4.698  59.030  -16.332 1.00 62.21  ? 271 TYR B CD2   1 
ATOM   6428 C  CE1   . TYR B 2 271 ? 7.286  58.150  -16.709 1.00 53.03  ? 271 TYR B CE1   1 
ATOM   6429 C  CE2   . TYR B 2 271 ? 5.423  58.542  -15.261 1.00 59.73  ? 271 TYR B CE2   1 
ATOM   6430 C  CZ    . TYR B 2 271 ? 6.716  58.104  -15.455 1.00 58.45  ? 271 TYR B CZ    1 
ATOM   6431 O  OH    . TYR B 2 271 ? 7.441  57.616  -14.393 1.00 60.47  ? 271 TYR B OH    1 
ATOM   6432 N  N     . PRO B 2 272 ? 1.719  58.701  -21.008 1.00 74.18  ? 272 PRO B N     1 
ATOM   6433 C  CA    . PRO B 2 272 ? 1.002  59.191  -22.199 1.00 64.46  ? 272 PRO B CA    1 
ATOM   6434 C  C     . PRO B 2 272 ? 0.700  60.681  -22.176 1.00 59.66  ? 272 PRO B C     1 
ATOM   6435 O  O     . PRO B 2 272 ? 0.324  61.229  -23.220 1.00 66.61  ? 272 PRO B O     1 
ATOM   6436 C  CB    . PRO B 2 272 ? -0.293 58.365  -22.195 1.00 60.17  ? 272 PRO B CB    1 
ATOM   6437 C  CG    . PRO B 2 272 ? 0.017  57.165  -21.353 1.00 60.13  ? 272 PRO B CG    1 
ATOM   6438 C  CD    . PRO B 2 272 ? 0.969  57.648  -20.305 1.00 68.16  ? 272 PRO B CD    1 
ATOM   6439 N  N     . GLY B 2 273 ? 0.848  61.351  -21.034 1.00 58.17  ? 273 GLY B N     1 
ATOM   6440 C  CA    . GLY B 2 273 ? 0.617  62.782  -20.976 1.00 56.78  ? 273 GLY B CA    1 
ATOM   6441 C  C     . GLY B 2 273 ? 1.720  63.638  -21.556 1.00 60.44  ? 273 GLY B C     1 
ATOM   6442 O  O     . GLY B 2 273 ? 1.498  64.828  -21.795 1.00 70.57  ? 273 GLY B O     1 
ATOM   6443 N  N     . ILE B 2 274 ? 2.902  63.064  -21.785 1.00 62.47  ? 274 ILE B N     1 
ATOM   6444 C  CA    . ILE B 2 274 ? 4.023  63.830  -22.315 1.00 62.63  ? 274 ILE B CA    1 
ATOM   6445 C  C     . ILE B 2 274 ? 3.711  64.277  -23.736 1.00 67.68  ? 274 ILE B C     1 
ATOM   6446 O  O     . ILE B 2 274 ? 3.378  63.459  -24.604 1.00 81.73  ? 274 ILE B O     1 
ATOM   6447 C  CB    . ILE B 2 274 ? 5.315  63.001  -22.267 1.00 55.80  ? 274 ILE B CB    1 
ATOM   6448 C  CG1   . ILE B 2 274 ? 5.703  62.690  -20.821 1.00 61.15  ? 274 ILE B CG1   1 
ATOM   6449 C  CG2   . ILE B 2 274 ? 6.445  63.735  -22.974 1.00 49.33  ? 274 ILE B CG2   1 
ATOM   6450 C  CD1   . ILE B 2 274 ? 6.147  63.902  -20.033 1.00 63.56  ? 274 ILE B CD1   1 
ATOM   6451 N  N     . LYS B 2 275 ? 3.811  65.581  -23.978 1.00 64.17  ? 275 LYS B N     1 
ATOM   6452 C  CA    . LYS B 2 275 ? 3.658  66.153  -25.305 1.00 68.25  ? 275 LYS B CA    1 
ATOM   6453 C  C     . LYS B 2 275 ? 4.930  66.895  -25.693 1.00 67.80  ? 275 LYS B C     1 
ATOM   6454 O  O     . LYS B 2 275 ? 5.704  67.335  -24.838 1.00 69.90  ? 275 LYS B O     1 
ATOM   6455 C  CB    . LYS B 2 275 ? 2.451  67.097  -25.377 1.00 77.65  ? 275 LYS B CB    1 
ATOM   6456 C  CG    . LYS B 2 275 ? 2.284  67.994  -24.165 1.00 90.26  ? 275 LYS B CG    1 
ATOM   6457 C  CD    . LYS B 2 275 ? 1.703  69.340  -24.568 1.00 93.44  ? 275 LYS B CD    1 
ATOM   6458 C  CE    . LYS B 2 275 ? 1.145  70.088  -23.371 1.00 91.90  ? 275 LYS B CE    1 
ATOM   6459 N  NZ    . LYS B 2 275 ? -0.138 69.486  -22.916 1.00 91.79  ? 275 LYS B NZ    1 
ATOM   6460 N  N     . VAL B 2 276 ? 5.137  67.036  -27.000 1.00 64.08  ? 276 VAL B N     1 
ATOM   6461 C  CA    . VAL B 2 276 ? 6.383  67.588  -27.518 1.00 59.25  ? 276 VAL B CA    1 
ATOM   6462 C  C     . VAL B 2 276 ? 6.089  68.420  -28.763 1.00 70.97  ? 276 VAL B C     1 
ATOM   6463 O  O     . VAL B 2 276 ? 6.986  68.722  -29.559 1.00 68.32  ? 276 VAL B O     1 
ATOM   6464 C  CB    . VAL B 2 276 ? 7.394  66.456  -27.797 1.00 56.16  ? 276 VAL B CB    1 
ATOM   6465 C  CG1   . VAL B 2 276 ? 7.049  65.704  -29.087 1.00 43.48  ? 276 VAL B CG1   1 
ATOM   6466 C  CG2   . VAL B 2 276 ? 8.823  66.982  -27.794 1.00 62.77  ? 276 VAL B CG2   1 
ATOM   6467 N  N     . ARG B 2 277 ? 4.826  68.822  -28.922 1.00 78.80  ? 277 ARG B N     1 
ATOM   6468 C  CA    . ARG B 2 277 ? 4.425  69.574  -30.107 1.00 74.90  ? 277 ARG B CA    1 
ATOM   6469 C  C     . ARG B 2 277 ? 5.077  70.953  -30.142 1.00 63.62  ? 277 ARG B C     1 
ATOM   6470 O  O     . ARG B 2 277 ? 5.627  71.364  -31.171 1.00 57.05  ? 277 ARG B O     1 
ATOM   6471 C  CB    . ARG B 2 277 ? 2.901  69.695  -30.155 1.00 82.39  ? 277 ARG B CB    1 
ATOM   6472 C  CG    . ARG B 2 277 ? 2.377  70.578  -31.275 1.00 93.03  ? 277 ARG B CG    1 
ATOM   6473 C  CD    . ARG B 2 277 ? 1.242  69.898  -32.018 1.00 102.84 ? 277 ARG B CD    1 
ATOM   6474 N  NE    . ARG B 2 277 ? 0.172  69.477  -31.119 1.00 115.05 ? 277 ARG B NE    1 
ATOM   6475 C  CZ    . ARG B 2 277 ? -0.880 68.758  -31.497 1.00 122.64 ? 277 ARG B CZ    1 
ATOM   6476 N  NH1   . ARG B 2 277 ? -1.005 68.380  -32.762 1.00 125.82 ? 277 ARG B NH1   1 
ATOM   6477 N  NH2   . ARG B 2 277 ? -1.809 68.419  -30.614 1.00 122.01 ? 277 ARG B NH2   1 
ATOM   6478 N  N     . GLN B 2 278 ? 5.029  71.684  -29.024 1.00 62.66  ? 278 GLN B N     1 
ATOM   6479 C  CA    . GLN B 2 278 ? 5.560  73.044  -29.012 1.00 69.04  ? 278 GLN B CA    1 
ATOM   6480 C  C     . GLN B 2 278 ? 7.083  73.063  -29.051 1.00 76.51  ? 278 GLN B C     1 
ATOM   6481 O  O     . GLN B 2 278 ? 7.674  74.034  -29.537 1.00 78.44  ? 278 GLN B O     1 
ATOM   6482 C  CB    . GLN B 2 278 ? 5.052  73.799  -27.784 1.00 74.88  ? 278 GLN B CB    1 
ATOM   6483 C  CG    . GLN B 2 278 ? 3.558  74.077  -27.801 1.00 87.08  ? 278 GLN B CG    1 
ATOM   6484 C  CD    . GLN B 2 278 ? 3.138  74.953  -28.967 1.00 88.62  ? 278 GLN B CD    1 
ATOM   6485 O  OE1   . GLN B 2 278 ? 3.854  75.878  -29.354 1.00 89.76  ? 278 GLN B OE1   1 
ATOM   6486 N  NE2   . GLN B 2 278 ? 1.974  74.662  -29.536 1.00 86.67  ? 278 GLN B NE2   1 
ATOM   6487 N  N     . LEU B 2 279 ? 7.734  72.016  -28.544 1.00 74.40  ? 279 LEU B N     1 
ATOM   6488 C  CA    . LEU B 2 279 ? 9.191  71.967  -28.587 1.00 59.32  ? 279 LEU B CA    1 
ATOM   6489 C  C     . LEU B 2 279 ? 9.700  71.596  -29.974 1.00 52.05  ? 279 LEU B C     1 
ATOM   6490 O  O     . LEU B 2 279 ? 10.702 72.151  -30.438 1.00 57.45  ? 279 LEU B O     1 
ATOM   6491 C  CB    . LEU B 2 279 ? 9.716  70.979  -27.545 1.00 55.24  ? 279 LEU B CB    1 
ATOM   6492 C  CG    . LEU B 2 279 ? 9.816  71.493  -26.108 1.00 55.45  ? 279 LEU B CG    1 
ATOM   6493 C  CD1   . LEU B 2 279 ? 9.950  70.333  -25.139 1.00 54.98  ? 279 LEU B CD1   1 
ATOM   6494 C  CD2   . LEU B 2 279 ? 10.991 72.447  -25.965 1.00 44.41  ? 279 LEU B CD2   1 
ATOM   6495 N  N     . SER B 2 280 ? 9.020  70.669  -30.653 1.00 55.87  ? 280 SER B N     1 
ATOM   6496 C  CA    . SER B 2 280 ? 9.506  70.195  -31.944 1.00 64.05  ? 280 SER B CA    1 
ATOM   6497 C  C     . SER B 2 280 ? 9.367  71.251  -33.033 1.00 58.29  ? 280 SER B C     1 
ATOM   6498 O  O     . SER B 2 280 ? 10.144 71.249  -33.994 1.00 56.02  ? 280 SER B O     1 
ATOM   6499 C  CB    . SER B 2 280 ? 8.771  68.915  -32.346 1.00 71.45  ? 280 SER B CB    1 
ATOM   6500 O  OG    . SER B 2 280 ? 7.366  69.094  -32.307 1.00 88.66  ? 280 SER B OG    1 
ATOM   6501 N  N     . LYS B 2 281 ? 8.394  72.159  -32.908 1.00 60.57  ? 281 LYS B N     1 
ATOM   6502 C  CA    . LYS B 2 281 ? 8.213  73.182  -33.932 1.00 56.07  ? 281 LYS B CA    1 
ATOM   6503 C  C     . LYS B 2 281 ? 9.319  74.228  -33.907 1.00 54.39  ? 281 LYS B C     1 
ATOM   6504 O  O     . LYS B 2 281 ? 9.531  74.908  -34.916 1.00 47.05  ? 281 LYS B O     1 
ATOM   6505 C  CB    . LYS B 2 281 ? 6.850  73.861  -33.780 1.00 60.61  ? 281 LYS B CB    1 
ATOM   6506 C  CG    . LYS B 2 281 ? 6.706  74.727  -32.544 1.00 72.55  ? 281 LYS B CG    1 
ATOM   6507 C  CD    . LYS B 2 281 ? 5.413  75.528  -32.584 1.00 84.69  ? 281 LYS B CD    1 
ATOM   6508 C  CE    . LYS B 2 281 ? 4.203  74.619  -32.726 1.00 89.75  ? 281 LYS B CE    1 
ATOM   6509 N  NZ    . LYS B 2 281 ? 2.926  75.387  -32.722 1.00 92.52  ? 281 LYS B NZ    1 
ATOM   6510 N  N     . LEU B 2 282 ? 10.029 74.370  -32.785 1.00 54.58  ? 282 LEU B N     1 
ATOM   6511 C  CA    . LEU B 2 282 ? 11.172 75.274  -32.737 1.00 55.07  ? 282 LEU B CA    1 
ATOM   6512 C  C     . LEU B 2 282 ? 12.298 74.817  -33.653 1.00 59.63  ? 282 LEU B C     1 
ATOM   6513 O  O     . LEU B 2 282 ? 13.158 75.627  -34.015 1.00 69.06  ? 282 LEU B O     1 
ATOM   6514 C  CB    . LEU B 2 282 ? 11.691 75.399  -31.305 1.00 56.00  ? 282 LEU B CB    1 
ATOM   6515 C  CG    . LEU B 2 282 ? 10.793 76.110  -30.293 1.00 61.32  ? 282 LEU B CG    1 
ATOM   6516 C  CD1   . LEU B 2 282 ? 11.345 75.939  -28.890 1.00 68.12  ? 282 LEU B CD1   1 
ATOM   6517 C  CD2   . LEU B 2 282 ? 10.664 77.583  -30.642 1.00 60.05  ? 282 LEU B CD2   1 
ATOM   6518 N  N     . LEU B 2 283 ? 12.312 73.542  -34.031 1.00 53.38  ? 283 LEU B N     1 
ATOM   6519 C  CA    . LEU B 2 283 ? 13.322 72.990  -34.920 1.00 55.45  ? 283 LEU B CA    1 
ATOM   6520 C  C     . LEU B 2 283 ? 12.890 73.003  -36.380 1.00 64.14  ? 283 LEU B C     1 
ATOM   6521 O  O     . LEU B 2 283 ? 13.547 72.370  -37.213 1.00 76.21  ? 283 LEU B O     1 
ATOM   6522 C  CB    . LEU B 2 283 ? 13.664 71.560  -34.496 1.00 50.02  ? 283 LEU B CB    1 
ATOM   6523 C  CG    . LEU B 2 283 ? 13.996 71.363  -33.016 1.00 48.07  ? 283 LEU B CG    1 
ATOM   6524 C  CD1   . LEU B 2 283 ? 14.070 69.883  -32.681 1.00 61.01  ? 283 LEU B CD1   1 
ATOM   6525 C  CD2   . LEU B 2 283 ? 15.298 72.064  -32.665 1.00 43.30  ? 283 LEU B CD2   1 
ATOM   6526 N  N     . ARG B 2 284 ? 11.805 73.704  -36.706 1.00 55.74  ? 284 ARG B N     1 
ATOM   6527 C  CA    . ARG B 2 284 ? 11.273 73.710  -38.065 1.00 63.93  ? 284 ARG B CA    1 
ATOM   6528 C  C     . ARG B 2 284 ? 12.285 74.359  -39.001 1.00 65.55  ? 284 ARG B C     1 
ATOM   6529 O  O     . ARG B 2 284 ? 12.530 75.566  -38.924 1.00 78.25  ? 284 ARG B O     1 
ATOM   6530 C  CB    . ARG B 2 284 ? 9.936  74.444  -38.102 1.00 73.13  ? 284 ARG B CB    1 
ATOM   6531 C  CG    . ARG B 2 284 ? 9.004  73.982  -39.211 1.00 84.17  ? 284 ARG B CG    1 
ATOM   6532 C  CD    . ARG B 2 284 ? 7.751  74.843  -39.278 1.00 106.11 ? 284 ARG B CD    1 
ATOM   6533 N  NE    . ARG B 2 284 ? 6.968  74.790  -38.045 1.00 109.84 ? 284 ARG B NE    1 
ATOM   6534 C  CZ    . ARG B 2 284 ? 5.906  74.010  -37.866 1.00 99.68  ? 284 ARG B CZ    1 
ATOM   6535 N  NH1   . ARG B 2 284 ? 5.493  73.213  -38.843 1.00 102.27 ? 284 ARG B NH1   1 
ATOM   6536 N  NH2   . ARG B 2 284 ? 5.254  74.028  -36.712 1.00 87.55  ? 284 ARG B NH2   1 
ATOM   6537 N  N     . GLY B 2 285 ? 12.871 73.560  -39.881 1.00 65.36  ? 285 GLY B N     1 
ATOM   6538 C  CA    . GLY B 2 285 ? 13.921 74.002  -40.774 1.00 47.66  ? 285 GLY B CA    1 
ATOM   6539 C  C     . GLY B 2 285 ? 15.165 73.147  -40.636 1.00 56.59  ? 285 GLY B C     1 
ATOM   6540 O  O     . GLY B 2 285 ? 15.234 72.221  -39.829 1.00 57.83  ? 285 GLY B O     1 
ATOM   6541 N  N     . THR B 2 286 ? 16.162 73.480  -41.450 1.00 53.62  ? 286 THR B N     1 
ATOM   6542 C  CA    . THR B 2 286 ? 17.438 72.766  -41.475 1.00 53.04  ? 286 THR B CA    1 
ATOM   6543 C  C     . THR B 2 286 ? 18.487 73.668  -40.825 1.00 49.95  ? 286 THR B C     1 
ATOM   6544 O  O     . THR B 2 286 ? 19.187 74.423  -41.503 1.00 51.46  ? 286 THR B O     1 
ATOM   6545 C  CB    . THR B 2 286 ? 17.830 72.385  -42.903 1.00 47.51  ? 286 THR B CB    1 
ATOM   6546 O  OG1   . THR B 2 286 ? 16.698 71.823  -43.579 1.00 47.92  ? 286 THR B OG1   1 
ATOM   6547 C  CG2   . THR B 2 286 ? 18.953 71.362  -42.885 1.00 46.94  ? 286 THR B CG2   1 
ATOM   6548 N  N     . LYS B 2 287 ? 18.596 73.577  -39.504 1.00 47.80  ? 287 LYS B N     1 
ATOM   6549 C  CA    . LYS B 2 287 ? 19.467 74.443  -38.724 1.00 45.94  ? 287 LYS B CA    1 
ATOM   6550 C  C     . LYS B 2 287 ? 20.727 73.705  -38.285 1.00 57.57  ? 287 LYS B C     1 
ATOM   6551 O  O     . LYS B 2 287 ? 20.781 72.473  -38.253 1.00 44.70  ? 287 LYS B O     1 
ATOM   6552 C  CB    . LYS B 2 287 ? 18.729 74.980  -37.495 1.00 45.74  ? 287 LYS B CB    1 
ATOM   6553 C  CG    . LYS B 2 287 ? 17.447 75.722  -37.817 1.00 50.35  ? 287 LYS B CG    1 
ATOM   6554 C  CD    . LYS B 2 287 ? 16.772 76.233  -36.555 1.00 61.34  ? 287 LYS B CD    1 
ATOM   6555 C  CE    . LYS B 2 287 ? 15.533 77.043  -36.888 1.00 65.30  ? 287 LYS B CE    1 
ATOM   6556 N  NZ    . LYS B 2 287 ? 15.859 78.203  -37.762 1.00 59.96  ? 287 LYS B NZ    1 
ATOM   6557 N  N     . ALA B 2 288 ? 21.747 74.488  -37.942 1.00 63.17  ? 288 ALA B N     1 
ATOM   6558 C  CA    . ALA B 2 288 ? 22.970 73.932  -37.385 1.00 45.13  ? 288 ALA B CA    1 
ATOM   6559 C  C     . ALA B 2 288 ? 22.732 73.450  -35.959 1.00 44.33  ? 288 ALA B C     1 
ATOM   6560 O  O     . ALA B 2 288 ? 21.858 73.952  -35.248 1.00 64.66  ? 288 ALA B O     1 
ATOM   6561 C  CB    . ALA B 2 288 ? 24.087 74.974  -37.404 1.00 45.83  ? 288 ALA B CB    1 
ATOM   6562 N  N     . LEU B 2 289 ? 23.526 72.464  -35.540 1.00 43.72  ? 289 LEU B N     1 
ATOM   6563 C  CA    . LEU B 2 289 ? 23.340 71.894  -34.209 1.00 46.57  ? 289 LEU B CA    1 
ATOM   6564 C  C     . LEU B 2 289 ? 23.729 72.876  -33.112 1.00 43.30  ? 289 LEU B C     1 
ATOM   6565 O  O     . LEU B 2 289 ? 23.150 72.843  -32.020 1.00 45.75  ? 289 LEU B O     1 
ATOM   6566 C  CB    . LEU B 2 289 ? 24.141 70.600  -34.072 1.00 42.37  ? 289 LEU B CB    1 
ATOM   6567 C  CG    . LEU B 2 289 ? 23.687 69.436  -34.954 1.00 42.04  ? 289 LEU B CG    1 
ATOM   6568 C  CD1   . LEU B 2 289 ? 24.422 68.159  -34.578 1.00 44.52  ? 289 LEU B CD1   1 
ATOM   6569 C  CD2   . LEU B 2 289 ? 22.181 69.245  -34.863 1.00 41.86  ? 289 LEU B CD2   1 
ATOM   6570 N  N     . THR B 2 290 ? 24.693 73.752  -33.378 1.00 43.98  ? 290 THR B N     1 
ATOM   6571 C  CA    . THR B 2 290 ? 25.171 74.704  -32.386 1.00 51.51  ? 290 THR B CA    1 
ATOM   6572 C  C     . THR B 2 290 ? 24.406 76.021  -32.407 1.00 51.02  ? 290 THR B C     1 
ATOM   6573 O  O     . THR B 2 290 ? 24.763 76.940  -31.663 1.00 53.53  ? 290 THR B O     1 
ATOM   6574 C  CB    . THR B 2 290 ? 26.665 74.967  -32.592 1.00 44.92  ? 290 THR B CB    1 
ATOM   6575 O  OG1   . THR B 2 290 ? 26.886 75.469  -33.915 1.00 59.61  ? 290 THR B OG1   1 
ATOM   6576 C  CG2   . THR B 2 290 ? 27.453 73.680  -32.410 1.00 44.27  ? 290 THR B CG2   1 
ATOM   6577 N  N     . GLU B 2 291 ? 23.368 76.134  -33.232 1.00 45.22  ? 291 GLU B N     1 
ATOM   6578 C  CA    . GLU B 2 291 ? 22.562 77.347  -33.264 1.00 53.08  ? 291 GLU B CA    1 
ATOM   6579 C  C     . GLU B 2 291 ? 21.726 77.452  -31.995 1.00 53.80  ? 291 GLU B C     1 
ATOM   6580 O  O     . GLU B 2 291 ? 21.051 76.496  -31.601 1.00 54.12  ? 291 GLU B O     1 
ATOM   6581 C  CB    . GLU B 2 291 ? 21.659 77.351  -34.496 1.00 49.02  ? 291 GLU B CB    1 
ATOM   6582 C  CG    . GLU B 2 291 ? 20.908 78.654  -34.711 1.00 46.97  ? 291 GLU B CG    1 
ATOM   6583 C  CD    . GLU B 2 291 ? 20.025 78.620  -35.942 1.00 64.30  ? 291 GLU B CD    1 
ATOM   6584 O  OE1   . GLU B 2 291 ? 18.786 78.692  -35.791 1.00 61.48  ? 291 GLU B OE1   1 
ATOM   6585 O  OE2   . GLU B 2 291 ? 20.570 78.514  -37.060 1.00 71.50  ? 291 GLU B OE2   1 
ATOM   6586 N  N     . VAL B 2 292 ? 21.771 78.615  -31.354 1.00 62.45  ? 292 VAL B N     1 
ATOM   6587 C  CA    . VAL B 2 292 ? 21.038 78.829  -30.111 1.00 61.92  ? 292 VAL B CA    1 
ATOM   6588 C  C     . VAL B 2 292 ? 19.588 79.166  -30.434 1.00 58.97  ? 292 VAL B C     1 
ATOM   6589 O  O     . VAL B 2 292 ? 19.308 80.034  -31.269 1.00 60.54  ? 292 VAL B O     1 
ATOM   6590 C  CB    . VAL B 2 292 ? 21.701 79.934  -29.271 1.00 55.65  ? 292 VAL B CB    1 
ATOM   6591 C  CG1   . VAL B 2 292 ? 22.076 81.124  -30.143 1.00 71.64  ? 292 VAL B CG1   1 
ATOM   6592 C  CG2   . VAL B 2 292 ? 20.783 80.364  -28.136 1.00 47.63  ? 292 VAL B CG2   1 
ATOM   6593 N  N     . ILE B 2 293 ? 18.665 78.472  -29.778 1.00 57.89  ? 293 ILE B N     1 
ATOM   6594 C  CA    . ILE B 2 293 ? 17.233 78.638  -29.989 1.00 57.51  ? 293 ILE B CA    1 
ATOM   6595 C  C     . ILE B 2 293 ? 16.621 79.174  -28.700 1.00 61.30  ? 293 ILE B C     1 
ATOM   6596 O  O     . ILE B 2 293 ? 16.770 78.555  -27.643 1.00 57.58  ? 293 ILE B O     1 
ATOM   6597 C  CB    . ILE B 2 293 ? 16.556 77.321  -30.402 1.00 59.70  ? 293 ILE B CB    1 
ATOM   6598 C  CG1   . ILE B 2 293 ? 17.112 76.832  -31.739 1.00 57.13  ? 293 ILE B CG1   1 
ATOM   6599 C  CG2   . ILE B 2 293 ? 15.046 77.494  -30.472 1.00 69.05  ? 293 ILE B CG2   1 
ATOM   6600 C  CD1   . ILE B 2 293 ? 16.898 77.801  -32.880 1.00 64.98  ? 293 ILE B CD1   1 
ATOM   6601 N  N     . PRO B 2 294 ? 15.937 80.319  -28.728 1.00 61.79  ? 294 PRO B N     1 
ATOM   6602 C  CA    . PRO B 2 294 ? 15.253 80.805  -27.521 1.00 58.08  ? 294 PRO B CA    1 
ATOM   6603 C  C     . PRO B 2 294 ? 13.887 80.147  -27.375 1.00 60.02  ? 294 PRO B C     1 
ATOM   6604 O  O     . PRO B 2 294 ? 13.110 80.079  -28.331 1.00 55.41  ? 294 PRO B O     1 
ATOM   6605 C  CB    . PRO B 2 294 ? 15.127 82.311  -27.769 1.00 49.39  ? 294 PRO B CB    1 
ATOM   6606 C  CG    . PRO B 2 294 ? 15.045 82.424  -29.257 1.00 55.33  ? 294 PRO B CG    1 
ATOM   6607 C  CD    . PRO B 2 294 ? 15.877 81.297  -29.829 1.00 61.98  ? 294 PRO B CD    1 
ATOM   6608 N  N     . LEU B 2 295 ? 13.597 79.660  -26.171 1.00 54.72  ? 295 LEU B N     1 
ATOM   6609 C  CA    . LEU B 2 295 ? 12.347 78.955  -25.921 1.00 53.62  ? 295 LEU B CA    1 
ATOM   6610 C  C     . LEU B 2 295 ? 11.193 79.945  -25.817 1.00 61.63  ? 295 LEU B C     1 
ATOM   6611 O  O     . LEU B 2 295 ? 11.284 80.948  -25.102 1.00 63.62  ? 295 LEU B O     1 
ATOM   6612 C  CB    . LEU B 2 295 ? 12.448 78.122  -24.644 1.00 60.05  ? 295 LEU B CB    1 
ATOM   6613 C  CG    . LEU B 2 295 ? 13.503 77.011  -24.632 1.00 59.03  ? 295 LEU B CG    1 
ATOM   6614 C  CD1   . LEU B 2 295 ? 13.420 76.205  -23.344 1.00 57.02  ? 295 LEU B CD1   1 
ATOM   6615 C  CD2   . LEU B 2 295 ? 13.357 76.105  -25.844 1.00 58.70  ? 295 LEU B CD2   1 
ATOM   6616 N  N     . THR B 2 296 ? 10.108 79.660  -26.532 1.00 58.01  ? 296 THR B N     1 
ATOM   6617 C  CA    . THR B 2 296 ? 8.929  80.507  -26.484 1.00 54.59  ? 296 THR B CA    1 
ATOM   6618 C  C     . THR B 2 296 ? 8.158  80.269  -25.186 1.00 59.42  ? 296 THR B C     1 
ATOM   6619 O  O     . THR B 2 296 ? 8.468  79.369  -24.402 1.00 64.83  ? 296 THR B O     1 
ATOM   6620 C  CB    . THR B 2 296 ? 8.032  80.253  -27.696 1.00 54.59  ? 296 THR B CB    1 
ATOM   6621 O  OG1   . THR B 2 296 ? 7.511  78.920  -27.638 1.00 63.42  ? 296 THR B OG1   1 
ATOM   6622 C  CG2   . THR B 2 296 ? 8.820  80.424  -28.986 1.00 49.67  ? 296 THR B CG2   1 
ATOM   6623 N  N     . GLU B 2 297 ? 7.139  81.103  -24.960 1.00 64.03  ? 297 GLU B N     1 
ATOM   6624 C  CA    . GLU B 2 297 ? 6.327  80.963  -23.754 1.00 74.94  ? 297 GLU B CA    1 
ATOM   6625 C  C     . GLU B 2 297 ? 5.558  79.649  -23.757 1.00 81.07  ? 297 GLU B C     1 
ATOM   6626 O  O     . GLU B 2 297 ? 5.509  78.948  -22.739 1.00 79.33  ? 297 GLU B O     1 
ATOM   6627 C  CB    . GLU B 2 297 ? 5.364  82.143  -23.630 1.00 83.23  ? 297 GLU B CB    1 
ATOM   6628 C  CG    . GLU B 2 297 ? 6.041  83.499  -23.579 1.00 89.38  ? 297 GLU B CG    1 
ATOM   6629 C  CD    . GLU B 2 297 ? 5.042  84.638  -23.558 1.00 98.08  ? 297 GLU B CD    1 
ATOM   6630 O  OE1   . GLU B 2 297 ? 3.835  84.373  -23.739 1.00 95.67  ? 297 GLU B OE1   1 
ATOM   6631 O  OE2   . GLU B 2 297 ? 5.464  85.797  -23.361 1.00 104.54 ? 297 GLU B OE2   1 
ATOM   6632 N  N     . GLU B 2 298 ? 4.952  79.299  -24.893 1.00 86.90  ? 298 GLU B N     1 
ATOM   6633 C  CA    . GLU B 2 298 ? 4.214  78.045  -24.988 1.00 90.85  ? 298 GLU B CA    1 
ATOM   6634 C  C     . GLU B 2 298 ? 5.143  76.838  -24.959 1.00 81.59  ? 298 GLU B C     1 
ATOM   6635 O  O     . GLU B 2 298 ? 4.766  75.781  -24.439 1.00 88.40  ? 298 GLU B O     1 
ATOM   6636 C  CB    . GLU B 2 298 ? 3.364  78.046  -26.259 1.00 99.53  ? 298 GLU B CB    1 
ATOM   6637 C  CG    . GLU B 2 298 ? 4.065  78.664  -27.458 1.00 108.76 ? 298 GLU B CG    1 
ATOM   6638 C  CD    . GLU B 2 298 ? 3.100  79.114  -28.537 1.00 116.27 ? 298 GLU B CD    1 
ATOM   6639 O  OE1   . GLU B 2 298 ? 1.912  78.732  -28.473 1.00 121.68 ? 298 GLU B OE1   1 
ATOM   6640 O  OE2   . GLU B 2 298 ? 3.529  79.855  -29.446 1.00 117.84 ? 298 GLU B OE2   1 
ATOM   6641 N  N     . ALA B 2 299 ? 6.356  76.972  -25.501 1.00 64.49  ? 299 ALA B N     1 
ATOM   6642 C  CA    . ALA B 2 299 ? 7.300  75.860  -25.476 1.00 62.63  ? 299 ALA B CA    1 
ATOM   6643 C  C     . ALA B 2 299 ? 7.855  75.636  -24.075 1.00 58.16  ? 299 ALA B C     1 
ATOM   6644 O  O     . ALA B 2 299 ? 8.035  74.489  -23.650 1.00 55.34  ? 299 ALA B O     1 
ATOM   6645 C  CB    . ALA B 2 299 ? 8.434  76.105  -26.469 1.00 64.00  ? 299 ALA B CB    1 
ATOM   6646 N  N     . GLU B 2 300 ? 8.138  76.715  -23.342 1.00 64.47  ? 300 GLU B N     1 
ATOM   6647 C  CA    . GLU B 2 300 ? 8.640  76.556  -21.983 1.00 72.62  ? 300 GLU B CA    1 
ATOM   6648 C  C     . GLU B 2 300 ? 7.536  76.129  -21.024 1.00 70.62  ? 300 GLU B C     1 
ATOM   6649 O  O     . GLU B 2 300 ? 7.818  75.477  -20.011 1.00 65.70  ? 300 GLU B O     1 
ATOM   6650 C  CB    . GLU B 2 300 ? 9.301  77.851  -21.506 1.00 79.55  ? 300 GLU B CB    1 
ATOM   6651 C  CG    . GLU B 2 300 ? 10.407 77.628  -20.483 1.00 85.09  ? 300 GLU B CG    1 
ATOM   6652 C  CD    . GLU B 2 300 ? 11.555 78.608  -20.635 1.00 96.24  ? 300 GLU B CD    1 
ATOM   6653 O  OE1   . GLU B 2 300 ? 11.462 79.511  -21.494 1.00 105.57 ? 300 GLU B OE1   1 
ATOM   6654 O  OE2   . GLU B 2 300 ? 12.555 78.472  -19.898 1.00 96.04  ? 300 GLU B OE2   1 
ATOM   6655 N  N     . LEU B 2 301 ? 6.283  76.483  -21.323 1.00 65.81  ? 301 LEU B N     1 
ATOM   6656 C  CA    . LEU B 2 301 ? 5.160  75.937  -20.568 1.00 64.84  ? 301 LEU B CA    1 
ATOM   6657 C  C     . LEU B 2 301 ? 5.020  74.440  -20.810 1.00 64.32  ? 301 LEU B C     1 
ATOM   6658 O  O     . LEU B 2 301 ? 4.717  73.679  -19.883 1.00 59.32  ? 301 LEU B O     1 
ATOM   6659 C  CB    . LEU B 2 301 ? 3.870  76.665  -20.947 1.00 77.40  ? 301 LEU B CB    1 
ATOM   6660 C  CG    . LEU B 2 301 ? 2.568  76.135  -20.342 1.00 76.59  ? 301 LEU B CG    1 
ATOM   6661 C  CD1   . LEU B 2 301 ? 2.541  76.363  -18.838 1.00 77.50  ? 301 LEU B CD1   1 
ATOM   6662 C  CD2   . LEU B 2 301 ? 1.363  76.778  -21.011 1.00 68.48  ? 301 LEU B CD2   1 
ATOM   6663 N  N     . GLU B 2 302 ? 5.237  74.001  -22.052 1.00 64.34  ? 302 GLU B N     1 
ATOM   6664 C  CA    . GLU B 2 302 ? 5.183  72.576  -22.359 1.00 62.96  ? 302 GLU B CA    1 
ATOM   6665 C  C     . GLU B 2 302 ? 6.268  71.812  -21.612 1.00 64.21  ? 302 GLU B C     1 
ATOM   6666 O  O     . GLU B 2 302 ? 6.041  70.688  -21.148 1.00 68.14  ? 302 GLU B O     1 
ATOM   6667 C  CB    . GLU B 2 302 ? 5.320  72.364  -23.866 1.00 64.89  ? 302 GLU B CB    1 
ATOM   6668 C  CG    . GLU B 2 302 ? 5.166  70.923  -24.315 1.00 65.46  ? 302 GLU B CG    1 
ATOM   6669 C  CD    . GLU B 2 302 ? 5.419  70.751  -25.799 1.00 76.89  ? 302 GLU B CD    1 
ATOM   6670 O  OE1   . GLU B 2 302 ? 6.482  71.200  -26.277 1.00 82.86  ? 302 GLU B OE1   1 
ATOM   6671 O  OE2   . GLU B 2 302 ? 4.550  70.178  -26.488 1.00 82.39  ? 302 GLU B OE2   1 
ATOM   6672 N  N     . LEU B 2 303 ? 7.454  72.410  -21.479 1.00 55.24  ? 303 LEU B N     1 
ATOM   6673 C  CA    . LEU B 2 303 ? 8.548  71.735  -20.788 1.00 66.28  ? 303 LEU B CA    1 
ATOM   6674 C  C     . LEU B 2 303 ? 8.298  71.667  -19.286 1.00 70.10  ? 303 LEU B C     1 
ATOM   6675 O  O     . LEU B 2 303 ? 8.556  70.635  -18.656 1.00 70.93  ? 303 LEU B O     1 
ATOM   6676 C  CB    . LEU B 2 303 ? 9.869  72.444  -21.081 1.00 66.28  ? 303 LEU B CB    1 
ATOM   6677 C  CG    . LEU B 2 303 ? 11.108 71.833  -20.425 1.00 60.78  ? 303 LEU B CG    1 
ATOM   6678 C  CD1   . LEU B 2 303 ? 11.274 70.380  -20.840 1.00 50.79  ? 303 LEU B CD1   1 
ATOM   6679 C  CD2   . LEU B 2 303 ? 12.349 72.638  -20.771 1.00 66.31  ? 303 LEU B CD2   1 
ATOM   6680 N  N     . ALA B 2 304 ? 7.802  72.756  -18.693 1.00 67.72  ? 304 ALA B N     1 
ATOM   6681 C  CA    . ALA B 2 304 ? 7.517  72.749  -17.263 1.00 68.86  ? 304 ALA B CA    1 
ATOM   6682 C  C     . ALA B 2 304 ? 6.378  71.797  -16.923 1.00 70.54  ? 304 ALA B C     1 
ATOM   6683 O  O     . ALA B 2 304 ? 6.369  71.205  -15.837 1.00 73.05  ? 304 ALA B O     1 
ATOM   6684 C  CB    . ALA B 2 304 ? 7.192  74.163  -16.782 1.00 68.35  ? 304 ALA B CB    1 
ATOM   6685 N  N     . GLU B 2 305 ? 5.416  71.633  -17.832 1.00 64.65  ? 305 GLU B N     1 
ATOM   6686 C  CA    . GLU B 2 305 ? 4.335  70.686  -17.593 1.00 65.73  ? 305 GLU B CA    1 
ATOM   6687 C  C     . GLU B 2 305 ? 4.802  69.245  -17.761 1.00 68.93  ? 305 GLU B C     1 
ATOM   6688 O  O     . GLU B 2 305 ? 4.300  68.350  -17.071 1.00 76.48  ? 305 GLU B O     1 
ATOM   6689 C  CB    . GLU B 2 305 ? 3.162  70.986  -18.526 1.00 70.87  ? 305 GLU B CB    1 
ATOM   6690 C  CG    . GLU B 2 305 ? 2.403  72.253  -18.164 1.00 87.16  ? 305 GLU B CG    1 
ATOM   6691 C  CD    . GLU B 2 305 ? 1.358  72.629  -19.196 1.00 87.07  ? 305 GLU B CD    1 
ATOM   6692 O  OE1   . GLU B 2 305 ? 1.358  72.028  -20.292 1.00 83.48  ? 305 GLU B OE1   1 
ATOM   6693 O  OE2   . GLU B 2 305 ? 0.539  73.528  -18.911 1.00 87.16  ? 305 GLU B OE2   1 
ATOM   6694 N  N     . ASN B 2 306 ? 5.761  69.002  -18.659 1.00 63.99  ? 306 ASN B N     1 
ATOM   6695 C  CA    . ASN B 2 306 ? 6.289  67.653  -18.829 1.00 54.06  ? 306 ASN B CA    1 
ATOM   6696 C  C     . ASN B 2 306 ? 7.050  67.184  -17.596 1.00 65.46  ? 306 ASN B C     1 
ATOM   6697 O  O     . ASN B 2 306 ? 7.036  65.988  -17.281 1.00 81.61  ? 306 ASN B O     1 
ATOM   6698 C  CB    . ASN B 2 306 ? 7.194  67.589  -20.059 1.00 52.58  ? 306 ASN B CB    1 
ATOM   6699 C  CG    . ASN B 2 306 ? 6.417  67.646  -21.358 1.00 52.79  ? 306 ASN B CG    1 
ATOM   6700 O  OD1   . ASN B 2 306 ? 5.312  67.112  -21.459 1.00 50.88  ? 306 ASN B OD1   1 
ATOM   6701 N  ND2   . ASN B 2 306 ? 6.994  68.295  -22.363 1.00 44.89  ? 306 ASN B ND2   1 
ATOM   6702 N  N     . ARG B 2 307 ? 7.719  68.099  -16.890 1.00 64.04  ? 307 ARG B N     1 
ATOM   6703 C  CA    . ARG B 2 307 ? 8.446  67.709  -15.686 1.00 69.01  ? 307 ARG B CA    1 
ATOM   6704 C  C     . ARG B 2 307 ? 7.497  67.227  -14.597 1.00 73.39  ? 307 ARG B C     1 
ATOM   6705 O  O     . ARG B 2 307 ? 7.778  66.234  -13.916 1.00 82.54  ? 307 ARG B O     1 
ATOM   6706 C  CB    . ARG B 2 307 ? 9.294  68.874  -15.176 1.00 75.56  ? 307 ARG B CB    1 
ATOM   6707 C  CG    . ARG B 2 307 ? 10.533 69.155  -16.003 1.00 84.98  ? 307 ARG B CG    1 
ATOM   6708 C  CD    . ARG B 2 307 ? 11.503 70.047  -15.244 1.00 88.05  ? 307 ARG B CD    1 
ATOM   6709 N  NE    . ARG B 2 307 ? 12.703 70.337  -16.023 1.00 86.84  ? 307 ARG B NE    1 
ATOM   6710 C  CZ    . ARG B 2 307 ? 12.840 71.395  -16.815 1.00 81.05  ? 307 ARG B CZ    1 
ATOM   6711 N  NH1   . ARG B 2 307 ? 11.850 72.270  -16.932 1.00 73.62  ? 307 ARG B NH1   1 
ATOM   6712 N  NH2   . ARG B 2 307 ? 13.967 71.580  -17.488 1.00 81.08  ? 307 ARG B NH2   1 
ATOM   6713 N  N     . GLU B 2 308 ? 6.366  67.915  -14.417 1.00 74.89  ? 308 GLU B N     1 
ATOM   6714 C  CA    . GLU B 2 308 ? 5.411  67.503  -13.395 1.00 79.41  ? 308 GLU B CA    1 
ATOM   6715 C  C     . GLU B 2 308 ? 4.777  66.158  -13.726 1.00 76.52  ? 308 GLU B C     1 
ATOM   6716 O  O     . GLU B 2 308 ? 4.350  65.436  -12.818 1.00 86.35  ? 308 GLU B O     1 
ATOM   6717 C  CB    . GLU B 2 308 ? 4.332  68.572  -13.221 1.00 84.00  ? 308 GLU B CB    1 
ATOM   6718 C  CG    . GLU B 2 308 ? 4.865  69.937  -12.808 1.00 83.89  ? 308 GLU B CG    1 
ATOM   6719 C  CD    . GLU B 2 308 ? 5.784  69.868  -11.602 1.00 81.16  ? 308 GLU B CD    1 
ATOM   6720 O  OE1   . GLU B 2 308 ? 7.019  69.831  -11.793 1.00 74.00  ? 308 GLU B OE1   1 
ATOM   6721 O  OE2   . GLU B 2 308 ? 5.272  69.843  -10.463 1.00 85.92  ? 308 GLU B OE2   1 
ATOM   6722 N  N     . ILE B 2 309 ? 4.706  65.806  -15.012 1.00 60.95  ? 309 ILE B N     1 
ATOM   6723 C  CA    . ILE B 2 309 ? 4.154  64.513  -15.400 1.00 58.69  ? 309 ILE B CA    1 
ATOM   6724 C  C     . ILE B 2 309 ? 5.091  63.386  -14.987 1.00 68.95  ? 309 ILE B C     1 
ATOM   6725 O  O     . ILE B 2 309 ? 4.649  62.318  -14.545 1.00 67.41  ? 309 ILE B O     1 
ATOM   6726 C  CB    . ILE B 2 309 ? 3.867  64.494  -16.913 1.00 53.39  ? 309 ILE B CB    1 
ATOM   6727 C  CG1   . ILE B 2 309 ? 2.717  65.446  -17.243 1.00 52.97  ? 309 ILE B CG1   1 
ATOM   6728 C  CG2   . ILE B 2 309 ? 3.556  63.083  -17.396 1.00 55.56  ? 309 ILE B CG2   1 
ATOM   6729 C  CD1   . ILE B 2 309 ? 2.271  65.385  -18.682 1.00 55.06  ? 309 ILE B CD1   1 
ATOM   6730 N  N     . LEU B 2 310 ? 6.402  63.610  -15.111 1.00 72.88  ? 310 LEU B N     1 
ATOM   6731 C  CA    . LEU B 2 310 ? 7.368  62.569  -14.774 1.00 59.80  ? 310 LEU B CA    1 
ATOM   6732 C  C     . LEU B 2 310 ? 7.370  62.263  -13.284 1.00 68.61  ? 310 LEU B C     1 
ATOM   6733 O  O     . LEU B 2 310 ? 7.760  61.163  -12.877 1.00 71.10  ? 310 LEU B O     1 
ATOM   6734 C  CB    . LEU B 2 310 ? 8.762  62.984  -15.239 1.00 59.02  ? 310 LEU B CB    1 
ATOM   6735 C  CG    . LEU B 2 310 ? 8.888  63.241  -16.740 1.00 59.02  ? 310 LEU B CG    1 
ATOM   6736 C  CD1   . LEU B 2 310 ? 10.270 63.771  -17.095 1.00 60.20  ? 310 LEU B CD1   1 
ATOM   6737 C  CD2   . LEU B 2 310 ? 8.585  61.970  -17.516 1.00 53.68  ? 310 LEU B CD2   1 
ATOM   6738 N  N     . LYS B 2 311 ? 6.937  63.217  -12.457 1.00 84.99  ? 311 LYS B N     1 
ATOM   6739 C  CA    . LYS B 2 311 ? 6.843  62.958  -11.025 1.00 96.36  ? 311 LYS B CA    1 
ATOM   6740 C  C     . LYS B 2 311 ? 5.715  61.986  -10.705 1.00 98.72  ? 311 LYS B C     1 
ATOM   6741 O  O     . LYS B 2 311 ? 5.814  61.220  -9.739  1.00 100.22 ? 311 LYS B O     1 
ATOM   6742 C  CB    . LYS B 2 311 ? 6.639  64.269  -10.264 1.00 100.69 ? 311 LYS B CB    1 
ATOM   6743 C  CG    . LYS B 2 311 ? 7.816  65.228  -10.328 1.00 101.82 ? 311 LYS B CG    1 
ATOM   6744 C  CD    . LYS B 2 311 ? 7.528  66.487  -9.521  1.00 105.56 ? 311 LYS B CD    1 
ATOM   6745 C  CE    . LYS B 2 311 ? 8.689  67.467  -9.587  1.00 106.15 ? 311 LYS B CE    1 
ATOM   6746 N  NZ    . LYS B 2 311 ? 8.403  68.734  -8.856  1.00 106.99 ? 311 LYS B NZ    1 
ATOM   6747 N  N     . GLU B 2 312 ? 4.648  61.999  -11.501 1.00 93.78  ? 312 GLU B N     1 
ATOM   6748 C  CA    . GLU B 2 312 ? 3.506  61.139  -11.241 1.00 91.54  ? 312 GLU B CA    1 
ATOM   6749 C  C     . GLU B 2 312 ? 3.897  59.671  -11.407 1.00 88.14  ? 312 GLU B C     1 
ATOM   6750 O  O     . GLU B 2 312 ? 4.725  59.331  -12.258 1.00 93.01  ? 312 GLU B O     1 
ATOM   6751 C  CB    . GLU B 2 312 ? 2.355  61.479  -12.185 1.00 93.55  ? 312 GLU B CB    1 
ATOM   6752 C  CG    . GLU B 2 312 ? 1.922  62.933  -12.150 1.00 100.21 ? 312 GLU B CG    1 
ATOM   6753 C  CD    . GLU B 2 312 ? 0.838  63.237  -13.167 1.00 106.71 ? 312 GLU B CD    1 
ATOM   6754 O  OE1   . GLU B 2 312 ? 0.393  62.298  -13.860 1.00 106.19 ? 312 GLU B OE1   1 
ATOM   6755 O  OE2   . GLU B 2 312 ? 0.433  64.414  -13.274 1.00 110.20 ? 312 GLU B OE2   1 
ATOM   6756 N  N     . PRO B 2 313 ? 3.319  58.780  -10.606 1.00 81.17  ? 313 PRO B N     1 
ATOM   6757 C  CA    . PRO B 2 313 ? 3.612  57.353  -10.767 1.00 79.59  ? 313 PRO B CA    1 
ATOM   6758 C  C     . PRO B 2 313 ? 2.976  56.798  -12.031 1.00 75.12  ? 313 PRO B C     1 
ATOM   6759 O  O     . PRO B 2 313 ? 1.953  57.293  -12.512 1.00 75.80  ? 313 PRO B O     1 
ATOM   6760 C  CB    . PRO B 2 313 ? 2.998  56.723  -9.512  1.00 81.86  ? 313 PRO B CB    1 
ATOM   6761 C  CG    . PRO B 2 313 ? 1.898  57.660  -9.132  1.00 82.62  ? 313 PRO B CG    1 
ATOM   6762 C  CD    . PRO B 2 313 ? 2.391  59.036  -9.491  1.00 79.73  ? 313 PRO B CD    1 
ATOM   6763 N  N     . VAL B 2 314 ? 3.604  55.753  -12.574 1.00 66.05  ? 314 VAL B N     1 
ATOM   6764 C  CA    . VAL B 2 314 ? 3.095  55.120  -13.784 1.00 63.76  ? 314 VAL B CA    1 
ATOM   6765 C  C     . VAL B 2 314 ? 1.744  54.480  -13.493 1.00 65.73  ? 314 VAL B C     1 
ATOM   6766 O  O     . VAL B 2 314 ? 1.554  53.821  -12.462 1.00 80.63  ? 314 VAL B O     1 
ATOM   6767 C  CB    . VAL B 2 314 ? 4.099  54.084  -14.316 1.00 67.10  ? 314 VAL B CB    1 
ATOM   6768 C  CG1   . VAL B 2 314 ? 3.719  53.653  -15.725 1.00 60.23  ? 314 VAL B CG1   1 
ATOM   6769 C  CG2   . VAL B 2 314 ? 5.512  54.647  -14.286 1.00 73.68  ? 314 VAL B CG2   1 
ATOM   6770 N  N     . HIS B 2 315 ? 0.795  54.674  -14.403 1.00 60.93  ? 315 HIS B N     1 
ATOM   6771 C  CA    . HIS B 2 315 ? -0.573 54.212  -14.218 1.00 64.35  ? 315 HIS B CA    1 
ATOM   6772 C  C     . HIS B 2 315 ? -0.781 52.860  -14.888 1.00 68.13  ? 315 HIS B C     1 
ATOM   6773 O  O     . HIS B 2 315 ? -0.213 52.585  -15.950 1.00 64.65  ? 315 HIS B O     1 
ATOM   6774 C  CB    . HIS B 2 315 ? -1.567 55.229  -14.782 1.00 67.94  ? 315 HIS B CB    1 
ATOM   6775 C  CG    . HIS B 2 315 ? -2.998 54.810  -14.648 1.00 82.31  ? 315 HIS B CG    1 
ATOM   6776 N  ND1   . HIS B 2 315 ? -3.738 54.336  -15.711 1.00 84.26  ? 315 HIS B ND1   1 
ATOM   6777 C  CD2   . HIS B 2 315 ? -3.824 54.788  -13.576 1.00 90.33  ? 315 HIS B CD2   1 
ATOM   6778 C  CE1   . HIS B 2 315 ? -4.958 54.044  -15.299 1.00 91.06  ? 315 HIS B CE1   1 
ATOM   6779 N  NE2   . HIS B 2 315 ? -5.037 54.309  -14.008 1.00 96.23  ? 315 HIS B NE2   1 
ATOM   6780 N  N     . GLY B 2 316 ? -1.597 52.020  -14.258 1.00 59.21  ? 316 GLY B N     1 
ATOM   6781 C  CA    . GLY B 2 316 ? -1.966 50.739  -14.836 1.00 61.64  ? 316 GLY B CA    1 
ATOM   6782 C  C     . GLY B 2 316 ? -0.875 49.690  -14.818 1.00 61.89  ? 316 GLY B C     1 
ATOM   6783 O  O     . GLY B 2 316 ? -0.762 48.906  -15.768 1.00 62.67  ? 316 GLY B O     1 
ATOM   6784 N  N     . VAL B 2 317 ? -0.072 49.651  -13.759 1.00 66.77  ? 317 VAL B N     1 
ATOM   6785 C  CA    . VAL B 2 317 ? 1.018  48.691  -13.622 1.00 63.63  ? 317 VAL B CA    1 
ATOM   6786 C  C     . VAL B 2 317 ? 0.683  47.782  -12.448 1.00 60.85  ? 317 VAL B C     1 
ATOM   6787 O  O     . VAL B 2 317 ? 0.774  48.195  -11.285 1.00 62.16  ? 317 VAL B O     1 
ATOM   6788 C  CB    . VAL B 2 317 ? 2.370  49.385  -13.419 1.00 54.13  ? 317 VAL B CB    1 
ATOM   6789 C  CG1   . VAL B 2 317 ? 3.495  48.366  -13.441 1.00 48.42  ? 317 VAL B CG1   1 
ATOM   6790 C  CG2   . VAL B 2 317 ? 2.581  50.447  -14.486 1.00 55.31  ? 317 VAL B CG2   1 
ATOM   6791 N  N     . TYR B 2 318 ? 0.301  46.544  -12.745 1.00 57.49  ? 318 TYR B N     1 
ATOM   6792 C  CA    . TYR B 2 318 ? -0.134 45.592  -11.734 1.00 54.76  ? 318 TYR B CA    1 
ATOM   6793 C  C     . TYR B 2 318 ? 0.753  44.357  -11.783 1.00 49.20  ? 318 TYR B C     1 
ATOM   6794 O  O     . TYR B 2 318 ? 0.937  43.760  -12.848 1.00 63.43  ? 318 TYR B O     1 
ATOM   6795 C  CB    . TYR B 2 318 ? -1.606 45.224  -11.937 1.00 52.12  ? 318 TYR B CB    1 
ATOM   6796 C  CG    . TYR B 2 318 ? -2.521 46.417  -11.792 1.00 56.79  ? 318 TYR B CG    1 
ATOM   6797 C  CD1   . TYR B 2 318 ? -3.023 46.781  -10.550 1.00 59.03  ? 318 TYR B CD1   1 
ATOM   6798 C  CD2   . TYR B 2 318 ? -2.863 47.194  -12.891 1.00 68.28  ? 318 TYR B CD2   1 
ATOM   6799 C  CE1   . TYR B 2 318 ? -3.851 47.876  -10.408 1.00 61.03  ? 318 TYR B CE1   1 
ATOM   6800 C  CE2   . TYR B 2 318 ? -3.690 48.293  -12.759 1.00 68.73  ? 318 TYR B CE2   1 
ATOM   6801 C  CZ    . TYR B 2 318 ? -4.180 48.630  -11.514 1.00 71.69  ? 318 TYR B CZ    1 
ATOM   6802 O  OH    . TYR B 2 318 ? -5.001 49.723  -11.374 1.00 80.41  ? 318 TYR B OH    1 
ATOM   6803 N  N     . TYR B 2 319 ? 1.301  43.986  -10.628 1.00 49.33  ? 319 TYR B N     1 
ATOM   6804 C  CA    . TYR B 2 319 ? 2.249  42.882  -10.548 1.00 50.88  ? 319 TYR B CA    1 
ATOM   6805 C  C     . TYR B 2 319 ? 1.561  41.564  -10.885 1.00 49.16  ? 319 TYR B C     1 
ATOM   6806 O  O     . TYR B 2 319 ? 0.610  41.158  -10.210 1.00 50.48  ? 319 TYR B O     1 
ATOM   6807 C  CB    . TYR B 2 319 ? 2.872  42.827  -9.155  1.00 51.57  ? 319 TYR B CB    1 
ATOM   6808 C  CG    . TYR B 2 319 ? 3.688  41.583  -8.889  1.00 55.39  ? 319 TYR B CG    1 
ATOM   6809 C  CD1   . TYR B 2 319 ? 4.897  41.369  -9.539  1.00 60.60  ? 319 TYR B CD1   1 
ATOM   6810 C  CD2   . TYR B 2 319 ? 3.254  40.626  -7.981  1.00 56.81  ? 319 TYR B CD2   1 
ATOM   6811 C  CE1   . TYR B 2 319 ? 5.647  40.232  -9.297  1.00 60.46  ? 319 TYR B CE1   1 
ATOM   6812 C  CE2   . TYR B 2 319 ? 3.997  39.487  -7.731  1.00 53.93  ? 319 TYR B CE2   1 
ATOM   6813 C  CZ    . TYR B 2 319 ? 5.192  39.296  -8.392  1.00 57.95  ? 319 TYR B CZ    1 
ATOM   6814 O  OH    . TYR B 2 319 ? 5.934  38.164  -8.146  1.00 58.67  ? 319 TYR B OH    1 
ATOM   6815 N  N     . ASP B 2 320 ? 2.045  40.902  -11.936 1.00 51.99  ? 320 ASP B N     1 
ATOM   6816 C  CA    . ASP B 2 320 ? 1.534  39.604  -12.347 1.00 60.83  ? 320 ASP B CA    1 
ATOM   6817 C  C     . ASP B 2 320 ? 2.434  38.525  -11.767 1.00 57.77  ? 320 ASP B C     1 
ATOM   6818 O  O     . ASP B 2 320 ? 3.580  38.380  -12.221 1.00 51.86  ? 320 ASP B O     1 
ATOM   6819 C  CB    . ASP B 2 320 ? 1.491  39.505  -13.873 1.00 62.07  ? 320 ASP B CB    1 
ATOM   6820 C  CG    . ASP B 2 320 ? 0.745  38.274  -14.369 1.00 70.88  ? 320 ASP B CG    1 
ATOM   6821 O  OD1   . ASP B 2 320 ? 0.788  37.219  -13.703 1.00 65.37  ? 320 ASP B OD1   1 
ATOM   6822 O  OD2   . ASP B 2 320 ? 0.110  38.366  -15.441 1.00 83.07  ? 320 ASP B OD2   1 
ATOM   6823 N  N     . PRO B 2 321 ? 1.980  37.751  -10.777 1.00 62.44  ? 321 PRO B N     1 
ATOM   6824 C  CA    . PRO B 2 321 ? 2.844  36.700  -10.218 1.00 64.15  ? 321 PRO B CA    1 
ATOM   6825 C  C     . PRO B 2 321 ? 3.073  35.531  -11.161 1.00 68.34  ? 321 PRO B C     1 
ATOM   6826 O  O     . PRO B 2 321 ? 4.014  34.759  -10.939 1.00 58.94  ? 321 PRO B O     1 
ATOM   6827 C  CB    . PRO B 2 321 ? 2.089  36.260  -8.957  1.00 56.98  ? 321 PRO B CB    1 
ATOM   6828 C  CG    . PRO B 2 321 ? 0.662  36.589  -9.245  1.00 66.75  ? 321 PRO B CG    1 
ATOM   6829 C  CD    . PRO B 2 321 ? 0.685  37.838  -10.081 1.00 65.30  ? 321 PRO B CD    1 
ATOM   6830 N  N     . SER B 2 322 ? 2.256  35.374  -12.200 1.00 77.81  ? 322 SER B N     1 
ATOM   6831 C  CA    . SER B 2 322 ? 2.407  34.276  -13.146 1.00 75.43  ? 322 SER B CA    1 
ATOM   6832 C  C     . SER B 2 322 ? 3.375  34.593  -14.279 1.00 73.50  ? 322 SER B C     1 
ATOM   6833 O  O     . SER B 2 322 ? 3.648  33.715  -15.104 1.00 74.75  ? 322 SER B O     1 
ATOM   6834 C  CB    . SER B 2 322 ? 1.043  33.890  -13.730 1.00 83.42  ? 322 SER B CB    1 
ATOM   6835 O  OG    . SER B 2 322 ? 0.456  34.979  -14.420 1.00 96.76  ? 322 SER B OG    1 
ATOM   6836 N  N     . LYS B 2 323 ? 3.894  35.814  -14.343 1.00 73.34  ? 323 LYS B N     1 
ATOM   6837 C  CA    . LYS B 2 323 ? 4.862  36.210  -15.352 1.00 62.71  ? 323 LYS B CA    1 
ATOM   6838 C  C     . LYS B 2 323 ? 6.208  36.494  -14.699 1.00 56.40  ? 323 LYS B C     1 
ATOM   6839 O  O     . LYS B 2 323 ? 6.304  36.713  -13.489 1.00 64.82  ? 323 LYS B O     1 
ATOM   6840 C  CB    . LYS B 2 323 ? 4.381  37.444  -16.125 1.00 59.77  ? 323 LYS B CB    1 
ATOM   6841 C  CG    . LYS B 2 323 ? 3.073  37.241  -16.874 1.00 66.65  ? 323 LYS B CG    1 
ATOM   6842 C  CD    . LYS B 2 323 ? 2.675  38.493  -17.641 1.00 78.78  ? 323 LYS B CD    1 
ATOM   6843 C  CE    . LYS B 2 323 ? 3.703  38.842  -18.706 1.00 84.42  ? 323 LYS B CE    1 
ATOM   6844 N  NZ    . LYS B 2 323 ? 3.811  37.786  -19.750 1.00 86.52  ? 323 LYS B NZ    1 
ATOM   6845 N  N     . ASP B 2 324 ? 7.254  36.486  -15.518 1.00 50.80  ? 324 ASP B N     1 
ATOM   6846 C  CA    . ASP B 2 324 ? 8.595  36.746  -15.021 1.00 63.17  ? 324 ASP B CA    1 
ATOM   6847 C  C     . ASP B 2 324 ? 8.812  38.237  -14.799 1.00 59.00  ? 324 ASP B C     1 
ATOM   6848 O  O     . ASP B 2 324 ? 8.164  39.084  -15.421 1.00 58.96  ? 324 ASP B O     1 
ATOM   6849 C  CB    . ASP B 2 324 ? 9.647  36.214  -15.994 1.00 78.22  ? 324 ASP B CB    1 
ATOM   6850 C  CG    . ASP B 2 324 ? 9.703  34.701  -16.022 1.00 81.78  ? 324 ASP B CG    1 
ATOM   6851 O  OD1   . ASP B 2 324 ? 9.429  34.076  -14.975 1.00 76.21  ? 324 ASP B OD1   1 
ATOM   6852 O  OD2   . ASP B 2 324 ? 10.025 34.138  -17.089 1.00 82.73  ? 324 ASP B OD2   1 
ATOM   6853 N  N     . LEU B 2 325 ? 9.734  38.550  -13.894 1.00 54.98  ? 325 LEU B N     1 
ATOM   6854 C  CA    . LEU B 2 325 ? 10.190 39.917  -13.688 1.00 51.50  ? 325 LEU B CA    1 
ATOM   6855 C  C     . LEU B 2 325 ? 11.387 40.169  -14.596 1.00 52.37  ? 325 LEU B C     1 
ATOM   6856 O  O     . LEU B 2 325 ? 12.381 39.438  -14.537 1.00 48.72  ? 325 LEU B O     1 
ATOM   6857 C  CB    . LEU B 2 325 ? 10.564 40.154  -12.225 1.00 44.66  ? 325 LEU B CB    1 
ATOM   6858 C  CG    . LEU B 2 325 ? 9.433  40.094  -11.197 1.00 53.43  ? 325 LEU B CG    1 
ATOM   6859 C  CD1   . LEU B 2 325 ? 9.992  40.192  -9.787  1.00 54.22  ? 325 LEU B CD1   1 
ATOM   6860 C  CD2   . LEU B 2 325 ? 8.420  41.198  -11.451 1.00 57.89  ? 325 LEU B CD2   1 
ATOM   6861 N  N     . ILE B 2 326 ? 11.285 41.189  -15.443 1.00 47.08  ? 326 ILE B N     1 
ATOM   6862 C  CA    . ILE B 2 326 ? 12.366 41.572  -16.344 1.00 41.93  ? 326 ILE B CA    1 
ATOM   6863 C  C     . ILE B 2 326 ? 13.122 42.731  -15.715 1.00 50.83  ? 326 ILE B C     1 
ATOM   6864 O  O     . ILE B 2 326 ? 12.512 43.705  -15.255 1.00 67.98  ? 326 ILE B O     1 
ATOM   6865 C  CB    . ILE B 2 326 ? 11.830 41.954  -17.734 1.00 47.53  ? 326 ILE B CB    1 
ATOM   6866 C  CG1   . ILE B 2 326 ? 10.869 40.882  -18.252 1.00 39.41  ? 326 ILE B CG1   1 
ATOM   6867 C  CG2   . ILE B 2 326 ? 12.983 42.156  -18.706 1.00 51.07  ? 326 ILE B CG2   1 
ATOM   6868 C  CD1   . ILE B 2 326 ? 11.490 39.510  -18.371 1.00 53.06  ? 326 ILE B CD1   1 
ATOM   6869 N  N     . ALA B 2 327 ? 14.448 42.627  -15.686 1.00 48.71  ? 327 ALA B N     1 
ATOM   6870 C  CA    . ALA B 2 327 ? 15.304 43.668  -15.132 1.00 43.87  ? 327 ALA B CA    1 
ATOM   6871 C  C     . ALA B 2 327 ? 16.352 44.041  -16.166 1.00 41.73  ? 327 ALA B C     1 
ATOM   6872 O  O     . ALA B 2 327 ? 17.171 43.201  -16.553 1.00 68.82  ? 327 ALA B O     1 
ATOM   6873 C  CB    . ALA B 2 327 ? 15.969 43.208  -13.833 1.00 38.07  ? 327 ALA B CB    1 
ATOM   6874 N  N     . GLU B 2 328 ? 16.319 45.288  -16.621 1.00 36.97  ? 328 GLU B N     1 
ATOM   6875 C  CA    . GLU B 2 328 ? 17.348 45.829  -17.495 1.00 41.31  ? 328 GLU B CA    1 
ATOM   6876 C  C     . GLU B 2 328 ? 18.282 46.714  -16.683 1.00 42.67  ? 328 GLU B C     1 
ATOM   6877 O  O     . GLU B 2 328 ? 17.843 47.427  -15.777 1.00 36.90  ? 328 GLU B O     1 
ATOM   6878 C  CB    . GLU B 2 328 ? 16.741 46.635  -18.643 1.00 43.31  ? 328 GLU B CB    1 
ATOM   6879 C  CG    . GLU B 2 328 ? 15.791 45.854  -19.527 1.00 53.46  ? 328 GLU B CG    1 
ATOM   6880 C  CD    . GLU B 2 328 ? 15.446 46.605  -20.794 1.00 60.91  ? 328 GLU B CD    1 
ATOM   6881 O  OE1   . GLU B 2 328 ? 16.312 47.357  -21.290 1.00 59.10  ? 328 GLU B OE1   1 
ATOM   6882 O  OE2   . GLU B 2 328 ? 14.310 46.452  -21.289 1.00 69.49  ? 328 GLU B OE2   1 
ATOM   6883 N  N     . ILE B 2 329 ? 19.570 46.661  -17.009 1.00 45.00  ? 329 ILE B N     1 
ATOM   6884 C  CA    . ILE B 2 329 ? 20.586 47.465  -16.342 1.00 43.39  ? 329 ILE B CA    1 
ATOM   6885 C  C     . ILE B 2 329 ? 21.354 48.236  -17.403 1.00 47.83  ? 329 ILE B C     1 
ATOM   6886 O  O     . ILE B 2 329 ? 21.753 47.665  -18.424 1.00 48.06  ? 329 ILE B O     1 
ATOM   6887 C  CB    . ILE B 2 329 ? 21.548 46.600  -15.504 1.00 45.20  ? 329 ILE B CB    1 
ATOM   6888 C  CG1   . ILE B 2 329 ? 20.767 45.687  -14.557 1.00 43.65  ? 329 ILE B CG1   1 
ATOM   6889 C  CG2   . ILE B 2 329 ? 22.505 47.481  -14.715 1.00 36.33  ? 329 ILE B CG2   1 
ATOM   6890 C  CD1   . ILE B 2 329 ? 21.649 44.813  -13.697 1.00 36.59  ? 329 ILE B CD1   1 
ATOM   6891 N  N     . GLN B 2 330 ? 21.555 49.530  -17.168 1.00 53.92  ? 330 GLN B N     1 
ATOM   6892 C  CA    . GLN B 2 330 ? 22.323 50.386  -18.061 1.00 48.15  ? 330 GLN B CA    1 
ATOM   6893 C  C     . GLN B 2 330 ? 23.557 50.886  -17.327 1.00 47.86  ? 330 GLN B C     1 
ATOM   6894 O  O     . GLN B 2 330 ? 23.452 51.402  -16.209 1.00 50.38  ? 330 GLN B O     1 
ATOM   6895 C  CB    . GLN B 2 330 ? 21.493 51.574  -18.560 1.00 35.99  ? 330 GLN B CB    1 
ATOM   6896 C  CG    . GLN B 2 330 ? 20.183 51.198  -19.229 1.00 35.77  ? 330 GLN B CG    1 
ATOM   6897 C  CD    . GLN B 2 330 ? 19.067 50.963  -18.233 1.00 41.51  ? 330 GLN B CD    1 
ATOM   6898 O  OE1   . GLN B 2 330 ? 19.036 51.571  -17.163 1.00 41.93  ? 330 GLN B OE1   1 
ATOM   6899 N  NE2   . GLN B 2 330 ? 18.144 50.073  -18.579 1.00 39.09  ? 330 GLN B NE2   1 
ATOM   6900 N  N     . LYS B 2 331 ? 24.721 50.728  -17.952 1.00 48.80  ? 331 LYS B N     1 
ATOM   6901 C  CA    . LYS B 2 331 ? 25.965 51.255  -17.403 1.00 43.48  ? 331 LYS B CA    1 
ATOM   6902 C  C     . LYS B 2 331 ? 26.065 52.732  -17.757 1.00 43.20  ? 331 LYS B C     1 
ATOM   6903 O  O     . LYS B 2 331 ? 26.314 53.086  -18.914 1.00 54.31  ? 331 LYS B O     1 
ATOM   6904 C  CB    . LYS B 2 331 ? 27.165 50.485  -17.945 1.00 42.89  ? 331 LYS B CB    1 
ATOM   6905 C  CG    . LYS B 2 331 ? 28.502 51.123  -17.604 1.00 41.67  ? 331 LYS B CG    1 
ATOM   6906 C  CD    . LYS B 2 331 ? 29.612 50.577  -18.483 1.00 40.58  ? 331 LYS B CD    1 
ATOM   6907 C  CE    . LYS B 2 331 ? 30.935 51.267  -18.198 1.00 46.24  ? 331 LYS B CE    1 
ATOM   6908 N  NZ    . LYS B 2 331 ? 32.012 50.773  -19.099 1.00 47.11  ? 331 LYS B NZ    1 
ATOM   6909 N  N     . GLN B 2 332 ? 25.867 53.599  -16.765 1.00 42.34  ? 332 GLN B N     1 
ATOM   6910 C  CA    . GLN B 2 332 ? 25.947 55.033  -17.000 1.00 55.70  ? 332 GLN B CA    1 
ATOM   6911 C  C     . GLN B 2 332 ? 27.372 55.564  -16.952 1.00 66.60  ? 332 GLN B C     1 
ATOM   6912 O  O     . GLN B 2 332 ? 27.606 56.699  -17.380 1.00 67.67  ? 332 GLN B O     1 
ATOM   6913 C  CB    . GLN B 2 332 ? 25.089 55.784  -15.978 1.00 54.39  ? 332 GLN B CB    1 
ATOM   6914 C  CG    . GLN B 2 332 ? 23.627 55.358  -15.944 1.00 54.91  ? 332 GLN B CG    1 
ATOM   6915 C  CD    . GLN B 2 332 ? 22.862 55.733  -17.203 1.00 59.23  ? 332 GLN B CD    1 
ATOM   6916 O  OE1   . GLN B 2 332 ? 23.403 56.355  -18.116 1.00 61.55  ? 332 GLN B OE1   1 
ATOM   6917 N  NE2   . GLN B 2 332 ? 21.590 55.356  -17.253 1.00 64.14  ? 332 GLN B NE2   1 
ATOM   6918 N  N     . GLY B 2 333 ? 28.322 54.776  -16.457 1.00 65.99  ? 333 GLY B N     1 
ATOM   6919 C  CA    . GLY B 2 333 ? 29.683 55.231  -16.284 1.00 56.66  ? 333 GLY B CA    1 
ATOM   6920 C  C     . GLY B 2 333 ? 29.892 55.910  -14.943 1.00 70.41  ? 333 GLY B C     1 
ATOM   6921 O  O     . GLY B 2 333 ? 28.951 56.265  -14.228 1.00 75.82  ? 333 GLY B O     1 
ATOM   6922 N  N     . GLN B 2 334 ? 31.170 56.086  -14.600 1.00 74.67  ? 334 GLN B N     1 
ATOM   6923 C  CA    . GLN B 2 334 ? 31.572 56.725  -13.345 1.00 73.15  ? 334 GLN B CA    1 
ATOM   6924 C  C     . GLN B 2 334 ? 30.936 56.032  -12.141 1.00 69.00  ? 334 GLN B C     1 
ATOM   6925 O  O     . GLN B 2 334 ? 30.527 56.676  -11.173 1.00 65.24  ? 334 GLN B O     1 
ATOM   6926 C  CB    . GLN B 2 334 ? 31.236 58.220  -13.355 1.00 86.72  ? 334 GLN B CB    1 
ATOM   6927 C  CG    . GLN B 2 334 ? 31.856 58.987  -14.515 1.00 99.34  ? 334 GLN B CG    1 
ATOM   6928 C  CD    . GLN B 2 334 ? 33.370 59.056  -14.430 1.00 108.82 ? 334 GLN B CD    1 
ATOM   6929 O  OE1   . GLN B 2 334 ? 33.943 59.056  -13.340 1.00 112.83 ? 334 GLN B OE1   1 
ATOM   6930 N  NE2   . GLN B 2 334 ? 34.026 59.113  -15.584 1.00 106.56 ? 334 GLN B NE2   1 
ATOM   6931 N  N     . GLY B 2 335 ? 30.842 54.705  -12.208 1.00 69.63  ? 335 GLY B N     1 
ATOM   6932 C  CA    . GLY B 2 335 ? 30.268 53.937  -11.123 1.00 63.33  ? 335 GLY B CA    1 
ATOM   6933 C  C     . GLY B 2 335 ? 28.762 53.996  -11.008 1.00 64.07  ? 335 GLY B C     1 
ATOM   6934 O  O     . GLY B 2 335 ? 28.208 53.434  -10.059 1.00 59.62  ? 335 GLY B O     1 
ATOM   6935 N  N     . GLN B 2 336 ? 28.079 54.654  -11.943 1.00 68.32  ? 336 GLN B N     1 
ATOM   6936 C  CA    . GLN B 2 336 ? 26.629 54.790  -11.891 1.00 63.13  ? 336 GLN B CA    1 
ATOM   6937 C  C     . GLN B 2 336 ? 25.963 53.659  -12.664 1.00 53.06  ? 336 GLN B C     1 
ATOM   6938 O  O     . GLN B 2 336 ? 26.413 53.283  -13.750 1.00 57.62  ? 336 GLN B O     1 
ATOM   6939 C  CB    . GLN B 2 336 ? 26.191 56.138  -12.464 1.00 70.94  ? 336 GLN B CB    1 
ATOM   6940 C  CG    . GLN B 2 336 ? 26.906 57.339  -11.867 1.00 78.88  ? 336 GLN B CG    1 
ATOM   6941 C  CD    . GLN B 2 336 ? 26.559 57.569  -10.408 1.00 89.56  ? 336 GLN B CD    1 
ATOM   6942 O  OE1   . GLN B 2 336 ? 25.494 57.167  -9.938  1.00 90.33  ? 336 GLN B OE1   1 
ATOM   6943 N  NE2   . GLN B 2 336 ? 27.462 58.219  -9.683  1.00 96.62  ? 336 GLN B NE2   1 
