data_5JKC
# 
_entry.id   5JKC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5JKC         
WWPDB D_1000220777 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5JKE PDB . 
unspecified 5JKD PDB . 
unspecified 5JKB PDB . 
unspecified 5JKA PDB . 
unspecified 5JK9 PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5JKC 
_pdbx_database_status.recvd_initial_deposition_date   2016-04-26 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ohto, U.'    1 
'Ishida, H.'  2 
'Shimizu, T.' 3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            534 
_citation.language                  ? 
_citation.page_first                566 
_citation.page_last                 569 
_citation.title                     'Structure of IZUMO1-JUNO reveals sperm-oocyte recognition during mammalian fertilization' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature18596 
_citation.pdbx_database_id_PubMed   27309808 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ohto, U.'       1 
primary 'Ishida, H.'     2 
primary 'Krayukhina, E.' 3 
primary 'Uchiyama, S.'   4 
primary 'Inoue, N.'      5 
primary 'Shimizu, T.'    6 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5JKC 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     65.188 
_cell.length_a_esd                 ? 
_cell.length_b                     144.750 
_cell.length_b_esd                 ? 
_cell.length_c                     141.880 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5JKC 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Izumo sperm-egg fusion protein 1' 28163.326 1 ? ? 'UNP residues 22-255' ? 
2 polymer     man 'Sperm-egg fusion protein Juno'    25428.842 1 ? ? 'UNP residues 20-228' ? 
3 non-polymer man N-ACETYL-D-GLUCOSAMINE             221.208   2 ? ? ?                     ? 
4 non-polymer syn 'CHLORIDE ION'                     35.453    1 ? ? ?                     ? 
5 water       nat water                              18.015    5 ? ? ?                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Oocyte binding/fusion factor,OBF,Sperm-specific protein izumo'                 
2 'Folate receptor 4,Folate receptor delta,FR-delta,IZUMO1 receptor protein JUNO' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;RSPWCVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRI
TDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMED
MILDCELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNSSPATIINFHVTVLPKEF
LEVLFQ
;
;RSPWCVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRI
TDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMED
MILDCELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNSSPATIINFHVTVLPKEF
LEVLFQ
;
A ? 
2 'polypeptide(L)' no no 
;RSPWGDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAIC
FYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPF
SHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASEFLEVLFQ
;
;RSPWGDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAIC
FYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPF
SHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASEFLEVLFQ
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   SER n 
1 3   PRO n 
1 4   TRP n 
1 5   CYS n 
1 6   VAL n 
1 7   ILE n 
1 8   CYS n 
1 9   ASP n 
1 10  PRO n 
1 11  SER n 
1 12  VAL n 
1 13  VAL n 
1 14  LEU n 
1 15  ALA n 
1 16  LEU n 
1 17  LYS n 
1 18  SER n 
1 19  LEU n 
1 20  GLU n 
1 21  LYS n 
1 22  ASP n 
1 23  TYR n 
1 24  LEU n 
1 25  PRO n 
1 26  GLY n 
1 27  HIS n 
1 28  LEU n 
1 29  ASP n 
1 30  ALA n 
1 31  LYS n 
1 32  HIS n 
1 33  HIS n 
1 34  LYS n 
1 35  ALA n 
1 36  MET n 
1 37  MET n 
1 38  GLU n 
1 39  ARG n 
1 40  VAL n 
1 41  GLU n 
1 42  ASN n 
1 43  ALA n 
1 44  VAL n 
1 45  LYS n 
1 46  ASP n 
1 47  PHE n 
1 48  GLN n 
1 49  GLU n 
1 50  LEU n 
1 51  SER n 
1 52  LEU n 
1 53  ASN n 
1 54  GLU n 
1 55  ASP n 
1 56  ALA n 
1 57  TYR n 
1 58  MET n 
1 59  GLY n 
1 60  VAL n 
1 61  VAL n 
1 62  ASP n 
1 63  GLU n 
1 64  ALA n 
1 65  THR n 
1 66  LEU n 
1 67  GLN n 
1 68  LYS n 
1 69  GLY n 
1 70  SER n 
1 71  TRP n 
1 72  SER n 
1 73  LEU n 
1 74  LEU n 
1 75  LYS n 
1 76  ASP n 
1 77  LEU n 
1 78  LYS n 
1 79  ARG n 
1 80  ILE n 
1 81  THR n 
1 82  ASP n 
1 83  SER n 
1 84  ASP n 
1 85  VAL n 
1 86  LYS n 
1 87  GLY n 
1 88  ASP n 
1 89  LEU n 
1 90  PHE n 
1 91  VAL n 
1 92  LYS n 
1 93  GLU n 
1 94  LEU n 
1 95  PHE n 
1 96  TRP n 
1 97  MET n 
1 98  LEU n 
1 99  HIS n 
1 100 LEU n 
1 101 GLN n 
1 102 LYS n 
1 103 GLU n 
1 104 THR n 
1 105 PHE n 
1 106 ALA n 
1 107 THR n 
1 108 TYR n 
1 109 VAL n 
1 110 ALA n 
1 111 ARG n 
1 112 PHE n 
1 113 GLN n 
1 114 LYS n 
1 115 GLU n 
1 116 ALA n 
1 117 TYR n 
1 118 CYS n 
1 119 PRO n 
1 120 ASN n 
1 121 LYS n 
1 122 CYS n 
1 123 GLY n 
1 124 VAL n 
1 125 MET n 
1 126 LEU n 
1 127 GLN n 
1 128 THR n 
1 129 LEU n 
1 130 ILE n 
1 131 TRP n 
1 132 CYS n 
1 133 LYS n 
1 134 ASN n 
1 135 CYS n 
1 136 LYS n 
1 137 LYS n 
1 138 GLU n 
1 139 VAL n 
1 140 HIS n 
1 141 ALA n 
1 142 CYS n 
1 143 ARG n 
1 144 LYS n 
1 145 SER n 
1 146 TYR n 
1 147 ASP n 
1 148 CYS n 
1 149 GLY n 
1 150 GLU n 
1 151 ARG n 
1 152 ASN n 
1 153 VAL n 
1 154 GLU n 
1 155 VAL n 
1 156 PRO n 
1 157 GLN n 
1 158 MET n 
1 159 GLU n 
1 160 ASP n 
1 161 MET n 
1 162 ILE n 
1 163 LEU n 
1 164 ASP n 
1 165 CYS n 
1 166 GLU n 
1 167 LEU n 
1 168 ASN n 
1 169 TRP n 
1 170 HIS n 
1 171 GLN n 
1 172 ALA n 
1 173 SER n 
1 174 GLU n 
1 175 GLY n 
1 176 LEU n 
1 177 THR n 
1 178 ASP n 
1 179 TYR n 
1 180 SER n 
1 181 PHE n 
1 182 TYR n 
1 183 ARG n 
1 184 VAL n 
1 185 TRP n 
1 186 GLY n 
1 187 ASN n 
1 188 ASN n 
1 189 THR n 
1 190 GLU n 
1 191 THR n 
1 192 LEU n 
1 193 VAL n 
1 194 SER n 
1 195 LYS n 
1 196 GLY n 
1 197 LYS n 
1 198 GLU n 
1 199 ALA n 
1 200 THR n 
1 201 LEU n 
1 202 THR n 
1 203 LYS n 
1 204 PRO n 
1 205 MET n 
1 206 VAL n 
1 207 GLY n 
1 208 PRO n 
1 209 GLU n 
1 210 ASP n 
1 211 ALA n 
1 212 GLY n 
1 213 SER n 
1 214 TYR n 
1 215 ARG n 
1 216 CYS n 
1 217 GLU n 
1 218 LEU n 
1 219 GLY n 
1 220 SER n 
1 221 VAL n 
1 222 ASN n 
1 223 SER n 
1 224 SER n 
1 225 PRO n 
1 226 ALA n 
1 227 THR n 
1 228 ILE n 
1 229 ILE n 
1 230 ASN n 
1 231 PHE n 
1 232 HIS n 
1 233 VAL n 
1 234 THR n 
1 235 VAL n 
1 236 LEU n 
1 237 PRO n 
1 238 LYS n 
1 239 GLU n 
1 240 PHE n 
1 241 LEU n 
1 242 GLU n 
1 243 VAL n 
1 244 LEU n 
1 245 PHE n 
1 246 GLN n 
2 1   ARG n 
2 2   SER n 
2 3   PRO n 
2 4   TRP n 
2 5   GLY n 
2 6   ASP n 
2 7   GLU n 
2 8   LEU n 
2 9   LEU n 
2 10  ASN n 
2 11  ILE n 
2 12  CYS n 
2 13  MET n 
2 14  ASN n 
2 15  ALA n 
2 16  LYS n 
2 17  HIS n 
2 18  HIS n 
2 19  LYS n 
2 20  ARG n 
2 21  VAL n 
2 22  PRO n 
2 23  SER n 
2 24  PRO n 
2 25  GLU n 
2 26  ASP n 
2 27  LYS n 
2 28  LEU n 
2 29  TYR n 
2 30  GLU n 
2 31  GLU n 
2 32  CYS n 
2 33  ILE n 
2 34  PRO n 
2 35  TRP n 
2 36  LYS n 
2 37  ASP n 
2 38  ASN n 
2 39  ALA n 
2 40  CYS n 
2 41  CYS n 
2 42  THR n 
2 43  LEU n 
2 44  THR n 
2 45  THR n 
2 46  SER n 
2 47  TRP n 
2 48  GLU n 
2 49  ALA n 
2 50  HIS n 
2 51  LEU n 
2 52  ASP n 
2 53  VAL n 
2 54  SER n 
2 55  PRO n 
2 56  LEU n 
2 57  TYR n 
2 58  ASN n 
2 59  PHE n 
2 60  SER n 
2 61  LEU n 
2 62  PHE n 
2 63  HIS n 
2 64  CYS n 
2 65  GLY n 
2 66  LEU n 
2 67  LEU n 
2 68  MET n 
2 69  PRO n 
2 70  GLY n 
2 71  CYS n 
2 72  ARG n 
2 73  LYS n 
2 74  HIS n 
2 75  PHE n 
2 76  ILE n 
2 77  GLN n 
2 78  ALA n 
2 79  ILE n 
2 80  CYS n 
2 81  PHE n 
2 82  TYR n 
2 83  GLU n 
2 84  CYS n 
2 85  SER n 
2 86  PRO n 
2 87  ASN n 
2 88  LEU n 
2 89  GLY n 
2 90  PRO n 
2 91  TRP n 
2 92  ILE n 
2 93  GLN n 
2 94  PRO n 
2 95  VAL n 
2 96  GLY n 
2 97  SER n 
2 98  LEU n 
2 99  GLY n 
2 100 TRP n 
2 101 GLU n 
2 102 VAL n 
2 103 ALA n 
2 104 PRO n 
2 105 SER n 
2 106 GLY n 
2 107 GLN n 
2 108 GLY n 
2 109 GLU n 
2 110 ARG n 
2 111 VAL n 
2 112 VAL n 
2 113 ASN n 
2 114 VAL n 
2 115 PRO n 
2 116 LEU n 
2 117 CYS n 
2 118 GLN n 
2 119 GLU n 
2 120 ASP n 
2 121 CYS n 
2 122 GLU n 
2 123 GLU n 
2 124 TRP n 
2 125 TRP n 
2 126 GLU n 
2 127 ASP n 
2 128 CYS n 
2 129 ARG n 
2 130 MET n 
2 131 SER n 
2 132 TYR n 
2 133 THR n 
2 134 CYS n 
2 135 LYS n 
2 136 SER n 
2 137 ASN n 
2 138 TRP n 
2 139 ARG n 
2 140 GLY n 
2 141 GLY n 
2 142 TRP n 
2 143 ASP n 
2 144 TRP n 
2 145 SER n 
2 146 GLN n 
2 147 GLY n 
2 148 LYS n 
2 149 ASN n 
2 150 ARG n 
2 151 CYS n 
2 152 PRO n 
2 153 LYS n 
2 154 GLY n 
2 155 ALA n 
2 156 GLN n 
2 157 CYS n 
2 158 LEU n 
2 159 PRO n 
2 160 PHE n 
2 161 SER n 
2 162 HIS n 
2 163 TYR n 
2 164 PHE n 
2 165 PRO n 
2 166 THR n 
2 167 PRO n 
2 168 ALA n 
2 169 ASP n 
2 170 LEU n 
2 171 CYS n 
2 172 GLU n 
2 173 LYS n 
2 174 THR n 
2 175 TRP n 
2 176 SER n 
2 177 ASN n 
2 178 SER n 
2 179 PHE n 
2 180 LYS n 
2 181 ALA n 
2 182 SER n 
2 183 PRO n 
2 184 GLU n 
2 185 ARG n 
2 186 ARG n 
2 187 ASN n 
2 188 SER n 
2 189 GLY n 
2 190 ARG n 
2 191 CYS n 
2 192 LEU n 
2 193 GLN n 
2 194 LYS n 
2 195 TRP n 
2 196 PHE n 
2 197 GLU n 
2 198 PRO n 
2 199 ALA n 
2 200 GLN n 
2 201 GLY n 
2 202 ASN n 
2 203 PRO n 
2 204 ASN n 
2 205 VAL n 
2 206 ALA n 
2 207 VAL n 
2 208 ALA n 
2 209 ARG n 
2 210 LEU n 
2 211 PHE n 
2 212 ALA n 
2 213 SER n 
2 214 GLU n 
2 215 PHE n 
2 216 LEU n 
2 217 GLU n 
2 218 VAL n 
2 219 LEU n 
2 220 PHE n 
2 221 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 246 Human ? IZUMO1                 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? Drosophila 
7215 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 221 Human ? 'IZUMO1R, FOLR4, JUNO' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? Drosophila 
7215 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP IZUM1_HUMAN Q8IYV9 ? 1 
;CVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSD
VKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMILD
CELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNSSPATIINFHVTVLPK
;
22 
2 UNP JUNO_HUMAN  A6ND01 ? 2 
;GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYEC
SPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYF
PTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFAS
;
20 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5JKC A 5 ? 238 ? Q8IYV9 22 ? 255 ? 22 255 
2 2 5JKC B 5 ? 213 ? A6ND01 20 ? 228 ? 20 228 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5JKC ARG A 1   ? UNP Q8IYV9 ? ? 'expression tag' 18  1  
1 5JKC SER A 2   ? UNP Q8IYV9 ? ? 'expression tag' 19  2  
1 5JKC PRO A 3   ? UNP Q8IYV9 ? ? 'expression tag' 20  3  
1 5JKC TRP A 4   ? UNP Q8IYV9 ? ? 'expression tag' 21  4  
1 5JKC GLU A 239 ? UNP Q8IYV9 ? ? 'expression tag' 256 5  
1 5JKC PHE A 240 ? UNP Q8IYV9 ? ? 'expression tag' 257 6  
1 5JKC LEU A 241 ? UNP Q8IYV9 ? ? 'expression tag' 258 7  
1 5JKC GLU A 242 ? UNP Q8IYV9 ? ? 'expression tag' 259 8  
1 5JKC VAL A 243 ? UNP Q8IYV9 ? ? 'expression tag' 260 9  
1 5JKC LEU A 244 ? UNP Q8IYV9 ? ? 'expression tag' 261 10 
1 5JKC PHE A 245 ? UNP Q8IYV9 ? ? 'expression tag' 262 11 
1 5JKC GLN A 246 ? UNP Q8IYV9 ? ? 'expression tag' 263 12 
2 5JKC ARG B 1   ? UNP A6ND01 ? ? 'expression tag' 16  13 
2 5JKC SER B 2   ? UNP A6ND01 ? ? 'expression tag' 17  14 
2 5JKC PRO B 3   ? UNP A6ND01 ? ? 'expression tag' 18  15 
2 5JKC TRP B 4   ? UNP A6ND01 ? ? 'expression tag' 19  16 
2 5JKC GLU B 214 ? UNP A6ND01 ? ? 'expression tag' 229 17 
2 5JKC PHE B 215 ? UNP A6ND01 ? ? 'expression tag' 230 18 
2 5JKC LEU B 216 ? UNP A6ND01 ? ? 'expression tag' 231 19 
2 5JKC GLU B 217 ? UNP A6ND01 ? ? 'expression tag' 232 20 
2 5JKC VAL B 218 ? UNP A6ND01 ? ? 'expression tag' 233 21 
2 5JKC LEU B 219 ? UNP A6ND01 ? ? 'expression tag' 234 22 
2 5JKC PHE B 220 ? UNP A6ND01 ? ? 'expression tag' 235 23 
2 5JKC GLN B 221 ? UNP A6ND01 ? ? 'expression tag' 236 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'         ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE               ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE             ? 'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking' y PHENYLALANINE          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5JKC 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.12 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         60.61 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '8-12% PEG4000, 0.2 M Li2SO4, 0.1 M MES-NaOH pH 6.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-10-26 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NE3A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   AR-NE3A 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5JKC 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.90 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       15228 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.5 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            34.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.73 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][2]                            2.42 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -3.15 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               105.131 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.944 
_refine.correlation_coeff_Fo_to_Fc_free          0.942 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5JKC 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.90 
_refine.ls_d_res_low                             50.0 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     14419 
_refine.ls_number_reflns_R_free                  787 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.81 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.22730 
_refine.ls_R_factor_R_free                       0.25941 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.22547 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '5JK9, 5JKA' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       2.175 
_refine.pdbx_overall_ESU_R_Free                  0.379 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             46.739 
_refine.overall_SU_ML                            0.379 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5JKC 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        3488 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.number_atoms_solvent             5 
_refine_hist.number_atoms_total               3522 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.012  0.019  3630  ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  3310  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.648  1.947  4931  ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.037  3.000  7664  ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.926  5.000  430   ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 35.139 24.320 169   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 17.106 15.000 607   ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 15.512 15.000 18    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.095  0.200  514   ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.021  4046  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  838   ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 3.159  7.616  1732  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 3.159  7.614  1731  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 5.247  11.412 2158  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 5.246  11.414 2159  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 3.101  7.981  1897  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 3.100  7.982  1898  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 5.291  11.837 2774  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 11.361 71.988 14953 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 11.360 71.991 14954 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.903 
_refine_ls_shell.d_res_low                        2.979 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             59 
_refine_ls_shell.number_reflns_R_work             1023 
_refine_ls_shell.percent_reflns_obs               98.54 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.423 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.382 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5JKC 
_struct.title                        'Crystal structure of human IZUMO1-JUNO complex (crystal form 1)' 
_struct.pdbx_descriptor              'Izumo sperm-egg fusion protein 1, Sperm-egg fusion protein Juno' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5JKC 
_struct_keywords.text            'fertilization, IZUMO1, JUNO, CELL ADHESION' 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 TRP A 4   ? CYS A 8   ? TRP A 21  CYS A 25  5 ? 5  
HELX_P HELX_P2  AA2 ASP A 9   ? TYR A 23  ? ASP A 26  TYR A 40  1 ? 15 
HELX_P HELX_P3  AA3 TYR A 23  ? LEU A 28  ? TYR A 40  LEU A 45  1 ? 6  
HELX_P HELX_P4  AA4 ASP A 29  ? LYS A 31  ? ASP A 46  LYS A 48  5 ? 3  
HELX_P HELX_P5  AA5 HIS A 32  ? ASP A 46  ? HIS A 49  ASP A 63  1 ? 15 
HELX_P HELX_P6  AA6 ASP A 62  ? SER A 83  ? ASP A 79  SER A 100 1 ? 22 
HELX_P HELX_P7  AA7 LYS A 86  ? ALA A 116 ? LYS A 103 ALA A 133 1 ? 31 
HELX_P HELX_P8  AA8 LEU A 167 ? SER A 173 ? LEU A 184 SER A 190 5 ? 7  
HELX_P HELX_P9  AA9 GLY A 207 ? ALA A 211 ? GLY A 224 ALA A 228 5 ? 5  
HELX_P HELX_P10 AB1 GLY B 5   ? LEU B 9   ? GLY B 20  LEU B 24  5 ? 5  
HELX_P HELX_P11 AB2 TYR B 29  ? LYS B 36  ? TYR B 44  LYS B 51  5 ? 8  
HELX_P HELX_P12 AB3 THR B 42  ? HIS B 50  ? THR B 57  HIS B 65  1 ? 9  
HELX_P HELX_P13 AB4 LEU B 61  ? GLY B 65  ? LEU B 76  GLY B 80  5 ? 5  
HELX_P HELX_P14 AB5 MET B 68  ? SER B 85  ? MET B 83  SER B 100 1 ? 18 
HELX_P HELX_P15 AB6 LEU B 88  ? PRO B 90  ? LEU B 103 PRO B 105 5 ? 3  
HELX_P HELX_P16 AB7 CYS B 117 ? ARG B 129 ? CYS B 132 ARG B 144 1 ? 13 
HELX_P HELX_P17 AB8 PHE B 160 ? PHE B 164 ? PHE B 175 PHE B 179 1 ? 5  
HELX_P HELX_P18 AB9 THR B 166 ? THR B 174 ? THR B 181 THR B 189 1 ? 9  
HELX_P HELX_P19 AC1 GLU B 197 ? GLY B 201 ? GLU B 212 GLY B 216 5 ? 5  
HELX_P HELX_P20 AC2 ASN B 204 ? GLU B 214 ? ASN B 219 GLU B 229 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ?   ? A CYS 5   SG  ? ? ? 1_555 A CYS 132 SG ? ? A CYS 22  A CYS 149 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf2  disulf ?   ? A CYS 8   SG  ? ? ? 1_555 A CYS 135 SG ? ? A CYS 25  A CYS 152 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf3  disulf ?   ? A CYS 118 SG  ? ? ? 1_555 A CYS 142 SG ? ? A CYS 135 A CYS 159 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf4  disulf ?   ? A CYS 122 SG  ? ? ? 1_555 A CYS 148 SG ? ? A CYS 139 A CYS 165 1_555 ? ? ? ? ? ? ? 2.054 ? 
disulf5  disulf ?   ? A CYS 165 SG  ? ? ? 1_555 A CYS 216 SG ? ? A CYS 182 A CYS 233 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf6  disulf ?   ? B CYS 12  SG  ? ? ? 1_555 B CYS 40  SG ? ? B CYS 27  B CYS 55  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf7  disulf ?   ? B CYS 32  SG  ? ? ? 1_555 B CYS 80  SG ? ? B CYS 47  B CYS 95  1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf8  disulf ?   ? B CYS 41  SG  ? ? ? 1_555 B CYS 84  SG ? ? B CYS 56  B CYS 99  1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf9  disulf ?   ? B CYS 64  SG  ? ? ? 1_555 B CYS 157 SG ? ? B CYS 79  B CYS 172 1_555 ? ? ? ? ? ? ? 2.064 ? 
disulf10 disulf ?   ? B CYS 71  SG  ? ? ? 1_555 B CYS 128 SG ? ? B CYS 86  B CYS 143 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf11 disulf ?   ? B CYS 117 SG  ? ? ? 1_555 B CYS 191 SG ? ? B CYS 132 B CYS 206 1_555 ? ? ? ? ? ? ? 2.054 ? 
disulf12 disulf ?   ? B CYS 121 SG  ? ? ? 1_555 B CYS 171 SG ? ? B CYS 136 B CYS 186 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf13 disulf ?   ? B CYS 134 SG  ? ? ? 1_555 B CYS 151 SG ? ? B CYS 149 B CYS 166 1_555 ? ? ? ? ? ? ? 2.043 ? 
covale1  covale one ? A ASN 187 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 204 A NAG 300 1_555 ? ? ? ? ? ? ? 1.443 ? 
covale2  covale one ? B ASN 58  ND2 ? ? ? 1_555 D NAG .   C1 ? ? B ASN 73  B NAG 301 1_555 ? ? ? ? ? ? ? 1.443 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 5 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? parallel      
AA6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 60  ? VAL A 61  ? VAL A 77  VAL A 78  
AA1 2 VAL A 124 ? TRP A 131 ? VAL A 141 TRP A 148 
AA1 3 LYS A 137 ? ARG A 143 ? LYS A 154 ARG A 160 
AA2 1 ARG A 151 ? PRO A 156 ? ARG A 168 PRO A 173 
AA2 2 THR A 227 ? LEU A 236 ? THR A 244 LEU A 253 
AA2 3 GLY A 212 ? SER A 220 ? GLY A 229 SER A 237 
AA2 4 LEU A 176 ? VAL A 184 ? LEU A 193 VAL A 201 
AA2 5 GLU A 190 ? GLY A 196 ? GLU A 207 GLY A 213 
AA3 1 MET A 161 ? ASP A 164 ? MET A 178 ASP A 181 
AA3 2 THR A 200 ? LYS A 203 ? THR A 217 LYS A 220 
AA4 1 ILE B 92  ? GLN B 93  ? ILE B 107 GLN B 108 
AA4 2 ARG B 110 ? VAL B 111 ? ARG B 125 VAL B 126 
AA5 1 VAL B 114 ? LEU B 116 ? VAL B 129 LEU B 131 
AA5 2 PHE B 179 ? ALA B 181 ? PHE B 194 ALA B 196 
AA6 1 TYR B 132 ? THR B 133 ? TYR B 147 THR B 148 
AA6 2 LEU B 158 ? PRO B 159 ? LEU B 173 PRO B 174 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 61  ? N VAL A 78  O ILE A 130 ? O ILE A 147 
AA1 2 3 N MET A 125 ? N MET A 142 O CYS A 142 ? O CYS A 159 
AA2 1 2 N ARG A 151 ? N ARG A 168 O HIS A 232 ? O HIS A 249 
AA2 2 3 O ILE A 229 ? O ILE A 246 N CYS A 216 ? N CYS A 233 
AA2 3 4 O GLU A 217 ? O GLU A 234 N SER A 180 ? N SER A 197 
AA2 4 5 N TYR A 179 ? N TYR A 196 O GLY A 196 ? O GLY A 213 
AA3 1 2 N LEU A 163 ? N LEU A 180 O LEU A 201 ? O LEU A 218 
AA4 1 2 N GLN B 93  ? N GLN B 108 O ARG B 110 ? O ARG B 125 
AA5 1 2 N VAL B 114 ? N VAL B 129 O LYS B 180 ? O LYS B 195 
AA6 1 2 N THR B 133 ? N THR B 148 O LEU B 158 ? O LEU B 173 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B CL  302 ? 5 'binding site for residue CL B 302'                             
AC2 Software A NAG 300 ? 1 'binding site for Mono-Saccharide NAG A 300 bound to ASN A 204' 
AC3 Software B NAG 301 ? 4 'binding site for Mono-Saccharide NAG B 301 bound to ASN B 73'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 TRP B 35  ? TRP B 50  . ? 1_555 ? 
