data_5J8E
# 
_entry.id   5J8E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5J8E         
WWPDB D_1000220090 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5J8E 
_pdbx_database_status.recvd_initial_deposition_date   2016-04-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schroeder, C.M.' 1 
'Ekiert, D.C.'    2 
'Vale, R.D.'      3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J.Cell Biol.' 
_citation.journal_id_ASTM           JCLBA3 
_citation.journal_id_CSD            2019 
_citation.journal_id_ISSN           1540-8140 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            214 
_citation.language                  ? 
_citation.page_first                309 
_citation.page_last                 318 
_citation.title                     'Assembly and activation of dynein-dynactin by the cargo adaptor protein Hook3.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1083/jcb.201604002 
_citation.pdbx_database_id_PubMed   27482052 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Schroeder, C.M.' 1 ? 
primary 'Vale, R.D.'      2 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5J8E 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     33.920 
_cell.length_a_esd                 ? 
_cell.length_b                     75.880 
_cell.length_b_esd                 ? 
_cell.length_c                     111.850 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5J8E 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 2 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protein Hook homolog 3' 18714.488 2   ? ? 'UNP residues 1-160' ? 
2 water   nat water                    18.015    181 ? ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        hHK3 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSMFSVESLERAELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDPAYFDENWLNRIKTEVGDNWRLKISN
LKKILKGILDYNHEILGQQINDFTLPDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQEYIQAIMMMEESVQHVVMTAIQ
ELMSK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSMFSVESLERAELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDPAYFDENWLNRIKTEVGDNWRLKISN
LKKILKGILDYNHEILGQQINDFTLPDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQEYIQAIMMMEESVQHVVMTAIQ
ELMSK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   MET n 
1 7   PHE n 
1 8   SER n 
1 9   VAL n 
1 10  GLU n 
1 11  SER n 
1 12  LEU n 
1 13  GLU n 
1 14  ARG n 
1 15  ALA n 
1 16  GLU n 
1 17  LEU n 
1 18  CYS n 
1 19  GLU n 
1 20  SER n 
1 21  LEU n 
1 22  LEU n 
1 23  THR n 
1 24  TRP n 
1 25  ILE n 
1 26  GLN n 
1 27  THR n 
1 28  PHE n 
1 29  ASN n 
1 30  VAL n 
1 31  ASP n 
1 32  ALA n 
1 33  PRO n 
1 34  CYS n 
1 35  GLN n 
1 36  THR n 
1 37  VAL n 
1 38  GLU n 
1 39  ASP n 
1 40  LEU n 
1 41  THR n 
1 42  ASN n 
1 43  GLY n 
1 44  VAL n 
1 45  VAL n 
1 46  MET n 
1 47  ALA n 
1 48  GLN n 
1 49  VAL n 
1 50  LEU n 
1 51  GLN n 
1 52  LYS n 
1 53  ILE n 
1 54  ASP n 
1 55  PRO n 
1 56  ALA n 
1 57  TYR n 
1 58  PHE n 
1 59  ASP n 
1 60  GLU n 
1 61  ASN n 
1 62  TRP n 
1 63  LEU n 
1 64  ASN n 
1 65  ARG n 
1 66  ILE n 
1 67  LYS n 
1 68  THR n 
1 69  GLU n 
1 70  VAL n 
1 71  GLY n 
1 72  ASP n 
1 73  ASN n 
1 74  TRP n 
1 75  ARG n 
1 76  LEU n 
1 77  LYS n 
1 78  ILE n 
1 79  SER n 
1 80  ASN n 
1 81  LEU n 
1 82  LYS n 
1 83  LYS n 
1 84  ILE n 
1 85  LEU n 
1 86  LYS n 
1 87  GLY n 
1 88  ILE n 
1 89  LEU n 
1 90  ASP n 
1 91  TYR n 
1 92  ASN n 
1 93  HIS n 
1 94  GLU n 
1 95  ILE n 
1 96  LEU n 
1 97  GLY n 
1 98  GLN n 
1 99  GLN n 
1 100 ILE n 
1 101 ASN n 
1 102 ASP n 
1 103 PHE n 
1 104 THR n 
1 105 LEU n 
1 106 PRO n 
1 107 ASP n 
1 108 VAL n 
1 109 ASN n 
1 110 LEU n 
1 111 ILE n 
1 112 GLY n 
1 113 GLU n 
1 114 HIS n 
1 115 SER n 
1 116 ASP n 
1 117 ALA n 
1 118 ALA n 
1 119 GLU n 
1 120 LEU n 
1 121 GLY n 
1 122 ARG n 
1 123 MET n 
1 124 LEU n 
1 125 GLN n 
1 126 LEU n 
1 127 ILE n 
1 128 LEU n 
1 129 GLY n 
1 130 CYS n 
1 131 ALA n 
1 132 VAL n 
1 133 ASN n 
1 134 CYS n 
1 135 GLU n 
1 136 GLN n 
1 137 LYS n 
1 138 GLN n 
1 139 GLU n 
1 140 TYR n 
1 141 ILE n 
1 142 GLN n 
1 143 ALA n 
1 144 ILE n 
1 145 MET n 
1 146 MET n 
1 147 MET n 
1 148 GLU n 
1 149 GLU n 
1 150 SER n 
1 151 VAL n 
1 152 GLN n 
1 153 HIS n 
1 154 VAL n 
1 155 VAL n 
1 156 MET n 
1 157 THR n 
1 158 ALA n 
1 159 ILE n 
1 160 GLN n 
1 161 GLU n 
1 162 LEU n 
1 163 MET n 
1 164 SER n 
1 165 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   165 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 HOOK3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-6P-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HOOK3_HUMAN 
_struct_ref.pdbx_db_accession          Q86VS8 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MFSVESLERAELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDPAYFDENWLNRIKTEVGDNWRLKISNLKKIL
KGILDYNHEILGQQINDFTLPDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQEYIQAIMMMEESVQHVVMTAIQELMSK

;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5J8E A 6 ? 165 ? Q86VS8 1 ? 160 ? 1 160 
2 1 5J8E B 6 ? 165 ? Q86VS8 1 ? 160 ? 1 160 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5J8E GLY A 1 ? UNP Q86VS8 ? ? 'expression tag' -4 1  
1 5J8E PRO A 2 ? UNP Q86VS8 ? ? 'expression tag' -3 2  
1 5J8E LEU A 3 ? UNP Q86VS8 ? ? 'expression tag' -2 3  
1 5J8E GLY A 4 ? UNP Q86VS8 ? ? 'expression tag' -1 4  
1 5J8E SER A 5 ? UNP Q86VS8 ? ? 'expression tag' 0  5  
2 5J8E GLY B 1 ? UNP Q86VS8 ? ? 'expression tag' -4 6  
2 5J8E PRO B 2 ? UNP Q86VS8 ? ? 'expression tag' -3 7  
2 5J8E LEU B 3 ? UNP Q86VS8 ? ? 'expression tag' -2 8  
2 5J8E GLY B 4 ? UNP Q86VS8 ? ? 'expression tag' -1 9  
2 5J8E SER B 5 ? UNP Q86VS8 ? ? 'expression tag' 0  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5J8E 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            1.92 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         36.03 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2 M sodium formate, 0.1 M sodium acetate pH 4.6' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-11-21 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Double flat crystal, Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.12 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 8.3.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.12 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   8.3.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5J8E 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.7 
_reflns.d_resolution_low                 45.019 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       32558 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.0 
_reflns.pdbx_Rmerge_I_obs                0.076 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            15.36 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.70 
_reflns_shell.d_res_low                   1.76 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.10 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.952 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.1 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5J8E 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.700 
_refine.ls_d_res_low                             45.019 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     32546 
_refine.ls_number_reflns_R_free                  1393 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.67 
_refine.ls_percent_reflns_R_free                 4.28 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1854 
_refine.ls_R_factor_R_free                       0.2139 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1842 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1WIX 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.95 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.20 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2417 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             181 
_refine_hist.number_atoms_total               2598 
_refine_hist.d_res_high                       1.700 
_refine_hist.d_res_low                        45.019 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  ? 2461 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.912  ? 3334 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 13.933 ? 924  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.035  ? 389  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 431  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.7000 1.7608  . . 136 3039 100.00 . . . 0.3306 . 0.3033 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7608 1.8313  . . 136 3048 100.00 . . . 0.3340 . 0.2803 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8313 1.9146  . . 138 3085 100.00 . . . 0.2807 . 0.2409 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9146 2.0156  . . 138 3107 100.00 . . . 0.2426 . 0.2049 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0156 2.1418  . . 138 3065 100.00 . . . 0.2455 . 0.1851 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1418 2.3072  . . 138 3109 100.00 . . . 0.2354 . 0.1716 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3072 2.5394  . . 140 3110 100.00 . . . 0.2017 . 0.1813 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5394 2.9068  . . 140 3147 100.00 . . . 0.2168 . 0.1744 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9068 3.6620  . . 143 3166 100.00 . . . 0.2131 . 0.1739 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6620 45.0347 . . 146 3277 98.00  . . . 0.1783 . 0.1730 . . . . . . . . . . 
# 
_struct.entry_id                     5J8E 
_struct.title                        
;Crystal structure of human Hook3's conserved Hook domain
;
_struct.pdbx_descriptor              'Protein Hook homolog 3' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5J8E 
_struct_keywords.text            'calponin homology Hook cargo adaptor, PROTEIN TRANSPORT' 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ARG A 14  ? GLN A 26  ? ARG A 9   GLN A 21  1 ? 13 
HELX_P HELX_P2  AA2 THR A 27  ? ASN A 29  ? THR A 22  ASN A 24  5 ? 3  
HELX_P HELX_P3  AA3 THR A 36  ? THR A 41  ? THR A 31  THR A 36  5 ? 6  
HELX_P HELX_P4  AA4 GLY A 43  ? ASP A 54  ? GLY A 38  ASP A 49  1 ? 12 
HELX_P HELX_P5  AA5 ASP A 59  ? ASN A 64  ? ASP A 54  ASN A 59  1 ? 6  
HELX_P HELX_P6  AA6 ASN A 73  ? ILE A 95  ? ASN A 68  ILE A 90  1 ? 23 
HELX_P HELX_P7  AA7 ASP A 107 ? SER A 115 ? ASP A 102 SER A 110 1 ? 9  
HELX_P HELX_P8  AA8 ASP A 116 ? CYS A 134 ? ASP A 111 CYS A 129 1 ? 19 
HELX_P HELX_P9  AA9 GLN A 136 ? MET A 163 ? GLN A 131 MET A 158 1 ? 28 
HELX_P HELX_P10 AB1 ARG B 14  ? THR B 27  ? ARG B 9   THR B 22  1 ? 14 
HELX_P HELX_P11 AB2 THR B 36  ? THR B 41  ? THR B 31  THR B 36  5 ? 6  
HELX_P HELX_P12 AB3 GLY B 43  ? ASP B 54  ? GLY B 38  ASP B 49  1 ? 12 
HELX_P HELX_P13 AB4 ASP B 59  ? ASN B 64  ? ASP B 54  ASN B 59  1 ? 6  
HELX_P HELX_P14 AB5 ASN B 73  ? ILE B 95  ? ASN B 68  ILE B 90  1 ? 23 
HELX_P HELX_P15 AB6 ASP B 107 ? SER B 115 ? ASP B 102 SER B 110 1 ? 9  
HELX_P HELX_P16 AB7 ASP B 116 ? CYS B 134 ? ASP B 111 CYS B 129 1 ? 19 
HELX_P HELX_P17 AB8 GLN B 136 ? MET B 163 ? GLN B 131 MET B 158 1 ? 28 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    5J8E 
_atom_sites.fract_transf_matrix[1][1]   0.029481 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013179 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008941 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 14  ? 24.246  10.827 65.916 1.00 65.25  ? 9   ARG A N   1 
ATOM   2    C CA  . ARG A 1 14  ? 24.383  10.854 64.462 1.00 67.61  ? 9   ARG A CA  1 
ATOM   3    C C   . ARG A 1 14  ? 23.573  11.987 63.837 1.00 60.79  ? 9   ARG A C   1 
ATOM   4    O O   . ARG A 1 14  ? 22.479  12.331 64.315 1.00 57.20  ? 9   ARG A O   1 
ATOM   5    C CB  . ARG A 1 14  ? 23.953  9.514  63.853 1.00 68.53  ? 9   ARG A CB  1 
ATOM   6    C CG  . ARG A 1 14  ? 24.191  9.411  62.353 1.00 71.88  ? 9   ARG A CG  1 
ATOM   7    C CD  . ARG A 1 14  ? 25.664  9.625  62.040 1.00 69.51  ? 9   ARG A CD  1 
ATOM   8    N NE  . ARG A 1 14  ? 25.881  10.204 60.722 1.00 58.41  ? 9   ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 14  ? 27.067  10.612 60.279 1.00 64.93  ? 9   ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 14  ? 28.137  10.502 61.057 1.00 69.71  1 9   ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 14  ? 27.186  11.130 59.062 1.00 47.69  ? 9   ARG A NH2 1 
ATOM   12   N N   . ALA A 1 15  ? 24.112  12.557 62.763 1.00 55.88  ? 10  ALA A N   1 
ATOM   13   C CA  . ALA A 1 15  ? 23.417  13.603 62.029 1.00 52.76  ? 10  ALA A CA  1 
ATOM   14   C C   . ALA A 1 15  ? 22.258  13.035 61.207 1.00 43.93  ? 10  ALA A C   1 
ATOM   15   O O   . ALA A 1 15  ? 21.265  13.721 60.990 1.00 36.63  ? 10  ALA A O   1 
ATOM   16   C CB  . ALA A 1 15  ? 24.384  14.358 61.137 1.00 58.98  ? 10  ALA A CB  1 
ATOM   17   N N   . GLU A 1 16  ? 22.388  11.788 60.753 1.00 39.02  ? 11  GLU A N   1 
ATOM   18   C CA  . GLU A 1 16  ? 21.308  11.125 60.017 1.00 34.92  ? 11  GLU A CA  1 
ATOM   19   C C   . GLU A 1 16  ? 20.097  10.831 60.913 1.00 27.78  ? 11  GLU A C   1 
ATOM   20   O O   . GLU A 1 16  ? 18.952  10.969 60.475 1.00 29.31  ? 11  GLU A O   1 
ATOM   21   C CB  . GLU A 1 16  ? 21.810  9.827  59.376 1.00 45.71  ? 11  GLU A CB  1 
ATOM   22   C CG  . GLU A 1 16  ? 20.743  9.091  58.567 1.00 60.76  ? 11  GLU A CG  1 
ATOM   23   C CD  . GLU A 1 16  ? 21.255  7.802  57.939 1.00 79.22  ? 11  GLU A CD  1 
ATOM   24   O OE1 . GLU A 1 16  ? 22.484  7.577  57.962 1.00 86.78  ? 11  GLU A OE1 1 
ATOM   25   O OE2 . GLU A 1 16  ? 20.428  7.015  57.423 1.00 77.13  1 11  GLU A OE2 1 
ATOM   26   N N   . LEU A 1 17  ? 20.352  10.433 62.158 1.00 33.86  ? 12  LEU A N   1 
ATOM   27   C CA  . LEU A 1 17  ? 19.271  10.228 63.117 1.00 31.58  ? 12  LEU A CA  1 
ATOM   28   C C   . LEU A 1 17  ? 18.506  11.536 63.325 1.00 24.99  ? 12  LEU A C   1 
ATOM   29   O O   . LEU A 1 17  ? 17.271  11.554 63.405 1.00 24.18  ? 12  LEU A O   1 
ATOM   30   C CB  . LEU A 1 17  ? 19.809  9.716  64.451 1.00 34.15  ? 12  LEU A CB  1 
ATOM   31   C CG  . LEU A 1 17  ? 18.728  9.511  65.507 1.00 37.32  ? 12  LEU A CG  1 
ATOM   32   C CD1 . LEU A 1 17  ? 17.692  8.504  65.015 1.00 30.70  ? 12  LEU A CD1 1 
ATOM   33   C CD2 . LEU A 1 17  ? 19.340  9.067  66.836 1.00 48.28  ? 12  LEU A CD2 1 
ATOM   34   N N   . CYS A 1 18  ? 19.248  12.641 63.401 1.00 28.55  ? 13  CYS A N   1 
ATOM   35   C CA  . CYS A 1 18  ? 18.616  13.942 63.596 1.00 27.01  ? 13  CYS A CA  1 
ATOM   36   C C   . CYS A 1 18  ? 17.680  14.280 62.435 1.00 26.15  ? 13  CYS A C   1 
ATOM   37   O O   . CYS A 1 18  ? 16.546  14.734 62.644 1.00 26.71  ? 13  CYS A O   1 
ATOM   38   C CB  . CYS A 1 18  ? 19.656  15.042 63.760 1.00 27.02  ? 13  CYS A CB  1 
ATOM   39   S SG  . CYS A 1 18  ? 18.890  16.632 64.208 1.00 31.19  ? 13  CYS A SG  1 
ATOM   40   N N   . GLU A 1 19  ? 18.144  14.058 61.208 1.00 26.91  ? 14  GLU A N   1 
ATOM   41   C CA  . GLU A 1 19  ? 17.291  14.262 60.045 1.00 28.78  ? 14  GLU A CA  1 
ATOM   42   C C   . GLU A 1 19  ? 16.028  13.407 60.115 1.00 22.36  ? 14  GLU A C   1 
ATOM   43   O O   . GLU A 1 19  ? 14.930  13.879 59.807 1.00 24.01  ? 14  GLU A O   1 
ATOM   44   C CB  . GLU A 1 19  ? 18.066  13.953 58.750 1.00 30.62  ? 14  GLU A CB  1 
ATOM   45   C CG  . GLU A 1 19  ? 19.097  15.010 58.388 1.00 47.77  ? 14  GLU A CG  1 
ATOM   46   C CD  . GLU A 1 19  ? 18.474  16.356 58.039 1.00 53.60  ? 14  GLU A CD  1 
ATOM   47   O OE1 . GLU A 1 19  ? 17.340  16.380 57.518 1.00 63.09  ? 14  GLU A OE1 1 
ATOM   48   O OE2 . GLU A 1 19  ? 19.121  17.395 58.288 1.00 61.88  1 14  GLU A OE2 1 
ATOM   49   N N   . SER A 1 20  ? 16.167  12.154 60.530 1.00 25.11  ? 15  SER A N   1 
ATOM   50   C CA  . SER A 1 20  ? 14.996  11.284 60.648 1.00 25.39  ? 15  SER A CA  1 
ATOM   51   C C   . SER A 1 20  ? 14.040  11.773 61.738 1.00 24.95  ? 15  SER A C   1 
ATOM   52   O O   . SER A 1 20  ? 12.816  11.787 61.561 1.00 24.19  ? 15  SER A O   1 
ATOM   53   C CB  . SER A 1 20  ? 15.427  9.848  60.943 1.00 24.80  ? 15  SER A CB  1 
ATOM   54   O OG  . SER A 1 20  ? 16.193  9.331  59.871 1.00 30.81  ? 15  SER A OG  1 
ATOM   55   N N   . LEU A 1 21  ? 14.589  12.189 62.872 1.00 21.82  ? 16  LEU A N   1 
ATOM   56   C CA  . LEU A 1 21  ? 13.724  12.649 63.958 1.00 20.69  ? 16  LEU A CA  1 
ATOM   57   C C   . LEU A 1 21  ? 13.064  13.981 63.596 1.00 21.73  ? 16  LEU A C   1 
ATOM   58   O O   . LEU A 1 21  ? 11.998  14.316 64.117 1.00 25.26  ? 16  LEU A O   1 
ATOM   59   C CB  . LEU A 1 21  ? 14.508  12.745 65.265 1.00 23.10  ? 16  LEU A CB  1 
ATOM   60   C CG  . LEU A 1 21  ? 14.998  11.382 65.755 1.00 25.07  ? 16  LEU A CG  1 
ATOM   61   C CD1 . LEU A 1 21  ? 15.765  11.494 67.080 1.00 29.17  ? 16  LEU A CD1 1 
ATOM   62   C CD2 . LEU A 1 21  ? 13.821  10.409 65.905 1.00 32.21  ? 16  LEU A CD2 1 
ATOM   63   N N   . LEU A 1 22  ? 13.673  14.728 62.680 1.00 25.41  ? 17  LEU A N   1 
ATOM   64   C CA  . LEU A 1 22  ? 13.059  15.958 62.171 1.00 22.07  ? 17  LEU A CA  1 
ATOM   65   C C   . LEU A 1 22  ? 11.736  15.649 61.460 1.00 25.02  ? 17  LEU A C   1 
ATOM   66   O O   . LEU A 1 22  ? 10.773  16.411 61.562 1.00 22.60  ? 17  LEU A O   1 
ATOM   67   C CB  . LEU A 1 22  ? 14.007  16.675 61.201 1.00 31.13  ? 17  LEU A CB  1 
ATOM   68   C CG  . LEU A 1 22  ? 14.234  18.181 61.286 1.00 55.78  ? 17  LEU A CG  1 
ATOM   69   C CD1 . LEU A 1 22  ? 15.168  18.632 60.161 1.00 55.56  ? 17  LEU A CD1 1 
ATOM   70   C CD2 . LEU A 1 22  ? 12.919  18.928 61.220 1.00 60.59  ? 17  LEU A CD2 1 
ATOM   71   N N   . THR A 1 23  ? 11.694  14.541 60.736 1.00 24.66  ? 18  THR A N   1 
ATOM   72   C CA  . THR A 1 23  ? 10.476  14.184 60.006 1.00 24.03  ? 18  THR A CA  1 
ATOM   73   C C   . THR A 1 23  ? 9.400   13.814 61.004 1.00 20.94  ? 18  THR A C   1 
ATOM   74   O O   . THR A 1 23  ? 8.213   14.023 60.751 1.00 23.06  ? 18  THR A O   1 
ATOM   75   C CB  . THR A 1 23  ? 10.702  13.027 59.009 1.00 26.00  ? 18  THR A CB  1 
ATOM   76   O OG1 . THR A 1 23  ? 10.972  11.814 59.730 1.00 30.85  ? 18  THR A OG1 1 
ATOM   77   C CG2 . THR A 1 23  ? 11.863  13.366 58.076 1.00 24.25  ? 18  THR A CG2 1 
ATOM   78   N N   . TRP A 1 24  ? 9.824   13.270 62.147 1.00 24.23  ? 19  TRP A N   1 
ATOM   79   C CA  . TRP A 1 24  ? 8.887   12.978 63.219 1.00 25.43  ? 19  TRP A CA  1 
ATOM   80   C C   . TRP A 1 24  ? 8.361   14.270 63.827 1.00 23.98  ? 19  TRP A C   1 
ATOM   81   O O   . TRP A 1 24  ? 7.164   14.406 64.047 1.00 23.12  ? 19  TRP A O   1 
ATOM   82   C CB  . TRP A 1 24  ? 9.533   12.109 64.293 1.00 22.53  ? 19  TRP A CB  1 
ATOM   83   C CG  . TRP A 1 24  ? 8.640   11.915 65.500 1.00 21.97  ? 19  TRP A CG  1 
ATOM   84   C CD1 . TRP A 1 24  ? 7.526   11.142 65.574 1.00 20.19  ? 19  TRP A CD1 1 
ATOM   85   C CD2 . TRP A 1 24  ? 8.818   12.492 66.806 1.00 22.76  ? 19  TRP A CD2 1 
ATOM   86   N NE1 . TRP A 1 24  ? 6.976   11.211 66.847 1.00 21.46  ? 19  TRP A NE1 1 
ATOM   87   C CE2 . TRP A 1 24  ? 7.753   12.032 67.615 1.00 23.91  ? 19  TRP A CE2 1 
ATOM   88   C CE3 . TRP A 1 24  ? 9.766   13.352 67.366 1.00 25.49  ? 19  TRP A CE3 1 
ATOM   89   C CZ2 . TRP A 1 24  ? 7.613   12.401 68.960 1.00 24.08  ? 19  TRP A CZ2 1 
ATOM   90   C CZ3 . TRP A 1 24  ? 9.614   13.723 68.714 1.00 25.52  ? 19  TRP A CZ3 1 
ATOM   91   C CH2 . TRP A 1 24  ? 8.552   13.251 69.483 1.00 28.39  ? 19  TRP A CH2 1 
ATOM   92   N N   . ILE A 1 25  ? 9.253   15.214 64.112 1.00 21.24  ? 20  ILE A N   1 
ATOM   93   C CA  . ILE A 1 25  ? 8.834   16.542 64.588 1.00 22.67  ? 20  ILE A CA  1 
ATOM   94   C C   . ILE A 1 25  ? 7.784   17.142 63.658 1.00 31.09  ? 20  ILE A C   1 
ATOM   95   O O   . ILE A 1 25  ? 6.825   17.775 64.095 1.00 27.18  ? 20  ILE A O   1 
ATOM   96   C CB  . ILE A 1 25  ? 10.034  17.490 64.703 1.00 27.68  ? 20  ILE A CB  1 
ATOM   97   C CG1 . ILE A 1 25  ? 10.932  17.045 65.856 1.00 23.32  ? 20  ILE A CG1 1 
ATOM   98   C CG2 . ILE A 1 25  ? 9.590   18.942 64.874 1.00 34.63  ? 20  ILE A CG2 1 
ATOM   99   C CD1 . ILE A 1 25  ? 10.295  17.232 67.254 1.00 23.91  ? 20  ILE A CD1 1 
ATOM   100  N N   . GLN A 1 26  ? 7.955   16.917 62.360 1.00 27.54  ? 21  GLN A N   1 
ATOM   101  C CA  . GLN A 1 26  ? 7.039   17.504 61.394 1.00 28.36  ? 21  GLN A CA  1 
ATOM   102  C C   . GLN A 1 26  ? 5.630   16.908 61.506 1.00 31.68  ? 21  GLN A C   1 
ATOM   103  O O   . GLN A 1 26  ? 4.665   17.530 61.061 1.00 35.40  ? 21  GLN A O   1 
ATOM   104  C CB  . GLN A 1 26  ? 7.616   17.358 59.975 1.00 28.13  ? 21  GLN A CB  1 
ATOM   105  C CG  . GLN A 1 26  ? 8.757   18.353 59.723 1.00 33.88  ? 21  GLN A CG  1 
ATOM   106  C CD  . GLN A 1 26  ? 9.727   17.926 58.630 1.00 44.42  ? 21  GLN A CD  1 
ATOM   107  O OE1 . GLN A 1 26  ? 9.648   16.818 58.108 1.00 37.64  ? 21  GLN A OE1 1 
ATOM   108  N NE2 . GLN A 1 26  ? 10.652  18.812 58.283 1.00 46.51  ? 21  GLN A NE2 1 
ATOM   109  N N   . THR A 1 27  ? 5.487   15.744 62.143 1.00 29.55  ? 22  THR A N   1 
ATOM   110  C CA  . THR A 1 27  ? 4.150   15.170 62.297 1.00 26.85  ? 22  THR A CA  1 
ATOM   111  C C   . THR A 1 27  ? 3.306   15.963 63.303 1.00 36.80  ? 22  THR A C   1 
ATOM   112  O O   . THR A 1 27  ? 2.091   15.771 63.374 1.00 33.16  ? 22  THR A O   1 
ATOM   113  C CB  . THR A 1 27  ? 4.169   13.686 62.744 1.00 28.19  ? 22  THR A CB  1 
ATOM   114  O OG1 . THR A 1 27  ? 4.655   13.575 64.088 1.00 26.58  ? 22  THR A OG1 1 
ATOM   115  C CG2 . THR A 1 27  ? 5.018   12.812 61.816 1.00 25.67  ? 22  THR A CG2 1 
ATOM   116  N N   . PHE A 1 28  ? 3.932   16.854 64.073 1.00 28.90  ? 23  PHE A N   1 
ATOM   117  C CA  . PHE A 1 28  ? 3.193   17.611 65.090 1.00 31.38  ? 23  PHE A CA  1 
ATOM   118  C C   . PHE A 1 28  ? 2.488   18.816 64.511 1.00 44.63  ? 23  PHE A C   1 
ATOM   119  O O   . PHE A 1 28  ? 1.519   19.310 65.097 1.00 46.97  ? 23  PHE A O   1 
ATOM   120  C CB  . PHE A 1 28  ? 4.120   18.064 66.228 1.00 24.01  ? 23  PHE A CB  1 
ATOM   121  C CG  . PHE A 1 28  ? 4.456   16.968 67.185 1.00 30.13  ? 23  PHE A CG  1 
ATOM   122  C CD1 . PHE A 1 28  ? 5.488   16.089 66.912 1.00 23.85  ? 23  PHE A CD1 1 
ATOM   123  C CD2 . PHE A 1 28  ? 3.720   16.801 68.352 1.00 27.81  ? 23  PHE A CD2 1 
ATOM   124  C CE1 . PHE A 1 28  ? 5.790   15.063 67.779 1.00 28.33  ? 23  PHE A CE1 1 
ATOM   125  C CE2 . PHE A 1 28  ? 4.018   15.786 69.227 1.00 27.90  ? 23  PHE A CE2 1 
ATOM   126  C CZ  . PHE A 1 28  ? 5.049   14.906 68.949 1.00 25.52  ? 23  PHE A CZ  1 
ATOM   127  N N   . ASN A 1 29  ? 2.984   19.293 63.375 1.00 38.88  ? 24  ASN A N   1 
ATOM   128  C CA  . ASN A 1 29  ? 2.466   20.515 62.762 1.00 46.25  ? 24  ASN A CA  1 
ATOM   129  C C   . ASN A 1 29  ? 2.367   21.686 63.739 1.00 45.61  ? 24  ASN A C   1 
ATOM   130  O O   . ASN A 1 29  ? 1.308   22.294 63.878 1.00 45.77  ? 24  ASN A O   1 
ATOM   131  C CB  . ASN A 1 29  ? 1.097   20.254 62.128 1.00 54.93  ? 24  ASN A CB  1 
ATOM   132  C CG  . ASN A 1 29  ? 1.197   19.473 60.829 1.00 66.26  ? 24  ASN A CG  1 
ATOM   133  O OD1 . ASN A 1 29  ? 0.836   18.297 60.768 1.00 62.82  ? 24  ASN A OD1 1 
ATOM   134  N ND2 . ASN A 1 29  ? 1.688   20.128 59.779 1.00 71.26  ? 24  ASN A ND2 1 
ATOM   135  N N   . VAL A 1 30  ? 3.470   21.999 64.415 1.00 38.99  ? 25  VAL A N   1 
ATOM   136  C CA  . VAL A 1 30  ? 3.521   23.179 65.275 1.00 42.36  ? 25  VAL A CA  1 
ATOM   137  C C   . VAL A 1 30  ? 3.602   24.433 64.413 1.00 53.19  ? 25  VAL A C   1 
ATOM   138  O O   . VAL A 1 30  ? 3.868   24.349 63.213 1.00 46.97  ? 25  VAL A O   1 
ATOM   139  C CB  . VAL A 1 30  ? 4.721   23.157 66.245 1.00 32.23  ? 25  VAL A CB  1 
ATOM   140  C CG1 . VAL A 1 30  ? 4.637   21.956 67.174 1.00 38.25  ? 25  VAL A CG1 1 
ATOM   141  C CG2 . VAL A 1 30  ? 6.035   23.158 65.470 1.00 38.33  ? 25  VAL A CG2 1 
ATOM   142  N N   . ASP A 1 31  ? 3.384   25.591 65.034 1.00 50.85  ? 26  ASP A N   1 
ATOM   143  C CA  . ASP A 1 31  ? 3.277   26.853 64.306 1.00 61.68  ? 26  ASP A CA  1 
ATOM   144  C C   . ASP A 1 31  ? 4.598   27.303 63.682 1.00 59.95  ? 26  ASP A C   1 
ATOM   145  O O   . ASP A 1 31  ? 4.642   27.651 62.504 1.00 69.99  ? 26  ASP A O   1 
ATOM   146  C CB  . ASP A 1 31  ? 2.743   27.950 65.230 1.00 73.48  ? 26  ASP A CB  1 
ATOM   147  C CG  . ASP A 1 31  ? 2.300   29.189 64.469 1.00 92.45  ? 26  ASP A CG  1 
ATOM   148  O OD1 . ASP A 1 31  ? 1.727   29.040 63.367 1.00 95.80  ? 26  ASP A OD1 1 
ATOM   149  O OD2 . ASP A 1 31  ? 2.526   30.312 64.974 1.00 100.03 1 26  ASP A OD2 1 
ATOM   150  N N   . ALA A 1 32  ? 5.669   27.308 64.471 1.00 49.68  ? 27  ALA A N   1 
ATOM   151  C CA  . ALA A 1 32  ? 6.976   27.707 63.963 1.00 46.16  ? 27  ALA A CA  1 
ATOM   152  C C   . ALA A 1 32  ? 7.478   26.735 62.892 1.00 49.78  ? 27  ALA A C   1 
ATOM   153  O O   . ALA A 1 32  ? 7.278   25.527 63.007 1.00 50.41  ? 27  ALA A O   1 
ATOM   154  C CB  . ALA A 1 32  ? 7.978   27.799 65.101 1.00 48.04  ? 27  ALA A CB  1 
ATOM   155  N N   . PRO A 1 33  ? 8.133   27.267 61.846 1.00 58.04  ? 28  PRO A N   1 
ATOM   156  C CA  . PRO A 1 33  ? 8.739   26.470 60.770 1.00 52.59  ? 28  PRO A CA  1 
ATOM   157  C C   . PRO A 1 33  ? 9.699   25.418 61.299 1.00 42.14  ? 28  PRO A C   1 
ATOM   158  O O   . PRO A 1 33  ? 10.400  25.679 62.271 1.00 46.37  ? 28  PRO A O   1 
ATOM   159  C CB  . PRO A 1 33  ? 9.495   27.513 59.945 1.00 60.57  ? 28  PRO A CB  1 
ATOM   160  C CG  . PRO A 1 33  ? 8.763   28.781 60.194 1.00 64.63  ? 28  PRO A CG  1 
ATOM   161  C CD  . PRO A 1 33  ? 8.314   28.712 61.623 1.00 66.52  ? 28  PRO A CD  1 
ATOM   162  N N   . CYS A 1 34  ? 9.733   24.246 60.670 1.00 37.08  ? 29  CYS A N   1 
ATOM   163  C CA  . CYS A 1 34  ? 10.588  23.162 61.144 1.00 38.44  ? 29  CYS A CA  1 
ATOM   164  C C   . CYS A 1 34  ? 11.040  22.250 60.014 1.00 45.60  ? 29  CYS A C   1 
ATOM   165  O O   . CYS A 1 34  ? 10.852  21.034 60.078 1.00 61.69  ? 29  CYS A O   1 
ATOM   166  C CB  . CYS A 1 34  ? 9.861   22.335 62.204 1.00 38.16  ? 29  CYS A CB  1 
ATOM   167  S SG  . CYS A 1 34  ? 8.228   21.746 61.674 1.00 57.35  ? 29  CYS A SG  1 
ATOM   168  N N   . GLN A 1 35  ? 11.644  22.833 58.987 1.00 47.12  ? 30  GLN A N   1 
ATOM   169  C CA  . GLN A 1 35  ? 12.078  22.061 57.825 1.00 46.92  ? 30  GLN A CA  1 
ATOM   170  C C   . GLN A 1 35  ? 13.526  21.601 57.950 1.00 53.59  ? 30  GLN A C   1 
ATOM   171  O O   . GLN A 1 35  ? 13.899  20.556 57.413 1.00 51.04  ? 30  GLN A O   1 
ATOM   172  C CB  . GLN A 1 35  ? 11.895  22.881 56.548 1.00 52.60  ? 30  GLN A CB  1 
ATOM   173  C CG  . GLN A 1 35  ? 10.435  23.139 56.195 1.00 67.72  ? 30  GLN A CG  1 
ATOM   174  C CD  . GLN A 1 35  ? 10.254  23.859 54.866 1.00 78.11  ? 30  GLN A CD  1 
ATOM   175  O OE1 . GLN A 1 35  ? 9.150   23.909 54.324 1.00 77.09  ? 30  GLN A OE1 1 
ATOM   176  N NE2 . GLN A 1 35  ? 11.338  24.423 54.338 1.00 81.94  ? 30  GLN A NE2 1 
ATOM   177  N N   . THR A 1 36  ? 14.336  22.384 58.661 1.00 46.03  ? 31  THR A N   1 
ATOM   178  C CA  . THR A 1 36  ? 15.763  22.101 58.792 1.00 38.21  ? 31  THR A CA  1 
ATOM   179  C C   . THR A 1 36  ? 16.266  22.042 60.226 1.00 37.80  ? 31  THR A C   1 
ATOM   180  O O   . THR A 1 36  ? 15.594  22.473 61.160 1.00 34.85  ? 31  THR A O   1 
ATOM   181  C CB  . THR A 1 36  ? 16.607  23.164 58.090 1.00 35.69  ? 31  THR A CB  1 
ATOM   182  O OG1 . THR A 1 36  ? 16.495  24.394 58.819 1.00 36.26  ? 31  THR A OG1 1 
ATOM   183  C CG2 . THR A 1 36  ? 16.153  23.358 56.646 1.00 46.69  ? 31  THR A CG2 1 
ATOM   184  N N   . VAL A 1 37  ? 17.483  21.536 60.376 1.00 33.88  ? 32  VAL A N   1 
ATOM   185  C CA  . VAL A 1 37  ? 18.192  21.548 61.643 1.00 36.43  ? 32  VAL A CA  1 
ATOM   186  C C   . VAL A 1 37  ? 18.259  22.954 62.233 1.00 37.88  ? 32  VAL A C   1 
ATOM   187  O O   . VAL A 1 37  ? 18.036  23.155 63.428 1.00 37.60  ? 32  VAL A O   1 
ATOM   188  C CB  . VAL A 1 37  ? 19.615  20.991 61.472 1.00 38.76  ? 32  VAL A CB  1 
ATOM   189  C CG1 . VAL A 1 37  ? 20.515  21.404 62.643 1.00 39.21  ? 32  VAL A CG1 1 
ATOM   190  C CG2 . VAL A 1 37  ? 19.560  19.492 61.322 1.00 39.32  ? 32  VAL A CG2 1 
ATOM   191  N N   . GLU A 1 38  ? 18.542  23.934 61.386 1.00 31.98  ? 33  GLU A N   1 
ATOM   192  C CA  . GLU A 1 38  ? 18.634  25.310 61.832 1.00 32.26  ? 33  GLU A CA  1 
ATOM   193  C C   . GLU A 1 38  ? 17.327  25.840 62.410 1.00 38.96  ? 33  GLU A C   1 
ATOM   194  O O   . GLU A 1 38  ? 17.344  26.684 63.307 1.00 39.31  ? 33  GLU A O   1 
ATOM   195  C CB  . GLU A 1 38  ? 19.086  26.204 60.679 1.00 42.34  ? 33  GLU A CB  1 
ATOM   196  C CG  . GLU A 1 38  ? 20.569  26.475 60.688 1.00 58.83  ? 33  GLU A CG  1 
ATOM   197  C CD  . GLU A 1 38  ? 20.996  27.301 61.887 1.00 75.14  ? 33  GLU A CD  1 
ATOM   198  O OE1 . GLU A 1 38  ? 22.174  27.202 62.287 1.00 85.34  ? 33  GLU A OE1 1 
ATOM   199  O OE2 . GLU A 1 38  ? 20.156  28.055 62.425 1.00 80.68  1 33  GLU A OE2 1 
ATOM   200  N N   . ASP A 1 39  ? 16.199  25.344 61.902 1.00 32.66  ? 34  ASP A N   1 
ATOM   201  C CA  . ASP A 1 39  ? 14.894  25.789 62.381 1.00 33.20  ? 34  ASP A CA  1 
ATOM   202  C C   . ASP A 1 39  ? 14.652  25.350 63.826 1.00 33.21  ? 34  ASP A C   1 
ATOM   203  O O   . ASP A 1 39  ? 13.747  25.853 64.491 1.00 34.09  ? 34  ASP A O   1 
ATOM   204  C CB  . ASP A 1 39  ? 13.763  25.242 61.500 1.00 38.13  ? 34  ASP A CB  1 
ATOM   205  C CG  . ASP A 1 39  ? 13.678  25.925 60.145 1.00 40.50  ? 34  ASP A CG  1 
ATOM   206  O OD1 . ASP A 1 39  ? 14.195  27.053 59.990 1.00 40.81  ? 34  ASP A OD1 1 
ATOM   207  O OD2 . ASP A 1 39  ? 13.073  25.328 59.233 1.00 39.53  1 34  ASP A OD2 1 
ATOM   208  N N   . LEU A 1 40  ? 15.448  24.399 64.305 1.00 28.42  ? 35  LEU A N   1 
ATOM   209  C CA  . LEU A 1 40  ? 15.240  23.853 65.647 1.00 30.43  ? 35  LEU A CA  1 
ATOM   210  C C   . LEU A 1 40  ? 16.205  24.399 66.694 1.00 31.27  ? 35  LEU A C   1 
ATOM   211  O O   . LEU A 1 40  ? 16.044  24.114 67.883 1.00 30.96  ? 35  LEU A O   1 
ATOM   212  C CB  . LEU A 1 40  ? 15.344  22.323 65.615 1.00 30.26  ? 35  LEU A CB  1 
ATOM   213  C CG  . LEU A 1 40  ? 14.032  21.561 65.386 1.00 38.60  ? 35  LEU A CG  1 
ATOM   214  C CD1 . LEU A 1 40  ? 13.280  22.112 64.198 1.00 40.93  ? 35  LEU A CD1 1 
ATOM   215  C CD2 . LEU A 1 40  ? 14.300  20.075 65.202 1.00 45.05  ? 35  LEU A CD2 1 
ATOM   216  N N   . THR A 1 41  ? 17.192  25.187 66.275 1.00 33.35  ? 36  THR A N   1 
ATOM   217  C CA  . THR A 1 41  ? 18.279  25.547 67.187 1.00 35.98  ? 36  THR A CA  1 
ATOM   218  C C   . THR A 1 41  ? 17.938  26.598 68.249 1.00 32.66  ? 36  THR A C   1 
ATOM   219  O O   . THR A 1 41  ? 18.657  26.712 69.235 1.00 30.40  ? 36  THR A O   1 
ATOM   220  C CB  . THR A 1 41  ? 19.539  26.049 66.416 1.00 35.49  ? 36  THR A CB  1 
ATOM   221  O OG1 . THR A 1 41  ? 19.217  27.192 65.614 1.00 34.60  ? 36  THR A OG1 1 
ATOM   222  C CG2 . THR A 1 41  ? 20.108  24.949 65.546 1.00 33.60  ? 36  THR A CG2 1 
ATOM   223  N N   . ASN A 1 42  ? 16.865  27.368 68.087 1.00 32.80  ? 37  ASN A N   1 
ATOM   224  C CA  . ASN A 1 42  ? 16.560  28.346 69.134 1.00 38.49  ? 37  ASN A CA  1 
ATOM   225  C C   . ASN A 1 42  ? 15.554  27.828 70.161 1.00 30.71  ? 37  ASN A C   1 
ATOM   226  O O   . ASN A 1 42  ? 15.197  28.541 71.101 1.00 34.20  ? 37  ASN A O   1 
ATOM   227  C CB  . ASN A 1 42  ? 16.073  29.672 68.537 1.00 39.09  ? 37  ASN A CB  1 
ATOM   228  C CG  . ASN A 1 42  ? 14.747  29.555 67.805 1.00 44.95  ? 37  ASN A CG  1 
ATOM   229  O OD1 . ASN A 1 42  ? 13.973  28.613 68.002 1.00 35.97  ? 37  ASN A OD1 1 
ATOM   230  N ND2 . ASN A 1 42  ? 14.475  30.533 66.951 1.00 45.77  ? 37  ASN A ND2 1 
ATOM   231  N N   . GLY A 1 43  ? 15.094  26.596 69.970 1.00 29.35  ? 38  GLY A N   1 
ATOM   232  C CA  . GLY A 1 43  ? 14.312  25.905 70.982 1.00 31.95  ? 38  GLY A CA  1 
ATOM   233  C C   . GLY A 1 43  ? 12.805  26.086 70.931 1.00 34.45  ? 38  GLY A C   1 
ATOM   234  O O   . GLY A 1 43  ? 12.062  25.366 71.598 1.00 34.04  ? 38  GLY A O   1 
ATOM   235  N N   . VAL A 1 44  ? 12.353  27.039 70.130 1.00 30.35  ? 39  VAL A N   1 
ATOM   236  C CA  . VAL A 1 44  ? 10.930  27.350 70.016 1.00 31.14  ? 39  VAL A CA  1 
ATOM   237  C C   . VAL A 1 44  ? 10.109  26.159 69.521 1.00 30.48  ? 39  VAL A C   1 
ATOM   238  O O   . VAL A 1 44  ? 9.106   25.793 70.137 1.00 29.51  ? 39  VAL A O   1 
ATOM   239  C CB  . VAL A 1 44  ? 10.716  28.555 69.087 1.00 36.87  ? 39  VAL A CB  1 
ATOM   240  C CG1 . VAL A 1 44  ? 9.237   28.800 68.859 1.00 38.83  ? 39  VAL A CG1 1 
ATOM   241  C CG2 . VAL A 1 44  ? 11.382  29.793 69.686 1.00 39.43  ? 39  VAL A CG2 1 
ATOM   242  N N   . VAL A 1 45  ? 10.532  25.545 68.416 1.00 32.94  ? 40  VAL A N   1 
ATOM   243  C CA  . VAL A 1 45  ? 9.837   24.369 67.901 1.00 28.09  ? 40  VAL A CA  1 
ATOM   244  C C   . VAL A 1 45  ? 9.777   23.243 68.934 1.00 31.34  ? 40  VAL A C   1 
ATOM   245  O O   . VAL A 1 45  ? 8.726   22.643 69.133 1.00 30.23  ? 40  VAL A O   1 
ATOM   246  C CB  . VAL A 1 45  ? 10.505  23.837 66.611 1.00 33.46  ? 40  VAL A CB  1 
ATOM   247  C CG1 . VAL A 1 45  ? 9.961   22.455 66.233 1.00 29.71  ? 40  VAL A CG1 1 
ATOM   248  C CG2 . VAL A 1 45  ? 10.312  24.830 65.475 1.00 31.99  ? 40  VAL A CG2 1 
ATOM   249  N N   . MET A 1 46  ? 10.886  22.972 69.617 1.00 25.82  ? 41  MET A N   1 
ATOM   250  C CA  . MET A 1 46  ? 10.875  21.876 70.584 1.00 24.94  ? 41  MET A CA  1 
ATOM   251  C C   . MET A 1 46  ? 9.935   22.197 71.754 1.00 25.31  ? 41  MET A C   1 
ATOM   252  O O   . MET A 1 46  ? 9.214   21.314 72.232 1.00 25.29  ? 41  MET A O   1 
ATOM   253  C CB  . MET A 1 46  ? 12.288  21.571 71.072 1.00 27.37  ? 41  MET A CB  1 
ATOM   254  C CG  . MET A 1 46  ? 13.089  20.828 70.025 1.00 27.05  ? 41  MET A CG  1 
ATOM   255  S SD  . MET A 1 46  ? 14.741  20.365 70.580 1.00 36.94  ? 41  MET A SD  1 
ATOM   256  C CE  . MET A 1 46  ? 15.432  21.994 70.754 1.00 34.67  ? 41  MET A CE  1 
ATOM   257  N N   . ALA A 1 47  ? 9.922   23.452 72.179 1.00 30.30  ? 42  ALA A N   1 
ATOM   258  C CA  . ALA A 1 47  ? 9.017   23.884 73.239 1.00 30.50  ? 42  ALA A CA  1 
ATOM   259  C C   . ALA A 1 47  ? 7.567   23.682 72.804 1.00 31.93  ? 42  ALA A C   1 
ATOM   260  O O   . ALA A 1 47  ? 6.747   23.188 73.580 1.00 29.36  ? 42  ALA A O   1 
ATOM   261  C CB  . ALA A 1 47  ? 9.274   25.349 73.613 1.00 28.16  ? 42  ALA A CB  1 
ATOM   262  N N   . GLN A 1 48  ? 7.257   24.037 71.558 1.00 28.98  ? 43  GLN A N   1 
ATOM   263  C CA  . GLN A 1 48  ? 5.898   23.863 71.037 1.00 30.39  ? 43  GLN A CA  1 
ATOM   264  C C   . GLN A 1 48  ? 5.502   22.400 70.907 1.00 30.27  ? 43  GLN A C   1 
ATOM   265  O O   . GLN A 1 48  ? 4.335   22.052 71.083 1.00 28.54  ? 43  GLN A O   1 
ATOM   266  C CB  . GLN A 1 48  ? 5.745   24.570 69.683 1.00 30.10  ? 43  GLN A CB  1 
ATOM   267  C CG  . GLN A 1 48  ? 5.793   26.090 69.827 1.00 37.25  ? 43  GLN A CG  1 
ATOM   268  C CD  . GLN A 1 48  ? 5.729   26.828 68.503 1.00 41.42  ? 43  GLN A CD  1 
ATOM   269  O OE1 . GLN A 1 48  ? 5.719   26.221 67.440 1.00 45.14  ? 43  GLN A OE1 1 
ATOM   270  N NE2 . GLN A 1 48  ? 5.693   28.151 68.570 1.00 42.09  ? 43  GLN A NE2 1 
ATOM   271  N N   . VAL A 1 49  ? 6.467   21.539 70.604 1.00 26.97  ? 44  VAL A N   1 
ATOM   272  C CA  . VAL A 1 49  ? 6.195   20.116 70.522 1.00 26.46  ? 44  VAL A CA  1 
ATOM   273  C C   . VAL A 1 49  ? 5.929   19.558 71.936 1.00 27.27  ? 44  VAL A C   1 
ATOM   274  O O   . VAL A 1 49  ? 5.036   18.732 72.127 1.00 27.07  ? 44  VAL A O   1 
ATOM   275  C CB  . VAL A 1 49  ? 7.368   19.366 69.836 1.00 25.97  ? 44  VAL A CB  1 
ATOM   276  C CG1 . VAL A 1 49  ? 7.259   17.857 70.038 1.00 26.20  ? 44  VAL A CG1 1 
ATOM   277  C CG2 . VAL A 1 49  ? 7.416   19.717 68.335 1.00 25.51  ? 44  VAL A CG2 1 
ATOM   278  N N   . LEU A 1 50  ? 6.699   20.009 72.922 1.00 27.69  ? 45  LEU A N   1 
ATOM   279  C CA  . LEU A 1 50  ? 6.499   19.550 74.295 1.00 24.72  ? 45  LEU A CA  1 
ATOM   280  C C   . LEU A 1 50  ? 5.116   19.982 74.765 1.00 25.58  ? 45  LEU A C   1 
ATOM   281  O O   . LEU A 1 50  ? 4.421   19.224 75.439 1.00 27.37  ? 45  LEU A O   1 
ATOM   282  C CB  . LEU A 1 50  ? 7.601   20.083 75.228 1.00 24.88  ? 45  LEU A CB  1 
ATOM   283  C CG  . LEU A 1 50  ? 8.905   19.288 75.074 1.00 24.24  ? 45  LEU A CG  1 
ATOM   284  C CD1 . LEU A 1 50  ? 10.059  20.019 75.760 1.00 24.97  ? 45  LEU A CD1 1 
ATOM   285  C CD2 . LEU A 1 50  ? 8.765   17.860 75.627 1.00 23.57  ? 45  LEU A CD2 1 
ATOM   286  N N   . GLN A 1 51  ? 4.687   21.171 74.349 1.00 27.06  ? 46  GLN A N   1 
ATOM   287  C CA  . GLN A 1 51  ? 3.324   21.609 74.650 1.00 29.56  ? 46  GLN A CA  1 
ATOM   288  C C   . GLN A 1 51  ? 2.271   20.681 74.040 1.00 27.98  ? 46  GLN A C   1 
ATOM   289  O O   . GLN A 1 51  ? 1.251   20.418 74.666 1.00 32.49  ? 46  GLN A O   1 
ATOM   290  C CB  . GLN A 1 51  ? 3.081   23.043 74.165 1.00 28.44  ? 46  GLN A CB  1 
ATOM   291  C CG  . GLN A 1 51  ? 1.672   23.544 74.491 1.00 32.92  ? 46  GLN A CG  1 
ATOM   292  C CD  . GLN A 1 51  ? 1.417   24.956 74.022 1.00 37.88  ? 46  GLN A CD  1 
ATOM   293  O OE1 . GLN A 1 51  ? 1.817   25.341 72.925 1.00 39.68  ? 46  GLN A OE1 1 
ATOM   294  N NE2 . GLN A 1 51  ? 0.729   25.737 74.849 1.00 44.99  ? 46  GLN A NE2 1 
ATOM   295  N N   . LYS A 1 52  ? 2.489   20.212 72.807 1.00 26.46  ? 47  LYS A N   1 
ATOM   296  C CA  . LYS A 1 52  ? 1.558   19.268 72.207 1.00 28.06  ? 47  LYS A CA  1 
ATOM   297  C C   . LYS A 1 52  ? 1.522   17.991 73.031 1.00 35.15  ? 47  LYS A C   1 
ATOM   298  O O   . LYS A 1 52  ? 0.449   17.450 73.287 1.00 30.98  ? 47  LYS A O   1 
ATOM   299  C CB  . LYS A 1 52  ? 1.939   18.947 70.757 1.00 32.35  ? 47  LYS A CB  1 
ATOM   300  C CG  . LYS A 1 52  ? 2.048   20.161 69.843 1.00 37.58  ? 47  LYS A CG  1 
ATOM   301  C CD  . LYS A 1 52  ? 0.688   20.650 69.396 1.00 49.09  ? 47  LYS A CD  1 
ATOM   302  C CE  . LYS A 1 52  ? 0.808   21.656 68.261 1.00 53.43  ? 47  LYS A CE  1 
ATOM   303  N NZ  . LYS A 1 52  ? -0.489  22.350 68.027 1.00 56.93  1 47  LYS A NZ  1 
ATOM   304  N N   . ILE A 1 53  ? 2.699   17.531 73.459 1.00 29.05  ? 48  ILE A N   1 
ATOM   305  C CA  . ILE A 1 53  ? 2.814   16.287 74.215 1.00 26.25  ? 48  ILE A CA  1 
ATOM   306  C C   . ILE A 1 53  ? 2.081   16.361 75.564 1.00 29.88  ? 48  ILE A C   1 
ATOM   307  O O   . ILE A 1 53  ? 1.269   15.489 75.883 1.00 27.78  ? 48  ILE A O   1 
ATOM   308  C CB  . ILE A 1 53  ? 4.297   15.916 74.431 1.00 26.23  ? 48  ILE A CB  1 
ATOM   309  C CG1 . ILE A 1 53  ? 4.920   15.510 73.090 1.00 24.56  ? 48  ILE A CG1 1 
ATOM   310  C CG2 . ILE A 1 53  ? 4.422   14.808 75.453 1.00 30.10  ? 48  ILE A CG2 1 
ATOM   311  C CD1 . ILE A 1 53  ? 6.449   15.307 73.140 1.00 27.89  ? 48  ILE A CD1 1 
ATOM   312  N N   . ASP A 1 54  ? 2.366   17.390 76.357 1.00 29.80  ? 49  ASP A N   1 
ATOM   313  C CA  . ASP A 1 54  ? 1.587   17.635 77.573 1.00 27.17  ? 49  ASP A CA  1 
ATOM   314  C C   . ASP A 1 54  ? 1.327   19.119 77.773 1.00 28.49  ? 49  ASP A C   1 
ATOM   315  O O   . ASP A 1 54  ? 2.119   19.807 78.413 1.00 28.51  ? 49  ASP A O   1 
ATOM   316  C CB  . ASP A 1 54  ? 2.297   17.074 78.814 1.00 30.71  ? 49  ASP A CB  1 
ATOM   317  C CG  . ASP A 1 54  ? 1.365   16.954 80.010 1.00 40.78  ? 49  ASP A CG  1 
ATOM   318  O OD1 . ASP A 1 54  ? 0.365   17.697 80.057 1.00 36.37  ? 49  ASP A OD1 1 
ATOM   319  O OD2 . ASP A 1 54  ? 1.625   16.115 80.897 1.00 32.62  1 49  ASP A OD2 1 
ATOM   320  N N   . PRO A 1 55  ? 0.190   19.609 77.260 1.00 28.84  ? 50  PRO A N   1 
ATOM   321  C CA  . PRO A 1 55  ? -0.144  21.033 77.339 1.00 29.90  ? 50  PRO A CA  1 
ATOM   322  C C   . PRO A 1 55  ? -0.505  21.464 78.756 1.00 36.80  ? 50  PRO A C   1 
ATOM   323  O O   . PRO A 1 55  ? -0.497  22.657 79.050 1.00 36.51  ? 50  PRO A O   1 
ATOM   324  C CB  . PRO A 1 55  ? -1.350  21.168 76.395 1.00 30.51  ? 50  PRO A CB  1 
ATOM   325  C CG  . PRO A 1 55  ? -1.926  19.808 76.322 1.00 35.95  ? 50  PRO A CG  1 
ATOM   326  C CD  . PRO A 1 55  ? -0.788  18.847 76.461 1.00 28.82  ? 50  PRO A CD  1 
ATOM   327  N N   . ALA A 1 56  ? -0.796  20.506 79.630 1.00 32.28  ? 51  ALA A N   1 
ATOM   328  C CA  . ALA A 1 56  ? -1.102  20.843 81.021 1.00 32.61  ? 51  ALA A CA  1 
ATOM   329  C C   . ALA A 1 56  ? 0.158   21.162 81.814 1.00 39.40  ? 51  ALA A C   1 
ATOM   330  O O   . ALA A 1 56  ? 0.117   21.956 82.753 1.00 36.60  ? 51  ALA A O   1 
ATOM   331  C CB  . ALA A 1 56  ? -1.886  19.707 81.693 1.00 34.47  ? 51  ALA A CB  1 
ATOM   332  N N   . TYR A 1 57  ? 1.276   20.544 81.442 1.00 30.43  ? 52  TYR A N   1 
ATOM   333  C CA  . TYR A 1 57  ? 2.555   20.796 82.095 1.00 33.93  ? 52  TYR A CA  1 
ATOM   334  C C   . TYR A 1 57  ? 3.333   21.883 81.359 1.00 29.81  ? 52  TYR A C   1 
ATOM   335  O O   . TYR A 1 57  ? 3.743   22.882 81.964 1.00 33.77  ? 52  TYR A O   1 
ATOM   336  C CB  . TYR A 1 57  ? 3.387   19.505 82.169 1.00 29.65  ? 52  TYR A CB  1 
ATOM   337  C CG  . TYR A 1 57  ? 4.662   19.617 82.981 1.00 31.11  ? 52  TYR A CG  1 
ATOM   338  C CD1 . TYR A 1 57  ? 5.846   20.007 82.384 1.00 32.91  ? 52  TYR A CD1 1 
ATOM   339  C CD2 . TYR A 1 57  ? 4.672   19.335 84.339 1.00 29.69  ? 52  TYR A CD2 1 
ATOM   340  C CE1 . TYR A 1 57  ? 7.021   20.112 83.115 1.00 28.77  ? 52  TYR A CE1 1 
ATOM   341  C CE2 . TYR A 1 57  ? 5.848   19.431 85.092 1.00 30.90  ? 52  TYR A CE2 1 
ATOM   342  C CZ  . TYR A 1 57  ? 7.018   19.826 84.467 1.00 28.36  ? 52  TYR A CZ  1 
ATOM   343  O OH  . TYR A 1 57  ? 8.198   19.934 85.165 1.00 35.17  ? 52  TYR A OH  1 
ATOM   344  N N   . PHE A 1 58  ? 3.541   21.673 80.063 1.00 33.06  ? 53  PHE A N   1 
ATOM   345  C CA  . PHE A 1 58  ? 4.203   22.646 79.201 1.00 33.15  ? 53  PHE A CA  1 
ATOM   346  C C   . PHE A 1 58  ? 3.156   23.608 78.652 1.00 30.03  ? 53  PHE A C   1 
ATOM   347  O O   . PHE A 1 58  ? 2.844   23.594 77.464 1.00 32.90  ? 53  PHE A O   1 
ATOM   348  C CB  . PHE A 1 58  ? 4.962   21.939 78.056 1.00 27.75  ? 53  PHE A CB  1 
ATOM   349  C CG  . PHE A 1 58  ? 6.010   20.967 78.533 1.00 27.79  ? 53  PHE A CG  1 
ATOM   350  C CD1 . PHE A 1 58  ? 7.242   21.424 78.984 1.00 27.13  ? 53  PHE A CD1 1 
ATOM   351  C CD2 . PHE A 1 58  ? 5.767   19.603 78.533 1.00 26.84  ? 53  PHE A CD2 1 
ATOM   352  C CE1 . PHE A 1 58  ? 8.210   20.540 79.418 1.00 30.44  ? 53  PHE A CE1 1 
ATOM   353  C CE2 . PHE A 1 58  ? 6.738   18.711 78.961 1.00 27.15  ? 53  PHE A CE2 1 
ATOM   354  C CZ  . PHE A 1 58  ? 7.960   19.185 79.417 1.00 25.60  ? 53  PHE A CZ  1 
ATOM   355  N N   . ASP A 1 59  ? 2.593   24.435 79.527 1.00 34.04  ? 54  ASP A N   1 
ATOM   356  C CA  . ASP A 1 59  ? 1.498   25.305 79.113 1.00 41.81  ? 54  ASP A CA  1 
ATOM   357  C C   . ASP A 1 59  ? 1.969   26.690 78.661 1.00 43.16  ? 54  ASP A C   1 
ATOM   358  O O   . ASP A 1 59  ? 3.160   26.955 78.589 1.00 38.71  ? 54  ASP A O   1 
ATOM   359  C CB  . ASP A 1 59  ? 0.453   25.436 80.237 1.00 41.08  ? 54  ASP A CB  1 
ATOM   360  C CG  . ASP A 1 59  ? 1.018   25.982 81.532 1.00 45.44  ? 54  ASP A CG  1 
ATOM   361  O OD1 . ASP A 1 59  ? 2.183   26.434 81.575 1.00 42.05  ? 54  ASP A OD1 1 
ATOM   362  O OD2 . ASP A 1 59  ? 0.256   25.981 82.533 1.00 50.46  1 54  ASP A OD2 1 
ATOM   363  N N   . GLU A 1 60  ? 1.018   27.563 78.344 1.00 45.29  ? 55  GLU A N   1 
ATOM   364  C CA  . GLU A 1 60  ? 1.337   28.883 77.812 1.00 41.34  ? 55  GLU A CA  1 
ATOM   365  C C   . GLU A 1 60  ? 2.233   29.663 78.770 1.00 44.12  ? 55  GLU A C   1 
ATOM   366  O O   . GLU A 1 60  ? 3.144   30.378 78.342 1.00 46.89  ? 55  GLU A O   1 
ATOM   367  C CB  . GLU A 1 60  ? 0.046   29.663 77.520 1.00 52.50  ? 55  GLU A CB  1 
ATOM   368  C CG  . GLU A 1 60  ? 0.268   31.096 77.058 1.00 70.65  ? 55  GLU A CG  1 
ATOM   369  C CD  . GLU A 1 60  ? -1.034  31.834 76.798 1.00 82.30  ? 55  GLU A CD  1 
ATOM   370  O OE1 . GLU A 1 60  ? -2.069  31.162 76.608 1.00 82.57  ? 55  GLU A OE1 1 
ATOM   371  O OE2 . GLU A 1 60  ? -1.025  33.084 76.789 1.00 88.18  1 55  GLU A OE2 1 
ATOM   372  N N   . ASN A 1 61  ? 1.985   29.516 80.070 1.00 44.85  ? 56  ASN A N   1 
ATOM   373  C CA  . ASN A 1 61  ? 2.832   30.147 81.072 1.00 48.44  ? 56  ASN A CA  1 
ATOM   374  C C   . ASN A 1 61  ? 4.245   29.598 81.011 1.00 48.19  ? 56  ASN A C   1 
ATOM   375  O O   . ASN A 1 61  ? 5.221   30.352 81.065 1.00 47.98  ? 56  ASN A O   1 
ATOM   376  C CB  . ASN A 1 61  ? 2.264   29.942 82.479 1.00 52.80  ? 56  ASN A CB  1 
ATOM   377  C CG  . ASN A 1 61  ? 1.069   30.838 82.768 1.00 72.76  ? 56  ASN A CG  1 
ATOM   378  O OD1 . ASN A 1 61  ? 0.849   31.846 82.093 1.00 69.12  ? 56  ASN A OD1 1 
ATOM   379  N ND2 . ASN A 1 61  ? 0.295   30.476 83.787 1.00 78.00  ? 56  ASN A ND2 1 
ATOM   380  N N   . TRP A 1 62  ? 4.348   28.276 80.918 1.00 42.16  ? 57  TRP A N   1 
ATOM   381  C CA  . TRP A 1 62  ? 5.644   27.617 80.812 1.00 39.67  ? 57  TRP A CA  1 
ATOM   382  C C   . TRP A 1 62  ? 6.412   28.102 79.597 1.00 43.66  ? 57  TRP A C   1 
ATOM   383  O O   . TRP A 1 62  ? 7.591   28.434 79.692 1.00 44.99  ? 57  TRP A O   1 
ATOM   384  C CB  . TRP A 1 62  ? 5.491   26.097 80.729 1.00 36.27  ? 57  TRP A CB  1 
ATOM   385  C CG  . TRP A 1 62  ? 6.797   25.404 80.954 1.00 35.60  ? 57  TRP A CG  1 
ATOM   386  C CD1 . TRP A 1 62  ? 7.299   24.971 82.150 1.00 53.41  ? 57  TRP A CD1 1 
ATOM   387  C CD2 . TRP A 1 62  ? 7.792   25.104 79.970 1.00 45.12  ? 57  TRP A CD2 1 
ATOM   388  N NE1 . TRP A 1 62  ? 8.537   24.408 81.965 1.00 49.60  ? 57  TRP A NE1 1 
ATOM   389  C CE2 . TRP A 1 62  ? 8.863   24.477 80.637 1.00 45.63  ? 57  TRP A CE2 1 
ATOM   390  C CE3 . TRP A 1 62  ? 7.877   25.294 78.588 1.00 47.66  ? 57  TRP A CE3 1 
ATOM   391  C CZ2 . TRP A 1 62  ? 9.999   24.041 79.973 1.00 51.37  ? 57  TRP A CZ2 1 
ATOM   392  C CZ3 . TRP A 1 62  ? 9.009   24.861 77.929 1.00 64.05  ? 57  TRP A CZ3 1 
ATOM   393  C CH2 . TRP A 1 62  ? 10.054  24.239 78.620 1.00 57.49  ? 57  TRP A CH2 1 
ATOM   394  N N   . LEU A 1 63  ? 5.732   28.138 78.459 1.00 39.61  ? 58  LEU A N   1 
ATOM   395  C CA  . LEU A 1 63  ? 6.340   28.570 77.204 1.00 49.43  ? 58  LEU A CA  1 
ATOM   396  C C   . LEU A 1 63  ? 6.863   30.003 77.243 1.00 53.73  ? 58  LEU A C   1 
ATOM   397  O O   . LEU A 1 63  ? 7.682   30.387 76.408 1.00 52.45  ? 58  LEU A O   1 
ATOM   398  C CB  . LEU A 1 63  ? 5.341   28.437 76.060 1.00 47.75  ? 58  LEU A CB  1 
ATOM   399  C CG  . LEU A 1 63  ? 5.042   27.031 75.554 1.00 61.61  ? 58  LEU A CG  1 
ATOM   400  C CD1 . LEU A 1 63  ? 4.199   27.102 74.290 1.00 65.56  ? 58  LEU A CD1 1 
ATOM   401  C CD2 . LEU A 1 63  ? 6.330   26.277 75.301 1.00 65.83  ? 58  LEU A CD2 1 
ATOM   402  N N   . ASN A 1 64  ? 6.385   30.791 78.203 1.00 53.48  ? 59  ASN A N   1 
ATOM   403  C CA  . ASN A 1 64  ? 6.778   32.192 78.306 1.00 60.47  ? 59  ASN A CA  1 
ATOM   404  C C   . ASN A 1 64  ? 8.269   32.353 78.535 1.00 62.22  ? 59  ASN A C   1 
ATOM   405  O O   . ASN A 1 64  ? 8.865   33.335 78.093 1.00 69.54  ? 59  ASN A O   1 
ATOM   406  C CB  . ASN A 1 64  ? 6.008   32.886 79.429 1.00 68.70  ? 59  ASN A CB  1 
ATOM   407  C CG  . ASN A 1 64  ? 4.966   33.848 78.909 1.00 83.78  ? 59  ASN A CG  1 
ATOM   408  O OD1 . ASN A 1 64  ? 3.851   33.450 78.570 1.00 89.65  ? 59  ASN A OD1 1 
ATOM   409  N ND2 . ASN A 1 64  ? 5.324   35.128 78.842 1.00 89.03  ? 59  ASN A ND2 1 
ATOM   410  N N   . ARG A 1 65  ? 8.869   31.380 79.218 1.00 49.87  ? 60  ARG A N   1 
ATOM   411  C CA  . ARG A 1 65  ? 10.288  31.446 79.545 1.00 46.59  ? 60  ARG A CA  1 
ATOM   412  C C   . ARG A 1 65  ? 11.131  31.308 78.281 1.00 42.91  ? 60  ARG A C   1 
ATOM   413  O O   . ARG A 1 65  ? 12.313  31.651 78.272 1.00 47.17  ? 60  ARG A O   1 
ATOM   414  C CB  . ARG A 1 65  ? 10.666  30.362 80.563 1.00 48.74  ? 60  ARG A CB  1 
ATOM   415  C CG  . ARG A 1 65  ? 10.644  28.936 80.002 1.00 49.49  ? 60  ARG A CG  1 
ATOM   416  C CD  . ARG A 1 65  ? 10.865  27.893 81.100 1.00 50.19  ? 60  ARG A CD  1 
ATOM   417  N NE  . ARG A 1 65  ? 9.765   27.867 82.064 1.00 54.66  ? 60  ARG A NE  1 
ATOM   418  C CZ  . ARG A 1 65  ? 9.790   27.189 83.208 1.00 50.81  ? 60  ARG A CZ  1 
ATOM   419  N NH1 . ARG A 1 65  ? 10.861  26.478 83.536 1.00 47.48  1 60  ARG A NH1 1 
ATOM   420  N NH2 . ARG A 1 65  ? 8.749   27.229 84.029 1.00 49.18  ? 60  ARG A NH2 1 
ATOM   421  N N   . ILE A 1 66  ? 10.522  30.803 77.217 1.00 43.70  ? 61  ILE A N   1 
ATOM   422  C CA  . ILE A 1 66  ? 11.243  30.587 75.969 1.00 49.00  ? 61  ILE A CA  1 
ATOM   423  C C   . ILE A 1 66  ? 11.153  31.816 75.082 1.00 56.17  ? 61  ILE A C   1 
ATOM   424  O O   . ILE A 1 66  ? 10.090  32.122 74.547 1.00 57.16  ? 61  ILE A O   1 
ATOM   425  C CB  . ILE A 1 66  ? 10.703  29.373 75.193 1.00 39.34  ? 61  ILE A CB  1 
ATOM   426  C CG1 . ILE A 1 66  ? 10.687  28.124 76.081 1.00 37.13  ? 61  ILE A CG1 1 
ATOM   427  C CG2 . ILE A 1 66  ? 11.534  29.135 73.939 1.00 40.93  ? 61  ILE A CG2 1 
ATOM   428  C CD1 . ILE A 1 66  ? 12.053  27.717 76.617 1.00 35.59  ? 61  ILE A CD1 1 
ATOM   429  N N   . LYS A 1 67  ? 12.269  32.519 74.931 1.00 47.56  ? 62  LYS A N   1 
ATOM   430  C CA  . LYS A 1 67  ? 12.311  33.721 74.102 1.00 53.80  ? 62  LYS A CA  1 
ATOM   431  C C   . LYS A 1 67  ? 12.138  33.377 72.626 1.00 53.96  ? 62  LYS A C   1 
ATOM   432  O O   . LYS A 1 67  ? 12.757  32.439 72.126 1.00 55.90  ? 62  LYS A O   1 
ATOM   433  C CB  . LYS A 1 67  ? 13.626  34.475 74.324 1.00 48.72  ? 62  LYS A CB  1 
ATOM   434  C CG  . LYS A 1 67  ? 13.510  35.664 75.263 1.00 62.96  ? 62  LYS A CG  1 
ATOM   435  C CD  . LYS A 1 67  ? 12.754  35.325 76.544 1.00 74.16  ? 62  LYS A CD  1 
ATOM   436  C CE  . LYS A 1 67  ? 13.594  34.489 77.494 1.00 81.96  ? 62  LYS A CE  1 
ATOM   437  N NZ  . LYS A 1 67  ? 12.910  34.299 78.808 1.00 84.20  1 62  LYS A NZ  1 
ATOM   438  N N   . THR A 1 68  ? 11.290  34.129 71.930 1.00 50.61  ? 63  THR A N   1 
ATOM   439  C CA  . THR A 1 68  ? 11.032  33.858 70.517 1.00 56.51  ? 63  THR A CA  1 
ATOM   440  C C   . THR A 1 68  ? 11.905  34.713 69.607 1.00 65.89  ? 63  THR A C   1 
ATOM   441  O O   . THR A 1 68  ? 12.499  34.209 68.656 1.00 79.05  ? 63  THR A O   1 
ATOM   442  C CB  . THR A 1 68  ? 9.555   34.094 70.150 1.00 61.24  ? 63  THR A CB  1 
ATOM   443  O OG1 . THR A 1 68  ? 9.086   35.287 70.788 1.00 63.52  ? 63  THR A OG1 1 
ATOM   444  C CG2 . THR A 1 68  ? 8.699   32.912 70.589 1.00 53.39  ? 63  THR A CG2 1 
ATOM   445  N N   . GLU A 1 69  ? 11.980  36.005 69.898 1.00 63.11  ? 64  GLU A N   1 
ATOM   446  C CA  . GLU A 1 69  ? 12.816  36.910 69.120 1.00 77.01  ? 64  GLU A CA  1 
ATOM   447  C C   . GLU A 1 69  ? 14.282  36.651 69.421 1.00 71.79  ? 64  GLU A C   1 
ATOM   448  O O   . GLU A 1 69  ? 14.876  37.311 70.270 1.00 76.04  ? 64  GLU A O   1 
ATOM   449  C CB  . GLU A 1 69  ? 12.461  38.367 69.419 1.00 91.95  ? 64  GLU A CB  1 
ATOM   450  C CG  . GLU A 1 69  ? 11.047  38.746 69.023 1.00 102.47 ? 64  GLU A CG  1 
ATOM   451  C CD  . GLU A 1 69  ? 10.790  38.566 67.537 1.00 113.22 ? 64  GLU A CD  1 
ATOM   452  O OE1 . GLU A 1 69  ? 11.645  38.985 66.728 1.00 118.77 ? 64  GLU A OE1 1 
ATOM   453  O OE2 . GLU A 1 69  ? 9.735   38.002 67.177 1.00 116.70 1 64  GLU A OE2 1 
ATOM   454  N N   . VAL A 1 70  ? 14.863  35.689 68.719 1.00 66.58  ? 65  VAL A N   1 
ATOM   455  C CA  . VAL A 1 70  ? 16.213  35.242 69.029 1.00 62.05  ? 65  VAL A CA  1 
ATOM   456  C C   . VAL A 1 70  ? 17.229  35.713 68.000 1.00 60.70  ? 65  VAL A C   1 
ATOM   457  O O   . VAL A 1 70  ? 18.288  36.234 68.349 1.00 60.83  ? 65  VAL A O   1 
ATOM   458  C CB  . VAL A 1 70  ? 16.275  33.710 69.125 1.00 61.48  ? 65  VAL A CB  1 
ATOM   459  C CG1 . VAL A 1 70  ? 17.698  33.255 69.381 1.00 61.79  ? 65  VAL A CG1 1 
ATOM   460  C CG2 . VAL A 1 70  ? 15.350  33.221 70.221 1.00 62.88  ? 65  VAL A CG2 1 
ATOM   461  N N   . GLY A 1 71  ? 16.904  35.521 66.729 1.00 64.44  ? 66  GLY A N   1 
ATOM   462  C CA  . GLY A 1 71  ? 17.822  35.857 65.661 1.00 66.38  ? 66  GLY A CA  1 
ATOM   463  C C   . GLY A 1 71  ? 19.075  35.008 65.739 1.00 62.11  ? 66  GLY A C   1 
ATOM   464  O O   . GLY A 1 71  ? 19.009  33.793 65.952 1.00 54.25  ? 66  GLY A O   1 
ATOM   465  N N   . ASP A 1 72  ? 20.222  35.655 65.579 1.00 66.37  ? 67  ASP A N   1 
ATOM   466  C CA  . ASP A 1 72  ? 21.497  34.957 65.602 1.00 68.73  ? 67  ASP A CA  1 
ATOM   467  C C   . ASP A 1 72  ? 22.187  35.115 66.958 1.00 62.98  ? 67  ASP A C   1 
ATOM   468  O O   . ASP A 1 72  ? 23.400  34.947 67.068 1.00 63.12  ? 67  ASP A O   1 
ATOM   469  C CB  . ASP A 1 72  ? 22.401  35.468 64.477 1.00 84.40  ? 67  ASP A CB  1 
ATOM   470  C CG  . ASP A 1 72  ? 21.706  35.471 63.126 1.00 95.59  ? 67  ASP A CG  1 
ATOM   471  O OD1 . ASP A 1 72  ? 21.601  34.392 62.502 1.00 94.31  ? 67  ASP A OD1 1 
ATOM   472  O OD2 . ASP A 1 72  ? 21.266  36.555 62.686 1.00 103.11 1 67  ASP A OD2 1 
ATOM   473  N N   . ASN A 1 73  ? 21.407  35.446 67.983 1.00 51.42  ? 68  ASN A N   1 
ATOM   474  C CA  . ASN A 1 73  ? 21.915  35.485 69.350 1.00 50.67  ? 68  ASN A CA  1 
ATOM   475  C C   . ASN A 1 73  ? 22.049  34.066 69.889 1.00 51.37  ? 68  ASN A C   1 
ATOM   476  O O   . ASN A 1 73  ? 21.107  33.537 70.484 1.00 44.19  ? 68  ASN A O   1 
ATOM   477  C CB  . ASN A 1 73  ? 20.987  36.318 70.240 1.00 51.69  ? 68  ASN A CB  1 
ATOM   478  C CG  . ASN A 1 73  ? 21.500  36.461 71.668 1.00 55.75  ? 68  ASN A CG  1 
ATOM   479  O OD1 . ASN A 1 73  ? 22.525  35.889 72.041 1.00 51.60  ? 68  ASN A OD1 1 
ATOM   480  N ND2 . ASN A 1 73  ? 20.788  37.247 72.473 1.00 55.52  ? 68  ASN A ND2 1 
ATOM   481  N N   . TRP A 1 74  ? 23.212  33.449 69.685 1.00 45.08  ? 69  TRP A N   1 
ATOM   482  C CA  . TRP A 1 74  ? 23.366  32.032 70.021 1.00 43.76  ? 69  TRP A CA  1 
ATOM   483  C C   . TRP A 1 74  ? 23.472  31.801 71.523 1.00 45.05  ? 69  TRP A C   1 
ATOM   484  O O   . TRP A 1 74  ? 23.208  30.696 71.995 1.00 39.06  ? 69  TRP A O   1 
ATOM   485  C CB  . TRP A 1 74  ? 24.585  31.423 69.316 1.00 42.17  ? 69  TRP A CB  1 
ATOM   486  C CG  . TRP A 1 74  ? 25.898  32.096 69.594 1.00 49.27  ? 69  TRP A CG  1 
ATOM   487  C CD1 . TRP A 1 74  ? 26.465  33.108 68.875 1.00 53.51  ? 69  TRP A CD1 1 
ATOM   488  C CD2 . TRP A 1 74  ? 26.829  31.777 70.640 1.00 50.55  ? 69  TRP A CD2 1 
ATOM   489  N NE1 . TRP A 1 74  ? 27.683  33.449 69.414 1.00 53.56  ? 69  TRP A NE1 1 
ATOM   490  C CE2 . TRP A 1 74  ? 27.929  32.647 70.498 1.00 56.13  ? 69  TRP A CE2 1 
ATOM   491  C CE3 . TRP A 1 74  ? 26.836  30.845 71.684 1.00 49.34  ? 69  TRP A CE3 1 
ATOM   492  C CZ2 . TRP A 1 74  ? 29.024  32.616 71.364 1.00 55.55  ? 69  TRP A CZ2 1 
ATOM   493  C CZ3 . TRP A 1 74  ? 27.926  30.815 72.541 1.00 50.34  ? 69  TRP A CZ3 1 
ATOM   494  C CH2 . TRP A 1 74  ? 29.005  31.695 72.374 1.00 47.40  ? 69  TRP A CH2 1 
ATOM   495  N N   . ARG A 1 75  ? 23.868  32.832 72.267 1.00 45.48  ? 70  ARG A N   1 
ATOM   496  C CA  . ARG A 1 75  ? 23.855  32.755 73.726 1.00 40.57  ? 70  ARG A CA  1 
ATOM   497  C C   . ARG A 1 75  ? 22.420  32.624 74.216 1.00 41.32  ? 70  ARG A C   1 
ATOM   498  O O   . ARG A 1 75  ? 22.134  31.872 75.146 1.00 42.90  ? 70  ARG A O   1 
ATOM   499  C CB  . ARG A 1 75  ? 24.518  33.980 74.347 1.00 46.17  ? 70  ARG A CB  1 
ATOM   500  C CG  . ARG A 1 75  ? 25.975  34.158 73.971 1.00 54.41  ? 70  ARG A CG  1 
ATOM   501  C CD  . ARG A 1 75  ? 26.902  33.391 74.895 1.00 56.33  ? 70  ARG A CD  1 
ATOM   502  N NE  . ARG A 1 75  ? 28.292  33.810 74.713 1.00 55.75  ? 70  ARG A NE  1 
ATOM   503  C CZ  . ARG A 1 75  ? 29.321  33.298 75.379 1.00 56.71  ? 70  ARG A CZ  1 
ATOM   504  N NH1 . ARG A 1 75  ? 29.121  32.348 76.282 1.00 55.80  1 70  ARG A NH1 1 
ATOM   505  N NH2 . ARG A 1 75  ? 30.551  33.737 75.144 1.00 52.60  ? 70  ARG A NH2 1 
ATOM   506  N N   . LEU A 1 76  ? 21.518  33.363 73.580 1.00 38.50  ? 71  LEU A N   1 
ATOM   507  C CA  . LEU A 1 76  ? 20.099  33.262 73.897 1.00 42.03  ? 71  LEU A CA  1 
ATOM   508  C C   . LEU A 1 76  ? 19.522  31.900 73.504 1.00 39.68  ? 71  LEU A C   1 
ATOM   509  O O   . LEU A 1 76  ? 18.685  31.357 74.224 1.00 36.53  ? 71  LEU A O   1 
ATOM   510  C CB  . LEU A 1 76  ? 19.312  34.370 73.202 1.00 44.25  ? 71  LEU A CB  1 
ATOM   511  C CG  . LEU A 1 76  ? 17.807  34.345 73.466 1.00 52.97  ? 71  LEU A CG  1 
ATOM   512  C CD1 . LEU A 1 76  ? 17.526  34.398 74.958 1.00 56.57  ? 71  LEU A CD1 1 
ATOM   513  C CD2 . LEU A 1 76  ? 17.120  35.497 72.748 1.00 56.58  ? 71  LEU A CD2 1 
ATOM   514  N N   . LYS A 1 77  ? 19.947  31.365 72.360 1.00 36.88  ? 72  LYS A N   1 
ATOM   515  C CA  . LYS A 1 77  ? 19.516  30.026 71.948 1.00 33.83  ? 72  LYS A CA  1 
ATOM   516  C C   . LYS A 1 77  ? 19.873  29.027 73.033 1.00 33.91  ? 72  LYS A C   1 
ATOM   517  O O   . LYS A 1 77  ? 19.054  28.206 73.441 1.00 31.35  ? 72  LYS A O   1 
ATOM   518  C CB  . LYS A 1 77  ? 20.169  29.594 70.635 1.00 33.83  ? 72  LYS A CB  1 
ATOM   519  C CG  . LYS A 1 77  ? 19.766  30.381 69.401 1.00 35.02  ? 72  LYS A CG  1 
ATOM   520  C CD  . LYS A 1 77  ? 20.424  29.778 68.169 1.00 42.34  ? 72  LYS A CD  1 
ATOM   521  C CE  . LYS A 1 77  ? 20.080  30.548 66.902 1.00 44.73  ? 72  LYS A CE  1 
ATOM   522  N NZ  . LYS A 1 77  ? 20.713  29.914 65.712 1.00 43.92  1 72  LYS A NZ  1 
ATOM   523  N N   . ILE A 1 78  ? 21.113  29.102 73.501 1.00 32.98  ? 73  ILE A N   1 
ATOM   524  C CA  . ILE A 1 78  ? 21.575  28.179 74.525 1.00 39.17  ? 73  ILE A CA  1 
ATOM   525  C C   . ILE A 1 78  ? 20.726  28.301 75.781 1.00 31.68  ? 73  ILE A C   1 
ATOM   526  O O   . ILE A 1 78  ? 20.334  27.296 76.368 1.00 31.58  ? 73  ILE A O   1 
ATOM   527  C CB  . ILE A 1 78  ? 23.052  28.422 74.870 1.00 39.20  ? 73  ILE A CB  1 
ATOM   528  C CG1 . ILE A 1 78  ? 23.927  27.955 73.710 1.00 33.48  ? 73  ILE A CG1 1 
ATOM   529  C CG2 . ILE A 1 78  ? 23.423  27.678 76.131 1.00 32.33  ? 73  ILE A CG2 1 
ATOM   530  C CD1 . ILE A 1 78  ? 25.407  28.269 73.893 1.00 33.99  ? 73  ILE A CD1 1 
ATOM   531  N N   . SER A 1 79  ? 20.446  29.541 76.178 1.00 32.89  ? 74  SER A N   1 
ATOM   532  C CA  . SER A 1 79  ? 19.598  29.815 77.331 1.00 32.90  ? 74  SER A CA  1 
ATOM   533  C C   . SER A 1 79  ? 18.237  29.127 77.188 1.00 36.35  ? 74  SER A C   1 
ATOM   534  O O   . SER A 1 79  ? 17.780  28.431 78.099 1.00 31.68  ? 74  SER A O   1 
ATOM   535  C CB  . SER A 1 79  ? 19.426  31.327 77.514 1.00 40.26  ? 74  SER A CB  1 
ATOM   536  O OG  . SER A 1 79  ? 18.537  31.606 78.578 1.00 49.59  ? 74  SER A OG  1 
ATOM   537  N N   . ASN A 1 80  ? 17.601  29.316 76.037 1.00 32.02  ? 75  ASN A N   1 
ATOM   538  C CA  . ASN A 1 80  ? 16.358  28.629 75.725 1.00 32.82  ? 75  ASN A CA  1 
ATOM   539  C C   . ASN A 1 80  ? 16.471  27.109 75.820 1.00 35.73  ? 75  ASN A C   1 
ATOM   540  O O   . ASN A 1 80  ? 15.617  26.434 76.397 1.00 29.87  ? 75  ASN A O   1 