ATOM   6944 N  N     . TRP B 2 337 ? 24.883 53.124  -12.099 1.00 46.02  ? 337 TRP B N     1 
ATOM   6945 C  CA    . TRP B 2 337 ? 24.150 52.019  -12.707 1.00 46.87  ? 337 TRP B CA    1 
ATOM   6946 C  C     . TRP B 2 337 ? 22.662 52.232  -12.485 1.00 44.11  ? 337 TRP B C     1 
ATOM   6947 O  O     . TRP B 2 337 ? 22.220 52.378  -11.342 1.00 53.10  ? 337 TRP B O     1 
ATOM   6948 C  CB    . TRP B 2 337 ? 24.591 50.673  -12.119 1.00 45.26  ? 337 TRP B CB    1 
ATOM   6949 C  CG    . TRP B 2 337 ? 26.046 50.375  -12.324 1.00 44.24  ? 337 TRP B CG    1 
ATOM   6950 C  CD1   . TRP B 2 337 ? 27.089 50.826  -11.568 1.00 43.32  ? 337 TRP B CD1   1 
ATOM   6951 C  CD2   . TRP B 2 337 ? 26.619 49.560  -13.353 1.00 37.18  ? 337 TRP B CD2   1 
ATOM   6952 N  NE1   . TRP B 2 337 ? 28.276 50.344  -12.065 1.00 44.36  ? 337 TRP B NE1   1 
ATOM   6953 C  CE2   . TRP B 2 337 ? 28.014 49.563  -13.160 1.00 37.38  ? 337 TRP B CE2   1 
ATOM   6954 C  CE3   . TRP B 2 337 ? 26.087 48.828  -14.419 1.00 41.58  ? 337 TRP B CE3   1 
ATOM   6955 C  CZ2   . TRP B 2 337 ? 28.884 48.862  -13.993 1.00 45.92  ? 337 TRP B CZ2   1 
ATOM   6956 C  CZ3   . TRP B 2 337 ? 26.952 48.133  -15.244 1.00 43.63  ? 337 TRP B CZ3   1 
ATOM   6957 C  CH2   . TRP B 2 337 ? 28.335 48.155  -15.027 1.00 45.77  ? 337 TRP B CH2   1 
ATOM   6958 N  N     . THR B 2 338 ? 21.894 52.250  -13.571 1.00 37.87  ? 338 THR B N     1 
ATOM   6959 C  CA    . THR B 2 338 ? 20.447 52.384  -13.511 1.00 51.32  ? 338 THR B CA    1 
ATOM   6960 C  C     . THR B 2 338 ? 19.790 51.047  -13.829 1.00 52.45  ? 338 THR B C     1 
ATOM   6961 O  O     . THR B 2 338 ? 20.362 50.208  -14.530 1.00 53.34  ? 338 THR B O     1 
ATOM   6962 C  CB    . THR B 2 338 ? 19.943 53.452  -14.488 1.00 49.70  ? 338 THR B CB    1 
ATOM   6963 O  OG1   . THR B 2 338 ? 20.329 53.104  -15.824 1.00 37.25  ? 338 THR B OG1   1 
ATOM   6964 C  CG2   . THR B 2 338 ? 20.522 54.811  -14.133 1.00 38.46  ? 338 THR B CG2   1 
ATOM   6965 N  N     . TYR B 2 339 ? 18.581 50.853  -13.305 1.00 45.99  ? 339 TYR B N     1 
ATOM   6966 C  CA    . TYR B 2 339 ? 17.864 49.609  -13.539 1.00 43.64  ? 339 TYR B CA    1 
ATOM   6967 C  C     . TYR B 2 339 ? 16.365 49.861  -13.512 1.00 50.11  ? 339 TYR B C     1 
ATOM   6968 O  O     . TYR B 2 339 ? 15.883 50.826  -12.912 1.00 60.13  ? 339 TYR B O     1 
ATOM   6969 C  CB    . TYR B 2 339 ? 18.246 48.532  -12.515 1.00 38.36  ? 339 TYR B CB    1 
ATOM   6970 C  CG    . TYR B 2 339 ? 17.900 48.862  -11.078 1.00 39.31  ? 339 TYR B CG    1 
ATOM   6971 C  CD1   . TYR B 2 339 ? 18.745 49.644  -10.301 1.00 46.96  ? 339 TYR B CD1   1 
ATOM   6972 C  CD2   . TYR B 2 339 ? 16.741 48.370  -10.491 1.00 40.74  ? 339 TYR B CD2   1 
ATOM   6973 C  CE1   . TYR B 2 339 ? 18.438 49.940  -8.985  1.00 40.73  ? 339 TYR B CE1   1 
ATOM   6974 C  CE2   . TYR B 2 339 ? 16.426 48.659  -9.176  1.00 45.59  ? 339 TYR B CE2   1 
ATOM   6975 C  CZ    . TYR B 2 339 ? 17.278 49.445  -8.428  1.00 47.38  ? 339 TYR B CZ    1 
ATOM   6976 O  OH    . TYR B 2 339 ? 16.969 49.736  -7.119  1.00 47.47  ? 339 TYR B OH    1 
ATOM   6977 N  N     . GLN B 2 340 ? 15.633 48.977  -14.189 1.00 50.14  ? 340 GLN B N     1 
ATOM   6978 C  CA    . GLN B 2 340 ? 14.178 49.019  -14.231 1.00 43.37  ? 340 GLN B CA    1 
ATOM   6979 C  C     . GLN B 2 340 ? 13.649 47.602  -14.079 1.00 46.01  ? 340 GLN B C     1 
ATOM   6980 O  O     . GLN B 2 340 ? 14.082 46.697  -14.797 1.00 50.37  ? 340 GLN B O     1 
ATOM   6981 C  CB    . GLN B 2 340 ? 13.662 49.630  -15.542 1.00 39.91  ? 340 GLN B CB    1 
ATOM   6982 C  CG    . GLN B 2 340 ? 14.290 50.961  -15.924 1.00 43.10  ? 340 GLN B CG    1 
ATOM   6983 C  CD    . GLN B 2 340 ? 15.604 50.795  -16.660 1.00 44.34  ? 340 GLN B CD    1 
ATOM   6984 O  OE1   . GLN B 2 340 ? 15.702 50.015  -17.608 1.00 48.99  ? 340 GLN B OE1   1 
ATOM   6985 N  NE2   . GLN B 2 340 ? 16.625 51.523  -16.223 1.00 40.76  ? 340 GLN B NE2   1 
ATOM   6986 N  N     . ILE B 2 341 ? 12.721 47.414  -13.146 1.00 50.02  ? 341 ILE B N     1 
ATOM   6987 C  CA    . ILE B 2 341 ? 12.040 46.139  -12.951 1.00 49.40  ? 341 ILE B CA    1 
ATOM   6988 C  C     . ILE B 2 341 ? 10.643 46.252  -13.542 1.00 56.31  ? 341 ILE B C     1 
ATOM   6989 O  O     . ILE B 2 341 ? 9.888  47.171  -13.197 1.00 61.13  ? 341 ILE B O     1 
ATOM   6990 C  CB    . ILE B 2 341 ? 11.980 45.757  -11.463 1.00 41.99  ? 341 ILE B CB    1 
ATOM   6991 C  CG1   . ILE B 2 341 ? 13.388 45.540  -10.906 1.00 45.90  ? 341 ILE B CG1   1 
ATOM   6992 C  CG2   . ILE B 2 341 ? 11.123 44.516  -11.264 1.00 46.44  ? 341 ILE B CG2   1 
ATOM   6993 C  CD1   . ILE B 2 341 ? 13.415 45.218  -9.428  1.00 42.99  ? 341 ILE B CD1   1 
ATOM   6994 N  N     . TYR B 2 342 ? 10.296 45.326  -14.431 1.00 40.63  ? 342 TYR B N     1 
ATOM   6995 C  CA    . TYR B 2 342 ? 9.005  45.370  -15.102 1.00 46.72  ? 342 TYR B CA    1 
ATOM   6996 C  C     . TYR B 2 342 ? 8.655  43.974  -15.594 1.00 56.76  ? 342 TYR B C     1 
ATOM   6997 O  O     . TYR B 2 342 ? 9.465  43.046  -15.532 1.00 64.36  ? 342 TYR B O     1 
ATOM   6998 C  CB    . TYR B 2 342 ? 9.014  46.366  -16.266 1.00 42.97  ? 342 TYR B CB    1 
ATOM   6999 C  CG    . TYR B 2 342 ? 9.975  45.994  -17.373 1.00 47.58  ? 342 TYR B CG    1 
ATOM   7000 C  CD1   . TYR B 2 342 ? 11.319 46.331  -17.293 1.00 48.39  ? 342 TYR B CD1   1 
ATOM   7001 C  CD2   . TYR B 2 342 ? 9.539  45.305  -18.497 1.00 44.17  ? 342 TYR B CD2   1 
ATOM   7002 C  CE1   . TYR B 2 342 ? 12.202 45.993  -18.299 1.00 49.42  ? 342 TYR B CE1   1 
ATOM   7003 C  CE2   . TYR B 2 342 ? 10.414 44.962  -19.509 1.00 39.12  ? 342 TYR B CE2   1 
ATOM   7004 C  CZ    . TYR B 2 342 ? 11.744 45.310  -19.405 1.00 47.67  ? 342 TYR B CZ    1 
ATOM   7005 O  OH    . TYR B 2 342 ? 12.623 44.972  -20.409 1.00 47.31  ? 342 TYR B OH    1 
ATOM   7006 N  N     . GLN B 2 343 ? 7.428  43.843  -16.088 1.00 57.41  ? 343 GLN B N     1 
ATOM   7007 C  CA    . GLN B 2 343 ? 6.930  42.619  -16.702 1.00 48.22  ? 343 GLN B CA    1 
ATOM   7008 C  C     . GLN B 2 343 ? 6.409  42.838  -18.111 1.00 48.75  ? 343 GLN B C     1 
ATOM   7009 O  O     . GLN B 2 343 ? 6.583  41.971  -18.971 1.00 50.65  ? 343 GLN B O     1 
ATOM   7010 C  CB    . GLN B 2 343 ? 5.818  42.008  -15.840 1.00 43.38  ? 343 GLN B CB    1 
ATOM   7011 C  CG    . GLN B 2 343 ? 6.273  41.578  -14.460 1.00 43.54  ? 343 GLN B CG    1 
ATOM   7012 C  CD    . GLN B 2 343 ? 5.132  41.056  -13.611 1.00 52.24  ? 343 GLN B CD    1 
ATOM   7013 O  OE1   . GLN B 2 343 ? 4.009  41.553  -13.689 1.00 57.23  ? 343 GLN B OE1   1 
ATOM   7014 N  NE2   . GLN B 2 343 ? 5.412  40.044  -12.800 1.00 45.07  ? 343 GLN B NE2   1 
ATOM   7015 N  N     . GLU B 2 344 ? 5.771  43.976  -18.366 1.00 68.51  ? 344 GLU B N     1 
ATOM   7016 C  CA    . GLU B 2 344 ? 5.281  44.395  -19.665 1.00 75.57  ? 344 GLU B CA    1 
ATOM   7017 C  C     . GLU B 2 344 ? 6.090  45.585  -20.169 1.00 70.64  ? 344 GLU B C     1 
ATOM   7018 O  O     . GLU B 2 344 ? 6.639  46.347  -19.367 1.00 74.48  ? 344 GLU B O     1 
ATOM   7019 C  CB    . GLU B 2 344 ? 3.797  44.778  -19.597 1.00 87.63  ? 344 GLU B CB    1 
ATOM   7020 C  CG    . GLU B 2 344 ? 2.874  43.629  -19.226 1.00 93.75  ? 344 GLU B CG    1 
ATOM   7021 C  CD    . GLU B 2 344 ? 2.772  42.581  -20.319 1.00 105.85 ? 344 GLU B CD    1 
ATOM   7022 O  OE1   . GLU B 2 344 ? 3.124  42.887  -21.479 1.00 105.51 ? 344 GLU B OE1   1 
ATOM   7023 O  OE2   . GLU B 2 344 ? 2.338  41.449  -20.018 1.00 116.46 ? 344 GLU B OE2   1 
ATOM   7024 N  N     . PRO B 2 345 ? 6.195  45.768  -21.485 1.00 72.08  ? 345 PRO B N     1 
ATOM   7025 C  CA    . PRO B 2 345 ? 6.962  46.906  -22.008 1.00 62.84  ? 345 PRO B CA    1 
ATOM   7026 C  C     . PRO B 2 345 ? 6.385  48.229  -21.527 1.00 55.17  ? 345 PRO B C     1 
ATOM   7027 O  O     . PRO B 2 345 ? 5.175  48.460  -21.592 1.00 50.80  ? 345 PRO B O     1 
ATOM   7028 C  CB    . PRO B 2 345 ? 6.839  46.749  -23.529 1.00 59.06  ? 345 PRO B CB    1 
ATOM   7029 C  CG    . PRO B 2 345 ? 5.639  45.878  -23.734 1.00 63.36  ? 345 PRO B CG    1 
ATOM   7030 C  CD    . PRO B 2 345 ? 5.632  44.942  -22.566 1.00 74.78  ? 345 PRO B CD    1 
ATOM   7031 N  N     . PHE B 2 346 ? 7.269  49.089  -21.018 1.00 52.76  ? 346 PHE B N     1 
ATOM   7032 C  CA    . PHE B 2 346 ? 6.934  50.431  -20.543 1.00 57.47  ? 346 PHE B CA    1 
ATOM   7033 C  C     . PHE B 2 346 ? 6.003  50.412  -19.334 1.00 56.75  ? 346 PHE B C     1 
ATOM   7034 O  O     . PHE B 2 346 ? 5.341  51.414  -19.043 1.00 69.91  ? 346 PHE B O     1 
ATOM   7035 C  CB    . PHE B 2 346 ? 6.329  51.282  -21.666 1.00 68.67  ? 346 PHE B CB    1 
ATOM   7036 C  CG    . PHE B 2 346 ? 7.096  51.212  -22.954 1.00 76.67  ? 346 PHE B CG    1 
ATOM   7037 C  CD1   . PHE B 2 346 ? 8.336  51.818  -23.071 1.00 81.71  ? 346 PHE B CD1   1 
ATOM   7038 C  CD2   . PHE B 2 346 ? 6.578  50.537  -24.049 1.00 69.44  ? 346 PHE B CD2   1 
ATOM   7039 C  CE1   . PHE B 2 346 ? 9.046  51.754  -24.254 1.00 81.40  ? 346 PHE B CE1   1 
ATOM   7040 C  CE2   . PHE B 2 346 ? 7.283  50.470  -25.236 1.00 68.49  ? 346 PHE B CE2   1 
ATOM   7041 C  CZ    . PHE B 2 346 ? 8.519  51.079  -25.339 1.00 75.86  ? 346 PHE B CZ    1 
ATOM   7042 N  N     . LYS B 2 347 ? 5.944  49.296  -18.617 1.00 42.20  ? 347 LYS B N     1 
ATOM   7043 C  CA    . LYS B 2 347 ? 5.124  49.156  -17.414 1.00 48.91  ? 347 LYS B CA    1 
ATOM   7044 C  C     . LYS B 2 347 ? 6.043  48.866  -16.230 1.00 48.07  ? 347 LYS B C     1 
ATOM   7045 O  O     . LYS B 2 347 ? 5.991  47.786  -15.634 1.00 56.67  ? 347 LYS B O     1 
ATOM   7046 C  CB    . LYS B 2 347 ? 4.070  48.052  -17.594 1.00 58.12  ? 347 LYS B CB    1 
ATOM   7047 C  CG    . LYS B 2 347 ? 2.671  48.563  -17.907 1.00 58.03  ? 347 LYS B CG    1 
ATOM   7048 C  CD    . LYS B 2 347 ? 2.609  49.252  -19.260 1.00 60.76  ? 347 LYS B CD    1 
ATOM   7049 C  CE    . LYS B 2 347 ? 1.222  49.815  -19.529 1.00 69.26  ? 347 LYS B CE    1 
ATOM   7050 N  NZ    . LYS B 2 347 ? 0.862  50.890  -18.561 1.00 68.03  ? 347 LYS B NZ    1 
ATOM   7051 N  N     . ASN B 2 348 ? 6.879  49.842  -15.886 1.00 46.73  ? 348 ASN B N     1 
ATOM   7052 C  CA    . ASN B 2 348 ? 7.900  49.637  -14.867 1.00 48.13  ? 348 ASN B CA    1 
ATOM   7053 C  C     . ASN B 2 348 ? 7.279  49.531  -13.480 1.00 47.19  ? 348 ASN B C     1 
ATOM   7054 O  O     . ASN B 2 348 ? 6.495  50.391  -13.068 1.00 49.89  ? 348 ASN B O     1 
ATOM   7055 C  CB    . ASN B 2 348 ? 8.914  50.778  -14.902 1.00 41.57  ? 348 ASN B CB    1 
ATOM   7056 C  CG    . ASN B 2 348 ? 9.714  50.806  -16.186 1.00 50.87  ? 348 ASN B CG    1 
ATOM   7057 O  OD1   . ASN B 2 348 ? 10.040 49.761  -16.750 1.00 40.11  ? 348 ASN B OD1   1 
ATOM   7058 N  ND2   . ASN B 2 348 ? 10.037 52.006  -16.656 1.00 56.64  ? 348 ASN B ND2   1 
ATOM   7059 N  N     . LEU B 2 349 ? 7.635  48.466  -12.760 1.00 48.79  ? 349 LEU B N     1 
ATOM   7060 C  CA    . LEU B 2 349 ? 7.265  48.351  -11.355 1.00 47.13  ? 349 LEU B CA    1 
ATOM   7061 C  C     . LEU B 2 349 ? 8.183  49.178  -10.465 1.00 53.45  ? 349 LEU B C     1 
ATOM   7062 O  O     . LEU B 2 349 ? 7.767  49.612  -9.384  1.00 59.94  ? 349 LEU B O     1 
ATOM   7063 C  CB    . LEU B 2 349 ? 7.296  46.885  -10.921 1.00 48.53  ? 349 LEU B CB    1 
ATOM   7064 C  CG    . LEU B 2 349 ? 6.212  45.964  -11.484 1.00 50.78  ? 349 LEU B CG    1 
ATOM   7065 C  CD1   . LEU B 2 349 ? 6.605  44.507  -11.306 1.00 44.54  ? 349 LEU B CD1   1 
ATOM   7066 C  CD2   . LEU B 2 349 ? 4.881  46.241  -10.808 1.00 46.12  ? 349 LEU B CD2   1 
ATOM   7067 N  N     . LYS B 2 350 ? 9.420  49.407  -10.902 1.00 43.17  ? 350 LYS B N     1 
ATOM   7068 C  CA    . LYS B 2 350 ? 10.388 50.182  -10.141 1.00 51.97  ? 350 LYS B CA    1 
ATOM   7069 C  C     . LYS B 2 350 ? 11.526 50.584  -11.068 1.00 45.55  ? 350 LYS B C     1 
ATOM   7070 O  O     . LYS B 2 350 ? 11.945 49.798  -11.920 1.00 46.37  ? 350 LYS B O     1 
ATOM   7071 C  CB    . LYS B 2 350 ? 10.926 49.387  -8.945  1.00 51.06  ? 350 LYS B CB    1 
ATOM   7072 C  CG    . LYS B 2 350 ? 12.029 50.089  -8.166  1.00 58.14  ? 350 LYS B CG    1 
ATOM   7073 C  CD    . LYS B 2 350 ? 12.472 49.265  -6.968  1.00 59.79  ? 350 LYS B CD    1 
ATOM   7074 C  CE    . LYS B 2 350 ? 13.683 49.885  -6.290  1.00 60.54  ? 350 LYS B CE    1 
ATOM   7075 N  NZ    . LYS B 2 350 ? 13.444 51.304  -5.907  1.00 66.75  ? 350 LYS B NZ    1 
ATOM   7076 N  N     . THR B 2 351 ? 12.006 51.817  -10.907 1.00 42.17  ? 351 THR B N     1 
ATOM   7077 C  CA    . THR B 2 351 ? 13.167 52.320  -11.636 1.00 53.32  ? 351 THR B CA    1 
ATOM   7078 C  C     . THR B 2 351 ? 14.107 52.963  -10.626 1.00 60.41  ? 351 THR B C     1 
ATOM   7079 O  O     . THR B 2 351 ? 13.820 54.049  -10.112 1.00 75.17  ? 351 THR B O     1 
ATOM   7080 C  CB    . THR B 2 351 ? 12.765 53.325  -12.718 1.00 42.83  ? 351 THR B CB    1 
ATOM   7081 O  OG1   . THR B 2 351 ? 12.107 54.444  -12.113 1.00 48.09  ? 351 THR B OG1   1 
ATOM   7082 C  CG2   . THR B 2 351 ? 11.834 52.684  -13.734 1.00 41.45  ? 351 THR B CG2   1 
ATOM   7083 N  N     . GLY B 2 352 ? 15.225 52.296  -10.341 1.00 41.30  ? 352 GLY B N     1 
ATOM   7084 C  CA    . GLY B 2 352 ? 16.199 52.783  -9.392  1.00 41.74  ? 352 GLY B CA    1 
ATOM   7085 C  C     . GLY B 2 352 ? 17.549 53.042  -10.040 1.00 43.88  ? 352 GLY B C     1 
ATOM   7086 O  O     . GLY B 2 352 ? 17.740 52.859  -11.245 1.00 40.10  ? 352 GLY B O     1 
ATOM   7087 N  N     . LYS B 2 353 ? 18.485 53.485  -9.205  1.00 54.67  ? 353 LYS B N     1 
ATOM   7088 C  CA    . LYS B 2 353 ? 19.858 53.698  -9.632  1.00 63.19  ? 353 LYS B CA    1 
ATOM   7089 C  C     . LYS B 2 353 ? 20.797 53.129  -8.579  1.00 63.80  ? 353 LYS B C     1 
ATOM   7090 O  O     . LYS B 2 353 ? 20.446 53.002  -7.404  1.00 53.77  ? 353 LYS B O     1 
ATOM   7091 C  CB    . LYS B 2 353 ? 20.164 55.183  -9.879  1.00 69.29  ? 353 LYS B CB    1 
ATOM   7092 C  CG    . LYS B 2 353 ? 20.334 56.014  -8.620  1.00 81.65  ? 353 LYS B CG    1 
ATOM   7093 C  CD    . LYS B 2 353 ? 20.710 57.447  -8.964  1.00 93.44  ? 353 LYS B CD    1 
ATOM   7094 C  CE    . LYS B 2 353 ? 20.929 58.283  -7.713  1.00 97.73  ? 353 LYS B CE    1 
ATOM   7095 N  NZ    . LYS B 2 353 ? 22.093 57.806  -6.917  1.00 96.86  ? 353 LYS B NZ    1 
ATOM   7096 N  N     . TYR B 2 354 ? 22.003 52.784  -9.024  1.00 72.55  ? 354 TYR B N     1 
ATOM   7097 C  CA    . TYR B 2 354 ? 23.010 52.149  -8.183  1.00 66.07  ? 354 TYR B CA    1 
ATOM   7098 C  C     . TYR B 2 354 ? 24.336 52.861  -8.401  1.00 57.64  ? 354 TYR B C     1 
ATOM   7099 O  O     . TYR B 2 354 ? 24.839 52.908  -9.529  1.00 49.77  ? 354 TYR B O     1 
ATOM   7100 C  CB    . TYR B 2 354 ? 23.128 50.658  -8.513  1.00 61.41  ? 354 TYR B CB    1 
ATOM   7101 C  CG    . TYR B 2 354 ? 24.144 49.899  -7.692  1.00 74.94  ? 354 TYR B CG    1 
ATOM   7102 C  CD1   . TYR B 2 354 ? 23.831 49.436  -6.423  1.00 78.26  ? 354 TYR B CD1   1 
ATOM   7103 C  CD2   . TYR B 2 354 ? 25.409 49.627  -8.194  1.00 84.90  ? 354 TYR B CD2   1 
ATOM   7104 C  CE1   . TYR B 2 354 ? 24.751 48.732  -5.670  1.00 81.42  ? 354 TYR B CE1   1 
ATOM   7105 C  CE2   . TYR B 2 354 ? 26.337 48.925  -7.450  1.00 82.27  ? 354 TYR B CE2   1 
ATOM   7106 C  CZ    . TYR B 2 354 ? 26.003 48.480  -6.189  1.00 84.63  ? 354 TYR B CZ    1 
ATOM   7107 O  OH    . TYR B 2 354 ? 26.925 47.780  -5.444  1.00 88.88  ? 354 TYR B OH    1 
ATOM   7108 N  N     . ALA B 2 355 ? 24.893 53.420  -7.332  1.00 65.29  ? 355 ALA B N     1 
ATOM   7109 C  CA    . ALA B 2 355 ? 26.154 54.142  -7.389  1.00 85.26  ? 355 ALA B CA    1 
ATOM   7110 C  C     . ALA B 2 355 ? 27.222 53.394  -6.602  1.00 106.09 ? 355 ALA B C     1 
ATOM   7111 O  O     . ALA B 2 355 ? 26.920 52.642  -5.671  1.00 101.19 ? 355 ALA B O     1 
ATOM   7112 C  CB    . ALA B 2 355 ? 26.001 55.564  -6.843  1.00 78.16  ? 355 ALA B CB    1 
ATOM   7113 N  N     . ARG B 2 356 ? 28.480 53.610  -6.987  1.00 127.54 ? 356 ARG B N     1 
ATOM   7114 C  CA    . ARG B 2 356 ? 29.604 52.957  -6.326  1.00 135.06 ? 356 ARG B CA    1 
ATOM   7115 C  C     . ARG B 2 356 ? 30.862 53.814  -6.390  1.00 136.32 ? 356 ARG B C     1 
ATOM   7116 O  O     . ARG B 2 356 ? 30.794 55.042  -6.272  1.00 137.07 ? 356 ARG B O     1 
ATOM   7117 C  CB    . ARG B 2 356 ? 29.872 51.586  -6.952  1.00 139.46 ? 356 ARG B CB    1 
ATOM   7118 C  CG    . ARG B 2 356 ? 29.237 50.424  -6.207  1.00 145.50 ? 356 ARG B CG    1 
ATOM   7119 C  CD    . ARG B 2 356 ? 29.772 50.323  -4.787  1.00 149.72 ? 356 ARG B CD    1 
ATOM   7120 N  NE    . ARG B 2 356 ? 29.223 49.174  -4.072  1.00 150.00 ? 356 ARG B NE    1 
ATOM   7121 C  CZ    . ARG B 2 356 ? 29.486 48.893  -2.800  1.00 149.50 ? 356 ARG B CZ    1 
ATOM   7122 N  NH1   . ARG B 2 356 ? 30.290 49.680  -2.099  1.00 148.74 ? 356 ARG B NH1   1 
ATOM   7123 N  NH2   . ARG B 2 356 ? 28.944 47.827  -2.227  1.00 148.23 ? 356 ARG B NH2   1 
ATOM   7124 N  N     . MET B 2 357 ? 32.012 53.171  -6.578  1.00 133.28 ? 357 MET B N     1 
ATOM   7125 C  CA    . MET B 2 357 ? 33.281 53.885  -6.600  1.00 129.47 ? 357 MET B CA    1 
ATOM   7126 C  C     . MET B 2 357 ? 33.419 54.713  -7.871  1.00 127.71 ? 357 MET B C     1 
ATOM   7127 O  O     . MET B 2 357 ? 32.979 54.307  -8.950  1.00 134.30 ? 357 MET B O     1 
ATOM   7128 C  CB    . MET B 2 357 ? 34.447 52.902  -6.496  1.00 129.32 ? 357 MET B CB    1 
ATOM   7129 C  CG    . MET B 2 357 ? 34.562 52.198  -5.157  1.00 128.18 ? 357 MET B CG    1 
ATOM   7130 S  SD    . MET B 2 357 ? 35.886 50.974  -5.151  1.00 123.14 ? 357 MET B SD    1 
ATOM   7131 C  CE    . MET B 2 357 ? 35.260 49.796  -6.349  1.00 124.13 ? 357 MET B CE    1 
ATOM   7132 N  N     . ARG B 2 358 ? 34.046 55.881  -7.735  1.00 117.13 ? 358 ARG B N     1 
ATOM   7133 C  CA    . ARG B 2 358 ? 34.341 56.760  -8.859  1.00 112.71 ? 358 ARG B CA    1 
ATOM   7134 C  C     . ARG B 2 358 ? 35.842 56.860  -9.118  1.00 118.62 ? 358 ARG B C     1 
ATOM   7135 O  O     . ARG B 2 358 ? 36.329 57.883  -9.605  1.00 122.28 ? 358 ARG B O     1 
ATOM   7136 C  CB    . ARG B 2 358 ? 33.751 58.149  -8.622  1.00 104.16 ? 358 ARG B CB    1 
ATOM   7137 C  CG    . ARG B 2 358 ? 32.236 58.175  -8.505  1.00 96.05  ? 358 ARG B CG    1 
ATOM   7138 C  CD    . ARG B 2 358 ? 31.739 59.562  -8.130  0.00 92.02  ? 358 ARG B CD    1 
ATOM   7139 N  NE    . ARG B 2 358 ? 32.202 60.584  -9.065  0.00 88.21  ? 358 ARG B NE    1 
ATOM   7140 C  CZ    . ARG B 2 358 ? 31.534 60.963  -10.149 0.00 85.18  ? 358 ARG B CZ    1 
ATOM   7141 N  NH1   . ARG B 2 358 ? 30.367 60.406  -10.440 0.00 83.74  ? 358 ARG B NH1   1 
ATOM   7142 N  NH2   . ARG B 2 358 ? 32.033 61.901  -10.942 0.00 84.69  ? 358 ARG B NH2   1 
ATOM   7143 N  N     . GLY B 2 359 ? 36.589 55.803  -8.792  1.00 120.54 ? 359 GLY B N     1 
ATOM   7144 C  CA    . GLY B 2 359 ? 38.026 55.799  -8.942  1.00 123.93 ? 359 GLY B CA    1 
ATOM   7145 C  C     . GLY B 2 359 ? 38.487 55.093  -10.210 1.00 127.58 ? 359 GLY B C     1 
ATOM   7146 O  O     . GLY B 2 359 ? 37.701 54.610  -11.021 1.00 129.82 ? 359 GLY B O     1 
ATOM   7147 N  N     . ALA B 2 360 ? 39.812 55.045  -10.366 1.00 128.93 ? 360 ALA B N     1 
ATOM   7148 C  CA    . ALA B 2 360 ? 40.414 54.385  -11.516 1.00 126.70 ? 360 ALA B CA    1 
ATOM   7149 C  C     . ALA B 2 360 ? 40.527 52.878  -11.335 1.00 124.33 ? 360 ALA B C     1 
ATOM   7150 O  O     . ALA B 2 360 ? 40.651 52.155  -12.330 1.00 121.82 ? 360 ALA B O     1 
ATOM   7151 C  CB    . ALA B 2 360 ? 41.798 54.973  -11.798 1.00 127.11 ? 360 ALA B CB    1 
ATOM   7152 N  N     . HIS B 2 361 ? 40.487 52.391  -10.097 1.00 120.89 ? 361 HIS B N     1 
ATOM   7153 C  CA    . HIS B 2 361 ? 40.569 50.960  -9.804  1.00 114.65 ? 361 HIS B CA    1 
ATOM   7154 C  C     . HIS B 2 361 ? 39.202 50.292  -9.831  1.00 107.41 ? 361 HIS B C     1 
ATOM   7155 O  O     . HIS B 2 361 ? 38.916 49.401  -9.025  1.00 107.36 ? 361 HIS B O     1 
ATOM   7156 C  CB    . HIS B 2 361 ? 41.249 50.757  -8.454  1.00 118.35 ? 361 HIS B CB    1 
ATOM   7157 C  CG    . HIS B 2 361 ? 42.384 51.701  -8.203  1.00 125.68 ? 361 HIS B CG    1 
ATOM   7158 N  ND1   . HIS B 2 361 ? 43.509 51.742  -8.999  1.00 126.54 ? 361 HIS B ND1   1 
ATOM   7159 C  CD2   . HIS B 2 361 ? 42.567 52.642  -7.246  1.00 128.32 ? 361 HIS B CD2   1 
ATOM   7160 C  CE1   . HIS B 2 361 ? 44.335 52.666  -8.543  1.00 124.09 ? 361 HIS B CE1   1 
ATOM   7161 N  NE2   . HIS B 2 361 ? 43.788 53.227  -7.480  1.00 124.55 ? 361 HIS B NE2   1 
ATOM   7162 N  N     . THR B 2 362 ? 38.342 50.704  -10.759 1.00 100.39 ? 362 THR B N     1 
ATOM   7163 C  CA    . THR B 2 362 ? 36.964 50.237  -10.821 1.00 87.88  ? 362 THR B CA    1 
ATOM   7164 C  C     . THR B 2 362 ? 36.854 48.988  -11.688 1.00 69.75  ? 362 THR B C     1 
ATOM   7165 O  O     . THR B 2 362 ? 37.469 48.898  -12.754 1.00 67.02  ? 362 THR B O     1 
ATOM   7166 C  CB    . THR B 2 362 ? 36.057 51.342  -11.372 1.00 87.67  ? 362 THR B CB    1 
ATOM   7167 O  OG1   . THR B 2 362 ? 36.029 52.442  -10.452 1.00 93.35  ? 362 THR B OG1   1 
ATOM   7168 C  CG2   . THR B 2 362 ? 34.639 50.833  -11.587 1.00 82.46  ? 362 THR B CG2   1 
ATOM   7169 N  N     . ASN B 2 363 ? 36.064 48.025  -11.218 1.00 54.36  ? 363 ASN B N     1 
ATOM   7170 C  CA    . ASN B 2 363 ? 35.795 46.784  -11.937 1.00 50.77  ? 363 ASN B CA    1 
ATOM   7171 C  C     . ASN B 2 363 ? 34.335 46.800  -12.379 1.00 51.51  ? 363 ASN B C     1 
ATOM   7172 O  O     . ASN B 2 363 ? 33.427 46.762  -11.541 1.00 51.57  ? 363 ASN B O     1 
ATOM   7173 C  CB    . ASN B 2 363 ? 36.101 45.574  -11.054 1.00 48.42  ? 363 ASN B CB    1 
ATOM   7174 C  CG    . ASN B 2 363 ? 36.070 44.259  -11.816 1.00 52.05  ? 363 ASN B CG    1 
ATOM   7175 O  OD1   . ASN B 2 363 ? 35.450 44.148  -12.874 1.00 61.71  ? 363 ASN B OD1   1 
ATOM   7176 N  ND2   . ASN B 2 363 ? 36.737 43.249  -11.271 1.00 52.20  ? 363 ASN B ND2   1 
ATOM   7177 N  N     . ASP B 2 364 ? 34.113 46.864  -13.696 1.00 43.75  ? 364 ASP B N     1 
ATOM   7178 C  CA    . ASP B 2 364 ? 32.751 46.850  -14.223 1.00 38.95  ? 364 ASP B CA    1 
ATOM   7179 C  C     . ASP B 2 364 ? 32.035 45.551  -13.879 1.00 48.75  ? 364 ASP B C     1 
ATOM   7180 O  O     . ASP B 2 364 ? 30.862 45.565  -13.487 1.00 53.63  ? 364 ASP B O     1 
ATOM   7181 C  CB    . ASP B 2 364 ? 32.765 47.057  -15.738 1.00 42.62  ? 364 ASP B CB    1 
ATOM   7182 C  CG    . ASP B 2 364 ? 32.786 48.519  -16.131 1.00 42.86  ? 364 ASP B CG    1 
ATOM   7183 O  OD1   . ASP B 2 364 ? 32.611 49.379  -15.243 1.00 50.68  ? 364 ASP B OD1   1 
ATOM   7184 O  OD2   . ASP B 2 364 ? 32.962 48.806  -17.334 1.00 40.72  ? 364 ASP B OD2   1 
ATOM   7185 N  N     . VAL B 2 365 ? 32.722 44.416  -14.027 1.00 52.52  ? 365 VAL B N     1 
ATOM   7186 C  CA    . VAL B 2 365 ? 32.093 43.130  -13.750 1.00 39.64  ? 365 VAL B CA    1 
ATOM   7187 C  C     . VAL B 2 365 ? 31.779 42.997  -12.267 1.00 37.14  ? 365 VAL B C     1 
ATOM   7188 O  O     . VAL B 2 365 ? 30.689 42.555  -11.888 1.00 54.57  ? 365 VAL B O     1 
ATOM   7189 C  CB    . VAL B 2 365 ? 32.986 41.979  -14.247 1.00 44.80  ? 365 VAL B CB    1 
ATOM   7190 C  CG1   . VAL B 2 365 ? 32.325 40.639  -13.970 1.00 45.21  ? 365 VAL B CG1   1 
ATOM   7191 C  CG2   . VAL B 2 365 ? 33.276 42.141  -15.731 1.00 53.43  ? 365 VAL B CG2   1 
ATOM   7192 N  N     . LYS B 2 366 ? 32.721 43.384  -11.404 1.00 43.17  ? 366 LYS B N     1 
ATOM   7193 C  CA    . LYS B 2 366 ? 32.467 43.335  -9.968  1.00 50.65  ? 366 LYS B CA    1 
ATOM   7194 C  C     . LYS B 2 366 ? 31.314 44.253  -9.581  1.00 53.22  ? 366 LYS B C     1 
ATOM   7195 O  O     . LYS B 2 366 ? 30.465 43.882  -8.760  1.00 46.50  ? 366 LYS B O     1 
ATOM   7196 C  CB    . LYS B 2 366 ? 33.734 43.707  -9.198  1.00 49.11  ? 366 LYS B CB    1 
ATOM   7197 C  CG    . LYS B 2 366 ? 33.528 43.837  -7.702  1.00 49.81  ? 366 LYS B CG    1 
ATOM   7198 C  CD    . LYS B 2 366 ? 34.820 44.202  -6.997  1.00 55.39  ? 366 LYS B CD    1 
ATOM   7199 C  CE    . LYS B 2 366 ? 34.580 44.441  -5.519  1.00 59.98  ? 366 LYS B CE    1 
ATOM   7200 N  NZ    . LYS B 2 366 ? 33.947 43.265  -4.862  1.00 78.89  ? 366 LYS B NZ    1 
ATOM   7201 N  N     . GLN B 2 367 ? 31.261 45.453  -10.165 1.00 56.93  ? 367 GLN B N     1 
ATOM   7202 C  CA    . GLN B 2 367 ? 30.157 46.364  -9.879  1.00 49.58  ? 367 GLN B CA    1 
ATOM   7203 C  C     . GLN B 2 367 ? 28.832 45.805  -10.382 1.00 47.34  ? 367 GLN B C     1 
ATOM   7204 O  O     . GLN B 2 367 ? 27.810 45.909  -9.694  1.00 50.20  ? 367 GLN B O     1 
ATOM   7205 C  CB    . GLN B 2 367 ? 30.426 47.733  -10.500 1.00 48.81  ? 367 GLN B CB    1 
ATOM   7206 C  CG    . GLN B 2 367 ? 31.298 48.642  -9.657  1.00 49.93  ? 367 GLN B CG    1 
ATOM   7207 C  CD    . GLN B 2 367 ? 31.442 50.022  -10.264 1.00 55.51  ? 367 GLN B CD    1 
ATOM   7208 O  OE1   . GLN B 2 367 ? 31.035 50.258  -11.403 1.00 46.45  ? 367 GLN B OE1   1 
ATOM   7209 N  NE2   . GLN B 2 367 ? 32.021 50.945  -9.504  1.00 65.46  ? 367 GLN B NE2   1 
ATOM   7210 N  N     . LEU B 2 368 ? 28.829 45.211  -11.577 1.00 46.27  ? 368 LEU B N     1 
ATOM   7211 C  CA    . LEU B 2 368 ? 27.589 44.667  -12.122 1.00 36.95  ? 368 LEU B CA    1 
ATOM   7212 C  C     . LEU B 2 368 ? 27.092 43.485  -11.298 1.00 41.18  ? 368 LEU B C     1 
ATOM   7213 O  O     . LEU B 2 368 ? 25.886 43.359  -11.055 1.00 42.57  ? 368 LEU B O     1 
ATOM   7214 C  CB    . LEU B 2 368 ? 27.788 44.263  -13.582 1.00 36.20  ? 368 LEU B CB    1 
ATOM   7215 C  CG    . LEU B 2 368 ? 26.569 43.671  -14.294 1.00 43.68  ? 368 LEU B CG    1 
ATOM   7216 C  CD1   . LEU B 2 368 ? 25.363 44.584  -14.141 1.00 41.28  ? 368 LEU B CD1   1 
ATOM   7217 C  CD2   . LEU B 2 368 ? 26.873 43.427  -15.764 1.00 42.56  ? 368 LEU B CD2   1 
ATOM   7218 N  N     . THR B 2 369 ? 28.004 42.612  -10.857 1.00 46.60  ? 369 THR B N     1 
ATOM   7219 C  CA    . THR B 2 369 ? 27.599 41.472  -10.038 1.00 44.73  ? 369 THR B CA    1 
ATOM   7220 C  C     . THR B 2 369 ? 26.997 41.929  -8.717  1.00 46.53  ? 369 THR B C     1 
ATOM   7221 O  O     . THR B 2 369 ? 26.010 41.357  -8.244  1.00 53.13  ? 369 THR B O     1 
ATOM   7222 C  CB    . THR B 2 369 ? 28.788 40.545  -9.780  1.00 56.96  ? 369 THR B CB    1 
ATOM   7223 O  OG1   . THR B 2 369 ? 29.870 41.299  -9.221  1.00 88.10  ? 369 THR B OG1   1 
ATOM   7224 C  CG2   . THR B 2 369 ? 29.246 39.880  -11.068 1.00 50.72  ? 369 THR B CG2   1 
ATOM   7225 N  N     . GLU B 2 370 ? 27.587 42.952  -8.097  1.00 41.10  ? 370 GLU B N     1 
ATOM   7226 C  CA    . GLU B 2 370 ? 26.979 43.522  -6.901  1.00 46.00  ? 370 GLU B CA    1 
ATOM   7227 C  C     . GLU B 2 370 ? 25.650 44.191  -7.224  1.00 49.04  ? 370 GLU B C     1 
ATOM   7228 O  O     . GLU B 2 370 ? 24.738 44.195  -6.389  1.00 50.90  ? 370 GLU B O     1 
ATOM   7229 C  CB    . GLU B 2 370 ? 27.938 44.518  -6.249  1.00 53.22  ? 370 GLU B CB    1 
ATOM   7230 C  CG    . GLU B 2 370 ? 29.229 43.891  -5.751  1.00 54.00  ? 370 GLU B CG    1 
ATOM   7231 C  CD    . GLU B 2 370 ? 30.256 44.922  -5.329  1.00 72.04  ? 370 GLU B CD    1 
ATOM   7232 O  OE1   . GLU B 2 370 ? 30.036 46.124  -5.590  1.00 85.30  ? 370 GLU B OE1   1 
ATOM   7233 O  OE2   . GLU B 2 370 ? 31.284 44.530  -4.737  1.00 74.75  ? 370 GLU B OE2   1 
ATOM   7234 N  N     . ALA B 2 371 ? 25.518 44.742  -8.433  1.00 54.08  ? 371 ALA B N     1 
ATOM   7235 C  CA    . ALA B 2 371 ? 24.275 45.405  -8.814  1.00 52.70  ? 371 ALA B CA    1 
ATOM   7236 C  C     . ALA B 2 371 ? 23.140 44.402  -8.989  1.00 57.86  ? 371 ALA B C     1 
ATOM   7237 O  O     . ALA B 2 371 ? 21.997 44.685  -8.614  1.00 56.31  ? 371 ALA B O     1 
ATOM   7238 C  CB    . ALA B 2 371 ? 24.482 46.217  -10.092 1.00 44.14  ? 371 ALA B CB    1 
ATOM   7239 N  N     . VAL B 2 372 ? 23.430 43.224  -9.551  1.00 52.20  ? 372 VAL B N     1 
ATOM   7240 C  CA    . VAL B 2 372 ? 22.365 42.241  -9.739  1.00 50.56  ? 372 VAL B CA    1 
ATOM   7241 C  C     . VAL B 2 372 ? 21.968 41.613  -8.411  1.00 45.50  ? 372 VAL B C     1 
ATOM   7242 O  O     . VAL B 2 372 ? 20.823 41.178  -8.242  1.00 60.48  ? 372 VAL B O     1 
ATOM   7243 C  CB    . VAL B 2 372 ? 22.771 41.167  -10.768 1.00 41.62  ? 372 VAL B CB    1 
ATOM   7244 C  CG1   . VAL B 2 372 ? 23.171 41.809  -12.081 1.00 36.91  ? 372 VAL B CG1   1 
ATOM   7245 C  CG2   . VAL B 2 372 ? 23.886 40.291  -10.234 1.00 63.51  ? 372 VAL B CG2   1 
ATOM   7246 N  N     . GLN B 2 373 ? 22.889 41.556  -7.446  1.00 40.43  ? 373 GLN B N     1 
ATOM   7247 C  CA    . GLN B 2 373 ? 22.536 41.011  -6.140  1.00 51.70  ? 373 GLN B CA    1 
ATOM   7248 C  C     . GLN B 2 373 ? 21.651 41.969  -5.357  1.00 60.03  ? 373 GLN B C     1 
ATOM   7249 O  O     . GLN B 2 373 ? 20.784 41.527  -4.596  1.00 75.98  ? 373 GLN B O     1 
ATOM   7250 C  CB    . GLN B 2 373 ? 23.797 40.679  -5.344  1.00 51.35  ? 373 GLN B CB    1 
ATOM   7251 C  CG    . GLN B 2 373 ? 24.636 39.566  -5.945  1.00 47.59  ? 373 GLN B CG    1 
ATOM   7252 C  CD    . GLN B 2 373 ? 25.888 39.282  -5.139  1.00 51.38  ? 373 GLN B CD    1 
ATOM   7253 O  OE1   . GLN B 2 373 ? 25.826 39.078  -3.925  1.00 54.96  ? 373 GLN B OE1   1 
ATOM   7254 N  NE2   . GLN B 2 373 ? 27.034 39.275  -5.809  1.00 40.66  ? 373 GLN B NE2   1 
ATOM   7255 N  N     . LYS B 2 374 ? 21.851 43.278  -5.527  1.00 53.04  ? 374 LYS B N     1 
ATOM   7256 C  CA    . LYS B 2 374 ? 20.972 44.243  -4.876  1.00 56.65  ? 374 LYS B CA    1 
ATOM   7257 C  C     . LYS B 2 374 ? 19.588 44.243  -5.514  1.00 52.33  ? 374 LYS B C     1 
ATOM   7258 O  O     . LYS B 2 374 ? 18.574 44.284  -4.808  1.00 55.40  ? 374 LYS B O     1 
ATOM   7259 C  CB    . LYS B 2 374 ? 21.589 45.640  -4.932  1.00 65.02  ? 374 LYS B CB    1 
ATOM   7260 C  CG    . LYS B 2 374 ? 20.688 46.736  -4.379  1.00 90.82  ? 374 LYS B CG    1 
ATOM   7261 C  CD    . LYS B 2 374 ? 21.270 48.111  -4.649  1.00 103.39 ? 374 LYS B CD    1 
ATOM   7262 C  CE    . LYS B 2 374 ? 20.271 49.217  -4.348  1.00 99.77  ? 374 LYS B CE    1 
ATOM   7263 N  NZ    . LYS B 2 374 ? 20.795 50.554  -4.744  1.00 88.97  ? 374 LYS B NZ    1 
ATOM   7264 N  N     . ILE B 2 375 ? 19.526 44.193  -6.847  1.00 45.31  ? 375 ILE B N     1 
ATOM   7265 C  CA    . ILE B 2 375 ? 18.237 44.189  -7.533  1.00 43.73  ? 375 ILE B CA    1 
ATOM   7266 C  C     . ILE B 2 375 ? 17.467 42.912  -7.221  1.00 48.44  ? 375 ILE B C     1 
ATOM   7267 O  O     . ILE B 2 375 ? 16.249 42.942  -7.009  1.00 57.48  ? 375 ILE B O     1 
ATOM   7268 C  CB    . ILE B 2 375 ? 18.435 44.372  -9.048  1.00 43.48  ? 375 ILE B CB    1 
ATOM   7269 C  CG1   . ILE B 2 375 ? 19.134 45.698  -9.344  1.00 43.98  ? 375 ILE B CG1   1 
ATOM   7270 C  CG2   . ILE B 2 375 ? 17.099 44.309  -9.772  1.00 47.19  ? 375 ILE B CG2   1 
ATOM   7271 C  CD1   . ILE B 2 375 ? 19.672 45.793  -10.752 1.00 50.66  ? 375 ILE B CD1   1 
ATOM   7272 N  N     . THR B 2 376 ? 18.160 41.771  -7.191  1.00 47.00  ? 376 THR B N     1 
ATOM   7273 C  CA    . THR B 2 376 ? 17.487 40.519  -6.861  1.00 50.07  ? 376 THR B CA    1 
ATOM   7274 C  C     . THR B 2 376 ? 16.994 40.527  -5.421  1.00 56.54  ? 376 THR B C     1 
ATOM   7275 O  O     . THR B 2 376 ? 15.878 40.076  -5.140  1.00 72.53  ? 376 THR B O     1 
ATOM   7276 C  CB    . THR B 2 376 ? 18.420 39.332  -7.093  1.00 47.99  ? 376 THR B CB    1 
ATOM   7277 O  OG1   . THR B 2 376 ? 18.995 39.419  -8.402  1.00 40.04  ? 376 THR B OG1   1 
ATOM   7278 C  CG2   . THR B 2 376 ? 17.647 38.027  -6.974  1.00 41.33  ? 376 THR B CG2   1 
ATOM   7279 N  N     . THR B 2 377 ? 17.809 41.040  -4.497  1.00 52.59  ? 377 THR B N     1 
ATOM   7280 C  CA    . THR B 2 377 ? 17.400 41.092  -3.099  1.00 54.27  ? 377 THR B CA    1 
ATOM   7281 C  C     . THR B 2 377 ? 16.191 42.000  -2.902  1.00 55.54  ? 377 THR B C     1 
ATOM   7282 O  O     . THR B 2 377 ? 15.331 41.712  -2.062  1.00 58.77  ? 377 THR B O     1 
ATOM   7283 C  CB    . THR B 2 377 ? 18.568 41.555  -2.227  1.00 55.60  ? 377 THR B CB    1 
ATOM   7284 O  OG1   . THR B 2 377 ? 19.719 40.748  -2.505  1.00 56.99  ? 377 THR B OG1   1 
ATOM   7285 C  CG2   . THR B 2 377 ? 18.219 41.415  -0.760  1.00 57.37  ? 377 THR B CG2   1 
ATOM   7286 N  N     . GLU B 2 378 ? 16.101 43.090  -3.668  1.00 57.03  ? 378 GLU B N     1 
ATOM   7287 C  CA    . GLU B 2 378 ? 14.922 43.946  -3.587  1.00 53.68  ? 378 GLU B CA    1 
ATOM   7288 C  C     . GLU B 2 378 ? 13.679 43.221  -4.085  1.00 53.50  ? 378 GLU B C     1 
ATOM   7289 O  O     . GLU B 2 378 ? 12.615 43.307  -3.461  1.00 61.96  ? 378 GLU B O     1 
ATOM   7290 C  CB    . GLU B 2 378 ? 15.148 45.232  -4.382  1.00 55.50  ? 378 GLU B CB    1 
ATOM   7291 C  CG    . GLU B 2 378 ? 16.167 46.172  -3.765  1.00 63.58  ? 378 GLU B CG    1 
ATOM   7292 C  CD    . GLU B 2 378 ? 16.401 47.410  -4.606  1.00 74.44  ? 378 GLU B CD    1 
ATOM   7293 O  OE1   . GLU B 2 378 ? 15.789 47.518  -5.689  1.00 66.27  ? 378 GLU B OE1   1 
ATOM   7294 O  OE2   . GLU B 2 378 ? 17.198 48.274  -4.183  1.00 84.08  ? 378 GLU B OE2   1 
ATOM   7295 N  N     . SER B 2 379 ? 13.792 42.502  -5.205  1.00 46.07  ? 379 SER B N     1 
ATOM   7296 C  CA    . SER B 2 379 ? 12.644 41.774  -5.735  1.00 49.51  ? 379 SER B CA    1 
ATOM   7297 C  C     . SER B 2 379 ? 12.170 40.694  -4.771  1.00 59.88  ? 379 SER B C     1 
ATOM   7298 O  O     . SER B 2 379 ? 10.965 40.432  -4.678  1.00 72.29  ? 379 SER B O     1 
ATOM   7299 C  CB    . SER B 2 379 ? 12.992 41.159  -7.091  1.00 49.07  ? 379 SER B CB    1 
ATOM   7300 O  OG    . SER B 2 379 ? 13.386 42.156  -8.017  1.00 54.12  ? 379 SER B OG    1 
ATOM   7301 N  N     . ILE B 2 380 ? 13.094 40.061  -4.047  1.00 48.35  ? 380 ILE B N     1 
ATOM   7302 C  CA    . ILE B 2 380 ? 12.699 39.062  -3.060  1.00 54.11  ? 380 ILE B CA    1 
ATOM   7303 C  C     . ILE B 2 380 ? 11.985 39.724  -1.887  1.00 62.16  ? 380 ILE B C     1 
ATOM   7304 O  O     . ILE B 2 380 ? 11.009 39.186  -1.352  1.00 73.61  ? 380 ILE B O     1 
ATOM   7305 C  CB    . ILE B 2 380 ? 13.925 38.254  -2.600  1.00 59.90  ? 380 ILE B CB    1 
ATOM   7306 C  CG1   . ILE B 2 380 ? 14.562 37.534  -3.789  1.00 60.98  ? 380 ILE B CG1   1 
ATOM   7307 C  CG2   . ILE B 2 380 ? 13.533 37.253  -1.526  1.00 55.26  ? 380 ILE B CG2   1 
ATOM   7308 C  CD1   . ILE B 2 380 ? 15.944 36.988  -3.508  1.00 48.77  ? 380 ILE B CD1   1 
ATOM   7309 N  N     . VAL B 2 381 ? 12.451 40.902  -1.473  1.00 63.83  ? 381 VAL B N     1 
ATOM   7310 C  CA    . VAL B 2 381 ? 11.810 41.593  -0.358  1.00 62.01  ? 381 VAL B CA    1 
ATOM   7311 C  C     . VAL B 2 381 ? 10.467 42.173  -0.787  1.00 64.54  ? 381 VAL B C     1 
ATOM   7312 O  O     . VAL B 2 381 ? 9.482  42.110  -0.041  1.00 71.20  ? 381 VAL B O     1 
ATOM   7313 C  CB    . VAL B 2 381 ? 12.747 42.675  0.208   1.00 61.43  ? 381 VAL B CB    1 
ATOM   7314 C  CG1   . VAL B 2 381 ? 12.024 43.523  1.242   1.00 63.85  ? 381 VAL B CG1   1 
ATOM   7315 C  CG2   . VAL B 2 381 ? 13.983 42.033  0.820   1.00 63.32  ? 381 VAL B CG2   1 
ATOM   7316 N  N     . ILE B 2 382 ? 10.398 42.730  -1.996  1.00 60.96  ? 382 ILE B N     1 
ATOM   7317 C  CA    . ILE B 2 382 ? 9.175  43.393  -2.442  1.00 58.92  ? 382 ILE B CA    1 
ATOM   7318 C  C     . ILE B 2 382 ? 8.160  42.376  -2.953  1.00 56.05  ? 382 ILE B C     1 
ATOM   7319 O  O     . ILE B 2 382 ? 7.019  42.324  -2.481  1.00 52.21  ? 382 ILE B O     1 
ATOM   7320 C  CB    . ILE B 2 382 ? 9.496  44.456  -3.508  1.00 60.13  ? 382 ILE B CB    1 
ATOM   7321 C  CG1   . ILE B 2 382 ? 10.416 45.531  -2.924  1.00 58.68  ? 382 ILE B CG1   1 
ATOM   7322 C  CG2   . ILE B 2 382 ? 8.217  45.090  -4.028  1.00 59.80  ? 382 ILE B CG2   1 
ATOM   7323 C  CD1   . ILE B 2 382 ? 10.877 46.559  -3.934  1.00 53.21  ? 382 ILE B CD1   1 
ATOM   7324 N  N     . TRP B 2 383 ? 8.559  41.550  -3.922  1.00 65.07  ? 383 TRP B N     1 
ATOM   7325 C  CA    . TRP B 2 383 ? 7.636  40.623  -4.564  1.00 59.15  ? 383 TRP B CA    1 
ATOM   7326 C  C     . TRP B 2 383 ? 7.890  39.159  -4.233  1.00 64.04  ? 383 TRP B C     1 
ATOM   7327 O  O     . TRP B 2 383 ? 7.069  38.312  -4.602  1.00 64.48  ? 383 TRP B O     1 
ATOM   7328 C  CB    . TRP B 2 383 ? 7.679  40.802  -6.090  1.00 49.29  ? 383 TRP B CB    1 
ATOM   7329 C  CG    . TRP B 2 383 ? 7.311  42.179  -6.536  1.00 51.86  ? 383 TRP B CG    1 
ATOM   7330 C  CD1   . TRP B 2 383 ? 6.054  42.701  -6.635  1.00 49.62  ? 383 TRP B CD1   1 
ATOM   7331 C  CD2   . TRP B 2 383 ? 8.209  43.214  -6.950  1.00 55.81  ? 383 TRP B CD2   1 
ATOM   7332 N  NE1   . TRP B 2 383 ? 6.114  43.998  -7.082  1.00 54.81  ? 383 TRP B NE1   1 
ATOM   7333 C  CE2   . TRP B 2 383 ? 7.426  44.337  -7.284  1.00 54.90  ? 383 TRP B CE2   1 
ATOM   7334 C  CE3   . TRP B 2 383 ? 9.600  43.301  -7.070  1.00 45.19  ? 383 TRP B CE3   1 
ATOM   7335 C  CZ2   . TRP B 2 383 ? 7.987  45.532  -7.729  1.00 53.63  ? 383 TRP B CZ2   1 
ATOM   7336 C  CZ3   . TRP B 2 383 ? 10.154 44.486  -7.512  1.00 49.45  ? 383 TRP B CZ3   1 
ATOM   7337 C  CH2   . TRP B 2 383 ? 9.349  45.586  -7.836  1.00 57.04  ? 383 TRP B CH2   1 
ATOM   7338 N  N     . GLY B 2 384 ? 8.989  38.834  -3.556  1.00 61.13  ? 384 GLY B N     1 
ATOM   7339 C  CA    . GLY B 2 384 ? 9.274  37.442  -3.249  1.00 52.56  ? 384 GLY B CA    1 
ATOM   7340 C  C     . GLY B 2 384 ? 9.549  36.592  -4.466  1.00 56.36  ? 384 GLY B C     1 
ATOM   7341 O  O     . GLY B 2 384 ? 9.249  35.393  -4.461  1.00 56.06  ? 384 GLY B O     1 
ATOM   7342 N  N     . LYS B 2 385 ? 10.115 37.183  -5.514  1.00 55.39  ? 385 LYS B N     1 
ATOM   7343 C  CA    . LYS B 2 385 ? 10.371 36.489  -6.765  1.00 54.49  ? 385 LYS B CA    1 
ATOM   7344 C  C     . LYS B 2 385 ? 11.706 36.957  -7.321  1.00 64.27  ? 385 LYS B C     1 
ATOM   7345 O  O     . LYS B 2 385 ? 12.155 38.071  -7.040  1.00 71.25  ? 385 LYS B O     1 
ATOM   7346 C  CB    . LYS B 2 385 ? 9.248  36.744  -7.782  1.00 56.38  ? 385 LYS B CB    1 
ATOM   7347 C  CG    . LYS B 2 385 ? 9.227  35.800  -8.973  1.00 63.42  ? 385 LYS B CG    1 
ATOM   7348 C  CD    . LYS B 2 385 ? 8.310  36.335  -10.064 1.00 78.68  ? 385 LYS B CD    1 
ATOM   7349 C  CE    . LYS B 2 385 ? 8.109  35.328  -11.186 1.00 81.06  ? 385 LYS B CE    1 
ATOM   7350 N  NZ    . LYS B 2 385 ? 7.167  34.241  -10.802 1.00 80.60  ? 385 LYS B NZ    1 
ATOM   7351 N  N     . THR B 2 386 ? 12.332 36.104  -8.097  1.00 71.48  ? 386 THR B N     1 
ATOM   7352 C  CA    . THR B 2 386 ? 13.605 36.488  -8.690  1.00 56.38  ? 386 THR B CA    1 
ATOM   7353 C  C     . THR B 2 386 ? 13.388 37.068  -10.086 1.00 47.71  ? 386 THR B C     1 
ATOM   7354 O  O     . THR B 2 386 ? 12.520 36.597  -10.826 1.00 47.48  ? 386 THR B O     1 
ATOM   7355 C  CB    . THR B 2 386 ? 14.545 35.288  -8.772  1.00 55.35  ? 386 THR B CB    1 
ATOM   7356 O  OG1   . THR B 2 386 ? 15.652 35.600  -9.624  1.00 62.04  ? 386 THR B OG1   1 
ATOM   7357 C  CG2   . THR B 2 386 ? 13.810 34.071  -9.322  1.00 67.23  ? 386 THR B CG2   1 
ATOM   7358 N  N     . PRO B 2 387 ? 14.143 38.096  -10.466 1.00 48.69  ? 387 PRO B N     1 
ATOM   7359 C  CA    . PRO B 2 387 ? 13.996 38.673  -11.803 1.00 40.06  ? 387 PRO B CA    1 
ATOM   7360 C  C     . PRO B 2 387 ? 14.936 38.048  -12.821 1.00 45.04  ? 387 PRO B C     1 
ATOM   7361 O  O     . PRO B 2 387 ? 16.023 37.562  -12.502 1.00 53.71  ? 387 PRO B O     1 
ATOM   7362 C  CB    . PRO B 2 387 ? 14.345 40.155  -11.583 1.00 39.88  ? 387 PRO B CB    1 
ATOM   7363 C  CG    . PRO B 2 387 ? 14.886 40.259  -10.158 1.00 45.48  ? 387 PRO B CG    1 
ATOM   7364 C  CD    . PRO B 2 387 ? 15.085 38.869  -9.646  1.00 48.96  ? 387 PRO B CD    1 
ATOM   7365 N  N     . LYS B 2 388 ? 14.489 38.070  -14.073 1.00 40.08  ? 388 LYS B N     1 
ATOM   7366 C  CA    . LYS B 2 388 ? 15.298 37.633  -15.205 1.00 38.23  ? 388 LYS B CA    1 
ATOM   7367 C  C     . LYS B 2 388 ? 16.051 38.845  -15.743 1.00 49.10  ? 388 LYS B C     1 
ATOM   7368 O  O     . LYS B 2 388 ? 15.448 39.748  -16.332 1.00 61.38  ? 388 LYS B O     1 
ATOM   7369 C  CB    . LYS B 2 388 ? 14.421 36.998  -16.281 1.00 44.51  ? 388 LYS B CB    1 
ATOM   7370 C  CG    . LYS B 2 388 ? 15.186 36.447  -17.472 1.00 67.90  ? 388 LYS B CG    1 
ATOM   7371 C  CD    . LYS B 2 388 ? 14.242 35.798  -18.473 1.00 77.33  ? 388 LYS B CD    1 
ATOM   7372 C  CE    . LYS B 2 388 ? 15.002 35.185  -19.637 1.00 79.33  ? 388 LYS B CE    1 
ATOM   7373 N  NZ    . LYS B 2 388 ? 15.973 34.151  -19.184 1.00 82.55  ? 388 LYS B NZ    1 
ATOM   7374 N  N     . PHE B 2 389 ? 17.363 38.869  -15.536 1.00 49.23  ? 389 PHE B N     1 
ATOM   7375 C  CA    . PHE B 2 389 ? 18.164 40.033  -15.881 1.00 43.32  ? 389 PHE B CA    1 
ATOM   7376 C  C     . PHE B 2 389 ? 18.554 40.026  -17.354 1.00 50.37  ? 389 PHE B C     1 
ATOM   7377 O  O     . PHE B 2 389 ? 18.806 38.976  -17.951 1.00 58.02  ? 389 PHE B O     1 
ATOM   7378 C  CB    . PHE B 2 389 ? 19.430 40.086  -15.024 1.00 36.50  ? 389 PHE B CB    1 
ATOM   7379 C  CG    . PHE B 2 389 ? 19.188 40.523  -13.611 1.00 39.03  ? 389 PHE B CG    1 
ATOM   7380 C  CD1   . PHE B 2 389 ? 18.727 39.626  -12.666 1.00 42.26  ? 389 PHE B CD1   1 
ATOM   7381 C  CD2   . PHE B 2 389 ? 19.430 41.833  -13.226 1.00 37.16  ? 389 PHE B CD2   1 
ATOM   7382 C  CE1   . PHE B 2 389 ? 18.504 40.025  -11.364 1.00 45.27  ? 389 PHE B CE1   1 
ATOM   7383 C  CE2   . PHE B 2 389 ? 19.212 42.238  -11.923 1.00 37.84  ? 389 PHE B CE2   1 
ATOM   7384 C  CZ    . PHE B 2 389 ? 18.749 41.332  -10.990 1.00 46.90  ? 389 PHE B CZ    1 
ATOM   7385 N  N     . LYS B 2 390 ? 18.604 41.221  -17.933 1.00 44.10  ? 390 LYS B N     1 
ATOM   7386 C  CA    . LYS B 2 390 ? 19.159 41.450  -19.263 1.00 41.74  ? 390 LYS B CA    1 
ATOM   7387 C  C     . LYS B 2 390 ? 20.465 42.212  -19.055 1.00 45.07  ? 390 LYS B C     1 
ATOM   7388 O  O     . LYS B 2 390 ? 20.481 43.441  -18.982 1.00 58.91  ? 390 LYS B O     1 
ATOM   7389 C  CB    . LYS B 2 390 ? 18.185 42.217  -20.149 1.00 39.57  ? 390 LYS B CB    1 
ATOM   7390 C  CG    . LYS B 2 390 ? 16.945 41.428  -20.529 1.00 44.88  ? 390 LYS B CG    1 
ATOM   7391 C  CD    . LYS B 2 390 ? 16.084 42.206  -21.509 1.00 51.20  ? 390 LYS B CD    1 
ATOM   7392 C  CE    . LYS B 2 390 ? 14.855 41.413  -21.910 1.00 53.81  ? 390 LYS B CE    1 
ATOM   7393 N  NZ    . LYS B 2 390 ? 14.023 42.151  -22.898 1.00 66.27  ? 390 LYS B NZ    1 
ATOM   7394 N  N     . LEU B 2 391 ? 21.559 41.469  -18.958 1.00 43.94  ? 391 LEU B N     1 
ATOM   7395 C  CA    . LEU B 2 391 ? 22.835 42.049  -18.558 1.00 34.74  ? 391 LEU B CA    1 
ATOM   7396 C  C     . LEU B 2 391 ? 23.545 42.657  -19.762 1.00 36.78  ? 391 LEU B C     1 
ATOM   7397 O  O     . LEU B 2 391 ? 23.663 42.002  -20.803 1.00 34.30  ? 391 LEU B O     1 
ATOM   7398 C  CB    . LEU B 2 391 ? 23.716 40.991  -17.909 1.00 34.76  ? 391 LEU B CB    1 
ATOM   7399 C  CG    . LEU B 2 391 ? 23.077 40.296  -16.707 1.00 35.30  ? 391 LEU B CG    1 
ATOM   7400 C  CD1   . LEU B 2 391 ? 23.977 39.191  -16.172 1.00 41.00  ? 391 LEU B CD1   1 
ATOM   7401 C  CD2   . LEU B 2 391 ? 22.766 41.312  -15.622 1.00 35.52  ? 391 LEU B CD2   1 
ATOM   7402 N  N     . PRO B 2 392 ? 24.056 43.973  -19.653 1.00 43.66  ? 392 PRO B N     1 
ATOM   7403 C  CA    . PRO B 2 392 ? 24.821 44.612  -20.742 1.00 47.03  ? 392 PRO B CA    1 
ATOM   7404 C  C     . PRO B 2 392 ? 26.299 44.246  -20.679 1.00 51.04  ? 392 PRO B C     1 
ATOM   7405 O  O     . PRO B 2 392 ? 27.184 45.074  -20.430 1.00 52.03  ? 392 PRO B O     1 
ATOM   7406 C  CB    . PRO B 2 392 ? 24.570 46.099  -20.481 1.00 43.92  ? 392 PRO B CB    1 
ATOM   7407 C  CG    . PRO B 2 392 ? 24.518 46.175  -18.986 1.00 41.39  ? 392 PRO B CG    1 
ATOM   7408 C  CD    . PRO B 2 392 ? 23.852 44.894  -18.520 1.00 47.88  ? 392 PRO B CD    1 
ATOM   7409 N  N     . ILE B 2 393 ? 26.589 42.966  -20.904 1.00 47.10  ? 393 ILE B N     1 
ATOM   7410 C  CA    . ILE B 2 393 ? 27.948 42.454  -20.802 1.00 39.98  ? 393 ILE B CA    1 
ATOM   7411 C  C     . ILE B 2 393 ? 28.106 41.314  -21.797 1.00 48.90  ? 393 ILE B C     1 
ATOM   7412 O  O     . ILE B 2 393 ? 27.152 40.592  -22.098 1.00 50.03  ? 393 ILE B O     1 
ATOM   7413 C  CB    . ILE B 2 393 ? 28.272 42.001  -19.356 1.00 41.53  ? 393 ILE B CB    1 
ATOM   7414 C  CG1   . ILE B 2 393 ? 29.735 41.569  -19.228 1.00 40.71  ? 393 ILE B CG1   1 
ATOM   7415 C  CG2   . ILE B 2 393 ? 27.334 40.884  -18.914 1.00 34.33  ? 393 ILE B CG2   1 
ATOM   7416 C  CD1   . ILE B 2 393 ? 30.190 41.370  -17.799 1.00 36.70  ? 393 ILE B CD1   1 
ATOM   7417 N  N     . GLN B 2 394 ? 29.317 41.178  -22.334 1.00 60.95  ? 394 GLN B N     1 
ATOM   7418 C  CA    . GLN B 2 394 ? 29.632 40.033  -23.176 1.00 58.16  ? 394 GLN B CA    1 
ATOM   7419 C  C     . GLN B 2 394 ? 29.467 38.749  -22.375 1.00 57.15  ? 394 GLN B C     1 
ATOM   7420 O  O     . GLN B 2 394 ? 29.830 38.684  -21.197 1.00 57.65  ? 394 GLN B O     1 
ATOM   7421 C  CB    . GLN B 2 394 ? 31.058 40.150  -23.716 1.00 64.15  ? 394 GLN B CB    1 
ATOM   7422 C  CG    . GLN B 2 394 ? 31.448 39.066  -24.709 1.00 81.72  ? 394 GLN B CG    1 
ATOM   7423 C  CD    . GLN B 2 394 ? 32.904 39.156  -25.128 1.00 87.10  ? 394 GLN B CD    1 
ATOM   7424 O  OE1   . GLN B 2 394 ? 33.517 38.156  -25.503 1.00 91.89  ? 394 GLN B OE1   1 
ATOM   7425 N  NE2   . GLN B 2 394 ? 33.466 40.359  -25.066 1.00 77.06  ? 394 GLN B NE2   1 
ATOM   7426 N  N     . LYS B 2 395 ? 28.899 37.727  -23.021 1.00 57.52  ? 395 LYS B N     1 
ATOM   7427 C  CA    . LYS B 2 395 ? 28.594 36.483  -22.319 1.00 51.13  ? 395 LYS B CA    1 
ATOM   7428 C  C     . LYS B 2 395 ? 29.846 35.859  -21.715 1.00 50.29  ? 395 LYS B C     1 
ATOM   7429 O  O     . LYS B 2 395 ? 29.824 35.392  -20.569 1.00 40.84  ? 395 LYS B O     1 
ATOM   7430 C  CB    . LYS B 2 395 ? 27.911 35.500  -23.269 1.00 57.42  ? 395 LYS B CB    1 
ATOM   7431 C  CG    . LYS B 2 395 ? 27.682 34.123  -22.672 1.00 62.37  ? 395 LYS B CG    1 
ATOM   7432 C  CD    . LYS B 2 395 ? 26.816 33.266  -23.576 1.00 71.49  ? 395 LYS B CD    1 
ATOM   7433 C  CE    . LYS B 2 395 ? 26.482 31.941  -22.914 1.00 76.25  ? 395 LYS B CE    1 
ATOM   7434 N  NZ    . LYS B 2 395 ? 27.695 31.108  -22.691 1.00 74.35  ? 395 LYS B NZ    1 
ATOM   7435 N  N     . GLU B 2 396 ? 30.950 35.850  -22.465 1.00 67.89  ? 396 GLU B N     1 
ATOM   7436 C  CA    . GLU B 2 396 ? 32.179 35.246  -21.958 1.00 68.36  ? 396 GLU B CA    1 
ATOM   7437 C  C     . GLU B 2 396 ? 32.768 36.066  -20.816 1.00 67.85  ? 396 GLU B C     1 
ATOM   7438 O  O     . GLU B 2 396 ? 33.313 35.503  -19.859 1.00 73.35  ? 396 GLU B O     1 
ATOM   7439 C  CB    . GLU B 2 396 ? 33.196 35.098  -23.089 1.00 66.99  ? 396 GLU B CB    1 
ATOM   7440 C  CG    . GLU B 2 396 ? 32.582 34.885  -24.462 1.00 76.55  ? 396 GLU B CG    1 
ATOM   7441 C  CD    . GLU B 2 396 ? 31.906 33.538  -24.608 1.00 81.18  ? 396 GLU B CD    1 
ATOM   7442 O  OE1   . GLU B 2 396 ? 32.234 32.614  -23.833 1.00 91.71  ? 396 GLU B OE1   1 
ATOM   7443 O  OE2   . GLU B 2 396 ? 31.045 33.402  -25.503 1.00 74.34  ? 396 GLU B OE2   1 
ATOM   7444 N  N     . THR B 2 397 ? 32.672 37.396  -20.902 1.00 61.54  ? 397 THR B N     1 
ATOM   7445 C  CA    . THR B 2 397 ? 33.183 38.249  -19.833 1.00 63.66  ? 397 THR B CA    1 
ATOM   7446 C  C     . THR B 2 397 ? 32.473 37.963  -18.516 1.00 66.18  ? 397 THR B C     1 
ATOM   7447 O  O     . THR B 2 397 ? 33.111 37.890  -17.458 1.00 65.54  ? 397 THR B O     1 
ATOM   7448 C  CB    . THR B 2 397 ? 33.020 39.723  -20.209 1.00 57.13  ? 397 THR B CB    1 
ATOM   7449 O  OG1   . THR B 2 397 ? 33.588 39.960  -21.503 1.00 57.57  ? 397 THR B OG1   1 
ATOM   7450 C  CG2   . THR B 2 397 ? 33.707 40.614  -19.186 1.00 45.52  ? 397 THR B CG2   1 
ATOM   7451 N  N     . TRP B 2 398 ? 31.151 37.795  -18.563 1.00 55.85  ? 398 TRP B N     1 
ATOM   7452 C  CA    . TRP B 2 398 ? 30.383 37.546  -17.349 1.00 46.19  ? 398 TRP B CA    1 
ATOM   7453 C  C     . TRP B 2 398 ? 30.696 36.172  -16.770 1.00 52.26  ? 398 TRP B C     1 
ATOM   7454 O  O     . TRP B 2 398 ? 31.015 36.046  -15.582 1.00 49.43  ? 398 TRP B O     1 
ATOM   7455 C  CB    . TRP B 2 398 ? 28.890 37.684  -17.647 1.00 46.30  ? 398 TRP B CB    1 
ATOM   7456 C  CG    . TRP B 2 398 ? 27.997 37.300  -16.510 1.00 42.45  ? 398 TRP B CG    1 
ATOM   7457 C  CD1   . TRP B 2 398 ? 27.414 36.084  -16.301 1.00 48.00  ? 398 TRP B CD1   1 
ATOM   7458 C  CD2   . TRP B 2 398 ? 27.576 38.138  -15.427 1.00 37.13  ? 398 TRP B CD2   1 
ATOM   7459 N  NE1   . TRP B 2 398 ? 26.660 36.113  -15.154 1.00 52.13  ? 398 TRP B NE1   1 