2  AC1 5 SER B 85  ? SER B 100 . ? 1_555 ? 
3  AC1 5 ASN B 87  ? ASN B 102 . ? 1_555 ? 
4  AC1 5 ASN B 202 ? ASN B 217 . ? 1_555 ? 
5  AC1 5 ASN B 204 ? ASN B 219 . ? 1_555 ? 
6  AC2 1 ASN A 187 ? ASN A 204 . ? 1_555 ? 
7  AC3 4 LYS B 16  ? LYS B 31  . ? 1_555 ? 
8  AC3 4 PRO B 55  ? PRO B 70  . ? 1_555 ? 
9  AC3 4 LEU B 56  ? LEU B 71  . ? 1_555 ? 
10 AC3 4 ASN B 58  ? ASN B 73  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5JKC 
_atom_sites.fract_transf_matrix[1][1]   0.015340 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006908 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007048 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ARG A 1 1   ? -16.294 -48.640 22.004  1.00 132.48 ? 18  ARG A N   1 
ATOM   2    C  CA  . ARG A 1 1   ? -15.656 -49.991 21.743  1.00 137.90 ? 18  ARG A CA  1 
ATOM   3    C  C   . ARG A 1 1   ? -14.431 -49.956 20.781  1.00 127.75 ? 18  ARG A C   1 
ATOM   4    O  O   . ARG A 1 1   ? -14.596 -49.946 19.554  1.00 127.64 ? 18  ARG A O   1 
ATOM   5    C  CB  . ARG A 1 1   ? -16.712 -50.989 21.228  1.00 146.62 ? 18  ARG A CB  1 
ATOM   6    C  CG  . ARG A 1 1   ? -16.152 -52.364 20.911  1.00 151.71 ? 18  ARG A CG  1 
ATOM   7    C  CD  . ARG A 1 1   ? -17.242 -53.422 20.854  1.00 160.15 ? 18  ARG A CD  1 
ATOM   8    N  NE  . ARG A 1 1   ? -16.748 -54.582 20.112  1.00 170.01 ? 18  ARG A NE  1 
ATOM   9    C  CZ  . ARG A 1 1   ? -16.011 -55.579 20.609  1.00 172.73 ? 18  ARG A CZ  1 
ATOM   10   N  NH1 . ARG A 1 1   ? -15.682 -55.635 21.898  1.00 172.52 ? 18  ARG A NH1 1 
ATOM   11   N  NH2 . ARG A 1 1   ? -15.615 -56.559 19.797  1.00 174.41 ? 18  ARG A NH2 1 
ATOM   12   N  N   . SER A 1 2   ? -13.218 -49.996 21.348  1.00 112.04 ? 19  SER A N   1 
ATOM   13   C  CA  . SER A 1 2   ? -12.011 -49.513 20.659  1.00 101.31 ? 19  SER A CA  1 
ATOM   14   C  C   . SER A 1 2   ? -10.790 -50.400 20.890  1.00 90.67  ? 19  SER A C   1 
ATOM   15   O  O   . SER A 1 2   ? -10.660 -50.981 21.963  1.00 90.71  ? 19  SER A O   1 
ATOM   16   C  CB  . SER A 1 2   ? -11.682 -48.093 21.142  1.00 102.23 ? 19  SER A CB  1 
ATOM   17   O  OG  . SER A 1 2   ? -11.306 -48.076 22.519  1.00 107.03 ? 19  SER A OG  1 
ATOM   18   N  N   . PRO A 1 3   ? -9.867  -50.472 19.909  1.00 80.45  ? 20  PRO A N   1 
ATOM   19   C  CA  . PRO A 1 3   ? -8.695  -51.316 20.128  1.00 78.01  ? 20  PRO A CA  1 
ATOM   20   C  C   . PRO A 1 3   ? -7.738  -50.843 21.224  1.00 76.30  ? 20  PRO A C   1 
ATOM   21   O  O   . PRO A 1 3   ? -7.706  -49.638 21.592  1.00 79.89  ? 20  PRO A O   1 
ATOM   22   C  CB  . PRO A 1 3   ? -7.979  -51.321 18.760  1.00 76.41  ? 20  PRO A CB  1 
ATOM   23   C  CG  . PRO A 1 3   ? -8.955  -50.798 17.791  1.00 77.67  ? 20  PRO A CG  1 
ATOM   24   C  CD  . PRO A 1 3   ? -9.845  -49.877 18.566  1.00 79.12  ? 20  PRO A CD  1 
ATOM   25   N  N   . TRP A 1 4   ? -6.967  -51.804 21.725  1.00 72.38  ? 21  TRP A N   1 
ATOM   26   C  CA  . TRP A 1 4   ? -5.881  -51.526 22.651  1.00 73.77  ? 21  TRP A CA  1 
ATOM   27   C  C   . TRP A 1 4   ? -4.783  -50.912 21.829  1.00 75.89  ? 21  TRP A C   1 
ATOM   28   O  O   . TRP A 1 4   ? -4.209  -51.561 20.937  1.00 78.05  ? 21  TRP A O   1 
ATOM   29   C  CB  . TRP A 1 4   ? -5.391  -52.791 23.327  1.00 72.13  ? 21  TRP A CB  1 
ATOM   30   C  CG  . TRP A 1 4   ? -4.309  -52.637 24.354  1.00 69.94  ? 21  TRP A CG  1 
ATOM   31   C  CD1 . TRP A 1 4   ? -3.875  -51.504 24.948  1.00 70.45  ? 21  TRP A CD1 1 
ATOM   32   C  CD2 . TRP A 1 4   ? -3.586  -53.709 24.960  1.00 71.21  ? 21  TRP A CD2 1 
ATOM   33   N  NE1 . TRP A 1 4   ? -2.901  -51.794 25.882  1.00 69.18  ? 21  TRP A NE1 1 
ATOM   34   C  CE2 . TRP A 1 4   ? -2.701  -53.144 25.898  1.00 70.03  ? 21  TRP A CE2 1 
ATOM   35   C  CE3 . TRP A 1 4   ? -3.609  -55.113 24.797  1.00 72.54  ? 21  TRP A CE3 1 
ATOM   36   C  CZ2 . TRP A 1 4   ? -1.831  -53.916 26.660  1.00 72.06  ? 21  TRP A CZ2 1 
ATOM   37   C  CZ3 . TRP A 1 4   ? -2.734  -55.890 25.544  1.00 74.04  ? 21  TRP A CZ3 1 
ATOM   38   C  CH2 . TRP A 1 4   ? -1.852  -55.290 26.461  1.00 74.52  ? 21  TRP A CH2 1 
ATOM   39   N  N   . CYS A 1 5   ? -4.493  -49.659 22.156  1.00 76.94  ? 22  CYS A N   1 
ATOM   40   C  CA  . CYS A 1 5   ? -3.693  -48.781 21.305  1.00 75.49  ? 22  CYS A CA  1 
ATOM   41   C  C   . CYS A 1 5   ? -2.271  -49.319 20.921  1.00 73.40  ? 22  CYS A C   1 
ATOM   42   O  O   . CYS A 1 5   ? -1.694  -48.985 19.881  1.00 71.07  ? 22  CYS A O   1 
ATOM   43   C  CB  . CYS A 1 5   ? -3.598  -47.433 21.998  1.00 74.64  ? 22  CYS A CB  1 
ATOM   44   S  SG  . CYS A 1 5   ? -3.610  -46.221 20.725  1.00 76.08  ? 22  CYS A SG  1 
ATOM   45   N  N   . VAL A 1 6   ? -1.780  -50.181 21.793  1.00 72.13  ? 23  VAL A N   1 
ATOM   46   C  CA  . VAL A 1 6   ? -0.577  -50.980 21.683  1.00 73.75  ? 23  VAL A CA  1 
ATOM   47   C  C   . VAL A 1 6   ? -0.428  -51.739 20.349  1.00 73.42  ? 23  VAL A C   1 
ATOM   48   O  O   . VAL A 1 6   ? 0.685   -52.032 19.912  1.00 72.54  ? 23  VAL A O   1 
ATOM   49   C  CB  . VAL A 1 6   ? -0.588  -51.937 22.914  1.00 78.87  ? 23  VAL A CB  1 
ATOM   50   C  CG1 . VAL A 1 6   ? 0.567   -52.889 22.918  1.00 81.81  ? 23  VAL A CG1 1 
ATOM   51   C  CG2 . VAL A 1 6   ? -0.498  -51.131 24.220  1.00 82.73  ? 23  VAL A CG2 1 
ATOM   52   N  N   . ILE A 1 7   ? -1.528  -52.058 19.694  1.00 75.04  ? 24  ILE A N   1 
ATOM   53   C  CA  . ILE A 1 7   ? -1.422  -52.759 18.410  1.00 77.52  ? 24  ILE A CA  1 
ATOM   54   C  C   . ILE A 1 7   ? -1.049  -51.880 17.273  1.00 76.79  ? 24  ILE A C   1 
ATOM   55   O  O   . ILE A 1 7   ? -0.641  -52.371 16.228  1.00 78.44  ? 24  ILE A O   1 
ATOM   56   C  CB  . ILE A 1 7   ? -2.671  -53.553 18.000  1.00 82.47  ? 24  ILE A CB  1 
ATOM   57   C  CG1 . ILE A 1 7   ? -3.916  -52.675 18.103  1.00 85.23  ? 24  ILE A CG1 1 
ATOM   58   C  CG2 . ILE A 1 7   ? -2.672  -54.833 18.783  1.00 85.10  ? 24  ILE A CG2 1 
ATOM   59   C  CD1 . ILE A 1 7   ? -5.217  -53.308 17.627  1.00 91.57  ? 24  ILE A CD1 1 
ATOM   60   N  N   . CYS A 1 8   ? -1.144  -50.575 17.476  1.00 75.12  ? 25  CYS A N   1 
ATOM   61   C  CA  . CYS A 1 8   ? -0.572  -49.648 16.541  1.00 73.16  ? 25  CYS A CA  1 
ATOM   62   C  C   . CYS A 1 8   ? 0.960   -49.689 16.505  1.00 74.63  ? 25  CYS A C   1 
ATOM   63   O  O   . CYS A 1 8   ? 1.542   -49.014 15.677  1.00 80.06  ? 25  CYS A O   1 
ATOM   64   C  CB  . CYS A 1 8   ? -1.135  -48.257 16.819  1.00 73.18  ? 25  CYS A CB  1 
ATOM   65   S  SG  . CYS A 1 8   ? -2.956  -48.289 16.661  1.00 73.48  ? 25  CYS A SG  1 
ATOM   66   N  N   . ASP A 1 9   ? 1.609   -50.488 17.357  1.00 74.87  ? 26  ASP A N   1 
ATOM   67   C  CA  . ASP A 1 9   ? 3.044   -50.688 17.313  1.00 76.36  ? 26  ASP A CA  1 
ATOM   68   C  C   . ASP A 1 9   ? 3.378   -51.891 16.483  1.00 76.29  ? 26  ASP A C   1 
ATOM   69   O  O   . ASP A 1 9   ? 2.928   -52.966 16.823  1.00 76.90  ? 26  ASP A O   1 
ATOM   70   C  CB  . ASP A 1 9   ? 3.597   -50.934 18.711  1.00 78.35  ? 26  ASP A CB  1 
ATOM   71   C  CG  . ASP A 1 9   ? 5.119   -51.139 18.712  1.00 81.67  ? 26  ASP A CG  1 
ATOM   72   O  OD1 . ASP A 1 9   ? 5.609   -52.259 18.436  1.00 80.62  ? 26  ASP A OD1 1 
ATOM   73   O  OD2 . ASP A 1 9   ? 5.836   -50.165 18.973  1.00 81.75  ? 26  ASP A OD2 1 
ATOM   74   N  N   . PRO A 1 10  ? 4.236   -51.742 15.464  1.00 77.75  ? 27  PRO A N   1 
ATOM   75   C  CA  . PRO A 1 10  ? 4.520   -52.858 14.536  1.00 79.00  ? 27  PRO A CA  1 
ATOM   76   C  C   . PRO A 1 10  ? 5.166   -54.060 15.180  1.00 79.82  ? 27  PRO A C   1 
ATOM   77   O  O   . PRO A 1 10  ? 4.904   -55.194 14.801  1.00 75.51  ? 27  PRO A O   1 
ATOM   78   C  CB  . PRO A 1 10  ? 5.499   -52.257 13.526  1.00 80.18  ? 27  PRO A CB  1 
ATOM   79   C  CG  . PRO A 1 10  ? 5.419   -50.783 13.704  1.00 80.23  ? 27  PRO A CG  1 
ATOM   80   C  CD  . PRO A 1 10  ? 4.973   -50.523 15.099  1.00 78.52  ? 27  PRO A CD  1 
ATOM   81   N  N   . SER A 1 11  ? 6.035   -53.794 16.140  1.00 83.52  ? 28  SER A N   1 
ATOM   82   C  CA  . SER A 1 11  ? 6.751   -54.857 16.812  1.00 86.96  ? 28  SER A CA  1 
ATOM   83   C  C   . SER A 1 11  ? 5.766   -55.697 17.614  1.00 84.28  ? 28  SER A C   1 
ATOM   84   O  O   . SER A 1 11  ? 5.947   -56.875 17.702  1.00 86.89  ? 28  SER A O   1 
ATOM   85   C  CB  . SER A 1 11  ? 7.866   -54.280 17.705  1.00 90.18  ? 28  SER A CB  1 
ATOM   86   O  OG  . SER A 1 11  ? 8.449   -53.100 17.141  1.00 93.88  ? 28  SER A OG  1 
ATOM   87   N  N   . VAL A 1 12  ? 4.727   -55.083 18.177  1.00 82.26  ? 29  VAL A N   1 
ATOM   88   C  CA  . VAL A 1 12  ? 3.689   -55.812 18.892  1.00 83.34  ? 29  VAL A CA  1 
ATOM   89   C  C   . VAL A 1 12  ? 2.954   -56.731 17.936  1.00 85.10  ? 29  VAL A C   1 
ATOM   90   O  O   . VAL A 1 12  ? 2.772   -57.910 18.243  1.00 88.68  ? 29  VAL A O   1 
ATOM   91   C  CB  . VAL A 1 12  ? 2.678   -54.872 19.610  1.00 82.13  ? 29  VAL A CB  1 
ATOM   92   C  CG1 . VAL A 1 12  ? 1.402   -55.595 20.024  1.00 79.46  ? 29  VAL A CG1 1 
ATOM   93   C  CG2 . VAL A 1 12  ? 3.327   -54.261 20.834  1.00 81.79  ? 29  VAL A CG2 1 
ATOM   94   N  N   . VAL A 1 13  ? 2.539   -56.231 16.781  1.00 82.97  ? 30  VAL A N   1 
ATOM   95   C  CA  . VAL A 1 13  ? 1.778   -57.115 15.912  1.00 84.31  ? 30  VAL A CA  1 
ATOM   96   C  C   . VAL A 1 13  ? 2.692   -58.251 15.438  1.00 85.12  ? 30  VAL A C   1 
ATOM   97   O  O   . VAL A 1 13  ? 2.256   -59.388 15.358  1.00 90.60  ? 30  VAL A O   1 
ATOM   98   C  CB  . VAL A 1 13  ? 0.888   -56.436 14.806  1.00 85.68  ? 30  VAL A CB  1 
ATOM   99   C  CG1 . VAL A 1 13  ? 1.013   -54.925 14.736  1.00 86.87  ? 30  VAL A CG1 1 
ATOM   100  C  CG2 . VAL A 1 13  ? 1.083   -57.051 13.431  1.00 88.85  ? 30  VAL A CG2 1 
ATOM   101  N  N   . LEU A 1 14  ? 3.959   -57.967 15.194  1.00 85.94  ? 31  LEU A N   1 
ATOM   102  C  CA  . LEU A 1 14  ? 4.850   -59.019 14.741  1.00 88.10  ? 31  LEU A CA  1 
ATOM   103  C  C   . LEU A 1 14  ? 5.138   -59.984 15.890  1.00 86.85  ? 31  LEU A C   1 
ATOM   104  O  O   . LEU A 1 14  ? 5.173   -61.189 15.655  1.00 89.39  ? 31  LEU A O   1 
ATOM   105  C  CB  . LEU A 1 14  ? 6.123   -58.456 14.114  1.00 92.55  ? 31  LEU A CB  1 
ATOM   106  C  CG  . LEU A 1 14  ? 5.912   -57.519 12.891  1.00 96.58  ? 31  LEU A CG  1 
ATOM   107  C  CD1 . LEU A 1 14  ? 7.220   -56.819 12.516  1.00 99.75  ? 31  LEU A CD1 1 
ATOM   108  C  CD2 . LEU A 1 14  ? 5.291   -58.175 11.653  1.00 96.65  ? 31  LEU A CD2 1 
ATOM   109  N  N   . ALA A 1 15  ? 5.251   -59.485 17.124  1.00 82.70  ? 32  ALA A N   1 
ATOM   110  C  CA  . ALA A 1 15  ? 5.414   -60.359 18.291  1.00 81.81  ? 32  ALA A CA  1 
ATOM   111  C  C   . ALA A 1 15  ? 4.225   -61.265 18.393  1.00 84.45  ? 32  ALA A C   1 
ATOM   112  O  O   . ALA A 1 15  ? 4.367   -62.448 18.656  1.00 87.32  ? 32  ALA A O   1 
ATOM   113  C  CB  . ALA A 1 15  ? 5.559   -59.577 19.576  1.00 78.13  ? 32  ALA A CB  1 
ATOM   114  N  N   . LEU A 1 16  ? 3.047   -60.716 18.161  1.00 84.28  ? 33  LEU A N   1 
ATOM   115  C  CA  . LEU A 1 16  ? 1.859   -61.529 18.214  1.00 85.17  ? 33  LEU A CA  1 
ATOM   116  C  C   . LEU A 1 16  ? 1.799   -62.540 17.074  1.00 88.23  ? 33  LEU A C   1 
ATOM   117  O  O   . LEU A 1 16  ? 1.340   -63.657 17.286  1.00 90.72  ? 33  LEU A O   1 
ATOM   118  C  CB  . LEU A 1 16  ? 0.601   -60.657 18.259  1.00 85.34  ? 33  LEU A CB  1 
ATOM   119  C  CG  . LEU A 1 16  ? 0.400   -59.828 19.538  1.00 84.22  ? 33  LEU A CG  1 
ATOM   120  C  CD1 . LEU A 1 16  ? -0.897  -59.052 19.467  1.00 83.13  ? 33  LEU A CD1 1 
ATOM   121  C  CD2 . LEU A 1 16  ? 0.406   -60.682 20.796  1.00 85.40  ? 33  LEU A CD2 1 
ATOM   122  N  N   . LYS A 1 17  ? 2.268   -62.193 15.881  1.00 87.71  ? 34  LYS A N   1 
ATOM   123  C  CA  . LYS A 1 17  ? 2.249   -63.171 14.826  1.00 89.13  ? 34  LYS A CA  1 
ATOM   124  C  C   . LYS A 1 17  ? 3.282   -64.220 15.160  1.00 91.50  ? 34  LYS A C   1 
ATOM   125  O  O   . LYS A 1 17  ? 3.056   -65.396 14.931  1.00 92.80  ? 34  LYS A O   1 
ATOM   126  C  CB  . LYS A 1 17  ? 2.498   -62.550 13.467  1.00 93.37  ? 34  LYS A CB  1 
ATOM   127  C  CG  . LYS A 1 17  ? 1.914   -63.368 12.315  1.00 97.88  ? 34  LYS A CG  1 
ATOM   128  C  CD  . LYS A 1 17  ? 1.649   -62.527 11.062  1.00 102.34 ? 34  LYS A CD  1 
ATOM   129  C  CE  . LYS A 1 17  ? 2.600   -62.757 9.894   1.00 104.15 ? 34  LYS A CE  1 
ATOM   130  N  NZ  . LYS A 1 17  ? 1.958   -62.269 8.635   1.00 103.00 ? 34  LYS A NZ  1 
ATOM   131  N  N   . SER A 1 18  ? 4.407   -63.809 15.735  1.00 93.48  ? 35  SER A N   1 
ATOM   132  C  CA  . SER A 1 18  ? 5.447   -64.774 16.082  1.00 95.73  ? 35  SER A CA  1 
ATOM   133  C  C   . SER A 1 18  ? 4.947   -65.714 17.155  1.00 94.21  ? 35  SER A C   1 
ATOM   134  O  O   . SER A 1 18  ? 5.223   -66.897 17.099  1.00 94.60  ? 35  SER A O   1 
ATOM   135  C  CB  . SER A 1 18  ? 6.726   -64.091 16.555  1.00 97.37  ? 35  SER A CB  1 
ATOM   136  O  OG  . SER A 1 18  ? 7.662   -65.074 16.961  1.00 101.31 ? 35  SER A OG  1 
ATOM   137  N  N   . LEU A 1 19  ? 4.209   -65.184 18.124  1.00 92.28  ? 36  LEU A N   1 
ATOM   138  C  CA  . LEU A 1 19  ? 3.537   -66.021 19.092  1.00 92.69  ? 36  LEU A CA  1 
ATOM   139  C  C   . LEU A 1 19  ? 2.685   -67.085 18.397  1.00 99.75  ? 36  LEU A C   1 
ATOM   140  O  O   . LEU A 1 19  ? 2.821   -68.290 18.692  1.00 104.65 ? 36  LEU A O   1 
ATOM   141  C  CB  . LEU A 1 19  ? 2.669   -65.187 20.023  1.00 89.48  ? 36  LEU A CB  1 
ATOM   142  C  CG  . LEU A 1 19  ? 2.086   -65.949 21.215  1.00 90.96  ? 36  LEU A CG  1 
ATOM   143  C  CD1 . LEU A 1 19  ? 3.182   -66.228 22.227  1.00 92.62  ? 36  LEU A CD1 1 
ATOM   144  C  CD2 . LEU A 1 19  ? 0.907   -65.245 21.878  1.00 89.13  ? 36  LEU A CD2 1 
ATOM   145  N  N   . GLU A 1 20  ? 1.830   -66.665 17.463  1.00 102.88 ? 37  GLU A N   1 
ATOM   146  C  CA  . GLU A 1 20  ? 0.955   -67.624 16.786  1.00 107.14 ? 37  GLU A CA  1 
ATOM   147  C  C   . GLU A 1 20  ? 1.723   -68.704 16.030  1.00 111.20 ? 37  GLU A C   1 
ATOM   148  O  O   . GLU A 1 20  ? 1.389   -69.876 16.142  1.00 115.94 ? 37  GLU A O   1 
ATOM   149  C  CB  . GLU A 1 20  ? -0.041  -66.974 15.816  1.00 107.84 ? 37  GLU A CB  1 
ATOM   150  C  CG  . GLU A 1 20  ? -0.992  -68.026 15.218  1.00 112.54 ? 37  GLU A CG  1 
ATOM   151  C  CD  . GLU A 1 20  ? -2.063  -67.497 14.276  1.00 116.71 ? 37  GLU A CD  1 
ATOM   152  O  OE1 . GLU A 1 20  ? -1.879  -66.423 13.684  1.00 126.25 ? 37  GLU A OE1 1 
ATOM   153  O  OE2 . GLU A 1 20  ? -3.100  -68.184 14.113  1.00 118.33 ? 37  GLU A OE2 1 
ATOM   154  N  N   . LYS A 1 21  ? 2.702   -68.311 15.222  1.00 112.20 ? 38  LYS A N   1 
ATOM   155  C  CA  . LYS A 1 21  ? 3.309   -69.258 14.287  1.00 115.37 ? 38  LYS A CA  1 
ATOM   156  C  C   . LYS A 1 21  ? 4.500   -69.976 14.909  1.00 113.60 ? 38  LYS A C   1 
ATOM   157  O  O   . LYS A 1 21  ? 4.673   -71.167 14.681  1.00 117.84 ? 38  LYS A O   1 
ATOM   158  C  CB  . LYS A 1 21  ? 3.737   -68.600 12.962  1.00 118.73 ? 38  LYS A CB  1 
ATOM   159  C  CG  . LYS A 1 21  ? 2.736   -67.708 12.210  1.00 121.99 ? 38  LYS A CG  1 
ATOM   160  C  CD  . LYS A 1 21  ? 1.247   -68.048 12.303  1.00 123.14 ? 38  LYS A CD  1 
ATOM   161  C  CE  . LYS A 1 21  ? 0.863   -69.405 11.754  1.00 127.10 ? 38  LYS A CE  1 
ATOM   162  N  NZ  . LYS A 1 21  ? 0.766   -69.331 10.277  1.00 131.32 ? 38  LYS A NZ  1 
ATOM   163  N  N   . ASP A 1 22  ? 5.315   -69.260 15.683  1.00 108.87 ? 39  ASP A N   1 
ATOM   164  C  CA  . ASP A 1 22  ? 6.517   -69.842 16.296  1.00 107.11 ? 39  ASP A CA  1 
ATOM   165  C  C   . ASP A 1 22  ? 6.277   -70.463 17.671  1.00 105.85 ? 39  ASP A C   1 
ATOM   166  O  O   . ASP A 1 22  ? 6.929   -71.443 18.008  1.00 102.57 ? 39  ASP A O   1 
ATOM   167  C  CB  . ASP A 1 22  ? 7.645   -68.802 16.438  1.00 106.24 ? 39  ASP A CB  1 
ATOM   168  C  CG  . ASP A 1 22  ? 7.940   -68.049 15.143  1.00 103.57 ? 39  ASP A CG  1 
ATOM   169  O  OD1 . ASP A 1 22  ? 7.717   -68.600 14.041  1.00 102.71 ? 39  ASP A OD1 1 
ATOM   170  O  OD2 . ASP A 1 22  ? 8.410   -66.899 15.239  1.00 98.31  ? 39  ASP A OD2 1 
ATOM   171  N  N   . TYR A 1 23  ? 5.398   -69.884 18.486  1.00 106.35 ? 40  TYR A N   1 
ATOM   172  C  CA  . TYR A 1 23  ? 5.265   -70.372 19.853  1.00 107.94 ? 40  TYR A CA  1 
ATOM   173  C  C   . TYR A 1 23  ? 4.187   -71.426 20.005  1.00 111.23 ? 40  TYR A C   1 
ATOM   174  O  O   . TYR A 1 23  ? 4.411   -72.424 20.677  1.00 116.16 ? 40  TYR A O   1 
ATOM   175  C  CB  . TYR A 1 23  ? 5.041   -69.242 20.847  1.00 105.86 ? 40  TYR A CB  1 
ATOM   176  C  CG  . TYR A 1 23  ? 5.384   -69.670 22.265  1.00 110.06 ? 40  TYR A CG  1 
ATOM   177  C  CD1 . TYR A 1 23  ? 6.710   -69.820 22.664  1.00 111.49 ? 40  TYR A CD1 1 
ATOM   178  C  CD2 . TYR A 1 23  ? 4.384   -69.952 23.205  1.00 112.18 ? 40  TYR A CD2 1 
ATOM   179  C  CE1 . TYR A 1 23  ? 7.037   -70.217 23.952  1.00 113.40 ? 40  TYR A CE1 1 
ATOM   180  C  CE2 . TYR A 1 23  ? 4.704   -70.356 24.497  1.00 112.58 ? 40  TYR A CE2 1 
ATOM   181  C  CZ  . TYR A 1 23  ? 6.035   -70.481 24.865  1.00 114.27 ? 40  TYR A CZ  1 
ATOM   182  O  OH  . TYR A 1 23  ? 6.390   -70.874 26.134  1.00 116.78 ? 40  TYR A OH  1 
ATOM   183  N  N   . LEU A 1 24  ? 3.029   -71.225 19.387  1.00 111.86 ? 41  LEU A N   1 
ATOM   184  C  CA  . LEU A 1 24  ? 1.905   -72.158 19.576  1.00 114.09 ? 41  LEU A CA  1 
ATOM   185  C  C   . LEU A 1 24  ? 2.158   -73.632 19.200  1.00 115.63 ? 41  LEU A C   1 
ATOM   186  O  O   . LEU A 1 24  ? 1.745   -74.521 19.957  1.00 110.71 ? 41  LEU A O   1 
ATOM   187  C  CB  . LEU A 1 24  ? 0.623   -71.653 18.888  1.00 114.69 ? 41  LEU A CB  1 
ATOM   188  C  CG  . LEU A 1 24  ? 0.022   -70.321 19.367  1.00 112.29 ? 41  LEU A CG  1 
ATOM   189  C  CD1 . LEU A 1 24  ? -1.422  -70.202 18.876  1.00 111.58 ? 41  LEU A CD1 1 
ATOM   190  C  CD2 . LEU A 1 24  ? 0.080   -70.137 20.886  1.00 111.97 ? 41  LEU A CD2 1 
ATOM   191  N  N   . PRO A 1 25  ? 2.844   -73.904 18.064  1.00 120.23 ? 42  PRO A N   1 
ATOM   192  C  CA  . PRO A 1 25  ? 3.057   -75.320 17.700  1.00 123.17 ? 42  PRO A CA  1 
ATOM   193  C  C   . PRO A 1 25  ? 3.765   -76.185 18.763  1.00 124.59 ? 42  PRO A C   1 
ATOM   194  O  O   . PRO A 1 25  ? 3.284   -77.281 19.057  1.00 123.64 ? 42  PRO A O   1 
ATOM   195  C  CB  . PRO A 1 25  ? 3.848   -75.225 16.394  1.00 124.06 ? 42  PRO A CB  1 
ATOM   196  C  CG  . PRO A 1 25  ? 3.448   -73.909 15.816  1.00 121.99 ? 42  PRO A CG  1 
ATOM   197  C  CD  . PRO A 1 25  ? 3.363   -73.005 17.012  1.00 119.62 ? 42  PRO A CD  1 
ATOM   198  N  N   . GLY A 1 26  ? 4.849   -75.681 19.353  1.00 124.27 ? 43  GLY A N   1 
ATOM   199  C  CA  . GLY A 1 26  ? 5.558   -76.386 20.410  1.00 127.42 ? 43  GLY A CA  1 
ATOM   200  C  C   . GLY A 1 26  ? 4.986   -76.293 21.820  1.00 130.67 ? 43  GLY A C   1 
ATOM   201  O  O   . GLY A 1 26  ? 5.461   -76.996 22.711  1.00 137.74 ? 43  GLY A O   1 
ATOM   202  N  N   . HIS A 1 27  ? 3.992   -75.437 22.062  1.00 131.22 ? 44  HIS A N   1 
ATOM   203  C  CA  . HIS A 1 27  ? 3.573   -75.150 23.460  1.00 132.75 ? 44  HIS A CA  1 
ATOM   204  C  C   . HIS A 1 27  ? 2.090   -75.318 23.810  1.00 132.42 ? 44  HIS A C   1 
ATOM   205  O  O   . HIS A 1 27  ? 1.740   -75.352 24.993  1.00 132.47 ? 44  HIS A O   1 
ATOM   206  C  CB  . HIS A 1 27  ? 4.079   -73.755 23.859  1.00 132.36 ? 44  HIS A CB  1 
ATOM   207  C  CG  . HIS A 1 27  ? 5.564   -73.615 23.734  1.00 134.67 ? 44  HIS A CG  1 
ATOM   208  N  ND1 . HIS A 1 27  ? 6.187   -73.377 22.526  1.00 136.58 ? 44  HIS A ND1 1 
ATOM   209  C  CD2 . HIS A 1 27  ? 6.552   -73.741 24.649  1.00 135.17 ? 44  HIS A CD2 1 
ATOM   210  C  CE1 . HIS A 1 27  ? 7.495   -73.351 22.708  1.00 137.93 ? 44  HIS A CE1 1 
ATOM   211  N  NE2 . HIS A 1 27  ? 7.742   -73.562 23.988  1.00 136.99 ? 44  HIS A NE2 1 
ATOM   212  N  N   . LEU A 1 28  ? 1.235   -75.451 22.800  1.00 132.67 ? 45  LEU A N   1 
ATOM   213  C  CA  . LEU A 1 28  ? -0.191  -75.634 23.002  1.00 132.93 ? 45  LEU A CA  1 
ATOM   214  C  C   . LEU A 1 28  ? -0.677  -76.662 22.021  1.00 135.02 ? 45  LEU A C   1 
ATOM   215  O  O   . LEU A 1 28  ? -0.240  -76.664 20.875  1.00 137.86 ? 45  LEU A O   1 
ATOM   216  C  CB  . LEU A 1 28  ? -0.916  -74.327 22.727  1.00 134.54 ? 45  LEU A CB  1 
ATOM   217  C  CG  . LEU A 1 28  ? -2.431  -74.290 22.940  1.00 136.95 ? 45  LEU A CG  1 
ATOM   218  C  CD1 . LEU A 1 28  ? -2.764  -74.468 24.417  1.00 138.09 ? 45  LEU A CD1 1 
ATOM   219  C  CD2 . LEU A 1 28  ? -3.003  -72.985 22.396  1.00 137.95 ? 45  LEU A CD2 1 