ATOM   541  C CB  . ASN A 1 80  ? 15.890  29.015 74.320 1.00 31.97  ? 75  ASN A CB  1 
ATOM   542  C CG  . ASN A 1 80  ? 15.114  30.318 74.306 1.00 39.82  ? 75  ASN A CG  1 
ATOM   543  O OD1 . ASN A 1 80  ? 14.909  30.939 75.348 1.00 37.59  ? 75  ASN A OD1 1 
ATOM   544  N ND2 . ASN A 1 80  ? 14.676  30.737 73.125 1.00 36.38  ? 75  ASN A ND2 1 
ATOM   545  N N   . LEU A 1 81  ? 17.532  26.571 75.239 1.00 29.21  ? 76  LEU A N   1 
ATOM   546  C CA  . LEU A 1 81  ? 17.706  25.131 75.172 1.00 27.93  ? 76  LEU A CA  1 
ATOM   547  C C   . LEU A 1 81  ? 17.938  24.500 76.543 1.00 29.89  ? 76  LEU A C   1 
ATOM   548  O O   . LEU A 1 81  ? 17.489  23.386 76.790 1.00 28.12  ? 76  LEU A O   1 
ATOM   549  C CB  . LEU A 1 81  ? 18.870  24.793 74.241 1.00 29.67  ? 76  LEU A CB  1 
ATOM   550  C CG  . LEU A 1 81  ? 18.627  25.148 72.767 1.00 30.33  ? 76  LEU A CG  1 
ATOM   551  C CD1 . LEU A 1 81  ? 19.931  25.175 71.996 1.00 30.49  ? 76  LEU A CD1 1 
ATOM   552  C CD2 . LEU A 1 81  ? 17.679  24.165 72.122 1.00 29.99  ? 76  LEU A CD2 1 
ATOM   553  N N   . LYS A 1 82  ? 18.646  25.204 77.429 1.00 28.21  ? 77  LYS A N   1 
ATOM   554  C CA  . LYS A 1 82  ? 18.826  24.705 78.788 1.00 27.94  ? 77  LYS A CA  1 
ATOM   555  C C   . LYS A 1 82  ? 17.498  24.687 79.541 1.00 29.50  ? 77  LYS A C   1 
ATOM   556  O O   . LYS A 1 82  ? 17.246  23.789 80.346 1.00 35.47  ? 77  LYS A O   1 
ATOM   557  C CB  . LYS A 1 82  ? 19.866  25.537 79.542 1.00 28.88  ? 77  LYS A CB  1 
ATOM   558  C CG  . LYS A 1 82  ? 21.267  25.276 78.999 1.00 29.00  ? 77  LYS A CG  1 
ATOM   559  C CD  . LYS A 1 82  ? 22.359  25.974 79.768 1.00 34.85  ? 77  LYS A CD  1 
ATOM   560  C CE  . LYS A 1 82  ? 23.711  25.479 79.263 1.00 33.66  ? 77  LYS A CE  1 
ATOM   561  N NZ  . LYS A 1 82  ? 24.845  26.253 79.816 1.00 35.67  1 77  LYS A NZ  1 
ATOM   562  N N   . LYS A 1 83  ? 16.640  25.659 79.264 1.00 29.71  ? 78  LYS A N   1 
ATOM   563  C CA  . LYS A 1 83  ? 15.320  25.665 79.900 1.00 32.11  ? 78  LYS A CA  1 
ATOM   564  C C   . LYS A 1 83  ? 14.484  24.474 79.420 1.00 28.78  ? 78  LYS A C   1 
ATOM   565  O O   . LYS A 1 83  ? 13.779  23.845 80.203 1.00 29.13  ? 78  LYS A O   1 
ATOM   566  C CB  . LYS A 1 83  ? 14.587  26.978 79.627 1.00 29.62  ? 78  LYS A CB  1 
ATOM   567  C CG  . LYS A 1 83  ? 15.295  28.201 80.210 1.00 35.70  ? 78  LYS A CG  1 
ATOM   568  C CD  . LYS A 1 83  ? 14.487  29.461 79.948 1.00 41.04  ? 78  LYS A CD  1 
ATOM   569  C CE  . LYS A 1 83  ? 15.278  30.700 80.317 1.00 52.75  ? 78  LYS A CE  1 
ATOM   570  N NZ  . LYS A 1 83  ? 16.004  30.485 81.594 1.00 58.51  1 78  LYS A NZ  1 
ATOM   571  N N   . ILE A 1 84  ? 14.579  24.164 78.132 1.00 28.12  ? 79  ILE A N   1 
ATOM   572  C CA  . ILE A 1 84  ? 13.878  23.028 77.569 1.00 26.17  ? 79  ILE A CA  1 
ATOM   573  C C   . ILE A 1 84  ? 14.439  21.721 78.106 1.00 25.40  ? 79  ILE A C   1 
ATOM   574  O O   . ILE A 1 84  ? 13.675  20.844 78.512 1.00 26.46  ? 79  ILE A O   1 
ATOM   575  C CB  . ILE A 1 84  ? 13.942  23.048 76.040 1.00 30.03  ? 79  ILE A CB  1 
ATOM   576  C CG1 . ILE A 1 84  ? 13.202  24.289 75.549 1.00 35.23  ? 79  ILE A CG1 1 
ATOM   577  C CG2 . ILE A 1 84  ? 13.300  21.788 75.472 1.00 29.52  ? 79  ILE A CG2 1 
ATOM   578  C CD1 . ILE A 1 84  ? 13.615  24.734 74.202 1.00 44.61  ? 79  ILE A CD1 1 
ATOM   579  N N   . LEU A 1 85  ? 15.763  21.597 78.158 1.00 27.26  ? 80  LEU A N   1 
ATOM   580  C CA  . LEU A 1 85  ? 16.358  20.369 78.678 1.00 24.83  ? 80  LEU A CA  1 
ATOM   581  C C   . LEU A 1 85  ? 15.968  20.164 80.150 1.00 25.03  ? 80  LEU A C   1 
ATOM   582  O O   . LEU A 1 85  ? 15.606  19.058 80.550 1.00 27.88  ? 80  LEU A O   1 
ATOM   583  C CB  . LEU A 1 85  ? 17.882  20.394 78.530 1.00 25.05  ? 80  LEU A CB  1 
ATOM   584  C CG  . LEU A 1 85  ? 18.620  19.131 78.977 1.00 25.07  ? 80  LEU A CG  1 
ATOM   585  C CD1 . LEU A 1 85  ? 18.055  17.887 78.291 1.00 24.75  ? 80  LEU A CD1 1 
ATOM   586  C CD2 . LEU A 1 85  ? 20.118  19.259 78.718 1.00 26.25  ? 80  LEU A CD2 1 
ATOM   587  N N   . LYS A 1 86  ? 16.057  21.226 80.945 1.00 26.02  ? 81  LYS A N   1 
ATOM   588  C CA  . LYS A 1 86  ? 15.662  21.164 82.357 1.00 26.12  ? 81  LYS A CA  1 
ATOM   589  C C   . LYS A 1 86  ? 14.179  20.803 82.437 1.00 31.42  ? 81  LYS A C   1 
ATOM   590  O O   . LYS A 1 86  ? 13.766  20.022 83.296 1.00 28.28  ? 81  LYS A O   1 
ATOM   591  C CB  . LYS A 1 86  ? 15.961  22.498 83.056 1.00 32.59  ? 81  LYS A CB  1 
ATOM   592  C CG  . LYS A 1 86  ? 15.534  22.606 84.522 1.00 38.39  ? 81  LYS A CG  1 
ATOM   593  C CD  . LYS A 1 86  ? 16.195  21.569 85.419 1.00 32.19  ? 81  LYS A CD  1 
ATOM   594  C CE  . LYS A 1 86  ? 15.910  21.911 86.895 1.00 35.20  ? 81  LYS A CE  1 
ATOM   595  N NZ  . LYS A 1 86  ? 15.655  20.700 87.723 1.00 38.44  1 81  LYS A NZ  1 
ATOM   596  N N   . GLY A 1 87  ? 13.389  21.357 81.517 1.00 29.51  ? 82  GLY A N   1 
ATOM   597  C CA  . GLY A 1 87  ? 11.964  21.063 81.440 1.00 28.35  ? 82  GLY A CA  1 
ATOM   598  C C   . GLY A 1 87  ? 11.698  19.586 81.214 1.00 29.81  ? 82  GLY A C   1 
ATOM   599  O O   . GLY A 1 87  ? 10.830  18.993 81.856 1.00 28.39  ? 82  GLY A O   1 
ATOM   600  N N   . ILE A 1 88  ? 12.445  18.992 80.289 1.00 26.46  ? 83  ILE A N   1 
ATOM   601  C CA  . ILE A 1 88  ? 12.317  17.569 79.994 1.00 24.12  ? 83  ILE A CA  1 
ATOM   602  C C   . ILE A 1 88  ? 12.700  16.744 81.230 1.00 32.07  ? 83  ILE A C   1 
ATOM   603  O O   . ILE A 1 88  ? 11.978  15.839 81.629 1.00 24.37  ? 83  ILE A O   1 
ATOM   604  C CB  . ILE A 1 88  ? 13.190  17.186 78.804 1.00 23.54  ? 83  ILE A CB  1 
ATOM   605  C CG1 . ILE A 1 88  ? 12.646  17.849 77.532 1.00 25.46  ? 83  ILE A CG1 1 
ATOM   606  C CG2 . ILE A 1 88  ? 13.276  15.669 78.646 1.00 27.46  ? 83  ILE A CG2 1 
ATOM   607  C CD1 . ILE A 1 88  ? 13.622  17.822 76.367 1.00 27.16  ? 83  ILE A CD1 1 
ATOM   608  N N   . LEU A 1 89  ? 13.839  17.064 81.836 1.00 24.49  ? 84  LEU A N   1 
ATOM   609  C CA  . LEU A 1 89  ? 14.259  16.365 83.051 1.00 24.80  ? 84  LEU A CA  1 
ATOM   610  C C   . LEU A 1 89  ? 13.237  16.511 84.169 1.00 26.79  ? 84  LEU A C   1 
ATOM   611  O O   . LEU A 1 89  ? 12.965  15.550 84.887 1.00 31.56  ? 84  LEU A O   1 
ATOM   612  C CB  . LEU A 1 89  ? 15.617  16.879 83.542 1.00 25.05  ? 84  LEU A CB  1 
ATOM   613  C CG  . LEU A 1 89  ? 16.728  16.616 82.517 1.00 34.38  ? 84  LEU A CG  1 
ATOM   614  C CD1 . LEU A 1 89  ? 18.024  17.243 82.975 1.00 35.76  ? 84  LEU A CD1 1 
ATOM   615  C CD2 . LEU A 1 89  ? 16.895  15.129 82.305 1.00 40.75  ? 84  LEU A CD2 1 
ATOM   616  N N   . ASP A 1 90  ? 12.684  17.712 84.326 1.00 25.89  ? 85  ASP A N   1 
ATOM   617  C CA  . ASP A 1 90  ? 11.726  17.959 85.399 1.00 27.91  ? 85  ASP A CA  1 
ATOM   618  C C   . ASP A 1 90  ? 10.412  17.222 85.152 1.00 29.63  ? 85  ASP A C   1 
ATOM   619  O O   . ASP A 1 90  ? 9.804   16.703 86.081 1.00 29.67  ? 85  ASP A O   1 
ATOM   620  C CB  . ASP A 1 90  ? 11.463  19.457 85.573 1.00 30.96  ? 85  ASP A CB  1 
ATOM   621  C CG  . ASP A 1 90  ? 12.590  20.167 86.305 1.00 36.70  ? 85  ASP A CG  1 
ATOM   622  O OD1 . ASP A 1 90  ? 13.447  19.475 86.904 1.00 37.51  ? 85  ASP A OD1 1 
ATOM   623  O OD2 . ASP A 1 90  ? 12.612  21.416 86.288 1.00 34.76  1 85  ASP A OD2 1 
ATOM   624  N N   . TYR A 1 91  ? 9.985   17.168 83.897 1.00 26.14  ? 86  TYR A N   1 
ATOM   625  C CA  . TYR A 1 91  ? 8.740   16.468 83.547 1.00 26.21  ? 86  TYR A CA  1 
ATOM   626  C C   . TYR A 1 91  ? 8.888   14.985 83.881 1.00 27.94  ? 86  TYR A C   1 
ATOM   627  O O   . TYR A 1 91  ? 8.002   14.354 84.446 1.00 31.52  ? 86  TYR A O   1 
ATOM   628  C CB  . TYR A 1 91  ? 8.438   16.659 82.066 1.00 25.62  ? 86  TYR A CB  1 
ATOM   629  C CG  . TYR A 1 91  ? 7.131   16.046 81.608 1.00 28.15  ? 86  TYR A CG  1 
ATOM   630  C CD1 . TYR A 1 91  ? 5.933   16.504 82.121 1.00 34.23  ? 86  TYR A CD1 1 
ATOM   631  C CD2 . TYR A 1 91  ? 7.100   15.026 80.645 1.00 30.80  ? 86  TYR A CD2 1 
ATOM   632  C CE1 . TYR A 1 91  ? 4.738   15.973 81.715 1.00 34.49  ? 86  TYR A CE1 1 
ATOM   633  C CE2 . TYR A 1 91  ? 5.897   14.484 80.230 1.00 34.48  ? 86  TYR A CE2 1 
ATOM   634  C CZ  . TYR A 1 91  ? 4.718   14.970 80.772 1.00 38.62  ? 86  TYR A CZ  1 
ATOM   635  O OH  . TYR A 1 91  ? 3.498   14.460 80.401 1.00 34.52  ? 86  TYR A OH  1 
ATOM   636  N N   . ASN A 1 92  ? 10.051  14.453 83.525 1.00 29.17  ? 87  ASN A N   1 
ATOM   637  C CA  . ASN A 1 92  ? 10.397  13.064 83.749 1.00 28.92  ? 87  ASN A CA  1 
ATOM   638  C C   . ASN A 1 92  ? 10.409  12.722 85.233 1.00 32.58  ? 87  ASN A C   1 
ATOM   639  O O   . ASN A 1 92  ? 9.967   11.643 85.634 1.00 35.84  ? 87  ASN A O   1 
ATOM   640  C CB  . ASN A 1 92  ? 11.766  12.789 83.122 1.00 28.46  ? 87  ASN A CB  1 
ATOM   641  C CG  . ASN A 1 92  ? 12.090  11.321 83.025 1.00 53.36  ? 87  ASN A CG  1 
ATOM   642  O OD1 . ASN A 1 92  ? 11.257  10.513 82.620 1.00 57.73  ? 87  ASN A OD1 1 
ATOM   643  N ND2 . ASN A 1 92  ? 13.324  10.966 83.382 1.00 46.26  ? 87  ASN A ND2 1 
ATOM   644  N N   . HIS A 1 93  ? 10.906  13.658 86.043 1.00 26.71  ? 88  HIS A N   1 
ATOM   645  C CA  . HIS A 1 93  ? 10.980  13.498 87.494 1.00 27.61  ? 88  HIS A CA  1 
ATOM   646  C C   . HIS A 1 93  ? 9.635   13.787 88.176 1.00 30.94  ? 88  HIS A C   1 
ATOM   647  O O   . HIS A 1 93  ? 9.200   13.029 89.053 1.00 39.30  ? 88  HIS A O   1 
ATOM   648  C CB  . HIS A 1 93  ? 12.086  14.414 88.054 1.00 32.43  ? 88  HIS A CB  1 
ATOM   649  C CG  . HIS A 1 93  ? 12.189  14.414 89.548 1.00 36.21  ? 88  HIS A CG  1 
ATOM   650  N ND1 . HIS A 1 93  ? 12.581  13.305 90.268 1.00 30.49  ? 88  HIS A ND1 1 
ATOM   651  C CD2 . HIS A 1 93  ? 11.979  15.396 90.455 1.00 30.70  ? 88  HIS A CD2 1 
ATOM   652  C CE1 . HIS A 1 93  ? 12.595  13.600 91.554 1.00 31.30  ? 88  HIS A CE1 1 
ATOM   653  N NE2 . HIS A 1 93  ? 12.226  14.862 91.697 1.00 37.22  ? 88  HIS A NE2 1 
ATOM   654  N N   . GLU A 1 94  ? 8.969   14.869 87.773 1.00 32.34  ? 89  GLU A N   1 
ATOM   655  C CA  . GLU A 1 94  ? 7.792   15.350 88.512 1.00 33.26  ? 89  GLU A CA  1 
ATOM   656  C C   . GLU A 1 94  ? 6.485   14.694 88.091 1.00 36.66  ? 89  GLU A C   1 
ATOM   657  O O   . GLU A 1 94  ? 5.561   14.576 88.908 1.00 36.27  ? 89  GLU A O   1 
ATOM   658  C CB  . GLU A 1 94  ? 7.641   16.868 88.369 1.00 32.62  ? 89  GLU A CB  1 
ATOM   659  C CG  . GLU A 1 94  ? 8.812   17.663 88.907 1.00 30.87  ? 89  GLU A CG  1 
ATOM   660  C CD  . GLU A 1 94  ? 8.779   19.142 88.516 1.00 48.32  ? 89  GLU A CD  1 
ATOM   661  O OE1 . GLU A 1 94  ? 7.881   19.548 87.746 1.00 37.13  ? 89  GLU A OE1 1 
ATOM   662  O OE2 . GLU A 1 94  ? 9.666   19.901 88.977 1.00 45.56  1 89  GLU A OE2 1 
ATOM   663  N N   . ILE A 1 95  ? 6.402   14.288 86.831 1.00 31.40  ? 90  ILE A N   1 
ATOM   664  C CA  . ILE A 1 95  ? 5.142   13.792 86.275 1.00 34.59  ? 90  ILE A CA  1 
ATOM   665  C C   . ILE A 1 95  ? 5.183   12.324 85.867 1.00 36.21  ? 90  ILE A C   1 
ATOM   666  O O   . ILE A 1 95  ? 4.314   11.542 86.256 1.00 39.08  ? 90  ILE A O   1 
ATOM   667  C CB  . ILE A 1 95  ? 4.715   14.607 85.039 1.00 30.91  ? 90  ILE A CB  1 
ATOM   668  C CG1 . ILE A 1 95  ? 4.440   16.055 85.439 1.00 30.11  ? 90  ILE A CG1 1 
ATOM   669  C CG2 . ILE A 1 95  ? 3.473   14.002 84.406 1.00 36.95  ? 90  ILE A CG2 1 
ATOM   670  C CD1 . ILE A 1 95  ? 3.562   16.208 86.677 1.00 41.50  ? 90  ILE A CD1 1 
ATOM   671  N N   . LEU A 1 96  ? 6.180   11.955 85.075 1.00 35.16  ? 91  LEU A N   1 
ATOM   672  C CA  . LEU A 1 96  ? 6.214   10.627 84.481 1.00 40.71  ? 91  LEU A CA  1 
ATOM   673  C C   . LEU A 1 96  ? 6.485   9.542  85.511 1.00 47.78  ? 91  LEU A C   1 
ATOM   674  O O   . LEU A 1 96  ? 7.408   9.645  86.317 1.00 46.93  ? 91  LEU A O   1 
ATOM   675  C CB  . LEU A 1 96  ? 7.255   10.563 83.365 1.00 39.42  ? 91  LEU A CB  1 
ATOM   676  C CG  . LEU A 1 96  ? 6.968   11.382 82.101 1.00 34.63  ? 91  LEU A CG  1 
ATOM   677  C CD1 . LEU A 1 96  ? 7.979   11.061 81.012 1.00 34.71  ? 91  LEU A CD1 1 
ATOM   678  C CD2 . LEU A 1 96  ? 5.546   11.128 81.590 1.00 44.16  ? 91  LEU A CD2 1 
ATOM   679  N N   . GLY A 1 97  ? 5.646   8.511  85.492 1.00 59.37  ? 92  GLY A N   1 
ATOM   680  C CA  . GLY A 1 97  ? 5.867   7.338  86.311 1.00 73.15  ? 92  GLY A CA  1 
ATOM   681  C C   . GLY A 1 97  ? 7.045   6.574  85.746 1.00 84.88  ? 92  GLY A C   1 
ATOM   682  O O   . GLY A 1 97  ? 8.051   6.372  86.425 1.00 87.57  ? 92  GLY A O   1 
ATOM   683  N N   . GLN A 1 98  ? 6.920   6.162  84.488 1.00 92.93  ? 93  GLN A N   1 
ATOM   684  C CA  . GLN A 1 98  ? 8.004   5.480  83.791 1.00 100.11 ? 93  GLN A CA  1 
ATOM   685  C C   . GLN A 1 98  ? 8.985   6.481  83.203 1.00 97.68  ? 93  GLN A C   1 
ATOM   686  O O   . GLN A 1 98  ? 8.672   7.188  82.246 1.00 95.42  ? 93  GLN A O   1 
ATOM   687  C CB  . GLN A 1 98  ? 7.456   4.570  82.691 1.00 109.75 ? 93  GLN A CB  1 
ATOM   688  C CG  . GLN A 1 98  ? 7.166   3.152  83.157 1.00 119.71 ? 93  GLN A CG  1 
ATOM   689  C CD  . GLN A 1 98  ? 8.423   2.410  83.575 1.00 126.25 ? 93  GLN A CD  1 
ATOM   690  O OE1 . GLN A 1 98  ? 9.516   2.692  83.082 1.00 128.85 ? 93  GLN A OE1 1 
ATOM   691  N NE2 . GLN A 1 98  ? 8.274   1.459  84.490 1.00 128.15 ? 93  GLN A NE2 1 
ATOM   692  N N   . GLN A 1 99  ? 10.177  6.529  83.788 1.00 98.17  ? 94  GLN A N   1 
ATOM   693  C CA  . GLN A 1 99  ? 11.209  7.469  83.374 1.00 92.28  ? 94  GLN A CA  1 
ATOM   694  C C   . GLN A 1 99  ? 11.692  7.192  81.954 1.00 86.98  ? 94  GLN A C   1 
ATOM   695  O O   . GLN A 1 99  ? 11.602  6.065  81.463 1.00 84.34  ? 94  GLN A O   1 
ATOM   696  C CB  . GLN A 1 99  ? 12.388  7.428  84.352 1.00 93.26  ? 94  GLN A CB  1 
ATOM   697  C CG  . GLN A 1 99  ? 12.245  8.365  85.546 1.00 93.58  ? 94  GLN A CG  1 
ATOM   698  C CD  . GLN A 1 99  ? 10.909  8.222  86.253 1.00 93.36  ? 94  GLN A CD  1 
ATOM   699  O OE1 . GLN A 1 99  ? 10.683  7.265  86.994 1.00 96.25  ? 94  GLN A OE1 1 
ATOM   700  N NE2 . GLN A 1 99  ? 10.015  9.175  86.022 1.00 88.57  ? 94  GLN A NE2 1 
ATOM   701  N N   . ILE A 1 100 ? 12.193  8.233  81.295 1.00 82.38  ? 95  ILE A N   1 
ATOM   702  C CA  . ILE A 1 100 ? 12.719  8.104  79.943 1.00 74.46  ? 95  ILE A CA  1 
ATOM   703  C C   . ILE A 1 100 ? 14.173  7.639  79.972 1.00 85.45  ? 95  ILE A C   1 
ATOM   704  O O   . ILE A 1 100 ? 14.726  7.374  81.039 1.00 90.76  ? 95  ILE A O   1 
ATOM   705  C CB  . ILE A 1 100 ? 12.624  9.435  79.158 1.00 64.00  ? 95  ILE A CB  1 
ATOM   706  C CG1 . ILE A 1 100 ? 13.428  10.534 79.860 1.00 67.32  ? 95  ILE A CG1 1 
ATOM   707  C CG2 . ILE A 1 100 ? 11.166  9.864  78.984 1.00 43.35  ? 95  ILE A CG2 1 
ATOM   708  C CD1 . ILE A 1 100 ? 13.365  11.879 79.161 1.00 65.78  ? 95  ILE A CD1 1 
ATOM   709  N N   . ASN A 1 101 ? 14.788  7.535  78.797 1.00 87.61  ? 96  ASN A N   1 
ATOM   710  C CA  . ASN A 1 101 ? 16.195  7.162  78.704 1.00 91.35  ? 96  ASN A CA  1 
ATOM   711  C C   . ASN A 1 101 ? 17.078  8.394  78.534 1.00 85.73  ? 96  ASN A C   1 
ATOM   712  O O   . ASN A 1 101 ? 17.288  8.872  77.419 1.00 86.18  ? 96  ASN A O   1 
ATOM   713  C CB  . ASN A 1 101 ? 16.421  6.185  77.547 1.00 97.23  ? 96  ASN A CB  1 
ATOM   714  C CG  . ASN A 1 101 ? 15.678  4.875  77.735 1.00 103.45 ? 96  ASN A CG  1 
ATOM   715  O OD1 . ASN A 1 101 ? 15.314  4.508  78.853 1.00 106.43 ? 96  ASN A OD1 1 
ATOM   716  N ND2 . ASN A 1 101 ? 15.455  4.159  76.639 1.00 105.28 ? 96  ASN A ND2 1 
ATOM   717  N N   . ASP A 1 102 ? 17.592  8.903  79.649 1.00 78.05  ? 97  ASP A N   1 
ATOM   718  C CA  . ASP A 1 102 ? 18.357  10.146 79.644 1.00 69.38  ? 97  ASP A CA  1 
ATOM   719  C C   . ASP A 1 102 ? 19.753  9.979  80.243 1.00 74.99  ? 97  ASP A C   1 
ATOM   720  O O   . ASP A 1 102 ? 20.275  10.895 80.881 1.00 65.59  ? 97  ASP A O   1 
ATOM   721  C CB  . ASP A 1 102 ? 17.592  11.238 80.401 1.00 67.81  ? 97  ASP A CB  1 
ATOM   722  C CG  . ASP A 1 102 ? 17.344  10.880 81.858 1.00 72.29  ? 97  ASP A CG  1 
ATOM   723  O OD1 . ASP A 1 102 ? 17.463  11.775 82.720 1.00 72.24  ? 97  ASP A OD1 1 
ATOM   724  O OD2 . ASP A 1 102 ? 17.029  9.707  82.144 1.00 78.71  1 97  ASP A OD2 1 
ATOM   725  N N   . PHE A 1 103 ? 20.358  8.812  80.035 1.00 74.99  ? 98  PHE A N   1 
ATOM   726  C CA  . PHE A 1 103 ? 21.712  8.568  80.523 1.00 73.51  ? 98  PHE A CA  1 
ATOM   727  C C   . PHE A 1 103 ? 22.681  9.563  79.891 1.00 65.69  ? 98  PHE A C   1 
ATOM   728  O O   . PHE A 1 103 ? 23.489  10.193 80.580 1.00 68.38  ? 98  PHE A O   1 
ATOM   729  C CB  . PHE A 1 103 ? 22.149  7.132  80.225 1.00 71.60  ? 98  PHE A CB  1 
ATOM   730  C CG  . PHE A 1 103 ? 23.508  6.785  80.772 1.00 75.82  ? 98  PHE A CG  1 
ATOM   731  C CD1 . PHE A 1 103 ? 23.684  6.544  82.125 1.00 77.23  ? 98  PHE A CD1 1 
ATOM   732  C CD2 . PHE A 1 103 ? 24.607  6.696  79.933 1.00 77.16  ? 98  PHE A CD2 1 
ATOM   733  C CE1 . PHE A 1 103 ? 24.928  6.224  82.632 1.00 78.42  ? 98  PHE A CE1 1 
ATOM   734  C CE2 . PHE A 1 103 ? 25.856  6.375  80.434 1.00 79.89  ? 98  PHE A CE2 1 
ATOM   735  C CZ  . PHE A 1 103 ? 26.016  6.139  81.786 1.00 80.71  ? 98  PHE A CZ  1 
ATOM   736  N N   . THR A 1 104 ? 22.582  9.706  78.575 1.00 53.05  ? 99  THR A N   1 
ATOM   737  C CA  . THR A 1 104 ? 23.398  10.660 77.841 1.00 46.78  ? 99  THR A CA  1 
ATOM   738  C C   . THR A 1 104 ? 22.545  11.852 77.439 1.00 41.73  ? 99  THR A C   1 
ATOM   739  O O   . THR A 1 104 ? 21.550  11.706 76.730 1.00 48.11  ? 99  THR A O   1 
ATOM   740  C CB  . THR A 1 104 ? 24.027  10.034 76.586 1.00 55.14  ? 99  THR A CB  1 
ATOM   741  O OG1 . THR A 1 104 ? 24.838  8.914  76.965 1.00 64.55  ? 99  THR A OG1 1 
ATOM   742  C CG2 . THR A 1 104 ? 24.893  11.056 75.860 1.00 50.96  ? 99  THR A CG2 1 
ATOM   743  N N   . LEU A 1 105 ? 22.927  13.032 77.905 1.00 36.02  ? 100 LEU A N   1 
ATOM   744  C CA  . LEU A 1 105 ? 22.166  14.232 77.599 1.00 34.59  ? 100 LEU A CA  1 
ATOM   745  C C   . LEU A 1 105 ? 22.744  14.950 76.400 1.00 30.73  ? 100 LEU A C   1 
ATOM   746  O O   . LEU A 1 105 ? 23.946  14.866 76.143 1.00 32.51  ? 100 LEU A O   1 
ATOM   747  C CB  . LEU A 1 105 ? 22.138  15.171 78.810 1.00 25.99  ? 100 LEU A CB  1 
ATOM   748  C CG  . LEU A 1 105 ? 21.402  14.657 80.040 1.00 33.04  ? 100 LEU A CG  1 
ATOM   749  C CD1 . LEU A 1 105 ? 21.249  15.793 81.022 1.00 32.62  ? 100 LEU A CD1 1 
ATOM   750  C CD2 . LEU A 1 105 ? 20.033  14.086 79.648 1.00 33.89  ? 100 LEU A CD2 1 
ATOM   751  N N   . PRO A 1 106 ? 21.886  15.647 75.645 1.00 28.04  ? 101 PRO A N   1 
ATOM   752  C CA  . PRO A 1 106 ? 22.394  16.522 74.591 1.00 29.05  ? 101 PRO A CA  1 
ATOM   753  C C   . PRO A 1 106 ? 23.262  17.616 75.194 1.00 31.16  ? 101 PRO A C   1 
ATOM   754  O O   . PRO A 1 106 ? 22.925  18.101 76.275 1.00 28.48  ? 101 PRO A O   1 
ATOM   755  C CB  . PRO A 1 106 ? 21.123  17.120 73.976 1.00 29.19  ? 101 PRO A CB  1 
ATOM   756  C CG  . PRO A 1 106 ? 20.098  17.031 75.066 1.00 29.49  ? 101 PRO A CG  1 
ATOM   757  C CD  . PRO A 1 106 ? 20.428  15.775 75.827 1.00 28.57  ? 101 PRO A CD  1 
ATOM   758  N N   . ASP A 1 107 ? 24.349  17.988 74.520 1.00 27.83  ? 102 ASP A N   1 
ATOM   759  C CA  . ASP A 1 107 ? 25.088  19.196 74.891 1.00 29.48  ? 102 ASP A CA  1 
ATOM   760  C C   . ASP A 1 107 ? 24.469  20.370 74.142 1.00 32.08  ? 102 ASP A C   1 
ATOM   761  O O   . ASP A 1 107 ? 24.783  20.613 72.970 1.00 28.77  ? 102 ASP A O   1 
ATOM   762  C CB  . ASP A 1 107 ? 26.578  19.057 74.564 1.00 30.22  ? 102 ASP A CB  1 
ATOM   763  C CG  . ASP A 1 107 ? 27.403  20.254 75.041 1.00 32.18  ? 102 ASP A CG  1 
ATOM   764  O OD1 . ASP A 1 107 ? 26.846  21.334 75.319 1.00 32.88  ? 102 ASP A OD1 1 
ATOM   765  O OD2 . ASP A 1 107 ? 28.628  20.113 75.131 1.00 29.53  1 102 ASP A OD2 1 
ATOM   766  N N   . VAL A 1 108 ? 23.572  21.094 74.803 1.00 26.96  ? 103 VAL A N   1 
ATOM   767  C CA  . VAL A 1 108 ? 22.801  22.096 74.079 1.00 31.45  ? 103 VAL A CA  1 
ATOM   768  C C   . VAL A 1 108 ? 23.661  23.309 73.750 1.00 29.04  ? 103 VAL A C   1 
ATOM   769  O O   . VAL A 1 108 ? 23.301  24.105 72.886 1.00 31.90  ? 103 VAL A O   1 
ATOM   770  C CB  . VAL A 1 108 ? 21.550  22.542 74.857 1.00 29.05  ? 103 VAL A CB  1 
ATOM   771  C CG1 . VAL A 1 108 ? 20.672  21.328 75.177 1.00 28.49  ? 103 VAL A CG1 1 
ATOM   772  C CG2 . VAL A 1 108 ? 21.937  23.294 76.118 1.00 34.58  ? 103 VAL A CG2 1 
ATOM   773  N N   . ASN A 1 109 ? 24.804  23.450 74.418 1.00 30.88  ? 104 ASN A N   1 
ATOM   774  C CA  . ASN A 1 109 ? 25.745  24.489 74.021 1.00 31.30  ? 104 ASN A CA  1 
ATOM   775  C C   . ASN A 1 109 ? 26.167  24.334 72.568 1.00 30.99  ? 104 ASN A C   1 
ATOM   776  O O   . ASN A 1 109 ? 26.349  25.320 71.858 1.00 33.42  ? 104 ASN A O   1 
ATOM   777  C CB  . ASN A 1 109 ? 26.979  24.479 74.916 1.00 35.29  ? 104 ASN A CB  1 
ATOM   778  C CG  . ASN A 1 109 ? 26.625  24.647 76.366 1.00 30.97  ? 104 ASN A CG  1 
ATOM   779  O OD1 . ASN A 1 109 ? 26.456  25.760 76.846 1.00 32.51  ? 104 ASN A OD1 1 
ATOM   780  N ND2 . ASN A 1 109 ? 26.462  23.532 77.065 1.00 30.93  ? 104 ASN A ND2 1 
ATOM   781  N N   . LEU A 1 110 ? 26.338  23.091 72.137 1.00 30.66  ? 105 LEU A N   1 
ATOM   782  C CA  . LEU A 1 110 ? 26.782  22.811 70.774 1.00 35.37  ? 105 LEU A CA  1 
ATOM   783  C C   . LEU A 1 110 ? 25.646  23.016 69.774 1.00 36.07  ? 105 LEU A C   1 
ATOM   784  O O   . LEU A 1 110 ? 25.875  23.330 68.605 1.00 34.54  ? 105 LEU A O   1 
ATOM   785  C CB  . LEU A 1 110 ? 27.320  21.384 70.665 1.00 35.10  ? 105 LEU A CB  1 
ATOM   786  C CG  . LEU A 1 110 ? 28.653  21.094 71.356 1.00 41.38  ? 105 LEU A CG  1 
ATOM   787  C CD1 . LEU A 1 110 ? 29.023  19.626 71.193 1.00 34.26  ? 105 LEU A CD1 1 
ATOM   788  C CD2 . LEU A 1 110 ? 29.755  21.996 70.797 1.00 39.14  ? 105 LEU A CD2 1 
ATOM   789  N N   . ILE A 1 111 ? 24.418  22.817 70.229 1.00 30.63  ? 106 ILE A N   1 
ATOM   790  C CA  . ILE A 1 111 ? 23.260  23.064 69.377 1.00 28.91  ? 106 ILE A CA  1 
ATOM   791  C C   . ILE A 1 111 ? 23.135  24.562 69.113 1.00 31.61  ? 106 ILE A C   1 
ATOM   792  O O   . ILE A 1 111 ? 23.001  25.008 67.966 1.00 33.27  ? 106 ILE A O   1 
ATOM   793  C CB  . ILE A 1 111 ? 21.955  22.541 70.022 1.00 29.82  ? 106 ILE A CB  1 
ATOM   794  C CG1 . ILE A 1 111 ? 22.032  21.025 70.237 1.00 26.80  ? 106 ILE A CG1 1 
ATOM   795  C CG2 . ILE A 1 111 ? 20.742  22.921 69.157 1.00 29.63  ? 106 ILE A CG2 1 
ATOM   796  C CD1 . ILE A 1 111 ? 20.831  20.444 70.984 1.00 27.87  ? 106 ILE A CD1 1 
ATOM   797  N N   . GLY A 1 112 ? 23.185  25.339 70.190 1.00 30.71  ? 107 GLY A N   1 
ATOM   798  C CA  . GLY A 1 112 ? 23.041  26.777 70.094 1.00 32.77  ? 107 GLY A CA  1 
ATOM   799  C C   . GLY A 1 112 ? 24.176  27.456 69.350 1.00 39.91  ? 107 GLY A C   1 
ATOM   800  O O   . GLY A 1 112 ? 23.943  28.289 68.481 1.00 39.75  ? 107 GLY A O   1 
ATOM   801  N N   . GLU A 1 113 ? 25.412  27.103 69.689 1.00 39.27  ? 108 GLU A N   1 
ATOM   802  C CA  . GLU A 1 113 ? 26.564  27.786 69.120 1.00 41.02  ? 108 GLU A CA  1 
ATOM   803  C C   . GLU A 1 113 ? 26.929  27.284 67.723 1.00 45.13  ? 108 GLU A C   1 
ATOM   804  O O   . GLU A 1 113 ? 27.395  28.053 66.885 1.00 43.81  ? 108 GLU A O   1 
ATOM   805  C CB  . GLU A 1 113 ? 27.777  27.647 70.039 1.00 41.62  ? 108 GLU A CB  1 
ATOM   806  C CG  . GLU A 1 113 ? 28.957  28.514 69.604 1.00 58.26  ? 108 GLU A CG  1 
ATOM   807  C CD  . GLU A 1 113 ? 30.064  28.580 70.637 1.00 58.79  ? 108 GLU A CD  1 
ATOM   808  O OE1 . GLU A 1 113 ? 29.951  27.904 71.683 1.00 58.57  ? 108 GLU A OE1 1 
ATOM   809  O OE2 . GLU A 1 113 ? 31.049  29.314 70.400 1.00 62.15  1 108 GLU A OE2 1 
ATOM   810  N N   . HIS A 1 114 ? 26.717  25.998 67.470 1.00 37.71  ? 109 HIS A N   1 
ATOM   811  C CA  . HIS A 1 114 ? 27.229  25.396 66.250 1.00 40.79  ? 109 HIS A CA  1 
ATOM   812  C C   . HIS A 1 114 ? 26.188  24.674 65.404 1.00 41.86  ? 109 HIS A C   1 
ATOM   813  O O   . HIS A 1 114 ? 26.534  24.073 64.394 1.00 38.12  ? 109 HIS A O   1 
ATOM   814  C CB  . HIS A 1 114 ? 28.360  24.425 66.599 1.00 47.74  ? 109 HIS A CB  1 
ATOM   815  C CG  . HIS A 1 114 ? 29.571  25.100 67.160 1.00 53.06  ? 109 HIS A CG  1 
ATOM   816  N ND1 . HIS A 1 114 ? 30.095  24.786 68.398 1.00 59.31  ? 109 HIS A ND1 1 
ATOM   817  C CD2 . HIS A 1 114 ? 30.357  26.081 66.658 1.00 54.34  ? 109 HIS A CD2 1 
ATOM   818  C CE1 . HIS A 1 114 ? 31.153  25.541 68.629 1.00 61.79  ? 109 HIS A CE1 1 
ATOM   819  N NE2 . HIS A 1 114 ? 31.335  26.336 67.589 1.00 63.55  ? 109 HIS A NE2 1 
ATOM   820  N N   . SER A 1 115 ? 24.921  24.749 65.801 1.00 36.51  ? 110 SER A N   1 
ATOM   821  C CA  . SER A 1 115 ? 23.859  24.001 65.124 1.00 31.66  ? 110 SER A CA  1 
ATOM   822  C C   . SER A 1 115 ? 24.247  22.533 64.952 1.00 35.93  ? 110 SER A C   1 
ATOM   823  O O   . SER A 1 115 ? 24.033  21.945 63.893 1.00 33.10  ? 110 SER A O   1 
ATOM   824  C CB  . SER A 1 115 ? 23.538  24.633 63.763 1.00 36.72  ? 110 SER A CB  1 
ATOM   825  O OG  . SER A 1 115 ? 23.500  26.052 63.870 1.00 36.56  ? 110 SER A OG  1 
ATOM   826  N N   . ASP A 1 116 ? 24.819  21.957 66.006 1.00 30.90  ? 111 ASP A N   1 
ATOM   827  C CA  . ASP A 1 116 ? 25.304  20.575 65.988 1.00 33.71  ? 111 ASP A CA  1 
ATOM   828  C C   . ASP A 1 116 ? 24.162  19.577 65.843 1.00 36.99  ? 111 ASP A C   1 
ATOM   829  O O   . ASP A 1 116 ? 23.398  19.372 66.782 1.00 31.95  ? 111 ASP A O   1 
ATOM   830  C CB  . ASP A 1 116 ? 26.100  20.290 67.270 1.00 31.71  ? 111 ASP A CB  1 
ATOM   831  C CG  . ASP A 1 116 ? 26.825  18.950 67.242 1.00 42.84  ? 111 ASP A CG  1 
ATOM   832  O OD1 . ASP A 1 116 ? 26.167  17.907 67.067 1.00 36.89  ? 111 ASP A OD1 1 
ATOM   833  O OD2 . ASP A 1 116 ? 28.064  18.939 67.422 1.00 49.15  1 111 ASP A OD2 1 
ATOM   834  N N   . ALA A 1 117 ? 24.074  18.931 64.682 1.00 32.38  ? 112 ALA A N   1 
ATOM   835  C CA  . ALA A 1 117 ? 22.964  18.018 64.405 1.00 33.88  ? 112 ALA A CA  1 
ATOM   836  C C   . ALA A 1 117 ? 22.973  16.785 65.302 1.00 29.62  ? 112 ALA A C   1 
ATOM   837  O O   . ALA A 1 117 ? 21.919  16.271 65.663 1.00 27.07  ? 112 ALA A O   1 
ATOM   838  C CB  . ALA A 1 117 ? 22.980  17.593 62.937 1.00 33.45  ? 112 ALA A CB  1 
ATOM   839  N N   . ALA A 1 118 ? 24.159  16.296 65.643 1.00 33.05  ? 113 ALA A N   1 
ATOM   840  C CA  . ALA A 1 118 ? 24.265  15.103 66.473 1.00 30.89  ? 113 ALA A CA  1 
ATOM   841  C C   . ALA A 1 118 ? 23.689  15.361 67.858 1.00 32.48  ? 113 ALA A C   1 
ATOM   842  O O   . ALA A 1 118 ? 22.959  14.535 68.411 1.00 29.65  ? 113 ALA A O   1 
ATOM   843  C CB  . ALA A 1 118 ? 25.721  14.651 66.567 1.00 36.14  ? 113 ALA A CB  1 
ATOM   844  N N   . GLU A 1 119 ? 24.012  16.517 68.425 1.00 29.60  ? 114 GLU A N   1 
ATOM   845  C CA  . GLU A 1 119 ? 23.468  16.873 69.724 1.00 28.56  ? 114 GLU A CA  1 
ATOM   846  C C   . GLU A 1 119 ? 21.976  17.126 69.620 1.00 26.07  ? 114 GLU A C   1 
ATOM   847  O O   . GLU A 1 119 ? 21.225  16.742 70.509 1.00 26.98  ? 114 GLU A O   1 
ATOM   848  C CB  . GLU A 1 119 ? 24.186  18.096 70.294 1.00 34.47  ? 114 GLU A CB  1 
ATOM   849  C CG  . GLU A 1 119 ? 25.671  17.843 70.564 1.00 32.07  ? 114 GLU A CG  1 
ATOM   850  C CD  . GLU A 1 119 ? 25.910  16.580 71.384 1.00 39.58  ? 114 GLU A CD  1 
ATOM   851  O OE1 . GLU A 1 119 ? 25.158  16.339 72.356 1.00 33.14  ? 114 GLU A OE1 1 
ATOM   852  O OE2 . GLU A 1 119 ? 26.849  15.820 71.053 1.00 40.85  1 114 GLU A OE2 1 
ATOM   853  N N   . LEU A 1 120 ? 21.544  17.772 68.537 1.00 25.86  ? 115 LEU A N   1 
ATOM   854  C CA  . LEU A 1 120 ? 20.113  18.051 68.368 1.00 26.79  ? 115 LEU A CA  1 
ATOM   855  C C   . LEU A 1 120 ? 19.330  16.738 68.280 1.00 24.59  ? 115 LEU A C   1 
ATOM   856  O O   . LEU A 1 120 ? 18.223  16.617 68.809 1.00 23.78  ? 115 LEU A O   1 
ATOM   857  C CB  . LEU A 1 120 ? 19.862  18.911 67.128 1.00 24.82  ? 115 LEU A CB  1 
ATOM   858  C CG  . LEU A 1 120 ? 18.382  19.194 66.819 1.00 34.80  ? 115 LEU A CG  1 
ATOM   859  C CD1 . LEU A 1 120 ? 17.688  19.886 67.999 1.00 35.62  ? 115 LEU A CD1 1 
ATOM   860  C CD2 . LEU A 1 120 ? 18.260  20.033 65.545 1.00 31.37  ? 115 LEU A CD2 1 
ATOM   861  N N   . GLY A 1 121 ? 19.922  15.746 67.618 1.00 26.13  ? 116 GLY A N   1 
ATOM   862  C CA  . GLY A 1 121 ? 19.304  14.433 67.528 1.00 25.69  ? 116 GLY A CA  1 
ATOM   863  C C   . GLY A 1 121 ? 19.076  13.796 68.892 1.00 26.14  ? 116 GLY A C   1 
ATOM   864  O O   . GLY A 1 121 ? 18.039  13.183 69.129 1.00 24.02  ? 116 GLY A O   1 
ATOM   865  N N   . ARG A 1 122 ? 20.045  13.934 69.793 1.00 23.73  ? 117 ARG A N   1 
ATOM   866  C CA  . ARG A 1 122 ? 19.897  13.419 71.152 1.00 22.86  ? 117 ARG A CA  1 
ATOM   867  C C   . ARG A 1 122 ? 18.744  14.100 71.888 1.00 23.04  ? 117 ARG A C   1 
ATOM   868  O O   . ARG A 1 122 ? 18.008  13.459 72.638 1.00 26.34  ? 117 ARG A O   1 
ATOM   869  C CB  . ARG A 1 122 ? 21.187  13.614 71.956 1.00 31.49  ? 117 ARG A CB  1 
ATOM   870  C CG  . ARG A 1 122 ? 22.348  12.765 71.495 1.00 35.24  ? 117 ARG A CG  1 
ATOM   871  C CD  . ARG A 1 122 ? 23.511  12.916 72.474 1.00 51.60  ? 117 ARG A CD  1 
ATOM   872  N NE  . ARG A 1 122 ? 24.702  12.178 72.068 1.00 62.50  ? 117 ARG A NE  1 
ATOM   873  C CZ  . ARG A 1 122 ? 24.911  10.892 72.333 1.00 73.60  ? 117 ARG A CZ  1 
ATOM   874  N NH1 . ARG A 1 122 ? 23.999  10.192 72.997 1.00 75.69  1 117 ARG A NH1 1 
ATOM   875  N NH2 . ARG A 1 122 ? 26.029  10.303 71.928 1.00 73.58  ? 117 ARG A NH2 1 
ATOM   876  N N   . MET A 1 123 ? 18.602  15.403 71.685 1.00 22.72  ? 118 MET A N   1 
ATOM   877  C CA  . MET A 1 123 ? 17.509  16.133 72.322 1.00 24.64  ? 118 MET A CA  1 
ATOM   878  C C   . MET A 1 123 ? 16.160  15.665 71.795 1.00 23.41  ? 118 MET A C   1 
ATOM   879  O O   . MET A 1 123 ? 15.221  15.514 72.561 1.00 24.04  ? 118 MET A O   1 
ATOM   880  C CB  . MET A 1 123 ? 17.659  17.631 72.097 1.00 25.65  ? 118 MET A CB  1 
ATOM   881  C CG  . MET A 1 123 ? 16.793  18.483 72.994 1.00 37.84  ? 118 MET A CG  1 
ATOM   882  S SD  . MET A 1 123 ? 17.621  20.063 73.256 1.00 37.47  ? 118 MET A SD  1 
ATOM   883  C CE  . MET A 1 123 ? 16.553  20.830 74.469 1.00 36.25  ? 118 MET A CE  1 
ATOM   884  N N   . LEU A 1 124 ? 16.066  15.461 70.484 1.00 22.86  ? 119 LEU A N   1 
ATOM   885  C CA  . LEU A 1 124 ? 14.816  15.000 69.876 1.00 21.91  ? 119 LEU A CA  1 
ATOM   886  C C   . LEU A 1 124 ? 14.445  13.607 70.364 1.00 22.31  ? 119 LEU A C   1 
ATOM   887  O O   . LEU A 1 124 ? 13.262  13.313 70.523 1.00 22.28  ? 119 LEU A O   1 
ATOM   888  C CB  . LEU A 1 124 ? 14.920  15.021 68.347 1.00 21.41  ? 119 LEU A CB  1 
ATOM   889  C CG  . LEU A 1 124 ? 15.105  16.414 67.737 1.00 24.19  ? 119 LEU A CG  1 
ATOM   890  C CD1 . LEU A 1 124 ? 15.135  16.346 66.217 1.00 27.08  ? 119 LEU A CD1 1 
ATOM   891  C CD2 . LEU A 1 124 ? 14.032  17.381 68.225 1.00 27.82  ? 119 LEU A CD2 1 
ATOM   892  N N   . GLN A 1 125 ? 15.452  12.764 70.607 1.00 21.04  ? 120 GLN A N   1 
ATOM   893  C CA  . GLN A 1 125 ? 15.240  11.433 71.185 1.00 24.63  ? 120 GLN A CA  1 
ATOM   894  C C   . GLN A 1 125 ? 14.616  11.528 72.563 1.00 22.62  ? 120 GLN A C   1 
ATOM   895  O O   . GLN A 1 125 ? 13.734  10.735 72.911 1.00 22.44  ? 120 GLN A O   1 
ATOM   896  C CB  . GLN A 1 125 ? 16.549  10.651 71.314 1.00 26.77  ? 120 GLN A CB  1 
ATOM   897  C CG  . GLN A 1 125 ? 17.181  10.163 70.024 1.00 34.59  ? 120 GLN A CG  1 
ATOM   898  C CD  . GLN A 1 125 ? 18.488  9.447  70.312 1.00 43.69  ? 120 GLN A CD  1 
ATOM   899  O OE1 . GLN A 1 125 ? 19.570  9.970  70.046 1.00 61.17  ? 120 GLN A OE1 1 
ATOM   900  N NE2 . GLN A 1 125 ? 18.392  8.264  70.899 1.00 39.36  ? 120 GLN A NE2 1 
ATOM   901  N N   . LEU A 1 126 ? 15.098  12.477 73.370 1.00 21.44  ? 121 LEU A N   1 
ATOM   902  C CA  . LEU A 1 126 ? 14.507  12.709 74.689 1.00 24.00  ? 121 LEU A CA  1 
ATOM   903  C C   . LEU A 1 126 ? 13.045  13.112 74.580 1.00 22.44  ? 121 LEU A C   1 
ATOM   904  O O   . LEU A 1 126 ? 12.197  12.643 75.349 1.00 22.66  ? 121 LEU A O   1 
ATOM   905  C CB  . LEU A 1 126 ? 15.275  13.790 75.452 1.00 27.64  ? 121 LEU A CB  1 
ATOM   906  C CG  . LEU A 1 126 ? 16.609  13.349 76.027 1.00 33.47  ? 121 LEU A CG  1 
ATOM   907  C CD1 . LEU A 1 126 ? 17.174  14.461 76.901 1.00 27.30  ? 121 LEU A CD1 1 
ATOM   908  C CD2 . LEU A 1 126 ? 16.446  12.071 76.835 1.00 44.05  ? 121 LEU A CD2 1 
ATOM   909  N N   . ILE A 1 127 ? 12.757  13.998 73.636 1.00 21.62  ? 122 ILE A N   1 
ATOM   910  C CA  . ILE A 1 127 ? 11.391  14.465 73.442 1.00 25.12  ? 122 ILE A CA  1 
ATOM   911  C C   . ILE A 1 127 ? 10.504  13.322 72.950 1.00 23.10  ? 122 ILE A C   1 
ATOM   912  O O   . ILE A 1 127 ? 9.372   13.174 73.401 1.00 22.53  ? 122 ILE A O   1 
ATOM   913  C CB  . ILE A 1 127 ? 11.362  15.652 72.469 1.00 24.42  ? 122 ILE A CB  1 
ATOM   914  C CG1 . ILE A 1 127 ? 12.052  16.853 73.126 1.00 26.28  ? 122 ILE A CG1 1 
ATOM   915  C CG2 . ILE A 1 127 ? 9.922   16.002 72.066 1.00 24.37  ? 122 ILE A CG2 1 
ATOM   916  C CD1 . ILE A 1 127 ? 12.283  18.025 72.170 1.00 24.14  ? 122 ILE A CD1 1 
ATOM   917  N N   . LEU A 1 128 ? 11.004  12.517 72.012 1.00 21.47  ? 123 LEU A N   1 
ATOM   918  C CA  . LEU A 1 128 ? 10.263  11.316 71.615 1.00 21.98  ? 123 LEU A CA  1 
ATOM   919  C C   . LEU A 1 128 ? 10.044  10.393 72.819 1.00 26.07  ? 123 LEU A C   1 
ATOM   920  O O   . LEU A 1 128 ? 8.966   9.798  72.966 1.00 27.57  ? 123 LEU A O   1 
ATOM   921  C CB  . LEU A 1 128 ? 10.988  10.586 70.473 1.00 21.22  ? 123 LEU A CB  1 
ATOM   922  C CG  . LEU A 1 128 ? 10.131  9.529  69.757 1.00 26.34  ? 123 LEU A CG  1 
ATOM   923  C CD1 . LEU A 1 128 ? 10.518  9.432  68.270 1.00 31.03  ? 123 LEU A CD1 1 
ATOM   924  C CD2 . LEU A 1 128 ? 10.352  8.207  70.424 1.00 29.89  ? 123 LEU A CD2 1 
ATOM   925  N N   . GLY A 1 129 ? 11.038  10.305 73.701 1.00 23.17  ? 124 GLY A N   1 
ATOM   926  C CA  . GLY A 1 129 ? 10.891  9.559  74.946 1.00 29.63  ? 124 GLY A CA  1 
ATOM   927  C C   . GLY A 1 129 ? 9.734   10.060 75.800 1.00 28.58  ? 124 GLY A C   1 
ATOM   928  O O   . GLY A 1 129 ? 8.971   9.265  76.369 1.00 25.68  ? 124 GLY A O   1 
ATOM   929  N N   . CYS A 1 130 ? 9.589   11.379 75.881 1.00 22.21  ? 125 CYS A N   1 
ATOM   930  C CA  . CYS A 1 130 ? 8.435   11.963 76.567 1.00 24.05  ? 125 CYS A CA  1 
ATOM   931  C C   . CYS A 1 130 ? 7.134   11.562 75.904 1.00 25.97  ? 125 CYS A C   1 
ATOM   932  O O   . CYS A 1 130 ? 6.175   11.217 76.573 1.00 26.94  ? 125 CYS A O   1 
ATOM   933  C CB  . CYS A 1 130 ? 8.539   13.488 76.611 1.00 27.91  ? 125 CYS A CB  1 
ATOM   934  S SG  . CYS A 1 130 ? 9.875   14.102 77.687 1.00 29.06  ? 125 CYS A SG  1 
ATOM   935  N N   . ALA A 1 131 ? 7.101   11.620 74.582 1.00 26.01  ? 126 ALA A N   1 
ATOM   936  C CA  . ALA A 1 131 ? 5.889   11.317 73.830 1.00 22.37  ? 126 ALA A CA  1 
ATOM   937  C C   . ALA A 1 131 ? 5.430   9.879  74.031 1.00 27.70  ? 126 ALA A C   1 
ATOM   938  O O   . ALA A 1 131 ? 4.229   9.625  74.212 1.00 26.90  ? 126 ALA A O   1 
ATOM   939  C CB  . ALA A 1 131 ? 6.110   11.600 72.332 1.00 21.83  ? 126 ALA A CB  1 
ATOM   940  N N   . VAL A 1 132 ? 6.364   8.930  74.025 1.00 22.41  ? 127 VAL A N   1 
ATOM   941  C CA  . VAL A 1 132 ? 5.962   7.521  74.094 1.00 27.08  ? 127 VAL A CA  1 
ATOM   942  C C   . VAL A 1 132 ? 5.891   6.978  75.524 1.00 28.48  ? 127 VAL A C   1 
ATOM   943  O O   . VAL A 1 132 ? 5.594   5.797  75.711 1.00 30.14  ? 127 VAL A O   1 
ATOM   944  C CB  . VAL A 1 132 ? 6.901   6.607  73.238 1.00 24.64  ? 127 VAL A CB  1 
ATOM   945  C CG1 . VAL A 1 132 ? 6.881   7.041  71.784 1.00 26.43  ? 127 VAL A CG1 1 
ATOM   946  C CG2 . VAL A 1 132 ? 8.324   6.604  73.799 1.00 30.67  ? 127 VAL A CG2 1 
ATOM   947  N N   . ASN A 1 133 ? 6.130   7.845  76.518 1.00 25.17  ? 128 ASN A N   1 
ATOM   948  C CA  . ASN A 1 133 ? 5.941   7.510  77.927 1.00 25.80  ? 128 ASN A CA  1 
ATOM   949  C C   . ASN A 1 133 ? 4.870   8.339  78.632 1.00 26.90  ? 128 ASN A C   1 
ATOM   950  O O   . ASN A 1 133 ? 4.545   8.071  79.793 1.00 31.96  ? 128 ASN A O   1 
ATOM   951  C CB  . ASN A 1 133 ? 7.261   7.646  78.684 1.00 30.46  ? 128 ASN A CB  1 
ATOM   952  C CG  . ASN A 1 133 ? 8.203   6.506  78.391 1.00 33.28  ? 128 ASN A CG  1 
ATOM   953  O OD1 . ASN A 1 133 ? 8.008   5.395  78.876 1.00 39.34  ? 128 ASN A OD1 1 
ATOM   954  N ND2 . ASN A 1 133 ? 9.219   6.764  77.574 1.00 34.80  ? 128 ASN A ND2 1 
ATOM   955  N N   . CYS A 1 134 ? 4.318   9.340  77.954 1.00 26.88  ? 129 CYS A N   1 
ATOM   956  C CA  . CYS A 1 134 ? 3.302   10.188 78.576 1.00 27.96  ? 129 CYS A CA  1 
ATOM   957  C C   . CYS A 1 134 ? 1.932   9.496  78.560 1.00 32.09  ? 129 CYS A C   1 
ATOM   958  O O   . CYS A 1 134 ? 1.797   8.391  78.020 1.00 27.67  ? 129 CYS A O   1 
ATOM   959  C CB  . CYS A 1 134 ? 3.219   11.543 77.865 1.00 28.18  ? 129 CYS A CB  1 
ATOM   960  S SG  . CYS A 1 134 ? 2.429   11.462 76.224 1.00 30.03  ? 129 CYS A SG  1 
ATOM   961  N N   . GLU A 1 135 ? 0.928   10.148 79.152 1.00 33.09  ? 130 GLU A N   1 
ATOM   962  C CA  . GLU A 1 135 ? -0.427  9.587  79.252 1.00 36.64  ? 130 GLU A CA  1 
ATOM   963  C C   . GLU A 1 135 ? -1.031  9.324  77.875 1.00 31.18  ? 130 GLU A C   1 
ATOM   964  O O   . GLU A 1 135 ? -1.820  8.389  77.693 1.00 36.41  ? 130 GLU A O   1 
ATOM   965  C CB  . GLU A 1 135 ? -1.341  10.522 80.066 1.00 42.28  ? 130 GLU A CB  1 
ATOM   966  C CG  . GLU A 1 135 ? -2.635  9.865  80.563 1.00 63.76  ? 130 GLU A CG  1 
ATOM   967  C CD  . GLU A 1 135 ? -3.205  10.522 81.823 1.00 81.89  ? 130 GLU A CD  1 
ATOM   968  O OE1 . GLU A 1 135 ? -2.428  11.105 82.609 1.00 76.24  ? 130 GLU A OE1 1 
ATOM   969  O OE2 . GLU A 1 135 ? -4.437  10.451 82.034 1.00 97.58  1 130 GLU A OE2 1 
ATOM   970  N N   . GLN A 1 136 ? -0.636  10.136 76.902 1.00 32.43  ? 131 GLN A N   1 
ATOM   971  C CA  . GLN A 1 136 ? -1.155  10.025 75.539 1.00 29.59  ? 131 GLN A CA  1 
ATOM   972  C C   . GLN A 1 136 ? -0.285  9.158  74.643 1.00 30.88  ? 131 GLN A C   1 
ATOM   973  O O   . GLN A 1 136 ? -0.356  9.281  73.427 1.00 33.63  ? 131 GLN A O   1 
ATOM   974  C CB  . GLN A 1 136 ? -1.277  11.409 74.902 1.00 33.17  ? 131 GLN A CB  1 
ATOM   975  C CG  . GLN A 1 136 ? -2.199  12.377 75.620 1.00 45.11  ? 131 GLN A CG  1 
ATOM   976  C CD  . GLN A 1 136 ? -2.201  13.755 74.968 1.00 61.49  ? 131 GLN A CD  1 
ATOM   977  O OE1 . GLN A 1 136 ? -1.141  14.336 74.687 1.00 48.82  ? 131 GLN A OE1 1 
ATOM   978  N NE2 . GLN A 1 136 ? -3.395  14.282 74.713 1.00 66.09  ? 131 GLN A NE2 1 
ATOM   979  N N   . LYS A 1 137 ? 0.532   8.290  75.232 1.00 27.31  ? 132 LYS A N   1 
ATOM   980  C CA  . LYS A 1 137 ? 1.528   7.560  74.451 1.00 27.49  ? 132 LYS A CA  1 
ATOM   981  C C   . LYS A 1 137 ? 0.928   6.691  73.340 1.00 32.28  ? 132 LYS A C   1 
ATOM   982  O O   . LYS A 1 137 ? 1.544   6.519  72.294 1.00 25.41  ? 132 LYS A O   1 
ATOM   983  C CB  . LYS A 1 137 ? 2.398   6.685  75.360 1.00 30.10  ? 132 LYS A CB  1 
ATOM   984  C CG  . LYS A 1 137 ? 1.655   5.631  76.174 1.00 35.28  ? 132 LYS A CG  1 
ATOM   985  C CD  . LYS A 1 137 ? 2.635   4.972  77.141 1.00 35.88  ? 132 LYS A CD  1 
ATOM   986  C CE  . LYS A 1 137 ? 1.934   4.144  78.193 1.00 49.45  ? 132 LYS A CE  1 
ATOM   987  N NZ  . LYS A 1 137 ? 2.938   3.546  79.112 1.00 57.87  1 132 LYS A NZ  1 
ATOM   988  N N   . GLN A 1 138 ? -0.261  6.137  73.543 1.00 30.88  ? 133 GLN A N   1 
ATOM   989  C CA  . GLN A 1 138 ? -0.844  5.337  72.464 1.00 31.62  ? 133 GLN A CA  1 
ATOM   990  C C   . GLN A 1 138 ? -1.107  6.183  71.224 1.00 27.78  ? 133 GLN A C   1 
ATOM   991  O O   . GLN A 1 138 ? -0.948  5.695  70.100 1.00 27.41  ? 133 GLN A O   1 
ATOM   992  C CB  . GLN A 1 138 ? -2.119  4.651  72.923 1.00 34.42  ? 133 GLN A CB  1 
ATOM   993  C CG  . GLN A 1 138 ? -1.850  3.465  73.842 1.00 40.90  ? 133 GLN A CG  1 
ATOM   994  C CD  . GLN A 1 138 ? -1.331  2.246  73.096 1.00 48.85  ? 133 GLN A CD  1 
ATOM   995  O OE1 . GLN A 1 138 ? -1.275  2.230  71.866 1.00 48.53  ? 133 GLN A OE1 1 
ATOM   996  N NE2 . GLN A 1 138 ? -0.959  1.213  73.842 1.00 47.48  ? 133 GLN A NE2 1 
ATOM   997  N N   . GLU A 1 139 ? -1.472  7.449  71.432 1.00 27.26  ? 134 GLU A N   1 
ATOM   998  C CA  . GLU A 1 139 ? -1.658  8.382  70.320 1.00 28.58  ? 134 GLU A CA  1 
ATOM   999  C C   . GLU A 1 139 ? -0.366  8.599  69.541 1.00 23.67  ? 134 GLU A C   1 
ATOM   1000 O O   . GLU A 1 139 ? -0.350  8.595  68.297 1.00 24.72  ? 134 GLU A O   1 
ATOM   1001 C CB  . GLU A 1 139 ? -2.170  9.736  70.814 1.00 36.38  ? 134 GLU A CB  1 
ATOM   1002 C CG  . GLU A 1 139 ? -2.221  10.797 69.707 1.00 49.28  ? 134 GLU A CG  1 
ATOM   1003 C CD  . GLU A 1 139 ? -2.446  12.215 70.218 1.00 61.11  ? 134 GLU A CD  1 
ATOM   1004 O OE1 . GLU A 1 139 ? -2.751  12.384 71.419 1.00 56.80  ? 134 GLU A OE1 1 
ATOM   1005 O OE2 . GLU A 1 139 ? -2.317  13.164 69.410 1.00 54.66  1 134 GLU A OE2 1 
ATOM   1006 N N   . TYR A 1 140 ? 0.718   8.816  70.277 1.00 26.51  ? 135 TYR A N   1 
ATOM   1007 C CA  . TYR A 1 140 ? 1.990   9.108  69.644 1.00 22.49  ? 135 TYR A CA  1 
ATOM   1008 C C   . TYR A 1 140 ? 2.604   7.877  69.010 1.00 25.44  ? 135 TYR A C   1 
ATOM   1009 O O   . TYR A 1 140 ? 3.235   7.971  67.951 1.00 24.82  ? 135 TYR A O   1 
ATOM   1010 C CB  . TYR A 1 140 ? 2.934   9.759  70.667 1.00 22.39  ? 135 TYR A CB  1 
ATOM   1011 C CG  . TYR A 1 140 ? 2.374   11.108 71.041 1.00 22.81  ? 135 TYR A CG  1 
ATOM   1012 C CD1 . TYR A 1 140 ? 2.234   12.096 70.075 1.00 30.02  ? 135 TYR A CD1 1 
ATOM   1013 C CD2 . TYR A 1 140 ? 1.913   11.374 72.334 1.00 29.69  ? 135 TYR A CD2 1 
ATOM   1014 C CE1 . TYR A 1 140 ? 1.678   13.320 70.376 1.00 32.26  ? 135 TYR A CE1 1 
ATOM   1015 C CE2 . TYR A 1 140 ? 1.358   12.605 72.645 1.00 32.45  ? 135 TYR A CE2 1 
ATOM   1016 C CZ  . TYR A 1 140 ? 1.242   13.568 71.656 1.00 32.09  ? 135 TYR A CZ  1 
ATOM   1017 O OH  . TYR A 1 140 ? 0.688   14.792 71.923 1.00 33.93  ? 135 TYR A OH  1 
ATOM   1018 N N   . ILE A 1 141 ? 2.407   6.717  69.621 1.00 25.86  ? 136 ILE A N   1 
ATOM   1019 C CA  . ILE A 1 141 ? 2.859   5.481  68.990 1.00 24.91  ? 136 ILE A CA  1 
ATOM   1020 C C   . ILE A 1 141 ? 2.076   5.206  67.697 1.00 28.54  ? 136 ILE A C   1 
ATOM   1021 O O   . ILE A 1 141 ? 2.659   4.840  66.668 1.00 25.77  ? 136 ILE A O   1 
ATOM   1022 C CB  . ILE A 1 141 ? 2.747   4.293  69.978 1.00 27.55  ? 136 ILE A CB  1 
ATOM   1023 C CG1 . ILE A 1 141 ? 3.886   4.359  70.991 1.00 34.31  ? 136 ILE A CG1 1 
ATOM   1024 C CG2 . ILE A 1 141 ? 2.778   2.965  69.237 1.00 28.88  ? 136 ILE A CG2 1 
ATOM   1025 C CD1 . ILE A 1 141 ? 5.258   4.183  70.353 1.00 41.92  ? 136 ILE A CD1 1 
ATOM   1026 N N   . GLN A 1 142 ? 0.762   5.425  67.719 1.00 25.66  ? 137 GLN A N   1 
ATOM   1027 C CA  . GLN A 1 142 ? -0.024  5.286  66.488 1.00 25.91  ? 137 GLN A CA  1 
ATOM   1028 C C   . GLN A 1 142 ? 0.454   6.254  65.402 1.00 25.29  ? 137 GLN A C   1 
ATOM   1029 O O   . GLN A 1 142 ? 0.526   5.886  64.222 1.00 28.40  ? 137 GLN A O   1 
ATOM   1030 C CB  . GLN A 1 142 ? -1.519  5.502  66.769 1.00 29.03  ? 137 GLN A CB  1 
ATOM   1031 C CG  . GLN A 1 142 ? -2.398  5.457  65.520 1.00 42.92  ? 137 GLN A CG  1 
ATOM   1032 C CD  . GLN A 1 142 ? -2.289  4.131  64.767 1.00 62.18  ? 137 GLN A CD  1 
ATOM   1033 O OE1 . GLN A 1 142 ? -2.158  3.066  65.375 1.00 69.86  ? 137 GLN A OE1 1 
ATOM   1034 N NE2 . GLN A 1 142 ? -2.333  4.195  63.437 1.00 54.75  ? 137 GLN A NE2 1 
ATOM   1035 N N   . ALA A 1 143 ? 0.795   7.481  65.786 1.00 26.73  ? 138 ALA A N   1 
ATOM   1036 C CA  . ALA A 1 143 ? 1.212   8.478  64.806 1.00 25.64  ? 138 ALA A CA  1 
ATOM   1037 C C   . ALA A 1 143 ? 2.549   8.077  64.201 1.00 24.83  ? 138 ALA A C   1 
ATOM   1038 O O   . ALA A 1 143 ? 2.810   8.334  63.030 1.00 25.38  ? 138 ALA A O   1 
ATOM   1039 C CB  . ALA A 1 143 ? 1.300   9.867  65.432 1.00 24.85  ? 138 ALA A CB  1 
ATOM   1040 N N   . ILE A 1 144 ? 3.407   7.452  65.003 1.00 23.42  ? 139 ILE A N   1 
ATOM   1041 C CA  . ILE A 1 144 ? 4.692   6.984  64.469 1.00 21.01  ? 139 ILE A CA  1 
ATOM   1042 C C   . ILE A 1 144 ? 4.480   5.836  63.462 1.00 24.20  ? 139 ILE A C   1 
ATOM   1043 O O   . ILE A 1 144 ? 5.083   5.832  62.376 1.00 23.98  ? 139 ILE A O   1 
ATOM   1044 C CB  . ILE A 1 144 ? 5.654   6.562  65.614 1.00 24.41  ? 139 ILE A CB  1 
ATOM   1045 C CG1 . ILE A 1 144 ? 6.246   7.808  66.274 1.00 24.09  ? 139 ILE A CG1 1 
ATOM   1046 C CG2 . ILE A 1 144 ? 6.764   5.638  65.087 1.00 25.74  ? 139 ILE A CG2 1 
ATOM   1047 C CD1 . ILE A 1 144 ? 6.790   7.579  67.672 1.00 26.52  ? 139 ILE A CD1 1 
ATOM   1048 N N   . MET A 1 145 ? 3.593   4.893  63.769 1.00 22.55  ? 140 MET A N   1 
ATOM   1049 C CA  . MET A 1 145 ? 3.355   3.799  62.836 1.00 26.86  ? 140 MET A CA  1 
ATOM   1050 C C   . MET A 1 145 ? 2.662   4.312  61.563 1.00 27.22  ? 140 MET A C   1 
ATOM   1051 O O   . MET A 1 145 ? 2.856   3.768  60.488 1.00 28.14  ? 140 MET A O   1 
ATOM   1052 C CB  . MET A 1 145 ? 2.549   2.680  63.502 1.00 32.59  ? 140 MET A CB  1 
ATOM   1053 C CG  . MET A 1 145 ? 3.346   1.921  64.558 1.00 27.25  ? 140 MET A CG  1 
ATOM   1054 S SD  . MET A 1 145 ? 4.999   1.369  64.045 1.00 33.53  ? 140 MET A SD  1 
ATOM   1055 C CE  . MET A 1 145 ? 4.565   0.225  62.734 1.00 33.89  ? 140 MET A CE  1 
ATOM   1056 N N   . MET A 1 146 ? 1.888   5.389  61.671 1.00 24.86  ? 141 MET A N   1 
ATOM   1057 C CA  . MET A 1 146 ? 1.321   6.013  60.478 1.00 28.78  ? 141 MET A CA  1 
ATOM   1058 C C   . MET A 1 146 ? 2.371   6.685  59.583 1.00 24.42  ? 141 MET A C   1 
ATOM   1059 O O   . MET A 1 146 ? 2.120   6.897  58.407 1.00 24.80  ? 141 MET A O   1 
ATOM   1060 C CB  . MET A 1 146 ? 0.250   7.036  60.862 1.00 27.04  ? 141 MET A CB  1 
ATOM   1061 C CG  . MET A 1 146 ? -1.005  6.413  61.445 1.00 39.46  ? 141 MET A CG  1 
ATOM   1062 S SD  . MET A 1 146 ? -1.823  5.387  60.214 1.00 51.83  ? 141 MET A SD  1 
ATOM   1063 C CE  . MET A 1 146 ? -1.765  6.529  58.823 1.00 33.70  ? 141 MET A CE  1 
ATOM   1064 N N   . MET A 1 147 ? 3.548   6.995  60.121 1.00 22.38  ? 142 MET A N   1 
ATOM   1065 C CA  . MET A 1 147 ? 4.659   7.444  59.284 1.00 23.27  ? 142 MET A CA  1 
ATOM   1066 C C   . MET A 1 147 ? 5.079   6.320  58.340 1.00 24.86  ? 142 MET A C   1 
ATOM   1067 O O   . MET A 1 147 ? 5.500   6.564  57.200 1.00 23.84  ? 142 MET A O   1 
ATOM   1068 C CB  . MET A 1 147 ? 5.855   7.885  60.132 1.00 19.98  ? 142 MET A CB  1 
ATOM   1069 C CG  . MET A 1 147 ? 5.567   9.082  61.025 1.00 24.77  ? 142 MET A CG  1 
ATOM   1070 S SD  . MET A 1 147 ? 7.040   9.554  61.961 1.00 25.87  ? 142 MET A SD  1 
ATOM   1071 C CE  . MET A 1 147 ? 8.093   10.283 60.698 1.00 25.07  ? 142 MET A CE  1 
ATOM   1072 N N   . GLU A 1 148 ? 4.971   5.085  58.824 1.00 22.07  ? 143 GLU A N   1 
ATOM   1073 C CA  . GLU A 1 148 ? 5.261   3.927  57.990 1.00 24.20  ? 143 GLU A CA  1 
ATOM   1074 C C   . GLU A 1 148 ? 4.240   3.779  56.859 1.00 25.90  ? 143 GLU A C   1 
ATOM   1075 O O   . GLU A 1 148 ? 4.599   3.525  55.698 1.00 24.47  ? 143 GLU A O   1 
ATOM   1076 C CB  . GLU A 1 148 ? 5.279   2.637  58.820 1.00 29.00  ? 143 GLU A CB  1 
ATOM   1077 C CG  . GLU A 1 148 ? 6.446   2.514  59.779 1.00 29.79  ? 143 GLU A CG  1 
ATOM   1078 C CD  . GLU A 1 148 ? 7.608   1.759  59.188 1.00 38.99  ? 143 GLU A CD  1 
ATOM   1079 O OE1 . GLU A 1 148 ? 7.665   1.617  57.947 1.00 34.30  ? 143 GLU A OE1 1 
ATOM   1080 O OE2 . GLU A 1 148 ? 8.456   1.291  59.972 1.00 40.94  1 143 GLU A OE2 1 
ATOM   1081 N N   . GLU A 1 149 ? 2.968   3.919  57.207 1.00 26.25  ? 144 GLU A N   1 
ATOM   1082 C CA  . GLU A 1 149 ? 1.894   3.816  56.221 1.00 27.61  ? 144 GLU A CA  1 
ATOM   1083 C C   . GLU A 1 149 ? 2.032   4.903  55.170 1.00 26.78  ? 144 GLU A C   1 
ATOM   1084 O O   . GLU A 1 149 ? 1.811   4.665  53.978 1.00 26.34  ? 144 GLU A O   1 
ATOM   1085 C CB  . GLU A 1 149 ? 0.522   3.920  56.891 1.00 28.02  ? 144 GLU A CB  1 
ATOM   1086 C CG  . GLU A 1 149 ? 0.177   2.771  57.806 1.00 45.66  ? 144 GLU A CG  1 
ATOM   1087 C CD  . GLU A 1 149 ? -1.312  2.720  58.113 1.00 62.75  ? 144 GLU A CD  1 
ATOM   1088 O OE1 . GLU A 1 149 ? -2.099  3.265  57.304 1.00 66.02  ? 144 GLU A OE1 1 
ATOM   1089 O OE2 . GLU A 1 149 ? -1.694  2.143  59.158 1.00 63.82  1 144 GLU A OE2 1 
ATOM   1090 N N   . SER A 1 150 ? 2.407   6.098  55.612 1.00 22.96  ? 145 SER A N   1 
ATOM   1091 C CA  . SER A 1 150 ? 2.548   7.243  54.713 1.00 24.91  ? 145 SER A CA  1 
ATOM   1092 C C   . SER A 1 150 ? 3.650   7.013  53.674 1.00 23.14  ? 145 SER A C   1 
ATOM   1093 O O   . SER A 1 150 ? 3.466   7.287  52.488 1.00 24.04  ? 145 SER A O   1 
ATOM   1094 C CB  . SER A 1 150 ? 2.838   8.515  55.516 1.00 26.48  ? 145 SER A CB  1 
ATOM   1095 O OG  . SER A 1 150 ? 3.047   9.621  54.647 1.00 29.04  ? 145 SER A OG  1 
ATOM   1096 N N   . VAL A 1 151 ? 4.796   6.505  54.112 1.00 22.19  ? 146 VAL A N   1 
ATOM   1097 C CA  . VAL A 1 151 ? 5.886   6.265  53.174 1.00 20.69  ? 146 VAL A CA  1 
ATOM   1098 C C   . VAL A 1 151 ? 5.512   5.207  52.141 1.00 27.61  ? 146 VAL A C   1 
ATOM   1099 O O   . VAL A 1 151 ? 5.879   5.317  50.977 1.00 21.82  ? 146 VAL A O   1 
ATOM   1100 C CB  . VAL A 1 151 ? 7.183   5.852  53.899 1.00 27.80  ? 146 VAL A CB  1 
ATOM   1101 C CG1 . VAL A 1 151 ? 8.265   5.475  52.876 1.00 28.45  ? 146 VAL A CG1 1 
ATOM   1102 C CG2 . VAL A 1 151 ? 7.662   7.002  54.698 1.00 33.29  ? 146 VAL A CG2 1 
ATOM   1103 N N   . GLN A 1 152 ? 4.750   4.198  52.536 1.00 23.25  ? 147 GLN A N   1 
ATOM   1104 C CA  . GLN A 1 152 ? 4.328   3.201  51.560 1.00 24.24  ? 147 GLN A CA  1 
ATOM   1105 C C   . GLN A 1 152 ? 3.450   3.812  50.471 1.00 23.97  ? 147 GLN A C   1 
ATOM   1106 O O   . GLN A 1 152 ? 3.458   3.330  49.343 1.00 24.41  ? 147 GLN A O   1 
ATOM   1107 C CB  . GLN A 1 152 ? 3.576   2.036  52.227 1.00 26.27  ? 147 GLN A CB  1 
ATOM   1108 C CG  . GLN A 1 152 ? 4.211   1.429  53.469 1.00 30.24  ? 147 GLN A CG  1 
ATOM   1109 C CD  . GLN A 1 152 ? 5.724   1.273  53.415 1.00 46.94  ? 147 GLN A CD  1 
ATOM   1110 O OE1 . GLN A 1 152 ? 6.410   1.482  54.424 1.00 55.77  ? 147 GLN A OE1 1 
ATOM   1111 N NE2 . GLN A 1 152 ? 6.249   0.878  52.260 1.00 39.23  ? 147 GLN A NE2 1 
ATOM   1112 N N   . HIS A 1 153 ? 2.695   4.866  50.789 1.00 25.22  ? 148 HIS A N   1 
ATOM   1113 C CA  . HIS A 1 153 ? 1.899   5.535  49.736 1.00 26.02  ? 148 HIS A CA  1 
ATOM   1114 C C   . HIS A 1 153 ? 2.810   6.205  48.704 1.00 24.66  ? 148 HIS A C   1 
ATOM   1115 O O   . HIS A 1 153 ? 2.511   6.215  47.505 1.00 26.36  ? 148 HIS A O   1 
ATOM   1116 C CB  . HIS A 1 153 ? 0.941   6.585  50.319 1.00 28.27  ? 148 HIS A CB  1 
ATOM   1117 C CG  . HIS A 1 153 ? -0.080  6.027  51.263 1.00 40.85  ? 148 HIS A CG  1 
ATOM   1118 N ND1 . HIS A 1 153 ? -0.563  4.739  51.167 1.00 50.16  ? 148 HIS A ND1 1 
ATOM   1119 C CD2 . HIS A 1 153 ? -0.704  6.584  52.330 1.00 37.20  ? 148 HIS A CD2 1 
ATOM   1120 C CE1 . HIS A 1 153 ? -1.440  4.527  52.133 1.00 48.50  ? 148 HIS A CE1 1 
ATOM   1121 N NE2 . HIS A 1 153 ? -1.543  5.629  52.853 1.00 45.05  ? 148 HIS A NE2 1 
ATOM   1122 N N   . VAL A 1 154 ? 3.914   6.769  49.181 1.00 23.23  ? 149 VAL A N   1 
ATOM   1123 C CA  . VAL A 1 154 ? 4.889   7.394  48.301 1.00 22.74  ? 149 VAL A CA  1 
ATOM   1124 C C   . VAL A 1 154 ? 5.514   6.329  47.399 1.00 22.02  ? 149 VAL A C   1 
ATOM   1125 O O   . VAL A 1 154 ? 5.640   6.519  46.197 1.00 23.31  ? 149 VAL A O   1 
ATOM   1126 C CB  . VAL A 1 154 ? 6.000   8.113  49.088 1.00 22.96  ? 149 VAL A CB  1 
ATOM   1127 C CG1 . VAL A 1 154 ? 7.061   8.669  48.123 1.00 25.40  ? 149 VAL A CG1 1 
ATOM   1128 C CG2 . VAL A 1 154 ? 5.415   9.252  49.946 1.00 24.80  ? 149 VAL A CG2 1 
ATOM   1129 N N   . VAL A 1 155 ? 5.894   5.205  47.997 1.00 23.63  ? 150 VAL A N   1 
ATOM   1130 C CA  . VAL A 1 155 ? 6.538   4.133  47.255 1.00 24.05  ? 150 VAL A CA  1 
ATOM   1131 C C   . VAL A 1 155 ? 5.575   3.539  46.236 1.00 22.19  ? 150 VAL A C   1 
ATOM   1132 O O   . VAL A 1 155 ? 5.951   3.321  45.086 1.00 22.65  ? 150 VAL A O   1 
ATOM   1133 C CB  . VAL A 1 155 ? 7.068   3.032  48.210 1.00 21.80  ? 150 VAL A CB  1 
ATOM   1134 C CG1 . VAL A 1 155 ? 7.568   1.816  47.410 1.00 23.05  ? 150 VAL A CG1 1 
ATOM   1135 C CG2 . VAL A 1 155 ? 8.191   3.592  49.074 1.00 23.91  ? 150 VAL A CG2 1 
ATOM   1136 N N   . MET A 1 156 ? 4.329   3.298  46.639 1.00 22.02  ? 151 MET A N   1 
ATOM   1137 C CA  . MET A 1 156 ? 3.335   2.780  45.692 1.00 24.16  ? 151 MET A CA  1 
ATOM   1138 C C   . MET A 1 156 ? 3.090   3.774  44.557 1.00 24.30  ? 151 MET A C   1 
ATOM   1139 O O   . MET A 1 156 ? 2.906   3.371  43.409 1.00 25.62  ? 151 MET A O   1 
ATOM   1140 C CB  . MET A 1 156 ? 2.008   2.451  46.381 1.00 26.41  ? 151 MET A CB  1 
ATOM   1141 C CG  . MET A 1 156 ? 0.976   1.772  45.445 1.00 28.90  ? 151 MET A CG  1 
ATOM   1142 S SD  . MET A 1 156 ? 1.532   0.267  44.587 1.00 35.23  ? 151 MET A SD  1 
ATOM   1143 C CE  . MET A 1 156 ? 0.387   -0.939 45.252 1.00 46.70  ? 151 MET A CE  1 
ATOM   1144 N N   . THR A 1 157 ? 3.104   5.072  44.863 1.00 24.53  ? 152 THR A N   1 
ATOM   1145 C CA  . THR A 1 157 ? 2.946   6.070  43.793 1.00 28.37  ? 152 THR A CA  1 
ATOM   1146 C C   . THR A 1 157 ? 4.105   5.983  42.800 1.00 25.53  ? 152 THR A C   1 
ATOM   1147 O O   . THR A 1 157 ? 3.904   6.014  41.582 1.00 27.99  ? 152 THR A O   1 
ATOM   1148 C CB  . THR A 1 157 ? 2.876   7.512  44.347 1.00 30.88  ? 152 THR A CB  1 
ATOM   1149 O OG1 . THR A 1 157 ? 1.770   7.628  45.245 1.00 31.02  ? 152 THR A OG1 1 
ATOM   1150 C CG2 . THR A 1 157 ? 2.715   8.517  43.213 1.00 30.47  ? 152 THR A CG2 1 
ATOM   1151 N N   . ALA A 1 158 ? 5.324   5.870  43.321 1.00 24.22  ? 153 ALA A N   1 
ATOM   1152 C CA  . ALA A 1 158 ? 6.485   5.741  42.453 1.00 25.88  ? 153 ALA A CA  1 
ATOM   1153 C C   . ALA A 1 158 ? 6.387   4.509  41.564 1.00 28.56  ? 153 ALA A C   1 
ATOM   1154 O O   . ALA A 1 158 ? 6.671   4.572  40.372 1.00 25.93  ? 153 ALA A O   1 
ATOM   1155 C CB  . ALA A 1 158 ? 7.758   5.696  43.279 1.00 25.53  ? 153 ALA A CB  1 
ATOM   1156 N N   . ILE A 1 159 ? 5.990   3.385  42.151 1.00 25.50  ? 154 ILE A N   1 
ATOM   1157 C CA  . ILE A 1 159 ? 5.844   2.146  41.397 1.00 26.24  ? 154 ILE A CA  1 
ATOM   1158 C C   . ILE A 1 159 ? 4.800   2.307  40.300 1.00 29.58  ? 154 ILE A C   1 
ATOM   1159 O O   . ILE A 1 159 ? 5.015   1.906  39.149 1.00 30.72  ? 154 ILE A O   1 
ATOM   1160 C CB  . ILE A 1 159 ? 5.479   0.978  42.349 1.00 25.61  ? 154 ILE A CB  1 
ATOM   1161 C CG1 . ILE A 1 159 ? 6.718   0.584  43.143 1.00 24.24  ? 154 ILE A CG1 1 
ATOM   1162 C CG2 . ILE A 1 159 ? 4.942   -0.213 41.571 1.00 35.39  ? 154 ILE A CG2 1 
ATOM   1163 C CD1 . ILE A 1 159 ? 6.447   -0.314 44.349 1.00 30.81  ? 154 ILE A CD1 1 
ATOM   1164 N N   . GLN A 1 160 ? 3.672   2.913  40.641 1.00 25.13  ? 155 GLN A N   1 
ATOM   1165 C CA  . GLN A 1 160 ? 2.638   3.127  39.642 1.00 30.35  ? 155 GLN A CA  1 
ATOM   1166 C C   . GLN A 1 160 ? 3.084   4.107  38.559 1.00 32.94  ? 155 GLN A C   1 
ATOM   1167 O O   . GLN A 1 160 ? 2.656   3.992  37.415 1.00 31.65  ? 155 GLN A O   1 
ATOM   1168 C CB  . GLN A 1 160 ? 1.349   3.621  40.298 1.00 31.89  ? 155 GLN A CB  1 
ATOM   1169 C CG  . GLN A 1 160 ? 0.717   2.596  41.223 1.00 32.71  ? 155 GLN A CG  1 
ATOM   1170 C CD  . GLN A 1 160 ? 0.264   1.368  40.468 1.00 37.81  ? 155 GLN A CD  1 
ATOM   1171 O OE1 . GLN A 1 160 ? -0.093  1.452  39.291 1.00 40.67  ? 155 GLN A OE1 1 
ATOM   1172 N NE2 . GLN A 1 160 ? 0.278   0.218  41.133 1.00 36.56  ? 155 GLN A NE2 1 
ATOM   1173 N N   . GLU A 1 161 ? 3.953   5.058  38.892 1.00 25.62  ? 156 GLU A N   1 
ATOM   1174 C CA  . GLU A 1 161 ? 4.419   5.976  37.846 1.00 26.55  ? 156 GLU A CA  1 
ATOM   1175 C C   . GLU A 1 161 ? 5.458   5.304  36.960 1.00 39.05  ? 156 GLU A C   1 
ATOM   1176 O O   . GLU A 1 161 ? 5.763   5.806  35.867 1.00 36.59  ? 156 GLU A O   1 
ATOM   1177 C CB  . GLU A 1 161 ? 4.975   7.271  38.449 1.00 31.31  ? 156 GLU A CB  1 
ATOM   1178 C CG  . GLU A 1 161 ? 3.908   8.195  39.034 1.00 28.69  ? 156 GLU A CG  1 
ATOM   1179 C CD  . GLU A 1 161 ? 2.955   8.737  37.979 1.00 37.77  ? 156 GLU A CD  1 
ATOM   1180 O OE1 . GLU A 1 161 ? 3.422   9.112  36.879 1.00 37.78  ? 156 GLU A OE1 1 
ATOM   1181 O OE2 . GLU A 1 161 ? 1.734   8.782  38.242 1.00 42.23  1 156 GLU A OE2 1 
ATOM   1182 N N   . LEU A 1 162 ? 5.976   4.157  37.400 1.00 27.95  ? 157 LEU A N   1 
ATOM   1183 C CA  . LEU A 1 162 ? 6.919   3.381  36.566 1.00 31.02  ? 157 LEU A CA  1 
ATOM   1184 C C   . LEU A 1 162 ? 6.264   2.280  35.735 1.00 40.19  ? 157 LEU A C   1 
ATOM   1185 O O   . LEU A 1 162 ? 6.840   1.809  34.757 1.00 43.12  ? 157 LEU A O   1 
ATOM   1186 C CB  . LEU A 1 162 ? 8.010   2.750  37.436 1.00 32.16  ? 157 LEU A CB  1 
ATOM   1187 C CG  . LEU A 1 162 ? 8.925   3.677  38.220 1.00 30.44  ? 157 LEU A CG  1 
ATOM   1188 C CD1 . LEU A 1 162 ? 9.676   2.854  39.233 1.00 32.20  ? 157 LEU A CD1 1 
ATOM   1189 C CD2 . LEU A 1 162 ? 9.886   4.377  37.283 1.00 43.62  ? 157 LEU A CD2 1 
ATOM   1190 N N   . MET A 1 163 ? 5.071   1.853  36.127 1.00 39.88  ? 158 MET A N   1 
ATOM   1191 C CA  . MET A 1 163 ? 4.374   0.813  35.385 1.00 49.80  ? 158 MET A CA  1 
ATOM   1192 C C   . MET A 1 163 ? 3.683   1.410  34.164 1.00 62.81  ? 158 MET A C   1 
ATOM   1193 O O   . MET A 1 163 ? 3.452   2.620  34.101 1.00 71.70  ? 158 MET A O   1 
ATOM   1194 C CB  . MET A 1 163 ? 3.360   0.101  36.277 1.00 45.98  ? 158 MET A CB  1 
ATOM   1195 C CG  . MET A 1 163 ? 3.987   -0.698 37.388 1.00 44.59  ? 158 MET A CG  1 
ATOM   1196 S SD  . MET A 1 163 ? 2.752   -1.426 38.463 1.00 83.87  ? 158 MET A SD  1 
ATOM   1197 C CE  . MET A 1 163 ? 1.911   -2.488 37.298 1.00 91.98  ? 158 MET A CE  1 
ATOM   1198 N N   . SER B 1 11  ? -13.534 14.006 50.880 1.00 93.19  ? 6   SER B N   1 
ATOM   1199 C CA  . SER B 1 11  ? -13.328 14.674 52.159 1.00 92.06  ? 6   SER B CA  1 
ATOM   1200 C C   . SER B 1 11  ? -11.868 14.574 52.584 1.00 83.95  ? 6   SER B C   1 
ATOM   1201 O O   . SER B 1 11  ? -10.981 15.113 51.924 1.00 80.53  ? 6   SER B O   1 
ATOM   1202 C CB  . SER B 1 11  ? -14.242 14.074 53.232 1.00 99.58  ? 6   SER B CB  1 
ATOM   1203 O OG  . SER B 1 11  ? -14.133 14.773 54.461 1.00 99.36  ? 6   SER B OG  1 
ATOM   1204 N N   . LEU B 1 12  ? -11.624 13.873 53.686 1.00 76.98  ? 7   LEU B N   1 
ATOM   1205 C CA  . LEU B 1 12  ? -10.273 13.713 54.208 1.00 78.17  ? 7   LEU B CA  1 
ATOM   1206 C C   . LEU B 1 12  ? -9.541  12.571 53.506 1.00 85.28  ? 7   LEU B C   1 
ATOM   1207 O O   . LEU B 1 12  ? -8.316  12.469 53.579 1.00 78.60  ? 7   LEU B O   1 
ATOM   1208 C CB  . LEU B 1 12  ? -10.309 13.473 55.717 1.00 73.75  ? 7   LEU B CB  1 
ATOM   1209 C CG  . LEU B 1 12  ? -11.532 14.027 56.450 1.00 79.55  ? 7   LEU B CG  1 
ATOM   1210 C CD1 . LEU B 1 12  ? -12.536 12.910 56.712 1.00 86.22  ? 7   LEU B CD1 1 