ATOM   7460 C  CE2   . TRP B 2 398 ? 26.742 37.362  -14.598 1.00 44.92  ? 398 TRP B CE2   1 
ATOM   7461 C  CE3   . TRP B 2 398 ? 27.826 39.467  -15.076 1.00 35.32  ? 398 TRP B CE3   1 
ATOM   7462 C  CZ2   . TRP B 2 398 ? 26.156 37.871  -13.442 1.00 43.33  ? 398 TRP B CZ2   1 
ATOM   7463 C  CZ3   . TRP B 2 398 ? 27.243 39.971  -13.928 1.00 35.75  ? 398 TRP B CZ3   1 
ATOM   7464 C  CH2   . TRP B 2 398 ? 26.418 39.175  -13.125 1.00 42.64  ? 398 TRP B CH2   1 
ATOM   7465 N  N     . GLU B 2 399 ? 30.622 35.128  -17.599 1.00 53.67  ? 399 GLU B N     1 
ATOM   7466 C  CA    . GLU B 2 399 ? 30.813 33.767  -17.110 1.00 54.73  ? 399 GLU B CA    1 
ATOM   7467 C  C     . GLU B 2 399 ? 32.229 33.514  -16.608 1.00 46.43  ? 399 GLU B C     1 
ATOM   7468 O  O     . GLU B 2 399 ? 32.449 32.535  -15.887 1.00 43.73  ? 399 GLU B O     1 
ATOM   7469 C  CB    . GLU B 2 399 ? 30.466 32.761  -18.207 1.00 58.94  ? 399 GLU B CB    1 
ATOM   7470 C  CG    . GLU B 2 399 ? 29.044 32.881  -18.721 1.00 67.76  ? 399 GLU B CG    1 
ATOM   7471 C  CD    . GLU B 2 399 ? 28.726 31.862  -19.795 1.00 81.74  ? 399 GLU B CD    1 
ATOM   7472 O  OE1   . GLU B 2 399 ? 27.584 31.357  -19.817 1.00 94.32  ? 399 GLU B OE1   1 
ATOM   7473 O  OE2   . GLU B 2 399 ? 29.619 31.562  -20.615 1.00 80.43  ? 399 GLU B OE2   1 
ATOM   7474 N  N     . THR B 2 400 ? 33.188 34.369  -16.962 1.00 45.54  ? 400 THR B N     1 
ATOM   7475 C  CA    . THR B 2 400 ? 34.559 34.161  -16.511 1.00 50.64  ? 400 THR B CA    1 
ATOM   7476 C  C     . THR B 2 400 ? 34.766 34.647  -15.079 1.00 57.76  ? 400 THR B C     1 
ATOM   7477 O  O     . THR B 2 400 ? 35.502 34.016  -14.311 1.00 61.49  ? 400 THR B O     1 
ATOM   7478 C  CB    . THR B 2 400 ? 35.538 34.860  -17.461 1.00 57.22  ? 400 THR B CB    1 
ATOM   7479 O  OG1   . THR B 2 400 ? 35.432 34.283  -18.769 1.00 69.39  ? 400 THR B OG1   1 
ATOM   7480 C  CG2   . THR B 2 400 ? 36.971 34.712  -16.969 1.00 48.82  ? 400 THR B CG2   1 
ATOM   7481 N  N     . TRP B 2 401 ? 34.114 35.745  -14.686 1.00 54.51  ? 401 TRP B N     1 
ATOM   7482 C  CA    . TRP B 2 401 ? 34.426 36.388  -13.418 1.00 44.99  ? 401 TRP B CA    1 
ATOM   7483 C  C     . TRP B 2 401 ? 33.261 36.538  -12.448 1.00 48.96  ? 401 TRP B C     1 
ATOM   7484 O  O     . TRP B 2 401 ? 33.500 36.914  -11.295 1.00 54.53  ? 401 TRP B O     1 
ATOM   7485 C  CB    . TRP B 2 401 ? 35.030 37.781  -13.663 1.00 45.46  ? 401 TRP B CB    1 
ATOM   7486 C  CG    . TRP B 2 401 ? 36.418 37.737  -14.213 1.00 51.25  ? 401 TRP B CG    1 
ATOM   7487 C  CD1   . TRP B 2 401 ? 37.550 37.359  -13.550 1.00 55.80  ? 401 TRP B CD1   1 
ATOM   7488 C  CD2   . TRP B 2 401 ? 36.829 38.092  -15.538 1.00 51.82  ? 401 TRP B CD2   1 
ATOM   7489 N  NE1   . TRP B 2 401 ? 38.639 37.451  -14.382 1.00 57.34  ? 401 TRP B NE1   1 
ATOM   7490 C  CE2   . TRP B 2 401 ? 38.224 37.899  -15.608 1.00 63.07  ? 401 TRP B CE2   1 
ATOM   7491 C  CE3   . TRP B 2 401 ? 36.154 38.553  -16.673 1.00 57.55  ? 401 TRP B CE3   1 
ATOM   7492 C  CZ2   . TRP B 2 401 ? 38.955 38.150  -16.767 1.00 77.34  ? 401 TRP B CZ2   1 
ATOM   7493 C  CZ3   . TRP B 2 401 ? 36.882 38.801  -17.823 1.00 70.22  ? 401 TRP B CZ3   1 
ATOM   7494 C  CH2   . TRP B 2 401 ? 38.268 38.600  -17.862 1.00 80.50  ? 401 TRP B CH2   1 
ATOM   7495 N  N     . TRP B 2 402 ? 32.019 36.257  -12.857 1.00 43.47  ? 402 TRP B N     1 
ATOM   7496 C  CA    . TRP B 2 402 ? 30.891 36.587  -11.987 1.00 43.16  ? 402 TRP B CA    1 
ATOM   7497 C  C     . TRP B 2 402 ? 30.885 35.752  -10.710 1.00 56.92  ? 402 TRP B C     1 
ATOM   7498 O  O     . TRP B 2 402 ? 30.426 36.231  -9.667  1.00 62.26  ? 402 TRP B O     1 
ATOM   7499 C  CB    . TRP B 2 402 ? 29.565 36.435  -12.736 1.00 38.07  ? 402 TRP B CB    1 
ATOM   7500 C  CG    . TRP B 2 402 ? 29.071 35.027  -12.884 1.00 45.40  ? 402 TRP B CG    1 
ATOM   7501 C  CD1   . TRP B 2 402 ? 29.300 34.185  -13.931 1.00 41.82  ? 402 TRP B CD1   1 
ATOM   7502 C  CD2   . TRP B 2 402 ? 28.241 34.304  -11.963 1.00 45.99  ? 402 TRP B CD2   1 
ATOM   7503 N  NE1   . TRP B 2 402 ? 28.674 32.981  -13.717 1.00 54.33  ? 402 TRP B NE1   1 
ATOM   7504 C  CE2   . TRP B 2 402 ? 28.017 33.028  -12.516 1.00 46.35  ? 402 TRP B CE2   1 
ATOM   7505 C  CE3   . TRP B 2 402 ? 27.671 34.611  -10.723 1.00 45.37  ? 402 TRP B CE3   1 
ATOM   7506 C  CZ2   . TRP B 2 402 ? 27.249 32.059  -11.873 1.00 40.38  ? 402 TRP B CZ2   1 
ATOM   7507 C  CZ3   . TRP B 2 402 ? 26.908 33.648  -10.086 1.00 41.41  ? 402 TRP B CZ3   1 
ATOM   7508 C  CH2   . TRP B 2 402 ? 26.705 32.387  -10.662 1.00 45.08  ? 402 TRP B CH2   1 
ATOM   7509 N  N     . THR B 2 403 ? 31.393 34.518  -10.760 1.00 66.54  ? 403 THR B N     1 
ATOM   7510 C  CA    . THR B 2 403 ? 31.471 33.709  -9.548  1.00 60.78  ? 403 THR B CA    1 
ATOM   7511 C  C     . THR B 2 403 ? 32.507 34.239  -8.566  1.00 57.66  ? 403 THR B C     1 
ATOM   7512 O  O     . THR B 2 403 ? 32.420 33.939  -7.370  1.00 52.07  ? 403 THR B O     1 
ATOM   7513 C  CB    . THR B 2 403 ? 31.795 32.253  -9.889  1.00 55.37  ? 403 THR B CB    1 
ATOM   7514 O  OG1   . THR B 2 403 ? 32.971 32.200  -10.706 1.00 51.26  ? 403 THR B OG1   1 
ATOM   7515 C  CG2   . THR B 2 403 ? 30.633 31.605  -10.624 1.00 58.45  ? 403 THR B CG2   1 
ATOM   7516 N  N     . GLU B 2 404 ? 33.480 35.020  -9.039  1.00 58.27  ? 404 GLU B N     1 
ATOM   7517 C  CA    . GLU B 2 404 ? 34.507 35.551  -8.154  1.00 55.26  ? 404 GLU B CA    1 
ATOM   7518 C  C     . GLU B 2 404 ? 33.956 36.592  -7.187  1.00 56.32  ? 404 GLU B C     1 
ATOM   7519 O  O     . GLU B 2 404 ? 34.572 36.838  -6.145  1.00 65.32  ? 404 GLU B O     1 
ATOM   7520 C  CB    . GLU B 2 404 ? 35.647 36.153  -8.980  1.00 57.95  ? 404 GLU B CB    1 
ATOM   7521 C  CG    . GLU B 2 404 ? 37.037 35.946  -8.395  1.00 71.78  ? 404 GLU B CG    1 
ATOM   7522 C  CD    . GLU B 2 404 ? 37.453 34.485  -8.372  1.00 83.60  ? 404 GLU B CD    1 
ATOM   7523 O  OE1   . GLU B 2 404 ? 38.118 34.070  -7.399  1.00 92.65  ? 404 GLU B OE1   1 
ATOM   7524 O  OE2   . GLU B 2 404 ? 37.116 33.751  -9.325  1.00 81.08  ? 404 GLU B OE2   1 
ATOM   7525 N  N     . TYR B 2 405 ? 32.809 37.198  -7.498  1.00 60.68  ? 405 TYR B N     1 
ATOM   7526 C  CA    . TYR B 2 405 ? 32.239 38.245  -6.662  1.00 61.08  ? 405 TYR B CA    1 
ATOM   7527 C  C     . TYR B 2 405 ? 30.884 37.884  -6.071  1.00 53.50  ? 405 TYR B C     1 
ATOM   7528 O  O     . TYR B 2 405 ? 30.342 38.669  -5.284  1.00 53.76  ? 405 TYR B O     1 
ATOM   7529 C  CB    . TYR B 2 405 ? 32.111 39.552  -7.459  1.00 52.97  ? 405 TYR B CB    1 
ATOM   7530 C  CG    . TYR B 2 405 ? 33.302 39.840  -8.342  1.00 49.55  ? 405 TYR B CG    1 
ATOM   7531 C  CD1   . TYR B 2 405 ? 34.515 40.239  -7.797  1.00 47.01  ? 405 TYR B CD1   1 
ATOM   7532 C  CD2   . TYR B 2 405 ? 33.213 39.710  -9.722  1.00 45.40  ? 405 TYR B CD2   1 
ATOM   7533 C  CE1   . TYR B 2 405 ? 35.608 40.500  -8.603  1.00 39.87  ? 405 TYR B CE1   1 
ATOM   7534 C  CE2   . TYR B 2 405 ? 34.299 39.970  -10.535 1.00 46.44  ? 405 TYR B CE2   1 
ATOM   7535 C  CZ    . TYR B 2 405 ? 35.494 40.364  -9.971  1.00 45.54  ? 405 TYR B CZ    1 
ATOM   7536 O  OH    . TYR B 2 405 ? 36.576 40.624  -10.778 1.00 53.40  ? 405 TYR B OH    1 
ATOM   7537 N  N     . TRP B 2 406 ? 30.324 36.727  -6.415  1.00 46.24  ? 406 TRP B N     1 
ATOM   7538 C  CA    . TRP B 2 406 ? 29.009 36.357  -5.914  1.00 47.15  ? 406 TRP B CA    1 
ATOM   7539 C  C     . TRP B 2 406 ? 29.054 36.082  -4.414  1.00 49.35  ? 406 TRP B C     1 
ATOM   7540 O  O     . TRP B 2 406 ? 30.050 35.589  -3.877  1.00 70.15  ? 406 TRP B O     1 
ATOM   7541 C  CB    . TRP B 2 406 ? 28.476 35.130  -6.652  1.00 48.33  ? 406 TRP B CB    1 
ATOM   7542 C  CG    . TRP B 2 406 ? 26.989 35.016  -6.580  1.00 52.23  ? 406 TRP B CG    1 
ATOM   7543 C  CD1   . TRP B 2 406 ? 26.263 34.182  -5.780  1.00 56.71  ? 406 TRP B CD1   1 
ATOM   7544 C  CD2   . TRP B 2 406 ? 26.039 35.782  -7.327  1.00 50.07  ? 406 TRP B CD2   1 
ATOM   7545 N  NE1   . TRP B 2 406 ? 24.919 34.375  -5.991  1.00 50.23  ? 406 TRP B NE1   1 
ATOM   7546 C  CE2   . TRP B 2 406 ? 24.755 35.353  -6.936  1.00 51.39  ? 406 TRP B CE2   1 
ATOM   7547 C  CE3   . TRP B 2 406 ? 26.149 36.786  -8.293  1.00 45.15  ? 406 TRP B CE3   1 
ATOM   7548 C  CZ2   . TRP B 2 406 ? 23.593 35.894  -7.477  1.00 53.13  ? 406 TRP B CZ2   1 
ATOM   7549 C  CZ3   . TRP B 2 406 ? 24.996 37.320  -8.829  1.00 38.42  ? 406 TRP B CZ3   1 
ATOM   7550 C  CH2   . TRP B 2 406 ? 23.734 36.875  -8.420  1.00 50.14  ? 406 TRP B CH2   1 
ATOM   7551 N  N     . GLN B 2 407 ? 27.952 36.409  -3.738  1.00 47.86  ? 407 GLN B N     1 
ATOM   7552 C  CA    . GLN B 2 407 ? 27.874 36.284  -2.290  1.00 47.06  ? 407 GLN B CA    1 
ATOM   7553 C  C     . GLN B 2 407 ? 26.519 35.811  -1.785  1.00 49.51  ? 407 GLN B C     1 
ATOM   7554 O  O     . GLN B 2 407 ? 26.358 35.648  -0.571  1.00 46.00  ? 407 GLN B O     1 
ATOM   7555 C  CB    . GLN B 2 407 ? 28.219 37.626  -1.624  1.00 43.89  ? 407 GLN B CB    1 
ATOM   7556 C  CG    . GLN B 2 407 ? 29.704 37.929  -1.567  1.00 50.24  ? 407 GLN B CG    1 
ATOM   7557 C  CD    . GLN B 2 407 ? 30.402 37.152  -0.472  1.00 67.02  ? 407 GLN B CD    1 
ATOM   7558 O  OE1   . GLN B 2 407 ? 30.103 37.326  0.710   1.00 72.04  ? 407 GLN B OE1   1 
ATOM   7559 N  NE2   . GLN B 2 407 ? 31.329 36.282  -0.858  1.00 65.73  ? 407 GLN B NE2   1 
ATOM   7560 N  N     . ALA B 2 408 ? 25.546 35.588  -2.662  1.00 49.88  ? 408 ALA B N     1 
ATOM   7561 C  CA    . ALA B 2 408 ? 24.210 35.172  -2.267  1.00 47.33  ? 408 ALA B CA    1 
ATOM   7562 C  C     . ALA B 2 408 ? 24.040 33.669  -2.459  1.00 48.82  ? 408 ALA B C     1 
ATOM   7563 O  O     . ALA B 2 408 ? 24.727 33.045  -3.271  1.00 42.60  ? 408 ALA B O     1 
ATOM   7564 C  CB    . ALA B 2 408 ? 23.147 35.924  -3.071  1.00 42.91  ? 408 ALA B CB    1 
ATOM   7565 N  N     . THR B 2 409 ? 23.107 33.093  -1.699  1.00 53.61  ? 409 THR B N     1 
ATOM   7566 C  CA    . THR B 2 409 ? 22.850 31.661  -1.781  1.00 51.65  ? 409 THR B CA    1 
ATOM   7567 C  C     . THR B 2 409 ? 22.007 31.281  -2.991  1.00 59.11  ? 409 THR B C     1 
ATOM   7568 O  O     . THR B 2 409 ? 22.014 30.111  -3.390  1.00 61.66  ? 409 THR B O     1 
ATOM   7569 C  CB    . THR B 2 409 ? 22.162 31.170  -0.504  1.00 48.29  ? 409 THR B CB    1 
ATOM   7570 O  OG1   . THR B 2 409 ? 20.873 31.785  -0.383  1.00 62.28  ? 409 THR B OG1   1 
ATOM   7571 C  CG2   . THR B 2 409 ? 23.001 31.518  0.718   1.00 47.62  ? 409 THR B CG2   1 
ATOM   7572 N  N     . TRP B 2 410 ? 21.287 32.231  -3.577  1.00 57.54  ? 410 TRP B N     1 
ATOM   7573 C  CA    . TRP B 2 410 ? 20.498 31.993  -4.775  1.00 49.47  ? 410 TRP B CA    1 
ATOM   7574 C  C     . TRP B 2 410 ? 21.221 32.532  -6.005  1.00 46.09  ? 410 TRP B C     1 
ATOM   7575 O  O     . TRP B 2 410 ? 22.198 33.279  -5.910  1.00 51.38  ? 410 TRP B O     1 
ATOM   7576 C  CB    . TRP B 2 410 ? 19.111 32.632  -4.643  1.00 45.61  ? 410 TRP B CB    1 
ATOM   7577 C  CG    . TRP B 2 410 ? 19.103 33.913  -3.862  1.00 48.66  ? 410 TRP B CG    1 
ATOM   7578 C  CD1   . TRP B 2 410 ? 18.614 34.098  -2.603  1.00 60.48  ? 410 TRP B CD1   1 
ATOM   7579 C  CD2   . TRP B 2 410 ? 19.609 35.186  -4.285  1.00 42.80  ? 410 TRP B CD2   1 
ATOM   7580 N  NE1   . TRP B 2 410 ? 18.780 35.406  -2.216  1.00 52.45  ? 410 TRP B NE1   1 
ATOM   7581 C  CE2   . TRP B 2 410 ? 19.390 36.094  -3.230  1.00 43.70  ? 410 TRP B CE2   1 
ATOM   7582 C  CE3   . TRP B 2 410 ? 20.225 35.647  -5.453  1.00 45.91  ? 410 TRP B CE3   1 
ATOM   7583 C  CZ2   . TRP B 2 410 ? 19.765 37.434  -3.307  1.00 47.17  ? 410 TRP B CZ2   1 
ATOM   7584 C  CZ3   . TRP B 2 410 ? 20.600 36.975  -5.527  1.00 54.70  ? 410 TRP B CZ3   1 
ATOM   7585 C  CH2   . TRP B 2 410 ? 20.366 37.854  -4.461  1.00 54.31  ? 410 TRP B CH2   1 
ATOM   7586 N  N     . ILE B 2 411 ? 20.734 32.127  -7.174  1.00 40.72  ? 411 ILE B N     1 
ATOM   7587 C  CA    . ILE B 2 411 ? 21.259 32.610  -8.449  1.00 39.73  ? 411 ILE B CA    1 
ATOM   7588 C  C     . ILE B 2 411 ? 20.089 32.940  -9.370  1.00 48.10  ? 411 ILE B C     1 
ATOM   7589 O  O     . ILE B 2 411 ? 19.290 32.050  -9.697  1.00 50.14  ? 411 ILE B O     1 
ATOM   7590 C  CB    . ILE B 2 411 ? 22.191 31.583  -9.110  1.00 48.57  ? 411 ILE B CB    1 
ATOM   7591 C  CG1   . ILE B 2 411 ? 23.303 31.149  -8.154  1.00 39.62  ? 411 ILE B CG1   1 
ATOM   7592 C  CG2   . ILE B 2 411 ? 22.803 32.166  -10.371 1.00 44.56  ? 411 ILE B CG2   1 
ATOM   7593 C  CD1   . ILE B 2 411 ? 24.174 30.042  -8.706  1.00 39.32  ? 411 ILE B CD1   1 
ATOM   7594 N  N     . PRO B 2 412 ? 19.945 34.185  -9.812  1.00 47.92  ? 412 PRO B N     1 
ATOM   7595 C  CA    . PRO B 2 412 ? 18.858 34.522  -10.731 1.00 42.41  ? 412 PRO B CA    1 
ATOM   7596 C  C     . PRO B 2 412 ? 19.192 34.128  -12.162 1.00 44.74  ? 412 PRO B C     1 
ATOM   7597 O  O     . PRO B 2 412 ? 20.352 33.960  -12.540 1.00 55.68  ? 412 PRO B O     1 
ATOM   7598 C  CB    . PRO B 2 412 ? 18.751 36.044  -10.595 1.00 41.79  ? 412 PRO B CB    1 
ATOM   7599 C  CG    . PRO B 2 412 ? 20.152 36.465  -10.308 1.00 38.57  ? 412 PRO B CG    1 
ATOM   7600 C  CD    . PRO B 2 412 ? 20.748 35.368  -9.455  1.00 45.42  ? 412 PRO B CD    1 
ATOM   7601 N  N     . GLU B 2 413 ? 18.140 33.981  -12.960 1.00 38.36  ? 413 GLU B N     1 
ATOM   7602 C  CA    . GLU B 2 413 ? 18.316 33.739  -14.382 1.00 45.70  ? 413 GLU B CA    1 
ATOM   7603 C  C     . GLU B 2 413 ? 18.702 35.032  -15.087 1.00 40.79  ? 413 GLU B C     1 
ATOM   7604 O  O     . GLU B 2 413 ? 18.342 36.131  -14.655 1.00 47.45  ? 413 GLU B O     1 
ATOM   7605 C  CB    . GLU B 2 413 ? 17.041 33.167  -14.998 1.00 50.98  ? 413 GLU B CB    1 
ATOM   7606 C  CG    . GLU B 2 413 ? 16.636 31.823  -14.431 1.00 54.98  ? 413 GLU B CG    1 
ATOM   7607 C  CD    . GLU B 2 413 ? 15.480 31.203  -15.185 1.00 76.76  ? 413 GLU B CD    1 
ATOM   7608 O  OE1   . GLU B 2 413 ? 15.394 31.402  -16.416 1.00 76.12  ? 413 GLU B OE1   1 
ATOM   7609 O  OE2   . GLU B 2 413 ? 14.652 30.523  -14.544 1.00 94.55  ? 413 GLU B OE2   1 
ATOM   7610 N  N     . TRP B 2 414 ? 19.445 34.896  -16.182 1.00 37.50  ? 414 TRP B N     1 
ATOM   7611 C  CA    . TRP B 2 414 ? 19.900 36.068  -16.912 1.00 43.11  ? 414 TRP B CA    1 
ATOM   7612 C  C     . TRP B 2 414 ? 20.131 35.723  -18.375 1.00 45.26  ? 414 TRP B C     1 
ATOM   7613 O  O     . TRP B 2 414 ? 20.389 34.570  -18.730 1.00 45.06  ? 414 TRP B O     1 
ATOM   7614 C  CB    . TRP B 2 414 ? 21.183 36.653  -16.304 1.00 36.58  ? 414 TRP B CB    1 
ATOM   7615 C  CG    . TRP B 2 414 ? 22.296 35.660  -16.107 1.00 35.84  ? 414 TRP B CG    1 
ATOM   7616 C  CD1   . TRP B 2 414 ? 22.911 34.909  -17.070 1.00 44.20  ? 414 TRP B CD1   1 
ATOM   7617 C  CD2   . TRP B 2 414 ? 22.945 35.333  -14.871 1.00 42.53  ? 414 TRP B CD2   1 
ATOM   7618 N  NE1   . TRP B 2 414 ? 23.889 34.125  -16.507 1.00 41.52  ? 414 TRP B NE1   1 
ATOM   7619 C  CE2   . TRP B 2 414 ? 23.932 34.368  -15.159 1.00 41.47  ? 414 TRP B CE2   1 
ATOM   7620 C  CE3   . TRP B 2 414 ? 22.784 35.758  -13.550 1.00 38.77  ? 414 TRP B CE3   1 
ATOM   7621 C  CZ2   . TRP B 2 414 ? 24.752 33.821  -14.174 1.00 38.80  ? 414 TRP B CZ2   1 
ATOM   7622 C  CZ3   . TRP B 2 414 ? 23.600 35.215  -12.573 1.00 46.91  ? 414 TRP B CZ3   1 
ATOM   7623 C  CH2   . TRP B 2 414 ? 24.572 34.257  -12.890 1.00 41.25  ? 414 TRP B CH2   1 
ATOM   7624 N  N     . GLU B 2 415 ? 20.018 36.746  -19.217 1.00 44.62  ? 415 GLU B N     1 
ATOM   7625 C  CA    . GLU B 2 415 ? 20.430 36.703  -20.609 1.00 50.97  ? 415 GLU B CA    1 
ATOM   7626 C  C     . GLU B 2 415 ? 21.303 37.920  -20.878 1.00 50.32  ? 415 GLU B C     1 
ATOM   7627 O  O     . GLU B 2 415 ? 21.366 38.855  -20.075 1.00 58.18  ? 415 GLU B O     1 
ATOM   7628 C  CB    . GLU B 2 415 ? 19.227 36.663  -21.562 1.00 56.98  ? 415 GLU B CB    1 
ATOM   7629 C  CG    . GLU B 2 415 ? 18.113 37.640  -21.222 1.00 77.19  ? 415 GLU B CG    1 
ATOM   7630 C  CD    . GLU B 2 415 ? 16.966 37.582  -22.216 1.00 88.46  ? 415 GLU B CD    1 
ATOM   7631 O  OE1   . GLU B 2 415 ? 16.766 38.568  -22.957 1.00 85.67  ? 415 GLU B OE1   1 
ATOM   7632 O  OE2   . GLU B 2 415 ? 16.272 36.545  -22.264 1.00 93.09  ? 415 GLU B OE2   1 
ATOM   7633 N  N     . PHE B 2 416 ? 21.988 37.906  -22.016 1.00 50.21  ? 416 PHE B N     1 
ATOM   7634 C  CA    . PHE B 2 416 ? 22.982 38.921  -22.336 1.00 48.22  ? 416 PHE B CA    1 
ATOM   7635 C  C     . PHE B 2 416 ? 22.508 39.759  -23.514 1.00 52.49  ? 416 PHE B C     1 
ATOM   7636 O  O     . PHE B 2 416 ? 22.152 39.218  -24.567 1.00 52.75  ? 416 PHE B O     1 
ATOM   7637 C  CB    . PHE B 2 416 ? 24.332 38.268  -22.625 1.00 34.41  ? 416 PHE B CB    1 
ATOM   7638 C  CG    . PHE B 2 416 ? 24.825 37.415  -21.496 1.00 44.12  ? 416 PHE B CG    1 
ATOM   7639 C  CD1   . PHE B 2 416 ? 25.360 37.996  -20.360 1.00 34.38  ? 416 PHE B CD1   1 
ATOM   7640 C  CD2   . PHE B 2 416 ? 24.725 36.034  -21.554 1.00 42.28  ? 416 PHE B CD2   1 
ATOM   7641 C  CE1   . PHE B 2 416 ? 25.802 37.218  -19.310 1.00 40.98  ? 416 PHE B CE1   1 
ATOM   7642 C  CE2   . PHE B 2 416 ? 25.166 35.251  -20.506 1.00 34.74  ? 416 PHE B CE2   1 
ATOM   7643 C  CZ    . PHE B 2 416 ? 25.706 35.844  -19.383 1.00 43.00  ? 416 PHE B CZ    1 
ATOM   7644 N  N     . VAL B 2 417 ? 22.508 41.075  -23.329 1.00 47.91  ? 417 VAL B N     1 
ATOM   7645 C  CA    . VAL B 2 417 ? 21.933 42.010  -24.286 1.00 63.66  ? 417 VAL B CA    1 
ATOM   7646 C  C     . VAL B 2 417 ? 23.042 42.845  -24.908 1.00 86.17  ? 417 VAL B C     1 
ATOM   7647 O  O     . VAL B 2 417 ? 24.059 43.149  -24.272 1.00 77.98  ? 417 VAL B O     1 
ATOM   7648 C  CB    . VAL B 2 417 ? 20.873 42.911  -23.612 1.00 57.86  ? 417 VAL B CB    1 
ATOM   7649 C  CG1   . VAL B 2 417 ? 21.501 43.747  -22.503 1.00 44.59  ? 417 VAL B CG1   1 
ATOM   7650 C  CG2   . VAL B 2 417 ? 20.177 43.801  -24.635 1.00 79.68  ? 417 VAL B CG2   1 
ATOM   7651 N  N     . ASN B 2 418 ? 22.850 43.190  -26.180 1.00 119.09 ? 418 ASN B N     1 
ATOM   7652 C  CA    . ASN B 2 418 ? 23.626 44.235  -26.842 1.00 124.95 ? 418 ASN B CA    1 
ATOM   7653 C  C     . ASN B 2 418 ? 22.756 45.488  -26.838 1.00 124.05 ? 418 ASN B C     1 
ATOM   7654 O  O     . ASN B 2 418 ? 22.088 45.826  -27.815 1.00 117.26 ? 418 ASN B O     1 
ATOM   7655 C  CB    . ASN B 2 418 ? 24.027 43.806  -28.249 1.00 125.03 ? 418 ASN B CB    1 
ATOM   7656 C  CG    . ASN B 2 418 ? 25.151 42.787  -28.247 1.00 125.56 ? 418 ASN B CG    1 
ATOM   7657 O  OD1   . ASN B 2 418 ? 24.955 41.626  -27.883 1.00 126.32 ? 418 ASN B OD1   1 
ATOM   7658 N  ND2   . ASN B 2 418 ? 26.339 43.218  -28.654 1.00 123.77 ? 418 ASN B ND2   1 
ATOM   7659 N  N     . THR B 2 419 ? 22.774 46.179  -25.699 1.00 128.96 ? 419 THR B N     1 
ATOM   7660 C  CA    . THR B 2 419 ? 21.783 47.204  -25.410 1.00 132.77 ? 419 THR B CA    1 
ATOM   7661 C  C     . THR B 2 419 ? 21.856 48.341  -26.429 1.00 128.24 ? 419 THR B C     1 
ATOM   7662 O  O     . THR B 2 419 ? 22.916 48.609  -27.004 1.00 120.99 ? 419 THR B O     1 
ATOM   7663 C  CB    . THR B 2 419 ? 21.986 47.753  -23.995 1.00 135.48 ? 419 THR B CB    1 
ATOM   7664 O  OG1   . THR B 2 419 ? 20.892 48.608  -23.643 1.00 134.81 ? 419 THR B OG1   1 
ATOM   7665 C  CG2   . THR B 2 419 ? 23.283 48.545  -23.898 1.00 137.67 ? 419 THR B CG2   1 
ATOM   7666 N  N     . PRO B 2 420 ? 20.730 49.006  -26.699 1.00 134.36 ? 420 PRO B N     1 
ATOM   7667 C  CA    . PRO B 2 420 ? 20.784 50.228  -27.493 1.00 144.30 ? 420 PRO B CA    1 
ATOM   7668 C  C     . PRO B 2 420 ? 21.486 51.329  -26.721 1.00 149.98 ? 420 PRO B C     1 
ATOM   7669 O  O     . PRO B 2 420 ? 21.427 51.372  -25.480 1.00 150.14 ? 420 PRO B O     1 
ATOM   7670 C  CB    . PRO B 2 420 ? 19.300 50.565  -27.726 0.80 146.27 ? 420 PRO B CB    1 
ATOM   7671 C  CG    . PRO B 2 420 ? 18.584 49.898  -26.599 0.80 143.35 ? 420 PRO B CG    1 
ATOM   7672 C  CD    . PRO B 2 420 ? 19.348 48.634  -26.345 0.80 137.17 ? 420 PRO B CD    1 
ATOM   7673 N  N     . PRO B 2 421 ? 22.163 52.246  -27.411 1.00 155.67 ? 421 PRO B N     1 
ATOM   7674 C  CA    . PRO B 2 421 ? 22.781 53.378  -26.713 1.00 152.40 ? 421 PRO B CA    1 
ATOM   7675 C  C     . PRO B 2 421 ? 21.759 54.447  -26.362 1.00 151.04 ? 421 PRO B C     1 
ATOM   7676 O  O     . PRO B 2 421 ? 22.120 55.591  -26.069 1.00 153.31 ? 421 PRO B O     1 
ATOM   7677 C  CB    . PRO B 2 421 ? 23.817 53.899  -27.725 1.00 152.55 ? 421 PRO B CB    1 
ATOM   7678 C  CG    . PRO B 2 421 ? 23.668 53.042  -28.973 1.00 153.25 ? 421 PRO B CG    1 
ATOM   7679 C  CD    . PRO B 2 421 ? 22.354 52.336  -28.866 1.00 156.47 ? 421 PRO B CD    1 
ATOM   7680 N  N     . LEU B 2 422 ? 20.475 54.083  -26.399 1.00 134.99 ? 422 LEU B N     1 
ATOM   7681 C  CA    . LEU B 2 422 ? 19.377 55.017  -26.167 1.00 114.55 ? 422 LEU B CA    1 
ATOM   7682 C  C     . LEU B 2 422 ? 18.865 54.959  -24.731 1.00 108.02 ? 422 LEU B C     1 
ATOM   7683 O  O     . LEU B 2 422 ? 18.827 55.984  -24.044 1.00 113.50 ? 422 LEU B O     1 
ATOM   7684 C  CB    . LEU B 2 422 ? 18.237 54.734  -27.154 1.00 101.77 ? 422 LEU B CB    1 
ATOM   7685 C  CG    . LEU B 2 422 ? 18.601 54.863  -28.634 1.00 96.18  ? 422 LEU B CG    1 
ATOM   7686 C  CD1   . LEU B 2 422 ? 17.373 54.693  -29.511 1.00 87.87  ? 422 LEU B CD1   1 
ATOM   7687 C  CD2   . LEU B 2 422 ? 19.272 56.203  -28.899 1.00 99.93  ? 422 LEU B CD2   1 
ATOM   7688 N  N     . VAL B 2 423 ? 18.464 53.771  -24.265 1.00 96.86  ? 423 VAL B N     1 
ATOM   7689 C  CA    . VAL B 2 423 ? 17.965 53.631  -22.898 1.00 91.10  ? 423 VAL B CA    1 
ATOM   7690 C  C     . VAL B 2 423 ? 19.015 54.086  -21.894 1.00 90.32  ? 423 VAL B C     1 
ATOM   7691 O  O     . VAL B 2 423 ? 18.681 54.531  -20.788 1.00 81.20  ? 423 VAL B O     1 
ATOM   7692 C  CB    . VAL B 2 423 ? 17.518 52.179  -22.636 1.00 86.40  ? 423 VAL B CB    1 
ATOM   7693 C  CG1   . VAL B 2 423 ? 16.736 52.085  -21.334 1.00 83.73  ? 423 VAL B CG1   1 
ATOM   7694 C  CG2   . VAL B 2 423 ? 16.685 51.661  -23.799 1.00 81.99  ? 423 VAL B CG2   1 
ATOM   7695 N  N     . LYS B 2 424 ? 20.295 53.987  -22.260 1.00 102.26 ? 424 LYS B N     1 
ATOM   7696 C  CA    . LYS B 2 424 ? 21.357 54.558  -21.438 1.00 111.19 ? 424 LYS B CA    1 
ATOM   7697 C  C     . LYS B 2 424 ? 21.199 56.069  -21.308 1.00 115.95 ? 424 LYS B C     1 
ATOM   7698 O  O     . LYS B 2 424 ? 21.439 56.636  -20.236 1.00 124.99 ? 424 LYS B O     1 
ATOM   7699 C  CB    . LYS B 2 424 ? 22.717 54.204  -22.040 1.00 114.14 ? 424 LYS B CB    1 
ATOM   7700 C  CG    . LYS B 2 424 ? 23.905 54.919  -21.421 1.00 118.31 ? 424 LYS B CG    1 
ATOM   7701 C  CD    . LYS B 2 424 ? 25.196 54.513  -22.118 1.00 124.17 ? 424 LYS B CD    1 
ATOM   7702 C  CE    . LYS B 2 424 ? 26.391 55.288  -21.586 1.00 123.88 ? 424 LYS B CE    1 
ATOM   7703 N  NZ    . LYS B 2 424 ? 27.654 54.890  -22.269 1.00 118.46 ? 424 LYS B NZ    1 
ATOM   7704 N  N     . LEU B 2 425 ? 20.784 56.736  -22.388 1.00 110.22 ? 425 LEU B N     1 
ATOM   7705 C  CA    . LEU B 2 425 ? 20.644 58.188  -22.364 1.00 98.37  ? 425 LEU B CA    1 
ATOM   7706 C  C     . LEU B 2 425 ? 19.352 58.635  -21.693 1.00 83.82  ? 425 LEU B C     1 
ATOM   7707 O  O     . LEU B 2 425 ? 19.285 59.756  -21.176 1.00 84.05  ? 425 LEU B O     1 
ATOM   7708 C  CB    . LEU B 2 425 ? 20.702 58.750  -23.786 1.00 100.63 ? 425 LEU B CB    1 
ATOM   7709 C  CG    . LEU B 2 425 ? 21.912 58.390  -24.650 1.00 101.55 ? 425 LEU B CG    1 
ATOM   7710 C  CD1   . LEU B 2 425 ? 21.774 58.992  -26.041 1.00 98.87  ? 425 LEU B CD1   1 
ATOM   7711 C  CD2   . LEU B 2 425 ? 23.207 58.838  -23.994 1.00 106.23 ? 425 LEU B CD2   1 
ATOM   7712 N  N     . TRP B 2 426 ? 18.319 57.789  -21.695 1.00 70.64  ? 426 TRP B N     1 
ATOM   7713 C  CA    . TRP B 2 426 ? 17.031 58.210  -21.154 1.00 62.39  ? 426 TRP B CA    1 
ATOM   7714 C  C     . TRP B 2 426 ? 17.052 58.247  -19.631 1.00 61.02  ? 426 TRP B C     1 
ATOM   7715 O  O     . TRP B 2 426 ? 16.511 59.176  -19.019 1.00 60.56  ? 426 TRP B O     1 
ATOM   7716 C  CB    . TRP B 2 426 ? 15.917 57.288  -21.648 1.00 72.55  ? 426 TRP B CB    1 
ATOM   7717 C  CG    . TRP B 2 426 ? 15.872 57.012  -23.141 1.00 76.60  ? 426 TRP B CG    1 
ATOM   7718 C  CD1   . TRP B 2 426 ? 15.523 55.831  -23.732 1.00 78.38  ? 426 TRP B CD1   1 
ATOM   7719 C  CD2   . TRP B 2 426 ? 16.167 57.922  -24.217 1.00 74.50  ? 426 TRP B CD2   1 
ATOM   7720 N  NE1   . TRP B 2 426 ? 15.585 55.942  -25.098 1.00 79.35  ? 426 TRP B NE1   1 
ATOM   7721 C  CE2   . TRP B 2 426 ? 15.977 57.214  -25.423 1.00 78.59  ? 426 TRP B CE2   1 
ATOM   7722 C  CE3   . TRP B 2 426 ? 16.573 59.259  -24.281 1.00 61.57  ? 426 TRP B CE3   1 
ATOM   7723 C  CZ2   . TRP B 2 426 ? 16.181 57.797  -26.673 1.00 68.07  ? 426 TRP B CZ2   1 
ATOM   7724 C  CZ3   . TRP B 2 426 ? 16.778 59.833  -25.524 1.00 58.04  ? 426 TRP B CZ3   1 
ATOM   7725 C  CH2   . TRP B 2 426 ? 16.578 59.104  -26.701 1.00 56.82  ? 426 TRP B CH2   1 
ATOM   7726 N  N     . TYR B 2 427 ? 17.658 57.245  -19.000 1.00 60.61  ? 427 TYR B N     1 
ATOM   7727 C  CA    . TYR B 2 427 ? 17.782 57.215  -17.549 1.00 56.43  ? 427 TYR B CA    1 
ATOM   7728 C  C     . TYR B 2 427 ? 19.061 57.874  -17.054 1.00 67.59  ? 427 TYR B C     1 
ATOM   7729 O  O     . TYR B 2 427 ? 19.314 57.875  -15.845 1.00 68.66  ? 427 TYR B O     1 
ATOM   7730 C  CB    . TYR B 2 427 ? 17.706 55.770  -17.044 1.00 43.58  ? 427 TYR B CB    1 
ATOM   7731 C  CG    . TYR B 2 427 ? 16.371 55.110  -17.307 1.00 44.68  ? 427 TYR B CG    1 
ATOM   7732 C  CD1   . TYR B 2 427 ? 15.255 55.434  -16.546 1.00 48.70  ? 427 TYR B CD1   1 
ATOM   7733 C  CD2   . TYR B 2 427 ? 16.226 54.167  -18.316 1.00 37.56  ? 427 TYR B CD2   1 
ATOM   7734 C  CE1   . TYR B 2 427 ? 14.031 54.837  -16.784 1.00 50.81  ? 427 TYR B CE1   1 
ATOM   7735 C  CE2   . TYR B 2 427 ? 15.005 53.565  -18.559 1.00 37.77  ? 427 TYR B CE2   1 
ATOM   7736 C  CZ    . TYR B 2 427 ? 13.913 53.903  -17.790 1.00 49.78  ? 427 TYR B CZ    1 
ATOM   7737 O  OH    . TYR B 2 427 ? 12.697 53.305  -18.030 1.00 55.57  ? 427 TYR B OH    1 
ATOM   7738 N  N     . GLN B 2 428 ? 19.864 58.436  -17.955 1.00 82.85  ? 428 GLN B N     1 
ATOM   7739 C  CA    . GLN B 2 428 ? 21.084 59.126  -17.561 1.00 102.18 ? 428 GLN B CA    1 
ATOM   7740 C  C     . GLN B 2 428 ? 20.749 60.381  -16.764 1.00 120.33 ? 428 GLN B C     1 
ATOM   7741 O  O     . GLN B 2 428 ? 19.858 61.150  -17.139 1.00 120.53 ? 428 GLN B O     1 
ATOM   7742 C  CB    . GLN B 2 428 ? 21.908 59.487  -18.797 1.00 105.82 ? 428 GLN B CB    1 
ATOM   7743 C  CG    . GLN B 2 428 ? 23.048 60.462  -18.537 1.00 117.25 ? 428 GLN B CG    1 
ATOM   7744 C  CD    . GLN B 2 428 ? 24.161 59.859  -17.701 1.00 124.69 ? 428 GLN B CD    1 
ATOM   7745 O  OE1   . GLN B 2 428 ? 24.756 58.848  -18.073 1.00 123.29 ? 428 GLN B OE1   1 
ATOM   7746 N  NE2   . GLN B 2 428 ? 24.448 60.482  -16.563 1.00 126.19 ? 428 GLN B NE2   1 
ATOM   7747 N  N     . LEU B 2 429 ? 21.464 60.585  -15.663 1.00 140.15 ? 429 LEU B N     1 
ATOM   7748 C  CA    . LEU B 2 429 ? 21.283 61.761  -14.829 1.00 141.17 ? 429 LEU B CA    1 
ATOM   7749 C  C     . LEU B 2 429 ? 22.211 62.884  -15.285 1.00 137.89 ? 429 LEU B C     1 
ATOM   7750 O  O     . LEU B 2 429 ? 23.161 62.673  -16.042 1.00 138.96 ? 429 LEU B O     1 
ATOM   7751 C  CB    . LEU B 2 429 ? 21.541 61.432  -13.356 1.00 141.24 ? 429 LEU B CB    1 
ATOM   7752 C  CG    . LEU B 2 429 ? 20.527 60.553  -12.613 1.00 136.87 ? 429 LEU B CG    1 
ATOM   7753 C  CD1   . LEU B 2 429 ? 20.723 59.074  -12.923 1.00 131.31 ? 429 LEU B CD1   1 
ATOM   7754 C  CD2   . LEU B 2 429 ? 20.605 60.801  -11.114 1.00 136.39 ? 429 LEU B CD2   1 
ATOM   7755 N  N     . GLU B 2 430 ? 21.920 64.092  -14.810 0.50 132.42 ? 430 GLU B N     1 
ATOM   7756 C  CA    . GLU B 2 430 ? 22.718 65.262  -15.157 1.00 124.57 ? 430 GLU B CA    1 
ATOM   7757 C  C     . GLU B 2 430 ? 23.117 66.045  -13.910 0.50 118.05 ? 430 GLU B C     1 
ATOM   7758 O  O     . GLU B 2 430 ? 23.968 65.607  -13.136 0.50 111.29 ? 430 GLU B O     1 
ATOM   7759 C  CB    . GLU B 2 430 ? 21.952 66.167  -16.125 0.50 120.28 ? 430 GLU B CB    1 
ATOM   7760 P  P     . DG  C 3 4   ? 4.486  37.388  -35.042 1.00 93.26  ? 805 DG  P P     1 
ATOM   7761 O  OP1   . DG  C 3 4   ? 4.374  38.433  -34.001 1.00 90.98  ? 805 DG  P OP1   1 
ATOM   7762 O  OP2   . DG  C 3 4   ? 3.956  36.029  -34.791 1.00 100.25 ? 805 DG  P OP2   1 
ATOM   7763 O  "O5'" . DG  C 3 4   ? 3.826  37.929  -36.394 1.00 91.28  ? 805 DG  P "O5'" 1 
ATOM   7764 C  "C5'" . DG  C 3 4   ? 2.723  37.243  -36.973 1.00 91.13  ? 805 DG  P "C5'" 1 
ATOM   7765 C  "C4'" . DG  C 3 4   ? 2.317  37.895  -38.281 1.00 89.98  ? 805 DG  P "C4'" 1 
ATOM   7766 O  "O4'" . DG  C 3 4   ? 1.824  39.230  -38.017 1.00 88.22  ? 805 DG  P "O4'" 1 
ATOM   7767 C  "C3'" . DG  C 3 4   ? 3.445  38.042  -39.290 1.00 87.18  ? 805 DG  P "C3'" 1 
ATOM   7768 O  "O3'" . DG  C 3 4   ? 3.407  36.945  -40.198 1.00 90.26  ? 805 DG  P "O3'" 1 
ATOM   7769 C  "C2'" . DG  C 3 4   ? 3.128  39.360  -39.998 1.00 81.78  ? 805 DG  P "C2'" 1 
ATOM   7770 C  "C1'" . DG  C 3 4   ? 2.369  40.155  -38.935 1.00 85.17  ? 805 DG  P "C1'" 1 
ATOM   7771 N  N9    . DG  C 3 4   ? 3.189  41.111  -38.190 1.00 79.74  ? 805 DG  P N9    1 
ATOM   7772 C  C8    . DG  C 3 4   ? 3.363  41.158  -36.828 1.00 79.59  ? 805 DG  P C8    1 
ATOM   7773 N  N7    . DG  C 3 4   ? 4.141  42.127  -36.434 1.00 77.46  ? 805 DG  P N7    1 
ATOM   7774 C  C5    . DG  C 3 4   ? 4.504  42.770  -37.609 1.00 76.10  ? 805 DG  P C5    1 
ATOM   7775 C  C6    . DG  C 3 4   ? 5.338  43.895  -37.809 1.00 73.66  ? 805 DG  P C6    1 
ATOM   7776 O  O6    . DG  C 3 4   ? 5.939  44.566  -36.958 1.00 72.18  ? 805 DG  P O6    1 
ATOM   7777 N  N1    . DG  C 3 4   ? 5.445  44.224  -39.158 1.00 73.00  ? 805 DG  P N1    1 
ATOM   7778 C  C2    . DG  C 3 4   ? 4.824  43.551  -40.183 1.00 74.50  ? 805 DG  P C2    1 
ATOM   7779 N  N2    . DG  C 3 4   ? 5.046  44.017  -41.421 1.00 73.54  ? 805 DG  P N2    1 
ATOM   7780 N  N3    . DG  C 3 4   ? 4.038  42.494  -40.010 1.00 81.02  ? 805 DG  P N3    1 
ATOM   7781 C  C4    . DG  C 3 4   ? 3.924  42.160  -38.701 1.00 77.47  ? 805 DG  P C4    1 
ATOM   7782 P  P     . DT  C 3 5   ? 4.761  36.195  -40.630 1.00 98.05  ? 806 DT  P P     1 
ATOM   7783 O  OP1   . DT  C 3 5   ? 4.380  34.979  -41.382 1.00 105.24 ? 806 DT  P OP1   1 
ATOM   7784 O  OP2   . DT  C 3 5   ? 5.625  36.083  -39.434 1.00 82.64  ? 806 DT  P OP2   1 
ATOM   7785 O  "O5'" . DT  C 3 5   ? 5.452  37.217  -41.642 1.00 88.50  ? 806 DT  P "O5'" 1 
ATOM   7786 C  "C5'" . DT  C 3 5   ? 4.734  37.691  -42.775 1.00 87.00  ? 806 DT  P "C5'" 1 
ATOM   7787 C  "C4'" . DT  C 3 5   ? 5.556  38.713  -43.536 1.00 86.60  ? 806 DT  P "C4'" 1 
ATOM   7788 O  "O4'" . DT  C 3 5   ? 5.737  39.896  -42.713 1.00 86.86  ? 806 DT  P "O4'" 1 
ATOM   7789 C  "C3'" . DT  C 3 5   ? 6.957  38.244  -43.920 1.00 84.91  ? 806 DT  P "C3'" 1 
ATOM   7790 O  "O3'" . DT  C 3 5   ? 7.301  38.730  -45.206 1.00 88.13  ? 806 DT  P "O3'" 1 
ATOM   7791 C  "C2'" . DT  C 3 5   ? 7.838  38.852  -42.836 1.00 81.40  ? 806 DT  P "C2'" 1 
ATOM   7792 C  "C1'" . DT  C 3 5   ? 7.113  40.156  -42.535 1.00 80.60  ? 806 DT  P "C1'" 1 
ATOM   7793 N  N1    . DT  C 3 5   ? 7.327  40.638  -41.141 1.00 79.43  ? 806 DT  P N1    1 
ATOM   7794 C  C2    . DT  C 3 5   ? 7.926  41.858  -40.935 1.00 79.56  ? 806 DT  P C2    1 
ATOM   7795 O  O2    . DT  C 3 5   ? 8.291  42.585  -41.841 1.00 92.06  ? 806 DT  P O2    1 
ATOM   7796 N  N3    . DT  C 3 5   ? 8.083  42.203  -39.618 1.00 72.06  ? 806 DT  P N3    1 
ATOM   7797 C  C4    . DT  C 3 5   ? 7.711  41.463  -38.511 1.00 73.52  ? 806 DT  P C4    1 
ATOM   7798 O  O4    . DT  C 3 5   ? 7.893  41.859  -37.364 1.00 73.42  ? 806 DT  P O4    1 
ATOM   7799 C  C5    . DT  C 3 5   ? 7.091  40.190  -38.798 1.00 75.82  ? 806 DT  P C5    1 
ATOM   7800 C  C7    . DT  C 3 5   ? 6.645  39.299  -37.677 1.00 77.57  ? 806 DT  P C7    1 
ATOM   7801 C  C6    . DT  C 3 5   ? 6.933  39.843  -40.084 1.00 76.34  ? 806 DT  P C6    1 
ATOM   7802 P  P     . DC  C 3 6   ? 8.521  38.068  -46.015 1.00 99.61  ? 807 DC  P P     1 
ATOM   7803 O  OP1   . DC  C 3 6   ? 8.160  38.086  -47.450 1.00 98.71  ? 807 DC  P OP1   1 
ATOM   7804 O  OP2   . DC  C 3 6   ? 8.872  36.790  -45.356 1.00 94.09  ? 807 DC  P OP2   1 
ATOM   7805 O  "O5'" . DC  C 3 6   ? 9.734  39.078  -45.770 1.00 102.74 ? 807 DC  P "O5'" 1 
ATOM   7806 C  "C5'" . DC  C 3 6   ? 9.656  40.404  -46.264 1.00 94.27  ? 807 DC  P "C5'" 1 
ATOM   7807 C  "C4'" . DC  C 3 6   ? 10.805 41.244  -45.743 1.00 82.55  ? 807 DC  P "C4'" 1 
ATOM   7808 O  "O4'" . DC  C 3 6   ? 10.615 41.519  -44.328 1.00 80.30  ? 807 DC  P "O4'" 1 
ATOM   7809 C  "C3'" . DC  C 3 6   ? 12.193 40.605  -45.870 1.00 73.98  ? 807 DC  P "C3'" 1 
ATOM   7810 O  "O3'" . DC  C 3 6   ? 13.115 41.582  -46.350 1.00 75.86  ? 807 DC  P "O3'" 1 
ATOM   7811 C  "C2'" . DC  C 3 6   ? 12.507 40.186  -44.432 1.00 70.20  ? 807 DC  P "C2'" 1 
ATOM   7812 C  "C1'" . DC  C 3 6   ? 11.834 41.304  -43.660 1.00 73.62  ? 807 DC  P "C1'" 1 
ATOM   7813 N  N1    . DC  C 3 6   ? 11.552 40.977  -42.234 1.00 75.20  ? 807 DC  P N1    1 
ATOM   7814 C  C2    . DC  C 3 6   ? 11.852 41.914  -41.240 1.00 77.45  ? 807 DC  P C2    1 
ATOM   7815 O  O2    . DC  C 3 6   ? 12.346 43.001  -41.566 1.00 70.80  ? 807 DC  P O2    1 
ATOM   7816 N  N3    . DC  C 3 6   ? 11.591 41.605  -39.945 1.00 79.37  ? 807 DC  P N3    1 
ATOM   7817 C  C4    . DC  C 3 6   ? 11.057 40.422  -39.636 1.00 72.61  ? 807 DC  P C4    1 
ATOM   7818 N  N4    . DC  C 3 6   ? 10.817 40.163  -38.347 1.00 71.21  ? 807 DC  P N4    1 
ATOM   7819 C  C5    . DC  C 3 6   ? 10.746 39.454  -40.636 1.00 72.06  ? 807 DC  P C5    1 
ATOM   7820 C  C6    . DC  C 3 6   ? 11.010 39.770  -41.908 1.00 71.56  ? 807 DC  P C6    1 
ATOM   7821 P  P     . DC  C 3 7   ? 14.585 41.168  -46.854 1.00 78.07  ? 808 DC  P P     1 
ATOM   7822 O  OP1   . DC  C 3 7   ? 14.698 41.585  -48.269 1.00 82.06  ? 808 DC  P OP1   1 
ATOM   7823 O  OP2   . DC  C 3 7   ? 14.851 39.761  -46.481 1.00 76.17  ? 808 DC  P OP2   1 
ATOM   7824 O  "O5'" . DC  C 3 7   ? 15.545 42.095  -45.979 1.00 77.20  ? 808 DC  P "O5'" 1 
ATOM   7825 C  "C5'" . DC  C 3 7   ? 15.251 42.299  -44.609 1.00 68.77  ? 808 DC  P "C5'" 1 
ATOM   7826 C  "C4'" . DC  C 3 7   ? 16.263 43.212  -43.958 1.00 63.75  ? 808 DC  P "C4'" 1 
ATOM   7827 O  "O4'" . DC  C 3 7   ? 15.965 43.305  -42.547 1.00 71.11  ? 808 DC  P "O4'" 1 
ATOM   7828 C  "C3'" . DC  C 3 7   ? 17.695 42.715  -44.016 1.00 63.75  ? 808 DC  P "C3'" 1 
ATOM   7829 O  "O3'" . DC  C 3 7   ? 18.588 43.805  -43.836 1.00 65.22  ? 808 DC  P "O3'" 1 
ATOM   7830 C  "C2'" . DC  C 3 7   ? 17.737 41.756  -42.834 1.00 60.79  ? 808 DC  P "C2'" 1 
ATOM   7831 C  "C1'" . DC  C 3 7   ? 16.847 42.471  -41.816 1.00 64.84  ? 808 DC  P "C1'" 1 
ATOM   7832 N  N1    . DC  C 3 7   ? 16.037 41.541  -40.975 1.00 62.84  ? 808 DC  P N1    1 
ATOM   7833 C  C2    . DC  C 3 7   ? 15.890 41.798  -39.608 1.00 68.57  ? 808 DC  P C2    1 
ATOM   7834 O  O2    . DC  C 3 7   ? 16.431 42.798  -39.122 1.00 74.82  ? 808 DC  P O2    1 
ATOM   7835 N  N3    . DC  C 3 7   ? 15.156 40.942  -38.854 1.00 74.59  ? 808 DC  P N3    1 
ATOM   7836 C  C4    . DC  C 3 7   ? 14.590 39.874  -39.416 1.00 66.77  ? 808 DC  P C4    1 
ATOM   7837 N  N4    . DC  C 3 7   ? 13.876 39.060  -38.632 1.00 68.71  ? 808 DC  P N4    1 
ATOM   7838 C  C5    . DC  C 3 7   ? 14.730 39.594  -40.808 1.00 66.83  ? 808 DC  P C5    1 
ATOM   7839 C  C6    . DC  C 3 7   ? 15.456 40.444  -41.541 1.00 67.19  ? 808 DC  P C6    1 
ATOM   7840 P  P     . DC  C 3 8   ? 20.161 43.618  -44.104 1.00 55.78  ? 809 DC  P P     1 
ATOM   7841 O  OP1   . DC  C 3 8   ? 20.670 44.893  -44.654 1.00 67.94  ? 809 DC  P OP1   1 
ATOM   7842 O  OP2   . DC  C 3 8   ? 20.354 42.361  -44.859 1.00 56.28  ? 809 DC  P OP2   1 
ATOM   7843 O  "O5'" . DC  C 3 8   ? 20.772 43.428  -42.642 1.00 54.64  ? 809 DC  P "O5'" 1 
ATOM   7844 C  "C5'" . DC  C 3 8   ? 20.668 44.480  -41.702 1.00 53.58  ? 809 DC  P "C5'" 1 
ATOM   7845 C  "C4'" . DC  C 3 8   ? 20.940 43.983  -40.296 1.00 63.31  ? 809 DC  P "C4'" 1 
ATOM   7846 O  "O4'" . DC  C 3 8   ? 19.904 43.067  -39.890 1.00 68.43  ? 809 DC  P "O4'" 1 
ATOM   7847 C  "C3'" . DC  C 3 8   ? 22.263 43.230  -40.115 1.00 57.09  ? 809 DC  P "C3'" 1 
ATOM   7848 O  "O3'" . DC  C 3 8   ? 23.134 44.001  -39.301 1.00 58.01  ? 809 DC  P "O3'" 1 
ATOM   7849 C  "C2'" . DC  C 3 8   ? 21.865 41.904  -39.437 1.00 56.61  ? 809 DC  P "C2'" 1 
ATOM   7850 C  "C1'" . DC  C 3 8   ? 20.451 42.189  -38.948 1.00 66.25  ? 809 DC  P "C1'" 1 
ATOM   7851 N  N1    . DC  C 3 8   ? 19.582 40.981  -38.867 1.00 65.63  ? 809 DC  P N1    1 
ATOM   7852 C  C2    . DC  C 3 8   ? 19.104 40.558  -37.622 1.00 63.52  ? 809 DC  P C2    1 
ATOM   7853 O  O2    . DC  C 3 8   ? 19.416 41.194  -36.608 1.00 61.04  ? 809 DC  P O2    1 
ATOM   7854 N  N3    . DC  C 3 8   ? 18.312 39.459  -37.563 1.00 66.52  ? 809 DC  P N3    1 
ATOM   7855 C  C4    . DC  C 3 8   ? 17.999 38.800  -38.679 1.00 63.95  ? 809 DC  P C4    1 
ATOM   7856 N  N4    . DC  C 3 8   ? 17.214 37.723  -38.569 1.00 66.22  ? 809 DC  P N4    1 
ATOM   7857 C  C5    . DC  C 3 8   ? 18.475 39.217  -39.957 1.00 62.75  ? 809 DC  P C5    1 
ATOM   7858 C  C6    . DC  C 3 8   ? 19.256 40.301  -40.003 1.00 69.86  ? 809 DC  P C6    1 
ATOM   7859 P  P     . DT  C 3 9   ? 24.632 43.504  -39.004 1.00 58.63  ? 810 DT  P P     1 
ATOM   7860 O  OP1   . DT  C 3 9   ? 25.448 44.712  -38.751 1.00 71.58  ? 810 DT  P OP1   1 
ATOM   7861 O  OP2   . DT  C 3 9   ? 25.031 42.559  -40.071 1.00 50.79  ? 810 DT  P OP2   1 
ATOM   7862 O  "O5'" . DT  C 3 9   ? 24.491 42.699  -37.632 1.00 51.49  ? 810 DT  P "O5'" 1 
ATOM   7863 C  "C5'" . DT  C 3 9   ? 23.841 43.311  -36.527 1.00 61.25  ? 810 DT  P "C5'" 1 
ATOM   7864 C  "C4'" . DT  C 3 9   ? 23.730 42.348  -35.361 1.00 65.39  ? 810 DT  P "C4'" 1 
ATOM   7865 O  "O4'" . DT  C 3 9   ? 22.632 41.429  -35.587 1.00 71.29  ? 810 DT  P "O4'" 1 
ATOM   7866 C  "C3'" . DT  C 3 9   ? 24.972 41.488  -35.117 1.00 64.52  ? 810 DT  P "C3'" 1 
ATOM   7867 O  "O3'" . DT  C 3 9   ? 25.366 41.588  -33.760 1.00 73.54  ? 810 DT  P "O3'" 1 
ATOM   7868 C  "C2'" . DT  C 3 9   ? 24.515 40.071  -35.469 1.00 69.07  ? 810 DT  P "C2'" 1 
ATOM   7869 C  "C1'" . DT  C 3 9   ? 23.024 40.140  -35.190 1.00 69.32  ? 810 DT  P "C1'" 1 
ATOM   7870 N  N1    . DT  C 3 9   ? 22.231 39.145  -35.966 1.00 63.96  ? 810 DT  P N1    1 
ATOM   7871 C  C2    . DT  C 3 9   ? 21.155 38.528  -35.372 1.00 65.61  ? 810 DT  P C2    1 
ATOM   7872 O  O2    . DT  C 3 9   ? 20.800 38.756  -34.228 1.00 62.15  ? 810 DT  P O2    1 
ATOM   7873 N  N3    . DT  C 3 9   ? 20.498 37.631  -36.172 1.00 62.53  ? 810 DT  P N3    1 
ATOM   7874 C  C4    . DT  C 3 9   ? 20.806 37.294  -37.478 1.00 63.61  ? 810 DT  P C4    1 
ATOM   7875 O  O4    . DT  C 3 9   ? 20.154 36.473  -38.116 1.00 64.19  ? 810 DT  P O4    1 
ATOM   7876 C  C5    . DT  C 3 9   ? 21.948 37.976  -38.038 1.00 62.42  ? 810 DT  P C5    1 
ATOM   7877 C  C7    . DT  C 3 9   ? 22.379 37.693  -39.446 1.00 59.91  ? 810 DT  P C7    1 
ATOM   7878 C  C6    . DT  C 3 9   ? 22.598 38.857  -37.264 1.00 60.59  ? 810 DT  P C6    1 
ATOM   7879 P  P     . DG  C 3 10  ? 26.845 41.149  -33.312 1.00 70.00  ? 811 DG  P P     1 
ATOM   7880 O  OP1   . DG  C 3 10  ? 27.451 42.294  -32.596 1.00 80.54  ? 811 DG  P OP1   1 
ATOM   7881 O  OP2   . DG  C 3 10  ? 27.527 40.571  -34.490 1.00 66.48  ? 811 DG  P OP2   1 
ATOM   7882 O  "O5'" . DG  C 3 10  ? 26.583 39.973  -32.263 1.00 73.47  ? 811 DG  P "O5'" 1 
ATOM   7883 C  "C5'" . DG  C 3 10  ? 25.679 40.177  -31.185 1.00 80.81  ? 811 DG  P "C5'" 1 
ATOM   7884 C  "C4'" . DG  C 3 10  ? 25.160 38.850  -30.668 1.00 86.16  ? 811 DG  P "C4'" 1 
ATOM   7885 O  "O4'" . DG  C 3 10  ? 24.224 38.297  -31.623 1.00 88.19  ? 811 DG  P "O4'" 1 
ATOM   7886 C  "C3'" . DG  C 3 10  ? 26.238 37.787  -30.447 1.00 88.04  ? 811 DG  P "C3'" 1 
ATOM   7887 O  "O3'" . DG  C 3 10  ? 26.244 37.370  -29.090 1.00 87.00  ? 811 DG  P "O3'" 1 
ATOM   7888 C  "C2'" . DG  C 3 10  ? 25.858 36.641  -31.395 1.00 95.49  ? 811 DG  P "C2'" 1 
ATOM   7889 C  "C1'" . DG  C 3 10  ? 24.389 36.905  -31.690 1.00 88.74  ? 811 DG  P "C1'" 1 
ATOM   7890 N  N9    . DG  C 3 10  ? 23.987 36.464  -33.021 1.00 76.85  ? 811 DG  P N9    1 
ATOM   7891 C  C8    . DG  C 3 10  ? 24.485 36.909  -34.222 1.00 71.47  ? 811 DG  P C8    1 
ATOM   7892 N  N7    . DG  C 3 10  ? 23.940 36.335  -35.257 1.00 61.11  ? 811 DG  P N7    1 
ATOM   7893 C  C5    . DG  C 3 10  ? 23.021 35.450  -34.709 1.00 62.24  ? 811 DG  P C5    1 
ATOM   7894 C  C6    . DG  C 3 10  ? 22.132 34.552  -35.344 1.00 67.01  ? 811 DG  P C6    1 
ATOM   7895 O  O6    . DG  C 3 10  ? 21.976 34.356  -36.558 1.00 64.68  ? 811 DG  P O6    1 
ATOM   7896 N  N1    . DG  C 3 10  ? 21.373 33.838  -34.420 1.00 75.87  ? 811 DG  P N1    1 
ATOM   7897 C  C2    . DG  C 3 10  ? 21.464 33.975  -33.055 1.00 74.11  ? 811 DG  P C2    1 
ATOM   7898 N  N2    . DG  C 3 10  ? 20.649 33.200  -32.324 1.00 76.13  ? 811 DG  P N2    1 
ATOM   7899 N  N3    . DG  C 3 10  ? 22.292 34.815  -32.446 1.00 66.04  ? 811 DG  P N3    1 
ATOM   7900 C  C4    . DG  C 3 10  ? 23.038 35.517  -33.333 1.00 64.30  ? 811 DG  P C4    1 
ATOM   7901 P  P     . DT  C 3 11  ? 27.339 36.315  -28.571 1.00 78.06  ? 812 DT  P P     1 
ATOM   7902 O  OP1   . DT  C 3 11  ? 27.687 36.684  -27.181 1.00 90.82  ? 812 DT  P OP1   1 
ATOM   7903 O  OP2   . DT  C 3 11  ? 28.406 36.209  -29.591 1.00 64.63  ? 812 DT  P OP2   1 
ATOM   7904 O  "O5'" . DT  C 3 11  ? 26.543 34.932  -28.543 1.00 83.51  ? 812 DT  P "O5'" 1 
ATOM   7905 C  "C5'" . DT  C 3 11  ? 25.342 34.825  -27.793 1.00 75.43  ? 812 DT  P "C5'" 1 
ATOM   7906 C  "C4'" . DT  C 3 11  ? 24.716 33.459  -27.982 1.00 72.41  ? 812 DT  P "C4'" 1 
ATOM   7907 O  "O4'" . DT  C 3 11  ? 24.211 33.344  -29.336 1.00 70.74  ? 812 DT  P "O4'" 1 
ATOM   7908 C  "C3'" . DT  C 3 11  ? 25.673 32.282  -27.771 1.00 70.02  ? 812 DT  P "C3'" 1 
ATOM   7909 O  "O3'" . DT  C 3 11  ? 25.121 31.370  -26.829 1.00 87.73  ? 812 DT  P "O3'" 1 
ATOM   7910 C  "C2'" . DT  C 3 11  ? 25.812 31.656  -29.162 1.00 71.51  ? 812 DT  P "C2'" 1 
ATOM   7911 C  "C1'" . DT  C 3 11  ? 24.518 32.070  -29.842 1.00 72.73  ? 812 DT  P "C1'" 1 
ATOM   7912 N  N1    . DT  C 3 11  ? 24.637 32.169  -31.328 1.00 70.71  ? 812 DT  P N1    1 
ATOM   7913 C  C2    . DT  C 3 11  ? 23.772 31.451  -32.121 1.00 72.87  ? 812 DT  P C2    1 
ATOM   7914 O  O2    . DT  C 3 11  ? 22.897 30.732  -31.674 1.00 83.77  ? 812 DT  P O2    1 
ATOM   7915 N  N3    . DT  C 3 11  ? 23.967 31.607  -33.468 1.00 65.86  ? 812 DT  P N3    1 
ATOM   7916 C  C4    . DT  C 3 11  ? 24.921 32.392  -34.089 1.00 63.71  ? 812 DT  P C4    1 
ATOM   7917 O  O4    . DT  C 3 11  ? 25.017 32.467  -35.311 1.00 63.41  ? 812 DT  P O4    1 
ATOM   7918 C  C5    . DT  C 3 11  ? 25.799 33.117  -33.200 1.00 61.85  ? 812 DT  P C5    1 
ATOM   7919 C  C7    . DT  C 3 11  ? 26.875 34.001  -33.757 1.00 59.46  ? 812 DT  P C7    1 
ATOM   7920 C  C6    . DT  C 3 11  ? 25.617 32.971  -31.878 1.00 62.36  ? 812 DT  P C6    1 
ATOM   7921 P  P     . DT  C 3 12  ? 25.928 30.045  -26.404 1.00 95.82  ? 813 DT  P P     1 
ATOM   7922 O  OP1   . DT  C 3 12  ? 25.579 29.748  -24.998 1.00 96.72  ? 813 DT  P OP1   1 
ATOM   7923 O  OP2   . DT  C 3 12  ? 27.348 30.198  -26.796 1.00 78.26  ? 813 DT  P OP2   1 
ATOM   7924 O  "O5'" . DT  C 3 12  ? 25.280 28.908  -27.317 1.00 96.34  ? 813 DT  P "O5'" 1 
ATOM   7925 C  "C5'" . DT  C 3 12  ? 23.880 28.683  -27.264 1.00 93.07  ? 813 DT  P "C5'" 1 
ATOM   7926 C  "C4'" . DT  C 3 12  ? 23.490 27.525  -28.158 1.00 92.23  ? 813 DT  P "C4'" 1 
ATOM   7927 O  "O4'" . DT  C 3 12  ? 23.616 27.922  -29.548 1.00 92.05  ? 813 DT  P "O4'" 1 
ATOM   7928 C  "C3'" . DT  C 3 12  ? 24.343 26.270  -27.990 1.00 98.23  ? 813 DT  P "C3'" 1 
ATOM   7929 O  "O3'" . DT  C 3 12  ? 23.511 25.119  -28.006 1.00 107.83 ? 813 DT  P "O3'" 1 
ATOM   7930 C  "C2'" . DT  C 3 12  ? 25.278 26.314  -29.198 1.00 91.00  ? 813 DT  P "C2'" 1 
ATOM   7931 C  "C1'" . DT  C 3 12  ? 24.400 26.981  -30.244 1.00 87.00  ? 813 DT  P "C1'" 1 
ATOM   7932 N  N1    . DT  C 3 12  ? 25.170 27.700  -31.299 1.00 77.62  ? 813 DT  P N1    1 
ATOM   7933 C  C2    . DT  C 3 12  ? 24.797 27.559  -32.615 1.00 82.12  ? 813 DT  P C2    1 
ATOM   7934 O  O2    . DT  C 3 12  ? 23.860 26.868  -32.973 1.00 85.93  ? 813 DT  P O2    1 
ATOM   7935 N  N3    . DT  C 3 12  ? 25.565 28.261  -33.506 1.00 80.78  ? 813 DT  P N3    1 
ATOM   7936 C  C4    . DT  C 3 12  ? 26.647 29.073  -33.219 1.00 75.65  ? 813 DT  P C4    1 
ATOM   7937 O  O4    . DT  C 3 12  ? 27.275 29.663  -34.092 1.00 69.56  ? 813 DT  P O4    1 
ATOM   7938 C  C5    . DT  C 3 12  ? 26.985 29.178  -31.819 1.00 71.85  ? 813 DT  P C5    1 
ATOM   7939 C  C7    . DT  C 3 12  ? 28.142 30.030  -31.386 1.00 64.50  ? 813 DT  P C7    1 
ATOM   7940 C  C6    . DT  C 3 12  ? 26.239 28.494  -30.936 1.00 73.96  ? 813 DT  P C6    1 
ATOM   7941 P  P     . DC  C 3 13  ? 24.113 23.675  -27.642 1.00 102.42 ? 814 DC  P P     1 
ATOM   7942 O  OP1   . DC  C 3 13  ? 23.152 23.009  -26.735 1.00 108.43 ? 814 DC  P OP1   1 
ATOM   7943 O  OP2   . DC  C 3 13  ? 25.519 23.852  -27.214 1.00 93.02  ? 814 DC  P OP2   1 
ATOM   7944 O  "O5'" . DC  C 3 13  ? 24.118 22.910  -29.046 1.00 103.48 ? 814 DC  P "O5'" 1 
ATOM   7945 C  "C5'" . DC  C 3 13  ? 22.923 22.837  -29.816 1.00 98.30  ? 814 DC  P "C5'" 1 
ATOM   7946 C  "C4'" . DC  C 3 13  ? 23.233 22.491  -31.260 1.00 100.95 ? 814 DC  P "C4'" 1 
ATOM   7947 O  "O4'" . DC  C 3 13  ? 23.788 23.643  -31.922 1.00 103.33 ? 814 DC  P "O4'" 1 
ATOM   7948 C  "C3'" . DC  C 3 13  ? 24.271 21.402  -31.443 1.00 103.20 ? 814 DC  P "C3'" 1 
ATOM   7949 O  "O3'" . DC  C 3 13  ? 23.637 20.129  -31.413 1.00 107.21 ? 814 DC  P "O3'" 1 
ATOM   7950 C  "C2'" . DC  C 3 13  ? 24.848 21.711  -32.827 1.00 98.96  ? 814 DC  P "C2'" 1 
ATOM   7951 C  "C1'" . DC  C 3 13  ? 24.632 23.222  -32.976 1.00 99.78  ? 814 DC  P "C1'" 1 
ATOM   7952 N  N1    . DC  C 3 13  ? 25.892 24.016  -32.921 1.00 97.95  ? 814 DC  P N1    1 
ATOM   7953 C  C2    . DC  C 3 13  ? 26.425 24.551  -34.100 1.00 91.84  ? 814 DC  P C2    1 
ATOM   7954 O  O2    . DC  C 3 13  ? 25.841 24.350  -35.172 1.00 88.37  ? 814 DC  P O2    1 
ATOM   7955 N  N3    . DC  C 3 13  ? 27.570 25.275  -34.033 1.00 85.86  ? 814 DC  P N3    1 
ATOM   7956 C  C4    . DC  C 3 13  ? 28.169 25.469  -32.857 1.00 86.27  ? 814 DC  P C4    1 
ATOM   7957 N  N4    . DC  C 3 13  ? 29.296 26.190  -32.840 1.00 86.39  ? 814 DC  P N4    1 
ATOM   7958 C  C5    . DC  C 3 13  ? 27.640 24.933  -31.645 1.00 90.67  ? 814 DC  P C5    1 
ATOM   7959 C  C6    . DC  C 3 13  ? 26.512 24.221  -31.724 1.00 96.02  ? 814 DC  P C6    1 
ATOM   7960 P  P     . DG  C 3 14  ? 24.507 18.794  -31.215 1.00 110.54 ? 815 DG  P P     1 
ATOM   7961 O  OP1   . DG  C 3 14  ? 23.590 17.725  -30.759 1.00 116.49 ? 815 DG  P OP1   1 
ATOM   7962 O  OP2   . DG  C 3 14  ? 25.691 19.147  -30.401 1.00 111.00 ? 815 DG  P OP2   1 
ATOM   7963 O  "O5'" . DG  C 3 14  ? 25.015 18.448  -32.690 1.00 107.11 ? 815 DG  P "O5'" 1 
ATOM   7964 C  "C5'" . DG  C 3 14  ? 24.088 18.404  -33.769 1.00 107.35 ? 815 DG  P "C5'" 1 
ATOM   7965 C  "C4'" . DG  C 3 14  ? 24.813 18.409  -35.101 1.00 109.75 ? 815 DG  P "C4'" 1 
ATOM   7966 O  "O4'" . DG  C 3 14  ? 25.600 19.624  -35.223 1.00 108.45 ? 815 DG  P "O4'" 1 
ATOM   7967 C  "C3'" . DG  C 3 14  ? 25.785 17.249  -35.307 1.00 113.76 ? 815 DG  P "C3'" 1 
ATOM   7968 O  "O3'" . DG  C 3 14  ? 25.655 16.739  -36.625 1.00 122.35 ? 815 DG  P "O3'" 1 
ATOM   7969 C  "C2'" . DG  C 3 14  ? 27.155 17.888  -35.079 1.00 104.82 ? 815 DG  P "C2'" 1 
ATOM   7970 C  "C1'" . DG  C 3 14  ? 26.922 19.298  -35.591 1.00 104.72 ? 815 DG  P "C1'" 1 
ATOM   7971 N  N9    . DG  C 3 14  ? 27.824 20.289  -35.007 1.00 106.65 ? 815 DG  P N9    1 
ATOM   7972 C  C8    . DG  C 3 14  ? 28.189 20.400  -33.686 1.00 105.44 ? 815 DG  P C8    1 
ATOM   7973 N  N7    . DG  C 3 14  ? 29.012 21.385  -33.455 1.00 92.24  ? 815 DG  P N7    1 
ATOM   7974 C  C5    . DG  C 3 14  ? 29.206 21.966  -34.701 1.00 89.63  ? 815 DG  P C5    1 
ATOM   7975 C  C6    . DG  C 3 14  ? 29.999 23.077  -35.076 1.00 89.75  ? 815 DG  P C6    1 