ATOM   220  N  N   . ASP A 1 29  ? -1.603  -77.504 22.467  1.00 139.72 ? 46  ASP A N   1 
ATOM   221  C  CA  . ASP A 1 29  ? -2.209  -78.539 21.623  1.00 144.47 ? 46  ASP A CA  1 
ATOM   222  C  C   . ASP A 1 29  ? -2.790  -77.914 20.384  1.00 141.32 ? 46  ASP A C   1 
ATOM   223  O  O   . ASP A 1 29  ? -3.471  -76.912 20.492  1.00 136.42 ? 46  ASP A O   1 
ATOM   224  C  CB  . ASP A 1 29  ? -3.354  -79.239 22.351  1.00 149.55 ? 46  ASP A CB  1 
ATOM   225  C  CG  . ASP A 1 29  ? -2.898  -80.004 23.569  1.00 158.60 ? 46  ASP A CG  1 
ATOM   226  O  OD1 . ASP A 1 29  ? -1.690  -80.333 23.657  1.00 162.40 ? 46  ASP A OD1 1 
ATOM   227  O  OD2 . ASP A 1 29  ? -3.758  -80.284 24.438  1.00 168.62 ? 46  ASP A OD2 1 
ATOM   228  N  N   . ALA A 1 30  ? -2.536  -78.524 19.225  1.00 145.38 ? 47  ALA A N   1 
ATOM   229  C  CA  . ALA A 1 30  ? -2.973  -78.006 17.911  1.00 146.08 ? 47  ALA A CA  1 
ATOM   230  C  C   . ALA A 1 30  ? -4.478  -77.712 17.826  1.00 143.31 ? 47  ALA A C   1 
ATOM   231  O  O   . ALA A 1 30  ? -4.906  -76.731 17.207  1.00 147.79 ? 47  ALA A O   1 
ATOM   232  C  CB  . ALA A 1 30  ? -2.559  -78.973 16.804  1.00 146.48 ? 47  ALA A CB  1 
ATOM   233  N  N   . LYS A 1 31  ? -5.270  -78.552 18.474  1.00 140.92 ? 48  LYS A N   1 
ATOM   234  C  CA  . LYS A 1 31  ? -6.713  -78.369 18.515  1.00 141.18 ? 48  LYS A CA  1 
ATOM   235  C  C   . LYS A 1 31  ? -7.164  -77.067 19.198  1.00 136.76 ? 48  LYS A C   1 
ATOM   236  O  O   . LYS A 1 31  ? -8.313  -76.663 19.054  1.00 133.78 ? 48  LYS A O   1 
ATOM   237  C  CB  . LYS A 1 31  ? -7.374  -79.579 19.181  1.00 145.63 ? 48  LYS A CB  1 
ATOM   238  C  CG  . LYS A 1 31  ? -7.102  -79.738 20.674  1.00 148.68 ? 48  LYS A CG  1 
ATOM   239  C  CD  . LYS A 1 31  ? -7.537  -81.125 21.135  1.00 153.82 ? 48  LYS A CD  1 
ATOM   240  C  CE  . LYS A 1 31  ? -7.944  -81.154 22.604  1.00 155.42 ? 48  LYS A CE  1 
ATOM   241  N  NZ  . LYS A 1 31  ? -9.012  -82.164 22.835  1.00 154.29 ? 48  LYS A NZ  1 
ATOM   242  N  N   . HIS A 1 32  ? -6.272  -76.414 19.933  1.00 132.11 ? 49  HIS A N   1 
ATOM   243  C  CA  . HIS A 1 32  ? -6.593  -75.149 20.575  1.00 128.89 ? 49  HIS A CA  1 
ATOM   244  C  C   . HIS A 1 32  ? -6.087  -73.889 19.860  1.00 126.05 ? 49  HIS A C   1 
ATOM   245  O  O   . HIS A 1 32  ? -6.502  -72.789 20.214  1.00 122.88 ? 49  HIS A O   1 
ATOM   246  C  CB  . HIS A 1 32  ? -6.064  -75.178 22.005  1.00 128.44 ? 49  HIS A CB  1 
ATOM   247  C  CG  . HIS A 1 32  ? -6.794  -76.133 22.895  1.00 128.06 ? 49  HIS A CG  1 
ATOM   248  N  ND1 . HIS A 1 32  ? -8.147  -76.039 23.127  1.00 127.91 ? 49  HIS A ND1 1 
ATOM   249  C  CD2 . HIS A 1 32  ? -6.360  -77.180 23.633  1.00 128.29 ? 49  HIS A CD2 1 
ATOM   250  C  CE1 . HIS A 1 32  ? -8.521  -76.994 23.958  1.00 126.21 ? 49  HIS A CE1 1 
ATOM   251  N  NE2 . HIS A 1 32  ? -7.454  -77.700 24.282  1.00 128.09 ? 49  HIS A NE2 1 
ATOM   252  N  N   . HIS A 1 33  ? -5.219  -74.039 18.864  1.00 125.59 ? 50  HIS A N   1 
ATOM   253  C  CA  . HIS A 1 33  ? -4.541  -72.884 18.262  1.00 128.14 ? 50  HIS A CA  1 
ATOM   254  C  C   . HIS A 1 33  ? -5.519  -71.863 17.750  1.00 125.97 ? 50  HIS A C   1 
ATOM   255  O  O   . HIS A 1 33  ? -5.413  -70.672 18.067  1.00 117.01 ? 50  HIS A O   1 
ATOM   256  C  CB  . HIS A 1 33  ? -3.653  -73.319 17.107  1.00 129.82 ? 50  HIS A CB  1 
ATOM   257  C  CG  . HIS A 1 33  ? -2.448  -74.075 17.547  1.00 134.82 ? 50  HIS A CG  1 
ATOM   258  N  ND1 . HIS A 1 33  ? -1.388  -74.331 16.708  1.00 139.86 ? 50  HIS A ND1 1 
ATOM   259  C  CD2 . HIS A 1 33  ? -2.125  -74.616 18.746  1.00 136.08 ? 50  HIS A CD2 1 
ATOM   260  C  CE1 . HIS A 1 33  ? -0.473  -75.019 17.365  1.00 139.61 ? 50  HIS A CE1 1 
ATOM   261  N  NE2 . HIS A 1 33  ? -0.895  -75.205 18.604  1.00 138.07 ? 50  HIS A NE2 1 
ATOM   262  N  N   . LYS A 1 34  ? -6.470  -72.366 16.968  1.00 128.03 ? 51  LYS A N   1 
ATOM   263  C  CA  . LYS A 1 34  ? -7.461  -71.547 16.281  1.00 129.02 ? 51  LYS A CA  1 
ATOM   264  C  C   . LYS A 1 34  ? -8.164  -70.629 17.273  1.00 129.22 ? 51  LYS A C   1 
ATOM   265  O  O   . LYS A 1 34  ? -8.102  -69.392 17.169  1.00 126.24 ? 51  LYS A O   1 
ATOM   266  C  CB  . LYS A 1 34  ? -8.462  -72.457 15.534  1.00 130.83 ? 51  LYS A CB  1 
ATOM   267  C  CG  . LYS A 1 34  ? -7.840  -73.157 14.318  1.00 133.57 ? 51  LYS A CG  1 
ATOM   268  C  CD  . LYS A 1 34  ? -8.438  -74.526 13.991  1.00 135.54 ? 51  LYS A CD  1 
ATOM   269  C  CE  . LYS A 1 34  ? -7.487  -75.340 13.111  1.00 136.89 ? 51  LYS A CE  1 
ATOM   270  N  NZ  . LYS A 1 34  ? -7.982  -76.721 12.827  1.00 135.73 ? 51  LYS A NZ  1 
ATOM   271  N  N   . ALA A 1 35  ? -8.770  -71.250 18.276  1.00 130.30 ? 52  ALA A N   1 
ATOM   272  C  CA  . ALA A 1 35  ? -9.598  -70.517 19.218  1.00 128.30 ? 52  ALA A CA  1 
ATOM   273  C  C   . ALA A 1 35  ? -8.779  -69.625 20.143  1.00 125.96 ? 52  ALA A C   1 
ATOM   274  O  O   . ALA A 1 35  ? -9.260  -68.583 20.563  1.00 122.15 ? 52  ALA A O   1 
ATOM   275  C  CB  . ALA A 1 35  ? -10.431 -71.480 20.028  1.00 129.27 ? 52  ALA A CB  1 
ATOM   276  N  N   . MET A 1 36  ? -7.558  -70.050 20.467  1.00 128.30 ? 53  MET A N   1 
ATOM   277  C  CA  . MET A 1 36  ? -6.627  -69.240 21.269  1.00 127.81 ? 53  MET A CA  1 
ATOM   278  C  C   . MET A 1 36  ? -6.402  -67.891 20.618  1.00 128.58 ? 53  MET A C   1 
ATOM   279  O  O   . MET A 1 36  ? -6.507  -66.834 21.247  1.00 118.24 ? 53  MET A O   1 
ATOM   280  C  CB  . MET A 1 36  ? -5.265  -69.938 21.405  1.00 126.59 ? 53  MET A CB  1 
ATOM   281  C  CG  . MET A 1 36  ? -4.124  -69.015 21.819  1.00 123.58 ? 53  MET A CG  1 
ATOM   282  S  SD  . MET A 1 36  ? -4.083  -68.611 23.574  1.00 116.78 ? 53  MET A SD  1 
ATOM   283  C  CE  . MET A 1 36  ? -2.626  -69.529 24.044  1.00 117.49 ? 53  MET A CE  1 
ATOM   284  N  N   . MET A 1 37  ? -6.054  -67.954 19.344  1.00 135.98 ? 54  MET A N   1 
ATOM   285  C  CA  . MET A 1 37  ? -5.740  -66.756 18.623  1.00 139.36 ? 54  MET A CA  1 
ATOM   286  C  C   . MET A 1 37  ? -6.945  -65.886 18.484  1.00 135.89 ? 54  MET A C   1 
ATOM   287  O  O   . MET A 1 37  ? -6.813  -64.708 18.687  1.00 138.55 ? 54  MET A O   1 
ATOM   288  C  CB  . MET A 1 37  ? -5.109  -67.067 17.279  1.00 146.01 ? 54  MET A CB  1 
ATOM   289  C  CG  . MET A 1 37  ? -3.677  -67.513 17.469  1.00 149.43 ? 54  MET A CG  1 
ATOM   290  S  SD  . MET A 1 37  ? -2.577  -66.303 18.271  1.00 148.51 ? 54  MET A SD  1 
ATOM   291  C  CE  . MET A 1 37  ? -2.884  -64.825 17.306  1.00 147.19 ? 54  MET A CE  1 
ATOM   292  N  N   . GLU A 1 38  ? -8.111  -66.455 18.197  1.00 137.14 ? 55  GLU A N   1 
ATOM   293  C  CA  . GLU A 1 38  ? -9.350  -65.666 18.171  1.00 138.63 ? 55  GLU A CA  1 
ATOM   294  C  C   . GLU A 1 38  ? -9.525  -64.892 19.481  1.00 134.67 ? 55  GLU A C   1 
ATOM   295  O  O   . GLU A 1 38  ? -9.857  -63.699 19.483  1.00 126.24 ? 55  GLU A O   1 
ATOM   296  C  CB  . GLU A 1 38  ? -10.565 -66.569 17.942  1.00 144.90 ? 55  GLU A CB  1 
ATOM   297  C  CG  . GLU A 1 38  ? -10.658 -67.146 16.539  1.00 152.79 ? 55  GLU A CG  1 
ATOM   298  C  CD  . GLU A 1 38  ? -11.752 -68.191 16.395  1.00 161.54 ? 55  GLU A CD  1 
ATOM   299  O  OE1 . GLU A 1 38  ? -12.605 -68.319 17.304  1.00 161.13 ? 55  GLU A OE1 1 
ATOM   300  O  OE2 . GLU A 1 38  ? -11.759 -68.888 15.357  1.00 173.52 ? 55  GLU A OE2 1 
ATOM   301  N  N   . ARG A 1 39  ? -9.255  -65.579 20.586  1.00 135.26 ? 56  ARG A N   1 
ATOM   302  C  CA  . ARG A 1 39  ? -9.372  -64.994 21.908  1.00 136.54 ? 56  ARG A CA  1 
ATOM   303  C  C   . ARG A 1 39  ? -8.348  -63.874 22.111  1.00 130.40 ? 56  ARG A C   1 
ATOM   304  O  O   . ARG A 1 39  ? -8.698  -62.804 22.607  1.00 125.49 ? 56  ARG A O   1 
ATOM   305  C  CB  . ARG A 1 39  ? -9.215  -66.082 22.964  1.00 142.45 ? 56  ARG A CB  1 
ATOM   306  C  CG  . ARG A 1 39  ? -9.742  -65.698 24.313  1.00 152.90 ? 56  ARG A CG  1 
ATOM   307  C  CD  . ARG A 1 39  ? -9.346  -66.728 25.352  1.00 162.72 ? 56  ARG A CD  1 
ATOM   308  N  NE  . ARG A 1 39  ? -9.404  -66.143 26.693  1.00 174.53 ? 56  ARG A NE  1 
ATOM   309  C  CZ  . ARG A 1 39  ? -8.935  -66.712 27.804  1.00 182.88 ? 56  ARG A CZ  1 
ATOM   310  N  NH1 . ARG A 1 39  ? -8.389  -67.923 27.771  1.00 182.58 ? 56  ARG A NH1 1 
ATOM   311  N  NH2 . ARG A 1 39  ? -9.042  -66.070 28.969  1.00 188.76 ? 56  ARG A NH2 1 
ATOM   312  N  N   . VAL A 1 40  ? -7.100  -64.101 21.693  1.00 127.87 ? 57  VAL A N   1 
ATOM   313  C  CA  . VAL A 1 40  ? -6.064  -63.060 21.794  1.00 121.32 ? 57  VAL A CA  1 
ATOM   314  C  C   . VAL A 1 40  ? -6.369  -61.858 20.895  1.00 116.80 ? 57  VAL A C   1 
ATOM   315  O  O   . VAL A 1 40  ? -6.308  -60.741 21.368  1.00 113.96 ? 57  VAL A O   1 
ATOM   316  C  CB  . VAL A 1 40  ? -4.653  -63.558 21.434  1.00 121.16 ? 57  VAL A CB  1 
ATOM   317  C  CG1 . VAL A 1 40  ? -3.660  -62.409 21.521  1.00 119.19 ? 57  VAL A CG1 1 
ATOM   318  C  CG2 . VAL A 1 40  ? -4.198  -64.677 22.358  1.00 122.98 ? 57  VAL A CG2 1 
ATOM   319  N  N   . GLU A 1 41  ? -6.686  -62.091 19.618  1.00 116.31 ? 58  GLU A N   1 
ATOM   320  C  CA  . GLU A 1 41  ? -7.080  -61.008 18.669  1.00 116.93 ? 58  GLU A CA  1 
ATOM   321  C  C   . GLU A 1 41  ? -8.137  -60.131 19.353  1.00 114.42 ? 58  GLU A C   1 
ATOM   322  O  O   . GLU A 1 41  ? -8.025  -58.911 19.354  1.00 113.28 ? 58  GLU A O   1 
ATOM   323  C  CB  . GLU A 1 41  ? -7.640  -61.484 17.300  1.00 127.50 ? 58  GLU A CB  1 
ATOM   324  C  CG  . GLU A 1 41  ? -7.022  -62.759 16.706  1.00 138.07 ? 58  GLU A CG  1 
ATOM   325  C  CD  . GLU A 1 41  ? -6.584  -62.706 15.263  1.00 147.38 ? 58  GLU A CD  1 
ATOM   326  O  OE1 . GLU A 1 41  ? -7.023  -61.808 14.502  1.00 158.48 ? 58  GLU A OE1 1 
ATOM   327  O  OE2 . GLU A 1 41  ? -5.792  -63.625 14.892  1.00 145.80 ? 58  GLU A OE2 1 
ATOM   328  N  N   . ASN A 1 42  ? -9.155  -60.761 19.937  1.00 114.68 ? 59  ASN A N   1 
ATOM   329  C  CA  . ASN A 1 42  ? -10.228 -60.020 20.610  1.00 115.22 ? 59  ASN A CA  1 
ATOM   330  C  C   . ASN A 1 42  ? -9.810  -59.301 21.867  1.00 110.19 ? 59  ASN A C   1 
ATOM   331  O  O   . ASN A 1 42  ? -10.367 -58.249 22.161  1.00 108.80 ? 59  ASN A O   1 
ATOM   332  C  CB  . ASN A 1 42  ? -11.429 -60.910 20.922  1.00 119.31 ? 59  ASN A CB  1 
ATOM   333  C  CG  . ASN A 1 42  ? -12.232 -61.252 19.689  1.00 122.98 ? 59  ASN A CG  1 
ATOM   334  O  OD1 . ASN A 1 42  ? -11.994 -60.735 18.591  1.00 127.09 ? 59  ASN A OD1 1 
ATOM   335  N  ND2 . ASN A 1 42  ? -13.196 -62.133 19.862  1.00 127.40 ? 59  ASN A ND2 1 
ATOM   336  N  N   . ALA A 1 43  ? -8.849  -59.850 22.611  1.00 109.10 ? 60  ALA A N   1 
ATOM   337  C  CA  . ALA A 1 43  ? -8.241  -59.116 23.754  1.00 108.77 ? 60  ALA A CA  1 
ATOM   338  C  C   . ALA A 1 43  ? -7.677  -57.751 23.317  1.00 106.67 ? 60  ALA A C   1 
ATOM   339  O  O   . ALA A 1 43  ? -7.829  -56.738 23.985  1.00 99.61  ? 60  ALA A O   1 
ATOM   340  C  CB  . ALA A 1 43  ? -7.144  -59.945 24.415  1.00 107.73 ? 60  ALA A CB  1 
ATOM   341  N  N   . VAL A 1 44  ? -7.053  -57.748 22.156  1.00 106.00 ? 61  VAL A N   1 
ATOM   342  C  CA  . VAL A 1 44  ? -6.433  -56.575 21.635  1.00 102.17 ? 61  VAL A CA  1 
ATOM   343  C  C   . VAL A 1 44  ? -7.416  -55.704 20.861  1.00 104.29 ? 61  VAL A C   1 
ATOM   344  O  O   . VAL A 1 44  ? -7.201  -54.512 20.783  1.00 107.30 ? 61  VAL A O   1 
ATOM   345  C  CB  . VAL A 1 44  ? -5.246  -56.979 20.762  1.00 101.24 ? 61  VAL A CB  1 
ATOM   346  C  CG1 . VAL A 1 44  ? -4.604  -55.780 20.174  1.00 101.97 ? 61  VAL A CG1 1 
ATOM   347  C  CG2 . VAL A 1 44  ? -4.222  -57.758 21.592  1.00 101.63 ? 61  VAL A CG2 1 
ATOM   348  N  N   . LYS A 1 45  ? -8.466  -56.273 20.274  1.00 107.96 ? 62  LYS A N   1 
ATOM   349  C  CA  . LYS A 1 45  ? -9.475  -55.474 19.533  1.00 109.64 ? 62  LYS A CA  1 
ATOM   350  C  C   . LYS A 1 45  ? -10.461 -54.653 20.395  1.00 111.27 ? 62  LYS A C   1 
ATOM   351  O  O   . LYS A 1 45  ? -11.152 -53.773 19.854  1.00 105.42 ? 62  LYS A O   1 
ATOM   352  C  CB  . LYS A 1 45  ? -10.262 -56.361 18.565  1.00 112.46 ? 62  LYS A CB  1 
ATOM   353  C  CG  . LYS A 1 45  ? -9.473  -56.783 17.338  1.00 114.70 ? 62  LYS A CG  1 
ATOM   354  C  CD  . LYS A 1 45  ? -10.341 -57.592 16.392  1.00 119.83 ? 62  LYS A CD  1 
ATOM   355  C  CE  . LYS A 1 45  ? -9.520  -58.571 15.571  1.00 122.87 ? 62  LYS A CE  1 
ATOM   356  N  NZ  . LYS A 1 45  ? -10.383 -59.241 14.565  1.00 124.41 ? 62  LYS A NZ  1 
ATOM   357  N  N   . ASP A 1 46  ? -10.545 -54.935 21.704  1.00 115.16 ? 63  ASP A N   1 
ATOM   358  C  CA  . ASP A 1 46  ? -11.328 -54.087 22.619  1.00 121.21 ? 63  ASP A CA  1 
ATOM   359  C  C   . ASP A 1 46  ? -10.586 -53.761 23.924  1.00 123.20 ? 63  ASP A C   1 
ATOM   360  O  O   . ASP A 1 46  ? -10.041 -54.644 24.581  1.00 128.43 ? 63  ASP A O   1 
ATOM   361  C  CB  . ASP A 1 46  ? -12.707 -54.686 22.930  1.00 126.88 ? 63  ASP A CB  1 
ATOM   362  C  CG  . ASP A 1 46  ? -13.635 -53.694 23.673  1.00 131.40 ? 63  ASP A CG  1 
ATOM   363  O  OD1 . ASP A 1 46  ? -13.535 -52.463 23.443  1.00 133.86 ? 63  ASP A OD1 1 
ATOM   364  O  OD2 . ASP A 1 46  ? -14.468 -54.151 24.488  1.00 135.46 ? 63  ASP A OD2 1 
ATOM   365  N  N   . PHE A 1 47  ? -10.626 -52.479 24.289  1.00 121.84 ? 64  PHE A N   1 
ATOM   366  C  CA  . PHE A 1 47  ? -9.913  -51.906 25.421  1.00 120.72 ? 64  PHE A CA  1 
ATOM   367  C  C   . PHE A 1 47  ? -10.944 -51.168 26.282  1.00 126.01 ? 64  PHE A C   1 
ATOM   368  O  O   . PHE A 1 47  ? -11.362 -50.036 25.968  1.00 127.31 ? 64  PHE A O   1 
ATOM   369  C  CB  . PHE A 1 47  ? -8.838  -50.951 24.881  1.00 119.37 ? 64  PHE A CB  1 
ATOM   370  C  CG  . PHE A 1 47  ? -8.089  -50.169 25.945  1.00 114.47 ? 64  PHE A CG  1 
ATOM   371  C  CD1 . PHE A 1 47  ? -7.107  -50.790 26.719  1.00 109.74 ? 64  PHE A CD1 1 
ATOM   372  C  CD2 . PHE A 1 47  ? -8.347  -48.807 26.150  1.00 109.41 ? 64  PHE A CD2 1 
ATOM   373  C  CE1 . PHE A 1 47  ? -6.413  -50.087 27.681  1.00 105.89 ? 64  PHE A CE1 1 
ATOM   374  C  CE2 . PHE A 1 47  ? -7.658  -48.102 27.121  1.00 107.88 ? 64  PHE A CE2 1 
ATOM   375  C  CZ  . PHE A 1 47  ? -6.690  -48.743 27.889  1.00 106.37 ? 64  PHE A CZ  1 
ATOM   376  N  N   . GLN A 1 48  ? -11.353 -51.821 27.363  1.00 130.13 ? 65  GLN A N   1 
ATOM   377  C  CA  . GLN A 1 48  ? -12.523 -51.397 28.121  1.00 135.60 ? 65  GLN A CA  1 
ATOM   378  C  C   . GLN A 1 48  ? -12.175 -50.515 29.310  1.00 131.11 ? 65  GLN A C   1 
ATOM   379  O  O   . GLN A 1 48  ? -13.042 -49.825 29.829  1.00 133.78 ? 65  GLN A O   1 
ATOM   380  C  CB  . GLN A 1 48  ? -13.308 -52.641 28.561  1.00 138.63 ? 65  GLN A CB  1 
ATOM   381  C  CG  . GLN A 1 48  ? -13.760 -53.469 27.360  1.00 141.68 ? 65  GLN A CG  1 
ATOM   382  C  CD  . GLN A 1 48  ? -14.569 -54.707 27.709  1.00 144.10 ? 65  GLN A CD  1 
ATOM   383  O  OE1 . GLN A 1 48  ? -14.066 -55.828 27.619  1.00 142.72 ? 65  GLN A OE1 1 
ATOM   384  N  NE2 . GLN A 1 48  ? -15.837 -54.516 28.078  1.00 145.64 ? 65  GLN A NE2 1 
ATOM   385  N  N   . GLU A 1 49  ? -10.904 -50.515 29.704  1.00 127.29 ? 66  GLU A N   1 
ATOM   386  C  CA  . GLU A 1 49  ? -10.460 -49.892 30.956  1.00 126.11 ? 66  GLU A CA  1 
ATOM   387  C  C   . GLU A 1 49  ? -10.864 -48.415 31.078  1.00 132.51 ? 66  GLU A C   1 
ATOM   388  O  O   . GLU A 1 49  ? -11.230 -47.963 32.170  1.00 136.99 ? 66  GLU A O   1 
ATOM   389  C  CB  . GLU A 1 49  ? -8.949  -50.095 31.155  1.00 118.39 ? 66  GLU A CB  1 
ATOM   390  C  CG  . GLU A 1 49  ? -8.576  -51.438 31.806  1.00 117.83 ? 66  GLU A CG  1 
ATOM   391  C  CD  . GLU A 1 49  ? -8.810  -52.689 30.945  1.00 115.34 ? 66  GLU A CD  1 
ATOM   392  O  OE1 . GLU A 1 49  ? -9.265  -52.577 29.789  1.00 118.92 ? 66  GLU A OE1 1 
ATOM   393  O  OE2 . GLU A 1 49  ? -8.528  -53.811 31.423  1.00 107.14 ? 66  GLU A OE2 1 
ATOM   394  N  N   . LEU A 1 50  ? -10.839 -47.694 29.955  1.00 137.84 ? 67  LEU A N   1 
ATOM   395  C  CA  . LEU A 1 50  ? -11.398 -46.333 29.860  1.00 140.74 ? 67  LEU A CA  1 
ATOM   396  C  C   . LEU A 1 50  ? -12.452 -46.284 28.734  1.00 130.77 ? 67  LEU A C   1 
ATOM   397  O  O   . LEU A 1 50  ? -13.053 -45.242 28.450  1.00 117.35 ? 67  LEU A O   1 
ATOM   398  C  CB  . LEU A 1 50  ? -10.276 -45.289 29.610  1.00 146.50 ? 67  LEU A CB  1 
ATOM   399  C  CG  . LEU A 1 50  ? -8.907  -45.308 30.335  1.00 144.19 ? 67  LEU A CG  1 
ATOM   400  C  CD1 . LEU A 1 50  ? -7.875  -44.361 29.696  1.00 138.72 ? 67  LEU A CD1 1 
ATOM   401  C  CD2 . LEU A 1 50  ? -9.084  -44.996 31.817  1.00 146.72 ? 67  LEU A CD2 1 
ATOM   402  N  N   . ASP A 1 55  ? -12.236 -39.854 33.772  1.00 147.17 ? 72  ASP A N   1 
ATOM   403  C  CA  . ASP A 1 55  ? -11.753 -38.964 32.710  1.00 150.59 ? 72  ASP A CA  1 
ATOM   404  C  C   . ASP A 1 55  ? -12.005 -39.628 31.335  1.00 142.73 ? 72  ASP A C   1 
ATOM   405  O  O   . ASP A 1 55  ? -11.271 -40.529 30.940  1.00 144.45 ? 72  ASP A O   1 
ATOM   406  C  CB  . ASP A 1 55  ? -10.250 -38.627 32.951  1.00 156.27 ? 72  ASP A CB  1 
ATOM   407  C  CG  . ASP A 1 55  ? -9.654  -37.643 31.910  1.00 158.79 ? 72  ASP A CG  1 
ATOM   408  O  OD1 . ASP A 1 55  ? -10.422 -36.888 31.277  1.00 169.95 ? 72  ASP A OD1 1 
ATOM   409  O  OD2 . ASP A 1 55  ? -8.405  -37.621 31.736  1.00 150.65 ? 72  ASP A OD2 1 
ATOM   410  N  N   . ALA A 1 56  ? -13.050 -39.195 30.620  1.00 135.91 ? 73  ALA A N   1 
ATOM   411  C  CA  . ALA A 1 56  ? -13.439 -39.837 29.356  1.00 125.90 ? 73  ALA A CA  1 
ATOM   412  C  C   . ALA A 1 56  ? -12.224 -39.915 28.387  1.00 120.16 ? 73  ALA A C   1 
ATOM   413  O  O   . ALA A 1 56  ? -11.413 -38.982 28.277  1.00 110.04 ? 73  ALA A O   1 
ATOM   414  C  CB  . ALA A 1 56  ? -14.652 -39.142 28.719  1.00 122.89 ? 73  ALA A CB  1 
ATOM   415  N  N   . TYR A 1 57  ? -12.093 -41.080 27.759  1.00 113.51 ? 74  TYR A N   1 
ATOM   416  C  CA  . TYR A 1 57  ? -10.980 -41.435 26.862  1.00 104.77 ? 74  TYR A CA  1 
ATOM   417  C  C   . TYR A 1 57  ? -11.203 -40.795 25.518  1.00 101.03 ? 74  TYR A C   1 
ATOM   418  O  O   . TYR A 1 57  ? -12.303 -40.852 24.994  1.00 101.43 ? 74  TYR A O   1 
ATOM   419  C  CB  . TYR A 1 57  ? -11.010 -42.945 26.709  1.00 103.25 ? 74  TYR A CB  1 
ATOM   420  C  CG  . TYR A 1 57  ? -10.055 -43.651 25.776  1.00 97.59  ? 74  TYR A CG  1 
ATOM   421  C  CD1 . TYR A 1 57  ? -8.689  -43.404 25.779  1.00 96.68  ? 74  TYR A CD1 1 
ATOM   422  C  CD2 . TYR A 1 57  ? -10.529 -44.691 24.983  1.00 94.55  ? 74  TYR A CD2 1 
ATOM   423  C  CE1 . TYR A 1 57  ? -7.840  -44.138 24.947  1.00 97.64  ? 74  TYR A CE1 1 
ATOM   424  C  CE2 . TYR A 1 57  ? -9.705  -45.428 24.167  1.00 94.46  ? 74  TYR A CE2 1 
ATOM   425  C  CZ  . TYR A 1 57  ? -8.369  -45.169 24.142  1.00 97.48  ? 74  TYR A CZ  1 
ATOM   426  O  OH  . TYR A 1 57  ? -7.616  -45.959 23.293  1.00 101.65 ? 74  TYR A OH  1 
ATOM   427  N  N   . MET A 1 58  ? -10.188 -40.171 24.945  1.00 95.69  ? 75  MET A N   1 
ATOM   428  C  CA  . MET A 1 58  ? -10.384 -39.555 23.622  1.00 91.66  ? 75  MET A CA  1 
ATOM   429  C  C   . MET A 1 58  ? -9.883  -40.399 22.434  1.00 80.90  ? 75  MET A C   1 
ATOM   430  O  O   . MET A 1 58  ? -10.052 -39.987 21.302  1.00 75.72  ? 75  MET A O   1 
ATOM   431  C  CB  . MET A 1 58  ? -9.762  -38.164 23.589  1.00 98.61  ? 75  MET A CB  1 
ATOM   432  C  CG  . MET A 1 58  ? -10.337 -37.160 24.584  1.00 102.04 ? 75  MET A CG  1 
ATOM   433  S  SD  . MET A 1 58  ? -9.232  -35.732 24.785  1.00 114.91 ? 75  MET A SD  1 
ATOM   434  C  CE  . MET A 1 58  ? -7.691  -36.524 25.285  1.00 109.25 ? 75  MET A CE  1 
ATOM   435  N  N   . GLY A 1 59  ? -9.285  -41.564 22.682  1.00 74.95  ? 76  GLY A N   1 
ATOM   436  C  CA  . GLY A 1 59  ? -8.928  -42.488 21.610  1.00 72.14  ? 76  GLY A CA  1 
ATOM   437  C  C   . GLY A 1 59  ? -7.630  -42.190 20.891  1.00 71.80  ? 76  GLY A C   1 
ATOM   438  O  O   . GLY A 1 59  ? -7.397  -42.650 19.773  1.00 73.17  ? 76  GLY A O   1 
ATOM   439  N  N   . VAL A 1 60  ? -6.761  -41.460 21.572  1.00 73.01  ? 77  VAL A N   1 
ATOM   440  C  CA  . VAL A 1 60  ? -5.502  -40.974 21.025  1.00 70.29  ? 77  VAL A CA  1 
ATOM   441  C  C   . VAL A 1 60  ? -4.399  -41.079 22.037  1.00 70.55  ? 77  VAL A C   1 
ATOM   442  O  O   . VAL A 1 60  ? -4.640  -41.149 23.232  1.00 71.54  ? 77  VAL A O   1 
ATOM   443  C  CB  . VAL A 1 60  ? -5.587  -39.489 20.643  1.00 69.20  ? 77  VAL A CB  1 
ATOM   444  C  CG1 . VAL A 1 60  ? -6.563  -39.301 19.501  1.00 71.21  ? 77  VAL A CG1 1 
ATOM   445  C  CG2 . VAL A 1 60  ? -6.000  -38.639 21.830  1.00 67.44  ? 77  VAL A CG2 1 
ATOM   446  N  N   . VAL A 1 61  ? -3.178  -41.019 21.552  1.00 71.28  ? 78  VAL A N   1 