ATOM   1211 C CD2 . LEU B 1 12  ? -11.135 14.716 57.747 1.00 77.87  ? 7   LEU B CD2 1 
ATOM   1212 N N   . GLU B 1 13  ? -10.299 11.710 52.831 1.00 94.11  ? 8   GLU B N   1 
ATOM   1213 C CA  . GLU B 1 13  ? -9.708  10.664 52.003 1.00 97.68  ? 8   GLU B CA  1 
ATOM   1214 C C   . GLU B 1 13  ? -9.204  11.285 50.706 1.00 94.43  ? 8   GLU B C   1 
ATOM   1215 O O   . GLU B 1 13  ? -9.704  12.331 50.285 1.00 93.32  ? 8   GLU B O   1 
ATOM   1216 C CB  . GLU B 1 13  ? -10.721 9.555  51.714 1.00 107.61 ? 8   GLU B CB  1 
ATOM   1217 C CG  . GLU B 1 13  ? -10.170 8.137  51.849 1.00 115.06 ? 8   GLU B CG  1 
ATOM   1218 C CD  . GLU B 1 13  ? -9.115  7.795  50.807 1.00 118.17 ? 8   GLU B CD  1 
ATOM   1219 O OE1 . GLU B 1 13  ? -9.171  6.679  50.250 1.00 119.19 ? 8   GLU B OE1 1 
ATOM   1220 O OE2 . GLU B 1 13  ? -8.225  8.632  50.550 1.00 118.40 1 8   GLU B OE2 1 
ATOM   1221 N N   . ARG B 1 14  ? -8.199  10.650 50.098 1.00 90.82  ? 9   ARG B N   1 
ATOM   1222 C CA  . ARG B 1 14  ? -7.492  11.157 48.910 1.00 76.70  ? 9   ARG B CA  1 
ATOM   1223 C C   . ARG B 1 14  ? -6.675  12.407 49.247 1.00 63.94  ? 9   ARG B C   1 
ATOM   1224 O O   . ARG B 1 14  ? -5.691  12.733 48.566 1.00 58.03  ? 9   ARG B O   1 
ATOM   1225 C CB  . ARG B 1 14  ? -8.463  11.441 47.757 1.00 81.47  ? 9   ARG B CB  1 
ATOM   1226 C CG  . ARG B 1 14  ? -7.778  11.657 46.421 1.00 74.81  ? 9   ARG B CG  1 
ATOM   1227 C CD  . ARG B 1 14  ? -6.623  10.688 46.266 1.00 74.67  ? 9   ARG B CD  1 
ATOM   1228 N NE  . ARG B 1 14  ? -5.939  10.812 44.983 1.00 76.33  ? 9   ARG B NE  1 
ATOM   1229 C CZ  . ARG B 1 14  ? -5.059  11.764 44.681 1.00 67.98  ? 9   ARG B CZ  1 
ATOM   1230 N NH1 . ARG B 1 14  ? -4.751  12.718 45.563 1.00 43.25  1 9   ARG B NH1 1 
ATOM   1231 N NH2 . ARG B 1 14  ? -4.490  11.763 43.485 1.00 72.97  ? 9   ARG B NH2 1 
ATOM   1232 N N   . ALA B 1 15  ? -7.086  13.101 50.303 1.00 54.74  ? 10  ALA B N   1 
ATOM   1233 C CA  . ALA B 1 15  ? -6.252  14.113 50.921 1.00 44.22  ? 10  ALA B CA  1 
ATOM   1234 C C   . ALA B 1 15  ? -5.086  13.417 51.600 1.00 39.80  ? 10  ALA B C   1 
ATOM   1235 O O   . ALA B 1 15  ? -4.011  13.992 51.744 1.00 35.63  ? 10  ALA B O   1 
ATOM   1236 C CB  . ALA B 1 15  ? -7.044  14.935 51.917 1.00 45.24  ? 10  ALA B CB  1 
ATOM   1237 N N   . GLU B 1 16  ? -5.310  12.173 52.023 1.00 39.14  ? 11  GLU B N   1 
ATOM   1238 C CA  . GLU B 1 16  ? -4.261  11.366 52.643 1.00 37.97  ? 11  GLU B CA  1 
ATOM   1239 C C   . GLU B 1 16  ? -3.065  11.173 51.709 1.00 30.72  ? 11  GLU B C   1 
ATOM   1240 O O   . GLU B 1 16  ? -1.909  11.302 52.129 1.00 32.99  ? 11  GLU B O   1 
ATOM   1241 C CB  . GLU B 1 16  ? -4.814  10.004 53.069 1.00 44.79  ? 11  GLU B CB  1 
ATOM   1242 C CG  . GLU B 1 16  ? -3.745  9.059  53.604 1.00 67.90  ? 11  GLU B CG  1 
ATOM   1243 C CD  . GLU B 1 16  ? -4.311  7.753  54.141 1.00 81.81  ? 11  GLU B CD  1 
ATOM   1244 O OE1 . GLU B 1 16  ? -5.544  7.558  54.067 1.00 85.33  ? 11  GLU B OE1 1 
ATOM   1245 O OE2 . GLU B 1 16  ? -3.517  6.923  54.641 1.00 79.57  1 11  GLU B OE2 1 
ATOM   1246 N N   . LEU B 1 17  ? -3.334  10.855 50.445 1.00 30.60  ? 12  LEU B N   1 
ATOM   1247 C CA  . LEU B 1 17  ? -2.257  10.723 49.473 1.00 28.32  ? 12  LEU B CA  1 
ATOM   1248 C C   . LEU B 1 17  ? -1.508  12.045 49.362 1.00 31.28  ? 12  LEU B C   1 
ATOM   1249 O O   . LEU B 1 17  ? -0.278  12.062 49.274 1.00 27.59  ? 12  LEU B O   1 
ATOM   1250 C CB  . LEU B 1 17  ? -2.785  10.295 48.099 1.00 31.64  ? 12  LEU B CB  1 
ATOM   1251 C CG  . LEU B 1 17  ? -1.691  10.101 47.044 1.00 37.25  ? 12  LEU B CG  1 
ATOM   1252 C CD1 . LEU B 1 17  ? -0.755  8.954  47.430 1.00 30.50  ? 12  LEU B CD1 1 
ATOM   1253 C CD2 . LEU B 1 17  ? -2.297  9.852  45.682 1.00 44.84  ? 12  LEU B CD2 1 
ATOM   1254 N N   . CYS B 1 18  ? -2.245  13.157 49.384 1.00 30.26  ? 13  CYS B N   1 
ATOM   1255 C CA  . CYS B 1 18  ? -1.598  14.462 49.245 1.00 36.39  ? 13  CYS B CA  1 
ATOM   1256 C C   . CYS B 1 18  ? -0.640  14.720 50.412 1.00 24.04  ? 13  CYS B C   1 
ATOM   1257 O O   . CYS B 1 18  ? 0.474   15.220 50.218 1.00 25.89  ? 13  CYS B O   1 
ATOM   1258 C CB  . CYS B 1 18  ? -2.630  15.582 49.155 1.00 34.94  ? 13  CYS B CB  1 
ATOM   1259 S SG  . CYS B 1 18  ? -1.901  17.204 48.785 1.00 32.37  ? 13  CYS B SG  1 
ATOM   1260 N N   . GLU B 1 19  ? -1.080  14.386 51.624 1.00 27.23  ? 14  GLU B N   1 
ATOM   1261 C CA  . GLU B 1 19  ? -0.237  14.555 52.793 1.00 27.00  ? 14  GLU B CA  1 
ATOM   1262 C C   . GLU B 1 19  ? 1.018   13.688 52.714 1.00 23.93  ? 14  GLU B C   1 
ATOM   1263 O O   . GLU B 1 19  ? 2.108   14.127 53.110 1.00 29.28  ? 14  GLU B O   1 
ATOM   1264 C CB  . GLU B 1 19  ? -1.033  14.238 54.063 1.00 33.64  ? 14  GLU B CB  1 
ATOM   1265 C CG  . GLU B 1 19  ? -2.122  15.262 54.357 1.00 38.31  ? 14  GLU B CG  1 
ATOM   1266 C CD  . GLU B 1 19  ? -1.566  16.633 54.745 1.00 52.36  ? 14  GLU B CD  1 
ATOM   1267 O OE1 . GLU B 1 19  ? -0.391  16.720 55.179 1.00 52.14  ? 14  GLU B OE1 1 
ATOM   1268 O OE2 . GLU B 1 19  ? -2.312  17.630 54.618 1.00 58.18  1 14  GLU B OE2 1 
ATOM   1269 N N   . SER B 1 20  ? 0.885   12.466 52.206 1.00 25.10  ? 15  SER B N   1 
ATOM   1270 C CA  . SER B 1 20  ? 2.074   11.610 52.017 1.00 25.12  ? 15  SER B CA  1 
ATOM   1271 C C   . SER B 1 20  ? 3.032   12.192 50.982 1.00 23.15  ? 15  SER B C   1 
ATOM   1272 O O   . SER B 1 20  ? 4.248   12.231 51.179 1.00 25.54  ? 15  SER B O   1 
ATOM   1273 C CB  . SER B 1 20  ? 1.660   10.201 51.603 1.00 27.46  ? 15  SER B CB  1 
ATOM   1274 O OG  . SER B 1 20  ? 0.825   9.638  52.593 1.00 31.60  ? 15  SER B OG  1 
ATOM   1275 N N   . LEU B 1 21  ? 2.482   12.656 49.868 1.00 22.90  ? 16  LEU B N   1 
ATOM   1276 C CA  . LEU B 1 21  ? 3.332   13.226 48.831 1.00 22.68  ? 16  LEU B CA  1 
ATOM   1277 C C   . LEU B 1 21  ? 3.986   14.521 49.292 1.00 26.14  ? 16  LEU B C   1 
ATOM   1278 O O   . LEU B 1 21  ? 5.059   14.890 48.821 1.00 26.94  ? 16  LEU B O   1 
ATOM   1279 C CB  . LEU B 1 21  ? 2.519   13.448 47.553 1.00 21.22  ? 16  LEU B CB  1 
ATOM   1280 C CG  . LEU B 1 21  ? 2.126   12.098 46.948 1.00 23.13  ? 16  LEU B CG  1 
ATOM   1281 C CD1 . LEU B 1 21  ? 1.378   12.297 45.621 1.00 31.62  ? 16  LEU B CD1 1 
ATOM   1282 C CD2 . LEU B 1 21  ? 3.366   11.273 46.727 1.00 32.06  ? 16  LEU B CD2 1 
ATOM   1283 N N   . LEU B 1 22  ? 3.342   15.206 50.227 1.00 24.43  ? 17  LEU B N   1 
ATOM   1284 C CA  . LEU B 1 22  ? 3.945   16.394 50.813 1.00 24.41  ? 17  LEU B CA  1 
ATOM   1285 C C   . LEU B 1 22  ? 5.243   16.022 51.524 1.00 28.24  ? 17  LEU B C   1 
ATOM   1286 O O   . LEU B 1 22  ? 6.226   16.766 51.460 1.00 26.01  ? 17  LEU B O   1 
ATOM   1287 C CB  . LEU B 1 22  ? 2.975   17.077 51.775 1.00 26.82  ? 17  LEU B CB  1 
ATOM   1288 C CG  . LEU B 1 22  ? 3.497   18.281 52.556 1.00 40.03  ? 17  LEU B CG  1 
ATOM   1289 C CD1 . LEU B 1 22  ? 3.999   19.358 51.614 1.00 43.87  ? 17  LEU B CD1 1 
ATOM   1290 C CD2 . LEU B 1 22  ? 2.393   18.834 53.467 1.00 37.86  ? 17  LEU B CD2 1 
ATOM   1291 N N   . THR B 1 23  ? 5.263   14.862 52.175 1.00 27.29  ? 18  THR B N   1 
ATOM   1292 C CA  . THR B 1 23  ? 6.486   14.445 52.858 1.00 27.48  ? 18  THR B CA  1 
ATOM   1293 C C   . THR B 1 23  ? 7.563   14.147 51.826 1.00 26.17  ? 18  THR B C   1 
ATOM   1294 O O   . THR B 1 23  ? 8.745   14.423 52.059 1.00 24.06  ? 18  THR B O   1 
ATOM   1295 C CB  . THR B 1 23  ? 6.261   13.222 53.790 1.00 30.59  ? 18  THR B CB  1 
ATOM   1296 O OG1 . THR B 1 23  ? 6.032   12.039 53.009 1.00 30.55  ? 18  THR B OG1 1 
ATOM   1297 C CG2 . THR B 1 23  ? 5.070   13.479 54.711 1.00 20.64  ? 18  THR B CG2 1 
ATOM   1298 N N   . TRP B 1 24  ? 7.162   13.622 50.668 1.00 23.87  ? 19  TRP B N   1 
ATOM   1299 C CA  . TRP B 1 24  ? 8.114   13.438 49.574 1.00 23.43  ? 19  TRP B CA  1 
ATOM   1300 C C   . TRP B 1 24  ? 8.644   14.787 49.055 1.00 28.06  ? 19  TRP B C   1 
ATOM   1301 O O   . TRP B 1 24  ? 9.848   14.949 48.843 1.00 27.05  ? 19  TRP B O   1 
ATOM   1302 C CB  . TRP B 1 24  ? 7.475   12.644 48.428 1.00 23.11  ? 19  TRP B CB  1 
ATOM   1303 C CG  . TRP B 1 24  ? 8.374   12.547 47.238 1.00 24.09  ? 19  TRP B CG  1 
ATOM   1304 C CD1 . TRP B 1 24  ? 9.504   11.779 47.129 1.00 25.97  ? 19  TRP B CD1 1 
ATOM   1305 C CD2 . TRP B 1 24  ? 8.245   13.254 45.991 1.00 25.32  ? 19  TRP B CD2 1 
ATOM   1306 N NE1 . TRP B 1 24  ? 10.081  11.963 45.886 1.00 26.31  ? 19  TRP B NE1 1 
ATOM   1307 C CE2 . TRP B 1 24  ? 9.322   12.855 45.171 1.00 26.58  ? 19  TRP B CE2 1 
ATOM   1308 C CE3 . TRP B 1 24  ? 7.316   14.180 45.487 1.00 27.06  ? 19  TRP B CE3 1 
ATOM   1309 C CZ2 . TRP B 1 24  ? 9.496   13.344 43.860 1.00 25.75  ? 19  TRP B CZ2 1 
ATOM   1310 C CZ3 . TRP B 1 24  ? 7.494   14.671 44.178 1.00 26.56  ? 19  TRP B CZ3 1 
ATOM   1311 C CH2 . TRP B 1 24  ? 8.579   14.253 43.390 1.00 25.03  ? 19  TRP B CH2 1 
ATOM   1312 N N   . ILE B 1 25  ? 7.754   15.763 48.876 1.00 21.42  ? 20  ILE B N   1 
ATOM   1313 C CA  . ILE B 1 25  ? 8.176   17.110 48.473 1.00 25.88  ? 20  ILE B CA  1 
ATOM   1314 C C   . ILE B 1 25  ? 9.207   17.678 49.440 1.00 27.79  ? 20  ILE B C   1 
ATOM   1315 O O   . ILE B 1 25  ? 10.166  18.340 49.033 1.00 27.96  ? 20  ILE B O   1 
ATOM   1316 C CB  . ILE B 1 25  ? 6.968   18.075 48.370 1.00 29.01  ? 20  ILE B CB  1 
ATOM   1317 C CG1 . ILE B 1 25  ? 6.119   17.715 47.150 1.00 28.11  ? 20  ILE B CG1 1 
ATOM   1318 C CG2 . ILE B 1 25  ? 7.420   19.556 48.327 1.00 25.95  ? 20  ILE B CG2 1 
ATOM   1319 C CD1 . ILE B 1 25  ? 6.834   17.938 45.785 1.00 24.70  ? 20  ILE B CD1 1 
ATOM   1320 N N   . GLN B 1 26  ? 9.034   17.392 50.727 1.00 27.85  ? 21  GLN B N   1 
ATOM   1321 C CA  . GLN B 1 26  ? 9.937   17.929 51.725 1.00 28.50  ? 21  GLN B CA  1 
ATOM   1322 C C   . GLN B 1 26  ? 11.368  17.371 51.604 1.00 38.18  ? 21  GLN B C   1 
ATOM   1323 O O   . GLN B 1 26  ? 12.299  17.984 52.118 1.00 39.17  ? 21  GLN B O   1 
ATOM   1324 C CB  . GLN B 1 26  ? 9.353   17.682 53.127 1.00 36.04  ? 21  GLN B CB  1 
ATOM   1325 C CG  . GLN B 1 26  ? 8.162   18.609 53.438 1.00 37.20  ? 21  GLN B CG  1 
ATOM   1326 C CD  . GLN B 1 26  ? 7.228   18.042 54.494 1.00 49.57  ? 21  GLN B CD  1 
ATOM   1327 O OE1 . GLN B 1 26  ? 7.499   16.994 55.077 1.00 44.52  ? 21  GLN B OE1 1 
ATOM   1328 N NE2 . GLN B 1 26  ? 6.116   18.732 54.738 1.00 59.22  ? 21  GLN B NE2 1 
ATOM   1329 N N   . THR B 1 27  ? 11.567  16.258 50.889 1.00 29.21  ? 22  THR B N   1 
ATOM   1330 C CA  . THR B 1 27  ? 12.926  15.723 50.713 1.00 33.22  ? 22  THR B CA  1 
ATOM   1331 C C   . THR B 1 27  ? 13.769  16.575 49.761 1.00 40.26  ? 22  THR B C   1 
ATOM   1332 O O   . THR B 1 27  ? 14.989  16.405 49.678 1.00 39.45  ? 22  THR B O   1 
ATOM   1333 C CB  . THR B 1 27  ? 12.944  14.243 50.190 1.00 24.88  ? 22  THR B CB  1 
ATOM   1334 O OG1 . THR B 1 27  ? 12.388  14.153 48.862 1.00 26.88  ? 22  THR B OG1 1 
ATOM   1335 C CG2 . THR B 1 27  ? 12.197  13.306 51.149 1.00 26.92  ? 22  THR B CG2 1 
ATOM   1336 N N   . PHE B 1 28  ? 13.134  17.500 49.049 1.00 30.14  ? 23  PHE B N   1 
ATOM   1337 C CA  . PHE B 1 28  ? 13.857  18.311 48.078 1.00 33.87  ? 23  PHE B CA  1 
ATOM   1338 C C   . PHE B 1 28  ? 14.557  19.513 48.691 1.00 36.65  ? 23  PHE B C   1 
ATOM   1339 O O   . PHE B 1 28  ? 15.460  20.085 48.075 1.00 46.25  ? 23  PHE B O   1 
ATOM   1340 C CB  . PHE B 1 28  ? 12.909  18.792 46.987 1.00 29.61  ? 23  PHE B CB  1 
ATOM   1341 C CG  . PHE B 1 28  ? 12.608  17.756 45.960 1.00 28.80  ? 23  PHE B CG  1 
ATOM   1342 C CD1 . PHE B 1 28  ? 11.576  16.860 46.141 1.00 25.33  ? 23  PHE B CD1 1 
ATOM   1343 C CD2 . PHE B 1 28  ? 13.360  17.681 44.806 1.00 26.70  ? 23  PHE B CD2 1 
ATOM   1344 C CE1 . PHE B 1 28  ? 11.296  15.902 45.184 1.00 29.40  ? 23  PHE B CE1 1 
ATOM   1345 C CE2 . PHE B 1 28  ? 13.084  16.734 43.843 1.00 25.74  ? 23  PHE B CE2 1 
ATOM   1346 C CZ  . PHE B 1 28  ? 12.056  15.837 44.031 1.00 24.27  ? 23  PHE B CZ  1 
ATOM   1347 N N   . ASN B 1 29  ? 14.131  19.891 49.892 1.00 39.45  ? 24  ASN B N   1 
ATOM   1348 C CA  . ASN B 1 29  ? 14.636  21.085 50.572 1.00 53.81  ? 24  ASN B CA  1 
ATOM   1349 C C   . ASN B 1 29  ? 14.739  22.306 49.663 1.00 55.02  ? 24  ASN B C   1 
ATOM   1350 O O   . ASN B 1 29  ? 15.820  22.865 49.478 1.00 56.46  ? 24  ASN B O   1 
ATOM   1351 C CB  . ASN B 1 29  ? 15.995  20.794 51.208 1.00 61.40  ? 24  ASN B CB  1 
ATOM   1352 C CG  . ASN B 1 29  ? 15.922  19.690 52.249 1.00 62.84  ? 24  ASN B CG  1 
ATOM   1353 O OD1 . ASN B 1 29  ? 16.513  18.622 52.079 1.00 52.12  ? 24  ASN B OD1 1 
ATOM   1354 N ND2 . ASN B 1 29  ? 15.179  19.936 53.327 1.00 67.56  ? 24  ASN B ND2 1 
ATOM   1355 N N   . VAL B 1 30  ? 13.612  22.708 49.086 1.00 48.30  ? 25  VAL B N   1 
ATOM   1356 C CA  . VAL B 1 30  ? 13.573  23.912 48.265 1.00 50.98  ? 25  VAL B CA  1 
ATOM   1357 C C   . VAL B 1 30  ? 13.460  25.140 49.163 1.00 55.68  ? 25  VAL B C   1 
ATOM   1358 O O   . VAL B 1 30  ? 13.103  25.026 50.336 1.00 52.93  ? 25  VAL B O   1 
ATOM   1359 C CB  . VAL B 1 30  ? 12.400  23.890 47.262 1.00 50.29  ? 25  VAL B CB  1 
ATOM   1360 C CG1 . VAL B 1 30  ? 12.579  22.757 46.251 1.00 39.30  ? 25  VAL B CG1 1 
ATOM   1361 C CG2 . VAL B 1 30  ? 11.081  23.761 47.997 1.00 39.04  ? 25  VAL B CG2 1 
ATOM   1362 N N   . ASP B 1 31  ? 13.759  26.309 48.610 1.00 59.86  ? 26  ASP B N   1 
ATOM   1363 C CA  . ASP B 1 31  ? 13.839  27.532 49.403 1.00 71.08  ? 26  ASP B CA  1 
ATOM   1364 C C   . ASP B 1 31  ? 12.497  27.943 49.999 1.00 65.45  ? 26  ASP B C   1 
ATOM   1365 O O   . ASP B 1 31  ? 12.430  28.344 51.159 1.00 67.74  ? 26  ASP B O   1 
ATOM   1366 C CB  . ASP B 1 31  ? 14.407  28.674 48.560 1.00 82.49  ? 26  ASP B CB  1 
ATOM   1367 C CG  . ASP B 1 31  ? 15.894  28.521 48.303 1.00 97.79  ? 26  ASP B CG  1 
ATOM   1368 O OD1 . ASP B 1 31  ? 16.694  28.925 49.175 1.00 102.39 ? 26  ASP B OD1 1 
ATOM   1369 O OD2 . ASP B 1 31  ? 16.264  27.994 47.233 1.00 104.36 1 26  ASP B OD2 1 
ATOM   1370 N N   . ALA B 1 32  ? 11.432  27.841 49.211 1.00 56.26  ? 27  ALA B N   1 
ATOM   1371 C CA  . ALA B 1 32  ? 10.108  28.206 49.694 1.00 48.94  ? 27  ALA B CA  1 
ATOM   1372 C C   . ALA B 1 32  ? 9.634   27.219 50.763 1.00 53.37  ? 27  ALA B C   1 
ATOM   1373 O O   . ALA B 1 32  ? 9.977   26.039 50.715 1.00 53.66  ? 27  ALA B O   1 
ATOM   1374 C CB  . ALA B 1 32  ? 9.121   28.264 48.537 1.00 47.04  ? 27  ALA B CB  1 
ATOM   1375 N N   . PRO B 1 33  ? 8.858   27.704 51.745 1.00 59.62  ? 28  PRO B N   1 
ATOM   1376 C CA  . PRO B 1 33  ? 8.288   26.826 52.775 1.00 49.59  ? 28  PRO B CA  1 
ATOM   1377 C C   . PRO B 1 33  ? 7.309   25.814 52.192 1.00 40.09  ? 28  PRO B C   1 
ATOM   1378 O O   . PRO B 1 33  ? 6.523   26.161 51.313 1.00 40.72  ? 28  PRO B O   1 
ATOM   1379 C CB  . PRO B 1 33  ? 7.570   27.799 53.714 1.00 57.21  ? 28  PRO B CB  1 
ATOM   1380 C CG  . PRO B 1 33  ? 7.353   29.030 52.906 1.00 60.60  ? 28  PRO B CG  1 
ATOM   1381 C CD  . PRO B 1 33  ? 8.529   29.118 51.988 1.00 63.99  ? 28  PRO B CD  1 
ATOM   1382 N N   . CYS B 1 34  ? 7.357   24.579 52.675 1.00 35.67  ? 29  CYS B N   1 
ATOM   1383 C CA  . CYS B 1 34  ? 6.496   23.530 52.141 1.00 44.13  ? 29  CYS B CA  1 
ATOM   1384 C C   . CYS B 1 34  ? 5.990   22.583 53.220 1.00 51.38  ? 29  CYS B C   1 
ATOM   1385 O O   . CYS B 1 34  ? 6.098   21.363 53.084 1.00 55.13  ? 29  CYS B O   1 
ATOM   1386 C CB  . CYS B 1 34  ? 7.244   22.728 51.076 1.00 42.52  ? 29  CYS B CB  1 
ATOM   1387 S SG  . CYS B 1 34  ? 8.835   22.110 51.647 1.00 67.53  ? 29  CYS B SG  1 
ATOM   1388 N N   . GLN B 1 35  ? 5.424   23.134 54.284 1.00 45.61  ? 30  GLN B N   1 
ATOM   1389 C CA  . GLN B 1 35  ? 5.011   22.297 55.404 1.00 48.23  ? 30  GLN B CA  1 
ATOM   1390 C C   . GLN B 1 35  ? 3.546   21.872 55.329 1.00 48.26  ? 30  GLN B C   1 
ATOM   1391 O O   . GLN B 1 35  ? 3.172   20.838 55.878 1.00 54.00  ? 30  GLN B O   1 
ATOM   1392 C CB  . GLN B 1 35  ? 5.291   23.023 56.718 1.00 55.41  ? 30  GLN B CB  1 
ATOM   1393 C CG  . GLN B 1 35  ? 6.764   23.003 57.093 1.00 66.29  ? 30  GLN B CG  1 
ATOM   1394 C CD  . GLN B 1 35  ? 7.136   24.081 58.089 1.00 74.82  ? 30  GLN B CD  1 
ATOM   1395 O OE1 . GLN B 1 35  ? 7.088   23.867 59.301 1.00 66.82  ? 30  GLN B OE1 1 
ATOM   1396 N NE2 . GLN B 1 35  ? 7.514   25.252 57.580 1.00 82.70  ? 30  GLN B NE2 1 
ATOM   1397 N N   . THR B 1 36  ? 2.720   22.660 54.646 1.00 45.43  ? 31  THR B N   1 
ATOM   1398 C CA  . THR B 1 36  ? 1.287   22.368 54.565 1.00 38.36  ? 31  THR B CA  1 
ATOM   1399 C C   . THR B 1 36  ? 0.772   22.388 53.132 1.00 38.17  ? 31  THR B C   1 
ATOM   1400 O O   . THR B 1 36  ? 1.436   22.888 52.234 1.00 33.41  ? 31  THR B O   1 
ATOM   1401 C CB  . THR B 1 36  ? 0.457   23.384 55.357 1.00 46.69  ? 31  THR B CB  1 
ATOM   1402 O OG1 . THR B 1 36  ? 0.526   24.647 54.689 1.00 41.05  ? 31  THR B OG1 1 
ATOM   1403 C CG2 . THR B 1 36  ? 0.978   23.526 56.779 1.00 42.10  ? 31  THR B CG2 1 
ATOM   1404 N N   . VAL B 1 37  ? -0.432  21.865 52.933 1.00 35.93  ? 32  VAL B N   1 
ATOM   1405 C CA  . VAL B 1 37  ? -1.115  21.972 51.648 1.00 35.45  ? 32  VAL B CA  1 
ATOM   1406 C C   . VAL B 1 37  ? -1.177  23.425 51.182 1.00 41.19  ? 32  VAL B C   1 
ATOM   1407 O O   . VAL B 1 37  ? -0.905  23.733 50.016 1.00 37.38  ? 32  VAL B O   1 
ATOM   1408 C CB  . VAL B 1 37  ? -2.539  21.390 51.728 1.00 36.16  ? 32  VAL B CB  1 
ATOM   1409 C CG1 . VAL B 1 37  ? -3.404  21.910 50.580 1.00 43.31  ? 32  VAL B CG1 1 
ATOM   1410 C CG2 . VAL B 1 37  ? -2.482  19.882 51.727 1.00 41.02  ? 32  VAL B CG2 1 
ATOM   1411 N N   . GLU B 1 38  ? -1.511  24.326 52.101 1.00 39.75  ? 33  GLU B N   1 
ATOM   1412 C CA  . GLU B 1 38  ? -1.624  25.733 51.759 1.00 40.73  ? 33  GLU B CA  1 
ATOM   1413 C C   . GLU B 1 38  ? -0.317  26.280 51.190 1.00 38.28  ? 33  GLU B C   1 
ATOM   1414 O O   . GLU B 1 38  ? -0.336  27.157 50.327 1.00 40.06  ? 33  GLU B O   1 
ATOM   1415 C CB  . GLU B 1 38  ? -2.051  26.554 52.976 1.00 46.87  ? 33  GLU B CB  1 
ATOM   1416 C CG  . GLU B 1 38  ? -2.473  27.968 52.629 1.00 65.31  ? 33  GLU B CG  1 
ATOM   1417 C CD  . GLU B 1 38  ? -3.636  28.004 51.648 1.00 74.33  ? 33  GLU B CD  1 
ATOM   1418 O OE1 . GLU B 1 38  ? -4.499  27.100 51.712 1.00 71.55  ? 33  GLU B OE1 1 
ATOM   1419 O OE2 . GLU B 1 38  ? -3.683  28.932 50.811 1.00 74.01  1 33  GLU B OE2 1 
ATOM   1420 N N   . ASP B 1 39  ? 0.817   25.756 51.657 1.00 34.88  ? 34  ASP B N   1 
ATOM   1421 C CA  . ASP B 1 39  ? 2.115   26.245 51.176 1.00 37.31  ? 34  ASP B CA  1 
ATOM   1422 C C   . ASP B 1 39  ? 2.346   25.921 49.704 1.00 37.62  ? 34  ASP B C   1 
ATOM   1423 O O   . ASP B 1 39  ? 3.215   26.512 49.069 1.00 43.20  ? 34  ASP B O   1 
ATOM   1424 C CB  . ASP B 1 39  ? 3.261   25.656 51.996 1.00 35.94  ? 34  ASP B CB  1 
ATOM   1425 C CG  . ASP B 1 39  ? 3.308   26.190 53.406 1.00 41.53  ? 34  ASP B CG  1 
ATOM   1426 O OD1 . ASP B 1 39  ? 2.935   27.359 53.612 1.00 42.08  ? 34  ASP B OD1 1 
ATOM   1427 O OD2 . ASP B 1 39  ? 3.730   25.436 54.308 1.00 42.47  1 34  ASP B OD2 1 
ATOM   1428 N N   . LEU B 1 40  ? 1.582   24.972 49.167 1.00 32.28  ? 35  LEU B N   1 
ATOM   1429 C CA  . LEU B 1 40  ? 1.784   24.536 47.781 1.00 30.69  ? 35  LEU B CA  1 
ATOM   1430 C C   . LEU B 1 40  ? 0.782   25.120 46.791 1.00 33.09  ? 35  LEU B C   1 
ATOM   1431 O O   . LEU B 1 40  ? 0.910   24.894 45.586 1.00 32.28  ? 35  LEU B O   1 
ATOM   1432 C CB  . LEU B 1 40  ? 1.730   23.008 47.693 1.00 32.54  ? 35  LEU B CB  1 
ATOM   1433 C CG  . LEU B 1 40  ? 3.074   22.271 47.791 1.00 39.86  ? 35  LEU B CG  1 
ATOM   1434 C CD1 . LEU B 1 40  ? 3.792   22.596 49.088 1.00 43.33  ? 35  LEU B CD1 1 
ATOM   1435 C CD2 . LEU B 1 40  ? 2.871   20.779 47.656 1.00 47.18  ? 35  LEU B CD2 1 
ATOM   1436 N N   . THR B 1 41  ? -0.203  25.870 47.279 1.00 31.23  ? 36  THR B N   1 
ATOM   1437 C CA  . THR B 1 41  ? -1.307  26.284 46.414 1.00 30.36  ? 36  THR B CA  1 
ATOM   1438 C C   . THR B 1 41  ? -0.946  27.387 45.403 1.00 32.91  ? 36  THR B C   1 
ATOM   1439 O O   . THR B 1 41  ? -1.641  27.552 44.405 1.00 36.49  ? 36  THR B O   1 
ATOM   1440 C CB  . THR B 1 41  ? -2.522  26.745 47.244 1.00 39.79  ? 36  THR B CB  1 
ATOM   1441 O OG1 . THR B 1 41  ? -2.156  27.860 48.067 1.00 34.92  ? 36  THR B OG1 1 
ATOM   1442 C CG2 . THR B 1 41  ? -3.020  25.607 48.118 1.00 37.02  ? 36  THR B CG2 1 
ATOM   1443 N N   . ASN B 1 42  ? 0.136   28.128 45.616 1.00 35.95  ? 37  ASN B N   1 
ATOM   1444 C CA  . ASN B 1 42  ? 0.452   29.177 44.649 1.00 39.78  ? 37  ASN B CA  1 
ATOM   1445 C C   . ASN B 1 42  ? 1.430   28.727 43.563 1.00 35.09  ? 37  ASN B C   1 
ATOM   1446 O O   . ASN B 1 42  ? 1.795   29.523 42.701 1.00 32.45  ? 37  ASN B O   1 
ATOM   1447 C CB  . ASN B 1 42  ? 0.988   30.440 45.345 1.00 45.40  ? 37  ASN B CB  1 
ATOM   1448 C CG  . ASN B 1 42  ? 2.342   30.233 46.018 1.00 47.04  ? 37  ASN B CG  1 
ATOM   1449 O OD1 . ASN B 1 42  ? 3.103   29.332 45.672 1.00 43.19  ? 37  ASN B OD1 1 
ATOM   1450 N ND2 . ASN B 1 42  ? 2.649   31.094 46.986 1.00 47.63  ? 37  ASN B ND2 1 
ATOM   1451 N N   . GLY B 1 43  ? 1.861   27.469 43.631 1.00 33.81  ? 38  GLY B N   1 
ATOM   1452 C CA  . GLY B 1 43  ? 2.684   26.868 42.592 1.00 37.22  ? 38  GLY B CA  1 
ATOM   1453 C C   . GLY B 1 43  ? 4.190   27.066 42.708 1.00 41.61  ? 38  GLY B C   1 
ATOM   1454 O O   . GLY B 1 43  ? 4.972   26.381 42.043 1.00 32.01  ? 38  GLY B O   1 
ATOM   1455 N N   . VAL B 1 44  ? 4.608   28.004 43.549 1.00 34.61  ? 39  VAL B N   1 
ATOM   1456 C CA  . VAL B 1 44  ? 6.030   28.320 43.675 1.00 39.12  ? 39  VAL B CA  1 
ATOM   1457 C C   . VAL B 1 44  ? 6.865   27.114 44.135 1.00 37.87  ? 39  VAL B C   1 
ATOM   1458 O O   . VAL B 1 44  ? 7.889   26.809 43.521 1.00 34.40  ? 39  VAL B O   1 
ATOM   1459 C CB  . VAL B 1 44  ? 6.249   29.505 44.635 1.00 38.21  ? 39  VAL B CB  1 
ATOM   1460 C CG1 . VAL B 1 44  ? 7.727   29.715 44.898 1.00 41.39  ? 39  VAL B CG1 1 
ATOM   1461 C CG2 . VAL B 1 44  ? 5.612   30.768 44.056 1.00 36.14  ? 39  VAL B CG2 1 
ATOM   1462 N N   . VAL B 1 45  ? 6.443   26.423 45.195 1.00 32.36  ? 40  VAL B N   1 
ATOM   1463 C CA  . VAL B 1 45  ? 7.174   25.226 45.632 1.00 28.74  ? 40  VAL B CA  1 
ATOM   1464 C C   . VAL B 1 45  ? 7.259   24.179 44.521 1.00 31.23  ? 40  VAL B C   1 
ATOM   1465 O O   . VAL B 1 45  ? 8.325   23.615 44.264 1.00 29.05  ? 40  VAL B O   1 
ATOM   1466 C CB  . VAL B 1 45  ? 6.533   24.564 46.874 1.00 31.69  ? 40  VAL B CB  1 
ATOM   1467 C CG1 . VAL B 1 45  ? 7.173   23.207 47.144 1.00 30.35  ? 40  VAL B CG1 1 
ATOM   1468 C CG2 . VAL B 1 45  ? 6.676   25.464 48.090 1.00 32.68  ? 40  VAL B CG2 1 
ATOM   1469 N N   . MET B 1 46  ? 6.140   23.912 43.856 1.00 31.07  ? 41  MET B N   1 
ATOM   1470 C CA  . MET B 1 46  ? 6.164   22.882 42.822 1.00 30.87  ? 41  MET B CA  1 
ATOM   1471 C C   . MET B 1 46  ? 7.105   23.289 41.689 1.00 27.85  ? 41  MET B C   1 
ATOM   1472 O O   . MET B 1 46  ? 7.816   22.448 41.143 1.00 28.78  ? 41  MET B O   1 
ATOM   1473 C CB  . MET B 1 46  ? 4.752   22.596 42.301 1.00 25.34  ? 41  MET B CB  1 
ATOM   1474 C CG  . MET B 1 46  ? 3.932   21.753 43.288 1.00 24.76  ? 41  MET B CG  1 
ATOM   1475 S SD  . MET B 1 46  ? 2.289   21.314 42.672 1.00 39.33  ? 41  MET B SD  1 
ATOM   1476 C CE  . MET B 1 46  ? 1.420   22.859 42.911 1.00 30.58  ? 41  MET B CE  1 
ATOM   1477 N N   . ALA B 1 47  ? 7.113   24.572 41.353 1.00 26.06  ? 42  ALA B N   1 
ATOM   1478 C CA  . ALA B 1 47  ? 8.000   25.073 40.309 1.00 26.12  ? 42  ALA B CA  1 
ATOM   1479 C C   . ALA B 1 47  ? 9.455   24.870 40.730 1.00 36.29  ? 42  ALA B C   1 
ATOM   1480 O O   . ALA B 1 47  ? 10.286  24.438 39.938 1.00 29.72  ? 42  ALA B O   1 
ATOM   1481 C CB  . ALA B 1 47  ? 7.707   26.538 40.014 1.00 28.11  ? 42  ALA B CB  1 
ATOM   1482 N N   . GLN B 1 48  ? 9.755   25.127 41.999 1.00 29.14  ? 43  GLN B N   1 
ATOM   1483 C CA  . GLN B 1 48  ? 11.118  24.937 42.483 1.00 28.47  ? 43  GLN B CA  1 
ATOM   1484 C C   . GLN B 1 48  ? 11.513  23.470 42.515 1.00 31.09  ? 43  GLN B C   1 
ATOM   1485 O O   . GLN B 1 48  ? 12.680  23.139 42.324 1.00 31.35  ? 43  GLN B O   1 
ATOM   1486 C CB  . GLN B 1 48  ? 11.280  25.568 43.867 1.00 30.24  ? 43  GLN B CB  1 
ATOM   1487 C CG  . GLN B 1 48  ? 11.233  27.087 43.809 1.00 28.79  ? 43  GLN B CG  1 
ATOM   1488 C CD  . GLN B 1 48  ? 11.271  27.720 45.184 1.00 42.26  ? 43  GLN B CD  1 
ATOM   1489 O OE1 . GLN B 1 48  ? 11.341  27.024 46.191 1.00 41.68  ? 43  GLN B OE1 1 
ATOM   1490 N NE2 . GLN B 1 48  ? 11.215  29.048 45.230 1.00 38.19  ? 43  GLN B NE2 1 
ATOM   1491 N N   . VAL B 1 49  ? 10.546  22.588 42.751 1.00 26.91  ? 44  VAL B N   1 
ATOM   1492 C CA  . VAL B 1 49  ? 10.819  21.158 42.764 1.00 24.19  ? 44  VAL B CA  1 
ATOM   1493 C C   . VAL B 1 49  ? 11.090  20.691 41.339 1.00 26.13  ? 44  VAL B C   1 
ATOM   1494 O O   . VAL B 1 49  ? 11.984  19.877 41.102 1.00 26.19  ? 44  VAL B O   1 
ATOM   1495 C CB  . VAL B 1 49  ? 9.649   20.351 43.376 1.00 24.58  ? 44  VAL B CB  1 
ATOM   1496 C CG1 . VAL B 1 49  ? 9.836   18.856 43.148 1.00 25.38  ? 44  VAL B CG1 1 
ATOM   1497 C CG2 . VAL B 1 49  ? 9.533   20.636 44.871 1.00 29.23  ? 44  VAL B CG2 1 
ATOM   1498 N N   . LEU B 1 50  ? 10.324  21.206 40.382 1.00 25.25  ? 45  LEU B N   1 
ATOM   1499 C CA  . LEU B 1 50  ? 10.559  20.831 38.983 1.00 23.30  ? 45  LEU B CA  1 
ATOM   1500 C C   . LEU B 1 50  ? 11.945  21.283 38.518 1.00 24.15  ? 45  LEU B C   1 
ATOM   1501 O O   . LEU B 1 50  ? 12.602  20.588 37.750 1.00 26.61  ? 45  LEU B O   1 
ATOM   1502 C CB  . LEU B 1 50  ? 9.476   21.422 38.058 1.00 25.55  ? 45  LEU B CB  1 
ATOM   1503 C CG  . LEU B 1 50  ? 8.168   20.645 38.210 1.00 26.16  ? 45  LEU B CG  1 
ATOM   1504 C CD1 . LEU B 1 50  ? 6.995   21.432 37.612 1.00 25.10  ? 45  LEU B CD1 1 
ATOM   1505 C CD2 . LEU B 1 50  ? 8.305   19.276 37.557 1.00 28.53  ? 45  LEU B CD2 1 
ATOM   1506 N N   . GLN B 1 51  ? 12.386  22.447 38.986 1.00 27.52  ? 46  GLN B N   1 
ATOM   1507 C CA  . GLN B 1 51  ? 13.735  22.904 38.679 1.00 26.18  ? 46  GLN B CA  1 
ATOM   1508 C C   . GLN B 1 51  ? 14.782  21.952 39.258 1.00 25.27  ? 46  GLN B C   1 
ATOM   1509 O O   . GLN B 1 51  ? 15.808  21.708 38.629 1.00 32.34  ? 46  GLN B O   1 
ATOM   1510 C CB  . GLN B 1 51  ? 13.965  24.322 39.202 1.00 31.07  ? 46  GLN B CB  1 
ATOM   1511 C CG  . GLN B 1 51  ? 15.381  24.835 38.975 1.00 34.98  ? 46  GLN B CG  1 
ATOM   1512 C CD  . GLN B 1 51  ? 15.561  26.252 39.464 1.00 35.65  ? 46  GLN B CD  1 
ATOM   1513 O OE1 . GLN B 1 51  ? 15.217  26.572 40.602 1.00 40.36  ? 46  GLN B OE1 1 
ATOM   1514 N NE2 . GLN B 1 51  ? 16.099  27.111 38.609 1.00 43.89  ? 46  GLN B NE2 1 
ATOM   1515 N N   . LYS B 1 52  ? 14.552  21.414 40.455 1.00 26.54  ? 47  LYS B N   1 
ATOM   1516 C CA  . LYS B 1 52  ? 15.503  20.447 40.994 1.00 31.72  ? 47  LYS B CA  1 
ATOM   1517 C C   . LYS B 1 52  ? 15.529  19.206 40.115 1.00 31.14  ? 47  LYS B C   1 
ATOM   1518 O O   . LYS B 1 52  ? 16.591  18.653 39.827 1.00 30.16  ? 47  LYS B O   1 
ATOM   1519 C CB  . LYS B 1 52  ? 15.150  20.055 42.431 1.00 30.16  ? 47  LYS B CB  1 
ATOM   1520 C CG  . LYS B 1 52  ? 15.135  21.217 43.405 1.00 39.31  ? 47  LYS B CG  1 
ATOM   1521 C CD  . LYS B 1 52  ? 16.539  21.705 43.701 1.00 45.81  ? 47  LYS B CD  1 
ATOM   1522 C CE  . LYS B 1 52  ? 16.559  22.599 44.938 1.00 53.95  ? 47  LYS B CE  1 
ATOM   1523 N NZ  . LYS B 1 52  ? 17.891  23.235 45.130 1.00 50.40  1 47  LYS B NZ  1 
ATOM   1524 N N   . ILE B 1 53  ? 14.351  18.770 39.685 1.00 27.47  ? 48  ILE B N   1 
ATOM   1525 C CA  . ILE B 1 53  ? 14.244  17.545 38.894 1.00 24.86  ? 48  ILE B CA  1 
ATOM   1526 C C   . ILE B 1 53  ? 14.934  17.685 37.535 1.00 32.89  ? 48  ILE B C   1 
ATOM   1527 O O   . ILE B 1 53  ? 15.697  16.805 37.129 1.00 29.73  ? 48  ILE B O   1 
ATOM   1528 C CB  . ILE B 1 53  ? 12.773  17.147 38.692 1.00 25.42  ? 48  ILE B CB  1 
ATOM   1529 C CG1 . ILE B 1 53  ? 12.193  16.630 40.015 1.00 23.80  ? 48  ILE B CG1 1 
ATOM   1530 C CG2 . ILE B 1 53  ? 12.660  16.071 37.616 1.00 28.49  ? 48  ILE B CG2 1 
ATOM   1531 C CD1 . ILE B 1 53  ? 10.683  16.437 39.986 1.00 24.96  ? 48  ILE B CD1 1 
ATOM   1532 N N   . ASP B 1 54  ? 14.661  18.778 36.830 1.00 31.51  ? 49  ASP B N   1 
ATOM   1533 C CA  . ASP B 1 54  ? 15.417  19.094 35.614 1.00 29.24  ? 49  ASP B CA  1 
ATOM   1534 C C   . ASP B 1 54  ? 15.693  20.592 35.504 1.00 29.44  ? 49  ASP B C   1 
ATOM   1535 O O   . ASP B 1 54  ? 14.890  21.343 34.966 1.00 27.11  ? 49  ASP B O   1 
ATOM   1536 C CB  . ASP B 1 54  ? 14.689  18.610 34.364 1.00 25.82  ? 49  ASP B CB  1 
ATOM   1537 C CG  . ASP B 1 54  ? 15.609  18.554 33.144 1.00 35.56  ? 49  ASP B CG  1 
ATOM   1538 O OD1 . ASP B 1 54  ? 16.545  19.369 33.066 1.00 35.85  ? 49  ASP B OD1 1 
ATOM   1539 O OD2 . ASP B 1 54  ? 15.403  17.696 32.267 1.00 32.73  1 49  ASP B OD2 1 
ATOM   1540 N N   . PRO B 1 55  ? 16.850  21.025 36.004 1.00 27.98  ? 50  PRO B N   1 
ATOM   1541 C CA  . PRO B 1 55  ? 17.179  22.451 35.999 1.00 27.29  ? 50  PRO B CA  1 
ATOM   1542 C C   . PRO B 1 55  ? 17.562  22.961 34.611 1.00 31.82  ? 50  PRO B C   1 
ATOM   1543 O O   . PRO B 1 55  ? 17.659  24.167 34.421 1.00 32.74  ? 50  PRO B O   1 
ATOM   1544 C CB  . PRO B 1 55  ? 18.355  22.532 36.983 1.00 29.93  ? 50  PRO B CB  1 
ATOM   1545 C CG  . PRO B 1 55  ? 18.999  21.213 36.896 1.00 36.78  ? 50  PRO B CG  1 
ATOM   1546 C CD  . PRO B 1 55  ? 17.901  20.212 36.646 1.00 26.30  ? 50  PRO B CD  1 
ATOM   1547 N N   . ALA B 1 56  ? 17.755  22.056 33.654 1.00 30.92  ? 51  ALA B N   1 
ATOM   1548 C CA  . ALA B 1 56  ? 18.089  22.451 32.289 1.00 31.33  ? 51  ALA B CA  1 
ATOM   1549 C C   . ALA B 1 56  ? 16.840  22.785 31.500 1.00 35.67  ? 51  ALA B C   1 
ATOM   1550 O O   . ALA B 1 56  ? 16.878  23.609 30.597 1.00 34.55  ? 51  ALA B O   1 
ATOM   1551 C CB  . ALA B 1 56  ? 18.880  21.347 31.580 1.00 33.45  ? 51  ALA B CB  1 
ATOM   1552 N N   . TYR B 1 57  ? 15.743  22.109 31.825 1.00 32.73  ? 52  TYR B N   1 
ATOM   1553 C CA  . TYR B 1 57  ? 14.448  22.383 31.214 1.00 31.13  ? 52  TYR B CA  1 
ATOM   1554 C C   . TYR B 1 57  ? 13.693  23.455 31.993 1.00 27.31  ? 52  TYR B C   1 
ATOM   1555 O O   . TYR B 1 57  ? 13.230  24.452 31.425 1.00 30.45  ? 52  TYR B O   1 
ATOM   1556 C CB  . TYR B 1 57  ? 13.598  21.105 31.153 1.00 28.96  ? 52  TYR B CB  1 
ATOM   1557 C CG  . TYR B 1 57  ? 12.318  21.246 30.347 1.00 26.42  ? 52  TYR B CG  1 
ATOM   1558 C CD1 . TYR B 1 57  ? 11.124  21.631 30.956 1.00 28.86  ? 52  TYR B CD1 1 
ATOM   1559 C CD2 . TYR B 1 57  ? 12.295  20.957 28.991 1.00 31.13  ? 52  TYR B CD2 1 
ATOM   1560 C CE1 . TYR B 1 57  ? 9.945   21.770 30.215 1.00 26.74  ? 52  TYR B CE1 1 
ATOM   1561 C CE2 . TYR B 1 57  ? 11.130  21.076 28.249 1.00 28.24  ? 52  TYR B CE2 1 
ATOM   1562 C CZ  . TYR B 1 57  ? 9.955   21.484 28.867 1.00 31.59  ? 52  TYR B CZ  1 
ATOM   1563 O OH  . TYR B 1 57  ? 8.788   21.606 28.145 1.00 36.81  ? 52  TYR B OH  1 
ATOM   1564 N N   . PHE B 1 58  ? 13.547  23.218 33.292 1.00 30.07  ? 53  PHE B N   1 
ATOM   1565 C CA  . PHE B 1 58  ? 12.871  24.157 34.183 1.00 30.86  ? 53  PHE B CA  1 
ATOM   1566 C C   . PHE B 1 58  ? 13.906  25.109 34.743 1.00 29.76  ? 53  PHE B C   1 
ATOM   1567 O O   . PHE B 1 58  ? 14.201  25.092 35.932 1.00 33.23  ? 53  PHE B O   1 
ATOM   1568 C CB  . PHE B 1 58  ? 12.129  23.410 35.300 1.00 30.60  ? 53  PHE B CB  1 
ATOM   1569 C CG  . PHE B 1 58  ? 11.090  22.455 34.782 1.00 25.11  ? 53  PHE B CG  1 
ATOM   1570 C CD1 . PHE B 1 58  ? 9.857   22.927 34.343 1.00 31.44  ? 53  PHE B CD1 1 
ATOM   1571 C CD2 . PHE B 1 58  ? 11.347  21.094 34.706 1.00 25.10  ? 53  PHE B CD2 1 
ATOM   1572 C CE1 . PHE B 1 58  ? 8.907   22.058 33.848 1.00 27.27  ? 53  PHE B CE1 1 
ATOM   1573 C CE2 . PHE B 1 58  ? 10.391  20.210 34.210 1.00 28.09  ? 53  PHE B CE2 1 
ATOM   1574 C CZ  . PHE B 1 58  ? 9.168   20.694 33.792 1.00 23.97  ? 53  PHE B CZ  1 
ATOM   1575 N N   . ASP B 1 59  ? 14.473  25.929 33.868 1.00 34.55  ? 54  ASP B N   1 
ATOM   1576 C CA  . ASP B 1 59  ? 15.592  26.770 34.258 1.00 38.62  ? 54  ASP B CA  1 
ATOM   1577 C C   . ASP B 1 59  ? 15.107  28.127 34.736 1.00 43.92  ? 54  ASP B C   1 
ATOM   1578 O O   . ASP B 1 59  ? 13.902  28.352 34.854 1.00 37.78  ? 54  ASP B O   1 
ATOM   1579 C CB  . ASP B 1 59  ? 16.592  26.919 33.100 1.00 39.06  ? 54  ASP B CB  1 
ATOM   1580 C CG  . ASP B 1 59  ? 15.965  27.448 31.821 1.00 47.60  ? 54  ASP B CG  1 
ATOM   1581 O OD1 . ASP B 1 59  ? 14.801  27.897 31.825 1.00 41.84  ? 54  ASP B OD1 1 
ATOM   1582 O OD2 . ASP B 1 59  ? 16.669  27.431 30.788 1.00 50.14  1 54  ASP B OD2 1 
ATOM   1583 N N   . GLU B 1 60  ? 16.048  29.021 35.023 1.00 42.06  ? 55  GLU B N   1 
ATOM   1584 C CA  . GLU B 1 60  ? 15.709  30.339 35.543 1.00 47.43  ? 55  GLU B CA  1 
ATOM   1585 C C   . GLU B 1 60  ? 14.764  31.085 34.602 1.00 46.39  ? 55  GLU B C   1 
ATOM   1586 O O   . GLU B 1 60  ? 13.807  31.714 35.053 1.00 45.97  ? 55  GLU B O   1 
ATOM   1587 C CB  . GLU B 1 60  ? 16.979  31.156 35.789 1.00 51.97  ? 55  GLU B CB  1 
ATOM   1588 C CG  . GLU B 1 60  ? 16.726  32.578 36.258 1.00 62.31  ? 55  GLU B CG  1 
ATOM   1589 C CD  . GLU B 1 60  ? 18.009  33.384 36.385 1.00 70.43  ? 55  GLU B CD  1 
ATOM   1590 O OE1 . GLU B 1 60  ? 18.973  32.879 37.000 1.00 60.77  ? 55  GLU B OE1 1 
ATOM   1591 O OE2 . GLU B 1 60  ? 18.055  34.519 35.857 1.00 77.01  1 55  GLU B OE2 1 
ATOM   1592 N N   . ASN B 1 61  ? 15.034  31.010 33.299 1.00 39.19  ? 56  ASN B N   1 
ATOM   1593 C CA  . ASN B 1 61  ? 14.164  31.601 32.294 1.00 45.24  ? 56  ASN B CA  1 
ATOM   1594 C C   . ASN B 1 61  ? 12.761  31.005 32.341 1.00 45.54  ? 56  ASN B C   1 
ATOM   1595 O O   . ASN B 1 61  ? 11.771  31.729 32.234 1.00 49.25  ? 56  ASN B O   1 
ATOM   1596 C CB  . ASN B 1 61  ? 14.745  31.417 30.889 1.00 40.97  ? 56  ASN B CB  1 
ATOM   1597 C CG  . ASN B 1 61  ? 15.863  32.400 30.580 1.00 56.76  ? 56  ASN B CG  1 
ATOM   1598 O OD1 . ASN B 1 61  ? 15.823  33.556 30.998 1.00 58.62  ? 56  ASN B OD1 1 
ATOM   1599 N ND2 . ASN B 1 61  ? 16.867  31.942 29.841 1.00 61.70  ? 56  ASN B ND2 1 
ATOM   1600 N N   . TRP B 1 62  ? 12.675  29.685 32.480 1.00 39.57  ? 57  TRP B N   1 
ATOM   1601 C CA  . TRP B 1 62  ? 11.368  29.038 32.535 1.00 36.56  ? 57  TRP B CA  1 
ATOM   1602 C C   . TRP B 1 62  ? 10.592  29.513 33.755 1.00 42.34  ? 57  TRP B C   1 
ATOM   1603 O O   . TRP B 1 62  ? 9.406   29.825 33.668 1.00 45.41  ? 57  TRP B O   1 
ATOM   1604 C CB  . TRP B 1 62  ? 11.485  27.512 32.571 1.00 33.51  ? 57  TRP B CB  1 
ATOM   1605 C CG  . TRP B 1 62  ? 10.127  26.862 32.462 1.00 40.89  ? 57  TRP B CG  1 
ATOM   1606 C CD1 . TRP B 1 62  ? 9.514   26.439 31.316 1.00 51.08  ? 57  TRP B CD1 1 
ATOM   1607 C CD2 . TRP B 1 62  ? 9.201   26.608 33.525 1.00 41.19  ? 57  TRP B CD2 1 
ATOM   1608 N NE1 . TRP B 1 62  ? 8.274   25.924 31.602 1.00 42.99  ? 57  TRP B NE1 1 
ATOM   1609 C CE2 . TRP B 1 62  ? 8.057   26.018 32.951 1.00 43.81  ? 57  TRP B CE2 1 
ATOM   1610 C CE3 . TRP B 1 62  ? 9.234   26.807 34.909 1.00 44.34  ? 57  TRP B CE3 1 
ATOM   1611 C CZ2 . TRP B 1 62  ? 6.961   25.629 33.709 1.00 40.94  ? 57  TRP B CZ2 1 
ATOM   1612 C CZ3 . TRP B 1 62  ? 8.139   26.421 35.660 1.00 58.81  ? 57  TRP B CZ3 1 
ATOM   1613 C CH2 . TRP B 1 62  ? 7.020   25.837 35.058 1.00 51.75  ? 57  TRP B CH2 1 
ATOM   1614 N N   . LEU B 1 63  ? 11.277  29.572 34.889 1.00 37.47  ? 58  LEU B N   1 
ATOM   1615 C CA  . LEU B 1 63  ? 10.668  29.956 36.162 1.00 43.40  ? 58  LEU B CA  1 
ATOM   1616 C C   . LEU B 1 63  ? 10.171  31.404 36.180 1.00 51.93  ? 58  LEU B C   1 
ATOM   1617 O O   . LEU B 1 63  ? 9.415   31.790 37.069 1.00 58.83  ? 58  LEU B O   1 
ATOM   1618 C CB  . LEU B 1 63  ? 11.667  29.748 37.305 1.00 40.33  ? 58  LEU B CB  1 
ATOM   1619 C CG  . LEU B 1 63  ? 11.714  28.418 38.051 1.00 50.72  ? 58  LEU B CG  1 
ATOM   1620 C CD1 . LEU B 1 63  ? 10.463  28.260 38.878 1.00 58.98  ? 58  LEU B CD1 1 
ATOM   1621 C CD2 . LEU B 1 63  ? 11.883  27.241 37.110 1.00 59.02  ? 58  LEU B CD2 1 
ATOM   1622 N N   . ASN B 1 64  ? 10.596  32.203 35.205 1.00 64.97  ? 59  ASN B N   1 
ATOM   1623 C CA  . ASN B 1 64  ? 10.188  33.605 35.139 1.00 65.91  ? 59  ASN B CA  1 
ATOM   1624 C C   . ASN B 1 64  ? 8.720   33.781 34.767 1.00 67.64  ? 59  ASN B C   1 
ATOM   1625 O O   . ASN B 1 64  ? 8.185   34.888 34.849 1.00 73.54  ? 59  ASN B O   1 
ATOM   1626 C CB  . ASN B 1 64  ? 11.062  34.376 34.142 1.00 78.85  ? 59  ASN B CB  1 
ATOM   1627 C CG  . ASN B 1 64  ? 12.460  34.641 34.673 1.00 90.12  ? 59  ASN B CG  1 
ATOM   1628 O OD1 . ASN B 1 64  ? 12.724  34.493 35.869 1.00 97.13  ? 59  ASN B OD1 1 
ATOM   1629 N ND2 . ASN B 1 64  ? 13.363  35.046 33.784 1.00 86.34  ? 59  ASN B ND2 1 
ATOM   1630 N N   . ARG B 1 65  ? 8.069   32.700 34.346 1.00 51.50  ? 60  ARG B N   1 
ATOM   1631 C CA  . ARG B 1 65  ? 6.648   32.769 34.033 1.00 45.41  ? 60  ARG B CA  1 
ATOM   1632 C C   . ARG B 1 65  ? 5.841   32.620 35.320 1.00 44.82  ? 60  ARG B C   1 
ATOM   1633 O O   . ARG B 1 65  ? 4.663   32.966 35.364 1.00 44.82  ? 60  ARG B O   1 
ATOM   1634 C CB  . ARG B 1 65  ? 6.248   31.699 33.004 1.00 42.05  ? 60  ARG B CB  1 
ATOM   1635 C CG  . ARG B 1 65  ? 6.279   30.263 33.526 1.00 44.97  ? 60  ARG B CG  1 
ATOM   1636 C CD  . ARG B 1 65  ? 6.164   29.238 32.389 1.00 42.09  ? 60  ARG B CD  1 
ATOM   1637 N NE  . ARG B 1 65  ? 7.244   29.385 31.410 1.00 47.79  ? 60  ARG B NE  1 
ATOM   1638 C CZ  . ARG B 1 65  ? 7.310   28.729 30.254 1.00 49.38  ? 60  ARG B CZ  1 
ATOM   1639 N NH1 . ARG B 1 65  ? 6.363   27.859 29.919 1.00 45.42  1 60  ARG B NH1 1 
ATOM   1640 N NH2 . ARG B 1 65  ? 8.326   28.946 29.428 1.00 37.27  ? 60  ARG B NH2 1 
ATOM   1641 N N   . ILE B 1 66  ? 6.493   32.126 36.371 1.00 41.88  ? 61  ILE B N   1 
ATOM   1642 C CA  . ILE B 1 66  ? 5.813   31.845 37.634 1.00 48.91  ? 61  ILE B CA  1 
ATOM   1643 C C   . ILE B 1 66  ? 5.908   33.030 38.580 1.00 54.70  ? 61  ILE B C   1 
ATOM   1644 O O   . ILE B 1 66  ? 6.988   33.356 39.073 1.00 57.70  ? 61  ILE B O   1 
ATOM   1645 C CB  . ILE B 1 66  ? 6.394   30.599 38.341 1.00 49.67  ? 61  ILE B CB  1 
ATOM   1646 C CG1 . ILE B 1 66  ? 6.286   29.367 37.444 1.00 45.52  ? 61  ILE B CG1 1 
ATOM   1647 C CG2 . ILE B 1 66  ? 5.671   30.346 39.656 1.00 48.11  ? 61  ILE B CG2 1 
ATOM   1648 C CD1 . ILE B 1 66  ? 4.864   29.031 37.053 1.00 41.29  ? 61  ILE B CD1 1 
ATOM   1649 N N   . LYS B 1 67  ? 4.771   33.672 38.833 1.00 52.30  ? 62  LYS B N   1 
ATOM   1650 C CA  . LYS B 1 67  ? 4.732   34.841 39.706 1.00 59.08  ? 62  LYS B CA  1 
ATOM   1651 C C   . LYS B 1 67  ? 4.938   34.412 41.153 1.00 55.63  ? 62  LYS B C   1 
ATOM   1652 O O   . LYS B 1 67  ? 4.264   33.507 41.647 1.00 50.81  ? 62  LYS B O   1 
ATOM   1653 C CB  . LYS B 1 67  ? 3.413   35.601 39.542 1.00 62.09  ? 62  LYS B CB  1 
ATOM   1654 C CG  . LYS B 1 67  ? 3.416   36.624 38.403 1.00 77.62  ? 62  LYS B CG  1 
ATOM   1655 C CD  . LYS B 1 67  ? 3.643   35.977 37.039 1.00 81.26  ? 62  LYS B CD  1 
ATOM   1656 C CE  . LYS B 1 67  ? 4.023   37.006 35.982 1.00 84.20  ? 62  LYS B CE  1 
ATOM   1657 N NZ  . LYS B 1 67  ? 4.414   36.355 34.700 1.00 78.22  1 62  LYS B NZ  1 
ATOM   1658 N N   . THR B 1 68  ? 5.884   35.060 41.823 1.00 54.62  ? 63  THR B N   1 
ATOM   1659 C CA  . THR B 1 68  ? 6.300   34.646 43.160 1.00 60.15  ? 63  THR B CA  1 
ATOM   1660 C C   . THR B 1 68  ? 5.459   35.287 44.257 1.00 71.62  ? 63  THR B C   1 
ATOM   1661 O O   . THR B 1 68  ? 5.063   34.622 45.216 1.00 74.02  ? 63  THR B O   1 
ATOM   1662 C CB  . THR B 1 68  ? 7.776   34.987 43.406 1.00 57.51  ? 63  THR B CB  1 
ATOM   1663 O OG1 . THR B 1 68  ? 8.014   36.349 43.032 1.00 70.06  ? 63  THR B OG1 1 
ATOM   1664 C CG2 . THR B 1 68  ? 8.669   34.082 42.579 1.00 56.70  ? 63  THR B CG2 1 
ATOM   1665 N N   . GLU B 1 69  ? 5.200   36.582 44.115 1.00 73.49  ? 64  GLU B N   1 
ATOM   1666 C CA  . GLU B 1 69  ? 4.380   37.312 45.071 1.00 81.07  ? 64  GLU B CA  1 
ATOM   1667 C C   . GLU B 1 69  ? 2.924   37.306 44.616 1.00 79.27  ? 64  GLU B C   1 
ATOM   1668 O O   . GLU B 1 69  ? 2.524   38.089 43.753 1.00 79.17  ? 64  GLU B O   1 
ATOM   1669 C CB  . GLU B 1 69  ? 4.898   38.741 45.239 1.00 88.08  ? 64  GLU B CB  1 
ATOM   1670 C CG  . GLU B 1 69  ? 6.317   38.810 45.790 1.00 93.45  ? 64  GLU B CG  1 
ATOM   1671 C CD  . GLU B 1 69  ? 6.906   40.206 45.729 1.00 103.26 ? 64  GLU B CD  1 
ATOM   1672 O OE1 . GLU B 1 69  ? 6.294   41.086 45.086 1.00 106.07 ? 64  GLU B OE1 1 
ATOM   1673 O OE2 . GLU B 1 69  ? 7.983   40.424 46.324 1.00 105.91 1 64  GLU B OE2 1 
ATOM   1674 N N   . VAL B 1 70  ? 2.140   36.409 45.205 1.00 69.82  ? 65  VAL B N   1 
ATOM   1675 C CA  . VAL B 1 70  ? 0.774   36.154 44.765 1.00 67.86  ? 65  VAL B CA  1 
ATOM   1676 C C   . VAL B 1 70  ? -0.244  36.534 45.836 1.00 64.42  ? 65  VAL B C   1 
ATOM   1677 O O   . VAL B 1 70  ? -1.323  37.040 45.533 1.00 65.98  ? 65  VAL B O   1 
ATOM   1678 C CB  . VAL B 1 70  ? 0.591   34.668 44.383 1.00 69.95  ? 65  VAL B CB  1 
ATOM   1679 C CG1 . VAL B 1 70  ? -0.864  34.355 44.085 1.00 73.15  ? 65  VAL B CG1 1 
ATOM   1680 C CG2 . VAL B 1 70  ? 1.475   34.319 43.193 1.00 70.01  ? 65  VAL B CG2 1 
ATOM   1681 N N   . GLY B 1 71  ? 0.111   36.296 47.093 1.00 63.24  ? 66  GLY B N   1 
ATOM   1682 C CA  . GLY B 1 71  ? -0.771  36.612 48.200 1.00 66.77  ? 66  GLY B CA  1 
ATOM   1683 C C   . GLY B 1 71  ? -2.011  35.741 48.202 1.00 67.93  ? 66  GLY B C   1 
ATOM   1684 O O   . GLY B 1 71  ? -1.932  34.530 47.991 1.00 60.95  ? 66  GLY B O   1 
ATOM   1685 N N   . ASP B 1 72  ? -3.163  36.360 48.436 1.00 70.05  ? 67  ASP B N   1 
ATOM   1686 C CA  . ASP B 1 72  ? -4.424  35.635 48.457 1.00 68.31  ? 67  ASP B CA  1 
ATOM   1687 C C   . ASP B 1 72  ? -5.189  35.824 47.152 1.00 69.80  ? 67  ASP B C   1 
ATOM   1688 O O   . ASP B 1 72  ? -6.402  35.627 47.099 1.00 69.73  ? 67  ASP B O   1 
ATOM   1689 C CB  . ASP B 1 72  ? -5.275  36.083 49.645 1.00 82.13  ? 67  ASP B CB  1 
ATOM   1690 C CG  . ASP B 1 72  ? -4.582  35.856 50.973 1.00 92.99  ? 67  ASP B CG  1 
ATOM   1691 O OD1 . ASP B 1 72  ? -3.762  34.918 51.061 1.00 95.26  ? 67  ASP B OD1 1 
ATOM   1692 O OD2 . ASP B 1 72  ? -4.854  36.615 51.926 1.00 100.31 1 67  ASP B OD2 1 
ATOM   1693 N N   . ASN B 1 73  ? -4.476  36.220 46.104 1.00 63.90  ? 68  ASN B N   1 
ATOM   1694 C CA  . ASN B 1 73  ? -5.052  36.279 44.766 1.00 55.38  ? 68  ASN B CA  1 
ATOM   1695 C C   . ASN B 1 73  ? -5.140  34.871 44.191 1.00 58.71  ? 68  ASN B C   1 
ATOM   1696 O O   . ASN B 1 73  ? -4.161  34.364 43.641 1.00 56.13  ? 68  ASN B O   1 
ATOM   1697 C CB  . ASN B 1 73  ? -4.209  37.175 43.858 1.00 53.34  ? 68  ASN B CB  1 
ATOM   1698 C CG  . ASN B 1 73  ? -4.867  37.444 42.512 1.00 59.48  ? 68  ASN B CG  1 
ATOM   1699 O OD1 . ASN B 1 73  ? -5.775  36.730 42.086 1.00 55.13  ? 68  ASN B OD1 1 
ATOM   1700 N ND2 . ASN B 1 73  ? -4.401  38.483 41.834 1.00 64.81  ? 68  ASN B ND2 1 
ATOM   1701 N N   . TRP B 1 74  ? -6.301  34.234 44.312 1.00 44.71  ? 69  TRP B N   1 
ATOM   1702 C CA  . TRP B 1 74  ? -6.400  32.834 43.907 1.00 42.04  ? 69  TRP B CA  1 
ATOM   1703 C C   . TRP B 1 74  ? -6.491  32.685 42.389 1.00 44.87  ? 69  TRP B C   1 
ATOM   1704 O O   . TRP B 1 74  ? -6.221  31.615 41.847 1.00 41.41  ? 69  TRP B O   1 
ATOM   1705 C CB  . TRP B 1 74  ? -7.595  32.149 44.588 1.00 47.13  ? 69  TRP B CB  1 
ATOM   1706 C CG  . TRP B 1 74  ? -8.922  32.817 44.403 1.00 47.03  ? 69  TRP B CG  1 
ATOM   1707 C CD1 . TRP B 1 74  ? -9.488  33.757 45.214 1.00 49.18  ? 69  TRP B CD1 1 
ATOM   1708 C CD2 . TRP B 1 74  ? -9.866  32.576 43.350 1.00 53.68  ? 69  TRP B CD2 1 
ATOM   1709 N NE1 . TRP B 1 74  ? -10.721 34.124 44.724 1.00 51.78  ? 69  TRP B NE1 1 
ATOM   1710 C CE2 . TRP B 1 74  ? -10.974 33.412 43.582 1.00 55.31  ? 69  TRP B CE2 1 
ATOM   1711 C CE3 . TRP B 1 74  ? -9.876  31.738 42.230 1.00 54.97  ? 69  TRP B CE3 1 
ATOM   1712 C CZ2 . TRP B 1 74  ? -12.079 33.435 42.737 1.00 63.56  ? 69  TRP B CZ2 1 
ATOM   1713 C CZ3 . TRP B 1 74  ? -10.974 31.761 41.395 1.00 53.92  ? 69  TRP B CZ3 1 
ATOM   1714 C CH2 . TRP B 1 74  ? -12.060 32.604 41.651 1.00 57.81  ? 69  TRP B CH2 1 
ATOM   1715 N N   . ARG B 1 75  ? -6.862  33.753 41.696 1.00 46.84  ? 70  ARG B N   1 
ATOM   1716 C CA  . ARG B 1 75  ? -6.904  33.683 40.243 1.00 51.21  ? 70  ARG B CA  1 
ATOM   1717 C C   . ARG B 1 75  ? -5.477  33.672 39.709 1.00 53.81  ? 70  ARG B C   1 
ATOM   1718 O O   . ARG B 1 75  ? -5.189  33.048 38.689 1.00 49.72  ? 70  ARG B O   1 
ATOM   1719 C CB  . ARG B 1 75  ? -7.722  34.835 39.665 1.00 51.36  ? 70  ARG B CB  1 
ATOM   1720 C CG  . ARG B 1 75  ? -9.192  34.754 40.061 1.00 57.90  ? 70  ARG B CG  1 
ATOM   1721 C CD  . ARG B 1 75  ? -10.057 35.715 39.266 1.00 70.93  ? 70  ARG B CD  1 
ATOM   1722 N NE  . ARG B 1 75  ? -11.479 35.531 39.554 1.00 73.02  ? 70  ARG B NE  1 
ATOM   1723 C CZ  . ARG B 1 75  ? -12.278 34.704 38.884 1.00 69.70  ? 70  ARG B CZ  1 
ATOM   1724 N NH1 . ARG B 1 75  ? -11.801 33.976 37.882 1.00 62.66  1 70  ARG B NH1 1 
ATOM   1725 N NH2 . ARG B 1 75  ? -13.557 34.605 39.216 1.00 68.21  ? 70  ARG B NH2 1 
ATOM   1726 N N   . LEU B 1 76  ? -4.581  34.332 40.432 1.00 52.96  ? 71  LEU B N   1 
ATOM   1727 C CA  . LEU B 1 76  ? -3.165  34.305 40.096 1.00 43.58  ? 71  LEU B CA  1 
ATOM   1728 C C   . LEU B 1 76  ? -2.540  32.940 40.404 1.00 46.70  ? 71  LEU B C   1 
ATOM   1729 O O   . LEU B 1 76  ? -1.676  32.467 39.655 1.00 43.14  ? 71  LEU B O   1 
ATOM   1730 C CB  . LEU B 1 76  ? -2.421  35.407 40.847 1.00 55.63  ? 71  LEU B CB  1 
ATOM   1731 C CG  . LEU B 1 76  ? -0.927  35.521 40.556 1.00 63.32  ? 71  LEU B CG  1 
ATOM   1732 C CD1 . LEU B 1 76  ? -0.683  35.546 39.056 1.00 64.07  ? 71  LEU B CD1 1 
ATOM   1733 C CD2 . LEU B 1 76  ? -0.373  36.773 41.208 1.00 74.63  ? 71  LEU B CD2 1 
ATOM   1734 N N   . LYS B 1 77  ? -2.956  32.321 41.509 1.00 38.90  ? 72  LYS B N   1 
ATOM   1735 C CA  . LYS B 1 77  ? -2.493  30.971 41.829 1.00 36.14  ? 72  LYS B CA  1 
ATOM   1736 C C   . LYS B 1 77  ? -2.874  30.048 40.690 1.00 34.24  ? 72  LYS B C   1 
ATOM   1737 O O   . LYS B 1 77  ? -2.069  29.254 40.233 1.00 35.19  ? 72  LYS B O   1 
ATOM   1738 C CB  . LYS B 1 77  ? -3.095  30.450 43.139 1.00 35.46  ? 72  LYS B CB  1 
ATOM   1739 C CG  . LYS B 1 77  ? -2.742  31.237 44.377 1.00 43.09  ? 72  LYS B CG  1 
ATOM   1740 C CD  . LYS B 1 77  ? -3.399  30.602 45.593 1.00 44.01  ? 72  LYS B CD  1 
ATOM   1741 C CE  . LYS B 1 77  ? -3.085  31.363 46.877 1.00 48.49  ? 72  LYS B CE  1 
ATOM   1742 N NZ  . LYS B 1 77  ? -3.670  30.672 48.069 1.00 45.07  1 72  LYS B NZ  1 
ATOM   1743 N N   . ILE B 1 78  ? -4.109  30.180 40.215 1.00 35.68  ? 73  ILE B N   1 
ATOM   1744 C CA  . ILE B 1 78  ? -4.584  29.322 39.138 1.00 37.48  ? 73  ILE B CA  1 
ATOM   1745 C C   . ILE B 1 78  ? -3.745  29.543 37.881 1.00 40.59  ? 73  ILE B C   1 
ATOM   1746 O O   . ILE B 1 78  ? -3.365  28.585 37.201 1.00 36.40  ? 73  ILE B O   1 
ATOM   1747 C CB  . ILE B 1 78  ? -6.073  29.568 38.851 1.00 40.26  ? 73  ILE B CB  1 
ATOM   1748 C CG1 . ILE B 1 78  ? -6.903  29.020 40.012 1.00 37.43  ? 73  ILE B CG1 1 
ATOM   1749 C CG2 . ILE B 1 78  ? -6.494  28.910 37.541 1.00 35.46  ? 73  ILE B CG2 1 
ATOM   1750 C CD1 . ILE B 1 78  ? -8.367  29.363 39.933 1.00 36.97  ? 73  ILE B CD1 1 
ATOM   1751 N N   . SER B 1 79  ? -3.432  30.804 37.602 1.00 40.07  ? 74  SER B N   1 
ATOM   1752 C CA  . SER B 1 79  ? -2.574  31.148 36.473 1.00 34.87  ? 74  SER B CA  1 
ATOM   1753 C C   . SER B 1 79  ? -1.211  30.455 36.600 1.00 39.25  ? 74  SER B C   1 
ATOM   1754 O O   . SER B 1 79  ? -0.751  29.812 35.659 1.00 33.44  ? 74  SER B O   1 
ATOM   1755 C CB  . SER B 1 79  ? -2.404  32.665 36.376 1.00 43.70  ? 74  SER B CB  1 
ATOM   1756 O OG  . SER B 1 79  ? -1.531  32.993 35.315 1.00 50.22  ? 74  SER B OG  1 
ATOM   1757 N N   . ASN B 1 80  ? -0.570  30.578 37.758 1.00 33.37  ? 75  ASN B N   1 
ATOM   1758 C CA  . ASN B 1 80  ? 0.681   29.860 38.001 1.00 34.79  ? 75  ASN B CA  1 
ATOM   1759 C C   . ASN B 1 80  ? 0.512   28.355 37.817 1.00 38.59  ? 75  ASN B C   1 
ATOM   1760 O O   . ASN B 1 80  ? 1.322   27.705 37.157 1.00 30.95  ? 75  ASN B O   1 
ATOM   1761 C CB  . ASN B 1 80  ? 1.224   30.132 39.412 1.00 32.37  ? 75  ASN B CB  1 
ATOM   1762 C CG  . ASN B 1 80  ? 1.961   31.458 39.520 1.00 43.92  ? 75  ASN B CG  1 
ATOM   1763 O OD1 . ASN B 1 80  ? 2.201   32.127 38.519 1.00 41.89  ? 75  ASN B OD1 1 
ATOM   1764 N ND2 . ASN B 1 80  ? 2.336   31.833 40.742 1.00 38.10  ? 75  ASN B ND2 1 
ATOM   1765 N N   . LEU B 1 81  ? -0.540  27.799 38.409 1.00 30.22  ? 76  LEU B N   1 
ATOM   1766 C CA  . LEU B 1 81  ? -0.709  26.352 38.405 1.00 28.81  ? 76  LEU B CA  1 
ATOM   1767 C C   . LEU B 1 81  ? -0.943  25.806 37.001 1.00 29.55  ? 76  LEU B C   1 
ATOM   1768 O O   . LEU B 1 81  ? -0.497  24.706 36.689 1.00 27.24  ? 76  LEU B O   1 
ATOM   1769 C CB  . LEU B 1 81  ? -1.867  25.939 39.326 1.00 31.50  ? 76  LEU B CB  1 
ATOM   1770 C CG  . LEU B 1 81  ? -1.649  26.164 40.820 1.00 29.23  ? 76  LEU B CG  1 
ATOM   1771 C CD1 . LEU B 1 81  ? -2.984  26.167 41.574 1.00 30.01  ? 76  LEU B CD1 1 
ATOM   1772 C CD2 . LEU B 1 81  ? -0.721  25.111 41.382 1.00 32.51  ? 76  LEU B CD2 1 
ATOM   1773 N N   . LYS B 1 82  ? -1.639  26.568 36.158 1.00 29.75  ? 77  LYS B N   1 
ATOM   1774 C CA  . LYS B 1 82  ? -1.852  26.133 34.786 1.00 29.77  ? 77  LYS B CA  1 
ATOM   1775 C C   . LYS B 1 82  ? -0.532  26.136 34.013 1.00 31.45  ? 77  LYS B C   1 
ATOM   1776 O O   . LYS B 1 82  ? -0.304  25.258 33.188 1.00 31.46  ? 77  LYS B O   1 
ATOM   1777 C CB  . LYS B 1 82  ? -2.896  27.013 34.083 1.00 32.95  ? 77  LYS B CB  1 
ATOM   1778 C CG  . LYS B 1 82  ? -4.324  26.675 34.485 1.00 30.88  ? 77  LYS B CG  1 
ATOM   1779 C CD  . LYS B 1 82  ? -5.375  27.486 33.704 1.00 35.35  ? 77  LYS B CD  1 
ATOM   1780 C CE  . LYS B 1 82  ? -6.781  27.079 34.163 1.00 42.75  ? 77  LYS B CE  1 
ATOM   1781 N NZ  . LYS B 1 82  ? -7.862  27.806 33.458 1.00 42.78  1 77  LYS B NZ  1 
ATOM   1782 N N   . LYS B 1 83  ? 0.334   27.109 34.292 1.00 29.23  ? 78  LYS B N   1 
ATOM   1783 C CA  . LYS B 1 83  ? 1.658   27.141 33.673 1.00 35.20  ? 78  LYS B CA  1 
ATOM   1784 C C   . LYS B 1 83  ? 2.476   25.926 34.103 1.00 32.64  ? 78  LYS B C   1 
ATOM   1785 O O   . LYS B 1 83  ? 3.215   25.360 33.302 1.00 29.75  ? 78  LYS B O   1 
ATOM   1786 C CB  . LYS B 1 83  ? 2.429   28.426 34.025 1.00 35.47  ? 78  LYS B CB  1 
ATOM   1787 C CG  . LYS B 1 83  ? 1.751   29.752 33.643 1.00 32.26  ? 78  LYS B CG  1 
ATOM   1788 C CD  . LYS B 1 83  ? 1.063   29.687 32.285 1.00 59.58  ? 78  LYS B CD  1 
ATOM   1789 C CE  . LYS B 1 83  ? 0.111   30.871 32.069 1.00 65.38  ? 78  LYS B CE  1 
ATOM   1790 N NZ  . LYS B 1 83  ? -1.215  30.698 32.749 1.00 55.33  1 78  LYS B NZ  1 
ATOM   1791 N N   . ILE B 1 84  ? 2.341   25.528 35.369 1.00 32.22  ? 79  ILE B N   1 
ATOM   1792 C CA  . ILE B 1 84  ? 3.074   24.379 35.886 1.00 26.33  ? 79  ILE B CA  1 
ATOM   1793 C C   . ILE B 1 84  ? 2.562   23.072 35.295 1.00 29.30  ? 79  ILE B C   1 
ATOM   1794 O O   . ILE B 1 84  ? 3.352   22.219 34.897 1.00 26.29  ? 79  ILE B O   1 
ATOM   1795 C CB  . ILE B 1 84  ? 3.014   24.326 37.427 1.00 26.09  ? 79  ILE B CB  1 
ATOM   1796 C CG1 . ILE B 1 84  ? 3.759   25.543 37.979 1.00 35.31  ? 79  ILE B CG1 1 
ATOM   1797 C CG2 . ILE B 1 84  ? 3.656   23.041 37.945 1.00 29.74  ? 79  ILE B CG2 1 
ATOM   1798 C CD1 . ILE B 1 84  ? 3.528   25.799 39.404 1.00 42.82  ? 79  ILE B CD1 1 
ATOM   1799 N N   . LEU B 1 85  ? 1.243   22.927 35.222 1.00 26.12  ? 80  LEU B N   1 
ATOM   1800 C CA  . LEU B 1 85  ? 0.644   21.735 34.633 1.00 26.44  ? 80  LEU B CA  1 
ATOM   1801 C C   . LEU B 1 85  ? 1.034   21.610 33.162 1.00 29.27  ? 80  LEU B C   1 
ATOM   1802 O O   . LEU B 1 85  ? 1.399   20.526 32.702 1.00 26.02  ? 80  LEU B O   1 
ATOM   1803 C CB  . LEU B 1 85  ? -0.877  21.766 34.780 1.00 29.50  ? 80  LEU B CB  1 
ATOM   1804 C CG  . LEU B 1 85  ? -1.613  20.557 34.192 1.00 26.79  ? 80  LEU B CG  1 
ATOM   1805 C CD1 . LEU B 1 85  ? -1.102  19.259 34.798 1.00 26.54  ? 80  LEU B CD1 1 
ATOM   1806 C CD2 . LEU B 1 85  ? -3.123  20.687 34.384 1.00 25.81  ? 80  LEU B CD2 1 
ATOM   1807 N N   . LYS B 1 86  ? 0.947   22.715 32.427 1.00 27.66  ? 81  LYS B N   1 
ATOM   1808 C CA  . LYS B 1 86  ? 1.371   22.722 31.032 1.00 28.23  ? 81  LYS B CA  1 
ATOM   1809 C C   . LYS B 1 86  ? 2.841   22.363 30.896 1.00 28.21  ? 81  LYS B C   1 
ATOM   1810 O O   . LYS B 1 86  ? 3.217   21.623 29.991 1.00 30.89  ? 81  LYS B O   1 
ATOM   1811 C CB  . LYS B 1 86  ? 1.115   24.077 30.389 1.00 31.07  ? 81  LYS B CB  1 
ATOM   1812 C CG  . LYS B 1 86  ? 1.491   24.162 28.907 1.00 39.73  ? 81  LYS B CG  1 
ATOM   1813 C CD  . LYS B 1 86  ? 0.740   23.148 28.046 1.00 35.75  ? 81  LYS B CD  1 
ATOM   1814 C CE  . LYS B 1 86  ? 0.854   23.532 26.560 1.00 44.48  ? 81  LYS B CE  1 
ATOM   1815 N NZ  . LYS B 1 86  ? 1.200   22.400 25.654 1.00 35.46  1 81  LYS B NZ  1 
ATOM   1816 N N   . GLY B 1 87  ? 3.665   22.907 31.789 1.00 27.03  ? 82  GLY B N   1 
ATOM   1817 C CA  . GLY B 1 87  ? 5.083   22.582 31.821 1.00 28.36  ? 82  GLY B CA  1 
ATOM   1818 C C   . GLY B 1 87  ? 5.343   21.101 32.057 1.00 27.75  ? 82  GLY B C   1 
ATOM   1819 O O   . GLY B 1 87  ? 6.231   20.519 31.427 1.00 28.44  ? 82  GLY B O   1 
ATOM   1820 N N   . ILE B 1 88  ? 4.582   20.485 32.967 1.00 24.52  ? 83  ILE B N   1 
ATOM   1821 C CA  . ILE B 1 88  ? 4.713   19.055 33.223 1.00 25.43  ? 83  ILE B CA  1 
ATOM   1822 C C   . ILE B 1 88  ? 4.329   18.247 31.979 1.00 25.61  ? 83  ILE B C   1 
ATOM   1823 O O   . ILE B 1 88  ? 5.019   17.307 31.595 1.00 23.78  ? 83  ILE B O   1 
ATOM   1824 C CB  . ILE B 1 88  ? 3.828   18.613 34.400 1.00 26.95  ? 83  ILE B CB  1 
ATOM   1825 C CG1 . ILE B 1 88  ? 4.384   19.182 35.706 1.00 24.17  ? 83  ILE B CG1 1 
ATOM   1826 C CG2 . ILE B 1 88  ? 3.721   17.098 34.443 1.00 26.83  ? 83  ILE B CG2 1 
ATOM   1827 C CD1 . ILE B 1 88  ? 3.430   19.055 36.878 1.00 26.83  ? 83  ILE B CD1 1 
ATOM   1828 N N   . LEU B 1 89  ? 3.213   18.618 31.359 1.00 24.06  ? 84  LEU B N   1 
ATOM   1829 C CA  . LEU B 1 89  ? 2.757   17.924 30.160 1.00 29.09  ? 84  LEU B CA  1 
ATOM   1830 C C   . LEU B 1 89  ? 3.750   18.093 29.006 1.00 26.79  ? 84  LEU B C   1 
ATOM   1831 O O   . LEU B 1 89  ? 4.026   17.139 28.279 1.00 24.60  ? 84  LEU B O   1 
ATOM   1832 C CB  . LEU B 1 89  ? 1.378   18.430 29.736 1.00 28.82  ? 84  LEU B CB  1 
ATOM   1833 C CG  . LEU B 1 89  ? 0.250   18.066 30.712 1.00 33.37  ? 84  LEU B CG  1 
ATOM   1834 C CD1 . LEU B 1 89  ? -1.076  18.588 30.189 1.00 34.99  ? 84  LEU B CD1 1 
ATOM   1835 C CD2 . LEU B 1 89  ? 0.182   16.563 30.962 1.00 36.02  ? 84  LEU B CD2 1 
ATOM   1836 N N   . ASP B 1 90  ? 4.267   19.307 28.834 1.00 24.84  ? 85  ASP B N   1 
ATOM   1837 C CA  . ASP B 1 90  ? 5.249   19.559 27.774 1.00 27.18  ? 85  ASP B CA  1 
ATOM   1838 C C   . ASP B 1 90  ? 6.554   18.807 28.037 1.00 32.65  ? 85  ASP B C   1 
ATOM   1839 O O   . ASP B 1 90  ? 7.150   18.271 27.110 1.00 26.22  ? 85  ASP B O   1 
ATOM   1840 C CB  . ASP B 1 90  ? 5.519   21.053 27.609 1.00 28.65  ? 85  ASP B CB  1 
ATOM   1841 C CG  . ASP B 1 90  ? 4.342   21.782 26.978 1.00 38.11  ? 85  ASP B CG  1 
ATOM   1842 O OD1 . ASP B 1 90  ? 3.459   21.097 26.413 1.00 34.30  ? 85  ASP B OD1 1 
ATOM   1843 O OD2 . ASP B 1 90  ? 4.298   23.027 27.044 1.00 33.25  1 85  ASP B OD2 1 
ATOM   1844 N N   . TYR B 1 91  ? 6.987   18.760 29.293 1.00 24.50  ? 86  TYR B N   1 
ATOM   1845 C CA  . TYR B 1 91  ? 8.203   18.023 29.651 1.00 26.11  ? 86  TYR B CA  1 
ATOM   1846 C C   . TYR B 1 91  ? 8.043   16.541 29.312 1.00 28.43  ? 86  TYR B C   1 
ATOM   1847 O O   . TYR B 1 91  ? 8.929   15.922 28.718 1.00 27.02  ? 86  TYR B O   1 
ATOM   1848 C CB  . TYR B 1 91  ? 8.523   18.198 31.139 1.00 24.27  ? 86  TYR B CB  1 
ATOM   1849 C CG  . TYR B 1 91  ? 9.856   17.593 31.556 1.00 24.75  ? 86  TYR B CG  1 
ATOM   1850 C CD1 . TYR B 1 91  ? 11.040  18.036 30.987 1.00 24.90  ? 86  TYR B CD1 1 
ATOM   1851 C CD2 . TYR B 1 91  ? 9.921   16.591 32.523 1.00 30.17  ? 86  TYR B CD2 1 
ATOM   1852 C CE1 . TYR B 1 91  ? 12.262  17.503 31.368 1.00 30.61  ? 86  TYR B CE1 1 
ATOM   1853 C CE2 . TYR B 1 91  ? 11.145  16.047 32.912 1.00 31.11  ? 86  TYR B CE2 1 
ATOM   1854 C CZ  . TYR B 1 91  ? 12.310  16.508 32.323 1.00 33.63  ? 86  TYR B CZ  1 
ATOM   1855 O OH  . TYR B 1 91  ? 13.531  15.978 32.692 1.00 34.22  ? 86  TYR B OH  1 
ATOM   1856 N N   . ASN B 1 92  ? 6.901   15.983 29.693 1.00 29.42  ? 87  ASN B N   1 
ATOM   1857 C CA  . ASN B 1 92  ? 6.571   14.591 29.416 1.00 24.29  ? 87  ASN B CA  1 
ATOM   1858 C C   . ASN B 1 92  ? 6.566   14.296 27.913 1.00 29.59  ? 87  ASN B C   1 
ATOM   1859 O O   . ASN B 1 92  ? 7.105   13.285 27.455 1.00 31.84  ? 87  ASN B O   1 
ATOM   1860 C CB  . ASN B 1 92  ? 5.207   14.265 30.032 1.00 28.04  ? 87  ASN B CB  1 
ATOM   1861 C CG  . ASN B 1 92  ? 4.835   12.800 29.903 1.00 39.78  ? 87  ASN B CG  1 
ATOM   1862 O OD1 . ASN B 1 92  ? 5.598   11.912 30.281 1.00 40.88  ? 87  ASN B OD1 1 
ATOM   1863 N ND2 . ASN B 1 92  ? 3.640   12.542 29.374 1.00 42.62  ? 87  ASN B ND2 1 
ATOM   1864 N N   . HIS B 1 93  ? 5.985   15.204 27.138 1.00 24.88  ? 88  HIS B N   1 
ATOM   1865 C CA  . HIS B 1 93  ? 5.920   15.042 25.693 1.00 25.72  ? 88  HIS B CA  1 
ATOM   1866 C C   . HIS B 1 93  ? 7.272   15.305 24.992 1.00 34.85  ? 88  HIS B C   1 
ATOM   1867 O O   . HIS B 1 93  ? 7.642   14.578 24.067 1.00 32.94  ? 88  HIS B O   1 
ATOM   1868 C CB  . HIS B 1 93  ? 4.827   15.969 25.123 1.00 26.88  ? 88  HIS B CB  1 
ATOM   1869 C CG  . HIS B 1 93  ? 4.716   15.937 23.624 1.00 31.83  ? 88  HIS B CG  1 
ATOM   1870 N ND1 . HIS B 1 93  ? 4.246   14.842 22.936 1.00 31.86  ? 88  HIS B ND1 1 
ATOM   1871 C CD2 . HIS B 1 93  ? 5.010   16.871 22.689 1.00 31.36  ? 88  HIS B CD2 1 
ATOM   1872 C CE1 . HIS B 1 93  ? 4.252   15.101 21.637 1.00 31.23  ? 88  HIS B CE1 1 
ATOM   1873 N NE2 . HIS B 1 93  ? 4.711   16.326 21.462 1.00 35.94  ? 88  HIS B NE2 1 
ATOM   1874 N N   . GLU B 1 94  ? 8.003   16.333 25.425 1.00 28.23  ? 89  GLU B N   1 
ATOM   1875 C CA  . GLU B 1 94  ? 9.171   16.803 24.671 1.00 31.29  ? 89  GLU B CA  1 
ATOM   1876 C C   . GLU B 1 94  ? 10.473  16.126 25.058 1.00 30.34  ? 89  GLU B C   1 
ATOM   1877 O O   . GLU B 1 94  ? 11.376  15.977 24.226 1.00 29.75  ? 89  GLU B O   1 
ATOM   1878 C CB  . GLU B 1 94  ? 9.339   18.320 24.830 1.00 29.47  ? 89  GLU B CB  1 
ATOM   1879 C CG  . GLU B 1 94  ? 8.195   19.115 24.205 1.00 32.01  ? 89  GLU B CG  1 
ATOM   1880 C CD  . GLU B 1 94  ? 8.154   20.577 24.633 1.00 42.81  ? 89  GLU B CD  1 
ATOM   1881 O OE1 . GLU B 1 94  ? 9.039   21.018 25.403 1.00 37.29  ? 89  GLU B OE1 1 