ATOM   7976 O  O6    . DG  C 3 14  ? 30.711 23.790  -34.355 1.00 91.86  ? 815 DG  P O6    1 
ATOM   7977 N  N1    . DG  C 3 14  ? 29.913 23.334  -36.442 1.00 89.71  ? 815 DG  P N1    1 
ATOM   7978 C  C2    . DG  C 3 14  ? 29.156 22.609  -37.332 1.00 90.21  ? 815 DG  P C2    1 
ATOM   7979 N  N2    . DG  C 3 14  ? 29.200 23.009  -38.612 1.00 94.67  ? 815 DG  P N2    1 
ATOM   7980 N  N3    . DG  C 3 14  ? 28.408 21.567  -36.994 1.00 90.49  ? 815 DG  P N3    1 
ATOM   7981 C  C4    . DG  C 3 14  ? 28.481 21.303  -35.667 1.00 94.84  ? 815 DG  P C4    1 
ATOM   7982 P  P     . DG  C 3 15  ? 26.450 15.414  -37.063 1.00 113.57 ? 816 DG  P P     1 
ATOM   7983 O  OP1   . DG  C 3 15  ? 25.754 14.837  -38.235 1.00 117.80 ? 816 DG  P OP1   1 
ATOM   7984 O  OP2   . DG  C 3 15  ? 26.660 14.590  -35.851 1.00 114.62 ? 816 DG  P OP2   1 
ATOM   7985 O  "O5'" . DG  C 3 15  ? 27.874 15.967  -37.530 1.00 95.23  ? 816 DG  P "O5'" 1 
ATOM   7986 C  "C5'" . DG  C 3 15  ? 28.627 15.257  -38.493 1.00 94.35  ? 816 DG  P "C5'" 1 
ATOM   7987 C  "C4'" . DG  C 3 15  ? 29.057 16.180  -39.616 1.00 95.61  ? 816 DG  P "C4'" 1 
ATOM   7988 O  "O4'" . DG  C 3 15  ? 28.692 17.545  -39.288 1.00 97.50  ? 816 DG  P "O4'" 1 
ATOM   7989 C  "C3'" . DG  C 3 15  ? 30.554 16.206  -39.877 1.00 96.81  ? 816 DG  P "C3'" 1 
ATOM   7990 O  "O3'" . DG  C 3 15  ? 30.885 15.232  -40.853 1.00 99.75  ? 816 DG  P "O3'" 1 
ATOM   7991 C  "C2'" . DG  C 3 15  ? 30.774 17.621  -40.397 1.00 96.45  ? 816 DG  P "C2'" 1 
ATOM   7992 C  "C1'" . DG  C 3 15  ? 29.775 18.415  -39.560 1.00 97.03  ? 816 DG  P "C1'" 1 
ATOM   7993 N  N9    . DG  C 3 15  ? 30.317 18.886  -38.287 1.00 95.86  ? 816 DG  P N9    1 
ATOM   7994 C  C8    . DG  C 3 15  ? 30.056 18.375  -37.039 1.00 97.78  ? 816 DG  P C8    1 
ATOM   7995 N  N7    . DG  C 3 15  ? 30.678 19.001  -36.079 1.00 91.25  ? 816 DG  P N7    1 
ATOM   7996 C  C5    . DG  C 3 15  ? 31.398 19.993  -36.732 1.00 89.45  ? 816 DG  P C5    1 
ATOM   7997 C  C6    . DG  C 3 15  ? 32.262 20.985  -36.209 1.00 86.22  ? 816 DG  P C6    1 
ATOM   7998 O  O6    . DG  C 3 15  ? 32.571 21.188  -35.025 1.00 79.50  ? 816 DG  P O6    1 
ATOM   7999 N  N1    . DG  C 3 15  ? 32.790 21.790  -37.214 1.00 83.54  ? 816 DG  P N1    1 
ATOM   8000 C  C2    . DG  C 3 15  ? 32.517 21.655  -38.555 1.00 86.39  ? 816 DG  P C2    1 
ATOM   8001 N  N2    . DG  C 3 15  ? 33.121 22.527  -39.374 1.00 88.59  ? 816 DG  P N2    1 
ATOM   8002 N  N3    . DG  C 3 15  ? 31.708 20.730  -39.059 1.00 86.91  ? 816 DG  P N3    1 
ATOM   8003 C  C4    . DG  C 3 15  ? 31.187 19.937  -38.092 1.00 89.27  ? 816 DG  P C4    1 
HETATM 8004 P  P     . MRG C 3 16  ? 32.024 14.143  -40.546 1.00 107.46 ? 817 MRG P P     1 
HETATM 8005 O  OP1   . MRG C 3 16  ? 31.853 12.913  -41.528 1.00 114.36 ? 817 MRG P OP1   1 
HETATM 8006 O  OP2   . MRG C 3 16  ? 31.967 13.750  -39.115 1.00 108.13 ? 817 MRG P OP2   1 
HETATM 8007 O  "O5'" . MRG C 3 16  ? 33.403 14.898  -40.937 1.00 99.66  ? 817 MRG P "O5'" 1 
HETATM 8008 N  N9    . MRG C 3 16  ? 34.922 18.313  -39.614 1.00 85.69  ? 817 MRG P N9    1 
HETATM 8009 C  C4    . MRG C 3 16  ? 35.478 19.187  -38.619 1.00 87.38  ? 817 MRG P C4    1 
HETATM 8010 N  N3    . MRG C 3 16  ? 36.430 20.175  -38.697 1.00 81.60  ? 817 MRG P N3    1 
HETATM 8011 C  C2    . MRG C 3 16  ? 36.707 20.820  -37.476 1.00 82.37  ? 817 MRG P C2    1 
HETATM 8012 N  N1    . MRG C 3 16  ? 36.098 20.531  -36.253 1.00 82.10  ? 817 MRG P N1    1 
HETATM 8013 C  C6    . MRG C 3 16  ? 35.170 19.547  -36.247 1.00 86.54  ? 817 MRG P C6    1 
HETATM 8014 O  O6    . MRG C 3 16  ? 34.566 19.248  -35.075 1.00 89.64  ? 817 MRG P O6    1 
HETATM 8015 C  C5    . MRG C 3 16  ? 34.796 18.816  -37.406 1.00 87.41  ? 817 MRG P C5    1 
HETATM 8016 N  N7    . MRG C 3 16  ? 33.873 17.776  -37.618 1.00 84.88  ? 817 MRG P N7    1 
HETATM 8017 C  C8    . MRG C 3 16  ? 33.981 17.517  -38.909 1.00 86.05  ? 817 MRG P C8    1 
HETATM 8018 N  N2    . MRG C 3 16  ? 37.676 21.842  -37.495 1.00 93.03  ? 817 MRG P N2    1 
HETATM 8019 C  C21   . MRG C 3 16  ? 37.932 22.783  -38.634 1.00 105.44 ? 817 MRG P C21   1 
HETATM 8020 C  C22   . MRG C 3 16  ? 39.371 22.761  -39.281 1.00 108.30 ? 817 MRG P C22   1 
HETATM 8021 C  C23   . MRG C 3 16  ? 39.398 23.092  -40.781 1.00 106.02 ? 817 MRG P C23   1 
HETATM 8022 S  S24   . MRG C 3 16  ? 38.272 21.960  -41.713 1.00 114.10 ? 817 MRG P S24   1 
HETATM 8023 C  "C2'" . MRG C 3 16  ? 36.508 17.395  -41.401 1.00 90.82  ? 817 MRG P "C2'" 1 
HETATM 8024 C  "C5'" . MRG C 3 16  ? 33.638 15.247  -42.275 1.00 101.49 ? 817 MRG P "C5'" 1 
HETATM 8025 C  "C4'" . MRG C 3 16  ? 34.664 16.374  -42.383 1.00 95.75  ? 817 MRG P "C4'" 1 
HETATM 8026 O  "O4'" . MRG C 3 16  ? 34.175 17.591  -41.794 1.00 94.78  ? 817 MRG P "O4'" 1 
HETATM 8027 C  "C1'" . MRG C 3 16  ? 35.254 18.238  -41.063 1.00 89.83  ? 817 MRG P "C1'" 1 
HETATM 8028 C  "C3'" . MRG C 3 16  ? 35.927 16.002  -41.579 1.00 92.08  ? 817 MRG P "C3'" 1 
HETATM 8029 O  "O3'" . MRG C 3 16  ? 36.769 15.187  -42.337 1.00 90.65  ? 817 MRG P "O3'" 1 
ATOM   8030 P  P     . DC  C 3 17  ? 37.660 14.064  -41.610 1.00 91.41  ? 818 DC  P P     1 
ATOM   8031 O  OP1   . DC  C 3 17  ? 38.134 13.113  -42.641 1.00 88.45  ? 818 DC  P OP1   1 
ATOM   8032 O  OP2   . DC  C 3 17  ? 36.890 13.572  -40.445 1.00 99.77  ? 818 DC  P OP2   1 
ATOM   8033 O  "O5'" . DC  C 3 17  ? 38.916 14.879  -41.050 1.00 83.17  ? 818 DC  P "O5'" 1 
ATOM   8034 C  "C5'" . DC  C 3 17  ? 39.803 15.517  -41.955 1.00 78.12  ? 818 DC  P "C5'" 1 
ATOM   8035 C  "C4'" . DC  C 3 17  ? 40.552 16.642  -41.270 1.00 80.26  ? 818 DC  P "C4'" 1 
ATOM   8036 O  "O4'" . DC  C 3 17  ? 39.602 17.564  -40.681 1.00 79.00  ? 818 DC  P "O4'" 1 
ATOM   8037 C  "C3'" . DC  C 3 17  ? 41.427 16.219  -40.107 1.00 78.01  ? 818 DC  P "C3'" 1 
ATOM   8038 O  "O3'" . DC  C 3 17  ? 42.686 15.759  -40.570 1.00 70.02  ? 818 DC  P "O3'" 1 
ATOM   8039 C  "C2'" . DC  C 3 17  ? 41.554 17.527  -39.337 1.00 76.88  ? 818 DC  P "C2'" 1 
ATOM   8040 C  "C1'" . DC  C 3 17  ? 40.149 18.111  -39.489 1.00 74.03  ? 818 DC  P "C1'" 1 
ATOM   8041 N  N1    . DC  C 3 17  ? 39.247 17.788  -38.344 1.00 71.12  ? 818 DC  P N1    1 
ATOM   8042 C  C2    . DC  C 3 17  ? 39.257 18.607  -37.211 1.00 68.68  ? 818 DC  P C2    1 
ATOM   8043 O  O2    . DC  C 3 17  ? 40.011 19.589  -37.184 1.00 61.58  ? 818 DC  P O2    1 
ATOM   8044 N  N3    . DC  C 3 17  ? 38.439 18.303  -36.173 1.00 68.78  ? 818 DC  P N3    1 
ATOM   8045 C  C4    . DC  C 3 17  ? 37.642 17.237  -36.242 1.00 67.25  ? 818 DC  P C4    1 
ATOM   8046 N  N4    . DC  C 3 17  ? 36.852 16.978  -35.195 1.00 68.52  ? 818 DC  P N4    1 
ATOM   8047 C  C5    . DC  C 3 17  ? 37.618 16.388  -37.388 1.00 74.55  ? 818 DC  P C5    1 
ATOM   8048 C  C6    . DC  C 3 17  ? 38.429 16.698  -38.405 1.00 71.65  ? 818 DC  P C6    1 
ATOM   8049 P  P     . DG  C 3 18  ? 43.536 14.728  -39.677 1.00 74.38  ? 819 DG  P P     1 
ATOM   8050 O  OP1   . DG  C 3 18  ? 44.722 14.315  -40.460 1.00 88.54  ? 819 DG  P OP1   1 
ATOM   8051 O  OP2   . DG  C 3 18  ? 42.597 13.703  -39.168 1.00 67.92  ? 819 DG  P OP2   1 
ATOM   8052 O  "O5'" . DG  C 3 18  ? 44.024 15.607  -38.432 1.00 64.12  ? 819 DG  P "O5'" 1 
ATOM   8053 C  "C5'" . DG  C 3 18  ? 44.955 16.665  -38.628 1.00 59.58  ? 819 DG  P "C5'" 1 
ATOM   8054 C  "C4'" . DG  C 3 18  ? 45.185 17.429  -37.336 1.00 67.28  ? 819 DG  P "C4'" 1 
ATOM   8055 O  "O4'" . DG  C 3 18  ? 43.955 18.077  -36.931 1.00 72.56  ? 819 DG  P "O4'" 1 
ATOM   8056 C  "C3'" . DG  C 3 18  ? 45.581 16.572  -36.147 1.00 63.63  ? 819 DG  P "C3'" 1 
ATOM   8057 O  "O3'" . DG  C 3 18  ? 46.985 16.369  -36.135 1.00 60.51  ? 819 DG  P "O3'" 1 
ATOM   8058 C  "C2'" . DG  C 3 18  ? 45.132 17.434  -34.974 1.00 62.36  ? 819 DG  P "C2'" 1 
ATOM   8059 C  "C1'" . DG  C 3 18  ? 43.845 18.057  -35.517 1.00 69.75  ? 819 DG  P "C1'" 1 
ATOM   8060 N  N9    . DG  C 3 18  ? 42.640 17.317  -35.156 1.00 72.60  ? 819 DG  P N9    1 
ATOM   8061 C  C8    . DG  C 3 18  ? 41.894 16.499  -35.972 1.00 73.15  ? 819 DG  P C8    1 
ATOM   8062 N  N7    . DG  C 3 18  ? 40.864 15.969  -35.374 1.00 77.46  ? 819 DG  P N7    1 
ATOM   8063 C  C5    . DG  C 3 18  ? 40.929 16.467  -34.078 1.00 75.73  ? 819 DG  P C5    1 
ATOM   8064 C  C6    . DG  C 3 18  ? 40.077 16.242  -32.971 1.00 75.96  ? 819 DG  P C6    1 
ATOM   8065 O  O6    . DG  C 3 18  ? 39.061 15.533  -32.916 1.00 78.86  ? 819 DG  P O6    1 
ATOM   8066 N  N1    . DG  C 3 18  ? 40.503 16.938  -31.842 1.00 69.61  ? 819 DG  P N1    1 
ATOM   8067 C  C2    . DG  C 3 18  ? 41.612 17.749  -31.791 1.00 62.26  ? 819 DG  P C2    1 
ATOM   8068 N  N2    . DG  C 3 18  ? 41.864 18.336  -30.613 1.00 61.31  ? 819 DG  P N2    1 
ATOM   8069 N  N3    . DG  C 3 18  ? 42.419 17.969  -32.821 1.00 63.18  ? 819 DG  P N3    1 
ATOM   8070 C  C4    . DG  C 3 18  ? 42.017 17.297  -33.928 1.00 70.11  ? 819 DG  P C4    1 
ATOM   8071 P  P     . DC  C 3 19  ? 47.594 15.000  -35.556 1.00 62.44  ? 820 DC  P P     1 
ATOM   8072 O  OP1   . DC  C 3 19  ? 49.059 15.030  -35.768 1.00 62.17  ? 820 DC  P OP1   1 
ATOM   8073 O  OP2   . DC  C 3 19  ? 46.791 13.886  -36.110 1.00 64.83  ? 820 DC  P OP2   1 
ATOM   8074 O  "O5'" . DC  C 3 19  ? 47.300 15.082  -33.986 1.00 67.00  ? 820 DC  P "O5'" 1 
ATOM   8075 C  "C5'" . DC  C 3 19  ? 47.946 16.070  -33.197 1.00 60.94  ? 820 DC  P "C5'" 1 
ATOM   8076 C  "C4'" . DC  C 3 19  ? 47.462 16.020  -31.759 1.00 66.44  ? 820 DC  P "C4'" 1 
ATOM   8077 O  "O4'" . DC  C 3 19  ? 46.092 16.483  -31.682 1.00 58.77  ? 820 DC  P "O4'" 1 
ATOM   8078 C  "C3'" . DC  C 3 19  ? 47.413 14.639  -31.140 1.00 66.31  ? 820 DC  P "C3'" 1 
ATOM   8079 O  "O3'" . DC  C 3 19  ? 48.704 14.239  -30.701 1.00 60.66  ? 820 DC  P "O3'" 1 
ATOM   8080 C  "C2'" . DC  C 3 19  ? 46.465 14.881  -29.972 1.00 68.60  ? 820 DC  P "C2'" 1 
ATOM   8081 C  "C1'" . DC  C 3 19  ? 45.437 15.823  -30.606 1.00 60.37  ? 820 DC  P "C1'" 1 
ATOM   8082 N  N1    . DC  C 3 19  ? 44.235 15.110  -31.130 1.00 71.53  ? 820 DC  P N1    1 
ATOM   8083 C  C2    . DC  C 3 19  ? 43.204 14.762  -30.251 1.00 67.25  ? 820 DC  P C2    1 
ATOM   8084 O  O2    . DC  C 3 19  ? 43.306 15.064  -29.055 1.00 64.40  ? 820 DC  P O2    1 
ATOM   8085 N  N3    . DC  C 3 19  ? 42.120 14.107  -30.735 1.00 66.22  ? 820 DC  P N3    1 
ATOM   8086 C  C4    . DC  C 3 19  ? 42.050 13.800  -32.030 1.00 70.32  ? 820 DC  P C4    1 
ATOM   8087 N  N4    . DC  C 3 19  ? 40.961 13.154  -32.461 1.00 79.34  ? 820 DC  P N4    1 
ATOM   8088 C  C5    . DC  C 3 19  ? 43.093 14.141  -32.943 1.00 66.87  ? 820 DC  P C5    1 
ATOM   8089 C  C6    . DC  C 3 19  ? 44.157 14.788  -32.454 1.00 70.44  ? 820 DC  P C6    1 
ATOM   8090 P  P     . DC  C 3 20  ? 49.058 12.675  -30.583 1.00 61.61  ? 821 DC  P P     1 
ATOM   8091 O  OP1   . DC  C 3 20  ? 50.508 12.543  -30.315 1.00 64.03  ? 821 DC  P OP1   1 
ATOM   8092 O  OP2   . DC  C 3 20  ? 48.460 11.993  -31.752 1.00 61.68  ? 821 DC  P OP2   1 
ATOM   8093 O  "O5'" . DC  C 3 20  ? 48.259 12.203  -29.283 1.00 62.88  ? 821 DC  P "O5'" 1 
ATOM   8094 C  "C5'" . DC  C 3 20  ? 48.581 12.763  -28.019 1.00 63.35  ? 821 DC  P "C5'" 1 
ATOM   8095 C  "C4'" . DC  C 3 20  ? 47.578 12.337  -26.965 1.00 65.66  ? 821 DC  P "C4'" 1 
ATOM   8096 O  "O4'" . DC  C 3 20  ? 46.257 12.785  -27.344 1.00 70.20  ? 821 DC  P "O4'" 1 
ATOM   8097 C  "C3'" . DC  C 3 20  ? 47.435 10.841  -26.786 1.00 64.44  ? 821 DC  P "C3'" 1 
ATOM   8098 O  "O3'" . DC  C 3 20  ? 48.436 10.364  -25.896 1.00 65.14  ? 821 DC  P "O3'" 1 
ATOM   8099 C  "C2'" . DC  C 3 20  ? 46.043 10.729  -26.172 1.00 66.24  ? 821 DC  P "C2'" 1 
ATOM   8100 C  "C1'" . DC  C 3 20  ? 45.288 11.874  -26.854 1.00 67.15  ? 821 DC  P "C1'" 1 
ATOM   8101 N  N1    . DC  C 3 20  ? 44.427 11.433  -27.993 1.00 70.05  ? 821 DC  P N1    1 
ATOM   8102 C  C2    . DC  C 3 20  ? 43.188 10.836  -27.734 1.00 69.18  ? 821 DC  P C2    1 
ATOM   8103 O  O2    . DC  C 3 20  ? 42.827 10.680  -26.561 1.00 69.84  ? 821 DC  P O2    1 
ATOM   8104 N  N3    . DC  C 3 20  ? 42.417 10.444  -28.778 1.00 70.50  ? 821 DC  P N3    1 
ATOM   8105 C  C4    . DC  C 3 20  ? 42.842 10.630  -30.029 1.00 74.78  ? 821 DC  P C4    1 
ATOM   8106 N  N4    . DC  C 3 20  ? 42.048 10.227  -31.025 1.00 82.23  ? 821 DC  P N4    1 
ATOM   8107 C  C5    . DC  C 3 20  ? 44.100 11.239  -30.313 1.00 69.67  ? 821 DC  P C5    1 
ATOM   8108 C  C6    . DC  C 3 20  ? 44.852 11.621  -29.275 1.00 66.42  ? 821 DC  P C6    1 
ATOM   8109 P  P     . DA  D 4 5   ? 33.143 4.321   -39.023 1.00 130.27 ? 705 DA  T P     1 
ATOM   8110 O  OP1   . DA  D 4 5   ? 31.811 4.786   -39.472 1.00 127.67 ? 705 DA  T OP1   1 
ATOM   8111 O  OP2   . DA  D 4 5   ? 34.313 5.222   -39.119 1.00 129.97 ? 705 DA  T OP2   1 
ATOM   8112 O  "O5'" . DA  D 4 5   ? 33.033 3.802   -37.513 1.00 130.93 ? 705 DA  T "O5'" 1 
ATOM   8113 C  "C5'" . DA  D 4 5   ? 32.324 2.603   -37.228 1.00 126.73 ? 705 DA  T "C5'" 1 
ATOM   8114 C  "C4'" . DA  D 4 5   ? 32.382 2.266   -35.746 1.00 119.61 ? 705 DA  T "C4'" 1 
ATOM   8115 O  "O4'" . DA  D 4 5   ? 33.544 1.446   -35.469 1.00 117.06 ? 705 DA  T "O4'" 1 
ATOM   8116 C  "C3'" . DA  D 4 5   ? 32.540 3.447   -34.809 1.00 112.19 ? 705 DA  T "C3'" 1 
ATOM   8117 O  "O3'" . DA  D 4 5   ? 31.290 4.088   -34.590 1.00 106.81 ? 705 DA  T "O3'" 1 
ATOM   8118 C  "C2'" . DA  D 4 5   ? 33.039 2.748   -33.553 1.00 112.69 ? 705 DA  T "C2'" 1 
ATOM   8119 C  "C1'" . DA  D 4 5   ? 33.988 1.704   -34.143 1.00 117.08 ? 705 DA  T "C1'" 1 
ATOM   8120 N  N9    . DA  D 4 5   ? 35.378 2.153   -34.173 1.00 125.22 ? 705 DA  T N9    1 
ATOM   8121 C  C8    . DA  D 4 5   ? 36.286 2.060   -33.155 1.00 127.36 ? 705 DA  T C8    1 
ATOM   8122 N  N7    . DA  D 4 5   ? 37.463 2.559   -33.447 1.00 127.71 ? 705 DA  T N7    1 
ATOM   8123 C  C5    . DA  D 4 5   ? 37.319 3.016   -34.745 1.00 127.73 ? 705 DA  T C5    1 
ATOM   8124 C  C6    . DA  D 4 5   ? 38.212 3.652   -35.630 1.00 123.85 ? 705 DA  T C6    1 
ATOM   8125 N  N6    . DA  D 4 5   ? 39.478 3.940   -35.315 1.00 125.17 ? 705 DA  T N6    1 
ATOM   8126 N  N1    . DA  D 4 5   ? 37.751 3.980   -36.855 1.00 117.98 ? 705 DA  T N1    1 
ATOM   8127 C  C2    . DA  D 4 5   ? 36.483 3.689   -37.166 1.00 119.84 ? 705 DA  T C2    1 
ATOM   8128 N  N3    . DA  D 4 5   ? 35.553 3.096   -36.420 1.00 125.34 ? 705 DA  T N3    1 
ATOM   8129 C  C4    . DA  D 4 5   ? 36.039 2.781   -35.209 1.00 128.08 ? 705 DA  T C4    1 
ATOM   8130 P  P     . DT  D 4 6   ? 31.245 5.621   -34.107 1.00 96.36  ? 706 DT  T P     1 
ATOM   8131 O  OP1   . DT  D 4 6   ? 29.830 6.051   -34.109 1.00 109.02 ? 706 DT  T OP1   1 
ATOM   8132 O  OP2   . DT  D 4 6   ? 32.245 6.375   -34.895 1.00 97.42  ? 706 DT  T OP2   1 
ATOM   8133 O  "O5'" . DT  D 4 6   ? 31.761 5.567   -32.593 1.00 90.35  ? 706 DT  T "O5'" 1 
ATOM   8134 C  "C5'" . DT  D 4 6   ? 31.026 4.838   -31.620 1.00 79.36  ? 706 DT  T "C5'" 1 
ATOM   8135 C  "C4'" . DT  D 4 6   ? 31.711 4.887   -30.267 1.00 76.75  ? 706 DT  T "C4'" 1 
ATOM   8136 O  "O4'" . DT  D 4 6   ? 33.013 4.258   -30.351 1.00 74.29  ? 706 DT  T "O4'" 1 
ATOM   8137 C  "C3'" . DT  D 4 6   ? 32.003 6.280   -29.749 1.00 70.47  ? 706 DT  T "C3'" 1 
ATOM   8138 O  "O3'" . DT  D 4 6   ? 30.850 6.823   -29.128 1.00 64.87  ? 706 DT  T "O3'" 1 
ATOM   8139 C  "C2'" . DT  D 4 6   ? 33.111 6.001   -28.742 1.00 63.04  ? 706 DT  T "C2'" 1 
ATOM   8140 C  "C1'" . DT  D 4 6   ? 33.907 4.905   -29.456 1.00 68.68  ? 706 DT  T "C1'" 1 
ATOM   8141 N  N1    . DT  D 4 6   ? 35.071 5.427   -30.233 1.00 71.19  ? 706 DT  T N1    1 
ATOM   8142 C  C2    . DT  D 4 6   ? 36.253 5.684   -29.579 1.00 70.97  ? 706 DT  T C2    1 
ATOM   8143 O  O2    . DT  D 4 6   ? 36.408 5.503   -28.384 1.00 69.96  ? 706 DT  T O2    1 
ATOM   8144 N  N3    . DT  D 4 6   ? 37.259 6.159   -30.378 1.00 69.44  ? 706 DT  T N3    1 
ATOM   8145 C  C4    . DT  D 4 6   ? 37.202 6.401   -31.738 1.00 74.99  ? 706 DT  T C4    1 
ATOM   8146 O  O4    . DT  D 4 6   ? 38.163 6.831   -32.368 1.00 76.74  ? 706 DT  T O4    1 
ATOM   8147 C  C5    . DT  D 4 6   ? 35.933 6.112   -32.364 1.00 74.15  ? 706 DT  T C5    1 
ATOM   8148 C  C7    . DT  D 4 6   ? 35.750 6.336   -33.836 1.00 72.91  ? 706 DT  T C7    1 
ATOM   8149 C  C6    . DT  D 4 6   ? 34.940 5.645   -31.591 1.00 72.39  ? 706 DT  T C6    1 
ATOM   8150 P  P     . DG  D 4 7   ? 30.598 8.409   -29.157 1.00 69.46  ? 707 DG  T P     1 
ATOM   8151 O  OP1   . DG  D 4 7   ? 29.207 8.650   -28.712 1.00 87.76  ? 707 DG  T OP1   1 
ATOM   8152 O  OP2   . DG  D 4 7   ? 31.047 8.916   -30.472 1.00 73.68  ? 707 DG  T OP2   1 
ATOM   8153 O  "O5'" . DG  D 4 7   ? 31.596 8.971   -28.042 1.00 63.04  ? 707 DG  T "O5'" 1 
ATOM   8154 C  "C5'" . DG  D 4 7   ? 31.430 8.574   -26.688 1.00 61.01  ? 707 DG  T "C5'" 1 
ATOM   8155 C  "C4'" . DG  D 4 7   ? 32.605 9.021   -25.839 1.00 65.34  ? 707 DG  T "C4'" 1 
ATOM   8156 O  "O4'" . DG  D 4 7   ? 33.773 8.222   -26.151 1.00 61.06  ? 707 DG  T "O4'" 1 
ATOM   8157 C  "C3'" . DG  D 4 7   ? 33.071 10.443  -26.071 1.00 65.36  ? 707 DG  T "C3'" 1 
ATOM   8158 O  "O3'" . DG  D 4 7   ? 32.247 11.361  -25.378 1.00 60.37  ? 707 DG  T "O3'" 1 
ATOM   8159 C  "C2'" . DG  D 4 7   ? 34.469 10.384  -25.476 1.00 61.56  ? 707 DG  T "C2'" 1 
ATOM   8160 C  "C1'" . DG  D 4 7   ? 34.939 9.014   -25.966 1.00 61.11  ? 707 DG  T "C1'" 1 
ATOM   8161 N  N9    . DG  D 4 7   ? 35.669 9.086   -27.225 1.00 56.34  ? 707 DG  T N9    1 
ATOM   8162 C  C8    . DG  D 4 7   ? 35.159 8.944   -28.492 1.00 57.84  ? 707 DG  T C8    1 
ATOM   8163 N  N7    . DG  D 4 7   ? 36.058 9.071   -29.429 1.00 62.58  ? 707 DG  T N7    1 
ATOM   8164 C  C5    . DG  D 4 7   ? 37.237 9.321   -28.736 1.00 62.07  ? 707 DG  T C5    1 
ATOM   8165 C  C6    . DG  D 4 7   ? 38.548 9.546   -29.216 1.00 58.40  ? 707 DG  T C6    1 
ATOM   8166 O  O6    . DG  D 4 7   ? 38.943 9.570   -30.390 1.00 70.02  ? 707 DG  T O6    1 
ATOM   8167 N  N1    . DG  D 4 7   ? 39.448 9.759   -28.176 1.00 57.18  ? 707 DG  T N1    1 
ATOM   8168 C  C2    . DG  D 4 7   ? 39.122 9.755   -26.840 1.00 60.12  ? 707 DG  T C2    1 
ATOM   8169 N  N2    . DG  D 4 7   ? 40.127 9.981   -25.982 1.00 66.09  ? 707 DG  T N2    1 
ATOM   8170 N  N3    . DG  D 4 7   ? 37.899 9.546   -26.378 1.00 62.98  ? 707 DG  T N3    1 
ATOM   8171 C  C4    . DG  D 4 7   ? 37.011 9.337   -27.379 1.00 66.91  ? 707 DG  T C4    1 
ATOM   8172 P  P     . DG  D 4 8   ? 32.226 12.901  -25.832 1.00 68.04  ? 708 DG  T P     1 
ATOM   8173 O  OP1   . DG  D 4 8   ? 31.119 13.578  -25.119 1.00 55.90  ? 708 DG  T OP1   1 
ATOM   8174 O  OP2   . DG  D 4 8   ? 32.270 12.919  -27.311 1.00 70.94  ? 708 DG  T OP2   1 
ATOM   8175 O  "O5'" . DG  D 4 8   ? 33.619 13.480  -25.294 1.00 68.03  ? 708 DG  T "O5'" 1 
ATOM   8176 C  "C5'" . DG  D 4 8   ? 33.873 13.523  -23.895 1.00 63.68  ? 708 DG  T "C5'" 1 
ATOM   8177 C  "C4'" . DG  D 4 8   ? 35.300 13.951  -23.609 1.00 51.88  ? 708 DG  T "C4'" 1 
ATOM   8178 O  "O4'" . DG  D 4 8   ? 36.226 12.993  -24.180 1.00 58.39  ? 708 DG  T "O4'" 1 
ATOM   8179 C  "C3'" . DG  D 4 8   ? 35.707 15.280  -24.213 1.00 55.13  ? 708 DG  T "C3'" 1 
ATOM   8180 O  "O3'" . DG  D 4 8   ? 35.296 16.345  -23.371 1.00 64.59  ? 708 DG  T "O3'" 1 
ATOM   8181 C  "C2'" . DG  D 4 8   ? 37.222 15.136  -24.246 1.00 51.92  ? 708 DG  T "C2'" 1 
ATOM   8182 C  "C1'" . DG  D 4 8   ? 37.371 13.674  -24.669 1.00 51.94  ? 708 DG  T "C1'" 1 
ATOM   8183 N  N9    . DG  D 4 8   ? 37.432 13.500  -26.116 1.00 52.91  ? 708 DG  T N9    1 
ATOM   8184 C  C8    . DG  D 4 8   ? 36.378 13.275  -26.969 1.00 56.18  ? 708 DG  T C8    1 
ATOM   8185 N  N7    . DG  D 4 8   ? 36.735 13.168  -28.219 1.00 55.31  ? 708 DG  T N7    1 
ATOM   8186 C  C5    . DG  D 4 8   ? 38.113 13.335  -28.194 1.00 54.40  ? 708 DG  T C5    1 
ATOM   8187 C  C6    . DG  D 4 8   ? 39.052 13.320  -29.252 1.00 57.62  ? 708 DG  T C6    1 
ATOM   8188 O  O6    . DG  D 4 8   ? 38.843 13.151  -30.461 1.00 60.23  ? 708 DG  T O6    1 
ATOM   8189 N  N1    . DG  D 4 8   ? 40.350 13.530  -28.791 1.00 55.88  ? 708 DG  T N1    1 
ATOM   8190 C  C2    . DG  D 4 8   ? 40.695 13.729  -27.475 1.00 60.21  ? 708 DG  T C2    1 
ATOM   8191 N  N2    . DG  D 4 8   ? 41.999 13.914  -27.224 1.00 64.87  ? 708 DG  T N2    1 
ATOM   8192 N  N3    . DG  D 4 8   ? 39.825 13.745  -26.475 1.00 55.49  ? 708 DG  T N3    1 
ATOM   8193 C  C4    . DG  D 4 8   ? 38.557 13.543  -26.907 1.00 52.92  ? 708 DG  T C4    1 
ATOM   8194 P  P     . DC  D 4 9   ? 34.630 17.663  -24.006 1.00 53.91  ? 709 DC  T P     1 
ATOM   8195 O  OP1   . DC  D 4 9   ? 33.926 18.371  -22.914 1.00 57.19  ? 709 DC  T OP1   1 
ATOM   8196 O  OP2   . DC  D 4 9   ? 33.891 17.263  -25.223 1.00 53.17  ? 709 DC  T OP2   1 
ATOM   8197 O  "O5'" . DC  D 4 9   ? 35.884 18.540  -24.465 1.00 50.93  ? 709 DC  T "O5'" 1 
ATOM   8198 C  "C5'" . DC  D 4 9   ? 36.861 18.928  -23.512 1.00 49.40  ? 709 DC  T "C5'" 1 
ATOM   8199 C  "C4'" . DC  D 4 9   ? 38.191 19.209  -24.186 1.00 49.10  ? 709 DC  T "C4'" 1 
ATOM   8200 O  "O4'" . DC  D 4 9   ? 38.680 18.002  -24.820 1.00 49.70  ? 709 DC  T "O4'" 1 
ATOM   8201 C  "C3'" . DC  D 4 9   ? 38.137 20.220  -25.310 1.00 52.36  ? 709 DC  T "C3'" 1 
ATOM   8202 O  "O3'" . DC  D 4 9   ? 38.199 21.537  -24.794 1.00 52.25  ? 709 DC  T "O3'" 1 
ATOM   8203 C  "C2'" . DC  D 4 9   ? 39.393 19.866  -26.097 1.00 50.40  ? 709 DC  T "C2'" 1 
ATOM   8204 C  "C1'" . DC  D 4 9   ? 39.403 18.342  -25.993 1.00 50.21  ? 709 DC  T "C1'" 1 
ATOM   8205 N  N1    . DC  D 4 9   ? 38.771 17.664  -27.163 1.00 51.81  ? 709 DC  T N1    1 
ATOM   8206 C  C2    . DC  D 4 9   ? 39.509 17.486  -28.339 1.00 52.47  ? 709 DC  T C2    1 
ATOM   8207 O  O2    . DC  D 4 9   ? 40.676 17.892  -28.386 1.00 51.71  ? 709 DC  T O2    1 
ATOM   8208 N  N3    . DC  D 4 9   ? 38.922 16.871  -29.395 1.00 60.55  ? 709 DC  T N3    1 
ATOM   8209 C  C4    . DC  D 4 9   ? 37.660 16.447  -29.305 1.00 54.73  ? 709 DC  T C4    1 
ATOM   8210 N  N4    . DC  D 4 9   ? 37.126 15.845  -30.372 1.00 64.99  ? 709 DC  T N4    1 
ATOM   8211 C  C5    . DC  D 4 9   ? 36.892 16.619  -28.116 1.00 54.08  ? 709 DC  T C5    1 
ATOM   8212 C  C6    . DC  D 4 9   ? 37.481 17.227  -27.081 1.00 52.64  ? 709 DC  T C6    1 
ATOM   8213 P  P     . DG  D 4 10  ? 37.572 22.749  -25.640 1.00 49.77  ? 710 DG  T P     1 
ATOM   8214 O  OP1   . DG  D 4 10  ? 37.573 23.956  -24.783 1.00 52.76  ? 710 DG  T OP1   1 
ATOM   8215 O  OP2   . DG  D 4 10  ? 36.306 22.257  -26.225 1.00 51.16  ? 710 DG  T OP2   1 
ATOM   8216 O  "O5'" . DG  D 4 10  ? 38.614 22.962  -26.835 1.00 60.35  ? 710 DG  T "O5'" 1 
ATOM   8217 C  "C5'" . DG  D 4 10  ? 39.951 23.364  -26.552 1.00 57.96  ? 710 DG  T "C5'" 1 
ATOM   8218 C  "C4'" . DG  D 4 10  ? 40.799 23.340  -27.810 1.00 49.62  ? 710 DG  T "C4'" 1 
ATOM   8219 O  "O4'" . DG  D 4 10  ? 40.895 21.984  -28.299 1.00 51.36  ? 710 DG  T "O4'" 1 
ATOM   8220 C  "C3'" . DG  D 4 10  ? 40.240 24.146  -28.968 1.00 60.39  ? 710 DG  T "C3'" 1 
ATOM   8221 O  "O3'" . DG  D 4 10  ? 40.706 25.485  -28.883 1.00 60.16  ? 710 DG  T "O3'" 1 
ATOM   8222 C  "C2'" . DG  D 4 10  ? 40.823 23.431  -30.186 1.00 58.97  ? 710 DG  T "C2'" 1 
ATOM   8223 C  "C1'" . DG  D 4 10  ? 40.913 21.977  -29.714 1.00 51.61  ? 710 DG  T "C1'" 1 
ATOM   8224 N  N9    . DG  D 4 10  ? 39.818 21.132  -30.185 1.00 56.49  ? 710 DG  T N9    1 
ATOM   8225 C  C8    . DG  D 4 10  ? 38.754 20.670  -29.448 1.00 53.00  ? 710 DG  T C8    1 
ATOM   8226 N  N7    . DG  D 4 10  ? 37.932 19.925  -30.133 1.00 54.30  ? 710 DG  T N7    1 
ATOM   8227 C  C5    . DG  D 4 10  ? 38.488 19.887  -31.405 1.00 55.12  ? 710 DG  T C5    1 
ATOM   8228 C  C6    . DG  D 4 10  ? 38.039 19.232  -32.576 1.00 66.56  ? 710 DG  T C6    1 
ATOM   8229 O  O6    . DG  D 4 10  ? 37.027 18.532  -32.725 1.00 67.44  ? 710 DG  T O6    1 
ATOM   8230 N  N1    . DG  D 4 10  ? 38.898 19.452  -33.650 1.00 62.43  ? 710 DG  T N1    1 
ATOM   8231 C  C2    . DG  D 4 10  ? 40.044 20.209  -33.598 1.00 56.10  ? 710 DG  T C2    1 
ATOM   8232 N  N2    . DG  D 4 10  ? 40.745 20.306  -34.737 1.00 59.53  ? 710 DG  T N2    1 
ATOM   8233 N  N3    . DG  D 4 10  ? 40.476 20.828  -32.507 1.00 61.01  ? 710 DG  T N3    1 
ATOM   8234 C  C4    . DG  D 4 10  ? 39.650 20.624  -31.453 1.00 54.28  ? 710 DG  T C4    1 
ATOM   8235 P  P     . DC  D 4 11  ? 39.763 26.702  -29.335 1.00 62.30  ? 711 DC  T P     1 
ATOM   8236 O  OP1   . DC  D 4 11  ? 40.342 27.943  -28.775 1.00 77.11  ? 711 DC  T OP1   1 
ATOM   8237 O  OP2   . DC  D 4 11  ? 38.364 26.333  -29.027 1.00 61.50  ? 711 DC  T OP2   1 
ATOM   8238 O  "O5'" . DC  D 4 11  ? 39.928 26.742  -30.922 1.00 58.62  ? 711 DC  T "O5'" 1 
ATOM   8239 C  "C5'" . DC  D 4 11  ? 41.202 26.997  -31.494 1.00 62.91  ? 711 DC  T "C5'" 1 
ATOM   8240 C  "C4'" . DC  D 4 11  ? 41.229 26.558  -32.943 1.00 73.82  ? 711 DC  T "C4'" 1 
ATOM   8241 O  "O4'" . DC  D 4 11  ? 40.919 25.151  -33.012 1.00 83.92  ? 711 DC  T "O4'" 1 
ATOM   8242 C  "C3'" . DC  D 4 11  ? 40.207 27.246  -33.831 1.00 71.50  ? 711 DC  T "C3'" 1 
ATOM   8243 O  "O3'" . DC  D 4 11  ? 40.793 28.404  -34.414 1.00 82.96  ? 711 DC  T "O3'" 1 
ATOM   8244 C  "C2'" . DC  D 4 11  ? 39.891 26.192  -34.892 1.00 66.86  ? 711 DC  T "C2'" 1 
ATOM   8245 C  "C1'" . DC  D 4 11  ? 40.179 24.867  -34.180 1.00 75.31  ? 711 DC  T "C1'" 1 
ATOM   8246 N  N1    . DC  D 4 11  ? 38.956 24.106  -33.792 1.00 70.07  ? 711 DC  T N1    1 
ATOM   8247 C  C2    . DC  D 4 11  ? 38.475 23.101  -34.635 1.00 70.52  ? 711 DC  T C2    1 
ATOM   8248 O  O2    . DC  D 4 11  ? 39.070 22.869  -35.694 1.00 71.52  ? 711 DC  T O2    1 
ATOM   8249 N  N3    . DC  D 4 11  ? 37.368 22.410  -34.268 1.00 67.73  ? 711 DC  T N3    1 
ATOM   8250 C  C4    . DC  D 4 11  ? 36.757 22.690  -33.117 1.00 65.81  ? 711 DC  T C4    1 
ATOM   8251 N  N4    . DC  D 4 11  ? 35.668 21.982  -32.799 1.00 62.09  ? 711 DC  T N4    1 
ATOM   8252 C  C5    . DC  D 4 11  ? 37.234 23.710  -32.241 1.00 64.47  ? 711 DC  T C5    1 
ATOM   8253 C  C6    . DC  D 4 11  ? 38.327 24.385  -32.614 1.00 63.11  ? 711 DC  T C6    1 
ATOM   8254 P  P     . DC  D 4 12  ? 39.879 29.652  -34.849 1.00 92.65  ? 712 DC  T P     1 
ATOM   8255 O  OP1   . DC  D 4 12  ? 40.794 30.710  -35.334 1.00 96.56  ? 712 DC  T OP1   1 
ATOM   8256 O  OP2   . DC  D 4 12  ? 38.937 29.942  -33.745 1.00 91.69  ? 712 DC  T OP2   1 
ATOM   8257 O  "O5'" . DC  D 4 12  ? 39.033 29.100  -36.088 1.00 94.52  ? 712 DC  T "O5'" 1 
ATOM   8258 C  "C5'" . DC  D 4 12  ? 39.670 28.871  -37.340 1.00 95.96  ? 712 DC  T "C5'" 1 
ATOM   8259 C  "C4'" . DC  D 4 12  ? 38.763 28.085  -38.268 1.00 91.32  ? 712 DC  T "C4'" 1 
ATOM   8260 O  "O4'" . DC  D 4 12  ? 38.333 26.886  -37.602 1.00 89.87  ? 712 DC  T "O4'" 1 
ATOM   8261 C  "C3'" . DC  D 4 12  ? 37.476 28.794  -38.657 1.00 84.58  ? 712 DC  T "C3'" 1 
ATOM   8262 O  "O3'" . DC  D 4 12  ? 37.674 29.541  -39.857 1.00 90.56  ? 712 DC  T "O3'" 1 
ATOM   8263 C  "C2'" . DC  D 4 12  ? 36.483 27.645  -38.877 1.00 80.65  ? 712 DC  T "C2'" 1 
ATOM   8264 C  "C1'" . DC  D 4 12  ? 37.132 26.441  -38.186 1.00 80.61  ? 712 DC  T "C1'" 1 
ATOM   8265 N  N1    . DC  D 4 12  ? 36.280 25.829  -37.124 1.00 75.53  ? 712 DC  T N1    1 
ATOM   8266 C  C2    . DC  D 4 12  ? 35.330 24.862  -37.471 1.00 80.40  ? 712 DC  T C2    1 
ATOM   8267 O  O2    . DC  D 4 12  ? 35.210 24.532  -38.658 1.00 86.06  ? 712 DC  T O2    1 
ATOM   8268 N  N3    . DC  D 4 12  ? 34.566 24.313  -36.494 1.00 82.30  ? 712 DC  T N3    1 
ATOM   8269 C  C4    . DC  D 4 12  ? 34.725 24.696  -35.227 1.00 77.47  ? 712 DC  T C4    1 
ATOM   8270 N  N4    . DC  D 4 12  ? 33.948 24.126  -34.299 1.00 73.20  ? 712 DC  T N4    1 
ATOM   8271 C  C5    . DC  D 4 12  ? 35.688 25.679  -34.854 1.00 74.20  ? 712 DC  T C5    1 
ATOM   8272 C  C6    . DC  D 4 12  ? 36.435 26.214  -35.825 1.00 74.96  ? 712 DC  T C6    1 
ATOM   8273 P  P     . DC  D 4 13  ? 36.615 30.667  -40.306 1.00 94.58  ? 713 DC  T P     1 
ATOM   8274 O  OP1   . DC  D 4 13  ? 37.207 31.386  -41.456 1.00 90.39  ? 713 DC  T OP1   1 
ATOM   8275 O  OP2   . DC  D 4 13  ? 36.211 31.423  -39.100 1.00 91.26  ? 713 DC  T OP2   1 
ATOM   8276 O  "O5'" . DC  D 4 13  ? 35.342 29.835  -40.815 1.00 95.40  ? 713 DC  T "O5'" 1 
ATOM   8277 C  "C5'" . DC  D 4 13  ? 35.407 29.097  -42.034 1.00 90.87  ? 713 DC  T "C5'" 1 
ATOM   8278 C  "C4'" . DC  D 4 13  ? 34.230 28.142  -42.159 1.00 89.32  ? 713 DC  T "C4'" 1 
ATOM   8279 O  "O4'" . DC  D 4 13  ? 34.173 27.292  -40.997 1.00 92.17  ? 713 DC  T "O4'" 1 
ATOM   8280 C  "C3'" . DC  D 4 13  ? 32.865 28.803  -42.209 1.00 85.89  ? 713 DC  T "C3'" 1 
ATOM   8281 O  "O3'" . DC  D 4 13  ? 32.544 29.155  -43.553 1.00 88.84  ? 713 DC  T "O3'" 1 
ATOM   8282 C  "C2'" . DC  D 4 13  ? 31.933 27.705  -41.682 1.00 83.48  ? 713 DC  T "C2'" 1 
ATOM   8283 C  "C1'" . DC  D 4 13  ? 32.850 26.825  -40.825 1.00 85.22  ? 713 DC  T "C1'" 1 
ATOM   8284 N  N1    . DC  D 4 13  ? 32.514 26.848  -39.368 1.00 79.81  ? 713 DC  T N1    1 
ATOM   8285 C  C2    . DC  D 4 13  ? 31.543 25.974  -38.866 1.00 77.28  ? 713 DC  T C2    1 
ATOM   8286 O  O2    . DC  D 4 13  ? 30.974 25.195  -39.641 1.00 81.36  ? 713 DC  T O2    1 
ATOM   8287 N  N3    . DC  D 4 13  ? 31.253 26.007  -37.541 1.00 74.73  ? 713 DC  T N3    1 
ATOM   8288 C  C4    . DC  D 4 13  ? 31.889 26.862  -36.739 1.00 78.99  ? 713 DC  T C4    1 
ATOM   8289 N  N4    . DC  D 4 13  ? 31.570 26.858  -35.441 1.00 81.99  ? 713 DC  T N4    1 
ATOM   8290 C  C5    . DC  D 4 13  ? 32.881 27.758  -37.233 1.00 82.31  ? 713 DC  T C5    1 
ATOM   8291 C  C6    . DC  D 4 13  ? 33.156 27.719  -38.540 1.00 81.60  ? 713 DC  T C6    1 
ATOM   8292 P  P     . DG  D 4 14  ? 31.305 30.132  -43.862 1.00 90.13  ? 714 DG  T P     1 
ATOM   8293 O  OP1   . DG  D 4 14  ? 31.432 30.608  -45.257 1.00 95.41  ? 714 DG  T OP1   1 
ATOM   8294 O  OP2   . DG  D 4 14  ? 31.220 31.108  -42.752 1.00 88.99  ? 714 DG  T OP2   1 
ATOM   8295 O  "O5'" . DG  D 4 14  ? 30.023 29.182  -43.760 1.00 78.73  ? 714 DG  T "O5'" 1 
ATOM   8296 C  "C5'" . DG  D 4 14  ? 29.932 28.014  -44.567 1.00 77.88  ? 714 DG  T "C5'" 1 
ATOM   8297 C  "C4'" . DG  D 4 14  ? 28.815 27.111  -44.076 1.00 84.06  ? 714 DG  T "C4'" 1 
ATOM   8298 O  "O4'" . DG  D 4 14  ? 29.010 26.815  -42.666 1.00 88.15  ? 714 DG  T "O4'" 1 
ATOM   8299 C  "C3'" . DG  D 4 14  ? 27.414 27.704  -44.185 1.00 87.32  ? 714 DG  T "C3'" 1 
ATOM   8300 O  "O3'" . DG  D 4 14  ? 26.489 26.684  -44.494 1.00 97.35  ? 714 DG  T "O3'" 1 
ATOM   8301 C  "C2'" . DG  D 4 14  ? 27.175 28.259  -42.787 1.00 86.46  ? 714 DG  T "C2'" 1 
ATOM   8302 C  "C1'" . DG  D 4 14  ? 27.864 27.205  -41.937 1.00 84.00  ? 714 DG  T "C1'" 1 
ATOM   8303 N  N9    . DG  D 4 14  ? 28.288 27.697  -40.630 1.00 74.90  ? 714 DG  T N9    1 
ATOM   8304 C  C8    . DG  D 4 14  ? 29.040 28.818  -40.373 1.00 77.21  ? 714 DG  T C8    1 
ATOM   8305 N  N7    . DG  D 4 14  ? 29.267 29.010  -39.103 1.00 75.56  ? 714 DG  T N7    1 
ATOM   8306 C  C5    . DG  D 4 14  ? 28.623 27.951  -38.478 1.00 72.02  ? 714 DG  T C5    1 
ATOM   8307 C  C6    . DG  D 4 14  ? 28.522 27.630  -37.104 1.00 71.89  ? 714 DG  T C6    1 
ATOM   8308 O  O6    . DG  D 4 14  ? 28.998 28.240  -36.137 1.00 62.50  ? 714 DG  T O6    1 
ATOM   8309 N  N1    . DG  D 4 14  ? 27.779 26.470  -36.899 1.00 71.83  ? 714 DG  T N1    1 
ATOM   8310 C  C2    . DG  D 4 14  ? 27.207 25.716  -37.896 1.00 71.14  ? 714 DG  T C2    1 
ATOM   8311 N  N2    . DG  D 4 14  ? 26.526 24.629  -37.503 1.00 67.30  ? 714 DG  T N2    1 
ATOM   8312 N  N3    . DG  D 4 14  ? 27.294 26.006  -39.189 1.00 73.40  ? 714 DG  T N3    1 
ATOM   8313 C  C4    . DG  D 4 14  ? 28.015 27.133  -39.404 1.00 72.05  ? 714 DG  T C4    1 
ATOM   8314 P  P     . DA  D 4 15  ? 25.160 27.026  -45.325 1.00 111.88 ? 715 DA  T P     1 
ATOM   8315 O  OP1   . DA  D 4 15  ? 25.489 26.916  -46.763 1.00 119.79 ? 715 DA  T OP1   1 
ATOM   8316 O  OP2   . DA  D 4 15  ? 24.608 28.290  -44.789 1.00 109.00 ? 715 DA  T OP2   1 
ATOM   8317 O  "O5'" . DA  D 4 15  ? 24.155 25.849  -44.930 1.00 107.70 ? 715 DA  T "O5'" 1 
ATOM   8318 C  "C5'" . DA  D 4 15  ? 22.941 26.156  -44.269 1.00 105.10 ? 715 DA  T "C5'" 1 
ATOM   8319 C  "C4'" . DA  D 4 15  ? 22.765 25.298  -43.031 1.00 100.91 ? 715 DA  T "C4'" 1 
ATOM   8320 O  "O4'" . DA  D 4 15  ? 23.763 25.658  -42.040 1.00 94.22  ? 715 DA  T "O4'" 1 
ATOM   8321 C  "C3'" . DA  D 4 15  ? 21.405 25.444  -42.348 1.00 105.06 ? 715 DA  T "C3'" 1 
ATOM   8322 O  "O3'" . DA  D 4 15  ? 20.856 24.163  -42.071 1.00 109.52 ? 715 DA  T "O3'" 1 
ATOM   8323 C  "C2'" . DA  D 4 15  ? 21.717 26.219  -41.068 1.00 101.34 ? 715 DA  T "C2'" 1 
ATOM   8324 C  "C1'" . DA  D 4 15  ? 23.146 25.794  -40.782 1.00 97.27  ? 715 DA  T "C1'" 1 
ATOM   8325 N  N9    . DA  D 4 15  ? 23.893 26.776  -40.001 1.00 95.23  ? 715 DA  T N9    1 
ATOM   8326 C  C8    . DA  D 4 15  ? 24.661 27.800  -40.482 1.00 92.89  ? 715 DA  T C8    1 
ATOM   8327 N  N7    . DA  D 4 15  ? 25.216 28.533  -39.545 1.00 88.37  ? 715 DA  T N7    1 
ATOM   8328 C  C5    . DA  D 4 15  ? 24.781 27.950  -38.366 1.00 88.13  ? 715 DA  T C5    1 
ATOM   8329 C  C6    . DA  D 4 15  ? 25.018 28.257  -37.012 1.00 77.76  ? 715 DA  T C6    1 
ATOM   8330 N  N6    . DA  D 4 15  ? 25.787 29.275  -36.611 1.00 70.21  ? 715 DA  T N6    1 
ATOM   8331 N  N1    . DA  D 4 15  ? 24.431 27.475  -36.081 1.00 81.79  ? 715 DA  T N1    1 
ATOM   8332 C  C2    . DA  D 4 15  ? 23.661 26.457  -36.486 1.00 84.64  ? 715 DA  T C2    1 
ATOM   8333 N  N3    . DA  D 4 15  ? 23.365 26.071  -37.727 1.00 89.96  ? 715 DA  T N3    1 
ATOM   8334 C  C4    . DA  D 4 15  ? 23.963 26.867  -38.629 1.00 92.94  ? 715 DA  T C4    1 
ATOM   8335 P  P     . DA  D 4 16  ? 19.340 23.833  -42.492 1.00 109.31 ? 716 DA  T P     1 
ATOM   8336 O  OP1   . DA  D 4 16  ? 19.293 22.439  -42.991 1.00 115.23 ? 716 DA  T OP1   1 
ATOM   8337 O  OP2   . DA  D 4 16  ? 18.870 24.941  -43.353 1.00 105.26 ? 716 DA  T OP2   1 
ATOM   8338 O  "O5'" . DA  D 4 16  ? 18.533 23.923  -41.116 1.00 102.13 ? 716 DA  T "O5'" 1 
ATOM   8339 C  "C5'" . DA  D 4 16  ? 18.333 25.182  -40.502 1.00 92.95  ? 716 DA  T "C5'" 1 
ATOM   8340 C  "C4'" . DA  D 4 16  ? 18.374 25.060  -38.993 1.00 89.49  ? 716 DA  T "C4'" 1 
ATOM   8341 O  "O4'" . DA  D 4 16  ? 19.581 25.700  -38.490 1.00 80.78  ? 716 DA  T "O4'" 1 
ATOM   8342 C  "C3'" . DA  D 4 16  ? 17.210 25.735  -38.277 1.00 97.70  ? 716 DA  T "C3'" 1 
ATOM   8343 O  "O3'" . DA  D 4 16  ? 16.819 24.977  -37.142 1.00 107.83 ? 716 DA  T "O3'" 1 
ATOM   8344 C  "C2'" . DA  D 4 16  ? 17.794 27.083  -37.879 1.00 89.71  ? 716 DA  T "C2'" 1 
ATOM   8345 C  "C1'" . DA  D 4 16  ? 19.235 26.716  -37.572 1.00 81.80  ? 716 DA  T "C1'" 1 
ATOM   8346 N  N9    . DA  D 4 16  ? 20.156 27.838  -37.741 1.00 74.91  ? 716 DA  T N9    1 
ATOM   8347 C  C8    . DA  D 4 16  ? 20.454 28.491  -38.904 1.00 69.90  ? 716 DA  T C8    1 
ATOM   8348 N  N7    . DA  D 4 16  ? 21.311 29.473  -38.754 1.00 74.64  ? 716 DA  T N7    1 
ATOM   8349 C  C5    . DA  D 4 16  ? 21.589 29.469  -37.398 1.00 73.96  ? 716 DA  T C5    1 
ATOM   8350 C  C6    . DA  D 4 16  ? 22.427 30.271  -36.598 1.00 71.49  ? 716 DA  T C6    1 
ATOM   8351 N  N6    . DA  D 4 16  ? 23.169 31.273  -37.082 1.00 65.89  ? 716 DA  T N6    1 
ATOM   8352 N  N1    . DA  D 4 16  ? 22.475 30.001  -35.276 1.00 67.63  ? 716 DA  T N1    1 
ATOM   8353 C  C2    . DA  D 4 16  ? 21.732 28.996  -34.795 1.00 68.87  ? 716 DA  T C2    1 
ATOM   8354 N  N3    . DA  D 4 16  ? 20.907 28.176  -35.447 1.00 67.64  ? 716 DA  T N3    1 
ATOM   8355 C  C4    . DA  D 4 16  ? 20.882 28.469  -36.757 1.00 69.46  ? 716 DA  T C4    1 
ATOM   8356 P  P     . DC  D 4 17  ? 15.318 25.093  -36.579 1.00 113.63 ? 717 DC  T P     1 
ATOM   8357 O  OP1   . DC  D 4 17  ? 15.301 24.519  -35.216 1.00 114.26 ? 717 DC  T OP1   1 
ATOM   8358 O  OP2   . DC  D 4 17  ? 14.408 24.554  -37.615 1.00 114.16 ? 717 DC  T OP2   1 
ATOM   8359 O  "O5'" . DC  D 4 17  ? 15.065 26.671  -36.493 1.00 107.49 ? 717 DC  T "O5'" 1 
ATOM   8360 C  "C5'" . DC  D 4 17  ? 14.430 27.234  -35.355 1.00 106.55 ? 717 DC  T "C5'" 1 
ATOM   8361 C  "C4'" . DC  D 4 17  ? 15.455 27.649  -34.314 1.00 103.10 ? 717 DC  T "C4'" 1 
ATOM   8362 O  "O4'" . DC  D 4 17  ? 16.701 27.975  -34.961 1.00 101.81 ? 717 DC  T "O4'" 1 
ATOM   8363 C  "C3'" . DC  D 4 17  ? 15.095 28.897  -33.534 1.00 102.22 ? 717 DC  T "C3'" 1 
ATOM   8364 O  "O3'" . DC  D 4 17  ? 14.274 28.552  -32.429 1.00 104.70 ? 717 DC  T "O3'" 1 
ATOM   8365 C  "C2'" . DC  D 4 17  ? 16.459 29.416  -33.078 1.00 98.54  ? 717 DC  T "C2'" 1 
ATOM   8366 C  "C1'" . DC  D 4 17  ? 17.412 28.910  -34.170 1.00 95.42  ? 717 DC  T "C1'" 1 
ATOM   8367 N  N1    . DC  D 4 17  ? 17.941 29.988  -35.061 1.00 82.51  ? 717 DC  T N1    1 
ATOM   8368 C  C2    . DC  D 4 17  ? 18.938 30.852  -34.593 1.00 86.29  ? 717 DC  T C2    1 
ATOM   8369 O  O2    . DC  D 4 17  ? 19.364 30.715  -33.439 1.00 92.47  ? 717 DC  T O2    1 
ATOM   8370 N  N3    . DC  D 4 17  ? 19.410 31.818  -35.420 1.00 84.50  ? 717 DC  T N3    1 
ATOM   8371 C  C4    . DC  D 4 17  ? 18.926 31.933  -36.657 1.00 80.29  ? 717 DC  T C4    1 
ATOM   8372 N  N4    . DC  D 4 17  ? 19.421 32.901  -37.435 1.00 82.54  ? 717 DC  T N4    1 
ATOM   8373 C  C5    . DC  D 4 17  ? 17.913 31.061  -37.152 1.00 74.72  ? 717 DC  T C5    1 
ATOM   8374 C  C6    . DC  D 4 17  ? 17.454 30.114  -36.328 1.00 75.72  ? 717 DC  T C6    1 
ATOM   8375 P  P     . DA  D 4 18  ? 13.123 29.559  -31.941 1.00 100.85 ? 718 DA  T P     1 
ATOM   8376 O  OP1   . DA  D 4 18  ? 12.281 28.847  -30.953 1.00 101.07 ? 718 DA  T OP1   1 
ATOM   8377 O  OP2   . DA  D 4 18  ? 12.507 30.143  -33.154 1.00 107.45 ? 718 DA  T OP2   1 
ATOM   8378 O  "O5'" . DA  D 4 18  ? 13.927 30.719  -31.193 1.00 93.83  ? 718 DA  T "O5'" 1 
ATOM   8379 C  "C5'" . DA  D 4 18  ? 14.768 30.402  -30.091 1.00 88.06  ? 718 DA  T "C5'" 1 
ATOM   8380 C  "C4'" . DA  D 4 18  ? 15.425 31.654  -29.540 1.00 84.28  ? 718 DA  T "C4'" 1 
ATOM   8381 O  "O4'" . DA  D 4 18  ? 16.345 32.195  -30.525 1.00 91.11  ? 718 DA  T "O4'" 1 
ATOM   8382 C  "C3'" . DA  D 4 18  ? 14.461 32.783  -29.189 1.00 80.34  ? 718 DA  T "C3'" 1 
ATOM   8383 O  "O3'" . DA  D 4 18  ? 14.873 33.418  -27.992 1.00 84.17  ? 718 DA  T "O3'" 1 
ATOM   8384 C  "C2'" . DA  D 4 18  ? 14.560 33.720  -30.391 1.00 84.95  ? 718 DA  T "C2'" 1 
ATOM   8385 C  "C1'" . DA  D 4 18  ? 16.009 33.534  -30.821 1.00 90.34  ? 718 DA  T "C1'" 1 
ATOM   8386 N  N9    . DA  D 4 18  ? 16.219 33.751  -32.250 1.00 84.22  ? 718 DA  T N9    1 
ATOM   8387 C  C8    . DA  D 4 18  ? 15.526 33.178  -33.280 1.00 80.12  ? 718 DA  T C8    1 
ATOM   8388 N  N7    . DA  D 4 18  ? 15.933 33.558  -34.468 1.00 75.49  ? 718 DA  T N7    1 
ATOM   8389 C  C5    . DA  D 4 18  ? 16.966 34.440  -34.199 1.00 74.47  ? 718 DA  T C5    1 
ATOM   8390 C  C6    . DA  D 4 18  ? 17.815 35.190  -35.035 1.00 69.67  ? 718 DA  T C6    1 
ATOM   8391 N  N6    . DA  D 4 18  ? 17.745 35.163  -36.370 1.00 67.39  ? 718 DA  T N6    1 
ATOM   8392 N  N1    . DA  D 4 18  ? 18.742 35.973  -34.444 1.00 68.00  ? 718 DA  T N1    1 
ATOM   8393 C  C2    . DA  D 4 18  ? 18.808 35.998  -33.108 1.00 70.74  ? 718 DA  T C2    1 
ATOM   8394 N  N3    . DA  D 4 18  ? 18.067 35.339  -32.219 1.00 71.37  ? 718 DA  T N3    1 
ATOM   8395 C  C4    . DA  D 4 18  ? 17.156 34.570  -32.836 1.00 78.14  ? 718 DA  T C4    1 
ATOM   8396 P  P     . DG  D 4 19  ? 13.897 34.460  -27.255 1.00 90.62  ? 719 DG  T P     1 
ATOM   8397 O  OP1   . DG  D 4 19  ? 14.136 34.348  -25.800 1.00 98.43  ? 719 DG  T OP1   1 
ATOM   8398 O  OP2   . DG  D 4 19  ? 12.534 34.282  -27.801 1.00 93.12  ? 719 DG  T OP2   1 
ATOM   8399 O  "O5'" . DG  D 4 19  ? 14.427 35.881  -27.742 1.00 79.03  ? 719 DG  T "O5'" 1 
ATOM   8400 C  "C5'" . DG  D 4 19  ? 15.702 36.335  -27.328 1.00 76.47  ? 719 DG  T "C5'" 1 
ATOM   8401 C  "C4'" . DG  D 4 19  ? 15.957 37.732  -27.849 1.00 81.37  ? 719 DG  T "C4'" 1 
ATOM   8402 O  "O4'" . DG  D 4 19  ? 16.317 37.664  -29.251 1.00 86.21  ? 719 DG  T "O4'" 1 
ATOM   8403 C  "C3'" . DG  D 4 19  ? 14.756 38.676  -27.754 1.00 79.47  ? 719 DG  T "C3'" 1 
ATOM   8404 O  "O3'" . DG  D 4 19  ? 15.166 39.923  -27.220 1.00 84.80  ? 719 DG  T "O3'" 1 
ATOM   8405 C  "C2'" . DG  D 4 19  ? 14.280 38.802  -29.203 1.00 76.68  ? 719 DG  T "C2'" 1 
ATOM   8406 C  "C1'" . DG  D 4 19  ? 15.572 38.612  -29.976 1.00 80.93  ? 719 DG  T "C1'" 1 
ATOM   8407 N  N9    . DG  D 4 19  ? 15.370 38.100  -31.327 1.00 74.54  ? 719 DG  T N9    1 
ATOM   8408 C  C8    . DG  D 4 19  ? 14.532 37.082  -31.711 1.00 67.79  ? 719 DG  T C8    1 
ATOM   8409 N  N7    . DG  D 4 19  ? 14.561 36.841  -32.993 1.00 70.66  ? 719 DG  T N7    1 
ATOM   8410 C  C5    . DG  D 4 19  ? 15.478 37.758  -33.490 1.00 70.20  ? 719 DG  T C5    1 
ATOM   8411 C  C6    . DG  D 4 19  ? 15.925 37.974  -34.815 1.00 66.39  ? 719 DG  T C6    1 
ATOM   8412 O  O6    . DG  D 4 19  ? 15.587 37.378  -35.846 1.00 67.62  ? 719 DG  T O6    1 
ATOM   8413 N  N1    . DG  D 4 19  ? 16.861 39.003  -34.881 1.00 69.34  ? 719 DG  T N1    1 
ATOM   8414 C  C2    . DG  D 4 19  ? 17.308 39.730  -33.803 1.00 71.86  ? 719 DG  T C2    1 
ATOM   8415 N  N2    . DG  D 4 19  ? 18.213 40.685  -34.063 1.00 72.27  ? 719 DG  T N2    1 
ATOM   8416 N  N3    . DG  D 4 19  ? 16.896 39.538  -32.557 1.00 75.14  ? 719 DG  T N3    1 
ATOM   8417 C  C4    . DG  D 4 19  ? 15.985 38.539  -32.476 1.00 72.94  ? 719 DG  T C4    1 
ATOM   8418 P  P     . DG  D 4 20  ? 14.085 41.064  -26.886 1.00 92.94  ? 720 DG  T P     1 
ATOM   8419 O  OP1   . DG  D 4 20  ? 14.434 41.631  -25.565 1.00 98.65  ? 720 DG  T OP1   1 
ATOM   8420 O  OP2   . DG  D 4 20  ? 12.727 40.524  -27.119 1.00 88.05  ? 720 DG  T OP2   1 
ATOM   8421 O  "O5'" . DG  D 4 20  ? 14.366 42.174  -27.995 1.00 91.21  ? 720 DG  T "O5'" 1 
ATOM   8422 C  "C5'" . DG  D 4 20  ? 15.677 42.685  -28.158 1.00 77.83  ? 720 DG  T "C5'" 1 
ATOM   8423 C  "C4'" . DG  D 4 20  ? 15.757 43.558  -29.390 1.00 68.42  ? 720 DG  T "C4'" 1 
ATOM   8424 O  "O4'" . DG  D 4 20  ? 15.720 42.728  -30.577 1.00 75.22  ? 720 DG  T "O4'" 1 
ATOM   8425 C  "C3'" . DG  D 4 20  ? 14.614 44.568  -29.535 1.00 67.84  ? 720 DG  T "C3'" 1 
ATOM   8426 O  "O3'" . DG  D 4 20  ? 15.150 45.860  -29.767 1.00 81.43  ? 720 DG  T "O3'" 1 
ATOM   8427 C  "C2'" . DG  D 4 20  ? 13.822 44.055  -30.741 1.00 62.70  ? 720 DG  T "C2'" 1 
ATOM   8428 C  "C1'" . DG  D 4 20  ? 14.898 43.339  -31.535 1.00 69.21  ? 720 DG  T "C1'" 1 
ATOM   8429 N  N9    . DG  D 4 20  ? 14.380 42.306  -32.427 1.00 70.55  ? 720 DG  T N9    1 
ATOM   8430 C  C8    . DG  D 4 20  ? 13.535 41.273  -32.098 1.00 64.70  ? 720 DG  T C8    1 
ATOM   8431 N  N7    . DG  D 4 20  ? 13.241 40.502  -33.108 1.00 65.91  ? 720 DG  T N7    1 
ATOM   8432 C  C5    . DG  D 4 20  ? 13.938 41.058  -34.174 1.00 66.22  ? 720 DG  T C5    1 
ATOM   8433 C  C6    . DG  D 4 20  ? 14.009 40.652  -35.528 1.00 68.61  ? 720 DG  T C6    1 
ATOM   8434 O  O6    . DG  D 4 20  ? 13.450 39.690  -36.072 1.00 71.20  ? 720 DG  T O6    1 
ATOM   8435 N  N1    . DG  D 4 20  ? 14.829 41.495  -36.275 1.00 68.02  ? 720 DG  T N1    1 
ATOM   8436 C  C2    . DG  D 4 20  ? 15.496 42.589  -35.777 1.00 66.22  ? 720 DG  T C2    1 
ATOM   8437 N  N2    . DG  D 4 20  ? 16.240 43.281  -36.650 1.00 82.19  ? 720 DG  T N2    1 
ATOM   8438 N  N3    . DG  D 4 20  ? 15.438 42.978  -34.511 1.00 65.10  ? 720 DG  T N3    1 
ATOM   8439 C  C4    . DG  D 4 20  ? 14.644 42.169  -33.770 1.00 67.53  ? 720 DG  T C4    1 
ATOM   8440 P  P     . DG  D 4 21  ? 14.208 47.160  -29.723 1.00 68.52  ? 721 DG  T P     1 
ATOM   8441 O  OP1   . DG  D 4 21  ? 14.849 48.126  -28.804 1.00 78.93  ? 721 DG  T OP1   1 
ATOM   8442 O  OP2   . DG  D 4 21  ? 12.809 46.739  -29.487 1.00 69.06  ? 721 DG  T OP2   1 
ATOM   8443 O  "O5'" . DG  D 4 21  ? 14.306 47.736  -31.207 1.00 61.88  ? 721 DG  T "O5'" 1 
ATOM   8444 C  "C5'" . DG  D 4 21  ? 15.576 48.045  -31.761 1.00 61.51  ? 721 DG  T "C5'" 1 
ATOM   8445 C  "C4'" . DG  D 4 21  ? 15.456 48.341  -33.242 1.00 75.29  ? 721 DG  T "C4'" 1 
ATOM   8446 O  "O4'" . DG  D 4 21  ? 15.184 47.108  -33.958 1.00 76.83  ? 721 DG  T "O4'" 1 
ATOM   8447 C  "C3'" . DG  D 4 21  ? 14.334 49.312  -33.612 1.00 63.44  ? 721 DG  T "C3'" 1 
ATOM   8448 O  "O3'" . DG  D 4 21  ? 14.792 50.234  -34.588 1.00 72.04  ? 721 DG  T "O3'" 1 
ATOM   8449 C  "C2'" . DG  D 4 21  ? 13.240 48.400  -34.165 1.00 68.41  ? 721 DG  T "C2'" 1 
ATOM   8450 C  "C1'" . DG  D 4 21  ? 14.052 47.272  -34.782 1.00 71.59  ? 721 DG  T "C1'" 1 
ATOM   8451 N  N9    . DG  D 4 21  ? 13.332 46.002  -34.834 1.00 65.85  ? 721 DG  T N9    1 
ATOM   8452 C  C8    . DG  D 4 21  ? 12.762 45.329  -33.780 1.00 65.49  ? 721 DG  T C8    1 
ATOM   8453 N  N7    . DG  D 4 21  ? 12.181 44.215  -34.128 1.00 66.41  ? 721 DG  T N7    1 
ATOM   8454 C  C5    . DG  D 4 21  ? 12.379 44.142  -35.501 1.00 67.44  ? 721 DG  T C5    1 
ATOM   8455 C  C6    . DG  D 4 21  ? 11.973 43.155  -36.429 1.00 68.71  ? 721 DG  T C6    1 
ATOM   8456 O  O6    . DG  D 4 21  ? 11.336 42.114  -36.214 1.00 69.19  ? 721 DG  T O6    1 
ATOM   8457 N  N1    . DG  D 4 21  ? 12.379 43.468  -37.724 1.00 69.46  ? 721 DG  T N1    1 
ATOM   8458 C  C2    . DG  D 4 21  ? 13.087 44.593  -38.076 1.00 69.04  ? 721 DG  T C2    1 
ATOM   8459 N  N2    . DG  D 4 21  ? 13.389 44.724  -39.376 1.00 72.54  ? 721 DG  T N2    1 
ATOM   8460 N  N3    . DG  D 4 21  ? 13.473 45.525  -37.216 1.00 71.57  ? 721 DG  T N3    1 
ATOM   8461 C  C4    . DG  D 4 21  ? 13.086 45.235  -35.950 1.00 68.77  ? 721 DG  T C4    1 
ATOM   8462 P  P     . DA  D 4 22  ? 13.918 51.535  -34.947 1.00 85.69  ? 722 DA  T P     1 
ATOM   8463 O  OP1   . DA  D 4 22  ? 14.839 52.692  -35.000 1.00 88.54  ? 722 DA  T OP1   1 
ATOM   8464 O  OP2   . DA  D 4 22  ? 12.742 51.573  -34.049 1.00 87.34  ? 722 DA  T OP2   1 
ATOM   8465 O  "O5'" . DA  D 4 22  ? 13.392 51.237  -36.424 1.00 73.30  ? 722 DA  T "O5'" 1 
ATOM   8466 C  "C5'" . DA  D 4 22  ? 14.322 51.005  -37.468 1.00 66.21  ? 722 DA  T "C5'" 1 
ATOM   8467 C  "C4'" . DA  D 4 22  ? 13.607 50.611  -38.746 1.00 70.82  ? 722 DA  T "C4'" 1 
ATOM   8468 O  "O4'" . DA  D 4 22  ? 13.101 49.257  -38.622 1.00 84.49  ? 722 DA  T "O4'" 1 
ATOM   8469 C  "C3'" . DA  D 4 22  ? 12.410 51.486  -39.111 1.00 68.55  ? 722 DA  T "C3'" 1 
ATOM   8470 O  "O3'" . DA  D 4 22  ? 12.403 51.731  -40.508 1.00 72.62  ? 722 DA  T "O3'" 1 
ATOM   8471 C  "C2'" . DA  D 4 22  ? 11.211 50.642  -38.680 1.00 73.10  ? 722 DA  T "C2'" 1 
ATOM   8472 C  "C1'" . DA  D 4 22  ? 11.723 49.230  -38.923 1.00 82.86  ? 722 DA  T "C1'" 1 
ATOM   8473 N  N9    . DA  D 4 22  ? 11.090 48.227  -38.072 1.00 69.27  ? 722 DA  T N9    1 
ATOM   8474 C  C8    . DA  D 4 22  ? 10.913 48.291  -36.718 1.00 68.25  ? 722 DA  T C8    1 
ATOM   8475 N  N7    . DA  D 4 22  ? 10.317 47.238  -36.212 1.00 68.45  ? 722 DA  T N7    1 
ATOM   8476 C  C5    . DA  D 4 22  ? 10.090 46.425  -37.310 1.00 69.70  ? 722 DA  T C5    1 
ATOM   8477 C  C6    . DA  D 4 22  ? 9.489  45.158  -37.445 1.00 70.50  ? 722 DA  T C6    1 
ATOM   8478 N  N6    . DA  D 4 22  ? 8.989  44.468  -36.415 1.00 70.14  ? 722 DA  T N6    1 
ATOM   8479 N  N1    . DA  D 4 22  ? 9.424  44.626  -38.683 1.00 71.70  ? 722 DA  T N1    1 
ATOM   8480 C  C2    . DA  D 4 22  ? 9.926  45.320  -39.712 1.00 72.07  ? 722 DA  T C2    1 
ATOM   8481 N  N3    . DA  D 4 22  ? 10.512 46.516  -39.708 1.00 71.41  ? 722 DA  T N3    1 
ATOM   8482 C  C4    . DA  D 4 22  ? 10.563 47.019  -38.464 1.00 70.22  ? 722 DA  T C4    1 
ATOM   8483 P  P     . DC  D 4 23  ? 11.405 52.823  -41.135 1.00 76.80  ? 723 DC  T P     1 
ATOM   8484 O  OP1   . DC  D 4 23  ? 12.159 53.565  -42.169 1.00 84.65  ? 723 DC  T OP1   1 
ATOM   8485 O  OP2   . DC  D 4 23  ? 10.759 53.556  -40.023 1.00 73.31  ? 723 DC  T OP2   1 
ATOM   8486 O  "O5'" . DC  D 4 23  ? 10.289 51.940  -41.861 1.00 74.88  ? 723 DC  T "O5'" 1 
ATOM   8487 C  "C5'" . DC  D 4 23  ? 10.652 51.100  -42.947 1.00 72.85  ? 723 DC  T "C5'" 1 
ATOM   8488 C  "C4'" . DC  D 4 23  ? 9.557  50.094  -43.238 1.00 77.32  ? 723 DC  T "C4'" 1 
ATOM   8489 O  "O4'" . DC  D 4 23  ? 9.386  49.233  -42.098 1.00 77.75  ? 723 DC  T "O4'" 1 
ATOM   8490 C  "C3'" . DC  D 4 23  ? 8.183  50.705  -43.515 1.00 80.55  ? 723 DC  T "C3'" 1 
ATOM   8491 O  "O3'" . DC  D 4 23  ? 7.857  50.553  -44.889 1.00 84.97  ? 723 DC  T "O3'" 1 