ATOM   447  C  CA  . VAL A 1 61  ? -2.032  -41.358 22.341  1.00 70.48  ? 78  VAL A CA  1 
ATOM   448  C  C   . VAL A 1 61  ? -0.920  -40.672 21.598  1.00 71.36  ? 78  VAL A C   1 
ATOM   449  O  O   . VAL A 1 61  ? -1.068  -40.488 20.406  1.00 77.23  ? 78  VAL A O   1 
ATOM   450  C  CB  . VAL A 1 61  ? -1.924  -42.876 22.293  1.00 72.68  ? 78  VAL A CB  1 
ATOM   451  C  CG1 . VAL A 1 61  ? -0.771  -43.363 23.086  1.00 75.70  ? 78  VAL A CG1 1 
ATOM   452  C  CG2 . VAL A 1 61  ? -3.139  -43.498 22.931  1.00 76.75  ? 78  VAL A CG2 1 
ATOM   453  N  N   . ASP A 1 62  ? 0.156   -40.251 22.261  1.00 72.25  ? 79  ASP A N   1 
ATOM   454  C  CA  . ASP A 1 62  ? 1.396   -39.824 21.563  1.00 70.84  ? 79  ASP A CA  1 
ATOM   455  C  C   . ASP A 1 62  ? 2.357   -40.987 21.371  1.00 72.93  ? 79  ASP A C   1 
ATOM   456  O  O   . ASP A 1 62  ? 2.212   -42.080 21.976  1.00 73.04  ? 79  ASP A O   1 
ATOM   457  C  CB  . ASP A 1 62  ? 2.093   -38.645 22.259  1.00 72.96  ? 79  ASP A CB  1 
ATOM   458  C  CG  . ASP A 1 62  ? 2.517   -38.939 23.711  1.00 75.48  ? 79  ASP A CG  1 
ATOM   459  O  OD1 . ASP A 1 62  ? 2.515   -40.112 24.121  1.00 77.71  ? 79  ASP A OD1 1 
ATOM   460  O  OD2 . ASP A 1 62  ? 2.856   -37.994 24.463  1.00 76.22  ? 79  ASP A OD2 1 
ATOM   461  N  N   . GLU A 1 63  ? 3.341   -40.770 20.508  1.00 74.83  ? 80  GLU A N   1 
ATOM   462  C  CA  . GLU A 1 63  ? 4.286   -41.842 20.181  1.00 76.99  ? 80  GLU A CA  1 
ATOM   463  C  C   . GLU A 1 63  ? 4.974   -42.381 21.465  1.00 75.03  ? 80  GLU A C   1 
ATOM   464  O  O   . GLU A 1 63  ? 5.164   -43.595 21.636  1.00 70.97  ? 80  GLU A O   1 
ATOM   465  C  CB  . GLU A 1 63  ? 5.279   -41.372 19.096  1.00 80.25  ? 80  GLU A CB  1 
ATOM   466  C  CG  . GLU A 1 63  ? 6.295   -42.416 18.600  1.00 87.18  ? 80  GLU A CG  1 
ATOM   467  C  CD  . GLU A 1 63  ? 5.680   -43.705 17.995  1.00 92.66  ? 80  GLU A CD  1 
ATOM   468  O  OE1 . GLU A 1 63  ? 4.687   -43.620 17.227  1.00 92.60  ? 80  GLU A OE1 1 
ATOM   469  O  OE2 . GLU A 1 63  ? 6.195   -44.826 18.271  1.00 94.74  ? 80  GLU A OE2 1 
ATOM   470  N  N   . ALA A 1 64  ? 5.272   -41.459 22.384  1.00 75.06  ? 81  ALA A N   1 
ATOM   471  C  CA  . ALA A 1 64  ? 5.959   -41.784 23.628  1.00 73.27  ? 81  ALA A CA  1 
ATOM   472  C  C   . ALA A 1 64  ? 5.155   -42.748 24.454  1.00 72.01  ? 81  ALA A C   1 
ATOM   473  O  O   . ALA A 1 64  ? 5.695   -43.736 24.958  1.00 74.12  ? 81  ALA A O   1 
ATOM   474  C  CB  . ALA A 1 64  ? 6.197   -40.526 24.433  1.00 73.39  ? 81  ALA A CB  1 
ATOM   475  N  N   . THR A 1 65  ? 3.867   -42.438 24.608  1.00 69.31  ? 82  THR A N   1 
ATOM   476  C  CA  . THR A 1 65  ? 2.964   -43.291 25.371  1.00 68.44  ? 82  THR A CA  1 
ATOM   477  C  C   . THR A 1 65  ? 2.819   -44.669 24.731  1.00 68.65  ? 82  THR A C   1 
ATOM   478  O  O   . THR A 1 65  ? 2.857   -45.674 25.425  1.00 66.14  ? 82  THR A O   1 
ATOM   479  C  CB  . THR A 1 65  ? 1.558   -42.710 25.435  1.00 66.96  ? 82  THR A CB  1 
ATOM   480  O  OG1 . THR A 1 65  ? 1.599   -41.345 25.868  1.00 64.76  ? 82  THR A OG1 1 
ATOM   481  C  CG2 . THR A 1 65  ? 0.636   -43.584 26.349  1.00 65.81  ? 82  THR A CG2 1 
ATOM   482  N  N   . LEU A 1 66  ? 2.660   -44.687 23.409  1.00 68.18  ? 83  LEU A N   1 
ATOM   483  C  CA  . LEU A 1 66  ? 2.522   -45.923 22.694  1.00 69.13  ? 83  LEU A CA  1 
ATOM   484  C  C   . LEU A 1 66  ? 3.732   -46.746 22.894  1.00 69.60  ? 83  LEU A C   1 
ATOM   485  O  O   . LEU A 1 66  ? 3.606   -47.925 23.128  1.00 70.95  ? 83  LEU A O   1 
ATOM   486  C  CB  . LEU A 1 66  ? 2.328   -45.672 21.212  1.00 73.15  ? 83  LEU A CB  1 
ATOM   487  C  CG  . LEU A 1 66  ? 2.268   -46.874 20.247  1.00 72.79  ? 83  LEU A CG  1 
ATOM   488  C  CD1 . LEU A 1 66  ? 1.228   -47.882 20.650  1.00 73.07  ? 83  LEU A CD1 1 
ATOM   489  C  CD2 . LEU A 1 66  ? 1.989   -46.354 18.835  1.00 73.13  ? 83  LEU A CD2 1 
ATOM   490  N  N   . GLN A 1 67  ? 4.899   -46.126 22.800  1.00 72.84  ? 84  GLN A N   1 
ATOM   491  C  CA  . GLN A 1 67  ? 6.142   -46.842 23.015  1.00 78.11  ? 84  GLN A CA  1 
ATOM   492  C  C   . GLN A 1 67  ? 6.290   -47.330 24.437  1.00 77.31  ? 84  GLN A C   1 
ATOM   493  O  O   . GLN A 1 67  ? 6.754   -48.444 24.658  1.00 76.99  ? 84  GLN A O   1 
ATOM   494  C  CB  . GLN A 1 67  ? 7.360   -45.997 22.660  1.00 87.85  ? 84  GLN A CB  1 
ATOM   495  C  CG  . GLN A 1 67  ? 7.764   -46.013 21.180  1.00 97.11  ? 84  GLN A CG  1 
ATOM   496  C  CD  . GLN A 1 67  ? 7.920   -47.413 20.586  1.00 103.26 ? 84  GLN A CD  1 
ATOM   497  O  OE1 . GLN A 1 67  ? 7.181   -47.771 19.680  1.00 105.66 ? 84  GLN A OE1 1 
ATOM   498  N  NE2 . GLN A 1 67  ? 8.863   -48.210 21.105  1.00 108.83 ? 84  GLN A NE2 1 
ATOM   499  N  N   . LYS A 1 68  ? 5.898   -46.517 25.410  1.00 77.63  ? 85  LYS A N   1 
ATOM   500  C  CA  . LYS A 1 68  ? 6.011   -46.913 26.829  1.00 81.30  ? 85  LYS A CA  1 
ATOM   501  C  C   . LYS A 1 68  ? 5.209   -48.196 27.133  1.00 81.75  ? 85  LYS A C   1 
ATOM   502  O  O   . LYS A 1 68  ? 5.697   -49.141 27.793  1.00 83.18  ? 85  LYS A O   1 
ATOM   503  C  CB  . LYS A 1 68  ? 5.540   -45.761 27.714  1.00 85.37  ? 85  LYS A CB  1 
ATOM   504  C  CG  . LYS A 1 68  ? 5.896   -45.904 29.185  1.00 92.05  ? 85  LYS A CG  1 
ATOM   505  C  CD  . LYS A 1 68  ? 5.557   -44.639 29.984  1.00 95.45  ? 85  LYS A CD  1 
ATOM   506  C  CE  . LYS A 1 68  ? 6.262   -44.614 31.344  1.00 100.17 ? 85  LYS A CE  1 
ATOM   507  N  NZ  . LYS A 1 68  ? 6.474   -43.230 31.871  1.00 101.28 ? 85  LYS A NZ  1 
ATOM   508  N  N   . GLY A 1 69  ? 3.983   -48.207 26.614  1.00 78.20  ? 86  GLY A N   1 
ATOM   509  C  CA  . GLY A 1 69  ? 3.126   -49.366 26.628  1.00 76.98  ? 86  GLY A CA  1 
ATOM   510  C  C   . GLY A 1 69  ? 3.616   -50.557 25.859  1.00 75.03  ? 86  GLY A C   1 
ATOM   511  O  O   . GLY A 1 69  ? 3.650   -51.667 26.372  1.00 72.32  ? 86  GLY A O   1 
ATOM   512  N  N   . SER A 1 70  ? 3.978   -50.341 24.613  1.00 75.78  ? 87  SER A N   1 
ATOM   513  C  CA  . SER A 1 70  ? 4.438   -51.468 23.804  1.00 79.63  ? 87  SER A CA  1 
ATOM   514  C  C   . SER A 1 70  ? 5.679   -52.133 24.377  1.00 82.83  ? 87  SER A C   1 
ATOM   515  O  O   . SER A 1 70  ? 5.787   -53.359 24.392  1.00 82.84  ? 87  SER A O   1 
ATOM   516  C  CB  . SER A 1 70  ? 4.750   -51.020 22.398  1.00 79.36  ? 87  SER A CB  1 
ATOM   517  O  OG  . SER A 1 70  ? 3.659   -50.316 21.880  1.00 80.16  ? 87  SER A OG  1 
ATOM   518  N  N   . TRP A 1 71  ? 6.609   -51.313 24.845  1.00 87.50  ? 88  TRP A N   1 
ATOM   519  C  CA  . TRP A 1 71  ? 7.852   -51.825 25.374  1.00 95.20  ? 88  TRP A CA  1 
ATOM   520  C  C   . TRP A 1 71  ? 7.560   -52.717 26.572  1.00 89.91  ? 88  TRP A C   1 
ATOM   521  O  O   . TRP A 1 71  ? 8.019   -53.871 26.593  1.00 88.62  ? 88  TRP A O   1 
ATOM   522  C  CB  . TRP A 1 71  ? 8.798   -50.684 25.728  1.00 108.30 ? 88  TRP A CB  1 
ATOM   523  C  CG  . TRP A 1 71  ? 10.052  -51.128 26.411  1.00 123.02 ? 88  TRP A CG  1 
ATOM   524  C  CD1 . TRP A 1 71  ? 10.254  -51.206 27.758  1.00 128.19 ? 88  TRP A CD1 1 
ATOM   525  C  CD2 . TRP A 1 71  ? 11.283  -51.541 25.792  1.00 135.50 ? 88  TRP A CD2 1 
ATOM   526  N  NE1 . TRP A 1 71  ? 11.534  -51.644 28.027  1.00 133.87 ? 88  TRP A NE1 1 
ATOM   527  C  CE2 . TRP A 1 71  ? 12.189  -51.862 26.842  1.00 138.39 ? 88  TRP A CE2 1 
ATOM   528  C  CE3 . TRP A 1 71  ? 11.715  -51.666 24.456  1.00 141.04 ? 88  TRP A CE3 1 
ATOM   529  C  CZ2 . TRP A 1 71  ? 13.502  -52.308 26.600  1.00 142.35 ? 88  TRP A CZ2 1 
ATOM   530  C  CZ3 . TRP A 1 71  ? 13.036  -52.104 24.209  1.00 143.24 ? 88  TRP A CZ3 1 
ATOM   531  C  CH2 . TRP A 1 71  ? 13.909  -52.417 25.282  1.00 145.12 ? 88  TRP A CH2 1 
ATOM   532  N  N   . SER A 1 72  ? 6.766   -52.199 27.524  1.00 83.36  ? 89  SER A N   1 
ATOM   533  C  CA  . SER A 1 72  ? 6.240   -52.995 28.666  1.00 80.45  ? 89  SER A CA  1 
ATOM   534  C  C   . SER A 1 72  ? 5.658   -54.348 28.247  1.00 78.79  ? 89  SER A C   1 
ATOM   535  O  O   . SER A 1 72  ? 6.092   -55.399 28.727  1.00 78.88  ? 89  SER A O   1 
ATOM   536  C  CB  . SER A 1 72  ? 5.162   -52.214 29.408  1.00 79.77  ? 89  SER A CB  1 
ATOM   537  O  OG  . SER A 1 72  ? 4.658   -52.909 30.530  1.00 77.22  ? 89  SER A OG  1 
ATOM   538  N  N   . LEU A 1 73  ? 4.701   -54.319 27.324  1.00 75.99  ? 90  LEU A N   1 
ATOM   539  C  CA  . LEU A 1 73  ? 4.053   -55.545 26.879  1.00 74.03  ? 90  LEU A CA  1 
ATOM   540  C  C   . LEU A 1 73  ? 5.038   -56.488 26.223  1.00 75.33  ? 90  LEU A C   1 
ATOM   541  O  O   . LEU A 1 73  ? 5.155   -57.606 26.674  1.00 75.56  ? 90  LEU A O   1 
ATOM   542  C  CB  . LEU A 1 73  ? 2.831   -55.272 25.991  1.00 72.34  ? 90  LEU A CB  1 
ATOM   543  C  CG  . LEU A 1 73  ? 2.402   -56.346 24.958  1.00 73.99  ? 90  LEU A CG  1 
ATOM   544  C  CD1 . LEU A 1 73  ? 2.133   -57.745 25.520  1.00 74.72  ? 90  LEU A CD1 1 
ATOM   545  C  CD2 . LEU A 1 73  ? 1.177   -55.889 24.151  1.00 72.35  ? 90  LEU A CD2 1 
ATOM   546  N  N   . LEU A 1 74  ? 5.737   -56.045 25.176  1.00 79.20  ? 91  LEU A N   1 
ATOM   547  C  CA  . LEU A 1 74  ? 6.722   -56.898 24.466  1.00 83.15  ? 91  LEU A CA  1 
ATOM   548  C  C   . LEU A 1 74  ? 7.708   -57.599 25.373  1.00 86.03  ? 91  LEU A C   1 
ATOM   549  O  O   . LEU A 1 74  ? 8.028   -58.774 25.164  1.00 80.31  ? 91  LEU A O   1 
ATOM   550  C  CB  . LEU A 1 74  ? 7.553   -56.067 23.517  1.00 82.47  ? 91  LEU A CB  1 
ATOM   551  C  CG  . LEU A 1 74  ? 6.848   -55.800 22.209  1.00 82.80  ? 91  LEU A CG  1 
ATOM   552  C  CD1 . LEU A 1 74  ? 7.344   -54.504 21.618  1.00 84.49  ? 91  LEU A CD1 1 
ATOM   553  C  CD2 . LEU A 1 74  ? 7.086   -56.946 21.240  1.00 84.67  ? 91  LEU A CD2 1 
ATOM   554  N  N   . LYS A 1 75  ? 8.222   -56.837 26.341  1.00 92.33  ? 92  LYS A N   1 
ATOM   555  C  CA  . LYS A 1 75  ? 9.147   -57.380 27.336  1.00 101.01 ? 92  LYS A CA  1 
ATOM   556  C  C   . LYS A 1 75  ? 8.490   -58.553 28.059  1.00 100.28 ? 92  LYS A C   1 
ATOM   557  O  O   . LYS A 1 75  ? 8.991   -59.672 27.989  1.00 101.74 ? 92  LYS A O   1 
ATOM   558  C  CB  . LYS A 1 75  ? 9.609   -56.297 28.323  1.00 107.56 ? 92  LYS A CB  1 
ATOM   559  C  CG  . LYS A 1 75  ? 10.582  -56.785 29.412  1.00 117.29 ? 92  LYS A CG  1 
ATOM   560  C  CD  . LYS A 1 75  ? 11.881  -55.984 29.496  1.00 126.57 ? 92  LYS A CD  1 
ATOM   561  C  CE  . LYS A 1 75  ? 11.680  -54.473 29.633  1.00 130.86 ? 92  LYS A CE  1 
ATOM   562  N  NZ  . LYS A 1 75  ? 10.674  -54.101 30.676  1.00 133.04 ? 92  LYS A NZ  1 
ATOM   563  N  N   . ASP A 1 76  ? 7.351   -58.296 28.705  1.00 96.33  ? 93  ASP A N   1 
ATOM   564  C  CA  . ASP A 1 76  ? 6.631   -59.335 29.434  1.00 92.57  ? 93  ASP A CA  1 
ATOM   565  C  C   . ASP A 1 76  ? 6.204   -60.496 28.548  1.00 90.20  ? 93  ASP A C   1 
ATOM   566  O  O   . ASP A 1 76  ? 6.259   -61.613 28.985  1.00 90.51  ? 93  ASP A O   1 
ATOM   567  C  CB  . ASP A 1 76  ? 5.404   -58.771 30.169  1.00 90.46  ? 93  ASP A CB  1 
ATOM   568  C  CG  . ASP A 1 76  ? 5.752   -58.186 31.521  1.00 89.92  ? 93  ASP A CG  1 
ATOM   569  O  OD1 . ASP A 1 76  ? 6.855   -58.459 32.031  1.00 88.35  ? 93  ASP A OD1 1 
ATOM   570  O  OD2 . ASP A 1 76  ? 4.914   -57.440 32.076  1.00 89.09  ? 93  ASP A OD2 1 
ATOM   571  N  N   . LEU A 1 77  ? 5.776   -60.245 27.322  1.00 88.47  ? 94  LEU A N   1 
ATOM   572  C  CA  . LEU A 1 77  ? 5.429   -61.332 26.427  1.00 88.88  ? 94  LEU A CA  1 
ATOM   573  C  C   . LEU A 1 77  ? 6.628   -62.240 26.118  1.00 95.11  ? 94  LEU A C   1 
ATOM   574  O  O   . LEU A 1 77  ? 6.517   -63.471 26.087  1.00 96.58  ? 94  LEU A O   1 
ATOM   575  C  CB  . LEU A 1 77  ? 4.888   -60.778 25.136  1.00 85.25  ? 94  LEU A CB  1 
ATOM   576  C  CG  . LEU A 1 77  ? 4.515   -61.822 24.110  1.00 85.42  ? 94  LEU A CG  1 
ATOM   577  C  CD1 . LEU A 1 77  ? 3.448   -62.740 24.663  1.00 86.41  ? 94  LEU A CD1 1 
ATOM   578  C  CD2 . LEU A 1 77  ? 4.000   -61.122 22.873  1.00 86.64  ? 94  LEU A CD2 1 
ATOM   579  N  N   . LYS A 1 78  ? 7.776   -61.636 25.866  1.00 99.19  ? 95  LYS A N   1 
ATOM   580  C  CA  . LYS A 1 78  ? 8.936   -62.437 25.578  1.00 103.91 ? 95  LYS A CA  1 
ATOM   581  C  C   . LYS A 1 78  ? 9.399   -63.161 26.852  1.00 106.92 ? 95  LYS A C   1 
ATOM   582  O  O   . LYS A 1 78  ? 9.950   -64.245 26.765  1.00 110.12 ? 95  LYS A O   1 
ATOM   583  C  CB  . LYS A 1 78  ? 10.054  -61.602 24.963  1.00 108.09 ? 95  LYS A CB  1 
ATOM   584  C  CG  . LYS A 1 78  ? 11.268  -62.439 24.565  1.00 109.93 ? 95  LYS A CG  1 
ATOM   585  C  CD  . LYS A 1 78  ? 12.333  -61.627 23.854  1.00 112.00 ? 95  LYS A CD  1 
ATOM   586  C  CE  . LYS A 1 78  ? 13.699  -62.282 23.955  1.00 114.81 ? 95  LYS A CE  1 
ATOM   587  N  NZ  . LYS A 1 78  ? 14.289  -62.127 25.314  1.00 115.83 ? 95  LYS A NZ  1 
ATOM   588  N  N   . ARG A 1 79  ? 9.171   -62.565 28.022  1.00 106.60 ? 96  ARG A N   1 
ATOM   589  C  CA  . ARG A 1 79  ? 9.420   -63.220 29.330  1.00 107.14 ? 96  ARG A CA  1 
ATOM   590  C  C   . ARG A 1 79  ? 8.648   -64.542 29.411  1.00 105.49 ? 96  ARG A C   1 
ATOM   591  O  O   . ARG A 1 79  ? 9.184   -65.552 29.850  1.00 110.96 ? 96  ARG A O   1 
ATOM   592  C  CB  . ARG A 1 79  ? 9.002   -62.291 30.483  1.00 108.15 ? 96  ARG A CB  1 
ATOM   593  C  CG  . ARG A 1 79  ? 9.846   -62.312 31.748  1.00 114.49 ? 96  ARG A CG  1 
ATOM   594  C  CD  . ARG A 1 79  ? 9.485   -61.113 32.650  1.00 119.22 ? 96  ARG A CD  1 
ATOM   595  N  NE  . ARG A 1 79  ? 10.459  -60.744 33.711  1.00 129.15 ? 96  ARG A NE  1 
ATOM   596  C  CZ  . ARG A 1 79  ? 10.276  -60.793 35.051  1.00 133.26 ? 96  ARG A CZ  1 
ATOM   597  N  NH1 . ARG A 1 79  ? 9.134   -61.222 35.611  1.00 131.81 ? 96  ARG A NH1 1 
ATOM   598  N  NH2 . ARG A 1 79  ? 11.269  -60.404 35.866  1.00 133.21 ? 96  ARG A NH2 1 
ATOM   599  N  N   . ILE A 1 80  ? 7.395   -64.521 28.962  1.00 104.45 ? 97  ILE A N   1 
ATOM   600  C  CA  . ILE A 1 80  ? 6.570   -65.727 28.862  1.00 108.23 ? 97  ILE A CA  1 
ATOM   601  C  C   . ILE A 1 80  ? 7.159   -66.737 27.888  1.00 109.72 ? 97  ILE A C   1 
ATOM   602  O  O   . ILE A 1 80  ? 7.334   -67.903 28.247  1.00 110.26 ? 97  ILE A O   1 
ATOM   603  C  CB  . ILE A 1 80  ? 5.093   -65.401 28.489  1.00 108.45 ? 97  ILE A CB  1 
ATOM   604  C  CG1 . ILE A 1 80  ? 4.398   -64.773 29.704  1.00 110.73 ? 97  ILE A CG1 1 
ATOM   605  C  CG2 . ILE A 1 80  ? 4.323   -66.650 28.035  1.00 107.89 ? 97  ILE A CG2 1 
ATOM   606  C  CD1 . ILE A 1 80  ? 3.009   -64.217 29.443  1.00 111.93 ? 97  ILE A CD1 1 
ATOM   607  N  N   . THR A 1 81  ? 7.464   -66.298 26.669  1.00 110.20 ? 98  THR A N   1 
ATOM   608  C  CA  . THR A 1 81  ? 7.945   -67.231 25.648  1.00 111.28 ? 98  THR A CA  1 
ATOM   609  C  C   . THR A 1 81  ? 9.343   -67.767 25.983  1.00 113.15 ? 98  THR A C   1 
ATOM   610  O  O   . THR A 1 81  ? 9.601   -68.957 25.791  1.00 112.94 ? 98  THR A O   1 
ATOM   611  C  CB  . THR A 1 81  ? 7.852   -66.657 24.216  1.00 109.69 ? 98  THR A CB  1 
ATOM   612  O  OG1 . THR A 1 81  ? 8.604   -65.446 24.102  1.00 109.32 ? 98  THR A OG1 1 
ATOM   613  C  CG2 . THR A 1 81  ? 6.406   -66.380 23.878  1.00 107.04 ? 98  THR A CG2 1 
ATOM   614  N  N   . ASP A 1 82  ? 10.208  -66.919 26.545  1.00 113.46 ? 99  ASP A N   1 
ATOM   615  C  CA  . ASP A 1 82  ? 11.534  -67.364 27.012  1.00 117.44 ? 99  ASP A CA  1 
ATOM   616  C  C   . ASP A 1 82  ? 11.422  -68.427 28.088  1.00 120.81 ? 99  ASP A C   1 
ATOM   617  O  O   . ASP A 1 82  ? 12.179  -69.403 28.084  1.00 119.27 ? 99  ASP A O   1 
ATOM   618  C  CB  . ASP A 1 82  ? 12.379  -66.193 27.547  1.00 115.74 ? 99  ASP A CB  1 
ATOM   619  C  CG  . ASP A 1 82  ? 12.899  -65.291 26.446  1.00 113.26 ? 99  ASP A CG  1 
ATOM   620  O  OD1 . ASP A 1 82  ? 12.845  -65.679 25.259  1.00 112.08 ? 99  ASP A OD1 1 
ATOM   621  O  OD2 . ASP A 1 82  ? 13.361  -64.185 26.770  1.00 110.94 ? 99  ASP A OD2 1 
ATOM   622  N  N   . SER A 1 83  ? 10.460  -68.251 28.990  1.00 124.89 ? 100 SER A N   1 
ATOM   623  C  CA  . SER A 1 83  ? 10.225  -69.243 30.039  1.00 128.75 ? 100 SER A CA  1 
ATOM   624  C  C   . SER A 1 83  ? 9.803   -70.636 29.517  1.00 130.77 ? 100 SER A C   1 
ATOM   625  O  O   . SER A 1 83  ? 9.837   -71.585 30.288  1.00 135.29 ? 100 SER A O   1 
ATOM   626  C  CB  . SER A 1 83  ? 9.201   -68.740 31.068  1.00 127.58 ? 100 SER A CB  1 
ATOM   627  O  OG  . SER A 1 83  ? 7.869   -68.957 30.625  1.00 128.69 ? 100 SER A OG  1 
ATOM   628  N  N   . ASP A 1 84  ? 9.383   -70.759 28.252  1.00 130.80 ? 101 ASP A N   1 
ATOM   629  C  CA  . ASP A 1 84  ? 9.074   -72.068 27.636  1.00 133.83 ? 101 ASP A CA  1 
ATOM   630  C  C   . ASP A 1 84  ? 7.800   -72.711 28.228  1.00 132.71 ? 101 ASP A C   1 
ATOM   631  O  O   . ASP A 1 84  ? 7.545   -73.910 28.056  1.00 128.80 ? 101 ASP A O   1 
ATOM   632  C  CB  . ASP A 1 84  ? 10.293  -73.016 27.761  1.00 138.11 ? 101 ASP A CB  1 
ATOM   633  C  CG  . ASP A 1 84  ? 10.286  -74.160 26.744  1.00 139.64 ? 101 ASP A CG  1 
ATOM   634  O  OD1 . ASP A 1 84  ? 9.767   -73.982 25.620  1.00 138.31 ? 101 ASP A OD1 1 
ATOM   635  O  OD2 . ASP A 1 84  ? 10.826  -75.245 27.075  1.00 139.55 ? 101 ASP A OD2 1 
ATOM   636  N  N   . VAL A 1 85  ? 6.989   -71.888 28.888  1.00 132.51 ? 102 VAL A N   1 
ATOM   637  C  CA  . VAL A 1 85  ? 5.776   -72.340 29.588  1.00 135.70 ? 102 VAL A CA  1 
ATOM   638  C  C   . VAL A 1 85  ? 4.760   -72.930 28.570  1.00 134.10 ? 102 VAL A C   1 
ATOM   639  O  O   . VAL A 1 85  ? 4.716   -72.455 27.445  1.00 134.92 ? 102 VAL A O   1 
ATOM   640  C  CB  . VAL A 1 85  ? 5.220   -71.163 30.447  1.00 136.21 ? 102 VAL A CB  1 
ATOM   641  C  CG1 . VAL A 1 85  ? 4.626   -70.057 29.587  1.00 136.56 ? 102 VAL A CG1 1 
ATOM   642  C  CG2 . VAL A 1 85  ? 4.208   -71.639 31.461  1.00 139.75 ? 102 VAL A CG2 1 
ATOM   643  N  N   . LYS A 1 86  ? 3.987   -73.968 28.933  1.00 131.94 ? 103 LYS A N   1 
ATOM   644  C  CA  . LYS A 1 86  ? 3.109   -74.700 27.961  1.00 129.66 ? 103 LYS A CA  1 
ATOM   645  C  C   . LYS A 1 86  ? 1.677   -74.905 28.426  1.00 124.76 ? 103 LYS A C   1 
ATOM   646  O  O   . LYS A 1 86  ? 1.390   -74.734 29.585  1.00 121.28 ? 103 LYS A O   1 
ATOM   647  C  CB  . LYS A 1 86  ? 3.625   -76.118 27.706  1.00 134.51 ? 103 LYS A CB  1 
ATOM   648  C  CG  . LYS A 1 86  ? 5.074   -76.283 27.280  1.00 140.43 ? 103 LYS A CG  1 
ATOM   649  C  CD  . LYS A 1 86  ? 5.248   -77.613 26.524  1.00 140.33 ? 103 LYS A CD  1 
ATOM   650  C  CE  . LYS A 1 86  ? 6.615   -78.250 26.720  1.00 141.03 ? 103 LYS A CE  1 
ATOM   651  N  NZ  . LYS A 1 86  ? 7.688   -77.526 25.998  1.00 142.19 ? 103 LYS A NZ  1 
ATOM   652  N  N   . GLY A 1 87  ? 0.791   -75.320 27.518  1.00 121.60 ? 104 GLY A N   1 
ATOM   653  C  CA  . GLY A 1 87  ? -0.563  -75.790 27.879  1.00 121.82 ? 104 GLY A CA  1 
ATOM   654  C  C   . GLY A 1 87  ? -1.384  -74.800 28.690  1.00 123.31 ? 104 GLY A C   1 
ATOM   655  O  O   . GLY A 1 87  ? -1.203  -73.596 28.556  1.00 127.23 ? 104 GLY A O   1 
ATOM   656  N  N   . ASP A 1 88  ? -2.271  -75.279 29.552  1.00 122.05 ? 105 ASP A N   1 
ATOM   657  C  CA  . ASP A 1 88  ? -3.046  -74.349 30.380  1.00 122.41 ? 105 ASP A CA  1 
ATOM   658  C  C   . ASP A 1 88  ? -2.237  -73.390 31.254  1.00 124.47 ? 105 ASP A C   1 
ATOM   659  O  O   . ASP A 1 88  ? -2.699  -72.277 31.469  1.00 125.15 ? 105 ASP A O   1 
ATOM   660  C  CB  . ASP A 1 88  ? -4.084  -75.083 31.231  1.00 121.66 ? 105 ASP A CB  1 
ATOM   661  C  CG  . ASP A 1 88  ? -5.387  -75.280 30.491  1.00 118.17 ? 105 ASP A CG  1 
ATOM   662  O  OD1 . ASP A 1 88  ? -5.359  -75.257 29.229  1.00 115.71 ? 105 ASP A OD1 1 
ATOM   663  O  OD2 . ASP A 1 88  ? -6.424  -75.447 31.170  1.00 110.41 ? 105 ASP A OD2 1 
ATOM   664  N  N   . LEU A 1 89  ? -1.070  -73.819 31.751  1.00 127.92 ? 106 LEU A N   1 
ATOM   665  C  CA  . LEU A 1 89  ? -0.096  -72.937 32.456  1.00 129.95 ? 106 LEU A CA  1 
ATOM   666  C  C   . LEU A 1 89  ? 0.155   -71.630 31.654  1.00 125.72 ? 106 LEU A C   1 
ATOM   667  O  O   . LEU A 1 89  ? 0.050   -70.493 32.160  1.00 119.81 ? 106 LEU A O   1 
ATOM   668  C  CB  . LEU A 1 89  ? 1.266   -73.671 32.636  1.00 135.71 ? 106 LEU A CB  1 
ATOM   669  C  CG  . LEU A 1 89  ? 1.495   -74.966 33.449  1.00 137.18 ? 106 LEU A CG  1 
ATOM   670  C  CD1 . LEU A 1 89  ? 2.803   -75.681 33.102  1.00 135.66 ? 106 LEU A CD1 1 
ATOM   671  C  CD2 . LEU A 1 89  ? 1.493   -74.627 34.923  1.00 140.24 ? 106 LEU A CD2 1 
ATOM   672  N  N   . PHE A 1 90  ? 0.506   -71.865 30.387  1.00 123.94 ? 107 PHE A N   1 
ATOM   673  C  CA  . PHE A 1 90  ? 0.805   -70.844 29.393  1.00 117.33 ? 107 PHE A CA  1 