ATOM   1882 O OE2 . GLU B 1 94  ? 7.226   21.289 24.188 1.00 44.93  1 89  GLU B OE2 1 
ATOM   1883 N N   . ILE B 1 95  ? 10.583  15.743 26.318 1.00 26.77  ? 90  ILE B N   1 
ATOM   1884 C CA  . ILE B 1 95  ? 11.852  15.257 26.839 1.00 31.24  ? 90  ILE B CA  1 
ATOM   1885 C C   . ILE B 1 95  ? 11.778  13.811 27.299 1.00 26.54  ? 90  ILE B C   1 
ATOM   1886 O O   . ILE B 1 95  ? 12.692  13.026 27.028 1.00 31.71  ? 90  ILE B O   1 
ATOM   1887 C CB  . ILE B 1 95  ? 12.343  16.128 28.018 1.00 28.95  ? 90  ILE B CB  1 
ATOM   1888 C CG1 . ILE B 1 95  ? 12.629  17.558 27.546 1.00 33.08  ? 90  ILE B CG1 1 
ATOM   1889 C CG2 . ILE B 1 95  ? 13.578  15.519 28.667 1.00 29.51  ? 90  ILE B CG2 1 
ATOM   1890 C CD1 . ILE B 1 95  ? 13.600  17.661 26.371 1.00 34.76  ? 90  ILE B CD1 1 
ATOM   1891 N N   . LEU B 1 96  ? 10.720  13.452 28.022 1.00 30.97  ? 91  LEU B N   1 
ATOM   1892 C CA  . LEU B 1 96  ? 10.674  12.119 28.630 1.00 29.29  ? 91  LEU B CA  1 
ATOM   1893 C C   . LEU B 1 96  ? 10.351  11.018 27.620 1.00 38.78  ? 91  LEU B C   1 
ATOM   1894 O O   . LEU B 1 96  ? 9.457   11.154 26.780 1.00 37.24  ? 91  LEU B O   1 
ATOM   1895 C CB  . LEU B 1 96  ? 9.666   12.073 29.788 1.00 29.00  ? 91  LEU B CB  1 
ATOM   1896 C CG  . LEU B 1 96  ? 9.996   12.989 30.959 1.00 28.91  ? 91  LEU B CG  1 
ATOM   1897 C CD1 . LEU B 1 96  ? 9.100   12.702 32.171 1.00 29.74  ? 91  LEU B CD1 1 
ATOM   1898 C CD2 . LEU B 1 96  ? 11.465  12.824 31.347 1.00 41.48  ? 91  LEU B CD2 1 
ATOM   1899 N N   . GLY B 1 97  ? 11.104  9.926  27.716 1.00 55.32  ? 92  GLY B N   1 
ATOM   1900 C CA  . GLY B 1 97  ? 10.854  8.742  26.917 1.00 67.73  ? 92  GLY B CA  1 
ATOM   1901 C C   . GLY B 1 97  ? 9.631   8.003  27.418 1.00 79.23  ? 92  GLY B C   1 
ATOM   1902 O O   . GLY B 1 97  ? 8.610   7.947  26.728 1.00 84.06  ? 92  GLY B O   1 
ATOM   1903 N N   . GLN B 1 98  ? 9.729   7.438  28.621 1.00 86.52  ? 93  GLN B N   1 
ATOM   1904 C CA  . GLN B 1 98  ? 8.590   6.757  29.228 1.00 87.45  ? 93  GLN B CA  1 
ATOM   1905 C C   . GLN B 1 98  ? 7.564   7.779  29.690 1.00 86.77  ? 93  GLN B C   1 
ATOM   1906 O O   . GLN B 1 98  ? 7.864   8.654  30.502 1.00 83.42  ? 93  GLN B O   1 
ATOM   1907 C CB  . GLN B 1 98  ? 9.014   5.878  30.408 1.00 88.44  ? 93  GLN B CB  1 
ATOM   1908 C CG  . GLN B 1 98  ? 7.913   4.914  30.865 1.00 92.13  ? 93  GLN B CG  1 
ATOM   1909 C CD  . GLN B 1 98  ? 7.929   4.637  32.363 1.00 89.43  ? 93  GLN B CD  1 
ATOM   1910 O OE1 . GLN B 1 98  ? 8.819   3.954  32.875 1.00 94.28  ? 93  GLN B OE1 1 
ATOM   1911 N NE2 . GLN B 1 98  ? 6.939   5.171  33.073 1.00 70.54  ? 93  GLN B NE2 1 
ATOM   1912 N N   . GLN B 1 99  ? 6.353   7.657  29.160 1.00 91.89  ? 94  GLN B N   1 
ATOM   1913 C CA  . GLN B 1 99  ? 5.263   8.561  29.494 1.00 98.13  ? 94  GLN B CA  1 
ATOM   1914 C C   . GLN B 1 99  ? 4.822   8.396  30.946 1.00 98.55  ? 94  GLN B C   1 
ATOM   1915 O O   . GLN B 1 99  ? 4.656   7.276  31.429 1.00 100.99 ? 94  GLN B O   1 
ATOM   1916 C CB  . GLN B 1 99  ? 4.075   8.322  28.554 1.00 106.87 ? 94  GLN B CB  1 
ATOM   1917 C CG  . GLN B 1 99  ? 4.208   8.953  27.172 1.00 111.08 ? 94  GLN B CG  1 
ATOM   1918 C CD  . GLN B 1 99  ? 5.296   8.313  26.330 1.00 116.60 ? 94  GLN B CD  1 
ATOM   1919 O OE1 . GLN B 1 99  ? 5.649   7.150  26.527 1.00 119.54 ? 94  GLN B OE1 1 
ATOM   1920 N NE2 . GLN B 1 99  ? 5.835   9.074  25.384 1.00 116.45 ? 94  GLN B NE2 1 
ATOM   1921 N N   . ILE B 1 100 ? 4.640   9.514  31.643 1.00 94.81  ? 95  ILE B N   1 
ATOM   1922 C CA  . ILE B 1 100 ? 4.076   9.483  32.988 1.00 86.24  ? 95  ILE B CA  1 
ATOM   1923 C C   . ILE B 1 100 ? 2.585   9.166  32.904 1.00 96.25  ? 95  ILE B C   1 
ATOM   1924 O O   . ILE B 1 100 ? 1.970   9.315  31.847 1.00 94.22  ? 95  ILE B O   1 
ATOM   1925 C CB  . ILE B 1 100 ? 4.278   10.821 33.740 1.00 61.30  ? 95  ILE B CB  1 
ATOM   1926 C CG1 . ILE B 1 100 ? 3.465   11.943 33.080 1.00 57.96  ? 95  ILE B CG1 1 
ATOM   1927 C CG2 . ILE B 1 100 ? 5.761   11.179 33.824 1.00 37.36  ? 95  ILE B CG2 1 
ATOM   1928 C CD1 . ILE B 1 100 ? 3.661   13.298 33.723 1.00 61.78  ? 95  ILE B CD1 1 
ATOM   1929 N N   . ASN B 1 101 ? 2.006   8.724  34.015 1.00 100.56 ? 96  ASN B N   1 
ATOM   1930 C CA  . ASN B 1 101 ? 0.588   8.389  34.044 1.00 102.97 ? 96  ASN B CA  1 
ATOM   1931 C C   . ASN B 1 101 ? -0.279  9.627  34.247 1.00 93.29  ? 96  ASN B C   1 
ATOM   1932 O O   . ASN B 1 101 ? -0.570  10.020 35.378 1.00 87.18  ? 96  ASN B O   1 
ATOM   1933 C CB  . ASN B 1 101 ? 0.308   7.353  35.133 1.00 110.33 ? 96  ASN B CB  1 
ATOM   1934 C CG  . ASN B 1 101 ? 0.856   5.982  34.781 1.00 117.20 ? 96  ASN B CG  1 
ATOM   1935 O OD1 . ASN B 1 101 ? 1.995   5.650  35.112 1.00 119.56 ? 96  ASN B OD1 1 
ATOM   1936 N ND2 . ASN B 1 101 ? 0.047   5.181  34.097 1.00 119.03 ? 96  ASN B ND2 1 
ATOM   1937 N N   . ASP B 1 102 ? -0.686  10.232 33.135 1.00 90.98  ? 97  ASP B N   1 
ATOM   1938 C CA  . ASP B 1 102 ? -1.468  11.464 33.150 1.00 88.45  ? 97  ASP B CA  1 
ATOM   1939 C C   . ASP B 1 102 ? -2.891  11.234 32.647 1.00 93.67  ? 97  ASP B C   1 
ATOM   1940 O O   . ASP B 1 102 ? -3.467  12.090 31.974 1.00 93.83  ? 97  ASP B O   1 
ATOM   1941 C CB  . ASP B 1 102 ? -0.781  12.539 32.301 1.00 81.63  ? 97  ASP B CB  1 
ATOM   1942 C CG  . ASP B 1 102 ? -0.531  12.084 30.874 1.00 76.68  ? 97  ASP B CG  1 
ATOM   1943 O OD1 . ASP B 1 102 ? -0.556  12.935 29.958 1.00 79.97  ? 97  ASP B OD1 1 
ATOM   1944 O OD2 . ASP B 1 102 ? -0.315  10.872 30.670 1.00 71.65  1 97  ASP B OD2 1 
ATOM   1945 N N   . PHE B 1 103 ? -3.456  10.078 32.981 1.00 93.92  ? 98  PHE B N   1 
ATOM   1946 C CA  . PHE B 1 103 ? -4.785  9.715  32.504 1.00 93.09  ? 98  PHE B CA  1 
ATOM   1947 C C   . PHE B 1 103 ? -5.874  10.519 33.211 1.00 82.78  ? 98  PHE B C   1 
ATOM   1948 O O   . PHE B 1 103 ? -6.970  10.692 32.679 1.00 90.95  ? 98  PHE B O   1 
ATOM   1949 C CB  . PHE B 1 103 ? -5.021  8.214  32.680 1.00 101.03 ? 98  PHE B CB  1 
ATOM   1950 C CG  . PHE B 1 103 ? -4.168  7.359  31.780 1.00 108.18 ? 98  PHE B CG  1 
ATOM   1951 C CD1 . PHE B 1 103 ? -2.877  7.012  32.149 1.00 110.12 ? 98  PHE B CD1 1 
ATOM   1952 C CD2 . PHE B 1 103 ? -4.657  6.907  30.563 1.00 109.43 ? 98  PHE B CD2 1 
ATOM   1953 C CE1 . PHE B 1 103 ? -2.091  6.229  31.322 1.00 112.36 ? 98  PHE B CE1 1 
ATOM   1954 C CE2 . PHE B 1 103 ? -3.876  6.123  29.732 1.00 111.57 ? 98  PHE B CE2 1 
ATOM   1955 C CZ  . PHE B 1 103 ? -2.591  5.784  30.112 1.00 113.14 ? 98  PHE B CZ  1 
ATOM   1956 N N   . THR B 1 104 ? -5.567  11.011 34.407 1.00 62.86  ? 99  THR B N   1 
ATOM   1957 C CA  . THR B 1 104 ? -6.474  11.906 35.120 1.00 56.12  ? 99  THR B CA  1 
ATOM   1958 C C   . THR B 1 104 ? -5.713  13.124 35.635 1.00 47.34  ? 99  THR B C   1 
ATOM   1959 O O   . THR B 1 104 ? -4.952  13.027 36.596 1.00 56.22  ? 99  THR B O   1 
ATOM   1960 C CB  . THR B 1 104 ? -7.165  11.201 36.301 1.00 60.74  ? 99  THR B CB  1 
ATOM   1961 O OG1 . THR B 1 104 ? -7.874  10.049 35.827 1.00 60.90  ? 99  THR B OG1 1 
ATOM   1962 C CG2 . THR B 1 104 ? -8.142  12.147 36.989 1.00 64.25  ? 99  THR B CG2 1 
ATOM   1963 N N   . LEU B 1 105 ? -5.916  14.270 34.996 1.00 39.86  ? 100 LEU B N   1 
ATOM   1964 C CA  . LEU B 1 105 ? -5.163  15.461 35.362 1.00 36.19  ? 100 LEU B CA  1 
ATOM   1965 C C   . LEU B 1 105 ? -5.757  16.156 36.573 1.00 32.45  ? 100 LEU B C   1 
ATOM   1966 O O   . LEU B 1 105 ? -6.965  16.085 36.802 1.00 37.54  ? 100 LEU B O   1 
ATOM   1967 C CB  . LEU B 1 105 ? -5.101  16.447 34.190 1.00 30.93  ? 100 LEU B CB  1 
ATOM   1968 C CG  . LEU B 1 105 ? -4.328  15.995 32.950 1.00 28.90  ? 100 LEU B CG  1 
ATOM   1969 C CD1 . LEU B 1 105 ? -4.206  17.149 31.988 1.00 33.66  ? 100 LEU B CD1 1 
ATOM   1970 C CD2 . LEU B 1 105 ? -2.952  15.444 33.343 1.00 34.78  ? 100 LEU B CD2 1 
ATOM   1971 N N   . PRO B 1 106 ? -4.904  16.828 37.357 1.00 30.86  ? 101 PRO B N   1 
ATOM   1972 C CA  . PRO B 1 106 ? -5.383  17.706 38.424 1.00 29.97  ? 101 PRO B CA  1 
ATOM   1973 C C   . PRO B 1 106 ? -6.226  18.839 37.862 1.00 30.94  ? 101 PRO B C   1 
ATOM   1974 O O   . PRO B 1 106 ? -5.868  19.440 36.852 1.00 30.73  ? 101 PRO B O   1 
ATOM   1975 C CB  . PRO B 1 106 ? -4.094  18.260 39.036 1.00 32.11  ? 101 PRO B CB  1 
ATOM   1976 C CG  . PRO B 1 106 ? -3.094  18.171 37.927 1.00 31.69  ? 101 PRO B CG  1 
ATOM   1977 C CD  . PRO B 1 106 ? -3.438  16.880 37.228 1.00 28.70  ? 101 PRO B CD  1 
ATOM   1978 N N   . ASP B 1 107 ? -7.343  19.131 38.509 1.00 29.58  ? 102 ASP B N   1 
ATOM   1979 C CA  . ASP B 1 107 ? -8.072  20.339 38.178 1.00 31.24  ? 102 ASP B CA  1 
ATOM   1980 C C   . ASP B 1 107 ? -7.469  21.459 39.015 1.00 33.51  ? 102 ASP B C   1 
ATOM   1981 O O   . ASP B 1 107 ? -7.799  21.601 40.193 1.00 30.14  ? 102 ASP B O   1 
ATOM   1982 C CB  . ASP B 1 107 ? -9.574  20.172 38.453 1.00 32.07  ? 102 ASP B CB  1 
ATOM   1983 C CG  . ASP B 1 107 ? -10.378 21.402 38.078 1.00 41.20  ? 102 ASP B CG  1 
ATOM   1984 O OD1 . ASP B 1 107 ? -9.771  22.464 37.850 1.00 36.80  ? 102 ASP B OD1 1 
ATOM   1985 O OD2 . ASP B 1 107 ? -11.621 21.312 38.032 1.00 35.61  1 102 ASP B OD2 1 
ATOM   1986 N N   . VAL B 1 108 ? -6.580  22.249 38.410 1.00 33.26  ? 103 VAL B N   1 
ATOM   1987 C CA  . VAL B 1 108 ? -5.832  23.245 39.171 1.00 31.81  ? 103 VAL B CA  1 
ATOM   1988 C C   . VAL B 1 108 ? -6.700  24.425 39.572 1.00 31.81  ? 103 VAL B C   1 
ATOM   1989 O O   . VAL B 1 108 ? -6.313  25.222 40.425 1.00 39.10  ? 103 VAL B O   1 
ATOM   1990 C CB  . VAL B 1 108 ? -4.600  23.742 38.385 1.00 30.86  ? 103 VAL B CB  1 
ATOM   1991 C CG1 . VAL B 1 108 ? -3.760  22.549 37.959 1.00 29.03  ? 103 VAL B CG1 1 
ATOM   1992 C CG2 . VAL B 1 108 ? -5.025  24.589 37.181 1.00 37.15  ? 103 VAL B CG2 1 
ATOM   1993 N N   . ASN B 1 109 ? -7.883  24.540 38.970 1.00 32.86  ? 104 ASN B N   1 
ATOM   1994 C CA  . ASN B 1 109 ? -8.819  25.554 39.397 1.00 33.09  ? 104 ASN B CA  1 
ATOM   1995 C C   . ASN B 1 109 ? -9.252  25.310 40.840 1.00 34.14  ? 104 ASN B C   1 
ATOM   1996 O O   . ASN B 1 109 ? -9.458  26.252 41.604 1.00 40.81  ? 104 ASN B O   1 
ATOM   1997 C CB  . ASN B 1 109 ? -10.030 25.595 38.461 1.00 41.81  ? 104 ASN B CB  1 
ATOM   1998 C CG  . ASN B 1 109 ? -9.631  25.846 37.010 1.00 42.23  ? 104 ASN B CG  1 
ATOM   1999 O OD1 . ASN B 1 109 ? -9.438  26.989 36.599 1.00 41.71  ? 104 ASN B OD1 1 
ATOM   2000 N ND2 . ASN B 1 109 ? -9.464  24.770 36.244 1.00 39.83  ? 104 ASN B ND2 1 
ATOM   2001 N N   . LEU B 1 110 ? -9.379  24.046 41.220 1.00 37.28  ? 105 LEU B N   1 
ATOM   2002 C CA  . LEU B 1 110 ? -9.778  23.717 42.586 1.00 34.80  ? 105 LEU B CA  1 
ATOM   2003 C C   . LEU B 1 110 ? -8.619  23.905 43.573 1.00 39.95  ? 105 LEU B C   1 
ATOM   2004 O O   . LEU B 1 110 ? -8.830  24.227 44.742 1.00 33.59  ? 105 LEU B O   1 
ATOM   2005 C CB  . LEU B 1 110 ? -10.309 22.282 42.655 1.00 38.21  ? 105 LEU B CB  1 
ATOM   2006 C CG  . LEU B 1 110 ? -11.545 22.014 41.785 1.00 45.98  ? 105 LEU B CG  1 
ATOM   2007 C CD1 . LEU B 1 110 ? -11.967 20.555 41.879 1.00 41.23  ? 105 LEU B CD1 1 
ATOM   2008 C CD2 . LEU B 1 110 ? -12.690 22.932 42.180 1.00 54.26  ? 105 LEU B CD2 1 
ATOM   2009 N N   . ILE B 1 111 ? -7.395  23.692 43.108 1.00 32.93  ? 106 ILE B N   1 
ATOM   2010 C CA  . ILE B 1 111 ? -6.218  23.912 43.954 1.00 30.24  ? 106 ILE B CA  1 
ATOM   2011 C C   . ILE B 1 111 ? -6.107  25.396 44.281 1.00 39.29  ? 106 ILE B C   1 
ATOM   2012 O O   . ILE B 1 111 ? -5.968  25.782 45.445 1.00 34.43  ? 106 ILE B O   1 
ATOM   2013 C CB  . ILE B 1 111 ? -4.927  23.425 43.264 1.00 31.38  ? 106 ILE B CB  1 
ATOM   2014 C CG1 . ILE B 1 111 ? -5.027  21.928 42.959 1.00 27.83  ? 106 ILE B CG1 1 
ATOM   2015 C CG2 . ILE B 1 111 ? -3.678  23.730 44.123 1.00 29.09  ? 106 ILE B CG2 1 
ATOM   2016 C CD1 . ILE B 1 111 ? -3.850  21.392 42.197 1.00 28.19  ? 106 ILE B CD1 1 
ATOM   2017 N N   . GLY B 1 112 ? -6.201  26.227 43.246 1.00 33.83  ? 107 GLY B N   1 
ATOM   2018 C CA  . GLY B 1 112 ? -6.097  27.661 43.410 1.00 36.23  ? 107 GLY B CA  1 
ATOM   2019 C C   . GLY B 1 112 ? -7.217  28.268 44.235 1.00 44.29  ? 107 GLY B C   1 
ATOM   2020 O O   . GLY B 1 112 ? -6.963  28.986 45.199 1.00 44.85  ? 107 GLY B O   1 
ATOM   2021 N N   . GLU B 1 113 ? -8.461  27.981 43.864 1.00 39.70  ? 108 GLU B N   1 
ATOM   2022 C CA  . GLU B 1 113 ? -9.596  28.639 44.504 1.00 42.06  ? 108 GLU B CA  1 
ATOM   2023 C C   . GLU B 1 113 ? -9.936  28.051 45.877 1.00 42.41  ? 108 GLU B C   1 
ATOM   2024 O O   . GLU B 1 113 ? -10.348 28.783 46.783 1.00 50.66  ? 108 GLU B O   1 
ATOM   2025 C CB  . GLU B 1 113 ? -10.827 28.580 43.592 1.00 39.12  ? 108 GLU B CB  1 
ATOM   2026 C CG  . GLU B 1 113 ? -12.002 29.410 44.090 1.00 51.83  ? 108 GLU B CG  1 
ATOM   2027 C CD  . GLU B 1 113 ? -13.185 29.386 43.140 1.00 52.64  ? 108 GLU B CD  1 
ATOM   2028 O OE1 . GLU B 1 113 ? -13.069 28.763 42.065 1.00 49.97  ? 108 GLU B OE1 1 
ATOM   2029 O OE2 . GLU B 1 113 ? -14.231 29.986 43.470 1.00 58.12  1 108 GLU B OE2 1 
ATOM   2030 N N   . HIS B 1 114 ? -9.750  26.747 46.047 1.00 41.17  ? 109 HIS B N   1 
ATOM   2031 C CA  . HIS B 1 114 ? -10.192 26.105 47.285 1.00 43.18  ? 109 HIS B CA  1 
ATOM   2032 C C   . HIS B 1 114 ? -9.137  25.298 48.044 1.00 41.84  ? 109 HIS B C   1 
ATOM   2033 O O   . HIS B 1 114 ? -9.472  24.644 49.025 1.00 37.81  ? 109 HIS B O   1 
ATOM   2034 C CB  . HIS B 1 114 ? -11.381 25.184 46.997 1.00 40.00  ? 109 HIS B CB  1 
ATOM   2035 C CG  . HIS B 1 114 ? -12.590 25.896 46.483 1.00 46.67  ? 109 HIS B CG  1 
ATOM   2036 N ND1 . HIS B 1 114 ? -12.888 25.983 45.140 1.00 54.03  ? 109 HIS B ND1 1 
ATOM   2037 C CD2 . HIS B 1 114 ? -13.580 26.553 47.131 1.00 52.71  ? 109 HIS B CD2 1 
ATOM   2038 C CE1 . HIS B 1 114 ? -14.007 26.664 44.984 1.00 55.70  ? 109 HIS B CE1 1 
ATOM   2039 N NE2 . HIS B 1 114 ? -14.447 27.024 46.176 1.00 58.19  ? 109 HIS B NE2 1 
ATOM   2040 N N   . SER B 1 115 ? -7.884  25.329 47.595 1.00 34.00  ? 110 SER B N   1 
ATOM   2041 C CA  . SER B 1 115 ? -6.809  24.550 48.227 1.00 35.19  ? 110 SER B CA  1 
ATOM   2042 C C   . SER B 1 115 ? -7.194  23.079 48.353 1.00 38.85  ? 110 SER B C   1 
ATOM   2043 O O   . SER B 1 115 ? -6.927  22.434 49.364 1.00 36.29  ? 110 SER B O   1 
ATOM   2044 C CB  . SER B 1 115 ? -6.457  25.124 49.602 1.00 37.78  ? 110 SER B CB  1 
ATOM   2045 O OG  . SER B 1 115 ? -6.321  26.538 49.538 1.00 36.19  ? 110 SER B OG  1 
ATOM   2046 N N   . ASP B 1 116 ? -7.836  22.569 47.310 1.00 36.42  ? 111 ASP B N   1 
ATOM   2047 C CA  . ASP B 1 116 ? -8.308  21.192 47.256 1.00 35.28  ? 111 ASP B CA  1 
ATOM   2048 C C   . ASP B 1 116 ? -7.129  20.224 47.314 1.00 33.30  ? 111 ASP B C   1 
ATOM   2049 O O   . ASP B 1 116 ? -6.331  20.137 46.375 1.00 32.57  ? 111 ASP B O   1 
ATOM   2050 C CB  . ASP B 1 116 ? -9.135  20.984 45.978 1.00 41.78  ? 111 ASP B CB  1 
ATOM   2051 C CG  . ASP B 1 116 ? -9.830  19.632 45.927 1.00 44.91  ? 111 ASP B CG  1 
ATOM   2052 O OD1 . ASP B 1 116 ? -9.159  18.596 46.092 1.00 38.06  ? 111 ASP B OD1 1 
ATOM   2053 O OD2 . ASP B 1 116 ? -11.059 19.611 45.694 1.00 53.00  1 111 ASP B OD2 1 
ATOM   2054 N N   . ALA B 1 117 ? -7.025  19.500 48.421 1.00 31.59  ? 112 ALA B N   1 
ATOM   2055 C CA  . ALA B 1 117 ? -5.906  18.593 48.637 1.00 34.85  ? 112 ALA B CA  1 
ATOM   2056 C C   . ALA B 1 117 ? -5.927  17.378 47.706 1.00 32.88  ? 112 ALA B C   1 
ATOM   2057 O O   . ALA B 1 117 ? -4.878  16.884 47.317 1.00 31.11  ? 112 ALA B O   1 
ATOM   2058 C CB  . ALA B 1 117 ? -5.882  18.143 50.083 1.00 32.15  ? 112 ALA B CB  1 
ATOM   2059 N N   . ALA B 1 118 ? -7.110  16.883 47.361 1.00 32.47  ? 113 ALA B N   1 
ATOM   2060 C CA  . ALA B 1 118 ? -7.207  15.760 46.431 1.00 34.66  ? 113 ALA B CA  1 
ATOM   2061 C C   . ALA B 1 118 ? -6.615  16.107 45.052 1.00 38.49  ? 113 ALA B C   1 
ATOM   2062 O O   . ALA B 1 118 ? -5.860  15.321 44.456 1.00 30.69  ? 113 ALA B O   1 
ATOM   2063 C CB  . ALA B 1 118 ? -8.669  15.316 46.299 1.00 37.87  ? 113 ALA B CB  1 
ATOM   2064 N N   . GLU B 1 119 ? -6.936  17.289 44.543 1.00 32.47  ? 114 GLU B N   1 
ATOM   2065 C CA  . GLU B 1 119 ? -6.365  17.716 43.269 1.00 28.47  ? 114 GLU B CA  1 
ATOM   2066 C C   . GLU B 1 119 ? -4.873  17.967 43.397 1.00 28.23  ? 114 GLU B C   1 
ATOM   2067 O O   . GLU B 1 119 ? -4.097  17.634 42.505 1.00 27.39  ? 114 GLU B O   1 
ATOM   2068 C CB  . GLU B 1 119 ? -7.062  18.978 42.756 1.00 29.81  ? 114 GLU B CB  1 
ATOM   2069 C CG  . GLU B 1 119 ? -8.550  18.804 42.526 1.00 36.29  ? 114 GLU B CG  1 
ATOM   2070 C CD  . GLU B 1 119 ? -8.878  17.647 41.591 1.00 43.44  ? 114 GLU B CD  1 
ATOM   2071 O OE1 . GLU B 1 119 ? -8.132  17.427 40.615 1.00 35.05  ? 114 GLU B OE1 1 
ATOM   2072 O OE2 . GLU B 1 119 ? -9.891  16.954 41.836 1.00 46.11  1 114 GLU B OE2 1 
ATOM   2073 N N   . LEU B 1 120 ? -4.463  18.567 44.506 1.00 28.72  ? 115 LEU B N   1 
ATOM   2074 C CA  . LEU B 1 120 ? -3.045  18.840 44.689 1.00 26.01  ? 115 LEU B CA  1 
ATOM   2075 C C   . LEU B 1 120 ? -2.273  17.519 44.708 1.00 28.08  ? 115 LEU B C   1 
ATOM   2076 O O   . LEU B 1 120 ? -1.188  17.422 44.155 1.00 25.54  ? 115 LEU B O   1 
ATOM   2077 C CB  . LEU B 1 120 ? -2.799  19.630 45.977 1.00 28.26  ? 115 LEU B CB  1 
ATOM   2078 C CG  . LEU B 1 120 ? -1.315  19.855 46.286 1.00 39.69  ? 115 LEU B CG  1 
ATOM   2079 C CD1 . LEU B 1 120 ? -0.670  20.742 45.212 1.00 29.91  ? 115 LEU B CD1 1 
ATOM   2080 C CD2 . LEU B 1 120 ? -1.143  20.451 47.673 1.00 36.94  ? 115 LEU B CD2 1 
ATOM   2081 N N   . GLY B 1 121 ? -2.850  16.499 45.336 1.00 28.97  ? 116 GLY B N   1 
ATOM   2082 C CA  . GLY B 1 121 ? -2.206  15.196 45.378 1.00 23.83  ? 116 GLY B CA  1 
ATOM   2083 C C   . GLY B 1 121 ? -2.007  14.618 43.982 1.00 24.52  ? 116 GLY B C   1 
ATOM   2084 O O   . GLY B 1 121 ? -0.982  13.995 43.702 1.00 25.62  ? 116 GLY B O   1 
ATOM   2085 N N   . ARG B 1 122 ? -2.987  14.823 43.106 1.00 25.31  ? 117 ARG B N   1 
ATOM   2086 C CA  . ARG B 1 122 ? -2.851  14.386 41.709 1.00 22.19  ? 117 ARG B CA  1 
ATOM   2087 C C   . ARG B 1 122 ? -1.695  15.110 41.029 1.00 23.90  ? 117 ARG B C   1 
ATOM   2088 O O   . ARG B 1 122 ? -0.969  14.523 40.236 1.00 29.52  ? 117 ARG B O   1 
ATOM   2089 C CB  . ARG B 1 122 ? -4.133  14.642 40.914 1.00 37.62  ? 117 ARG B CB  1 
ATOM   2090 C CG  . ARG B 1 122 ? -5.342  13.855 41.373 1.00 43.91  ? 117 ARG B CG  1 
ATOM   2091 C CD  . ARG B 1 122 ? -6.554  14.163 40.505 1.00 51.93  ? 117 ARG B CD  1 
ATOM   2092 N NE  . ARG B 1 122 ? -7.740  13.443 40.957 1.00 60.70  ? 117 ARG B NE  1 
ATOM   2093 C CZ  . ARG B 1 122 ? -8.009  12.180 40.645 1.00 74.90  ? 117 ARG B CZ  1 
ATOM   2094 N NH1 . ARG B 1 122 ? -7.170  11.489 39.883 1.00 78.61  1 117 ARG B NH1 1 
ATOM   2095 N NH2 . ARG B 1 122 ? -9.113  11.604 41.099 1.00 77.61  ? 117 ARG B NH2 1 
ATOM   2096 N N   . MET B 1 123 ? -1.563  16.403 41.309 1.00 22.64  ? 118 MET B N   1 
ATOM   2097 C CA  . MET B 1 123 ? -0.493  17.205 40.722 1.00 23.96  ? 118 MET B CA  1 
ATOM   2098 C C   . MET B 1 123 ? 0.863   16.739 41.234 1.00 30.87  ? 118 MET B C   1 
ATOM   2099 O O   . MET B 1 123 ? 1.826   16.612 40.470 1.00 23.93  ? 118 MET B O   1 
ATOM   2100 C CB  . MET B 1 123 ? -0.697  18.685 41.041 1.00 24.85  ? 118 MET B CB  1 
ATOM   2101 C CG  . MET B 1 123 ? 0.193   19.608 40.236 1.00 33.82  ? 118 MET B CG  1 
ATOM   2102 S SD  . MET B 1 123 ? -0.659  21.178 40.001 1.00 40.03  ? 118 MET B SD  1 
ATOM   2103 C CE  . MET B 1 123 ? 0.389   21.944 38.781 1.00 40.37  ? 118 MET B CE  1 
ATOM   2104 N N   . LEU B 1 124 ? 0.941   16.485 42.537 1.00 25.17  ? 119 LEU B N   1 
ATOM   2105 C CA  . LEU B 1 124 ? 2.192   15.985 43.107 1.00 23.88  ? 119 LEU B CA  1 
ATOM   2106 C C   . LEU B 1 124 ? 2.579   14.615 42.529 1.00 23.82  ? 119 LEU B C   1 
ATOM   2107 O O   . LEU B 1 124 ? 3.766   14.334 42.344 1.00 21.65  ? 119 LEU B O   1 
ATOM   2108 C CB  . LEU B 1 124 ? 2.096   15.914 44.642 1.00 21.26  ? 119 LEU B CB  1 
ATOM   2109 C CG  . LEU B 1 124 ? 1.916   17.263 45.354 1.00 24.89  ? 119 LEU B CG  1 
ATOM   2110 C CD1 . LEU B 1 124 ? 1.934   17.083 46.903 1.00 24.92  ? 119 LEU B CD1 1 
ATOM   2111 C CD2 . LEU B 1 124 ? 2.961   18.279 44.913 1.00 26.86  ? 119 LEU B CD2 1 
ATOM   2112 N N   A GLN B 1 125 ? 1.580   13.778 42.254 0.47 22.27  ? 120 GLN B N   1 
ATOM   2113 N N   B GLN B 1 125 ? 1.591   13.783 42.218 0.53 22.32  ? 120 GLN B N   1 
ATOM   2114 C CA  A GLN B 1 125 ? 1.799   12.486 41.600 0.47 23.57  ? 120 GLN B CA  1 
ATOM   2115 C CA  B GLN B 1 125 ? 1.866   12.473 41.628 0.53 22.89  ? 120 GLN B CA  1 
ATOM   2116 C C   A GLN B 1 125 ? 2.503   12.668 40.260 0.47 21.75  ? 120 GLN B C   1 
ATOM   2117 C C   B GLN B 1 125 ? 2.451   12.608 40.215 0.53 21.75  ? 120 GLN B C   1 
ATOM   2118 O O   A GLN B 1 125 ? 3.446   11.943 39.929 0.47 25.57  ? 120 GLN B O   1 
ATOM   2119 O O   B GLN B 1 125 ? 3.283   11.798 39.799 0.53 22.71  ? 120 GLN B O   1 
ATOM   2120 C CB  A GLN B 1 125 ? 0.476   11.754 41.358 0.47 22.52  ? 120 GLN B CB  1 
ATOM   2121 C CB  B GLN B 1 125 ? 0.595   11.619 41.593 0.53 25.83  ? 120 GLN B CB  1 
ATOM   2122 C CG  A GLN B 1 125 ? -0.146  11.061 42.555 0.47 28.23  ? 120 GLN B CG  1 
ATOM   2123 C CG  B GLN B 1 125 ? 0.762   10.299 40.865 0.53 30.36  ? 120 GLN B CG  1 
ATOM   2124 C CD  A GLN B 1 125 ? -1.456  10.385 42.175 0.47 37.74  ? 120 GLN B CD  1 
ATOM   2125 C CD  B GLN B 1 125 ? -0.312  9.285  41.212 0.53 37.70  ? 120 GLN B CD  1 
ATOM   2126 O OE1 A GLN B 1 125 ? -2.534  10.949 42.360 0.47 38.16  ? 120 GLN B OE1 1 
ATOM   2127 O OE1 B GLN B 1 125 ? -1.117  9.500  42.120 0.53 42.91  ? 120 GLN B OE1 1 
ATOM   2128 N NE2 A GLN B 1 125 ? -1.363  9.183  41.619 0.47 41.40  ? 120 GLN B NE2 1 
ATOM   2129 N NE2 B GLN B 1 125 ? -0.326  8.168  40.491 0.53 36.87  ? 120 GLN B NE2 1 
ATOM   2130 N N   . LEU B 1 126 ? 2.007   13.626 39.482 1.00 23.06  ? 121 LEU B N   1 
ATOM   2131 C CA  . LEU B 1 126 ? 2.589   13.939 38.188 1.00 25.81  ? 121 LEU B CA  1 
ATOM   2132 C C   . LEU B 1 126 ? 4.034   14.348 38.351 1.00 22.84  ? 121 LEU B C   1 
ATOM   2133 O O   . LEU B 1 126 ? 4.883   13.942 37.566 1.00 24.53  ? 121 LEU B O   1 
ATOM   2134 C CB  . LEU B 1 126 ? 1.825   15.065 37.475 1.00 25.49  ? 121 LEU B CB  1 
ATOM   2135 C CG  . LEU B 1 126 ? 0.480   14.662 36.877 1.00 33.54  ? 121 LEU B CG  1 
ATOM   2136 C CD1 . LEU B 1 126 ? -0.191  15.863 36.232 1.00 32.85  ? 121 LEU B CD1 1 
ATOM   2137 C CD2 . LEU B 1 126 ? 0.684   13.554 35.848 1.00 35.98  ? 121 LEU B CD2 1 
ATOM   2138 N N   . ILE B 1 127 ? 4.310   15.164 39.364 1.00 20.50  ? 122 ILE B N   1 
ATOM   2139 C CA  . ILE B 1 127 ? 5.674   15.639 39.576 1.00 23.74  ? 122 ILE B CA  1 
ATOM   2140 C C   . ILE B 1 127 ? 6.577   14.463 39.973 1.00 21.58  ? 122 ILE B C   1 
ATOM   2141 O O   . ILE B 1 127 ? 7.698   14.351 39.485 1.00 23.12  ? 122 ILE B O   1 
ATOM   2142 C CB  . ILE B 1 127 ? 5.697   16.779 40.617 1.00 23.57  ? 122 ILE B CB  1 
ATOM   2143 C CG1 . ILE B 1 127 ? 4.937   17.995 40.050 1.00 24.02  ? 122 ILE B CG1 1 
ATOM   2144 C CG2 . ILE B 1 127 ? 7.122   17.166 40.975 1.00 23.57  ? 122 ILE B CG2 1 
ATOM   2145 C CD1 . ILE B 1 127 ? 4.890   19.198 40.988 1.00 28.64  ? 122 ILE B CD1 1 
ATOM   2146 N N   . LEU B 1 128 ? 6.087   13.579 40.842 1.00 21.99  ? 123 LEU B N   1 
ATOM   2147 C CA  . LEU B 1 128 ? 6.824   12.360 41.161 1.00 23.02  ? 123 LEU B CA  1 
ATOM   2148 C C   . LEU B 1 128 ? 7.040   11.509 39.911 1.00 23.24  ? 123 LEU B C   1 
ATOM   2149 O O   . LEU B 1 128 ? 8.097   10.912 39.741 1.00 22.18  ? 123 LEU B O   1 
ATOM   2150 C CB  . LEU B 1 128 ? 6.106   11.560 42.256 1.00 23.88  ? 123 LEU B CB  1 
ATOM   2151 C CG  . LEU B 1 128 ? 6.972   10.503 42.955 1.00 27.57  ? 123 LEU B CG  1 
ATOM   2152 C CD1 . LEU B 1 128 ? 6.533   10.334 44.405 1.00 28.87  ? 123 LEU B CD1 1 
ATOM   2153 C CD2 . LEU B 1 128 ? 6.894   9.187  42.218 1.00 28.64  ? 123 LEU B CD2 1 
ATOM   2154 N N   . GLY B 1 129 ? 6.050   11.465 39.030 1.00 22.66  ? 124 GLY B N   1 
ATOM   2155 C CA  . GLY B 1 129 ? 6.218   10.824 37.732 1.00 26.63  ? 124 GLY B CA  1 
ATOM   2156 C C   . GLY B 1 129 ? 7.390   11.356 36.930 1.00 26.05  ? 124 GLY B C   1 
ATOM   2157 O O   . GLY B 1 129 ? 8.152   10.579 36.357 1.00 26.51  ? 124 GLY B O   1 
ATOM   2158 N N   . CYS B 1 130 ? 7.550   12.675 36.893 1.00 25.78  ? 125 CYS B N   1 
ATOM   2159 C CA  . CYS B 1 130 ? 8.706   13.281 36.234 1.00 21.91  ? 125 CYS B CA  1 
ATOM   2160 C C   . CYS B 1 130 ? 10.014  12.866 36.905 1.00 24.61  ? 125 CYS B C   1 
ATOM   2161 O O   . CYS B 1 130 ? 10.990  12.539 36.235 1.00 26.85  ? 125 CYS B O   1 
ATOM   2162 C CB  . CYS B 1 130 ? 8.600   14.810 36.222 1.00 29.57  ? 125 CYS B CB  1 
ATOM   2163 S SG  . CYS B 1 130 ? 7.195   15.463 35.293 1.00 28.00  ? 125 CYS B SG  1 
ATOM   2164 N N   . ALA B 1 131 ? 10.029  12.893 38.231 1.00 24.92  ? 126 ALA B N   1 
ATOM   2165 C CA  . ALA B 1 131 ? 11.234  12.531 38.976 1.00 22.05  ? 126 ALA B CA  1 
ATOM   2166 C C   . ALA B 1 131 ? 11.675  11.092 38.711 1.00 23.54  ? 126 ALA B C   1 
ATOM   2167 O O   . ALA B 1 131 ? 12.871  10.833 38.560 1.00 26.00  ? 126 ALA B O   1 
ATOM   2168 C CB  . ALA B 1 131 ? 11.003  12.737 40.476 1.00 20.92  ? 126 ALA B CB  1 
ATOM   2169 N N   . VAL B 1 132 ? 10.737  10.141 38.673 1.00 22.59  ? 127 VAL B N   1 
ATOM   2170 C CA  . VAL B 1 132 ? 11.171  8.745  38.577 1.00 21.07  ? 127 VAL B CA  1 
ATOM   2171 C C   . VAL B 1 132 ? 11.296  8.297  37.123 1.00 27.28  ? 127 VAL B C   1 
ATOM   2172 O O   . VAL B 1 132 ? 11.608  7.136  36.843 1.00 26.17  ? 127 VAL B O   1 
ATOM   2173 C CB  . VAL B 1 132 ? 10.228  7.778  39.362 1.00 24.51  ? 127 VAL B CB  1 
ATOM   2174 C CG1 . VAL B 1 132 ? 10.228  8.144  40.837 1.00 24.81  ? 127 VAL B CG1 1 
ATOM   2175 C CG2 . VAL B 1 132 ? 8.822   7.788  38.800 1.00 25.52  ? 127 VAL B CG2 1 
ATOM   2176 N N   . ASN B 1 133 ? 11.093  9.225  36.192 1.00 22.99  ? 128 ASN B N   1 
ATOM   2177 C CA  . ASN B 1 133 ? 11.271  8.913  34.775 1.00 23.69  ? 128 ASN B CA  1 
ATOM   2178 C C   . ASN B 1 133 ? 12.333  9.754  34.083 1.00 24.65  ? 128 ASN B C   1 
ATOM   2179 O O   . ASN B 1 133 ? 12.672  9.495  32.936 1.00 28.63  ? 128 ASN B O   1 
ATOM   2180 C CB  . ASN B 1 133 ? 9.949   9.067  34.033 1.00 29.46  ? 128 ASN B CB  1 
ATOM   2181 C CG  . ASN B 1 133 ? 9.031   7.898  34.277 1.00 35.02  ? 128 ASN B CG  1 
ATOM   2182 O OD1 . ASN B 1 133 ? 9.288   6.802  33.799 1.00 34.06  ? 128 ASN B OD1 1 
ATOM   2183 N ND2 . ASN B 1 133 ? 7.989   8.110  35.064 1.00 28.81  ? 128 ASN B ND2 1 
ATOM   2184 N N   . CYS B 1 134 ? 12.865  10.746 34.795 1.00 28.39  ? 129 CYS B N   1 
ATOM   2185 C CA  . CYS B 1 134 ? 13.832  11.658 34.214 1.00 27.13  ? 129 CYS B CA  1 
ATOM   2186 C C   . CYS B 1 134 ? 15.220  11.021 34.140 1.00 28.17  ? 129 CYS B C   1 
ATOM   2187 O O   . CYS B 1 134 ? 15.431  9.899  34.603 1.00 27.53  ? 129 CYS B O   1 
ATOM   2188 C CB  . CYS B 1 134 ? 13.889  12.971 35.002 1.00 27.21  ? 129 CYS B CB  1 
ATOM   2189 S SG  . CYS B 1 134 ? 14.660  12.894 36.653 1.00 28.19  ? 129 CYS B SG  1 
ATOM   2190 N N   . GLU B 1 135 ? 16.158  11.745 33.541 1.00 30.21  ? 130 GLU B N   1 
ATOM   2191 C CA  . GLU B 1 135 ? 17.535  11.265 33.423 1.00 33.70  ? 130 GLU B CA  1 
ATOM   2192 C C   . GLU B 1 135 ? 18.146  10.899 34.770 1.00 33.38  ? 130 GLU B C   1 
ATOM   2193 O O   . GLU B 1 135 ? 18.913  9.936  34.877 1.00 32.71  ? 130 GLU B O   1 
ATOM   2194 C CB  . GLU B 1 135 ? 18.402  12.325 32.739 1.00 37.71  ? 130 GLU B CB  1 
ATOM   2195 C CG  . GLU B 1 135 ? 19.776  11.842 32.346 1.00 56.45  ? 130 GLU B CG  1 
ATOM   2196 C CD  . GLU B 1 135 ? 20.287  12.548 31.106 1.00 73.63  ? 130 GLU B CD  1 
ATOM   2197 O OE1 . GLU B 1 135 ? 19.601  12.493 30.065 1.00 72.21  ? 130 GLU B OE1 1 
ATOM   2198 O OE2 . GLU B 1 135 ? 21.370  13.165 31.175 1.00 84.64  1 130 GLU B OE2 1 
ATOM   2199 N N   . GLN B 1 136 ? 17.818  11.678 35.793 1.00 27.53  ? 131 GLN B N   1 
ATOM   2200 C CA  . GLN B 1 136 ? 18.317  11.429 37.153 1.00 27.42  ? 131 GLN B CA  1 
ATOM   2201 C C   . GLN B 1 136 ? 17.465  10.458 37.965 1.00 27.12  ? 131 GLN B C   1 
ATOM   2202 O O   . GLN B 1 136 ? 17.551  10.456 39.196 1.00 29.35  ? 131 GLN B O   1 
ATOM   2203 C CB  . GLN B 1 136 ? 18.391  12.739 37.949 1.00 34.01  ? 131 GLN B CB  1 
ATOM   2204 C CG  . GLN B 1 136 ? 19.173  13.885 37.320 1.00 41.71  ? 131 GLN B CG  1 
ATOM   2205 C CD  . GLN B 1 136 ? 19.113  15.148 38.184 1.00 48.75  ? 131 GLN B CD  1 
ATOM   2206 O OE1 . GLN B 1 136 ? 18.071  15.808 38.283 1.00 42.98  ? 131 GLN B OE1 1 
ATOM   2207 N NE2 . GLN B 1 136 ? 20.227  15.476 38.826 1.00 45.38  ? 131 GLN B NE2 1 
ATOM   2208 N N   . LYS B 1 137 ? 16.632  9.657  37.314 1.00 27.51  ? 132 LYS B N   1 
ATOM   2209 C CA  . LYS B 1 137 ? 15.623  8.879  38.054 1.00 24.58  ? 132 LYS B CA  1 
ATOM   2210 C C   . LYS B 1 137 ? 16.196  7.944  39.126 1.00 29.86  ? 132 LYS B C   1 
ATOM   2211 O O   . LYS B 1 137 ? 15.549  7.698  40.151 1.00 25.32  ? 132 LYS B O   1 
ATOM   2212 C CB  . LYS B 1 137 ? 14.769  8.065  37.085 1.00 29.96  ? 132 LYS B CB  1 
ATOM   2213 C CG  . LYS B 1 137 ? 15.550  7.082  36.222 1.00 29.00  ? 132 LYS B CG  1 
ATOM   2214 C CD  . LYS B 1 137 ? 14.614  6.501  35.171 1.00 37.98  ? 132 LYS B CD  1 
ATOM   2215 C CE  . LYS B 1 137 ? 15.279  5.475  34.276 1.00 47.33  ? 132 LYS B CE  1 
ATOM   2216 N NZ  . LYS B 1 137 ? 14.297  4.949  33.282 1.00 46.86  1 132 LYS B NZ  1 
ATOM   2217 N N   . GLN B 1 138 ? 17.398  7.421  38.910 1.00 28.37  ? 133 GLN B N   1 
ATOM   2218 C CA  . GLN B 1 138 ? 17.969  6.542  39.924 1.00 30.21  ? 133 GLN B CA  1 
ATOM   2219 C C   . GLN B 1 138 ? 18.222  7.299  41.219 1.00 28.55  ? 133 GLN B C   1 
ATOM   2220 O O   . GLN B 1 138 ? 18.010  6.749  42.288 1.00 27.88  ? 133 GLN B O   1 
ATOM   2221 C CB  . GLN B 1 138 ? 19.258  5.885  39.438 1.00 31.54  ? 133 GLN B CB  1 
ATOM   2222 C CG  . GLN B 1 138 ? 19.029  4.796  38.391 1.00 38.21  ? 133 GLN B CG  1 
ATOM   2223 C CD  . GLN B 1 138 ? 18.369  3.535  38.952 1.00 53.05  ? 133 GLN B CD  1 
ATOM   2224 O OE1 . GLN B 1 138 ? 18.109  3.428  40.151 1.00 46.78  ? 133 GLN B OE1 1 
ATOM   2225 N NE2 . GLN B 1 138 ? 18.108  2.568  38.076 1.00 52.07  ? 133 GLN B NE2 1 
ATOM   2226 N N   . GLU B 1 139 ? 18.674  8.549  41.120 1.00 25.95  ? 134 GLU B N   1 
ATOM   2227 C CA  . GLU B 1 139 ? 18.821  9.407  42.296 1.00 23.47  ? 134 GLU B CA  1 
ATOM   2228 C C   . GLU B 1 139 ? 17.500  9.590  43.048 1.00 23.91  ? 134 GLU B C   1 
ATOM   2229 O O   . GLU B 1 139 ? 17.461  9.509  44.286 1.00 25.69  ? 134 GLU B O   1 
ATOM   2230 C CB  . GLU B 1 139 ? 19.376  10.783 41.914 1.00 35.12  ? 134 GLU B CB  1 
ATOM   2231 C CG  . GLU B 1 139 ? 19.348  11.782 43.073 1.00 45.23  ? 134 GLU B CG  1 
ATOM   2232 C CD  . GLU B 1 139 ? 19.645  13.218 42.658 1.00 61.18  ? 134 GLU B CD  1 
ATOM   2233 O OE1 . GLU B 1 139 ? 20.087  13.437 41.509 1.00 68.83  ? 134 GLU B OE1 1 
ATOM   2234 O OE2 . GLU B 1 139 ? 19.436  14.128 43.494 1.00 59.32  1 134 GLU B OE2 1 
ATOM   2235 N N   . TYR B 1 140 ? 16.416  9.835  42.315 1.00 23.38  ? 135 TYR B N   1 
ATOM   2236 C CA  . TYR B 1 140 ? 15.149  10.100 42.980 1.00 23.36  ? 135 TYR B CA  1 
ATOM   2237 C C   . TYR B 1 140 ? 14.506  8.832  43.533 1.00 21.00  ? 135 TYR B C   1 
ATOM   2238 O O   . TYR B 1 140 ? 13.902  8.853  44.603 1.00 22.69  ? 135 TYR B O   1 
ATOM   2239 C CB  . TYR B 1 140 ? 14.203  10.848 42.027 1.00 22.38  ? 135 TYR B CB  1 
ATOM   2240 C CG  . TYR B 1 140 ? 14.754  12.228 41.762 1.00 23.67  ? 135 TYR B CG  1 
ATOM   2241 C CD1 . TYR B 1 140 ? 14.850  13.151 42.787 1.00 30.56  ? 135 TYR B CD1 1 
ATOM   2242 C CD2 . TYR B 1 140 ? 15.240  12.582 40.511 1.00 26.59  ? 135 TYR B CD2 1 
ATOM   2243 C CE1 . TYR B 1 140 ? 15.396  14.407 42.576 1.00 37.98  ? 135 TYR B CE1 1 
ATOM   2244 C CE2 . TYR B 1 140 ? 15.769  13.848 40.285 1.00 30.36  ? 135 TYR B CE2 1 
ATOM   2245 C CZ  . TYR B 1 140 ? 15.850  14.749 41.327 1.00 36.11  ? 135 TYR B CZ  1 
ATOM   2246 O OH  . TYR B 1 140 ? 16.381  16.005 41.129 1.00 33.83  ? 135 TYR B OH  1 
ATOM   2247 N N   . ILE B 1 141 ? 14.677  7.713  42.842 1.00 26.07  ? 136 ILE B N   1 
ATOM   2248 C CA  . ILE B 1 141 ? 14.249  6.424  43.398 1.00 24.59  ? 136 ILE B CA  1 
ATOM   2249 C C   . ILE B 1 141 ? 15.031  6.064  44.663 1.00 27.26  ? 136 ILE B C   1 
ATOM   2250 O O   . ILE B 1 141 ? 14.458  5.582  45.658 1.00 24.11  ? 136 ILE B O   1 
ATOM   2251 C CB  . ILE B 1 141 ? 14.393  5.299  42.350 1.00 29.43  ? 136 ILE B CB  1 
ATOM   2252 C CG1 . ILE B 1 141 ? 13.319  5.471  41.282 1.00 30.40  ? 136 ILE B CG1 1 
ATOM   2253 C CG2 . ILE B 1 141 ? 14.269  3.926  43.012 1.00 29.74  ? 136 ILE B CG2 1 
ATOM   2254 C CD1 . ILE B 1 141 ? 11.929  5.123  41.806 1.00 39.00  ? 136 ILE B CD1 1 
ATOM   2255 N N   . GLN B 1 142 ? 16.338  6.310  44.649 1.00 26.00  ? 137 GLN B N   1 
ATOM   2256 C CA  . GLN B 1 142 ? 17.130  6.084  45.854 1.00 25.44  ? 137 GLN B CA  1 
ATOM   2257 C C   . GLN B 1 142 ? 16.626  6.939  47.012 1.00 26.30  ? 137 GLN B C   1 
ATOM   2258 O O   . GLN B 1 142 ? 16.579  6.477  48.156 1.00 26.54  ? 137 GLN B O   1 
ATOM   2259 C CB  . GLN B 1 142 ? 18.614  6.369  45.587 1.00 29.71  ? 137 GLN B CB  1 
ATOM   2260 C CG  . GLN B 1 142 ? 19.507  6.110  46.781 1.00 35.53  ? 137 GLN B CG  1 
ATOM   2261 C CD  . GLN B 1 142 ? 19.505  4.648  47.205 1.00 52.31  ? 137 GLN B CD  1 
ATOM   2262 O OE1 . GLN B 1 142 ? 19.450  4.337  48.393 1.00 60.80  ? 137 GLN B OE1 1 
ATOM   2263 N NE2 . GLN B 1 142 ? 19.569  3.746  46.230 1.00 66.44  ? 137 GLN B NE2 1 
ATOM   2264 N N   . ALA B 1 143 ? 16.232  8.175  46.718 1.00 25.14  ? 138 ALA B N   1 
ATOM   2265 C CA  . ALA B 1 143 ? 15.773  9.098  47.742 1.00 26.58  ? 138 ALA B CA  1 
ATOM   2266 C C   . ALA B 1 143 ? 14.458  8.619  48.342 1.00 24.12  ? 138 ALA B C   1 
ATOM   2267 O O   . ALA B 1 143 ? 14.244  8.728  49.558 1.00 25.05  ? 138 ALA B O   1 
ATOM   2268 C CB  . ALA B 1 143 ? 15.617  10.508 47.178 1.00 26.66  ? 138 ALA B CB  1 
ATOM   2269 N N   . ILE B 1 144 ? 13.586  8.076  47.494 1.00 20.93  ? 139 ILE B N   1 
ATOM   2270 C CA  . ILE B 1 144 ? 12.306  7.544  47.961 1.00 22.68  ? 139 ILE B CA  1 
ATOM   2271 C C   . ILE B 1 144 ? 12.534  6.331  48.860 1.00 27.28  ? 139 ILE B C   1 
ATOM   2272 O O   . ILE B 1 144 ? 11.924  6.218  49.931 1.00 23.04  ? 139 ILE B O   1 
ATOM   2273 C CB  . ILE B 1 144 ? 11.372  7.169  46.774 1.00 23.59  ? 139 ILE B CB  1 
ATOM   2274 C CG1 . ILE B 1 144 ? 10.781  8.441  46.159 1.00 27.70  ? 139 ILE B CG1 1 
ATOM   2275 C CG2 . ILE B 1 144 ? 10.247  6.237  47.258 1.00 26.52  ? 139 ILE B CG2 1 
ATOM   2276 C CD1 . ILE B 1 144 ? 10.296  8.255  44.716 1.00 27.17  ? 139 ILE B CD1 1 
ATOM   2277 N N   . MET B 1 145 ? 13.432  5.434  48.465 1.00 24.13  ? 140 MET B N   1 
ATOM   2278 C CA  . MET B 1 145 ? 13.716  4.289  49.327 1.00 26.22  ? 140 MET B CA  1 
ATOM   2279 C C   . MET B 1 145 ? 14.415  4.721  50.617 1.00 25.98  ? 140 MET B C   1 
ATOM   2280 O O   . MET B 1 145 ? 14.289  4.056  51.657 1.00 26.21  ? 140 MET B O   1 
ATOM   2281 C CB  . MET B 1 145 ? 14.545  3.235  48.599 1.00 28.45  ? 140 MET B CB  1 
ATOM   2282 C CG  . MET B 1 145 ? 13.780  2.517  47.484 1.00 25.77  ? 140 MET B CG  1 
ATOM   2283 S SD  . MET B 1 145 ? 12.123  1.917  47.908 1.00 32.54  ? 140 MET B SD  1 
ATOM   2284 C CE  . MET B 1 145 ? 12.481  0.694  49.177 1.00 34.75  ? 140 MET B CE  1 
ATOM   2285 N N   . MET B 1 146 ? 15.132  5.838  50.584 1.00 23.60  ? 141 MET B N   1 
ATOM   2286 C CA  . MET B 1 146 ? 15.739  6.336  51.823 1.00 29.21  ? 141 MET B CA  1 
ATOM   2287 C C   . MET B 1 146 ? 14.698  6.895  52.802 1.00 21.43  ? 141 MET B C   1 
ATOM   2288 O O   . MET B 1 146 ? 14.956  6.947  53.998 1.00 25.24  ? 141 MET B O   1 
ATOM   2289 C CB  . MET B 1 146 ? 16.803  7.389  51.520 1.00 29.10  ? 141 MET B CB  1 
ATOM   2290 C CG  . MET B 1 146 ? 18.093  6.786  50.974 1.00 42.32  ? 141 MET B CG  1 
ATOM   2291 S SD  . MET B 1 146 ? 18.840  5.608  52.128 1.00 54.57  ? 141 MET B SD  1 
ATOM   2292 C CE  . MET B 1 146 ? 20.289  5.100  51.231 1.00 72.77  ? 141 MET B CE  1 
ATOM   2293 N N   . MET B 1 147 ? 13.523  7.288  52.310 1.00 23.00  ? 142 MET B N   1 
ATOM   2294 C CA  . MET B 1 147 ? 12.407  7.666  53.179 1.00 23.46  ? 142 MET B CA  1 
ATOM   2295 C C   . MET B 1 147 ? 11.973  6.473  54.028 1.00 24.70  ? 142 MET B C   1 
ATOM   2296 O O   . MET B 1 147 ? 11.627  6.615  55.206 1.00 22.14  ? 142 MET B O   1 
ATOM   2297 C CB  . MET B 1 147 ? 11.204  8.188  52.367 1.00 23.98  ? 142 MET B CB  1 
ATOM   2298 C CG  . MET B 1 147 ? 11.457  9.484  51.619 1.00 27.01  ? 142 MET B CG  1 
ATOM   2299 S SD  . MET B 1 147 ? 10.013  9.939  50.619 1.00 27.32  ? 142 MET B SD  1 
ATOM   2300 C CE  . MET B 1 147 ? 8.948   10.640 51.866 1.00 28.46  ? 142 MET B CE  1 
ATOM   2301 N N   . GLU B 1 148 ? 12.014  5.284  53.441 1.00 23.46  ? 143 GLU B N   1 
ATOM   2302 C CA  . GLU B 1 148 ? 11.748  4.069  54.209 1.00 23.21  ? 143 GLU B CA  1 
ATOM   2303 C C   . GLU B 1 148 ? 12.776  3.854  55.306 1.00 25.71  ? 143 GLU B C   1 
ATOM   2304 O O   . GLU B 1 148 ? 12.424  3.523  56.438 1.00 24.34  ? 143 GLU B O   1 
ATOM   2305 C CB  . GLU B 1 148 ? 11.741  2.829  53.311 1.00 29.08  ? 143 GLU B CB  1 
ATOM   2306 C CG  . GLU B 1 148 ? 10.607  2.783  52.310 1.00 35.65  ? 143 GLU B CG  1 
ATOM   2307 C CD  . GLU B 1 148 ? 9.416   2.007  52.818 1.00 43.66  ? 143 GLU B CD  1 
ATOM   2308 O OE1 . GLU B 1 148 ? 9.317   1.792  54.052 1.00 36.04  ? 143 GLU B OE1 1 
ATOM   2309 O OE2 . GLU B 1 148 ? 8.588   1.601  51.976 1.00 40.67  1 143 GLU B OE2 1 
ATOM   2310 N N   . GLU B 1 149 ? 14.051  3.997  54.960 1.00 24.93  ? 144 GLU B N   1 
ATOM   2311 C CA  . GLU B 1 149 ? 15.119  3.823  55.942 1.00 26.58  ? 144 GLU B CA  1 
ATOM   2312 C C   . GLU B 1 149 ? 14.943  4.815  57.087 1.00 22.53  ? 144 GLU B C   1 
ATOM   2313 O O   . GLU B 1 149 ? 15.076  4.455  58.253 1.00 25.31  ? 144 GLU B O   1 
ATOM   2314 C CB  . GLU B 1 149 ? 16.495  4.009  55.291 1.00 29.30  ? 144 GLU B CB  1 
ATOM   2315 C CG  . GLU B 1 149 ? 16.832  2.985  54.236 1.00 47.33  ? 144 GLU B CG  1 
ATOM   2316 C CD  . GLU B 1 149 ? 18.323  2.921  53.951 1.00 61.04  ? 144 GLU B CD  1 
ATOM   2317 O OE1 . GLU B 1 149 ? 19.105  3.492  54.742 1.00 68.00  ? 144 GLU B OE1 1 
ATOM   2318 O OE2 . GLU B 1 149 ? 18.715  2.307  52.934 1.00 71.59  1 144 GLU B OE2 1 
ATOM   2319 N N   . SER B 1 150 ? 14.620  6.057  56.730 1.00 24.29  ? 145 SER B N   1 
ATOM   2320 C CA  . SER B 1 150 ? 14.439  7.130  57.704 1.00 25.71  ? 145 SER B CA  1 
ATOM   2321 C C   . SER B 1 150 ? 13.339  6.821  58.712 1.00 24.89  ? 145 SER B C   1 
ATOM   2322 O O   . SER B 1 150 ? 13.536  6.964  59.921 1.00 22.53  ? 145 SER B O   1 
ATOM   2323 C CB  . SER B 1 150 ? 14.129  8.445  56.981 1.00 29.88  ? 145 SER B CB  1 
ATOM   2324 O OG  . SER B 1 150 ? 13.937  9.485  57.916 1.00 30.56  ? 145 SER B OG  1 
ATOM   2325 N N   . VAL B 1 151 ? 12.178  6.378  58.233 1.00 20.54  ? 146 VAL B N   1 
ATOM   2326 C CA  . VAL B 1 151 ? 11.097  6.058  59.169 1.00 19.94  ? 146 VAL B CA  1 
ATOM   2327 C C   . VAL B 1 151 ? 11.495  4.918  60.113 1.00 26.03  ? 146 VAL B C   1 
ATOM   2328 O O   . VAL B 1 151 ? 11.142  4.928  61.297 1.00 22.56  ? 146 VAL B O   1 
ATOM   2329 C CB  . VAL B 1 151 ? 9.799   5.673  58.439 1.00 28.32  ? 146 VAL B CB  1 
ATOM   2330 C CG1 . VAL B 1 151 ? 8.738   5.263  59.452 1.00 35.29  ? 146 VAL B CG1 1 
ATOM   2331 C CG2 . VAL B 1 151 ? 9.308   6.846  57.651 1.00 32.87  ? 146 VAL B CG2 1 
ATOM   2332 N N   . GLN B 1 152 ? 12.236  3.940  59.609 1.00 25.79  ? 147 GLN B N   1 
ATOM   2333 C CA  . GLN B 1 152 ? 12.716  2.881  60.487 1.00 27.54  ? 147 GLN B CA  1 
ATOM   2334 C C   . GLN B 1 152 ? 13.585  3.404  61.635 1.00 23.40  ? 147 GLN B C   1 
ATOM   2335 O O   . GLN B 1 152 ? 13.628  2.799  62.717 1.00 22.46  ? 147 GLN B O   1 
ATOM   2336 C CB  . GLN B 1 152 ? 13.521  1.835  59.706 1.00 24.87  ? 147 GLN B CB  1 
ATOM   2337 C CG  . GLN B 1 152 ? 12.831  1.178  58.507 1.00 30.68  ? 147 GLN B CG  1 
ATOM   2338 C CD  . GLN B 1 152 ? 11.323  1.119  58.558 1.00 43.76  ? 147 GLN B CD  1 
ATOM   2339 O OE1 . GLN B 1 152 ? 10.651  1.524  57.602 1.00 55.76  ? 147 GLN B OE1 1 
ATOM   2340 N NE2 . GLN B 1 152 ? 10.777  0.579  59.639 1.00 44.63  ? 147 GLN B NE2 1 
ATOM   2341 N N   . HIS B 1 153 ? 14.309  4.498  61.402 1.00 28.18  ? 148 HIS B N   1 
ATOM   2342 C CA  . HIS B 1 153 ? 15.126  5.069  62.474 1.00 25.36  ? 148 HIS B CA  1 
ATOM   2343 C C   . HIS B 1 153 ? 14.240  5.653  63.565 1.00 22.59  ? 148 HIS B C   1 
ATOM   2344 O O   . HIS B 1 153 ? 14.537  5.528  64.744 1.00 24.29  ? 148 HIS B O   1 
ATOM   2345 C CB  . HIS B 1 153 ? 16.079  6.141  61.940 1.00 28.79  ? 148 HIS B CB  1 
ATOM   2346 C CG  . HIS B 1 153 ? 17.118  5.609  61.007 1.00 35.91  ? 148 HIS B CG  1 
ATOM   2347 N ND1 . HIS B 1 153 ? 17.625  4.332  61.108 1.00 46.62  ? 148 HIS B ND1 1 
ATOM   2348 C CD2 . HIS B 1 153 ? 17.726  6.174  59.936 1.00 36.05  ? 148 HIS B CD2 1 
ATOM   2349 C CE1 . HIS B 1 153 ? 18.510  4.136  60.146 1.00 51.36  ? 148 HIS B CE1 1 
ATOM   2350 N NE2 . HIS B 1 153 ? 18.592  5.238  59.423 1.00 41.84  ? 148 HIS B NE2 1 
ATOM   2351 N N   . VAL B 1 154 ? 13.139  6.278  63.157 1.00 24.29  ? 149 VAL B N   1 
ATOM   2352 C CA  . VAL B 1 154 ? 12.185  6.834  64.111 1.00 21.77  ? 149 VAL B CA  1 
ATOM   2353 C C   . VAL B 1 154 ? 11.563  5.706  64.932 1.00 21.84  ? 149 VAL B C   1 
ATOM   2354 O O   . VAL B 1 154 ? 11.471  5.791  66.163 1.00 22.53  ? 149 VAL B O   1 
ATOM   2355 C CB  . VAL B 1 154 ? 11.085  7.627  63.376 1.00 24.19  ? 149 VAL B CB  1 
ATOM   2356 C CG1 . VAL B 1 154 ? 10.033  8.145  64.363 1.00 24.31  ? 149 VAL B CG1 1 
ATOM   2357 C CG2 . VAL B 1 154 ? 11.715  8.777  62.573 1.00 21.97  ? 149 VAL B CG2 1 
ATOM   2358 N N   . VAL B 1 155 ? 11.137  4.648  64.241 1.00 22.25  ? 150 VAL B N   1 
ATOM   2359 C CA  . VAL B 1 155 ? 10.539  3.501  64.908 1.00 23.27  ? 150 VAL B CA  1 
ATOM   2360 C C   . VAL B 1 155 ? 11.513  2.837  65.889 1.00 23.27  ? 150 VAL B C   1 
ATOM   2361 O O   . VAL B 1 155 ? 11.142  2.522  67.032 1.00 22.53  ? 150 VAL B O   1 
ATOM   2362 C CB  . VAL B 1 155 ? 10.052  2.465  63.877 1.00 21.26  ? 150 VAL B CB  1 
ATOM   2363 C CG1 . VAL B 1 155 ? 9.647   1.174  64.567 1.00 26.33  ? 150 VAL B CG1 1 
ATOM   2364 C CG2 . VAL B 1 155 ? 8.897   3.033  63.064 1.00 21.44  ? 150 VAL B CG2 1 
ATOM   2365 N N   . MET B 1 156 ? 12.760  2.629  65.462 1.00 22.16  ? 151 MET B N   1 
ATOM   2366 C CA  . MET B 1 156 ? 13.734  2.011  66.365 1.00 23.98  ? 151 MET B CA  1 
ATOM   2367 C C   . MET B 1 156 ? 13.998  2.921  67.571 1.00 27.78  ? 151 MET B C   1 
ATOM   2368 O O   . MET B 1 156 ? 14.213  2.441  68.681 1.00 24.93  ? 151 MET B O   1 
ATOM   2369 C CB  . MET B 1 156 ? 15.048  1.689  65.638 1.00 23.49  ? 151 MET B CB  1 
ATOM   2370 C CG  . MET B 1 156 ? 16.103  1.033  66.561 1.00 29.07  ? 151 MET B CG  1 
ATOM   2371 S SD  . MET B 1 156 ? 15.495  -0.509 67.287 1.00 32.71  ? 151 MET B SD  1 
ATOM   2372 C CE  . MET B 1 156 ? 16.800  -1.639 66.792 1.00 42.83  ? 151 MET B CE  1 
ATOM   2373 N N   . THR B 1 157 ? 13.989  4.233  67.362 1.00 23.20  ? 152 THR B N   1 
ATOM   2374 C CA  . THR B 1 157 ? 14.168  5.158  68.490 1.00 25.62  ? 152 THR B CA  1 
ATOM   2375 C C   . THR B 1 157 ? 13.027  5.003  69.496 1.00 24.12  ? 152 THR B C   1 
ATOM   2376 O O   . THR B 1 157 ? 13.241  4.938  70.713 1.00 27.60  ? 152 THR B O   1 
ATOM   2377 C CB  . THR B 1 157 ? 14.234  6.634  68.021 1.00 26.27  ? 152 THR B CB  1 
ATOM   2378 O OG1 . THR B 1 157 ? 15.317  6.787  67.101 1.00 29.37  ? 152 THR B OG1 1 
ATOM   2379 C CG2 . THR B 1 157 ? 14.476  7.565  69.205 1.00 34.10  ? 152 THR B CG2 1 
ATOM   2380 N N   . ALA B 1 158 ? 11.805  4.941  68.982 1.00 24.34  ? 153 ALA B N   1 
ATOM   2381 C CA  . ALA B 1 158 ? 10.648  4.779  69.851 1.00 24.67  ? 153 ALA B CA  1 
ATOM   2382 C C   . ALA B 1 158 ? 10.746  3.483  70.649 1.00 31.20  ? 153 ALA B C   1 
ATOM   2383 O O   . ALA B 1 158 ? 10.498  3.456  71.853 1.00 25.88  ? 153 ALA B O   1 
ATOM   2384 C CB  . ALA B 1 158 ? 9.362   4.820  69.033 1.00 26.36  ? 153 ALA B CB  1 
ATOM   2385 N N   . ILE B 1 159 ? 11.129  2.410  69.972 1.00 25.73  ? 154 ILE B N   1 
ATOM   2386 C CA  . ILE B 1 159 ? 11.294  1.120  70.630 1.00 24.28  ? 154 ILE B CA  1 
ATOM   2387 C C   . ILE B 1 159 ? 12.331  1.188  71.745 1.00 27.22  ? 154 ILE B C   1 
ATOM   2388 O O   . ILE B 1 159 ? 12.087  0.715  72.865 1.00 30.04  ? 154 ILE B O   1 
ATOM   2389 C CB  . ILE B 1 159 ? 11.673  0.032  69.600 1.00 23.95  ? 154 ILE B CB  1 
ATOM   2390 C CG1 . ILE B 1 159 ? 10.454  -0.351 68.761 1.00 26.66  ? 154 ILE B CG1 1 
ATOM   2391 C CG2 . ILE B 1 159 ? 12.211  -1.210 70.299 1.00 27.05  ? 154 ILE B CG2 1 
ATOM   2392 C CD1 . ILE B 1 159 ? 10.811  -1.217 67.539 1.00 28.79  ? 154 ILE B CD1 1 
ATOM   2393 N N   . GLN B 1 160 ? 13.480  1.787  71.452 1.00 30.14  ? 155 GLN B N   1 
ATOM   2394 C CA  . GLN B 1 160 ? 14.534  1.924  72.455 1.00 36.01  ? 155 GLN B CA  1 
ATOM   2395 C C   . GLN B 1 160 ? 14.082  2.774  73.659 1.00 36.90  ? 155 GLN B C   1 
ATOM   2396 O O   . GLN B 1 160 ? 14.468  2.494  74.797 1.00 32.40  ? 155 GLN B O   1 
ATOM   2397 C CB  . GLN B 1 160 ? 15.796  2.516  71.814 1.00 33.77  ? 155 GLN B CB  1 
ATOM   2398 C CG  . GLN B 1 160 ? 16.453  1.590  70.797 1.00 33.61  ? 155 GLN B CG  1 
ATOM   2399 C CD  . GLN B 1 160 ? 16.814  0.226  71.374 1.00 36.47  ? 155 GLN B CD  1 
ATOM   2400 O OE1 . GLN B 1 160 ? 17.118  0.098  72.563 1.00 39.91  ? 155 GLN B OE1 1 
ATOM   2401 N NE2 . GLN B 1 160 ? 16.773  -0.801 70.534 1.00 39.80  ? 155 GLN B NE2 1 
ATOM   2402 N N   . GLU B 1 161 ? 13.244  3.781  73.413 1.00 30.31  ? 156 GLU B N   1 
ATOM   2403 C CA  . GLU B 1 161 ? 12.716  4.637  74.486 1.00 28.40  ? 156 GLU B CA  1 
ATOM   2404 C C   . GLU B 1 161 ? 11.611  3.946  75.291 1.00 37.08  ? 156 GLU B C   1 
ATOM   2405 O O   . GLU B 1 161 ? 11.272  4.381  76.393 1.00 39.03  ? 156 GLU B O   1 
ATOM   2406 C CB  . GLU B 1 161 ? 12.191  5.957  73.908 1.00 33.91  ? 156 GLU B CB  1 
ATOM   2407 C CG  . GLU B 1 161 ? 13.283  6.879  73.380 1.00 35.67  ? 156 GLU B CG  1 
ATOM   2408 C CD  . GLU B 1 161 ? 14.241  7.342  74.470 1.00 42.70  ? 156 GLU B CD  1 
ATOM   2409 O OE1 . GLU B 1 161 ? 13.782  7.600  75.603 1.00 38.76  ? 156 GLU B OE1 1 
ATOM   2410 O OE2 . GLU B 1 161 ? 15.454  7.451  74.191 1.00 43.40  1 156 GLU B OE2 1 
ATOM   2411 N N   . LEU B 1 162 ? 11.063  2.866  74.744 1.00 29.85  ? 157 LEU B N   1 
ATOM   2412 C CA  . LEU B 1 162 ? 10.087  2.044  75.461 1.00 29.67  ? 157 LEU B CA  1 
ATOM   2413 C C   . LEU B 1 162 ? 10.739  0.915  76.238 1.00 45.15  ? 157 LEU B C   1 
ATOM   2414 O O   . LEU B 1 162 ? 10.167  0.421  77.205 1.00 47.32  ? 157 LEU B O   1 
ATOM   2415 C CB  . LEU B 1 162 ? 9.063   1.456  74.496 1.00 32.54  ? 157 LEU B CB  1 
ATOM   2416 C CG  . LEU B 1 162 ? 8.113   2.447  73.829 1.00 35.63  ? 157 LEU B CG  1 
ATOM   2417 C CD1 . LEU B 1 162 ? 7.335   1.758  72.744 1.00 37.54  ? 157 LEU B CD1 1 
ATOM   2418 C CD2 . LEU B 1 162 ? 7.176   3.025  74.877 1.00 41.75  ? 157 LEU B CD2 1 
ATOM   2419 N N   . MET B 1 163 ? 11.927  0.498  75.810 1.00 44.70  ? 158 MET B N   1 
ATOM   2420 C CA  . MET B 1 163 ? 12.639  -0.588 76.479 1.00 57.75  ? 158 MET B CA  1 
ATOM   2421 C C   . MET B 1 163 ? 13.325  -0.110 77.754 1.00 69.04  ? 158 MET B C   1 
ATOM   2422 O O   . MET B 1 163 ? 13.266  -0.779 78.789 1.00 87.23  ? 158 MET B O   1 
ATOM   2423 C CB  . MET B 1 163 ? 13.668  -1.218 75.539 1.00 57.28  ? 158 MET B CB  1 
ATOM   2424 C CG  . MET B 1 163 ? 13.052  -1.985 74.390 1.00 60.71  ? 158 MET B CG  1 
ATOM   2425 S SD  . MET B 1 163 ? 14.288  -2.645 73.260 1.00 70.32  ? 158 MET B SD  1 
ATOM   2426 C CE  . MET B 1 163 ? 15.149  -3.767 74.350 1.00 130.68 ? 158 MET B CE  1 
HETATM 2427 O O   . HOH C 2 .   ? -2.428  2.056  67.260 1.00 55.07  ? 201 HOH A O   1 
HETATM 2428 O O   . HOH C 2 .   ? 15.202  8.275  83.031 1.00 52.84  ? 202 HOH A O   1 
HETATM 2429 O O   . HOH C 2 .   ? -0.406  18.712 66.155 1.00 57.70  ? 203 HOH A O   1 
HETATM 2430 O O   . HOH C 2 .   ? 0.033   15.889 70.027 1.00 42.84  ? 204 HOH A O   1 
HETATM 2431 O O   . HOH C 2 .   ? 16.923  6.992  72.162 1.00 48.49  ? 205 HOH A O   1 
HETATM 2432 O O   . HOH C 2 .   ? 11.800  22.945 84.630 1.00 37.35  ? 206 HOH A O   1 
HETATM 2433 O O   . HOH C 2 .   ? -1.142  2.776  69.468 1.00 52.05  ? 207 HOH A O   1 
HETATM 2434 O O   . HOH C 2 .   ? 18.164  7.925  57.066 1.00 66.74  ? 208 HOH A O   1 
HETATM 2435 O O   . HOH C 2 .   ? 13.098  11.041 89.349 1.00 35.88  ? 209 HOH A O   1 
HETATM 2436 O O   . HOH C 2 .   ? -2.790  15.065 72.389 1.00 50.48  ? 210 HOH A O   1 
HETATM 2437 O O   . HOH C 2 .   ? 26.864  13.006 71.028 1.00 54.18  ? 211 HOH A O   1 
HETATM 2438 O O   . HOH C 2 .   ? 2.532   17.224 59.208 1.00 58.59  ? 212 HOH A O   1 
HETATM 2439 O O   . HOH C 2 .   ? 18.535  19.879 57.922 1.00 53.90  ? 213 HOH A O   1 
HETATM 2440 O O   . HOH C 2 .   ? 9.372   21.320 91.127 1.00 53.09  ? 214 HOH A O   1 
HETATM 2441 O O   . HOH C 2 .   ? 16.001  31.913 77.496 1.00 41.90  ? 215 HOH A O   1 
HETATM 2442 O O   . HOH C 2 .   ? 14.849  15.627 57.471 1.00 39.40  ? 216 HOH A O   1 
HETATM 2443 O O   . HOH C 2 .   ? -1.883  18.525 72.721 1.00 36.13  ? 217 HOH A O   1 
HETATM 2444 O O   . HOH C 2 .   ? 2.329   23.862 70.804 1.00 34.77  ? 218 HOH A O   1 
HETATM 2445 O O   . HOH C 2 .   ? -0.489  2.645  36.959 1.00 47.66  ? 219 HOH A O   1 
HETATM 2446 O O   . HOH C 2 .   ? 13.041  26.111 67.033 1.00 32.68  ? 220 HOH A O   1 
HETATM 2447 O O   . HOH C 2 .   ? 23.840  31.393 77.139 1.00 42.17  ? 221 HOH A O   1 
HETATM 2448 O O   . HOH C 2 .   ? 22.665  27.615 66.230 1.00 48.38  ? 222 HOH A O   1 
HETATM 2449 O O   . HOH C 2 .   ? 13.484  24.016 68.676 1.00 28.34  ? 223 HOH A O   1 
HETATM 2450 O O   . HOH C 2 .   ? 10.070  3.715  79.232 1.00 49.14  ? 224 HOH A O   1 
HETATM 2451 O O   . HOH C 2 .   ? 28.665  16.689 68.762 1.00 52.48  ? 225 HOH A O   1 
HETATM 2452 O O   . HOH C 2 .   ? -4.949  15.604 72.940 1.00 54.92  ? 226 HOH A O   1 
HETATM 2453 O O   . HOH C 2 .   ? 25.897  14.437 74.131 1.00 48.83  ? 227 HOH A O   1 
HETATM 2454 O O   . HOH C 2 .   ? 17.232  8.463  84.548 1.00 51.58  ? 228 HOH A O   1 
HETATM 2455 O O   . HOH C 2 .   ? 29.841  17.782 74.430 1.00 37.09  ? 229 HOH A O   1 
HETATM 2456 O O   . HOH C 2 .   ? 12.830  24.853 82.597 1.00 43.88  ? 230 HOH A O   1 
HETATM 2457 O O   . HOH C 2 .   ? 9.774   39.927 64.956 1.00 70.37  ? 231 HOH A O   1 
HETATM 2458 O O   . HOH C 2 .   ? 1.960   10.628 61.787 1.00 36.38  ? 232 HOH A O   1 
HETATM 2459 O O   . HOH C 2 .   ? 23.298  20.450 77.674 1.00 26.10  ? 233 HOH A O   1 
HETATM 2460 O O   . HOH C 2 .   ? -2.234  6.408  75.810 1.00 35.27  ? 234 HOH A O   1 
HETATM 2461 O O   . HOH C 2 .   ? 6.644   13.776 58.485 1.00 30.55  ? 235 HOH A O   1 
HETATM 2462 O O   . HOH C 2 .   ? 3.133   12.829 66.278 1.00 36.64  ? 236 HOH A O   1 
HETATM 2463 O O   . HOH C 2 .   ? -2.314  9.483  66.528 1.00 36.82  ? 237 HOH A O   1 
HETATM 2464 O O   . HOH C 2 .   ? 5.707   29.938 70.716 1.00 49.66  ? 238 HOH A O   1 
HETATM 2465 O O   . HOH C 2 .   ? 29.871  20.998 66.870 1.00 61.61  ? 239 HOH A O   1 
HETATM 2466 O O   . HOH C 2 .   ? 4.314   10.651 67.501 1.00 25.65  ? 240 HOH A O   1 
HETATM 2467 O O   . HOH C 2 .   ? 14.603  13.296 85.169 1.00 31.68  ? 241 HOH A O   1 
HETATM 2468 O O   . HOH C 2 .   ? 10.963  22.374 88.354 1.00 46.92  ? 242 HOH A O   1 
HETATM 2469 O O   . HOH C 2 .   ? 1.854   12.271 81.054 1.00 29.16  ? 243 HOH A O   1 
HETATM 2470 O O   . HOH C 2 .   ? 30.188  22.358 74.456 1.00 45.26  ? 244 HOH A O   1 
HETATM 2471 O O   . HOH C 2 .   ? 1.415   1.192  79.427 1.00 57.35  ? 245 HOH A O   1 
HETATM 2472 O O   . HOH C 2 .   ? -2.431  25.057 82.418 1.00 42.68  ? 246 HOH A O   1 
HETATM 2473 O O   . HOH C 2 .   ? 15.018  21.764 90.285 1.00 35.87  ? 247 HOH A O   1 
HETATM 2474 O O   . HOH C 2 .   ? 21.794  12.288 67.104 1.00 37.94  ? 248 HOH A O   1 
HETATM 2475 O O   . HOH C 2 .   ? 5.755   20.357 63.516 1.00 37.03  ? 249 HOH A O   1 
HETATM 2476 O O   . HOH C 2 .   ? 15.858  28.151 65.266 1.00 39.16  ? 250 HOH A O   1 
HETATM 2477 O O   . HOH C 2 .   ? 5.797   3.682  77.655 1.00 48.30  ? 251 HOH A O   1 
HETATM 2478 O O   . HOH C 2 .   ? 27.739  26.262 79.891 1.00 49.09  ? 252 HOH A O   1 
HETATM 2479 O O   . HOH C 2 .   ? 12.283  18.727 89.448 1.00 43.07  ? 253 HOH A O   1 
HETATM 2480 O O   . HOH C 2 .   ? -1.109  24.671 77.020 1.00 35.31  ? 254 HOH A O   1 
HETATM 2481 O O   . HOH C 2 .   ? 11.666  27.958 63.635 1.00 47.88  ? 255 HOH A O   1 
HETATM 2482 O O   . HOH C 2 .   ? 9.142   22.686 84.710 1.00 40.53  ? 256 HOH A O   1 
HETATM 2483 O O   . HOH C 2 .   ? 16.699  32.003 65.581 1.00 54.40  ? 257 HOH A O   1 
HETATM 2484 O O   . HOH C 2 .   ? 12.320  19.098 55.391 1.00 60.37  ? 258 HOH A O   1 
HETATM 2485 O O   . HOH C 2 .   ? 24.310  10.890 83.331 1.00 56.00  ? 259 HOH A O   1 
HETATM 2486 O O   . HOH C 2 .   ? 11.836  30.001 65.602 1.00 60.84  ? 260 HOH A O   1 
HETATM 2487 O O   . HOH C 2 .   ? 3.631   23.562 84.905 1.00 59.51  ? 261 HOH A O   1 
HETATM 2488 O O   . HOH C 2 .   ? -2.401  20.040 67.637 1.00 50.64  ? 262 HOH A O   1 
HETATM 2489 O O   . HOH C 2 .   ? 17.854  29.866 64.717 1.00 55.96  ? 263 HOH A O   1 
HETATM 2490 O O   . HOH C 2 .   ? 0.403   13.443 77.957 1.00 35.30  ? 264 HOH A O   1 
HETATM 2491 O O   . HOH C 2 .   ? 7.742   22.591 87.523 1.00 44.90  ? 265 HOH A O   1 
HETATM 2492 O O   . HOH C 2 .   ? 25.985  19.545 62.371 1.00 48.91  ? 266 HOH A O   1 
HETATM 2493 O O   . HOH C 2 .   ? -0.705  28.643 81.330 1.00 44.10  ? 267 HOH A O   1 
HETATM 2494 O O   . HOH C 2 .   ? 3.765   26.519 84.225 1.00 48.59  ? 268 HOH A O   1 
HETATM 2495 O O   . HOH C 2 .   ? 1.518   0.983  60.148 1.00 53.47  ? 269 HOH A O   1 
HETATM 2496 O O   . HOH C 2 .   ? 1.274   10.804 86.110 1.00 54.46  ? 270 HOH A O   1 
HETATM 2497 O O   . HOH C 2 .   ? -2.072  26.962 78.279 1.00 42.37  ? 271 HOH A O   1 
HETATM 2498 O O   . HOH C 2 .   ? 5.654   30.508 66.460 1.00 57.20  ? 272 HOH A O   1 
HETATM 2499 O O   . HOH C 2 .   ? -0.680  23.371 71.040 1.00 40.37  ? 273 HOH A O   1 
HETATM 2500 O O   . HOH C 2 .   ? -2.471  9.819  85.643 1.00 43.55  ? 274 HOH A O   1 
HETATM 2501 O O   . HOH C 2 .   ? 17.102  10.865 57.078 1.00 49.41  ? 275 HOH A O   1 
HETATM 2502 O O   . HOH C 2 .   ? -1.353  21.543 72.822 1.00 39.12  ? 276 HOH A O   1 
HETATM 2503 O O   . HOH C 2 .   ? -1.313  1.753  77.232 1.00 63.43  ? 277 HOH A O   1 
HETATM 2504 O O   . HOH C 2 .   ? -0.732  1.195  62.644 1.00 71.09  ? 278 HOH A O   1 
HETATM 2505 O O   . HOH C 2 .   ? 13.291  17.054 56.715 1.00 53.68  ? 279 HOH A O   1 
HETATM 2506 O O   . HOH C 2 .   ? 23.357  29.401 79.133 1.00 49.04  ? 280 HOH A O   1 
HETATM 2507 O O   . HOH C 2 .   ? 2.219   25.333 68.433 1.00 44.39  ? 281 HOH A O   1 
HETATM 2508 O O   . HOH C 2 .   ? 32.465  25.130 71.173 1.00 56.17  ? 282 HOH A O   1 
HETATM 2509 O O   . HOH C 2 .   ? 1.145   13.878 66.384 1.00 48.72  ? 283 HOH A O   1 
HETATM 2510 O O   . HOH C 2 .   ? -3.678  16.627 77.829 1.00 60.28  ? 284 HOH A O   1 
HETATM 2511 O O   . HOH C 2 .   ? -7.697  12.595 82.470 1.00 41.78  ? 285 HOH A O   1 
HETATM 2512 O O   . HOH C 2 .   ? 2.444   10.849 58.888 1.00 45.69  ? 286 HOH A O   1 
HETATM 2513 O O   . HOH C 2 .   ? 1.762   10.712 83.220 1.00 52.71  ? 287 HOH A O   1 
HETATM 2514 O O   . HOH C 2 .   ? -1.969  18.073 69.910 1.00 48.51  ? 288 HOH A O   1 
HETATM 2515 O O   . HOH C 2 .   ? 0.054   0.837  49.333 1.00 58.23  ? 289 HOH A O   1 
HETATM 2516 O O   . HOH C 2 .   ? 1.521   -0.168 57.624 1.00 51.85  ? 290 HOH A O   1 
HETATM 2517 O O   . HOH C 2 .   ? -2.055  3.874  77.468 1.00 49.67  ? 291 HOH A O   1 
HETATM 2518 O O   . HOH C 2 .   ? 5.690   11.226 58.030 1.00 33.00  ? 292 HOH A O   1 
HETATM 2519 O O   . HOH D 2 .   ? 22.983  12.540 30.421 1.00 49.89  ? 201 HOH B O   1 
HETATM 2520 O O   . HOH D 2 .   ? 19.494  11.388 28.037 1.00 54.82  ? 202 HOH B O   1 
HETATM 2521 O O   . HOH D 2 .   ? 16.706  25.753 29.134 1.00 42.20  ? 203 HOH B O   1 
HETATM 2522 O O   . HOH D 2 .   ? 8.374   15.274 56.573 1.00 46.68  ? 204 HOH B O   1 
HETATM 2523 O O   . HOH D 2 .   ? 2.077   10.234 29.573 1.00 43.40  ? 205 HOH B O   1 
HETATM 2524 O O   . HOH D 2 .   ? -5.342  25.157 52.973 1.00 61.38  ? 206 HOH B O   1 
HETATM 2525 O O   . HOH D 2 .   ? 6.792   10.797 27.313 1.00 49.72  ? 207 HOH B O   1 
HETATM 2526 O O   . HOH D 2 .   ? 11.416  9.452  58.375 1.00 37.28  ? 208 HOH B O   1 
HETATM 2527 O O   . HOH D 2 .   ? 16.941  17.276 43.285 1.00 42.39  ? 209 HOH B O   1 
HETATM 2528 O O   . HOH D 2 .   ? 5.679   9.771  54.189 1.00 34.46  ? 210 HOH B O   1 
HETATM 2529 O O   . HOH D 2 .   ? 12.415  6.507  77.501 1.00 42.26  ? 211 HOH B O   1 
HETATM 2530 O O   . HOH D 2 .   ? 18.144  3.784  42.717 1.00 45.09  ? 212 HOH B O   1 
HETATM 2531 O O   . HOH D 2 .   ? 4.048   27.129 46.685 1.00 36.61  ? 213 HOH B O   1 
HETATM 2532 O O   . HOH D 2 .   ? 2.376   15.126 28.020 1.00 31.82  ? 214 HOH B O   1 
HETATM 2533 O O   . HOH D 2 .   ? -12.826 19.043 38.567 1.00 43.22  ? 215 HOH B O   1 
HETATM 2534 O O   . HOH D 2 .   ? 2.262   15.547 55.343 1.00 34.65  ? 216 HOH B O   1 
HETATM 2535 O O   . HOH D 2 .   ? 19.071  20.873 45.365 1.00 64.97  ? 217 HOH B O   1 
HETATM 2536 O O   . HOH D 2 .   ? 4.195   26.283 30.978 1.00 38.55  ? 218 HOH B O   1 
HETATM 2537 O O   . HOH D 2 .   ? 15.171  10.954 50.751 1.00 38.71  ? 219 HOH B O   1 
HETATM 2538 O O   . HOH D 2 .   ? 19.402  10.276 45.985 1.00 37.83  ? 220 HOH B O   1 
HETATM 2539 O O   . HOH D 2 .   ? 5.147   24.695 28.978 1.00 37.58  ? 221 HOH B O   1 
HETATM 2540 O O   . HOH D 2 .   ? 17.943  26.029 36.362 1.00 35.11  ? 222 HOH B O   1 
HETATM 2541 O O   . HOH D 2 .   ? 6.288   23.927 25.441 1.00 49.87  ? 223 HOH B O   1 
HETATM 2542 O O   . HOH D 2 .   ? -8.732  15.446 38.774 1.00 50.60  ? 224 HOH B O   1 
HETATM 2543 O O   . HOH D 2 .   ? 15.105  13.911 31.871 1.00 30.87  ? 225 HOH B O   1 
HETATM 2544 O O   . HOH D 2 .   ? 13.490  28.125 29.445 1.00 50.34  ? 226 HOH B O   1 
HETATM 2545 O O   . HOH D 2 .   ? 14.729  24.897 42.794 1.00 31.23  ? 227 HOH B O   1 
HETATM 2546 O O   . HOH D 2 .   ? 3.555   24.975 44.873 1.00 29.91  ? 228 HOH B O   1 
HETATM 2547 O O   . HOH D 2 .   ? 4.721   20.235 23.814 1.00 41.85  ? 229 HOH B O   1 
HETATM 2548 O O   . HOH D 2 .   ? -11.710 17.559 43.988 1.00 45.59  ? 230 HOH B O   1 
HETATM 2549 O O   . HOH D 2 .   ? 15.800  2.756  32.533 1.00 55.41  ? 231 HOH B O   1 
HETATM 2550 O O   . HOH D 2 .   ? 3.726   12.326 23.960 1.00 41.89  ? 232 HOH B O   1 
HETATM 2551 O O   . HOH D 2 .   ? 18.930  19.899 40.620 1.00 40.06  ? 233 HOH B O   1 