ATOM   8492 C  "C2'" . DC  D 4 23  ? 7.211  49.927  -42.609 1.00 75.36  ? 723 DC  T "C2'" 1 
ATOM   8493 C  "C1'" . DC  D 4 23  ? 8.062  48.780  -42.071 1.00 74.22  ? 723 DC  T "C1'" 1 
ATOM   8494 N  N1    . DC  D 4 23  ? 7.727  48.403  -40.669 1.00 74.22  ? 723 DC  T N1    1 
ATOM   8495 C  C2    . DC  D 4 23  ? 7.124  47.168  -40.409 1.00 73.82  ? 723 DC  T C2    1 
ATOM   8496 O  O2    . DC  D 4 23  ? 6.877  46.407  -41.353 1.00 79.27  ? 723 DC  T O2    1 
ATOM   8497 N  N3    . DC  D 4 23  ? 6.826  46.840  -39.128 1.00 73.03  ? 723 DC  T N3    1 
ATOM   8498 C  C4    . DC  D 4 23  ? 7.109  47.689  -38.138 1.00 71.82  ? 723 DC  T C4    1 
ATOM   8499 N  N4    . DC  D 4 23  ? 6.796  47.322  -36.891 1.00 76.37  ? 723 DC  T N4    1 
ATOM   8500 C  C5    . DC  D 4 23  ? 7.725  48.952  -38.383 1.00 71.33  ? 723 DC  T C5    1 
ATOM   8501 C  C6    . DC  D 4 23  ? 8.015  49.264  -39.651 1.00 72.89  ? 723 DC  T C6    1 
ATOM   8502 P  P     . DT  D 4 24  ? 6.778  51.522  -45.578 1.00 91.16  ? 724 DT  T P     1 
ATOM   8503 O  OP1   . DT  D 4 24  ? 7.333  51.976  -46.873 1.00 103.78 ? 724 DT  T OP1   1 
ATOM   8504 O  OP2   . DT  D 4 24  ? 6.350  52.516  -44.568 1.00 81.07  ? 724 DT  T OP2   1 
ATOM   8505 O  "O5'" . DT  D 4 24  ? 5.538  50.557  -45.863 1.00 103.98 ? 724 DT  T "O5'" 1 
ATOM   8506 C  "C5'" . DT  D 4 24  ? 5.766  49.224  -46.299 1.00 102.19 ? 724 DT  T "C5'" 1 
ATOM   8507 C  "C4'" . DT  D 4 24  ? 4.469  48.440  -46.312 1.00 94.04  ? 724 DT  T "C4'" 1 
ATOM   8508 O  "O4'" . DT  D 4 24  ? 3.964  48.322  -44.955 1.00 88.46  ? 724 DT  T "O4'" 1 
ATOM   8509 C  "C3'" . DT  D 4 24  ? 3.348  49.076  -47.133 1.00 94.98  ? 724 DT  T "C3'" 1 
ATOM   8510 O  "O3'" . DT  D 4 24  ? 2.670  48.084  -47.891 1.00 98.25  ? 724 DT  T "O3'" 1 
ATOM   8511 C  "C2'" . DT  D 4 24  ? 2.441  49.699  -46.074 1.00 96.01  ? 724 DT  T "C2'" 1 
ATOM   8512 C  "C1'" . DT  D 4 24  ? 2.619  48.738  -44.910 1.00 93.54  ? 724 DT  T "C1'" 1 
ATOM   8513 N  N1    . DT  D 4 24  ? 2.356  49.364  -43.581 1.00 94.06  ? 724 DT  T N1    1 
ATOM   8514 C  C2    . DT  D 4 24  ? 1.363  48.849  -42.780 1.00 93.28  ? 724 DT  T C2    1 
ATOM   8515 O  O2    . DT  D 4 24  ? 0.680  47.891  -43.095 1.00 92.32  ? 724 DT  T O2    1 
ATOM   8516 N  N3    . DT  D 4 24  ? 1.198  49.498  -41.585 1.00 91.39  ? 724 DT  T N3    1 
ATOM   8517 C  C4    . DT  D 4 24  ? 1.909  50.590  -41.121 1.00 84.92  ? 724 DT  T C4    1 
ATOM   8518 O  O4    . DT  D 4 24  ? 1.686  51.103  -40.028 1.00 75.71  ? 724 DT  T O4    1 
ATOM   8519 C  C5    . DT  D 4 24  ? 2.934  51.083  -42.011 1.00 84.11  ? 724 DT  T C5    1 
ATOM   8520 C  C7    . DT  D 4 24  ? 3.771  52.263  -41.617 1.00 75.46  ? 724 DT  T C7    1 
ATOM   8521 C  C6    . DT  D 4 24  ? 3.105  50.454  -43.185 1.00 91.17  ? 724 DT  T C6    1 
ATOM   8522 P  P     . DG  D 4 25  ? 1.526  48.512  -48.935 1.00 108.02 ? 725 DG  T P     1 
ATOM   8523 O  OP1   . DG  D 4 25  ? 1.395  47.419  -49.925 1.00 113.13 ? 725 DG  T OP1   1 
ATOM   8524 O  OP2   . DG  D 4 25  ? 1.827  49.888  -49.392 1.00 103.73 ? 725 DG  T OP2   1 
ATOM   8525 O  "O5'" . DG  D 4 25  ? 0.201  48.565  -48.040 1.00 114.44 ? 725 DG  T "O5'" 1 
ATOM   8526 C  "C5'" . DG  D 4 25  ? -0.945 49.273  -48.494 1.00 121.20 ? 725 DG  T "C5'" 1 
ATOM   8527 C  "C4'" . DG  D 4 25  ? -2.038 49.244  -47.440 1.00 119.79 ? 725 DG  T "C4'" 1 
ATOM   8528 O  "O4'" . DG  D 4 25  ? -1.431 49.279  -46.125 1.00 116.82 ? 725 DG  T "O4'" 1 
ATOM   8529 C  "C3'" . DG  D 4 25  ? -3.006 50.418  -47.488 1.00 113.99 ? 725 DG  T "C3'" 1 
ATOM   8530 O  "O3'" . DG  D 4 25  ? -4.137 50.078  -48.285 1.00 99.60  ? 725 DG  T "O3'" 1 
ATOM   8531 C  "C2'" . DG  D 4 25  ? -3.394 50.607  -46.024 1.00 119.75 ? 725 DG  T "C2'" 1 
ATOM   8532 C  "C1'" . DG  D 4 25  ? -2.131 50.171  -45.281 1.00 120.78 ? 725 DG  T "C1'" 1 
ATOM   8533 N  N9    . DG  D 4 25  ? -1.237 51.272  -44.924 1.00 120.95 ? 725 DG  T N9    1 
ATOM   8534 C  C8    . DG  D 4 25  ? -0.387 51.956  -45.761 1.00 119.87 ? 725 DG  T C8    1 
ATOM   8535 N  N7    . DG  D 4 25  ? 0.298  52.888  -45.159 1.00 115.67 ? 725 DG  T N7    1 
ATOM   8536 C  C5    . DG  D 4 25  ? -0.119 52.816  -43.835 1.00 111.49 ? 725 DG  T C5    1 
ATOM   8537 C  C6    . DG  D 4 25  ? 0.277  53.580  -42.711 1.00 102.67 ? 725 DG  T C6    1 
ATOM   8538 O  O6    . DG  D 4 25  ? 1.101  54.504  -42.662 1.00 96.26  ? 725 DG  T O6    1 
ATOM   8539 N  N1    . DG  D 4 25  ? -0.392 53.183  -41.556 1.00 102.89 ? 725 DG  T N1    1 
ATOM   8540 C  C2    . DG  D 4 25  ? -1.324 52.174  -41.495 1.00 101.29 ? 725 DG  T C2    1 
ATOM   8541 N  N2    . DG  D 4 25  ? -1.861 51.934  -40.290 1.00 97.93  ? 725 DG  T N2    1 
ATOM   8542 N  N3    . DG  D 4 25  ? -1.703 51.450  -42.540 1.00 106.66 ? 725 DG  T N3    1 
ATOM   8543 C  C4    . DG  D 4 25  ? -1.062 51.825  -43.674 1.00 114.07 ? 725 DG  T C4    1 
HETATM 8544 MG MG    . MG  E 5 .   ? 15.656 56.861  -41.271 1.00 111.69 ? 601 MG  A MG    1 
HETATM 8545 C  C4    . 6FM F 6 .   ? 42.344 6.908   -27.989 1.00 75.00  ? 901 6FM P C4    1 
HETATM 8546 N  N3    . 6FM F 6 .   ? 41.242 6.556   -27.370 1.00 81.47  ? 901 6FM P N3    1 
HETATM 8547 C  C2    . 6FM F 6 .   ? 40.101 6.445   -28.049 1.00 78.14  ? 901 6FM P C2    1 
HETATM 8548 F  F32   . 6FM F 6 .   ? 38.961 6.078   -27.395 1.00 79.93  ? 901 6FM P F32   1 
HETATM 8549 N  N1    . 6FM F 6 .   ? 40.057 6.689   -29.366 1.00 83.88  ? 901 6FM P N1    1 
HETATM 8550 C  C6    . 6FM F 6 .   ? 41.142 7.049   -30.047 1.00 76.13  ? 901 6FM P C6    1 
HETATM 8551 N  N6    . 6FM F 6 .   ? 41.077 7.311   -31.475 1.00 75.84  ? 901 6FM P N6    1 
HETATM 8552 C  C5    . 6FM F 6 .   ? 42.324 7.166   -29.356 1.00 74.66  ? 901 6FM P C5    1 
HETATM 8553 N  N7    . 6FM F 6 .   ? 43.684 7.515   -29.670 1.00 79.68  ? 901 6FM P N7    1 
HETATM 8554 C  C8    . 6FM F 6 .   ? 44.344 7.427   -28.488 1.00 82.62  ? 901 6FM P C8    1 
HETATM 8555 N  N9    . 6FM F 6 .   ? 43.502 7.090   -27.668 1.00 81.97  ? 901 6FM P N9    1 
HETATM 8556 C  "C1'" . 6FM F 6 .   ? 43.886 6.912   -26.318 1.00 78.91  ? 901 6FM P "C1'" 1 
HETATM 8557 C  "C2'" . 6FM F 6 .   ? 44.179 5.465   -26.057 1.00 74.78  ? 901 6FM P "C2'" 1 
HETATM 8558 C  "C3'" . 6FM F 6 .   ? 45.625 5.394   -25.933 1.00 73.24  ? 901 6FM P "C3'" 1 
HETATM 8559 O  "O3'" . 6FM F 6 .   ? 46.005 4.366   -24.963 1.00 74.12  ? 901 6FM P "O3'" 1 
HETATM 8560 C  "C4'" . 6FM F 6 .   ? 46.102 6.753   -25.547 1.00 76.69  ? 901 6FM P "C4'" 1 
HETATM 8561 C  C33   . 6FM F 6 .   ? 46.216 6.922   -24.047 1.00 70.76  ? 901 6FM P C33   1 
HETATM 8562 C  C34   . 6FM F 6 .   ? 46.301 7.074   -22.873 1.00 70.53  ? 901 6FM P C34   1 
HETATM 8563 O  "O4'" . 6FM F 6 .   ? 45.120 7.713   -26.039 1.00 70.93  ? 901 6FM P "O4'" 1 
HETATM 8564 C  "C5'" . 6FM F 6 .   ? 47.444 7.024   -26.229 1.00 75.32  ? 901 6FM P "C5'" 1 
HETATM 8565 O  "O5'" . 6FM F 6 .   ? 48.293 7.734   -25.378 1.00 67.38  ? 901 6FM P "O5'" 1 
HETATM 8566 P  PA    . 6FM F 6 .   ? 49.159 8.988   -26.007 1.00 64.84  ? 901 6FM P PA    1 
HETATM 8567 O  OP3   . 6FM F 6 .   ? 50.463 9.119   -25.360 1.00 79.65  ? 901 6FM P OP3   1 
HETATM 8568 O  OP2   . 6FM F 6 .   ? 49.314 8.824   -27.638 1.00 64.80  ? 901 6FM P OP2   1 
HETATM 8569 C  C4    . 6FM G 6 .   ? 40.104 2.883   -28.540 1.00 93.76  ? 801 6FM T C4    1 
HETATM 8570 N  N3    . 6FM G 6 .   ? 38.802 2.723   -28.469 1.00 104.33 ? 801 6FM T N3    1 
HETATM 8571 C  C2    . 6FM G 6 .   ? 38.047 2.897   -29.554 1.00 100.42 ? 801 6FM T C2    1 
HETATM 8572 F  F32   . 6FM G 6 .   ? 36.695 2.728   -29.468 1.00 99.30  ? 801 6FM T F32   1 
HETATM 8573 N  N1    . 6FM G 6 .   ? 38.594 3.236   -30.730 1.00 95.39  ? 801 6FM T N1    1 
HETATM 8574 C  C6    . 6FM G 6 .   ? 39.907 3.412   -30.864 1.00 94.40  ? 801 6FM T C6    1 
HETATM 8575 N  N6    . 6FM G 6 .   ? 40.489 3.779   -32.145 1.00 91.78  ? 801 6FM T N6    1 
HETATM 8576 C  C5    . 6FM G 6 .   ? 40.694 3.235   -29.750 1.00 93.08  ? 801 6FM T C5    1 
HETATM 8577 N  N7    . 6FM G 6 .   ? 42.099 3.318   -29.449 1.00 89.30  ? 801 6FM T N7    1 
HETATM 8578 C  C8    . 6FM G 6 .   ? 42.186 3.016   -28.130 1.00 84.78  ? 801 6FM T C8    1 
HETATM 8579 N  N9    . 6FM G 6 .   ? 41.040 2.801   -27.765 1.00 83.04  ? 801 6FM T N9    1 
HETATM 8580 C  "C1'" . 6FM G 6 .   ? 40.809 2.460   -26.411 1.00 82.69  ? 801 6FM T "C1'" 1 
HETATM 8581 C  "C2'" . 6FM G 6 .   ? 40.899 0.975   -26.216 1.00 93.84  ? 801 6FM T "C2'" 1 
HETATM 8582 C  "C3'" . 6FM G 6 .   ? 41.953 0.771   -25.234 1.00 95.47  ? 801 6FM T "C3'" 1 
HETATM 8583 O  "O3'" . 6FM G 6 .   ? 41.525 -0.189  -24.221 1.00 84.91  ? 801 6FM T "O3'" 1 
HETATM 8584 C  "C4'" . 6FM G 6 .   ? 42.253 2.086   -24.608 1.00 81.22  ? 801 6FM T "C4'" 1 
HETATM 8585 C  C33   . 6FM G 6 .   ? 41.498 2.276   -23.313 1.00 82.41  ? 801 6FM T C33   1 
HETATM 8586 C  C34   . 6FM G 6 .   ? 40.922 2.447   -22.290 1.00 86.62  ? 801 6FM T C34   1 
HETATM 8587 O  "O4'" . 6FM G 6 .   ? 41.843 3.121   -25.551 1.00 85.36  ? 801 6FM T "O4'" 1 
HETATM 8588 C  "C5'" . 6FM G 6 .   ? 43.749 2.189   -24.316 1.00 79.74  ? 801 6FM T "C5'" 1 
HETATM 8589 O  "O5'" . 6FM G 6 .   ? 44.466 2.258   -25.510 1.00 78.46  ? 801 6FM T "O5'" 1 
HETATM 8590 P  PA    . 6FM G 6 .   ? 45.989 2.885   -25.452 1.00 75.96  ? 801 6FM T PA    1 
HETATM 8591 O  OP3   . 6FM G 6 .   ? 46.938 1.925   -24.506 1.00 76.12  ? 801 6FM T OP3   1 
HETATM 8592 O  OP2   . 6FM G 6 .   ? 46.549 2.981   -26.798 1.00 81.49  ? 801 6FM T OP2   1 
HETATM 8593 O  O     . HOH H 7 .   ? 14.228 56.029  -42.521 1.00 54.19  ? 701 HOH A O     1 
HETATM 8594 O  O     . HOH H 7 .   ? 14.521 55.394  -40.348 1.00 72.91  ? 702 HOH A O     1 
HETATM 8595 O  O     . HOH I 7 .   ? 25.337 46.299  -24.873 1.00 51.64  ? 501 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . PRO A 1   ? 1.2314 0.9272 1.1952 0.0380  -0.0068 -0.0610 1   PRO A N     
2    C  CA    . PRO A 1   ? 1.3054 0.9951 1.2896 0.0273  -0.0216 -0.0522 1   PRO A CA    
3    C  C     . PRO A 1   ? 1.2513 0.9525 1.2472 0.0175  -0.0280 -0.0464 1   PRO A C     
4    O  O     . PRO A 1   ? 1.2375 0.9353 1.2154 0.0184  -0.0284 -0.0543 1   PRO A O     
5    C  CB    . PRO A 1   ? 1.2669 0.9769 1.2755 0.0274  -0.0134 -0.0401 1   PRO A CB    
6    C  CG    . PRO A 1   ? 1.1949 0.9098 1.1909 0.0387  0.0003  -0.0463 1   PRO A CG    
7    C  CD    . PRO A 1   ? 1.1722 0.8899 1.1485 0.0433  0.0069  -0.0557 1   PRO A CD    
8    N  N     . ILE A 2   ? 1.1221 0.8370 1.1489 0.0090  -0.0319 -0.0316 2   ILE A N     
9    C  CA    . ILE A 2   ? 1.0224 0.7516 1.0666 0.0001  -0.0362 -0.0226 2   ILE A CA    
10   C  C     . ILE A 2   ? 0.9569 0.7194 1.0208 0.0014  -0.0204 -0.0090 2   ILE A C     
11   O  O     . ILE A 2   ? 0.9603 0.7295 1.0378 0.0041  -0.0146 0.0001  2   ILE A O     
12   C  CB    . ILE A 2   ? 0.8991 0.6115 0.9654 -0.0107 -0.0567 -0.0144 2   ILE A CB    
13   C  CG1   . ILE A 2   ? 0.9779 0.6510 1.0175 -0.0105 -0.0754 -0.0297 2   ILE A CG1   
14   C  CG2   . ILE A 2   ? 0.6921 0.4231 0.7828 -0.0195 -0.0594 -0.0020 2   ILE A CG2   
15   C  CD1   . ILE A 2   ? 1.0002 0.6519 1.0612 -0.0217 -0.1007 -0.0228 2   ILE A CD1   
16   N  N     . SER A 3   ? 0.9284 0.7094 0.9912 0.0006  -0.0140 -0.0077 3   SER A N     
17   C  CA    . SER A 3   ? 0.8794 0.6876 0.9526 0.0045  0.0009  0.0032  3   SER A CA    
18   C  C     . SER A 3   ? 0.7496 0.5672 0.8547 -0.0002 0.0003  0.0235  3   SER A C     
19   O  O     . SER A 3   ? 0.6711 0.4846 0.7950 -0.0093 -0.0109 0.0305  3   SER A O     
20   C  CB    . SER A 3   ? 0.8439 0.6665 0.9070 0.0049  0.0064  -0.0007 3   SER A CB    
21   O  OG    . SER A 3   ? 0.5837 0.4280 0.6509 0.0107  0.0196  0.0081  3   SER A OG    
22   N  N     . PRO A 4   ? 0.8080 0.6377 0.9210 0.0065  0.0120  0.0346  4   PRO A N     
23   C  CA    . PRO A 4   ? 0.7552 0.5956 0.8990 0.0045  0.0154  0.0570  4   PRO A CA    
24   C  C     . PRO A 4   ? 0.6980 0.5586 0.8485 0.0059  0.0248  0.0677  4   PRO A C     
25   O  O     . PRO A 4   ? 0.7904 0.6631 0.9629 0.0085  0.0335  0.0881  4   PRO A O     
26   C  CB    . PRO A 4   ? 0.6064 0.4492 0.7480 0.0141  0.0259  0.0631  4   PRO A CB    
27   C  CG    . PRO A 4   ? 0.8110 0.6541 0.9209 0.0223  0.0316  0.0463  4   PRO A CG    
28   C  CD    . PRO A 4   ? 0.8325 0.6632 0.9280 0.0166  0.0212  0.0281  4   PRO A CD    
29   N  N     . ILE A 5   ? 0.6192 0.4831 0.7511 0.0053  0.0243  0.0551  5   ILE A N     
30   C  CA    . ILE A 5   ? 0.6831 0.5645 0.8196 0.0066  0.0322  0.0639  5   ILE A CA    
31   C  C     . ILE A 5   ? 0.7253 0.6088 0.8954 -0.0037 0.0239  0.0788  5   ILE A C     
32   O  O     . ILE A 5   ? 0.7699 0.6379 0.9517 -0.0137 0.0071  0.0753  5   ILE A O     
33   C  CB    . ILE A 5   ? 0.6790 0.5621 0.7888 0.0076  0.0322  0.0465  5   ILE A CB    
34   C  CG1   . ILE A 5   ? 0.7125 0.6134 0.8229 0.0116  0.0423  0.0551  5   ILE A CG1   
35   C  CG2   . ILE A 5   ? 0.5702 0.4388 0.6771 -0.0023 0.0169  0.0342  5   ILE A CG2   
36   C  CD1   . ILE A 5   ? 0.7444 0.6477 0.8324 0.0117  0.0416  0.0397  5   ILE A CD1   
37   N  N     . GLU A 6   ? 0.7373 0.6388 0.9236 -0.0004 0.0350  0.0964  6   GLU A N     
38   C  CA    . GLU A 6   ? 0.6954 0.6024 0.9189 -0.0098 0.0281  0.1133  6   GLU A CA    
39   C  C     . GLU A 6   ? 0.6359 0.5352 0.8530 -0.0201 0.0123  0.0991  6   GLU A C     
40   O  O     . GLU A 6   ? 0.7109 0.6097 0.8964 -0.0170 0.0144  0.0817  6   GLU A O     
41   C  CB    . GLU A 6   ? 0.8722 0.8007 1.1108 -0.0014 0.0466  0.1352  6   GLU A CB    
42   C  CG    . GLU A 6   ? 1.0754 1.0101 1.3235 0.0101  0.0629  0.1543  6   GLU A CG    
43   C  CD    . GLU A 6   ? 1.2991 1.2307 1.5056 0.0243  0.0746  0.1422  6   GLU A CD    
44   O  OE1   . GLU A 6   ? 1.3672 1.2997 1.5742 0.0350  0.0866  0.1550  6   GLU A OE1   
45   O  OE2   . GLU A 6   ? 1.3271 1.2548 1.5015 0.0251  0.0711  0.1208  6   GLU A OE2   
46   N  N     . THR A 7   ? 0.6002 0.4921 0.8484 -0.0321 -0.0047 0.1074  7   THR A N     
47   C  CA    . THR A 7   ? 0.5985 0.4801 0.8409 -0.0416 -0.0220 0.0955  7   THR A CA    
48   C  C     . THR A 7   ? 0.6237 0.5258 0.8774 -0.0413 -0.0138 0.1058  7   THR A C     
49   O  O     . THR A 7   ? 0.6782 0.6007 0.9533 -0.0354 0.0027  0.1263  7   THR A O     
50   C  CB    . THR A 7   ? 0.6765 0.5384 0.9471 -0.0545 -0.0473 0.1001  7   THR A CB    
51   O  OG1   . THR A 7   ? 0.6005 0.4771 0.9226 -0.0583 -0.0452 0.1288  7   THR A OG1   
52   C  CG2   . THR A 7   ? 0.7268 0.5641 0.9800 -0.0540 -0.0569 0.0869  7   THR A CG2   
53   N  N     . VAL A 8   ? 0.6300 0.5251 0.8669 -0.0465 -0.0245 0.0916  8   VAL A N     
54   C  CA    . VAL A 8   ? 0.6332 0.5454 0.8789 -0.0472 -0.0193 0.0990  8   VAL A CA    
55   C  C     . VAL A 8   ? 0.6322 0.5412 0.9199 -0.0601 -0.0384 0.1138  8   VAL A C     
56   O  O     . VAL A 8   ? 0.6925 0.5776 0.9753 -0.0693 -0.0624 0.1020  8   VAL A O     
57   C  CB    . VAL A 8   ? 0.6685 0.5758 0.8736 -0.0453 -0.0199 0.0766  8   VAL A CB    
58   C  CG1   . VAL A 8   ? 0.6326 0.5552 0.8492 -0.0476 -0.0178 0.0842  8   VAL A CG1   
59   C  CG2   . VAL A 8   ? 0.5428 0.4555 0.7140 -0.0330 -0.0020 0.0652  8   VAL A CG2   
60   N  N     . PRO A 9   ? 0.7325 0.6629 1.0615 -0.0602 -0.0295 0.1398  9   PRO A N     
61   C  CA    . PRO A 9   ? 0.6743 0.6030 1.0519 -0.0733 -0.0491 0.1569  9   PRO A CA    
62   C  C     . PRO A 9   ? 0.6659 0.5871 1.0325 -0.0809 -0.0655 0.1450  9   PRO A C     
63   O  O     . PRO A 9   ? 0.7182 0.6560 1.0748 -0.0760 -0.0522 0.1452  9   PRO A O     
64   C  CB    . PRO A 9   ? 0.5672 0.5249 0.9881 -0.0675 -0.0282 0.1890  9   PRO A CB    
65   C  CG    . PRO A 9   ? 0.6935 0.6661 1.0766 -0.0516 -0.0004 0.1831  9   PRO A CG    
66   C  CD    . PRO A 9   ? 0.7786 0.7342 1.1114 -0.0471 -0.0010 0.1558  9   PRO A CD    
67   N  N     . VAL A 10  ? 0.6836 0.5772 1.0500 -0.0921 -0.0953 0.1343  10  VAL A N     
68   C  CA    . VAL A 10  ? 0.7702 0.6496 1.1201 -0.0989 -0.1145 0.1207  10  VAL A CA    
69   C  C     . VAL A 10  ? 0.8078 0.6789 1.2083 -0.1131 -0.1423 0.1376  10  VAL A C     
70   O  O     . VAL A 10  ? 0.8418 0.6972 1.2677 -0.1197 -0.1596 0.1447  10  VAL A O     
71   C  CB    . VAL A 10  ? 0.9600 0.8072 1.2530 -0.0967 -0.1266 0.0897  10  VAL A CB    
72   C  CG1   . VAL A 10  ? 1.1141 0.9436 1.3880 -0.1023 -0.1468 0.0770  10  VAL A CG1   
73   C  CG2   . VAL A 10  ? 0.9617 0.8191 1.2121 -0.0834 -0.0999 0.0755  10  VAL A CG2   
74   N  N     . LYS A 11  ? 0.8654 0.7463 1.2822 -0.1179 -0.1479 0.1446  11  LYS A N     
75   C  CA    . LYS A 11  ? 0.8410 0.7141 1.3070 -0.1320 -0.1769 0.1605  11  LYS A CA    
76   C  C     . LYS A 11  ? 0.8045 0.6514 1.2375 -0.1374 -0.2022 0.1398  11  LYS A C     
77   O  O     . LYS A 11  ? 0.7027 0.5448 1.0808 -0.1295 -0.1919 0.1174  11  LYS A O     
78   C  CB    . LYS A 11  ? 0.8546 0.7649 1.3800 -0.1327 -0.1613 0.1932  11  LYS A CB    
79   C  CG    . LYS A 11  ? 0.9850 0.9209 1.5432 -0.1250 -0.1341 0.2172  11  LYS A CG    
80   C  CD    . LYS A 11  ? 1.0574 1.0274 1.6752 -0.1240 -0.1183 0.2520  11  LYS A CD    
81   C  CE    . LYS A 11  ? 0.9428 0.9371 1.5316 -0.1102 -0.0867 0.2498  11  LYS A CE    
82   N  NZ    . LYS A 11  ? 0.8370 0.8223 1.3921 -0.1139 -0.0988 0.2289  11  LYS A NZ    
83   N  N     . LEU A 12  ? 0.8438 0.6725 1.3117 -0.1506 -0.2364 0.1484  12  LEU A N     
84   C  CA    . LEU A 12  ? 0.8515 0.6543 1.2935 -0.1559 -0.2632 0.1326  12  LEU A CA    
85   C  C     . LEU A 12  ? 0.8501 0.6823 1.3247 -0.1588 -0.2560 0.1494  12  LEU A C     
86   O  O     . LEU A 12  ? 0.9386 0.8088 1.4585 -0.1567 -0.2320 0.1746  12  LEU A O     
87   C  CB    . LEU A 12  ? 0.9893 0.7514 1.4481 -0.1682 -0.3086 0.1316  12  LEU A CB    
88   C  CG    . LEU A 12  ? 1.1018 0.8256 1.5218 -0.1652 -0.3221 0.1120  12  LEU A CG    
89   C  CD1   . LEU A 12  ? 1.0354 0.7192 1.4806 -0.1781 -0.3697 0.1151  12  LEU A CD1   
90   C  CD2   . LEU A 12  ? 1.2332 0.9334 1.5695 -0.1531 -0.3149 0.0788  12  LEU A CD2   
91   N  N     . LYS A 13  ? 0.8589 0.6715 1.3074 -0.1622 -0.2762 0.1353  13  LYS A N     
92   C  CA    . LYS A 13  ? 0.9173 0.7528 1.4007 -0.1669 -0.2762 0.1516  13  LYS A CA    
93   C  C     . LYS A 13  ? 1.1583 0.9933 1.7176 -0.1817 -0.3051 0.1791  13  LYS A C     
94   O  O     . LYS A 13  ? 1.1575 0.9581 1.7240 -0.1903 -0.3392 0.1754  13  LYS A O     
95   C  CB    . LYS A 13  ? 0.9329 0.7463 1.3644 -0.1657 -0.2898 0.1284  13  LYS A CB    
96   C  CG    . LYS A 13  ? 1.0286 0.8477 1.3941 -0.1514 -0.2597 0.1054  13  LYS A CG    
97   C  CD    . LYS A 13  ? 1.0276 0.8282 1.3480 -0.1499 -0.2711 0.0866  13  LYS A CD    
98   C  CE    . LYS A 13  ? 1.0335 0.8447 1.2983 -0.1362 -0.2395 0.0680  13  LYS A CE    
99   N  NZ    . LYS A 13  ? 1.1405 0.9343 1.3620 -0.1337 -0.2485 0.0511  13  LYS A NZ    
100  N  N     . PRO A 14  ? 1.2752 1.1470 1.8935 -0.1844 -0.2924 0.2079  14  PRO A N     
101  C  CA    . PRO A 14  ? 1.2456 1.1226 1.9470 -0.1982 -0.3164 0.2392  14  PRO A CA    
102  C  C     . PRO A 14  ? 1.2455 1.0849 1.9420 -0.2076 -0.3650 0.2287  14  PRO A C     
103  O  O     . PRO A 14  ? 1.1849 1.0028 1.8371 -0.2092 -0.3785 0.2079  14  PRO A O     
104  C  CB    . PRO A 14  ? 1.2263 1.1500 1.9767 -0.1948 -0.2885 0.2680  14  PRO A CB    
105  C  CG    . PRO A 14  ? 1.2658 1.2111 1.9634 -0.1776 -0.2442 0.2552  14  PRO A CG    
106  C  CD    . PRO A 14  ? 1.2817 1.1926 1.8956 -0.1738 -0.2536 0.2151  14  PRO A CD    
107  N  N     . GLY A 15  ? 1.3767 1.2095 2.1120 -0.2091 -0.3896 0.2426  15  GLY A N     
108  C  CA    . GLY A 15  ? 1.4994 1.2988 2.2287 -0.2126 -0.4350 0.2354  15  GLY A CA    
109  C  C     . GLY A 15  ? 1.5557 1.2993 2.2100 -0.2122 -0.4624 0.1998  15  GLY A C     
110  O  O     . GLY A 15  ? 1.5971 1.3078 2.2304 -0.2127 -0.4985 0.1898  15  GLY A O     
111  N  N     . MET A 16  ? 1.4883 1.2182 2.0992 -0.2095 -0.4459 0.1810  16  MET A N     
112  C  CA    . MET A 16  ? 1.3524 1.0288 1.8869 -0.2057 -0.4669 0.1469  16  MET A CA    
113  C  C     . MET A 16  ? 1.2703 0.9334 1.8034 -0.2040 -0.4670 0.1444  16  MET A C     
114  O  O     . MET A 16  ? 1.1899 0.8869 1.7735 -0.2057 -0.4444 0.1662  16  MET A O     
115  C  CB    . MET A 16  ? 1.2490 0.9153 1.7181 -0.2017 -0.4467 0.1210  16  MET A CB    
116  C  CG    . MET A 16  ? 1.1923 0.8742 1.6603 -0.2027 -0.4437 0.1227  16  MET A CG    
117  S  SD    . MET A 16  ? 1.3614 1.0449 1.7381 -0.1849 -0.4100 0.0922  16  MET A SD    
118  C  CE    . MET A 16  ? 1.3178 1.0252 1.7165 -0.1893 -0.4101 0.1030  16  MET A CE    
119  N  N     . ASP A 17  ? 1.3662 0.9787 1.8383 -0.1989 -0.4916 0.1181  17  ASP A N     
120  C  CA    . ASP A 17  ? 1.3945 0.9880 1.8598 -0.1964 -0.4968 0.1134  17  ASP A CA    
121  C  C     . ASP A 17  ? 1.4175 0.9675 1.7941 -0.1868 -0.4944 0.0780  17  ASP A C     
122  O  O     . ASP A 17  ? 1.4338 0.9739 1.7604 -0.1821 -0.4849 0.0597  17  ASP A O     
123  C  CB    . ASP A 17  ? 1.4356 1.0109 1.9315 -0.1986 -0.5367 0.1245  17  ASP A CB    
124  C  CG    . ASP A 17  ? 1.4997 1.0815 2.0311 -0.2000 -0.5350 0.1367  17  ASP A CG    
125  O  OD1   . ASP A 17  ? 1.4854 1.1116 2.0904 -0.2052 -0.5190 0.1668  17  ASP A OD1   
126  O  OD2   . ASP A 17  ? 1.5554 1.0979 2.0401 -0.1946 -0.5486 0.1168  17  ASP A OD2   
127  N  N     . GLY A 18  ? 1.5149 1.0390 1.8718 -0.1824 -0.5022 0.0690  18  GLY A N     
128  C  CA    . GLY A 18  ? 1.6501 1.1353 1.9269 -0.1709 -0.4960 0.0382  18  GLY A CA    
129  C  C     . GLY A 18  ? 1.7853 1.2216 1.9897 -0.1604 -0.5219 0.0138  18  GLY A C     
130  O  O     . GLY A 18  ? 1.8386 1.2633 2.0546 -0.1626 -0.5525 0.0202  18  GLY A O     
131  N  N     . PRO A 19  ? 1.8235 1.2299 1.9513 -0.1471 -0.5091 -0.0134 19  PRO A N     
132  C  CA    . PRO A 19  ? 1.8341 1.1928 1.8859 -0.1333 -0.5287 -0.0360 19  PRO A CA    
133  C  C     . PRO A 19  ? 1.7875 1.1013 1.8097 -0.1248 -0.5579 -0.0439 19  PRO A C     
134  O  O     . PRO A 19  ? 1.7370 1.0492 1.7722 -0.1252 -0.5546 -0.0418 19  PRO A O     
135  C  CB    . PRO A 19  ? 1.8186 1.1695 1.8059 -0.1206 -0.4968 -0.0584 19  PRO A CB    
136  C  CG    . PRO A 19  ? 1.7720 1.1535 1.7856 -0.1212 -0.4667 -0.0517 19  PRO A CG    
137  C  CD    . PRO A 19  ? 1.7490 1.1728 1.8552 -0.1398 -0.4694 -0.0218 19  PRO A CD    
138  N  N     . LYS A 20  ? 1.7340 1.0092 1.7145 -0.1165 -0.5877 -0.0525 20  LYS A N     
139  C  CA    . LYS A 20  ? 1.7777 1.0047 1.7259 -0.1073 -0.6206 -0.0595 20  LYS A CA    
140  C  C     . LYS A 20  ? 1.9145 1.0922 1.7695 -0.0869 -0.6271 -0.0827 20  LYS A C     
141  O  O     . LYS A 20  ? 1.9290 1.0837 1.7693 -0.0842 -0.6547 -0.0819 20  LYS A O     
142  C  CB    . LYS A 20  ? 1.6294 0.8598 1.6407 -0.1195 -0.6592 -0.0377 20  LYS A CB    
143  C  CG    . LYS A 20  ? 1.4702 0.7595 1.5800 -0.1390 -0.6476 -0.0095 20  LYS A CG    
144  C  CD    . LYS A 20  ? 1.4145 0.7060 1.5890 -0.1486 -0.6836 0.0131  20  LYS A CD    
145  C  CE    . LYS A 20  ? 1.2854 0.6384 1.5567 -0.1650 -0.6658 0.0432  20  LYS A CE    
146  N  NZ    . LYS A 20  ? 1.2786 0.6377 1.6185 -0.1731 -0.6967 0.0673  20  LYS A NZ    
147  N  N     . VAL A 21  ? 2.0433 1.2046 1.8355 -0.0712 -0.6003 -0.1022 21  VAL A N     
148  C  CA    . VAL A 21  ? 2.1169 1.2341 1.8184 -0.0486 -0.5986 -0.1227 21  VAL A CA    
149  C  C     . VAL A 21  ? 2.1640 1.2427 1.8132 -0.0318 -0.5979 -0.1361 21  VAL A C     
150  O  O     . VAL A 21  ? 2.1304 1.2264 1.7973 -0.0343 -0.5773 -0.1362 21  VAL A O     
151  C  CB    . VAL A 21  ? 2.0804 1.2184 1.7523 -0.0423 -0.5601 -0.1322 21  VAL A CB    
152  C  CG1   . VAL A 21  ? 2.1364 1.2304 1.7171 -0.0173 -0.5565 -0.1502 21  VAL A CG1   
153  C  CG2   . VAL A 21  ? 2.0305 1.2090 1.7574 -0.0597 -0.5596 -0.1183 21  VAL A CG2   
154  N  N     . LYS A 22  ? 2.2232 1.2488 1.8073 -0.0138 -0.6204 -0.1466 22  LYS A N     
155  C  CA    . LYS A 22  ? 2.2292 1.2138 1.7588 0.0042  -0.6220 -0.1586 22  LYS A CA    
156  C  C     . LYS A 22  ? 2.1908 1.1698 1.6545 0.0252  -0.5804 -0.1745 22  LYS A C     
157  O  O     . LYS A 22  ? 2.1497 1.1538 1.6075 0.0261  -0.5527 -0.1768 22  LYS A O     
158  C  CB    . LYS A 22  ? 2.2806 1.2082 1.7682 0.0158  -0.6650 -0.1615 22  LYS A CB    
159  C  CG    . LYS A 22  ? 2.2751 1.2036 1.8277 -0.0025 -0.7083 -0.1452 22  LYS A CG    
160  C  CD    . LYS A 22  ? 2.2331 1.1766 1.8295 -0.0120 -0.7073 -0.1394 22  LYS A CD    
161  C  CE    . LYS A 22  ? 2.2414 1.1903 1.9091 -0.0301 -0.7486 -0.1205 22  LYS A CE    
162  N  NZ    . LYS A 22  ? 2.1909 1.1888 1.9349 -0.0512 -0.7484 -0.1017 22  LYS A NZ    
163  N  N     . GLN A 23  ? 2.2201 1.1658 1.6349 0.0429  -0.5759 -0.1845 23  GLN A N     
164  C  CA    . GLN A 23  ? 2.1878 1.1290 1.5455 0.0642  -0.5353 -0.1969 23  GLN A CA    
165  C  C     . GLN A 23  ? 2.2304 1.1216 1.5029 0.0910  -0.5396 -0.2068 23  GLN A C     
166  O  O     . GLN A 23  ? 2.3713 1.2176 1.6171 0.0974  -0.5766 -0.2074 23  GLN A O     
167  C  CB    . GLN A 23  ? 2.1756 1.1143 1.5352 0.0682  -0.5235 -0.2000 23  GLN A CB    
168  C  CG    . GLN A 23  ? 2.1720 1.1091 1.4799 0.0904  -0.4804 -0.2104 23  GLN A CG    
169  C  CD    . GLN A 23  ? 2.1046 1.0912 1.4398 0.0840  -0.4414 -0.2086 23  GLN A CD    
170  O  OE1   . GLN A 23  ? 2.0566 1.0806 1.4485 0.0674  -0.4299 -0.2027 23  GLN A OE1   
171  N  NE2   . GLN A 23  ? 2.0902 1.0763 1.3847 0.0977  -0.4214 -0.2129 23  GLN A NE2   
172  N  N     . TRP A 24  ? 2.0171 0.9157 1.2477 0.1074  -0.5017 -0.2132 24  TRP A N     
173  C  CA    . TRP A 24  ? 1.9486 0.8037 1.0974 0.1356  -0.4969 -0.2207 24  TRP A CA    
174  C  C     . TRP A 24  ? 1.9144 0.7460 1.0132 0.1590  -0.4745 -0.2277 24  TRP A C     
175  O  O     . TRP A 24  ? 1.8024 0.6609 0.9299 0.1538  -0.4524 -0.2277 24  TRP A O     
176  C  CB    . TRP A 24  ? 1.8497 0.7283 0.9851 0.1408  -0.4675 -0.2209 24  TRP A CB    
177  C  CG    . TRP A 24  ? 1.7035 0.6327 0.8672 0.1366  -0.4226 -0.2204 24  TRP A CG    
178  C  CD1   . TRP A 24  ? 1.6869 0.6206 0.8264 0.1529  -0.3867 -0.2243 24  TRP A CD1   
179  C  CD2   . TRP A 24  ? 1.6153 0.5962 0.8363 0.1156  -0.4095 -0.2150 24  TRP A CD2   
180  N  NE1   . TRP A 24  ? 1.6121 0.5964 0.7910 0.1434  -0.3534 -0.2218 24  TRP A NE1   
181  C  CE2   . TRP A 24  ? 1.5684 0.5811 0.7954 0.1207  -0.3668 -0.2166 24  TRP A CE2   
182  C  CE3   . TRP A 24  ? 1.5825 0.5854 0.8509 0.0936  -0.4300 -0.2081 24  TRP A CE3   
183  C  CZ2   . TRP A 24  ? 1.4946 0.5572 0.7697 0.1051  -0.3457 -0.2126 24  TRP A CZ2   
184  C  CZ3   . TRP A 24  ? 1.5080 0.5618 0.8246 0.0779  -0.4075 -0.2037 24  TRP A CZ3   
185  C  CH2   . TRP A 24  ? 1.4663 0.5478 0.7840 0.0838  -0.3665 -0.2065 24  TRP A CH2   
186  N  N     . PRO A 25  ? 1.9076 0.6876 0.9310 0.1858  -0.4796 -0.2328 25  PRO A N     
187  C  CA    . PRO A 25  ? 2.2667 1.0235 1.2415 0.2096  -0.4573 -0.2378 25  PRO A CA    
188  C  C     . PRO A 25  ? 2.2927 1.0882 1.2671 0.2188  -0.4030 -0.2373 25  PRO A C     
189  O  O     . PRO A 25  ? 2.2884 1.1141 1.2738 0.2157  -0.3820 -0.2346 25  PRO A O     
190  C  CB    . PRO A 25  ? 2.1667 0.8601 1.0603 0.2367  -0.4748 -0.2413 25  PRO A CB    
191  C  CG    . PRO A 25  ? 2.0605 0.7551 0.9557 0.2306  -0.4890 -0.2385 25  PRO A CG    
192  C  CD    . PRO A 25  ? 1.9748 0.7116 0.9539 0.1961  -0.5088 -0.2333 25  PRO A CD    
193  N  N     . LEU A 26  ? 2.4343 1.2285 1.3974 0.2303  -0.3810 -0.2393 26  LEU A N     
194  C  CA    . LEU A 26  ? 2.5034 1.3337 1.4705 0.2397  -0.3304 -0.2373 26  LEU A CA    
195  C  C     . LEU A 26  ? 2.6484 1.4458 1.5570 0.2695  -0.3111 -0.2388 26  LEU A C     
196  O  O     . LEU A 26  ? 2.6885 1.4406 1.5643 0.2783  -0.3370 -0.2426 26  LEU A O     
197  C  CB    . LEU A 26  ? 2.4120 1.2928 1.4512 0.2165  -0.3180 -0.2353 26  LEU A CB    
198  C  CG    . LEU A 26  ? 2.3330 1.2549 1.4353 0.1880  -0.3275 -0.2316 26  LEU A CG    
199  C  CD1   . LEU A 26  ? 2.2615 1.2236 1.4286 0.1680  -0.3184 -0.2290 26  LEU A CD1   
200  C  CD2   . LEU A 26  ? 2.3027 1.2495 1.3967 0.1934  -0.2997 -0.2293 26  LEU A CD2   
201  N  N     . THR A 27  ? 2.6871 1.5080 1.5846 0.2852  -0.2652 -0.2346 27  THR A N     
202  C  CA    . THR A 27  ? 2.7572 1.5532 1.6049 0.3141  -0.2408 -0.2330 27  THR A CA    
203  C  C     . THR A 27  ? 2.7253 1.5282 1.5993 0.3085  -0.2391 -0.2353 27  THR A C     
204  O  O     . THR A 27  ? 2.7617 1.6040 1.6985 0.2848  -0.2391 -0.2355 27  THR A O     
205  C  CB    . THR A 27  ? 2.7830 1.6092 1.6240 0.3303  -0.1913 -0.2247 27  THR A CB    
206  O  OG1   . THR A 27  ? 2.7624 1.5928 1.5944 0.3294  -0.1928 -0.2224 27  THR A OG1   
207  C  CG2   . THR A 27  ? 2.8765 1.6688 1.6563 0.3641  -0.1686 -0.2203 27  THR A CG2   
208  N  N     . GLU A 28  ? 2.6475 1.4094 1.4707 0.3316  -0.2379 -0.2365 28  GLU A N     
209  C  CA    . GLU A 28  ? 2.5046 1.2680 1.3465 0.3290  -0.2366 -0.2387 28  GLU A CA    
210  C  C     . GLU A 28  ? 2.5035 1.3229 1.3951 0.3237  -0.1946 -0.2332 28  GLU A C     
211  O  O     . GLU A 28  ? 2.4565 1.2954 1.3923 0.3085  -0.1976 -0.2350 28  GLU A O     
212  C  CB    . GLU A 28  ? 2.5332 1.2428 1.3056 0.3587  -0.2370 -0.2397 28  GLU A CB    
213  C  CG    . GLU A 28  ? 2.4449 1.1528 1.2306 0.3591  -0.2338 -0.2418 28  GLU A CG    
214  C  CD    . GLU A 28  ? 2.3432 1.0447 1.1667 0.3335  -0.2767 -0.2485 28  GLU A CD    
215  O  OE1   . GLU A 28  ? 2.3586 1.0347 1.1744 0.3240  -0.3165 -0.2520 28  GLU A OE1   
216  O  OE2   . GLU A 28  ? 2.2801 1.0023 1.1433 0.3232  -0.2708 -0.2490 28  GLU A OE2   
217  N  N     . GLU A 29  ? 2.5731 1.4186 1.4599 0.3362  -0.1560 -0.2256 29  GLU A N     
218  C  CA    . GLU A 29  ? 2.5282 1.4278 1.4650 0.3311  -0.1176 -0.2192 29  GLU A CA    
219  C  C     . GLU A 29  ? 2.4222 1.3645 1.4272 0.2995  -0.1279 -0.2214 29  GLU A C     
220  O  O     . GLU A 29  ? 2.3875 1.3640 1.4393 0.2895  -0.1125 -0.2195 29  GLU A O     
221  C  CB    . GLU A 29  ? 2.5624 1.4807 1.4827 0.3507  -0.0768 -0.2086 29  GLU A CB    
222  C  CG    . GLU A 29  ? 2.5084 1.4807 1.4787 0.3488  -0.0362 -0.1999 29  GLU A CG    
223  C  CD    . GLU A 29  ? 2.4738 1.4643 1.4314 0.3685  0.0033  -0.1868 29  GLU A CD    
224  O  OE1   . GLU A 29  ? 2.5050 1.4626 1.4095 0.3863  0.0013  -0.1844 29  GLU A OE1   
225  O  OE2   . GLU A 29  ? 2.3945 1.4317 1.3966 0.3666  0.0356  -0.1778 29  GLU A OE2   
226  N  N     . LYS A 30  ? 2.3387 1.2785 1.3499 0.2843  -0.1541 -0.2245 30  LYS A N     
227  C  CA    . LYS A 30  ? 2.2297 1.2067 1.3042 0.2545  -0.1661 -0.2255 30  LYS A CA    
228  C  C     . LYS A 30  ? 2.2061 1.1713 1.3095 0.2358  -0.2003 -0.2301 30  LYS A C     
229  O  O     . LYS A 30  ? 2.0913 1.0905 1.2521 0.2151  -0.1999 -0.2285 30  LYS A O     
230  C  CB    . LYS A 30  ? 2.1957 1.1753 1.2697 0.2445  -0.1821 -0.2258 30  LYS A CB    
231  C  CG    . LYS A 30  ? 2.1234 1.1244 1.1828 0.2579  -0.1477 -0.2199 30  LYS A CG    
232  C  CD    . LYS A 30  ? 2.0766 1.0864 1.1464 0.2437  -0.1644 -0.2204 30  LYS A CD    
233  C  CE    . LYS A 30  ? 2.0751 1.1036 1.1283 0.2578  -0.1315 -0.2139 30  LYS A CE    
234  N  NZ    . LYS A 30  ? 2.1480 1.1371 1.1350 0.2874  -0.1222 -0.2113 30  LYS A NZ    
235  N  N     . ILE A 31  ? 2.2649 1.1818 1.3302 0.2432  -0.2303 -0.2347 31  ILE A N     
236  C  CA    . ILE A 31  ? 2.2390 1.1439 1.3334 0.2260  -0.2637 -0.2374 31  ILE A CA    
237  C  C     . ILE A 31  ? 2.3112 1.2311 1.4270 0.2284  -0.2426 -0.2365 31  ILE A C     
238  O  O     . ILE A 31  ? 2.3001 1.2382 1.4681 0.2078  -0.2548 -0.2352 31  ILE A O     
239  C  CB    . ILE A 31  ? 2.2626 1.1095 1.3077 0.2353  -0.3018 -0.2421 31  ILE A CB    
240  C  CG1   . ILE A 31  ? 2.2782 1.1105 1.3045 0.2328  -0.3239 -0.2423 31  ILE A CG1   
241  C  CG2   . ILE A 31  ? 2.2295 1.0654 1.3089 0.2173  -0.3371 -0.2433 31  ILE A CG2   
242  C  CD1   . ILE A 31  ? 2.3871 1.1600 1.3636 0.2428  -0.3640 -0.2463 31  ILE A CD1   
243  N  N     . LYS A 32  ? 2.3935 1.3065 1.4716 0.2537  -0.2103 -0.2354 32  LYS A N     
244  C  CA    . LYS A 32  ? 2.3505 1.2798 1.4497 0.2574  -0.1877 -0.2335 32  LYS A CA    
245  C  C     . LYS A 32  ? 2.1863 1.1711 1.3472 0.2417  -0.1637 -0.2284 32  LYS A C     
246  O  O     . LYS A 32  ? 2.1455 1.1470 1.3470 0.2306  -0.1627 -0.2273 32  LYS A O     
247  C  CB    . LYS A 32  ? 2.4645 1.3771 1.5126 0.2888  -0.1565 -0.2310 32  LYS A CB    
248  C  CG    . LYS A 32  ? 2.4611 1.4020 1.5368 0.2942  -0.1235 -0.2262 32  LYS A CG    
249  C  CD    . LYS A 32  ? 2.4862 1.4015 1.5111 0.3245  -0.1010 -0.2231 32  LYS A CD    
250  C  CE    . LYS A 32  ? 2.4105 1.3576 1.4689 0.3291  -0.0681 -0.2168 32  LYS A CE    
251  N  NZ    . LYS A 32  ? 2.3553 1.3143 1.4625 0.3071  -0.0863 -0.2209 32  LYS A NZ    
252  N  N     . ALA A 33  ? 2.0730 1.0853 1.2408 0.2410  -0.1450 -0.2249 33  ALA A N     
253  C  CA    . ALA A 33  ? 1.9389 1.0016 1.1614 0.2276  -0.1229 -0.2199 33  ALA A CA    
254  C  C     . ALA A 33  ? 1.8904 0.9666 1.1646 0.1980  -0.1516 -0.2208 33  ALA A C     
255  O  O     . ALA A 33  ? 1.7879 0.8959 1.1090 0.1864  -0.1401 -0.2170 33  ALA A O     
256  C  CB    . ALA A 33  ? 1.8385 0.9254 1.0544 0.2343  -0.0980 -0.2155 33  ALA A CB    
257  N  N     . LEU A 34  ? 1.9937 1.0460 1.2621 0.1861  -0.1891 -0.2240 34  LEU A N     
258  C  CA    . LEU A 34  ? 2.0316 1.0988 1.3548 0.1577  -0.2164 -0.2214 34  LEU A CA    
259  C  C     . LEU A 34  ? 2.1193 1.1764 1.4682 0.1489  -0.2337 -0.2204 34  LEU A C     
260  O  O     . LEU A 34  ? 2.1371 1.2211 1.5411 0.1303  -0.2352 -0.2147 34  LEU A O     
261  C  CB    . LEU A 34  ? 2.0596 1.1084 1.3746 0.1476  -0.2505 -0.2224 34  LEU A CB    
262  C  CG    . LEU A 34  ? 1.9667 1.0315 1.2705 0.1494  -0.2383 -0.2219 34  LEU A CG    
263  C  CD1   . LEU A 34  ? 1.9768 1.0230 1.2784 0.1377  -0.2759 -0.2220 34  LEU A CD1   
264  C  CD2   . LEU A 34  ? 1.8358 0.9489 1.1882 0.1364  -0.2152 -0.2168 34  LEU A CD2   
265  N  N     . VAL A 35  ? 2.1767 1.1943 1.4862 0.1624  -0.2468 -0.2251 35  VAL A N     
266  C  CA    . VAL A 35  ? 2.2224 1.2292 1.5556 0.1544  -0.2641 -0.2241 35  VAL A CA    
267  C  C     . VAL A 35  ? 2.2017 1.2335 1.5560 0.1596  -0.2315 -0.2215 35  VAL A C     
268  O  O     . VAL A 35  ? 2.1849 1.2250 1.5805 0.1463  -0.2404 -0.2174 35  VAL A O     
269  C  CB    . VAL A 35  ? 2.3190 1.2745 1.6006 0.1690  -0.2871 -0.2303 35  VAL A CB    
270  C  CG1   . VAL A 35  ? 2.3397 1.2697 1.6054 0.1625  -0.3239 -0.2317 35  VAL A CG1   
271  C  CG2   . VAL A 35  ? 2.3803 1.3185 1.6014 0.1996  -0.2567 -0.2346 35  VAL A CG2   
272  N  N     . GLU A 36  ? 2.1872 1.2321 1.5166 0.1790  -0.1937 -0.2220 36  GLU A N     
273  C  CA    . GLU A 36  ? 2.1323 1.2054 1.4867 0.1838  -0.1621 -0.2178 36  GLU A CA    
274  C  C     . GLU A 36  ? 1.9576 1.0871 1.3792 0.1611  -0.1541 -0.2073 36  GLU A C     
275  O  O     . GLU A 36  ? 1.8604 1.0272 1.3250 0.1547  -0.1384 -0.1982 36  GLU A O     
276  C  CB    . GLU A 36  ? 2.2232 1.3025 1.5413 0.2098  -0.1234 -0.2170 36  GLU A CB    
277  C  CG    . GLU A 36  ? 2.2132 1.3193 1.5549 0.2180  -0.0906 -0.2115 36  GLU A CG    
278  C  CD    . GLU A 36  ? 2.2468 1.3660 1.5635 0.2417  -0.0518 -0.2068 36  GLU A CD    
279  O  OE1   . GLU A 36  ? 2.3407 1.4450 1.6177 0.2530  -0.0501 -0.2081 36  GLU A OE1   
280  O  OE2   . GLU A 36  ? 2.1799 1.3250 1.5194 0.2491  -0.0234 -0.2003 36  GLU A OE2   
281  N  N     . ILE A 37  ? 1.8787 1.0285 1.3174 0.1470  -0.1627 -0.2040 37  ILE A N     
282  C  CA    . ILE A 37  ? 1.7448 0.9617 1.2528 0.1241  -0.1534 -0.1892 37  ILE A CA    
283  C  C     . ILE A 37  ? 1.6951 0.9156 1.2491 0.0998  -0.1850 -0.1828 37  ILE A C     
284  O  O     . ILE A 37  ? 1.5950 0.8605 1.2056 0.0851  -0.1771 -0.1700 37  ILE A O     
285  C  CB    . ILE A 37  ? 1.7538 0.9944 1.2580 0.1231  -0.1420 -0.1873 37  ILE A CB    
286  C  CG1   . ILE A 37  ? 1.7777 1.0248 1.2496 0.1460  -0.1061 -0.1890 37  ILE A CG1   
287  C  CG2   . ILE A 37  ? 1.7573 1.0605 1.3286 0.0998  -0.1368 -0.1729 37  ILE A CG2   
288  C  CD1   . ILE A 37  ? 1.7089 0.9760 1.1741 0.1470  -0.0942 -0.1872 37  ILE A CD1   
289  N  N     . CYS A 38  ? 1.7687 0.9409 1.2998 0.0962  -0.2217 -0.1905 38  CYS A N     
290  C  CA    . CYS A 38  ? 1.7231 0.9002 1.3043 0.0723  -0.2530 -0.1816 38  CYS A CA    
291  C  C     . CYS A 38  ? 1.6717 0.8434 1.2783 0.0680  -0.2598 -0.1774 38  CYS A C     
292  O  O     . CYS A 38  ? 1.6867 0.8917 1.3551 0.0483  -0.2663 -0.1627 38  CYS A O     
293  C  CB    . CYS A 38  ? 1.8114 0.9338 1.3616 0.0701  -0.2936 -0.1910 38  CYS A CB    
294  S  SG    . CYS A 38  ? 1.8352 0.9704 1.3715 0.0684  -0.2918 -0.1920 38  CYS A SG    
295  N  N     . THR A 39  ? 1.5954 0.7247 1.1549 0.0873  -0.2575 -0.1892 39  THR A N     
296  C  CA    . THR A 39  ? 1.6493 0.7719 1.2313 0.0841  -0.2638 -0.1855 39  THR A CA    
297  C  C     . THR A 39  ? 1.5205 0.7063 1.1508 0.0793  -0.2293 -0.1719 39  THR A C     
298  O  O     . THR A 39  ? 1.4536 0.6587 1.1320 0.0657  -0.2351 -0.1607 39  THR A O     
299  C  CB    . THR A 39  ? 1.8013 0.8663 1.3197 0.1074  -0.2678 -0.2005 39  THR A CB    
300  O  OG1   . THR A 39  ? 1.9562 1.0236 1.4306 0.1306  -0.2329 -0.2072 39  THR A OG1   
301  C  CG2   . THR A 39  ? 1.7925 0.8202 1.2792 0.1080  -0.3019 -0.2056 39  THR A CG2   
302  N  N     . GLU A 40  ? 1.5518 0.7693 1.1708 0.0906  -0.1943 -0.1718 40  GLU A N     
303  C  CA    . GLU A 40  ? 1.6156 0.8903 1.2781 0.0866  -0.1642 -0.1595 40  GLU A CA    
304  C  C     . GLU A 40  ? 1.5626 0.8900 1.2838 0.0650  -0.1632 -0.1442 40  GLU A C     
305  O  O     . GLU A 40  ? 1.4878 0.8516 1.2547 0.0555  -0.1539 -0.1317 40  GLU A O     
306  C  CB    . GLU A 40  ? 1.7075 0.9966 1.3418 0.1059  -0.1294 -0.1633 40  GLU A CB    
307  C  CG    . GLU A 40  ? 1.7238 1.0590 1.3939 0.1063  -0.1013 -0.1532 40  GLU A CG    
308  C  CD    . GLU A 40  ? 1.7799 1.0936 1.4480 0.1127  -0.1040 -0.1546 40  GLU A CD    
309  O  OE1   . GLU A 40  ? 1.7150 0.9737 1.3414 0.1232  -0.1212 -0.1659 40  GLU A OE1   
310  O  OE2   . GLU A 40  ? 1.7762 1.1258 1.4822 0.1079  -0.0896 -0.1447 40  GLU A OE2   
311  N  N     . MET A 41  ? 1.5898 0.9206 1.3087 0.0582  -0.1722 -0.1445 41  MET A N     
312  C  CA    . MET A 41  ? 1.4792 0.8567 1.2521 0.0389  -0.1721 -0.1294 41  MET A CA    
313  C  C     . MET A 41  ? 1.4165 0.7906 1.2333 0.0218  -0.1973 -0.1183 41  MET A C     
314  O  O     . MET A 41  ? 1.3058 0.7229 1.1743 0.0092  -0.1889 -0.1020 41  MET A O     
315  C  CB    . MET A 41  ? 1.5238 0.9011 1.2831 0.0359  -0.1785 -0.1325 41  MET A CB    
316  C  CG    . MET A 41  ? 1.6696 1.0657 1.4021 0.0489  -0.1497 -0.1377 41  MET A CG    
317  S  SD    . MET A 41  ? 1.7519 1.1526 1.4757 0.0432  -0.1575 -0.1390 41  MET A SD    
318  C  CE    . MET A 41  ? 1.6128 1.0706 1.4089 0.0204  -0.1561 -0.1190 41  MET A CE    
319  N  N     . GLU A 42  ? 1.5021 0.8238 1.2988 0.0219  -0.2287 -0.1262 42  GLU A N     
320  C  CA    . GLU A 42  ? 1.3985 0.7144 1.2409 0.0050  -0.2556 -0.1142 42  GLU A CA    
321  C  C     . GLU A 42  ? 1.2890 0.6274 1.1651 0.0032  -0.2419 -0.1036 42  GLU A C     
322  O  O     . GLU A 42  ? 1.2134 0.5755 1.1451 -0.0121 -0.2487 -0.0858 42  GLU A O     
323  C  CB    . GLU A 42  ? 1.3819 0.6308 1.1909 0.0071  -0.2947 -0.1266 42  GLU A CB    
324  C  CG    . GLU A 42  ? 1.4377 0.6776 1.2978 -0.0128 -0.3295 -0.1132 42  GLU A CG    
325  C  CD    . GLU A 42  ? 1.4490 0.6880 1.3402 -0.0167 -0.3325 -0.1046 42  GLU A CD    
326  O  OE1   . GLU A 42  ? 1.4534 0.6768 1.3104 -0.0016 -0.3185 -0.1150 42  GLU A OE1   
327  O  OE2   . GLU A 42  ? 1.4145 0.6693 1.3663 -0.0343 -0.3481 -0.0859 42  GLU A OE2   
328  N  N     . LYS A 43  ? 1.3626 0.6943 1.2072 0.0193  -0.2218 -0.1128 43  LYS A N     
329  C  CA    . LYS A 43  ? 1.4530 0.8061 1.3271 0.0186  -0.2080 -0.1033 43  LYS A CA    
330  C  C     . LYS A 43  ? 1.3700 0.7852 1.2830 0.0134  -0.1789 -0.0886 43  LYS A C     
331  O  O     . LYS A 43  ? 1.3757 0.8151 1.3288 0.0067  -0.1732 -0.0744 43  LYS A O     
332  C  CB    . LYS A 43  ? 1.6038 0.9291 1.4328 0.0382  -0.1963 -0.1173 43  LYS A CB    
333  C  CG    . LYS A 43  ? 1.6306 0.9706 1.4860 0.0384  -0.1856 -0.1089 43  LYS A CG    
334  C  CD    . LYS A 43  ? 1.6558 0.9800 1.5477 0.0240  -0.2135 -0.0989 43  LYS A CD    
335  C  CE    . LYS A 43  ? 1.6163 0.9556 1.5341 0.0248  -0.2018 -0.0898 43  LYS A CE    
336  N  NZ    . LYS A 43  ? 1.5259 0.8506 1.4827 0.0110  -0.2281 -0.0782 43  LYS A NZ    
337  N  N     . GLU A 44  ? 1.3365 0.7756 1.2366 0.0172  -0.1611 -0.0916 44  GLU A N     
338  C  CA    . GLU A 44  ? 1.2186 0.7121 1.1504 0.0132  -0.1363 -0.0790 44  GLU A CA    
339  C  C     . GLU A 44  ? 1.1578 0.6769 1.1337 -0.0033 -0.1449 -0.0630 44  GLU A C     
340  O  O     . GLU A 44  ? 1.1721 0.7329 1.1693 -0.0057 -0.1257 -0.0532 44  GLU A O     
341  C  CB    . GLU A 44  ? 1.1662 0.6741 1.0680 0.0243  -0.1143 -0.0882 44  GLU A CB    
342  C  CG    . GLU A 44  ? 1.1706 0.6559 1.0308 0.0425  -0.1022 -0.1017 44  GLU A CG    
343  C  CD    . GLU A 44  ? 1.2226 0.7252 1.0608 0.0528  -0.0800 -0.1072 44  GLU A CD    
344  O  OE1   . GLU A 44  ? 1.2251 0.7701 1.0881 0.0501  -0.0615 -0.0988 44  GLU A OE1   
345  O  OE2   . GLU A 44  ? 1.2554 0.7274 1.0509 0.0643  -0.0817 -0.1195 44  GLU A OE2   
346  N  N     . GLY A 45  ? 1.0464 0.5403 1.0366 -0.0139 -0.1738 -0.0596 45  GLY A N     
347  C  CA    . GLY A 45  ? 1.0328 0.5503 1.0682 -0.0290 -0.1823 -0.0425 45  GLY A CA    
348  C  C     . GLY A 45  ? 1.0439 0.5781 1.0700 -0.0303 -0.1766 -0.0449 45  GLY A C     
349  O  O     . GLY A 45  ? 1.0426 0.6038 1.1075 -0.0412 -0.1774 -0.0292 45  GLY A O     
350  N  N     . LYS A 46  ? 0.9713 0.4905 0.9481 -0.0187 -0.1697 -0.0630 46  LYS A N     
351  C  CA    . LYS A 46  ? 0.9388 0.4724 0.9050 -0.0193 -0.1642 -0.0658 46  LYS A CA    
352  C  C     . LYS A 46  ? 0.9873 0.4913 0.9508 -0.0278 -0.1950 -0.0681 46  LYS A C     
353  O  O     . LYS A 46  ? 0.9924 0.5161 0.9720 -0.0352 -0.1959 -0.0617 46  LYS A O     
354  C  CB    . LYS A 46  ? 0.9580 0.4865 0.8754 -0.0033 -0.1448 -0.0819 46  LYS A CB    
355  C  CG    . LYS A 46  ? 0.9997 0.5595 0.9231 0.0046  -0.1157 -0.0789 46  LYS A CG    
356  C  CD    . LYS A 46  ? 1.0846 0.6384 0.9658 0.0205  -0.0977 -0.0926 46  LYS A CD    
357  C  CE    . LYS A 46  ? 1.1137 0.6989 1.0064 0.0271  -0.0719 -0.0882 46  LYS A CE    
358  N  NZ    . LYS A 46  ? 1.2165 0.7959 1.0746 0.0428  -0.0544 -0.0989 46  LYS A NZ    
359  N  N     . ILE A 47  ? 1.1307 0.5857 1.0733 -0.0265 -0.2217 -0.0774 47  ILE A N     
360  C  CA    . ILE A 47  ? 1.1721 0.5936 1.1160 -0.0357 -0.2573 -0.0786 47  ILE A CA    
361  C  C     . ILE A 47  ? 1.1307 0.5269 1.1029 -0.0444 -0.2843 -0.0714 47  ILE A C     
362  O  O     . ILE A 47  ? 1.0496 0.4262 1.0054 -0.0365 -0.2823 -0.0777 47  ILE A O     
363  C  CB    . ILE A 47  ? 1.2687 0.6432 1.1456 -0.0227 -0.2689 -0.1007 47  ILE A CB    
364  C  CG1   . ILE A 47  ? 1.3611 0.6986 1.1889 -0.0054 -0.2645 -0.1165 47  ILE A CG1   
365  C  CG2   . ILE A 47  ? 1.1073 0.5086 0.9648 -0.0168 -0.2455 -0.1046 47  ILE A CG2   
366  C  CD1   . ILE A 47  ? 1.3828 0.6691 1.1399 0.0107  -0.2745 -0.1371 47  ILE A CD1   
367  N  N     . SER A 48  ? 1.0980 0.4955 1.1163 -0.0609 -0.3094 -0.0568 48  SER A N     
368  C  CA    . SER A 48  ? 1.0877 0.4631 1.1430 -0.0716 -0.3382 -0.0465 48  SER A CA    
369  C  C     . SER A 48  ? 1.2173 0.5361 1.2525 -0.0759 -0.3828 -0.0567 48  SER A C     
370  O  O     . SER A 48  ? 1.1206 0.4364 1.1486 -0.0794 -0.3938 -0.0591 48  SER A O     
371  C  CB    . SER A 48  ? 1.0115 0.4338 1.1458 -0.0875 -0.3327 -0.0170 48  SER A CB    
372  O  OG    . SER A 48  ? 0.9859 0.4531 1.1349 -0.0821 -0.2947 -0.0078 48  SER A OG    
373  N  N     . LYS A 49  ? 1.3302 0.6023 1.3549 -0.0750 -0.4097 -0.0631 49  LYS A N     
374  C  CA    . LYS A 49  ? 1.3656 0.5939 1.3700 -0.0762 -0.4506 -0.0708 49  LYS A CA    
375  C  C     . LYS A 49  ? 1.3115 0.5659 1.3877 -0.0957 -0.4733 -0.0466 49  LYS A C     
376  O  O     . LYS A 49  ? 1.2639 0.5553 1.4091 -0.1086 -0.4647 -0.0231 49  LYS A O     
377  C  CB    . LYS A 49  ? 1.4696 0.6615 1.4451 -0.0668 -0.4654 -0.0803 49  LYS A CB    
378  C  CG    . LYS A 49  ? 1.5449 0.7094 1.4476 -0.0449 -0.4433 -0.1033 49  LYS A CG    
379  C  CD    . LYS A 49  ? 1.6667 0.8008 1.5502 -0.0367 -0.4546 -0.1092 49  LYS A CD    
380  C  CE    . LYS A 49  ? 1.6646 0.8264 1.6119 -0.0486 -0.4466 -0.0908 49  LYS A CE    
381  N  NZ    . LYS A 49  ? 1.6928 0.8254 1.6194 -0.0398 -0.4548 -0.0976 49  LYS A NZ    
382  N  N     . ILE A 50  ? 1.3713 0.6069 1.4308 -0.0963 -0.5014 -0.0511 50  ILE A N     
383  C  CA    . ILE A 50  ? 1.5082 0.7662 1.6331 -0.1128 -0.5257 -0.0287 50  ILE A CA    
384  C  C     . ILE A 50  ? 1.6585 0.8783 1.7704 -0.1108 -0.5686 -0.0324 50  ILE A C     
385  O  O     . ILE A 50  ? 1.6262 0.8061 1.6857 -0.0981 -0.5769 -0.0496 50  ILE A O     
386  C  CB    . ILE A 50  ? 1.4791 0.7555 1.6068 -0.1170 -0.5212 -0.0266 50  ILE A CB    
387  C  CG1   . ILE A 50  ? 1.4041 0.6376 1.4475 -0.1015 -0.5309 -0.0531 50  ILE A CG1   
388  C  CG2   . ILE A 50  ? 1.4142 0.7313 1.5646 -0.1206 -0.4811 -0.0191 50  ILE A CG2   
389  C  CD1   . ILE A 50  ? 1.2438 0.4923 1.2843 -0.1044 -0.5268 -0.0529 50  ILE A CD1   
390  N  N     . GLY A 51  ? 1.7750 1.0062 1.9348 -0.1225 -0.5965 -0.0156 51  GLY A N     
391  C  CA    . GLY A 51  ? 1.9224 1.1177 2.0752 -0.1212 -0.6411 -0.0168 51  GLY A CA    
392  C  C     . GLY A 51  ? 1.8891 1.0830 2.0532 -0.1260 -0.6678 -0.0107 51  GLY A C     
393  O  O     . GLY A 51  ? 1.8751 1.0835 2.0266 -0.1258 -0.6516 -0.0139 51  GLY A O     
394  N  N     . PRO A 52  ? 1.7299 0.9052 1.9188 -0.1302 -0.7107 -0.0014 52  PRO A N     
395  C  CA    . PRO A 52  ? 1.7186 0.8920 1.9241 -0.1348 -0.7394 0.0069  52  PRO A CA    
396  C  C     . PRO A 52  ? 1.6616 0.8942 1.9528 -0.1509 -0.7256 0.0349  52  PRO A C     
397  O  O     . PRO A 52  ? 1.5820 0.8183 1.8885 -0.1546 -0.7436 0.0423  52  PRO A O     
398  C  CB    . PRO A 52  ? 1.6478 0.7861 1.8638 -0.1347 -0.7891 0.0117  52  PRO A CB    
399  C  CG    . PRO A 52  ? 1.6161 0.7653 1.8654 -0.1386 -0.7814 0.0193  52  PRO A CG    
400  C  CD    . PRO A 52  ? 1.6585 0.8117 1.8605 -0.1301 -0.7365 0.0019  52  PRO A CD    
401  N  N     . GLU A 53  ? 1.7615 1.0396 2.1074 -0.1593 -0.6937 0.0514  53  GLU A N     
402  C  CA    . GLU A 53  ? 1.7802 1.1165 2.2054 -0.1720 -0.6747 0.0796  53  GLU A CA    
403  C  C     . GLU A 53  ? 1.8132 1.1693 2.2133 -0.1703 -0.6412 0.0720  53  GLU A C     
404  O  O     . GLU A 53  ? 1.7892 1.1944 2.2483 -0.1790 -0.6189 0.0942  53  GLU A O     
405  C  CB    . GLU A 53  ? 1.7425 1.1180 2.2321 -0.1791 -0.6517 0.1015  53  GLU A CB    
406  C  CG    . GLU A 53  ? 1.7240 1.1025 2.1761 -0.1728 -0.6115 0.0878  53  GLU A CG    
407  C  CD    . GLU A 53  ? 1.7821 1.1112 2.1702 -0.1621 -0.6233 0.0631  53  GLU A CD    
408  O  OE1   . GLU A 53  ? 1.7995 1.0936 2.1767 -0.1602 -0.6628 0.0586  53  GLU A OE1   
409  O  OE2   . GLU A 53  ? 1.7861 1.1110 2.1350 -0.1546 -0.5934 0.0489  53  GLU A OE2   
410  N  N     . ASN A 54  ? 1.8076 1.1272 2.1220 -0.1582 -0.6363 0.0423  54  ASN A N     
411  C  CA    . ASN A 54  ? 1.7009 1.0350 1.9861 -0.1555 -0.6072 0.0330  54  ASN A CA    
412  C  C     . ASN A 54  ? 1.6905 0.9885 1.9202 -0.1480 -0.6318 0.0163  54  ASN A C     
413  O  O     . ASN A 54  ? 1.8003 1.0526 1.9494 -0.1332 -0.6370 -0.0099 54  ASN A O     
414  C  CB    . ASN A 54  ? 1.6239 0.9514 1.8576 -0.1458 -0.5719 0.0138  54  ASN A CB    
415  C  CG    . ASN A 54  ? 1.5151 0.8704 1.7406 -0.1460 -0.5372 0.0113  54  ASN A CG    
416  O  OD1   . ASN A 54  ? 1.5167 0.8799 1.7432 -0.1487 -0.5424 0.0130  54  ASN A OD1   
417  N  ND2   . ASN A 54  ? 1.4514 0.8209 1.6691 -0.1427 -0.5026 0.0076  54  ASN A ND2   
418  N  N     . PRO A 55  ? 1.5733 0.8897 1.8422 -0.1560 -0.6463 0.0315  55  PRO A N     
419  C  CA    . PRO A 55  ? 1.5820 0.8618 1.7992 -0.1485 -0.6724 0.0172  55  PRO A CA    
420  C  C     . PRO A 55  ? 1.4860 0.7569 1.6346 -0.1383 -0.6463 -0.0051 55  PRO A C     
421  O  O     . PRO A 55  ? 1.5227 0.7595 1.6176 -0.1291 -0.6645 -0.0192 55  PRO A O     
422  C  CB    . PRO A 55  ? 1.6321 0.9429 1.9232 -0.1613 -0.6902 0.0438  55  PRO A CB    
423  C  CG    . PRO A 55  ? 1.6391 0.9961 2.0195 -0.1737 -0.6795 0.0726  55  PRO A CG    
424  C  CD    . PRO A 55  ? 1.5233 0.8938 1.8864 -0.1709 -0.6399 0.0642  55  PRO A CD    
425  N  N     . TYR A 56  ? 1.3935 0.6927 1.5418 -0.1388 -0.6052 -0.0080 56  TYR A N     
426  C  CA    . TYR A 56  ? 1.4794 0.7775 1.5738 -0.1306 -0.5789 -0.0257 56  TYR A CA    