ATOM   674  C  C   . PHE A 1 90  ? -0.429  -70.007 29.166  1.00 113.88 ? 107 PHE A C   1 
ATOM   675  O  O   . PHE A 1 90  ? -0.366  -68.787 29.243  1.00 114.18 ? 107 PHE A O   1 
ATOM   676  C  CB  . PHE A 1 90  ? 1.297   -71.517 28.080  1.00 117.84 ? 107 PHE A CB  1 
ATOM   677  C  CG  . PHE A 1 90  ? 1.123   -70.683 26.821  1.00 113.47 ? 107 PHE A CG  1 
ATOM   678  C  CD1 . PHE A 1 90  ? 1.605   -69.386 26.747  1.00 109.95 ? 107 PHE A CD1 1 
ATOM   679  C  CD2 . PHE A 1 90  ? 0.514   -71.237 25.680  1.00 110.48 ? 107 PHE A CD2 1 
ATOM   680  C  CE1 . PHE A 1 90  ? 1.442   -68.650 25.585  1.00 108.27 ? 107 PHE A CE1 1 
ATOM   681  C  CE2 . PHE A 1 90  ? 0.360   -70.503 24.518  1.00 105.73 ? 107 PHE A CE2 1 
ATOM   682  C  CZ  . PHE A 1 90  ? 0.829   -69.213 24.468  1.00 105.31 ? 107 PHE A CZ  1 
ATOM   683  N  N   . VAL A 1 91  ? -1.558  -70.659 28.924  1.00 111.33 ? 108 VAL A N   1 
ATOM   684  C  CA  . VAL A 1 91  ? -2.755  -69.924 28.555  1.00 110.85 ? 108 VAL A CA  1 
ATOM   685  C  C   . VAL A 1 91  ? -3.092  -68.958 29.678  1.00 111.60 ? 108 VAL A C   1 
ATOM   686  O  O   . VAL A 1 91  ? -3.323  -67.760 29.442  1.00 110.40 ? 108 VAL A O   1 
ATOM   687  C  CB  . VAL A 1 91  ? -3.945  -70.849 28.265  1.00 110.76 ? 108 VAL A CB  1 
ATOM   688  C  CG1 . VAL A 1 91  ? -5.199  -70.030 27.998  1.00 109.60 ? 108 VAL A CG1 1 
ATOM   689  C  CG2 . VAL A 1 91  ? -3.661  -71.709 27.051  1.00 112.14 ? 108 VAL A CG2 1 
ATOM   690  N  N   . LYS A 1 92  ? -3.080  -69.481 30.898  1.00 113.83 ? 109 LYS A N   1 
ATOM   691  C  CA  . LYS A 1 92  ? -3.414  -68.677 32.049  1.00 116.60 ? 109 LYS A CA  1 
ATOM   692  C  C   . LYS A 1 92  ? -2.430  -67.509 32.208  1.00 111.77 ? 109 LYS A C   1 
ATOM   693  O  O   . LYS A 1 92  ? -2.869  -66.376 32.330  1.00 105.11 ? 109 LYS A O   1 
ATOM   694  C  CB  . LYS A 1 92  ? -3.539  -69.542 33.317  1.00 126.99 ? 109 LYS A CB  1 
ATOM   695  C  CG  . LYS A 1 92  ? -4.748  -70.493 33.300  1.00 133.34 ? 109 LYS A CG  1 
ATOM   696  C  CD  . LYS A 1 92  ? -4.849  -71.412 34.528  1.00 138.25 ? 109 LYS A CD  1 
ATOM   697  C  CE  . LYS A 1 92  ? -6.057  -72.349 34.414  1.00 141.65 ? 109 LYS A CE  1 
ATOM   698  N  NZ  . LYS A 1 92  ? -5.958  -73.607 35.219  1.00 143.39 ? 109 LYS A NZ  1 
ATOM   699  N  N   . GLU A 1 93  ? -1.122  -67.753 32.133  1.00 108.68 ? 110 GLU A N   1 
ATOM   700  C  CA  . GLU A 1 93  ? -0.153  -66.655 32.293  1.00 106.70 ? 110 GLU A CA  1 
ATOM   701  C  C   . GLU A 1 93  ? -0.385  -65.552 31.251  1.00 104.36 ? 110 GLU A C   1 
ATOM   702  O  O   . GLU A 1 93  ? -0.334  -64.352 31.550  1.00 101.18 ? 110 GLU A O   1 
ATOM   703  C  CB  . GLU A 1 93  ? 1.301   -67.161 32.216  1.00 111.23 ? 110 GLU A CB  1 
ATOM   704  C  CG  . GLU A 1 93  ? 2.054   -67.169 33.544  1.00 116.95 ? 110 GLU A CG  1 
ATOM   705  C  CD  . GLU A 1 93  ? 3.313   -68.031 33.531  1.00 123.42 ? 110 GLU A CD  1 
ATOM   706  O  OE1 . GLU A 1 93  ? 4.203   -67.800 32.681  1.00 130.24 ? 110 GLU A OE1 1 
ATOM   707  O  OE2 . GLU A 1 93  ? 3.419   -68.955 34.372  1.00 127.06 ? 110 GLU A OE2 1 
ATOM   708  N  N   . LEU A 1 94  ? -0.645  -65.974 30.024  1.00 102.39 ? 111 LEU A N   1 
ATOM   709  C  CA  . LEU A 1 94  ? -0.763  -65.038 28.923  1.00 98.38  ? 111 LEU A CA  1 
ATOM   710  C  C   . LEU A 1 94  ? -1.917  -64.074 29.129  1.00 94.81  ? 111 LEU A C   1 
ATOM   711  O  O   . LEU A 1 94  ? -1.731  -62.871 29.059  1.00 93.36  ? 111 LEU A O   1 
ATOM   712  C  CB  . LEU A 1 94  ? -0.925  -65.800 27.613  1.00 99.77  ? 111 LEU A CB  1 
ATOM   713  C  CG  . LEU A 1 94  ? -1.497  -65.059 26.411  1.00 99.25  ? 111 LEU A CG  1 
ATOM   714  C  CD1 . LEU A 1 94  ? -0.555  -63.974 25.944  1.00 96.94  ? 111 LEU A CD1 1 
ATOM   715  C  CD2 . LEU A 1 94  ? -1.763  -66.058 25.297  1.00 100.44 ? 111 LEU A CD2 1 
ATOM   716  N  N   . PHE A 1 95  ? -3.114  -64.599 29.367  1.00 93.94  ? 112 PHE A N   1 
ATOM   717  C  CA  . PHE A 1 95  ? -4.284  -63.711 29.488  1.00 90.22  ? 112 PHE A CA  1 
ATOM   718  C  C   . PHE A 1 95  ? -4.261  -62.899 30.755  1.00 91.09  ? 112 PHE A C   1 
ATOM   719  O  O   . PHE A 1 95  ? -4.660  -61.736 30.772  1.00 90.66  ? 112 PHE A O   1 
ATOM   720  C  CB  . PHE A 1 95  ? -5.557  -64.486 29.333  1.00 86.14  ? 112 PHE A CB  1 
ATOM   721  C  CG  . PHE A 1 95  ? -5.805  -64.859 27.932  1.00 84.37  ? 112 PHE A CG  1 
ATOM   722  C  CD1 . PHE A 1 95  ? -6.481  -63.991 27.093  1.00 83.88  ? 112 PHE A CD1 1 
ATOM   723  C  CD2 . PHE A 1 95  ? -5.283  -66.014 27.412  1.00 86.04  ? 112 PHE A CD2 1 
ATOM   724  C  CE1 . PHE A 1 95  ? -6.697  -64.299 25.758  1.00 83.26  ? 112 PHE A CE1 1 
ATOM   725  C  CE2 . PHE A 1 95  ? -5.487  -66.331 26.080  1.00 87.54  ? 112 PHE A CE2 1 
ATOM   726  C  CZ  . PHE A 1 95  ? -6.193  -65.469 25.248  1.00 84.29  ? 112 PHE A CZ  1 
ATOM   727  N  N   . TRP A 1 96  ? -3.717  -63.513 31.787  1.00 92.51  ? 113 TRP A N   1 
ATOM   728  C  CA  . TRP A 1 96  ? -3.488  -62.849 33.034  1.00 94.50  ? 113 TRP A CA  1 
ATOM   729  C  C   . TRP A 1 96  ? -2.635  -61.639 32.758  1.00 93.59  ? 113 TRP A C   1 
ATOM   730  O  O   . TRP A 1 96  ? -2.997  -60.492 33.084  1.00 92.45  ? 113 TRP A O   1 
ATOM   731  C  CB  . TRP A 1 96  ? -2.792  -63.843 33.959  1.00 97.56  ? 113 TRP A CB  1 
ATOM   732  C  CG  . TRP A 1 96  ? -2.799  -63.519 35.346  1.00 100.16 ? 113 TRP A CG  1 
ATOM   733  C  CD1 . TRP A 1 96  ? -1.736  -63.539 36.173  1.00 103.13 ? 113 TRP A CD1 1 
ATOM   734  C  CD2 . TRP A 1 96  ? -3.929  -63.172 36.134  1.00 100.59 ? 113 TRP A CD2 1 
ATOM   735  N  NE1 . TRP A 1 96  ? -2.117  -63.200 37.432  1.00 104.91 ? 113 TRP A NE1 1 
ATOM   736  C  CE2 . TRP A 1 96  ? -3.462  -62.954 37.439  1.00 102.63 ? 113 TRP A CE2 1 
ATOM   737  C  CE3 . TRP A 1 96  ? -5.281  -62.980 35.857  1.00 101.18 ? 113 TRP A CE3 1 
ATOM   738  C  CZ2 . TRP A 1 96  ? -4.294  -62.569 38.472  1.00 102.28 ? 113 TRP A CZ2 1 
ATOM   739  C  CZ3 . TRP A 1 96  ? -6.102  -62.600 36.878  1.00 105.18 ? 113 TRP A CZ3 1 
ATOM   740  C  CH2 . TRP A 1 96  ? -5.607  -62.400 38.180  1.00 104.67 ? 113 TRP A CH2 1 
ATOM   741  N  N   . MET A 1 97  ? -1.535  -61.912 32.069  1.00 95.35  ? 114 MET A N   1 
ATOM   742  C  CA  . MET A 1 97  ? -0.566  -60.891 31.712  1.00 95.77  ? 114 MET A CA  1 
ATOM   743  C  C   . MET A 1 97  ? -1.189  -59.784 30.894  1.00 91.73  ? 114 MET A C   1 
ATOM   744  O  O   . MET A 1 97  ? -0.947  -58.619 31.163  1.00 90.63  ? 114 MET A O   1 
ATOM   745  C  CB  . MET A 1 97  ? 0.566   -61.498 30.896  1.00 97.99  ? 114 MET A CB  1 
ATOM   746  C  CG  . MET A 1 97  ? 1.719   -60.551 30.609  1.00 97.99  ? 114 MET A CG  1 
ATOM   747  S  SD  . MET A 1 97  ? 1.576   -59.740 29.019  1.00 94.88  ? 114 MET A SD  1 
ATOM   748  C  CE  . MET A 1 97  ? 1.712   -61.128 27.910  1.00 93.98  ? 114 MET A CE  1 
ATOM   749  N  N   . LEU A 1 98  ? -1.986  -60.157 29.904  1.00 90.78  ? 115 LEU A N   1 
ATOM   750  C  CA  . LEU A 1 98  ? -2.583  -59.166 29.031  1.00 90.42  ? 115 LEU A CA  1 
ATOM   751  C  C   . LEU A 1 98  ? -3.476  -58.234 29.806  1.00 88.96  ? 115 LEU A C   1 
ATOM   752  O  O   . LEU A 1 98  ? -3.464  -57.033 29.575  1.00 88.84  ? 115 LEU A O   1 
ATOM   753  C  CB  . LEU A 1 98  ? -3.359  -59.837 27.918  1.00 90.57  ? 115 LEU A CB  1 
ATOM   754  C  CG  . LEU A 1 98  ? -2.450  -60.678 27.014  1.00 91.35  ? 115 LEU A CG  1 
ATOM   755  C  CD1 . LEU A 1 98  ? -3.284  -61.594 26.123  1.00 92.78  ? 115 LEU A CD1 1 
ATOM   756  C  CD2 . LEU A 1 98  ? -1.514  -59.817 26.190  1.00 88.07  ? 115 LEU A CD2 1 
ATOM   757  N  N   . HIS A 1 99  ? -4.235  -58.793 30.740  1.00 92.47  ? 116 HIS A N   1 
ATOM   758  C  CA  . HIS A 1 99  ? -5.138  -57.992 31.550  1.00 94.65  ? 116 HIS A CA  1 
ATOM   759  C  C   . HIS A 1 99  ? -4.350  -56.964 32.343  1.00 95.68  ? 116 HIS A C   1 
ATOM   760  O  O   . HIS A 1 99  ? -4.683  -55.769 32.403  1.00 88.11  ? 116 HIS A O   1 
ATOM   761  C  CB  . HIS A 1 99  ? -5.953  -58.895 32.486  1.00 96.25  ? 116 HIS A CB  1 
ATOM   762  C  CG  . HIS A 1 99  ? -6.703  -58.151 33.548  1.00 98.46  ? 116 HIS A CG  1 
ATOM   763  N  ND1 . HIS A 1 99  ? -7.675  -57.208 33.266  1.00 100.21 ? 116 HIS A ND1 1 
ATOM   764  C  CD2 . HIS A 1 99  ? -6.609  -58.200 34.895  1.00 99.02  ? 116 HIS A CD2 1 
ATOM   765  C  CE1 . HIS A 1 99  ? -8.142  -56.706 34.395  1.00 100.84 ? 116 HIS A CE1 1 
ATOM   766  N  NE2 . HIS A 1 99  ? -7.515  -57.295 35.399  1.00 103.48 ? 116 HIS A NE2 1 
ATOM   767  N  N   . LEU A 1 100 ? -3.289  -57.453 32.953  1.00 102.21 ? 117 LEU A N   1 
ATOM   768  C  CA  . LEU A 1 100 ? -2.474  -56.588 33.771  1.00 106.98 ? 117 LEU A CA  1 
ATOM   769  C  C   . LEU A 1 100 ? -1.840  -55.480 32.926  1.00 101.14 ? 117 LEU A C   1 
ATOM   770  O  O   . LEU A 1 100 ? -1.782  -54.315 33.338  1.00 95.35  ? 117 LEU A O   1 
ATOM   771  C  CB  . LEU A 1 100 ? -1.388  -57.401 34.437  1.00 114.15 ? 117 LEU A CB  1 
ATOM   772  C  CG  . LEU A 1 100 ? -1.661  -58.327 35.654  1.00 123.63 ? 117 LEU A CG  1 
ATOM   773  C  CD1 . LEU A 1 100 ? -2.847  -57.871 36.518  1.00 126.73 ? 117 LEU A CD1 1 
ATOM   774  C  CD2 . LEU A 1 100 ? -1.688  -59.809 35.302  1.00 123.16 ? 117 LEU A CD2 1 
ATOM   775  N  N   . GLN A 1 101 ? -1.392  -55.861 31.733  1.00 95.64  ? 118 GLN A N   1 
ATOM   776  C  CA  . GLN A 1 101 ? -0.840  -54.914 30.815  1.00 94.19  ? 118 GLN A CA  1 
ATOM   777  C  C   . GLN A 1 101 ? -1.812  -53.840 30.429  1.00 91.97  ? 118 GLN A C   1 
ATOM   778  O  O   . GLN A 1 101 ? -1.444  -52.662 30.374  1.00 89.92  ? 118 GLN A O   1 
ATOM   779  C  CB  . GLN A 1 101 ? -0.339  -55.602 29.545  1.00 97.44  ? 118 GLN A CB  1 
ATOM   780  C  CG  . GLN A 1 101 ? 1.071   -56.149 29.642  1.00 98.69  ? 118 GLN A CG  1 
ATOM   781  C  CD  . GLN A 1 101 ? 2.062   -55.131 30.193  1.00 100.31 ? 118 GLN A CD  1 
ATOM   782  O  OE1 . GLN A 1 101 ? 3.098   -55.540 30.717  1.00 101.99 ? 118 GLN A OE1 1 
ATOM   783  N  NE2 . GLN A 1 101 ? 1.748   -53.799 30.098  1.00 96.30  ? 118 GLN A NE2 1 
ATOM   784  N  N   . LYS A 1 102 ? -3.046  -54.238 30.150  1.00 90.97  ? 119 LYS A N   1 
ATOM   785  C  CA  . LYS A 1 102 ? -4.046  -53.256 29.778  1.00 90.26  ? 119 LYS A CA  1 
ATOM   786  C  C   . LYS A 1 102 ? -4.207  -52.264 30.893  1.00 88.40  ? 119 LYS A C   1 
ATOM   787  O  O   . LYS A 1 102 ? -4.319  -51.089 30.643  1.00 85.37  ? 119 LYS A O   1 
ATOM   788  C  CB  . LYS A 1 102 ? -5.396  -53.885 29.493  1.00 94.67  ? 119 LYS A CB  1 
ATOM   789  C  CG  . LYS A 1 102 ? -5.478  -54.692 28.206  1.00 97.30  ? 119 LYS A CG  1 
ATOM   790  C  CD  . LYS A 1 102 ? -6.818  -54.440 27.526  1.00 99.70  ? 119 LYS A CD  1 
ATOM   791  C  CE  . LYS A 1 102 ? -7.289  -55.618 26.701  1.00 99.82  ? 119 LYS A CE  1 
ATOM   792  N  NZ  . LYS A 1 102 ? -8.575  -55.239 26.059  1.00 102.10 ? 119 LYS A NZ  1 
ATOM   793  N  N   . GLU A 1 103 ? -4.219  -52.741 32.129  1.00 92.50  ? 120 GLU A N   1 
ATOM   794  C  CA  . GLU A 1 103 ? -4.343  -51.849 33.267  1.00 96.16  ? 120 GLU A CA  1 
ATOM   795  C  C   . GLU A 1 103 ? -3.204  -50.863 33.350  1.00 92.96  ? 120 GLU A C   1 
ATOM   796  O  O   . GLU A 1 103 ? -3.411  -49.653 33.523  1.00 87.40  ? 120 GLU A O   1 
ATOM   797  C  CB  . GLU A 1 103 ? -4.428  -52.641 34.576  1.00 105.23 ? 120 GLU A CB  1 
ATOM   798  C  CG  . GLU A 1 103 ? -5.841  -52.790 35.102  1.00 110.66 ? 120 GLU A CG  1 
ATOM   799  C  CD  . GLU A 1 103 ? -6.543  -51.441 35.197  1.00 111.96 ? 120 GLU A CD  1 
ATOM   800  O  OE1 . GLU A 1 103 ? -5.854  -50.383 35.330  1.00 106.89 ? 120 GLU A OE1 1 
ATOM   801  O  OE2 . GLU A 1 103 ? -7.793  -51.461 35.118  1.00 112.93 ? 120 GLU A OE2 1 
ATOM   802  N  N   . THR A 1 104 ? -1.992  -51.380 33.194  1.00 90.17  ? 121 THR A N   1 
ATOM   803  C  CA  . THR A 1 104 ? -0.822  -50.526 33.263  1.00 85.83  ? 121 THR A CA  1 
ATOM   804  C  C   . THR A 1 104 ? -0.907  -49.501 32.179  1.00 77.90  ? 121 THR A C   1 
ATOM   805  O  O   . THR A 1 104 ? -0.627  -48.358 32.413  1.00 78.00  ? 121 THR A O   1 
ATOM   806  C  CB  . THR A 1 104 ? 0.477   -51.329 33.094  1.00 88.94  ? 121 THR A CB  1 
ATOM   807  O  OG1 . THR A 1 104 ? 0.589   -52.291 34.151  1.00 91.93  ? 121 THR A OG1 1 
ATOM   808  C  CG2 . THR A 1 104 ? 1.683   -50.425 33.117  1.00 87.30  ? 121 THR A CG2 1 
ATOM   809  N  N   . PHE A 1 105 ? -1.293  -49.933 30.989  1.00 74.02  ? 122 PHE A N   1 
ATOM   810  C  CA  . PHE A 1 105 ? -1.393  -49.045 29.856  1.00 70.71  ? 122 PHE A CA  1 
ATOM   811  C  C   . PHE A 1 105 ? -2.445  -47.976 30.085  1.00 67.88  ? 122 PHE A C   1 
ATOM   812  O  O   . PHE A 1 105 ? -2.259  -46.836 29.757  1.00 66.37  ? 122 PHE A O   1 
ATOM   813  C  CB  . PHE A 1 105 ? -1.723  -49.847 28.613  1.00 72.12  ? 122 PHE A CB  1 
ATOM   814  C  CG  . PHE A 1 105 ? -1.598  -49.060 27.346  1.00 73.02  ? 122 PHE A CG  1 
ATOM   815  C  CD1 . PHE A 1 105 ? -0.390  -48.974 26.716  1.00 74.41  ? 122 PHE A CD1 1 
ATOM   816  C  CD2 . PHE A 1 105 ? -2.678  -48.379 26.809  1.00 71.80  ? 122 PHE A CD2 1 
ATOM   817  C  CE1 . PHE A 1 105 ? -0.245  -48.227 25.560  1.00 73.83  ? 122 PHE A CE1 1 
ATOM   818  C  CE2 . PHE A 1 105 ? -2.550  -47.637 25.658  1.00 72.06  ? 122 PHE A CE2 1 
ATOM   819  C  CZ  . PHE A 1 105 ? -1.329  -47.570 25.019  1.00 73.07  ? 122 PHE A CZ  1 
ATOM   820  N  N   . ALA A 1 106 ? -3.550  -48.364 30.684  1.00 71.41  ? 123 ALA A N   1 
ATOM   821  C  CA  . ALA A 1 106 ? -4.610  -47.438 31.022  1.00 73.45  ? 123 ALA A CA  1 
ATOM   822  C  C   . ALA A 1 106 ? -4.062  -46.333 31.823  1.00 73.98  ? 123 ALA A C   1 
ATOM   823  O  O   . ALA A 1 106 ? -4.364  -45.162 31.601  1.00 74.36  ? 123 ALA A O   1 
ATOM   824  C  CB  . ALA A 1 106 ? -5.678  -48.126 31.825  1.00 76.55  ? 123 ALA A CB  1 
ATOM   825  N  N   . THR A 1 107 ? -3.212  -46.699 32.758  1.00 77.69  ? 124 THR A N   1 
ATOM   826  C  CA  . THR A 1 107 ? -2.620  -45.677 33.558  1.00 80.39  ? 124 THR A CA  1 
ATOM   827  C  C   . THR A 1 107 ? -1.818  -44.749 32.721  1.00 76.40  ? 124 THR A C   1 
ATOM   828  O  O   . THR A 1 107 ? -1.988  -43.543 32.841  1.00 75.53  ? 124 THR A O   1 
ATOM   829  C  CB  . THR A 1 107 ? -1.717  -46.197 34.671  1.00 85.95  ? 124 THR A CB  1 
ATOM   830  O  OG1 . THR A 1 107 ? -2.358  -47.282 35.368  1.00 86.77  ? 124 THR A OG1 1 
ATOM   831  C  CG2 . THR A 1 107 ? -1.497  -45.028 35.640  1.00 88.80  ? 124 THR A CG2 1 
ATOM   832  N  N   . TYR A 1 108 ? -0.950  -45.305 31.871  1.00 73.59  ? 125 TYR A N   1 
ATOM   833  C  CA  . TYR A 1 108 ? -0.160  -44.453 30.978  1.00 71.22  ? 125 TYR A CA  1 
ATOM   834  C  C   . TYR A 1 108 ? -1.018  -43.551 30.152  1.00 70.30  ? 125 TYR A C   1 
ATOM   835  O  O   . TYR A 1 108 ? -0.628  -42.435 29.894  1.00 70.74  ? 125 TYR A O   1 
ATOM   836  C  CB  . TYR A 1 108 ? 0.700   -45.232 30.013  1.00 70.05  ? 125 TYR A CB  1 
ATOM   837  C  CG  . TYR A 1 108 ? 1.699   -46.139 30.646  1.00 73.14  ? 125 TYR A CG  1 
ATOM   838  C  CD1 . TYR A 1 108 ? 2.278   -45.836 31.866  1.00 73.87  ? 125 TYR A CD1 1 
ATOM   839  C  CD2 . TYR A 1 108 ? 2.109   -47.316 29.998  1.00 76.61  ? 125 TYR A CD2 1 
ATOM   840  C  CE1 . TYR A 1 108 ? 3.210   -46.681 32.442  1.00 76.35  ? 125 TYR A CE1 1 
ATOM   841  C  CE2 . TYR A 1 108 ? 3.058   -48.173 30.569  1.00 77.66  ? 125 TYR A CE2 1 
ATOM   842  C  CZ  . TYR A 1 108 ? 3.611   -47.835 31.799  1.00 77.26  ? 125 TYR A CZ  1 
ATOM   843  O  OH  . TYR A 1 108 ? 4.554   -48.615 32.431  1.00 77.94  ? 125 TYR A OH  1 
ATOM   844  N  N   . VAL A 1 109 ? -2.176  -44.021 29.717  1.00 70.08  ? 126 VAL A N   1 
ATOM   845  C  CA  . VAL A 1 109 ? -3.027  -43.167 28.922  1.00 71.77  ? 126 VAL A CA  1 
ATOM   846  C  C   . VAL A 1 109 ? -3.552  -41.975 29.738  1.00 76.00  ? 126 VAL A C   1 
ATOM   847  O  O   . VAL A 1 109 ? -3.403  -40.818 29.311  1.00 72.62  ? 126 VAL A O   1 
ATOM   848  C  CB  . VAL A 1 109 ? -4.191  -43.948 28.307  1.00 72.71  ? 126 VAL A CB  1 
ATOM   849  C  CG1 . VAL A 1 109 ? -5.217  -42.989 27.696  1.00 72.49  ? 126 VAL A CG1 1 
ATOM   850  C  CG2 . VAL A 1 109 ? -3.673  -44.936 27.259  1.00 71.40  ? 126 VAL A CG2 1 
ATOM   851  N  N   . ALA A 1 110 ? -4.151  -42.253 30.908  1.00 79.20  ? 127 ALA A N   1 
ATOM   852  C  CA  . ALA A 1 110 ? -4.717  -41.182 31.763  1.00 79.13  ? 127 ALA A CA  1 
ATOM   853  C  C   . ALA A 1 110 ? -3.666  -40.107 32.084  1.00 77.68  ? 127 ALA A C   1 
ATOM   854  O  O   . ALA A 1 110 ? -3.964  -38.913 32.125  1.00 78.93  ? 127 ALA A O   1 
ATOM   855  C  CB  . ALA A 1 110 ? -5.296  -41.771 33.036  1.00 78.93  ? 127 ALA A CB  1 
ATOM   856  N  N   . ARG A 1 111 ? -2.432  -40.565 32.282  1.00 76.65  ? 128 ARG A N   1 
ATOM   857  C  CA  . ARG A 1 111 ? -1.282  -39.700 32.499  1.00 77.03  ? 128 ARG A CA  1 
ATOM   858  C  C   . ARG A 1 111 ? -1.069  -38.853 31.266  1.00 74.39  ? 128 ARG A C   1 
ATOM   859  O  O   . ARG A 1 111 ? -0.967  -37.658 31.373  1.00 72.92  ? 128 ARG A O   1 
ATOM   860  C  CB  . ARG A 1 111 ? -0.002  -40.536 32.830  1.00 77.25  ? 128 ARG A CB  1 
ATOM   861  C  CG  . ARG A 1 111 ? 1.125   -39.757 33.497  1.00 74.49  ? 128 ARG A CG  1 
ATOM   862  C  CD  . ARG A 1 111 ? 2.366   -40.555 33.922  1.00 74.35  ? 128 ARG A CD  1 
ATOM   863  N  NE  . ARG A 1 111 ? 3.518   -39.655 34.093  1.00 76.51  ? 128 ARG A NE  1 
ATOM   864  C  CZ  . ARG A 1 111 ? 4.770   -39.989 34.413  1.00 78.20  ? 128 ARG A CZ  1 
ATOM   865  N  NH1 . ARG A 1 111 ? 5.121   -41.238 34.673  1.00 79.57  ? 128 ARG A NH1 1 
ATOM   866  N  NH2 . ARG A 1 111 ? 5.702   -39.034 34.500  1.00 80.60  ? 128 ARG A NH2 1 
ATOM   867  N  N   . PHE A 1 112 ? -1.015  -39.480 30.092  1.00 75.54  ? 129 PHE A N   1 
ATOM   868  C  CA  . PHE A 1 112 ? -0.826  -38.727 28.867  1.00 72.69  ? 129 PHE A CA  1 
ATOM   869  C  C   . PHE A 1 112 ? -1.938  -37.669 28.714  1.00 71.49  ? 129 PHE A C   1 
ATOM   870  O  O   . PHE A 1 112 ? -1.647  -36.504 28.477  1.00 70.24  ? 129 PHE A O   1 
ATOM   871  C  CB  . PHE A 1 112 ? -0.771  -39.629 27.626  1.00 71.58  ? 129 PHE A CB  1 
ATOM   872  C  CG  . PHE A 1 112 ? -1.161  -38.907 26.367  1.00 70.19  ? 129 PHE A CG  1 
ATOM   873  C  CD1 . PHE A 1 112 ? -0.231  -38.119 25.710  1.00 69.63  ? 129 PHE A CD1 1 
ATOM   874  C  CD2 . PHE A 1 112 ? -2.489  -38.935 25.890  1.00 69.29  ? 129 PHE A CD2 1 
ATOM   875  C  CE1 . PHE A 1 112 ? -0.585  -37.405 24.583  1.00 68.99  ? 129 PHE A CE1 1 
ATOM   876  C  CE2 . PHE A 1 112 ? -2.852  -38.221 24.767  1.00 69.24  ? 129 PHE A CE2 1 
ATOM   877  C  CZ  . PHE A 1 112 ? -1.892  -37.456 24.107  1.00 69.26  ? 129 PHE A CZ  1 
ATOM   878  N  N   . GLN A 1 113 ? -3.197  -38.067 28.867  1.00 70.64  ? 130 GLN A N   1 
ATOM   879  C  CA  . GLN A 1 113 ? -4.295  -37.127 28.709  1.00 71.70  ? 130 GLN A CA  1 
ATOM   880  C  C   . GLN A 1 113 ? -4.180  -35.941 29.602  1.00 74.08  ? 130 GLN A C   1 
ATOM   881  O  O   . GLN A 1 113 ? -4.437  -34.843 29.154  1.00 77.15  ? 130 GLN A O   1 
ATOM   882  C  CB  . GLN A 1 113 ? -5.645  -37.734 29.031  1.00 75.84  ? 130 GLN A CB  1 
ATOM   883  C  CG  . GLN A 1 113 ? -5.999  -38.981 28.230  1.00 79.77  ? 130 GLN A CG  1 
ATOM   884  C  CD  . GLN A 1 113 ? -7.496  -39.149 27.996  1.00 84.47  ? 130 GLN A CD  1 
ATOM   885  O  OE1 . GLN A 1 113 ? -7.911  -40.107 27.378  1.00 84.60  ? 130 GLN A OE1 1 
ATOM   886  N  NE2 . GLN A 1 113 ? -8.313  -38.210 28.496  1.00 92.95  ? 130 GLN A NE2 1 
ATOM   887  N  N   . LYS A 1 114 ? -3.857  -36.148 30.879  1.00 76.37  ? 131 LYS A N   1 
ATOM   888  C  CA  . LYS A 1 114 ? -3.782  -35.027 31.810  1.00 76.39  ? 131 LYS A CA  1 
ATOM   889  C  C   . LYS A 1 114 ? -2.459  -34.240 31.781  1.00 73.28  ? 131 LYS A C   1 
ATOM   890  O  O   . LYS A 1 114 ? -2.407  -33.132 32.258  1.00 74.87  ? 131 LYS A O   1 
ATOM   891  C  CB  . LYS A 1 114 ? -4.080  -35.483 33.225  1.00 82.21  ? 131 LYS A CB  1 
ATOM   892  C  CG  . LYS A 1 114 ? -4.001  -34.320 34.212  1.00 89.32  ? 131 LYS A CG  1 
ATOM   893  C  CD  . LYS A 1 114 ? -4.904  -34.462 35.435  1.00 94.28  ? 131 LYS A CD  1 
ATOM   894  C  CE  . LYS A 1 114 ? -4.916  -33.162 36.251  1.00 97.88  ? 131 LYS A CE  1 
ATOM   895  N  NZ  . LYS A 1 114 ? -4.826  -33.341 37.738  1.00 99.64  ? 131 LYS A NZ  1 
ATOM   896  N  N   . GLU A 1 115 ? -1.409  -34.793 31.200  1.00 69.30  ? 132 GLU A N   1 
ATOM   897  C  CA  . GLU A 1 115 ? -0.108  -34.180 31.260  1.00 67.65  ? 132 GLU A CA  1 
ATOM   898  C  C   . GLU A 1 115 ? 0.555   -33.846 29.955  1.00 69.06  ? 132 GLU A C   1 
ATOM   899  O  O   . GLU A 1 115 ? 1.382   -32.963 29.944  1.00 73.93  ? 132 GLU A O   1 