HETATM 2552 O O   . HOH D 2 .   ? -6.909  30.351 34.053 1.00 50.42  ? 234 HOH B O   1 
HETATM 2553 O O   . HOH D 2 .   ? 7.518   21.811 21.469 1.00 46.69  ? 235 HOH B O   1 
HETATM 2554 O O   . HOH D 2 .   ? 12.741  11.504 45.200 1.00 25.54  ? 236 HOH B O   1 
HETATM 2555 O O   . HOH D 2 .   ? 17.861  1.222  75.001 1.00 51.61  ? 237 HOH B O   1 
HETATM 2556 O O   . HOH D 2 .   ? -1.371  20.280 55.023 1.00 42.62  ? 238 HOH B O   1 
HETATM 2557 O O   . HOH D 2 .   ? 11.040  20.871 49.849 1.00 39.61  ? 239 HOH B O   1 
HETATM 2558 O O   . HOH D 2 .   ? -6.739  22.389 52.168 1.00 56.60  ? 240 HOH B O   1 
HETATM 2559 O O   . HOH D 2 .   ? 13.949  13.629 46.564 1.00 38.85  ? 241 HOH B O   1 
HETATM 2560 O O   . HOH D 2 .   ? -6.161  21.903 35.456 1.00 29.82  ? 242 HOH B O   1 
HETATM 2561 O O   . HOH D 2 .   ? 19.354  7.808  36.740 1.00 27.94  ? 243 HOH B O   1 
HETATM 2562 O O   . HOH D 2 .   ? 15.144  1.325  51.729 1.00 45.57  ? 244 HOH B O   1 
HETATM 2563 O O   . HOH D 2 .   ? 19.454  26.759 30.948 1.00 38.27  ? 245 HOH B O   1 
HETATM 2564 O O   . HOH D 2 .   ? -7.100  32.491 36.596 1.00 45.21  ? 246 HOH B O   1 
HETATM 2565 O O   . HOH D 2 .   ? 10.466  13.952 54.331 1.00 30.57  ? 247 HOH B O   1 
HETATM 2566 O O   . HOH D 2 .   ? 1.956   23.452 23.059 1.00 43.05  ? 248 HOH B O   1 
HETATM 2567 O O   . HOH D 2 .   ? 17.887  24.345 42.444 1.00 43.67  ? 249 HOH B O   1 
HETATM 2568 O O   . HOH D 2 .   ? -8.839  19.810 50.682 1.00 37.50  ? 250 HOH B O   1 
HETATM 2569 O O   . HOH D 2 .   ? 16.654  14.959 35.075 1.00 36.59  ? 251 HOH B O   1 
HETATM 2570 O O   . HOH D 2 .   ? 5.357   28.558 50.027 1.00 41.40  ? 252 HOH B O   1 
HETATM 2571 O O   . HOH D 2 .   ? 18.961  28.461 35.210 1.00 40.93  ? 253 HOH B O   1 
HETATM 2572 O O   . HOH D 2 .   ? 14.193  10.331 30.512 1.00 46.61  ? 254 HOH B O   1 
HETATM 2573 O O   . HOH D 2 .   ? 14.789  11.860 56.287 1.00 65.15  ? 255 HOH B O   1 
HETATM 2574 O O   . HOH D 2 .   ? 18.498  13.607 46.301 1.00 58.24  ? 256 HOH B O   1 
HETATM 2575 O O   . HOH D 2 .   ? 9.270   23.997 25.816 1.00 48.93  ? 257 HOH B O   1 
HETATM 2576 O O   . HOH D 2 .   ? 10.407  9.325  55.746 1.00 36.56  ? 258 HOH B O   1 
HETATM 2577 O O   . HOH D 2 .   ? 11.043  30.743 42.717 1.00 51.03  ? 259 HOH B O   1 
HETATM 2578 O O   . HOH D 2 .   ? 11.592  4.861  34.660 1.00 46.33  ? 260 HOH B O   1 
HETATM 2579 O O   . HOH D 2 .   ? 18.130  3.155  35.084 1.00 48.60  ? 261 HOH B O   1 
HETATM 2580 O O   . HOH D 2 .   ? 3.236   30.118 49.817 1.00 53.78  ? 262 HOH B O   1 
HETATM 2581 O O   . HOH D 2 .   ? 5.380   30.780 48.314 1.00 58.78  ? 263 HOH B O   1 
HETATM 2582 O O   . HOH D 2 .   ? 7.745   24.408 28.995 1.00 42.58  ? 264 HOH B O   1 
HETATM 2583 O O   . HOH D 2 .   ? 14.870  25.978 45.394 1.00 49.13  ? 265 HOH B O   1 
HETATM 2584 O O   . HOH D 2 .   ? 4.382   16.931 56.577 1.00 56.25  ? 266 HOH B O   1 
HETATM 2585 O O   . HOH D 2 .   ? 0.778   19.015 56.930 1.00 60.97  ? 267 HOH B O   1 
HETATM 2586 O O   . HOH D 2 .   ? -3.127  23.451 54.688 1.00 41.82  ? 268 HOH B O   1 
HETATM 2587 O O   . HOH D 2 .   ? -1.062  8.553  55.952 1.00 62.13  ? 269 HOH B O   1 
HETATM 2588 O O   . HOH D 2 .   ? 2.168   30.020 51.877 1.00 57.56  ? 270 HOH B O   1 
HETATM 2589 O O   . HOH D 2 .   ? -16.192 27.347 43.244 1.00 44.17  ? 271 HOH B O   1 
HETATM 2590 O O   . HOH D 2 .   ? 18.483  22.688 40.291 1.00 41.04  ? 272 HOH B O   1 
HETATM 2591 O O   . HOH D 2 .   ? -15.588 12.003 55.513 1.00 54.01  ? 273 HOH B O   1 
HETATM 2592 O O   . HOH D 2 .   ? -0.861  10.648 55.312 1.00 54.45  ? 274 HOH B O   1 
HETATM 2593 O O   . HOH D 2 .   ? 15.625  28.721 43.982 1.00 62.45  ? 275 HOH B O   1 
HETATM 2594 O O   . HOH D 2 .   ? 24.728  13.984 30.780 1.00 44.34  ? 276 HOH B O   1 
HETATM 2595 O O   . HOH D 2 .   ? 22.542  16.240 36.300 1.00 45.93  ? 277 HOH B O   1 
HETATM 2596 O O   . HOH D 2 .   ? 13.448  -0.000 55.925 0.5  62.41  ? 278 HOH B O   1 
HETATM 2597 O O   . HOH D 2 .   ? 15.022  12.055 29.606 1.00 42.65  ? 279 HOH B O   1 
HETATM 2598 O O   . HOH D 2 .   ? 18.585  7.152  54.050 1.00 59.65  ? 280 HOH B O   1 
HETATM 2599 O O   . HOH D 2 .   ? 16.136  14.580 46.572 1.00 47.66  ? 281 HOH B O   1 
HETATM 2600 O O   . HOH D 2 .   ? 20.638  17.682 35.652 1.00 51.65  ? 282 HOH B O   1 
HETATM 2601 O O   . HOH D 2 .   ? 19.959  26.002 38.533 1.00 51.88  ? 283 HOH B O   1 
HETATM 2602 O O   . HOH D 2 .   ? 13.376  14.863 54.447 1.00 51.30  ? 284 HOH B O   1 
HETATM 2603 O O   . HOH D 2 .   ? 15.444  0.160  54.173 1.00 48.09  ? 285 HOH B O   1 
HETATM 2604 O O   . HOH D 2 .   ? 14.285  11.059 53.876 1.00 64.79  ? 286 HOH B O   1 
HETATM 2605 O O   . HOH D 2 .   ? 19.060  5.264  35.025 1.00 55.32  ? 287 HOH B O   1 
HETATM 2606 O O   . HOH D 2 .   ? 19.182  19.013 43.249 1.00 40.77  ? 288 HOH B O   1 
HETATM 2607 O O   . HOH D 2 .   ? 11.518  11.451 54.754 1.00 32.98  ? 289 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ARG A 14  ? 0.7925 0.8965 0.7900 0.0222  0.0133  -0.0634 9   ARG A N   
2    C CA  . ARG A 14  ? 0.8210 0.9315 0.8163 0.0160  0.0161  -0.0602 9   ARG A CA  
3    C C   . ARG A 14  ? 0.7392 0.8331 0.7374 0.0005  0.0193  -0.0497 9   ARG A C   
4    O O   . ARG A 14  ? 0.7017 0.7715 0.7002 -0.0005 0.0176  -0.0436 9   ARG A O   
5    C CB  . ARG A 14  ? 0.8404 0.9402 0.8233 0.0284  0.0120  -0.0588 9   ARG A CB  
6    C CG  . ARG A 14  ? 0.8797 0.9912 0.8601 0.0241  0.0144  -0.0575 9   ARG A CG  
7    C CD  . ARG A 14  ? 0.8346 0.9850 0.8213 0.0215  0.0174  -0.0684 9   ARG A CD  
8    N NE  . ARG A 14  ? 0.6892 0.8535 0.6767 0.0076  0.0227  -0.0647 9   ARG A NE  
9    C CZ  . ARG A 14  ? 0.7578 0.9584 0.7508 -0.0008 0.0271  -0.0725 9   ARG A CZ  
10   N NH1 . ARG A 14  ? 0.8072 1.0346 0.8069 0.0048  0.0266  -0.0856 9   ARG A NH1 
11   N NH2 . ARG A 14  ? 0.5364 0.7481 0.5274 -0.0154 0.0320  -0.0675 9   ARG A NH2 
12   N N   . ALA A 15  ? 0.6721 0.7797 0.6714 -0.0113 0.0233  -0.0480 10  ALA A N   
13   C CA  . ALA A 15  ? 0.6390 0.7284 0.6374 -0.0257 0.0248  -0.0372 10  ALA A CA  
14   C C   . ALA A 15  ? 0.5373 0.6052 0.5266 -0.0208 0.0226  -0.0288 10  ALA A C   
15   O O   . ALA A 15  ? 0.4531 0.4975 0.4411 -0.0264 0.0211  -0.0204 10  ALA A O   
16   C CB  . ALA A 15  ? 0.7105 0.8207 0.7097 -0.0420 0.0296  -0.0370 10  ALA A CB  
17   N N   . GLU A 16  ? 0.4746 0.5507 0.4574 -0.0094 0.0214  -0.0322 11  GLU A N   
18   C CA  . GLU A 16  ? 0.4318 0.4889 0.4061 -0.0041 0.0191  -0.0257 11  GLU A CA  
19   C C   . GLU A 16  ? 0.3504 0.3818 0.3234 0.0028  0.0154  -0.0229 11  GLU A C   
20   O O   . GLU A 16  ? 0.3773 0.3894 0.3471 0.0009  0.0141  -0.0159 11  GLU A O   
21   C CB  . GLU A 16  ? 0.5658 0.6377 0.5334 0.0070  0.0177  -0.0318 11  GLU A CB  
22   C CG  . GLU A 16  ? 0.7655 0.8190 0.7243 0.0121  0.0152  -0.0262 11  GLU A CG  
23   C CD  . GLU A 16  ? 0.9969 1.0638 0.9491 0.0240  0.0126  -0.0336 11  GLU A CD  
24   O OE1 . GLU A 16  ? 1.0828 1.1768 1.0377 0.0279  0.0129  -0.0434 11  GLU A OE1 
25   O OE2 . GLU A 16  ? 0.9783 1.0294 0.9229 0.0299  0.0096  -0.0309 11  GLU A OE2 
26   N N   . LEU A 17  ? 0.4261 0.4593 0.4011 0.0102  0.0135  -0.0290 12  LEU A N   
27   C CA  . LEU A 17  ? 0.4043 0.4176 0.3778 0.0142  0.0107  -0.0269 12  LEU A CA  
28   C C   . LEU A 17  ? 0.3221 0.3242 0.3034 0.0047  0.0114  -0.0224 12  LEU A C   
29   O O   . LEU A 17  ? 0.3178 0.3033 0.2975 0.0051  0.0095  -0.0187 12  LEU A O   
30   C CB  . LEU A 17  ? 0.4350 0.4542 0.4082 0.0222  0.0086  -0.0338 12  LEU A CB  
31   C CG  . LEU A 17  ? 0.4818 0.4838 0.4522 0.0241  0.0062  -0.0318 12  LEU A CG  
32   C CD1 . LEU A 17  ? 0.4080 0.3920 0.3666 0.0274  0.0039  -0.0269 12  LEU A CD1 
33   C CD2 . LEU A 17  ? 0.6191 0.6277 0.5876 0.0312  0.0039  -0.0379 12  LEU A CD2 
34   N N   . CYS A 18  ? 0.3611 0.3729 0.3507 -0.0039 0.0135  -0.0239 13  CYS A N   
35   C CA  . CYS A 18  ? 0.3440 0.3424 0.3400 -0.0121 0.0123  -0.0207 13  CYS A CA  
36   C C   . CYS A 18  ? 0.3404 0.3219 0.3312 -0.0161 0.0107  -0.0123 13  CYS A C   
37   O O   . CYS A 18  ? 0.3525 0.3175 0.3449 -0.0151 0.0072  -0.0105 13  CYS A O   
38   C CB  . CYS A 18  ? 0.3379 0.3472 0.3414 -0.0224 0.0142  -0.0233 13  CYS A CB  
39   S SG  . CYS A 18  ? 0.3954 0.3835 0.4061 -0.0302 0.0101  -0.0213 13  CYS A SG  
40   N N   . GLU A 19  ? 0.3501 0.3378 0.3344 -0.0198 0.0129  -0.0083 14  GLU A N   
41   C CA  . GLU A 19  ? 0.3810 0.3539 0.3585 -0.0226 0.0112  -0.0003 14  GLU A CA  
42   C C   . GLU A 19  ? 0.3047 0.2660 0.2788 -0.0128 0.0086  0.0000  14  GLU A C   
43   O O   . GLU A 19  ? 0.3313 0.2767 0.3045 -0.0130 0.0052  0.0038  14  GLU A O   
44   C CB  . GLU A 19  ? 0.4020 0.3889 0.3724 -0.0274 0.0145  0.0028  14  GLU A CB  
45   C CG  . GLU A 19  ? 0.6159 0.6122 0.5870 -0.0421 0.0171  0.0049  14  GLU A CG  
46   C CD  . GLU A 19  ? 0.6990 0.6706 0.6670 -0.0524 0.0133  0.0135  14  GLU A CD  
47   O OE1 . GLU A 19  ? 0.8274 0.7796 0.7901 -0.0483 0.0092  0.0190  14  GLU A OE1 
48   O OE2 . GLU A 19  ? 0.8035 0.7741 0.7737 -0.0643 0.0135  0.0141  14  GLU A OE2 
49   N N   . SER A 20  ? 0.3379 0.3067 0.3093 -0.0043 0.0094  -0.0045 15  SER A N   
50   C CA  . SER A 20  ? 0.3469 0.3045 0.3134 0.0025  0.0072  -0.0042 15  SER A CA  
51   C C   . SER A 20  ? 0.3421 0.2911 0.3147 0.0028  0.0050  -0.0064 15  SER A C   
52   O O   . SER A 20  ? 0.3361 0.2754 0.3077 0.0037  0.0028  -0.0052 15  SER A O   
53   C CB  . SER A 20  ? 0.3399 0.3030 0.2995 0.0105  0.0072  -0.0083 15  SER A CB  
54   O OG  . SER A 20  ? 0.4142 0.3875 0.3688 0.0122  0.0083  -0.0083 15  SER A OG  
55   N N   . LEU A 21  ? 0.2981 0.2535 0.2774 0.0022  0.0054  -0.0110 16  LEU A N   
56   C CA  . LEU A 21  ? 0.2830 0.2344 0.2686 0.0029  0.0033  -0.0148 16  LEU A CA  
57   C C   . LEU A 21  ? 0.2974 0.2390 0.2894 -0.0009 -0.0001 -0.0135 16  LEU A C   
58   O O   . LEU A 21  ? 0.3419 0.2797 0.3383 0.0013  -0.0032 -0.0171 16  LEU A O   
59   C CB  . LEU A 21  ? 0.3083 0.2703 0.2992 0.0038  0.0042  -0.0206 16  LEU A CB  
60   C CG  . LEU A 21  ? 0.3343 0.3019 0.3163 0.0096  0.0052  -0.0222 16  LEU A CG  
61   C CD1 . LEU A 21  ? 0.3811 0.3598 0.3675 0.0116  0.0055  -0.0282 16  LEU A CD1 
62   C CD2 . LEU A 21  ? 0.4309 0.3891 0.4039 0.0118  0.0039  -0.0206 16  LEU A CD2 
63   N N   . LEU A 22  ? 0.3456 0.2832 0.3367 -0.0065 -0.0002 -0.0087 17  LEU A N   
64   C CA  . LEU A 22  ? 0.3079 0.2301 0.3007 -0.0098 -0.0054 -0.0059 17  LEU A CA  
65   C C   . LEU A 22  ? 0.3498 0.2629 0.3379 -0.0050 -0.0085 -0.0038 17  LEU A C   
66   O O   . LEU A 22  ? 0.3214 0.2245 0.3130 -0.0022 -0.0145 -0.0063 17  LEU A O   
67   C CB  . LEU A 22  ? 0.4255 0.3436 0.4137 -0.0192 -0.0047 0.0008  17  LEU A CB  
68   C CG  . LEU A 22  ? 0.7415 0.6455 0.7325 -0.0269 -0.0094 0.0021  17  LEU A CG  
69   C CD1 . LEU A 22  ? 0.7424 0.6441 0.7244 -0.0391 -0.0074 0.0106  17  LEU A CD1 
70   C CD2 . LEU A 22  ? 0.8090 0.6927 0.8004 -0.0217 -0.0181 0.0015  17  LEU A CD2 
71   N N   . THR A 23  ? 0.3463 0.2639 0.3266 -0.0031 -0.0053 -0.0006 18  THR A N   
72   C CA  . THR A 23  ? 0.3420 0.2532 0.3178 0.0008  -0.0079 0.0008  18  THR A CA  
73   C C   . THR A 23  ? 0.2998 0.2152 0.2806 0.0055  -0.0091 -0.0067 18  THR A C   
74   O O   . THR A 23  ? 0.3275 0.2393 0.3093 0.0087  -0.0131 -0.0091 18  THR A O   
75   C CB  . THR A 23  ? 0.3686 0.2842 0.3350 0.0016  -0.0044 0.0049  18  THR A CB  
76   O OG1 . THR A 23  ? 0.4277 0.3520 0.3926 0.0044  -0.0010 0.0010  18  THR A OG1 
77   C CG2 . THR A 23  ? 0.3471 0.2652 0.3089 -0.0042 -0.0023 0.0110  18  THR A CG2 
78   N N   . TRP A 24  ? 0.3376 0.2624 0.3208 0.0056  -0.0059 -0.0109 19  TRP A N   
79   C CA  . TRP A 24  ? 0.3493 0.2807 0.3363 0.0075  -0.0065 -0.0180 19  TRP A CA  
80   C C   . TRP A 24  ? 0.3272 0.2588 0.3253 0.0091  -0.0115 -0.0244 19  TRP A C   
81   O O   . TRP A 24  ? 0.3137 0.2494 0.3154 0.0119  -0.0146 -0.0306 19  TRP A O   
82   C CB  . TRP A 24  ? 0.3107 0.2503 0.2949 0.0068  -0.0027 -0.0198 19  TRP A CB  
83   C CG  . TRP A 24  ? 0.2998 0.2482 0.2867 0.0063  -0.0030 -0.0267 19  TRP A CG  
84   C CD1 . TRP A 24  ? 0.2780 0.2294 0.2596 0.0047  -0.0025 -0.0286 19  TRP A CD1 
85   C CD2 . TRP A 24  ? 0.3039 0.2620 0.2990 0.0063  -0.0034 -0.0331 19  TRP A CD2 
86   N NE1 . TRP A 24  ? 0.2886 0.2526 0.2742 0.0027  -0.0023 -0.0356 19  TRP A NE1 
87   C CE2 . TRP A 24  ? 0.3154 0.2836 0.3094 0.0044  -0.0030 -0.0386 19  TRP A CE2 
88   C CE3 . TRP A 24  ? 0.3348 0.2955 0.3380 0.0068  -0.0039 -0.0354 19  TRP A CE3 
89   C CZ2 . TRP A 24  ? 0.3107 0.2929 0.3114 0.0038  -0.0031 -0.0462 19  TRP A CZ2 
90   C CZ3 . TRP A 24  ? 0.3287 0.3016 0.3393 0.0071  -0.0045 -0.0433 19  TRP A CZ3 
91   C CH2 . TRP A 24  ? 0.3619 0.3457 0.3710 0.0059  -0.0041 -0.0486 19  TRP A CH2 
92   N N   . ILE A 25  ? 0.2918 0.2200 0.2953 0.0073  -0.0127 -0.0243 20  ILE A N   
93   C CA  . ILE A 25  ? 0.3081 0.2320 0.3212 0.0096  -0.0193 -0.0308 20  ILE A CA  
94   C C   . ILE A 25  ? 0.4192 0.3310 0.4309 0.0137  -0.0263 -0.0305 20  ILE A C   
95   O O   . ILE A 25  ? 0.3667 0.2802 0.3857 0.0195  -0.0327 -0.0395 20  ILE A O   
96   C CB  . ILE A 25  ? 0.3729 0.2898 0.3892 0.0049  -0.0201 -0.0287 20  ILE A CB  
97   C CG1 . ILE A 25  ? 0.3112 0.2434 0.3316 0.0032  -0.0147 -0.0324 20  ILE A CG1 
98   C CG2 . ILE A 25  ? 0.4628 0.3669 0.4860 0.0072  -0.0292 -0.0338 20  ILE A CG2 
99   C CD1 . ILE A 25  ? 0.3114 0.2559 0.3413 0.0073  -0.0166 -0.0435 20  ILE A CD1 
100  N N   . GLN A 26  ? 0.3809 0.2824 0.3830 0.0117  -0.0257 -0.0212 21  GLN A N   
101  C CA  . GLN A 26  ? 0.3968 0.2852 0.3954 0.0161  -0.0332 -0.0200 21  GLN A CA  
102  C C   . GLN A 26  ? 0.4340 0.3344 0.4352 0.0225  -0.0345 -0.0279 21  GLN A C   
103  O O   . GLN A 26  ? 0.4829 0.3773 0.4850 0.0292  -0.0425 -0.0319 21  GLN A O   
104  C CB  . GLN A 26  ? 0.4017 0.2788 0.3883 0.0114  -0.0316 -0.0078 21  GLN A CB  
105  C CG  . GLN A 26  ? 0.4802 0.3433 0.4636 0.0037  -0.0331 -0.0010 21  GLN A CG  
106  C CD  . GLN A 26  ? 0.6173 0.4806 0.5899 -0.0044 -0.0274 0.0098  21  GLN A CD  
107  O OE1 . GLN A 26  ? 0.5292 0.4033 0.4977 -0.0030 -0.0223 0.0116  21  GLN A OE1 
108  N NE2 . GLN A 26  ? 0.6489 0.5014 0.6168 -0.0137 -0.0286 0.0162  21  GLN A NE2 
109  N N   . THR A 27  ? 0.4012 0.3187 0.4029 0.0204  -0.0274 -0.0309 22  THR A N   
110  C CA  . THR A 27  ? 0.3618 0.2932 0.3654 0.0234  -0.0279 -0.0388 22  THR A CA  
111  C C   . THR A 27  ? 0.4798 0.4230 0.4953 0.0287  -0.0336 -0.0524 22  THR A C   
112  O O   . THR A 27  ? 0.4278 0.3854 0.4466 0.0321  -0.0357 -0.0615 22  THR A O   
113  C CB  . THR A 27  ? 0.3765 0.3201 0.3745 0.0175  -0.0196 -0.0379 22  THR A CB  
114  O OG1 . THR A 27  ? 0.3517 0.3046 0.3535 0.0145  -0.0164 -0.0415 22  THR A OG1 
115  C CG2 . THR A 27  ? 0.3516 0.2854 0.3384 0.0141  -0.0150 -0.0269 22  THR A CG2 
116  N N   . PHE A 28  ? 0.3787 0.3184 0.4011 0.0296  -0.0362 -0.0553 23  PHE A N   
117  C CA  . PHE A 28  ? 0.4016 0.3546 0.4361 0.0356  -0.0421 -0.0700 23  PHE A CA  
118  C C   . PHE A 28  ? 0.5724 0.5129 0.6105 0.0459  -0.0546 -0.0759 23  PHE A C   
119  O O   . PHE A 28  ? 0.5939 0.5491 0.6418 0.0539  -0.0611 -0.0908 23  PHE A O   
120  C CB  . PHE A 28  ? 0.3052 0.2607 0.3463 0.0331  -0.0406 -0.0724 23  PHE A CB  
121  C CG  . PHE A 28  ? 0.3772 0.3511 0.4166 0.0261  -0.0310 -0.0721 23  PHE A CG  
122  C CD1 . PHE A 28  ? 0.3033 0.2700 0.3328 0.0195  -0.0236 -0.0602 23  PHE A CD1 
123  C CD2 . PHE A 28  ? 0.3372 0.3360 0.3835 0.0264  -0.0302 -0.0841 23  PHE A CD2 
124  C CE1 . PHE A 28  ? 0.3574 0.3367 0.3825 0.0143  -0.0167 -0.0596 23  PHE A CE1 
125  C CE2 . PHE A 28  ? 0.3355 0.3480 0.3767 0.0190  -0.0222 -0.0824 23  PHE A CE2 
126  C CZ  . PHE A 28  ? 0.3132 0.3137 0.3430 0.0134  -0.0160 -0.0697 23  PHE A CZ  
127  N N   . ASN A 29  ? 0.5113 0.4253 0.5405 0.0458  -0.0585 -0.0647 24  ASN A N   
128  C CA  . ASN A 29  ? 0.6117 0.5055 0.6401 0.0554  -0.0723 -0.0679 24  ASN A CA  
129  C C   . ASN A 29  ? 0.6008 0.4923 0.6399 0.0624  -0.0818 -0.0804 24  ASN A C   
130  O O   . ASN A 29  ? 0.5992 0.4952 0.6445 0.0746  -0.0926 -0.0940 24  ASN A O   
131  C CB  . ASN A 29  ? 0.7187 0.6221 0.7463 0.0642  -0.0772 -0.0748 24  ASN A CB  
132  C CG  . ASN A 29  ? 0.8690 0.7646 0.8839 0.0596  -0.0722 -0.0616 24  ASN A CG  
133  O OD1 . ASN A 29  ? 0.8193 0.7341 0.8335 0.0555  -0.0637 -0.0619 24  ASN A OD1 
134  N ND2 . ASN A 29  ? 0.9456 0.8125 0.9493 0.0595  -0.0780 -0.0501 24  ASN A ND2 
135  N N   . VAL A 30  ? 0.5179 0.4039 0.5597 0.0554  -0.0784 -0.0772 25  VAL A N   
136  C CA  . VAL A 30  ? 0.5595 0.4393 0.6107 0.0613  -0.0880 -0.0884 25  VAL A CA  
137  C C   . VAL A 30  ? 0.7125 0.5536 0.7549 0.0656  -0.1022 -0.0837 25  VAL A C   
138  O O   . VAL A 30  ? 0.6454 0.4658 0.6736 0.0608  -0.1020 -0.0693 25  VAL A O   
139  C CB  . VAL A 30  ? 0.4276 0.3131 0.4839 0.0520  -0.0803 -0.0866 25  VAL A CB  
140  C CG1 . VAL A 30  ? 0.4902 0.4105 0.5524 0.0482  -0.0681 -0.0909 25  VAL A CG1 
141  C CG2 . VAL A 30  ? 0.5161 0.3796 0.5608 0.0398  -0.0752 -0.0691 25  VAL A CG2 
142  N N   . ASP A 31  ? 0.6841 0.5145 0.7335 0.0742  -0.1150 -0.0958 26  ASP A N   
143  C CA  . ASP A 31  ? 0.8382 0.6279 0.8776 0.0803  -0.1319 -0.0934 26  ASP A CA  
144  C C   . ASP A 31  ? 0.8322 0.5883 0.8573 0.0649  -0.1301 -0.0749 26  ASP A C   
145  O O   . ASP A 31  ? 0.9751 0.7011 0.9833 0.0625  -0.1363 -0.0624 26  ASP A O   
146  C CB  . ASP A 31  ? 0.9848 0.7715 1.0358 0.0942  -0.1470 -0.1130 26  ASP A CB  
147  C CG  . ASP A 31  ? 1.2432 0.9870 1.2824 0.1053  -0.1681 -0.1137 26  ASP A CG  
148  O OD1 . ASP A 31  ? 1.2938 1.0253 1.3208 0.1099  -0.1726 -0.1069 26  ASP A OD1 
149  O OD2 . ASP A 31  ? 1.3463 1.0670 1.3874 0.1096  -0.1810 -0.1212 26  ASP A OD2 
150  N N   . ALA A 32  ? 0.6977 0.4607 0.7291 0.0539  -0.1219 -0.0737 27  ALA A N   
151  C CA  . ALA A 32  ? 0.6655 0.4034 0.6849 0.0372  -0.1189 -0.0580 27  ALA A CA  
152  C C   . ALA A 32  ? 0.7138 0.4566 0.7210 0.0259  -0.1065 -0.0409 27  ALA A C   
153  O O   . ALA A 32  ? 0.7098 0.4832 0.7225 0.0271  -0.0949 -0.0418 27  ALA A O   
154  C CB  . ALA A 32  ? 0.6809 0.4328 0.7117 0.0287  -0.1118 -0.0628 27  ALA A CB  
155  N N   . PRO A 33  ? 0.8344 0.5468 0.8240 0.0144  -0.1094 -0.0256 28  PRO A N   
156  C CA  . PRO A 33  ? 0.7679 0.4852 0.7452 0.0025  -0.0983 -0.0098 28  PRO A CA  
157  C C   . PRO A 33  ? 0.6213 0.3724 0.6075 -0.0064 -0.0812 -0.0091 28  PRO A C   
158  O O   . PRO A 33  ? 0.6689 0.4281 0.6648 -0.0110 -0.0783 -0.0149 28  PRO A O   
159  C CB  . PRO A 33  ? 0.8877 0.5676 0.8463 -0.0116 -0.1051 0.0039  28  PRO A CB  
160  C CG  . PRO A 33  ? 0.9511 0.5973 0.9073 -0.0013 -0.1243 -0.0035 28  PRO A CG  
161  C CD  . PRO A 33  ? 0.9597 0.6295 0.9385 0.0115  -0.1248 -0.0229 28  PRO A CD  
162  N N   . CYS A 34  ? 0.5521 0.3222 0.5346 -0.0078 -0.0709 -0.0029 29  CYS A N   
163  C CA  . CYS A 34  ? 0.5569 0.3574 0.5463 -0.0135 -0.0565 -0.0032 29  CYS A CA  
164  C C   . CYS A 34  ? 0.6484 0.4573 0.6269 -0.0201 -0.0479 0.0080  29  CYS A C   
165  O O   . CYS A 34  ? 0.8438 0.6747 0.8256 -0.0154 -0.0403 0.0059  29  CYS A O   
166  C CB  . CYS A 34  ? 0.5402 0.3661 0.5434 -0.0022 -0.0530 -0.0156 29  CYS A CB  
167  S SG  . CYS A 34  ? 0.7827 0.6122 0.7843 0.0110  -0.0572 -0.0192 29  CYS A SG  
168  N N   . GLN A 35  ? 0.6781 0.4695 0.6427 -0.0316 -0.0496 0.0196  30  GLN A N   
169  C CA  . GLN A 35  ? 0.6760 0.4770 0.6297 -0.0380 -0.0422 0.0296  30  GLN A CA  
170  C C   . GLN A 35  ? 0.7524 0.5758 0.7079 -0.0499 -0.0311 0.0312  30  GLN A C   
171  O O   . GLN A 35  ? 0.7140 0.5580 0.6671 -0.0505 -0.0230 0.0334  30  GLN A O   
172  C CB  . GLN A 35  ? 0.7635 0.5363 0.6989 -0.0445 -0.0500 0.0416  30  GLN A CB  
173  C CG  . GLN A 35  ? 0.9624 0.7166 0.8942 -0.0302 -0.0613 0.0398  30  GLN A CG  
174  C CD  . GLN A 35  ? 1.1106 0.8360 1.0212 -0.0357 -0.0697 0.0527  30  GLN A CD  
175  O OE1 . GLN A 35  ? 1.1034 0.8171 1.0086 -0.0241 -0.0781 0.0525  30  GLN A OE1 
176  N NE2 . GLN A 35  ? 1.1669 0.8818 1.0646 -0.0539 -0.0678 0.0639  30  GLN A NE2 
177  N N   . THR A 36  ? 0.6560 0.4767 0.6161 -0.0587 -0.0314 0.0287  31  THR A N   
178  C CA  . THR A 36  ? 0.5486 0.3924 0.5109 -0.0708 -0.0217 0.0287  31  THR A CA  
179  C C   . THR A 36  ? 0.5328 0.3928 0.5107 -0.0679 -0.0187 0.0172  31  THR A C   
180  O O   . THR A 36  ? 0.4957 0.3461 0.4824 -0.0595 -0.0247 0.0098  31  THR A O   
181  C CB  . THR A 36  ? 0.5258 0.3548 0.4756 -0.0905 -0.0232 0.0380  31  THR A CB  
182  O OG1 . THR A 36  ? 0.5404 0.3446 0.4929 -0.0937 -0.0319 0.0352  31  THR A OG1 
183  C CG2 . THR A 36  ? 0.6775 0.4877 0.6087 -0.0951 -0.0272 0.0508  31  THR A CG2 
184  N N   . VAL A 37  ? 0.4731 0.3599 0.4542 -0.0749 -0.0097 0.0149  32  VAL A N   
185  C CA  . VAL A 37  ? 0.4953 0.3994 0.4895 -0.0743 -0.0066 0.0046  32  VAL A CA  
186  C C   . VAL A 37  ? 0.5194 0.4030 0.5170 -0.0820 -0.0135 0.0025  32  VAL A C   
187  O O   . VAL A 37  ? 0.5112 0.3968 0.5208 -0.0745 -0.0160 -0.0072 32  VAL A O   
188  C CB  . VAL A 37  ? 0.5142 0.4496 0.5089 -0.0827 0.0027  0.0028  32  VAL A CB  
189  C CG1 . VAL A 37  ? 0.5110 0.4612 0.5175 -0.0868 0.0047  -0.0069 32  VAL A CG1 
190  C CG2 . VAL A 37  ? 0.5142 0.4709 0.5090 -0.0702 0.0078  0.0002  32  VAL A CG2 
191  N N   . GLU A 38  ? 0.4557 0.3181 0.4414 -0.0974 -0.0171 0.0116  33  GLU A N   
192  C CA  . GLU A 38  ? 0.4676 0.3047 0.4535 -0.1062 -0.0252 0.0105  33  GLU A CA  
193  C C   . GLU A 38  ? 0.5595 0.3708 0.5500 -0.0912 -0.0369 0.0053  33  GLU A C   
194  O O   . GLU A 38  ? 0.5650 0.3654 0.5633 -0.0912 -0.0430 -0.0024 33  GLU A O   
195  C CB  . GLU A 38  ? 0.6092 0.4231 0.5764 -0.1267 -0.0280 0.0235  33  GLU A CB  
196  C CG  . GLU A 38  ? 0.8116 0.6454 0.7785 -0.1477 -0.0201 0.0233  33  GLU A CG  
197  C CD  . GLU A 38  ? 1.0155 0.8454 0.9941 -0.1518 -0.0234 0.0134  33  GLU A CD  
198  O OE1 . GLU A 38  ? 1.1325 0.9916 1.1183 -0.1627 -0.0151 0.0074  33  GLU A OE1 
199  O OE2 . GLU A 38  ? 1.0950 0.8944 1.0759 -0.1434 -0.0347 0.0102  33  GLU A OE2 
200  N N   . ASP A 39  ? 0.4835 0.2874 0.4699 -0.0782 -0.0402 0.0081  34  ASP A N   
201  C CA  . ASP A 39  ? 0.4952 0.2799 0.4863 -0.0628 -0.0515 0.0014  34  ASP A CA  
202  C C   . ASP A 39  ? 0.4812 0.2895 0.4911 -0.0505 -0.0491 -0.0133 34  ASP A C   
203  O O   . ASP A 39  ? 0.4931 0.2919 0.5104 -0.0392 -0.0581 -0.0225 34  ASP A O   
204  C CB  . ASP A 39  ? 0.5626 0.3406 0.5458 -0.0520 -0.0545 0.0064  34  ASP A CB  
205  C CG  . ASP A 39  ? 0.6096 0.3566 0.5727 -0.0609 -0.0613 0.0201  34  ASP A CG  
206  O OD1 . ASP A 39  ? 0.6251 0.3461 0.5793 -0.0736 -0.0677 0.0250  34  ASP A OD1 
207  O OD2 . ASP A 39  ? 0.5998 0.3473 0.5547 -0.0557 -0.0607 0.0261  34  ASP A OD2 
208  N N   . LEU A 40  ? 0.4076 0.2479 0.4244 -0.0522 -0.0375 -0.0162 35  LEU A N   
209  C CA  . LEU A 40  ? 0.4203 0.2838 0.4519 -0.0413 -0.0347 -0.0286 35  LEU A CA  
210  C C   . LEU A 40  ? 0.4242 0.2980 0.4660 -0.0473 -0.0332 -0.0367 35  LEU A C   
211  O O   . LEU A 40  ? 0.4104 0.3020 0.4639 -0.0387 -0.0321 -0.0474 35  LEU A O   
212  C CB  . LEU A 40  ? 0.4096 0.2995 0.4405 -0.0360 -0.0247 -0.0274 35  LEU A CB  
213  C CG  . LEU A 40  ? 0.5162 0.4058 0.5447 -0.0241 -0.0263 -0.0273 35  LEU A CG  
214  C CD1 . LEU A 40  ? 0.5575 0.4216 0.5760 -0.0244 -0.0334 -0.0197 35  LEU A CD1 
215  C CD2 . LEU A 40  ? 0.5925 0.5023 0.6169 -0.0216 -0.0173 -0.0245 35  LEU A CD2 
216  N N   . THR A 41  ? 0.4555 0.3193 0.4924 -0.0628 -0.0333 -0.0320 36  THR A N   
217  C CA  . THR A 41  ? 0.4804 0.3599 0.5270 -0.0703 -0.0299 -0.0398 36  THR A CA  
218  C C   . THR A 41  ? 0.4388 0.3061 0.4962 -0.0665 -0.0390 -0.0511 36  THR A C   
219  O O   . THR A 41  ? 0.4002 0.2861 0.4686 -0.0684 -0.0360 -0.0604 36  THR A O   
220  C CB  . THR A 41  ? 0.4777 0.3551 0.5158 -0.0914 -0.0259 -0.0323 36  THR A CB  
221  O OG1 . THR A 41  ? 0.4835 0.3221 0.5092 -0.1014 -0.0354 -0.0239 36  THR A OG1 
222  C CG2 . THR A 41  ? 0.4486 0.3485 0.4794 -0.0946 -0.0158 -0.0251 36  THR A CG2 
223  N N   . ASN A 42  ? 0.4512 0.2890 0.5059 -0.0599 -0.0509 -0.0518 37  ASN A N   
224  C CA  . ASN A 42  ? 0.5227 0.3511 0.5886 -0.0545 -0.0606 -0.0648 37  ASN A CA  
225  C C   . ASN A 42  ? 0.4131 0.2619 0.4920 -0.0356 -0.0618 -0.0775 37  ASN A C   
226  O O   . ASN A 42  ? 0.4542 0.3012 0.5440 -0.0286 -0.0697 -0.0906 37  ASN A O   
227  C CB  . ASN A 42  ? 0.5486 0.3318 0.6047 -0.0577 -0.0756 -0.0617 37  ASN A CB  
228  C CG  . ASN A 42  ? 0.6316 0.3966 0.6796 -0.0449 -0.0835 -0.0578 37  ASN A CG  
229  O OD1 . ASN A 42  ? 0.5086 0.2959 0.5623 -0.0315 -0.0793 -0.0614 37  ASN A OD1 
230  N ND2 . ASN A 42  ? 0.6609 0.3841 0.6942 -0.0495 -0.0957 -0.0504 37  ASN A ND2 
231  N N   . GLY A 43  ? 0.3899 0.2583 0.4668 -0.0282 -0.0543 -0.0739 38  GLY A N   
232  C CA  . GLY A 43  ? 0.4112 0.3047 0.4983 -0.0145 -0.0525 -0.0846 38  GLY A CA  
233  C C   . GLY A 43  ? 0.4450 0.3304 0.5335 -0.0013 -0.0615 -0.0904 38  GLY A C   
234  O O   . GLY A 43  ? 0.4300 0.3388 0.5244 0.0080  -0.0587 -0.0976 38  GLY A O   
235  N N   . VAL A 44  ? 0.4062 0.2590 0.4880 -0.0009 -0.0727 -0.0874 39  VAL A N   
236  C CA  . VAL A 44  ? 0.4187 0.2628 0.5019 0.0132  -0.0836 -0.0948 39  VAL A CA  
237  C C   . VAL A 44  ? 0.4064 0.2666 0.4850 0.0187  -0.0772 -0.0902 39  VAL A C   
238  O O   . VAL A 44  ? 0.3846 0.2655 0.4712 0.0296  -0.0783 -0.1013 39  VAL A O   
239  C CB  . VAL A 44  ? 0.5093 0.3099 0.5818 0.0122  -0.0979 -0.0901 39  VAL A CB  
240  C CG1 . VAL A 44  ? 0.5364 0.3296 0.6093 0.0289  -0.1099 -0.0982 39  VAL A CG1 
241  C CG2 . VAL A 44  ? 0.5463 0.3284 0.6234 0.0071  -0.1063 -0.0968 39  VAL A CG2 
242  N N   . VAL A 45  ? 0.4444 0.2970 0.5101 0.0106  -0.0705 -0.0748 40  VAL A N   
243  C CA  . VAL A 45  ? 0.3800 0.2465 0.4406 0.0147  -0.0643 -0.0702 40  VAL A CA  
244  C C   . VAL A 45  ? 0.4072 0.3084 0.4753 0.0170  -0.0543 -0.0764 40  VAL A C   
245  O O   . VAL A 45  ? 0.3875 0.3036 0.4576 0.0242  -0.0539 -0.0819 40  VAL A O   
246  C CB  . VAL A 45  ? 0.4564 0.3124 0.5025 0.0047  -0.0578 -0.0534 40  VAL A CB  
247  C CG1 . VAL A 45  ? 0.4045 0.2781 0.4463 0.0081  -0.0499 -0.0496 40  VAL A CG1 
248  C CG2 . VAL A 45  ? 0.4532 0.2743 0.4879 0.0026  -0.0681 -0.0457 40  VAL A CG2 
249  N N   . MET A 46  ? 0.3319 0.2460 0.4032 0.0104  -0.0469 -0.0759 41  MET A N   
250  C CA  . MET A 46  ? 0.3099 0.2530 0.3846 0.0124  -0.0386 -0.0803 41  MET A CA  
251  C C   . MET A 46  ? 0.3050 0.2650 0.3915 0.0208  -0.0433 -0.0958 41  MET A C   
252  O O   . MET A 46  ? 0.2982 0.2786 0.3842 0.0238  -0.0393 -0.0993 41  MET A O   
253  C CB  . MET A 46  ? 0.3372 0.2906 0.4123 0.0054  -0.0312 -0.0776 41  MET A CB  
254  C CG  . MET A 46  ? 0.3387 0.2871 0.4021 -0.0012 -0.0245 -0.0645 41  MET A CG  
255  S SD  . MET A 46  ? 0.4578 0.4237 0.5220 -0.0071 -0.0165 -0.0640 41  MET A SD  
256  C CE  . MET A 46  ? 0.4301 0.3842 0.5031 -0.0145 -0.0221 -0.0687 41  MET A CE  
257  N N   . ALA A 47  ? 0.3679 0.3195 0.4638 0.0240  -0.0523 -0.1055 42  ALA A N   
258  C CA  . ALA A 47  ? 0.3605 0.3298 0.4688 0.0334  -0.0584 -0.1226 42  ALA A CA  
259  C C   . ALA A 47  ? 0.3775 0.3508 0.4847 0.0416  -0.0630 -0.1271 42  ALA A C   
260  O O   . ALA A 47  ? 0.3337 0.3354 0.4464 0.0457  -0.0609 -0.1372 42  ALA A O   
261  C CB  . ALA A 47  ? 0.3326 0.2868 0.4504 0.0364  -0.0695 -0.1326 42  ALA A CB  
262  N N   . GLN A 48  ? 0.3517 0.2985 0.4510 0.0431  -0.0690 -0.1197 43  GLN A N   
263  C CA  . GLN A 48  ? 0.3687 0.3194 0.4668 0.0516  -0.0740 -0.1243 43  GLN A CA  
264  C C   . GLN A 48  ? 0.3622 0.3341 0.4538 0.0472  -0.0626 -0.1184 43  GLN A C   
265  O O   . GLN A 48  ? 0.3325 0.3245 0.4274 0.0525  -0.0637 -0.1277 43  GLN A O   
266  C CB  . GLN A 48  ? 0.3800 0.2949 0.4686 0.0541  -0.0836 -0.1163 43  GLN A CB  
267  C CG  . GLN A 48  ? 0.4773 0.3676 0.5706 0.0606  -0.0986 -0.1247 43  GLN A CG  
268  C CD  . GLN A 48  ? 0.5481 0.3977 0.6280 0.0615  -0.1092 -0.1148 43  GLN A CD  
269  O OE1 . GLN A 48  ? 0.6018 0.4435 0.6697 0.0569  -0.1044 -0.1012 43  GLN A OE1 
270  N NE2 . GLN A 48  ? 0.5654 0.3877 0.6461 0.0675  -0.1245 -0.1216 43  GLN A NE2 
271  N N   . VAL A 49  ? 0.3248 0.2929 0.4070 0.0373  -0.0523 -0.1041 44  VAL A N   
272  C CA  . VAL A 49  ? 0.3159 0.2996 0.3901 0.0328  -0.0426 -0.0982 44  VAL A CA  
273  C C   . VAL A 49  ? 0.3141 0.3286 0.3936 0.0316  -0.0376 -0.1078 44  VAL A C   
274  O O   . VAL A 49  ? 0.3065 0.3392 0.3829 0.0303  -0.0341 -0.1107 44  VAL A O   
275  C CB  . VAL A 49  ? 0.3178 0.2887 0.3803 0.0244  -0.0346 -0.0820 44  VAL A CB  
276  C CG1 . VAL A 49  ? 0.3188 0.3043 0.3724 0.0200  -0.0255 -0.0772 44  VAL A CG1 
277  C CG2 . VAL A 49  ? 0.3231 0.2684 0.3777 0.0241  -0.0384 -0.0720 44  VAL A CG2 
278  N N   . LEU A 50  ? 0.3149 0.3359 0.4015 0.0309  -0.0373 -0.1127 45  LEU A N   
279  C CA  . LEU A 50  ? 0.2661 0.3166 0.3565 0.0296  -0.0330 -0.1215 45  LEU A CA  
280  C C   . LEU A 50  ? 0.2664 0.3386 0.3668 0.0362  -0.0389 -0.1380 45  LEU A C   
281  O O   . LEU A 50  ? 0.2809 0.3798 0.3793 0.0326  -0.0341 -0.1430 45  LEU A O   
282  C CB  . LEU A 50  ? 0.2647 0.3185 0.3620 0.0289  -0.0327 -0.1250 45  LEU A CB  
283  C CG  . LEU A 50  ? 0.2630 0.3083 0.3496 0.0220  -0.0249 -0.1114 45  LEU A CG  
284  C CD1 . LEU A 50  ? 0.2693 0.3155 0.3641 0.0217  -0.0258 -0.1154 45  LEU A CD1 
285  C CD2 . LEU A 50  ? 0.2533 0.3144 0.3280 0.0175  -0.0171 -0.1067 45  LEU A CD2 
286  N N   . GLN A 51  ? 0.2860 0.3467 0.3956 0.0454  -0.0498 -0.1466 46  GLN A N   
287  C CA  . GLN A 51  ? 0.3071 0.3894 0.4266 0.0543  -0.0571 -0.1644 46  GLN A CA  
288  C C   . GLN A 51  ? 0.2857 0.3796 0.3978 0.0519  -0.0533 -0.1622 46  GLN A C   
289  O O   . GLN A 51  ? 0.3300 0.4571 0.4473 0.0526  -0.0527 -0.1754 46  GLN A O   
290  C CB  . GLN A 51  ? 0.2973 0.3581 0.4252 0.0666  -0.0720 -0.1732 46  GLN A CB  
291  C CG  . GLN A 51  ? 0.3420 0.4276 0.4813 0.0789  -0.0815 -0.1947 46  GLN A CG  
292  C CD  . GLN A 51  ? 0.4111 0.4714 0.5567 0.0933  -0.0988 -0.2041 46  GLN A CD  
293  O OE1 . GLN A 51  ? 0.4501 0.4714 0.5862 0.0936  -0.1038 -0.1914 46  GLN A OE1 
294  N NE2 . GLN A 51  ? 0.4890 0.5710 0.6492 0.1055  -0.1088 -0.2270 46  GLN A NE2 
295  N N   . LYS A 52  ? 0.2786 0.3475 0.3790 0.0485  -0.0510 -0.1467 47  LYS A N   
296  C CA  . LYS A 52  ? 0.2981 0.3771 0.3909 0.0451  -0.0470 -0.1443 47  LYS A CA  
297  C C   . LYS A 52  ? 0.3825 0.4851 0.4679 0.0331  -0.0355 -0.1414 47  LYS A C   
298  O O   . LYS A 52  ? 0.3210 0.4500 0.4062 0.0297  -0.0332 -0.1494 47  LYS A O   
299  C CB  . LYS A 52  ? 0.3668 0.4147 0.4478 0.0433  -0.0461 -0.1276 47  LYS A CB  
300  C CG  . LYS A 52  ? 0.4417 0.4609 0.5251 0.0529  -0.0575 -0.1270 47  LYS A CG  
301  C CD  . LYS A 52  ? 0.5832 0.6101 0.6719 0.0641  -0.0674 -0.1398 47  LYS A CD  
302  C CE  . LYS A 52  ? 0.6515 0.6427 0.7361 0.0725  -0.0790 -0.1348 47  LYS A CE  
303  N NZ  . LYS A 52  ? 0.6911 0.6897 0.7824 0.0873  -0.0921 -0.1511 47  LYS A NZ  
304  N N   . ILE A 53  ? 0.3107 0.4040 0.3891 0.0263  -0.0291 -0.1305 48  ILE A N   
305  C CA  . ILE A 53  ? 0.2742 0.3821 0.3412 0.0150  -0.0197 -0.1252 48  ILE A CA  
306  C C   . ILE A 53  ? 0.3054 0.4506 0.3794 0.0127  -0.0189 -0.1404 48  ILE A C   
307  O O   . ILE A 53  ? 0.2744 0.4402 0.3408 0.0036  -0.0139 -0.1421 48  ILE A O   
308  C CB  . ILE A 53  ? 0.2825 0.3727 0.3414 0.0114  -0.0152 -0.1125 48  ILE A CB  
309  C CG1 . ILE A 53  ? 0.2745 0.3350 0.3236 0.0109  -0.0141 -0.0975 48  ILE A CG1 
310  C CG2 . ILE A 53  ? 0.3306 0.4354 0.3775 0.0018  -0.0082 -0.1092 48  ILE A CG2 
311  C CD1 . ILE A 53  ? 0.3238 0.3687 0.3672 0.0095  -0.0110 -0.0873 48  ILE A CD1 
312  N N   . ASP A 54  ? 0.2964 0.4515 0.3843 0.0199  -0.0238 -0.1518 49  ASP A N   
313  C CA  . ASP A 54  ? 0.2469 0.4414 0.3441 0.0197  -0.0244 -0.1695 49  ASP A CA  
314  C C   . ASP A 54  ? 0.2547 0.4559 0.3720 0.0342  -0.0355 -0.1874 49  ASP A C   
315  O O   . ASP A 54  ? 0.2535 0.4515 0.3784 0.0383  -0.0382 -0.1910 49  ASP A O   
316  C CB  . ASP A 54  ? 0.2897 0.4973 0.3799 0.0112  -0.0176 -0.1660 49  ASP A CB  
317  C CG  . ASP A 54  ? 0.4010 0.6534 0.4949 0.0062  -0.0156 -0.1813 49  ASP A CG  
318  O OD1 . ASP A 54  ? 0.3322 0.6085 0.4411 0.0136  -0.0216 -0.1994 49  ASP A OD1 
319  O OD2 . ASP A 54  ? 0.2978 0.5625 0.3790 -0.0051 -0.0085 -0.1756 49  ASP A OD2 
320  N N   . PRO A 55  ? 0.2530 0.4641 0.3787 0.0425  -0.0428 -0.2000 50  PRO A N   
321  C CA  . PRO A 55  ? 0.2601 0.4729 0.4033 0.0587  -0.0561 -0.2182 50  PRO A CA  
322  C C   . PRO A 55  ? 0.3292 0.5831 0.4858 0.0617  -0.0579 -0.2388 50  PRO A C   
323  O O   . PRO A 55  ? 0.3210 0.5741 0.4920 0.0750  -0.0691 -0.2538 50  PRO A O   
324  C CB  . PRO A 55  ? 0.2659 0.4820 0.4112 0.0663  -0.0628 -0.2257 50  PRO A CB  
325  C CG  . PRO A 55  ? 0.3319 0.5684 0.4655 0.0521  -0.0513 -0.2190 50  PRO A CG  
326  C CD  . PRO A 55  ? 0.2532 0.4704 0.3713 0.0380  -0.0400 -0.1974 50  PRO A CD  
327  N N   . ALA A 56  ? 0.2626 0.5508 0.4131 0.0489  -0.0475 -0.2394 51  ALA A N   
328  C CA  . ALA A 56  ? 0.2488 0.5799 0.4104 0.0499  -0.0479 -0.2585 51  ALA A CA  
329  C C   . ALA A 56  ? 0.3379 0.6580 0.5010 0.0495  -0.0467 -0.2539 51  ALA A C   
330  O O   . ALA A 56  ? 0.2898 0.6335 0.4673 0.0571  -0.0521 -0.2718 51  ALA A O   
331  C CB  . ALA A 56  ? 0.2616 0.6345 0.4137 0.0339  -0.0371 -0.2602 51  ALA A CB  
332  N N   . TYR A 57  ? 0.2403 0.5270 0.3891 0.0414  -0.0400 -0.2314 52  TYR A N   
333  C CA  . TYR A 57  ? 0.2881 0.5635 0.4375 0.0409  -0.0386 -0.2264 52  TYR A CA  
334  C C   . TYR A 57  ? 0.2460 0.4831 0.4037 0.0511  -0.0475 -0.2243 52  TYR A C   
335  O O   . TYR A 57  ? 0.2910 0.5303 0.4619 0.0587  -0.0542 -0.2362 52  TYR A O   
336  C CB  . TYR A 57  ? 0.2449 0.5082 0.3737 0.0272  -0.0272 -0.2050 52  TYR A CB  
337  C CG  . TYR A 57  ? 0.2648 0.5242 0.3932 0.0264  -0.0251 -0.2013 52  TYR A CG  
338  C CD1 . TYR A 57  ? 0.2987 0.5239 0.4278 0.0298  -0.0270 -0.1914 52  TYR A CD1 
339  C CD2 . TYR A 57  ? 0.2362 0.5285 0.3633 0.0218  -0.0211 -0.2083 52  TYR A CD2 
340  C CE1 . TYR A 57  ? 0.2463 0.4710 0.3759 0.0292  -0.0251 -0.1896 52  TYR A CE1 
341  C CE2 . TYR A 57  ? 0.2524 0.5426 0.3792 0.0220  -0.0196 -0.2057 52  TYR A CE2 
342  C CZ  . TYR A 57  ? 0.2307 0.4874 0.3594 0.0262  -0.0217 -0.1969 52  TYR A CZ  
343  O OH  . TYR A 57  ? 0.3167 0.5734 0.4460 0.0266  -0.0203 -0.1956 52  TYR A OH  
344  N N   . PHE A 58  ? 0.3018 0.5039 0.4503 0.0499  -0.0475 -0.2090 53  PHE A N   
345  C CA  . PHE A 58  ? 0.3145 0.4780 0.4670 0.0566  -0.0557 -0.2047 53  PHE A CA  
346  C C   . PHE A 58  ? 0.2730 0.4325 0.4354 0.0695  -0.0687 -0.2188 53  PHE A C   
347  O O   . PHE A 58  ? 0.3195 0.4552 0.4754 0.0715  -0.0719 -0.2107 53  PHE A O   
348  C CB  . PHE A 58  ? 0.2625 0.3928 0.3992 0.0488  -0.0495 -0.1816 53  PHE A CB  
349  C CG  . PHE A 58  ? 0.2658 0.3984 0.3918 0.0386  -0.0386 -0.1688 53  PHE A CG  
350  C CD1 . PHE A 58  ? 0.2589 0.3834 0.3887 0.0379  -0.0385 -0.1674 53  PHE A CD1 
351  C CD2 . PHE A 58  ? 0.2556 0.3974 0.3669 0.0300  -0.0296 -0.1589 53  PHE A CD2 
352  C CE1 . PHE A 58  ? 0.3030 0.4307 0.4228 0.0308  -0.0298 -0.1571 53  PHE A CE1 
353  C CE2 . PHE A 58  ? 0.2639 0.4042 0.3634 0.0228  -0.0218 -0.1476 53  PHE A CE2 
354  C CZ  . PHE A 58  ? 0.2446 0.3792 0.3488 0.0241  -0.0221 -0.1473 53  PHE A CZ  
355  N N   . ASP A 59  ? 0.3104 0.4946 0.4883 0.0795  -0.0771 -0.2410 54  ASP A N   
356  C CA  . ASP A 59  ? 0.4054 0.5904 0.5928 0.0943  -0.0910 -0.2579 54  ASP A CA  
357  C C   . ASP A 59  ? 0.4339 0.5791 0.6268 0.1052  -0.1060 -0.2613 54  ASP A C   
358  O O   . ASP A 59  ? 0.3881 0.5055 0.5772 0.0990  -0.1043 -0.2495 54  ASP A O   
359  C CB  . ASP A 59  ? 0.3739 0.6114 0.5754 0.1009  -0.0936 -0.2833 54  ASP A CB  
360  C CG  . ASP A 59  ? 0.4191 0.6752 0.6321 0.1028  -0.0949 -0.2958 54  ASP A CG  
361  O OD1 . ASP A 59  ? 0.3861 0.6130 0.5985 0.1008  -0.0958 -0.2873 54  ASP A OD1 
362  O OD2 . ASP A 59  ? 0.4632 0.7667 0.6874 0.1055  -0.0943 -0.3122 54  ASP A OD2 
363  N N   . GLU A 60  ? 0.4593 0.6016 0.6599 0.1211  -0.1214 -0.2779 55  GLU A N   
364  C CA  . GLU A 60  ? 0.4236 0.5217 0.6255 0.1317  -0.1382 -0.2805 55  GLU A CA  
365  C C   . GLU A 60  ? 0.4567 0.5522 0.6677 0.1305  -0.1412 -0.2848 55  GLU A C   
366  O O   . GLU A 60  ? 0.5078 0.5604 0.7136 0.1278  -0.1469 -0.2756 55  GLU A O   
367  C CB  . GLU A 60  ? 0.5602 0.6658 0.7687 0.1478  -0.1546 -0.2922 55  GLU A CB  
368  C CG  . GLU A 60  ? 0.8052 0.8671 1.0119 0.1571  -0.1734 -0.2903 55  GLU A CG  
369  C CD  . GLU A 60  ? 0.9479 1.0193 1.1597 0.1739  -0.1912 -0.3031 55  GLU A CD  
370  O OE1 . GLU A 60  ? 0.9401 1.0434 1.1540 0.1774  -0.1882 -0.3097 55  GLU A OE1 
371  O OE2 . GLU A 60  ? 1.0301 1.0774 1.2431 0.1834  -0.2086 -0.3071 55  GLU A OE2 
372  N N   . ASN A 61  ? 0.4457 0.5885 0.6699 0.1311  -0.1369 -0.2981 56  ASN A N   
373  C CA  . ASN A 61  ? 0.4868 0.6331 0.7205 0.1297  -0.1382 -0.3030 56  ASN A CA  
374  C C   . ASN A 61  ? 0.4939 0.6191 0.7178 0.1152  -0.1261 -0.2896 56  ASN A C   
375  O O   . ASN A 61  ? 0.5001 0.5977 0.7252 0.1126  -0.1305 -0.2863 56  ASN A O   
376  C CB  . ASN A 61  ? 0.5172 0.7228 0.7661 0.1320  -0.1344 -0.3188 56  ASN A CB  
377  C CG  . ASN A 61  ? 0.7573 0.9858 1.0214 0.1477  -0.1503 -0.3357 56  ASN A CG  
378  O OD1 . ASN A 61  ? 0.7223 0.9180 0.9861 0.1580  -0.1665 -0.3367 56  ASN A OD1 
379  N ND2 . ASN A 61  ? 0.8003 1.0861 1.0773 0.1491  -0.1461 -0.3490 56  ASN A ND2 
380  N N   . TRP A 62  ? 0.4155 0.5574 0.6290 0.1032  -0.1100 -0.2751 57  TRP A N   
381  C CA  . TRP A 62  ? 0.3921 0.5201 0.5950 0.0883  -0.0972 -0.2542 57  TRP A CA  
382  C C   . TRP A 62  ? 0.4628 0.5398 0.6561 0.0841  -0.1014 -0.2379 57  TRP A C   
383  O O   . TRP A 62  ? 0.4857 0.5455 0.6783 0.0768  -0.0996 -0.2312 57  TRP A O   
384  C CB  . TRP A 62  ? 0.3466 0.4946 0.5370 0.0777  -0.0819 -0.2401 57  TRP A CB  
385  C CG  . TRP A 62  ? 0.3426 0.4858 0.5242 0.0656  -0.0701 -0.2241 57  TRP A CG  
386  C CD1 . TRP A 62  ? 0.5580 0.7296 0.7418 0.0613  -0.0629 -0.2277 57  TRP A CD1 
387  C CD2 . TRP A 62  ? 0.4784 0.5883 0.6479 0.0572  -0.0654 -0.2037 57  TRP A CD2 
388  N NE1 . TRP A 62  ? 0.5180 0.6750 0.6917 0.0522  -0.0545 -0.2112 57  TRP A NE1 
389  C CE2 . TRP A 62  ? 0.4824 0.6034 0.6480 0.0493  -0.0557 -0.1969 57  TRP A CE2 
390  C CE3 . TRP A 62  ? 0.5254 0.5992 0.6864 0.0558  -0.0686 -0.1911 57  TRP A CE3 
391  C CZ2 . TRP A 62  ? 0.5656 0.6655 0.7207 0.0410  -0.0494 -0.1798 57  TRP A CZ2 
392  C CZ3 . TRP A 62  ? 0.7432 0.7968 0.8934 0.0459  -0.0614 -0.1732 57  TRP A CZ3 
393  C CH2 . TRP A 62  ? 0.6562 0.7240 0.8042 0.0390  -0.0520 -0.1685 57  TRP A CH2 
394  N N   . LEU A 63  ? 0.4214 0.4767 0.6070 0.0879  -0.1068 -0.2320 58  LEU A N   
395  C CA  . LEU A 63  ? 0.5657 0.5731 0.7395 0.0831  -0.1110 -0.2156 58  LEU A CA  
396  C C   . LEU A 63  ? 0.6294 0.6043 0.8077 0.0864  -0.1251 -0.2223 58  LEU A C   
397  O O   . LEU A 63  ? 0.6294 0.5663 0.7972 0.0774  -0.1266 -0.2076 58  LEU A O   
398  C CB  . LEU A 63  ? 0.5519 0.5450 0.7173 0.0892  -0.1164 -0.2112 58  LEU A CB  
399  C CG  . LEU A 63  ? 0.7254 0.7346 0.8807 0.0819  -0.1027 -0.1978 58  LEU A CG  
400  C CD1 . LEU A 63  ? 0.7852 0.7737 0.9319 0.0880  -0.1099 -0.1931 58  LEU A CD1 
401  C CD2 . LEU A 63  ? 0.7854 0.7854 0.9304 0.0666  -0.0892 -0.1778 58  LEU A CD2 
402  N N   . ASN A 64  ? 0.6162 0.6063 0.8095 0.0984  -0.1357 -0.2449 59  ASN A N   
403  C CA  . ASN A 64  ? 0.7140 0.6719 0.9116 0.1028  -0.1512 -0.2534 59  ASN A CA  
404  C C   . ASN A 64  ? 0.7413 0.6856 0.9371 0.0873  -0.1442 -0.2437 59  ASN A C   
405  O O   . ASN A 64  ? 0.8496 0.7526 1.0402 0.0830  -0.1541 -0.2400 59  ASN A O   
406  C CB  . ASN A 64  ? 0.8018 0.7925 1.0160 0.1167  -0.1602 -0.2727 59  ASN A CB  
407  C CG  . ASN A 64  ? 0.9988 0.9726 1.2118 0.1312  -0.1784 -0.2774 59  ASN A CG  
408  O OD1 . ASN A 64  ? 1.0675 1.0586 1.2803 0.1400  -0.1805 -0.2814 59  ASN A OD1 
409  N ND2 . ASN A 64  ? 1.0771 1.0172 1.2885 0.1336  -0.1924 -0.2774 59  ASN A ND2 
410  N N   . ARG A 65  ? 0.5725 0.5514 0.7711 0.0785  -0.1276 -0.2392 60  ARG A N   
411  C CA  . ARG A 65  ? 0.5323 0.5071 0.7309 0.0650  -0.1202 -0.2321 60  ARG A CA  
412  C C   . ARG A 65  ? 0.5028 0.4426 0.6849 0.0505  -0.1154 -0.2092 60  ARG A C   
413  O O   . ARG A 65  ? 0.5616 0.4887 0.7420 0.0382  -0.1126 -0.2034 60  ARG A O   
414  C CB  . ARG A 65  ? 0.5425 0.5632 0.7461 0.0613  -0.1047 -0.2330 60  ARG A CB  
415  C CG  . ARG A 65  ? 0.5527 0.5845 0.7432 0.0546  -0.0905 -0.2152 60  ARG A CG  
416  C CD  . ARG A 65  ? 0.5466 0.6208 0.7396 0.0527  -0.0781 -0.2174 60  ARG A CD  
417  N NE  . ARG A 65  ? 0.5886 0.6967 0.7916 0.0630  -0.0813 -0.2352 60  ARG A NE  
418  C CZ  . ARG A 65  ? 0.5261 0.6727 0.7320 0.0623  -0.0735 -0.2410 60  ARG A CZ  
419  N NH1 . ARG A 65  ? 0.4837 0.6373 0.6830 0.0537  -0.0630 -0.2305 60  ARG A NH1 
420  N NH2 . ARG A 65  ? 0.4915 0.6710 0.7061 0.0704  -0.0766 -0.2579 60  ARG A NH2 
421  N N   . ILE A 66  ? 0.5211 0.4483 0.6912 0.0514  -0.1143 -0.1971 61  ILE A N   
422  C CA  . ILE A 66  ? 0.6032 0.5017 0.7569 0.0378  -0.1092 -0.1756 61  ILE A CA  
423  C C   . ILE A 66  ? 0.7134 0.5626 0.8583 0.0371  -0.1248 -0.1726 61  ILE A C   
424  O O   . ILE A 66  ? 0.7327 0.5656 0.8735 0.0484  -0.1359 -0.1755 61  ILE A O   
425  C CB  . ILE A 66  ? 0.4808 0.3894 0.6244 0.0381  -0.1000 -0.1629 61  ILE A CB  
426  C CG1 . ILE A 66  ? 0.4363 0.3890 0.5853 0.0388  -0.0863 -0.1655 61  ILE A CG1 
427  C CG2 . ILE A 66  ? 0.5147 0.3981 0.6422 0.0240  -0.0942 -0.1420 61  ILE A CG2 
428  C CD1 . ILE A 66  ? 0.4119 0.3786 0.5619 0.0279  -0.0753 -0.1606 61  ILE A CD1 
429  N N   . LYS A 67  ? 0.6137 0.4391 0.7544 0.0232  -0.1262 -0.1669 62  LYS A N   
430  C CA  . LYS A 67  ? 0.7141 0.4875 0.8425 0.0188  -0.1414 -0.1620 62  LYS A CA  
431  C C   . LYS A 67  ? 0.7310 0.4797 0.8396 0.0128  -0.1399 -0.1420 62  LYS A C   
432  O O   . LYS A 67  ? 0.7526 0.5164 0.8549 0.0014  -0.1247 -0.1277 62  LYS A O   
433  C CB  . LYS A 67  ? 0.6554 0.4125 0.7830 0.0014  -0.1412 -0.1600 62  LYS A CB  
434  C CG  . LYS A 67  ? 0.8362 0.5809 0.9753 0.0087  -0.1564 -0.1795 62  LYS A CG  
435  C CD  . LYS A 67  ? 0.9565 0.7446 1.1165 0.0278  -0.1561 -0.2008 62  LYS A CD  
436  C CE  . LYS A 67  ? 1.0357 0.8707 1.2076 0.0212  -0.1387 -0.2032 62  LYS A CE  
437  N NZ  . LYS A 67  ? 1.0444 0.9199 1.2350 0.0377  -0.1396 -0.2243 62  LYS A NZ  
438  N N   . THR A 68  ? 0.7044 0.4157 0.8029 0.0216  -0.1565 -0.1421 63  THR A N   
439  C CA  . THR A 68  ? 0.7936 0.4809 0.8725 0.0173  -0.1567 -0.1239 63  THR A CA  
440  C C   . THR A 68  ? 0.9349 0.5748 0.9938 -0.0018 -0.1623 -0.1081 63  THR A C   
441  O O   . THR A 68  ? 1.1074 0.7440 1.1523 -0.0170 -0.1521 -0.0897 63  THR A O   
442  C CB  . THR A 68  ? 0.8586 0.5332 0.9350 0.0383  -0.1716 -0.1317 63  THR A CB  
443  O OG1 . THR A 68  ? 0.8903 0.5510 0.9722 0.0507  -0.1884 -0.1468 63  THR A OG1 
444  C CG2 . THR A 68  ? 0.7384 0.4622 0.8281 0.0511  -0.1613 -0.1400 63  THR A CG2 
445  N N   . GLU A 69  ? 0.9121 0.5173 0.9684 -0.0017 -0.1784 -0.1152 64  GLU A N   
446  C CA  . GLU A 69  ? 1.1089 0.6735 1.1437 -0.0220 -0.1820 -0.0989 64  GLU A CA  
447  C C   . GLU A 69  ? 1.0373 0.6137 1.0768 -0.0461 -0.1691 -0.0950 64  GLU A C   
448  O O   . GLU A 69  ? 1.0877 0.6654 1.1360 -0.0515 -0.1709 -0.1047 64  GLU A O   
449  C CB  . GLU A 69  ? 1.3091 0.8458 1.3386 -0.0141 -0.1985 -0.1054 64  GLU A CB  
450  C CG  . GLU A 69  ? 1.4484 0.9731 1.4718 0.0089  -0.2135 -0.1089 64  GLU A CG  
451  C CD  . GLU A 69  ? 1.6012 1.1000 1.6007 0.0038  -0.2148 -0.0892 64  GLU A CD  
452  O OE1 . GLU A 69  ? 1.6883 1.1570 1.6673 -0.0178 -0.2129 -0.0716 64  GLU A OE1 
453  O OE2 . GLU A 69  ? 1.6407 1.1517 1.6416 0.0206  -0.2173 -0.0918 64  GLU A OE2 
454  N N   . VAL A 70  ? 0.9662 0.5645 0.9991 -0.0591 -0.1519 -0.0796 65  VAL A N   
455  C CA  . VAL A 70  ? 0.8966 0.5256 0.9355 -0.0781 -0.1348 -0.0763 65  VAL A CA  
456  C C   . VAL A 70  ? 0.8957 0.4976 0.9131 -0.1060 -0.1327 -0.0584 65  VAL A C   
457  O O   . VAL A 70  ? 0.8970 0.4984 0.9157 -0.1245 -0.1298 -0.0598 65  VAL A O   
458  C CB  . VAL A 70  ? 0.8687 0.5496 0.9176 -0.0724 -0.1160 -0.0747 65  VAL A CB  
459  C CG1 . VAL A 70  ? 0.8606 0.5729 0.9144 -0.0903 -0.1000 -0.0722 65  VAL A CG1 
460  C CG2 . VAL A 70  ? 0.8699 0.5805 0.9386 -0.0488 -0.1168 -0.0919 65  VAL A CG2 
461  N N   . GLY A 71  ? 0.9564 0.5381 0.9538 -0.1099 -0.1337 -0.0419 66  GLY A N   
462  C CA  . GLY A 71  ? 0.9955 0.5562 0.9706 -0.1375 -0.1303 -0.0237 66  GLY A CA  
463  C C   . GLY A 71  ? 0.9226 0.5316 0.9056 -0.1538 -0.1092 -0.0213 66  GLY A C   
464  O O   . GLY A 71  ? 0.8040 0.4572 0.8002 -0.1424 -0.0962 -0.0248 66  GLY A O   
465  N N   . ASP A 72  ? 0.9823 0.5827 0.9567 -0.1808 -0.1066 -0.0162 67  ASP A N   
466  C CA  . ASP A 72  ? 0.9943 0.6416 0.9754 -0.1975 -0.0878 -0.0154 67  ASP A CA  
467  C C   . ASP A 72  ? 0.9050 0.5797 0.9083 -0.1977 -0.0839 -0.0329 67  ASP A C   
468  O O   . ASP A 72  ? 0.8952 0.6005 0.9025 -0.2160 -0.0719 -0.0343 67  ASP A O   
469  C CB  . ASP A 72  ? 1.2067 0.8365 1.1638 -0.2300 -0.0850 0.0011  67  ASP A CB  
470  C CG  . ASP A 72  ? 1.3675 0.9648 1.2998 -0.2309 -0.0910 0.0190  67  ASP A CG  
471  O OD1 . ASP A 72  ? 1.3414 0.9685 1.2736 -0.2246 -0.0803 0.0247  67  ASP A OD1 
472  O OD2 . ASP A 72  ? 1.4870 1.0307 1.3999 -0.2358 -0.1065 0.0269  67  ASP A OD2 
473  N N   . ASN A 73  ? 0.7566 0.4226 0.7744 -0.1771 -0.0942 -0.0473 68  ASN A N   
474  C CA  . ASN A 73  ? 0.7296 0.4257 0.7701 -0.1729 -0.0906 -0.0652 68  ASN A CA  
475  C C   . ASN A 73  ? 0.7136 0.4670 0.7713 -0.1583 -0.0752 -0.0718 68  ASN A C   
476  O O   . ASN A 73  ? 0.6150 0.3800 0.6839 -0.1344 -0.0773 -0.0797 68  ASN A O   
477  C CB  . ASN A 73  ? 0.7485 0.4175 0.7981 -0.1550 -0.1076 -0.0793 68  ASN A CB  
478  C CG  . ASN A 73  ? 0.7824 0.4810 0.8548 -0.1512 -0.1051 -0.0986 68  ASN A CG  
479  O OD1 . ASN A 73  ? 0.7128 0.4532 0.7948 -0.1603 -0.0906 -0.1017 68  ASN A OD1 
480  N ND2 . ASN A 73  ? 0.7835 0.4614 0.8646 -0.1368 -0.1200 -0.1127 68  ASN A ND2 
481  N N   . TRP A 74  ? 0.6215 0.4110 0.6803 -0.1728 -0.0604 -0.0689 69  TRP A N   
482  C CA  . TRP A 74  ? 0.5846 0.4232 0.6548 -0.1590 -0.0471 -0.0729 69  TRP A CA  
483  C C   . TRP A 74  ? 0.5836 0.4526 0.6755 -0.1447 -0.0454 -0.0909 69  TRP A C   
484  O O   . TRP A 74  ? 0.4946 0.3945 0.5950 -0.1276 -0.0389 -0.0951 69  TRP A O   
485  C CB  . TRP A 74  ? 0.5561 0.4257 0.6206 -0.1765 -0.0333 -0.0663 69  TRP A CB  
486  C CG  . TRP A 74  ? 0.6404 0.5232 0.7083 -0.1994 -0.0294 -0.0720 69  TRP A CG  
487  C CD1 . TRP A 74  ? 0.7077 0.5646 0.7609 -0.2268 -0.0323 -0.0638 69  TRP A CD1 
488  C CD2 . TRP A 74  ? 0.6362 0.5626 0.7220 -0.1982 -0.0216 -0.0872 69  TRP A CD2 
489  N NE1 . TRP A 74  ? 0.6966 0.5799 0.7585 -0.2438 -0.0263 -0.0736 69  TRP A NE1 
490  C CE2 . TRP A 74  ? 0.7077 0.6347 0.7904 -0.2256 -0.0198 -0.0886 69  TRP A CE2 
491  C CE3 . TRP A 74  ? 0.6026 0.5669 0.7051 -0.1772 -0.0165 -0.0995 69  TRP A CE3 
492  C CZ2 . TRP A 74  ? 0.6818 0.6489 0.7798 -0.2314 -0.0130 -0.1033 69  TRP A CZ2 
493  C CZ3 . TRP A 74  ? 0.5983 0.5998 0.7145 -0.1819 -0.0104 -0.1132 69  TRP A CZ3 
494  C CH2 . TRP A 74  ? 0.5607 0.5648 0.6756 -0.2082 -0.0086 -0.1156 69  TRP A CH2 
495  N N   . ARG A 75  ? 0.5896 0.4492 0.6892 -0.1526 -0.0517 -0.1012 70  ARG A N   
496  C CA  . ARG A 75  ? 0.5121 0.3974 0.6318 -0.1383 -0.0520 -0.1191 70  ARG A CA  
497  C C   . ARG A 75  ? 0.5234 0.3979 0.6485 -0.1139 -0.0608 -0.1244 70  ARG A C   
498  O O   . ARG A 75  ? 0.5287 0.4349 0.6664 -0.0971 -0.0566 -0.1338 70  ARG A O   
499  C CB  . ARG A 75  ? 0.5848 0.4586 0.7110 -0.1523 -0.0583 -0.1295 70  ARG A CB  
500  C CG  . ARG A 75  ? 0.6849 0.5750 0.8075 -0.1785 -0.0492 -0.1268 70  ARG A CG  
501  C CD  . ARG A 75  ? 0.6850 0.6309 0.8243 -0.1741 -0.0375 -0.1395 70  ARG A CD  
502  N NE  . ARG A 75  ? 0.6723 0.6348 0.8111 -0.1997 -0.0309 -0.1417 70  ARG A NE  
503  C CZ  . ARG A 75  ? 0.6638 0.6752 0.8156 -0.2004 -0.0211 -0.1533 70  ARG A CZ  
504  N NH1 . ARG A 75  ? 0.6372 0.6816 0.8014 -0.1767 -0.0174 -0.1623 70  ARG A NH1 
505  N NH2 . ARG A 75  ? 0.6066 0.6343 0.7578 -0.2252 -0.0154 -0.1560 70  ARG A NH2 
506  N N   . LEU A 76  ? 0.5061 0.3364 0.6204 -0.1123 -0.0734 -0.1185 71  LEU A N   
507  C CA  . LEU A 76  ? 0.5524 0.3739 0.6708 -0.0895 -0.0823 -0.1241 71  LEU A CA  
508  C C   . LEU A 76  ? 0.5161 0.3601 0.6315 -0.0775 -0.0732 -0.1165 71  LEU A C   
509  O O   . LEU A 76  ? 0.4666 0.3295 0.5917 -0.0592 -0.0735 -0.1252 71  LEU A O   
510  C CB  . LEU A 76  ? 0.6026 0.3703 0.7083 -0.0898 -0.0992 -0.1198 71  LEU A CB  
511  C CG  . LEU A 76  ? 0.7141 0.4742 0.8244 -0.0654 -0.1099 -0.1277 71  LEU A CG  
512  C CD1 . LEU A 76  ? 0.7430 0.5316 0.8748 -0.0503 -0.1120 -0.1487 71  LEU A CD1 
513  C CD2 . LEU A 76  ? 0.7830 0.4876 0.8791 -0.0648 -0.1287 -0.1242 71  LEU A CD2 
514  N N   . LYS A 77  ? 0.4860 0.3280 0.5874 -0.0886 -0.0654 -0.1008 72  LYS A N   
515  C CA  . LYS A 77  ? 0.4415 0.3045 0.5394 -0.0786 -0.0566 -0.0938 72  LYS A CA  
516  C C   . LYS A 77  ? 0.4233 0.3305 0.5344 -0.0693 -0.0468 -0.1033 72  LYS A C   
517  O O   . LYS A 77  ? 0.3847 0.3069 0.4994 -0.0538 -0.0452 -0.1062 72  LYS A O   
518  C CB  . LYS A 77  ? 0.4475 0.3081 0.5300 -0.0933 -0.0488 -0.0777 72  LYS A CB  
519  C CG  . LYS A 77  ? 0.4828 0.3001 0.5476 -0.1026 -0.0576 -0.0650 72  LYS A CG  
520  C CD  . LYS A 77  ? 0.5779 0.4023 0.6286 -0.1164 -0.0480 -0.0503 72  LYS A CD  
521  C CE  . LYS A 77  ? 0.6292 0.4108 0.6594 -0.1275 -0.0565 -0.0360 72  LYS A CE  
522  N NZ  . LYS A 77  ? 0.6194 0.4132 0.6362 -0.1408 -0.0464 -0.0226 72  LYS A NZ  
523  N N   . ILE A 78  ? 0.4025 0.3307 0.5198 -0.0797 -0.0405 -0.1081 73  ILE A N   
524  C CA  . ILE A 78  ? 0.4639 0.4329 0.5916 -0.0710 -0.0321 -0.1169 73  ILE A CA  
525  C C   . ILE A 78  ? 0.3623 0.3389 0.5023 -0.0551 -0.0378 -0.1303 73  ILE A C   
526  O O   . ILE A 78  ? 0.3525 0.3525 0.4948 -0.0425 -0.0334 -0.1328 73  ILE A O   
527  C CB  . ILE A 78  ? 0.4551 0.4456 0.5886 -0.0844 -0.0262 -0.1226 73  ILE A CB  
528  C CG1 . ILE A 78  ? 0.3843 0.3813 0.5065 -0.0980 -0.0179 -0.1112 73  ILE A CG1 
529  C CG2 . ILE A 78  ? 0.3515 0.3804 0.4965 -0.0728 -0.0209 -0.1343 73  ILE A CG2 
530  C CD1 . ILE A 78  ? 0.3812 0.4017 0.5085 -0.1139 -0.0121 -0.1173 73  ILE A CD1 
531  N N   . SER A 79  ? 0.3822 0.3387 0.5290 -0.0564 -0.0483 -0.1390 74  SER A N   
532  C CA  . SER A 79  ? 0.3754 0.3398 0.5347 -0.0414 -0.0552 -0.1538 74  SER A CA  
533  C C   . SER A 79  ? 0.4203 0.3850 0.5760 -0.0264 -0.0568 -0.1514 74  SER A C   
534  O O   . SER A 79  ? 0.3497 0.3422 0.5118 -0.0150 -0.0536 -0.1588 74  SER A O   
535  C CB  . SER A 79  ? 0.4768 0.4115 0.6413 -0.0446 -0.0688 -0.1629 74  SER A CB  
536  O OG  . SER A 79  ? 0.5875 0.5321 0.7646 -0.0286 -0.0764 -0.1789 74  SER A OG  
537  N N   . ASN A 80  ? 0.3792 0.3139 0.5234 -0.0277 -0.0617 -0.1408 75  ASN A N   
538  C CA  . ASN A 80  ? 0.3906 0.3261 0.5303 -0.0155 -0.0626 -0.1376 75  ASN A CA  
539  C C   . ASN A 80  ? 0.4190 0.3840 0.5547 -0.0127 -0.0499 -0.1314 75  ASN A C   
540  O O   . ASN A 80  ? 0.3377 0.3210 0.4761 -0.0018 -0.0486 -0.1363 75  ASN A O   
541  C CB  . ASN A 80  ? 0.3967 0.2955 0.5226 -0.0194 -0.0688 -0.1253 75  ASN A CB  
542  C CG  . ASN A 80  ? 0.5060 0.3732 0.6338 -0.0136 -0.0853 -0.1335 75  ASN A CG  
543  O OD1 . ASN A 80  ? 0.4710 0.3453 0.6119 -0.0063 -0.0921 -0.1495 75  ASN A OD1 
544  N ND2 . ASN A 80  ? 0.4786 0.3108 0.5928 -0.0159 -0.0928 -0.1232 75  ASN A ND2 
545  N N   . LEU A 81  ? 0.3374 0.3068 0.4656 -0.0229 -0.0412 -0.1211 76  LEU A N   
546  C CA  . LEU A 81  ? 0.3161 0.3074 0.4378 -0.0198 -0.0311 -0.1145 76  LEU A CA  
547  C C   . LEU A 81  ? 0.3277 0.3510 0.4569 -0.0126 -0.0267 -0.1242 76  LEU A C   
548  O O   . LEU A 81  ? 0.3026 0.3397 0.4262 -0.0056 -0.0224 -0.1217 76  LEU A O   
549  C CB  . LEU A 81  ? 0.3412 0.3321 0.4542 -0.0314 -0.0242 -0.1039 76  LEU A CB  
550  C CG  . LEU A 81  ? 0.3630 0.3251 0.4644 -0.0392 -0.0268 -0.0915 76  LEU A CG  
551  C CD1 . LEU A 81  ? 0.3660 0.3311 0.4614 -0.0541 -0.0208 -0.0844 76  LEU A CD1 
552  C CD2 . LEU A 81  ? 0.3626 0.3219 0.4549 -0.0310 -0.0251 -0.0835 76  LEU A CD2 
553  N N   . LYS A 82  ? 0.2992 0.3332 0.4395 -0.0151 -0.0282 -0.1350 77  LYS A N   
554  C CA  . LYS A 82  ? 0.2834 0.3478 0.4304 -0.0077 -0.0252 -0.1450 77  LYS A CA  
555  C C   . LYS A 82  ? 0.2994 0.3704 0.4509 0.0030  -0.0298 -0.1530 77  LYS A C   
556  O O   . LYS A 82  ? 0.3683 0.4619 0.5174 0.0092  -0.0257 -0.1550 77  LYS A O   
557  C CB  . LYS A 82  ? 0.2876 0.3631 0.4465 -0.0128 -0.0262 -0.1560 77  LYS A CB  
558  C CG  . LYS A 82  ? 0.2884 0.3704 0.4431 -0.0230 -0.0195 -0.1503 77  LYS A CG  
559  C CD  . LYS A 82  ? 0.3532 0.4513 0.5196 -0.0288 -0.0194 -0.1619 77  LYS A CD  
560  C CE  . LYS A 82  ? 0.3346 0.4478 0.4964 -0.0372 -0.0118 -0.1576 77  LYS A CE  
561  N NZ  . LYS A 82  ? 0.3512 0.4799 0.5242 -0.0461 -0.0114 -0.1689 77  LYS A NZ  
562  N N   . LYS A 83  ? 0.3068 0.3585 0.4634 0.0050  -0.0387 -0.1576 78  LYS A N   
563  C CA  . LYS A 83  ? 0.3321 0.3940 0.4938 0.0155  -0.0434 -0.1672 78  LYS A CA  
564  C C   . LYS A 83  ? 0.2929 0.3583 0.4425 0.0185  -0.0385 -0.1574 78  LYS A C   
565  O O   . LYS A 83  ? 0.2897 0.3778 0.4394 0.0239  -0.0364 -0.1625 78  LYS A O   
566  C CB  . LYS A 83  ? 0.3057 0.3448 0.4750 0.0192  -0.0560 -0.1757 78  LYS A CB  
567  C CG  . LYS A 83  ? 0.3805 0.4142 0.5618 0.0165  -0.0626 -0.1874 78  LYS A CG  
568  C CD  . LYS A 83  ? 0.4553 0.4623 0.6418 0.0222  -0.0775 -0.1964 78  LYS A CD  
569  C CE  . LYS A 83  ? 0.6056 0.5980 0.8006 0.0168  -0.0850 -0.2056 78  LYS A CE  
570  N NZ  . LYS A 83  ? 0.6631 0.6905 0.8693 0.0167  -0.0788 -0.2161 78  LYS A NZ  
571  N N   . ILE A 84  ? 0.2953 0.3391 0.4339 0.0136  -0.0366 -0.1433 79  ILE A N   
572  C CA  . ILE A 84  ? 0.2743 0.3190 0.4009 0.0153  -0.0319 -0.1336 79  ILE A CA  
573  C C   . ILE A 84  ? 0.2607 0.3254 0.3789 0.0145  -0.0229 -0.1287 79  ILE A C   
574  O O   . ILE A 84  ? 0.2719 0.3495 0.3840 0.0175  -0.0203 -0.1283 79  ILE A O   
575  C CB  . ILE A 84  ? 0.3355 0.3529 0.4524 0.0104  -0.0324 -0.1204 79  ILE A CB  
576  C CG1 . ILE A 84  ? 0.4074 0.4019 0.5294 0.0130  -0.0433 -0.1251 79  ILE A CG1 
577  C CG2 . ILE A 84  ? 0.3325 0.3520 0.4370 0.0119  -0.0272 -0.1109 79  ILE A CG2 
578  C CD1 . ILE A 84  ? 0.5391 0.5036 0.6523 0.0056  -0.0455 -0.1133 79  ILE A CD1 
579  N N   . LEU A 85  ? 0.2835 0.3515 0.4006 0.0102  -0.0189 -0.1257 80  LEU A N   
580  C CA  . LEU A 85  ? 0.2503 0.3350 0.3580 0.0116  -0.0124 -0.1219 80  LEU A CA  
581  C C   . LEU A 85  ? 0.2438 0.3524 0.3549 0.0166  -0.0126 -0.1318 80  LEU A C   
582  O O   . LEU A 85  ? 0.2809 0.3982 0.3801 0.0185  -0.0095 -0.1276 80  LEU A O   
583  C CB  . LEU A 85  ? 0.2517 0.3401 0.3598 0.0077  -0.0093 -0.1204 80  LEU A CB  
584  C CG  . LEU A 85  ? 0.2506 0.3541 0.3478 0.0115  -0.0045 -0.1172 80  LEU A CG  
585  C CD1 . LEU A 85  ? 0.2557 0.3486 0.3361 0.0135  -0.0024 -0.1057 80  LEU A CD1 
586  C CD2 . LEU A 85  ? 0.2624 0.3731 0.3620 0.0082  -0.0021 -0.1181 80  LEU A CD2 
587  N N   . LYS A 86  ? 0.2480 0.3664 0.3741 0.0179  -0.0167 -0.1448 81  LYS A N   
588  C CA  . LYS A 86  ? 0.2390 0.3834 0.3699 0.0224  -0.0172 -0.1558 81  LYS A CA  
589  C C   . LYS A 86  ? 0.3059 0.4551 0.4329 0.0246  -0.0183 -0.1568 81  LYS A C   
590  O O   . LYS A 86  ? 0.2622 0.4308 0.3817 0.0252  -0.0154 -0.1578 81  LYS A O   
591  C CB  . LYS A 86  ? 0.3122 0.4645 0.4617 0.0238  -0.0227 -0.1711 81  LYS A CB  
592  C CG  . LYS A 86  ? 0.3732 0.5553 0.5300 0.0289  -0.0240 -0.1851 81  LYS A CG  
593  C CD  . LYS A 86  ? 0.2912 0.4942 0.4375 0.0295  -0.0182 -0.1821 81  LYS A CD  
594  C CE  . LYS A 86  ? 0.3159 0.5500 0.4714 0.0336  -0.0201 -0.1975 81  LYS A CE  
595  N NZ  . LYS A 86  ? 0.3561 0.6093 0.4951 0.0338  -0.0155 -0.1927 81  LYS A NZ  
596  N N   . GLY A 87  ? 0.2863 0.4179 0.4170 0.0250  -0.0226 -0.1563 82  GLY A N   
597  C CA  . GLY A 87  ? 0.2706 0.4081 0.3987 0.0270  -0.0239 -0.1584 82  GLY A CA  
598  C C   . GLY A 87  ? 0.2949 0.4335 0.4042 0.0229  -0.0171 -0.1456 82  GLY A C   
599  O O   . GLY A 87  ? 0.2724 0.4298 0.3764 0.0218  -0.0151 -0.1486 82  GLY A O   
600  N N   . ILE A 88  ? 0.2628 0.3813 0.3612 0.0200  -0.0137 -0.1318 83  ILE A N   
601  C CA  . ILE A 88  ? 0.2410 0.3553 0.3203 0.0168  -0.0086 -0.1196 83  ILE A CA  
602  C C   . ILE A 88  ? 0.3390 0.4711 0.4084 0.0161  -0.0054 -0.1199 83  ILE A C   
603  O O   . ILE A 88  ? 0.2435 0.3826 0.2998 0.0127  -0.0032 -0.1166 83  ILE A O   
604  C CB  . ILE A 88  ? 0.2438 0.3356 0.3151 0.0154  -0.0067 -0.1074 83  ILE A CB  
605  C CG1 . ILE A 88  ? 0.2726 0.3456 0.3491 0.0149  -0.0099 -0.1049 83  ILE A CG1 
606  C CG2 . ILE A 88  ? 0.3020 0.3887 0.3528 0.0138  -0.0027 -0.0962 83  ILE A CG2 
607  C CD1 . ILE A 88  ? 0.3018 0.3562 0.3740 0.0126  -0.0085 -0.0952 83  ILE A CD1 
608  N N   . LEU A 89  ? 0.2389 0.3781 0.3135 0.0186  -0.0055 -0.1237 84  LEU A N   
609  C CA  . LEU A 89  ? 0.2405 0.3965 0.3053 0.0194  -0.0038 -0.1246 84  LEU A CA  
610  C C   . LEU A 89  ? 0.2566 0.4370 0.3242 0.0178  -0.0042 -0.1341 84  LEU A C   
611  O O   . LEU A 89  ? 0.3197 0.5088 0.3705 0.0144  -0.0020 -0.1299 84  LEU A O   
612  C CB  . LEU A 89  ? 0.2381 0.4020 0.3116 0.0232  -0.0045 -0.1304 84  LEU A CB  
613  C CG  . LEU A 89  ? 0.3635 0.5100 0.4329 0.0240  -0.0034 -0.1222 84  LEU A CG  
614  C CD1 . LEU A 89  ? 0.3732 0.5317 0.4537 0.0264  -0.0039 -0.1301 84  LEU A CD1 
615  C CD2 . LEU A 89  ? 0.4553 0.5916 0.5015 0.0252  -0.0018 -0.1103 84  LEU A CD2 
616  N N   . ASP A 90  ? 0.2349 0.4262 0.3224 0.0200  -0.0076 -0.1473 85  ASP A N   
617  C CA  . ASP A 90  ? 0.2491 0.4693 0.3421 0.0195  -0.0085 -0.1596 85  ASP A CA  
618  C C   . ASP A 90  ? 0.2734 0.4974 0.3551 0.0136  -0.0063 -0.1556 85  ASP A C   
619  O O   . ASP A 90  ? 0.2690 0.5162 0.3423 0.0085  -0.0039 -0.1585 85  ASP A O   
620  C CB  . ASP A 90  ? 0.2763 0.5061 0.3940 0.0254  -0.0146 -0.1768 85  ASP A CB  
621  C CG  . ASP A 90  ? 0.3425 0.5803 0.4716 0.0293  -0.0164 -0.1850 85  ASP A CG  
622  O OD1 . ASP A 90  ? 0.3542 0.5983 0.4726 0.0281  -0.0127 -0.1796 85  ASP A OD1 
623  O OD2 . ASP A 90  ? 0.3120 0.5489 0.4600 0.0337  -0.0224 -0.1974 85  ASP A OD2 
624  N N   . TYR A 91  ? 0.2367 0.4390 0.3173 0.0130  -0.0069 -0.1489 86  TYR A N   
625  C CA  . TYR A 91  ? 0.2399 0.4455 0.3104 0.0069  -0.0048 -0.1456 86  TYR A CA  
626  C C   . TYR A 91  ? 0.2718 0.4735 0.3162 -0.0017 0.0004  -0.1319 86  TYR A C   
627  O O   . TYR A 91  ? 0.3151 0.5340 0.3487 -0.0101 0.0030  -0.1325 86  TYR A O   
628  C CB  . TYR A 91  ? 0.2399 0.4202 0.3132 0.0089  -0.0068 -0.1399 86  TYR A CB  
629  C CG  . TYR A 91  ? 0.2730 0.4579 0.3386 0.0033  -0.0052 -0.1383 86  TYR A CG  