427  C  C     . TYR A 56  ? 1.6490 0.9008 1.6528 -0.1110 -0.5729 -0.0546 56  TYR A C     
428  O  O     . TYR A 56  ? 1.7912 1.0211 1.7798 -0.1052 -0.5783 -0.0602 56  TYR A O     
429  C  CB    . TYR A 56  ? 1.5487 0.8968 1.6846 -0.1390 -0.5388 -0.0145 56  TYR A CB    
430  C  CG    . TYR A 56  ? 1.5183 0.9158 1.7469 -0.1559 -0.5385 0.0175  56  TYR A CG    
431  C  CD1   . TYR A 56  ? 1.4542 0.8581 1.7123 -0.1622 -0.5623 0.0299  56  TYR A CD1   
432  C  CD2   . TYR A 56  ? 1.3957 0.8332 1.6820 -0.1637 -0.5131 0.0369  56  TYR A CD2   
433  C  CE1   . TYR A 56  ? 1.3036 0.7540 1.6471 -0.1752 -0.5596 0.0609  56  TYR A CE1   
434  C  CE2   . TYR A 56  ? 1.1995 0.6834 1.5689 -0.1760 -0.5090 0.0685  56  TYR A CE2   
435  C  CZ    . TYR A 56  ? 1.2337 0.7247 1.6321 -0.1814 -0.5318 0.0804  56  TYR A CZ    
436  O  OH    . TYR A 56  ? 1.0030 0.5412 1.4845 -0.1912 -0.5256 0.1131  56  TYR A OH    
437  N  N     . ASN A 57  ? 1.7092 0.9473 1.6530 -0.0998 -0.5602 -0.0719 57  ASN A N     
438  C  CA    . ASN A 57  ? 1.7653 0.9651 1.6229 -0.0785 -0.5471 -0.0972 57  ASN A CA    
439  C  C     . ASN A 57  ? 1.6954 0.9013 1.5110 -0.0703 -0.5225 -0.1090 57  ASN A C     
440  O  O     . ASN A 57  ? 1.6288 0.8532 1.4673 -0.0789 -0.5277 -0.1011 57  ASN A O     
441  C  CB    . ASN A 57  ? 1.8325 0.9774 1.6374 -0.0650 -0.5810 -0.1078 57  ASN A CB    
442  C  CG    . ASN A 57  ? 1.8070 0.9143 1.5275 -0.0414 -0.5644 -0.1304 57  ASN A CG    
443  O  OD1   . ASN A 57  ? 1.7686 0.8691 1.4842 -0.0369 -0.5558 -0.1340 57  ASN A OD1   
444  N  ND2   . ASN A 57  ? 1.8343 0.9184 1.4893 -0.0252 -0.5581 -0.1443 57  ASN A ND2   
445  N  N     . THR A 58  ? 1.6644 0.8556 1.4200 -0.0529 -0.4949 -0.1269 58  THR A N     
446  C  CA    . THR A 58  ? 1.5724 0.7693 1.2854 -0.0427 -0.4682 -0.1383 58  THR A CA    
447  C  C     . THR A 58  ? 1.5584 0.7189 1.1895 -0.0167 -0.4520 -0.1581 58  THR A C     
448  O  O     . THR A 58  ? 1.5671 0.7220 1.1917 -0.0106 -0.4399 -0.1619 58  THR A O     
449  C  CB    . THR A 58  ? 1.4559 0.7064 1.2139 -0.0527 -0.4337 -0.1294 58  THR A CB    
450  O  OG1   . THR A 58  ? 1.3014 0.5903 1.1423 -0.0751 -0.4446 -0.1064 58  THR A OG1   
451  C  CG2   . THR A 58  ? 1.4421 0.7147 1.1707 -0.0437 -0.4070 -0.1342 58  THR A CG2   
452  N  N     . PRO A 59  ? 1.5227 0.6592 1.0928 -0.0004 -0.4500 -0.1689 59  PRO A N     
453  C  CA    . PRO A 59  ? 1.4735 0.5771 0.9673 0.0264  -0.4318 -0.1842 59  PRO A CA    
454  C  C     . PRO A 59  ? 1.3922 0.5214 0.8779 0.0343  -0.3876 -0.1894 59  PRO A C     
455  O  O     . PRO A 59  ? 1.3467 0.5148 0.8702 0.0224  -0.3699 -0.1842 59  PRO A O     
456  C  CB    . PRO A 59  ? 1.4578 0.5359 0.8992 0.0395  -0.4401 -0.1900 59  PRO A CB    
457  C  CG    . PRO A 59  ? 1.4138 0.5254 0.9035 0.0200  -0.4465 -0.1804 59  PRO A CG    
458  C  CD    . PRO A 59  ? 1.3772 0.5145 0.9464 -0.0049 -0.4653 -0.1658 59  PRO A CD    
459  N  N     . VAL A 60  ? 1.4083 0.5143 0.8439 0.0559  -0.3700 -0.1988 60  VAL A N     
460  C  CA    . VAL A 60  ? 1.3706 0.4974 0.7969 0.0666  -0.3285 -0.2028 60  VAL A CA    
461  C  C     . VAL A 60  ? 1.4154 0.5174 0.7690 0.0956  -0.3064 -0.2117 60  VAL A C     
462  O  O     . VAL A 60  ? 1.4755 0.5400 0.7834 0.1079  -0.3244 -0.2153 60  VAL A O     
463  C  CB    . VAL A 60  ? 1.3542 0.4864 0.8087 0.0624  -0.3238 -0.2007 60  VAL A CB    
464  C  CG1   . VAL A 60  ? 1.3056 0.4730 0.8401 0.0345  -0.3403 -0.1858 60  VAL A CG1   
465  C  CG2   . VAL A 60  ? 1.4181 0.5070 0.8326 0.0767  -0.3400 -0.2062 60  VAL A CG2   
466  N  N     . PHE A 61  ? 1.3867 0.5103 0.7318 0.1073  -0.2667 -0.2134 61  PHE A N     
467  C  CA    . PHE A 61  ? 1.4219 0.5297 0.7082 0.1356  -0.2387 -0.2177 61  PHE A CA    
468  C  C     . PHE A 61  ? 1.3791 0.5178 0.6801 0.1426  -0.1989 -0.2161 61  PHE A C     
469  O  O     . PHE A 61  ? 1.3197 0.5024 0.6819 0.1245  -0.1931 -0.2074 61  PHE A O     
470  C  CB    . PHE A 61  ? 1.4551 0.5605 0.7096 0.1442  -0.2330 -0.2179 61  PHE A CB    
471  C  CG    . PHE A 61  ? 1.3916 0.5394 0.6834 0.1301  -0.2190 -0.2141 61  PHE A CG    
472  C  CD1   . PHE A 61  ? 1.3569 0.5395 0.6504 0.1404  -0.1773 -0.2100 61  PHE A CD1   
473  C  CD2   . PHE A 61  ? 1.3672 0.5280 0.7003 0.1060  -0.2463 -0.2106 61  PHE A CD2   
474  C  CE1   . PHE A 61  ? 1.2946 0.5364 0.6379 0.1254  -0.1617 -0.1987 61  PHE A CE1   
475  C  CE2   . PHE A 61  ? 1.3046 0.5255 0.6865 0.0920  -0.2282 -0.1987 61  PHE A CE2   
476  C  CZ    . PHE A 61  ? 1.2678 0.5279 0.6530 0.1017  -0.1866 -0.1936 61  PHE A CZ    
477  N  N     . ALA A 62  ? 1.4929 0.6273 0.7528 0.1673  -0.1678 -0.2163 62  ALA A N     
478  C  CA    . ALA A 62  ? 1.5394 0.7026 0.8135 0.1764  -0.1294 -0.2128 62  ALA A CA    
479  C  C     . ALA A 62  ? 1.6803 0.8520 0.9224 0.1984  -0.0949 -0.2086 62  ALA A C     
480  O  O     . ALA A 62  ? 1.7374 0.8794 0.9316 0.2142  -0.0988 -0.2092 62  ALA A O     
481  C  CB    . ALA A 62  ? 1.4833 0.6292 0.7519 0.1846  -0.1284 -0.2143 62  ALA A CB    
482  N  N     . ILE A 63  ? 1.8205 1.0420 1.0992 0.1977  -0.0611 -0.1995 63  ILE A N     
483  C  CA    . ILE A 63  ? 1.9686 1.2014 1.2262 0.2180  -0.0254 -0.1939 63  ILE A CA    
484  C  C     . ILE A 63  ? 2.0963 1.3634 1.3847 0.2252  0.0078  -0.1842 63  ILE A C     
485  O  O     . ILE A 63  ? 2.0661 1.3475 1.3888 0.2143  0.0024  -0.1829 63  ILE A O     
486  C  CB    . ILE A 63  ? 1.7936 1.0679 1.0806 0.2051  -0.0191 -0.1864 63  ILE A CB    
487  C  CG1   . ILE A 63  ? 1.6725 1.0134 1.0398 0.1785  -0.0148 -0.1756 63  ILE A CG1   
488  C  CG2   . ILE A 63  ? 1.8360 1.0756 1.0928 0.1987  -0.0523 -0.1953 63  ILE A CG2   
489  C  CD1   . ILE A 63  ? 1.6316 1.0168 1.0298 0.1682  -0.0033 -0.1671 63  ILE A CD1   
490  N  N     . LYS A 64  ? 2.2361 1.5170 1.5145 0.2438  0.0421  -0.1760 64  LYS A N     
491  C  CA    . LYS A 64  ? 2.2398 1.5529 1.5486 0.2526  0.0747  -0.1648 64  LYS A CA    
492  C  C     . LYS A 64  ? 2.1064 1.4897 1.4887 0.2317  0.0875  -0.1519 64  LYS A C     
493  O  O     . LYS A 64  ? 2.0804 1.4856 1.4749 0.2235  0.0884  -0.1483 64  LYS A O     
494  C  CB    . LYS A 64  ? 2.3442 1.6442 1.6168 0.2815  0.1042  -0.1562 64  LYS A CB    
495  C  CG    . LYS A 64  ? 2.3924 1.6414 1.6072 0.2979  0.0908  -0.1602 64  LYS A CG    
496  C  CD    . LYS A 64  ? 2.3874 1.6194 1.6034 0.2983  0.0818  -0.1653 64  LYS A CD    
497  C  CE    . LYS A 64  ? 2.3359 1.6003 1.5863 0.3075  0.1158  -0.1535 64  LYS A CE    
498  N  NZ    . LYS A 64  ? 2.3330 1.5998 1.5644 0.3319  0.1474  -0.1385 64  LYS A NZ    
499  N  N     . LYS A 65  ? 2.0059 1.4217 1.4348 0.2240  0.0963  -0.1453 65  LYS A N     
500  C  CA    . LYS A 65  ? 1.8166 1.2943 1.3126 0.2054  0.1058  -0.1339 65  LYS A CA    
501  C  C     . LYS A 65  ? 1.7235 1.2271 1.2321 0.2195  0.1391  -0.1209 65  LYS A C     
502  O  O     . LYS A 65  ? 1.7277 1.2034 1.1947 0.2444  0.1574  -0.1193 65  LYS A O     
503  C  CB    . LYS A 65  ? 1.7622 1.2611 1.2995 0.1938  0.1019  -0.1316 65  LYS A CB    
504  C  CG    . LYS A 65  ? 1.6998 1.1810 1.2372 0.1773  0.0700  -0.1409 65  LYS A CG    
505  C  CD    . LYS A 65  ? 1.6055 1.1136 1.1880 0.1659  0.0694  -0.1361 65  LYS A CD    
506  C  CE    . LYS A 65  ? 1.5609 1.0553 1.1504 0.1488  0.0392  -0.1423 65  LYS A CE    
507  N  NZ    . LYS A 65  ? 1.4805 1.0024 1.1140 0.1381  0.0398  -0.1364 65  LYS A NZ    
508  N  N     . LYS A 66  ? 1.6363 1.1928 1.2039 0.2042  0.1469  -0.1105 66  LYS A N     
509  C  CA    . LYS A 66  ? 1.6064 1.1918 1.1973 0.2146  0.1758  -0.0962 66  LYS A CA    
510  C  C     . LYS A 66  ? 1.7333 1.3133 1.3249 0.2349  0.1994  -0.0882 66  LYS A C     
511  O  O     . LYS A 66  ? 1.6870 1.2735 1.2798 0.2526  0.2262  -0.0760 66  LYS A O     
512  C  CB    . LYS A 66  ? 1.3597 0.9988 1.0134 0.1928  0.1737  -0.0881 66  LYS A CB    
513  C  CG    . LYS A 66  ? 1.2451 0.9136 0.9241 0.1983  0.1958  -0.0743 66  LYS A CG    
514  C  CD    . LYS A 66  ? 1.1171 0.8318 0.8517 0.1760  0.1878  -0.0691 66  LYS A CD    
515  C  CE    . LYS A 66  ? 1.0356 0.7775 0.7960 0.1796  0.2056  -0.0559 66  LYS A CE    
516  N  NZ    . LYS A 66  ? 1.0309 0.7547 0.7541 0.1858  0.2073  -0.0588 66  LYS A NZ    
517  N  N     . ASP A 67  ? 1.9239 1.4923 1.5167 0.2333  0.1906  -0.0934 67  ASP A N     
518  C  CA    . ASP A 67  ? 2.0878 1.6465 1.6773 0.2536  0.2116  -0.0867 67  ASP A CA    
519  C  C     . ASP A 67  ? 2.3172 1.8190 1.8361 0.2810  0.2189  -0.0933 67  ASP A C     
520  O  O     . ASP A 67  ? 2.4434 1.9335 1.9528 0.3030  0.2413  -0.0860 67  ASP A O     
521  C  CB    . ASP A 67  ? 2.0379 1.6058 1.6558 0.2415  0.1991  -0.0896 67  ASP A CB    
522  C  CG    . ASP A 67  ? 2.0377 1.6150 1.6766 0.2570  0.2228  -0.0779 67  ASP A CG    
523  O  OD1   . ASP A 67  ? 2.0222 1.6242 1.6869 0.2667  0.2471  -0.0628 67  ASP A OD1   
524  O  OD2   . ASP A 67  ? 2.0485 1.6090 1.6810 0.2594  0.2167  -0.0828 67  ASP A OD2   
525  N  N     . SER A 68  ? 2.2425 1.7071 1.7111 0.2810  0.1997  -0.1065 68  SER A N     
526  C  CA    . SER A 68  ? 2.1034 1.5099 1.4980 0.3074  0.2032  -0.1134 68  SER A CA    
527  C  C     . SER A 68  ? 2.0991 1.4756 1.4717 0.3167  0.1970  -0.1176 68  SER A C     
528  O  O     . SER A 68  ? 2.1723 1.5213 1.5050 0.3362  0.2045  -0.1130 68  SER A O     
529  C  CB    . SER A 68  ? 1.9467 1.3665 1.3386 0.3256  0.2328  -0.0953 68  SER A CB    
530  O  OG    . SER A 68  ? 1.9852 1.3616 1.3162 0.3435  0.2294  -0.0961 68  SER A OG    
531  N  N     . THR A 69  ? 2.0802 1.4619 1.4788 0.3024  0.1826  -0.1251 69  THR A N     
532  C  CA    . THR A 69  ? 2.1408 1.4920 1.5187 0.3106  0.1755  -0.1305 69  THR A CA    
533  C  C     . THR A 69  ? 2.1179 1.4451 1.4877 0.2917  0.1379  -0.1468 69  THR A C     
534  O  O     . THR A 69  ? 2.0719 1.3539 1.3976 0.2982  0.1190  -0.1562 69  THR A O     
535  C  CB    . THR A 69  ? 2.1673 1.5499 1.5915 0.3147  0.1986  -0.1190 69  THR A CB    
536  O  OG1   . THR A 69  ? 2.1944 1.6057 1.6377 0.3288  0.2313  -0.1003 69  THR A OG1   
537  C  CG2   . THR A 69  ? 2.1837 1.5358 1.5848 0.3249  0.1934  -0.1225 69  THR A CG2   
538  N  N     . LYS A 70  ? 2.1062 1.4776 1.5321 0.2621  0.1233  -0.1444 70  LYS A N     
539  C  CA    . LYS A 70  ? 2.1043 1.4649 1.5370 0.2404  0.0882  -0.1545 70  LYS A CA    
540  C  C     . LYS A 70  ? 2.1613 1.5045 1.5704 0.2312  0.0657  -0.1622 70  LYS A C     
541  O  O     . LYS A 70  ? 2.1528 1.5104 1.5587 0.2340  0.0774  -0.1580 70  LYS A O     
542  C  CB    . LYS A 70  ? 1.9685 1.3835 1.4718 0.2153  0.0850  -0.1464 70  LYS A CB    
543  C  CG    . LYS A 70  ? 1.9024 1.3349 1.4326 0.2221  0.1032  -0.1389 70  LYS A CG    
544  C  CD    . LYS A 70  ? 1.7962 1.2787 1.3906 0.1984  0.0981  -0.1315 70  LYS A CD    
545  C  CE    . LYS A 70  ? 1.7510 1.2500 1.3721 0.2053  0.1147  -0.1238 70  LYS A CE    
546  N  NZ    . LYS A 70  ? 1.6713 1.2151 1.3496 0.1842  0.1091  -0.1169 70  LYS A NZ    
547  N  N     . TRP A 71  ? 2.2245 1.5365 1.6197 0.2199  0.0322  -0.1728 71  TRP A N     
548  C  CA    . TRP A 71  ? 2.2190 1.5092 1.5927 0.2105  0.0056  -0.1804 71  TRP A CA    
549  C  C     . TRP A 71  ? 2.1213 1.4563 1.5559 0.1794  -0.0108 -0.1749 71  TRP A C     
550  O  O     . TRP A 71  ? 2.1069 1.4594 1.5804 0.1649  -0.0197 -0.1718 71  TRP A O     
551  C  CB    . TRP A 71  ? 2.3162 1.5377 1.6345 0.2190  -0.0243 -0.1949 71  TRP A CB    
552  C  CG    . TRP A 71  ? 2.3775 1.5597 1.6331 0.2474  -0.0129 -0.1970 71  TRP A CG    
553  C  CD1   . TRP A 71  ? 2.3660 1.5353 1.6023 0.2664  0.0035  -0.1937 71  TRP A CD1   
554  C  CD2   . TRP A 71  ? 2.4423 1.6048 1.6561 0.2569  -0.0172 -0.1973 71  TRP A CD2   
555  N  NE1   . TRP A 71  ? 2.4322 1.5741 1.6164 0.2878  0.0102  -0.1913 71  TRP A NE1   
556  C  CE2   . TRP A 71  ? 2.4573 1.5939 1.6261 0.2827  -0.0024 -0.1935 71  TRP A CE2   
557  C  CE3   . TRP A 71  ? 2.4370 1.6004 1.6470 0.2467  -0.0321 -0.1996 71  TRP A CE3   
558  C  CZ2   . TRP A 71  ? 2.4835 1.5935 1.6019 0.2992  -0.0019 -0.1916 71  TRP A CZ2   
559  C  CZ3   . TRP A 71  ? 2.4437 1.5822 1.6053 0.2625  -0.0320 -0.1984 71  TRP A CZ3   
560  C  CH2   . TRP A 71  ? 2.4822 1.5934 1.5977 0.2888  -0.0170 -0.1943 71  TRP A CH2   
561  N  N     . ARG A 72  ? 1.9615 1.3140 1.4031 0.1706  -0.0136 -0.1728 72  ARG A N     
562  C  CA    . ARG A 72  ? 1.7667 1.1568 1.2596 0.1436  -0.0293 -0.1673 72  ARG A CA    
563  C  C     . ARG A 72  ? 1.7352 1.0867 1.2080 0.1344  -0.0663 -0.1756 72  ARG A C     
564  O  O     . ARG A 72  ? 1.8919 1.2069 1.3171 0.1448  -0.0752 -0.1833 72  ARG A O     
565  C  CB    . ARG A 72  ? 1.6355 1.0689 1.1516 0.1389  -0.0109 -0.1591 72  ARG A CB    
566  C  CG    . ARG A 72  ? 1.4998 0.9545 1.0466 0.1164  -0.0307 -0.1563 72  ARG A CG    
567  C  CD    . ARG A 72  ? 1.3412 0.8432 0.9172 0.1110  -0.0111 -0.1474 72  ARG A CD    
568  N  NE    . ARG A 72  ? 1.2559 0.8053 0.8828 0.1025  0.0047  -0.1377 72  ARG A NE    
569  C  CZ    . ARG A 72  ? 1.2131 0.7815 0.8478 0.1137  0.0308  -0.1326 72  ARG A CZ    
570  N  NH1   . ARG A 72  ? 1.3085 0.8551 0.9060 0.1345  0.0473  -0.1347 72  ARG A NH1   
571  N  NH2   . ARG A 72  ? 1.1395 0.7475 0.8197 0.1049  0.0402  -0.1243 72  ARG A NH2   
572  N  N     . LYS A 73  ? 1.5454 0.9042 1.0553 0.1153  -0.0882 -0.1731 73  LYS A N     
573  C  CA    . LYS A 73  ? 1.5123 0.8368 1.0142 0.1043  -0.1261 -0.1784 73  LYS A CA    
574  C  C     . LYS A 73  ? 1.4273 0.7855 0.9659 0.0852  -0.1343 -0.1708 73  LYS A C     
575  O  O     . LYS A 73  ? 1.3269 0.7342 0.9222 0.0688  -0.1272 -0.1592 73  LYS A O     
576  C  CB    . LYS A 73  ? 1.4960 0.8113 1.0241 0.0935  -0.1456 -0.1770 73  LYS A CB    
577  C  CG    . LYS A 73  ? 1.4605 0.7433 0.9913 0.0798  -0.1870 -0.1797 73  LYS A CG    
578  C  CD    . LYS A 73  ? 1.3378 0.6226 0.9084 0.0666  -0.2031 -0.1741 73  LYS A CD    
579  C  CE    . LYS A 73  ? 1.2721 0.5322 0.8596 0.0500  -0.2445 -0.1727 73  LYS A CE    
580  N  NZ    . LYS A 73  ? 1.2624 0.5341 0.9005 0.0352  -0.2569 -0.1628 73  LYS A NZ    
581  N  N     . LEU A 74  ? 1.4833 0.8132 0.9873 0.0887  -0.1493 -0.1773 74  LEU A N     
582  C  CA    . LEU A 74  ? 1.4657 0.8220 0.9991 0.0723  -0.1587 -0.1708 74  LEU A CA    
583  C  C     . LEU A 74  ? 1.5744 0.8928 1.1040 0.0613  -0.2009 -0.1745 74  LEU A C     
584  O  O     . LEU A 74  ? 1.7030 0.9621 1.1805 0.0733  -0.2221 -0.1868 74  LEU A O     
585  C  CB    . LEU A 74  ? 1.4902 0.8502 0.9919 0.0845  -0.1403 -0.1732 74  LEU A CB    
586  C  CG    . LEU A 74  ? 1.4118 0.8120 0.9236 0.0941  -0.0999 -0.1673 74  LEU A CG    
587  C  CD1   . LEU A 74  ? 1.4155 0.8065 0.8870 0.1098  -0.0844 -0.1704 74  LEU A CD1   
588  C  CD2   . LEU A 74  ? 1.2957 0.7581 0.8742 0.0751  -0.0887 -0.1542 74  LEU A CD2   
589  N  N     . VAL A 75  ? 1.5221 0.8732 1.1072 0.0393  -0.2136 -0.1631 75  VAL A N     
590  C  CA    . VAL A 75  ? 1.5588 0.8823 1.1551 0.0257  -0.2542 -0.1624 75  VAL A CA    
591  C  C     . VAL A 75  ? 1.5692 0.9071 1.1716 0.0187  -0.2592 -0.1590 75  VAL A C     
592  O  O     . VAL A 75  ? 1.4741 0.8627 1.1062 0.0139  -0.2337 -0.1500 75  VAL A O     
593  C  CB    . VAL A 75  ? 1.4200 0.7688 1.0826 0.0059  -0.2662 -0.1487 75  VAL A CB    
594  C  CG1   . VAL A 75  ? 1.4876 0.8012 1.1627 -0.0071 -0.3112 -0.1474 75  VAL A CG1   
595  C  CG2   . VAL A 75  ? 1.3260 0.6713 0.9874 0.0129  -0.2539 -0.1504 75  VAL A CG2   
596  N  N     . ASP A 76  ? 1.6647 0.9555 1.2377 0.0185  -0.2937 -0.1664 76  ASP A N     
597  C  CA    . ASP A 76  ? 1.7477 1.0458 1.3230 0.0123  -0.3026 -0.1639 76  ASP A CA    
598  C  C     . ASP A 76  ? 1.7016 1.0288 1.3486 -0.0127 -0.3238 -0.1478 76  ASP A C     
599  O  O     . ASP A 76  ? 1.7465 1.0423 1.3981 -0.0218 -0.3621 -0.1476 76  ASP A O     
600  C  CB    . ASP A 76  ? 1.9067 1.1378 1.4112 0.0264  -0.3291 -0.1797 76  ASP A CB    
601  C  CG    . ASP A 76  ? 1.9648 1.2006 1.4682 0.0210  -0.3393 -0.1776 76  ASP A CG    
602  O  OD1   . ASP A 76  ? 1.8765 1.1681 1.4195 0.0125  -0.3151 -0.1665 76  ASP A OD1   
603  O  OD2   . ASP A 76  ? 2.0588 1.2441 1.5222 0.0259  -0.3712 -0.1859 76  ASP A OD2   
604  N  N     . PHE A 77  ? 1.5733 0.9610 1.2774 -0.0230 -0.2978 -0.1329 77  PHE A N     
605  C  CA    . PHE A 77  ? 1.3742 0.7968 1.1495 -0.0443 -0.3094 -0.1143 77  PHE A CA    
606  C  C     . PHE A 77  ? 1.2875 0.7301 1.0752 -0.0508 -0.3109 -0.1086 77  PHE A C     
607  O  O     . PHE A 77  ? 1.1491 0.6380 0.9942 -0.0639 -0.3022 -0.0915 77  PHE A O     
608  C  CB    . PHE A 77  ? 1.1531 0.6295 0.9786 -0.0498 -0.2797 -0.1004 77  PHE A CB    
609  C  CG    . PHE A 77  ? 1.0611 0.5246 0.8988 -0.0507 -0.2858 -0.0992 77  PHE A CG    
610  C  CD1   . PHE A 77  ? 1.1519 0.5908 1.0176 -0.0625 -0.3209 -0.0929 77  PHE A CD1   
611  C  CD2   . PHE A 77  ? 0.9703 0.4473 0.7954 -0.0401 -0.2571 -0.1030 77  PHE A CD2   
612  C  CE1   . PHE A 77  ? 1.1686 0.5956 1.0469 -0.0635 -0.3266 -0.0911 77  PHE A CE1   
613  C  CE2   . PHE A 77  ? 1.0007 0.4662 0.8373 -0.0407 -0.2623 -0.1016 77  PHE A CE2   
614  C  CZ    . PHE A 77  ? 1.0534 0.4939 0.9159 -0.0523 -0.2967 -0.0959 77  PHE A CZ    
615  N  N     . ARG A 78  ? 1.3439 0.7508 1.0766 -0.0405 -0.3212 -0.1221 78  ARG A N     
616  C  CA    . ARG A 78  ? 1.3844 0.8089 1.1252 -0.0456 -0.3221 -0.1175 78  ARG A CA    
617  C  C     . ARG A 78  ? 1.4804 0.9086 1.2755 -0.0653 -0.3548 -0.1033 78  ARG A C     
618  O  O     . ARG A 78  ? 1.4636 0.9259 1.2926 -0.0743 -0.3495 -0.0919 78  ARG A O     
619  C  CB    . ARG A 78  ? 1.4834 0.8631 1.1503 -0.0291 -0.3283 -0.1348 78  ARG A CB    
620  C  CG    . ARG A 78  ? 1.5797 0.9826 1.2469 -0.0303 -0.3186 -0.1315 78  ARG A CG    
621  C  CD    . ARG A 78  ? 1.6892 1.0541 1.2797 -0.0097 -0.3130 -0.1476 78  ARG A CD    
622  N  NE    . ARG A 78  ? 1.8241 1.1190 1.3622 -0.0018 -0.3503 -0.1609 78  ARG A NE    
623  C  CZ    . ARG A 78  ? 1.8583 1.1070 1.3223 0.0179  -0.3528 -0.1752 78  ARG A CZ    
624  N  NH1   . ARG A 78  ? 1.8391 1.1076 1.2776 0.0307  -0.3189 -0.1766 78  ARG A NH1   
625  N  NH2   . ARG A 78  ? 1.8662 1.0593 1.2892 0.0264  -0.3846 -0.1826 78  ARG A NH2   
626  N  N     . GLU A 79  ? 1.5668 0.9605 1.3738 -0.0722 -0.3888 -0.1025 79  GLU A N     
627  C  CA    . GLU A 79  ? 1.4882 0.8869 1.3559 -0.0918 -0.4208 -0.0860 79  GLU A CA    
628  C  C     . GLU A 79  ? 1.3943 0.8485 1.3399 -0.1050 -0.4026 -0.0630 79  GLU A C     
629  O  O     . GLU A 79  ? 1.4480 0.9330 1.4526 -0.1190 -0.4084 -0.0438 79  GLU A O     
630  C  CB    . GLU A 79  ? 1.5211 0.8566 1.3712 -0.0939 -0.4685 -0.0938 79  GLU A CB    
631  C  CG    . GLU A 79  ? 1.5481 0.8898 1.4617 -0.1117 -0.5030 -0.0743 79  GLU A CG    
632  C  CD    . GLU A 79  ? 1.5121 0.8615 1.4272 -0.1148 -0.5113 -0.0707 79  GLU A CD    
633  O  OE1   . GLU A 79  ? 1.5443 0.8721 1.3938 -0.1010 -0.5035 -0.0881 79  GLU A OE1   
634  O  OE2   . GLU A 79  ? 1.4514 0.8295 1.4343 -0.1301 -0.5241 -0.0491 79  GLU A OE2   
635  N  N     . LEU A 80  ? 1.2766 0.7435 1.2226 -0.0995 -0.3797 -0.0639 80  LEU A N     
636  C  CA    . LEU A 80  ? 1.1390 0.6567 1.1522 -0.1092 -0.3598 -0.0424 80  LEU A CA    
637  C  C     . LEU A 80  ? 1.2685 0.8409 1.3000 -0.1081 -0.3232 -0.0333 80  LEU A C     
638  O  O     . LEU A 80  ? 1.2907 0.9032 1.3828 -0.1182 -0.3150 -0.0116 80  LEU A O     
639  C  CB    . LEU A 80  ? 1.0545 0.5681 1.0578 -0.1023 -0.3457 -0.0470 80  LEU A CB    
640  C  CG    . LEU A 80  ? 0.9745 0.5363 1.0377 -0.1089 -0.3224 -0.0264 80  LEU A CG    
641  C  CD1   . LEU A 80  ? 1.0429 0.6146 1.1774 -0.1261 -0.3462 -0.0028 80  LEU A CD1   
642  C  CD2   . LEU A 80  ? 0.9010 0.4524 0.9458 -0.1008 -0.3111 -0.0339 80  LEU A CD2   
643  N  N     . ASN A 81  ? 1.2353 0.8085 1.2149 -0.0949 -0.3009 -0.0487 81  ASN A N     
644  C  CA    . ASN A 81  ? 1.2957 0.9171 1.2890 -0.0931 -0.2680 -0.0416 81  ASN A CA    
645  C  C     . ASN A 81  ? 1.3777 1.0151 1.4034 -0.1034 -0.2792 -0.0293 81  ASN A C     
646  O  O     . ASN A 81  ? 1.3679 1.0501 1.4304 -0.1067 -0.2574 -0.0148 81  ASN A O     
647  C  CB    . ASN A 81  ? 1.3229 0.9383 1.2563 -0.0773 -0.2453 -0.0599 81  ASN A CB    
648  C  CG    . ASN A 81  ? 1.2992 0.9035 1.2046 -0.0662 -0.2304 -0.0701 81  ASN A CG    
649  O  OD1   . ASN A 81  ? 1.2105 0.8278 1.1467 -0.0701 -0.2259 -0.0616 81  ASN A OD1   
650  N  ND2   . ASN A 81  ? 1.2714 0.8516 1.1187 -0.0514 -0.2217 -0.0873 81  ASN A ND2   
651  N  N     . LYS A 82  ? 1.4511 1.0509 1.4621 -0.1074 -0.3136 -0.0349 82  LYS A N     
652  C  CA    . LYS A 82  ? 1.3357 0.9493 1.3814 -0.1180 -0.3275 -0.0221 82  LYS A CA    
653  C  C     . LYS A 82  ? 1.2454 0.8900 1.3705 -0.1324 -0.3324 0.0046  82  LYS A C     
654  O  O     . LYS A 82  ? 1.1512 0.8315 1.3178 -0.1385 -0.3230 0.0214  82  LYS A O     
655  C  CB    . LYS A 82  ? 1.4502 1.0116 1.4629 -0.1192 -0.3677 -0.0337 82  LYS A CB    
656  C  CG    . LYS A 82  ? 1.5698 1.1028 1.5051 -0.1035 -0.3610 -0.0566 82  LYS A CG    
657  C  CD    . LYS A 82  ? 1.6673 1.1427 1.5657 -0.1031 -0.4034 -0.0680 82  LYS A CD    
658  C  CE    . LYS A 82  ? 1.7287 1.1793 1.5525 -0.0864 -0.3939 -0.0872 82  LYS A CE    
659  N  NZ    . LYS A 82  ? 1.7770 1.2156 1.5481 -0.0688 -0.3679 -0.1023 82  LYS A NZ    
660  N  N     . ARG A 83  ? 1.1210 0.7526 1.2688 -0.1370 -0.3455 0.0100  83  ARG A N     
661  C  CA    . ARG A 83  ? 1.1535 0.8105 1.3789 -0.1501 -0.3519 0.0373  83  ARG A CA    
662  C  C     . ARG A 83  ? 1.0615 0.7598 1.3135 -0.1461 -0.3150 0.0497  83  ARG A C     
663  O  O     . ARG A 83  ? 0.9795 0.7034 1.2958 -0.1543 -0.3133 0.0748  83  ARG A O     
664  C  CB    . ARG A 83  ? 1.3139 0.9284 1.5544 -0.1590 -0.3942 0.0383  83  ARG A CB    
665  C  CG    . ARG A 83  ? 1.3642 0.9292 1.5717 -0.1616 -0.4354 0.0244  83  ARG A CG    
666  C  CD    . ARG A 83  ? 1.2934 0.8096 1.5073 -0.1687 -0.4793 0.0222  83  ARG A CD    
667  N  NE    . ARG A 83  ? 1.3717 0.8441 1.5439 -0.1643 -0.5143 0.0092  83  ARG A NE    
668  C  CZ    . ARG A 83  ? 1.4354 0.8724 1.5971 -0.1605 -0.5476 0.0074  83  ARG A CZ    
669  N  NH1   . ARG A 83  ? 1.4439 0.8813 1.6370 -0.1636 -0.5534 0.0166  83  ARG A NH1   
670  N  NH2   . ARG A 83  ? 1.4721 0.8719 1.5913 -0.1532 -0.5754 -0.0030 83  ARG A NH2   
671  N  N     . THR A 84  ? 1.0920 0.7964 1.2970 -0.1330 -0.2859 0.0339  84  THR A N     
672  C  CA    . THR A 84  ? 0.9834 0.7243 1.2072 -0.1278 -0.2517 0.0439  84  THR A CA    
673  C  C     . THR A 84  ? 0.7697 0.5548 1.0124 -0.1252 -0.2233 0.0559  84  THR A C     
674  O  O     . THR A 84  ? 0.7993 0.5856 1.0216 -0.1239 -0.2232 0.0489  84  THR A O     
675  C  CB    . THR A 84  ? 0.9858 0.7127 1.1539 -0.1150 -0.2352 0.0224  84  THR A CB    
676  O  OG1   . THR A 84  ? 1.1068 0.7865 1.2478 -0.1153 -0.2631 0.0086  84  THR A OG1   
677  C  CG2   . THR A 84  ? 0.8531 0.6100 1.0422 -0.1106 -0.2070 0.0328  84  THR A CG2   
678  N  N     . GLN A 85  ? 0.6674 0.4868 0.9474 -0.1236 -0.1995 0.0746  85  GLN A N     
679  C  CA    . GLN A 85  ? 0.7008 0.5597 0.9982 -0.1192 -0.1721 0.0876  85  GLN A CA    
680  C  C     . GLN A 85  ? 0.6577 0.5205 0.9006 -0.1083 -0.1517 0.0672  85  GLN A C     
681  O  O     . GLN A 85  ? 0.6416 0.4823 0.8372 -0.1024 -0.1523 0.0457  85  GLN A O     
682  C  CB    . GLN A 85  ? 0.6838 0.5720 1.0181 -0.1152 -0.1483 0.1085  85  GLN A CB    
683  C  CG    . GLN A 85  ? 0.6889 0.5751 0.9877 -0.1048 -0.1292 0.0953  85  GLN A CG    
684  C  CD    . GLN A 85  ? 0.6746 0.5911 0.9994 -0.0973 -0.1012 0.1145  85  GLN A CD    
685  O  OE1   . GLN A 85  ? 0.6948 0.6133 1.0542 -0.0999 -0.1031 0.1304  85  GLN A OE1   
686  N  NE2   . GLN A 85  ? 0.5721 0.5103 0.8785 -0.0871 -0.0756 0.1132  85  GLN A NE2   
687  N  N     . ASP A 86  ? 0.6321 0.5235 0.8839 -0.1049 -0.1330 0.0755  86  ASP A N     
688  C  CA    . ASP A 86  ? 0.7198 0.6195 0.9287 -0.0948 -0.1123 0.0601  86  ASP A CA    
689  C  C     . ASP A 86  ? 0.7682 0.6867 0.9718 -0.0846 -0.0849 0.0622  86  ASP A C     
690  O  O     . ASP A 86  ? 0.8594 0.7970 1.0985 -0.0836 -0.0739 0.0819  86  ASP A O     
691  C  CB    . ASP A 86  ? 0.6508 0.5698 0.8696 -0.0955 -0.1065 0.0672  86  ASP A CB    
692  C  CG    . ASP A 86  ? 0.7851 0.6832 0.9996 -0.1040 -0.1336 0.0615  86  ASP A CG    
693  O  OD1   . ASP A 86  ? 0.8335 0.7003 1.0086 -0.1036 -0.1488 0.0419  86  ASP A OD1   
694  O  OD2   . ASP A 86  ? 0.8408 0.7523 1.0901 -0.1101 -0.1396 0.0771  86  ASP A OD2   
695  N  N     . PHE A 87  ? 0.6960 0.6078 0.8556 -0.0764 -0.0742 0.0430  87  PHE A N     
696  C  CA    . PHE A 87  ? 0.6563 0.5832 0.8053 -0.0662 -0.0504 0.0423  87  PHE A CA    
697  C  C     . PHE A 87  ? 0.8036 0.7459 0.9313 -0.0590 -0.0339 0.0362  87  PHE A C     
698  O  O     . PHE A 87  ? 0.8662 0.8030 0.9777 -0.0611 -0.0402 0.0273  87  PHE A O     
699  C  CB    . PHE A 87  ? 0.5532 0.4604 0.6734 -0.0623 -0.0518 0.0265  87  PHE A CB    
700  C  CG    . PHE A 87  ? 0.6330 0.5213 0.7698 -0.0687 -0.0692 0.0305  87  PHE A CG    
701  C  CD1   . PHE A 87  ? 0.6882 0.5859 0.8503 -0.0674 -0.0617 0.0437  87  PHE A CD1   
702  C  CD2   . PHE A 87  ? 0.6037 0.4624 0.7288 -0.0750 -0.0938 0.0209  87  PHE A CD2   
703  C  CE1   . PHE A 87  ? 0.8083 0.6884 0.9881 -0.0737 -0.0785 0.0480  87  PHE A CE1   
704  C  CE2   . PHE A 87  ? 0.6707 0.5089 0.8105 -0.0808 -0.1124 0.0240  87  PHE A CE2   
705  C  CZ    . PHE A 87  ? 0.8314 0.6813 1.0006 -0.0808 -0.1047 0.0378  87  PHE A CZ    
706  N  N     . TRP A 88  ? 0.8251 0.7845 0.9518 -0.0499 -0.0136 0.0410  88  TRP A N     
707  C  CA    . TRP A 88  ? 0.6727 0.6418 0.7744 -0.0419 0.0004  0.0323  88  TRP A CA    
708  C  C     . TRP A 88  ? 0.5962 0.5547 0.6681 -0.0362 0.0046  0.0160  88  TRP A C     
709  O  O     . TRP A 88  ? 0.5468 0.5052 0.6208 -0.0318 0.0106  0.0184  88  TRP A O     
710  C  CB    . TRP A 88  ? 0.5153 0.5054 0.6292 -0.0336 0.0181  0.0467  88  TRP A CB    
711  C  CG    . TRP A 88  ? 0.5986 0.5956 0.6882 -0.0266 0.0281  0.0377  88  TRP A CG    
712  C  CD1   . TRP A 88  ? 0.5370 0.5342 0.6034 -0.0175 0.0381  0.0288  88  TRP A CD1   
713  C  CD2   . TRP A 88  ? 0.6366 0.6399 0.7243 -0.0287 0.0268  0.0369  88  TRP A CD2   
714  N  NE1   . TRP A 88  ? 0.5482 0.5510 0.5997 -0.0140 0.0425  0.0229  88  TRP A NE1   
715  C  CE2   . TRP A 88  ? 0.5858 0.5928 0.6491 -0.0205 0.0367  0.0276  88  TRP A CE2   
716  C  CE3   . TRP A 88  ? 0.6609 0.6665 0.7666 -0.0368 0.0171  0.0437  88  TRP A CE3   
717  C  CZ2   . TRP A 88  ? 0.5809 0.5940 0.6368 -0.0201 0.0381  0.0247  88  TRP A CZ2   
718  C  CZ3   . TRP A 88  ? 0.6522 0.6644 0.7493 -0.0361 0.0193  0.0407  88  TRP A CZ3   
719  C  CH2   . TRP A 88  ? 0.6375 0.6536 0.7097 -0.0278 0.0302  0.0312  88  TRP A CH2   
720  N  N     . GLU A 89  ? 0.5282 0.4777 0.5743 -0.0359 0.0017  0.0009  89  GLU A N     
721  C  CA    . GLU A 89  ? 0.6754 0.6160 0.6969 -0.0300 0.0066  -0.0128 89  GLU A CA    
722  C  C     . GLU A 89  ? 0.6716 0.6271 0.6898 -0.0213 0.0218  -0.0115 89  GLU A C     
723  O  O     . GLU A 89  ? 0.7330 0.7021 0.7539 -0.0187 0.0285  -0.0067 89  GLU A O     
724  C  CB    . GLU A 89  ? 0.5002 0.4293 0.4972 -0.0299 0.0026  -0.0261 89  GLU A CB    
725  C  CG    . GLU A 89  ? 0.5221 0.4313 0.5151 -0.0368 -0.0148 -0.0288 89  GLU A CG    
726  C  CD    . GLU A 89  ? 0.8506 0.7384 0.8402 -0.0379 -0.0248 -0.0320 89  GLU A CD    
727  O  OE1   . GLU A 89  ? 0.7047 0.5918 0.6881 -0.0322 -0.0164 -0.0357 89  GLU A OE1   
728  O  OE2   . GLU A 89  ? 0.8895 0.7600 0.8831 -0.0445 -0.0427 -0.0309 89  GLU A OE2   
729  N  N     . VAL A 90  ? 0.5823 0.5329 0.5935 -0.0164 0.0258  -0.0159 90  VAL A N     
730  C  CA    . VAL A 90  ? 0.5563 0.5165 0.5627 -0.0079 0.0368  -0.0155 90  VAL A CA    
731  C  C     . VAL A 90  ? 0.5129 0.4707 0.5019 -0.0038 0.0397  -0.0277 90  VAL A C     
732  O  O     . VAL A 90  ? 0.5152 0.4798 0.5005 0.0027  0.0455  -0.0283 90  VAL A O     
733  C  CB    . VAL A 90  ? 0.5370 0.4951 0.5504 -0.0041 0.0396  -0.0097 90  VAL A CB    
734  C  CG1   . VAL A 90  ? 0.4726 0.4368 0.5079 -0.0063 0.0400  0.0064  90  VAL A CG1   
735  C  CG2   . VAL A 90  ? 0.7508 0.6937 0.7588 -0.0063 0.0337  -0.0179 90  VAL A CG2   
736  N  N     . GLN A 91  ? 0.4758 0.4229 0.4545 -0.0065 0.0354  -0.0366 91  GLN A N     
737  C  CA    . GLN A 91  ? 0.5750 0.5210 0.5415 -0.0019 0.0401  -0.0454 91  GLN A CA    
738  C  C     . GLN A 91  ? 0.5720 0.5271 0.5361 -0.0027 0.0418  -0.0459 91  GLN A C     
739  O  O     . GLN A 91  ? 0.6288 0.5783 0.5857 -0.0061 0.0383  -0.0486 91  GLN A O     
740  C  CB    . GLN A 91  ? 0.5799 0.5083 0.5333 -0.0015 0.0374  -0.0531 91  GLN A CB    
741  C  CG    . GLN A 91  ? 0.6892 0.6168 0.6351 0.0054  0.0453  -0.0588 91  GLN A CG    
742  C  CD    . GLN A 91  ? 0.7162 0.6494 0.6714 0.0099  0.0493  -0.0572 91  GLN A CD    
743  O  OE1   . GLN A 91  ? 0.6886 0.6161 0.6471 0.0095  0.0467  -0.0554 91  GLN A OE1   
744  N  NE2   . GLN A 91  ? 0.6048 0.5482 0.5656 0.0140  0.0543  -0.0573 91  GLN A NE2   
745  N  N     . LEU A 92  ? 0.5590 0.5259 0.5272 0.0012  0.0462  -0.0435 92  LEU A N     
746  C  CA    . LEU A 92  ? 0.6178 0.5936 0.5853 0.0007  0.0473  -0.0428 92  LEU A CA    
747  C  C     . LEU A 92  ? 0.6977 0.6740 0.6602 0.0027  0.0500  -0.0489 92  LEU A C     
748  O  O     . LEU A 92  ? 0.7761 0.7596 0.7390 0.0024  0.0506  -0.0485 92  LEU A O     
749  C  CB    . LEU A 92  ? 0.4361 0.4204 0.4071 0.0055  0.0495  -0.0372 92  LEU A CB    
750  C  CG    . LEU A 92  ? 0.5790 0.5640 0.5561 0.0066  0.0504  -0.0280 92  LEU A CG    
751  C  CD1   . LEU A 92  ? 0.4378 0.4276 0.4112 0.0147  0.0543  -0.0225 92  LEU A CD1   
752  C  CD2   . LEU A 92  ? 0.5522 0.5380 0.5381 -0.0007 0.0473  -0.0222 92  LEU A CD2   
753  N  N     . GLY A 93  ? 0.6745 0.6436 0.6340 0.0053  0.0524  -0.0534 93  GLY A N     
754  C  CA    . GLY A 93  ? 0.5948 0.5657 0.5540 0.0084  0.0573  -0.0562 93  GLY A CA    
755  C  C     . GLY A 93  ? 0.8477 0.8117 0.8074 0.0133  0.0618  -0.0583 93  GLY A C     
756  O  O     . GLY A 93  ? 0.7213 0.6774 0.6785 0.0138  0.0602  -0.0592 93  GLY A O     
757  N  N     . ILE A 94  ? 0.9341 0.9018 0.8993 0.0174  0.0679  -0.0579 94  ILE A N     
758  C  CA    . ILE A 94  ? 0.6639 0.6267 0.6326 0.0237  0.0749  -0.0578 94  ILE A CA    
759  C  C     . ILE A 94  ? 0.5010 0.4756 0.4927 0.0260  0.0748  -0.0538 94  ILE A C     
760  O  O     . ILE A 94  ? 0.4997 0.4838 0.5024 0.0251  0.0741  -0.0510 94  ILE A O     
761  C  CB    . ILE A 94  ? 0.5632 0.5185 0.5202 0.0285  0.0840  -0.0580 94  ILE A CB    
762  C  CG1   . ILE A 94  ? 0.5540 0.4943 0.4858 0.0259  0.0798  -0.0627 94  ILE A CG1   
763  C  CG2   . ILE A 94  ? 0.4914 0.4403 0.4508 0.0372  0.0937  -0.0564 94  ILE A CG2   
764  C  CD1   . ILE A 94  ? 0.6061 0.5330 0.5284 0.0240  0.0729  -0.0663 94  ILE A CD1   
765  N  N     . PRO A 95  ? 0.6517 0.6250 0.6523 0.0288  0.0736  -0.0531 95  PRO A N     
766  C  CA    . PRO A 95  ? 0.5348 0.5170 0.5587 0.0309  0.0703  -0.0490 95  PRO A CA    
767  C  C     . PRO A 95  ? 0.5276 0.5159 0.5691 0.0350  0.0789  -0.0434 95  PRO A C     
768  O  O     . PRO A 95  ? 0.5121 0.4949 0.5466 0.0397  0.0905  -0.0423 95  PRO A O     
769  C  CB    . PRO A 95  ? 0.4907 0.4675 0.5173 0.0335  0.0679  -0.0496 95  PRO A CB    
770  C  CG    . PRO A 95  ? 0.4652 0.4306 0.4736 0.0346  0.0745  -0.0529 95  PRO A CG    
771  C  CD    . PRO A 95  ? 0.5886 0.5511 0.5793 0.0299  0.0735  -0.0558 95  PRO A CD    
772  N  N     . HIS A 96  ? 0.4354 0.4335 0.4997 0.0340  0.0730  -0.0389 96  HIS A N     
773  C  CA    . HIS A 96  ? 0.5163 0.5229 0.6052 0.0374  0.0806  -0.0305 96  HIS A CA    
774  C  C     . HIS A 96  ? 0.5077 0.5200 0.6294 0.0392  0.0739  -0.0242 96  HIS A C     
775  O  O     . HIS A 96  ? 0.4354 0.4463 0.5613 0.0363  0.0581  -0.0268 96  HIS A O     
776  C  CB    . HIS A 96  ? 0.5397 0.5534 0.6330 0.0338  0.0784  -0.0285 96  HIS A CB    
777  C  CG    . HIS A 96  ? 0.5093 0.5305 0.6220 0.0381  0.0911  -0.0189 96  HIS A CG    
778  N  ND1   . HIS A 96  ? 0.5050 0.5368 0.6571 0.0393  0.0891  -0.0084 96  HIS A ND1   
779  C  CD2   . HIS A 96  ? 0.4398 0.4584 0.5384 0.0424  0.1061  -0.0168 96  HIS A CD2   
780  C  CE1   . HIS A 96  ? 0.6063 0.6439 0.7703 0.0444  0.1045  0.0011  96  HIS A CE1   
781  N  NE2   . HIS A 96  ? 0.6122 0.6410 0.7412 0.0471  0.1155  -0.0043 96  HIS A NE2   
782  N  N     . PRO A 97  ? 0.4352 0.4525 0.5801 0.0451  0.0851  -0.0151 97  PRO A N     
783  C  CA    . PRO A 97  ? 0.6322 0.6551 0.8128 0.0465  0.0776  -0.0076 97  PRO A CA    
784  C  C     . PRO A 97  ? 0.6153 0.6452 0.8244 0.0418  0.0610  -0.0031 97  PRO A C     
785  O  O     . PRO A 97  ? 0.5430 0.5726 0.7747 0.0412  0.0464  -0.0005 97  PRO A O     
786  C  CB    . PRO A 97  ? 0.4399 0.4682 0.6404 0.0550  0.0972  0.0037  97  PRO A CB    
787  C  CG    . PRO A 97  ? 0.4457 0.4730 0.6267 0.0577  0.1124  0.0042  97  PRO A CG    
788  C  CD    . PRO A 97  ? 0.4460 0.4624 0.5848 0.0521  0.1055  -0.0101 97  PRO A CD    
789  N  N     . ALA A 98  ? 0.5823 0.6166 0.7902 0.0386  0.0610  -0.0024 98  ALA A N     
790  C  CA    . ALA A 98  ? 0.5303 0.5682 0.7629 0.0341  0.0431  0.0010  98  ALA A CA    
791  C  C     . ALA A 98  ? 0.5325 0.5581 0.7444 0.0311  0.0217  -0.0096 98  ALA A C     
792  O  O     . ALA A 98  ? 0.4189 0.4414 0.6493 0.0291  0.0022  -0.0079 98  ALA A O     
793  C  CB    . ALA A 98  ? 0.4946 0.5386 0.7268 0.0317  0.0488  0.0036  98  ALA A CB    
794  N  N     . GLY A 99  ? 0.4198 0.4365 0.5935 0.0317  0.0247  -0.0197 99  GLY A N     
795  C  CA    . GLY A 99  ? 0.4257 0.4298 0.5764 0.0316  0.0087  -0.0280 99  GLY A CA    
796  C  C     . GLY A 99  ? 0.4329 0.4297 0.5872 0.0350  0.0008  -0.0286 99  GLY A C     
797  O  O     . GLY A 99  ? 0.6311 0.6152 0.7651 0.0370  -0.0126 -0.0345 99  GLY A O     
798  N  N     . LEU A 100 ? 0.4593 0.4627 0.6372 0.0369  0.0095  -0.0221 100 LEU A N     
799  C  CA    . LEU A 100 ? 0.4382 0.4354 0.6240 0.0400  0.0012  -0.0216 100 LEU A CA    
800  C  C     . LEU A 100 ? 0.4486 0.4429 0.6648 0.0396  -0.0211 -0.0167 100 LEU A C     
801  O  O     . LEU A 100 ? 0.5381 0.5420 0.7893 0.0374  -0.0231 -0.0078 100 LEU A O     
802  C  CB    . LEU A 100 ? 0.4365 0.4413 0.6383 0.0432  0.0187  -0.0154 100 LEU A CB    
803  C  CG    . LEU A 100 ? 0.5045 0.5082 0.6773 0.0446  0.0388  -0.0200 100 LEU A CG    
804  C  CD1   . LEU A 100 ? 0.5500 0.5583 0.7399 0.0501  0.0552  -0.0127 100 LEU A CD1   
805  C  CD2   . LEU A 100 ? 0.4416 0.4335 0.5798 0.0443  0.0345  -0.0295 100 LEU A CD2   
806  N  N     . LYS A 101 ? 0.4845 0.4639 0.6871 0.0422  -0.0389 -0.0218 101 LYS A N     
807  C  CA    . LYS A 101 ? 0.5392 0.5105 0.7675 0.0425  -0.0644 -0.0182 101 LYS A CA    
808  C  C     . LYS A 101 ? 0.5718 0.5491 0.8363 0.0440  -0.0647 -0.0095 101 LYS A C     
809  O  O     . LYS A 101 ? 0.5571 0.5400 0.8163 0.0462  -0.0470 -0.0090 101 LYS A O     
810  C  CB    . LYS A 101 ? 0.5616 0.5092 0.7524 0.0470  -0.0849 -0.0280 101 LYS A CB    
811  C  CG    . LYS A 101 ? 0.7480 0.6889 0.9019 0.0474  -0.0832 -0.0356 101 LYS A CG    
812  C  CD    . LYS A 101 ? 0.7780 0.6936 0.8904 0.0552  -0.0995 -0.0438 101 LYS A CD    
813  C  CE    . LYS A 101 ? 0.6644 0.5749 0.7400 0.0572  -0.0934 -0.0496 101 LYS A CE    
814  N  NZ    . LYS A 101 ? 0.7306 0.6148 0.7630 0.0678  -0.1065 -0.0560 101 LYS A NZ    
815  N  N     . LYS A 102 ? 0.7015 0.6768 1.0048 0.0427  -0.0861 -0.0020 102 LYS A N     
816  C  CA    . LYS A 102 ? 0.7154 0.6971 1.0598 0.0439  -0.0887 0.0083  102 LYS A CA    
817  C  C     . LYS A 102 ? 0.5967 0.5625 0.9142 0.0487  -0.0974 0.0008  102 LYS A C     
818  O  O     . LYS A 102 ? 0.5601 0.5043 0.8480 0.0512  -0.1192 -0.0081 102 LYS A O     
819  C  CB    . LYS A 102 ? 0.8551 0.8371 1.2511 0.0405  -0.1135 0.0191  102 LYS A CB    
820  C  CG    . LYS A 102 ? 1.0174 1.0048 1.4608 0.0417  -0.1210 0.0312  102 LYS A CG    
821  C  CD    . LYS A 102 ? 1.1020 1.1130 1.5721 0.0440  -0.0881 0.0431  102 LYS A CD    
822  C  CE    . LYS A 102 ? 1.1091 1.1261 1.6286 0.0460  -0.0947 0.0564  102 LYS A CE    
823  N  NZ    . LYS A 102 ? 1.0608 1.0977 1.6009 0.0511  -0.0611 0.0679  102 LYS A NZ    
824  N  N     . LYS A 103 ? 0.5625 0.5373 0.8875 0.0512  -0.0796 0.0047  103 LYS A N     
825  C  CA    . LYS A 103 ? 0.5991 0.5613 0.9049 0.0557  -0.0857 -0.0003 103 LYS A CA    
826  C  C     . LYS A 103 ? 0.6735 0.6450 1.0278 0.0570  -0.0867 0.0121  103 LYS A C     
827  O  O     . LYS A 103 ? 0.8470 0.8378 1.2397 0.0563  -0.0697 0.0240  103 LYS A O     
828  C  CB    . LYS A 103 ? 0.5094 0.4710 0.7723 0.0581  -0.0626 -0.0086 103 LYS A CB    
829  C  CG    . LYS A 103 ? 0.6293 0.5891 0.8542 0.0562  -0.0537 -0.0170 103 LYS A CG    
830  C  CD    . LYS A 103 ? 0.6863 0.6272 0.8822 0.0578  -0.0757 -0.0248 103 LYS A CD    
831  C  CE    . LYS A 103 ? 0.7963 0.7190 0.9587 0.0641  -0.0836 -0.0309 103 LYS A CE    
832  N  NZ    . LYS A 103 ? 0.7794 0.6804 0.9072 0.0689  -0.1026 -0.0379 103 LYS A NZ    
833  N  N     . LYS A 104 ? 0.5454 0.5024 0.8973 0.0601  -0.1062 0.0102  104 LYS A N     
834  C  CA    . LYS A 104 ? 0.5753 0.5404 0.9744 0.0614  -0.1092 0.0223  104 LYS A CA    
835  C  C     . LYS A 104 ? 0.5877 0.5660 0.9863 0.0650  -0.0780 0.0255  104 LYS A C     
836  O  O     . LYS A 104 ? 0.4857 0.4805 0.9300 0.0664  -0.0658 0.0395  104 LYS A O     
837  C  CB    . LYS A 104 ? 0.6241 0.5675 1.0150 0.0645  -0.1387 0.0183  104 LYS A CB    
838  C  CG    . LYS A 104 ? 0.8551 0.7827 1.2601 0.0623  -0.1749 0.0187  104 LYS A CG    
839  C  CD    . LYS A 104 ? 0.8988 0.8060 1.3066 0.0662  -0.2042 0.0182  104 LYS A CD    
840  C  CE    . LYS A 104 ? 0.7200 0.6444 1.1803 0.0661  -0.1965 0.0323  104 LYS A CE    
841  N  NZ    . LYS A 104 ? 0.6538 0.5582 1.1198 0.0696  -0.2268 0.0325  104 LYS A NZ    
842  N  N     . SER A 105 ? 0.4943 0.4644 0.8424 0.0674  -0.0649 0.0137  105 SER A N     
843  C  CA    . SER A 105 ? 0.4894 0.4659 0.8305 0.0713  -0.0394 0.0147  105 SER A CA    
844  C  C     . SER A 105 ? 0.4837 0.4597 0.7821 0.0704  -0.0193 0.0053  105 SER A C     
845  O  O     . SER A 105 ? 0.4873 0.4523 0.7477 0.0685  -0.0268 -0.0051 105 SER A O     
846  C  CB    . SER A 105 ? 0.5007 0.4646 0.8282 0.0752  -0.0481 0.0110  105 SER A CB    
847  O  OG    . SER A 105 ? 0.5092 0.4699 0.8726 0.0756  -0.0720 0.0184  105 SER A OG    
848  N  N     . VAL A 106 ? 0.5201 0.5064 0.8242 0.0729  0.0059  0.0096  106 VAL A N     
849  C  CA    . VAL A 106 ? 0.4747 0.4598 0.7426 0.0722  0.0239  0.0020  106 VAL A CA    
850  C  C     . VAL A 106 ? 0.5096 0.4909 0.7632 0.0776  0.0431  0.0008  106 VAL A C     
851  O  O     . VAL A 106 ? 0.4913 0.4781 0.7724 0.0834  0.0523  0.0101  106 VAL A O     
852  C  CB    . VAL A 106 ? 0.4673 0.4644 0.7510 0.0708  0.0344  0.0079  106 VAL A CB    
853  C  CG1   . VAL A 106 ? 0.5101 0.5046 0.7593 0.0720  0.0549  0.0017  106 VAL A CG1   
854  C  CG2   . VAL A 106 ? 0.4632 0.4602 0.7506 0.0647  0.0147  0.0060  106 VAL A CG2   
855  N  N     . THR A 107 ? 0.5963 0.5673 0.8081 0.0763  0.0485  -0.0098 107 THR A N     
856  C  CA    . THR A 107 ? 0.4923 0.4558 0.6851 0.0809  0.0647  -0.0126 107 THR A CA    
857  C  C     . THR A 107 ? 0.6605 0.6186 0.8198 0.0785  0.0744  -0.0202 107 THR A C     
858  O  O     . THR A 107 ? 0.5249 0.4812 0.6655 0.0724  0.0656  -0.0263 107 THR A O     
859  C  CB    . THR A 107 ? 0.4985 0.4512 0.6768 0.0814  0.0568  -0.0174 107 THR A CB    
860  O  OG1   . THR A 107 ? 0.5262 0.4824 0.7345 0.0835  0.0448  -0.0107 107 THR A OG1   
861  C  CG2   . THR A 107 ? 0.5096 0.4530 0.6718 0.0865  0.0722  -0.0196 107 THR A CG2   
862  N  N     . VAL A 108 ? 0.7623 0.7160 0.9131 0.0845  0.0921  -0.0193 108 VAL A N     
863  C  CA    . VAL A 108 ? 0.6334 0.5779 0.7508 0.0834  0.1000  -0.0265 108 VAL A CA    
864  C  C     . VAL A 108 ? 0.6488 0.5761 0.7424 0.0883  0.1071  -0.0315 108 VAL A C     
865  O  O     . VAL A 108 ? 0.7265 0.6489 0.8243 0.0981  0.1204  -0.0272 108 VAL A O     
866  C  CB    . VAL A 108 ? 0.5681 0.5184 0.6914 0.0876  0.1135  -0.0211 108 VAL A CB    
867  C  CG1   . VAL A 108 ? 0.5258 0.4624 0.6109 0.0877  0.1200  -0.0293 108 VAL A CG1   
868  C  CG2   . VAL A 108 ? 0.4964 0.4628 0.6444 0.0817  0.1045  -0.0163 108 VAL A CG2   
869  N  N     . LEU A 109 ? 0.7094 0.6266 0.7789 0.0823  0.0983  -0.0396 109 LEU A N     
870  C  CA    . LEU A 109 ? 0.5809 0.4801 0.6290 0.0852  0.1010  -0.0447 109 LEU A CA    
871  C  C     . LEU A 109 ? 0.5949 0.4819 0.6131 0.0795  0.0973  -0.0524 109 LEU A C     
872  O  O     . LEU A 109 ? 0.6215 0.5160 0.6376 0.0715  0.0895  -0.0537 109 LEU A O     
873  C  CB    . LEU A 109 ? 0.6226 0.5210 0.6787 0.0836  0.0919  -0.0442 109 LEU A CB    
874  C  CG    . LEU A 109 ? 0.7822 0.6887 0.8415 0.0757  0.0777  -0.0445 109 LEU A CG    
875  C  CD1   . LEU A 109 ? 0.9427 0.8398 0.9786 0.0696  0.0727  -0.0495 109 LEU A CD1   
876  C  CD2   . LEU A 109 ? 0.8379 0.7474 0.9147 0.0781  0.0706  -0.0404 109 LEU A CD2   
877  N  N     . ASP A 110 ? 0.6713 0.5380 0.6668 0.0843  0.1020  -0.0570 110 ASP A N     
878  C  CA    . ASP A 110 ? 0.7810 0.6322 0.7495 0.0792  0.0959  -0.0640 110 ASP A CA    
879  C  C     . ASP A 110 ? 0.8411 0.6784 0.8018 0.0758  0.0869  -0.0670 110 ASP A C     
880  O  O     . ASP A 110 ? 0.8100 0.6439 0.7782 0.0805  0.0888  -0.0654 110 ASP A O     
881  C  CB    . ASP A 110 ? 0.8906 0.7234 0.8342 0.0879  0.1051  -0.0675 110 ASP A CB    
882  C  CG    . ASP A 110 ? 0.9534 0.7992 0.9026 0.0901  0.1135  -0.0638 110 ASP A CG    
883  O  OD1   . ASP A 110 ? 1.0361 0.8921 1.0032 0.0984  0.1257  -0.0567 110 ASP A OD1   
884  O  OD2   . ASP A 110 ? 1.0929 0.9391 1.0310 0.0836  0.1080  -0.0670 110 ASP A OD2   
885  N  N     . VAL A 111 ? 0.8621 0.6919 0.8104 0.0675  0.0769  -0.0704 111 VAL A N     
886  C  CA    . VAL A 111 ? 0.7295 0.5456 0.6732 0.0632  0.0673  -0.0717 111 VAL A CA    
887  C  C     . VAL A 111 ? 0.6871 0.4730 0.6041 0.0680  0.0653  -0.0787 111 VAL A C     
888  O  O     . VAL A 111 ? 0.7744 0.5497 0.6725 0.0690  0.0646  -0.0830 111 VAL A O     
889  C  CB    . VAL A 111 ? 0.7324 0.5576 0.6829 0.0518  0.0571  -0.0688 111 VAL A CB    
890  C  CG1   . VAL A 111 ? 0.8906 0.6991 0.8377 0.0469  0.0467  -0.0687 111 VAL A CG1   
891  C  CG2   . VAL A 111 ? 0.6689 0.5172 0.6397 0.0499  0.0582  -0.0622 111 VAL A CG2   
892  N  N     . GLY A 112 ? 0.6726 0.4422 0.5855 0.0720  0.0633  -0.0801 112 GLY A N     
893  C  CA    . GLY A 112 ? 0.7016 0.4372 0.5856 0.0781  0.0593  -0.0875 112 GLY A CA    
894  C  C     . GLY A 112 ? 0.7898 0.5101 0.6680 0.0675  0.0410  -0.0897 112 GLY A C     
895  O  O     . GLY A 112 ? 0.8187 0.5494 0.7179 0.0583  0.0334  -0.0842 112 GLY A O     
896  N  N     . ASP A 113 ? 0.8953 0.5897 0.7454 0.0696  0.0337  -0.0969 113 ASP A N     
897  C  CA    . ASP A 113 ? 1.0298 0.7060 0.8750 0.0595  0.0132  -0.0988 113 ASP A CA    
898  C  C     . ASP A 113 ? 0.9993 0.7048 0.8751 0.0451  0.0083  -0.0901 113 ASP A C     
899  O  O     . ASP A 113 ? 1.0718 0.7842 0.9703 0.0365  0.0004  -0.0833 113 ASP A O     
900  C  CB    . ASP A 113 ? 1.1443 0.7957 0.9870 0.0595  0.0017  -0.1005 113 ASP A CB    
901  C  CG    . ASP A 113 ? 1.2861 0.8957 1.0881 0.0731  -0.0007 -0.1112 113 ASP A CG    
902  O  OD1   . ASP A 113 ? 1.2600 0.8480 1.0325 0.0772  -0.0062 -0.1180 113 ASP A OD1   
903  O  OD2   . ASP A 113 ? 1.4419 1.0383 1.2390 0.0811  0.0030  -0.1127 113 ASP A OD2   
904  N  N     . ALA A 114 ? 0.9691 0.6910 0.8443 0.0439  0.0143  -0.0896 114 ALA A N     
905  C  CA    . ALA A 114 ? 0.9370 0.6867 0.8373 0.0330  0.0125  -0.0815 114 ALA A CA    
906  C  C     . ALA A 114 ? 0.8875 0.6276 0.7971 0.0217  -0.0058 -0.0778 114 ALA A C     
907  O  O     . ALA A 114 ? 0.7033 0.4537 0.6378 0.0151  -0.0096 -0.0689 114 ALA A O     
908  C  CB    . ALA A 114 ? 0.9574 0.7208 0.8511 0.0346  0.0206  -0.0830 114 ALA A CB    
909  N  N     . TYR A 115 ? 0.8259 0.5459 0.7168 0.0198  -0.0173 -0.0835 115 TYR A N     
910  C  CA    . TYR A 115 ? 0.7552 0.4663 0.6594 0.0081  -0.0371 -0.0787 115 TYR A CA    
911  C  C     . TYR A 115 ? 0.8128 0.5069 0.7283 0.0048  -0.0494 -0.0757 115 TYR A C     
912  O  O     . TYR A 115 ? 0.7996 0.5047 0.7470 -0.0055 -0.0575 -0.0641 115 TYR A O     
913  C  CB    . TYR A 115 ? 0.7851 0.4689 0.6612 0.0087  -0.0506 -0.0874 115 TYR A CB    
914  C  CG    . TYR A 115 ? 0.7672 0.4689 0.6404 0.0076  -0.0437 -0.0872 115 TYR A CG    
915  C  CD1   . TYR A 115 ? 0.7330 0.4726 0.6303 0.0049  -0.0286 -0.0789 115 TYR A CD1   
916  C  CD2   . TYR A 115 ? 0.8163 0.4941 0.6601 0.0102  -0.0533 -0.0953 115 TYR A CD2   
917  C  CE1   . TYR A 115 ? 0.8099 0.5645 0.7047 0.0039  -0.0232 -0.0788 115 TYR A CE1   
918  C  CE2   . TYR A 115 ? 0.8274 0.5211 0.6688 0.0092  -0.0471 -0.0947 115 TYR A CE2   
919  C  CZ    . TYR A 115 ? 0.8580 0.5909 0.7263 0.0057  -0.0319 -0.0863 115 TYR A CZ    
920  O  OH    . TYR A 115 ? 0.8307 0.5783 0.6968 0.0047  -0.0264 -0.0858 115 TYR A OH    
921  N  N     . PHE A 116 ? 0.8218 0.4888 0.7126 0.0140  -0.0502 -0.0849 116 PHE A N     
922  C  CA    . PHE A 116 ? 0.8397 0.4837 0.7364 0.0114  -0.0649 -0.0839 116 PHE A CA    
923  C  C     . PHE A 116 ? 0.8371 0.5045 0.7644 0.0095  -0.0549 -0.0735 116 PHE A C     
924  O  O     . PHE A 116 ? 0.8849 0.5350 0.8174 0.0088  -0.0640 -0.0724 116 PHE A O     
925  C  CB    . PHE A 116 ? 0.9494 0.5527 0.8042 0.0241  -0.0689 -0.0979 116 PHE A CB    
926  C  CG    . PHE A 116 ? 1.1342 0.7066 0.9520 0.0284  -0.0806 -0.1085 116 PHE A CG    
927  C  CD1   . PHE A 116 ? 1.1669 0.7424 0.9954 0.0173  -0.0953 -0.1050 116 PHE A CD1   
928  C  CD2   . PHE A 116 ? 1.2714 0.8107 1.0426 0.0448  -0.0764 -0.1211 116 PHE A CD2   
929  C  CE1   . PHE A 116 ? 1.2172 0.7625 1.0096 0.0217  -0.1074 -0.1149 116 PHE A CE1   
930  C  CE2   . PHE A 116 ? 1.3314 0.8390 1.0634 0.0508  -0.0868 -0.1307 116 PHE A CE2   
931  C  CZ    . PHE A 116 ? 1.2987 0.8089 1.0408 0.0389  -0.1033 -0.1281 116 PHE A CZ    
932  N  N     . SER A 117 ? 0.7390 0.4427 0.6844 0.0093  -0.0377 -0.0660 117 SER A N     
933  C  CA    . SER A 117 ? 0.7337 0.4588 0.7053 0.0084  -0.0288 -0.0554 117 SER A CA    
934  C  C     . SER A 117 ? 0.7371 0.4878 0.7413 -0.0007 -0.0288 -0.0401 117 SER A C     
935  O  O     . SER A 117 ? 0.8123 0.5782 0.8370 -0.0006 -0.0220 -0.0294 117 SER A O     
936  C  CB    . SER A 117 ? 0.8277 0.5704 0.7918 0.0184  -0.0092 -0.0585 117 SER A CB    
937  O  OG    . SER A 117 ? 1.0575 0.7788 0.9971 0.0284  -0.0062 -0.0691 117 SER A OG    
938  N  N     . VAL A 118 ? 0.7043 0.4593 0.7126 -0.0073 -0.0352 -0.0379 118 VAL A N     
939  C  CA    . VAL A 118 ? 0.7154 0.4954 0.7538 -0.0142 -0.0328 -0.0223 118 VAL A CA    
940  C  C     . VAL A 118 ? 0.7777 0.5444 0.8395 -0.0249 -0.0524 -0.0133 118 VAL A C     
941  O  O     . VAL A 118 ? 0.8662 0.6107 0.9157 -0.0290 -0.0690 -0.0212 118 VAL A O     
942  C  CB    . VAL A 118 ? 0.7103 0.5074 0.7410 -0.0137 -0.0253 -0.0245 118 VAL A CB    
943  C  CG1   . VAL A 118 ? 0.6281 0.4489 0.6885 -0.0193 -0.0221 -0.0076 118 VAL A CG1   
944  C  CG2   . VAL A 118 ? 0.7181 0.5273 0.7303 -0.0038 -0.0084 -0.0322 118 VAL A CG2   
945  N  N     . PRO A 119 ? 0.7317 0.5101 0.8279 -0.0292 -0.0520 0.0040  119 PRO A N     
946  C  CA    . PRO A 119 ? 0.7443 0.5098 0.8697 -0.0401 -0.0723 0.0148  119 PRO A CA    
947  C  C     . PRO A 119 ? 0.8100 0.5829 0.9500 -0.0481 -0.0806 0.0210  119 PRO A C     
948  O  O     . PRO A 119 ? 0.6877 0.4849 0.8277 -0.0456 -0.0662 0.0246  119 PRO A O     
949  C  CB    . PRO A 119 ? 0.6530 0.4362 0.8139 -0.0404 -0.0632 0.0350  119 PRO A CB    
950  C  CG    . PRO A 119 ? 0.7301 0.5413 0.8825 -0.0310 -0.0384 0.0378  119 PRO A CG    
951  C  CD    . PRO A 119 ? 0.6971 0.5004 0.8077 -0.0236 -0.0332 0.0161  119 PRO A CD    
952  N  N     . LEU A 120 ? 0.9500 0.6997 1.1025 -0.0576 -0.1058 0.0222  120 LEU A N     
953  C  CA    . LEU A 120 ? 0.8043 0.5570 0.9755 -0.0666 -0.1189 0.0293  120 LEU A CA    
954  C  C     . LEU A 120 ? 0.8167 0.5846 1.0458 -0.0759 -0.1243 0.0558  120 LEU A C     
955  O  O     . LEU A 120 ? 0.8470 0.6091 1.0984 -0.0778 -0.1286 0.0652  120 LEU A O     
956  C  CB    . LEU A 120 ? 0.8104 0.5236 0.9557 -0.0705 -0.1465 0.0132  120 LEU A CB    
957  C  CG    . LEU A 120 ? 0.8795 0.5889 1.0380 -0.0797 -0.1648 0.0172  120 LEU A CG    
958  C  CD1   . LEU A 120 ? 0.8353 0.5696 0.9783 -0.0751 -0.1459 0.0138  120 LEU A CD1   
959  C  CD2   . LEU A 120 ? 1.0184 0.6806 1.1468 -0.0818 -0.1955 0.0007  120 LEU A CD2   