ATOM   900  C  CB  . GLU A 1 115 ? 0.850   -35.108 31.982  1.00 66.22  ? 132 GLU A CB  1 
ATOM   901  C  CG  . GLU A 1 115 ? 0.460   -35.487 33.397  1.00 64.20  ? 132 GLU A CG  1 
ATOM   902  C  CD  . GLU A 1 115 ? 1.568   -36.300 34.084  1.00 64.20  ? 132 GLU A CD  1 
ATOM   903  O  OE1 . GLU A 1 115 ? 2.701   -36.415 33.516  1.00 59.24  ? 132 GLU A OE1 1 
ATOM   904  O  OE2 . GLU A 1 115 ? 1.293   -36.844 35.194  1.00 64.47  ? 132 GLU A OE2 1 
ATOM   905  N  N   . ALA A 1 116 ? 0.311   -34.593 28.892  1.00 70.83  ? 133 ALA A N   1 
ATOM   906  C  CA  . ALA A 1 116 ? 0.977   -34.320 27.595  1.00 71.59  ? 133 ALA A CA  1 
ATOM   907  C  C   . ALA A 1 116 ? 0.036   -33.958 26.439  1.00 70.36  ? 133 ALA A C   1 
ATOM   908  O  O   . ALA A 1 116 ? 0.492   -33.466 25.412  1.00 69.58  ? 133 ALA A O   1 
ATOM   909  C  CB  . ALA A 1 116 ? 1.877   -35.493 27.204  1.00 73.36  ? 133 ALA A CB  1 
ATOM   910  N  N   . TYR A 1 117 ? -1.262  -34.194 26.584  1.00 70.80  ? 134 TYR A N   1 
ATOM   911  C  CA  . TYR A 1 117 ? -2.222  -33.786 25.551  1.00 71.45  ? 134 TYR A CA  1 
ATOM   912  C  C   . TYR A 1 117 ? -2.439  -32.259 25.619  1.00 71.11  ? 134 TYR A C   1 
ATOM   913  O  O   . TYR A 1 117 ? -2.819  -31.740 26.642  1.00 70.84  ? 134 TYR A O   1 
ATOM   914  C  CB  . TYR A 1 117 ? -3.541  -34.574 25.697  1.00 70.47  ? 134 TYR A CB  1 
ATOM   915  C  CG  . TYR A 1 117 ? -4.680  -34.066 24.840  1.00 73.22  ? 134 TYR A CG  1 
ATOM   916  C  CD1 . TYR A 1 117 ? -4.740  -34.343 23.469  1.00 77.24  ? 134 TYR A CD1 1 
ATOM   917  C  CD2 . TYR A 1 117 ? -5.705  -33.307 25.389  1.00 74.31  ? 134 TYR A CD2 1 
ATOM   918  C  CE1 . TYR A 1 117 ? -5.788  -33.871 22.673  1.00 76.95  ? 134 TYR A CE1 1 
ATOM   919  C  CE2 . TYR A 1 117 ? -6.753  -32.828 24.605  1.00 76.36  ? 134 TYR A CE2 1 
ATOM   920  C  CZ  . TYR A 1 117 ? -6.792  -33.113 23.253  1.00 77.27  ? 134 TYR A CZ  1 
ATOM   921  O  OH  . TYR A 1 117 ? -7.831  -32.628 22.500  1.00 79.83  ? 134 TYR A OH  1 
ATOM   922  N  N   . CYS A 1 118 ? -2.182  -31.553 24.524  1.00 73.65  ? 135 CYS A N   1 
ATOM   923  C  CA  . CYS A 1 118 ? -2.486  -30.115 24.395  1.00 74.92  ? 135 CYS A CA  1 
ATOM   924  C  C   . CYS A 1 118 ? -2.140  -29.372 25.645  1.00 75.56  ? 135 CYS A C   1 
ATOM   925  O  O   . CYS A 1 118 ? -3.003  -28.803 26.301  1.00 78.40  ? 135 CYS A O   1 
ATOM   926  C  CB  . CYS A 1 118 ? -3.964  -29.898 24.062  1.00 77.65  ? 135 CYS A CB  1 
ATOM   927  S  SG  . CYS A 1 118 ? -4.497  -30.607 22.493  1.00 74.77  ? 135 CYS A SG  1 
ATOM   928  N  N   . PRO A 1 119 ? -0.871  -29.436 26.021  1.00 75.15  ? 136 PRO A N   1 
ATOM   929  C  CA  . PRO A 1 119 ? -0.452  -28.775 27.216  1.00 74.41  ? 136 PRO A CA  1 
ATOM   930  C  C   . PRO A 1 119 ? -0.307  -27.250 27.076  1.00 73.50  ? 136 PRO A C   1 
ATOM   931  O  O   . PRO A 1 119 ? -0.030  -26.572 28.050  1.00 73.24  ? 136 PRO A O   1 
ATOM   932  C  CB  . PRO A 1 119 ? 0.897   -29.416 27.456  1.00 75.30  ? 136 PRO A CB  1 
ATOM   933  C  CG  . PRO A 1 119 ? 1.412   -29.648 26.078  1.00 74.59  ? 136 PRO A CG  1 
ATOM   934  C  CD  . PRO A 1 119 ? 0.224   -30.224 25.431  1.00 73.65  ? 136 PRO A CD  1 
ATOM   935  N  N   . ASN A 1 120 ? -0.443  -26.693 25.894  1.00 74.65  ? 137 ASN A N   1 
ATOM   936  C  CA  . ASN A 1 120 ? -0.413  -25.234 25.801  1.00 78.33  ? 137 ASN A CA  1 
ATOM   937  C  C   . ASN A 1 120 ? -1.493  -24.602 26.677  1.00 79.90  ? 137 ASN A C   1 
ATOM   938  O  O   . ASN A 1 120 ? -2.531  -25.205 26.889  1.00 79.43  ? 137 ASN A O   1 
ATOM   939  C  CB  . ASN A 1 120 ? -0.583  -24.765 24.354  1.00 78.59  ? 137 ASN A CB  1 
ATOM   940  C  CG  . ASN A 1 120 ? -1.866  -25.263 23.725  1.00 77.73  ? 137 ASN A CG  1 
ATOM   941  O  OD1 . ASN A 1 120 ? -2.216  -26.449 23.856  1.00 79.60  ? 137 ASN A OD1 1 
ATOM   942  N  ND2 . ASN A 1 120 ? -2.569  -24.373 23.027  1.00 77.56  ? 137 ASN A ND2 1 
ATOM   943  N  N   . LYS A 1 121 ? -1.236  -23.400 27.189  1.00 82.51  ? 138 LYS A N   1 
ATOM   944  C  CA  . LYS A 1 121 ? -2.217  -22.699 28.023  1.00 81.15  ? 138 LYS A CA  1 
ATOM   945  C  C   . LYS A 1 121 ? -2.882  -21.531 27.319  1.00 77.34  ? 138 LYS A C   1 
ATOM   946  O  O   . LYS A 1 121 ? -3.819  -20.956 27.842  1.00 75.25  ? 138 LYS A O   1 
ATOM   947  C  CB  . LYS A 1 121 ? -1.549  -22.223 29.288  1.00 84.11  ? 138 LYS A CB  1 
ATOM   948  C  CG  . LYS A 1 121 ? -1.143  -23.354 30.213  1.00 89.80  ? 138 LYS A CG  1 
ATOM   949  C  CD  . LYS A 1 121 ? 0.108   -22.982 31.026  1.00 97.32  ? 138 LYS A CD  1 
ATOM   950  C  CE  . LYS A 1 121 ? 0.275   -23.846 32.271  1.00 99.56  ? 138 LYS A CE  1 
ATOM   951  N  NZ  . LYS A 1 121 ? 1.615   -23.673 32.878  1.00 101.06 ? 138 LYS A NZ  1 
ATOM   952  N  N   . CYS A 1 122 ? -2.357  -21.153 26.166  1.00 76.13  ? 139 CYS A N   1 
ATOM   953  C  CA  . CYS A 1 122 ? -2.968  -20.148 25.310  1.00 79.27  ? 139 CYS A CA  1 
ATOM   954  C  C   . CYS A 1 122 ? -2.547  -20.544 23.919  1.00 77.21  ? 139 CYS A C   1 
ATOM   955  O  O   . CYS A 1 122 ? -1.720  -21.463 23.777  1.00 72.96  ? 139 CYS A O   1 
ATOM   956  C  CB  . CYS A 1 122 ? -2.414  -18.748 25.644  1.00 83.51  ? 139 CYS A CB  1 
ATOM   957  S  SG  . CYS A 1 122 ? -0.631  -18.507 25.349  1.00 81.30  ? 139 CYS A SG  1 
ATOM   958  N  N   . GLY A 1 123 ? -3.091  -19.851 22.920  1.00 78.55  ? 140 GLY A N   1 
ATOM   959  C  CA  . GLY A 1 123 ? -2.646  -19.970 21.524  1.00 78.50  ? 140 GLY A CA  1 
ATOM   960  C  C   . GLY A 1 123 ? -3.018  -21.314 20.953  1.00 76.74  ? 140 GLY A C   1 
ATOM   961  O  O   . GLY A 1 123 ? -3.993  -21.911 21.410  1.00 75.74  ? 140 GLY A O   1 
ATOM   962  N  N   . VAL A 1 124 ? -2.211  -21.790 19.999  1.00 74.98  ? 141 VAL A N   1 
ATOM   963  C  CA  . VAL A 1 124 ? -2.472  -23.017 19.258  1.00 75.07  ? 141 VAL A CA  1 
ATOM   964  C  C   . VAL A 1 124 ? -1.202  -23.828 19.120  1.00 70.94  ? 141 VAL A C   1 
ATOM   965  O  O   . VAL A 1 124 ? -0.251  -23.392 18.505  1.00 70.91  ? 141 VAL A O   1 
ATOM   966  C  CB  . VAL A 1 124 ? -3.003  -22.694 17.833  1.00 78.25  ? 141 VAL A CB  1 
ATOM   967  C  CG1 . VAL A 1 124 ? -3.241  -23.976 17.031  1.00 79.17  ? 141 VAL A CG1 1 
ATOM   968  C  CG2 . VAL A 1 124 ? -4.280  -21.849 17.904  1.00 78.40  ? 141 VAL A CG2 1 
ATOM   969  N  N   . MET A 1 125 ? -1.212  -25.025 19.654  1.00 70.71  ? 142 MET A N   1 
ATOM   970  C  CA  . MET A 1 125 ? -0.102  -25.942 19.523  1.00 71.55  ? 142 MET A CA  1 
ATOM   971  C  C   . MET A 1 125 ? -0.541  -27.065 18.613  1.00 68.44  ? 142 MET A C   1 
ATOM   972  O  O   . MET A 1 125 ? -1.603  -27.617 18.794  1.00 68.60  ? 142 MET A O   1 
ATOM   973  C  CB  . MET A 1 125 ? 0.218   -26.515 20.899  1.00 75.80  ? 142 MET A CB  1 
ATOM   974  C  CG  . MET A 1 125 ? 1.341   -27.533 20.952  1.00 77.58  ? 142 MET A CG  1 
ATOM   975  S  SD  . MET A 1 125 ? 1.674   -28.059 22.646  1.00 80.63  ? 142 MET A SD  1 
ATOM   976  C  CE  . MET A 1 125 ? 2.858   -29.348 22.326  1.00 84.14  ? 142 MET A CE  1 
ATOM   977  N  N   . LEU A 1 126 ? 0.279   -27.423 17.642  1.00 66.41  ? 143 LEU A N   1 
ATOM   978  C  CA  . LEU A 1 126 ? -0.028  -28.547 16.776  1.00 64.96  ? 143 LEU A CA  1 
ATOM   979  C  C   . LEU A 1 126 ? 0.719   -29.750 17.309  1.00 65.63  ? 143 LEU A C   1 
ATOM   980  O  O   . LEU A 1 126 ? 1.935   -29.655 17.550  1.00 65.18  ? 143 LEU A O   1 
ATOM   981  C  CB  . LEU A 1 126 ? 0.392   -28.262 15.336  1.00 64.18  ? 143 LEU A CB  1 
ATOM   982  C  CG  . LEU A 1 126 ? -0.166  -26.999 14.666  1.00 64.78  ? 143 LEU A CG  1 
ATOM   983  C  CD1 . LEU A 1 126 ? 0.387   -26.836 13.251  1.00 65.37  ? 143 LEU A CD1 1 
ATOM   984  C  CD2 . LEU A 1 126 ? -1.683  -26.974 14.646  1.00 65.46  ? 143 LEU A CD2 1 
ATOM   985  N  N   . GLN A 1 127 ? 0.021   -30.870 17.503  1.00 65.25  ? 144 GLN A N   1 
ATOM   986  C  CA  . GLN A 1 127 ? 0.709   -32.047 17.977  1.00 67.80  ? 144 GLN A CA  1 
ATOM   987  C  C   . GLN A 1 127 ? 0.246   -33.322 17.327  1.00 67.30  ? 144 GLN A C   1 
ATOM   988  O  O   . GLN A 1 127 ? -0.935  -33.571 17.127  1.00 68.93  ? 144 GLN A O   1 
ATOM   989  C  CB  . GLN A 1 127 ? 0.648   -32.125 19.504  1.00 71.41  ? 144 GLN A CB  1 
ATOM   990  C  CG  . GLN A 1 127 ? -0.269  -33.163 20.122  1.00 77.04  ? 144 GLN A CG  1 
ATOM   991  C  CD  . GLN A 1 127 ? -0.354  -33.029 21.634  1.00 81.22  ? 144 GLN A CD  1 
ATOM   992  O  OE1 . GLN A 1 127 ? -1.100  -32.176 22.147  1.00 89.76  ? 144 GLN A OE1 1 
ATOM   993  N  NE2 . GLN A 1 127 ? 0.395   -33.869 22.361  1.00 78.10  ? 144 GLN A NE2 1 
ATOM   994  N  N   . THR A 1 128 ? 1.215   -34.153 17.030  1.00 66.63  ? 145 THR A N   1 
ATOM   995  C  CA  . THR A 1 128 ? 0.984   -35.383 16.347  1.00 66.61  ? 145 THR A CA  1 
ATOM   996  C  C   . THR A 1 128 ? 0.431   -36.362 17.344  1.00 67.80  ? 145 THR A C   1 
ATOM   997  O  O   . THR A 1 128 ? 0.998   -36.540 18.426  1.00 67.58  ? 145 THR A O   1 
ATOM   998  C  CB  . THR A 1 128 ? 2.300   -35.900 15.783  1.00 66.19  ? 145 THR A CB  1 
ATOM   999  O  OG1 . THR A 1 128 ? 2.731   -35.002 14.772  1.00 65.13  ? 145 THR A OG1 1 
ATOM   1000 C  CG2 . THR A 1 128 ? 2.145   -37.283 15.185  1.00 68.08  ? 145 THR A CG2 1 
ATOM   1001 N  N   . LEU A 1 129 ? -0.684  -36.979 16.989  1.00 68.34  ? 146 LEU A N   1 
ATOM   1002 C  CA  . LEU A 1 129 ? -1.281  -38.003 17.828  1.00 69.75  ? 146 LEU A CA  1 
ATOM   1003 C  C   . LEU A 1 129 ? -1.460  -39.221 16.990  1.00 67.77  ? 146 LEU A C   1 
ATOM   1004 O  O   . LEU A 1 129 ? -1.430  -39.131 15.794  1.00 70.41  ? 146 LEU A O   1 
ATOM   1005 C  CB  . LEU A 1 129 ? -2.651  -37.564 18.352  1.00 70.12  ? 146 LEU A CB  1 
ATOM   1006 C  CG  . LEU A 1 129 ? -2.679  -36.306 19.197  1.00 69.19  ? 146 LEU A CG  1 
ATOM   1007 C  CD1 . LEU A 1 129 ? -4.119  -35.925 19.500  1.00 69.74  ? 146 LEU A CD1 1 
ATOM   1008 C  CD2 . LEU A 1 129 ? -1.879  -36.527 20.458  1.00 68.79  ? 146 LEU A CD2 1 
ATOM   1009 N  N   . ILE A 1 130 ? -1.671  -40.340 17.640  1.00 65.96  ? 147 ILE A N   1 
ATOM   1010 C  CA  . ILE A 1 130 ? -1.981  -41.566 16.973  1.00 68.17  ? 147 ILE A CA  1 
ATOM   1011 C  C   . ILE A 1 130 ? -3.377  -41.941 17.396  1.00 68.13  ? 147 ILE A C   1 
ATOM   1012 O  O   . ILE A 1 130 ? -3.661  -41.962 18.584  1.00 71.33  ? 147 ILE A O   1 
ATOM   1013 C  CB  . ILE A 1 130 ? -1.026  -42.646 17.436  1.00 67.26  ? 147 ILE A CB  1 
ATOM   1014 C  CG1 . ILE A 1 130 ? 0.377   -42.306 16.956  1.00 67.81  ? 147 ILE A CG1 1 
ATOM   1015 C  CG2 . ILE A 1 130 ? -1.495  -44.008 16.940  1.00 68.86  ? 147 ILE A CG2 1 
ATOM   1016 C  CD1 . ILE A 1 130 ? 1.442   -42.658 17.963  1.00 69.15  ? 147 ILE A CD1 1 
ATOM   1017 N  N   . TRP A 1 131 ? -4.235  -42.243 16.432  1.00 66.94  ? 148 TRP A N   1 
ATOM   1018 C  CA  . TRP A 1 131 ? -5.625  -42.556 16.717  1.00 66.65  ? 148 TRP A CA  1 
ATOM   1019 C  C   . TRP A 1 131 ? -5.711  -44.062 16.817  1.00 72.08  ? 148 TRP A C   1 
ATOM   1020 O  O   . TRP A 1 131 ? -5.297  -44.778 15.896  1.00 72.11  ? 148 TRP A O   1 
ATOM   1021 C  CB  . TRP A 1 131 ? -6.538  -42.037 15.628  1.00 65.09  ? 148 TRP A CB  1 
ATOM   1022 C  CG  . TRP A 1 131 ? -7.063  -40.671 15.843  1.00 63.95  ? 148 TRP A CG  1 
ATOM   1023 C  CD1 . TRP A 1 131 ? -8.311  -40.353 16.220  1.00 64.51  ? 148 TRP A CD1 1 
ATOM   1024 C  CD2 . TRP A 1 131 ? -6.370  -39.427 15.678  1.00 61.95  ? 148 TRP A CD2 1 
ATOM   1025 N  NE1 . TRP A 1 131 ? -8.457  -39.012 16.317  1.00 63.53  ? 148 TRP A NE1 1 
ATOM   1026 C  CE2 . TRP A 1 131 ? -7.280  -38.411 15.989  1.00 61.06  ? 148 TRP A CE2 1 
ATOM   1027 C  CE3 . TRP A 1 131 ? -5.070  -39.078 15.301  1.00 60.90  ? 148 TRP A CE3 1 
ATOM   1028 C  CZ2 . TRP A 1 131 ? -6.954  -37.063 15.923  1.00 61.69  ? 148 TRP A CZ2 1 
ATOM   1029 C  CZ3 . TRP A 1 131 ? -4.740  -37.744 15.244  1.00 60.40  ? 148 TRP A CZ3 1 
ATOM   1030 C  CH2 . TRP A 1 131 ? -5.676  -36.744 15.567  1.00 61.24  ? 148 TRP A CH2 1 
ATOM   1031 N  N   . CYS A 1 132 ? -6.241  -44.543 17.938  1.00 76.82  ? 149 CYS A N   1 
ATOM   1032 C  CA  . CYS A 1 132 ? -6.151  -45.955 18.272  1.00 79.75  ? 149 CYS A CA  1 
ATOM   1033 C  C   . CYS A 1 132 ? -7.103  -46.776 17.436  1.00 80.33  ? 149 CYS A C   1 
ATOM   1034 O  O   . CYS A 1 132 ? -6.846  -47.912 17.178  1.00 77.84  ? 149 CYS A O   1 
ATOM   1035 C  CB  . CYS A 1 132 ? -6.453  -46.186 19.756  1.00 81.08  ? 149 CYS A CB  1 
ATOM   1036 S  SG  . CYS A 1 132 ? -5.386  -45.270 20.898  1.00 78.42  ? 149 CYS A SG  1 
ATOM   1037 N  N   . LYS A 1 133 ? -8.238  -46.198 17.099  1.00 87.18  ? 150 LYS A N   1 
ATOM   1038 C  CA  . LYS A 1 133 ? -9.245  -46.832 16.239  1.00 91.86  ? 150 LYS A CA  1 
ATOM   1039 C  C   . LYS A 1 133 ? -8.721  -47.358 14.926  1.00 88.54  ? 150 LYS A C   1 
ATOM   1040 O  O   . LYS A 1 133 ? -9.165  -48.406 14.477  1.00 94.58  ? 150 LYS A O   1 
ATOM   1041 C  CB  . LYS A 1 133 ? -10.375 -45.844 15.937  1.00 99.87  ? 150 LYS A CB  1 
ATOM   1042 C  CG  . LYS A 1 133 ? -9.863  -44.434 15.565  1.00 105.73 ? 150 LYS A CG  1 
ATOM   1043 C  CD  . LYS A 1 133 ? -10.520 -43.278 16.358  1.00 103.53 ? 150 LYS A CD  1 
ATOM   1044 C  CE  . LYS A 1 133 ? -11.443 -42.477 15.436  1.00 104.37 ? 150 LYS A CE  1 
ATOM   1045 N  NZ  . LYS A 1 133 ? -12.279 -41.448 16.103  1.00 105.90 ? 150 LYS A NZ  1 
ATOM   1046 N  N   . ASN A 1 134 ? -7.788  -46.642 14.316  1.00 81.19  ? 151 ASN A N   1 
ATOM   1047 C  CA  . ASN A 1 134 ? -7.320  -46.999 12.981  1.00 79.80  ? 151 ASN A CA  1 
ATOM   1048 C  C   . ASN A 1 134 ? -5.794  -46.962 12.802  1.00 76.83  ? 151 ASN A C   1 
ATOM   1049 O  O   . ASN A 1 134 ? -5.318  -47.079 11.683  1.00 75.74  ? 151 ASN A O   1 
ATOM   1050 C  CB  . ASN A 1 134 ? -7.999  -46.058 11.987  1.00 83.60  ? 151 ASN A CB  1 
ATOM   1051 C  CG  . ASN A 1 134 ? -7.708  -44.590 12.294  1.00 86.79  ? 151 ASN A CG  1 
ATOM   1052 O  OD1 . ASN A 1 134 ? -6.664  -44.293 12.831  1.00 91.09  ? 151 ASN A OD1 1 
ATOM   1053 N  ND2 . ASN A 1 134 ? -8.631  -43.682 11.979  1.00 87.13  ? 151 ASN A ND2 1 
ATOM   1054 N  N   . CYS A 1 135 ? -5.051  -46.799 13.910  1.00 75.18  ? 152 CYS A N   1 
ATOM   1055 C  CA  . CYS A 1 135 ? -3.597  -46.565 13.942  1.00 73.05  ? 152 CYS A CA  1 
ATOM   1056 C  C   . CYS A 1 135 ? -3.066  -45.398 13.123  1.00 75.10  ? 152 CYS A C   1 
ATOM   1057 O  O   . CYS A 1 135 ? -1.880  -45.295 12.881  1.00 75.08  ? 152 CYS A O   1 
ATOM   1058 C  CB  . CYS A 1 135 ? -2.859  -47.855 13.620  1.00 71.42  ? 152 CYS A CB  1 
ATOM   1059 S  SG  . CYS A 1 135 ? -3.253  -49.141 14.826  1.00 71.91  ? 152 CYS A SG  1 
ATOM   1060 N  N   . LYS A 1 136 ? -3.929  -44.468 12.774  1.00 76.91  ? 153 LYS A N   1 
ATOM   1061 C  CA  . LYS A 1 136 ? -3.574  -43.460 11.823  1.00 84.34  ? 153 LYS A CA  1 
ATOM   1062 C  C   . LYS A 1 136 ? -2.931  -42.294 12.623  1.00 79.88  ? 153 LYS A C   1 
ATOM   1063 O  O   . LYS A 1 136 ? -3.484  -41.821 13.622  1.00 79.57  ? 153 LYS A O   1 
ATOM   1064 C  CB  . LYS A 1 136 ? -4.834  -43.089 11.001  1.00 94.51  ? 153 LYS A CB  1 
ATOM   1065 C  CG  . LYS A 1 136 ? -4.718  -41.967 9.963   1.00 107.42 ? 153 LYS A CG  1 
ATOM   1066 C  CD  . LYS A 1 136 ? -3.497  -42.039 9.042   1.00 114.50 ? 153 LYS A CD  1 
ATOM   1067 C  CE  . LYS A 1 136 ? -3.625  -41.076 7.852   1.00 118.48 ? 153 LYS A CE  1 
ATOM   1068 N  NZ  . LYS A 1 136 ? -2.323  -40.519 7.375   1.00 120.21 ? 153 LYS A NZ  1 
ATOM   1069 N  N   . LYS A 1 137 ? -1.747  -41.856 12.188  1.00 75.55  ? 154 LYS A N   1 
ATOM   1070 C  CA  . LYS A 1 137 ? -0.972  -40.806 12.874  1.00 71.80  ? 154 LYS A CA  1 
ATOM   1071 C  C   . LYS A 1 137 ? -1.067  -39.445 12.175  1.00 67.99  ? 154 LYS A C   1 
ATOM   1072 O  O   . LYS A 1 137 ? -0.576  -39.261 11.086  1.00 67.38  ? 154 LYS A O   1 
ATOM   1073 C  CB  . LYS A 1 137 ? 0.482   -41.255 12.959  1.00 73.54  ? 154 LYS A CB  1 
ATOM   1074 C  CG  . LYS A 1 137 ? 1.427   -40.390 13.771  1.00 75.36  ? 154 LYS A CG  1 
ATOM   1075 C  CD  . LYS A 1 137 ? 2.871   -40.773 13.494  1.00 79.24  ? 154 LYS A CD  1 
ATOM   1076 C  CE  . LYS A 1 137 ? 3.284   -42.062 14.179  1.00 82.82  ? 154 LYS A CE  1 
ATOM   1077 N  NZ  . LYS A 1 137 ? 4.277   -41.816 15.250  1.00 85.10  ? 154 LYS A NZ  1 
ATOM   1078 N  N   . GLU A 1 138 ? -1.681  -38.479 12.819  1.00 66.24  ? 155 GLU A N   1 
ATOM   1079 C  CA  . GLU A 1 138 ? -1.939  -37.204 12.182  1.00 69.48  ? 155 GLU A CA  1 
ATOM   1080 C  C   . GLU A 1 138 ? -1.743  -36.079 13.158  1.00 66.23  ? 155 GLU A C   1 
ATOM   1081 O  O   . GLU A 1 138 ? -1.560  -36.314 14.340  1.00 65.67  ? 155 GLU A O   1 
ATOM   1082 C  CB  . GLU A 1 138 ? -3.350  -37.183 11.559  1.00 75.25  ? 155 GLU A CB  1 
ATOM   1083 C  CG  . GLU A 1 138 ? -3.398  -37.561 10.074  1.00 79.10  ? 155 GLU A CG  1 
ATOM   1084 C  CD  . GLU A 1 138 ? -4.808  -37.683 9.588   1.00 84.10  ? 155 GLU A CD  1 
ATOM   1085 O  OE1 . GLU A 1 138 ? -5.511  -36.648 9.459   1.00 86.34  ? 155 GLU A OE1 1 
ATOM   1086 O  OE2 . GLU A 1 138 ? -5.218  -38.828 9.352   1.00 88.59  ? 155 GLU A OE2 1 
ATOM   1087 N  N   . VAL A 1 139 ? -1.752  -34.861 12.648  1.00 65.97  ? 156 VAL A N   1 
ATOM   1088 C  CA  . VAL A 1 139 ? -1.451  -33.693 13.462  1.00 67.16  ? 156 VAL A CA  1 
ATOM   1089 C  C   . VAL A 1 139 ? -2.737  -33.069 13.964  1.00 66.82  ? 156 VAL A C   1 
ATOM   1090 O  O   . VAL A 1 139 ? -3.553  -32.678 13.149  1.00 69.27  ? 156 VAL A O   1 
ATOM   1091 C  CB  . VAL A 1 139 ? -0.672  -32.662 12.622  1.00 67.70  ? 156 VAL A CB  1 
ATOM   1092 C  CG1 . VAL A 1 139 ? -0.410  -31.378 13.399  1.00 67.33  ? 156 VAL A CG1 1 
ATOM   1093 C  CG2 . VAL A 1 139 ? 0.636   -33.278 12.173  1.00 69.22  ? 156 VAL A CG2 1 
ATOM   1094 N  N   . HIS A 1 140 ? -2.903  -32.955 15.283  1.00 65.63  ? 157 HIS A N   1 
ATOM   1095 C  CA  . HIS A 1 140 ? -4.063  -32.291 15.882  1.00 65.48  ? 157 HIS A CA  1 
ATOM   1096 C  C   . HIS A 1 140 ? -3.740  -30.876 16.266  1.00 65.69  ? 157 HIS A C   1 
ATOM   1097 O  O   . HIS A 1 140 ? -2.651  -30.645 16.779  1.00 69.86  ? 157 HIS A O   1 
ATOM   1098 C  CB  . HIS A 1 140 ? -4.433  -33.042 17.133  1.00 67.31  ? 157 HIS A CB  1 
ATOM   1099 C  CG  . HIS A 1 140 ? -5.520  -32.402 17.923  1.00 69.68  ? 157 HIS A CG  1 
ATOM   1100 N  ND1 . HIS A 1 140 ? -6.847  -32.458 17.561  1.00 73.04  ? 157 HIS A ND1 1 
ATOM   1101 C  CD2 . HIS A 1 140 ? -5.472  -31.699 19.071  1.00 70.98  ? 157 HIS A CD2 1 
ATOM   1102 C  CE1 . HIS A 1 140 ? -7.570  -31.811 18.455  1.00 74.38  ? 157 HIS A CE1 1 
ATOM   1103 N  NE2 . HIS A 1 140 ? -6.758  -31.338 19.381  1.00 72.77  ? 157 HIS A NE2 1 
ATOM   1104 N  N   . ALA A 1 141 ? -4.679  -29.943 16.075  1.00 67.17  ? 158 ALA A N   1 
ATOM   1105 C  CA  . ALA A 1 141 ? -4.532  -28.525 16.509  1.00 66.35  ? 158 ALA A CA  1 
ATOM   1106 C  C   . ALA A 1 141 ? -5.142  -28.339 17.873  1.00 68.06  ? 158 ALA A C   1 
ATOM   1107 O  O   . ALA A 1 141 ? -6.325  -28.521 18.022  1.00 70.55  ? 158 ALA A O   1 
ATOM   1108 C  CB  . ALA A 1 141 ? -5.226  -27.600 15.541  1.00 67.66  ? 158 ALA A CB  1 
ATOM   1109 N  N   . CYS A 1 142 ? -4.327  -27.991 18.860  1.00 70.65  ? 159 CYS A N   1 
ATOM   1110 C  CA  . CYS A 1 142 ? -4.750  -27.744 20.233  1.00 70.95  ? 159 CYS A CA  1 
ATOM   1111 C  C   . CYS A 1 142 ? -5.086  -26.265 20.410  1.00 74.46  ? 159 CYS A C   1 
ATOM   1112 O  O   . CYS A 1 142 ? -4.169  -25.446 20.589  1.00 70.70  ? 159 CYS A O   1 
ATOM   1113 C  CB  . CYS A 1 142 ? -3.611  -28.087 21.170  1.00 70.19  ? 159 CYS A CB  1 
ATOM   1114 S  SG  . CYS A 1 142 ? -3.161  -29.828 21.156  1.00 73.09  ? 159 CYS A SG  1 
ATOM   1115 N  N   . ARG A 1 143 ? -6.375  -25.909 20.333  1.00 79.98  ? 160 ARG A N   1 
ATOM   1116 C  CA  . ARG A 1 143 ? -6.777  -24.478 20.425  1.00 83.48  ? 160 ARG A CA  1 
ATOM   1117 C  C   . ARG A 1 143 ? -7.216  -24.057 21.842  1.00 88.22  ? 160 ARG A C   1 
ATOM   1118 O  O   . ARG A 1 143 ? -8.171  -24.612 22.379  1.00 90.53  ? 160 ARG A O   1 
ATOM   1119 C  CB  . ARG A 1 143 ? -7.856  -24.152 19.382  1.00 84.09  ? 160 ARG A CB  1 
ATOM   1120 C  CG  . ARG A 1 143 ? -7.409  -24.384 17.924  1.00 82.27  ? 160 ARG A CG  1 
ATOM   1121 C  CD  . ARG A 1 143 ? -8.380  -23.832 16.889  1.00 82.39  ? 160 ARG A CD  1 
ATOM   1122 N  NE  . ARG A 1 143 ? -8.696  -24.868 15.894  1.00 84.43  ? 160 ARG A NE  1 
ATOM   1123 C  CZ  . ARG A 1 143 ? -8.013  -25.113 14.780  1.00 78.90  ? 160 ARG A CZ  1 
ATOM   1124 N  NH1 . ARG A 1 143 ? -8.413  -26.100 14.013  1.00 76.83  ? 160 ARG A NH1 1 
ATOM   1125 N  NH2 . ARG A 1 143 ? -6.945  -24.396 14.435  1.00 77.89  ? 160 ARG A NH2 1 
ATOM   1126 N  N   . LYS A 1 144 ? -6.468  -23.111 22.441  1.00 94.26  ? 161 LYS A N   1 