630  C CD1 . TYR A 91  ? 0.3369 0.5509 0.4126 0.0033  -0.0071 -0.1533 86  TYR A CD1 
631  C CD2 . TYR A 91  ? 0.3198 0.4820 0.3686 -0.0018 -0.0021 -0.1234 86  TYR A CD2 
632  C CE1 . TYR A 91  ? 0.3393 0.5619 0.4092 -0.0025 -0.0054 -0.1537 86  TYR A CE1 
633  C CE2 . TYR A 91  ? 0.3667 0.5344 0.4091 -0.0079 -0.0006 -0.1230 86  TYR A CE2 
634  C CZ  . TYR A 91  ? 0.4051 0.6039 0.4583 -0.0087 -0.0020 -0.1382 86  TYR A CZ  
635  O OH  . TYR A 91  ? 0.3513 0.5609 0.3993 -0.0154 -0.0002 -0.1399 86  TYR A OH  
636  N N   . ASN A 92  ? 0.2986 0.4773 0.3325 0.0003  0.0011  -0.1203 87  ASN A N   
637  C CA  . ASN A 92  ? 0.3081 0.4751 0.3156 -0.0050 0.0035  -0.1069 87  ASN A CA  
638  C C   . ASN A 92  ? 0.3504 0.5396 0.3478 -0.0089 0.0044  -0.1100 87  ASN A C   
639  O O   . ASN A 92  ? 0.4000 0.5875 0.3741 -0.0181 0.0062  -0.1018 87  ASN A O   
640  C CB  . ASN A 92  ? 0.3119 0.4548 0.3147 0.0017  0.0023  -0.0983 87  ASN A CB  
641  C CG  . ASN A 92  ? 0.6432 0.7660 0.6180 -0.0011 0.0025  -0.0843 87  ASN A CG  
642  O OD1 . ASN A 92  ? 0.7071 0.8192 0.6671 -0.0085 0.0037  -0.0769 87  ASN A OD1 
643  N ND2 . ASN A 92  ? 0.5580 0.6749 0.5249 0.0053  0.0006  -0.0814 87  ASN A ND2 
644  N N   . HIS A 93  ? 0.2638 0.4734 0.2778 -0.0028 0.0029  -0.1220 88  HIS A N   
645  C CA  . HIS A 93  ? 0.2691 0.5038 0.2763 -0.0054 0.0034  -0.1268 88  HIS A CA  
646  C C   . HIS A 93  ? 0.2986 0.5659 0.3111 -0.0128 0.0051  -0.1378 88  HIS A C   
647  O O   . HIS A 93  ? 0.4059 0.6877 0.3994 -0.0226 0.0075  -0.1346 88  HIS A O   
648  C CB  . HIS A 93  ? 0.3207 0.5661 0.3452 0.0046  0.0009  -0.1367 88  HIS A CB  
649  C CG  . HIS A 93  ? 0.3603 0.6347 0.3809 0.0036  0.0011  -0.1440 88  HIS A CG  
650  N ND1 . HIS A 93  ? 0.2980 0.5691 0.2916 -0.0001 0.0015  -0.1336 88  HIS A ND1 
651  C CD2 . HIS A 93  ? 0.2734 0.5801 0.3131 0.0063  0.0000  -0.1609 88  HIS A CD2 
652  C CE1 . HIS A 93  ? 0.2975 0.5989 0.2931 -0.0003 0.0014  -0.1430 88  HIS A CE1 
653  N NE2 . HIS A 93  ? 0.3549 0.6800 0.3793 0.0036  0.0008  -0.1602 88  HIS A NE2 
654  N N   . GLU A 94  ? 0.3042 0.5835 0.3411 -0.0085 0.0032  -0.1512 89  GLU A N   
655  C CA  . GLU A 94  ? 0.2996 0.6173 0.3469 -0.0122 0.0034  -0.1669 89  GLU A CA  
656  C C   . GLU A 94  ? 0.3442 0.6676 0.3810 -0.0232 0.0065  -0.1639 89  GLU A C   
657  O O   . GLU A 94  ? 0.3285 0.6868 0.3628 -0.0316 0.0088  -0.1727 89  GLU A O   
658  C CB  . GLU A 94  ? 0.2771 0.6066 0.3556 -0.0005 -0.0022 -0.1856 89  GLU A CB  
659  C CG  . GLU A 94  ? 0.2505 0.5804 0.3421 0.0087  -0.0054 -0.1922 89  GLU A CG  
660  C CD  . GLU A 94  ? 0.4627 0.7909 0.5821 0.0196  -0.0125 -0.2077 89  GLU A CD  
661  O OE1 . GLU A 94  ? 0.3198 0.6434 0.4475 0.0219  -0.0158 -0.2125 89  GLU A OE1 
662  O OE2 . GLU A 94  ? 0.4231 0.7531 0.5549 0.0260  -0.0156 -0.2153 89  GLU A OE2 
663  N N   . ILE A 95  ? 0.2899 0.5822 0.3210 -0.0237 0.0066  -0.1527 90  ILE A N   
664  C CA  . ILE A 95  ? 0.3308 0.6282 0.3554 -0.0330 0.0090  -0.1518 90  ILE A CA  
665  C C   . ILE A 95  ? 0.3701 0.6410 0.3648 -0.0450 0.0128  -0.1319 90  ILE A C   
666  O O   . ILE A 95  ? 0.4071 0.6925 0.3853 -0.0598 0.0166  -0.1296 90  ILE A O   
667  C CB  . ILE A 95  ? 0.2815 0.5674 0.3257 -0.0236 0.0049  -0.1579 90  ILE A CB  
668  C CG1 . ILE A 95  ? 0.2536 0.5648 0.3257 -0.0120 -0.0009 -0.1793 90  ILE A CG1 
669  C CG2 . ILE A 95  ? 0.3588 0.6497 0.3954 -0.0329 0.0074  -0.1565 90  ILE A CG2 
670  C CD1 . ILE A 95  ? 0.3800 0.7399 0.4568 -0.0171 0.0004  -0.1957 90  ILE A CD1 
671  N N   . LEU A 96  ? 0.3720 0.6049 0.3592 -0.0392 0.0114  -0.1185 91  LEU A N   
672  C CA  . LEU A 96  ? 0.4611 0.6641 0.4218 -0.0478 0.0132  -0.1011 91  LEU A CA  
673  C C   . LEU A 96  ? 0.5610 0.7617 0.4928 -0.0582 0.0145  -0.0912 91  LEU A C   
674  O O   . LEU A 96  ? 0.5504 0.7531 0.4795 -0.0527 0.0128  -0.0910 91  LEU A O   
675  C CB  . LEU A 96  ? 0.4564 0.6232 0.4182 -0.0372 0.0105  -0.0916 91  LEU A CB  
676  C CG  . LEU A 96  ? 0.3913 0.5507 0.3738 -0.0296 0.0089  -0.0964 91  LEU A CG  
677  C CD1 . LEU A 96  ? 0.4054 0.5305 0.3830 -0.0228 0.0074  -0.0849 91  LEU A CD1 
678  C CD2 . LEU A 96  ? 0.5094 0.6777 0.4906 -0.0382 0.0107  -0.0989 91  LEU A CD2 
679  N N   . GLY A 97  ? 0.7167 0.9132 0.6258 -0.0742 0.0171  -0.0831 92  GLY A N   
680  C CA  . GLY A 97  ? 0.9065 1.0909 0.7818 -0.0861 0.0171  -0.0703 92  GLY A CA  
681  C C   . GLY A 97  ? 1.0758 1.2151 0.9340 -0.0774 0.0123  -0.0557 92  GLY A C   
682  O O   . GLY A 97  ? 1.1162 1.2471 0.9638 -0.0709 0.0090  -0.0516 92  GLY A O   
683  N N   . GLN A 98  ? 1.1873 1.3000 1.0436 -0.0761 0.0116  -0.0493 93  GLN A N   
684  C CA  . GLN A 98  ? 1.2959 1.3687 1.1391 -0.0661 0.0066  -0.0380 93  GLN A CA  
685  C C   . GLN A 98  ? 1.2557 1.3296 1.1261 -0.0475 0.0052  -0.0449 93  GLN A C   
686  O O   . GLN A 98  ? 1.2185 1.2964 1.1106 -0.0432 0.0068  -0.0506 93  GLN A O   
687  C CB  . GLN A 98  ? 1.4320 1.4771 1.2608 -0.0732 0.0062  -0.0288 93  GLN A CB  
688  C CG  . GLN A 98  ? 1.5793 1.6004 1.3690 -0.0886 0.0038  -0.0155 93  GLN A CG  
689  C CD  . GLN A 98  ? 1.6800 1.6706 1.4463 -0.0793 -0.0038 -0.0059 93  GLN A CD  
690  O OE1 . GLN A 98  ? 1.7126 1.6929 1.4903 -0.0611 -0.0074 -0.0076 93  GLN A OE1 
691  N NE2 . GLN A 98  ? 1.7201 1.6969 1.4522 -0.0920 -0.0068 0.0039  93  GLN A NE2 
692  N N   . GLN A 99  ? 1.2640 1.3344 1.1316 -0.0373 0.0018  -0.0445 94  GLN A N   
693  C CA  . GLN A 99  ? 1.1801 1.2544 1.0719 -0.0220 0.0007  -0.0515 94  GLN A CA  
694  C C   . GLN A 99  ? 1.1211 1.1693 1.0143 -0.0149 -0.0011 -0.0459 94  GLN A C   
695  O O   . GLN A 99  ? 1.1039 1.1260 0.9748 -0.0179 -0.0034 -0.0357 94  GLN A O   
696  C CB  . GLN A 99  ? 1.1932 1.2711 1.0789 -0.0136 -0.0028 -0.0525 94  GLN A CB  
697  C CG  . GLN A 99  ? 1.1806 1.2935 1.0814 -0.0146 -0.0007 -0.0642 94  GLN A CG  
698  C CD  . GLN A 99  ? 1.1740 1.3060 1.0674 -0.0296 0.0028  -0.0657 94  GLN A CD  
699  O OE1 . GLN A 99  ? 1.2218 1.3482 1.0872 -0.0390 0.0018  -0.0573 94  GLN A OE1 
700  N NE2 . GLN A 99  ? 1.0975 1.2528 1.0149 -0.0322 0.0062  -0.0768 94  GLN A NE2 
701  N N   . ILE A 100 ? 1.0520 1.1073 0.9705 -0.0062 -0.0002 -0.0529 95  ILE A N   
702  C CA  . ILE A 100 ? 0.9572 0.9930 0.8789 0.0002  -0.0013 -0.0488 95  ILE A CA  
703  C C   . ILE A 100 ? 1.1027 1.1280 1.0160 0.0110  -0.0053 -0.0464 95  ILE A C   
704  O O   . ILE A 100 ? 1.1714 1.2020 1.0750 0.0140  -0.0078 -0.0473 95  ILE A O   
705  C CB  . ILE A 100 ? 0.8119 0.8582 0.7618 0.0030  0.0010  -0.0563 95  ILE A CB  
706  C CG1 . ILE A 100 ? 0.8414 0.9068 0.8098 0.0087  0.0008  -0.0661 95  ILE A CG1 
707  C CG2 . ILE A 100 ? 0.5443 0.6002 0.5025 -0.0049 0.0033  -0.0601 95  ILE A CG2 
708  C CD1 . ILE A 100 ? 0.8118 0.8828 0.8049 0.0103  0.0014  -0.0730 95  ILE A CD1 
709  N N   . ASN A 101 ? 1.1331 1.1458 1.0498 0.0174  -0.0062 -0.0443 96  ASN A N   
710  C CA  . ASN A 101 ? 1.1838 1.1918 1.0955 0.0288  -0.0102 -0.0449 96  ASN A CA  
711  C C   . ASN A 101 ? 1.0975 1.1256 1.0345 0.0335  -0.0078 -0.0540 96  ASN A C   
712  O O   . ASN A 101 ? 1.0993 1.1264 1.0486 0.0338  -0.0058 -0.0546 96  ASN A O   
713  C CB  . ASN A 101 ? 1.2705 1.2553 1.1686 0.0331  -0.0134 -0.0384 96  ASN A CB  
714  C CG  . ASN A 101 ? 1.3668 1.3271 1.2368 0.0281  -0.0172 -0.0292 96  ASN A CG  
715  O OD1 . ASN A 101 ? 1.4097 1.3690 1.2651 0.0230  -0.0187 -0.0267 96  ASN A OD1 
716  N ND2 . ASN A 101 ? 1.3996 1.3398 1.2606 0.0285  -0.0189 -0.0240 96  ASN A ND2 
717  N N   . ASP A 102 ? 0.9918 1.0382 0.9354 0.0360  -0.0081 -0.0609 97  ASP A N   
718  C CA  . ASP A 102 ? 0.8676 0.9336 0.8351 0.0380  -0.0059 -0.0705 97  ASP A CA  
719  C C   . ASP A 102 ? 0.9352 1.0130 0.9010 0.0476  -0.0089 -0.0762 97  ASP A C   
720  O O   . ASP A 102 ? 0.8040 0.9024 0.7858 0.0481  -0.0076 -0.0854 97  ASP A O   
721  C CB  . ASP A 102 ? 0.8369 0.9191 0.8206 0.0316  -0.0033 -0.0772 97  ASP A CB  
722  C CG  . ASP A 102 ? 0.8934 0.9863 0.8668 0.0314  -0.0048 -0.0791 97  ASP A CG  
723  O OD1 . ASP A 102 ? 0.8810 0.9947 0.8690 0.0314  -0.0041 -0.0886 97  ASP A OD1 
724  O OD2 . ASP A 102 ? 0.9872 1.0669 0.9366 0.0307  -0.0070 -0.0710 97  ASP A OD2 
725  N N   . PHE A 103 ? 0.9458 1.0111 0.8923 0.0560  -0.0137 -0.0721 98  PHE A N   
726  C CA  . PHE A 103 ? 0.9240 1.0013 0.8678 0.0676  -0.0179 -0.0789 98  PHE A CA  
727  C C   . PHE A 103 ? 0.8101 0.9082 0.7775 0.0679  -0.0142 -0.0880 98  PHE A C   
728  O O   . PHE A 103 ? 0.8328 0.9533 0.8120 0.0706  -0.0139 -0.0977 98  PHE A O   
729  C CB  . PHE A 103 ? 0.9148 0.9721 0.8334 0.0783  -0.0254 -0.0738 98  PHE A CB  
730  C CG  . PHE A 103 ? 0.9658 1.0356 0.8794 0.0929  -0.0316 -0.0821 98  PHE A CG  
731  C CD1 . PHE A 103 ? 0.9861 1.0601 0.8882 0.0976  -0.0361 -0.0837 98  PHE A CD1 
732  C CD2 . PHE A 103 ? 0.9771 1.0573 0.8973 0.1020  -0.0333 -0.0892 98  PHE A CD2 
733  C CE1 . PHE A 103 ? 0.9986 1.0851 0.8958 0.1125  -0.0428 -0.0922 98  PHE A CE1 
734  C CE2 . PHE A 103 ? 1.0077 1.1033 0.9243 0.1166  -0.0396 -0.0990 98  PHE A CE2 
735  C CZ  . PHE A 103 ? 1.0212 1.1191 0.9262 0.1226  -0.0447 -0.1005 98  PHE A CZ  
736  N N   . THR A 104 ? 0.6505 0.7414 0.6237 0.0639  -0.0114 -0.0848 99  THR A N   
737  C CA  . THR A 104 ? 0.5588 0.6671 0.5518 0.0604  -0.0074 -0.0915 99  THR A CA  
738  C C   . THR A 104 ? 0.4905 0.5956 0.4995 0.0474  -0.0023 -0.0895 99  THR A C   
739  O O   . THR A 104 ? 0.5787 0.6658 0.5835 0.0426  -0.0013 -0.0814 99  THR A O   
740  C CB  . THR A 104 ? 0.6673 0.7730 0.6549 0.0650  -0.0083 -0.0903 99  THR A CB  
741  O OG1 . THR A 104 ? 0.7910 0.8986 0.7631 0.0797  -0.0152 -0.0940 99  THR A OG1 
742  C CG2 . THR A 104 ? 0.6009 0.7277 0.6076 0.0583  -0.0035 -0.0971 99  THR A CG2 
743  N N   . LEU A 105 ? 0.4066 0.5284 0.4336 0.0423  -0.0001 -0.0975 100 LEU A N   
744  C CA  . LEU A 105 ? 0.3856 0.5017 0.4269 0.0316  0.0025  -0.0970 100 LEU A CA  
745  C C   . LEU A 105 ? 0.3333 0.4501 0.3840 0.0237  0.0052  -0.0966 100 LEU A C   
746  O O   . LEU A 105 ? 0.3499 0.4826 0.4026 0.0249  0.0063  -0.1015 100 LEU A O   
747  C CB  . LEU A 105 ? 0.2676 0.3978 0.3222 0.0298  0.0020  -0.1062 100 LEU A CB  
748  C CG  . LEU A 105 ? 0.3590 0.4910 0.4053 0.0346  -0.0001 -0.1067 100 LEU A CG  
749  C CD1 . LEU A 105 ? 0.3433 0.4899 0.4061 0.0317  -0.0004 -0.1169 100 LEU A CD1 
750  C CD2 . LEU A 105 ? 0.3800 0.4926 0.4150 0.0324  -0.0003 -0.0972 100 LEU A CD2 
751  N N   . PRO A 106 ? 0.3032 0.4038 0.3584 0.0156  0.0060  -0.0913 101 PRO A N   
752  C CA  . PRO A 106 ? 0.3139 0.4130 0.3768 0.0054  0.0081  -0.0902 101 PRO A CA  
753  C C   . PRO A 106 ? 0.3305 0.4455 0.4078 -0.0008 0.0087  -0.1000 101 PRO A C   
754  O O   . PRO A 106 ? 0.2929 0.4113 0.3777 0.0010  0.0066  -0.1063 101 PRO A O   
755  C CB  . PRO A 106 ? 0.3232 0.3990 0.3869 0.0000  0.0066  -0.0835 101 PRO A CB  
756  C CG  . PRO A 106 ? 0.3273 0.4012 0.3919 0.0056  0.0039  -0.0865 101 PRO A CG  
757  C CD  . PRO A 106 ? 0.3156 0.4005 0.3695 0.0148  0.0043  -0.0874 101 PRO A CD  
758  N N   . ASP A 107 ? 0.2833 0.4097 0.3644 -0.0088 0.0115  -0.1021 102 ASP A N   
759  C CA  . ASP A 107 ? 0.2960 0.4334 0.3906 -0.0191 0.0122  -0.1103 102 ASP A CA  
760  C C   . ASP A 107 ? 0.3362 0.4488 0.4338 -0.0322 0.0105  -0.1044 102 ASP A C   
761  O O   . ASP A 107 ? 0.2978 0.4044 0.3910 -0.0427 0.0127  -0.0979 102 ASP A O   
762  C CB  . ASP A 107 ? 0.2956 0.4605 0.3923 -0.0234 0.0161  -0.1166 102 ASP A CB  
763  C CG  . ASP A 107 ? 0.3110 0.4901 0.4215 -0.0356 0.0171  -0.1264 102 ASP A CG  
764  O OD1 . ASP A 107 ? 0.3235 0.4851 0.4409 -0.0432 0.0143  -0.1264 102 ASP A OD1 
765  O OD2 . ASP A 107 ? 0.2663 0.4750 0.3809 -0.0373 0.0201  -0.1351 102 ASP A OD2 
766  N N   . VAL A 108 ? 0.2742 0.3723 0.3780 -0.0310 0.0060  -0.1067 103 VAL A N   
767  C CA  . VAL A 108 ? 0.3406 0.4100 0.4444 -0.0396 0.0019  -0.1008 103 VAL A CA  
768  C C   . VAL A 108 ? 0.3093 0.3755 0.4186 -0.0561 0.0016  -0.1032 103 VAL A C   
769  O O   . VAL A 108 ? 0.3556 0.3959 0.4604 -0.0661 -0.0018 -0.0960 103 VAL A O   
770  C CB  . VAL A 108 ? 0.3128 0.3690 0.4221 -0.0320 -0.0043 -0.1049 103 VAL A CB  
771  C CG1 . VAL A 108 ? 0.3065 0.3671 0.4087 -0.0189 -0.0034 -0.1021 103 VAL A CG1 
772  C CG2 . VAL A 108 ? 0.3739 0.4432 0.4968 -0.0318 -0.0067 -0.1182 103 VAL A CG2 
773  N N   . ASN A 109 ? 0.3214 0.4131 0.4389 -0.0598 0.0046  -0.1130 104 ASN A N   
774  C CA  . ASN A 109 ? 0.3255 0.4175 0.4464 -0.0786 0.0056  -0.1150 104 ASN A CA  
775  C C   . ASN A 109 ? 0.3265 0.4148 0.4360 -0.0909 0.0098  -0.1042 104 ASN A C   
776  O O   . ASN A 109 ? 0.3647 0.4349 0.4705 -0.1086 0.0083  -0.0991 104 ASN A O   
777  C CB  . ASN A 109 ? 0.3608 0.4878 0.4923 -0.0800 0.0093  -0.1283 104 ASN A CB  
778  C CG  . ASN A 109 ? 0.3003 0.4339 0.4427 -0.0684 0.0054  -0.1395 104 ASN A CG  
779  O OD1 . ASN A 109 ? 0.3210 0.4423 0.4719 -0.0746 0.0005  -0.1454 104 ASN A OD1 
780  N ND2 . ASN A 109 ? 0.2943 0.4455 0.4352 -0.0514 0.0067  -0.1422 104 ASN A ND2 
781  N N   . LEU A 110 ? 0.3190 0.4241 0.4218 -0.0819 0.0145  -0.1009 105 LEU A N   
782  C CA  . LEU A 110 ? 0.3810 0.4892 0.4735 -0.0919 0.0189  -0.0924 105 LEU A CA  
783  C C   . LEU A 110 ? 0.4055 0.4779 0.4870 -0.0940 0.0152  -0.0785 105 LEU A C   
784  O O   . LEU A 110 ? 0.3918 0.4564 0.4642 -0.1080 0.0169  -0.0699 105 LEU A O   
785  C CB  . LEU A 110 ? 0.3689 0.5065 0.4581 -0.0791 0.0235  -0.0955 105 LEU A CB  
786  C CG  . LEU A 110 ? 0.4322 0.6101 0.5299 -0.0774 0.0271  -0.1095 105 LEU A CG  
787  C CD1 . LEU A 110 ? 0.3366 0.5368 0.4283 -0.0611 0.0288  -0.1123 105 LEU A CD1 
788  C CD2 . LEU A 110 ? 0.3972 0.5917 0.4982 -0.1001 0.0315  -0.1128 105 LEU A CD2 
789  N N   . ILE A 111 ? 0.3431 0.3960 0.4248 -0.0801 0.0100  -0.0768 106 ILE A N   
790  C CA  . ILE A 111 ? 0.3353 0.3554 0.4079 -0.0801 0.0053  -0.0657 106 ILE A CA  
791  C C   . ILE A 111 ? 0.3792 0.3710 0.4509 -0.0948 -0.0008 -0.0630 106 ILE A C   
792  O O   . ILE A 111 ? 0.4111 0.3819 0.4712 -0.1061 -0.0025 -0.0522 106 ILE A O   
793  C CB  . ILE A 111 ? 0.3494 0.3598 0.4237 -0.0624 0.0011  -0.0670 106 ILE A CB  
794  C CG1 . ILE A 111 ? 0.3052 0.3370 0.3762 -0.0493 0.0060  -0.0680 106 ILE A CG1 
795  C CG2 . ILE A 111 ? 0.3605 0.3387 0.4267 -0.0621 -0.0047 -0.0577 106 ILE A CG2 
796  C CD1 . ILE A 111 ? 0.3205 0.3466 0.3920 -0.0348 0.0028  -0.0697 106 ILE A CD1 
797  N N   . GLY A 112 ? 0.3647 0.3546 0.4475 -0.0947 -0.0050 -0.0728 107 GLY A N   
798  C CA  . GLY A 112 ? 0.4013 0.3607 0.4832 -0.1069 -0.0130 -0.0720 107 GLY A CA  
799  C C   . GLY A 112 ? 0.4942 0.4529 0.5693 -0.1309 -0.0099 -0.0673 107 GLY A C   
800  O O   . GLY A 112 ? 0.5071 0.4332 0.5700 -0.1439 -0.0153 -0.0575 107 GLY A O   
801  N N   . GLU A 113 ? 0.4717 0.4670 0.5535 -0.1373 -0.0014 -0.0746 108 GLU A N   
802  C CA  . GLU A 113 ? 0.4934 0.4949 0.5705 -0.1624 0.0024  -0.0728 108 GLU A CA  
803  C C   . GLU A 113 ? 0.5476 0.5567 0.6104 -0.1730 0.0088  -0.0612 108 GLU A C   
804  O O   . GLU A 113 ? 0.5388 0.5355 0.5904 -0.1961 0.0090  -0.0535 108 GLU A O   
805  C CB  . GLU A 113 ? 0.4824 0.5252 0.5736 -0.1653 0.0088  -0.0876 108 GLU A CB  
806  C CG  . GLU A 113 ? 0.6916 0.7424 0.7797 -0.1939 0.0124  -0.0881 108 GLU A CG  
807  C CD  . GLU A 113 ? 0.6802 0.7696 0.7840 -0.1968 0.0170  -0.1049 108 GLU A CD  
808  O OE1 . GLU A 113 ? 0.6664 0.7765 0.7825 -0.1756 0.0172  -0.1155 108 GLU A OE1 
809  O OE2 . GLU A 113 ? 0.7198 0.8190 0.8226 -0.2213 0.0202  -0.1074 108 GLU A OE2 
810  N N   . HIS A 114 ? 0.4472 0.4763 0.5093 -0.1569 0.0135  -0.0602 109 HIS A N   
811  C CA  . HIS A 114 ? 0.4841 0.5304 0.5355 -0.1652 0.0204  -0.0529 109 HIS A CA  
812  C C   . HIS A 114 ? 0.5069 0.5358 0.5478 -0.1529 0.0185  -0.0420 109 HIS A C   
813  O O   . HIS A 114 ? 0.4573 0.5016 0.4896 -0.1571 0.0238  -0.0367 109 HIS A O   
814  C CB  . HIS A 114 ? 0.5520 0.6497 0.6123 -0.1598 0.0289  -0.0650 109 HIS A CB  
815  C CG  . HIS A 114 ? 0.6080 0.7307 0.6775 -0.1756 0.0324  -0.0759 109 HIS A CG  
816  N ND1 . HIS A 114 ? 0.6730 0.8234 0.7574 -0.1641 0.0335  -0.0911 109 HIS A ND1 
817  C CD2 . HIS A 114 ? 0.6252 0.7496 0.6900 -0.2033 0.0348  -0.0740 109 HIS A CD2 
818  C CE1 . HIS A 114 ? 0.6958 0.8658 0.7860 -0.1831 0.0367  -0.0991 109 HIS A CE1 
819  N NE2 . HIS A 114 ? 0.7273 0.8818 0.8056 -0.2080 0.0378  -0.0889 109 HIS A NE2 
820  N N   . SER A 115 ? 0.4487 0.4479 0.4904 -0.1382 0.0109  -0.0396 110 SER A N   
821  C CA  . SER A 115 ? 0.3947 0.3800 0.4282 -0.1249 0.0091  -0.0312 110 SER A CA  
822  C C   . SER A 115 ? 0.4374 0.4561 0.4717 -0.1134 0.0164  -0.0345 110 SER A C   
823  O O   . SER A 115 ? 0.4048 0.4235 0.4292 -0.1126 0.0183  -0.0268 110 SER A O   
824  C CB  . SER A 115 ? 0.4737 0.4312 0.4904 -0.1391 0.0060  -0.0169 110 SER A CB  
825  O OG  . SER A 115 ? 0.4831 0.4098 0.4963 -0.1535 -0.0012 -0.0141 110 SER A OG  
826  N N   . ASP A 116 ? 0.3608 0.4069 0.4064 -0.1037 0.0193  -0.0464 111 ASP A N   
827  C CA  . ASP A 116 ? 0.3863 0.4627 0.4320 -0.0912 0.0242  -0.0515 111 ASP A CA  
828  C C   . ASP A 116 ? 0.4345 0.4965 0.4745 -0.0739 0.0216  -0.0466 111 ASP A C   
829  O O   . ASP A 116 ? 0.3725 0.4246 0.4169 -0.0617 0.0179  -0.0495 111 ASP A O   
830  C CB  . ASP A 116 ? 0.3478 0.4517 0.4053 -0.0836 0.0258  -0.0655 111 ASP A CB  
831  C CG  . ASP A 116 ? 0.4786 0.6143 0.5349 -0.0711 0.0292  -0.0723 111 ASP A CG  
832  O OD1 . ASP A 116 ? 0.4079 0.5361 0.4575 -0.0565 0.0275  -0.0689 111 ASP A OD1 
833  O OD2 . ASP A 116 ? 0.5456 0.7144 0.6076 -0.0755 0.0330  -0.0823 111 ASP A OD2 
834  N N   . ALA A 117 ? 0.3789 0.4425 0.4090 -0.0736 0.0236  -0.0399 112 ALA A N   
835  C CA  . ALA A 117 ? 0.4050 0.4536 0.4287 -0.0596 0.0211  -0.0348 112 ALA A CA  
836  C C   . ALA A 117 ? 0.3461 0.4076 0.3718 -0.0420 0.0208  -0.0424 112 ALA A C   
837  O O   . ALA A 117 ? 0.3199 0.3654 0.3431 -0.0316 0.0176  -0.0402 112 ALA A O   
838  C CB  . ALA A 117 ? 0.4027 0.4529 0.4155 -0.0636 0.0233  -0.0272 112 ALA A CB  
839  N N   . ALA A 118 ? 0.3787 0.4693 0.4077 -0.0391 0.0237  -0.0515 113 ALA A N   
840  C CA  . ALA A 118 ? 0.3485 0.4488 0.3763 -0.0219 0.0218  -0.0584 113 ALA A CA  
841  C C   . ALA A 118 ? 0.3703 0.4602 0.4037 -0.0165 0.0188  -0.0613 113 ALA A C   
842  O O   . ALA A 118 ? 0.3397 0.4191 0.3677 -0.0050 0.0159  -0.0603 113 ALA A O   
843  C CB  . ALA A 118 ? 0.4024 0.5377 0.4330 -0.0189 0.0241  -0.0694 113 ALA A CB  
844  N N   . GLU A 119 ? 0.3294 0.4224 0.3730 -0.0260 0.0193  -0.0651 114 GLU A N   
845  C CA  . GLU A 119 ? 0.3164 0.4022 0.3666 -0.0214 0.0163  -0.0691 114 GLU A CA  
846  C C   . GLU A 119 ? 0.2950 0.3529 0.3427 -0.0205 0.0129  -0.0618 114 GLU A C   
847  O O   . GLU A 119 ? 0.3082 0.3613 0.3557 -0.0118 0.0105  -0.0636 114 GLU A O   
848  C CB  . GLU A 119 ? 0.3839 0.4796 0.4462 -0.0321 0.0170  -0.0761 114 GLU A CB  
849  C CG  . GLU A 119 ? 0.3409 0.4700 0.4076 -0.0323 0.0204  -0.0861 114 GLU A CG  
850  C CD  . GLU A 119 ? 0.4326 0.5760 0.4953 -0.0145 0.0188  -0.0923 114 GLU A CD  
851  O OE1 . GLU A 119 ? 0.3549 0.4876 0.4168 -0.0057 0.0155  -0.0925 114 GLU A OE1 
852  O OE2 . GLU A 119 ? 0.4426 0.6079 0.5018 -0.0091 0.0201  -0.0973 114 GLU A OE2 
853  N N   . LEU A 120 ? 0.2990 0.3399 0.3439 -0.0296 0.0124  -0.0540 115 LEU A N   
854  C CA  . LEU A 120 ? 0.3197 0.3358 0.3625 -0.0274 0.0081  -0.0485 115 LEU A CA  
855  C C   . LEU A 120 ? 0.2957 0.3089 0.3297 -0.0163 0.0082  -0.0453 115 LEU A C   
856  O O   . LEU A 120 ? 0.2884 0.2923 0.3227 -0.0108 0.0053  -0.0458 115 LEU A O   
857  C CB  . LEU A 120 ? 0.3024 0.2996 0.3408 -0.0382 0.0065  -0.0401 115 LEU A CB  
858  C CG  . LEU A 120 ? 0.4381 0.4106 0.4737 -0.0342 0.0010  -0.0353 115 LEU A CG  
859  C CD1 . LEU A 120 ? 0.4470 0.4137 0.4925 -0.0296 -0.0042 -0.0431 115 LEU A CD1 
860  C CD2 . LEU A 120 ? 0.4037 0.3561 0.4320 -0.0446 -0.0017 -0.0262 115 LEU A CD2 
861  N N   . GLY A 121 ? 0.3147 0.3374 0.3407 -0.0135 0.0110  -0.0431 116 GLY A N   
862  C CA  . GLY A 121 ? 0.3140 0.3321 0.3299 -0.0037 0.0104  -0.0405 116 GLY A CA  
863  C C   . GLY A 121 ? 0.3187 0.3406 0.3338 0.0048  0.0088  -0.0456 116 GLY A C   
864  O O   . GLY A 121 ? 0.2976 0.3087 0.3063 0.0089  0.0071  -0.0430 116 GLY A O   
865  N N   . ARG A 122 ? 0.2809 0.3194 0.3014 0.0065  0.0093  -0.0530 117 ARG A N   
866  C CA  . ARG A 122 ? 0.2691 0.3119 0.2876 0.0139  0.0075  -0.0577 117 ARG A CA  
867  C C   . ARG A 122 ? 0.2719 0.3069 0.2967 0.0113  0.0059  -0.0585 117 ARG A C   
868  O O   . ARG A 122 ? 0.3168 0.3489 0.3351 0.0155  0.0046  -0.0584 117 ARG A O   
869  C CB  . ARG A 122 ? 0.3691 0.4333 0.3939 0.0161  0.0080  -0.0665 117 ARG A CB  
870  C CG  . ARG A 122 ? 0.4144 0.4921 0.4327 0.0222  0.0082  -0.0692 117 ARG A CG  
871  C CD  . ARG A 122 ? 0.6116 0.7127 0.6362 0.0262  0.0079  -0.0797 117 ARG A CD  
872  N NE  . ARG A 122 ? 0.7452 0.8642 0.7653 0.0335  0.0072  -0.0853 117 ARG A NE  
873  C CZ  . ARG A 122 ? 0.8911 1.0080 0.8973 0.0476  0.0023  -0.0867 117 ARG A CZ  
874  N NH1 . ARG A 122 ? 0.9286 1.0248 0.9227 0.0531  -0.0014 -0.0812 117 ARG A NH1 
875  N NH2 . ARG A 122 ? 0.8855 1.0211 0.8891 0.0557  0.0006  -0.0942 117 ARG A NH2 
876  N N   . MET A 123 ? 0.2649 0.2969 0.3014 0.0042  0.0056  -0.0601 118 MET A N   
877  C CA  . MET A 123 ? 0.2888 0.3149 0.3326 0.0035  0.0027  -0.0633 118 MET A CA  
878  C C   . MET A 123 ? 0.2801 0.2927 0.3167 0.0050  0.0014  -0.0578 118 MET A C   
879  O O   . MET A 123 ? 0.2872 0.3022 0.3241 0.0075  0.0000  -0.0611 118 MET A O   
880  C CB  . MET A 123 ? 0.2994 0.3200 0.3551 -0.0036 0.0004  -0.0662 118 MET A CB  
881  C CG  . MET A 123 ? 0.4510 0.4703 0.5167 -0.0019 -0.0040 -0.0738 118 MET A CG  
882  S SD  . MET A 123 ? 0.4421 0.4604 0.5213 -0.0092 -0.0069 -0.0809 118 MET A SD  
883  C CE  . MET A 123 ? 0.4218 0.4427 0.5128 -0.0033 -0.0131 -0.0927 118 MET A CE  
884  N N   . LEU A 124 ? 0.2790 0.2801 0.3094 0.0029  0.0020  -0.0502 119 LEU A N   
885  C CA  . LEU A 124 ? 0.2730 0.2625 0.2968 0.0042  0.0008  -0.0455 119 LEU A CA  
886  C C   . LEU A 124 ? 0.2811 0.2734 0.2933 0.0084  0.0022  -0.0442 119 LEU A C   
887  O O   . LEU A 124 ? 0.2827 0.2720 0.2920 0.0084  0.0012  -0.0443 119 LEU A O   
888  C CB  . LEU A 124 ? 0.2722 0.2505 0.2908 0.0012  0.0013  -0.0377 119 LEU A CB  
889  C CG  . LEU A 124 ? 0.3081 0.2774 0.3336 -0.0051 -0.0012 -0.0367 119 LEU A CG  
890  C CD1 . LEU A 124 ? 0.3508 0.3097 0.3683 -0.0088 -0.0007 -0.0280 119 LEU A CD1 
891  C CD2 . LEU A 124 ? 0.3540 0.3154 0.3877 -0.0036 -0.0068 -0.0418 119 LEU A CD2 
892  N N   . GLN A 125 ? 0.2655 0.2635 0.2703 0.0116  0.0037  -0.0436 120 GLN A N   
893  C CA  . GLN A 125 ? 0.3165 0.3126 0.3069 0.0155  0.0032  -0.0420 120 GLN A CA  
894  C C   . GLN A 125 ? 0.2880 0.2916 0.2799 0.0146  0.0026  -0.0466 120 GLN A C   
895  O O   . GLN A 125 ? 0.2909 0.2899 0.2718 0.0131  0.0022  -0.0443 120 GLN A O   
896  C CB  . GLN A 125 ? 0.3446 0.3453 0.3271 0.0214  0.0028  -0.0425 120 GLN A CB  
897  C CG  . GLN A 125 ? 0.4466 0.4436 0.4240 0.0238  0.0030  -0.0392 120 GLN A CG  
898  C CD  . GLN A 125 ? 0.5610 0.5669 0.5320 0.0319  0.0012  -0.0431 120 GLN A CD  
899  O OE1 . GLN A 125 ? 0.7745 0.7957 0.7541 0.0321  0.0027  -0.0476 120 GLN A OE1 
900  N NE2 . GLN A 125 ? 0.5145 0.5113 0.4696 0.0384  -0.0026 -0.0420 120 GLN A NE2 
901  N N   . LEU A 126 ? 0.2646 0.2810 0.2691 0.0146  0.0025  -0.0536 121 LEU A N   
902  C CA  . LEU A 126 ? 0.2921 0.3198 0.3000 0.0139  0.0019  -0.0597 121 LEU A CA  
903  C C   . LEU A 126 ? 0.2710 0.2980 0.2837 0.0103  0.0011  -0.0616 121 LEU A C   
904  O O   . LEU A 126 ? 0.2734 0.3073 0.2802 0.0081  0.0014  -0.0633 121 LEU A O   
905  C CB  . LEU A 126 ? 0.3284 0.3703 0.3513 0.0148  0.0014  -0.0683 121 LEU A CB  
906  C CG  . LEU A 126 ? 0.4008 0.4516 0.4194 0.0191  0.0017  -0.0700 121 LEU A CG  
907  C CD1 . LEU A 126 ? 0.3119 0.3790 0.3466 0.0189  0.0013  -0.0800 121 LEU A CD1 
908  C CD2 . LEU A 126 ? 0.5410 0.5912 0.5414 0.0223  0.0008  -0.0669 121 LEU A CD2 
909  N N   . ILE A 127 ? 0.2597 0.2794 0.2822 0.0095  -0.0002 -0.0618 122 ILE A N   
910  C CA  . ILE A 127 ? 0.3022 0.3219 0.3303 0.0085  -0.0024 -0.0653 122 ILE A CA  
911  C C   . ILE A 127 ? 0.2832 0.2971 0.2976 0.0061  -0.0008 -0.0593 122 ILE A C   
912  O O   . ILE A 127 ? 0.2728 0.2962 0.2869 0.0038  -0.0010 -0.0637 122 ILE A O   
913  C CB  . ILE A 127 ? 0.2936 0.3020 0.3321 0.0091  -0.0060 -0.0658 122 ILE A CB  
914  C CG1 . ILE A 127 ? 0.3110 0.3245 0.3630 0.0098  -0.0085 -0.0734 122 ILE A CG1 
915  C CG2 . ILE A 127 ? 0.2925 0.2991 0.3345 0.0105  -0.0096 -0.0693 122 ILE A CG2 
916  C CD1 . ILE A 127 ? 0.2874 0.2842 0.3457 0.0083  -0.0128 -0.0719 122 ILE A CD1 
917  N N   . LEU A 128 ? 0.2707 0.2710 0.2740 0.0062  0.0007  -0.0504 123 LEU A N   
918  C CA  . LEU A 128 ? 0.2845 0.2776 0.2732 0.0034  0.0018  -0.0449 123 LEU A CA  
919  C C   . LEU A 128 ? 0.3382 0.3376 0.3147 0.0000  0.0029  -0.0452 123 LEU A C   
920  O O   . LEU A 128 ? 0.3593 0.3605 0.3278 -0.0059 0.0037  -0.0449 123 LEU A O   
921  C CB  . LEU A 128 ? 0.2832 0.2612 0.2620 0.0055  0.0023  -0.0366 123 LEU A CB  
922  C CG  . LEU A 128 ? 0.3558 0.3233 0.3216 0.0028  0.0025  -0.0316 123 LEU A CG  
923  C CD1 . LEU A 128 ? 0.4193 0.3759 0.3837 0.0055  0.0023  -0.0264 123 LEU A CD1 
924  C CD2 . LEU A 128 ? 0.4090 0.3702 0.3567 0.0014  0.0024  -0.0281 123 LEU A CD2 
925  N N   . GLY A 129 ? 0.3007 0.3046 0.2750 0.0026  0.0028  -0.0461 124 GLY A N   
926  C CA  . GLY A 129 ? 0.3849 0.3945 0.3463 -0.0008 0.0031  -0.0462 124 GLY A CA  
927  C C   . GLY A 129 ? 0.3627 0.3917 0.3313 -0.0067 0.0041  -0.0538 124 GLY A C   
928  O O   . GLY A 129 ? 0.3296 0.3617 0.2844 -0.0145 0.0052  -0.0520 124 GLY A O   
929  N N   . CYS A 130 ? 0.2707 0.3130 0.2602 -0.0035 0.0032  -0.0629 125 CYS A N   
930  C CA  . CYS A 130 ? 0.2836 0.3474 0.2827 -0.0067 0.0031  -0.0730 125 CYS A CA  
931  C C   . CYS A 130 ? 0.3094 0.3732 0.3044 -0.0121 0.0038  -0.0725 125 CYS A C   
932  O O   . CYS A 130 ? 0.3174 0.3983 0.3080 -0.0193 0.0054  -0.0769 125 CYS A O   
933  C CB  . CYS A 130 ? 0.3219 0.3947 0.3437 -0.0002 -0.0002 -0.0836 125 CYS A CB  
934  S SG  . CYS A 130 ? 0.3310 0.4126 0.3607 0.0042  -0.0009 -0.0885 125 CYS A SG  
935  N N   . ALA A 131 ? 0.3150 0.3619 0.3114 -0.0091 0.0027  -0.0677 126 ALA A N   
936  C CA  . ALA A 131 ? 0.2694 0.3168 0.2636 -0.0129 0.0028  -0.0682 126 ALA A CA  
937  C C   . ALA A 131 ? 0.3450 0.3890 0.3183 -0.0232 0.0061  -0.0615 126 ALA A C   
938  O O   . ALA A 131 ? 0.3304 0.3896 0.3019 -0.0309 0.0075  -0.0664 126 ALA A O   
939  C CB  . ALA A 131 ? 0.2679 0.2959 0.2655 -0.0073 0.0008  -0.0628 126 ALA A CB  
940  N N   . VAL A 132 ? 0.2900 0.3147 0.2467 -0.0239 0.0067  -0.0511 127 VAL A N   
941  C CA  . VAL A 132 ? 0.3605 0.3741 0.2942 -0.0338 0.0080  -0.0436 127 VAL A CA  
942  C C   . VAL A 132 ? 0.3799 0.4026 0.2996 -0.0425 0.0092  -0.0432 127 VAL A C   
943  O O   . VAL A 132 ? 0.4126 0.4229 0.3096 -0.0526 0.0095  -0.0360 127 VAL A O   
944  C CB  . VAL A 132 ? 0.3443 0.3283 0.2634 -0.0293 0.0061  -0.0329 127 VAL A CB  
945  C CG1 . VAL A 132 ? 0.3657 0.3426 0.2959 -0.0229 0.0054  -0.0325 127 VAL A CG1 
946  C CG2 . VAL A 132 ? 0.4238 0.4015 0.3400 -0.0214 0.0041  -0.0304 127 VAL A CG2 
947  N N   . ASN A 133 ? 0.3269 0.3704 0.2590 -0.0394 0.0094  -0.0511 128 ASN A N   
948  C CA  . ASN A 133 ? 0.3335 0.3922 0.2546 -0.0481 0.0108  -0.0525 128 ASN A CA  
949  C C   . ASN A 133 ? 0.3301 0.4254 0.2667 -0.0529 0.0130  -0.0662 128 ASN A C   
950  O O   . ASN A 133 ? 0.3911 0.5047 0.3187 -0.0622 0.0149  -0.0685 128 ASN A O   
951  C CB  . ASN A 133 ? 0.3945 0.4490 0.3138 -0.0400 0.0088  -0.0507 128 ASN A CB  
952  C CG  . ASN A 133 ? 0.4483 0.4711 0.3450 -0.0374 0.0058  -0.0383 128 ASN A CG  
953  O OD1 . ASN A 133 ? 0.5378 0.5481 0.4089 -0.0465 0.0048  -0.0306 128 ASN A OD1 
954  N ND2 . ASN A 133 ? 0.4693 0.4787 0.3741 -0.0253 0.0037  -0.0368 128 ASN A ND2 
955  N N   . CYS A 134 ? 0.3184 0.4254 0.2773 -0.0462 0.0119  -0.0759 129 CYS A N   
956  C CA  . CYS A 134 ? 0.3145 0.4579 0.2899 -0.0477 0.0122  -0.0917 129 CYS A CA  
957  C C   . CYS A 134 ? 0.3644 0.5246 0.3305 -0.0620 0.0155  -0.0943 129 CYS A C   
958  O O   . CYS A 134 ? 0.3216 0.4613 0.2683 -0.0711 0.0173  -0.0829 129 CYS A O   
959  C CB  . CYS A 134 ? 0.3078 0.4543 0.3087 -0.0337 0.0076  -0.1019 129 CYS A CB  
960  S SG  . CYS A 134 ? 0.3351 0.4674 0.3385 -0.0316 0.0060  -0.0998 129 CYS A SG  
961  N N   . GLU A 135 ? 0.3595 0.5582 0.3395 -0.0642 0.0159  -0.1104 130 GLU A N   
962  C CA  . GLU A 135 ? 0.3982 0.6224 0.3715 -0.0793 0.0196  -0.1161 130 GLU A CA  
963  C C   . GLU A 135 ? 0.3334 0.5437 0.3075 -0.0785 0.0188  -0.1139 130 GLU A C   
964  O O   . GLU A 135 ? 0.4032 0.6174 0.3627 -0.0939 0.0226  -0.1108 130 GLU A O   
965  C CB  . GLU A 135 ? 0.4466 0.7201 0.4396 -0.0779 0.0190  -0.1377 130 GLU A CB  
966  C CG  . GLU A 135 ? 0.7098 1.0195 0.6933 -0.0975 0.0243  -0.1448 130 GLU A CG  
967  C CD  . GLU A 135 ? 0.9182 1.2794 0.9140 -0.0998 0.0251  -0.1636 130 GLU A CD  
968  O OE1 . GLU A 135 ? 0.8436 1.2071 0.8460 -0.0913 0.0230  -0.1660 130 GLU A OE1 
969  O OE2 . GLU A 135 ? 1.1021 1.5043 1.1013 -0.1102 0.0278  -0.1773 130 GLU A OE2 
970  N N   . GLN A 136 ? 0.3498 0.5429 0.3397 -0.0617 0.0138  -0.1149 131 GLN A N   
971  C CA  . GLN A 136 ? 0.3173 0.4975 0.3093 -0.0585 0.0121  -0.1134 131 GLN A CA  
972  C C   . GLN A 136 ? 0.3531 0.4913 0.3287 -0.0590 0.0129  -0.0950 131 GLN A C   
973  O O   . GLN A 136 ? 0.3919 0.5144 0.3717 -0.0520 0.0104  -0.0925 131 GLN A O   
974  C CB  . GLN A 136 ? 0.3537 0.5371 0.3695 -0.0402 0.0051  -0.1245 131 GLN A CB  
975  C CG  . GLN A 136 ? 0.4849 0.7094 0.5196 -0.0354 0.0018  -0.1459 131 GLN A CG  
976  C CD  . GLN A 136 ? 0.6877 0.9062 0.7426 -0.0157 -0.0077 -0.1555 131 GLN A CD  
977  O OE1 . GLN A 136 ? 0.5355 0.7258 0.5936 -0.0063 -0.0112 -0.1482 131 GLN A OE1 
978  N NE2 . GLN A 136 ? 0.7330 0.9775 0.8005 -0.0098 -0.0124 -0.1723 131 GLN A NE2 
979  N N   . LYS A 137 ? 0.3201 0.4408 0.2766 -0.0662 0.0153  -0.0829 132 LYS A N   
980  C CA  . LYS A 137 ? 0.3400 0.4220 0.2826 -0.0630 0.0144  -0.0677 132 LYS A CA  
981  C C   . LYS A 137 ? 0.4092 0.4763 0.3411 -0.0691 0.0150  -0.0622 132 LYS A C   
982  O O   . LYS A 137 ? 0.3312 0.3729 0.2615 -0.0612 0.0130  -0.0547 132 LYS A O   
983  C CB  . LYS A 137 ? 0.3851 0.4518 0.3066 -0.0692 0.0153  -0.0573 132 LYS A CB  
984  C CG  . LYS A 137 ? 0.4558 0.5296 0.3551 -0.0887 0.0185  -0.0544 132 LYS A CG  
985  C CD  . LYS A 137 ? 0.4760 0.5328 0.3547 -0.0914 0.0174  -0.0446 132 LYS A CD  
986  C CE  . LYS A 137 ? 0.6518 0.7190 0.5081 -0.1119 0.0202  -0.0421 132 LYS A CE  
987  N NZ  . LYS A 137 ? 0.7723 0.8198 0.6069 -0.1125 0.0175  -0.0320 132 LYS A NZ  
988  N N   . GLN A 138 ? 0.3879 0.4727 0.3127 -0.0838 0.0181  -0.0666 133 GLN A N   
989  C CA  . GLN A 138 ? 0.4047 0.4763 0.3204 -0.0898 0.0185  -0.0624 133 GLN A CA  
990  C C   . GLN A 138 ? 0.3489 0.4226 0.2842 -0.0756 0.0155  -0.0685 133 GLN A C   
991  O O   . GLN A 138 ? 0.3535 0.4049 0.2831 -0.0729 0.0143  -0.0616 133 GLN A O   
992  C CB  . GLN A 138 ? 0.4362 0.5303 0.3415 -0.1100 0.0227  -0.0675 133 GLN A CB  
993  C CG  . GLN A 138 ? 0.5330 0.6116 0.4095 -0.1275 0.0247  -0.0564 133 GLN A CG  
994  C CD  . GLN A 138 ? 0.6559 0.6908 0.5095 -0.1307 0.0224  -0.0419 133 GLN A CD  
995  O OE1 . GLN A 138 ? 0.6544 0.6751 0.5143 -0.1216 0.0203  -0.0408 133 GLN A OE1 
996  N NE2 . GLN A 138 ? 0.6551 0.6681 0.4807 -0.1433 0.0217  -0.0309 133 GLN A NE2 
997  N N   . GLU A 139 ? 0.3266 0.4255 0.2838 -0.0660 0.0134  -0.0813 134 GLU A N   
998  C CA  . GLU A 139 ? 0.3382 0.4355 0.3123 -0.0512 0.0086  -0.0866 134 GLU A CA  
999  C C   . GLU A 139 ? 0.2873 0.3515 0.2606 -0.0397 0.0060  -0.0750 134 GLU A C   
1000 O O   . GLU A 139 ? 0.3054 0.3546 0.2792 -0.0339 0.0039  -0.0709 134 GLU A O   
1001 C CB  . GLU A 139 ? 0.4204 0.5461 0.4160 -0.0415 0.0046  -0.1027 134 GLU A CB  
1002 C CG  . GLU A 139 ? 0.5818 0.6986 0.5919 -0.0248 -0.0024 -0.1065 134 GLU A CG  
1003 C CD  . GLU A 139 ? 0.7192 0.8539 0.7488 -0.0124 -0.0090 -0.1212 134 GLU A CD  
1004 O OE1 . GLU A 139 ? 0.6538 0.8157 0.6885 -0.0165 -0.0075 -0.1314 134 GLU A OE1 
1005 O OE2 . GLU A 139 ? 0.6391 0.7599 0.6778 0.0013  -0.0163 -0.1226 134 GLU A OE2 
1006 N N   . TYR A 140 ? 0.3262 0.3822 0.2987 -0.0368 0.0062  -0.0705 135 TYR A N   
1007 C CA  . TYR A 140 ? 0.2834 0.3143 0.2567 -0.0270 0.0041  -0.0615 135 TYR A CA  
1008 C C   . TYR A 140 ? 0.3353 0.3411 0.2903 -0.0306 0.0058  -0.0490 135 TYR A C   
1009 O O   . TYR A 140 ? 0.3329 0.3216 0.2885 -0.0234 0.0041  -0.0432 135 TYR A O   
1010 C CB  . TYR A 140 ? 0.2791 0.3131 0.2585 -0.0229 0.0036  -0.0628 135 TYR A CB  
1011 C CG  . TYR A 140 ? 0.2710 0.3256 0.2701 -0.0163 -0.0001 -0.0762 135 TYR A CG  
1012 C CD1 . TYR A 140 ? 0.3606 0.4084 0.3715 -0.0063 -0.0053 -0.0791 135 TYR A CD1 
1013 C CD2 . TYR A 140 ? 0.3476 0.4284 0.3521 -0.0199 0.0007  -0.0865 135 TYR A CD2 
1014 C CE1 . TYR A 140 ? 0.3785 0.4413 0.4058 0.0014  -0.0109 -0.0922 135 TYR A CE1 
1015 C CE2 . TYR A 140 ? 0.3698 0.4702 0.3929 -0.0120 -0.0041 -0.1010 135 TYR A CE2 
1016 C CZ  . TYR A 140 ? 0.3652 0.4547 0.3994 -0.0008 -0.0105 -0.1038 135 TYR A CZ  
1017 O OH  . TYR A 140 ? 0.3780 0.4823 0.4290 0.0088  -0.0175 -0.1187 135 TYR A OH  
1018 N N   . ILE A 141 ? 0.3474 0.3503 0.2850 -0.0420 0.0084  -0.0451 136 ILE A N   
1019 C CA  . ILE A 141 ? 0.3503 0.3272 0.2691 -0.0448 0.0082  -0.0348 136 ILE A CA  
1020 C C   . ILE A 141 ? 0.3972 0.3707 0.3166 -0.0455 0.0078  -0.0353 136 ILE A C   
1021 O O   . ILE A 141 ? 0.3699 0.3244 0.2849 -0.0395 0.0061  -0.0292 136 ILE A O   
1022 C CB  . ILE A 141 ? 0.3934 0.3634 0.2900 -0.0581 0.0094  -0.0301 136 ILE A CB  
1023 C CG1 . ILE A 141 ? 0.4825 0.4469 0.3744 -0.0539 0.0084  -0.0266 136 ILE A CG1 
1024 C CG2 . ILE A 141 ? 0.4259 0.3692 0.3022 -0.0629 0.0078  -0.0219 136 ILE A CG2 
1025 C CD1 . ILE A 141 ? 0.5873 0.5290 0.4764 -0.0415 0.0051  -0.0200 136 ILE A CD1 
1026 N N   . GLN A 142 ? 0.3512 0.3464 0.2773 -0.0518 0.0091  -0.0440 137 GLN A N   
1027 C CA  . GLN A 142 ? 0.3533 0.3490 0.2820 -0.0510 0.0083  -0.0462 137 GLN A CA  
1028 C C   . GLN A 142 ? 0.3431 0.3325 0.2853 -0.0358 0.0049  -0.0457 137 GLN A C   
1029 O O   . GLN A 142 ? 0.3881 0.3645 0.3265 -0.0326 0.0038  -0.0414 137 GLN A O   
1030 C CB  . GLN A 142 ? 0.3803 0.4065 0.3164 -0.0590 0.0098  -0.0585 137 GLN A CB  
1031 C CG  . GLN A 142 ? 0.5531 0.5839 0.4937 -0.0569 0.0084  -0.0628 137 GLN A CG  
1032 C CD  . GLN A 142 ? 0.8106 0.8184 0.7334 -0.0643 0.0095  -0.0541 137 GLN A CD  
1033 O OE1 . GLN A 142 ? 0.9178 0.9140 0.8226 -0.0771 0.0116  -0.0484 137 GLN A OE1 
1034 N NE2 . GLN A 142 ? 0.7180 0.7177 0.6444 -0.0559 0.0071  -0.0530 137 GLN A NE2 
1035 N N   . ALA A 143 ? 0.3538 0.3515 0.3105 -0.0273 0.0028  -0.0498 138 ALA A N   
1036 C CA  . ALA A 143 ? 0.3391 0.3289 0.3062 -0.0152 -0.0011 -0.0485 138 ALA A CA  
1037 C C   . ALA A 143 ? 0.3393 0.3062 0.2980 -0.0118 -0.0005 -0.0372 138 ALA A C   
1038 O O   . ALA A 143 ? 0.3491 0.3065 0.3089 -0.0060 -0.0024 -0.0333 138 ALA A O   
1039 C CB  . ALA A 143 ? 0.3205 0.3207 0.3029 -0.0081 -0.0044 -0.0557 138 ALA A CB  
1040 N N   . ILE A 144 ? 0.3267 0.2866 0.2765 -0.0152 0.0016  -0.0327 139 ILE A N   
1041 C CA  . ILE A 144 ? 0.3048 0.2469 0.2467 -0.0109 0.0016  -0.0242 139 ILE A CA  
1042 C C   . ILE A 144 ? 0.3534 0.2832 0.2827 -0.0128 0.0014  -0.0200 139 ILE A C   
1043 O O   . ILE A 144 ? 0.3536 0.2752 0.2825 -0.0068 0.0004  -0.0161 139 ILE A O   
1044 C CB  . ILE A 144 ? 0.3516 0.2898 0.2863 -0.0121 0.0025  -0.0219 139 ILE A CB  
1045 C CG1 . ILE A 144 ? 0.3395 0.2876 0.2883 -0.0076 0.0021  -0.0253 139 ILE A CG1 
1046 C CG2 . ILE A 144 ? 0.3783 0.2993 0.3005 -0.0081 0.0014  -0.0152 139 ILE A CG2 
1047 C CD1 . ILE A 144 ? 0.3704 0.3223 0.3149 -0.0098 0.0030  -0.0262 139 ILE A CD1 
1048 N N   . MET A 145 ? 0.3360 0.2656 0.2551 -0.0218 0.0024  -0.0214 140 MET A N   
1049 C CA  . MET A 145 ? 0.3991 0.3156 0.3061 -0.0241 0.0015  -0.0184 140 MET A CA  
1050 C C   . MET A 145 ? 0.3979 0.3218 0.3145 -0.0200 0.0008  -0.0212 140 MET A C   
1051 O O   . MET A 145 ? 0.4147 0.3287 0.3257 -0.0169 -0.0003 -0.0182 140 MET A O   
1052 C CB  . MET A 145 ? 0.4779 0.3906 0.3698 -0.0373 0.0024  -0.0189 140 MET A CB  
1053 C CG  . MET A 145 ? 0.4206 0.3180 0.2966 -0.0406 0.0013  -0.0137 140 MET A CG  
1054 S SD  . MET A 145 ? 0.5109 0.3849 0.3781 -0.0277 -0.0030 -0.0075 140 MET A SD  
1055 C CE  . MET A 145 ? 0.5249 0.3823 0.3803 -0.0291 -0.0058 -0.0064 140 MET A CE  
1056 N N   . MET A 146 ? 0.3576 0.2989 0.2882 -0.0186 0.0006  -0.0275 141 MET A N   
1057 C CA  . MET A 146 ? 0.4028 0.3492 0.3415 -0.0124 -0.0017 -0.0299 141 MET A CA  
1058 C C   . MET A 146 ? 0.3499 0.2861 0.2917 -0.0031 -0.0036 -0.0236 141 MET A C   
1059 O O   . MET A 146 ? 0.3548 0.2898 0.2976 0.0013  -0.0055 -0.0225 141 MET A O   
1060 C CB  . MET A 146 ? 0.3696 0.3360 0.3217 -0.0111 -0.0035 -0.0396 141 MET A CB  
1061 C CG  . MET A 146 ? 0.5219 0.5055 0.4720 -0.0214 -0.0014 -0.0479 141 MET A CG  
1062 S SD  . MET A 146 ? 0.6820 0.6636 0.6238 -0.0257 -0.0011 -0.0484 141 MET A SD  
1063 C CE  . MET A 146 ? 0.4497 0.4292 0.4017 -0.0101 -0.0065 -0.0480 141 MET A CE  
1064 N N   . MET A 147 ? 0.3258 0.2564 0.2683 -0.0009 -0.0029 -0.0195 142 MET A N   
1065 C CA  . MET A 147 ? 0.3393 0.2624 0.2824 0.0048  -0.0036 -0.0134 142 MET A CA  
1066 C C   . MET A 147 ? 0.3658 0.2808 0.2979 0.0057  -0.0030 -0.0095 142 MET A C   
1067 O O   . MET A 147 ? 0.3535 0.2671 0.2853 0.0096  -0.0037 -0.0060 142 MET A O   
1068 C CB  . MET A 147 ? 0.2970 0.2191 0.2430 0.0057  -0.0025 -0.0116 142 MET A CB  
1069 C CG  . MET A 147 ? 0.3514 0.2808 0.3090 0.0059  -0.0039 -0.0161 142 MET A CG  
1070 S SD  . MET A 147 ? 0.3642 0.2935 0.3253 0.0064  -0.0025 -0.0146 142 MET A SD  
1071 C CE  . MET A 147 ? 0.3558 0.2791 0.3177 0.0087  -0.0031 -0.0080 142 MET A CE  
1072 N N   . GLU A 148 ? 0.3358 0.2451 0.2577 0.0017  -0.0022 -0.0103 143 GLU A N   
1073 C CA  . GLU A 148 ? 0.3697 0.2694 0.2803 0.0032  -0.0032 -0.0084 143 GLU A CA  
1074 C C   . GLU A 148 ? 0.3901 0.2929 0.3010 0.0027  -0.0040 -0.0103 143 GLU A C   
1075 O O   . GLU A 148 ? 0.3735 0.2745 0.2816 0.0073  -0.0050 -0.0086 143 GLU A O   
1076 C CB  . GLU A 148 ? 0.4393 0.3266 0.3360 -0.0017 -0.0040 -0.0087 143 GLU A CB  
1077 C CG  . GLU A 148 ? 0.4525 0.3342 0.3452 0.0012  -0.0047 -0.0068 143 GLU A CG  
1078 C CD  . GLU A 148 ? 0.5748 0.4473 0.4591 0.0093  -0.0077 -0.0057 143 GLU A CD  
1079 O OE1 . GLU A 148 ? 0.5146 0.3890 0.3997 0.0134  -0.0084 -0.0061 143 GLU A OE1 
1080 O OE2 . GLU A 148 ? 0.6047 0.4696 0.4814 0.0124  -0.0099 -0.0054 143 GLU A OE2 
1081 N N   . GLU A 149 ? 0.3909 0.3013 0.3053 -0.0029 -0.0036 -0.0150 144 GLU A N   
1082 C CA  . GLU A 149 ? 0.4056 0.3223 0.3213 -0.0032 -0.0046 -0.0185 144 GLU A CA  
1083 C C   . GLU A 149 ? 0.3908 0.3124 0.3144 0.0050  -0.0065 -0.0165 144 GLU A C   
1084 O O   . GLU A 149 ? 0.3859 0.3080 0.3069 0.0080  -0.0078 -0.0160 144 GLU A O   
1085 C CB  . GLU A 149 ? 0.4049 0.3347 0.3250 -0.0105 -0.0039 -0.0260 144 GLU A CB  
1086 C CG  . GLU A 149 ? 0.6336 0.5588 0.5427 -0.0223 -0.0019 -0.0274 144 GLU A CG  
1087 C CD  . GLU A 149 ? 0.8428 0.7862 0.7553 -0.0314 -0.0006 -0.0362 144 GLU A CD  
1088 O OE1 . GLU A 149 ? 0.8767 0.8338 0.7981 -0.0268 -0.0022 -0.0417 144 GLU A OE1 
1089 O OE2 . GLU A 149 ? 0.8580 0.8034 0.7634 -0.0435 0.0016  -0.0380 144 GLU A OE2 
1090 N N   . SER A 150 ? 0.3389 0.2629 0.2706 0.0080  -0.0073 -0.0150 145 SER A N   
1091 C CA  . SER A 150 ? 0.3620 0.2862 0.2984 0.0142  -0.0103 -0.0118 145 SER A CA  
1092 C C   . SER A 150 ? 0.3436 0.2622 0.2735 0.0166  -0.0095 -0.0047 145 SER A C   
1093 O O   . SER A 150 ? 0.3554 0.2749 0.2831 0.0198  -0.0115 -0.0023 145 SER A O   
1094 C CB  . SER A 150 ? 0.3791 0.3031 0.3239 0.0157  -0.0120 -0.0117 145 SER A CB  
1095 O OG  . SER A 150 ? 0.4130 0.3317 0.3588 0.0202  -0.0160 -0.0072 145 SER A OG  
1096 N N   . VAL A 151 ? 0.3340 0.2490 0.2603 0.0155  -0.0068 -0.0022 146 VAL A N   
1097 C CA  . VAL A 151 ? 0.3165 0.2319 0.2376 0.0180  -0.0060 0.0022  146 VAL A CA  
1098 C C   . VAL A 151 ? 0.4063 0.3224 0.3203 0.0200  -0.0067 0.0003  146 VAL A C   
1099 O O   . VAL A 151 ? 0.3324 0.2531 0.2436 0.0225  -0.0070 0.0030  146 VAL A O   
1100 C CB  . VAL A 151 ? 0.4075 0.3221 0.3267 0.0182  -0.0039 0.0026  146 VAL A CB  
1101 C CG1 . VAL A 151 ? 0.4154 0.3360 0.3296 0.0214  -0.0033 0.0043  146 VAL A CG1 
1102 C CG2 . VAL A 151 ? 0.4741 0.3900 0.4008 0.0162  -0.0032 0.0045  146 VAL A CG2 
1103 N N   . GLN A 152 ? 0.3537 0.2657 0.2641 0.0177  -0.0070 -0.0045 147 GLN A N   
1104 C CA  . GLN A 152 ? 0.3686 0.2801 0.2724 0.0190  -0.0083 -0.0073 147 GLN A CA  
1105 C C   . GLN A 152 ? 0.3613 0.2810 0.2684 0.0209  -0.0097 -0.0074 147 GLN A C   
1106 O O   . GLN A 152 ? 0.3672 0.2901 0.2700 0.0240  -0.0107 -0.0079 147 GLN A O   
1107 C CB  . GLN A 152 ? 0.3991 0.3023 0.2967 0.0135  -0.0088 -0.0122 147 GLN A CB  
1108 C CG  . GLN A 152 ? 0.4552 0.3470 0.3468 0.0108  -0.0086 -0.0117 147 GLN A CG  
1109 C CD  . GLN A 152 ? 0.6687 0.5576 0.5573 0.0176  -0.0094 -0.0094 147 GLN A CD  
1110 O OE1 . GLN A 152 ? 0.7812 0.6674 0.6703 0.0176  -0.0088 -0.0080 147 GLN A OE1 
1111 N NE2 . GLN A 152 ? 0.5708 0.4631 0.4566 0.0238  -0.0109 -0.0104 147 GLN A NE2 
1112 N N   . HIS A 153 ? 0.3736 0.2968 0.2879 0.0204  -0.0108 -0.0077 148 HIS A N   
1113 C CA  . HIS A 153 ? 0.3812 0.3104 0.2971 0.0243  -0.0140 -0.0077 148 HIS A CA  
1114 C C   . HIS A 153 ? 0.3653 0.2941 0.2775 0.0276  -0.0148 0.0001  148 HIS A C   
1115 O O   . HIS A 153 ? 0.3867 0.3199 0.2948 0.0308  -0.0167 0.0012  148 HIS A O   
1116 C CB  . HIS A 153 ? 0.4060 0.3384 0.3299 0.0253  -0.0170 -0.0112 148 HIS A CB  
1117 C CG  . HIS A 153 ? 0.5618 0.5008 0.4896 0.0205  -0.0159 -0.0201 148 HIS A CG  
1118 N ND1 . HIS A 153 ? 0.6805 0.6218 0.6034 0.0153  -0.0138 -0.0247 148 HIS A ND1 
1119 C CD2 . HIS A 153 ? 0.5109 0.4561 0.4464 0.0189  -0.0167 -0.0257 148 HIS A CD2 
1120 C CE1 . HIS A 153 ? 0.6559 0.6047 0.5824 0.0090  -0.0127 -0.0319 148 HIS A CE1 
1121 N NE2 . HIS A 153 ? 0.6079 0.5612 0.5426 0.0115  -0.0142 -0.0331 148 HIS A NE2 
1122 N N   . VAL A 154 ? 0.3482 0.2733 0.2612 0.0259  -0.0131 0.0054  149 VAL A N   
1123 C CA  . VAL A 154 ? 0.3430 0.2698 0.2513 0.0258  -0.0129 0.0131  149 VAL A CA  
1124 C C   . VAL A 154 ? 0.3331 0.2685 0.2352 0.0272  -0.0107 0.0120  149 VAL A C   
1125 O O   . VAL A 154 ? 0.3491 0.2908 0.2458 0.0282  -0.0115 0.0155  149 VAL A O   
1126 C CB  . VAL A 154 ? 0.3460 0.2696 0.2569 0.0219  -0.0109 0.0173  149 VAL A CB  
1127 C CG1 . VAL A 154 ? 0.3773 0.3058 0.2820 0.0187  -0.0098 0.0249  149 VAL A CG1 
1128 C CG2 . VAL A 154 ? 0.3702 0.2848 0.2874 0.0214  -0.0142 0.0175  149 VAL A CG2 
1129 N N   . VAL A 155 ? 0.3535 0.2886 0.2556 0.0278  -0.0088 0.0067  150 VAL A N   
1130 C CA  . VAL A 155 ? 0.3584 0.3006 0.2549 0.0312  -0.0083 0.0034  150 VAL A CA  
1131 C C   . VAL A 155 ? 0.3349 0.2802 0.2282 0.0339  -0.0104 -0.0002 150 VAL A C   
1132 O O   . VAL A 155 ? 0.3385 0.2944 0.2275 0.0367  -0.0106 -0.0002 150 VAL A O   
1133 C CB  . VAL A 155 ? 0.3325 0.2682 0.2275 0.0327  -0.0082 -0.0021 150 VAL A CB  
1134 C CG1 . VAL A 155 ? 0.3489 0.2895 0.2376 0.0385  -0.0100 -0.0080 150 VAL A CG1 
1135 C CG2 . VAL A 155 ? 0.3577 0.2949 0.2560 0.0313  -0.0061 0.0005  150 VAL A CG2 
1136 N N   . MET A 156 ? 0.3342 0.2729 0.2296 0.0325  -0.0119 -0.0041 151 MET A N   
1137 C CA  . MET A 156 ? 0.3604 0.3038 0.2536 0.0344  -0.0140 -0.0086 151 MET A CA  
1138 C C   . MET A 156 ? 0.3597 0.3116 0.2520 0.0370  -0.0156 -0.0035 151 MET A C   
1139 O O   . MET A 156 ? 0.3749 0.3354 0.2630 0.0402  -0.0168 -0.0054 151 MET A O   
1140 C CB  . MET A 156 ? 0.3894 0.3282 0.2857 0.0306  -0.0149 -0.0145 151 MET A CB  
1141 C CG  . MET A 156 ? 0.4195 0.3648 0.3138 0.0317  -0.0168 -0.0210 151 MET A CG  
1142 S SD  . MET A 156 ? 0.5027 0.4470 0.3890 0.0344  -0.0179 -0.0261 151 MET A SD  
1143 C CE  . MET A 156 ? 0.6521 0.5866 0.5358 0.0264  -0.0188 -0.0349 151 MET A CE  
1144 N N   . THR A 157 ? 0.3631 0.3112 0.2577 0.0358  -0.0165 0.0029  152 THR A N   
1145 C CA  . THR A 157 ? 0.4123 0.3634 0.3022 0.0379  -0.0196 0.0094  152 THR A CA  
1146 C C   . THR A 157 ? 0.3756 0.3362 0.2581 0.0369  -0.0174 0.0146  152 THR A C   
1147 O O   . THR A 157 ? 0.4062 0.3750 0.2822 0.0391  -0.0191 0.0164  152 THR A O   
1148 C CB  . THR A 157 ? 0.4472 0.3875 0.3387 0.0365  -0.0225 0.0157  152 THR A CB  
1149 O OG1 . THR A 157 ? 0.4476 0.3841 0.3470 0.0384  -0.0249 0.0088  152 THR A OG1 
1150 C CG2 . THR A 157 ? 0.4458 0.3837 0.3283 0.0384  -0.0274 0.0236  152 THR A CG2 
1151 N N   . ALA A 158 ? 0.3583 0.3205 0.2416 0.0336  -0.0136 0.0162  153 ALA A N   
1152 C CA  . ALA A 158 ? 0.3762 0.3533 0.2537 0.0321  -0.0111 0.0188  153 ALA A CA  
1153 C C   . ALA A 158 ? 0.4068 0.3966 0.2818 0.0376  -0.0113 0.0109  153 ALA A C   
1154 O O   . ALA A 158 ? 0.3707 0.3751 0.2394 0.0378  -0.0112 0.0129  153 ALA A O   
1155 C CB  . ALA A 158 ? 0.3697 0.3498 0.2504 0.0289  -0.0074 0.0185  153 ALA A CB  
1156 N N   . ILE A 159 ? 0.3687 0.3526 0.2477 0.0413  -0.0121 0.0019  154 ILE A N   
1157 C CA  . ILE A 159 ? 0.3762 0.3680 0.2527 0.0467  -0.0136 -0.0070 154 ILE A CA  
1158 C C   . ILE A 159 ? 0.4175 0.4152 0.2913 0.0485  -0.0159 -0.0069 154 ILE A C   
1159 O O   . ILE A 159 ? 0.4283 0.4413 0.2977 0.0519  -0.0165 -0.0096 154 ILE A O   
1160 C CB  . ILE A 159 ? 0.3725 0.3497 0.2510 0.0482  -0.0152 -0.0154 154 ILE A CB  
1161 C CG1 . ILE A 159 ? 0.3559 0.3307 0.2344 0.0496  -0.0144 -0.0172 154 ILE A CG1 
1162 C CG2 . ILE A 159 ? 0.4966 0.4762 0.3719 0.0526  -0.0183 -0.0246 154 ILE A CG2 
1163 C CD1 . ILE A 159 ? 0.4462 0.4008 0.3238 0.0491  -0.0164 -0.0220 154 ILE A CD1 
1164 N N   . GLN A 160 ? 0.3635 0.3514 0.2399 0.0471  -0.0177 -0.0046 155 GLN A N   
1165 C CA  . GLN A 160 ? 0.4285 0.4225 0.3023 0.0501  -0.0209 -0.0053 155 GLN A CA  
1166 C C   . GLN A 160 ? 0.4610 0.4639 0.3265 0.0499  -0.0217 0.0042  155 GLN A C   
1167 O O   . GLN A 160 ? 0.4428 0.4566 0.3033 0.0534  -0.0239 0.0032  155 GLN A O   
1168 C CB  . GLN A 160 ? 0.4494 0.4339 0.3283 0.0498  -0.0236 -0.0069 155 GLN A CB  
1169 C CG  . GLN A 160 ? 0.4598 0.4385 0.3446 0.0474  -0.0227 -0.0166 155 GLN A CG  
1170 C CD  . GLN A 160 ? 0.5226 0.5086 0.4054 0.0493  -0.0236 -0.0258 155 GLN A CD  
1171 O OE1 . GLN A 160 ? 0.5559 0.5536 0.4357 0.0537  -0.0257 -0.0268 155 GLN A OE1 
1172 N NE2 . GLN A 160 ? 0.5094 0.4870 0.3925 0.0459  -0.0227 -0.0326 155 GLN A NE2 
1173 N N   . GLU A 161 ? 0.3707 0.3692 0.2337 0.0448  -0.0201 0.0137  156 GLU A N   
1174 C CA  . GLU A 161 ? 0.3838 0.3891 0.2357 0.0416  -0.0209 0.0241  156 GLU A CA  
1175 C C   . GLU A 161 ? 0.5360 0.5641 0.3835 0.0407  -0.0172 0.0218  156 GLU A C   
1176 O O   . GLU A 161 ? 0.5046 0.5443 0.3414 0.0377  -0.0174 0.0287  156 GLU A O   
1177 C CB  . GLU A 161 ? 0.4498 0.4413 0.2986 0.0344  -0.0209 0.0353  156 GLU A CB  
1178 C CG  . GLU A 161 ? 0.4230 0.3936 0.2735 0.0368  -0.0268 0.0380  156 GLU A CG  
1179 C CD  . GLU A 161 ? 0.5421 0.5102 0.3830 0.0416  -0.0337 0.0416  156 GLU A CD  
1180 O OE1 . GLU A 161 ? 0.5446 0.5187 0.3721 0.0382  -0.0343 0.0501  156 GLU A OE1 
1181 O OE2 . GLU A 161 ? 0.5990 0.5607 0.4449 0.0488  -0.0387 0.0355  156 GLU A OE2 
1182 N N   . LEU A 162 ? 0.3908 0.4258 0.2453 0.0438  -0.0146 0.0115  157 LEU A N   
1183 C CA  . LEU A 162 ? 0.4224 0.4820 0.2743 0.0459  -0.0124 0.0054  157 LEU A CA  
1184 C C   . LEU A 162 ? 0.5352 0.6045 0.3875 0.0540  -0.0152 -0.0053 157 LEU A C   
1185 O O   . LEU A 162 ? 0.5658 0.6582 0.4144 0.0565  -0.0146 -0.0102 157 LEU A O   
1186 C CB  . LEU A 162 ? 0.4338 0.4965 0.2918 0.0468  -0.0099 -0.0013 157 LEU A CB  
1187 C CG  . LEU A 162 ? 0.4128 0.4724 0.2715 0.0388  -0.0064 0.0066  157 LEU A CG  
1188 C CD1 . LEU A 162 ? 0.4331 0.4915 0.2988 0.0430  -0.0057 -0.0024 157 LEU A CD1 
1189 C CD2 . LEU A 162 ? 0.5745 0.6576 0.4253 0.0311  -0.0031 0.0131  157 LEU A CD2 
1190 N N   . MET A 163 ? 0.5350 0.5886 0.3917 0.0574  -0.0182 -0.0102 158 MET A N   
1191 C CA  . MET A 163 ? 0.6580 0.7190 0.5151 0.0638  -0.0210 -0.0209 158 MET A CA  
1192 C C   . MET A 163 ? 0.8211 0.8936 0.6718 0.0649  -0.0230 -0.0164 158 MET A C   
1193 O O   . MET A 163 ? 0.9374 1.0039 0.7831 0.0611  -0.0237 -0.0049 158 MET A O   
1194 C CB  . MET A 163 ? 0.6139 0.6558 0.4773 0.0645  -0.0231 -0.0283 158 MET A CB  
1195 C CG  . MET A 163 ? 0.5996 0.6284 0.4663 0.0642  -0.0225 -0.0334 158 MET A CG  
1196 S SD  . MET A 163 ? 1.1035 1.1092 0.9740 0.0608  -0.0245 -0.0397 158 MET A SD  
1197 C CE  . MET A 163 ? 1.2037 1.2186 1.0724 0.0651  -0.0283 -0.0513 158 MET A CE  
1198 N N   . SER B 11  ? 1.0576 1.3520 1.1314 0.0663  0.0726  0.1381  6   SER B N   
1199 C CA  . SER B 11  ? 1.0482 1.3322 1.1175 0.0845  0.0822  0.1252  6   SER B CA  
1200 C C   . SER B 11  ? 0.9660 1.2030 1.0206 0.0798  0.0787  0.1044  6   SER B C   
1201 O O   . SER B 11  ? 0.9331 1.1385 0.9882 0.0815  0.0771  0.0965  6   SER B O   
1202 C CB  . SER B 11  ? 1.1318 1.4532 1.1986 0.0835  0.0848  0.1328  6   SER B CB  
1203 O OG  . SER B 11  ? 1.1333 1.4474 1.1946 0.1027  0.0951  0.1205  6   SER B OG  
1204 N N   . LEU B 12  ? 0.8823 1.1177 0.9247 0.0734  0.0771  0.0971  7   LEU B N   
1205 C CA  . LEU B 12  ? 0.9151 1.1110 0.9439 0.0686  0.0737  0.0791  7   LEU B CA  
1206 C C   . LEU B 12  ? 1.0127 1.1931 1.0345 0.0469  0.0617  0.0793  7   LEU B C   
1207 O O   . LEU B 12  ? 0.9419 1.0894 0.9550 0.0429  0.0582  0.0667  7   LEU B O   
1208 C CB  . LEU B 12  ? 0.8608 1.0624 0.8792 0.0714  0.0774  0.0716  7   LEU B CB  
1209 C CG  . LEU B 12  ? 0.9207 1.1573 0.9446 0.0884  0.0881  0.0785  7   LEU B CG  
1210 C CD1 . LEU B 12  ? 0.9902 1.2701 1.0159 0.0754  0.0842  0.0947  7   LEU B CD1 
1211 C CD2 . LEU B 12  ? 0.9086 1.1288 0.9212 0.1031  0.0962  0.0623  7   LEU B CD2 
1212 N N   . GLU B 13  ? 1.1158 1.3200 1.1400 0.0332  0.0554  0.0940  8   GLU B N   
1213 C CA  . GLU B 13  ? 1.1697 1.3568 1.1848 0.0143  0.0442  0.0947  8   GLU B CA  
1214 C C   . GLU B 13  ? 1.1320 1.3022 1.1536 0.0174  0.0436  0.0937  8   GLU B C   
1215 O O   . GLU B 13  ? 1.1095 1.2915 1.1448 0.0303  0.0501  0.0990  8   GLU B O   
1216 C CB  . GLU B 13  ? 1.2872 1.5024 1.2993 -0.0031 0.0364  0.1108  8   GLU B CB  
1217 C CG  . GLU B 13  ? 1.3939 1.5902 1.3877 -0.0227 0.0253  0.1078  8   GLU B CG  
1218 C CD  . GLU B 13  ? 1.4480 1.6091 1.4328 -0.0292 0.0190  0.1003  8   GLU B CD  
1219 O OE1 . GLU B 13  ? 1.4678 1.6216 1.4393 -0.0463 0.0089  0.1052  8   GLU B OE1 
1220 O OE2 . GLU B 13  ? 1.4563 1.5967 1.4459 -0.0173 0.0240  0.0899  8   GLU B OE2 
1221 N N   . ARG B 14  ? 1.0987 1.2418 1.1101 0.0067  0.0362  0.0874  9   ARG B N   
1222 C CA  . ARG B 14  ? 0.9245 1.0497 0.9399 0.0089  0.0352  0.0851  9   ARG B CA  
1223 C C   . ARG B 14  ? 0.7674 0.8730 0.7892 0.0244  0.0421  0.0742  9   ARG B C   
1224 O O   . ARG B 14  ? 0.6996 0.7839 0.7215 0.0249  0.0404  0.0689  9   ARG B O   
1225 C CB  . ARG B 14  ? 0.9734 1.1225 0.9998 0.0074  0.0348  0.1001  9   ARG B CB  
1226 C CG  . ARG B 14  ? 0.8937 1.0272 0.9213 0.0050  0.0315  0.0995  9   ARG B CG  
1227 C CD  . ARG B 14  ? 0.9074 1.0123 0.9174 -0.0052 0.0247  0.0894  9   ARG B CD  
1228 N NE  . ARG B 14  ? 0.9329 1.0252 0.9421 -0.0072 0.0219  0.0890  9   ARG B NE  
1229 C CZ  . ARG B 14  ? 0.8288 0.9077 0.8463 0.0026  0.0256  0.0834  9   ARG B CZ  
1230 N NH1 . ARG B 14  ? 0.5152 0.5874 0.5408 0.0147  0.0318  0.0771  9   ARG B NH1 
1231 N NH2 . ARG B 14  ? 0.8949 0.9667 0.9109 -0.0005 0.0226  0.0846  9   ARG B NH2 
1232 N N   . ALA B 15  ? 0.6472 0.7599 0.6729 0.0367  0.0496  0.0711  10  ALA B N   
1233 C CA  . ALA B 15  ? 0.5221 0.6106 0.5473 0.0486  0.0546  0.0584  10  ALA B CA  
1234 C C   . ALA B 15  ? 0.4782 0.5445 0.4896 0.0402  0.0499  0.0468  10  ALA B C   
1235 O O   . ALA B 15  ? 0.4344 0.4762 0.4434 0.0434  0.0501  0.0371  10  ALA B O   
1236 C CB  . ALA B 15  ? 0.5300 0.6303 0.5585 0.0641  0.0637  0.0573  10  ALA B CB  
1237 N N   . GLU B 16  ? 0.4696 0.5454 0.4720 0.0288  0.0453  0.0491  11  GLU B N   
1238 C CA  . GLU B 16  ? 0.4654 0.5224 0.4549 0.0206  0.0404  0.0402  11  GLU B CA  
1239 C C   . GLU B 16  ? 0.3819 0.4165 0.3686 0.0159  0.0353  0.0367  11  GLU B C   
1240 O O   . GLU B 16  ? 0.4188 0.4341 0.4007 0.0168  0.0346  0.0277  11  GLU B O   
1241 C CB  . GLU B 16  ? 0.5503 0.6209 0.5306 0.0081  0.0350  0.0459  11  GLU B CB  
1242 C CG  . GLU B 16  ? 0.8541 0.9047 0.8210 -0.0002 0.0293  0.0386  11  GLU B CG  
1243 C CD  . GLU B 16  ? 1.0300 1.0915 0.9869 -0.0126 0.0235  0.0447  11  GLU B CD  
1244 O OE1 . GLU B 16  ? 1.0650 1.1516 1.0253 -0.0164 0.0233  0.0553  11  GLU B OE1 
1245 O OE2 . GLU B 16  ? 1.0106 1.0563 0.9562 -0.0189 0.0187  0.0400  11  GLU B OE2 
1246 N N   . LEU B 17  ? 0.3781 0.4173 0.3672 0.0109  0.0318  0.0446  12  LEU B N   
1247 C CA  . LEU B 17  ? 0.3562 0.3775 0.3425 0.0083  0.0281  0.0421  12  LEU B CA  
1248 C C   . LEU B 17  ? 0.3942 0.4043 0.3901 0.0180  0.0322  0.0372  12  LEU B C   
1249 O O   . LEU B 17  ? 0.3540 0.3478 0.3465 0.0174  0.0302  0.0316  12  LEU B O   
1250 C CB  . LEU B 17  ? 0.3954 0.4250 0.3818 0.0019  0.0243  0.0514  12  LEU B CB  
1251 C CG  . LEU B 17  ? 0.4733 0.4867 0.4552 0.0002  0.0210  0.0489  12  LEU B CG  
1252 C CD1 . LEU B 17  ? 0.3995 0.3948 0.3647 -0.0048 0.0166  0.0422  12  LEU B CD1 
1253 C CD2 . LEU B 17  ? 0.5664 0.5893 0.5480 -0.0055 0.0179  0.0578  12  LEU B CD2 
1254 N N   . CYS B 18  ? 0.3745 0.3935 0.3818 0.0271  0.0377  0.0402  13  CYS B N   
1255 C CA  . CYS B 18  ? 0.4544 0.4590 0.4692 0.0355  0.0405  0.0364  13  CYS B CA  
1256 C C   . CYS B 18  ? 0.3067 0.2928 0.3137 0.0367  0.0408  0.0250  13  CYS B C   
1257 O O   . CYS B 18  ? 0.3355 0.3053 0.3427 0.0359  0.0387  0.0213  13  CYS B O   
1258 C CB  . CYS B 18  ? 0.4289 0.4433 0.4552 0.0468  0.0466  0.0416  13  CYS B CB  
1259 S SG  . CYS B 18  ? 0.4011 0.3935 0.4353 0.0557  0.0483  0.0390  13  CYS B SG  
1260 N N   . GLU B 19  ? 0.3479 0.3387 0.3479 0.0375  0.0431  0.0205  14  GLU B N   
1261 C CA  . GLU B 19  ? 0.3532 0.3286 0.3442 0.0372  0.0431  0.0100  14  GLU B CA  
1262 C C   . GLU B 19  ? 0.3196 0.2857 0.3039 0.0277  0.0368  0.0077  14  GLU B C   
1263 O O   . GLU B 19  ? 0.3934 0.3445 0.3745 0.0265  0.0352  0.0018  14  GLU B O   
1264 C CB  . GLU B 19  ? 0.4357 0.4224 0.4200 0.0395  0.0467  0.0069  14  GLU B CB  
1265 C CG  . GLU B 19  ? 0.4906 0.4851 0.4799 0.0527  0.0545  0.0076  14  GLU B CG  
1266 C CD  . GLU B 19  ? 0.6778 0.6475 0.6642 0.0614  0.0574  -0.0015 14  GLU B CD  
1267 O OE1 . GLU B 19  ? 0.6843 0.6342 0.6627 0.0553  0.0534  -0.0094 14  GLU B OE1 
1268 O OE2 . GLU B 19  ? 0.7499 0.7194 0.7412 0.0741  0.0634  -0.0002 14  GLU B OE2 
1269 N N   . SER B 20  ? 0.3328 0.3071 0.3137 0.0209  0.0331  0.0128  15  SER B N   
1270 C CA  . SER B 20  ? 0.3386 0.3034 0.3125 0.0146  0.0280  0.0113  15  SER B CA  
1271 C C   . SER B 20  ? 0.3142 0.2712 0.2942 0.0161  0.0266  0.0129  15  SER B C   
1272 O O   . SER B 20  ? 0.3481 0.2965 0.3258 0.0146  0.0244  0.0101  15  SER B O   
1273 C CB  . SER B 20  ? 0.3691 0.3394 0.3350 0.0081  0.0241  0.0161  15  SER B CB  
1274 O OG  . SER B 20  ? 0.4203 0.3997 0.3808 0.0049  0.0243  0.0163  15  SER B OG  
1275 N N   . LEU B 21  ? 0.3062 0.2691 0.2946 0.0186  0.0277  0.0190  16  LEU B N   
1276 C CA  . LEU B 21  ? 0.3027 0.2614 0.2976 0.0194  0.0263  0.0220  16  LEU B CA  
1277 C C   . LEU B 21  ? 0.3483 0.2962 0.3486 0.0222  0.0271  0.0186  16  LEU B C   
1278 O O   . LEU B 21  ? 0.3589 0.3023 0.3622 0.0204  0.0245  0.0204  16  LEU B O   
1279 C CB  . LEU B 21  ? 0.2782 0.2473 0.2809 0.0207  0.0270  0.0302  16  LEU B CB  
1280 C CG  . LEU B 21  ? 0.3033 0.2788 0.2966 0.0152  0.0242  0.0334  16  LEU B CG  
1281 C CD1 . LEU B 21  ? 0.4048 0.3920 0.4046 0.0146  0.0240  0.0420  16  LEU B CD1 
1282 C CD2 . LEU B 21  ? 0.4227 0.3892 0.4061 0.0131  0.0210  0.0306  16  LEU B CD2 
1283 N N   . LEU B 22  ? 0.3282 0.2717 0.3283 0.0263  0.0305  0.0141  17  LEU B N   
1284 C CA  . LEU B 22  ? 0.3333 0.2607 0.3334 0.0278  0.0304  0.0092  17  LEU B CA  
1285 C C   . LEU B 22  ? 0.3868 0.3072 0.3789 0.0209  0.0263  0.0046  17  LEU B C   
1286 O O   . LEU B 22  ? 0.3615 0.2718 0.3548 0.0175  0.0230  0.0048  17  LEU B O   
1287 C CB  . LEU B 22  ? 0.3665 0.2888 0.3635 0.0352  0.0355  0.0035  17  LEU B CB  
1288 C CG  . LEU B 22  ? 0.5434 0.4430 0.5345 0.0368  0.0353  -0.0039 17  LEU B CG  
1289 C CD1 . LEU B 22  ? 0.5934 0.4809 0.5924 0.0367  0.0324  0.0011  17  LEU B CD1 
1290 C CD2 . LEU B 22  ? 0.5191 0.4149 0.5047 0.0472  0.0418  -0.0100 17  LEU B CD2 
1291 N N   . THR B 23  ? 0.3754 0.3022 0.3595 0.0179  0.0258  0.0020  18  THR B N   
1292 C CA  . THR B 23  ? 0.3812 0.3043 0.3587 0.0120  0.0220  -0.0007 18  THR B CA  
1293 C C   . THR B 23  ? 0.3616 0.2892 0.3437 0.0096  0.0186  0.0061  18  THR B C   
1294 O O   . THR B 23  ? 0.3357 0.2610 0.3175 0.0054  0.0152  0.0070  18  THR B O   
1295 C CB  . THR B 23  ? 0.4217 0.3508 0.3899 0.0097  0.0221  -0.0037 18  THR B CB  
1296 O OG1 . THR B 23  ? 0.4188 0.3560 0.3861 0.0095  0.0211  0.0015  18  THR B OG1 
1297 C CG2 . THR B 23  ? 0.2965 0.2268 0.2609 0.0129  0.0263  -0.0088 18  THR B CG2 
1298 N N   . TRP B 24  ? 0.3286 0.2642 0.3144 0.0123  0.0193  0.0116  19  TRP B N   
1299 C CA  . TRP B 24  ? 0.3198 0.2611 0.3094 0.0121  0.0171  0.0180  19  TRP B CA  
1300 C C   . TRP B 24  ? 0.3757 0.3148 0.3755 0.0108  0.0156  0.0222  19  TRP B C   
1301 O O   . TRP B 24  ? 0.3608 0.3039 0.3629 0.0078  0.0125  0.0265  19  TRP B O   
1302 C CB  . TRP B 24  ? 0.3137 0.2620 0.3023 0.0147  0.0182  0.0220  19  TRP B CB  
1303 C CG  . TRP B 24  ? 0.3228 0.2780 0.3143 0.0162  0.0169  0.0283  19  TRP B CG  
1304 C CD1 . TRP B 24  ? 0.3474 0.3061 0.3332 0.0176  0.0157  0.0298  19  TRP B CD1 
1305 C CD2 . TRP B 24  ? 0.3331 0.2949 0.3340 0.0173  0.0172  0.0348  19  TRP B CD2 
1306 N NE1 . TRP B 24  ? 0.3470 0.3152 0.3375 0.0201  0.0156  0.0365  19  TRP B NE1 
1307 C CE2 . TRP B 24  ? 0.3466 0.3168 0.3463 0.0190  0.0162  0.0396  19  TRP B CE2 
1308 C CE3 . TRP B 24  ? 0.3517 0.3145 0.3620 0.0177  0.0184  0.0378  19  TRP B CE3 
1309 C CZ2 . TRP B 24  ? 0.3301 0.3107 0.3374 0.0201  0.0161  0.0471  19  TRP B CZ2 
1310 C CZ3 . TRP B 24  ? 0.3396 0.3115 0.3582 0.0182  0.0178  0.0457  19  TRP B CZ3 
1311 C CH2 . TRP B 24  ? 0.3178 0.2988 0.3347 0.0188  0.0166  0.0501  19  TRP B CH2 
1312 N N   . ILE B 25  ? 0.2916 0.2250 0.2972 0.0131  0.0175  0.0220  20  ILE B N   
1313 C CA  . ILE B 25  ? 0.3477 0.2742 0.3613 0.0114  0.0152  0.0261  20  ILE B CA  
1314 C C   . ILE B 25  ? 0.3772 0.2927 0.3859 0.0048  0.0111  0.0229  20  ILE B C   
1315 O O   . ILE B 25  ? 0.3778 0.2933 0.3914 -0.0008 0.0065  0.0291  20  ILE B O   