960  N  N     . ASP A 121 ? 0.8102 0.5983 1.0652 -0.0810 -0.1229 0.0692  121 ASP A N     
961  C  CA    . ASP A 121 ? 0.8264 0.6315 1.1413 -0.0891 -0.1263 0.0975  121 ASP A CA    
962  C  C     . ASP A 121 ? 0.8639 0.6399 1.2050 -0.1004 -0.1581 0.1019  121 ASP A C     
963  O  O     . ASP A 121 ? 0.9659 0.7106 1.2876 -0.1060 -0.1847 0.0869  121 ASP A O     
964  C  CB    . ASP A 121 ? 0.8174 0.6427 1.1520 -0.0931 -0.1243 0.1083  121 ASP A CB    
965  C  CG    . ASP A 121 ? 0.8839 0.7313 1.2839 -0.0993 -0.1230 0.1411  121 ASP A CG    
966  O  OD1   . ASP A 121 ? 0.8265 0.7041 1.2412 -0.0909 -0.0953 0.1577  121 ASP A OD1   
967  O  OD2   . ASP A 121 ? 1.0367 0.8698 1.4736 -0.1118 -0.1499 0.1511  121 ASP A OD2   
968  N  N     . GLU A 122 ? 0.8783 0.6628 1.2623 -0.1030 -0.1558 0.1228  122 GLU A N     
969  C  CA    . GLU A 122 ? 1.0149 0.7706 1.4256 -0.1135 -0.1864 0.1273  122 GLU A CA    
970  C  C     . GLU A 122 ? 1.0807 0.8266 1.5283 -0.1274 -0.2160 0.1376  122 GLU A C     
971  O  O     . GLU A 122 ? 1.1659 0.8731 1.6052 -0.1350 -0.2502 0.1260  122 GLU A O     
972  C  CB    . GLU A 122 ? 0.9830 0.7541 1.4377 -0.1131 -0.1753 0.1512  122 GLU A CB    
973  C  CG    . GLU A 122 ? 1.0595 0.8329 1.4785 -0.1003 -0.1525 0.1403  122 GLU A CG    
974  C  CD    . GLU A 122 ? 1.0007 0.7850 1.4617 -0.0999 -0.1441 0.1637  122 GLU A CD    
975  O  OE1   . GLU A 122 ? 1.0955 0.8845 1.6156 -0.1100 -0.1567 0.1888  122 GLU A OE1   
976  O  OE2   . GLU A 122 ? 0.8708 0.6590 1.3076 -0.0894 -0.1251 0.1580  122 GLU A OE2   
977  N  N     . ASP A 123 ? 0.9984 0.7769 1.4858 -0.1301 -0.2045 0.1595  123 ASP A N     
978  C  CA    . ASP A 123 ? 0.9941 0.7667 1.5230 -0.1436 -0.2323 0.1721  123 ASP A CA    
979  C  C     . ASP A 123 ? 0.9459 0.6921 1.4275 -0.1454 -0.2524 0.1460  123 ASP A C     
980  O  O     . ASP A 123 ? 0.9460 0.6762 1.4531 -0.1570 -0.2833 0.1512  123 ASP A O     
981  C  CB    . ASP A 123 ? 1.0539 0.8703 1.6367 -0.1439 -0.2108 0.2033  123 ASP A CB    
982  C  CG    . ASP A 123 ? 1.1303 0.9705 1.7668 -0.1420 -0.1930 0.2340  123 ASP A CG    
983  O  OD1   . ASP A 123 ? 1.1798 1.0007 1.8399 -0.1486 -0.2120 0.2393  123 ASP A OD1   
984  O  OD2   . ASP A 123 ? 1.1041 0.9807 1.7575 -0.1328 -0.1600 0.2533  123 ASP A OD2   
985  N  N     . PHE A 124 ? 0.8710 0.6115 1.2861 -0.1338 -0.2363 0.1195  124 PHE A N     
986  C  CA    . PHE A 124 ? 0.9152 0.6312 1.2805 -0.1327 -0.2507 0.0951  124 PHE A CA    
987  C  C     . PHE A 124 ? 0.9254 0.5921 1.2388 -0.1295 -0.2730 0.0687  124 PHE A C     
988  O  O     . PHE A 124 ? 1.0571 0.6944 1.3301 -0.1286 -0.2913 0.0498  124 PHE A O     
989  C  CB    . PHE A 124 ? 0.7240 0.4664 1.0515 -0.1210 -0.2175 0.0849  124 PHE A CB    
990  C  CG    . PHE A 124 ? 0.8558 0.5856 1.1492 -0.1211 -0.2278 0.0690  124 PHE A CG    
991  C  CD1   . PHE A 124 ? 0.9179 0.6657 1.2448 -0.1285 -0.2328 0.0836  124 PHE A CD1   
992  C  CD2   . PHE A 124 ? 0.9586 0.6593 1.1868 -0.1126 -0.2307 0.0409  124 PHE A CD2   
993  C  CE1   . PHE A 124 ? 0.8897 0.6257 1.1845 -0.1283 -0.2422 0.0694  124 PHE A CE1   
994  C  CE2   . PHE A 124 ? 0.9452 0.6339 1.1410 -0.1114 -0.2388 0.0275  124 PHE A CE2   
995  C  CZ    . PHE A 124 ? 0.8571 0.5632 1.0856 -0.1197 -0.2451 0.0412  124 PHE A CZ    
996  N  N     . ARG A 125 ? 0.8044 0.4599 1.1164 -0.1266 -0.2715 0.0674  125 ARG A N     
997  C  CA    . ARG A 125 ? 0.9789 0.5871 1.2383 -0.1209 -0.2892 0.0425  125 ARG A CA    
998  C  C     . ARG A 125 ? 1.1170 0.6784 1.3778 -0.1304 -0.3351 0.0375  125 ARG A C     
999  O  O     . ARG A 125 ? 1.2498 0.7654 1.4545 -0.1234 -0.3521 0.0136  125 ARG A O     
1000 C  CB    . ARG A 125 ? 1.0081 0.6161 1.2734 -0.1167 -0.2786 0.0453  125 ARG A CB    
1001 C  CG    . ARG A 125 ? 0.9699 0.6170 1.2264 -0.1057 -0.2366 0.0475  125 ARG A CG    
1002 C  CD    . ARG A 125 ? 0.8675 0.5142 1.1341 -0.1023 -0.2282 0.0524  125 ARG A CD    
1003 N  NE    . ARG A 125 ? 0.8273 0.5104 1.0881 -0.0920 -0.1907 0.0561  125 ARG A NE    
1004 C  CZ    . ARG A 125 ? 0.8515 0.5422 1.1202 -0.0871 -0.1768 0.0619  125 ARG A CZ    
1005 N  NH1   . ARG A 125 ? 0.7813 0.4473 1.0658 -0.0918 -0.1959 0.0651  125 ARG A NH1   
1006 N  NH2   . ARG A 125 ? 0.7256 0.4467 0.9857 -0.0773 -0.1453 0.0645  125 ARG A NH2   
1007 N  N     . LYS A 126 ? 1.1468 0.7167 1.4699 -0.1451 -0.3559 0.0601  126 LYS A N     
1008 C  CA    . LYS A 126 ? 1.2698 0.7933 1.5985 -0.1552 -0.4039 0.0566  126 LYS A CA    
1009 C  C     . LYS A 126 ? 1.3108 0.8029 1.5775 -0.1494 -0.4180 0.0322  126 LYS A C     
1010 O  O     . LYS A 126 ? 1.4411 0.8775 1.6634 -0.1465 -0.4496 0.0126  126 LYS A O     
1011 C  CB    . LYS A 126 ? 1.2518 0.7975 1.6654 -0.1722 -0.4206 0.0883  126 LYS A CB    
1012 C  CG    . LYS A 126 ? 1.1396 0.7297 1.6189 -0.1755 -0.3956 0.1180  126 LYS A CG    
1013 C  CD    . LYS A 126 ? 1.0635 0.6880 1.6218 -0.1869 -0.4012 0.1508  126 LYS A CD    
1014 C  CE    . LYS A 126 ? 1.0783 0.7481 1.6980 -0.1874 -0.3700 0.1822  126 LYS A CE    
1015 N  NZ    . LYS A 126 ? 1.1681 0.8814 1.8568 -0.1917 -0.3654 0.2141  126 LYS A NZ    
1016 N  N     . TYR A 127 ? 1.1482 0.6729 1.4083 -0.1464 -0.3947 0.0332  127 TYR A N     
1017 C  CA    . TYR A 127 ? 1.2338 0.7335 1.4423 -0.1417 -0.4068 0.0139  127 TYR A CA    
1018 C  C     . TYR A 127 ? 1.2551 0.7284 1.3800 -0.1236 -0.3923 -0.0153 127 TYR A C     
1019 O  O     . TYR A 127 ? 1.3554 0.7962 1.4286 -0.1172 -0.4060 -0.0333 127 TYR A O     
1020 C  CB    . TYR A 127 ? 1.2543 0.8001 1.4879 -0.1446 -0.3854 0.0265  127 TYR A CB    
1021 C  CG    . TYR A 127 ? 1.2720 0.8580 1.5919 -0.1582 -0.3836 0.0598  127 TYR A CG    
1022 C  CD1   . TYR A 127 ? 1.3538 0.9246 1.7239 -0.1733 -0.4219 0.0752  127 TYR A CD1   
1023 C  CD2   . TYR A 127 ? 1.2102 0.8478 1.5616 -0.1549 -0.3439 0.0769  127 TYR A CD2   
1024 C  CE1   . TYR A 127 ? 1.3579 0.9670 1.8115 -0.1847 -0.4182 0.1087  127 TYR A CE1   
1025 C  CE2   . TYR A 127 ? 1.2077 0.8809 1.6358 -0.1645 -0.3392 0.1092  127 TYR A CE2   
1026 C  CZ    . TYR A 127 ? 1.2898 0.9502 1.7709 -0.1794 -0.3752 0.1259  127 TYR A CZ    
1027 O  OH    . TYR A 127 ? 1.3053 1.0027 1.8672 -0.1880 -0.3684 0.1609  127 TYR A OH    
1028 N  N     . THR A 128 ? 1.1601 0.6458 1.2713 -0.1143 -0.3650 -0.0192 128 THR A N     
1029 C  CA    . THR A 128 ? 1.1521 0.6159 1.1909 -0.0965 -0.3487 -0.0437 128 THR A CA    
1030 C  C     . THR A 128 ? 1.3026 0.7057 1.3006 -0.0905 -0.3769 -0.0602 128 THR A C     
1031 O  O     . THR A 128 ? 1.3743 0.7622 1.3241 -0.0755 -0.3603 -0.0757 128 THR A O     
1032 C  CB    . THR A 128 ? 0.9788 0.4850 1.0230 -0.0889 -0.3063 -0.0398 128 THR A CB    
1033 O  OG1   . THR A 128 ? 0.9968 0.5077 1.0793 -0.0943 -0.3086 -0.0275 128 THR A OG1   
1034 C  CG2   . THR A 128 ? 0.8822 0.4433 0.9599 -0.0927 -0.2793 -0.0249 128 THR A CG2   
1035 N  N     . ALA A 129 ? 1.3841 0.7509 1.4007 -0.1014 -0.4198 -0.0567 129 ALA A N     
1036 C  CA    . ALA A 129 ? 1.4053 0.7102 1.3852 -0.0961 -0.4508 -0.0715 129 ALA A CA    
1037 C  C     . ALA A 129 ? 1.4381 0.6950 1.3315 -0.0782 -0.4583 -0.0975 129 ALA A C     
1038 O  O     . ALA A 129 ? 1.3428 0.5996 1.2165 -0.0767 -0.4602 -0.1018 129 ALA A O     
1039 C  CB    . ALA A 129 ? 1.1699 0.4691 1.1996 -0.1094 -0.4888 -0.0550 129 ALA A CB    
1040 N  N     . PHE A 130 ? 1.4926 0.7137 1.3345 -0.0624 -0.4591 -0.1126 130 PHE A N     
1041 C  CA    . PHE A 130 ? 1.5913 0.7703 1.3494 -0.0410 -0.4614 -0.1337 130 PHE A CA    
1042 C  C     . PHE A 130 ? 1.6441 0.7832 1.3697 -0.0297 -0.4786 -0.1412 130 PHE A C     
1043 O  O     . PHE A 130 ? 1.5504 0.6960 1.3029 -0.0336 -0.4740 -0.1363 130 PHE A O     
1044 C  CB    . PHE A 130 ? 1.4892 0.6736 1.2007 -0.0258 -0.4226 -0.1477 130 PHE A CB    
1045 C  CG    . PHE A 130 ? 1.3601 0.5618 1.0744 -0.0186 -0.3926 -0.1480 130 PHE A CG    
1046 C  CD1   . PHE A 130 ? 1.2516 0.5174 1.0295 -0.0301 -0.3657 -0.1296 130 PHE A CD1   
1047 C  CD2   . PHE A 130 ? 1.3917 0.5497 1.0448 0.0014  -0.3890 -0.1649 130 PHE A CD2   
1048 C  CE1   . PHE A 130 ? 1.2902 0.5754 1.0715 -0.0230 -0.3381 -0.1287 130 PHE A CE1   
1049 C  CE2   . PHE A 130 ? 1.3736 0.5526 1.0331 0.0082  -0.3603 -0.1632 130 PHE A CE2   
1050 C  CZ    . PHE A 130 ? 1.3244 0.5674 1.0486 -0.0045 -0.3358 -0.1453 130 PHE A CZ    
1051 N  N     . THR A 131 ? 1.7972 0.8938 1.4639 -0.0152 -0.4988 -0.1526 131 THR A N     
1052 C  CA    . THR A 131 ? 2.0355 1.0886 1.6626 -0.0021 -0.5168 -0.1607 131 THR A CA    
1053 C  C     . THR A 131 ? 2.1392 1.1661 1.6873 0.0245  -0.4895 -0.1788 131 THR A C     
1054 O  O     . THR A 131 ? 2.2029 1.2133 1.6974 0.0392  -0.4824 -0.1879 131 THR A O     
1055 C  CB    . THR A 131 ? 2.0926 1.1095 1.7051 -0.0014 -0.5613 -0.1594 131 THR A CB    
1056 O  OG1   . THR A 131 ? 2.0655 1.1088 1.7573 -0.0253 -0.5866 -0.1399 131 THR A OG1   
1057 C  CG2   . THR A 131 ? 2.1111 1.0800 1.6787 0.0134  -0.5805 -0.1682 131 THR A CG2   
1058 N  N     . ARG A 143 ? 1.6002 0.6505 1.3129 -0.0147 -0.5275 -0.1458 143 ARG A N     
1059 C  CA    . ARG A 143 ? 1.5968 0.6916 1.3664 -0.0326 -0.5198 -0.1316 143 ARG A CA    
1060 C  C     . ARG A 143 ? 1.6757 0.8139 1.4974 -0.0429 -0.4888 -0.1207 143 ARG A C     
1061 O  O     . ARG A 143 ? 1.7912 0.9364 1.6498 -0.0494 -0.4914 -0.1115 143 ARG A O     
1062 C  CB    . ARG A 143 ? 1.5972 0.6986 1.4228 -0.0504 -0.5580 -0.1143 143 ARG A CB    
1063 C  CG    . ARG A 143 ? 1.6378 0.6958 1.4177 -0.0414 -0.5933 -0.1226 143 ARG A CG    
1064 C  CD    . ARG A 143 ? 1.6546 0.7281 1.4986 -0.0599 -0.6270 -0.1031 143 ARG A CD    
1065 N  NE    . ARG A 143 ? 1.7187 0.8357 1.6038 -0.0723 -0.6100 -0.0921 143 ARG A NE    
1066 C  CZ    . ARG A 143 ? 1.6555 0.8033 1.6135 -0.0905 -0.6266 -0.0702 143 ARG A CZ    
1067 N  NH1   . ARG A 143 ? 1.6548 0.7956 1.6553 -0.0988 -0.6613 -0.0563 143 ARG A NH1   
1068 N  NH2   . ARG A 143 ? 1.3966 0.5829 1.3864 -0.0998 -0.6080 -0.0611 143 ARG A NH2   
1069 N  N     . TYR A 144 ? 1.6246 0.7909 1.4487 -0.0437 -0.4603 -0.1212 144 TYR A N     
1070 C  CA    . TYR A 144 ? 1.5586 0.7653 1.4296 -0.0525 -0.4311 -0.1101 144 TYR A CA    
1071 C  C     . TYR A 144 ? 1.5477 0.8039 1.4695 -0.0670 -0.4223 -0.0931 144 TYR A C     
1072 O  O     . TYR A 144 ? 1.5803 0.8229 1.5005 -0.0729 -0.4456 -0.0936 144 TYR A O     
1073 C  CB    . TYR A 144 ? 1.5830 0.8011 1.4063 -0.0329 -0.3898 -0.1228 144 TYR A CB    
1074 C  CG    . TYR A 144 ? 1.5728 0.7401 1.3395 -0.0152 -0.3938 -0.1405 144 TYR A CG    
1075 C  CD1   . TYR A 144 ? 1.5989 0.7718 1.3892 -0.0162 -0.3878 -0.1347 144 TYR A CD1   
1076 C  CD2   . TYR A 144 ? 1.5540 0.6815 1.2457 0.0047  -0.3969 -0.1589 144 TYR A CD2   
1077 C  CE1   . TYR A 144 ? 1.6765 0.8092 1.4166 0.0010  -0.3884 -0.1491 144 TYR A CE1   
1078 C  CE2   . TYR A 144 ? 1.5999 0.6942 1.2425 0.0232  -0.3939 -0.1707 144 TYR A CE2   
1079 C  CZ    . TYR A 144 ? 1.7051 0.8023 1.3724 0.0210  -0.3899 -0.1662 144 TYR A CZ    
1080 O  OH    . TYR A 144 ? 1.7544 0.8190 1.3737 0.0396  -0.3865 -0.1773 144 TYR A OH    
1081 N  N     . GLN A 145 ? 1.4589 0.7764 1.4251 -0.0712 -0.3869 -0.0770 145 GLN A N     
1082 C  CA    . GLN A 145 ? 1.2529 0.6231 1.2562 -0.0794 -0.3677 -0.0624 145 GLN A CA    
1083 C  C     . GLN A 145 ? 1.2207 0.6406 1.2270 -0.0714 -0.3214 -0.0587 145 GLN A C     
1084 O  O     . GLN A 145 ? 1.1934 0.6183 1.2039 -0.0670 -0.3082 -0.0573 145 GLN A O     
1085 C  CB    . GLN A 145 ? 1.1952 0.5880 1.2773 -0.0998 -0.3863 -0.0365 145 GLN A CB    
1086 C  CG    . GLN A 145 ? 1.1324 0.5671 1.2724 -0.1058 -0.3657 -0.0148 145 GLN A CG    
1087 C  CD    . GLN A 145 ? 1.0969 0.5536 1.3164 -0.1242 -0.3821 0.0136  145 GLN A CD    
1088 O  OE1   . GLN A 145 ? 1.2018 0.6375 1.4366 -0.1342 -0.4148 0.0166  145 GLN A OE1   
1089 N  NE2   . GLN A 145 ? 0.9517 0.4504 1.2231 -0.1279 -0.3593 0.0358  145 GLN A NE2   
1090 N  N     . TYR A 146 ? 1.1963 0.6509 1.1995 -0.0695 -0.2984 -0.0573 146 TYR A N     
1091 C  CA    . TYR A 146 ? 1.0512 0.5483 1.0515 -0.0609 -0.2574 -0.0558 146 TYR A CA    
1092 C  C     . TYR A 146 ? 1.0077 0.5498 1.0700 -0.0701 -0.2424 -0.0324 146 TYR A C     
1093 O  O     . TYR A 146 ? 1.0943 0.6582 1.2048 -0.0824 -0.2494 -0.0142 146 TYR A O     
1094 C  CB    . TYR A 146 ? 1.1230 0.6407 1.1018 -0.0563 -0.2400 -0.0611 146 TYR A CB    
1095 C  CG    . TYR A 146 ? 1.2492 0.7363 1.1600 -0.0398 -0.2345 -0.0835 146 TYR A CG    
1096 C  CD1   . TYR A 146 ? 1.2444 0.7458 1.1304 -0.0263 -0.2038 -0.0906 146 TYR A CD1   
1097 C  CD2   . TYR A 146 ? 1.3645 0.8071 1.2363 -0.0369 -0.2599 -0.0964 146 TYR A CD2   
1098 C  CE1   . TYR A 146 ? 1.2924 0.7675 1.1202 -0.0099 -0.1961 -0.1080 146 TYR A CE1   
1099 C  CE2   . TYR A 146 ? 1.4258 0.8390 1.2330 -0.0193 -0.2522 -0.1151 146 TYR A CE2   
1100 C  CZ    . TYR A 146 ? 1.3922 0.8231 1.1794 -0.0058 -0.2190 -0.1200 146 TYR A CZ    
1101 O  OH    . TYR A 146 ? 1.4443 0.8479 1.1714 0.0129  -0.2087 -0.1357 146 TYR A OH    
1102 N  N     . ASN A 147 ? 0.9459 0.5005 1.0065 -0.0629 -0.2214 -0.0321 147 ASN A N     
1103 C  CA    . ASN A 147 ? 0.9054 0.5044 1.0122 -0.0665 -0.1996 -0.0121 147 ASN A CA    
1104 C  C     . ASN A 147 ? 0.8091 0.4455 0.9029 -0.0579 -0.1659 -0.0136 147 ASN A C     
1105 O  O     . ASN A 147 ? 0.7909 0.4639 0.9173 -0.0592 -0.1469 0.0027  147 ASN A O     
1106 C  CB    . ASN A 147 ? 0.9387 0.5285 1.0540 -0.0640 -0.1985 -0.0093 147 ASN A CB    
1107 C  CG    . ASN A 147 ? 0.9732 0.5249 1.1046 -0.0728 -0.2333 -0.0069 147 ASN A CG    
1108 O  OD1   . ASN A 147 ? 1.1660 0.7152 1.3329 -0.0853 -0.2551 0.0053  147 ASN A OD1   
1109 N  ND2   . ASN A 147 ? 1.0058 0.5267 1.1128 -0.0662 -0.2397 -0.0180 147 ASN A ND2   
1110 N  N     . VAL A 148 ? 0.8353 0.4614 0.8816 -0.0483 -0.1585 -0.0320 148 VAL A N     
1111 C  CA    . VAL A 148 ? 0.7661 0.4240 0.7995 -0.0404 -0.1298 -0.0344 148 VAL A CA    
1112 C  C     . VAL A 148 ? 0.8934 0.5511 0.9090 -0.0412 -0.1330 -0.0409 148 VAL A C     
1113 O  O     . VAL A 148 ? 0.9849 0.6198 1.0009 -0.0482 -0.1572 -0.0420 148 VAL A O     
1114 C  CB    . VAL A 148 ? 0.7715 0.4211 0.7688 -0.0266 -0.1138 -0.0484 148 VAL A CB    
1115 C  CG1   . VAL A 148 ? 0.7628 0.4203 0.7813 -0.0257 -0.1069 -0.0400 148 VAL A CG1   
1116 C  CG2   . VAL A 148 ? 0.8179 0.4216 0.7702 -0.0195 -0.1292 -0.0665 148 VAL A CG2   
1117 N  N     . LEU A 149 ? 0.8412 0.5227 0.8418 -0.0341 -0.1103 -0.0449 149 LEU A N     
1118 C  CA    . LEU A 149 ? 0.7706 0.4547 0.7549 -0.0342 -0.1108 -0.0503 149 LEU A CA    
1119 C  C     . LEU A 149 ? 0.9828 0.6268 0.9183 -0.0262 -0.1219 -0.0688 149 LEU A C     
1120 O  O     . LEU A 149 ? 1.0323 0.6659 0.9370 -0.0140 -0.1093 -0.0795 149 LEU A O     
1121 C  CB    . LEU A 149 ? 0.7035 0.4228 0.6864 -0.0284 -0.0840 -0.0490 149 LEU A CB    
1122 C  CG    . LEU A 149 ? 0.7334 0.4905 0.7560 -0.0335 -0.0718 -0.0314 149 LEU A CG    
1123 C  CD1   . LEU A 149 ? 0.7353 0.5191 0.7481 -0.0261 -0.0489 -0.0336 149 LEU A CD1   
1124 C  CD2   . LEU A 149 ? 0.6641 0.4278 0.7161 -0.0448 -0.0852 -0.0189 149 LEU A CD2   
1125 N  N     . PRO A 150 ? 1.0104 0.6293 0.9364 -0.0313 -0.1451 -0.0723 150 PRO A N     
1126 C  CA    . PRO A 150 ? 1.0126 0.5894 0.8851 -0.0210 -0.1553 -0.0900 150 PRO A CA    
1127 C  C     . PRO A 150 ? 0.8847 0.4732 0.7310 -0.0135 -0.1388 -0.0964 150 PRO A C     
1128 O  O     . PRO A 150 ? 0.8173 0.4427 0.6884 -0.0191 -0.1263 -0.0876 150 PRO A O     
1129 C  CB    . PRO A 150 ? 1.0219 0.5666 0.9001 -0.0311 -0.1909 -0.0891 150 PRO A CB    
1130 C  CG    . PRO A 150 ? 1.0078 0.5905 0.9404 -0.0460 -0.1917 -0.0707 150 PRO A CG    
1131 C  CD    . PRO A 150 ? 0.9699 0.5954 0.9350 -0.0461 -0.1646 -0.0589 150 PRO A CD    
1132 N  N     . GLN A 151 ? 1.0548 0.6096 0.8493 0.0006  -0.1383 -0.1112 151 GLN A N     
1133 C  CA    . GLN A 151 ? 1.0732 0.6331 0.8393 0.0094  -0.1237 -0.1171 151 GLN A CA    
1134 C  C     . GLN A 151 ? 1.1142 0.6467 0.8606 0.0060  -0.1476 -0.1217 151 GLN A C     
1135 O  O     . GLN A 151 ? 1.1501 0.6409 0.8800 0.0047  -0.1755 -0.1273 151 GLN A O     
1136 C  CB    . GLN A 151 ? 1.1982 0.7386 0.9196 0.0290  -0.1059 -0.1280 151 GLN A CB    
1137 C  CG    . GLN A 151 ? 1.1963 0.7594 0.9362 0.0329  -0.0851 -0.1240 151 GLN A CG    
1138 C  CD    . GLN A 151 ? 1.2329 0.7920 0.9410 0.0515  -0.0607 -0.1301 151 GLN A CD    
1139 O  OE1   . GLN A 151 ? 1.3322 0.8820 1.0104 0.0609  -0.0536 -0.1348 151 GLN A OE1   
1140 N  NE2   . GLN A 151 ? 1.2155 0.7823 0.9320 0.0574  -0.0470 -0.1285 151 GLN A NE2   
1141 N  N     . GLY A 152 ? 1.1047 0.6589 0.8526 0.0046  -0.1382 -0.1194 152 GLY A N     
1142 C  CA    . GLY A 152 ? 1.1715 0.7064 0.9077 -0.0003 -0.1601 -0.1216 152 GLY A CA    
1143 C  C     . GLY A 152 ? 1.1478 0.7075 0.9368 -0.0194 -0.1751 -0.1076 152 GLY A C     
1144 O  O     . GLY A 152 ? 1.0529 0.5991 0.8388 -0.0252 -0.1951 -0.1076 152 GLY A O     
1145 N  N     . TRP A 153 ? 1.1827 0.7773 1.0198 -0.0284 -0.1657 -0.0947 153 TRP A N     
1146 C  CA    . TRP A 153 ? 1.1029 0.7251 0.9935 -0.0443 -0.1744 -0.0781 153 TRP A CA    
1147 C  C     . TRP A 153 ? 0.9538 0.6203 0.8620 -0.0452 -0.1503 -0.0707 153 TRP A C     
1148 O  O     . TRP A 153 ? 0.9969 0.6827 0.8937 -0.0364 -0.1245 -0.0740 153 TRP A O     
1149 C  CB    . TRP A 153 ? 1.1435 0.7776 1.0751 -0.0515 -0.1761 -0.0663 153 TRP A CB    
1150 C  CG    . TRP A 153 ? 1.0857 0.7482 1.0751 -0.0659 -0.1825 -0.0461 153 TRP A CG    
1151 C  CD1   . TRP A 153 ? 0.9857 0.6438 0.9948 -0.0760 -0.2038 -0.0390 153 TRP A CD1   
1152 C  CD2   . TRP A 153 ? 1.0771 0.7762 1.1120 -0.0703 -0.1663 -0.0289 153 TRP A CD2   
1153 N  NE1   . TRP A 153 ? 0.9615 0.6530 1.0287 -0.0863 -0.2004 -0.0173 153 TRP A NE1   
1154 C  CE2   . TRP A 153 ? 0.9886 0.7047 1.0703 -0.0822 -0.1769 -0.0108 153 TRP A CE2   
1155 C  CE3   . TRP A 153 ? 1.0777 0.7956 1.1175 -0.0642 -0.1440 -0.0264 153 TRP A CE3   
1156 C  CZ2   . TRP A 153 ? 0.9817 0.7325 1.1126 -0.0867 -0.1635 0.0103  153 TRP A CZ2   
1157 C  CZ3   . TRP A 153 ? 1.0258 0.7760 1.1113 -0.0690 -0.1327 -0.0070 153 TRP A CZ3   
1158 C  CH2   . TRP A 153 ? 1.0062 0.7724 1.1357 -0.0794 -0.1413 0.0115  153 TRP A CH2   
1159 N  N     . LYS A 154 ? 0.8938 0.5752 0.8314 -0.0558 -0.1601 -0.0600 154 LYS A N     
1160 C  CA    . LYS A 154 ? 0.7980 0.5174 0.7498 -0.0564 -0.1399 -0.0533 154 LYS A CA    
1161 C  C     . LYS A 154 ? 0.7537 0.5104 0.7327 -0.0550 -0.1149 -0.0434 154 LYS A C     
1162 O  O     . LYS A 154 ? 0.8000 0.5790 0.7703 -0.0487 -0.0929 -0.0455 154 LYS A O     
1163 C  CB    . LYS A 154 ? 0.8960 0.6237 0.8794 -0.0681 -0.1562 -0.0414 154 LYS A CB    
1164 C  CG    . LYS A 154 ? 0.8975 0.6665 0.9040 -0.0695 -0.1358 -0.0310 154 LYS A CG    
1165 C  CD    . LYS A 154 ? 0.8270 0.6109 0.8812 -0.0816 -0.1487 -0.0126 154 LYS A CD    
1166 C  CE    . LYS A 154 ? 0.9619 0.7185 1.0062 -0.0875 -0.1767 -0.0170 154 LYS A CE    
1167 N  NZ    . LYS A 154 ? 1.0201 0.7926 1.1173 -0.0997 -0.1901 0.0031  154 LYS A NZ    
1168 N  N     . GLY A 155 ? 0.7501 0.5120 0.7616 -0.0604 -0.1190 -0.0323 155 GLY A N     
1169 C  CA    . GLY A 155 ? 0.7455 0.5406 0.7826 -0.0585 -0.0970 -0.0209 155 GLY A CA    
1170 C  C     . GLY A 155 ? 0.7528 0.5465 0.7698 -0.0488 -0.0816 -0.0294 155 GLY A C     
1171 O  O     . GLY A 155 ? 0.7204 0.5398 0.7517 -0.0454 -0.0630 -0.0220 155 GLY A O     
1172 N  N     . SER A 156 ? 0.7807 0.5434 0.7637 -0.0432 -0.0889 -0.0441 156 SER A N     
1173 C  CA    . SER A 156 ? 0.7278 0.4887 0.6953 -0.0340 -0.0749 -0.0507 156 SER A CA    
1174 C  C     . SER A 156 ? 0.7390 0.5253 0.6980 -0.0260 -0.0505 -0.0531 156 SER A C     
1175 O  O     . SER A 156 ? 0.8250 0.6282 0.7961 -0.0227 -0.0372 -0.0485 156 SER A O     
1176 C  CB    . SER A 156 ? 0.7307 0.4513 0.6599 -0.0273 -0.0863 -0.0658 156 SER A CB    
1177 O  OG    . SER A 156 ? 0.8832 0.5790 0.8230 -0.0339 -0.1090 -0.0633 156 SER A OG    
1178 N  N     . PRO A 157 ? 0.8024 0.5915 0.7417 -0.0225 -0.0449 -0.0596 157 PRO A N     
1179 C  CA    . PRO A 157 ? 0.7441 0.5577 0.6810 -0.0158 -0.0238 -0.0604 157 PRO A CA    
1180 C  C     . PRO A 157 ? 0.6803 0.5250 0.6474 -0.0192 -0.0147 -0.0478 157 PRO A C     
1181 O  O     . PRO A 157 ? 0.6267 0.4850 0.5975 -0.0138 -0.0017 -0.0464 157 PRO A O     
1182 C  CB    . PRO A 157 ? 0.6659 0.4756 0.5813 -0.0135 -0.0230 -0.0671 157 PRO A CB    
1183 C  CG    . PRO A 157 ? 0.7516 0.5258 0.6430 -0.0134 -0.0405 -0.0749 157 PRO A CG    
1184 C  CD    . PRO A 157 ? 0.7884 0.5555 0.7039 -0.0230 -0.0578 -0.0674 157 PRO A CD    
1185 N  N     . ALA A 158 ? 0.7059 0.5604 0.6937 -0.0271 -0.0214 -0.0379 158 ALA A N     
1186 C  CA    . ALA A 158 ? 0.5637 0.4455 0.5757 -0.0275 -0.0107 -0.0250 158 ALA A CA    
1187 C  C     . ALA A 158 ? 0.6017 0.4875 0.6321 -0.0266 -0.0075 -0.0158 158 ALA A C     
1188 O  O     . ALA A 158 ? 0.7178 0.6205 0.7535 -0.0209 0.0059  -0.0102 158 ALA A O     
1189 C  CB    . ALA A 158 ? 0.5395 0.4302 0.5712 -0.0350 -0.0175 -0.0147 158 ALA A CB    
1190 N  N     . ILE A 159 ? 0.5598 0.4280 0.5985 -0.0314 -0.0206 -0.0141 159 ILE A N     
1191 C  CA    . ILE A 159 ? 0.6739 0.5457 0.7322 -0.0308 -0.0177 -0.0039 159 ILE A CA    
1192 C  C     . ILE A 159 ? 0.6320 0.5011 0.6717 -0.0219 -0.0073 -0.0128 159 ILE A C     
1193 O  O     . ILE A 159 ? 0.6771 0.5581 0.7268 -0.0174 0.0028  -0.0051 159 ILE A O     
1194 C  CB    . ILE A 159 ? 0.6607 0.5134 0.7362 -0.0392 -0.0367 0.0011  159 ILE A CB    
1195 C  CG1   . ILE A 159 ? 0.7191 0.5799 0.8248 -0.0483 -0.0462 0.0154  159 ILE A CG1   
1196 C  CG2   . ILE A 159 ? 0.5802 0.4334 0.6725 -0.0376 -0.0334 0.0097  159 ILE A CG2   
1197 C  CD1   . ILE A 159 ? 0.5991 0.4407 0.7278 -0.0578 -0.0684 0.0220  159 ILE A CD1   
1198 N  N     . PHE A 160 ? 0.5693 0.4221 0.5817 -0.0182 -0.0092 -0.0282 160 PHE A N     
1199 C  CA    . PHE A 160 ? 0.6201 0.4721 0.6189 -0.0096 0.0011  -0.0351 160 PHE A CA    
1200 C  C     . PHE A 160 ? 0.5898 0.4640 0.5875 -0.0038 0.0156  -0.0340 160 PHE A C     
1201 O  O     . PHE A 160 ? 0.6211 0.5029 0.6224 0.0017  0.0235  -0.0314 160 PHE A O     
1202 C  CB    . PHE A 160 ? 0.6771 0.5063 0.6481 -0.0051 -0.0020 -0.0496 160 PHE A CB    
1203 C  CG    . PHE A 160 ? 0.7712 0.6013 0.7324 0.0042  0.0095  -0.0550 160 PHE A CG    
1204 C  CD1   . PHE A 160 ? 0.7517 0.5715 0.7160 0.0064  0.0080  -0.0545 160 PHE A CD1   
1205 C  CD2   . PHE A 160 ? 0.6733 0.5152 0.6258 0.0104  0.0212  -0.0593 160 PHE A CD2   
1206 C  CE1   . PHE A 160 ? 0.5940 0.4154 0.5522 0.0149  0.0182  -0.0584 160 PHE A CE1   
1207 C  CE2   . PHE A 160 ? 0.6866 0.5304 0.6359 0.0184  0.0306  -0.0623 160 PHE A CE2   
1208 C  CZ    . PHE A 160 ? 0.7658 0.5995 0.7177 0.0208  0.0293  -0.0619 160 PHE A CZ    
1209 N  N     . GLN A 161 ? 0.5361 0.4189 0.5282 -0.0046 0.0177  -0.0361 161 GLN A N     
1210 C  CA    . GLN A 161 ? 0.5176 0.4184 0.5080 0.0007  0.0288  -0.0358 161 GLN A CA    
1211 C  C     . GLN A 161 ? 0.5062 0.4215 0.5116 0.0026  0.0339  -0.0236 161 GLN A C     
1212 O  O     . GLN A 161 ? 0.5003 0.4228 0.5022 0.0096  0.0410  -0.0235 161 GLN A O     
1213 C  CB    . GLN A 161 ? 0.5121 0.4184 0.4954 -0.0013 0.0288  -0.0392 161 GLN A CB    
1214 C  CG    . GLN A 161 ? 0.5790 0.4717 0.5428 0.0008  0.0278  -0.0506 161 GLN A CG    
1215 C  CD    . GLN A 161 ? 0.5775 0.4692 0.5343 -0.0031 0.0237  -0.0526 161 GLN A CD    
1216 O  OE1   . GLN A 161 ? 0.6810 0.5833 0.6498 -0.0083 0.0209  -0.0455 161 GLN A OE1   
1217 N  NE2   . GLN A 161 ? 0.6433 0.5216 0.5800 0.0004  0.0241  -0.0614 161 GLN A NE2   
1218 N  N     . SER A 162 ? 0.5651 0.4833 0.5873 -0.0026 0.0303  -0.0124 162 SER A N     
1219 C  CA    . SER A 162 ? 0.5746 0.5052 0.6097 0.0016  0.0379  0.0016  162 SER A CA    
1220 C  C     . SER A 162 ? 0.5703 0.4956 0.6096 0.0056  0.0400  0.0056  162 SER A C     
1221 O  O     . SER A 162 ? 0.5673 0.4989 0.6033 0.0142  0.0486  0.0109  162 SER A O     
1222 C  CB    . SER A 162 ? 0.5008 0.4377 0.5578 -0.0045 0.0350  0.0155  162 SER A CB    
1223 O  OG    . SER A 162 ? 0.5511 0.4985 0.6212 0.0017  0.0448  0.0316  162 SER A OG    
1224 N  N     . SER A 163 ? 0.6232 0.5346 0.6677 0.0004  0.0315  0.0030  163 SER A N     
1225 C  CA    . SER A 163 ? 0.6750 0.5806 0.7239 0.0039  0.0331  0.0064  163 SER A CA    
1226 C  C     . SER A 163 ? 0.6295 0.5345 0.6602 0.0124  0.0391  -0.0034 163 SER A C     
1227 O  O     . SER A 163 ? 0.5231 0.4304 0.5546 0.0191  0.0446  0.0019  163 SER A O     
1228 C  CB    . SER A 163 ? 0.7039 0.5914 0.7591 -0.0032 0.0207  0.0035  163 SER A CB    
1229 O  OG    . SER A 163 ? 0.8751 0.7622 0.9520 -0.0118 0.0120  0.0140  163 SER A OG    
1230 N  N     . MET A 164 ? 0.5889 0.4905 0.6045 0.0127  0.0379  -0.0166 164 MET A N     
1231 C  CA    . MET A 164 ? 0.5176 0.4203 0.5221 0.0202  0.0428  -0.0240 164 MET A CA    
1232 C  C     . MET A 164 ? 0.5434 0.4584 0.5455 0.0268  0.0486  -0.0191 164 MET A C     
1233 O  O     . MET A 164 ? 0.5094 0.4239 0.5079 0.0338  0.0507  -0.0192 164 MET A O     
1234 C  CB    . MET A 164 ? 0.5183 0.4168 0.5112 0.0197  0.0421  -0.0358 164 MET A CB    
1235 C  CG    . MET A 164 ? 0.6980 0.5976 0.6862 0.0268  0.0466  -0.0417 164 MET A CG    
1236 S  SD    . MET A 164 ? 0.8922 0.7766 0.8795 0.0300  0.0460  -0.0451 164 MET A SD    
1237 C  CE    . MET A 164 ? 0.6996 0.5913 0.6891 0.0382  0.0514  -0.0483 164 MET A CE    
1238 N  N     . THR A 165 ? 0.5014 0.4254 0.5039 0.0255  0.0502  -0.0149 165 THR A N     
1239 C  CA    . THR A 165 ? 0.5830 0.5144 0.5787 0.0336  0.0549  -0.0102 165 THR A CA    
1240 C  C     . THR A 165 ? 0.5800 0.5100 0.5782 0.0402  0.0594  0.0017  165 THR A C     
1241 O  O     . THR A 165 ? 0.6883 0.6161 0.6748 0.0499  0.0614  0.0024  165 THR A O     
1242 C  CB    . THR A 165 ? 0.6187 0.5587 0.6142 0.0314  0.0564  -0.0071 165 THR A CB    
1243 O  OG1   . THR A 165 ? 0.4852 0.4258 0.4772 0.0261  0.0528  -0.0176 165 THR A OG1   
1244 C  CG2   . THR A 165 ? 0.4931 0.4365 0.4765 0.0417  0.0607  -0.0030 165 THR A CG2   
1245 N  N     . LYS A 166 ? 0.6107 0.5409 0.6246 0.0355  0.0603  0.0119  166 LYS A N     
1246 C  CA    . LYS A 166 ? 0.6683 0.5975 0.6879 0.0420  0.0662  0.0254  166 LYS A CA    
1247 C  C     . LYS A 166 ? 0.6136 0.5338 0.6259 0.0468  0.0645  0.0201  166 LYS A C     
1248 O  O     . LYS A 166 ? 0.5788 0.4966 0.5822 0.0573  0.0695  0.0266  166 LYS A O     
1249 C  CB    . LYS A 166 ? 0.8116 0.7422 0.8564 0.0339  0.0650  0.0376  166 LYS A CB    
1250 C  CG    . LYS A 166 ? 0.9813 0.9167 1.0378 0.0413  0.0751  0.0579  166 LYS A CG    
1251 C  CD    . LYS A 166 ? 0.9700 0.9165 1.0306 0.0447  0.0830  0.0695  166 LYS A CD    
1252 C  CE    . LYS A 166 ? 0.7332 0.6849 0.8164 0.0310  0.0753  0.0711  166 LYS A CE    
1253 N  NZ    . LYS A 166 ? 0.7337 0.6973 0.8228 0.0344  0.0831  0.0827  166 LYS A NZ    
1254 N  N     . ILE A 167 ? 0.6729 0.5867 0.6869 0.0404  0.0578  0.0086  167 ILE A N     
1255 C  CA    . ILE A 167 ? 0.6523 0.5579 0.6626 0.0445  0.0564  0.0042  167 ILE A CA    
1256 C  C     . ILE A 167 ? 0.6820 0.5879 0.6771 0.0531  0.0561  -0.0025 167 ILE A C     
1257 O  O     . ILE A 167 ? 0.7448 0.6459 0.7340 0.0610  0.0566  0.0000  167 ILE A O     
1258 C  CB    . ILE A 167 ? 0.5319 0.4287 0.5469 0.0371  0.0504  -0.0054 167 ILE A CB    
1259 C  CG1   . ILE A 167 ? 0.5539 0.4453 0.5841 0.0292  0.0465  0.0018  167 ILE A CG1   
1260 C  CG2   . ILE A 167 ? 0.6060 0.4953 0.6171 0.0422  0.0498  -0.0105 167 ILE A CG2   
1261 C  CD1   . ILE A 167 ? 0.5469 0.4245 0.5753 0.0229  0.0386  -0.0086 167 ILE A CD1   
1262 N  N     . LEU A 168 ? 0.6151 0.5256 0.6045 0.0515  0.0541  -0.0105 168 LEU A N     
1263 C  CA    . LEU A 168 ? 0.6639 0.5738 0.6434 0.0584  0.0508  -0.0163 168 LEU A CA    
1264 C  C     . LEU A 168 ? 0.6422 0.5507 0.6070 0.0684  0.0518  -0.0099 168 LEU A C     
1265 O  O     . LEU A 168 ? 0.6791 0.5822 0.6337 0.0757  0.0460  -0.0138 168 LEU A O     
1266 C  CB    . LEU A 168 ? 0.5102 0.4256 0.4915 0.0537  0.0483  -0.0253 168 LEU A CB    
1267 C  CG    . LEU A 168 ? 0.5076 0.4208 0.4973 0.0483  0.0481  -0.0326 168 LEU A CG    
1268 C  CD1   . LEU A 168 ? 0.4993 0.4182 0.4897 0.0448  0.0482  -0.0386 168 LEU A CD1   
1269 C  CD2   . LEU A 168 ? 0.5122 0.4207 0.5059 0.0534  0.0461  -0.0349 168 LEU A CD2   
1270 N  N     . GLU A 169 ? 0.6297 0.5411 0.5930 0.0700  0.0585  0.0005  169 GLU A N     
1271 C  CA    . GLU A 169 ? 0.6540 0.5617 0.5986 0.0821  0.0616  0.0071  169 GLU A CA    
1272 C  C     . GLU A 169 ? 0.7628 0.6579 0.6916 0.0947  0.0600  0.0100  169 GLU A C     
1273 O  O     . GLU A 169 ? 0.7801 0.6658 0.6874 0.1049  0.0546  0.0068  169 GLU A O     
1274 C  CB    . GLU A 169 ? 0.5480 0.4624 0.4986 0.0822  0.0717  0.0208  169 GLU A CB    
1275 C  CG    . GLU A 169 ? 0.6112 0.5235 0.5420 0.0939  0.0767  0.0266  169 GLU A CG    
1276 C  CD    . GLU A 169 ? 0.8506 0.7496 0.7581 0.1115  0.0813  0.0348  169 GLU A CD    
1277 O  OE1   . GLU A 169 ? 1.0078 0.8972 0.8888 0.1241  0.0808  0.0343  169 GLU A OE1   
1278 O  OE2   . GLU A 169 ? 0.9379 0.8339 0.8516 0.1135  0.0850  0.0419  169 GLU A OE2   
1279 N  N     . PRO A 170 ? 0.8028 0.6948 0.7391 0.0952  0.0631  0.0158  170 PRO A N     
1280 C  CA    . PRO A 170 ? 0.7646 0.6432 0.6838 0.1077  0.0604  0.0176  170 PRO A CA    
1281 C  C     . PRO A 170 ? 0.7568 0.6290 0.6715 0.1081  0.0469  0.0045  170 PRO A C     
1282 O  O     . PRO A 170 ? 0.7322 0.5906 0.6255 0.1201  0.0401  0.0037  170 PRO A O     
1283 C  CB    . PRO A 170 ? 0.5888 0.4679 0.5236 0.1048  0.0659  0.0257  170 PRO A CB    
1284 C  CG    . PRO A 170 ? 0.5773 0.4679 0.5324 0.0952  0.0735  0.0335  170 PRO A CG    
1285 C  CD    . PRO A 170 ? 0.7718 0.6700 0.7309 0.0859  0.0685  0.0227  170 PRO A CD    
1286 N  N     . PHE A 171 ? 0.7413 0.6218 0.6756 0.0962  0.0426  -0.0047 171 PHE A N     
1287 C  CA    . PHE A 171 ? 0.7396 0.6165 0.6768 0.0964  0.0311  -0.0142 171 PHE A CA    
1288 C  C     . PHE A 171 ? 0.7394 0.6141 0.6658 0.0997  0.0227  -0.0193 171 PHE A C     
1289 O  O     . PHE A 171 ? 0.7511 0.6158 0.6704 0.1061  0.0103  -0.0231 171 PHE A O     
1290 C  CB    . PHE A 171 ? 0.6283 0.5140 0.5891 0.0852  0.0320  -0.0204 171 PHE A CB    
1291 C  CG    . PHE A 171 ? 0.6571 0.5413 0.6281 0.0860  0.0226  -0.0267 171 PHE A CG    
1292 C  CD1   . PHE A 171 ? 0.6983 0.5767 0.6754 0.0890  0.0201  -0.0259 171 PHE A CD1   
1293 C  CD2   . PHE A 171 ? 0.5618 0.4508 0.5394 0.0837  0.0164  -0.0319 171 PHE A CD2   
1294 C  CE1   . PHE A 171 ? 0.6037 0.4818 0.5949 0.0899  0.0115  -0.0296 171 PHE A CE1   
1295 C  CE2   . PHE A 171 ? 0.5425 0.4315 0.5359 0.0843  0.0077  -0.0349 171 PHE A CE2   
1296 C  CZ    . PHE A 171 ? 0.6571 0.5411 0.6581 0.0875  0.0054  -0.0335 171 PHE A CZ    
1297 N  N     . ARG A 172 ? 0.6205 0.5036 0.5468 0.0951  0.0277  -0.0192 172 ARG A N     
1298 C  CA    . ARG A 172 ? 0.6327 0.5127 0.5481 0.0984  0.0197  -0.0236 172 ARG A CA    
1299 C  C     . ARG A 172 ? 0.6651 0.5273 0.5492 0.1139  0.0153  -0.0198 172 ARG A C     
1300 O  O     . ARG A 172 ? 0.6246 0.4746 0.4964 0.1202  0.0011  -0.0252 172 ARG A O     
1301 C  CB    . ARG A 172 ? 0.5496 0.4420 0.4706 0.0907  0.0271  -0.0235 172 ARG A CB    
1302 C  CG    . ARG A 172 ? 0.5283 0.4338 0.4735 0.0776  0.0294  -0.0288 172 ARG A CG    
1303 C  CD    . ARG A 172 ? 0.5169 0.4317 0.4639 0.0716  0.0332  -0.0298 172 ARG A CD    
1304 N  NE    . ARG A 172 ? 0.5148 0.4385 0.4794 0.0620  0.0338  -0.0357 172 ARG A NE    
1305 C  CZ    . ARG A 172 ? 0.5838 0.5133 0.5561 0.0540  0.0407  -0.0356 172 ARG A CZ    
1306 N  NH1   . ARG A 172 ? 0.6893 0.6188 0.6589 0.0526  0.0461  -0.0293 172 ARG A NH1   
1307 N  NH2   . ARG A 172 ? 0.4853 0.4192 0.4679 0.0484  0.0417  -0.0409 172 ARG A NH2   
1308 N  N     . LYS A 173 ? 0.7128 0.5716 0.5835 0.1214  0.0270  -0.0098 173 LYS A N     
1309 C  CA    . LYS A 173 ? 0.7526 0.5913 0.5882 0.1395  0.0257  -0.0046 173 LYS A CA    
1310 C  C     . LYS A 173 ? 0.8029 0.6237 0.6261 0.1479  0.0119  -0.0085 173 LYS A C     
1311 O  O     . LYS A 173 ? 0.8241 0.6234 0.6175 0.1612  -0.0002 -0.0114 173 LYS A O     
1312 C  CB    . LYS A 173 ? 0.7779 0.6189 0.6075 0.1461  0.0440  0.0101  173 LYS A CB    
1313 C  CG    . LYS A 173 ? 0.9244 0.7550 0.7239 0.1614  0.0513  0.0177  173 LYS A CG    
1314 C  CD    . LYS A 173 ? 0.9181 0.7625 0.7283 0.1528  0.0544  0.0155  173 LYS A CD    
1315 C  CE    . LYS A 173 ? 0.9265 0.7613 0.7082 0.1689  0.0644  0.0249  173 LYS A CE    
1316 N  NZ    . LYS A 173 ? 1.1325 0.9829 0.9282 0.1599  0.0690  0.0246  173 LYS A NZ    
1317 N  N     . GLN A 174 ? 0.7982 0.6253 0.6427 0.1409  0.0120  -0.0088 174 GLN A N     
1318 C  CA    . GLN A 174 ? 0.9564 0.7681 0.7936 0.1478  -0.0015 -0.0119 174 GLN A CA    
1319 C  C     . GLN A 174 ? 0.8476 0.6572 0.6972 0.1428  -0.0209 -0.0225 174 GLN A C     
1320 O  O     . GLN A 174 ? 0.7209 0.5119 0.5576 0.1514  -0.0379 -0.0255 174 GLN A O     
1321 C  CB    . GLN A 174 ? 0.9944 0.8143 0.8524 0.1419  0.0059  -0.0080 174 GLN A CB    
1322 C  CG    . GLN A 174 ? 1.0189 0.8240 0.8715 0.1490  -0.0065 -0.0097 174 GLN A CG    
1323 C  CD    . GLN A 174 ? 1.1267 0.9400 1.0003 0.1430  0.0017  -0.0058 174 GLN A CD    
1324 O  OE1   . GLN A 174 ? 1.2541 1.0788 1.1383 0.1373  0.0169  0.0004  174 GLN A OE1   
1325 N  NE2   . GLN A 174 ? 1.0644 0.8710 0.9454 0.1443  -0.0098 -0.0091 174 GLN A NE2   
1326 N  N     . ASN A 175 ? 0.7415 0.5689 0.6169 0.1295  -0.0195 -0.0271 175 ASN A N     
1327 C  CA    . ASN A 175 ? 0.6919 0.5214 0.5875 0.1235  -0.0354 -0.0344 175 ASN A CA    
1328 C  C     . ASN A 175 ? 0.8182 0.6546 0.7151 0.1189  -0.0358 -0.0376 175 ASN A C     
1329 O  O     . ASN A 175 ? 0.7889 0.6446 0.7107 0.1069  -0.0274 -0.0389 175 ASN A O     
1330 C  CB    . ASN A 175 ? 0.6364 0.4823 0.5687 0.1123  -0.0314 -0.0352 175 ASN A CB    
1331 C  CG    . ASN A 175 ? 0.7117 0.5514 0.6436 0.1165  -0.0301 -0.0318 175 ASN A CG    
1332 O  OD1   . ASN A 175 ? 0.8147 0.6386 0.7379 0.1247  -0.0448 -0.0322 175 ASN A OD1   
1333 N  ND2   . ASN A 175 ? 0.8376 0.6878 0.7785 0.1111  -0.0140 -0.0284 175 ASN A ND2   
1334 N  N     . PRO A 176 ? 0.8547 0.6735 0.7223 0.1292  -0.0456 -0.0390 176 PRO A N     
1335 C  CA    . PRO A 176 ? 0.7218 0.5459 0.5893 0.1254  -0.0463 -0.0420 176 PRO A CA    
1336 C  C     . PRO A 176 ? 0.6753 0.5050 0.5714 0.1168  -0.0615 -0.0474 176 PRO A C     
1337 O  O     . PRO A 176 ? 0.7626 0.6024 0.6679 0.1104  -0.0595 -0.0492 176 PRO A O     
1338 C  CB    . PRO A 176 ? 0.6642 0.4626 0.4873 0.1421  -0.0530 -0.0416 176 PRO A CB    
1339 C  CG    . PRO A 176 ? 0.6934 0.4687 0.4989 0.1535  -0.0674 -0.0421 176 PRO A CG    
1340 C  CD    . PRO A 176 ? 0.7599 0.5502 0.5895 0.1464  -0.0566 -0.0381 176 PRO A CD    
1341 N  N     . ASP A 177 ? 0.7601 0.5845 0.6735 0.1165  -0.0764 -0.0486 177 ASP A N     
1342 C  CA    . ASP A 177 ? 0.8034 0.6327 0.7491 0.1093  -0.0921 -0.0508 177 ASP A CA    
1343 C  C     . ASP A 177 ? 0.7540 0.6089 0.7430 0.0971  -0.0801 -0.0479 177 ASP A C     
1344 O  O     . ASP A 177 ? 0.8435 0.7068 0.8651 0.0908  -0.0885 -0.0470 177 ASP A O     
1345 C  CB    . ASP A 177 ? 0.9829 0.7887 0.9243 0.1173  -0.1191 -0.0523 177 ASP A CB    
1346 C  CG    . ASP A 177 ? 1.0637 0.8379 0.9540 0.1328  -0.1315 -0.0556 177 ASP A CG    
1347 O  OD1   . ASP A 177 ? 0.9791 0.7487 0.8491 0.1355  -0.1295 -0.0578 177 ASP A OD1   
1348 O  OD2   . ASP A 177 ? 1.1663 0.9188 1.0346 0.1436  -0.1426 -0.0557 177 ASP A OD2   
1349 N  N     . ILE A 178 ? 0.6299 0.4956 0.6200 0.0944  -0.0609 -0.0456 178 ILE A N     
1350 C  CA    . ILE A 178 ? 0.5467 0.4332 0.5689 0.0850  -0.0467 -0.0436 178 ILE A CA    
1351 C  C     . ILE A 178 ? 0.5308 0.4297 0.5483 0.0788  -0.0312 -0.0446 178 ILE A C     
1352 O  O     . ILE A 178 ? 0.5325 0.4295 0.5266 0.0802  -0.0210 -0.0446 178 ILE A O     
1353 C  CB    . ILE A 178 ? 0.5459 0.4335 0.5700 0.0859  -0.0369 -0.0414 178 ILE A CB    
1354 C  CG1   . ILE A 178 ? 0.6247 0.5052 0.6660 0.0897  -0.0513 -0.0394 178 ILE A CG1   
1355 C  CG2   . ILE A 178 ? 0.5259 0.4301 0.5677 0.0782  -0.0182 -0.0406 178 ILE A CG2   
1356 C  CD1   . ILE A 178 ? 0.7121 0.5700 0.7251 0.1000  -0.0671 -0.0404 178 ILE A CD1   
1357 N  N     . VAL A 179 ? 0.5557 0.4671 0.5970 0.0724  -0.0295 -0.0443 179 VAL A N     
1358 C  CA    . VAL A 179 ? 0.5864 0.5086 0.6238 0.0667  -0.0166 -0.0454 179 VAL A CA    
1359 C  C     . VAL A 179 ? 0.5734 0.5057 0.6194 0.0622  0.0010  -0.0445 179 VAL A C     
1360 O  O     . VAL A 179 ? 0.5798 0.5176 0.6490 0.0615  0.0042  -0.0421 179 VAL A O     
1361 C  CB    . VAL A 179 ? 0.4962 0.4251 0.5523 0.0631  -0.0232 -0.0450 179 VAL A CB    
1362 C  CG1   . VAL A 179 ? 0.5628 0.4977 0.6561 0.0619  -0.0294 -0.0404 179 VAL A CG1   
1363 C  CG2   . VAL A 179 ? 0.5973 0.5385 0.6530 0.0570  -0.0081 -0.0455 179 VAL A CG2   
1364 N  N     . ILE A 180 ? 0.6036 0.5366 0.6310 0.0599  0.0116  -0.0457 180 ILE A N     
1365 C  CA    . ILE A 180 ? 0.5514 0.4883 0.5806 0.0562  0.0252  -0.0460 180 ILE A CA    
1366 C  C     . ILE A 180 ? 0.5939 0.5371 0.6177 0.0508  0.0325  -0.0476 180 ILE A C     
1367 O  O     . ILE A 180 ? 0.6163 0.5583 0.6242 0.0495  0.0334  -0.0475 180 ILE A O     
1368 C  CB    . ILE A 180 ? 0.4941 0.4233 0.5087 0.0580  0.0283  -0.0450 180 ILE A CB    
1369 C  CG1   . ILE A 180 ? 0.5178 0.4395 0.5352 0.0641  0.0204  -0.0433 180 ILE A CG1   
1370 C  CG2   . ILE A 180 ? 0.4894 0.4189 0.5054 0.0540  0.0389  -0.0460 180 ILE A CG2   
1371 C  CD1   . ILE A 180 ? 0.5094 0.4235 0.5131 0.0668  0.0236  -0.0408 180 ILE A CD1   
1372 N  N     . TYR A 181 ? 0.5726 0.5225 0.6102 0.0487  0.0384  -0.0477 181 TYR A N     
1373 C  CA    . TYR A 181 ? 0.4949 0.4489 0.5258 0.0444  0.0455  -0.0493 181 TYR A CA    
1374 C  C     . TYR A 181 ? 0.4709 0.4185 0.4898 0.0427  0.0537  -0.0514 181 TYR A C     
1375 O  O     . TYR A 181 ? 0.5937 0.5377 0.6169 0.0452  0.0603  -0.0517 181 TYR A O     
1376 C  CB    . TYR A 181 ? 0.4671 0.4292 0.5161 0.0446  0.0490  -0.0473 181 TYR A CB    
1377 C  CG    . TYR A 181 ? 0.5325 0.5004 0.5868 0.0428  0.0411  -0.0465 181 TYR A CG    
1378 C  CD1   . TYR A 181 ? 0.5336 0.5001 0.5981 0.0452  0.0276  -0.0450 181 TYR A CD1   
1379 C  CD2   . TYR A 181 ? 0.6282 0.6007 0.6762 0.0393  0.0454  -0.0474 181 TYR A CD2   
1380 C  CE1   . TYR A 181 ? 0.5040 0.4722 0.5714 0.0441  0.0183  -0.0448 181 TYR A CE1   
1381 C  CE2   . TYR A 181 ? 0.5747 0.5514 0.6273 0.0379  0.0377  -0.0467 181 TYR A CE2   
1382 C  CZ    . TYR A 181 ? 0.5260 0.5000 0.5881 0.0404  0.0240  -0.0456 181 TYR A CZ    
1383 O  OH    . TYR A 181 ? 0.4732 0.4480 0.5381 0.0396  0.0145  -0.0455 181 TYR A OH    
1384 N  N     . GLN A 182 ? 0.5311 0.4758 0.5355 0.0391  0.0527  -0.0520 182 GLN A N     
1385 C  CA    . GLN A 182 ? 0.5733 0.5092 0.5679 0.0366  0.0558  -0.0532 182 GLN A CA    
1386 C  C     . GLN A 182 ? 0.5067 0.4412 0.4927 0.0324  0.0587  -0.0558 182 GLN A C     
1387 O  O     . GLN A 182 ? 0.5600 0.4997 0.5426 0.0286  0.0564  -0.0546 182 GLN A O     
1388 C  CB    . GLN A 182 ? 0.4814 0.4150 0.4710 0.0354  0.0521  -0.0495 182 GLN A CB    
1389 C  CG    . GLN A 182 ? 0.6452 0.5711 0.6292 0.0306  0.0522  -0.0488 182 GLN A CG    
1390 C  CD    . GLN A 182 ? 0.6779 0.6065 0.6623 0.0291  0.0503  -0.0416 182 GLN A CD    
1391 O  OE1   . GLN A 182 ? 0.5550 0.4878 0.5388 0.0340  0.0500  -0.0377 182 GLN A OE1   
1392 N  NE2   . GLN A 182 ? 0.6509 0.5755 0.6360 0.0233  0.0486  -0.0390 182 GLN A NE2   
1393 N  N     . TYR A 183 ? 0.4926 0.4184 0.4732 0.0344  0.0638  -0.0590 183 TYR A N     
1394 C  CA    . TYR A 183 ? 0.5377 0.4564 0.5045 0.0322  0.0654  -0.0622 183 TYR A CA    
1395 C  C     . TYR A 183 ? 0.5658 0.4650 0.5185 0.0337  0.0648  -0.0658 183 TYR A C     
1396 O  O     . TYR A 183 ? 0.5787 0.4699 0.5287 0.0407  0.0710  -0.0674 183 TYR A O     
1397 C  CB    . TYR A 183 ? 0.5508 0.4745 0.5194 0.0362  0.0729  -0.0623 183 TYR A CB    
1398 C  CG    . TYR A 183 ? 0.5722 0.4874 0.5231 0.0350  0.0741  -0.0654 183 TYR A CG    
1399 C  CD1   . TYR A 183 ? 0.6123 0.5349 0.5621 0.0288  0.0695  -0.0648 183 TYR A CD1   
1400 C  CD2   . TYR A 183 ? 0.5348 0.4321 0.4675 0.0413  0.0795  -0.0688 183 TYR A CD2   
1401 C  CE1   . TYR A 183 ? 0.6981 0.6118 0.6313 0.0277  0.0692  -0.0676 183 TYR A CE1   
1402 C  CE2   . TYR A 183 ? 0.5499 0.4354 0.4618 0.0415  0.0789  -0.0721 183 TYR A CE2   
1403 C  CZ    . TYR A 183 ? 0.6532 0.5476 0.5666 0.0341  0.0732  -0.0715 183 TYR A CZ    
1404 O  OH    . TYR A 183 ? 0.6405 0.5224 0.5331 0.0343  0.0713  -0.0746 183 TYR A OH    
1405 N  N     . MET A 184 ? 0.7132 0.6039 0.6581 0.0276  0.0567  -0.0665 184 MET A N     
1406 C  CA    . MET A 184 ? 0.5659 0.4354 0.4988 0.0277  0.0516  -0.0698 184 MET A CA    
1407 C  C     . MET A 184 ? 0.6414 0.5091 0.5826 0.0314  0.0534  -0.0684 184 MET A C     
1408 O  O     . MET A 184 ? 0.6085 0.4875 0.5642 0.0287  0.0514  -0.0631 184 MET A O     
1409 C  CB    . MET A 184 ? 0.6964 0.5465 0.6061 0.0340  0.0547  -0.0762 184 MET A CB    
1410 C  CG    . MET A 184 ? 0.8332 0.6792 0.7302 0.0305  0.0504  -0.0783 184 MET A CG    
1411 S  SD    . MET A 184 ? 0.9630 0.7957 0.8578 0.0199  0.0321  -0.0782 184 MET A SD    
1412 C  CE    . MET A 184 ? 0.9409 0.7668 0.8176 0.0187  0.0284  -0.0815 184 MET A CE    
1413 N  N     . ASP A 185 ? 0.6936 0.5460 0.6238 0.0389  0.0579  -0.0725 185 ASP A N     
1414 C  CA    . ASP A 185 ? 0.7624 0.6120 0.6999 0.0431  0.0600  -0.0713 185 ASP A CA    
1415 C  C     . ASP A 185 ? 0.7358 0.5984 0.6861 0.0504  0.0703  -0.0688 185 ASP A C     
1416 O  O     . ASP A 185 ? 0.7280 0.5907 0.6875 0.0540  0.0719  -0.0670 185 ASP A O     
1417 C  CB    . ASP A 185 ? 0.8355 0.6574 0.7535 0.0476  0.0574  -0.0768 185 ASP A CB    
1418 C  CG    . ASP A 185 ? 0.9277 0.7353 0.8241 0.0575  0.0659  -0.0816 185 ASP A CG    
1419 O  OD1   . ASP A 185 ? 0.8797 0.6978 0.7757 0.0583  0.0716  -0.0807 185 ASP A OD1   
1420 O  OD2   . ASP A 185 ? 0.9565 0.7409 0.8351 0.0657  0.0676  -0.0858 185 ASP A OD2   
1421 N  N     . ASP A 186 ? 0.5542 0.4279 0.5080 0.0523  0.0765  -0.0677 186 ASP A N     
1422 C  CA    . ASP A 186 ? 0.6256 0.5124 0.5978 0.0584  0.0847  -0.0633 186 ASP A CA    
1423 C  C     . ASP A 186 ? 0.6223 0.5272 0.6147 0.0537  0.0782  -0.0591 186 ASP A C     
1424 O  O     . ASP A 186 ? 0.6704 0.5819 0.6611 0.0473  0.0719  -0.0590 186 ASP A O     
1425 C  CB    . ASP A 186 ? 0.6993 0.5895 0.6694 0.0629  0.0940  -0.0622 186 ASP A CB    
1426 C  CG    . ASP A 186 ? 0.8159 0.7195 0.8108 0.0696  0.1028  -0.0551 186 ASP A CG    
1427 O  OD1   . ASP A 186 ? 0.9639 0.8593 0.9581 0.0793  0.1132  -0.0530 186 ASP A OD1   
1428 O  OD2   . ASP A 186 ? 0.7524 0.6735 0.7683 0.0656  0.0988  -0.0510 186 ASP A OD2   
1429 N  N     . LEU A 187 ? 0.6096 0.5206 0.6199 0.0580  0.0792  -0.0554 187 LEU A N     
1430 C  CA    . LEU A 187 ? 0.6064 0.5290 0.6319 0.0558  0.0708  -0.0521 187 LEU A CA    
1431 C  C     . LEU A 187 ? 0.6439 0.5774 0.6937 0.0600  0.0727  -0.0471 187 LEU A C     
1432 O  O     . LEU A 187 ? 0.6382 0.5702 0.7003 0.0660  0.0782  -0.0440 187 LEU A O     
1433 C  CB    . LEU A 187 ? 0.5894 0.5061 0.6138 0.0562  0.0653  -0.0516 187 LEU A CB    
1434 C  CG    . LEU A 187 ? 0.5670 0.4753 0.5750 0.0514  0.0618  -0.0533 187 LEU A CG    
1435 C  CD1   . LEU A 187 ? 0.5861 0.4901 0.5965 0.0531  0.0577  -0.0508 187 LEU A CD1   
1436 C  CD2   . LEU A 187 ? 0.6644 0.5798 0.6672 0.0462  0.0578  -0.0525 187 LEU A CD2   
1437 N  N     . TYR A 188 ? 0.5014 0.4452 0.5601 0.0572  0.0675  -0.0453 188 TYR A N     
1438 C  CA    . TYR A 188 ? 0.4791 0.4332 0.5658 0.0594  0.0638  -0.0394 188 TYR A CA    
1439 C  C     . TYR A 188 ? 0.5861 0.5391 0.6759 0.0585  0.0484  -0.0395 188 TYR A C     
1440 O  O     . TYR A 188 ? 0.6302 0.5812 0.7042 0.0555  0.0409  -0.0425 188 TYR A O     
1441 C  CB    . TYR A 188 ? 0.4717 0.4349 0.5656 0.0571  0.0656  -0.0374 188 TYR A CB    
1442 C  CG    . TYR A 188 ? 0.4644 0.4378 0.5891 0.0572  0.0568  -0.0310 188 TYR A CG    
1443 C  CD1   . TYR A 188 ? 0.4610 0.4334 0.5852 0.0543  0.0399  -0.0328 188 TYR A CD1   
1444 C  CD2   . TYR A 188 ? 0.4752 0.4574 0.6297 0.0612  0.0650  -0.0221 188 TYR A CD2   
1445 C  CE1   . TYR A 188 ? 0.5665 0.5444 0.7184 0.0541  0.0280  -0.0275 188 TYR A CE1   
1446 C  CE2   . TYR A 188 ? 0.4577 0.4492 0.6461 0.0602  0.0546  -0.0147 188 TYR A CE2   
1447 C  CZ    . TYR A 188 ? 0.5641 0.5523 0.7507 0.0561  0.0345  -0.0182 188 TYR A CZ    
1448 O  OH    . TYR A 188 ? 0.7454 0.7391 0.9651 0.0550  0.0203  -0.0114 188 TYR A OH    
1449 N  N     . VAL A 189 ? 0.5661 0.5189 0.6746 0.0624  0.0438  -0.0356 189 VAL A N     
1450 C  CA    . VAL A 189 ? 0.5434 0.4907 0.6511 0.0635  0.0281  -0.0359 189 VAL A CA    
1451 C  C     . VAL A 189 ? 0.4821 0.4349 0.6208 0.0648  0.0163  -0.0302 189 VAL A C     
1452 O  O     . VAL A 189 ? 0.4815 0.4404 0.6485 0.0673  0.0207  -0.0238 189 VAL A O     
1453 C  CB    . VAL A 189 ? 0.6028 0.5417 0.7037 0.0669  0.0295  -0.0364 189 VAL A CB    
1454 C  CG1   . VAL A 189 ? 0.4993 0.4303 0.5953 0.0697  0.0133  -0.0363 189 VAL A CG1   
1455 C  CG2   . VAL A 189 ? 0.6485 0.5812 0.7236 0.0648  0.0391  -0.0407 189 VAL A CG2   
1456 N  N     . GLY A 190 ? 0.5190 0.4684 0.6532 0.0636  0.0008  -0.0318 190 GLY A N     
1457 C  CA    . GLY A 190 ? 0.4858 0.4367 0.6489 0.0640  -0.0157 -0.0268 190 GLY A CA    
1458 C  C     . GLY A 190 ? 0.5012 0.4360 0.6498 0.0678  -0.0370 -0.0298 190 GLY A C     
1459 O  O     . GLY A 190 ? 0.5092 0.4329 0.6220 0.0700  -0.0388 -0.0356 190 GLY A O     
1460 N  N     . SER A 191 ? 0.5327 0.4651 0.7098 0.0695  -0.0533 -0.0248 191 SER A N     
1461 C  CA    . SER A 191 ? 0.5770 0.4901 0.7392 0.0746  -0.0760 -0.0276 191 SER A CA    
1462 C  C     . SER A 191 ? 0.6556 0.5661 0.8537 0.0738  -0.0997 -0.0221 191 SER A C     
1463 O  O     . SER A 191 ? 0.6627 0.5894 0.9059 0.0701  -0.0955 -0.0131 191 SER A O     
1464 C  CB    . SER A 191 ? 0.6107 0.5179 0.7647 0.0791  -0.0723 -0.0275 191 SER A CB    
1465 O  OG    . SER A 191 ? 0.5288 0.4465 0.7244 0.0783  -0.0706 -0.0195 191 SER A OG    
1466 N  N     . ASP A 192 ? 0.6520 0.5402 0.8295 0.0784  -0.1252 -0.0266 192 ASP A N     
1467 C  CA    . ASP A 192 ? 0.6366 0.5157 0.8448 0.0782  -0.1545 -0.0223 192 ASP A CA    
1468 C  C     . ASP A 192 ? 0.6993 0.5704 0.9231 0.0821  -0.1678 -0.0184 192 ASP A C     
1469 O  O     . ASP A 192 ? 0.6575 0.5097 0.8884 0.0848  -0.1986 -0.0181 192 ASP A O     
1470 C  CB    . ASP A 192 ? 0.7184 0.5720 0.8924 0.0826  -0.1785 -0.0300 192 ASP A CB    
1471 C  CG    . ASP A 192 ? 0.7984 0.6599 0.9608 0.0787  -0.1673 -0.0330 192 ASP A CG    
1472 O  OD1   . ASP A 192 ? 0.7646 0.6501 0.9636 0.0709  -0.1531 -0.0266 192 ASP A OD1   
1473 O  OD2   . ASP A 192 ? 0.7822 0.6255 0.8982 0.0846  -0.1719 -0.0411 192 ASP A OD2   
1474 N  N     . LEU A 193 ? 0.7604 0.6434 0.9890 0.0826  -0.1468 -0.0157 193 LEU A N     
1475 C  CA    . LEU A 193 ? 0.6919 0.5680 0.9322 0.0867  -0.1563 -0.0123 193 LEU A CA    
1476 C  C     . LEU A 193 ? 0.6341 0.5320 0.9363 0.0825  -0.1501 0.0006  193 LEU A C     
1477 O  O     . LEU A 193 ? 0.5464 0.4658 0.8758 0.0778  -0.1312 0.0068  193 LEU A O     
1478 C  CB    . LEU A 193 ? 0.5841 0.4564 0.7863 0.0914  -0.1376 -0.0175 193 LEU A CB    
1479 C  CG    . LEU A 193 ? 0.6202 0.4742 0.7632 0.0970  -0.1371 -0.0271 193 LEU A CG    
1480 C  CD1   . LEU A 193 ? 0.5921 0.4504 0.7106 0.0988  -0.1127 -0.0289 193 LEU A CD1   
1481 C  CD2   . LEU A 193 ? 0.6335 0.4573 0.7506 0.1058  -0.1668 -0.0308 193 LEU A CD2   
1482 N  N     . GLU A 194 ? 0.6834 0.5747 1.0071 0.0854  -0.1657 0.0058  194 GLU A N     
1483 C  CA    . GLU A 194 ? 0.7125 0.6243 1.0952 0.0834  -0.1577 0.0198  194 GLU A CA    
1484 C  C     . GLU A 194 ? 0.7369 0.6651 1.1132 0.0848  -0.1212 0.0207  194 GLU A C     
1485 O  O     . GLU A 194 ? 0.8225 0.7439 1.1509 0.0868  -0.1071 0.0105  194 GLU A O     
1486 C  CB    . GLU A 194 ? 0.8975 0.7968 1.3009 0.0868  -0.1829 0.0245  194 GLU A CB    
1487 C  CG    . GLU A 194 ? 1.0890 0.9693 1.5060 0.0857  -0.2234 0.0253  194 GLU A CG    
1488 C  CD    . GLU A 194 ? 1.2488 1.1477 1.7348 0.0788  -0.2310 0.0402  194 GLU A CD    
1489 O  OE1   . GLU A 194 ? 1.2952 1.2223 1.8204 0.0766  -0.2031 0.0517  194 GLU A OE1   
1490 O  OE2   . GLU A 194 ? 1.2655 1.1492 1.7663 0.0765  -0.2651 0.0411  194 GLU A OE2   
1491 N  N     . ILE A 195 ? 0.7858 0.7346 1.2121 0.0845  -0.1064 0.0341  195 ILE A N     
1492 C  CA    . ILE A 195 ? 0.6699 0.6315 1.0898 0.0874  -0.0719 0.0354  195 ILE A CA    
1493 C  C     . ILE A 195 ? 0.6439 0.5933 1.0295 0.0919  -0.0671 0.0279  195 ILE A C     