ATOM   1127 C  CA  . LYS A 1 144 ? -6.836  -22.357 23.658  1.00 94.69  ? 161 LYS A CA  1 
ATOM   1128 C  C   . LYS A 1 144 ? -6.943  -20.916 23.240  1.00 98.59  ? 161 LYS A C   1 
ATOM   1129 O  O   . LYS A 1 144 ? -6.544  -20.566 22.145  1.00 99.15  ? 161 LYS A O   1 
ATOM   1130 C  CB  . LYS A 1 144 ? -5.726  -22.425 24.660  1.00 96.16  ? 161 LYS A CB  1 
ATOM   1131 C  CG  . LYS A 1 144 ? -5.390  -23.818 25.112  1.00 100.89 ? 161 LYS A CG  1 
ATOM   1132 C  CD  . LYS A 1 144 ? -6.414  -24.339 26.099  1.00 106.28 ? 161 LYS A CD  1 
ATOM   1133 C  CE  . LYS A 1 144 ? -5.847  -25.510 26.911  1.00 108.89 ? 161 LYS A CE  1 
ATOM   1134 N  NZ  . LYS A 1 144 ? -5.198  -26.590 26.092  1.00 106.15 ? 161 LYS A NZ  1 
ATOM   1135 N  N   . SER A 1 145 ? -7.402  -20.036 24.102  1.00 105.54 ? 162 SER A N   1 
ATOM   1136 C  CA  . SER A 1 145 ? -7.676  -18.686 23.618  1.00 109.98 ? 162 SER A CA  1 
ATOM   1137 C  C   . SER A 1 145 ? -6.682  -18.208 22.548  1.00 105.86 ? 162 SER A C   1 
ATOM   1138 O  O   . SER A 1 145 ? -5.460  -18.471 22.614  1.00 109.27 ? 162 SER A O   1 
ATOM   1139 C  CB  . SER A 1 145 ? -7.754  -17.667 24.749  1.00 115.77 ? 162 SER A CB  1 
ATOM   1140 O  OG  . SER A 1 145 ? -6.490  -17.500 25.380  1.00 122.65 ? 162 SER A OG  1 
ATOM   1141 N  N   . TYR A 1 146 ? -7.292  -17.543 21.569  1.00 101.58 ? 163 TYR A N   1 
ATOM   1142 C  CA  . TYR A 1 146 ? -6.676  -16.762 20.494  1.00 101.66 ? 163 TYR A CA  1 
ATOM   1143 C  C   . TYR A 1 146 ? -5.498  -15.909 20.965  1.00 101.95 ? 163 TYR A C   1 
ATOM   1144 O  O   . TYR A 1 146 ? -4.496  -15.747 20.270  1.00 102.05 ? 163 TYR A O   1 
ATOM   1145 C  CB  . TYR A 1 146 ? -7.780  -15.833 19.943  1.00 105.02 ? 163 TYR A CB  1 
ATOM   1146 C  CG  . TYR A 1 146 ? -7.443  -15.032 18.710  1.00 108.05 ? 163 TYR A CG  1 
ATOM   1147 C  CD1 . TYR A 1 146 ? -6.927  -15.662 17.588  1.00 112.62 ? 163 TYR A CD1 1 
ATOM   1148 C  CD2 . TYR A 1 146 ? -7.690  -13.656 18.636  1.00 108.37 ? 163 TYR A CD2 1 
ATOM   1149 C  CE1 . TYR A 1 146 ? -6.618  -14.955 16.435  1.00 112.06 ? 163 TYR A CE1 1 
ATOM   1150 C  CE2 . TYR A 1 146 ? -7.377  -12.940 17.488  1.00 111.49 ? 163 TYR A CE2 1 
ATOM   1151 C  CZ  . TYR A 1 146 ? -6.845  -13.605 16.389  1.00 111.93 ? 163 TYR A CZ  1 
ATOM   1152 O  OH  . TYR A 1 146 ? -6.523  -12.951 15.227  1.00 113.15 ? 163 TYR A OH  1 
ATOM   1153 N  N   . ASP A 1 147 ? -5.652  -15.359 22.163  1.00 103.59 ? 164 ASP A N   1 
ATOM   1154 C  CA  . ASP A 1 147 ? -4.632  -14.558 22.801  1.00 103.87 ? 164 ASP A CA  1 
ATOM   1155 C  C   . ASP A 1 147 ? -3.653  -15.360 23.633  1.00 102.57 ? 164 ASP A C   1 
ATOM   1156 O  O   . ASP A 1 147 ? -3.874  -16.526 23.946  1.00 99.51  ? 164 ASP A O   1 
ATOM   1157 C  CB  . ASP A 1 147 ? -5.305  -13.523 23.729  1.00 105.86 ? 164 ASP A CB  1 
ATOM   1158 C  CG  . ASP A 1 147 ? -5.286  -12.135 23.165  1.00 103.62 ? 164 ASP A CG  1 
ATOM   1159 O  OD1 . ASP A 1 147 ? -5.086  -11.985 21.937  1.00 98.02  ? 164 ASP A OD1 1 
ATOM   1160 O  OD2 . ASP A 1 147 ? -5.465  -11.202 23.974  1.00 104.92 ? 164 ASP A OD2 1 
ATOM   1161 N  N   . CYS A 1 148 ? -2.564  -14.683 23.984  1.00 100.79 ? 165 CYS A N   1 
ATOM   1162 C  CA  . CYS A 1 148 ? -1.706  -15.074 25.099  1.00 98.26  ? 165 CYS A CA  1 
ATOM   1163 C  C   . CYS A 1 148 ? -1.424  -13.950 26.086  1.00 100.10 ? 165 CYS A C   1 
ATOM   1164 O  O   . CYS A 1 148 ? -0.731  -14.174 27.081  1.00 99.48  ? 165 CYS A O   1 
ATOM   1165 C  CB  . CYS A 1 148 ? -0.396  -15.613 24.551  1.00 95.17  ? 165 CYS A CB  1 
ATOM   1166 S  SG  . CYS A 1 148 ? -0.527  -17.224 23.749  1.00 89.61  ? 165 CYS A SG  1 
ATOM   1167 N  N   . GLY A 1 149 ? -1.906  -12.746 25.768  1.00 103.61 ? 166 GLY A N   1 
ATOM   1168 C  CA  . GLY A 1 149 ? -2.121  -11.709 26.743  1.00 108.01 ? 166 GLY A CA  1 
ATOM   1169 C  C   . GLY A 1 149 ? -0.963  -10.759 26.870  1.00 112.50 ? 166 GLY A C   1 
ATOM   1170 O  O   . GLY A 1 149 ? 0.167   -11.080 26.549  1.00 116.13 ? 166 GLY A O   1 
ATOM   1171 N  N   . GLU A 1 150 ? -1.256  -9.603  27.432  1.00 118.97 ? 167 GLU A N   1 
ATOM   1172 C  CA  . GLU A 1 150 ? -0.333  -8.491  27.434  1.00 118.17 ? 167 GLU A CA  1 
ATOM   1173 C  C   . GLU A 1 150 ? 0.783   -8.676  28.436  1.00 109.75 ? 167 GLU A C   1 
ATOM   1174 O  O   . GLU A 1 150 ? 0.560   -9.216  29.495  1.00 104.36 ? 167 GLU A O   1 
ATOM   1175 C  CB  . GLU A 1 150 ? -1.093  -7.211  27.755  1.00 128.03 ? 167 GLU A CB  1 
ATOM   1176 C  CG  . GLU A 1 150 ? -2.087  -6.840  26.669  1.00 135.76 ? 167 GLU A CG  1 
ATOM   1177 C  CD  . GLU A 1 150 ? -2.981  -5.677  27.045  1.00 146.07 ? 167 GLU A CD  1 
ATOM   1178 O  OE1 . GLU A 1 150 ? -2.846  -5.110  28.162  1.00 151.82 ? 167 GLU A OE1 1 
ATOM   1179 O  OE2 . GLU A 1 150 ? -3.827  -5.329  26.197  1.00 152.90 ? 167 GLU A OE2 1 
ATOM   1180 N  N   . ARG A 1 151 ? 1.986   -8.256  28.068  1.00 109.09 ? 168 ARG A N   1 
ATOM   1181 C  CA  . ARG A 1 151 ? 3.067   -7.977  29.038  1.00 108.82 ? 168 ARG A CA  1 
ATOM   1182 C  C   . ARG A 1 151 ? 3.229   -6.451  29.306  1.00 107.61 ? 168 ARG A C   1 
ATOM   1183 O  O   . ARG A 1 151 ? 3.391   -5.672  28.374  1.00 100.40 ? 168 ARG A O   1 
ATOM   1184 C  CB  . ARG A 1 151 ? 4.422   -8.556  28.548  1.00 105.33 ? 168 ARG A CB  1 
ATOM   1185 C  CG  . ARG A 1 151 ? 4.430   -10.017 28.090  1.00 99.22  ? 168 ARG A CG  1 
ATOM   1186 C  CD  . ARG A 1 151 ? 3.871   -10.952 29.144  1.00 98.32  ? 168 ARG A CD  1 
ATOM   1187 N  NE  . ARG A 1 151 ? 4.104   -12.371 28.852  1.00 102.09 ? 168 ARG A NE  1 
ATOM   1188 C  CZ  . ARG A 1 151 ? 3.191   -13.291 28.477  1.00 101.06 ? 168 ARG A CZ  1 
ATOM   1189 N  NH1 . ARG A 1 151 ? 1.881   -12.998 28.291  1.00 100.02 ? 168 ARG A NH1 1 
ATOM   1190 N  NH2 . ARG A 1 151 ? 3.609   -14.551 28.266  1.00 96.45  ? 168 ARG A NH2 1 
ATOM   1191 N  N   . ASN A 1 152 ? 3.185   -6.027  30.572  1.00 113.34 ? 169 ASN A N   1 
ATOM   1192 C  CA  . ASN A 1 152 ? 3.772   -4.722  30.971  1.00 120.18 ? 169 ASN A CA  1 
ATOM   1193 C  C   . ASN A 1 152 ? 5.300   -4.843  31.066  1.00 114.52 ? 169 ASN A C   1 
ATOM   1194 O  O   . ASN A 1 152 ? 5.795   -5.666  31.830  1.00 112.70 ? 169 ASN A O   1 
ATOM   1195 C  CB  . ASN A 1 152 ? 3.236   -4.226  32.342  1.00 129.81 ? 169 ASN A CB  1 
ATOM   1196 C  CG  . ASN A 1 152 ? 3.975   -2.952  32.862  1.00 141.29 ? 169 ASN A CG  1 
ATOM   1197 O  OD1 . ASN A 1 152 ? 3.895   -1.887  32.243  1.00 150.10 ? 169 ASN A OD1 1 
ATOM   1198 N  ND2 . ASN A 1 152 ? 4.686   -3.062  34.005  1.00 142.00 ? 169 ASN A ND2 1 
ATOM   1199 N  N   . VAL A 1 153 ? 6.051   -4.032  30.322  1.00 111.85 ? 170 VAL A N   1 
ATOM   1200 C  CA  . VAL A 1 153 ? 7.503   -3.922  30.549  1.00 113.46 ? 170 VAL A CA  1 
ATOM   1201 C  C   . VAL A 1 153 ? 7.869   -2.465  30.863  1.00 114.24 ? 170 VAL A C   1 
ATOM   1202 O  O   . VAL A 1 153 ? 7.550   -1.587  30.079  1.00 108.92 ? 170 VAL A O   1 
ATOM   1203 C  CB  . VAL A 1 153 ? 8.333   -4.410  29.324  1.00 113.08 ? 170 VAL A CB  1 
ATOM   1204 C  CG1 . VAL A 1 153 ? 9.801   -4.534  29.685  1.00 113.76 ? 170 VAL A CG1 1 
ATOM   1205 C  CG2 . VAL A 1 153 ? 7.857   -5.767  28.815  1.00 114.05 ? 170 VAL A CG2 1 
ATOM   1206 N  N   . GLU A 1 154 ? 8.531   -2.204  31.996  1.00 119.25 ? 171 GLU A N   1 
ATOM   1207 C  CA  . GLU A 1 154 ? 9.189   -0.890  32.243  1.00 122.65 ? 171 GLU A CA  1 
ATOM   1208 C  C   . GLU A 1 154 ? 10.701  -1.066  32.192  1.00 114.63 ? 171 GLU A C   1 
ATOM   1209 O  O   . GLU A 1 154 ? 11.246  -1.826  32.972  1.00 109.06 ? 171 GLU A O   1 
ATOM   1210 C  CB  . GLU A 1 154 ? 8.836   -0.294  33.616  1.00 133.54 ? 171 GLU A CB  1 
ATOM   1211 C  CG  . GLU A 1 154 ? 7.353   -0.101  33.914  1.00 142.54 ? 171 GLU A CG  1 
ATOM   1212 C  CD  . GLU A 1 154 ? 7.069   0.042   35.407  1.00 148.99 ? 171 GLU A CD  1 
ATOM   1213 O  OE1 . GLU A 1 154 ? 7.889   0.675   36.120  1.00 145.17 ? 171 GLU A OE1 1 
ATOM   1214 O  OE2 . GLU A 1 154 ? 6.026   -0.480  35.871  1.00 155.82 ? 171 GLU A OE2 1 
ATOM   1215 N  N   . VAL A 1 155 ? 11.386  -0.360  31.300  1.00 113.96 ? 172 VAL A N   1 
ATOM   1216 C  CA  . VAL A 1 155 ? 12.851  -0.479  31.192  1.00 116.26 ? 172 VAL A CA  1 
ATOM   1217 C  C   . VAL A 1 155 ? 13.530  0.839   31.592  1.00 115.77 ? 172 VAL A C   1 
ATOM   1218 O  O   . VAL A 1 155 ? 13.151  1.917   31.093  1.00 109.28 ? 172 VAL A O   1 
ATOM   1219 C  CB  . VAL A 1 155 ? 13.289  -0.911  29.772  1.00 116.51 ? 172 VAL A CB  1 
ATOM   1220 C  CG1 . VAL A 1 155 ? 14.801  -1.188  29.704  1.00 116.82 ? 172 VAL A CG1 1 
ATOM   1221 C  CG2 . VAL A 1 155 ? 12.496  -2.141  29.341  1.00 114.05 ? 172 VAL A CG2 1 
ATOM   1222 N  N   . PRO A 1 156 ? 14.502  0.759   32.529  1.00 118.15 ? 173 PRO A N   1 
ATOM   1223 C  CA  . PRO A 1 156 ? 15.322  1.912   32.809  1.00 121.97 ? 173 PRO A CA  1 
ATOM   1224 C  C   . PRO A 1 156 ? 16.006  2.405   31.560  1.00 123.29 ? 173 PRO A C   1 
ATOM   1225 O  O   . PRO A 1 156 ? 16.583  1.611   30.817  1.00 120.99 ? 173 PRO A O   1 
ATOM   1226 C  CB  . PRO A 1 156 ? 16.341  1.374   33.811  1.00 122.76 ? 173 PRO A CB  1 
ATOM   1227 C  CG  . PRO A 1 156 ? 15.559  0.396   34.596  1.00 122.70 ? 173 PRO A CG  1 
ATOM   1228 C  CD  . PRO A 1 156 ? 14.667  -0.267  33.580  1.00 121.04 ? 173 PRO A CD  1 
ATOM   1229 N  N   . GLN A 1 157 ? 15.922  3.710   31.335  1.00 127.07 ? 174 GLN A N   1 
ATOM   1230 C  CA  . GLN A 1 157 ? 16.560  4.323   30.188  1.00 127.45 ? 174 GLN A CA  1 
ATOM   1231 C  C   . GLN A 1 157 ? 18.001  3.845   30.089  1.00 126.62 ? 174 GLN A C   1 
ATOM   1232 O  O   . GLN A 1 157 ? 18.684  3.652   31.091  1.00 119.41 ? 174 GLN A O   1 
ATOM   1233 C  CB  . GLN A 1 157 ? 16.508  5.851   30.276  1.00 131.55 ? 174 GLN A CB  1 
ATOM   1234 C  CG  . GLN A 1 157 ? 16.382  6.535   28.926  1.00 133.57 ? 174 GLN A CG  1 
ATOM   1235 C  CD  . GLN A 1 157 ? 15.703  7.882   29.023  1.00 136.10 ? 174 GLN A CD  1 
ATOM   1236 O  OE1 . GLN A 1 157 ? 16.302  8.912   28.744  1.00 137.97 ? 174 GLN A OE1 1 
ATOM   1237 N  NE2 . GLN A 1 157 ? 14.437  7.879   29.410  1.00 138.40 ? 174 GLN A NE2 1 
ATOM   1238 N  N   . MET A 1 158 ? 18.414  3.578   28.863  1.00 131.98 ? 175 MET A N   1 
ATOM   1239 C  CA  . MET A 1 158 ? 19.786  3.219   28.525  1.00 139.70 ? 175 MET A CA  1 
ATOM   1240 C  C   . MET A 1 158 ? 20.262  1.813   28.952  1.00 137.43 ? 175 MET A C   1 
ATOM   1241 O  O   . MET A 1 158 ? 21.366  1.421   28.597  1.00 133.59 ? 175 MET A O   1 
ATOM   1242 C  CB  . MET A 1 158 ? 20.761  4.332   28.949  1.00 148.25 ? 175 MET A CB  1 
ATOM   1243 C  CG  . MET A 1 158 ? 20.369  5.733   28.445  1.00 156.29 ? 175 MET A CG  1 
ATOM   1244 S  SD  . MET A 1 158 ? 20.312  5.910   26.639  1.00 168.64 ? 175 MET A SD  1 
ATOM   1245 C  CE  . MET A 1 158 ? 19.382  7.420   26.381  1.00 165.53 ? 175 MET A CE  1 
ATOM   1246 N  N   . GLU A 1 159 ? 19.439  1.033   29.649  1.00 137.78 ? 176 GLU A N   1 
ATOM   1247 C  CA  . GLU A 1 159 ? 19.661  -0.422  29.700  1.00 136.23 ? 176 GLU A CA  1 
ATOM   1248 C  C   . GLU A 1 159 ? 19.114  -1.113  28.439  1.00 127.98 ? 176 GLU A C   1 
ATOM   1249 O  O   . GLU A 1 159 ? 18.521  -0.467  27.571  1.00 122.40 ? 176 GLU A O   1 
ATOM   1250 C  CB  . GLU A 1 159 ? 18.987  -1.030  30.918  1.00 141.36 ? 176 GLU A CB  1 
ATOM   1251 C  CG  . GLU A 1 159 ? 19.462  -0.493  32.248  1.00 146.43 ? 176 GLU A CG  1 
ATOM   1252 C  CD  . GLU A 1 159 ? 18.911  -1.314  33.402  1.00 151.37 ? 176 GLU A CD  1 
ATOM   1253 O  OE1 . GLU A 1 159 ? 18.033  -2.183  33.176  1.00 149.76 ? 176 GLU A OE1 1 
ATOM   1254 O  OE2 . GLU A 1 159 ? 19.361  -1.099  34.543  1.00 161.82 ? 176 GLU A OE2 1 
ATOM   1255 N  N   . ASP A 1 160 ? 19.305  -2.431  28.353  1.00 125.18 ? 177 ASP A N   1 
ATOM   1256 C  CA  . ASP A 1 160 ? 18.741  -3.242  27.255  1.00 124.29 ? 177 ASP A CA  1 
ATOM   1257 C  C   . ASP A 1 160 ? 17.287  -3.721  27.525  1.00 117.47 ? 177 ASP A C   1 
ATOM   1258 O  O   . ASP A 1 160 ? 16.964  -4.145  28.633  1.00 112.54 ? 177 ASP A O   1 
ATOM   1259 C  CB  . ASP A 1 160 ? 19.662  -4.443  26.957  1.00 124.34 ? 177 ASP A CB  1 
ATOM   1260 C  CG  . ASP A 1 160 ? 21.038  -4.031  26.411  1.00 125.87 ? 177 ASP A CG  1 
ATOM   1261 O  OD1 . ASP A 1 160 ? 21.330  -2.821  26.256  1.00 129.41 ? 177 ASP A OD1 1 
ATOM   1262 O  OD2 . ASP A 1 160 ? 21.836  -4.940  26.124  1.00 122.01 ? 177 ASP A OD2 1 
ATOM   1263 N  N   . MET A 1 161 ? 16.427  -3.619  26.507  1.00 114.40 ? 178 MET A N   1 
ATOM   1264 C  CA  . MET A 1 161 ? 15.060  -4.174  26.528  1.00 112.55 ? 178 MET A CA  1 
ATOM   1265 C  C   . MET A 1 161 ? 15.117  -5.546  25.890  1.00 107.06 ? 178 MET A C   1 
ATOM   1266 O  O   . MET A 1 161 ? 15.637  -5.689  24.799  1.00 104.96 ? 178 MET A O   1 
ATOM   1267 C  CB  . MET A 1 161 ? 14.130  -3.278  25.708  1.00 114.35 ? 178 MET A CB  1 
ATOM   1268 C  CG  . MET A 1 161 ? 12.653  -3.633  25.708  1.00 115.52 ? 178 MET A CG  1 
ATOM   1269 S  SD  . MET A 1 161 ? 11.778  -2.749  24.386  1.00 126.38 ? 178 MET A SD  1 
ATOM   1270 C  CE  . MET A 1 161 ? 12.283  -3.672  22.932  1.00 122.61 ? 178 MET A CE  1 
ATOM   1271 N  N   . ILE A 1 162 ? 14.611  -6.565  26.570  1.00 106.67 ? 179 ILE A N   1 
ATOM   1272 C  CA  . ILE A 1 162 ? 14.532  -7.913  25.985  1.00 103.32 ? 179 ILE A CA  1 
ATOM   1273 C  C   . ILE A 1 162 ? 13.075  -8.306  25.975  1.00 98.51  ? 179 ILE A C   1 
ATOM   1274 O  O   . ILE A 1 162 ? 12.443  -8.354  27.025  1.00 100.75 ? 179 ILE A O   1 
ATOM   1275 C  CB  . ILE A 1 162 ? 15.293  -8.988  26.800  1.00 104.82 ? 179 ILE A CB  1 
ATOM   1276 C  CG1 . ILE A 1 162 ? 16.675  -8.488  27.270  1.00 105.61 ? 179 ILE A CG1 1 
ATOM   1277 C  CG2 . ILE A 1 162 ? 15.378  -10.291 25.989  1.00 103.17 ? 179 ILE A CG2 1 
ATOM   1278 C  CD1 . ILE A 1 162 ? 17.690  -8.305  26.155  1.00 107.80 ? 179 ILE A CD1 1 
ATOM   1279 N  N   . LEU A 1 163 ? 12.522  -8.569  24.808  1.00 93.47  ? 180 LEU A N   1 
ATOM   1280 C  CA  . LEU A 1 163 ? 11.142  -9.020  24.746  1.00 90.69  ? 180 LEU A CA  1 
ATOM   1281 C  C   . LEU A 1 163 ? 11.156  -10.504 24.472  1.00 87.38  ? 180 LEU A C   1 
ATOM   1282 O  O   . LEU A 1 163 ? 11.623  -10.917 23.429  1.00 87.21  ? 180 LEU A O   1 
ATOM   1283 C  CB  . LEU A 1 163 ? 10.405  -8.247  23.658  1.00 89.96  ? 180 LEU A CB  1 
ATOM   1284 C  CG  . LEU A 1 163 ? 10.351  -6.720  23.839  1.00 89.70  ? 180 LEU A CG  1 
ATOM   1285 C  CD1 . LEU A 1 163 ? 9.423   -6.073  22.798  1.00 90.91  ? 180 LEU A CD1 1 
ATOM   1286 C  CD2 . LEU A 1 163 ? 9.911   -6.325  25.249  1.00 88.61  ? 180 LEU A CD2 1 
ATOM   1287 N  N   . ASP A 1 164 ? 10.678  -11.312 25.412  1.00 87.05  ? 181 ASP A N   1 
ATOM   1288 C  CA  . ASP A 1 164 ? 10.713  -12.786 25.268  1.00 86.23  ? 181 ASP A CA  1 
ATOM   1289 C  C   . ASP A 1 164 ? 9.339   -13.255 24.841  1.00 84.08  ? 181 ASP A C   1 
ATOM   1290 O  O   . ASP A 1 164 ? 8.369   -13.128 25.582  1.00 84.17  ? 181 ASP A O   1 
ATOM   1291 C  CB  . ASP A 1 164 ? 11.139  -13.481 26.589  1.00 85.87  ? 181 ASP A CB  1 
ATOM   1292 C  CG  . ASP A 1 164 ? 11.443  -14.991 26.427  1.00 81.94  ? 181 ASP A CG  1 
ATOM   1293 O  OD1 . ASP A 1 164 ? 11.377  -15.531 25.308  1.00 75.75  ? 181 ASP A OD1 1 
ATOM   1294 O  OD2 . ASP A 1 164 ? 11.769  -15.637 27.446  1.00 83.28  ? 181 ASP A OD2 1 
ATOM   1295 N  N   . CYS A 1 165 ? 9.268   -13.800 23.637  1.00 87.38  ? 182 CYS A N   1 
ATOM   1296 C  CA  . CYS A 1 165 ? 8.032   -14.362 23.107  1.00 88.01  ? 182 CYS A CA  1 
ATOM   1297 C  C   . CYS A 1 165 ? 7.903   -15.851 23.402  1.00 86.29  ? 182 CYS A C   1 
ATOM   1298 O  O   . CYS A 1 165 ? 6.880   -16.418 23.081  1.00 91.44  ? 182 CYS A O   1 
ATOM   1299 C  CB  . CYS A 1 165 ? 7.975   -14.142 21.595  1.00 89.48  ? 182 CYS A CB  1 
ATOM   1300 S  SG  . CYS A 1 165 ? 6.328   -14.378 20.921  1.00 94.79  ? 182 CYS A SG  1 
ATOM   1301 N  N   . GLU A 1 166 ? 8.921   -16.483 23.990  1.00 86.50  ? 183 GLU A N   1 
ATOM   1302 C  CA  . GLU A 1 166 ? 8.953   -17.936 24.110  1.00 89.10  ? 183 GLU A CA  1 
ATOM   1303 C  C   . GLU A 1 166 ? 8.051   -18.416 25.222  1.00 89.63  ? 183 GLU A C   1 
ATOM   1304 O  O   . GLU A 1 166 ? 8.072   -17.865 26.318  1.00 96.32  ? 183 GLU A O   1 
ATOM   1305 C  CB  . GLU A 1 166 ? 10.358  -18.462 24.385  1.00 92.22  ? 183 GLU A CB  1 
ATOM   1306 C  CG  . GLU A 1 166 ? 10.422  -19.985 24.412  1.00 95.70  ? 183 GLU A CG  1 
ATOM   1307 C  CD  . GLU A 1 166 ? 11.845  -20.493 24.367  1.00 98.87  ? 183 GLU A CD  1 
ATOM   1308 O  OE1 . GLU A 1 166 ? 12.229  -21.118 23.354  1.00 100.91 ? 183 GLU A OE1 1 
ATOM   1309 O  OE2 . GLU A 1 166 ? 12.576  -20.251 25.346  1.00 101.10 ? 183 GLU A OE2 1 
ATOM   1310 N  N   . LEU A 1 167 ? 7.286   -19.464 24.932  1.00 85.90  ? 184 LEU A N   1 
ATOM   1311 C  CA  . LEU A 1 167 ? 6.486   -20.156 25.922  1.00 84.09  ? 184 LEU A CA  1 
ATOM   1312 C  C   . LEU A 1 167 ? 6.982   -21.593 25.963  1.00 83.07  ? 184 LEU A C   1 
ATOM   1313 O  O   . LEU A 1 167 ? 7.553   -22.113 24.986  1.00 80.33  ? 184 LEU A O   1 
ATOM   1314 C  CB  . LEU A 1 167 ? 5.004   -20.107 25.571  1.00 83.18  ? 184 LEU A CB  1 
ATOM   1315 C  CG  . LEU A 1 167 ? 4.392   -18.731 25.310  1.00 80.74  ? 184 LEU A CG  1 
ATOM   1316 C  CD1 . LEU A 1 167 ? 2.956   -18.847 24.819  1.00 82.25  ? 184 LEU A CD1 1 
ATOM   1317 C  CD2 . LEU A 1 167 ? 4.426   -17.915 26.577  1.00 82.13  ? 184 LEU A CD2 1 
ATOM   1318 N  N   . ASN A 1 168 ? 6.801   -22.196 27.128  1.00 84.58  ? 185 ASN A N   1 
ATOM   1319 C  CA  . ASN A 1 168 ? 7.266   -23.557 27.433  1.00 88.75  ? 185 ASN A CA  1 
ATOM   1320 C  C   . ASN A 1 168 ? 7.072   -24.550 26.288  1.00 87.52  ? 185 ASN A C   1 
ATOM   1321 O  O   . ASN A 1 168 ? 8.015   -25.239 25.862  1.00 87.71  ? 185 ASN A O   1 
ATOM   1322 C  CB  . ASN A 1 168 ? 6.590   -24.084 28.716  1.00 92.05  ? 185 ASN A CB  1 
ATOM   1323 C  CG  . ASN A 1 168 ? 5.167   -23.527 28.916  1.00 98.08  ? 185 ASN A CG  1 
ATOM   1324 O  OD1 . ASN A 1 168 ? 4.993   -22.315 29.120  1.00 106.33 ? 185 ASN A OD1 1 
ATOM   1325 N  ND2 . ASN A 1 168 ? 4.154   -24.395 28.860  1.00 96.94  ? 185 ASN A ND2 1 
ATOM   1326 N  N   . TRP A 1 169 ? 5.851   -24.554 25.762  1.00 85.11  ? 186 TRP A N   1 
ATOM   1327 C  CA  . TRP A 1 169 ? 5.371   -25.586 24.839  1.00 77.65  ? 186 TRP A CA  1 
ATOM   1328 C  C   . TRP A 1 169 ? 5.825   -25.411 23.399  1.00 77.44  ? 186 TRP A C   1 
ATOM   1329 O  O   . TRP A 1 169 ? 5.696   -26.334 22.611  1.00 81.18  ? 186 TRP A O   1 
ATOM   1330 C  CB  . TRP A 1 169 ? 3.843   -25.685 24.911  1.00 73.98  ? 186 TRP A CB  1 
ATOM   1331 C  CG  . TRP A 1 169 ? 3.105   -24.421 24.597  1.00 72.20  ? 186 TRP A CG  1 
ATOM   1332 C  CD1 . TRP A 1 169 ? 2.654   -23.473 25.493  1.00 73.15  ? 186 TRP A CD1 1 
ATOM   1333 C  CD2 . TRP A 1 169 ? 2.730   -23.947 23.298  1.00 70.54  ? 186 TRP A CD2 1 
ATOM   1334 N  NE1 . TRP A 1 169 ? 2.030   -22.438 24.821  1.00 71.00  ? 186 TRP A NE1 1 
ATOM   1335 C  CE2 . TRP A 1 169 ? 2.056   -22.710 23.474  1.00 68.88  ? 186 TRP A CE2 1 
ATOM   1336 C  CE3 . TRP A 1 169 ? 2.883   -24.450 22.000  1.00 69.33  ? 186 TRP A CE3 1 
ATOM   1337 C  CZ2 . TRP A 1 169 ? 1.539   -21.982 22.394  1.00 66.05  ? 186 TRP A CZ2 1 
ATOM   1338 C  CZ3 . TRP A 1 169 ? 2.375   -23.710 20.928  1.00 67.68  ? 186 TRP A CZ3 1 
ATOM   1339 C  CH2 . TRP A 1 169 ? 1.719   -22.493 21.132  1.00 65.30  ? 186 TRP A CH2 1 
ATOM   1340 N  N   . HIS A 1 170 ? 6.361   -24.248 23.056  1.00 77.24  ? 187 HIS A N   1 
ATOM   1341 C  CA  . HIS A 1 170 ? 6.801   -23.991 21.688  1.00 79.31  ? 187 HIS A CA  1 
ATOM   1342 C  C   . HIS A 1 170 ? 7.813   -24.996 21.172  1.00 81.34  ? 187 HIS A C   1 
ATOM   1343 O  O   . HIS A 1 170 ? 7.686   -25.446 20.050  1.00 78.64  ? 187 HIS A O   1 
ATOM   1344 C  CB  . HIS A 1 170 ? 7.415   -22.598 21.551  1.00 82.39  ? 187 HIS A CB  1 
ATOM   1345 C  CG  . HIS A 1 170 ? 6.433   -21.473 21.692  1.00 84.04  ? 187 HIS A CG  1 
ATOM   1346 N  ND1 . HIS A 1 170 ? 6.823   -20.155 21.797  1.00 84.01  ? 187 HIS A ND1 1 
ATOM   1347 C  CD2 . HIS A 1 170 ? 5.079   -21.469 21.752  1.00 83.82  ? 187 HIS A CD2 1 
ATOM   1348 C  CE1 . HIS A 1 170 ? 5.749   -19.388 21.900  1.00 84.70  ? 187 HIS A CE1 1 
ATOM   1349 N  NE2 . HIS A 1 170 ? 4.679   -20.161 21.879  1.00 82.26  ? 187 HIS A NE2 1 
ATOM   1350 N  N   . GLN A 1 171 ? 8.816   -25.347 21.972  1.00 89.33  ? 188 GLN A N   1 
ATOM   1351 C  CA  . GLN A 1 171 ? 9.846   -26.297 21.501  1.00 96.03  ? 188 GLN A CA  1 
ATOM   1352 C  C   . GLN A 1 171 ? 9.248   -27.638 21.085  1.00 96.65  ? 188 GLN A C   1 