1316 C CB  . ILE B 25  ? 0.3886 0.3066 0.4070 0.0169  0.0183  0.0254  20  ILE B CB  
1317 C CG1 . ILE B 25  ? 0.3698 0.3023 0.3958 0.0210  0.0208  0.0323  20  ILE B CG1 
1318 C CG2 . ILE B 25  ? 0.3540 0.2558 0.3764 0.0146  0.0151  0.0274  20  ILE B CG2 
1319 C CD1 . ILE B 25  ? 0.3206 0.2627 0.3554 0.0184  0.0178  0.0422  20  ILE B CD1 
1320 N N   . GLN B 26  ? 0.3838 0.2919 0.3825 0.0040  0.0121  0.0142  21  GLN B N   
1321 C CA  . GLN B 26  ? 0.3981 0.2951 0.3898 -0.0036 0.0077  0.0107  21  GLN B CA  
1322 C C   . GLN B 26  ? 0.5156 0.4264 0.5086 -0.0104 0.0030  0.0174  21  GLN B C   
1323 O O   . GLN B 26  ? 0.5310 0.4364 0.5211 -0.0192 -0.0024 0.0186  21  GLN B O   
1324 C CB  . GLN B 26  ? 0.5004 0.3890 0.4801 -0.0024 0.0104  0.0000  21  GLN B CB  
1325 C CG  . GLN B 26  ? 0.5212 0.3940 0.4981 0.0046  0.0147  -0.0065 21  GLN B CG  
1326 C CD  . GLN B 26  ? 0.6801 0.5551 0.6482 0.0096  0.0198  -0.0148 21  GLN B CD  
1327 O OE1 . GLN B 26  ? 0.6141 0.4998 0.5775 0.0060  0.0192  -0.0160 21  GLN B OE1 
1328 N NE2 . GLN B 26  ? 0.8059 0.6722 0.7719 0.0184  0.0250  -0.0195 21  GLN B NE2 
1329 N N   . THR B 27  ? 0.3950 0.3233 0.3915 -0.0063 0.0047  0.0224  22  THR B N   
1330 C CA  . THR B 27  ? 0.4401 0.3839 0.4382 -0.0095 0.0015  0.0299  22  THR B CA  
1331 C C   . THR B 27  ? 0.5233 0.4752 0.5313 -0.0138 -0.0024 0.0405  22  THR B C   
1332 O O   . THR B 27  ? 0.5070 0.4742 0.5176 -0.0177 -0.0058 0.0486  22  THR B O   
1333 C CB  . THR B 27  ? 0.3308 0.2879 0.3266 -0.0017 0.0049  0.0318  22  THR B CB  
1334 O OG1 . THR B 27  ? 0.3530 0.3146 0.3536 0.0041  0.0075  0.0353  22  THR B OG1 
1335 C CG2 . THR B 27  ? 0.3624 0.3126 0.3480 0.0006  0.0073  0.0234  22  THR B CG2 
1336 N N   . PHE B 28  ? 0.3958 0.3395 0.4100 -0.0131 -0.0022 0.0419  23  PHE B N   
1337 C CA  . PHE B 28  ? 0.4369 0.3891 0.4610 -0.0179 -0.0064 0.0533  23  PHE B CA  
1338 C C   . PHE B 28  ? 0.4766 0.4163 0.4994 -0.0302 -0.0139 0.0556  23  PHE B C   
1339 O O   . PHE B 28  ? 0.5922 0.5426 0.6224 -0.0375 -0.0193 0.0672  23  PHE B O   
1340 C CB  . PHE B 28  ? 0.3813 0.3309 0.4130 -0.0126 -0.0038 0.0556  23  PHE B CB  
1341 C CG  . PHE B 28  ? 0.3644 0.3315 0.3985 -0.0041 0.0009  0.0584  23  PHE B CG  
1342 C CD1 . PHE B 28  ? 0.3239 0.2872 0.3513 0.0028  0.0060  0.0505  23  PHE B CD1 
1343 C CD2 . PHE B 28  ? 0.3286 0.3160 0.3699 -0.0038 -0.0001 0.0693  23  PHE B CD2 
1344 C CE1 . PHE B 28  ? 0.3719 0.3473 0.3979 0.0089  0.0092  0.0526  23  PHE B CE1 
1345 C CE2 . PHE B 28  ? 0.3125 0.3132 0.3523 0.0041  0.0042  0.0706  23  PHE B CE2 
1346 C CZ  . PHE B 28  ? 0.2995 0.2921 0.3306 0.0100  0.0084  0.0619  23  PHE B CZ  
1347 N N   . ASN B 29  ? 0.5233 0.4402 0.5353 -0.0331 -0.0145 0.0449  24  ASN B N   
1348 C CA  . ASN B 29  ? 0.7141 0.6108 0.7195 -0.0454 -0.0221 0.0445  24  ASN B CA  
1349 C C   . ASN B 29  ? 0.7299 0.6180 0.7428 -0.0504 -0.0271 0.0533  24  ASN B C   
1350 O O   . ASN B 29  ? 0.7453 0.6391 0.7608 -0.0631 -0.0353 0.0638  24  ASN B O   
1351 C CB  . ASN B 29  ? 0.8066 0.7174 0.8089 -0.0569 -0.0283 0.0501  24  ASN B CB  
1352 C CG  . ASN B 29  ? 0.8259 0.7421 0.8197 -0.0532 -0.0244 0.0418  24  ASN B CG  
1353 O OD1 . ASN B 29  ? 0.6803 0.6213 0.6786 -0.0497 -0.0225 0.0475  24  ASN B OD1 
1354 N ND2 . ASN B 29  ? 0.8977 0.7906 0.8787 -0.0529 -0.0228 0.0286  24  ASN B ND2 
1355 N N   . VAL B 30  ? 0.6474 0.5238 0.6641 -0.0410 -0.0225 0.0505  25  VAL B N   
1356 C CA  . VAL B 30  ? 0.6830 0.5477 0.7064 -0.0448 -0.0272 0.0587  25  VAL B CA  
1357 C C   . VAL B 30  ? 0.7602 0.5858 0.7695 -0.0515 -0.0326 0.0516  25  VAL B C   
1358 O O   . VAL B 30  ? 0.7359 0.5441 0.7309 -0.0494 -0.0302 0.0385  25  VAL B O   
1359 C CB  . VAL B 30  ? 0.6696 0.5382 0.7031 -0.0318 -0.0203 0.0601  25  VAL B CB  
1360 C CG1 . VAL B 30  ? 0.5150 0.4190 0.5593 -0.0268 -0.0163 0.0674  25  VAL B CG1 
1361 C CG2 . VAL B 30  ? 0.5355 0.3869 0.5609 -0.0200 -0.0128 0.0465  25  VAL B CG2 
1362 N N   . ASP B 31  ? 0.8172 0.6278 0.8292 -0.0595 -0.0401 0.0603  26  ASP B N   
1363 C CA  . ASP B 31  ? 0.9789 0.7475 0.9742 -0.0682 -0.0473 0.0546  26  ASP B CA  
1364 C C   . ASP B 31  ? 0.9222 0.6585 0.9061 -0.0533 -0.0400 0.0396  26  ASP B C   
1365 O O   . ASP B 31  ? 0.9679 0.6742 0.9317 -0.0557 -0.0415 0.0273  26  ASP B O   
1366 C CB  . ASP B 31  ? 1.1249 0.8836 1.1259 -0.0802 -0.0577 0.0690  26  ASP B CB  
1367 C CG  . ASP B 31  ? 1.3076 1.0934 1.3146 -0.0986 -0.0673 0.0838  26  ASP B CG  
1368 O OD1 . ASP B 31  ? 1.3756 1.1462 1.3684 -0.1146 -0.0765 0.0828  26  ASP B OD1 
1369 O OD2 . ASP B 31  ? 1.3719 1.1958 1.3973 -0.0971 -0.0658 0.0970  26  ASP B OD2 
1370 N N   . ALA B 32  ? 0.7993 0.5433 0.7953 -0.0379 -0.0319 0.0412  27  ALA B N   
1371 C CA  . ALA B 32  ? 0.7173 0.4371 0.7051 -0.0216 -0.0238 0.0294  27  ALA B CA  
1372 C C   . ALA B 32  ? 0.7736 0.5020 0.7522 -0.0142 -0.0159 0.0159  27  ALA B C   
1373 O O   . ALA B 32  ? 0.7645 0.5246 0.7499 -0.0165 -0.0139 0.0179  27  ALA B O   
1374 C CB  . ALA B 32  ? 0.6830 0.4162 0.6883 -0.0082 -0.0175 0.0373  27  ALA B CB  
1375 N N   . PRO B 33  ? 0.8680 0.5675 0.8298 -0.0047 -0.0114 0.0024  28  PRO B N   
1376 C CA  . PRO B 33  ? 0.7406 0.4497 0.6939 0.0031  -0.0035 -0.0097 28  PRO B CA  
1377 C C   . PRO B 33  ? 0.6035 0.3466 0.5730 0.0158  0.0060  -0.0061 28  PRO B C   
1378 O O   . PRO B 33  ? 0.6064 0.3530 0.5877 0.0258  0.0098  0.0004  28  PRO B O   
1379 C CB  . PRO B 33  ? 0.8571 0.5269 0.7898 0.0130  -0.0002 -0.0230 28  PRO B CB  
1380 C CG  . PRO B 33  ? 0.9076 0.5516 0.8434 0.0169  -0.0032 -0.0166 28  PRO B CG  
1381 C CD  . PRO B 33  ? 0.9429 0.5976 0.8909 -0.0009 -0.0139 -0.0023 28  PRO B CD  
1382 N N   . CYS B 34  ? 0.5395 0.3068 0.5088 0.0145  0.0090  -0.0094 29  CYS B N   
1383 C CA  . CYS B 34  ? 0.6323 0.4303 0.6142 0.0233  0.0162  -0.0054 29  CYS B CA  
1384 C C   . CYS B 34  ? 0.7235 0.5322 0.6965 0.0271  0.0216  -0.0145 29  CYS B C   
1385 O O   . CYS B 34  ? 0.7610 0.5944 0.7391 0.0241  0.0222  -0.0115 29  CYS B O   
1386 C CB  . CYS B 34  ? 0.5986 0.4228 0.5943 0.0154  0.0124  0.0059  29  CYS B CB  
1387 S SG  . CYS B 34  ? 0.9153 0.7459 0.9044 -0.0001 0.0050  0.0058  29  CYS B SG  
1388 N N   . GLN B 35  ? 0.6617 0.4512 0.6203 0.0341  0.0255  -0.0254 30  GLN B N   
1389 C CA  . GLN B 35  ? 0.6943 0.4948 0.6434 0.0364  0.0301  -0.0337 30  GLN B CA  
1390 C C   . GLN B 35  ? 0.6861 0.5060 0.6415 0.0506  0.0393  -0.0325 30  GLN B C   
1391 O O   . GLN B 35  ? 0.7526 0.5929 0.7064 0.0503  0.0422  -0.0340 30  GLN B O   
1392 C CB  . GLN B 35  ? 0.8019 0.5742 0.7291 0.0349  0.0290  -0.0466 30  GLN B CB  
1393 C CG  . GLN B 35  ? 0.9452 0.7088 0.8647 0.0170  0.0193  -0.0472 30  GLN B CG  
1394 C CD  . GLN B 35  ? 1.0730 0.8002 0.9696 0.0130  0.0157  -0.0584 30  GLN B CD  
1395 O OE1 . GLN B 35  ? 0.9784 0.7017 0.8587 0.0120  0.0173  -0.0687 30  GLN B OE1 
1396 N NE2 . GLN B 35  ? 1.1831 0.8822 1.0768 0.0097  0.0101  -0.0563 30  GLN B NE2 
1397 N N   . THR B 36  ? 0.6493 0.4644 0.6122 0.0623  0.0434  -0.0282 31  THR B N   
1398 C CA  . THR B 36  ? 0.5504 0.3869 0.5202 0.0761  0.0522  -0.0249 31  THR B CA  
1399 C C   . THR B 36  ? 0.5362 0.3889 0.5252 0.0795  0.0527  -0.0114 31  THR B C   
1400 O O   . THR B 36  ? 0.4769 0.3196 0.4728 0.0741  0.0474  -0.0057 31  THR B O   
1401 C CB  . THR B 36  ? 0.6660 0.4839 0.6242 0.0926  0.0596  -0.0332 31  THR B CB  
1402 O OG1 . THR B 36  ? 0.6024 0.3944 0.5629 0.0986  0.0584  -0.0306 31  THR B OG1 
1403 C CG2 . THR B 36  ? 0.6221 0.4197 0.5580 0.0892  0.0589  -0.0477 31  THR B CG2 
1404 N N   . VAL B 37  ? 0.4960 0.3758 0.4933 0.0877  0.0589  -0.0054 32  VAL B N   
1405 C CA  . VAL B 37  ? 0.4786 0.3755 0.4930 0.0921  0.0601  0.0079  32  VAL B CA  
1406 C C   . VAL B 37  ? 0.5579 0.4312 0.5757 0.1019  0.0611  0.0100  32  VAL B C   
1407 O O   . VAL B 37  ? 0.5054 0.3795 0.5352 0.0982  0.0571  0.0196  32  VAL B O   
1408 C CB  . VAL B 37  ? 0.4748 0.4037 0.4954 0.1007  0.0671  0.0143  32  VAL B CB  
1409 C CG1 . VAL B 37  ? 0.5553 0.4982 0.5923 0.1092  0.0698  0.0277  32  VAL B CG1 
1410 C CG2 . VAL B 37  ? 0.5285 0.4812 0.5487 0.0877  0.0636  0.0168  32  VAL B CG2 
1411 N N   . GLU B 38  ? 0.5514 0.4019 0.5571 0.1147  0.0661  0.0010  33  GLU B N   
1412 C CA  . GLU B 38  ? 0.5732 0.3955 0.5789 0.1256  0.0670  0.0022  33  GLU B CA  
1413 C C   . GLU B 38  ? 0.5511 0.3475 0.5560 0.1116  0.0568  0.0032  33  GLU B C   
1414 O O   . GLU B 38  ? 0.5748 0.3592 0.5882 0.1151  0.0548  0.0113  33  GLU B O   
1415 C CB  . GLU B 38  ? 0.6662 0.4619 0.6528 0.1413  0.0737  -0.0106 33  GLU B CB  
1416 C CG  . GLU B 38  ? 0.9096 0.6766 0.8954 0.1577  0.0766  -0.0084 33  GLU B CG  
1417 C CD  . GLU B 38  ? 1.0064 0.8039 1.0139 0.1708  0.0827  0.0076  33  GLU B CD  
1418 O OE1 . GLU B 38  ? 0.9547 0.7928 0.9712 0.1743  0.0885  0.0131  33  GLU B OE1 
1419 O OE2 . GLU B 38  ? 1.0049 0.7866 1.0204 0.1765  0.0811  0.0157  33  GLU B OE2 
1420 N N   . ASP B 39  ? 0.5130 0.3036 0.5088 0.0956  0.0501  -0.0034 34  ASP B N   
1421 C CA  . ASP B 39  ? 0.5506 0.3213 0.5458 0.0810  0.0399  -0.0010 34  ASP B CA  
1422 C C   . ASP B 39  ? 0.5400 0.3340 0.5554 0.0740  0.0360  0.0140  34  ASP B C   
1423 O O   . ASP B 39  ? 0.6137 0.3951 0.6326 0.0648  0.0285  0.0198  34  ASP B O   
1424 C CB  . ASP B 39  ? 0.5388 0.3052 0.5215 0.0656  0.0340  -0.0092 34  ASP B CB  
1425 C CG  . ASP B 39  ? 0.6271 0.3640 0.5868 0.0688  0.0354  -0.0242 34  ASP B CG  
1426 O OD1 . ASP B 39  ? 0.6479 0.3532 0.5978 0.0788  0.0370  -0.0285 34  ASP B OD1 
1427 O OD2 . ASP B 39  ? 0.6399 0.3838 0.5899 0.0613  0.0345  -0.0316 34  ASP B OD2 
1428 N N   . LEU B 40  ? 0.4568 0.2853 0.4843 0.0773  0.0406  0.0207  35  LEU B N   
1429 C CA  . LEU B 40  ? 0.4235 0.2754 0.4672 0.0703  0.0371  0.0338  35  LEU B CA  
1430 C C   . LEU B 40  ? 0.4457 0.3075 0.5042 0.0807  0.0406  0.0455  35  LEU B C   
1431 O O   . LEU B 40  ? 0.4250 0.3052 0.4963 0.0750  0.0376  0.0569  35  LEU B O   
1432 C CB  . LEU B 40  ? 0.4365 0.3184 0.4815 0.0639  0.0379  0.0343  35  LEU B CB  
1433 C CG  . LEU B 40  ? 0.5307 0.4135 0.5701 0.0499  0.0315  0.0313  35  LEU B CG  
1434 C CD1 . LEU B 40  ? 0.5876 0.4467 0.6119 0.0464  0.0295  0.0197  35  LEU B CD1 
1435 C CD2 . LEU B 40  ? 0.6152 0.5232 0.6541 0.0461  0.0327  0.0320  35  LEU B CD2 
1436 N N   . THR B 41  ? 0.4265 0.2773 0.4829 0.0965  0.0472  0.0434  36  THR B N   
1437 C CA  . THR B 41  ? 0.4051 0.2718 0.4767 0.1081  0.0518  0.0561  36  THR B CA  
1438 C C   . THR B 41  ? 0.4394 0.2906 0.5206 0.1076  0.0468  0.0663  36  THR B C   
1439 O O   . THR B 41  ? 0.4728 0.3438 0.5698 0.1125  0.0485  0.0799  36  THR B O   
1440 C CB  . THR B 41  ? 0.5271 0.3905 0.5942 0.1282  0.0616  0.0522  36  THR B CB  
1441 O OG1 . THR B 41  ? 0.4850 0.3052 0.5366 0.1356  0.0616  0.0415  36  THR B OG1 
1442 C CG2 . THR B 41  ? 0.4866 0.3730 0.5472 0.1282  0.0664  0.0456  36  THR B CG2 
1443 N N   . ASN B 42  ? 0.4918 0.3099 0.5641 0.1000  0.0399  0.0615  37  ASN B N   
1444 C CA  . ASN B 42  ? 0.5419 0.3459 0.6234 0.0982  0.0342  0.0730  37  ASN B CA  
1445 C C   . ASN B 42  ? 0.4725 0.2962 0.5645 0.0805  0.0262  0.0828  37  ASN B C   
1446 O O   . ASN B 42  ? 0.4386 0.2550 0.5394 0.0764  0.0205  0.0938  37  ASN B O   
1447 C CB  . ASN B 42  ? 0.6351 0.3891 0.7008 0.0998  0.0300  0.0654  37  ASN B CB  
1448 C CG  . ASN B 42  ? 0.6665 0.4035 0.7173 0.0823  0.0220  0.0557  37  ASN B CG  
1449 O OD1 . ASN B 42  ? 0.6077 0.3694 0.6637 0.0681  0.0179  0.0583  37  ASN B OD1 
1450 N ND2 . ASN B 42  ? 0.6951 0.3887 0.7259 0.0838  0.0195  0.0446  37  ASN B ND2 
1451 N N   . GLY B 43  ? 0.4489 0.2965 0.5392 0.0708  0.0257  0.0790  38  GLY B N   
1452 C CA  . GLY B 43  ? 0.4814 0.3524 0.5803 0.0572  0.0201  0.0877  38  GLY B CA  
1453 C C   . GLY B 43  ? 0.5435 0.4012 0.6363 0.0428  0.0115  0.0863  38  GLY B C   
1454 O O   . GLY B 43  ? 0.4132 0.2929 0.5103 0.0327  0.0080  0.0915  38  GLY B O   
1455 N N   . VAL B 44  ? 0.4704 0.2926 0.5519 0.0418  0.0079  0.0798  39  VAL B N   
1456 C CA  . VAL B 44  ? 0.5336 0.3435 0.6094 0.0262  -0.0016 0.0808  39  VAL B CA  
1457 C C   . VAL B 44  ? 0.5135 0.3421 0.5832 0.0173  -0.0023 0.0746  39  VAL B C   
1458 O O   . VAL B 44  ? 0.4618 0.3082 0.5370 0.0061  -0.0077 0.0826  39  VAL B O   
1459 C CB  . VAL B 44  ? 0.5426 0.3066 0.6027 0.0256  -0.0059 0.0732  39  VAL B CB  
1460 C CG1 . VAL B 44  ? 0.5886 0.3429 0.6411 0.0068  -0.0166 0.0744  39  VAL B CG1 
1461 C CG2 . VAL B 44  ? 0.5218 0.2639 0.5876 0.0338  -0.0068 0.0815  39  VAL B CG2 
1462 N N   . VAL B 45  ? 0.4480 0.2746 0.5068 0.0229  0.0034  0.0615  40  VAL B N   
1463 C CA  . VAL B 45  ? 0.3982 0.2423 0.4514 0.0157  0.0030  0.0565  40  VAL B CA  
1464 C C   . VAL B 45  ? 0.4143 0.2936 0.4786 0.0146  0.0045  0.0649  40  VAL B C   
1465 O O   . VAL B 45  ? 0.3817 0.2758 0.4464 0.0062  0.0007  0.0684  40  VAL B O   
1466 C CB  . VAL B 45  ? 0.4411 0.2808 0.4821 0.0226  0.0093  0.0426  40  VAL B CB  
1467 C CG1 . VAL B 45  ? 0.4183 0.2790 0.4558 0.0165  0.0091  0.0398  40  VAL B CG1 
1468 C CG2 . VAL B 45  ? 0.4705 0.2753 0.4959 0.0223  0.0074  0.0322  40  VAL B CG2 
1469 N N   . MET B 46  ? 0.4050 0.2983 0.4773 0.0233  0.0100  0.0686  41  MET B N   
1470 C CA  . MET B 46  ? 0.3904 0.3136 0.4690 0.0217  0.0111  0.0751  41  MET B CA  
1471 C C   . MET B 46  ? 0.3454 0.2796 0.4333 0.0141  0.0054  0.0874  41  MET B C   
1472 O O   . MET B 46  ? 0.3505 0.3048 0.4381 0.0100  0.0044  0.0904  41  MET B O   
1473 C CB  . MET B 46  ? 0.3140 0.2504 0.3985 0.0302  0.0168  0.0781  41  MET B CB  
1474 C CG  . MET B 46  ? 0.3095 0.2467 0.3846 0.0355  0.0222  0.0679  41  MET B CG  
1475 S SD  . MET B 46  ? 0.4845 0.4433 0.5666 0.0427  0.0277  0.0741  41  MET B SD  
1476 C CE  . MET B 46  ? 0.3762 0.3192 0.4665 0.0545  0.0310  0.0774  41  MET B CE  
1477 N N   . ALA B 47  ? 0.3247 0.2455 0.4200 0.0129  0.0017  0.0948  42  ALA B N   
1478 C CA  . ALA B 47  ? 0.3185 0.2506 0.4234 0.0045  -0.0046 0.1083  42  ALA B CA  
1479 C C   . ALA B 47  ? 0.4485 0.3826 0.5475 -0.0061 -0.0102 0.1078  42  ALA B C   
1480 O O   . ALA B 47  ? 0.3554 0.3144 0.4593 -0.0111 -0.0123 0.1163  42  ALA B O   
1481 C CB  . ALA B 47  ? 0.3478 0.2601 0.4601 0.0046  -0.0086 0.1165  42  ALA B CB  
1482 N N   . GLN B 48  ? 0.3698 0.2800 0.4575 -0.0089 -0.0121 0.0981  43  GLN B N   
1483 C CA  . GLN B 48  ? 0.3619 0.2758 0.4440 -0.0198 -0.0178 0.0987  43  GLN B CA  
1484 C C   . GLN B 48  ? 0.3876 0.3271 0.4665 -0.0172 -0.0135 0.0951  43  GLN B C   
1485 O O   . GLN B 48  ? 0.3845 0.3422 0.4645 -0.0238 -0.0170 0.1016  43  GLN B O   
1486 C CB  . GLN B 48  ? 0.3998 0.2807 0.4684 -0.0242 -0.0212 0.0887  43  GLN B CB  
1487 C CG  . GLN B 48  ? 0.3914 0.2426 0.4598 -0.0293 -0.0280 0.0936  43  GLN B CG  
1488 C CD  . GLN B 48  ? 0.5807 0.3940 0.6313 -0.0326 -0.0310 0.0816  43  GLN B CD  
1489 O OE1 . GLN B 48  ? 0.5771 0.3896 0.6169 -0.0315 -0.0279 0.0701  43  GLN B OE1 
1490 N NE2 . GLN B 48  ? 0.5417 0.3216 0.5876 -0.0365 -0.0372 0.0840  43  GLN B NE2 
1491 N N   . VAL B 49  ? 0.3357 0.2768 0.4099 -0.0074 -0.0061 0.0858  44  VAL B N   
1492 C CA  . VAL B 49  ? 0.2968 0.2568 0.3655 -0.0043 -0.0024 0.0820  44  VAL B CA  
1493 C C   . VAL B 49  ? 0.3101 0.2968 0.3860 -0.0028 -0.0015 0.0921  44  VAL B C   
1494 O O   . VAL B 49  ? 0.3059 0.3103 0.3788 -0.0030 -0.0014 0.0944  44  VAL B O   
1495 C CB  . VAL B 49  ? 0.3066 0.2601 0.3673 0.0038  0.0040  0.0706  44  VAL B CB  
1496 C CG1 . VAL B 49  ? 0.3132 0.2836 0.3673 0.0069  0.0071  0.0682  44  VAL B CG1 
1497 C CG2 . VAL B 49  ? 0.3761 0.3072 0.4273 0.0028  0.0038  0.0598  44  VAL B CG2 
1498 N N   . LEU B 50  ? 0.2948 0.2851 0.3796 -0.0006 -0.0007 0.0986  45  LEU B N   
1499 C CA  . LEU B 50  ? 0.2596 0.2757 0.3500 0.0002  -0.0001 0.1084  45  LEU B CA  
1500 C C   . LEU B 50  ? 0.2630 0.2947 0.3598 -0.0070 -0.0055 0.1199  45  LEU B C   
1501 O O   . LEU B 50  ? 0.2864 0.3422 0.3823 -0.0052 -0.0041 0.1250  45  LEU B O   
1502 C CB  . LEU B 50  ? 0.2841 0.3027 0.3841 0.0026  0.0009  0.1150  45  LEU B CB  
1503 C CG  . LEU B 50  ? 0.2949 0.3106 0.3885 0.0094  0.0065  0.1068  45  LEU B CG  
1504 C CD1 . LEU B 50  ? 0.2779 0.2935 0.3823 0.0121  0.0074  0.1136  45  LEU B CD1 
1505 C CD2 . LEU B 50  ? 0.3222 0.3556 0.4063 0.0114  0.0092  0.1049  45  LEU B CD2 
1506 N N   . GLN B 51  ? 0.3088 0.3264 0.4105 -0.0152 -0.0118 0.1244  46  GLN B N   
1507 C CA  . GLN B 51  ? 0.2845 0.3180 0.3921 -0.0247 -0.0182 0.1368  46  GLN B CA  
1508 C C   . GLN B 51  ? 0.2710 0.3182 0.3709 -0.0246 -0.0173 0.1338  46  GLN B C   
1509 O O   . GLN B 51  ? 0.3497 0.4253 0.4538 -0.0264 -0.0186 0.1445  46  GLN B O   
1510 C CB  . GLN B 51  ? 0.3534 0.3631 0.4641 -0.0357 -0.0266 0.1413  46  GLN B CB  
1511 C CG  . GLN B 51  ? 0.3955 0.4220 0.5117 -0.0488 -0.0351 0.1559  46  GLN B CG  
1512 C CD  . GLN B 51  ? 0.4135 0.4113 0.5297 -0.0616 -0.0450 0.1604  46  GLN B CD  
1513 O OE1 . GLN B 51  ? 0.4879 0.4524 0.5930 -0.0627 -0.0461 0.1485  46  GLN B OE1 
1514 N NE2 . GLN B 51  ? 0.5105 0.5196 0.6374 -0.0718 -0.0526 0.1776  46  GLN B NE2 
1515 N N   . LYS B 52  ? 0.2966 0.3262 0.3855 -0.0219 -0.0149 0.1204  47  LYS B N   
1516 C CA  . LYS B 52  ? 0.3599 0.4034 0.4419 -0.0206 -0.0137 0.1184  47  LYS B CA  
1517 C C   . LYS B 52  ? 0.3461 0.4122 0.4249 -0.0093 -0.0070 0.1186  47  LYS B C   
1518 O O   . LYS B 52  ? 0.3257 0.4160 0.4043 -0.0070 -0.0065 0.1254  47  LYS B O   
1519 C CB  . LYS B 52  ? 0.3516 0.3722 0.4221 -0.0196 -0.0123 0.1041  47  LYS B CB  
1520 C CG  . LYS B 52  ? 0.4768 0.4713 0.5455 -0.0299 -0.0185 0.1015  47  LYS B CG  
1521 C CD  . LYS B 52  ? 0.5550 0.5598 0.6258 -0.0427 -0.0266 0.1118  47  LYS B CD  
1522 C CE  . LYS B 52  ? 0.6713 0.6453 0.7334 -0.0534 -0.0329 0.1055  47  LYS B CE  
1523 N NZ  . LYS B 52  ? 0.6226 0.6059 0.6865 -0.0695 -0.0430 0.1179  47  LYS B NZ  
1524 N N   . ILE B 53  ? 0.3036 0.3617 0.3786 -0.0020 -0.0021 0.1115  48  ILE B N   
1525 C CA  . ILE B 53  ? 0.2684 0.3408 0.3354 0.0079  0.0037  0.1095  48  ILE B CA  
1526 C C   . ILE B 53  ? 0.3583 0.4594 0.4321 0.0089  0.0035  0.1226  48  ILE B C   
1527 O O   . ILE B 53  ? 0.3143 0.4339 0.3814 0.0163  0.0068  0.1244  48  ILE B O   
1528 C CB  . ILE B 53  ? 0.2822 0.3402 0.3434 0.0122  0.0074  0.1009  48  ILE B CB  
1529 C CG1 . ILE B 53  ? 0.2722 0.3083 0.3238 0.0134  0.0088  0.0880  48  ILE B CG1 
1530 C CG2 . ILE B 53  ? 0.3199 0.3913 0.3715 0.0198  0.0116  0.1006  48  ILE B CG2 
1531 C CD1 . ILE B 53  ? 0.2921 0.3160 0.3403 0.0155  0.0114  0.0816  48  ILE B CD1 
1532 N N   . ASP B 54  ? 0.3353 0.4405 0.4216 0.0026  0.0000  0.1320  49  ASP B N   
1533 C CA  . ASP B 54  ? 0.2935 0.4290 0.3884 0.0013  -0.0013 0.1467  49  ASP B CA  
1534 C C   . ASP B 54  ? 0.2906 0.4267 0.4012 -0.0111 -0.0092 0.1596  49  ASP B C   
1535 O O   . ASP B 54  ? 0.2609 0.3899 0.3791 -0.0141 -0.0109 0.1634  49  ASP B O   
1536 C CB  . ASP B 54  ? 0.2481 0.3939 0.3392 0.0078  0.0031  0.1469  49  ASP B CB  
1537 C CG  . ASP B 54  ? 0.3583 0.5396 0.4530 0.0100  0.0039  0.1599  49  ASP B CG  
1538 O OD1 . ASP B 54  ? 0.3521 0.5507 0.4592 0.0026  -0.0011 0.1733  49  ASP B OD1 
1539 O OD2 . ASP B 54  ? 0.3225 0.5146 0.4064 0.0185  0.0091  0.1571  49  ASP B OD2 
1540 N N   . PRO B 55  ? 0.2677 0.4126 0.3828 -0.0190 -0.0146 0.1676  50  PRO B N   
1541 C CA  . PRO B 55  ? 0.2563 0.3972 0.3835 -0.0333 -0.0239 0.1801  50  PRO B CA  
1542 C C   . PRO B 55  ? 0.2994 0.4708 0.4388 -0.0370 -0.0264 0.1979  50  PRO B C   
1543 O O   . PRO B 55  ? 0.3093 0.4757 0.4591 -0.0489 -0.0345 0.2094  50  PRO B O   
1544 C CB  . PRO B 55  ? 0.2893 0.4335 0.4146 -0.0416 -0.0290 0.1832  50  PRO B CB  
1545 C CG  . PRO B 55  ? 0.3696 0.5395 0.4882 -0.0301 -0.0220 0.1811  50  PRO B CG  
1546 C CD  . PRO B 55  ? 0.2444 0.4022 0.3527 -0.0158 -0.0130 0.1662  50  PRO B CD  
1547 N N   . ALA B 56  ? 0.2791 0.4800 0.4159 -0.0267 -0.0197 0.2001  51  ALA B N   
1548 C CA  . ALA B 56  ? 0.2699 0.5035 0.4171 -0.0290 -0.0211 0.2166  51  ALA B CA  
1549 C C   . ALA B 56  ? 0.3271 0.5504 0.4777 -0.0275 -0.0198 0.2154  51  ALA B C   
1550 O O   . ALA B 56  ? 0.3037 0.5424 0.4665 -0.0345 -0.0243 0.2303  51  ALA B O   
1551 C CB  . ALA B 56  ? 0.2865 0.5572 0.4271 -0.0173 -0.0140 0.2194  51  ALA B CB  
1552 N N   . TYR B 57  ? 0.3013 0.5011 0.4411 -0.0189 -0.0139 0.1990  52  TYR B N   
1553 C CA  . TYR B 57  ? 0.2834 0.4732 0.4263 -0.0175 -0.0126 0.1977  52  TYR B CA  
1554 C C   . TYR B 57  ? 0.2438 0.3999 0.3937 -0.0235 -0.0174 0.1957  52  TYR B C   
1555 O O   . TYR B 57  ? 0.2804 0.4345 0.4422 -0.0286 -0.0215 0.2062  52  TYR B O   
1556 C CB  . TYR B 57  ? 0.2634 0.4466 0.3904 -0.0064 -0.0046 0.1825  52  TYR B CB  
1557 C CG  . TYR B 57  ? 0.2309 0.4125 0.3605 -0.0056 -0.0032 0.1836  52  TYR B CG  
1558 C CD1 . TYR B 57  ? 0.2698 0.4250 0.4019 -0.0058 -0.0034 0.1773  52  TYR B CD1 
1559 C CD2 . TYR B 57  ? 0.2818 0.4905 0.4104 -0.0041 -0.0013 0.1912  52  TYR B CD2 
1560 C CE1 . TYR B 57  ? 0.2407 0.3987 0.3766 -0.0051 -0.0023 0.1806  52  TYR B CE1 
1561 C CE2 . TYR B 57  ? 0.2442 0.4539 0.3750 -0.0047 -0.0007 0.1934  52  TYR B CE2 
1562 C CZ  . TYR B 57  ? 0.2932 0.4785 0.4286 -0.0054 -0.0013 0.1888  52  TYR B CZ  
1563 O OH  . TYR B 57  ? 0.3565 0.5465 0.4955 -0.0060 -0.0007 0.1930  52  TYR B OH  
1564 N N   . PHE B 58  ? 0.2907 0.4200 0.4320 -0.0218 -0.0164 0.1822  53  PHE B N   
1565 C CA  . PHE B 58  ? 0.3114 0.4059 0.4552 -0.0251 -0.0199 0.1777  53  PHE B CA  
1566 C C   . PHE B 58  ? 0.2989 0.3853 0.4467 -0.0370 -0.0286 0.1854  53  PHE B C   
1567 O O   . PHE B 58  ? 0.3523 0.4184 0.4918 -0.0394 -0.0301 0.1764  53  PHE B O   
1568 C CB  . PHE B 58  ? 0.3201 0.3913 0.4511 -0.0174 -0.0143 0.1592  53  PHE B CB  
1569 C CG  . PHE B 58  ? 0.2500 0.3285 0.3756 -0.0083 -0.0072 0.1527  53  PHE B CG  
1570 C CD1 . PHE B 58  ? 0.3300 0.4026 0.4621 -0.0058 -0.0060 0.1552  53  PHE B CD1 
1571 C CD2 . PHE B 58  ? 0.2499 0.3408 0.3630 -0.0027 -0.0023 0.1453  53  PHE B CD2 
1572 C CE1 . PHE B 58  ? 0.2761 0.3574 0.4027 0.0000  -0.0007 0.1509  53  PHE B CE1 
1573 C CE2 . PHE B 58  ? 0.2891 0.3836 0.3944 0.0033  0.0027  0.1396  53  PHE B CE2 
1574 C CZ  . PHE B 58  ? 0.2359 0.3267 0.3480 0.0036  0.0031  0.1427  53  PHE B CZ  
1575 N N   . ASP B 59  ? 0.3499 0.4533 0.5096 -0.0459 -0.0351 0.2031  54  ASP B N   
1576 C CA  . ASP B 59  ? 0.4010 0.5022 0.5640 -0.0601 -0.0449 0.2135  54  ASP B CA  
1577 C C   . ASP B 59  ? 0.4807 0.5425 0.6454 -0.0677 -0.0525 0.2150  54  ASP B C   
1578 O O   . ASP B 59  ? 0.4114 0.4490 0.5751 -0.0593 -0.0486 0.2069  54  ASP B O   
1579 C CB  . ASP B 59  ? 0.3888 0.5322 0.5630 -0.0672 -0.0489 0.2338  54  ASP B CB  
1580 C CG  . ASP B 59  ? 0.4890 0.6445 0.6751 -0.0669 -0.0494 0.2456  54  ASP B CG  
1581 O OD1 . ASP B 59  ? 0.4242 0.5538 0.6117 -0.0627 -0.0482 0.2407  54  ASP B OD1 
1582 O OD2 . ASP B 59  ? 0.5056 0.6996 0.7000 -0.0706 -0.0510 0.2612  54  ASP B OD2 
1583 N N   . GLU B 60  ? 0.4590 0.5140 0.6252 -0.0834 -0.0635 0.2258  55  GLU B N   
1584 C CA  . GLU B 60  ? 0.5424 0.5537 0.7059 -0.0915 -0.0719 0.2267  55  GLU B CA  
1585 C C   . GLU B 60  ? 0.5280 0.5322 0.7023 -0.0873 -0.0721 0.2351  55  GLU B C   
1586 O O   . GLU B 60  ? 0.5372 0.5026 0.7070 -0.0813 -0.0714 0.2273  55  GLU B O   
1587 C CB  . GLU B 60  ? 0.6006 0.6104 0.7637 -0.1123 -0.0857 0.2406  55  GLU B CB  
1588 C CG  . GLU B 60  ? 0.7502 0.7102 0.9072 -0.1227 -0.0963 0.2425  55  GLU B CG  
1589 C CD  . GLU B 60  ? 0.8530 0.8147 1.0082 -0.1454 -0.1114 0.2567  55  GLU B CD  
1590 O OE1 . GLU B 60  ? 0.7271 0.7047 0.8771 -0.1540 -0.1138 0.2572  55  GLU B OE1 
1591 O OE2 . GLU B 60  ? 0.9389 0.8904 1.0969 -0.1525 -0.1203 0.2643  55  GLU B OE2 
1592 N N   . ASN B 61  ? 0.4191 0.4624 0.6074 -0.0895 -0.0726 0.2514  56  ASN B N   
1593 C CA  . ASN B 61  ? 0.4915 0.5358 0.6916 -0.0855 -0.0723 0.2612  56  ASN B CA  
1594 C C   . ASN B 61  ? 0.4990 0.5348 0.6966 -0.0675 -0.0608 0.2468  56  ASN B C   
1595 O O   . ASN B 61  ? 0.5524 0.5649 0.7541 -0.0620 -0.0607 0.2481  56  ASN B O   
1596 C CB  . ASN B 61  ? 0.4161 0.5107 0.6300 -0.0905 -0.0736 0.2802  56  ASN B CB  
1597 C CG  . ASN B 61  ? 0.6106 0.7157 0.8302 -0.1067 -0.0867 0.2927  56  ASN B CG  
1598 O OD1 . ASN B 61  ? 0.6468 0.7167 0.8637 -0.1146 -0.0958 0.2931  56  ASN B OD1 
1599 N ND2 . ASN B 61  ? 0.6549 0.8085 0.8809 -0.1110 -0.0876 0.3026  56  ASN B ND2 
1600 N N   . TRP B 62  ? 0.4191 0.4746 0.6100 -0.0584 -0.0515 0.2345  57  TRP B N   
1601 C CA  . TRP B 62  ? 0.3838 0.4340 0.5713 -0.0437 -0.0415 0.2220  57  TRP B CA  
1602 C C   . TRP B 62  ? 0.4746 0.4803 0.6537 -0.0377 -0.0403 0.2086  57  TRP B C   
1603 O O   . TRP B 62  ? 0.5166 0.5095 0.6992 -0.0283 -0.0364 0.2070  57  TRP B O   
1604 C CB  . TRP B 62  ? 0.3404 0.4142 0.5188 -0.0366 -0.0332 0.2106  57  TRP B CB  
1605 C CG  . TRP B 62  ? 0.4354 0.5075 0.6108 -0.0246 -0.0247 0.2012  57  TRP B CG  
1606 C CD1 . TRP B 62  ? 0.5541 0.6519 0.7346 -0.0209 -0.0210 0.2073  57  TRP B CD1 
1607 C CD2 . TRP B 62  ? 0.4509 0.4965 0.6176 -0.0161 -0.0196 0.1857  57  TRP B CD2 
1608 N NE1 . TRP B 62  ? 0.4562 0.5453 0.6319 -0.0119 -0.0146 0.1972  57  TRP B NE1 
1609 C CE2 . TRP B 62  ? 0.4795 0.5379 0.6474 -0.0082 -0.0133 0.1843  57  TRP B CE2 
1610 C CE3 . TRP B 62  ? 0.5045 0.5184 0.6617 -0.0150 -0.0199 0.1733  57  TRP B CE3 
1611 C CZ2 . TRP B 62  ? 0.4503 0.4936 0.6117 0.0005  -0.0075 0.1724  57  TRP B CZ2 
1612 C CZ3 . TRP B 62  ? 0.6953 0.6936 0.8455 -0.0049 -0.0133 0.1604  57  TRP B CZ3 
1613 C CH2 . TRP B 62  ? 0.5996 0.6139 0.7529 0.0027  -0.0073 0.1606  57  TRP B CH2 
1614 N N   . LEU B 63  ? 0.4239 0.4083 0.5916 -0.0430 -0.0436 0.1997  58  LEU B N   
1615 C CA  . LEU B 63  ? 0.5169 0.4590 0.6729 -0.0374 -0.0422 0.1850  58  LEU B CA  
1616 C C   . LEU B 63  ? 0.6360 0.5426 0.7945 -0.0377 -0.0478 0.1912  58  LEU B C   
1617 O O   . LEU B 63  ? 0.7382 0.6098 0.8872 -0.0288 -0.0448 0.1796  58  LEU B O   
1618 C CB  . LEU B 63  ? 0.4868 0.4163 0.6293 -0.0458 -0.0460 0.1761  58  LEU B CB  
1619 C CG  . LEU B 63  ? 0.6181 0.5584 0.7504 -0.0396 -0.0384 0.1609  58  LEU B CG  
1620 C CD1 . LEU B 63  ? 0.7338 0.6495 0.8578 -0.0264 -0.0308 0.1453  58  LEU B CD1 
1621 C CD2 . LEU B 63  ? 0.7070 0.6899 0.8455 -0.0356 -0.0329 0.1649  58  LEU B CD2 
1622 N N   . ASN B 64  ? 0.7943 0.7095 0.9646 -0.0472 -0.0558 0.2098  59  ASN B N   
1623 C CA  . ASN B 64  ? 0.8174 0.6969 0.9898 -0.0480 -0.0623 0.2177  59  ASN B CA  
1624 C C   . ASN B 64  ? 0.8385 0.7133 1.0183 -0.0306 -0.0542 0.2175  59  ASN B C   
1625 O O   . ASN B 64  ? 0.9246 0.7653 1.1043 -0.0261 -0.0573 0.2215  59  ASN B O   
1626 C CB  . ASN B 64  ? 0.9729 0.8661 1.1569 -0.0643 -0.0739 0.2400  59  ASN B CB  
1627 C CG  . ASN B 64  ? 1.1208 1.0075 1.2961 -0.0833 -0.0848 0.2428  59  ASN B CG  
1628 O OD1 . ASN B 64  ? 1.2233 1.0847 1.3824 -0.0848 -0.0851 0.2283  59  ASN B OD1 
1629 N ND2 . ASN B 64  ? 1.0603 0.9759 1.2444 -0.0967 -0.0930 0.2574  59  ASN B ND2 
1630 N N   . ARG B 65  ? 0.6209 0.5295 0.8064 -0.0210 -0.0443 0.2137  60  ARG B N   
1631 C CA  . ARG B 65  ? 0.5409 0.4507 0.7338 -0.0053 -0.0365 0.2145  60  ARG B CA  
1632 C C   . ARG B 65  ? 0.5475 0.4284 0.7269 0.0084  -0.0290 0.1960  60  ARG B C   
1633 O O   . ARG B 65  ? 0.5494 0.4210 0.7325 0.0229  -0.0232 0.1961  60  ARG B O   
1634 C CB  . ARG B 65  ? 0.4789 0.4369 0.6818 -0.0030 -0.0304 0.2195  60  ARG B CB  
1635 C CG  . ARG B 65  ? 0.5142 0.4885 0.7061 -0.0003 -0.0232 0.2038  60  ARG B CG  
1636 C CD  . ARG B 65  ? 0.4610 0.4795 0.6589 -0.0017 -0.0197 0.2096  60  ARG B CD  
1637 N NE  . ARG B 65  ? 0.5230 0.5651 0.7278 -0.0136 -0.0262 0.2233  60  ARG B NE  
1638 C CZ  . ARG B 65  ? 0.5290 0.6087 0.7385 -0.0160 -0.0246 0.2311  60  ARG B CZ  
1639 N NH1 . ARG B 65  ? 0.4743 0.5701 0.6812 -0.0091 -0.0178 0.2265  60  ARG B NH1 
1640 N NH2 . ARG B 65  ? 0.3663 0.4681 0.5819 -0.0260 -0.0303 0.2441  60  ARG B NH2 
1641 N N   . ILE B 66  ? 0.5195 0.3882 0.6836 0.0040  -0.0292 0.1812  61  ILE B N   
1642 C CA  . ILE B 66  ? 0.6207 0.4668 0.7708 0.0160  -0.0218 0.1630  61  ILE B CA  
1643 C C   . ILE B 66  ? 0.7159 0.5102 0.8524 0.0174  -0.0264 0.1569  61  ILE B C   
1644 O O   . ILE B 66  ? 0.7639 0.5389 0.8896 0.0038  -0.0349 0.1544  61  ILE B O   
1645 C CB  . ILE B 66  ? 0.6292 0.4897 0.7685 0.0113  -0.0191 0.1496  61  ILE B CB  
1646 C CG1 . ILE B 66  ? 0.5584 0.4644 0.7066 0.0108  -0.0145 0.1539  61  ILE B CG1 
1647 C CG2 . ILE B 66  ? 0.6213 0.4601 0.7464 0.0229  -0.0119 0.1320  61  ILE B CG2 
1648 C CD1 . ILE B 66  ? 0.4975 0.4184 0.6529 0.0240  -0.0063 0.1551  61  ILE B CD1 
1649 N N   . LYS B 67  ? 0.6933 0.4652 0.8288 0.0341  -0.0209 0.1548  62  LYS B N   
1650 C CA  . LYS B 67  ? 0.8027 0.5201 0.9220 0.0388  -0.0243 0.1478  62  LYS B CA  
1651 C C   . LYS B 67  ? 0.7731 0.4702 0.8706 0.0398  -0.0213 0.1271  62  LYS B C   
1652 O O   . LYS B 67  ? 0.7063 0.4219 0.8022 0.0503  -0.0113 0.1169  62  LYS B O   
1653 C CB  . LYS B 67  ? 0.8444 0.5460 0.9687 0.0599  -0.0176 0.1519  62  LYS B CB  
1654 C CG  . LYS B 67  ? 1.0381 0.7343 1.1768 0.0573  -0.0247 0.1721  62  LYS B CG  
1655 C CD  . LYS B 67  ? 1.0587 0.8085 1.2201 0.0469  -0.0265 0.1886  62  LYS B CD  
1656 C CE  . LYS B 67  ? 1.0940 0.8399 1.2654 0.0376  -0.0363 0.2071  62  LYS B CE  
1657 N NZ  . LYS B 67  ? 0.9942 0.7928 1.1849 0.0256  -0.0386 0.2221  62  LYS B NZ  
1658 N N   . THR B 68  ? 0.7783 0.4383 0.8586 0.0271  -0.0308 0.1219  63  THR B N   
1659 C CA  . THR B 68  ? 0.8610 0.5043 0.9201 0.0236  -0.0301 0.1037  63  THR B CA  
1660 C C   . THR B 68  ? 1.0279 0.6265 1.0667 0.0409  -0.0241 0.0884  63  THR B C   
1661 O O   . THR B 68  ? 1.0608 0.6628 1.0890 0.0494  -0.0160 0.0734  63  THR B O   
1662 C CB  . THR B 68  ? 0.8363 0.4638 0.8849 -0.0004 -0.0440 0.1059  63  THR B CB  
1663 O OG1 . THR B 68  ? 1.0091 0.5988 1.0539 -0.0067 -0.0543 0.1158  63  THR B OG1 
1664 C CG2 . THR B 68  ? 0.8035 0.4815 0.8692 -0.0151 -0.0473 0.1176  63  THR B CG2 
1665 N N   . GLU B 69  ? 1.0678 0.6242 1.1003 0.0466  -0.0283 0.0926  64  GLU B N   
1666 C CA  . GLU B 69  ? 1.1864 0.6963 1.1976 0.0660  -0.0222 0.0787  64  GLU B CA  
1667 C C   . GLU B 69  ? 1.1525 0.6803 1.1790 0.0922  -0.0092 0.0838  64  GLU B C   
1668 O O   . GLU B 69  ? 1.1499 0.6699 1.1881 0.0991  -0.0109 0.0978  64  GLU B O   
1669 C CB  . GLU B 69  ? 1.3025 0.7501 1.2941 0.0588  -0.0342 0.0796  64  GLU B CB  
1670 C CG  . GLU B 69  ? 1.3820 0.8123 1.3563 0.0313  -0.0476 0.0751  64  GLU B CG  
1671 C CD  . GLU B 69  ? 1.5231 0.9162 1.4840 0.0190  -0.0561 0.0782  64  GLU B CD  
1672 O OE1 . GLU B 69  ? 1.5610 0.9409 1.5281 0.0305  -0.0532 0.0866  64  GLU B OE1 
1673 O OE2 . GLU B 69  ? 1.5673 0.9454 1.5115 -0.0024 -0.0661 0.0731  64  GLU B OE2 
1674 N N   . VAL B 70  ? 1.0240 0.5780 1.0508 0.1061  0.0032  0.0736  65  VAL B N   
1675 C CA  . VAL B 70  ? 0.9834 0.5678 1.0274 0.1283  0.0157  0.0804  65  VAL B CA  
1676 C C   . VAL B 70  ? 0.9541 0.5129 0.9807 0.1538  0.0270  0.0667  65  VAL B C   
1677 O O   . VAL B 70  ? 0.9709 0.5307 1.0054 0.1758  0.0348  0.0736  65  VAL B O   
1678 C CB  . VAL B 70  ? 0.9832 0.6293 1.0453 0.1226  0.0208  0.0838  65  VAL B CB  
1679 C CG1 . VAL B 70  ? 1.0079 0.6863 1.0850 0.1438  0.0332  0.0903  65  VAL B CG1 
1680 C CG2 . VAL B 70  ? 0.9688 0.6427 1.0485 0.1015  0.0114  0.0984  65  VAL B CG2 
1681 N N   . GLY B 71  ? 0.9540 0.4922 0.9565 0.1513  0.0279  0.0478  66  GLY B N   
1682 C CA  . GLY B 71  ? 1.0129 0.5281 0.9958 0.1751  0.0388  0.0332  66  GLY B CA  
1683 C C   . GLY B 71  ? 1.0054 0.5712 1.0045 0.1932  0.0531  0.0364  66  GLY B C   
1684 O O   . GLY B 71  ? 0.8964 0.5097 0.9097 0.1817  0.0539  0.0395  66  GLY B O   
1685 N N   . ASP B 72  ? 1.0323 0.5985 1.0307 0.2163  0.0609  0.0349  67  ASP B N   
1686 C CA  . ASP B 72  ? 0.9890 0.6044 1.0021 0.2338  0.0743  0.0401  67  ASP B CA  
1687 C C   . ASP B 72  ? 0.9877 0.6357 1.0287 0.2407  0.0756  0.0614  67  ASP B C   
1688 O O   . ASP B 72  ? 0.9710 0.6549 1.0234 0.2575  0.0855  0.0678  67  ASP B O   
1689 C CB  . ASP B 72  ? 1.1738 0.7784 1.1685 0.2544  0.0832  0.0254  67  ASP B CB  
1690 C CG  . ASP B 72  ? 1.3299 0.9069 1.2965 0.2470  0.0821  0.0042  67  ASP B CG  
1691 O OD1 . ASP B 72  ? 1.3566 0.9411 1.3218 0.2297  0.0787  0.0021  67  ASP B OD1 
1692 O OD2 . ASP B 72  ? 1.4392 0.9876 1.3847 0.2582  0.0847  -0.0099 67  ASP B OD2 
1693 N N   . ASN B 73  ? 0.9129 0.5504 0.9646 0.2265  0.0652  0.0733  68  ASN B N   
1694 C CA  . ASN B 73  ? 0.7842 0.4566 0.8632 0.2283  0.0651  0.0947  68  ASN B CA  
1695 C C   . ASN B 73  ? 0.8013 0.5280 0.9015 0.2188  0.0686  0.1056  68  ASN B C   
1696 O O   . ASN B 73  ? 0.7640 0.4991 0.8696 0.1956  0.0594  0.1084  68  ASN B O   
1697 C CB  . ASN B 73  ? 0.7667 0.4110 0.8490 0.2148  0.0519  0.1041  68  ASN B CB  
1698 C CG  . ASN B 73  ? 0.8253 0.5019 0.9328 0.2181  0.0514  0.1254  68  ASN B CG  
1699 O OD1 . ASN B 73  ? 0.7475 0.4740 0.8734 0.2247  0.0595  0.1354  68  ASN B OD1 
1700 N ND2 . ASN B 73  ? 0.9022 0.5507 1.0095 0.2120  0.0410  0.1330  68  ASN B ND2 
1701 N N   . TRP B 74  ? 0.6065 0.3759 0.7165 0.2318  0.0790  0.1097  69  TRP B N   
1702 C CA  . TRP B 74  ? 0.5506 0.3719 0.6749 0.2180  0.0794  0.1159  69  TRP B CA  
1703 C C   . TRP B 74  ? 0.5673 0.4216 0.7160 0.2077  0.0742  0.1367  69  TRP B C   
1704 O O   . TRP B 74  ? 0.5095 0.3980 0.6661 0.1894  0.0701  0.1403  69  TRP B O   
1705 C CB  . TRP B 74  ? 0.6028 0.4595 0.7282 0.2329  0.0911  0.1148  69  TRP B CB  
1706 C CG  . TRP B 74  ? 0.5928 0.4664 0.7275 0.2552  0.0994  0.1256  69  TRP B CG  
1707 C CD1 . TRP B 74  ? 0.6332 0.4824 0.7529 0.2744  0.1052  0.1161  69  TRP B CD1 
1708 C CD2 . TRP B 74  ? 0.6530 0.5754 0.8111 0.2559  0.1012  0.1464  69  TRP B CD2 
1709 N NE1 . TRP B 74  ? 0.6512 0.5315 0.7848 0.2883  0.1111  0.1303  69  TRP B NE1 
1710 C CE2 . TRP B 74  ? 0.6729 0.5986 0.8300 0.2765  0.1086  0.1493  69  TRP B CE2 
1711 C CE3 . TRP B 74  ? 0.6488 0.6123 0.8274 0.2405  0.0968  0.1628  69  TRP B CE3 
1712 C CZ2 . TRP B 74  ? 0.7564 0.7258 0.9329 0.2814  0.1121  0.1689  69  TRP B CZ2 
1713 C CZ3 . TRP B 74  ? 0.6156 0.6213 0.8118 0.2442  0.0995  0.1812  69  TRP B CZ3 
1714 C CH2 . TRP B 74  ? 0.6639 0.6729 0.8595 0.2642  0.1073  0.1847  69  TRP B CH2 
1715 N N   . ARG B 75  ? 0.5924 0.4365 0.7507 0.2180  0.0736  0.1491  70  ARG B N   
1716 C CA  . ARG B 75  ? 0.6302 0.5052 0.8105 0.2071  0.0681  0.1688  70  ARG B CA  
1717 C C   . ARG B 75  ? 0.6696 0.5263 0.8487 0.1846  0.0562  0.1684  70  ARG B C   
1718 O O   . ARG B 75  ? 0.6026 0.4919 0.7947 0.1680  0.0508  0.1787  70  ARG B O   
1719 C CB  . ARG B 75  ? 0.6302 0.5037 0.8176 0.2200  0.0692  0.1794  70  ARG B CB  
1720 C CG  . ARG B 75  ? 0.7021 0.6050 0.8930 0.2398  0.0809  0.1822  70  ARG B CG  
1721 C CD  . ARG B 75  ? 0.8599 0.7725 1.0627 0.2507  0.0823  0.1971  70  ARG B CD  
1722 N NE  . ARG B 75  ? 0.8724 0.8213 1.0809 0.2674  0.0935  0.2030  70  ARG B NE  
1723 C CZ  . ARG B 75  ? 0.8056 0.8109 1.0318 0.2618  0.0967  0.2189  70  ARG B CZ  
1724 N NH1 . ARG B 75  ? 0.7038 0.7342 0.9429 0.2408  0.0895  0.2290  70  ARG B NH1 
1725 N NH2 . ARG B 75  ? 0.7751 0.8120 1.0047 0.2764  0.1066  0.2250  70  ARG B NH2 
1726 N N   . LEU B 76  ? 0.6817 0.4884 0.8420 0.1820  0.0514  0.1550  71  LEU B N   
1727 C CA  . LEU B 76  ? 0.5694 0.3612 0.7252 0.1583  0.0394  0.1528  71  LEU B CA  
1728 C C   . LEU B 76  ? 0.6026 0.4189 0.7527 0.1412  0.0379  0.1423  71  LEU B C   
1729 O O   . LEU B 76  ? 0.5500 0.3829 0.7060 0.1221  0.0303  0.1475  71  LEU B O   
1730 C CB  . LEU B 76  ? 0.7491 0.4799 0.8845 0.1590  0.0338  0.1422  71  LEU B CB  
1731 C CG  . LEU B 76  ? 0.8535 0.5682 0.9840 0.1339  0.0204  0.1420  71  LEU B CG  
1732 C CD1 . LEU B 76  ? 0.8455 0.5903 0.9986 0.1221  0.0140  0.1627  71  LEU B CD1 
1733 C CD2 . LEU B 76  ? 1.0245 0.6765 1.1347 0.1349  0.0139  0.1348  71  LEU B CD2 
1734 N N   . LYS B 77  ? 0.5073 0.3255 0.6451 0.1487  0.0453  0.1280  72  LYS B N   
1735 C CA  . LYS B 77  ? 0.4663 0.3082 0.5988 0.1344  0.0445  0.1191  72  LYS B CA  
1736 C C   . LYS B 77  ? 0.4201 0.3106 0.5701 0.1266  0.0444  0.1326  72  LYS B C   
1737 O O   . LYS B 77  ? 0.4271 0.3328 0.5773 0.1095  0.0387  0.1323  72  LYS B O   
1738 C CB  . LYS B 77  ? 0.4623 0.3040 0.5812 0.1451  0.0530  0.1046  72  LYS B CB  
1739 C CG  . LYS B 77  ? 0.5820 0.3761 0.6792 0.1526  0.0537  0.0888  72  LYS B CG  
1740 C CD  . LYS B 77  ? 0.5948 0.3972 0.6802 0.1629  0.0627  0.0760  72  LYS B CD  
1741 C CE  . LYS B 77  ? 0.6757 0.4305 0.7363 0.1709  0.0640  0.0588  72  LYS B CE  
1742 N NZ  . LYS B 77  ? 0.6321 0.3993 0.6810 0.1795  0.0726  0.0467  72  LYS B NZ  
1743 N N   . ILE B 78  ? 0.4257 0.3406 0.5895 0.1395  0.0505  0.1449  73  ILE B N   
1744 C CA  . ILE B 78  ? 0.4282 0.3891 0.6066 0.1314  0.0500  0.1582  73  ILE B CA  
1745 C C   . ILE B 78  ? 0.4631 0.4283 0.6509 0.1168  0.0412  0.1691  73  ILE B C   
1746 O O   . ILE B 78  ? 0.4009 0.3919 0.5903 0.1019  0.0375  0.1714  73  ILE B O   
1747 C CB  . ILE B 78  ? 0.4499 0.4373 0.6425 0.1478  0.0576  0.1720  73  ILE B CB  
1748 C CG1 . ILE B 78  ? 0.4140 0.4103 0.5979 0.1591  0.0663  0.1628  73  ILE B CG1 
1749 C CG2 . ILE B 78  ? 0.3692 0.4010 0.5771 0.1370  0.0549  0.1887  73  ILE B CG2 
1750 C CD1 . ILE B 78  ? 0.3952 0.4173 0.5920 0.1782  0.0749  0.1763  73  ILE B CD1 
1751 N N   . SER B 79  ? 0.4640 0.4023 0.6562 0.1211  0.0376  0.1754  74  SER B N   
1752 C CA  . SER B 79  ? 0.3943 0.3353 0.5953 0.1071  0.0287  0.1867  74  SER B CA  
1753 C C   . SER B 79  ? 0.4546 0.3921 0.6445 0.0887  0.0223  0.1766  74  SER B C   
1754 O O   . SER B 79  ? 0.3700 0.3350 0.5656 0.0757  0.0183  0.1833  74  SER B O   
1755 C CB  . SER B 79  ? 0.5171 0.4221 0.7212 0.1142  0.0250  0.1938  74  SER B CB  
1756 O OG  . SER B 79  ? 0.5952 0.5049 0.8080 0.0991  0.0156  0.2058  74  SER B OG  
1757 N N   . ASN B 80  ? 0.3966 0.3015 0.5700 0.0882  0.0214  0.1609  75  ASN B N   
1758 C CA  . ASN B 80  ? 0.4181 0.3227 0.5811 0.0723  0.0162  0.1517  75  ASN B CA  
1759 C C   . ASN B 80  ? 0.4549 0.3948 0.6166 0.0670  0.0195  0.1481  75  ASN B C   
1760 O O   . ASN B 80  ? 0.3520 0.3098 0.5143 0.0544  0.0151  0.1507  75  ASN B O   
1761 C CB  . ASN B 80  ? 0.4062 0.2731 0.5506 0.0732  0.0156  0.1350  75  ASN B CB  
1762 C CG  . ASN B 80  ? 0.5670 0.3947 0.7069 0.0695  0.0078  0.1374  75  ASN B CG  
1763 O OD1 . ASN B 80  ? 0.5366 0.3667 0.6884 0.0645  0.0021  0.1522  75  ASN B OD1 
1764 N ND2 . ASN B 80  ? 0.5117 0.3026 0.6332 0.0705  0.0068  0.1231  75  ASN B ND2 
1765 N N   . LEU B 81  ? 0.3467 0.2962 0.5054 0.0769  0.0270  0.1425  76  LEU B N   
1766 C CA  . LEU B 81  ? 0.3216 0.2980 0.4752 0.0708  0.0291  0.1377  76  LEU B CA  
1767 C C   . LEU B 81  ? 0.3161 0.3267 0.4800 0.0635  0.0271  0.1510  76  LEU B C   
1768 O O   . LEU B 81  ? 0.2840 0.3099 0.4409 0.0535  0.0253  0.1475  76  LEU B O   
1769 C CB  . LEU B 81  ? 0.3555 0.3371 0.5045 0.0820  0.0369  0.1314  76  LEU B CB  
1770 C CG  . LEU B 81  ? 0.3413 0.2934 0.4759 0.0883  0.0396  0.1156  76  LEU B CG  
1771 C CD1 . LEU B 81  ? 0.3489 0.3081 0.4831 0.1037  0.0483  0.1140  76  LEU B CD1 
1772 C CD2 . LEU B 81  ? 0.3879 0.3384 0.5089 0.0765  0.0367  0.1035  76  LEU B CD2 
1773 N N   . LYS B 82  ? 0.3099 0.3314 0.4890 0.0687  0.0275  0.1660  77  LYS B N   
1774 C CA  . LYS B 82  ? 0.2963 0.3504 0.4845 0.0607  0.0251  0.1793  77  LYS B CA  
1775 C C   . LYS B 82  ? 0.3177 0.3722 0.5051 0.0483  0.0182  0.1817  77  LYS B C   
1776 O O   . LYS B 82  ? 0.3110 0.3888 0.4955 0.0391  0.0164  0.1842  77  LYS B O   
1777 C CB  . LYS B 82  ? 0.3263 0.3936 0.5321 0.0694  0.0268  0.1966  77  LYS B CB  
1778 C CG  . LYS B 82  ? 0.2932 0.3782 0.5018 0.0795  0.0337  0.1990  77  LYS B CG  
1779 C CD  . LYS B 82  ? 0.3371 0.4413 0.5648 0.0885  0.0356  0.2187  77  LYS B CD  
1780 C CE  . LYS B 82  ? 0.4222 0.5494 0.6527 0.0982  0.0426  0.2222  77  LYS B CE  
1781 N NZ  . LYS B 82  ? 0.4084 0.5588 0.6583 0.1082  0.0452  0.2428  77  LYS B NZ  
1782 N N   . LYS B 83  ? 0.2979 0.3265 0.4864 0.0478  0.0143  0.1812  78  LYS B N   
1783 C CA  . LYS B 83  ? 0.3727 0.4040 0.5608 0.0357  0.0077  0.1844  78  LYS B CA  
1784 C C   . LYS B 83  ? 0.3441 0.3793 0.5169 0.0290  0.0079  0.1712  78  LYS B C   
1785 O O   . LYS B 83  ? 0.3016 0.3559 0.4728 0.0207  0.0052  0.1746  78  LYS B O   
1786 C CB  . LYS B 83  ? 0.3855 0.3862 0.5759 0.0344  0.0022  0.1868  78  LYS B CB  
1787 C CG  . LYS B 83  ? 0.3443 0.3334 0.5482 0.0419  0.0011  0.2001  78  LYS B CG  
1788 C CD  . LYS B 83  ? 0.6735 0.6973 0.8928 0.0414  0.0015  0.2170  78  LYS B CD  
1789 C CE  . LYS B 83  ? 0.7459 0.7597 0.9787 0.0530  0.0026  0.2297  78  LYS B CE  
1790 N NZ  . LYS B 83  ? 0.6189 0.6324 0.8509 0.0687  0.0113  0.2248  78  LYS B NZ  
1791 N N   . ILE B 84  ? 0.3485 0.3659 0.5096 0.0335  0.0113  0.1566  79  ILE B N   
1792 C CA  . ILE B 84  ? 0.2782 0.2972 0.4249 0.0284  0.0116  0.1443  79  ILE B CA  
1793 C C   . ILE B 84  ? 0.3094 0.3535 0.4504 0.0264  0.0142  0.1437  79  ILE B C   
1794 O O   . ILE B 84  ? 0.2706 0.3250 0.4033 0.0204  0.0126  0.1411  79  ILE B O   
1795 C CB  . ILE B 84  ? 0.2873 0.2812 0.4229 0.0333  0.0143  0.1296  79  ILE B CB  
1796 C CG1 . ILE B 84  ? 0.4133 0.3788 0.5494 0.0321  0.0099  0.1291  79  ILE B CG1 
1797 C CG2 . ILE B 84  ? 0.3369 0.3348 0.4583 0.0286  0.0147  0.1183  79  ILE B CG2 
1798 C CD1 . ILE B 84  ? 0.5211 0.4592 0.6466 0.0383  0.0126  0.1162  79  ILE B CD1 
1799 N N   . LEU B 85  ? 0.2647 0.3186 0.4093 0.0314  0.0179  0.1468  80  LEU B N   
1800 C CA  . LEU B 85  ? 0.2637 0.3396 0.4012 0.0272  0.0189  0.1475  80  LEU B CA  
1801 C C   . LEU B 85  ? 0.2915 0.3884 0.4323 0.0201  0.0155  0.1579  80  LEU B C   
1802 O O   . LEU B 85  ? 0.2516 0.3578 0.3792 0.0144  0.0145  0.1538  80  LEU B O   
1803 C CB  . LEU B 85  ? 0.2970 0.3837 0.4403 0.0327  0.0226  0.1525  80  LEU B CB  
1804 C CG  . LEU B 85  ? 0.2581 0.3671 0.3929 0.0258  0.0221  0.1547  80  LEU B CG  
1805 C CD1 . LEU B 85  ? 0.2649 0.3644 0.3793 0.0207  0.0215  0.1405  80  LEU B CD1 
1806 C CD2 . LEU B 85  ? 0.2379 0.3620 0.3807 0.0306  0.0254  0.1626  80  LEU B CD2 
1807 N N   . LYS B 86  ? 0.2634 0.3668 0.4205 0.0210  0.0136  0.1714  81  LYS B N   
1808 C CA  . LYS B 86  ? 0.2621 0.3872 0.4233 0.0141  0.0103  0.1824  81  LYS B CA  
1809 C C   . LYS B 86  ? 0.2654 0.3885 0.4178 0.0092  0.0078  0.1773  81  LYS B C   
1810 O O   . LYS B 86  ? 0.2962 0.4372 0.4405 0.0045  0.0070  0.1787  81  LYS B O   
1811 C CB  . LYS B 86  ? 0.2897 0.4197 0.4710 0.0158  0.0081  0.1987  81  LYS B CB  
1812 C CG  . LYS B 86  ? 0.3888 0.5448 0.5760 0.0082  0.0044  0.2122  81  LYS B CG  
1813 C CD  . LYS B 86  ? 0.3325 0.5141 0.5118 0.0035  0.0054  0.2145  81  LYS B CD  
1814 C CE  . LYS B 86  ? 0.4310 0.6396 0.6196 -0.0028 0.0019  0.2309  81  LYS B CE  
1815 N NZ  . LYS B 86  ? 0.3162 0.5437 0.4875 -0.0102 0.0013  0.2277  81  LYS B NZ  
1816 N N   . GLY B 87  ? 0.2571 0.3593 0.4104 0.0107  0.0066  0.1719  82  GLY B N   
1817 C CA  . GLY B 87  ? 0.2763 0.3788 0.4223 0.0066  0.0044  0.1680  82  GLY B CA  
1818 C C   . GLY B 87  ? 0.2742 0.3793 0.4010 0.0070  0.0073  0.1554  82  GLY B C   
1819 O O   . GLY B 87  ? 0.2808 0.3996 0.4002 0.0049  0.0068  0.1560  82  GLY B O   
1820 N N   . ILE B 88  ? 0.2406 0.3325 0.3584 0.0105  0.0103  0.1446  83  ILE B N   
1821 C CA  . ILE B 88  ? 0.2590 0.3497 0.3574 0.0105  0.0123  0.1333  83  ILE B CA  
1822 C C   . ILE B 88  ? 0.2581 0.3674 0.3475 0.0073  0.0122  0.1371  83  ILE B C   
1823 O O   . ILE B 88  ? 0.2389 0.3517 0.3129 0.0071  0.0126  0.1321  83  ILE B O   
1824 C CB  . ILE B 88  ? 0.2857 0.3610 0.3775 0.0133  0.0148  0.1234  83  ILE B CB  
1825 C CG1 . ILE B 88  ? 0.2564 0.3113 0.3506 0.0162  0.0149  0.1165  83  ILE B CG1 
1826 C CG2 . ILE B 88  ? 0.2912 0.3659 0.3624 0.0116  0.0156  0.1144  83  ILE B CG2 
1827 C CD1 . ILE B 88  ? 0.2954 0.3373 0.3865 0.0200  0.0178  0.1087  83  ILE B CD1 
1828 N N   . LEU B 89  ? 0.2317 0.3527 0.3297 0.0053  0.0119  0.1461  84  LEU B N   
1829 C CA  . LEU B 89  ? 0.2926 0.4314 0.3813 0.0003  0.0109  0.1506  84  LEU B CA  
1830 C C   . LEU B 89  ? 0.2578 0.4130 0.3469 -0.0014 0.0095  0.1574  84  LEU B C   
1831 O O   . LEU B 89  ? 0.2339 0.3960 0.3049 -0.0032 0.0097  0.1538  84  LEU B O   
1832 C CB  . LEU B 89  ? 0.2807 0.4328 0.3816 -0.0021 0.0103  0.1618  84  LEU B CB  
1833 C CG  . LEU B 89  ? 0.3421 0.4856 0.4402 -0.0008 0.0120  0.1568  84  LEU B CG  
1834 C CD1 . LEU B 89  ? 0.3515 0.5144 0.4635 -0.0024 0.0117  0.1708  84  LEU B CD1 
1835 C CD2 . LEU B 89  ? 0.3869 0.5222 0.4597 -0.0054 0.0113  0.1451  84  LEU B CD2 
1836 N N   . ASP B 90  ? 0.2247 0.3857 0.3333 -0.0008 0.0080  0.1675  85  ASP B N   
1837 C CA  . ASP B 90  ? 0.2469 0.4275 0.3582 -0.0030 0.0064  0.1761  85  ASP B CA  
1838 C C   . ASP B 90  ? 0.3221 0.4996 0.4189 0.0004  0.0080  0.1670  85  ASP B C   
1839 O O   . ASP B 90  ? 0.2385 0.4327 0.3248 0.0008  0.0088  0.1685  85  ASP B O   
1840 C CB  . ASP B 90  ? 0.2558 0.4415 0.3912 -0.0047 0.0032  0.1903  85  ASP B CB  
1841 C CG  . ASP B 90  ? 0.3673 0.5633 0.5174 -0.0068 0.0018  0.2031  85  ASP B CG  
1842 O OD1 . ASP B 90  ? 0.3181 0.5252 0.4599 -0.0089 0.0029  0.2031  85  ASP B OD1 
1843 O OD2 . ASP B 90  ? 0.3007 0.4929 0.4697 -0.0068 -0.0008 0.2137  85  ASP B OD2 
1844 N N   . TYR B 91  ? 0.2260 0.3834 0.3214 0.0036  0.0087  0.1579  86  TYR B N   
1845 C CA  . TYR B 91  ? 0.2513 0.4067 0.3339 0.0077  0.0104  0.1501  86  TYR B CA  
1846 C C   . TYR B 91  ? 0.2900 0.4431 0.3471 0.0112  0.0134  0.1396  86  TYR B C   
1847 O O   . TYR B 91  ? 0.2725 0.4367 0.3174 0.0155  0.0154  0.1386  86  TYR B O   
1848 C CB  . TYR B 91  ? 0.2347 0.3679 0.3195 0.0093  0.0102  0.1421  86  TYR B CB  
1849 C CG  . TYR B 91  ? 0.2435 0.3781 0.3189 0.0133  0.0114  0.1371  86  TYR B CG  
1850 C CD1 . TYR B 91  ? 0.2359 0.3916 0.3188 0.0125  0.0100  0.1475  86  TYR B CD1 
1851 C CD2 . TYR B 91  ? 0.3230 0.4402 0.3830 0.0177  0.0138  0.1238  86  TYR B CD2 
1852 C CE1 . TYR B 91  ? 0.3085 0.4700 0.3844 0.0170  0.0114  0.1450  86  TYR B CE1 
1853 C CE2 . TYR B 91  ? 0.3364 0.4567 0.3890 0.0224  0.0151  0.1208  86  TYR B CE2 
1854 C CZ  . TYR B 91  ? 0.3578 0.5013 0.4187 0.0225  0.0141  0.1317  86  TYR B CZ  
1855 O OH  . TYR B 91  ? 0.3646 0.5159 0.4195 0.0280  0.0158  0.1308  86  TYR B OH  
1856 N N   . ASN B 92  ? 0.3105 0.4488 0.3586 0.0095  0.0137  0.1324  87  ASN B N   
1857 C CA  . ASN B 92  ? 0.2569 0.3874 0.2786 0.0104  0.0149  0.1226  87  ASN B CA  
1858 C C   . ASN B 92  ? 0.3214 0.4703 0.3327 0.0086  0.0147  0.1279  87  ASN B C   
1859 O O   . ASN B 92  ? 0.3586 0.5047 0.3465 0.0131  0.0166  0.1207  87  ASN B O   
1860 C CB  . ASN B 92  ? 0.3104 0.4266 0.3284 0.0056  0.0136  0.1181  87  ASN B CB  
1861 C CG  . ASN B 92  ? 0.4734 0.5760 0.4620 0.0041  0.0131  0.1079  87  ASN B CG  
1862 O OD1 . ASN B 92  ? 0.4980 0.5864 0.4690 0.0097  0.0146  0.0980  87  ASN B OD1 
1863 N ND2 . ASN B 92  ? 0.5101 0.6164 0.4927 -0.0041 0.0104  0.1112  87  ASN B ND2 
1864 N N   . HIS B 93  ? 0.2500 0.4174 0.2780 0.0027  0.0126  0.1407  88  HIS B N   
1865 C CA  . HIS B 93  ? 0.2564 0.4444 0.2763 -0.0004 0.0120  0.1472  88  HIS B CA  
1866 C C   . HIS B 93  ? 0.3647 0.5727 0.3868 0.0049  0.0139  0.1527  88  HIS B C   
1867 O O   . HIS B 93  ? 0.3443 0.5612 0.3461 0.0076  0.0157  0.1501  88  HIS B O   
1868 C CB  . HIS B 93  ? 0.2594 0.4633 0.2986 -0.0086 0.0089  0.1611  88  HIS B CB  
1869 C CG  . HIS B 93  ? 0.3159 0.5442 0.3494 -0.0134 0.0077  0.1698  88  HIS B CG  
1870 N ND1 . HIS B 93  ? 0.3263 0.5523 0.3319 -0.0175 0.0070  0.1634  88  HIS B ND1 
1871 C CD2 . HIS B 93  ? 0.2952 0.5503 0.3460 -0.0157 0.0064  0.1848  88  HIS B CD2 
1872 C CE1 . HIS B 93  ? 0.3100 0.5611 0.3155 -0.0217 0.0058  0.1734  88  HIS B CE1 
1873 N NE2 . HIS B 93  ? 0.3537 0.6244 0.3875 -0.0206 0.0056  0.1870  88  HIS B NE2 
1874 N N   . GLU B 94  ? 0.2706 0.4860 0.3159 0.0062  0.0133  0.1607  89  GLU B N   
1875 C CA  . GLU B 94  ? 0.2981 0.5399 0.3509 0.0084  0.0138  0.1710  89  GLU B CA  
1876 C C   . GLU B 94  ? 0.2904 0.5316 0.3307 0.0180  0.0175  0.1638  89  GLU B C   
1877 O O   . GLU B 94  ? 0.2766 0.5418 0.3119 0.0228  0.0199  0.1691  89  GLU B O   
1878 C CB  . GLU B 94  ? 0.2616 0.5132 0.3451 0.0026  0.0096  0.1861  89  GLU B CB  
1879 C CG  . GLU B 94  ? 0.2863 0.5454 0.3846 -0.0051 0.0063  0.1973  89  GLU B CG  
1880 C CD  . GLU B 94  ? 0.4149 0.6709 0.5407 -0.0094 0.0019  0.2094  89  GLU B CD  
1881 O OE1 . GLU B 94  ? 0.3454 0.5932 0.4782 -0.0086 0.0005  0.2093  89  GLU B OE1 
1882 O OE2 . GLU B 94  ? 0.4356 0.6967 0.5750 -0.0139 -0.0006 0.2196  89  GLU B OE2 
1883 N N   . ILE B 95  ? 0.2547 0.4715 0.2911 0.0214  0.0183  0.1531  90  ILE B N   
1884 C CA  . ILE B 95  ? 0.3131 0.5311 0.3426 0.0303  0.0214  0.1489  90  ILE B CA  
1885 C C   . ILE B 95  ? 0.2710 0.4652 0.2723 0.0388  0.0251  0.1322  90  ILE B C   
1886 O O   . ILE B 95  ? 0.3397 0.5403 0.3248 0.0497  0.0295  0.1286  90  ILE B O   
1887 C CB  . ILE B 95  ? 0.2794 0.4911 0.3294 0.0268  0.0184  0.1527  90  ILE B CB  
1888 C CG1 . ILE B 95  ? 0.3161 0.5492 0.3916 0.0183  0.0137  0.1703  90  ILE B CG1 
1889 C CG2 . ILE B 95  ? 0.2886 0.5018 0.3308 0.0354  0.0213  0.1484  90  ILE B CG2 
1890 C CD1 . ILE B 95  ? 0.3246 0.5943 0.4018 0.0206  0.0148  0.1826  90  ILE B CD1 
1891 N N   . LEU B 96  ? 0.3381 0.5053 0.3335 0.0346  0.0235  0.1228  91  LEU B N   
1892 C CA  . LEU B 96  ? 0.3340 0.4753 0.3037 0.0411  0.0257  0.1078  91  LEU B CA  
1893 C C   . LEU B 96  ? 0.4661 0.6016 0.4056 0.0443  0.0273  0.1009  91  LEU B C   
1894 O O   . LEU B 96  ? 0.4459 0.5864 0.3827 0.0364  0.0250  0.1041  91  LEU B O   
1895 C CB  . LEU B 96  ? 0.3376 0.4539 0.3104 0.0346  0.0230  0.1010  91  LEU B CB  
1896 C CG  . LEU B 96  ? 0.3295 0.4440 0.3250 0.0327  0.0217  0.1042  91  LEU B CG  
1897 C CD1 . LEU B 96  ? 0.3491 0.4387 0.3422 0.0291  0.0203  0.0953  91  LEU B CD1 
1898 C CD2 . LEU B 96  ? 0.4863 0.6081 0.4817 0.0409  0.0240  0.1045  91  LEU B CD2 
1899 N N   . GLY B 97  ? 0.6875 0.8113 0.6032 0.0563  0.0312  0.0916  92  GLY B N   
1900 C CA  . GLY B 97  ? 0.8614 0.9701 0.7420 0.0608  0.0326  0.0820  92  GLY B CA  
1901 C C   . GLY B 97  ? 1.0236 1.0994 0.8873 0.0518  0.0280  0.0722  92  GLY B C   
1902 O O   . GLY B 97  ? 1.0882 1.1622 0.9437 0.0412  0.0243  0.0731  92  GLY B O   
1903 N N   . GLN B 98  ? 1.1254 1.1777 0.9844 0.0549  0.0278  0.0644  93  GLN B N   
1904 C CA  . GLN B 98  ? 1.1514 1.1748 0.9966 0.0452  0.0229  0.0567  93  GLN B CA  
1905 C C   . GLN B 98  ? 1.1297 1.1640 1.0031 0.0317  0.0191  0.0647  93  GLN B C   
1906 O O   . GLN B 98  ? 1.0751 1.1196 0.9751 0.0325  0.0201  0.0695  93  GLN B O   
1907 C CB  . GLN B 98  ? 1.1767 1.1738 1.0097 0.0524  0.0236  0.0473  93  GLN B CB  
1908 C CG  . GLN B 98  ? 1.2415 1.2066 1.0524 0.0426  0.0180  0.0392  93  GLN B CG  
1909 C CD  . GLN B 98  ? 1.2107 1.1598 1.0275 0.0428  0.0169  0.0353  93  GLN B CD  
1910 O OE1 . GLN B 98  ? 1.2806 1.2159 1.0858 0.0545  0.0196  0.0296  93  GLN B OE1 
1911 N NE2 . GLN B 98  ? 0.9642 0.9170 0.7990 0.0305  0.0133  0.0390  93  GLN B NE2 
1912 N N   . GLN B 99  ? 1.1979 1.2298 1.0639 0.0197  0.0147  0.0663  94  GLN B N   
1913 C CA  . GLN B 99  ? 1.2645 1.3085 1.1553 0.0085  0.0116  0.0749  94  GLN B CA  
1914 C C   . GLN B 99  ? 1.2734 1.3011 1.1700 0.0062  0.0103  0.0704  94  GLN B C   
1915 O O   . GLN B 99  ? 1.3202 1.3234 1.1935 0.0052  0.0082  0.0614  94  GLN B O   
1916 C CB  . GLN B 99  ? 1.3779 1.4256 1.2569 -0.0041 0.0069  0.0788  94  GLN B CB  
1917 C CG  . GLN B 99  ? 1.4207 1.4943 1.3056 -0.0052 0.0076  0.0879  94  GLN B CG  
1918 C CD  . GLN B 99  ? 1.4996 1.5702 1.3605 0.0047  0.0110  0.0817  94  GLN B CD  
1919 O OE1 . GLN B 99  ? 1.5556 1.5995 1.3867 0.0102  0.0114  0.0695  94  GLN B OE1 
1920 N NE2 . GLN B 99  ? 1.4843 1.5826 1.3577 0.0079  0.0135  0.0905  94  GLN B NE2 
1921 N N   . ILE B 100 ? 1.2120 1.2521 1.1382 0.0056  0.0113  0.0768  95  ILE B N   
1922 C CA  . ILE B 100 ? 1.1051 1.1338 1.0379 0.0030  0.0104  0.0735  95  ILE B CA  
1923 C C   . ILE B 100 ? 1.2336 1.2623 1.1610 -0.0086 0.0062  0.0766  95  ILE B C   
1924 O O   . ILE B 100 ? 1.2040 1.2459 1.1301 -0.0151 0.0040  0.0836  95  ILE B O   
1925 C CB  . ILE B 100 ? 0.7755 0.8151 0.7386 0.0063  0.0129  0.0788  95  ILE B CB  
1926 C CG1 . ILE B 100 ? 0.7196 0.7795 0.7033 0.0018  0.0123  0.0907  95  ILE B CG1 
1927 C CG2 . ILE B 100 ? 0.4692 0.5119 0.4384 0.0150  0.0157  0.0781  95  ILE B CG2 
1928 C CD1 . ILE B 100 ? 0.7573 0.8228 0.7675 0.0055  0.0141  0.0957  95  ILE B CD1 
1929 N N   . ASN B 101 ? 1.2933 1.3099 1.2176 -0.0119 0.0046  0.0726  96  ASN B N   
1930 C CA  . ASN B 101 ? 1.3242 1.3442 1.2440 -0.0238 0.0002  0.0773  96  ASN B CA  
1931 C C   . ASN B 101 ? 1.1840 1.2276 1.1331 -0.0246 0.0020  0.0882  96  ASN B C   
1932 O O   . ASN B 101 ? 1.1021 1.1460 1.0643 -0.0216 0.0042  0.0877  96  ASN B O   
1933 C CB  . ASN B 101 ? 1.4296 1.4292 1.3331 -0.0276 -0.0027 0.0700  96  ASN B CB  
1934 C CG  . ASN B 101 ? 1.5369 1.5097 1.4064 -0.0286 -0.0061 0.0607  96  ASN B CG  
1935 O OD1 . ASN B 101 ? 1.5742 1.5322 1.4365 -0.0183 -0.0032 0.0526  96  ASN B OD1 
1936 N ND2 . ASN B 101 ? 1.5699 1.5357 1.4170 -0.0410 -0.0126 0.0622  96  ASN B ND2 
1937 N N   . ASP B 102 ? 1.1451 1.2084 1.1033 -0.0278 0.0015  0.0982  97  ASP B N   
1938 C CA  . ASP B 102 ? 1.0963 1.1822 1.0824 -0.0265 0.0036  0.1101  97  ASP B CA  
1939 C C   . ASP B 102 ? 1.1570 1.2605 1.1416 -0.0380 -0.0005 0.1208  97  ASP B C   
1940 O O   . ASP B 102 ? 1.1455 1.2719 1.1478 -0.0386 0.0000  0.1333  97  ASP B O   
1941 C CB  . ASP B 102 ? 1.0002 1.0984 1.0030 -0.0205 0.0061  0.1163  97  ASP B CB  
1942 C CG  . ASP B 102 ? 0.9403 1.0451 0.9283 -0.0261 0.0033  0.1188  97  ASP B CG  
1943 O OD1 . ASP B 102 ? 0.9705 1.0947 0.9733 -0.0260 0.0037  0.1293  97  ASP B OD1 
1944 O OD2 . ASP B 102 ? 0.8910 0.9803 0.8511 -0.0303 0.0006  0.1101  97  ASP B OD2 
1945 N N   . PHE B 103 ? 1.1705 1.2642 1.1339 -0.0478 -0.0053 0.1171  98  PHE B N   
1946 C CA  . PHE B 103 ? 1.1557 1.2668 1.1144 -0.0618 -0.0108 0.1282  98  PHE B CA  
1947 C C   . PHE B 103 ? 1.0085 1.1439 0.9928 -0.0593 -0.0079 0.1397  98  PHE B C   
1948 O O   . PHE B 103 ? 1.1010 1.2621 1.0925 -0.0674 -0.0107 0.1538  98  PHE B O   
1949 C CB  . PHE B 103 ? 1.2742 1.3644 1.2002 -0.0747 -0.0181 0.1214  98  PHE B CB  
1950 C CG  . PHE B 103 ? 1.3825 1.4493 1.2788 -0.0774 -0.0213 0.1116  98  PHE B CG  
1951 C CD1 . PHE B 103 ? 1.4191 1.4601 1.3048 -0.0661 -0.0179 0.0976  98  PHE B CD1 
1952 C CD2 . PHE B 103 ? 1.4027 1.4742 1.2808 -0.0906 -0.0276 0.1168  98  PHE B CD2 
1953 C CE1 . PHE B 103 ? 1.4637 1.4841 1.3212 -0.0656 -0.0197 0.0888  98  PHE B CE1 
1954 C CE2 . PHE B 103 ? 1.4478 1.4959 1.2954 -0.0913 -0.0299 0.1067  98  PHE B CE2 
1955 C CZ  . PHE B 103 ? 1.4795 1.5021 1.3170 -0.0776 -0.0254 0.0926  98  PHE B CZ  
1956 N N   . THR B 104 ? 0.7541 0.8825 0.7516 -0.0475 -0.0023 0.1339  99  THR B N   
1957 C CA  . THR B 104 ? 0.6538 0.8031 0.6753 -0.0405 0.0023  0.1431  99  THR B CA  
1958 C C   . THR B 104 ? 0.5387 0.6803 0.5797 -0.0237 0.0097  0.1386  99  THR B C   
1959 O O   . THR B 104 ? 0.6595 0.7805 0.6961 -0.0176 0.0120  0.1265  99  THR B O   
1960 C CB  . THR B 104 ? 0.7146 0.8640 0.7291 -0.0447 0.0012  0.1414  99  THR B CB  
1961 O OG1 . THR B 104 ? 0.7217 0.8759 0.7162 -0.0628 -0.0073 0.1466  99  THR B OG1 
1962 C CG2 . THR B 104 ? 0.7427 0.9171 0.7814 -0.0352 0.0072  0.1516  99  THR B CG2 
1963 N N   . LEU B 105 ? 0.4320 0.5893 0.4934 -0.0173 0.0125  0.1490  100 LEU B N   
1964 C CA  . LEU B 105 ? 0.3839 0.5301 0.4612 -0.0034 0.0178  0.1456  100 LEU B CA  
1965 C C   . LEU B 105 ? 0.3318 0.4792 0.4220 0.0080  0.0236  0.1456  100 LEU B C   
1966 O O   . LEU B 105 ? 0.3875 0.5558 0.4832 0.0078  0.0247  0.1547  100 LEU B O   
1967 C CB  . LEU B 105 ? 0.3075 0.4670 0.4008 -0.0011 0.0179  0.1573  100 LEU B CB  
1968 C CG  . LEU B 105 ? 0.2857 0.4447 0.3678 -0.0097 0.0134  0.1569  100 LEU B CG  
1969 C CD1 . LEU B 105 ? 0.3352 0.5075 0.4363 -0.0060 0.0140  0.1690  100 LEU B CD1 
1970 C CD2 . LEU B 105 ? 0.3739 0.5072 0.4404 -0.0086 0.0131  0.1413  100 LEU B CD2 
1971 N N   . PRO B 106 ? 0.3177 0.4433 0.4115 0.0181  0.0271  0.1358  101 PRO B N   
1972 C CA  . PRO B 106 ? 0.3036 0.4265 0.4085 0.0312  0.0333  0.1351  101 PRO B CA  
1973 C C   . PRO B 106 ? 0.3033 0.4438 0.4284 0.0401  0.0365  0.1499  101 PRO B C   
1974 O O   . PRO B 106 ? 0.2972 0.4394 0.4309 0.0395  0.0346  0.1570  101 PRO B O   
1975 C CB  . PRO B 106 ? 0.3414 0.4348 0.4438 0.0369  0.0343  0.1227  101 PRO B CB  
1976 C CG  . PRO B 106 ? 0.3379 0.4278 0.4383 0.0297  0.0296  0.1238  101 PRO B CG  
1977 C CD  . PRO B 106 ? 0.2997 0.4035 0.3873 0.0177  0.0255  0.1262  101 PRO B CD  
1978 N N   . ASP B 107 ? 0.2787 0.4339 0.4115 0.0491  0.0416  0.1556  102 ASP B N   
1979 C CA  . ASP B 107 ? 0.2890 0.4567 0.4412 0.0622  0.0462  0.1687  102 ASP B CA  
1980 C C   . ASP B 107 ? 0.3273 0.4641 0.4817 0.0773  0.0509  0.1590  102 ASP B C   
1981 O O   . ASP B 107 ? 0.2883 0.4181 0.4389 0.0875  0.0563  0.1518  102 ASP B O   
1982 C CB  . ASP B 107 ? 0.2859 0.4869 0.4456 0.0668  0.0501  0.1811  102 ASP B CB  
1983 C CG  . ASP B 107 ? 0.3895 0.6059 0.5699 0.0827  0.0555  0.1964  102 ASP B CG  
1984 O OD1 . ASP B 107 ? 0.3390 0.5332 0.5262 0.0918  0.0567  0.1949  102 ASP B OD1 
1985 O OD2 . ASP B 107 ? 0.3041 0.5550 0.4938 0.0861  0.0584  0.2109  102 ASP B OD2 
1986 N N   . VAL B 108 ? 0.3287 0.4470 0.4879 0.0777  0.0482  0.1590  103 VAL B N   
1987 C CA  . VAL B 108 ? 0.3226 0.4062 0.4798 0.0878  0.0503  0.1488  103 VAL B CA  
1988 C C   . VAL B 108 ? 0.3202 0.4005 0.4879 0.1073  0.0572  0.1548  103 VAL B C   
1989 O O   . VAL B 108 ? 0.4248 0.4740 0.5869 0.1176  0.0598  0.1450  103 VAL B O   
1990 C CB  . VAL B 108 ? 0.3158 0.3821 0.4747 0.0805  0.0442  0.1490  103 VAL B CB  
1991 C CG1 . VAL B 108 ? 0.2945 0.3662 0.4423 0.0641  0.0387  0.1435  103 VAL B CG1 
1992 C CG2 . VAL B 108 ? 0.3849 0.4652 0.5614 0.0834  0.0432  0.1667  103 VAL B CG2 
1993 N N   . ASN B 109 ? 0.3184 0.4301 0.4999 0.1128  0.0601  0.1712  104 ASN B N   
1994 C CA  . ASN B 109 ? 0.3178 0.4303 0.5090 0.1342  0.0681  0.1779  104 ASN B CA  
1995 C C   . ASN B 109 ? 0.3363 0.4443 0.5165 0.1448  0.0750  0.1663  104 ASN B C   
1996 O O   . ASN B 109 ? 0.4284 0.5154 0.6067 0.1637  0.0816  0.1615  104 ASN B O   
1997 C CB  . ASN B 109 ? 0.4084 0.5627 0.6176 0.1371  0.0697  0.1999  104 ASN B CB  
1998 C CG  . ASN B 109 ? 0.4078 0.5691 0.6277 0.1263  0.0628  0.2121  104 ASN B CG  
1999 O OD1 . ASN B 109 ? 0.4032 0.5487 0.6328 0.1355  0.0629  0.2185  104 ASN B OD1 
2000 N ND2 . ASN B 109 ? 0.3715 0.5542 0.5875 0.1064  0.0564  0.2149  104 ASN B ND2 
2001 N N   . LEU B 110 ? 0.3731 0.4990 0.5443 0.1326  0.0734  0.1616  105 LEU B N   