1494 O  O     . ILE A 195 ? 0.5278 0.4746 0.8748 0.0929  -0.0476 0.0195  195 ILE A O     
1495 C  CB    . ILE A 195 ? 0.6384 0.6211 1.1184 0.0895  -0.0576 0.0533  195 ILE A CB    
1496 C  CG1   . ILE A 195 ? 1.0015 0.9953 1.5256 0.0847  -0.0693 0.0639  195 ILE A CG1   
1497 C  CG2   . ILE A 195 ? 0.5056 0.4979 0.9715 0.0941  -0.0214 0.0537  195 ILE A CG2   
1498 C  CD1   . ILE A 195 ? 1.0147 1.0113 1.5131 0.0809  -0.0592 0.0571  195 ILE A CD1   
1499 N  N     . GLY A 196 ? 0.7065 0.6474 1.1069 0.0946  -0.0862 0.0312  196 GLY A N     
1500 C  CA    . GLY A 196 ? 0.5517 0.4811 0.9227 0.0992  -0.0820 0.0255  196 GLY A CA    
1501 C  C     . GLY A 196 ? 0.6357 0.5470 0.9465 0.0996  -0.0861 0.0114  196 GLY A C     
1502 O  O     . GLY A 196 ? 0.6067 0.5148 0.8865 0.1015  -0.0689 0.0058  196 GLY A O     
1503 N  N     . GLN A 197 ? 0.8433 0.7414 1.1374 0.0986  -0.1091 0.0065  197 GLN A N     
1504 C  CA    . GLN A 197 ? 0.7889 0.6697 1.0262 0.1011  -0.1111 -0.0047 197 GLN A CA    
1505 C  C     . GLN A 197 ? 0.7042 0.5945 0.9193 0.0972  -0.0880 -0.0097 197 GLN A C     
1506 O  O     . GLN A 197 ? 0.5875 0.4687 0.7607 0.0992  -0.0805 -0.0165 197 GLN A O     
1507 C  CB    . GLN A 197 ? 0.7622 0.6229 0.9844 0.1034  -0.1416 -0.0084 197 GLN A CB    
1508 C  CG    . GLN A 197 ? 0.8552 0.6936 1.0174 0.1102  -0.1452 -0.0176 197 GLN A CG    
1509 C  CD    . GLN A 197 ? 1.0268 0.8387 1.1689 0.1161  -0.1774 -0.0212 197 GLN A CD    
1510 O  OE1   . GLN A 197 ? 1.1134 0.9219 1.2889 0.1142  -0.2012 -0.0171 197 GLN A OE1   
1511 N  NE2   . GLN A 197 ? 1.0731 0.8642 1.1603 0.1242  -0.1789 -0.0281 197 GLN A NE2   
1512 N  N     . HIS A 198 ? 0.6876 0.5958 0.9313 0.0923  -0.0766 -0.0054 198 HIS A N     
1513 C  CA    . HIS A 198 ? 0.5514 0.4679 0.7751 0.0889  -0.0548 -0.0098 198 HIS A CA    
1514 C  C     . HIS A 198 ? 0.5992 0.5191 0.8125 0.0904  -0.0317 -0.0108 198 HIS A C     
1515 O  O     . HIS A 198 ? 0.5737 0.4899 0.7538 0.0891  -0.0203 -0.0172 198 HIS A O     
1516 C  CB    . HIS A 198 ? 0.5243 0.4570 0.7806 0.0846  -0.0494 -0.0040 198 HIS A CB    
1517 C  CG    . HIS A 198 ? 0.5129 0.4531 0.7498 0.0816  -0.0282 -0.0081 198 HIS A CG    
1518 N  ND1   . HIS A 198 ? 0.5122 0.4476 0.7197 0.0786  -0.0315 -0.0153 198 HIS A ND1   
1519 C  CD2   . HIS A 198 ? 0.5047 0.4548 0.7462 0.0821  -0.0045 -0.0060 198 HIS A CD2   
1520 C  CE1   . HIS A 198 ? 0.5311 0.4744 0.7284 0.0762  -0.0117 -0.0172 198 HIS A CE1   
1521 N  NE2   . HIS A 198 ? 0.4992 0.4500 0.7146 0.0786  0.0044  -0.0122 198 HIS A NE2   
1522 N  N     . ARG A 199 ? 0.5968 0.5226 0.8393 0.0934  -0.0256 -0.0037 199 ARG A N     
1523 C  CA    . ARG A 199 ? 0.5325 0.4578 0.7639 0.0961  -0.0057 -0.0050 199 ARG A CA    
1524 C  C     . ARG A 199 ? 0.5422 0.4526 0.7363 0.0973  -0.0091 -0.0119 199 ARG A C     
1525 O  O     . ARG A 199 ? 0.5419 0.4490 0.7130 0.0967  0.0054  -0.0163 199 ARG A O     
1526 C  CB    . ARG A 199 ? 0.5643 0.4961 0.8332 0.1009  -0.0009 0.0046  199 ARG A CB    
1527 C  CG    . ARG A 199 ? 0.6932 0.6414 1.0042 0.1015  0.0066  0.0151  199 ARG A CG    
1528 C  CD    . ARG A 199 ? 0.8953 0.8486 1.1930 0.1023  0.0311  0.0135  199 ARG A CD    
1529 N  NE    . ARG A 199 ? 0.9106 0.8794 1.2461 0.1036  0.0390  0.0247  199 ARG A NE    
1530 C  CZ    . ARG A 199 ? 0.8424 0.8207 1.2139 0.1108  0.0526  0.0375  199 ARG A CZ    
1531 N  NH1   . ARG A 199 ? 0.9211 0.8941 1.2940 0.1171  0.0591  0.0393  199 ARG A NH1   
1532 N  NH2   . ARG A 199 ? 0.6591 0.6523 1.0665 0.1125  0.0609  0.0497  199 ARG A NH2   
1533 N  N     . THR A 200 ? 0.5740 0.4738 0.7621 0.0997  -0.0290 -0.0121 200 THR A N     
1534 C  CA    . THR A 200 ? 0.5963 0.4816 0.7488 0.1026  -0.0314 -0.0166 200 THR A CA    
1535 C  C     . THR A 200 ? 0.7359 0.6185 0.8547 0.0998  -0.0245 -0.0222 200 THR A C     
1536 O  O     . THR A 200 ? 0.7362 0.6145 0.8336 0.0998  -0.0136 -0.0241 200 THR A O     
1537 C  CB    . THR A 200 ? 0.6241 0.4953 0.7722 0.1078  -0.0551 -0.0155 200 THR A CB    
1538 O  OG1   . THR A 200 ? 0.6395 0.5105 0.8124 0.1111  -0.0591 -0.0101 200 THR A OG1   
1539 C  CG2   . THR A 200 ? 0.7878 0.6429 0.8920 0.1123  -0.0575 -0.0195 200 THR A CG2   
1540 N  N     . LYS A 201 ? 0.7399 0.6251 0.8564 0.0973  -0.0312 -0.0240 201 LYS A N     
1541 C  CA    . LYS A 201 ? 0.6798 0.5635 0.7670 0.0950  -0.0248 -0.0283 201 LYS A CA    
1542 C  C     . LYS A 201 ? 0.6707 0.5641 0.7581 0.0896  -0.0046 -0.0298 201 LYS A C     
1543 O  O     . LYS A 201 ? 0.6889 0.5794 0.7531 0.0879  0.0030  -0.0320 201 LYS A O     
1544 C  CB    . LYS A 201 ? 0.5569 0.4409 0.6436 0.0938  -0.0367 -0.0299 201 LYS A CB    
1545 C  CG    . LYS A 201 ? 0.5719 0.4414 0.6213 0.0987  -0.0443 -0.0327 201 LYS A CG    
1546 C  CD    . LYS A 201 ? 0.6786 0.5298 0.7123 0.1078  -0.0583 -0.0316 201 LYS A CD    
1547 C  CE    . LYS A 201 ? 0.7262 0.5613 0.7175 0.1158  -0.0606 -0.0327 201 LYS A CE    
1548 N  NZ    . LYS A 201 ? 0.8345 0.6483 0.8046 0.1270  -0.0739 -0.0313 201 LYS A NZ    
1549 N  N     . ILE A 202 ? 0.6830 0.5864 0.7961 0.0878  0.0039  -0.0278 202 ILE A N     
1550 C  CA    . ILE A 202 ? 0.6295 0.5367 0.7376 0.0849  0.0216  -0.0300 202 ILE A CA    
1551 C  C     . ILE A 202 ? 0.6012 0.4990 0.6946 0.0863  0.0281  -0.0312 202 ILE A C     
1552 O  O     . ILE A 202 ? 0.6363 0.5304 0.7116 0.0830  0.0359  -0.0343 202 ILE A O     
1553 C  CB    . ILE A 202 ? 0.6848 0.6017 0.8207 0.0862  0.0308  -0.0261 202 ILE A CB    
1554 C  CG1   . ILE A 202 ? 0.7454 0.6725 0.8996 0.0840  0.0240  -0.0233 202 ILE A CG1   
1555 C  CG2   . ILE A 202 ? 0.5253 0.4403 0.6486 0.0857  0.0481  -0.0292 202 ILE A CG2   
1556 C  CD1   . ILE A 202 ? 0.5104 0.4381 0.6430 0.0790  0.0236  -0.0284 202 ILE A CD1   
1557 N  N     . GLU A 203 ? 0.5595 0.4526 0.6622 0.0909  0.0236  -0.0282 203 GLU A N     
1558 C  CA    . GLU A 203 ? 0.5529 0.4364 0.6433 0.0924  0.0286  -0.0286 203 GLU A CA    
1559 C  C     . GLU A 203 ? 0.5828 0.4592 0.6483 0.0912  0.0248  -0.0291 203 GLU A C     
1560 O  O     . GLU A 203 ? 0.6503 0.5212 0.7040 0.0890  0.0316  -0.0295 203 GLU A O     
1561 C  CB    . GLU A 203 ? 0.6039 0.4843 0.7108 0.0980  0.0240  -0.0246 203 GLU A CB    
1562 C  CG    . GLU A 203 ? 0.7316 0.6185 0.8647 0.1008  0.0324  -0.0218 203 GLU A CG    
1563 C  CD    . GLU A 203 ? 0.7862 0.6700 0.9091 0.1002  0.0487  -0.0253 203 GLU A CD    
1564 O  OE1   . GLU A 203 ? 0.6071 0.4801 0.7095 0.0988  0.0519  -0.0288 203 GLU A OE1   
1565 O  OE2   . GLU A 203 ? 0.8129 0.7035 0.9481 0.1019  0.0577  -0.0238 203 GLU A OE2   
1566 N  N     . GLU A 204 ? 0.5871 0.4622 0.6446 0.0935  0.0136  -0.0280 204 GLU A N     
1567 C  CA    . GLU A 204 ? 0.6156 0.4843 0.6482 0.0947  0.0129  -0.0265 204 GLU A CA    
1568 C  C     . GLU A 204 ? 0.8049 0.6792 0.8298 0.0881  0.0223  -0.0283 204 GLU A C     
1569 O  O     . GLU A 204 ? 0.8492 0.7199 0.8618 0.0871  0.0275  -0.0253 204 GLU A O     
1570 C  CB    . GLU A 204 ? 0.5766 0.4395 0.5975 0.1006  -0.0008 -0.0258 204 GLU A CB    
1571 C  CG    . GLU A 204 ? 0.8114 0.6661 0.8037 0.1052  0.0006  -0.0226 204 GLU A CG    
1572 C  CD    . GLU A 204 ? 0.9465 0.7897 0.9205 0.1139  -0.0138 -0.0228 204 GLU A CD    
1573 O  OE1   . GLU A 204 ? 0.9701 0.8089 0.9547 0.1164  -0.0281 -0.0248 204 GLU A OE1   
1574 O  OE2   . GLU A 204 ? 1.0414 0.8784 0.9904 0.1189  -0.0115 -0.0204 204 GLU A OE2   
1575 N  N     . LEU A 205 ? 0.8423 0.7252 0.8764 0.0838  0.0243  -0.0319 205 LEU A N     
1576 C  CA    . LEU A 205 ? 0.6826 0.5697 0.7097 0.0775  0.0320  -0.0340 205 LEU A CA    
1577 C  C     . LEU A 205 ? 0.6270 0.5099 0.6555 0.0741  0.0407  -0.0355 205 LEU A C     
1578 O  O     . LEU A 205 ? 0.6961 0.5764 0.7155 0.0696  0.0440  -0.0349 205 LEU A O     
1579 C  CB    . LEU A 205 ? 0.5917 0.4880 0.6272 0.0749  0.0316  -0.0371 205 LEU A CB    
1580 C  CG    . LEU A 205 ? 0.5229 0.4234 0.5507 0.0688  0.0381  -0.0395 205 LEU A CG    
1581 C  CD1   . LEU A 205 ? 0.5239 0.4235 0.5355 0.0680  0.0363  -0.0370 205 LEU A CD1   
1582 C  CD2   . LEU A 205 ? 0.5142 0.4236 0.5530 0.0673  0.0385  -0.0416 205 LEU A CD2   
1583 N  N     . ARG A 206 ? 0.6062 0.4868 0.6463 0.0767  0.0435  -0.0368 206 ARG A N     
1584 C  CA    . ARG A 206 ? 0.6114 0.4830 0.6484 0.0754  0.0504  -0.0391 206 ARG A CA    
1585 C  C     . ARG A 206 ? 0.6679 0.5304 0.6985 0.0751  0.0484  -0.0358 206 ARG A C     
1586 O  O     . ARG A 206 ? 0.6969 0.5510 0.7211 0.0711  0.0504  -0.0368 206 ARG A O     
1587 C  CB    . ARG A 206 ? 0.5579 0.4280 0.6076 0.0809  0.0555  -0.0400 206 ARG A CB    
1588 C  CG    . ARG A 206 ? 0.6714 0.5506 0.7304 0.0819  0.0604  -0.0409 206 ARG A CG    
1589 C  CD    . ARG A 206 ? 0.6530 0.5308 0.7259 0.0892  0.0689  -0.0392 206 ARG A CD    
1590 N  NE    . ARG A 206 ? 0.7160 0.5779 0.7732 0.0919  0.0770  -0.0431 206 ARG A NE    
1591 C  CZ    . ARG A 206 ? 0.6510 0.5025 0.7090 0.0969  0.0790  -0.0425 206 ARG A CZ    
1592 N  NH1   . ARG A 206 ? 0.5831 0.4402 0.6585 0.0995  0.0743  -0.0377 206 ARG A NH1   
1593 N  NH2   . ARG A 206 ? 0.6064 0.4397 0.6464 0.1000  0.0845  -0.0471 206 ARG A NH2   
1594 N  N     . GLN A 207 ? 0.6497 0.5124 0.6823 0.0795  0.0434  -0.0312 207 GLN A N     
1595 C  CA    . GLN A 207 ? 0.5726 0.4277 0.5996 0.0801  0.0427  -0.0259 207 GLN A CA    
1596 C  C     . GLN A 207 ? 0.7485 0.6060 0.7663 0.0765  0.0433  -0.0212 207 GLN A C     
1597 O  O     . GLN A 207 ? 0.6723 0.5246 0.6901 0.0740  0.0452  -0.0160 207 GLN A O     
1598 C  CB    . GLN A 207 ? 0.6326 0.4854 0.6610 0.0875  0.0373  -0.0218 207 GLN A CB    
1599 C  CG    . GLN A 207 ? 0.7075 0.5553 0.7476 0.0909  0.0378  -0.0231 207 GLN A CG    
1600 C  CD    . GLN A 207 ? 0.8916 0.7292 0.9306 0.0887  0.0422  -0.0222 207 GLN A CD    
1601 O  OE1   . GLN A 207 ? 0.8219 0.6541 0.8653 0.0883  0.0462  -0.0267 207 GLN A OE1   
1602 N  NE2   . GLN A 207 ? 1.0859 0.9193 1.1188 0.0884  0.0415  -0.0156 207 GLN A NE2   
1603 N  N     . HIS A 208 ? 0.8502 0.7156 0.8624 0.0766  0.0419  -0.0218 208 HIS A N     
1604 C  CA    . HIS A 208 ? 0.5620 0.4305 0.5667 0.0741  0.0442  -0.0164 208 HIS A CA    
1605 C  C     . HIS A 208 ? 0.6034 0.4721 0.6125 0.0651  0.0470  -0.0184 208 HIS A C     
1606 O  O     . HIS A 208 ? 0.5831 0.4506 0.5946 0.0617  0.0486  -0.0113 208 HIS A O     
1607 C  CB    . HIS A 208 ? 0.6578 0.5324 0.6536 0.0773  0.0413  -0.0173 208 HIS A CB    
1608 C  CG    . HIS A 208 ? 0.5946 0.4733 0.5831 0.0758  0.0453  -0.0115 208 HIS A CG    
1609 N  ND1   . HIS A 208 ? 0.5665 0.4421 0.5457 0.0825  0.0485  -0.0012 208 HIS A ND1   
1610 C  CD2   . HIS A 208 ? 0.5468 0.4324 0.5368 0.0693  0.0474  -0.0133 208 HIS A CD2   
1611 C  CE1   . HIS A 208 ? 0.6173 0.4987 0.5947 0.0802  0.0532  0.0039  208 HIS A CE1   
1612 N  NE2   . HIS A 208 ? 0.5775 0.4651 0.5617 0.0716  0.0516  -0.0038 208 HIS A NE2   
1613 N  N     . LEU A 209 ? 0.6267 0.4959 0.6377 0.0619  0.0472  -0.0269 209 LEU A N     
1614 C  CA    . LEU A 209 ? 0.6259 0.4907 0.6363 0.0547  0.0478  -0.0302 209 LEU A CA    
1615 C  C     . LEU A 209 ? 0.6630 0.5139 0.6762 0.0528  0.0461  -0.0292 209 LEU A C     
1616 O  O     . LEU A 209 ? 0.5740 0.4197 0.5895 0.0465  0.0430  -0.0262 209 LEU A O     
1617 C  CB    . LEU A 209 ? 0.5530 0.4185 0.5606 0.0548  0.0498  -0.0389 209 LEU A CB    
1618 C  CG    . LEU A 209 ? 0.6182 0.4966 0.6251 0.0549  0.0503  -0.0400 209 LEU A CG    
1619 C  CD1   . LEU A 209 ? 0.5392 0.4185 0.5473 0.0564  0.0540  -0.0462 209 LEU A CD1   
1620 C  CD2   . LEU A 209 ? 0.6214 0.5039 0.6239 0.0490  0.0493  -0.0371 209 LEU A CD2   
1621 N  N     . LEU A 210 ? 0.6830 0.5275 0.6982 0.0580  0.0468  -0.0312 210 LEU A N     
1622 C  CA    . LEU A 210 ? 0.5904 0.4198 0.6075 0.0569  0.0446  -0.0307 210 LEU A CA    
1623 C  C     . LEU A 210 ? 0.6986 0.5281 0.7235 0.0541  0.0423  -0.0197 210 LEU A C     
1624 O  O     . LEU A 210 ? 0.7001 0.5180 0.7300 0.0492  0.0378  -0.0175 210 LEU A O     
1625 C  CB    . LEU A 210 ? 0.7522 0.5767 0.7711 0.0643  0.0469  -0.0335 210 LEU A CB    
1626 C  CG    . LEU A 210 ? 0.6139 0.4203 0.6325 0.0650  0.0449  -0.0348 210 LEU A CG    
1627 C  CD1   . LEU A 210 ? 0.6287 0.4190 0.6353 0.0636  0.0437  -0.0435 210 LEU A CD1   
1628 C  CD2   . LEU A 210 ? 0.9212 0.7269 0.9448 0.0730  0.0479  -0.0348 210 LEU A CD2   
1629 N  N     . ARG A 211 ? 0.5851 0.4258 0.6112 0.0582  0.0451  -0.0119 211 ARG A N     
1630 C  CA    . ARG A 211 ? 0.5883 0.4308 0.6216 0.0575  0.0463  0.0013  211 ARG A CA    
1631 C  C     . ARG A 211 ? 0.7000 0.5441 0.7412 0.0488  0.0443  0.0057  211 ARG A C     
1632 O  O     . ARG A 211 ? 0.6666 0.5068 0.7217 0.0448  0.0426  0.0159  211 ARG A O     
1633 C  CB    . ARG A 211 ? 0.6518 0.5034 0.6773 0.0660  0.0506  0.0079  211 ARG A CB    
1634 C  CG    . ARG A 211 ? 0.7771 0.6357 0.8050 0.0664  0.0554  0.0210  211 ARG A CG    
1635 C  CD    . ARG A 211 ? 0.9473 0.8021 0.9854 0.0691  0.0591  0.0357  211 ARG A CD    
1636 N  NE    . ARG A 211 ? 0.9627 0.8252 1.0045 0.0720  0.0667  0.0512  211 ARG A NE    
1637 C  CZ    . ARG A 211 ? 0.9187 0.7857 0.9802 0.0637  0.0672  0.0603  211 ARG A CZ    
1638 N  NH1   . ARG A 211 ? 0.8868 0.7481 0.9620 0.0519  0.0582  0.0537  211 ARG A NH1   
1639 N  NH2   . ARG A 211 ? 0.8401 0.7154 0.9070 0.0683  0.0762  0.0766  211 ARG A NH2   
1640 N  N     . TRP A 212 ? 0.7125 0.5621 0.7475 0.0455  0.0437  -0.0010 212 TRP A N     
1641 C  CA    . TRP A 212 ? 0.7005 0.5511 0.7427 0.0370  0.0402  0.0021  212 TRP A CA    
1642 C  C     . TRP A 212 ? 0.6881 0.5237 0.7264 0.0309  0.0321  -0.0088 212 TRP A C     
1643 O  O     . TRP A 212 ? 0.6870 0.5224 0.7233 0.0252  0.0281  -0.0118 212 TRP A O     
1644 C  CB    . TRP A 212 ? 0.6037 0.4684 0.6399 0.0379  0.0443  0.0025  212 TRP A CB    
1645 C  CG    . TRP A 212 ? 0.6277 0.5025 0.6633 0.0455  0.0517  0.0141  212 TRP A CG    
1646 C  CD1   . TRP A 212 ? 0.7154 0.5936 0.7367 0.0549  0.0550  0.0116  212 TRP A CD1   
1647 C  CD2   . TRP A 212 ? 0.6124 0.4924 0.6606 0.0460  0.0563  0.0310  212 TRP A CD2   
1648 N  NE1   . TRP A 212 ? 0.8015 0.6839 0.8199 0.0625  0.0613  0.0245  212 TRP A NE1   
1649 C  CE2   . TRP A 212 ? 0.5669 0.4519 0.6026 0.0577  0.0642  0.0375  212 TRP A CE2   
1650 C  CE3   . TRP A 212 ? 0.5681 0.4481 0.6385 0.0382  0.0541  0.0423  212 TRP A CE3   
1651 C  CZ2   . TRP A 212 ? 0.5732 0.4632 0.6147 0.0637  0.0730  0.0554  212 TRP A CZ2   
1652 C  CZ3   . TRP A 212 ? 0.5708 0.4591 0.6540 0.0425  0.0626  0.0615  212 TRP A CZ3   
1653 C  CH2   . TRP A 212 ? 0.5737 0.4670 0.6411 0.0560  0.0735  0.0682  212 TRP A CH2   
1654 N  N     . GLY A 213 ? 0.6001 0.4208 0.6342 0.0331  0.0294  -0.0149 213 GLY A N     
1655 C  CA    . GLY A 213 ? 0.6669 0.4671 0.6925 0.0297  0.0210  -0.0245 213 GLY A CA    
1656 C  C     . GLY A 213 ? 0.6368 0.4340 0.6436 0.0324  0.0232  -0.0369 213 GLY A C     
1657 O  O     . GLY A 213 ? 0.7067 0.4855 0.7017 0.0301  0.0158  -0.0442 213 GLY A O     
1658 N  N     . LEU A 214 ? 0.6028 0.4158 0.6061 0.0379  0.0323  -0.0389 214 LEU A N     
1659 C  CA    . LEU A 214 ? 0.6079 0.4209 0.5976 0.0411  0.0364  -0.0481 214 LEU A CA    
1660 C  C     . LEU A 214 ? 0.7371 0.5478 0.7234 0.0504  0.0435  -0.0525 214 LEU A C     
1661 O  O     . LEU A 214 ? 0.8445 0.6680 0.8408 0.0541  0.0474  -0.0483 214 LEU A O     
1662 C  CB    . LEU A 214 ? 0.5821 0.4153 0.5749 0.0395  0.0401  -0.0456 214 LEU A CB    
1663 C  CG    . LEU A 214 ? 0.5783 0.4153 0.5751 0.0312  0.0347  -0.0409 214 LEU A CG    
1664 C  CD1   . LEU A 214 ? 0.6151 0.4708 0.6125 0.0313  0.0394  -0.0392 214 LEU A CD1   
1665 C  CD2   . LEU A 214 ? 0.6384 0.4565 0.6240 0.0270  0.0269  -0.0476 214 LEU A CD2   
1666 N  N     . THR A 215 ? 0.6251 0.4180 0.5967 0.0552  0.0449  -0.0603 215 THR A N     
1667 C  CA    . THR A 215 ? 0.7238 0.5139 0.6937 0.0653  0.0536  -0.0630 215 THR A CA    
1668 C  C     . THR A 215 ? 0.8485 0.6493 0.8165 0.0702  0.0628  -0.0651 215 THR A C     
1669 O  O     . THR A 215 ? 0.9236 0.7252 0.8826 0.0670  0.0621  -0.0676 215 THR A O     
1670 C  CB    . THR A 215 ? 0.6619 0.4234 0.6149 0.0707  0.0519  -0.0689 215 THR A CB    
1671 O  OG1   . THR A 215 ? 0.6811 0.4249 0.6119 0.0708  0.0486  -0.0758 215 THR A OG1   
1672 C  CG2   . THR A 215 ? 0.6695 0.4204 0.6287 0.0653  0.0418  -0.0658 215 THR A CG2   
1673 N  N     . THR A 216 ? 0.7779 0.5873 0.7572 0.0779  0.0710  -0.0627 216 THR A N     
1674 C  CA    . THR A 216 ? 0.6195 0.4403 0.6041 0.0834  0.0806  -0.0618 216 THR A CA    
1675 C  C     . THR A 216 ? 0.6662 0.4769 0.6498 0.0956  0.0914  -0.0616 216 THR A C     
1676 O  O     . THR A 216 ? 0.6649 0.4853 0.6687 0.0999  0.0946  -0.0563 216 THR A O     
1677 C  CB    . THR A 216 ? 0.6097 0.4549 0.6172 0.0804  0.0786  -0.0559 216 THR A CB    
1678 O  OG1   . THR A 216 ? 0.5824 0.4301 0.6025 0.0815  0.0745  -0.0521 216 THR A OG1   
1679 C  CG2   . THR A 216 ? 0.5721 0.4261 0.5764 0.0711  0.0712  -0.0559 216 THR A CG2   
1680 N  N     . PRO A 217 ? 0.6558 0.4451 0.6150 0.1026  0.0970  -0.0668 217 PRO A N     
1681 C  CA    . PRO A 217 ? 0.6779 0.4543 0.6322 0.1170  0.1096  -0.0659 217 PRO A CA    
1682 C  C     . PRO A 217 ? 0.7277 0.5250 0.7063 0.1243  0.1231  -0.0573 217 PRO A C     
1683 O  O     . PRO A 217 ? 0.8172 0.6299 0.8037 0.1211  0.1252  -0.0548 217 PRO A O     
1684 C  CB    . PRO A 217 ? 0.7128 0.4589 0.6288 0.1237  0.1114  -0.0738 217 PRO A CB    
1685 C  CG    . PRO A 217 ? 0.7021 0.4538 0.6109 0.1134  0.1034  -0.0768 217 PRO A CG    
1686 C  CD    . PRO A 217 ? 0.6705 0.4436 0.6033 0.0990  0.0916  -0.0736 217 PRO A CD    
1687 N  N     . ASP A 218 ? 0.7823 0.5801 0.7756 0.1341  0.1319  -0.0517 218 ASP A N     
1688 C  CA    . ASP A 218 ? 0.7660 0.5844 0.7906 0.1411  0.1439  -0.0407 218 ASP A CA    
1689 C  C     . ASP A 218 ? 0.8172 0.6314 0.8306 0.1519  0.1604  -0.0379 218 ASP A C     
1690 O  O     . ASP A 218 ? 0.8604 0.6956 0.9027 0.1543  0.1687  -0.0278 218 ASP A O     
1691 C  CB    . ASP A 218 ? 0.6667 0.4843 0.7095 0.1502  0.1501  -0.0345 218 ASP A CB    
1692 C  CG    . ASP A 218 ? 0.7356 0.5798 0.8237 0.1522  0.1546  -0.0214 218 ASP A CG    
1693 O  OD1   . ASP A 218 ? 0.7534 0.5996 0.8547 0.1656  0.1721  -0.0121 218 ASP A OD1   
1694 O  OD2   . ASP A 218 ? 0.7839 0.6458 0.8946 0.1412  0.1403  -0.0196 218 ASP A OD2   
1695 N  N     . LYS A 219 ? 0.7861 0.5717 0.7577 0.1589  0.1644  -0.0461 219 LYS A N     
1696 C  CA    . LYS A 219 ? 0.7886 0.5657 0.7422 0.1715  0.1808  -0.0437 219 LYS A CA    
1697 C  C     . LYS A 219 ? 0.8227 0.6194 0.7862 0.1618  0.1775  -0.0421 219 LYS A C     
1698 O  O     . LYS A 219 ? 0.9134 0.7158 0.8806 0.1711  0.1929  -0.0347 219 LYS A O     
1699 C  CB    . LYS A 219 ? 0.8558 0.5926 0.7560 0.1806  0.1806  -0.0549 219 LYS A CB    
1700 C  CG    . LYS A 219 ? 1.1138 0.8341 0.9852 0.1975  0.1984  -0.0531 219 LYS A CG    
1701 C  CD    . LYS A 219 ? 1.3069 1.0316 1.1940 0.2174  0.2237  -0.0394 219 LYS A CD    
1702 C  CE    . LYS A 219 ? 1.3257 1.0315 1.1803 0.2371  0.2440  -0.0361 219 LYS A CE    
1703 N  NZ    . LYS A 219 ? 1.3370 0.9948 1.1268 0.2470  0.2384  -0.0506 219 LYS A NZ    
1704 N  N     . LYS A 220 ? 0.8347 0.6416 0.8031 0.1444  0.1588  -0.0479 220 LYS A N     
1705 C  CA    . LYS A 220 ? 0.7991 0.6242 0.7767 0.1345  0.1540  -0.0470 220 LYS A CA    
1706 C  C     . LYS A 220 ? 0.7428 0.5969 0.7605 0.1234  0.1443  -0.0411 220 LYS A C     
1707 O  O     . LYS A 220 ? 0.6238 0.4894 0.6449 0.1119  0.1334  -0.0435 220 LYS A O     
1708 C  CB    . LYS A 220 ? 0.7984 0.6082 0.7442 0.1250  0.1406  -0.0582 220 LYS A CB    
1709 C  CG    . LYS A 220 ? 0.9300 0.7093 0.8333 0.1357  0.1469  -0.0645 220 LYS A CG    
1710 C  CD    . LYS A 220 ? 1.1171 0.8750 0.9920 0.1263  0.1288  -0.0757 220 LYS A CD    
1711 C  CE    . LYS A 220 ? 1.2895 1.0174 1.1214 0.1351  0.1306  -0.0825 220 LYS A CE    
1712 N  NZ    . LYS A 220 ? 1.3497 1.0921 1.1839 0.1334  0.1360  -0.0794 220 LYS A NZ    
1713 N  N     . HIS A 221 ? 0.6156 0.4796 0.6621 0.1278  0.1474  -0.0333 221 HIS A N     
1714 C  CA    . HIS A 221 ? 0.5878 0.4745 0.6704 0.1195  0.1361  -0.0277 221 HIS A CA    
1715 C  C     . HIS A 221 ? 0.5977 0.5026 0.7175 0.1261  0.1465  -0.0143 221 HIS A C     
1716 O  O     . HIS A 221 ? 0.7300 0.6366 0.8701 0.1358  0.1562  -0.0058 221 HIS A O     
1717 C  CB    . HIS A 221 ? 0.5875 0.4700 0.6759 0.1182  0.1276  -0.0288 221 HIS A CB    
1718 C  CG    . HIS A 221 ? 0.6268 0.5265 0.7432 0.1104  0.1129  -0.0249 221 HIS A CG    
1719 N  ND1   . HIS A 221 ? 0.7272 0.6241 0.8490 0.1089  0.1033  -0.0253 221 HIS A ND1   
1720 C  CD2   . HIS A 221 ? 0.6422 0.5587 0.7799 0.1047  0.1048  -0.0208 221 HIS A CD2   
1721 C  CE1   . HIS A 221 ? 0.5481 0.4579 0.6904 0.1035  0.0898  -0.0219 221 HIS A CE1   
1722 N  NE2   . HIS A 221 ? 0.5381 0.4593 0.6904 0.1007  0.0897  -0.0194 221 HIS A NE2   
1723 N  N     . GLN A 222 ? 0.5665 0.4855 0.6982 0.1209  0.1444  -0.0113 222 GLN A N     
1724 C  CA    . GLN A 222 ? 0.6243 0.5618 0.7959 0.1257  0.1529  0.0030  222 GLN A CA    
1725 C  C     . GLN A 222 ? 0.7161 0.6702 0.9278 0.1185  0.1359  0.0089  222 GLN A C     
1726 O  O     . GLN A 222 ? 0.9155 0.8713 1.1212 0.1076  0.1172  0.0018  222 GLN A O     
1727 C  CB    . GLN A 222 ? 0.5957 0.5393 0.7621 0.1234  0.1573  0.0038  222 GLN A CB    
1728 C  CG    . GLN A 222 ? 0.5756 0.4988 0.6942 0.1279  0.1671  -0.0056 222 GLN A CG    
1729 C  CD    . GLN A 222 ? 0.6728 0.6020 0.7888 0.1287  0.1749  -0.0022 222 GLN A CD    
1730 O  OE1   . GLN A 222 ? 0.7048 0.6509 0.8558 0.1327  0.1835  0.0113  222 GLN A OE1   
1731 N  NE2   . GLN A 222 ? 0.5862 0.5017 0.6631 0.1247  0.1713  -0.0134 222 GLN A NE2   
1732 N  N     . LYS A 223 ? 0.6789 0.6434 0.9308 0.1256  0.1421  0.0227  223 LYS A N     
1733 C  CA    . LYS A 223 ? 0.6787 0.6556 0.9702 0.1200  0.1238  0.0290  223 LYS A CA    
1734 C  C     . LYS A 223 ? 0.7331 0.7299 1.0771 0.1208  0.1241  0.0457  223 LYS A C     
1735 O  O     . LYS A 223 ? 0.8519 0.8571 1.2286 0.1144  0.1038  0.0502  223 LYS A O     
1736 C  CB    . LYS A 223 ? 0.7855 0.7566 1.0853 0.1258  0.1243  0.0314  223 LYS A CB    
1737 C  CG    . LYS A 223 ? 0.7668 0.7178 1.0200 0.1252  0.1234  0.0169  223 LYS A CG    
1738 C  CD    . LYS A 223 ? 0.8734 0.8189 1.1367 0.1320  0.1255  0.0204  223 LYS A CD    
1739 C  CE    . LYS A 223 ? 0.9269 0.8516 1.1461 0.1319  0.1256  0.0072  223 LYS A CE    
1740 N  NZ    . LYS A 223 ? 0.9250 0.8346 1.1090 0.1387  0.1429  0.0018  223 LYS A NZ    
1741 N  N     . GLU A 224 ? 0.7923 0.7953 1.1456 0.1290  0.1456  0.0555  224 GLU A N     
1742 C  CA    . GLU A 224 ? 0.8143 0.8375 1.2225 0.1302  0.1480  0.0741  224 GLU A CA    
1743 C  C     . GLU A 224 ? 0.7717 0.7988 1.1688 0.1301  0.1587  0.0751  224 GLU A C     
1744 O  O     . GLU A 224 ? 0.7599 0.7736 1.1115 0.1358  0.1746  0.0667  224 GLU A O     
1745 C  CB    . GLU A 224 ? 0.9260 0.9572 1.3722 0.1445  0.1690  0.0933  224 GLU A CB    
1746 C  CG    . GLU A 224 ? 1.0509 1.0792 1.5122 0.1460  0.1601  0.0943  224 GLU A CG    
1747 C  CD    . GLU A 224 ? 1.1995 1.2384 1.7034 0.1344  0.1298  0.0983  224 GLU A CD    
1748 O  OE1   . GLU A 224 ? 1.2923 1.3431 1.8257 0.1272  0.1179  0.1048  224 GLU A OE1   
1749 O  OE2   . GLU A 224 ? 1.2068 1.2398 1.7131 0.1331  0.1166  0.0949  224 GLU A OE2   
1750 N  N     . PRO A 225 ? 0.6529 0.6964 1.0907 0.1236  0.1487  0.0853  225 PRO A N     
1751 C  CA    . PRO A 225 ? 0.6471 0.6962 1.0809 0.1243  0.1602  0.0891  225 PRO A CA    
1752 C  C     . PRO A 225 ? 0.5583 0.6121 1.0054 0.1411  0.1934  0.1063  225 PRO A C     
1753 O  O     . PRO A 225 ? 0.6167 0.6771 1.0984 0.1505  0.2040  0.1211  225 PRO A O     
1754 C  CB    . PRO A 225 ? 0.6430 0.7081 1.1259 0.1134  0.1380  0.0978  225 PRO A CB    
1755 C  CG    . PRO A 225 ? 0.6910 0.7627 1.2198 0.1129  0.1244  0.1077  225 PRO A CG    
1756 C  CD    . PRO A 225 ? 0.5883 0.6437 1.0774 0.1154  0.1237  0.0937  225 PRO A CD    
1757 N  N     . PRO A 226 ? 0.6400 0.6893 1.0582 0.1463  0.2103  0.1050  226 PRO A N     
1758 C  CA    . PRO A 226 ? 0.7850 0.8269 1.1635 0.1356  0.1986  0.0884  226 PRO A CA    
1759 C  C     . PRO A 226 ? 0.6737 0.6919 0.9867 0.1342  0.1955  0.0661  226 PRO A C     
1760 O  O     . PRO A 226 ? 0.6873 0.6899 0.9706 0.1466  0.2130  0.0640  226 PRO A O     
1761 C  CB    . PRO A 226 ? 0.8740 0.9205 1.2531 0.1449  0.2216  0.0999  226 PRO A CB    
1762 C  CG    . PRO A 226 ? 0.8222 0.8646 1.2052 0.1649  0.2511  0.1139  226 PRO A CG    
1763 C  CD    . PRO A 226 ? 0.6307 0.6823 1.0570 0.1647  0.2436  0.1225  226 PRO A CD    
1764 N  N     . PHE A 227 ? 0.5403 0.5548 0.8323 0.1199  0.1729  0.0506  227 PHE A N     
1765 C  CA    . PHE A 227 ? 0.5958 0.5901 0.8325 0.1169  0.1680  0.0316  227 PHE A CA    
1766 C  C     . PHE A 227 ? 0.6761 0.6600 0.8734 0.1194  0.1787  0.0254  227 PHE A C     
1767 O  O     . PHE A 227 ? 0.8850 0.8792 1.0932 0.1159  0.1789  0.0298  227 PHE A O     
1768 C  CB    . PHE A 227 ? 0.5032 0.4979 0.7350 0.1023  0.1413  0.0201  227 PHE A CB    
1769 C  CG    . PHE A 227 ? 0.5497 0.5514 0.8158 0.0998  0.1272  0.0251  227 PHE A CG    
1770 C  CD1   . PHE A 227 ? 0.5218 0.5136 0.7780 0.1037  0.1275  0.0214  227 PHE A CD1   
1771 C  CD2   . PHE A 227 ? 0.6930 0.7090 1.0007 0.0938  0.1117  0.0333  227 PHE A CD2   
1772 C  CE1   . PHE A 227 ? 0.4974 0.4945 0.7841 0.1018  0.1136  0.0261  227 PHE A CE1   
1773 C  CE2   . PHE A 227 ? 0.4770 0.4962 0.8145 0.0918  0.0958  0.0376  227 PHE A CE2   
1774 C  CZ    . PHE A 227 ? 0.4849 0.4952 0.8116 0.0960  0.0972  0.0340  227 PHE A CZ    
1775 N  N     . LEU A 228 ? 0.5538 0.5156 0.7052 0.1256  0.1862  0.0151  228 LEU A N     
1776 C  CA    . LEU A 228 ? 0.5766 0.5233 0.6850 0.1280  0.1927  0.0072  228 LEU A CA    
1777 C  C     . LEU A 228 ? 0.5578 0.4987 0.6406 0.1133  0.1719  -0.0084 228 LEU A C     
1778 O  O     . LEU A 228 ? 0.7207 0.6495 0.7849 0.1099  0.1627  -0.0179 228 LEU A O     
1779 C  CB    . LEU A 228 ? 0.6055 0.5272 0.6768 0.1442  0.2102  0.0051  228 LEU A CB    
1780 C  CG    . LEU A 228 ? 0.7595 0.6857 0.8533 0.1622  0.2352  0.0228  228 LEU A CG    
1781 C  CD1   . LEU A 228 ? 0.7832 0.6787 0.8299 0.1808  0.2528  0.0194  228 LEU A CD1   
1782 C  CD2   . LEU A 228 ? 0.8116 0.7561 0.9322 0.1638  0.2452  0.0364  228 LEU A CD2   
1783 N  N     . TRP A 229 ? 0.5440 0.4940 0.6281 0.1050  0.1652  -0.0097 229 TRP A N     
1784 C  CA    . TRP A 229 ? 0.6015 0.5505 0.6700 0.0913  0.1463  -0.0212 229 TRP A CA    
1785 C  C     . TRP A 229 ? 0.6001 0.5486 0.6512 0.0881  0.1471  -0.0239 229 TRP A C     
1786 O  O     . TRP A 229 ? 0.5202 0.4833 0.5942 0.0880  0.1510  -0.0155 229 TRP A O     
1787 C  CB    . TRP A 229 ? 0.5537 0.5194 0.6550 0.0821  0.1303  -0.0187 229 TRP A CB    
1788 C  CG    . TRP A 229 ? 0.5911 0.5563 0.6773 0.0707  0.1133  -0.0281 229 TRP A CG    
1789 C  CD1   . TRP A 229 ? 0.5409 0.4955 0.6054 0.0664  0.1046  -0.0367 229 TRP A CD1   
1790 C  CD2   . TRP A 229 ? 0.6588 0.6342 0.7519 0.0632  0.1041  -0.0282 229 TRP A CD2   
1791 N  NE1   . TRP A 229 ? 0.4832 0.4416 0.5410 0.0578  0.0923  -0.0411 229 TRP A NE1   
1792 C  CE2   . TRP A 229 ? 0.5200 0.4902 0.5932 0.0559  0.0915  -0.0368 229 TRP A CE2   
1793 C  CE3   . TRP A 229 ? 0.6816 0.6696 0.7968 0.0626  0.1057  -0.0210 229 TRP A CE3   
1794 C  CZ2   . TRP A 229 ? 0.4616 0.4378 0.5334 0.0491  0.0814  -0.0388 229 TRP A CZ2   
1795 C  CZ3   . TRP A 229 ? 0.6319 0.6252 0.7455 0.0547  0.0937  -0.0242 229 TRP A CZ3   
1796 C  CH2   . TRP A 229 ? 0.5937 0.5805 0.6843 0.0486  0.0821  -0.0333 229 TRP A CH2   
1797 N  N     . MET A 230 ? 0.6404 0.5718 0.6533 0.0855  0.1425  -0.0347 230 MET A N     
1798 C  CA    . MET A 230 ? 0.6534 0.5833 0.6482 0.0804  0.1392  -0.0387 230 MET A CA    
1799 C  C     . MET A 230 ? 0.6753 0.6045 0.6667 0.0903  0.1557  -0.0315 230 MET A C     
1800 O  O     . MET A 230 ? 0.7978 0.7335 0.7880 0.0862  0.1542  -0.0309 230 MET A O     
1801 C  CB    . MET A 230 ? 0.5131 0.4609 0.5276 0.0679  0.1250  -0.0391 230 MET A CB    
1802 C  CG    . MET A 230 ? 0.5034 0.4498 0.5152 0.0597  0.1102  -0.0454 230 MET A CG    
1803 S  SD    . MET A 230 ? 0.7245 0.6504 0.6983 0.0560  0.1040  -0.0556 230 MET A SD    
1804 C  CE    . MET A 230 ? 0.7078 0.6388 0.6725 0.0497  0.1005  -0.0569 230 MET A CE    
1805 N  N     . GLY A 231 ? 0.6179 0.5385 0.6067 0.1048  0.1726  -0.0251 231 GLY A N     
1806 C  CA    . GLY A 231 ? 0.6810 0.6002 0.6668 0.1173  0.1917  -0.0156 231 GLY A CA    
1807 C  C     . GLY A 231 ? 0.6730 0.6183 0.7086 0.1187  0.2005  0.0006  231 GLY A C     
1808 O  O     . GLY A 231 ? 0.6893 0.6379 0.7284 0.1271  0.2156  0.0105  231 GLY A O     
1809 N  N     . TYR A 232 ? 0.6240 0.5866 0.6987 0.1112  0.1906  0.0044  232 TYR A N     
1810 C  CA    . TYR A 232 ? 0.6002 0.5866 0.7282 0.1110  0.1939  0.0202  232 TYR A CA    
1811 C  C     . TYR A 232 ? 0.7024 0.6925 0.8580 0.1188  0.2011  0.0295  232 TYR A C     
1812 O  O     . TYR A 232 ? 0.5530 0.5272 0.6843 0.1243  0.2039  0.0228  232 TYR A O     
1813 C  CB    . TYR A 232 ? 0.5653 0.5670 0.7170 0.0948  0.1712  0.0168  232 TYR A CB    
1814 C  CG    . TYR A 232 ? 0.7123 0.7106 0.8371 0.0865  0.1629  0.0072  232 TYR A CG    
1815 C  CD1   . TYR A 232 ? 0.6985 0.6843 0.7880 0.0792  0.1503  -0.0081 232 TYR A CD1   
1816 C  CD2   . TYR A 232 ? 0.5834 0.5918 0.7213 0.0863  0.1680  0.0149  232 TYR A CD2   
1817 C  CE1   . TYR A 232 ? 0.6187 0.6023 0.6872 0.0720  0.1430  -0.0153 232 TYR A CE1   
1818 C  CE2   . TYR A 232 ? 0.5349 0.5404 0.6491 0.0790  0.1604  0.0065  232 TYR A CE2   
1819 C  CZ    . TYR A 232 ? 0.6426 0.6358 0.7224 0.0720  0.1480  -0.0085 232 TYR A CZ    
1820 O  OH    . TYR A 232 ? 0.7364 0.7276 0.7960 0.0650  0.1408  -0.0154 232 TYR A OH    
1821 N  N     . GLU A 233 ? 0.6832 0.6944 0.8927 0.1191  0.2032  0.0459  233 GLU A N     
1822 C  CA    . GLU A 233 ? 0.5916 0.6106 0.8385 0.1244  0.2066  0.0569  233 GLU A CA    
1823 C  C     . GLU A 233 ? 0.5855 0.6221 0.8782 0.1107  0.1828  0.0601  233 GLU A C     
1824 O  O     . GLU A 233 ? 0.7282 0.7812 1.0611 0.1077  0.1805  0.0726  233 GLU A O     
1825 C  CB    . GLU A 233 ? 0.6327 0.6581 0.9050 0.1415  0.2344  0.0779  233 GLU A CB    
1826 C  CG    . GLU A 233 ? 0.8559 0.8580 1.0767 0.1587  0.2582  0.0748  233 GLU A CG    
1827 C  CD    . GLU A 233 ? 0.9804 0.9833 1.2216 0.1785  0.2848  0.0933  233 GLU A CD    
1828 O  OE1   . GLU A 233 ? 0.9802 1.0050 1.2819 0.1777  0.2850  0.1104  233 GLU A OE1   
1829 O  OE2   . GLU A 233 ? 0.9880 0.9678 1.1843 0.1957  0.3048  0.0913  233 GLU A OE2   
1830 N  N     . LEU A 234 ? 0.5005 0.5316 0.7859 0.1032  0.1642  0.0489  234 LEU A N     
1831 C  CA    . LEU A 234 ? 0.4916 0.5321 0.8077 0.0914  0.1383  0.0485  234 LEU A CA    
1832 C  C     . LEU A 234 ? 0.6282 0.6803 0.9980 0.0953  0.1371  0.0643  234 LEU A C     
1833 O  O     . LEU A 234 ? 0.5835 0.6298 0.9505 0.1004  0.1405  0.0635  234 LEU A O     
1834 C  CB    . LEU A 234 ? 0.4671 0.4944 0.7468 0.0833  0.1198  0.0301  234 LEU A CB    
1835 C  CG    . LEU A 234 ? 0.4701 0.4851 0.6983 0.0795  0.1205  0.0151  234 LEU A CG    
1836 C  CD1   . LEU A 234 ? 0.4651 0.4710 0.6696 0.0716  0.1015  0.0016  234 LEU A CD1   
1837 C  CD2   . LEU A 234 ? 0.5048 0.5273 0.7358 0.0753  0.1201  0.0171  234 LEU A CD2   
1838 N  N     . HIS A 235 ? 0.6470 0.7153 1.0676 0.0926  0.1315  0.0793  235 HIS A N     
1839 C  CA    . HIS A 235 ? 0.4556 0.5364 0.9364 0.0934  0.1239  0.0958  235 HIS A CA    
1840 C  C     . HIS A 235 ? 0.5129 0.5906 1.0060 0.0810  0.0885  0.0882  235 HIS A C     
1841 O  O     . HIS A 235 ? 0.5030 0.5707 0.9598 0.0731  0.0731  0.0722  235 HIS A O     
1842 C  CB    . HIS A 235 ? 0.6089 0.7085 1.1430 0.0983  0.1380  0.1193  235 HIS A CB    
1843 C  CG    . HIS A 235 ? 0.6095 0.7099 1.1322 0.1143  0.1748  0.1297  235 HIS A CG    
1844 N  ND1   . HIS A 235 ? 0.4783 0.5712 0.9577 0.1186  0.1915  0.1234  235 HIS A ND1   
1845 C  CD2   . HIS A 235 ? 0.5535 0.6588 1.0994 0.1286  0.1980  0.1460  235 HIS A CD2   
1846 C  CE1   . HIS A 235 ? 0.5403 0.6312 1.0134 0.1356  0.2229  0.1348  235 HIS A CE1   
1847 N  NE2   . HIS A 235 ? 0.5877 0.6862 1.1004 0.1425  0.2285  0.1490  235 HIS A NE2   
1848 N  N     . PRO A 236 ? 0.6141 0.6983 1.1563 0.0802  0.0742  0.0996  236 PRO A N     
1849 C  CA    . PRO A 236 ? 0.5905 0.6664 1.1387 0.0702  0.0379  0.0915  236 PRO A CA    
1850 C  C     . PRO A 236 ? 0.5884 0.6647 1.1440 0.0615  0.0193  0.0900  236 PRO A C     
1851 O  O     . PRO A 236 ? 0.5288 0.5900 1.0499 0.0554  -0.0028 0.0738  236 PRO A O     
1852 C  CB    . PRO A 236 ? 0.5016 0.5862 1.1108 0.0721  0.0283  0.1086  236 PRO A CB    
1853 C  CG    . PRO A 236 ? 0.4608 0.5516 1.0713 0.0838  0.0599  0.1170  236 PRO A CG    
1854 C  CD    . PRO A 236 ? 0.5764 0.6710 1.1613 0.0897  0.0894  0.1178  236 PRO A CD    
1855 N  N     . ASP A 237 ? 0.6512 0.7436 1.2504 0.0619  0.0284  0.1071  237 ASP A N     
1856 C  CA    . ASP A 237 ? 0.6104 0.7034 1.2237 0.0536  0.0092  0.1076  237 ASP A CA    
1857 C  C     . ASP A 237 ? 0.5299 0.6295 1.1239 0.0550  0.0313  0.1080  237 ASP A C     
1858 O  O     . ASP A 237 ? 0.5004 0.6017 1.1074 0.0485  0.0181  0.1096  237 ASP A O     
1859 C  CB    . ASP A 237 ? 0.7291 0.8346 1.4212 0.0505  -0.0076 0.1295  237 ASP A CB    
1860 C  CG    . ASP A 237 ? 0.8938 0.9897 1.6062 0.0479  -0.0366 0.1285  237 ASP A CG    
1861 O  OD1   . ASP A 237 ? 0.9735 1.0483 1.6398 0.0445  -0.0585 0.1085  237 ASP A OD1   
1862 O  OD2   . ASP A 237 ? 0.9420 1.0508 1.7165 0.0501  -0.0370 0.1487  237 ASP A OD2   
1863 N  N     . LYS A 238 ? 0.4538 0.5548 1.0157 0.0636  0.0629  0.1063  238 LYS A N     
1864 C  CA    . LYS A 238 ? 0.4852 0.5902 1.0264 0.0663  0.0839  0.1070  238 LYS A CA    
1865 C  C     . LYS A 238 ? 0.4953 0.5887 0.9748 0.0733  0.1058  0.0934  238 LYS A C     
1866 O  O     . LYS A 238 ? 0.5070 0.5916 0.9665 0.0766  0.1072  0.0861  238 LYS A O     
1867 C  CB    . LYS A 238 ? 0.4256 0.5500 1.0223 0.0733  0.1044  0.1332  238 LYS A CB    
1868 C  CG    . LYS A 238 ? 0.5902 0.7197 1.1971 0.0875  0.1336  0.1462  238 LYS A CG    
1869 C  CD    . LYS A 238 ? 0.6737 0.8230 1.3379 0.0963  0.1560  0.1751  238 LYS A CD    
1870 C  CE    . LYS A 238 ? 0.7971 0.9494 1.4687 0.1131  0.1867  0.1888  238 LYS A CE    
1871 N  NZ    . LYS A 238 ? 0.9114 1.0836 1.6410 0.1242  0.2120  0.2202  238 LYS A NZ    
1872 N  N     . TRP A 239 ? 0.5373 0.6293 0.9869 0.0755  0.1215  0.0901  239 TRP A N     
1873 C  CA    . TRP A 239 ? 0.5285 0.6074 0.9213 0.0827  0.1412  0.0787  239 TRP A CA    
1874 C  C     . TRP A 239 ? 0.5379 0.6207 0.9256 0.0913  0.1662  0.0886  239 TRP A C     
1875 O  O     . TRP A 239 ? 0.6624 0.7568 1.0786 0.0878  0.1642  0.0985  239 TRP A O     
1876 C  CB    . TRP A 239 ? 0.5276 0.5916 0.8675 0.0740  0.1254  0.0558  239 TRP A CB    
1877 C  CG    . TRP A 239 ? 0.5324 0.5984 0.8648 0.0657  0.1146  0.0510  239 TRP A CG    
1878 C  CD1   . TRP A 239 ? 0.5691 0.6371 0.9180 0.0558  0.0893  0.0481  239 TRP A CD1   
1879 C  CD2   . TRP A 239 ? 0.5390 0.6028 0.8428 0.0674  0.1280  0.0483  239 TRP A CD2   
1880 N  NE1   . TRP A 239 ? 0.4205 0.4889 0.7544 0.0512  0.0873  0.0440  239 TRP A NE1   
1881 C  CE2   . TRP A 239 ? 0.4281 0.4950 0.7358 0.0576  0.1108  0.0444  239 TRP A CE2   
1882 C  CE3   . TRP A 239 ? 0.4550 0.5117 0.7279 0.0771  0.1519  0.0486  239 TRP A CE3   
1883 C  CZ2   . TRP A 239 ? 0.4963 0.5624 0.7815 0.0564  0.1174  0.0414  239 TRP A CZ2   
1884 C  CZ3   . TRP A 239 ? 0.5705 0.6248 0.8194 0.0760  0.1571  0.0453  239 TRP A CZ3   
1885 C  CH2   . TRP A 239 ? 0.5188 0.5793 0.7757 0.0653  0.1403  0.0420  239 TRP A CH2   
1886 N  N     . THR A 240 ? 0.5090 0.5798 0.8584 0.1033  0.1892  0.0859  240 THR A N     
1887 C  CA    . THR A 240 ? 0.7333 0.8021 1.0663 0.1144  0.2139  0.0937  240 THR A CA    
1888 C  C     . THR A 240 ? 0.7306 0.7753 0.9943 0.1200  0.2220  0.0763  240 THR A C     
1889 O  O     . THR A 240 ? 0.7333 0.7651 0.9706 0.1184  0.2143  0.0631  240 THR A O     
1890 C  CB    . THR A 240 ? 0.8701 0.9495 1.2430 0.1302  0.2402  0.1185  240 THR A CB    
1891 O  OG1   . THR A 240 ? 1.1321 1.2112 1.4939 0.1407  0.2627  0.1286  240 THR A OG1   
1892 C  CG2   . THR A 240 ? 0.7650 0.8309 1.1159 0.1434  0.2551  0.1170  240 THR A CG2   
1893 N  N     . VAL A 241 ? 0.8140 0.8515 1.0492 0.1264  0.2359  0.0768  241 VAL A N     
1894 C  CA    . VAL A 241 ? 0.8023 0.8141 0.9717 0.1322  0.2415  0.0612  241 VAL A CA    
1895 C  C     . VAL A 241 ? 0.8179 0.8153 0.9690 0.1538  0.2690  0.0702  241 VAL A C     
1896 O  O     . VAL A 241 ? 0.9521 0.9608 1.1363 0.1662  0.2900  0.0911  241 VAL A O     
1897 C  CB    . VAL A 241 ? 0.7731 0.7813 0.9166 0.1278  0.2391  0.0556  241 VAL A CB    
1898 C  CG1   . VAL A 241 ? 0.7009 0.7173 0.8628 0.1402  0.2622  0.0750  241 VAL A CG1   
1899 C  CG2   . VAL A 241 ? 0.9037 0.8841 0.9816 0.1300  0.2366  0.0373  241 VAL A CG2   
1900 N  N     . GLN A 242 ? 0.8911 0.8621 0.9901 0.1593  0.2689  0.0554  242 GLN A N     
1901 C  CA    . GLN A 242 ? 1.0154 0.9657 1.0860 0.1818  0.2937  0.0613  242 GLN A CA    
1902 C  C     . GLN A 242 ? 1.0309 0.9726 1.0792 0.1969  0.3153  0.0707  242 GLN A C     
1903 O  O     . GLN A 242 ? 1.0330 0.9759 1.0684 0.1884  0.3066  0.0650  242 GLN A O     
1904 C  CB    . GLN A 242 ? 1.1978 1.1173 1.2124 0.1831  0.2844  0.0412  242 GLN A CB    
1905 C  CG    . GLN A 242 ? 1.2728 1.1994 1.3078 0.1709  0.2665  0.0338  242 GLN A CG    
1906 C  CD    . GLN A 242 ? 1.2701 1.1668 1.2541 0.1718  0.2569  0.0155  242 GLN A CD    
1907 O  OE1   . GLN A 242 ? 1.3485 1.2166 1.2805 0.1817  0.2620  0.0077  242 GLN A OE1   
1908 N  NE2   . GLN A 242 ? 1.1651 1.0666 1.1639 0.1616  0.2417  0.0091  242 GLN A NE2   
1909 N  N     . PRO A 243 ? 0.9205 0.8532 0.9640 0.2206  0.3446  0.0863  243 PRO A N     
1910 C  CA    . PRO A 243 ? 0.9920 0.9196 1.0215 0.2373  0.3685  0.1000  243 PRO A CA    
1911 C  C     . PRO A 243 ? 1.0982 0.9966 1.0595 0.2379  0.3607  0.0821  243 PRO A C     
1912 O  O     . PRO A 243 ? 1.1363 1.0065 1.0465 0.2365  0.3468  0.0618  243 PRO A O     
1913 C  CB    . PRO A 243 ? 1.0444 0.9581 1.0651 0.2655  0.4005  0.1158  243 PRO A CB    
1914 C  CG    . PRO A 243 ? 1.0225 0.9530 1.0889 0.2591  0.3943  0.1196  243 PRO A CG    
1915 C  CD    . PRO A 243 ? 0.8582 0.7871 0.9135 0.2344  0.3589  0.0948  243 PRO A CD    
1916 N  N     . ILE A 244 ? 1.1121 1.0175 1.0756 0.2398  0.3686  0.0906  244 ILE A N     
1917 C  CA    . ILE A 244 ? 1.1123 0.9927 1.0170 0.2403  0.3613  0.0763  244 ILE A CA    
1918 C  C     . ILE A 244 ? 1.1993 1.0616 1.0736 0.2681  0.3930  0.0916  244 ILE A C     
1919 O  O     . ILE A 244 ? 1.2938 1.1798 1.2103 0.2729  0.4106  0.1136  244 ILE A O     
1920 C  CB    . ILE A 244 ? 1.0666 0.9701 0.9970 0.2164  0.3396  0.0710  244 ILE A CB    
1921 C  CG1   . ILE A 244 ? 0.9927 0.9134 0.9532 0.1920  0.3110  0.0582  244 ILE A CG1   
1922 C  CG2   . ILE A 244 ? 1.1485 1.0258 1.0190 0.2169  0.3311  0.0566  244 ILE A CG2   
1923 C  CD1   . ILE A 244 ? 0.8439 0.7863 0.8302 0.1702  0.2903  0.0537  244 ILE A CD1   
1924 N  N     . VAL A 245 ? 1.2477 1.0667 1.0494 0.2852  0.3963  0.0807  245 VAL A N     
1925 C  CA    . VAL A 245 ? 1.2695 1.0639 1.0341 0.3056  0.4116  0.0938  245 VAL A CA    
1926 C  C     . VAL A 245 ? 1.2918 1.0646 1.0060 0.3044  0.4008  0.0816  245 VAL A C     
1927 O  O     . VAL A 245 ? 1.2579 1.0032 0.9220 0.2995  0.3808  0.0580  245 VAL A O     
1928 C  CB    . VAL A 245 ? 1.2150 0.9725 0.9329 0.3242  0.4167  0.0916  245 VAL A CB    
1929 C  CG1   . VAL A 245 ? 1.2597 0.9904 0.9391 0.3476  0.4341  0.1073  245 VAL A CG1   
1930 C  CG2   . VAL A 245 ? 1.0987 0.8783 0.8675 0.3239  0.4259  0.1026  245 VAL A CG2   
1931 N  N     . LEU A 246 ? 1.3297 1.1143 1.0588 0.3086  0.4127  0.0983  246 LEU A N     
1932 C  CA    . LEU A 246 ? 1.4661 1.2302 1.1484 0.3088  0.4035  0.0887  246 LEU A CA    
1933 C  C     . LEU A 246 ? 1.6920 1.4072 1.3022 0.3322  0.4078  0.0882  246 LEU A C     
1934 O  O     . LEU A 246 ? 1.5730 1.2811 1.1848 0.3512  0.4284  0.1076  246 LEU A O     
1935 C  CB    . LEU A 246 ? 1.4126 1.2080 1.1395 0.3039  0.4136  0.1067  246 LEU A CB    
1936 C  CG    . LEU A 246 ? 1.3263 1.1670 1.1201 0.2803  0.4059  0.1064  246 LEU A CG    
1937 C  CD1   . LEU A 246 ? 1.3047 1.1685 1.1314 0.2766  0.4129  0.1223  246 LEU A CD1   
1938 C  CD2   . LEU A 246 ? 1.3408 1.1745 1.1109 0.2617  0.3783  0.0787  246 LEU A CD2   
1939 N  N     . PRO A 247 ? 1.9814 1.6610 1.5283 0.3316  0.3877  0.0671  247 PRO A N     
1940 C  CA    . PRO A 247 ? 2.0729 1.7015 1.5481 0.3542  0.3879  0.0652  247 PRO A CA    
1941 C  C     . PRO A 247 ? 2.0620 1.6857 1.5304 0.3724  0.4085  0.0870  247 PRO A C     
1942 O  O     . PRO A 247 ? 2.1113 1.7406 1.5774 0.3671  0.4045  0.0868  247 PRO A O     
1943 C  CB    . PRO A 247 ? 2.1337 1.7321 1.5558 0.3442  0.3571  0.0384  247 PRO A CB    
1944 C  CG    . PRO A 247 ? 2.0584 1.6885 1.5218 0.3180  0.3421  0.0249  247 PRO A CG    
1945 C  CD    . PRO A 247 ? 1.9696 1.6517 1.5081 0.3105  0.3622  0.0445  247 PRO A CD    
1946 N  N     . GLU A 248 ? 1.9822 1.5948 1.4474 0.3946  0.4312  0.1066  248 GLU A N     
1947 C  CA    . GLU A 248 ? 1.8764 1.4803 1.3329 0.4153  0.4530  0.1297  248 GLU A CA    
1948 C  C     . GLU A 248 ? 1.9493 1.4955 1.3184 0.4346  0.4436  0.1192  248 GLU A C     
1949 O  O     . GLU A 248 ? 1.9623 1.4704 1.2846 0.4524  0.4444  0.1168  248 GLU A O     
1950 C  CB    . GLU A 248 ? 1.8192 1.4351 1.3112 0.4315  0.4817  0.1572  248 GLU A CB    
1951 C  CG    . GLU A 248 ? 1.9174 1.5296 1.4122 0.4528  0.5072  0.1855  248 GLU A CG    
1952 C  CD    . GLU A 248 ? 1.8320 1.4802 1.3742 0.4384  0.5085  0.1940  248 GLU A CD    
1953 O  OE1   . GLU A 248 ? 1.7911 1.4226 1.2949 0.4369  0.4963  0.1822  248 GLU A OE1   
1954 O  OE2   . GLU A 248 ? 1.7221 1.4145 1.3409 0.4282  0.5202  0.2126  248 GLU A OE2   
1955 N  N     . LYS A 249 ? 2.0335 1.5719 1.3804 0.4313  0.4335  0.1132  249 LYS A N     
1956 C  CA    . LYS A 249 ? 2.1396 1.6235 1.4057 0.4471  0.4200  0.1019  249 LYS A CA    
1957 C  C     . LYS A 249 ? 2.1450 1.6264 1.4049 0.4608  0.4354  0.1193  249 LYS A C     
1958 O  O     . LYS A 249 ? 2.1365 1.6592 1.4562 0.4561  0.4546  0.1391  249 LYS A O     
1959 C  CB    . LYS A 249 ? 2.1981 1.6687 1.4360 0.4265  0.3839  0.0715  249 LYS A CB    
1960 C  CG    . LYS A 249 ? 2.3493 1.7571 1.5033 0.4412  0.3626  0.0554  249 LYS A CG    
1961 C  CD    . LYS A 249 ? 2.3617 1.7600 1.4973 0.4187  0.3258  0.0282  249 LYS A CD    
1962 C  CE    . LYS A 249 ? 2.4881 1.8228 1.5446 0.4322  0.3009  0.0129  249 LYS A CE    
1963 N  NZ    . LYS A 249 ? 2.5059 1.8312 1.5495 0.4093  0.2629  -0.0118 249 LYS A NZ    
1964 N  N     . ASP A 250 ? 2.1493 1.5805 1.3370 0.4782  0.4255  0.1123  250 ASP A N     
1965 C  CA    . ASP A 250 ? 2.2145 1.6351 1.3854 0.4941  0.4383  0.1271  250 ASP A CA    
1966 C  C     . ASP A 250 ? 2.3826 1.7942 1.5280 0.4806  0.4128  0.1087  250 ASP A C     
1967 O  O     . ASP A 250 ? 2.3703 1.8003 1.5358 0.4795  0.4221  0.1197  250 ASP A O     
1968 C  CB    . ASP A 250 ? 2.1890 1.5550 1.2941 0.5308  0.4515  0.1383  250 ASP A CB    
1969 C  CG    . ASP A 250 ? 2.1318 1.5055 1.2613 0.5473  0.4802  0.1606  250 ASP A CG    
1970 O  OD1   . ASP A 250 ? 2.0387 1.4366 1.2094 0.5579  0.5095  0.1885  250 ASP A OD1   
1971 O  OD2   . ASP A 250 ? 2.1927 1.5481 1.3019 0.5497  0.4730  0.1509  250 ASP A OD2   
1972 N  N     . SER A 251 ? 2.5217 1.9048 1.6248 0.4701  0.3803  0.0819  251 SER A N     
1973 C  CA    . SER A 251 ? 2.5116 1.8856 1.5926 0.4552  0.3527  0.0638  251 SER A CA    
1974 C  C     . SER A 251 ? 2.4383 1.8237 1.5327 0.4273  0.3237  0.0396  251 SER A C     
1975 O  O     . SER A 251 ? 2.5193 1.8672 1.5709 0.4299  0.3024  0.0236  251 SER A O     
1976 C  CB    . SER A 251 ? 2.6049 1.9160 1.6045 0.4779  0.3394  0.0578  251 SER A CB    
1977 O  OG    . SER A 251 ? 2.6497 1.9162 1.6000 0.4893  0.3252  0.0465  251 SER A OG    
1978 N  N     . TRP A 252 ? 2.2301 1.6658 1.3841 0.4015  0.3226  0.0379  252 TRP A N     
1979 C  CA    . TRP A 252 ? 2.0517 1.5020 1.2244 0.3756  0.2984  0.0176  252 TRP A CA    
1980 C  C     . TRP A 252 ? 2.0308 1.4500 1.1595 0.3651  0.2623  -0.0043 252 TRP A C     
1981 O  O     . TRP A 252 ? 1.9922 1.3934 1.0919 0.3715  0.2569  -0.0033 252 TRP A O     
1982 C  CB    . TRP A 252 ? 1.8461 1.3574 1.0943 0.3532  0.3091  0.0238  252 TRP A CB    
1983 C  CG    . TRP A 252 ? 1.7239 1.2672 1.0234 0.3573  0.3361  0.0410  252 TRP A CG    
1984 C  CD1   . TRP A 252 ? 1.6930 1.2516 1.0200 0.3474  0.3339  0.0350  252 TRP A CD1   
1985 C  CD2   . TRP A 252 ? 1.6739 1.2371 1.0058 0.3723  0.3682  0.0681  252 TRP A CD2   
1986 N  NE1   . TRP A 252 ? 1.6850 1.2720 1.0596 0.3549  0.3618  0.0564  252 TRP A NE1   
1987 C  CE2   . TRP A 252 ? 1.7099 1.3003 1.0898 0.3699  0.3829  0.0775  252 TRP A CE2   
1988 C  CE3   . TRP A 252 ? 1.7112 1.2712 1.0379 0.3876  0.3854  0.0862  252 TRP A CE3   
1989 C  CZ2   . TRP A 252 ? 1.7310 1.3456 1.1555 0.3814  0.4127  0.1048  252 TRP A CZ2   
1990 C  CZ3   . TRP A 252 ? 1.7531 1.3370 1.1237 0.3995  0.4160  0.1135  252 TRP A CZ3   
1991 C  CH2   . TRP A 252 ? 1.7430 1.3539 1.1630 0.3960  0.4288  0.1229  252 TRP A CH2   
1992 N  N     . THR A 253 ? 2.0938 1.5065 1.2199 0.3488  0.2368  -0.0233 253 THR A N     
1993 C  CA    . THR A 253 ? 2.1057 1.4918 1.2001 0.3353  0.1989  -0.0439 253 THR A CA    
1994 C  C     . THR A 253 ? 2.0644 1.4911 1.2073 0.3053  0.1866  -0.0533 253 THR A C     
1995 O  O     . THR A 253 ? 2.0745 1.5471 1.2718 0.2963  0.2070  -0.0447 253 THR A O     
1996 C  CB    . THR A 253 ? 2.1533 1.4906 1.2005 0.3425  0.1754  -0.0575 253 THR A CB    
1997 O  OG1   . THR A 253 ? 2.1307 1.4875 1.2097 0.3328  0.1779  -0.0616 253 THR A OG1   
1998 C  CG2   . THR A 253 ? 2.2026 1.4972 1.1985 0.3745  0.1890  -0.0473 253 THR A CG2   
1999 N  N     . VAL A 254 ? 2.0230 1.4310 1.1463 0.2903  0.1518  -0.0701 254 VAL A N     
2000 C  CA    . VAL A 254 ? 1.8504 1.2912 1.0142 0.2628  0.1375  -0.0793 254 VAL A CA    
2001 C  C     . VAL A 254 ? 1.8785 1.3363 1.0727 0.2538  0.1398  -0.0841 254 VAL A C     
2002 O  O     . VAL A 254 ? 1.8414 1.3453 1.0918 0.2369  0.1483  -0.0803 254 VAL A O     
2003 C  CB    . VAL A 254 ? 1.6952 1.1080 0.8318 0.2495  0.0972  -0.0951 254 VAL A CB    
2004 C  CG1   . VAL A 254 ? 1.6230 1.0687 0.8057 0.2206  0.0802  -0.1031 254 VAL A CG1   
2005 C  CG2   . VAL A 254 ? 1.6244 1.0270 0.7381 0.2565  0.0964  -0.0898 254 VAL A CG2   
2006 N  N     . ASN A 255 ? 1.9480 1.3716 1.1128 0.2635  0.1303  -0.0904 255 ASN A N     
2007 C  CA    . ASN A 255 ? 1.9735 1.4104 1.1648 0.2563  0.1324  -0.0948 255 ASN A CA    
2008 C  C     . ASN A 255 ? 1.9918 1.4632 1.2201 0.2664  0.1710  -0.0779 255 ASN A C     
2009 O  O     . ASN A 255 ? 1.9557 1.4575 1.2261 0.2554  0.1784  -0.0782 255 ASN A O     
2010 C  CB    . ASN A 255 ? 2.0826 1.4719 1.2318 0.2643  0.1106  -0.1054 255 ASN A CB    
2011 C  CG    . ASN A 255 ? 2.0236 1.4233 1.1989 0.2531  0.1054  -0.1130 255 ASN A CG    
2012 O  OD1   . ASN A 255 ? 2.0464 1.4426 1.2305 0.2337  0.0770  -0.1262 255 ASN A OD1   
2013 N  ND2   . ASN A 255 ? 1.9333 1.3455 1.1231 0.2654  0.1324  -0.1035 255 ASN A ND2   
2014 N  N     . ASP A 256 ? 2.0595 1.5261 1.2747 0.2874  0.1952  -0.0621 256 ASP A N     
2015 C  CA    . ASP A 256 ? 2.0349 1.5340 1.2902 0.2971  0.2306  -0.0433 256 ASP A CA    
2016 C  C     . ASP A 256 ? 1.9427 1.4948 1.2573 0.2833  0.2467  -0.0328 256 ASP A C     
2017 O  O     . ASP A 256 ? 1.9127 1.5004 1.2773 0.2818  0.2681  -0.0210 256 ASP A O     
2018 C  CB    . ASP A 256 ? 2.1358 1.6101 1.3584 0.3250  0.2507  -0.0278 256 ASP A CB    
2019 C  CG    . ASP A 256 ? 2.2635 1.6861 1.4299 0.3415  0.2389  -0.0355 256 ASP A CG    
2020 O  OD1   . ASP A 256 ? 2.3137 1.7066 1.4487 0.3325  0.2065  -0.0546 256 ASP A OD1   
2021 O  OD2   . ASP A 256 ? 2.3217 1.7328 1.4768 0.3636  0.2613  -0.0214 256 ASP A OD2   
2022 N  N     . ILE A 257 ? 1.8739 1.4312 1.1852 0.2733  0.2358  -0.0363 257 ILE A N     
2023 C  CA    . ILE A 257 ? 1.7480 1.3545 1.1157 0.2589  0.2480  -0.0270 257 ILE A CA    
2024 C  C     . ILE A 257 ? 1.6250 1.2684 1.0526 0.2294  0.2284  -0.0336 257 ILE A C     
2025 O  O     . ILE A 257 ? 1.6794 1.3673 1.1699 0.2192  0.2406  -0.0222 257 ILE A O     
2026 C  CB    . ILE A 257 ? 1.7746 1.3776 1.1264 0.2539  0.2374  -0.0282 257 ILE A CB    
2027 C  CG1   . ILE A