2002 C CA  . LEU B 110 ? 0.3452 0.4709 0.5059 0.1406  0.0794  0.1515  105 LEU B CA  
2003 C C   . LEU B 110 ? 0.4305 0.5135 0.5742 0.1405  0.0786  0.1307  105 LEU B C   
2004 O O   . LEU B 110 ? 0.3569 0.4275 0.4920 0.1535  0.0849  0.1210  105 LEU B O   
2005 C CB  . LEU B 110 ? 0.3789 0.5377 0.5353 0.1258  0.0767  0.1551  105 LEU B CB  
2006 C CG  . LEU B 110 ? 0.4571 0.6617 0.6284 0.1235  0.0768  0.1767  105 LEU B CG  
2007 C CD1 . LEU B 110 ? 0.3908 0.6220 0.5538 0.1053  0.0719  0.1794  105 LEU B CD1 
2008 C CD2 . LEU B 110 ? 0.5514 0.7746 0.7355 0.1472  0.0870  0.1875  105 LEU B CD2 
2009 N N   . ILE B 111 ? 0.3501 0.4129 0.4883 0.1256  0.0707  0.1243  106 ILE B N   
2010 C CA  . ILE B 111 ? 0.3336 0.3584 0.4569 0.1235  0.0686  0.1068  106 ILE B CA  
2011 C C   . ILE B 111 ? 0.4589 0.4517 0.5822 0.1396  0.0721  0.1038  106 ILE B C   
2012 O O   . ILE B 111 ? 0.4099 0.3784 0.5200 0.1484  0.0758  0.0909  106 ILE B O   
2013 C CB  . ILE B 111 ? 0.3526 0.3675 0.4723 0.1051  0.0596  0.1038  106 ILE B CB  
2014 C CG1 . ILE B 111 ? 0.3004 0.3409 0.4161 0.0906  0.0561  0.1053  106 ILE B CG1 
2015 C CG2 . ILE B 111 ? 0.3404 0.3189 0.4462 0.1022  0.0568  0.0882  106 ILE B CG2 
2016 C CD1 . ILE B 111 ? 0.3085 0.3427 0.4200 0.0755  0.0486  0.1034  106 ILE B CD1 
2017 N N   . GLY B 112 ? 0.3856 0.3774 0.5223 0.1432  0.0704  0.1162  107 GLY B N   
2018 C CA  . GLY B 112 ? 0.4275 0.3854 0.5637 0.1576  0.0723  0.1152  107 GLY B CA  
2019 C C   . GLY B 112 ? 0.5307 0.4873 0.6650 0.1817  0.0830  0.1144  107 GLY B C   
2020 O O   . GLY B 112 ? 0.5549 0.4750 0.6741 0.1925  0.0859  0.1015  107 GLY B O   
2021 N N   . GLU B 113 ? 0.4543 0.4514 0.6027 0.1903  0.0888  0.1287  108 GLU B N   
2022 C CA  . GLU B 113 ? 0.4822 0.4839 0.6318 0.2162  0.1000  0.1316  108 GLU B CA  
2023 C C   . GLU B 113 ? 0.4898 0.4971 0.6246 0.2221  0.1066  0.1186  108 GLU B C   
2024 O O   . GLU B 113 ? 0.6035 0.5927 0.7286 0.2437  0.1151  0.1114  108 GLU B O   
2025 C CB  . GLU B 113 ? 0.4220 0.4706 0.5939 0.2234  0.1038  0.1544  108 GLU B CB  
2026 C CG  . GLU B 113 ? 0.5793 0.6349 0.7551 0.2531  0.1159  0.1607  108 GLU B CG  
2027 C CD  . GLU B 113 ? 0.5673 0.6706 0.7621 0.2538  0.1174  0.1828  108 GLU B CD  
2028 O OE1 . GLU B 113 ? 0.5197 0.6497 0.7290 0.2370  0.1105  0.1961  108 GLU B OE1 
2029 O OE2 . GLU B 113 ? 0.6334 0.7476 0.8273 0.2708  0.1253  0.1870  108 GLU B OE2 
2030 N N   . HIS B 114 ? 0.4673 0.4979 0.5989 0.2036  0.1026  0.1155  109 HIS B N   
2031 C CA  . HIS B 114 ? 0.4923 0.5358 0.6124 0.2080  0.1085  0.1066  109 HIS B CA  
2032 C C   . HIS B 114 ? 0.4874 0.5123 0.5900 0.1904  0.1026  0.0893  109 HIS B C   
2033 O O   . HIS B 114 ? 0.4347 0.4734 0.5284 0.1911  0.1063  0.0831  109 HIS B O   
2034 C CB  . HIS B 114 ? 0.4288 0.5287 0.5621 0.2054  0.1111  0.1229  109 HIS B CB  
2035 C CG  . HIS B 114 ? 0.4986 0.6256 0.6492 0.2251  0.1187  0.1412  109 HIS B CG  
2036 N ND1 . HIS B 114 ? 0.5786 0.7268 0.7477 0.2192  0.1145  0.1594  109 HIS B ND1 
2037 C CD2 . HIS B 114 ? 0.5707 0.7089 0.7230 0.2515  0.1305  0.1450  109 HIS B CD2 
2038 C CE1 . HIS B 114 ? 0.5873 0.7593 0.7700 0.2407  0.1231  0.1745  109 HIS B CE1 
2039 N NE2 . HIS B 114 ? 0.6245 0.7901 0.7963 0.2603  0.1328  0.1656  109 HIS B NE2 
2040 N N   . SER B 115 ? 0.3988 0.3958 0.4972 0.1749  0.0935  0.0831  110 SER B N   
2041 C CA  . SER B 115 ? 0.4239 0.4057 0.5074 0.1582  0.0875  0.0688  110 SER B CA  
2042 C C   . SER B 115 ? 0.4582 0.4757 0.5421 0.1456  0.0861  0.0720  110 SER B C   
2043 O O   . SER B 115 ? 0.4310 0.4458 0.5019 0.1407  0.0861  0.0613  110 SER B O   
2044 C CB  . SER B 115 ? 0.4743 0.4228 0.5384 0.1678  0.0914  0.0514  110 SER B CB  
2045 O OG  . SER B 115 ? 0.4669 0.3803 0.5280 0.1816  0.0933  0.0491  110 SER B OG  
2046 N N   . ASP B 116 ? 0.4119 0.4620 0.5100 0.1397  0.0841  0.0877  111 ASP B N   
2047 C CA  . ASP B 116 ? 0.3864 0.4696 0.4844 0.1262  0.0813  0.0934  111 ASP B CA  
2048 C C   . ASP B 116 ? 0.3706 0.4382 0.4565 0.1070  0.0730  0.0833  111 ASP B C   
2049 O O   . ASP B 116 ? 0.3639 0.4216 0.4519 0.0967  0.0666  0.0846  111 ASP B O   
2050 C CB  . ASP B 116 ? 0.4525 0.5688 0.5664 0.1220  0.0795  0.1126  111 ASP B CB  
2051 C CG  . ASP B 116 ? 0.4810 0.6320 0.5934 0.1081  0.0761  0.1206  111 ASP B CG  
2052 O OD1 . ASP B 116 ? 0.4012 0.5438 0.5012 0.0920  0.0697  0.1128  111 ASP B OD1 
2053 O OD2 . ASP B 116 ? 0.5678 0.7547 0.6911 0.1129  0.0796  0.1359  111 ASP B OD2 
2054 N N   . ALA B 117 ? 0.3532 0.4205 0.4267 0.1033  0.0734  0.0739  112 ALA B N   
2055 C CA  . ALA B 117 ? 0.4037 0.4555 0.4650 0.0876  0.0664  0.0642  112 ALA B CA  
2056 C C   . ALA B 117 ? 0.3729 0.4418 0.4346 0.0711  0.0592  0.0723  112 ALA B C   
2057 O O   . ALA B 117 ? 0.3577 0.4112 0.4130 0.0605  0.0531  0.0674  112 ALA B O   
2058 C CB  . ALA B 117 ? 0.3747 0.4238 0.4231 0.0883  0.0688  0.0538  112 ALA B CB  
2059 N N   . ALA B 118 ? 0.3553 0.4557 0.4229 0.0689  0.0598  0.0849  113 ALA B N   
2060 C CA  . ALA B 118 ? 0.3796 0.4930 0.4443 0.0523  0.0522  0.0926  113 ALA B CA  
2061 C C   . ALA B 118 ? 0.4289 0.5339 0.4994 0.0487  0.0483  0.0965  113 ALA B C   
2062 O O   . ALA B 118 ? 0.3365 0.4317 0.3979 0.0365  0.0418  0.0936  113 ALA B O   
2063 C CB  . ALA B 118 ? 0.4058 0.5568 0.4764 0.0497  0.0528  0.1077  113 ALA B CB  
2064 N N   . GLU B 119 ? 0.3468 0.4553 0.4316 0.0600  0.0525  0.1033  114 GLU B N   
2065 C CA  . GLU B 119 ? 0.2960 0.3982 0.3875 0.0569  0.0490  0.1080  114 GLU B CA  
2066 C C   . GLU B 119 ? 0.3058 0.3765 0.3904 0.0553  0.0465  0.0956  114 GLU B C   
2067 O O   . GLU B 119 ? 0.2976 0.3634 0.3796 0.0465  0.0413  0.0960  114 GLU B O   
2068 C CB  . GLU B 119 ? 0.3037 0.4161 0.4127 0.0700  0.0538  0.1193  114 GLU B CB  
2069 C CG  . GLU B 119 ? 0.3703 0.5197 0.4889 0.0722  0.0564  0.1347  114 GLU B CG  
2070 C CD  . GLU B 119 ? 0.4551 0.6260 0.5693 0.0537  0.0491  0.1437  114 GLU B CD  
2071 O OE1 . GLU B 119 ? 0.3532 0.5146 0.4640 0.0441  0.0434  0.1430  114 GLU B OE1 
2072 O OE2 . GLU B 119 ? 0.4804 0.6780 0.5934 0.0485  0.0486  0.1518  114 GLU B OE2 
2073 N N   . LEU B 120 ? 0.3199 0.3705 0.4009 0.0639  0.0500  0.0850  115 LEU B N   
2074 C CA  . LEU B 120 ? 0.2969 0.3199 0.3715 0.0610  0.0469  0.0749  115 LEU B CA  
2075 C C   . LEU B 120 ? 0.3280 0.3491 0.3898 0.0481  0.0416  0.0691  115 LEU B C   
2076 O O   . LEU B 120 ? 0.2999 0.3111 0.3594 0.0425  0.0375  0.0673  115 LEU B O   
2077 C CB  . LEU B 120 ? 0.3345 0.3356 0.4038 0.0704  0.0509  0.0641  115 LEU B CB  
2078 C CG  . LEU B 120 ? 0.4907 0.4653 0.5522 0.0648  0.0465  0.0544  115 LEU B CG  
2079 C CD1 . LEU B 120 ? 0.3666 0.3323 0.4374 0.0636  0.0430  0.0609  115 LEU B CD1 
2080 C CD2 . LEU B 120 ? 0.4662 0.4194 0.5180 0.0716  0.0497  0.0427  115 LEU B CD2 
2081 N N   . GLY B 121 ? 0.3386 0.3702 0.3919 0.0441  0.0418  0.0673  116 GLY B N   
2082 C CA  . GLY B 121 ? 0.2795 0.3068 0.3191 0.0330  0.0367  0.0624  116 GLY B CA  
2083 C C   . GLY B 121 ? 0.2867 0.3201 0.3248 0.0249  0.0319  0.0689  116 GLY B C   
2084 O O   . GLY B 121 ? 0.3076 0.3297 0.3362 0.0197  0.0283  0.0641  116 GLY B O   
2085 N N   . ARG B 122 ? 0.2875 0.3400 0.3342 0.0244  0.0322  0.0802  117 ARG B N   
2086 C CA  . ARG B 122 ? 0.2465 0.3055 0.2910 0.0166  0.0277  0.0867  117 ARG B CA  
2087 C C   . ARG B 122 ? 0.2700 0.3180 0.3200 0.0195  0.0272  0.0854  117 ARG B C   
2088 O O   . ARG B 122 ? 0.3450 0.3898 0.3866 0.0139  0.0237  0.0845  117 ARG B O   
2089 C CB  . ARG B 122 ? 0.4302 0.5144 0.4849 0.0153  0.0280  0.1008  117 ARG B CB  
2090 C CG  . ARG B 122 ? 0.5056 0.6074 0.5553 0.0095  0.0271  0.1059  117 ARG B CG  
2091 C CD  . ARG B 122 ? 0.5937 0.7244 0.6551 0.0076  0.0270  0.1221  117 ARG B CD  
2092 N NE  . ARG B 122 ? 0.6988 0.8509 0.7566 0.0008  0.0255  0.1294  117 ARG B NE  
2093 C CZ  . ARG B 122 ? 0.8834 1.0381 0.9244 -0.0155 0.0180  0.1314  117 ARG B CZ  
2094 N NH1 . ARG B 122 ? 0.9421 1.0775 0.9673 -0.0243 0.0124  0.1253  117 ARG B NH1 
2095 N NH2 . ARG B 122 ? 0.9113 1.0876 0.9501 -0.0228 0.0160  0.1401  117 ARG B NH2 
2096 N N   . MET B 123 ? 0.2515 0.2941 0.3147 0.0285  0.0306  0.0862  118 MET B N   
2097 C CA  . MET B 123 ? 0.2693 0.3023 0.3389 0.0299  0.0293  0.0870  118 MET B CA  
2098 C C   . MET B 123 ? 0.3658 0.3825 0.4244 0.0269  0.0271  0.0768  118 MET B C   
2099 O O   . MET B 123 ? 0.2785 0.2951 0.3356 0.0236  0.0243  0.0782  118 MET B O   
2100 C CB  . MET B 123 ? 0.2784 0.3039 0.3617 0.0393  0.0324  0.0897  118 MET B CB  
2101 C CG  . MET B 123 ? 0.3913 0.4105 0.4833 0.0388  0.0297  0.0948  118 MET B CG  
2102 S SD  . MET B 123 ? 0.4645 0.4827 0.5738 0.0494  0.0327  0.1049  118 MET B SD  
2103 C CE  . MET B 123 ? 0.4662 0.4828 0.5848 0.0440  0.0273  0.1138  118 MET B CE  
2104 N N   . LEU B 124 ? 0.2999 0.3055 0.3512 0.0285  0.0285  0.0675  119 LEU B N   
2105 C CA  . LEU B 124 ? 0.2912 0.2839 0.3324 0.0256  0.0264  0.0591  119 LEU B CA  
2106 C C   . LEU B 124 ? 0.2933 0.2900 0.3217 0.0200  0.0236  0.0582  119 LEU B C   
2107 O O   . LEU B 124 ? 0.2690 0.2609 0.2926 0.0190  0.0218  0.0559  119 LEU B O   
2108 C CB  . LEU B 124 ? 0.2637 0.2456 0.2985 0.0278  0.0284  0.0498  119 LEU B CB  
2109 C CG  . LEU B 124 ? 0.3109 0.2817 0.3529 0.0345  0.0312  0.0477  119 LEU B CG  
2110 C CD1 . LEU B 124 ? 0.3181 0.2786 0.3503 0.0359  0.0330  0.0373  119 LEU B CD1 
2111 C CD2 . LEU B 124 ? 0.3375 0.2974 0.3858 0.0337  0.0284  0.0499  119 LEU B CD2 
2112 N N   A GLN B 125 ? 0.2730 0.2782 0.2948 0.0165  0.0230  0.0606  120 GLN B N   
2113 N N   B GLN B 125 ? 0.2736 0.2790 0.2955 0.0164  0.0230  0.0608  120 GLN B N   
2114 C CA  A GLN B 125 ? 0.2950 0.2996 0.3010 0.0109  0.0197  0.0597  120 GLN B CA  
2115 C CA  B GLN B 125 ? 0.2866 0.2906 0.2924 0.0110  0.0197  0.0593  120 GLN B CA  
2116 C C   A GLN B 125 ? 0.2698 0.2792 0.2774 0.0110  0.0186  0.0644  120 GLN B C   
2117 C C   B GLN B 125 ? 0.2699 0.2797 0.2768 0.0107  0.0184  0.0645  120 GLN B C   
2118 O O   A GLN B 125 ? 0.3241 0.3275 0.3198 0.0112  0.0172  0.0608  120 GLN B O   
2119 O O   B GLN B 125 ? 0.2883 0.2924 0.2821 0.0103  0.0169  0.0612  120 GLN B O   
2120 C CB  A GLN B 125 ? 0.2809 0.2946 0.2802 0.0046  0.0179  0.0641  120 GLN B CB  
2121 C CB  B GLN B 125 ? 0.3245 0.3352 0.3217 0.0047  0.0179  0.0621  120 GLN B CB  
2122 C CG  A GLN B 125 ? 0.3569 0.3675 0.3483 0.0017  0.0175  0.0601  120 GLN B CG  
2123 C CG  B GLN B 125 ? 0.3908 0.3951 0.3676 -0.0019 0.0135  0.0608  120 GLN B CG  
2124 C CD  A GLN B 125 ? 0.4751 0.4983 0.4605 -0.0069 0.0144  0.0673  120 GLN B CD  
2125 C CD  B GLN B 125 ? 0.4879 0.4927 0.4519 -0.0107 0.0098  0.0619  120 GLN B CD  
2126 O OE1 A GLN B 125 ? 0.4707 0.5113 0.4680 -0.0060 0.0166  0.0744  120 GLN B OE1 
2127 O OE1 B GLN B 125 ? 0.5489 0.5616 0.5199 -0.0112 0.0112  0.0636  120 GLN B OE1 
2128 N NE2 A GLN B 125 ? 0.5309 0.5453 0.4968 -0.0152 0.0091  0.0662  120 GLN B NE2 
2129 N NE2 B GLN B 125 ? 0.4872 0.4829 0.4306 -0.0179 0.0049  0.0613  120 GLN B NE2 
2130 N N   . LEU B 126 ? 0.2774 0.2994 0.2995 0.0118  0.0194  0.0731  121 LEU B N   
2131 C CA  . LEU B 126 ? 0.3082 0.3386 0.3340 0.0115  0.0183  0.0793  121 LEU B CA  
2132 C C   . LEU B 126 ? 0.2715 0.2960 0.3004 0.0150  0.0184  0.0768  121 LEU B C   
2133 O O   . LEU B 126 ? 0.2936 0.3224 0.3160 0.0152  0.0176  0.0777  121 LEU B O   
2134 C CB  . LEU B 126 ? 0.2933 0.3381 0.3371 0.0121  0.0190  0.0904  121 LEU B CB  
2135 C CG  . LEU B 126 ? 0.3912 0.4501 0.4331 0.0071  0.0180  0.0972  121 LEU B CG  
2136 C CD1 . LEU B 126 ? 0.3705 0.4450 0.4325 0.0095  0.0191  0.1096  121 LEU B CD1 
2137 C CD2 . LEU B 126 ? 0.4273 0.4887 0.4510 0.0005  0.0147  0.0967  121 LEU B CD2 
2138 N N   . ILE B 127 ? 0.2417 0.2576 0.2796 0.0176  0.0194  0.0741  122 ILE B N   
2139 C CA  . ILE B 127 ? 0.2829 0.2948 0.3243 0.0186  0.0183  0.0736  122 ILE B CA  
2140 C C   . ILE B 127 ? 0.2623 0.2693 0.2883 0.0192  0.0180  0.0665  122 ILE B C   
2141 O O   . ILE B 127 ? 0.2800 0.2935 0.3049 0.0204  0.0173  0.0691  122 ILE B O   
2142 C CB  . ILE B 127 ? 0.2816 0.2814 0.3325 0.0197  0.0184  0.0717  122 ILE B CB  
2143 C CG1 . ILE B 127 ? 0.2812 0.2843 0.3470 0.0212  0.0188  0.0802  122 ILE B CG1 
2144 C CG2 . ILE B 127 ? 0.2828 0.2781 0.3348 0.0177  0.0159  0.0713  122 ILE B CG2 
2145 C CD1 . ILE B 127 ? 0.3433 0.3293 0.4155 0.0236  0.0189  0.0779  122 ILE B CD1 
2146 N N   . LEU B 128 ? 0.2745 0.2719 0.2890 0.0190  0.0187  0.0588  123 LEU B N   
2147 C CA  . LEU B 128 ? 0.2949 0.2860 0.2936 0.0204  0.0182  0.0529  123 LEU B CA  
2148 C C   . LEU B 128 ? 0.3000 0.2961 0.2868 0.0219  0.0179  0.0549  123 LEU B C   
2149 O O   . LEU B 128 ? 0.2897 0.2854 0.2677 0.0264  0.0184  0.0535  123 LEU B O   
2150 C CB  . LEU B 128 ? 0.3130 0.2930 0.3014 0.0186  0.0181  0.0459  123 LEU B CB  
2151 C CG  . LEU B 128 ? 0.3675 0.3379 0.3420 0.0206  0.0174  0.0399  123 LEU B CG  
2152 C CD1 . LEU B 128 ? 0.3874 0.3497 0.3599 0.0182  0.0173  0.0343  123 LEU B CD1 
2153 C CD2 . LEU B 128 ? 0.3893 0.3539 0.3449 0.0213  0.0163  0.0385  123 LEU B CD2 
2154 N N   . GLY B 129 ? 0.2914 0.2928 0.2768 0.0187  0.0174  0.0586  124 GLY B N   
2155 C CA  . GLY B 129 ? 0.3442 0.3504 0.3174 0.0193  0.0169  0.0606  124 GLY B CA  
2156 C C   . GLY B 129 ? 0.3300 0.3496 0.3103 0.0241  0.0182  0.0660  124 GLY B C   
2157 O O   . GLY B 129 ? 0.3405 0.3602 0.3064 0.0293  0.0192  0.0641  124 GLY B O   
2158 N N   . CYS B 130 ? 0.3158 0.3464 0.3172 0.0227  0.0181  0.0732  125 CYS B N   
2159 C CA  . CYS B 130 ? 0.2587 0.3046 0.2691 0.0253  0.0183  0.0805  125 CYS B CA  
2160 C C   . CYS B 130 ? 0.2952 0.3394 0.3007 0.0303  0.0192  0.0773  125 CYS B C   
2161 O O   . CYS B 130 ? 0.3209 0.3776 0.3217 0.0357  0.0206  0.0806  125 CYS B O   
2162 C CB  . CYS B 130 ? 0.3457 0.3989 0.3787 0.0212  0.0166  0.0892  125 CYS B CB  
2163 S SG  . CYS B 130 ? 0.3200 0.3810 0.3628 0.0171  0.0159  0.0969  125 CYS B SG  
2164 N N   . ALA B 131 ? 0.3030 0.3341 0.3098 0.0291  0.0186  0.0717  126 ALA B N   
2165 C CA  . ALA B 131 ? 0.2677 0.2988 0.2712 0.0328  0.0189  0.0699  126 ALA B CA  
2166 C C   . ALA B 131 ? 0.2945 0.3222 0.2776 0.0411  0.0213  0.0650  126 ALA B C   
2167 O O   . ALA B 131 ? 0.3225 0.3617 0.3039 0.0476  0.0228  0.0685  126 ALA B O   
2168 C CB  . ALA B 131 ? 0.2576 0.2739 0.2635 0.0290  0.0175  0.0638  126 ALA B CB  
2169 N N   . VAL B 132 ? 0.2932 0.3050 0.2601 0.0411  0.0214  0.0577  127 VAL B N   
2170 C CA  . VAL B 132 ? 0.2850 0.2862 0.2293 0.0492  0.0230  0.0520  127 VAL B CA  
2171 C C   . VAL B 132 ? 0.3661 0.3731 0.2974 0.0548  0.0249  0.0535  127 VAL B C   
2172 O O   . VAL B 132 ? 0.3635 0.3585 0.2721 0.0630  0.0265  0.0482  127 VAL B O   
2173 C CB  . VAL B 132 ? 0.3419 0.3189 0.2705 0.0456  0.0210  0.0433  127 VAL B CB  
2174 C CG1 . VAL B 132 ? 0.3434 0.3165 0.2828 0.0416  0.0199  0.0414  127 VAL B CG1 
2175 C CG2 . VAL B 132 ? 0.3575 0.3298 0.2823 0.0373  0.0188  0.0428  127 VAL B CG2 
2176 N N   . ASN B 133 ? 0.3015 0.3261 0.2458 0.0509  0.0247  0.0610  128 ASN B N   
2177 C CA  . ASN B 133 ? 0.3110 0.3453 0.2438 0.0557  0.0266  0.0633  128 ASN B CA  
2178 C C   . ASN B 133 ? 0.3083 0.3718 0.2566 0.0598  0.0286  0.0740  128 ASN B C   
2179 O O   . ASN B 133 ? 0.3579 0.4334 0.2966 0.0656  0.0311  0.0766  128 ASN B O   
2180 C CB  . ASN B 133 ? 0.3858 0.4175 0.3162 0.0465  0.0241  0.0639  128 ASN B CB  
2181 C CG  . ASN B 133 ? 0.4729 0.4784 0.3793 0.0433  0.0218  0.0544  128 ASN B CG  
2182 O OD1 . ASN B 133 ? 0.4740 0.4658 0.3542 0.0494  0.0226  0.0483  128 ASN B OD1 
2183 N ND2 . ASN B 133 ? 0.3944 0.3919 0.3083 0.0340  0.0188  0.0535  128 ASN B ND2 
2184 N N   . CYS B 134 ? 0.3445 0.4192 0.3150 0.0559  0.0272  0.0805  129 CYS B N   
2185 C CA  . CYS B 134 ? 0.3134 0.4169 0.3007 0.0564  0.0273  0.0929  129 CYS B CA  
2186 C C   . CYS B 134 ? 0.3242 0.4424 0.3039 0.0687  0.0312  0.0954  129 CYS B C   
2187 O O   . CYS B 134 ? 0.3271 0.4301 0.2887 0.0778  0.0339  0.0869  129 CYS B O   
2188 C CB  . CYS B 134 ? 0.3054 0.4120 0.3165 0.0460  0.0230  0.0994  129 CYS B CB  
2189 S SG  . CYS B 134 ? 0.3199 0.4171 0.3339 0.0456  0.0216  0.0959  129 CYS B SG  
2190 N N   . GLU B 135 ? 0.3351 0.4841 0.3287 0.0694  0.0314  0.1083  130 GLU B N   
2191 C CA  . GLU B 135 ? 0.3732 0.5443 0.3629 0.0818  0.0355  0.1140  130 GLU B CA  
2192 C C   . GLU B 135 ? 0.3717 0.5346 0.3619 0.0842  0.0352  0.1113  130 GLU B C   
2193 O O   . GLU B 135 ? 0.3664 0.5330 0.3435 0.0985  0.0399  0.1096  130 GLU B O   
2194 C CB  . GLU B 135 ? 0.4045 0.6140 0.4143 0.0778  0.0340  0.1313  130 GLU B CB  
2195 C CG  . GLU B 135 ? 0.6327 0.8735 0.6388 0.0920  0.0392  0.1398  130 GLU B CG  
2196 C CD  . GLU B 135 ? 0.8337 1.1128 0.8509 0.0910  0.0396  0.1549  130 GLU B CD  
2197 O OE1 . GLU B 135 ? 0.8189 1.0966 0.8282 0.0915  0.0410  0.1522  130 GLU B OE1 
2198 O OE2 . GLU B 135 ? 0.9566 1.2689 0.9904 0.0885  0.0377  0.1705  130 GLU B OE2 
2199 N N   . GLN B 136 ? 0.2965 0.4485 0.3009 0.0710  0.0297  0.1112  131 GLN B N   
2200 C CA  . GLN B 136 ? 0.2974 0.4415 0.3029 0.0705  0.0283  0.1087  131 GLN B CA  
2201 C C   . GLN B 136 ? 0.3106 0.4206 0.2994 0.0729  0.0292  0.0937  131 GLN B C   
2202 O O   . GLN B 136 ? 0.3413 0.4409 0.3328 0.0685  0.0268  0.0907  131 GLN B O   
2203 C CB  . GLN B 136 ? 0.3737 0.5195 0.3992 0.0544  0.0215  0.1149  131 GLN B CB  
2204 C CG  . GLN B 136 ? 0.4551 0.6309 0.4987 0.0470  0.0179  0.1313  131 GLN B CG  
2205 C CD  . GLN B 136 ? 0.5423 0.7093 0.6005 0.0299  0.0100  0.1350  131 GLN B CD  
2206 O OE1 . GLN B 136 ? 0.4755 0.6207 0.5369 0.0222  0.0074  0.1297  131 GLN B OE1 
2207 N NE2 . GLN B 136 ? 0.4918 0.6750 0.5574 0.0244  0.0062  0.1444  131 GLN B NE2 
2208 N N   . LYS B 137 ? 0.3270 0.4201 0.2981 0.0783  0.0318  0.0849  132 LYS B N   
2209 C CA  . LYS B 137 ? 0.3056 0.3662 0.2623 0.0763  0.0308  0.0722  132 LYS B CA  
2210 C C   . LYS B 137 ? 0.3794 0.4291 0.3262 0.0834  0.0318  0.0679  132 LYS B C   
2211 O O   . LYS B 137 ? 0.3296 0.3589 0.2735 0.0773  0.0293  0.0608  132 LYS B O   
2212 C CB  . LYS B 137 ? 0.3857 0.4309 0.3216 0.0801  0.0324  0.0650  132 LYS B CB  
2213 C CG  . LYS B 137 ? 0.3789 0.4281 0.2949 0.0963  0.0376  0.0644  132 LYS B CG  
2214 C CD  . LYS B 137 ? 0.5049 0.5381 0.3999 0.0963  0.0377  0.0576  132 LYS B CD  
2215 C CE  . LYS B 137 ? 0.6327 0.6636 0.5022 0.1133  0.0430  0.0545  132 LYS B CE  
2216 N NZ  . LYS B 137 ? 0.6406 0.6528 0.4870 0.1102  0.0418  0.0473  132 LYS B NZ  
2217 N N   . GLN B 138 ? 0.3568 0.4221 0.2989 0.0968  0.0357  0.0730  133 GLN B N   
2218 C CA  . GLN B 138 ? 0.3859 0.4424 0.3197 0.1044  0.0367  0.0705  133 GLN B CA  
2219 C C   . GLN B 138 ? 0.3565 0.4194 0.3087 0.0925  0.0323  0.0744  133 GLN B C   
2220 O O   . GLN B 138 ? 0.3558 0.4014 0.3020 0.0911  0.0308  0.0686  133 GLN B O   
2221 C CB  . GLN B 138 ? 0.3988 0.4745 0.3253 0.1231  0.0425  0.0771  133 GLN B CB  
2222 C CG  . GLN B 138 ? 0.4978 0.5569 0.3972 0.1381  0.0474  0.0697  133 GLN B CG  
2223 C CD  . GLN B 138 ? 0.7075 0.7259 0.5822 0.1418  0.0464  0.0571  133 GLN B CD  
2224 O OE1 . GLN B 138 ? 0.6308 0.6365 0.5099 0.1341  0.0427  0.0547  133 GLN B OE1 
2225 N NE2 . GLN B 138 ? 0.7115 0.7087 0.5584 0.1532  0.0494  0.0495  133 GLN B NE2 
2226 N N   . GLU B 139 ? 0.3089 0.3954 0.2817 0.0834  0.0297  0.0842  134 GLU B N   
2227 C CA  . GLU B 139 ? 0.2720 0.3603 0.2594 0.0697  0.0244  0.0869  134 GLU B CA  
2228 C C   . GLU B 139 ? 0.2881 0.3476 0.2729 0.0593  0.0215  0.0755  134 GLU B C   
2229 O O   . GLU B 139 ? 0.3139 0.3636 0.2985 0.0541  0.0192  0.0717  134 GLU B O   
2230 C CB  . GLU B 139 ? 0.4049 0.5176 0.4119 0.0597  0.0208  0.0990  134 GLU B CB  
2231 C CG  . GLU B 139 ? 0.5313 0.6379 0.5495 0.0435  0.0143  0.0996  134 GLU B CG  
2232 C CD  . GLU B 139 ? 0.7231 0.8439 0.7575 0.0311  0.0091  0.1101  134 GLU B CD  
2233 O OE1 . GLU B 139 ? 0.8106 0.9538 0.8507 0.0348  0.0105  0.1199  134 GLU B OE1 
2234 O OE2 . GLU B 139 ? 0.7019 0.8102 0.7419 0.0176  0.0034  0.1087  134 GLU B OE2 
2235 N N   . TYR B 140 ? 0.2856 0.3342 0.2686 0.0565  0.0218  0.0709  135 TYR B N   
2236 C CA  . TYR B 140 ? 0.2927 0.3195 0.2752 0.0475  0.0195  0.0623  135 TYR B CA  
2237 C C   . TYR B 140 ? 0.2759 0.2813 0.2407 0.0514  0.0206  0.0526  135 TYR B C   
2238 O O   . TYR B 140 ? 0.3017 0.2942 0.2662 0.0450  0.0186  0.0470  135 TYR B O   
2239 C CB  . TYR B 140 ? 0.2785 0.3046 0.2671 0.0429  0.0192  0.0631  135 TYR B CB  
2240 C CG  . TYR B 140 ? 0.2833 0.3258 0.2902 0.0362  0.0165  0.0727  135 TYR B CG  
2241 C CD1 . TYR B 140 ? 0.3692 0.4063 0.3855 0.0269  0.0127  0.0729  135 TYR B CD1 
2242 C CD2 . TYR B 140 ? 0.3116 0.3741 0.3245 0.0387  0.0173  0.0820  135 TYR B CD2 
2243 C CE1 . TYR B 140 ? 0.4550 0.5028 0.4853 0.0191  0.0087  0.0822  135 TYR B CE1 
2244 C CE2 . TYR B 140 ? 0.3489 0.4260 0.3784 0.0308  0.0135  0.0925  135 TYR B CE2 
2245 C CZ  . TYR B 140 ? 0.4222 0.4901 0.4598 0.0206  0.0089  0.0925  135 TYR B CZ  
2246 O OH  . TYR B 140 ? 0.3853 0.4632 0.4367 0.0112  0.0038  0.1031  135 TYR B OH  
2247 N N   . ILE B 141 ? 0.3470 0.3480 0.2957 0.0620  0.0234  0.0509  136 ILE B N   
2248 C CA  . ILE B 141 ? 0.3420 0.3204 0.2717 0.0655  0.0232  0.0431  136 ILE B CA  
2249 C C   . ILE B 141 ? 0.3752 0.3545 0.3060 0.0673  0.0225  0.0440  136 ILE B C   
2250 O O   . ILE B 141 ? 0.3426 0.3060 0.2673 0.0625  0.0203  0.0385  136 ILE B O   
2251 C CB  . ILE B 141 ? 0.4134 0.3827 0.3220 0.0776  0.0261  0.0409  136 ILE B CB  
2252 C CG1 . ILE B 141 ? 0.4295 0.3926 0.3328 0.0725  0.0254  0.0383  136 ILE B CG1 
2253 C CG2 . ILE B 141 ? 0.4327 0.3770 0.3203 0.0826  0.0252  0.0345  136 ILE B CG2 
2254 C CD1 . ILE B 141 ? 0.5480 0.4900 0.4437 0.0620  0.0215  0.0316  136 ILE B CD1 
2255 N N   . GLN B 142 ? 0.3493 0.3501 0.2886 0.0732  0.0240  0.0524  137 GLN B N   
2256 C CA  . GLN B 142 ? 0.3392 0.3454 0.2818 0.0733  0.0228  0.0553  137 GLN B CA  
2257 C C   . GLN B 142 ? 0.3477 0.3505 0.3010 0.0581  0.0185  0.0526  137 GLN B C   
2258 O O   . GLN B 142 ? 0.3549 0.3495 0.3041 0.0554  0.0168  0.0496  137 GLN B O   
2259 C CB  . GLN B 142 ? 0.3800 0.4162 0.3326 0.0803  0.0246  0.0674  137 GLN B CB  
2260 C CG  . GLN B 142 ? 0.4492 0.4952 0.4057 0.0804  0.0230  0.0726  137 GLN B CG  
2261 C CD  . GLN B 142 ? 0.6736 0.7018 0.6123 0.0921  0.0250  0.0683  137 GLN B CD  
2262 O OE1 . GLN B 142 ? 0.7839 0.8047 0.7214 0.0871  0.0223  0.0666  137 GLN B OE1 
2263 N NE2 . GLN B 142 ? 0.8605 0.8802 0.7837 0.1078  0.0296  0.0665  137 GLN B NE2 
2264 N N   . ALA B 143 ? 0.3273 0.3351 0.2930 0.0489  0.0169  0.0535  138 ALA B N   
2265 C CA  . ALA B 143 ? 0.3446 0.3469 0.3183 0.0362  0.0134  0.0502  138 ALA B CA  
2266 C C   . ALA B 143 ? 0.3236 0.3047 0.2880 0.0332  0.0134  0.0402  138 ALA B C   
2267 O O   . ALA B 143 ? 0.3375 0.3128 0.3015 0.0269  0.0115  0.0362  138 ALA B O   
2268 C CB  . ALA B 143 ? 0.3392 0.3476 0.3262 0.0289  0.0118  0.0537  138 ALA B CB  
2269 N N   . ILE B 144 ? 0.2892 0.2606 0.2453 0.0371  0.0152  0.0368  139 ILE B N   
2270 C CA  . ILE B 144 ? 0.3199 0.2748 0.2670 0.0333  0.0145  0.0295  139 ILE B CA  
2271 C C   . ILE B 144 ? 0.3855 0.3311 0.3200 0.0357  0.0134  0.0272  139 ILE B C   
2272 O O   . ILE B 144 ? 0.3346 0.2737 0.2671 0.0294  0.0118  0.0232  139 ILE B O   
2273 C CB  . ILE B 144 ? 0.3363 0.2842 0.2758 0.0351  0.0154  0.0282  139 ILE B CB  
2274 C CG1 . ILE B 144 ? 0.3811 0.3368 0.3344 0.0306  0.0160  0.0303  139 ILE B CG1 
2275 C CG2 . ILE B 144 ? 0.3832 0.3151 0.3093 0.0312  0.0136  0.0229  139 ILE B CG2 
2276 C CD1 . ILE B 144 ? 0.3755 0.3323 0.3245 0.0330  0.0169  0.0324  139 ILE B CD1 
2277 N N   . MET B 145 ? 0.3485 0.2942 0.2742 0.0455  0.0146  0.0303  140 MET B N   
2278 C CA  . MET B 145 ? 0.3822 0.3179 0.2961 0.0487  0.0133  0.0293  140 MET B CA  
2279 C C   . MET B 145 ? 0.3719 0.3196 0.2959 0.0439  0.0118  0.0320  140 MET B C   
2280 O O   . MET B 145 ? 0.3792 0.3197 0.2968 0.0415  0.0097  0.0304  140 MET B O   
2281 C CB  . MET B 145 ? 0.4164 0.3476 0.3171 0.0631  0.0155  0.0321  140 MET B CB  
2282 C CG  . MET B 145 ? 0.3946 0.3066 0.2778 0.0668  0.0158  0.0275  140 MET B CG  
2283 S SD  . MET B 145 ? 0.4927 0.3806 0.3630 0.0545  0.0110  0.0208  140 MET B SD  
2284 C CE  . MET B 145 ? 0.5298 0.4028 0.3877 0.0567  0.0080  0.0209  140 MET B CE  
2285 N N   . MET B 146 ? 0.3307 0.2965 0.2695 0.0410  0.0119  0.0367  141 MET B N   
2286 C CA  . MET B 146 ? 0.3960 0.3717 0.3422 0.0336  0.0094  0.0389  141 MET B CA  
2287 C C   . MET B 146 ? 0.3004 0.2667 0.2473 0.0222  0.0075  0.0313  141 MET B C   
2288 O O   . MET B 146 ? 0.3478 0.3167 0.2946 0.0162  0.0053  0.0308  141 MET B O   
2289 C CB  . MET B 146 ? 0.3831 0.3795 0.3429 0.0312  0.0086  0.0470  141 MET B CB  
2290 C CG  . MET B 146 ? 0.5445 0.5584 0.5050 0.0426  0.0105  0.0571  141 MET B CG  
2291 S SD  . MET B 146 ? 0.7009 0.7179 0.6545 0.0478  0.0097  0.0609  141 MET B SD  
2292 C CE  . MET B 146 ? 0.9227 0.9636 0.8787 0.0645  0.0136  0.0739  141 MET B CE  
2293 N N   . MET B 147 ? 0.3234 0.2803 0.2702 0.0200  0.0086  0.0260  142 MET B N   
2294 C CA  . MET B 147 ? 0.3321 0.2813 0.2779 0.0125  0.0082  0.0191  142 MET B CA  
2295 C C   . MET B 147 ? 0.3540 0.2960 0.2884 0.0118  0.0070  0.0167  142 MET B C   
2296 O O   . MET B 147 ? 0.3220 0.2641 0.2551 0.0055  0.0059  0.0133  142 MET B O   
2297 C CB  . MET B 147 ? 0.3396 0.2835 0.2880 0.0123  0.0101  0.0161  142 MET B CB  
2298 C CG  . MET B 147 ? 0.3723 0.3215 0.3324 0.0117  0.0108  0.0186  142 MET B CG  
2299 S SD  . MET B 147 ? 0.3764 0.3217 0.3398 0.0128  0.0132  0.0172  142 MET B SD  
2300 C CE  . MET B 147 ? 0.3924 0.3324 0.3565 0.0082  0.0143  0.0104  142 MET B CE  
2301 N N   . GLU B 148 ? 0.3441 0.2787 0.2687 0.0181  0.0068  0.0188  143 GLU B N   
2302 C CA  . GLU B 148 ? 0.3479 0.2735 0.2605 0.0172  0.0044  0.0183  143 GLU B CA  
2303 C C   . GLU B 148 ? 0.3764 0.3100 0.2905 0.0167  0.0029  0.0217  143 GLU B C   
2304 O O   . GLU B 148 ? 0.3606 0.2934 0.2709 0.0106  0.0007  0.0203  143 GLU B O   
2305 C CB  . GLU B 148 ? 0.4319 0.3427 0.3304 0.0248  0.0039  0.0199  143 GLU B CB  
2306 C CG  . GLU B 148 ? 0.5200 0.4214 0.4131 0.0229  0.0039  0.0171  143 GLU B CG  
2307 C CD  . GLU B 148 ? 0.6290 0.5190 0.5110 0.0149  0.0002  0.0155  143 GLU B CD  
2308 O OE1 . GLU B 148 ? 0.5314 0.4243 0.4136 0.0097  -0.0017 0.0156  143 GLU B OE1 
2309 O OE2 . GLU B 148 ? 0.5976 0.4773 0.4704 0.0129  -0.0013 0.0149  143 GLU B OE2 
2310 N N   . GLU B 149 ? 0.3614 0.3053 0.2807 0.0230  0.0038  0.0275  144 GLU B N   
2311 C CA  . GLU B 149 ? 0.3774 0.3331 0.2994 0.0223  0.0020  0.0329  144 GLU B CA  
2312 C C   . GLU B 149 ? 0.3214 0.2849 0.2497 0.0097  0.0001  0.0296  144 GLU B C   
2313 O O   . GLU B 149 ? 0.3566 0.3232 0.2817 0.0047  -0.0023 0.0303  144 GLU B O   
2314 C CB  . GLU B 149 ? 0.4041 0.3758 0.3334 0.0304  0.0035  0.0415  144 GLU B CB  
2315 C CG  . GLU B 149 ? 0.6377 0.6024 0.5582 0.0455  0.0063  0.0448  144 GLU B CG  
2316 C CD  . GLU B 149 ? 0.8022 0.7878 0.7290 0.0555  0.0080  0.0556  144 GLU B CD  
2317 O OE1 . GLU B 149 ? 0.8803 0.8859 0.8177 0.0488  0.0058  0.0618  144 GLU B OE1 
2318 O OE2 . GLU B 149 ? 0.9387 0.9221 0.8593 0.0700  0.0116  0.0583  144 GLU B OE2 
2319 N N   . SER B 150 ? 0.3409 0.3057 0.2764 0.0051  0.0010  0.0258  145 SER B N   
2320 C CA  . SER B 150 ? 0.3571 0.3242 0.2955 -0.0056 -0.0005 0.0211  145 SER B CA  
2321 C C   . SER B 150 ? 0.3517 0.3116 0.2823 -0.0104 -0.0005 0.0142  145 SER B C   
2322 O O   . SER B 150 ? 0.3213 0.2859 0.2490 -0.0175 -0.0025 0.0126  145 SER B O   
2323 C CB  . SER B 150 ? 0.4088 0.3726 0.3541 -0.0075 0.0007  0.0181  145 SER B CB  
2324 O OG  . SER B 150 ? 0.4188 0.3793 0.3631 -0.0166 -0.0008 0.0124  145 SER B OG  
2325 N N   . VAL B 151 ? 0.3009 0.2519 0.2276 -0.0073 0.0015  0.0108  146 VAL B N   
2326 C CA  . VAL B 151 ? 0.2961 0.2450 0.2164 -0.0120 0.0015  0.0063  146 VAL B CA  
2327 C C   . VAL B 151 ? 0.3746 0.3264 0.2880 -0.0142 -0.0017 0.0103  146 VAL B C   
2328 O O   . VAL B 151 ? 0.3302 0.2870 0.2399 -0.0207 -0.0026 0.0077  146 VAL B O   
2329 C CB  . VAL B 151 ? 0.4055 0.3476 0.3230 -0.0097 0.0032  0.0048  146 VAL B CB  
2330 C CG1 . VAL B 151 ? 0.4948 0.4398 0.4062 -0.0153 0.0027  0.0026  146 VAL B CG1 
2331 C CG2 . VAL B 151 ? 0.4608 0.4020 0.3859 -0.0077 0.0064  0.0016  146 VAL B CG2 
2332 N N   . GLN B 152 ? 0.3734 0.3222 0.2842 -0.0080 -0.0032 0.0168  147 GLN B N   
2333 C CA  . GLN B 152 ? 0.3969 0.3477 0.3018 -0.0089 -0.0064 0.0220  147 GLN B CA  
2334 C C   . GLN B 152 ? 0.3381 0.3038 0.2471 -0.0153 -0.0081 0.0238  147 GLN B C   
2335 O O   . GLN B 152 ? 0.3261 0.2966 0.2306 -0.0201 -0.0108 0.0262  147 GLN B O   
2336 C CB  . GLN B 152 ? 0.3668 0.3106 0.2676 0.0019  -0.0070 0.0290  147 GLN B CB  
2337 C CG  . GLN B 152 ? 0.4492 0.3749 0.3417 0.0082  -0.0062 0.0275  147 GLN B CG  
2338 C CD  . GLN B 152 ? 0.6192 0.5370 0.5065 0.0005  -0.0072 0.0225  147 GLN B CD  
2339 O OE1 . GLN B 152 ? 0.7724 0.6856 0.6606 0.0014  -0.0052 0.0192  147 GLN B OE1 
2340 N NE2 . GLN B 152 ? 0.6316 0.5502 0.5137 -0.0071 -0.0103 0.0233  147 GLN B NE2 
2341 N N   . HIS B 153 ? 0.3935 0.3669 0.3103 -0.0166 -0.0074 0.0235  148 HIS B N   
2342 C CA  . HIS B 153 ? 0.3528 0.3394 0.2715 -0.0253 -0.0102 0.0253  148 HIS B CA  
2343 C C   . HIS B 153 ? 0.3203 0.3051 0.2331 -0.0348 -0.0102 0.0163  148 HIS B C   
2344 O O   . HIS B 153 ? 0.3402 0.3338 0.2490 -0.0422 -0.0129 0.0173  148 HIS B O   
2345 C CB  . HIS B 153 ? 0.3911 0.3850 0.3180 -0.0268 -0.0107 0.0281  148 HIS B CB  
2346 C CG  . HIS B 153 ? 0.4763 0.4787 0.4094 -0.0171 -0.0103 0.0386  148 HIS B CG  
2347 N ND1 . HIS B 153 ? 0.6113 0.6180 0.5420 -0.0091 -0.0106 0.0466  148 HIS B ND1 
2348 C CD2 . HIS B 153 ? 0.4737 0.4816 0.4146 -0.0128 -0.0092 0.0429  148 HIS B CD2 
2349 C CE1 . HIS B 153 ? 0.6668 0.6816 0.6030 0.0012  -0.0090 0.0548  148 HIS B CE1 
2350 N NE2 . HIS B 153 ? 0.5432 0.5606 0.4861 -0.0015 -0.0082 0.0531  148 HIS B NE2 
2351 N N   . VAL B 154 ? 0.3453 0.3203 0.2574 -0.0337 -0.0068 0.0080  149 VAL B N   
2352 C CA  . VAL B 154 ? 0.3158 0.2898 0.2214 -0.0394 -0.0053 -0.0009 149 VAL B CA  
2353 C C   . VAL B 154 ? 0.3171 0.2965 0.2164 -0.0414 -0.0063 0.0011  149 VAL B C   
2354 O O   . VAL B 154 ? 0.3252 0.3123 0.2184 -0.0484 -0.0074 -0.0015 149 VAL B O   
2355 C CB  . VAL B 154 ? 0.3491 0.3134 0.2565 -0.0348 -0.0007 -0.0080 149 VAL B CB  
2356 C CG1 . VAL B 154 ? 0.3528 0.3180 0.2528 -0.0375 0.0021  -0.0167 149 VAL B CG1 
2357 C CG2 . VAL B 154 ? 0.3211 0.2791 0.2347 -0.0338 -0.0006 -0.0089 149 VAL B CG2 
2358 N N   . VAL B 155 ? 0.3238 0.2984 0.2233 -0.0361 -0.0065 0.0060  150 VAL B N   
2359 C CA  . VAL B 155 ? 0.3379 0.3154 0.2309 -0.0392 -0.0089 0.0097  150 VAL B CA  
2360 C C   . VAL B 155 ? 0.3358 0.3220 0.2265 -0.0434 -0.0132 0.0164  150 VAL B C   
2361 O O   . VAL B 155 ? 0.3251 0.3205 0.2106 -0.0504 -0.0149 0.0168  150 VAL B O   
2362 C CB  . VAL B 155 ? 0.3172 0.2828 0.2080 -0.0339 -0.0099 0.0143  150 VAL B CB  
2363 C CG1 . VAL B 155 ? 0.3840 0.3496 0.2667 -0.0385 -0.0144 0.0205  150 VAL B CG1 
2364 C CG2 . VAL B 155 ? 0.3202 0.2816 0.2130 -0.0319 -0.0063 0.0092  150 VAL B CG2 
2365 N N   . MET B 156 ? 0.3203 0.3066 0.2153 -0.0389 -0.0148 0.0228  151 MET B N   
2366 C CA  . MET B 156 ? 0.3398 0.3371 0.2341 -0.0420 -0.0187 0.0311  151 MET B CA  
2367 C C   . MET B 156 ? 0.3836 0.3951 0.2767 -0.0530 -0.0197 0.0271  151 MET B C   
2368 O O   . MET B 156 ? 0.3451 0.3676 0.2345 -0.0595 -0.0230 0.0314  151 MET B O   
2369 C CB  . MET B 156 ? 0.3312 0.3301 0.2313 -0.0333 -0.0194 0.0400  151 MET B CB  
2370 C CG  . MET B 156 ? 0.3967 0.4102 0.2976 -0.0353 -0.0233 0.0509  151 MET B CG  
2371 S SD  . MET B 156 ? 0.4480 0.4550 0.3399 -0.0359 -0.0269 0.0566  151 MET B SD  
2372 C CE  . MET B 156 ? 0.5761 0.5815 0.4699 -0.0215 -0.0282 0.0709  151 MET B CE  
2373 N N   . THR B 157 ? 0.3259 0.3352 0.2205 -0.0554 -0.0175 0.0190  152 THR B N   
2374 C CA  . THR B 157 ? 0.3559 0.3729 0.2448 -0.0662 -0.0188 0.0132  152 THR B CA  
2375 C C   . THR B 157 ? 0.3388 0.3588 0.2186 -0.0707 -0.0173 0.0069  152 THR B C   
2376 O O   . THR B 157 ? 0.3812 0.4129 0.2544 -0.0794 -0.0199 0.0073  152 THR B O   
2377 C CB  . THR B 157 ? 0.3672 0.3747 0.2563 -0.0676 -0.0170 0.0046  152 THR B CB  
2378 O OG1 . THR B 157 ? 0.4029 0.4118 0.3012 -0.0646 -0.0187 0.0123  152 THR B OG1 
2379 C CG2 . THR B 157 ? 0.4689 0.4791 0.3477 -0.0794 -0.0192 -0.0021 152 THR B CG2 
2380 N N   . ALA B 158 ? 0.3444 0.3566 0.2238 -0.0650 -0.0133 0.0020  153 ALA B N   
2381 C CA  . ALA B 158 ? 0.3487 0.3681 0.2207 -0.0681 -0.0113 -0.0023 153 ALA B CA  
2382 C C   . ALA B 158 ? 0.4281 0.4595 0.2979 -0.0732 -0.0159 0.0074  153 ALA B C   
2383 O O   . ALA B 158 ? 0.3587 0.4033 0.2214 -0.0805 -0.0167 0.0062  153 ALA B O   
2384 C CB  . ALA B 158 ? 0.3715 0.3843 0.2457 -0.0611 -0.0068 -0.0057 153 ALA B CB  
2385 N N   . ILE B 159 ? 0.3592 0.3847 0.2338 -0.0689 -0.0190 0.0173  154 ILE B N   
2386 C CA  . ILE B 159 ? 0.3394 0.3717 0.2115 -0.0727 -0.0241 0.0279  154 ILE B CA  
2387 C C   . ILE B 159 ? 0.3719 0.4194 0.2429 -0.0801 -0.0275 0.0321  154 ILE B C   
2388 O O   . ILE B 159 ? 0.4048 0.4659 0.2708 -0.0879 -0.0302 0.0356  154 ILE B O   
2389 C CB  . ILE B 159 ? 0.3393 0.3566 0.2141 -0.0645 -0.0266 0.0369  154 ILE B CB  
2390 C CG1 . ILE B 159 ? 0.3789 0.3830 0.2510 -0.0615 -0.0255 0.0349  154 ILE B CG1 
2391 C CG2 . ILE B 159 ? 0.3780 0.3996 0.2503 -0.0669 -0.0324 0.0490  154 ILE B CG2 
2392 C CD1 . ILE B 159 ? 0.4131 0.3966 0.2843 -0.0523 -0.0272 0.0404  154 ILE B CD1 
2393 N N   . GLN B 160 ? 0.4072 0.4551 0.2829 -0.0787 -0.0279 0.0327  155 GLN B N   
2394 C CA  . GLN B 160 ? 0.4763 0.5407 0.3512 -0.0872 -0.0318 0.0380  155 GLN B CA  
2395 C C   . GLN B 160 ? 0.4878 0.5619 0.3525 -0.0985 -0.0313 0.0282  155 GLN B C   
2396 O O   . GLN B 160 ? 0.4268 0.5172 0.2871 -0.1077 -0.0351 0.0331  155 GLN B O   
2397 C CB  . GLN B 160 ? 0.4453 0.5102 0.3275 -0.0848 -0.0326 0.0414  155 GLN B CB  
2398 C CG  . GLN B 160 ? 0.4420 0.5022 0.3328 -0.0725 -0.0330 0.0526  155 GLN B CG  
2399 C CD  . GLN B 160 ? 0.4757 0.5436 0.3665 -0.0709 -0.0369 0.0658  155 GLN B CD  
2400 O OE1 . GLN B 160 ? 0.5144 0.5992 0.4028 -0.0808 -0.0406 0.0705  155 GLN B OE1 
2401 N NE2 . GLN B 160 ? 0.5220 0.5760 0.4141 -0.0586 -0.0364 0.0718  155 GLN B NE2 
2402 N N   . GLU B 161 ? 0.4093 0.4734 0.2691 -0.0969 -0.0263 0.0148  156 GLU B N   
2403 C CA  . GLU B 161 ? 0.3876 0.4570 0.2346 -0.1045 -0.0243 0.0035  156 GLU B CA  
2404 C C   . GLU B 161 ? 0.4951 0.5770 0.3366 -0.1062 -0.0230 0.0041  156 GLU B C   
2405 O O   . GLU B 161 ? 0.5203 0.6126 0.3501 -0.1128 -0.0219 -0.0026 156 GLU B O   
2406 C CB  . GLU B 161 ? 0.4644 0.5166 0.3073 -0.0995 -0.0189 -0.0105 156 GLU B CB  
2407 C CG  . GLU B 161 ? 0.4897 0.5313 0.3345 -0.1019 -0.0213 -0.0119 156 GLU B CG  
2408 C CD  . GLU B 161 ? 0.5791 0.6292 0.4140 -0.1158 -0.0268 -0.0119 156 GLU B CD  
2409 O OE1 . GLU B 161 ? 0.5324 0.5876 0.3529 -0.1221 -0.0261 -0.0195 156 GLU B OE1 
2410 O OE2 . GLU B 161 ? 0.5850 0.6383 0.4258 -0.1207 -0.0319 -0.0038 156 GLU B OE2 
2411 N N   . LEU B 162 ? 0.4015 0.4824 0.2500 -0.1010 -0.0235 0.0124  157 LEU B N   
2412 C CA  . LEU B 162 ? 0.3959 0.4908 0.2406 -0.1047 -0.0241 0.0168  157 LEU B CA  
2413 C C   . LEU B 162 ? 0.5874 0.6953 0.4329 -0.1121 -0.0311 0.0305  157 LEU B C   
2414 O O   . LEU B 162 ? 0.6109 0.7357 0.4513 -0.1191 -0.0327 0.0343  157 LEU B O   
2415 C CB  . LEU B 162 ? 0.4336 0.5196 0.2832 -0.0979 -0.0225 0.0196  157 LEU B CB  
2416 C CG  . LEU B 162 ? 0.4753 0.5539 0.3247 -0.0905 -0.0153 0.0083  157 LEU B CG  
2417 C CD1 . LEU B 162 ? 0.5004 0.5702 0.3556 -0.0854 -0.0155 0.0138  157 LEU B CD1 
2418 C CD2 . LEU B 162 ? 0.5500 0.6462 0.3902 -0.0931 -0.0106 0.0008  157 LEU B CD2 
2419 N N   . MET B 163 ? 0.5813 0.6832 0.4337 -0.1100 -0.0352 0.0391  158 MET B N   
2420 C CA  . MET B 163 ? 0.7422 0.8554 0.5965 -0.1149 -0.0417 0.0537  158 MET B CA  
2421 C C   . MET B 163 ? 0.8800 1.0140 0.7290 -0.1262 -0.0441 0.0537  158 MET B C   
2422 O O   . MET B 163 ? 1.1057 1.2570 0.9515 -0.1344 -0.0481 0.0618  158 MET B O   
2423 C CB  . MET B 163 ? 0.7375 0.8382 0.6007 -0.1058 -0.0442 0.0637  158 MET B CB  
2424 C CG  . MET B 163 ? 0.7876 0.8667 0.6526 -0.0959 -0.0435 0.0658  158 MET B CG  
2425 S SD  . MET B 163 ? 0.9121 0.9755 0.7843 -0.0822 -0.0449 0.0756  158 MET B SD  
2426 C CE  . MET B 163 ? 1.6714 1.7497 1.5442 -0.0861 -0.0517 0.0929  158 MET B CE  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -4  ?   ?   ?   A . n 
A 1 2   PRO 2   -3  ?   ?   ?   A . n 
A 1 3   LEU 3   -2  ?   ?   ?   A . n 
A 1 4   GLY 4   -1  ?   ?   ?   A . n 
A 1 5   SER 5   0   ?   ?   ?   A . n 
A 1 6   MET 6   1   ?   ?   ?   A . n 
A 1 7   PHE 7   2   ?   ?   ?   A . n 
A 1 8   SER 8   3   ?   ?   ?   A . n 
A 1 9   VAL 9   4   ?   ?   ?   A . n 
A 1 10  GLU 10  5   ?   ?   ?   A . n 
A 1 11  SER 11  6   ?   ?   ?   A . n 
A 1 12  LEU 12  7   ?   ?   ?   A . n 
A 1 13  GLU 13  8   ?   ?   ?   A . n 
A 1 14  ARG 14  9   9   ARG ARG A . n 
A 1 15  ALA 15  10  10  ALA ALA A . n 
A 1 16  GLU 16  11  11  GLU GLU A . n 
A 1 17  LEU 17  12  12  LEU LEU A . n 
A 1 18  CYS 18  13  13  CYS CYS A . n 
A 1 19  GLU 19  14  14  GLU GLU A . n 
A 1 20  SER 20  15  15  SER SER A . n 
A 1 21  LEU 21  16  16  LEU LEU A . n 
A 1 22  LEU 22  17  17  LEU LEU A . n 
A 1 23  THR 23  18  18  THR THR A . n 
A 1 24  TRP 24  19  19  TRP TRP A . n 
A 1 25  ILE 25  20  20  ILE ILE A . n 
A 1 26  GLN 26  21  21  GLN GLN A . n 
A 1 27  THR 27  22  22  THR THR A . n 
A 1 28  PHE 28  23  23  PHE PHE A . n 
A 1 29  ASN 29  24  24  ASN ASN A . n 
A 1 30  VAL 30  25  25  VAL VAL A . n 
A 1 31  ASP 31  26  26  ASP ASP A . n 
A 1 32  ALA 32  27  27  ALA ALA A . n 
A 1 33  PRO 33  28  28  PRO PRO A . n 
A 1 34  CYS 34  29  29  CYS CYS A . n 
A 1 35  GLN 35  30  30  GLN GLN A . n 
A 1 36  THR 36  31  31  THR THR A . n 
A 1 37  VAL 37  32  32  VAL VAL A . n 
A 1 38  GLU 38  33  33  GLU GLU A . n 
A 1 39  ASP 39  34  34  ASP ASP A . n 
A 1 40  LEU 40  35  35  LEU LEU A . n 
A 1 41  THR 41  36  36  THR THR A . n 
A 1 42  ASN 42  37  37  ASN ASN A . n 
A 1 43  GLY 43  38  38  GLY GLY A . n 
A 1 44  VAL 44  39  39  VAL VAL A . n 
A 1 45  VAL 45  40  40  VAL VAL A . n 
A 1 46  MET 46  41  41  MET MET A . n 
A 1 47  ALA 47  42  42  ALA ALA A . n 
A 1 48  GLN 48  43  43  GLN GLN A . n 
A 1 49  VAL 49  44  44  VAL VAL A . n 
A 1 50  LEU 50  45  45  LEU LEU A . n 
A 1 51  GLN 51  46  46  GLN GLN A . n 
A 1 52  LYS 52  47  47  LYS LYS A . n 
A 1 53  ILE 53  48  48  ILE ILE A . n 
A 1 54  ASP 54  49  49  ASP ASP A . n 
A 1 55  PRO 55  50  50  PRO PRO A . n 
A 1 56  ALA 56  51  51  ALA ALA A . n 
A 1 57  TYR 57  52  52  TYR TYR A . n 
A 1 58  PHE 58  53  53  PHE PHE A . n 
A 1 59  ASP 59  54  54  ASP ASP A . n 
A 1 60  GLU 60  55  55  GLU GLU A . n 
A 1 61  ASN 61  56  56  ASN ASN A . n 
A 1 62  TRP 62  57  57  TRP TRP A . n 
A 1 63  LEU 63  58  58  LEU LEU A . n 
A 1 64  ASN 64  59  59  ASN ASN A . n 
A 1 65  ARG 65  60  60  ARG ARG A . n 
A 1 66  ILE 66  61  61  ILE ILE A . n 
A 1 67  LYS 67  62  62  LYS LYS A . n 
A 1 68  THR 68  63  63  THR THR A . n 
A 1 69  GLU 69  64  64  GLU GLU A . n 
A 1 70  VAL 70  65  65  VAL VAL A . n 
A 1 71  GLY 71  66  66  GLY GLY A . n 
A 1 72  ASP 72  67  67  ASP ASP A . n 
A 1 73  ASN 73  68  68  ASN ASN A . n 
A 1 74  TRP 74  69  69  TRP TRP A . n 
A 1 75  ARG 75  70  70  ARG ARG A . n 
A 1 76  LEU 76  71  71  LEU LEU A . n 
A 1 77  LYS 77  72  72  LYS LYS A . n 
A 1 78  ILE 78  73  73  ILE ILE A . n 
A 1 79  SER 79  74  74  SER SER A . n 
A 1 80  ASN 80  75  75  ASN ASN A . n 
A 1 81  LEU 81  76  76  LEU LEU A . n 
A 1 82  LYS 82  77  77  LYS LYS A . n 
A 1 83  LYS 83  78  78  LYS LYS A . n 
A 1 84  ILE 84  79  79  ILE ILE A . n 
A 1 85  LEU 85  80  80  LEU LEU A . n 
A 1 86  LYS 86  81  81  LYS LYS A . n 
A 1 87  GLY 87  82  82  GLY GLY A . n 
A 1 88  ILE 88  83  83  ILE ILE A . n 
A 1 89  LEU 89  84  84  LEU LEU A . n 
A 1 90  ASP 90  85  85  ASP ASP A . n 
A 1 91  TYR 91  86  86  TYR TYR A . n 
A 1 92  ASN 92  87  87  ASN ASN A . n 
A 1 93  HIS 93  88  88  HIS HIS A . n 
A 1 94  GLU 94  89  89  GLU GLU A . n 
A 1 95  ILE 95  90  90  ILE ILE A . n 
A 1 96  LEU 96  91  91  LEU LEU A . n 
A 1 97  GLY 97  92  92  GLY GLY A . n 
A 1 98  GLN 98  93  93  GLN GLN A . n 
A 1 99  GLN 99  94  94  GLN GLN A . n 
A 1 100 ILE 100 95  95  ILE ILE A . n 
A 1 101 ASN 101 96  96  ASN ASN A . n 
A 1 102 ASP 102 97  97  ASP ASP A . n 
A 1 103 PHE 103 98  98  PHE PHE A . n 
A 1 104 THR 104 99  99  THR THR A . n 
A 1 105 LEU 105 100 100 LEU LEU A . n 
A 1 106 PRO 106 101 101 PRO PRO A . n 
A 1 107 ASP 107 102 102 ASP ASP A . n 
A 1 108 VAL 108 103 103 VAL VAL A . n 
A 1 109 ASN 109 104 104 ASN ASN A . n 
A 1 110 LEU 110 105 105 LEU LEU A . n 
A 1 111 ILE 111 106 106 ILE ILE A . n 
A 1 112 GLY 112 107 107 GLY GLY A . n 
A 1 113 GLU 113 108 108 GLU GLU A . n 
A 1 114 HIS 114 109 109 HIS HIS A . n 
A 1 115 SER 115 110 110 SER SER A . n 
A 1 116 ASP 116 111 111 ASP ASP A . n 
A 1 117 ALA 117 112 112 ALA ALA A . n 
A 1 118 ALA 118 113 113 ALA ALA A . n 
A 1 119 GLU 119 114 114 GLU GLU A . n 
A 1 120 LEU 120 115 115 LEU LEU A . n 
A 1 121 GLY 121 116 116 GLY GLY A . n 
A 1 122 ARG 122 117 117 ARG ARG A . n 
A 1 123 MET 123 118 118 MET MET A . n 
A 1 124 LEU 124 119 119 LEU LEU A . n 
A 1 125 GLN 125 120 120 GLN GLN A . n 
A 1 126 LEU 126 121 121 LEU LEU A . n 
A 1 127 ILE 127 122 122 ILE ILE A . n 
A 1 128 LEU 128 123 123 LEU LEU A . n 
A 1 129 GLY 129 124 124 GLY GLY A . n 
A 1 130 CYS 130 125 125 CYS CYS A . n 
A 1 131 ALA 131 126 126 ALA ALA A . n 
A 1 132 VAL 132 127 127 VAL VAL A . n 
A 1 133 ASN 133 128 128 ASN ASN A . n 
A 1 134 CYS 134 129 129 CYS CYS A . n 
A 1 135 GLU 135 130 130 GLU GLU A . n 
A 1 136 GLN 136 131 131 GLN GLN A . n 
A 1 137 LYS 137 132 132 LYS LYS A . n 
A 1 138 GLN 138 133 133 GLN GLN A . n 
A 1 139 GLU 139 134 134 GLU GLU A . n 
A 1 140 TYR 140 135 135 TYR TYR A . n 
A 1 141 ILE 141 136 136 ILE ILE A . n 
A 1 142 GLN 142 137 137 GLN GLN A . n 
A 1 143 ALA 143 138 138 ALA ALA A . n 
A 1 144 ILE 144 139 139 ILE ILE A . n 
A 1 145 MET 145 140 140 MET MET A . n 
A 1 146 MET 146 141 141 MET MET A . n 
A 1 147 MET 147 142 142 MET MET A . n 
A 1 148 GLU 148 143 143 GLU GLU A . n 
A 1 149 GLU 149 144 144 GLU GLU A . n 
A 1 150 SER 150 145 145 SER SER A . n 
A 1 151 VAL 151 146 146 VAL VAL A . n 
A 1 152 GLN 152 147 147 GLN GLN A . n 
A 1 153 HIS 153 148 148 HIS HIS A . n 
A 1 154 VAL 154 149 149 VAL VAL A . n 
A 1 155 VAL 155 150 150 VAL VAL A . n 
A 1 156 MET 156 151 151 MET MET A . n 
A 1 157 THR 157 152 152 THR THR A . n 
A 1 158 ALA 158 153 153 ALA ALA A . n 
A 1 159 ILE 159 154 154 ILE ILE A . n 
A 1 160 GLN 160 155 155 GLN GLN A . n 
A 1 161 GLU 161 156 156 GLU GLU A . n 
A 1 162 LEU 162 157 157 LEU LEU A . n 
A 1 163 MET 163 158 158 MET MET A . n 
A 1 164 SER 164 159 ?   ?   ?   A . n 
A 1 165 LYS 165 160 ?   ?   ?   A . n 
B 1 1   GLY 1   -4  ?   ?   ?   B . n 
B 1 2   PRO 2   -3  ?   ?   ?   B . n 
B 1 3   LEU 3   -2  ?   ?   ?   B . n 
B 1 4   GLY 4   -1  ?   ?   ?   B . n 
B 1 5   SER 5   0   ?   ?   ?   B . n 
B 1 6   MET 6   1   ?   ?   ?   B . n 
B 1 7   PHE 7   2   ?   ?   ?   B . n 
B 1 8   SER 8   3   ?   ?   ?   B . n 
B 1 9   VAL 9   4   ?   ?   ?   B . n 
B 1 10  GLU 10  5   ?   ?   ?   B . n 
B 1 11  SER 11  6   6   SER SER B . n 
B 1 12  LEU 12  7   7   LEU LEU B . n 
B 1 13  GLU 13  8   8   GLU GLU B . n 
B 1 14  ARG 14  9   9   ARG ARG B . n 
B 1 15  ALA 15  10  10  ALA ALA B . n 
B 1 16  GLU 16  11  11  GLU GLU B . n 
B 1 17  LEU 17  12  12  LEU LEU B . n 
B 1 18  CYS 18  13  13  CYS CYS B . n 
B 1 19  GLU 19  14  14  GLU GLU B . n 
B 1 20  SER 20  15  15  SER SER B . n 
B 1 21  LEU 21  16  16  LEU LEU B . n 
B 1 22  LEU 22  17  17  LEU LEU B . n 
B 1 23  THR 23  18  18  THR THR B . n 
B 1 24  TRP 24  19  19  TRP TRP B . n 
B 1 25  ILE 25  20  20  ILE ILE B . n 
B 1 26  GLN 26  21  21  GLN GLN B . n 
B 1 27  THR 27  22  22  THR THR B . n 
B 1 28  PHE 28  23  23  PHE PHE B . n 
B 1 29  ASN 29  24  24  ASN ASN B . n 
B 1 30  VAL 30  25  25  VAL VAL B . n 
B 1 31  ASP 31  26  26  ASP ASP B . n 
B 1 32  ALA 32  27  27  ALA ALA B . n 
B 1 33  PRO 33  28  28  PRO PRO B . n 
B 1 34  CYS 34  29  29  CYS CYS B . n 
B 1 35  GLN 35  30  30  GLN GLN B . n 
B 1 36  THR 36  31  31  THR THR B . n 
B 1 37  VAL 37  32  32  VAL VAL B . n 
B 1 38  GLU 38  33  33  GLU GLU B . n 
B 1 39  ASP 39  34  34  ASP ASP B . n 
B 1 40  LEU 40  35  35  LEU LEU B . n 
B 1 41  THR 41  36  36  THR THR B . n 
B 1 42  ASN 42  37  37  ASN ASN B . n 
B 1 43  GLY 43  38  38  GLY GLY B . n 
B 1 44  VAL 44  39  39  VAL VAL B . n 
B 1 45  VAL 45  40  40  VAL VAL B . n 
B 1 46  MET 46  41  41  MET MET B . n 
B 1 47  ALA 47  42  42  ALA ALA B . n 
B 1 48  GLN 48  43  43  GLN GLN B . n 
B 1 49  VAL 49  44  44  VAL VAL B . n 
B 1 50  LEU 50  45  45  LEU LEU B . n 
B 1 51  GLN 51  46  46  GLN GLN B . n 
B 1 52  LYS 52  47  47  LYS LYS B . n 
B 1 53  ILE 53  48  48  ILE ILE B . n 
B 1 54  ASP 54  49  49  ASP ASP B . n 
B 1 55  PRO 55  50  50  PRO PRO B . n 
B 1 56  ALA 56  51  51  ALA ALA B . n 
B 1 57  TYR 57  52  52  TYR TYR B . n 
B 1 58  PHE 58  53  53  PHE PHE B . n 
B 1 59  ASP 59  54  54  ASP ASP B . n 
B 1 60  GLU 60  55  55  GLU GLU B . n 
B 1 61  ASN 61  56  56  ASN ASN B . n 
B 1 62  TRP 62  57  57  TRP TRP B . n 
B 1 63  LEU 63  58  58  LEU LEU B . n 
B 1 64  ASN 64  59  59  ASN ASN B . n 
B 1 65  ARG 65  60  60  ARG ARG B . n 
B 1 66  ILE 66  61  61  ILE ILE B . n 
B 1 67  LYS 67  62  62  LYS LYS B . n 
B 1 68  THR 68  63  63  THR THR B . n 
B 1 69  GLU 69  64  64  GLU GLU B . n 
B 1 70  VAL 70  65  65  VAL VAL B . n 
B 1 71  GLY 71  66  66  GLY GLY B . n 
B 1 72  ASP 72  67  67  ASP ASP B . n 
B 1 73  ASN 73  68  68  ASN ASN B . n 
B 1 74  TRP 74  69  69  TRP TRP B . n 
B 1 75  ARG 75  70  70  ARG ARG B . n 
B 1 76  LEU 76  71  71  LEU LEU B . n 
B 1 77  LYS 77  72  72  LYS LYS B . n 
B 1 78  ILE 78  73  73  ILE ILE B . n 
B 1 79  SER 79  74  74  SER SER B . n 
B 1 80  ASN 80  75  75  ASN ASN B . n 
B 1 81  LEU 81  76  76  LEU LEU B . n 
B 1 82  LYS 82  77  77  LYS LYS B . n 
B 1 83  LYS 83  78  78  LYS LYS B . n 
B 1 84  ILE 84  79  79  ILE ILE B . n 
B 1 85  LEU 85  80  80  LEU LEU B . n 
B 1 86  LYS 86  81  81  LYS LYS B . n 
B 1 87  GLY 87  82  82  GLY GLY B . n 
B 1 88  ILE 88  83  83  ILE ILE B . n 
B 1 89  LEU 89  84  84  LEU LEU B . n 
B 1 90  ASP 90  85  85  ASP ASP B . n 
B 1 91  TYR 91  86  86  TYR TYR B . n 
B 1 92  ASN 92  87  87  ASN ASN B . n 
B 1 93  HIS 93  88  88  HIS HIS B . n 
B 1 94  GLU 94  89  89  GLU GLU B . n 
B 1 95  ILE 95  90  90  ILE ILE B . n 
B 1 96  LEU 96  91  91  LEU LEU B . n 
B 1 97  GLY 97  92  92  GLY GLY B . n 
B 1 98  GLN 98  93  93  GLN GLN B . n 
B 1 99  GLN 99  94  94  GLN GLN B . n 
B 1 100 ILE 100 95  95  ILE ILE B . n 
B 1 101 ASN 101 96  96  ASN ASN B . n 
B 1 102 ASP 102 97  97  ASP ASP B . n 
B 1 103 PHE 103 98  98  PHE PHE B . n 
B 1 104 THR 104 99  99  THR THR B . n 
B 1 105 LEU 105 100 100 LEU LEU B . n 
B 1 106 PRO 106 101 101 PRO PRO B . n 
B 1 107 ASP 107 102 102 ASP ASP B . n 
B 1 108 VAL 108 103 103 VAL VAL B . n 
B 1 109 ASN 109 104 104 ASN ASN B . n 
B 1 110 LEU 110 105 105 LEU LEU B . n 
B 1 111 ILE 111 106 106 ILE ILE B . n 
B 1 112 GLY 112 107 107 GLY GLY B . n 
B 1 113 GLU 113 108 108 GLU GLU B . n 
B 1 114 HIS 114 109 109 HIS HIS B . n 
B 1 115 SER 115 110 110 SER SER B . n 
B 1 116 ASP 116 111 111 ASP ASP B . n 
B 1 117 ALA 117 112 112 ALA ALA B . n 
B 1 118 ALA 118 113 113 ALA ALA B . n 
B 1 119 GLU 119 114 114 GLU GLU B . n 
B 1 120 LEU 120 115 115 LEU LEU B . n 
B 1 121 GLY 121 116 116 GLY GLY B . n 
B 1 122 ARG 122 117 117 ARG ARG B . n 
B 1 123 MET 123 118 118 MET MET B . n 
B 1 124 LEU 124 119 119 LEU LEU B . n 
B 1 125 GLN 125 120 120 GLN GLN B . n 
B 1 126 LEU 126 121 121 LEU LEU B . n 
B 1 127 ILE 127 122 122 ILE ILE B . n 
B 1 128 LEU 128 123 123 LEU LEU B . n 
B 1 129 GLY 129 124 124 GLY GLY B . n 
B 1 130 CYS 130 125 125 CYS CYS B . n 
B 1 131 ALA 131 126 126 ALA ALA B . n 
B 1 132 VAL 132 127 127 VAL VAL B . n 
B 1 133 ASN 133 128 128 ASN ASN B . n 
B 1 134 CYS 134 129 129 CYS CYS B . n 
B 1 135 GLU 135 130 130 GLU GLU B . n 
B 1 136 GLN 136 131 131 GLN GLN B . n 
B 1 137 LYS 137 132 132 LYS LYS B . n 
B 1 138 GLN 138 133 133 GLN GLN B . n 
B 1 139 GLU 139 134 134 GLU GLU B . n 
B 1 140 TYR 140 135 135 TYR TYR B . n 
B 1 141 ILE 141 136 136 ILE ILE B . n 
B 1 142 GLN 142 137 137 GLN GLN B . n 
B 1 143 ALA 143 138 138 ALA ALA B . n 
B 1 144 ILE 144 139 139 ILE ILE B . n 
B 1 145 MET 145 140 140 MET MET B . n 
B 1 146 MET 146 141 141 MET MET B . n 
B 1 147 MET 147 142 142 MET MET B . n 
B 1 148 GLU 148 143 143 GLU GLU B . n 
B 1 149 GLU 149 144 144 GLU GLU B . n 
B 1 150 SER 150 145 145 SER SER B . n 
B 1 151 VAL 151 146 146 VAL VAL B . n 
B 1 152 GLN 152 147 147 GLN GLN B . n 
B 1 153 HIS 153 148 148 HIS HIS B . n 
B 1 154 VAL 154 149 149 VAL VAL B . n 
B 1 155 VAL 155 150 150 VAL VAL B . n 
B 1 156 MET 156 151 151 MET MET B . n 
B 1 157 THR 157 152 152 THR THR B . n 
B 1 158 ALA 158 153 153 ALA ALA B . n 
B 1 159 ILE 159 154 154 ILE ILE B . n 
B 1 160 GLN 160 155 155 GLN GLN B . n 
B 1 161 GLU 161 156 156 GLU GLU B . n 
B 1 162 LEU 162 157 157 LEU LEU B . n 
B 1 163 MET 163 158 158 MET MET B . n 
B 1 164 SER 164 159 ?   ?   ?   B . n 
B 1 165 LYS 165 160 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  201 122 HOH HOH A . 
C 2 HOH 2  202 139 HOH HOH A . 
C 2 HOH 3  203 177 HOH HOH A . 
C 2 HOH 4  204 143 HOH HOH A . 
C 2 HOH 5  205 118 HOH HOH A . 
C 2 HOH 6  206 17  HOH HOH A . 
C 2 HOH 7  207 80  HOH HOH A . 
C 2 HOH 8  208 153 HOH HOH A . 
C 2 HOH 9  209 56  HOH HOH A . 
C 2 HOH 10 210 86  HOH HOH A . 
C 2 HOH 11 211 95  HOH HOH A . 
C 2 HOH 12 212 127 HOH HOH A . 
C 2 HOH 13 213 81  HOH HOH A . 
C 2 HOH 14 214 156 HOH HOH A . 
C 2 HOH 15 215 75  HOH HOH A . 
C 2 HOH 16 216 67  HOH HOH A . 
C 2 HOH 17 217 142 HOH HOH A . 
C 2 HOH 18 218 25  HOH HOH A . 
C 2 HOH 19 219 102 HOH HOH A . 
C 2 HOH 20 220 6   HOH HOH A . 
C 2 HOH 21 221 21  HOH HOH A . 
C 2 HOH 22 222 79  HOH HOH A . 
C 2 HOH 23 223 7   HOH HOH A . 
C 2 HOH 24 224 160 HOH HOH A . 
C 2 HOH 25 225 84  HOH HOH A . 
C 2 HOH 26 226 85  HOH HOH A . 
C 2 HOH 27 227 87  HOH HOH A . 
C 2 HOH 28 228 164 HOH HOH A . 
C 2 HOH 29 229 71  HOH HOH A . 
C 2 HOH 30 230 30  HOH HOH A . 
C 2 HOH 31 231 175 HOH HOH A . 
C 2 HOH 32 232 22  HOH HOH A . 
C 2 HOH 33 233 41  HOH HOH A . 
C 2 HOH 34 234 9   HOH HOH A . 
C 2 HOH 35 235 18  HOH HOH A . 
C 2 HOH 36 236 11  HOH HOH A . 
C 2 HOH 37 237 37  HOH HOH A . 
C 2 HOH 38 238 108 HOH HOH A . 
C 2 HOH 39 239 179 HOH HOH A . 
C 2 HOH 40 240 1   HOH HOH A . 
C 2 HOH 41 241 13  HOH HOH A . 
C 2 HOH 42 242 112 HOH HOH A . 
C 2 HOH 43 243 8   HOH HOH A . 
C 2 HOH 44 244 172 HOH HOH A . 
C 2 HOH 45 245 140 HOH HOH A . 
C 2 HOH 46 246 31  HOH HOH A . 
C 2 HOH 47 247 130 HOH HOH A . 
C 2 HOH 48 248 52  HOH HOH A . 
C 2 HOH 49 249 48  HOH HOH A . 
C 2 HOH 50 250 64  HOH HOH A . 
C 2 HOH 51 251 136 HOH HOH A . 
C 2 HOH 52 252 120 HOH HOH A . 
C 2 HOH 53 253 76  HOH HOH A . 
C 2 HOH 54 254 16  HOH HOH A . 
C 2 HOH 55 255 107 HOH HOH A . 
C 2 HOH 56 256 34  HOH HOH A . 
C 2 HOH 57 257 174 HOH HOH A . 
C 2 HOH 58 258 163 HOH HOH A . 
C 2 HOH 59 259 103 HOH HOH A . 
C 2 HOH 60 260 178 HOH HOH A . 
C 2 HOH 61 261 165 HOH HOH A . 
C 2 HOH 62 262 123 HOH HOH A . 
C 2 HOH 63 263 92  HOH HOH A . 
C 2 HOH 64 264 68  HOH HOH A . 
C 2 HOH 65 265 24  HOH HOH A . 
C 2 HOH 66 266 66  HOH HOH A . 
C 2 HOH 67 267 90  HOH HOH A . 
C 2 HOH 68 268 62  HOH HOH A . 
C 2 HOH 69 269 129 HOH HOH A . 
C 2 HOH 70 270 111 HOH HOH A . 
C 2 HOH 71 271 36  HOH HOH A . 
C 2 HOH 72 272 166 HOH HOH A . 
C 2 HOH 73 273 78  HOH HOH A . 
C 2 HOH 74 274 73  HOH HOH A . 
C 2 HOH 75 275 97  HOH HOH A . 
C 2 HOH 76 276 35  HOH HOH A . 
C 2 HOH 77 277 137 HOH HOH A . 
C 2 HOH 78 278 101 HOH HOH A . 
C 2 HOH 79 279 88  HOH HOH A . 
C 2 HOH 80 280 155 HOH HOH A . 
C 2 HOH 81 281 93  HOH HOH A . 
C 2 HOH 82 282 159 HOH HOH A . 
C 2 HOH 83 283 60  HOH HOH A . 
C 2 HOH 84 284 158 HOH HOH A . 
C 2 HOH 85 285 91  HOH HOH A . 
C 2 HOH 86 286 40  HOH HOH A . 
C 2 HOH 87 287 113 HOH HOH A . 
C 2 HOH 88 288 74  HOH HOH A . 
C 2 HOH 89 289 125 HOH HOH A . 
C 2 HOH 90 290 144 HOH HOH A . 
C 2 HOH 91 291 89  HOH HOH A . 
C 2 HOH 92 292 38  HOH HOH A . 
D 2 HOH 1  201 131 HOH HOH B . 
D 2 HOH 2  202 149 HOH HOH B . 
D 2 HOH 3  203 116 HOH HOH B . 
D 2 HOH 4  204 61  HOH HOH B . 
D 2 HOH 5  205 114 HOH HOH B . 
D 2 HOH 6  206 181 HOH HOH B . 
D 2 HOH 7  207 133 HOH HOH B . 
D 2 HOH 8  208 19  HOH HOH B . 
D 2 HOH 9  209 82  HOH HOH B . 
D 2 HOH 10 210 26  HOH HOH B . 
D 2 HOH 11 211 151 HOH HOH B . 
D 2 HOH 12 212 46  HOH HOH B . 
D 2 HOH 13 213 20  HOH HOH B . 
D 2 HOH 14 214 10  HOH HOH B . 
D 2 HOH 15 215 70  HOH HOH B . 
D 2 HOH 16 216 32  HOH HOH B . 
D 2 HOH 17 217 176 HOH HOH B . 
D 2 HOH 18 218 14  HOH HOH B . 
D 2 HOH 19 219 58  HOH HOH B . 
D 2 HOH 20 220 39  HOH HOH B . 
D 2 HOH 21 221 47  HOH HOH B . 
D 2 HOH 22 222 15  HOH HOH B . 
D 2 HOH 23 223 119 HOH HOH B . 
D 2 HOH 24 224 170 HOH HOH B . 
D 2 HOH 25 225 57  HOH HOH B . 
D 2 HOH 26 226 171 HOH HOH B . 
D 2 HOH 27 227 49  HOH HOH B . 
D 2 HOH 28 228 2   HOH HOH B . 
D 2 HOH 29 229 54  HOH HOH B . 
D 2 HOH 30 230 99  HOH HOH B . 
D 2 HOH 31 231 148 HOH HOH B . 
D 2 HOH 32 232 51  HOH HOH B . 
D 2 HOH 33 233 45  HOH HOH B . 
D 2 HOH 34 234 50  HOH HOH B . 
D 2 HOH 35 235 145 HOH HOH B . 
D 2 HOH 36 236 4   HOH HOH B . 
D 2 HOH 37 237 154 HOH HOH B . 
D 2 HOH 38 238 69  HOH HOH B . 
D 2 HOH 39 239 12  HOH HOH B . 
D 2 HOH 40 240 150 HOH HOH B . 
D 2 HOH 41 241 27  HOH HOH B . 
D 2 HOH 42 242 3   HOH HOH B . 
D 2 HOH 43 243 33  HOH HOH B . 
D 2 HOH 44 244 106 HOH HOH B . 
D 2 HOH 45 245 23  HOH HOH B . 
D 2 HOH 46 246 96  HOH HOH B . 
D 2 HOH 47 247 5   HOH HOH B . 
D 2 HOH 48 248 83  HOH HOH B . 
D 2 HOH 49 249 29  HOH HOH B . 
D 2 HOH 50 250 42  HOH HOH B . 
D 2 HOH 51 251 63  HOH HOH B . 
D 2 HOH 52 252 55  HOH HOH B . 
D 2 HOH 53 253 28  HOH HOH B . 
D 2 HOH 54 254 59  HOH HOH B . 
D 2 HOH 55 255 109 HOH HOH B . 
D 2 HOH 56 256 180 HOH HOH B . 
D 2 HOH 57 257 141 HOH HOH B . 
D 2 HOH 58 258 43  HOH HOH B . 
D 2 HOH 59 259 147 HOH HOH B . 
D 2 HOH 60 260 121 HOH HOH B . 
D 2 HOH 61 261 72  HOH HOH B . 
D 2 HOH 62 262 126 HOH HOH B . 
D 2 HOH 63 263 77  HOH HOH B . 
D 2 HOH 64 264 65  HOH HOH B . 
D 2 HOH 65 265 100 HOH HOH B . 
D 2 HOH 66 266 152 HOH HOH B . 
D 2 HOH 67 267 135 HOH HOH B . 
D 2 HOH 68 268 169 HOH HOH B . 
D 2 HOH 69 269 117 HOH HOH B . 
D 2 HOH 70 270 161 HOH HOH B . 
D 2 HOH 71 271 115 HOH HOH B . 
D 2 HOH 72 272 44  HOH HOH B . 
D 2 HOH 73 273 162 HOH HOH B . 
D 2 HOH 74 274 138 HOH HOH B . 
D 2 HOH 75 275 132 HOH HOH B . 
D 2 HOH 76 276 128 HOH HOH B . 
D 2 HOH 77 277 146 HOH HOH B . 
D 2 HOH 78 278 157 HOH HOH B . 
D 2 HOH 79 279 168 HOH HOH B . 
D 2 HOH 80 280 167 HOH HOH B . 
D 2 HOH 81 281 124 HOH HOH B . 
D 2 HOH 82 282 105 HOH HOH B . 
D 2 HOH 83 283 173 HOH HOH B . 
D 2 HOH 84 284 98  HOH HOH B . 
D 2 HOH 85 285 94  HOH HOH B . 
D 2 HOH 86 286 104 HOH HOH B . 
D 2 HOH 87 287 110 HOH HOH B . 
D 2 HOH 88 288 134 HOH HOH B . 
D 2 HOH 89 289 53  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 author_defined_assembly   ?    monomeric 1 
3 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C     
2 1 B,D     
3 1 A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
3 'ABSA (A^2)' 2930  ? 
3 MORE         -17   ? 
3 'SSA (A^2)'  14980 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    B 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     278 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-04-27 
2 'Structure model' 1 1 2016-08-17 
3 'Structure model' 1 2 2017-11-22 
4 'Structure model' 1 3 2019-11-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 3 'Structure model' 'Derived calculations'       
4 3 'Structure model' 'Refinement description'     
5 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' citation              
2 3 'Structure model' pdbx_struct_oper_list 
3 3 'Structure model' software              
4 4 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_citation.journal_id_CSD'                  
2 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3 4 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 11.4409 17.3984 69.4566 0.2774 0.2448 0.3187 0.0066 -0.0132 -0.0544 1.4099 0.4718 2.5430 0.1592 
0.8926 1.0443  -0.1057 -0.1821 0.3616 -0.1419 -0.0253 0.0237 -0.1635 0.0058  0.0465 
'X-RAY DIFFRACTION' 2 ? refined 5.2773  18.0530 43.7378 0.2650 0.2278 0.3139 0.0237 0.0208  0.0554  1.3253 0.6193 2.6223 0.1970 
0.4010 -1.1530 -0.0209 0.1323  0.3860 0.1513  0.0150  0.0430 -0.1915 -0.0632 0.0514 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'Chain A' 
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'Chain B' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement     ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .        2 
? phasing        ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .        3 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE2 B GLU 130 ? ? O B HOH 201 ? ? 1.89 
2 1 O   B HOH 254 ? ? O B HOH 279 ? ? 2.12 
3 1 OE1 A GLN 137 ? ? O A HOH 201 ? ? 2.16 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 273 ? ? 1_555 O A HOH 282 ? ? 1_455 1.93 
2 1 O A HOH 239 ? ? 1_555 O A HOH 262 ? ? 1_655 2.05 
3 1 O A HOH 265 ? ? 1_555 O B HOH 276 ? ? 4_655 2.15 
4 1 O A HOH 278 ? ? 1_555 O A HOH 289 ? ? 2_556 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 29 ? ? -150.75 54.56  
2 1 ARG B 9  ? ? 67.86   -24.02 
3 1 CYS B 29 ? ? -142.41 51.30  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -4  ? A GLY 1   
2  1 Y 1 A PRO -3  ? A PRO 2   
3  1 Y 1 A LEU -2  ? A LEU 3   
4  1 Y 1 A GLY -1  ? A GLY 4   
5  1 Y 1 A SER 0   ? A SER 5   
6  1 Y 1 A MET 1   ? A MET 6   
7  1 Y 1 A PHE 2   ? A PHE 7   
8  1 Y 1 A SER 3   ? A SER 8   
9  1 Y 1 A VAL 4   ? A VAL 9   
10 1 Y 1 A GLU 5   ? A GLU 10  
11 1 Y 1 A SER 6   ? A SER 11  
12 1 Y 1 A LEU 7   ? A LEU 12  
13 1 Y 1 A GLU 8   ? A GLU 13  
14 1 Y 1 A SER 159 ? A SER 164 
15 1 Y 1 A LYS 160 ? A LYS 165 
16 1 Y 1 B GLY -4  ? B GLY 1   
17 1 Y 1 B PRO -3  ? B PRO 2   
18 1 Y 1 B LEU -2  ? B LEU 3   
19 1 Y 1 B GLY -1  ? B GLY 4   
20 1 Y 1 B SER 0   ? B SER 5   
21 1 Y 1 B MET 1   ? B MET 6   
22 1 Y 1 B PHE 2   ? B PHE 7   
23 1 Y 1 B SER 3   ? B SER 8   
24 1 Y 1 B VAL 4   ? B VAL 9   
25 1 Y 1 B GLU 5   ? B GLU 10  
26 1 Y 1 B SER 159 ? B SER 164 
27 1 Y 1 B LYS 160 ? B LYS 165 
# 
_pdbx_audit_support.funding_organization   'Howard Hughes Medical Institute (HHMI)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#