ATOM   1353 O  O   . GLN A 1 171 ? 9.784   -28.304 20.204  1.00 98.91  ? 188 GLN A O   1 
ATOM   1354 C  CB  . GLN A 1 171 ? 11.037  -26.475 22.482  1.00 104.74 ? 188 GLN A CB  1 
ATOM   1355 C  CG  . GLN A 1 171 ? 10.742  -26.766 23.961  1.00 112.91 ? 188 GLN A CG  1 
ATOM   1356 C  CD  . GLN A 1 171 ? 9.949   -28.055 24.213  1.00 119.28 ? 188 GLN A CD  1 
ATOM   1357 O  OE1 . GLN A 1 171 ? 10.375  -29.149 23.835  1.00 124.71 ? 188 GLN A OE1 1 
ATOM   1358 N  NE2 . GLN A 1 171 ? 8.796   -27.929 24.876  1.00 117.96 ? 188 GLN A NE2 1 
ATOM   1359 N  N   . ALA A 1 172 ? 8.114   -28.003 21.683  1.00 94.79  ? 189 ALA A N   1 
ATOM   1360 C  CA  . ALA A 1 172 ? 7.431   -29.256 21.372  1.00 92.45  ? 189 ALA A CA  1 
ATOM   1361 C  C   . ALA A 1 172 ? 6.415   -29.174 20.245  1.00 88.83  ? 189 ALA A C   1 
ATOM   1362 O  O   . ALA A 1 172 ? 6.064   -30.192 19.670  1.00 90.94  ? 189 ALA A O   1 
ATOM   1363 C  CB  . ALA A 1 172 ? 6.742   -29.765 22.616  1.00 93.99  ? 189 ALA A CB  1 
ATOM   1364 N  N   . SER A 1 173 ? 5.912   -27.980 19.962  1.00 85.70  ? 190 SER A N   1 
ATOM   1365 C  CA  . SER A 1 173 ? 4.925   -27.794 18.915  1.00 82.63  ? 190 SER A CA  1 
ATOM   1366 C  C   . SER A 1 173 ? 5.516   -28.098 17.578  1.00 79.60  ? 190 SER A C   1 
ATOM   1367 O  O   . SER A 1 173 ? 6.680   -27.866 17.346  1.00 80.92  ? 190 SER A O   1 
ATOM   1368 C  CB  . SER A 1 173 ? 4.398   -26.357 18.892  1.00 83.61  ? 190 SER A CB  1 
ATOM   1369 O  OG  . SER A 1 173 ? 3.341   -26.206 17.939  1.00 83.85  ? 190 SER A OG  1 
ATOM   1370 N  N   . GLU A 1 174 ? 4.687   -28.611 16.690  1.00 81.83  ? 191 GLU A N   1 
ATOM   1371 C  CA  . GLU A 1 174 ? 5.136   -28.959 15.361  1.00 84.78  ? 191 GLU A CA  1 
ATOM   1372 C  C   . GLU A 1 174 ? 4.617   -27.919 14.436  1.00 84.33  ? 191 GLU A C   1 
ATOM   1373 O  O   . GLU A 1 174 ? 3.684   -27.205 14.783  1.00 82.28  ? 191 GLU A O   1 
ATOM   1374 C  CB  . GLU A 1 174 ? 4.618   -30.331 14.963  1.00 84.99  ? 191 GLU A CB  1 
ATOM   1375 C  CG  . GLU A 1 174 ? 5.183   -31.446 15.820  1.00 86.47  ? 191 GLU A CG  1 
ATOM   1376 C  CD  . GLU A 1 174 ? 4.561   -32.755 15.510  1.00 93.44  ? 191 GLU A CD  1 
ATOM   1377 O  OE1 . GLU A 1 174 ? 3.549   -32.722 14.784  1.00 101.34 ? 191 GLU A OE1 1 
ATOM   1378 O  OE2 . GLU A 1 174 ? 5.094   -33.799 15.961  1.00 97.09  ? 191 GLU A OE2 1 
ATOM   1379 N  N   . GLY A 1 175 ? 5.230   -27.847 13.254  1.00 88.39  ? 192 GLY A N   1 
ATOM   1380 C  CA  . GLY A 1 175 ? 4.832   -26.917 12.199  1.00 89.88  ? 192 GLY A CA  1 
ATOM   1381 C  C   . GLY A 1 175 ? 4.854   -25.444 12.563  1.00 91.13  ? 192 GLY A C   1 
ATOM   1382 O  O   . GLY A 1 175 ? 3.904   -24.711 12.293  1.00 94.70  ? 192 GLY A O   1 
ATOM   1383 N  N   . LEU A 1 176 ? 5.927   -25.006 13.194  1.00 94.03  ? 193 LEU A N   1 
ATOM   1384 C  CA  . LEU A 1 176 ? 6.097   -23.597 13.494  1.00 93.35  ? 193 LEU A CA  1 
ATOM   1385 C  C   . LEU A 1 176 ? 7.127   -23.014 12.564  1.00 94.02  ? 193 LEU A C   1 
ATOM   1386 O  O   . LEU A 1 176 ? 8.025   -23.696 12.098  1.00 92.78  ? 193 LEU A O   1 
ATOM   1387 C  CB  . LEU A 1 176 ? 6.518   -23.417 14.937  1.00 92.84  ? 193 LEU A CB  1 
ATOM   1388 C  CG  . LEU A 1 176 ? 5.628   -24.129 15.964  1.00 93.54  ? 193 LEU A CG  1 
ATOM   1389 C  CD1 . LEU A 1 176 ? 5.795   -23.390 17.287  1.00 91.12  ? 193 LEU A CD1 1 
ATOM   1390 C  CD2 . LEU A 1 176 ? 4.141   -24.242 15.561  1.00 92.25  ? 193 LEU A CD2 1 
ATOM   1391 N  N   . THR A 1 177 ? 6.997   -21.729 12.299  1.00 96.49  ? 194 THR A N   1 
ATOM   1392 C  CA  . THR A 1 177 ? 7.884   -21.059 11.379  1.00 99.51  ? 194 THR A CA  1 
ATOM   1393 C  C   . THR A 1 177 ? 8.702   -20.035 12.173  1.00 99.35  ? 194 THR A C   1 
ATOM   1394 O  O   . THR A 1 177 ? 9.707   -20.381 12.818  1.00 95.18  ? 194 THR A O   1 
ATOM   1395 C  CB  . THR A 1 177 ? 7.081   -20.436 10.211  1.00 101.12 ? 194 THR A CB  1 
ATOM   1396 O  OG1 . THR A 1 177 ? 6.371   -19.272 10.658  1.00 100.57 ? 194 THR A OG1 1 
ATOM   1397 C  CG2 . THR A 1 177 ? 6.079   -21.449 9.660   1.00 99.55  ? 194 THR A CG2 1 
ATOM   1398 N  N   . ASP A 1 178 ? 8.261   -18.784 12.158  1.00 100.90 ? 195 ASP A N   1 
ATOM   1399 C  CA  . ASP A 1 178 ? 9.099   -17.696 12.611  1.00 100.89 ? 195 ASP A CA  1 
ATOM   1400 C  C   . ASP A 1 178 ? 8.406   -16.798 13.594  1.00 98.39  ? 195 ASP A C   1 
ATOM   1401 O  O   . ASP A 1 178 ? 7.178   -16.692 13.622  1.00 95.24  ? 195 ASP A O   1 
ATOM   1402 C  CB  . ASP A 1 178 ? 9.589   -16.883 11.416  1.00 104.57 ? 195 ASP A CB  1 
ATOM   1403 C  CG  . ASP A 1 178 ? 10.694  -17.588 10.643  1.00 107.25 ? 195 ASP A CG  1 
ATOM   1404 O  OD1 . ASP A 1 178 ? 11.298  -18.541 11.171  1.00 113.18 ? 195 ASP A OD1 1 
ATOM   1405 O  OD2 . ASP A 1 178 ? 10.954  -17.210 9.487   1.00 109.56 ? 195 ASP A OD2 1 
ATOM   1406 N  N   . TYR A 1 179 ? 9.235   -16.157 14.405  1.00 99.82  ? 196 TYR A N   1 
ATOM   1407 C  CA  . TYR A 1 179 ? 8.799   -15.151 15.363  1.00 101.22 ? 196 TYR A CA  1 
ATOM   1408 C  C   . TYR A 1 179 ? 8.844   -13.823 14.626  1.00 101.20 ? 196 TYR A C   1 
ATOM   1409 O  O   . TYR A 1 179 ? 9.908   -13.426 14.184  1.00 102.95 ? 196 TYR A O   1 
ATOM   1410 C  CB  . TYR A 1 179 ? 9.747   -15.118 16.582  1.00 99.02  ? 196 TYR A CB  1 
ATOM   1411 C  CG  . TYR A 1 179 ? 9.552   -16.266 17.573  1.00 96.33  ? 196 TYR A CG  1 
ATOM   1412 C  CD1 . TYR A 1 179 ? 8.565   -16.194 18.565  1.00 94.95  ? 196 TYR A CD1 1 
ATOM   1413 C  CD2 . TYR A 1 179 ? 10.359  -17.414 17.531  1.00 93.71  ? 196 TYR A CD2 1 
ATOM   1414 C  CE1 . TYR A 1 179 ? 8.374   -17.231 19.470  1.00 94.28  ? 196 TYR A CE1 1 
ATOM   1415 C  CE2 . TYR A 1 179 ? 10.172  -18.457 18.430  1.00 92.44  ? 196 TYR A CE2 1 
ATOM   1416 C  CZ  . TYR A 1 179 ? 9.181   -18.368 19.396  1.00 91.31  ? 196 TYR A CZ  1 
ATOM   1417 O  OH  . TYR A 1 179 ? 9.012   -19.390 20.304  1.00 85.04  ? 196 TYR A OH  1 
ATOM   1418 N  N   . SER A 1 180 ? 7.697   -13.177 14.456  1.00 101.26 ? 197 SER A N   1 
ATOM   1419 C  CA  . SER A 1 180 ? 7.634   -11.846 13.880  1.00 110.81 ? 197 SER A CA  1 
ATOM   1420 C  C   . SER A 1 180 ? 7.437   -10.869 15.010  1.00 119.29 ? 197 SER A C   1 
ATOM   1421 O  O   . SER A 1 180 ? 6.535   -11.062 15.826  1.00 124.83 ? 197 SER A O   1 
ATOM   1422 C  CB  . SER A 1 180 ? 6.439   -11.704 12.940  1.00 112.18 ? 197 SER A CB  1 
ATOM   1423 O  OG  . SER A 1 180 ? 6.549   -12.572 11.845  1.00 113.41 ? 197 SER A OG  1 
ATOM   1424 N  N   . PHE A 1 181 ? 8.241   -9.811  15.057  1.00 123.44 ? 198 PHE A N   1 
ATOM   1425 C  CA  . PHE A 1 181 ? 7.999   -8.746  16.014  1.00 121.47 ? 198 PHE A CA  1 
ATOM   1426 C  C   . PHE A 1 181 ? 7.572   -7.471  15.254  1.00 120.93 ? 198 PHE A C   1 
ATOM   1427 O  O   . PHE A 1 181 ? 8.254   -7.047  14.306  1.00 117.72 ? 198 PHE A O   1 
ATOM   1428 C  CB  . PHE A 1 181 ? 9.244   -8.524  16.867  1.00 121.35 ? 198 PHE A CB  1 
ATOM   1429 C  CG  . PHE A 1 181 ? 9.498   -9.591  17.927  1.00 117.86 ? 198 PHE A CG  1 
ATOM   1430 C  CD1 . PHE A 1 181 ? 10.343  -10.671 17.669  1.00 117.81 ? 198 PHE A CD1 1 
ATOM   1431 C  CD2 . PHE A 1 181 ? 8.961   -9.473  19.214  1.00 114.14 ? 198 PHE A CD2 1 
ATOM   1432 C  CE1 . PHE A 1 181 ? 10.621  -11.622 18.661  1.00 114.83 ? 198 PHE A CE1 1 
ATOM   1433 C  CE2 . PHE A 1 181 ? 9.234   -10.421 20.199  1.00 110.26 ? 198 PHE A CE2 1 
ATOM   1434 C  CZ  . PHE A 1 181 ? 10.064  -11.496 19.922  1.00 110.07 ? 198 PHE A CZ  1 
ATOM   1435 N  N   . TYR A 1 182 ? 6.433   -6.900  15.662  1.00 123.32 ? 199 TYR A N   1 
ATOM   1436 C  CA  . TYR A 1 182 ? 5.884   -5.665  15.082  1.00 131.78 ? 199 TYR A CA  1 
ATOM   1437 C  C   . TYR A 1 182 ? 5.854   -4.539  16.115  1.00 136.13 ? 199 TYR A C   1 
ATOM   1438 O  O   . TYR A 1 182 ? 5.539   -4.810  17.271  1.00 138.28 ? 199 TYR A O   1 
ATOM   1439 C  CB  . TYR A 1 182 ? 4.443   -5.884  14.621  1.00 134.95 ? 199 TYR A CB  1 
ATOM   1440 C  CG  . TYR A 1 182 ? 4.273   -6.873  13.498  1.00 140.38 ? 199 TYR A CG  1 
ATOM   1441 C  CD1 . TYR A 1 182 ? 3.980   -8.211  13.768  1.00 143.29 ? 199 TYR A CD1 1 
ATOM   1442 C  CD2 . TYR A 1 182 ? 4.389   -6.471  12.159  1.00 141.14 ? 199 TYR A CD2 1 
ATOM   1443 C  CE1 . TYR A 1 182 ? 3.805   -9.130  12.739  1.00 145.57 ? 199 TYR A CE1 1 
ATOM   1444 C  CE2 . TYR A 1 182 ? 4.230   -7.382  11.124  1.00 143.09 ? 199 TYR A CE2 1 
ATOM   1445 C  CZ  . TYR A 1 182 ? 3.941   -8.709  11.419  1.00 144.30 ? 199 TYR A CZ  1 
ATOM   1446 O  OH  . TYR A 1 182 ? 3.777   -9.624  10.409  1.00 143.18 ? 199 TYR A OH  1 
ATOM   1447 N  N   . ARG A 1 183 ? 6.171   -3.299  15.711  1.00 137.89 ? 200 ARG A N   1 
ATOM   1448 C  CA  . ARG A 1 183 ? 5.888   -2.106  16.540  1.00 140.78 ? 200 ARG A CA  1 
ATOM   1449 C  C   . ARG A 1 183 ? 4.565   -1.528  16.092  1.00 140.26 ? 200 ARG A C   1 
ATOM   1450 O  O   . ARG A 1 183 ? 4.328   -1.438  14.887  1.00 140.84 ? 200 ARG A O   1 
ATOM   1451 C  CB  . ARG A 1 183 ? 6.972   -1.033  16.403  1.00 144.08 ? 200 ARG A CB  1 
ATOM   1452 C  CG  . ARG A 1 183 ? 8.268   -1.370  17.123  1.00 146.90 ? 200 ARG A CG  1 
ATOM   1453 C  CD  . ARG A 1 183 ? 9.063   -0.129  17.501  1.00 146.20 ? 200 ARG A CD  1 
ATOM   1454 N  NE  . ARG A 1 183 ? 8.399   0.654   18.544  1.00 147.81 ? 200 ARG A NE  1 
ATOM   1455 C  CZ  . ARG A 1 183 ? 8.872   1.791   19.058  1.00 150.36 ? 200 ARG A CZ  1 
ATOM   1456 N  NH1 . ARG A 1 183 ? 10.023  2.305   18.634  1.00 152.71 ? 200 ARG A NH1 1 
ATOM   1457 N  NH2 . ARG A 1 183 ? 8.191   2.426   20.006  1.00 149.55 ? 200 ARG A NH2 1 
ATOM   1458 N  N   . VAL A 1 184 ? 3.723   -1.130  17.050  1.00 140.62 ? 201 VAL A N   1 
ATOM   1459 C  CA  . VAL A 1 184 ? 2.353   -0.663  16.760  1.00 145.32 ? 201 VAL A CA  1 
ATOM   1460 C  C   . VAL A 1 184 ? 2.222   0.852   16.990  1.00 147.32 ? 201 VAL A C   1 
ATOM   1461 O  O   . VAL A 1 184 ? 2.270   1.326   18.134  1.00 142.99 ? 201 VAL A O   1 
ATOM   1462 C  CB  . VAL A 1 184 ? 1.297   -1.475  17.561  1.00 144.87 ? 201 VAL A CB  1 
ATOM   1463 C  CG1 . VAL A 1 184 ? -0.081  -0.809  17.555  1.00 145.18 ? 201 VAL A CG1 1 
ATOM   1464 C  CG2 . VAL A 1 184 ? 1.197   -2.889  16.996  1.00 143.84 ? 201 VAL A CG2 1 
ATOM   1465 N  N   . TRP A 1 185 ? 2.034   1.584   15.884  1.00 151.39 ? 202 TRP A N   1 
ATOM   1466 C  CA  . TRP A 1 185 ? 2.038   3.055   15.873  1.00 152.21 ? 202 TRP A CA  1 
ATOM   1467 C  C   . TRP A 1 185 ? 0.672   3.661   16.184  1.00 153.90 ? 202 TRP A C   1 
ATOM   1468 O  O   . TRP A 1 185 ? -0.370  3.041   15.926  1.00 155.89 ? 202 TRP A O   1 
ATOM   1469 C  CB  . TRP A 1 185 ? 2.565   3.588   14.522  1.00 149.13 ? 202 TRP A CB  1 
ATOM   1470 C  CG  . TRP A 1 185 ? 3.943   3.078   14.199  1.00 147.39 ? 202 TRP A CG  1 
ATOM   1471 C  CD1 . TRP A 1 185 ? 4.326   2.353   13.096  1.00 146.14 ? 202 TRP A CD1 1 
ATOM   1472 C  CD2 . TRP A 1 185 ? 5.113   3.201   15.023  1.00 145.99 ? 202 TRP A CD2 1 
ATOM   1473 N  NE1 . TRP A 1 185 ? 5.670   2.042   13.175  1.00 144.06 ? 202 TRP A NE1 1 
ATOM   1474 C  CE2 . TRP A 1 185 ? 6.174   2.548   14.347  1.00 145.52 ? 202 TRP A CE2 1 
ATOM   1475 C  CE3 . TRP A 1 185 ? 5.370   3.805   16.266  1.00 142.30 ? 202 TRP A CE3 1 
ATOM   1476 C  CZ2 . TRP A 1 185 ? 7.471   2.484   14.879  1.00 143.70 ? 202 TRP A CZ2 1 
ATOM   1477 C  CZ3 . TRP A 1 185 ? 6.651   3.732   16.793  1.00 140.73 ? 202 TRP A CZ3 1 
ATOM   1478 C  CH2 . TRP A 1 185 ? 7.687   3.080   16.099  1.00 142.07 ? 202 TRP A CH2 1 
ATOM   1479 N  N   . GLY A 1 186 ? 0.706   4.881   16.734  1.00 150.83 ? 203 GLY A N   1 
ATOM   1480 C  CA  . GLY A 1 186 ? -0.490  5.666   17.056  1.00 149.57 ? 203 GLY A CA  1 
ATOM   1481 C  C   . GLY A 1 186 ? -1.443  5.959   15.900  1.00 152.09 ? 203 GLY A C   1 
ATOM   1482 O  O   . GLY A 1 186 ? -2.620  6.209   16.139  1.00 153.18 ? 203 GLY A O   1 
ATOM   1483 N  N   . ASN A 1 187 ? -0.944  5.933   14.657  1.00 152.40 ? 204 ASN A N   1 
ATOM   1484 C  CA  . ASN A 1 187 ? -1.788  6.061   13.435  1.00 154.06 ? 204 ASN A CA  1 
ATOM   1485 C  C   . ASN A 1 187 ? -2.305  4.732   12.825  1.00 155.65 ? 204 ASN A C   1 
ATOM   1486 O  O   . ASN A 1 187 ? -2.656  4.703   11.640  1.00 155.06 ? 204 ASN A O   1 
ATOM   1487 C  CB  . ASN A 1 187 ? -1.047  6.877   12.345  1.00 153.94 ? 204 ASN A CB  1 
ATOM   1488 C  CG  . ASN A 1 187 ? 0.293   6.269   11.962  1.00 151.01 ? 204 ASN A CG  1 
ATOM   1489 O  OD1 . ASN A 1 187 ? 0.466   5.055   12.031  1.00 151.17 ? 204 ASN A OD1 1 
ATOM   1490 N  ND2 . ASN A 1 187 ? 1.248   7.115   11.563  1.00 147.92 ? 204 ASN A ND2 1 
ATOM   1491 N  N   . ASN A 1 188 ? -2.337  3.653   13.619  1.00 156.04 ? 205 ASN A N   1 
ATOM   1492 C  CA  . ASN A 1 188 ? -2.782  2.300   13.188  1.00 153.64 ? 205 ASN A CA  1 
ATOM   1493 C  C   . ASN A 1 188 ? -2.049  1.669   12.014  1.00 149.50 ? 205 ASN A C   1 
ATOM   1494 O  O   . ASN A 1 188 ? -2.648  0.951   11.213  1.00 147.85 ? 205 ASN A O   1 
ATOM   1495 C  CB  . ASN A 1 188 ? -4.278  2.285   12.923  1.00 157.55 ? 205 ASN A CB  1 
ATOM   1496 C  CG  . ASN A 1 188 ? -5.052  2.742   14.119  1.00 164.48 ? 205 ASN A CG  1 
ATOM   1497 O  OD1 . ASN A 1 188 ? -4.967  2.131   15.184  1.00 163.68 ? 205 ASN A OD1 1 
ATOM   1498 N  ND2 . ASN A 1 188 ? -5.774  3.846   13.976  1.00 171.04 ? 205 ASN A ND2 1 
ATOM   1499 N  N   . THR A 1 189 ? -0.754  1.950   11.923  1.00 147.16 ? 206 THR A N   1 
ATOM   1500 C  CA  . THR A 1 189 ? 0.152   1.207   11.063  1.00 142.12 ? 206 THR A CA  1 
ATOM   1501 C  C   . THR A 1 189 ? 1.123   0.486   11.975  1.00 140.33 ? 206 THR A C   1 
ATOM   1502 O  O   . THR A 1 189 ? 1.185   0.761   13.192  1.00 136.90 ? 206 THR A O   1 
ATOM   1503 C  CB  . THR A 1 189 ? 0.914   2.114   10.071  1.00 139.38 ? 206 THR A CB  1 
ATOM   1504 O  OG1 . THR A 1 189 ? 1.700   3.087   10.782  1.00 131.44 ? 206 THR A OG1 1 
ATOM   1505 C  CG2 . THR A 1 189 ? -0.067  2.807   9.137   1.00 140.18 ? 206 THR A CG2 1 
ATOM   1506 N  N   . GLU A 1 190 ? 1.859   -0.442  11.362  1.00 138.76 ? 207 GLU A N   1 
ATOM   1507 C  CA  . GLU A 1 190 ? 2.814   -1.312  12.040  1.00 134.58 ? 207 GLU A CA  1 
ATOM   1508 C  C   . GLU A 1 190 ? 4.086   -1.405  11.228  1.00 130.70 ? 207 GLU A C   1 
ATOM   1509 O  O   . GLU A 1 190 ? 4.048   -1.293  10.010  1.00 134.72 ? 207 GLU A O   1 
ATOM   1510 C  CB  . GLU A 1 190 ? 2.244   -2.723  12.168  1.00 135.35 ? 207 GLU A CB  1 
ATOM   1511 C  CG  . GLU A 1 190 ? 0.784   -2.789  12.587  1.00 135.69 ? 207 GLU A CG  1 
ATOM   1512 C  CD  . GLU A 1 190 ? 0.292   -4.201  12.808  1.00 133.14 ? 207 GLU A CD  1 
ATOM   1513 O  OE1 . GLU A 1 190 ? 0.915   -5.159  12.309  1.00 129.24 ? 207 GLU A OE1 1 
ATOM   1514 O  OE2 . GLU A 1 190 ? -0.732  -4.355  13.495  1.00 136.40 ? 207 GLU A OE2 1 
ATOM   1515 N  N   . THR A 1 191 ? 5.203   -1.628  11.895  1.00 127.12 ? 208 THR A N   1 
ATOM   1516 C  CA  . THR A 1 191 ? 6.441   -1.910  11.195  1.00 129.76 ? 208 THR A CA  1 
ATOM   1517 C  C   . THR A 1 191 ? 6.939   -3.247  11.678  1.00 127.27 ? 208 THR A C   1 
ATOM   1518 O  O   . THR A 1 191 ? 7.049   -3.475  12.885  1.00 127.82 ? 208 THR A O   1 
ATOM   1519 C  CB  . THR A 1 191 ? 7.508   -0.842  11.466  1.00 132.75 ? 208 THR A CB  1 
ATOM   1520 O  OG1 . THR A 1 191 ? 6.924   0.454   11.301  1.00 142.68 ? 208 THR A OG1 1 
ATOM   1521 C  CG2 . THR A 1 191 ? 8.717   -1.016  10.519  1.00 130.02 ? 208 THR A CG2 1 
ATOM   1522 N  N   . LEU A 1 192 ? 7.206   -4.135  10.731  1.00 126.31 ? 209 LEU A N   1 
ATOM   1523 C  CA  . LEU A 1 192 ? 7.905   -5.377  11.008  1.00 126.90 ? 209 LEU A CA  1 
ATOM   1524 C  C   . LEU A 1 192 ? 9.358   -5.048  11.341  1.00 123.82 ? 209 LEU A C   1 
ATOM   1525 O  O   . LEU A 1 192 ? 10.089  -4.548  10.497  1.00 129.35 ? 209 LEU A O   1 
ATOM   1526 C  CB  . LEU A 1 192 ? 7.843   -6.287  9.776   1.00 128.41 ? 209 LEU A CB  1 
ATOM   1527 C  CG  . LEU A 1 192 ? 8.553   -7.633  9.865   1.00 125.26 ? 209 LEU A CG  1 
ATOM   1528 C  CD1 . LEU A 1 192 ? 7.779   -8.535  10.820  1.00 125.39 ? 209 LEU A CD1 1 
ATOM   1529 C  CD2 . LEU A 1 192 ? 8.700   -8.242  8.477   1.00 124.04 ? 209 LEU A CD2 1 
ATOM   1530 N  N   . VAL A 1 193 ? 9.790   -5.324  12.559  1.00 118.57 ? 210 VAL A N   1 
ATOM   1531 C  CA  . VAL A 1 193 ? 11.156  -4.958  12.945  1.00 118.05 ? 210 VAL A CA  1 
ATOM   1532 C  C   . VAL A 1 193 ? 12.151  -6.118  12.969  1.00 115.46 ? 210 VAL A C   1 
ATOM   1533 O  O   . VAL A 1 193 ? 13.365  -5.898  12.972  1.00 110.14 ? 210 VAL A O   1 
ATOM   1534 C  CB  . VAL A 1 193 ? 11.161  -4.191  14.277  1.00 120.54 ? 210 VAL A CB  1 
ATOM   1535 C  CG1 . VAL A 1 193 ? 10.340  -2.911  14.145  1.00 121.31 ? 210 VAL A CG1 1 
ATOM   1536 C  CG2 . VAL A 1 193 ? 10.633  -5.041  15.421  1.00 120.82 ? 210 VAL A CG2 1 
ATOM   1537 N  N   . SER A 1 194 ? 11.625  -7.342  13.012  1.00 116.80 ? 211 SER A N   1 
ATOM   1538 C  CA  . SER A 1 194 ? 12.431  -8.571  12.973  1.00 113.61 ? 211 SER A CA  1 
ATOM   1539 C  C   . SER A 1 194 ? 11.517  -9.749  12.646  1.00 110.57 ? 211 SER A C   1 
ATOM   1540 O  O   . SER A 1 194 ? 10.324  -9.741  12.996  1.00 109.58 ? 211 SER A O   1 
ATOM   1541 C  CB  . SER A 1 194 ? 13.171  -8.820  14.309  1.00 113.42 ? 211 SER A CB  1 
ATOM   1542 O  OG  . SER A 1 194 ? 12.301  -9.253  15.346  1.00 107.96 ? 211 SER A OG  1 
ATOM   1543 N  N   . LYS A 1 195 ? 12.083  -10.740 11.963  1.00 109.30 ? 212 LYS A N   1 
ATOM   1544 C  CA  . LYS A 1 195 ? 11.362  -11.947 11.583  1.00 110.67 ? 212 LYS A CA  1 
ATOM   1545 C  C   . LYS A 1 195 ? 12.359  -13.076 11.431  1.00 111.90 ? 212 LYS A C   1 
ATOM   1546 O  O   . LYS A 1 195 ? 13.170  -13.053 10.510  1.00 114.62 ? 212 LYS A O   1 
ATOM   1547 C  CB  . LYS A 1 195 ? 10.605  -11.734 10.272  1.00 113.21 ? 212 LYS A CB  1 
ATOM   1548 C  CG  . LYS A 1 195 ? 9.757   -12.922 9.856   1.00 116.18 ? 212 LYS A CG  1 
ATOM   1549 C  CD  . LYS A 1 195 ? 8.722   -12.541 8.796   1.00 117.80 ? 212 LYS A CD  1 
ATOM   1550 C  CE  . LYS A 1 195 ? 7.773   -13.687 8.448   1.00 119.37 ? 212 LYS A CE  1 
ATOM   1551 N  NZ  . LYS A 1 195 ? 8.446   -15.015 8.283   1.00 122.66 ? 212 LYS A NZ  1 
ATOM   1552 N  N   . GLY A 1 196 ? 12.302  -14.062 12.319  1.00 113.55 ? 213 GLY A N   1 
ATOM   1553 C  CA  . GLY A 1 196 ? 13.371  -15.069 12.400  1.00 114.69 ? 213 GLY A CA  1 
ATOM   1554 C  C   . GLY A 1 196 ? 13.116  -16.132 13.435  1.00 113.26 ? 213 GLY A C   1 
ATOM   1555 O  O   . GLY A 1 196 ? 12.051  -16.153 14.038  1.00 114.26 ? 213 GLY A O   1 
ATOM   1556 N  N   . LYS A 1 197 ? 14.086  -17.018 13.639  1.00 115.91 ? 214 LYS A N   1 
ATOM   1557 C  CA  . LYS A 1 197 ? 13.909  -18.135 14.575  1.00 115.07 ? 214 LYS A CA  1 
ATOM   1558 C  C   . LYS A 1 197 ? 14.149  -17.743 16.006  1.00 111.11 ? 214 LYS A C   1 
ATOM   1559 O  O   . LYS A 1 197 ? 13.800  -18.494 16.888  1.00 109.06 ? 214 LYS A O   1 
ATOM   1560 C  CB  . LYS A 1 197 ? 14.801  -19.323 14.209  1.00 118.96 ? 214 LYS A CB  1 
ATOM   1561 C  CG  . LYS A 1 197 ? 14.370  -20.043 12.932  1.00 125.03 ? 214 LYS A CG  1 
ATOM   1562 C  CD  . LYS A 1 197 ? 13.000  -20.727 13.046  1.00 127.84 ? 214 LYS A CD  1 
ATOM   1563 C  CE  . LYS A 1 197 ? 12.658  -21.606 11.839  1.00 131.92 ? 214 LYS A CE  1 
ATOM   1564 N  NZ  . LYS A 1 197 ? 12.378  -20.845 10.576  1.00 137.78 ? 214 LYS A NZ  1 
ATOM   1565 N  N   . GLU A 1 198 ? 14.708  -16.558 16.238  1.00 113.03 ? 215 GLU A N   1 
ATOM   1566 C  CA  . GLU A 1 198 ? 14.985  -16.079 17.592  1.00 110.70 ? 215 GLU A CA  1 
ATOM   1567 C  C   . GLU A 1 198 ? 13.686  -15.751 18.306  1.00 104.72 ? 215 GLU A C   1 
ATOM   1568 O  O   . GLU A 1 198 ? 12.870  -14.999 17.771  1.00 102.37 ? 215 GLU A O   1 
ATOM   1569 C  CB  . GLU A 1 198 ? 15.844  -14.811 17.551  1.00 117.18 ? 215 GLU A CB  1 
ATOM   1570 C  CG  . GLU A 1 198 ? 17.185  -14.925 16.820  1.00 122.03 ? 215 GLU A CG  1 
ATOM   1571 C  CD  . GLU A 1 198 ? 18.300  -15.579 17.630  1.00 124.35 ? 215 GLU A CD  1 
ATOM   1572 O  OE1 . GLU A 1 198 ? 19.380  -15.773 17.039  1.00 126.75 ? 215 GLU A OE1 1 
ATOM   1573 O  OE2 . GLU A 1 198 ? 18.130  -15.890 18.834  1.00 123.27 ? 215 GLU A OE2 1 
ATOM   1574 N  N   . ALA A 1 199 ? 13.498  -16.301 19.507  1.00 101.82 ? 216 ALA A N   1 
ATOM   1575 C  CA  . ALA A 1 199 ? 12.236  -16.132 20.242  1.00 98.36  ? 216 ALA A CA  1 
ATOM   1576 C  C   . ALA A 1 199 ? 12.182  -14.827 21.023  1.00 96.48  ? 216 ALA A C   1 
ATOM   1577 O  O   . ALA A 1 199 ? 11.134  -14.458 21.533  1.00 91.63  ? 216 ALA A O   1 
ATOM   1578 C  CB  . ALA A 1 199 ? 11.992  -17.315 21.166  1.00 97.67  ? 216 ALA A CB  1 
ATOM   1579 N  N   . THR A 1 200 ? 13.315  -14.141 21.133  1.00 98.39  ? 217 THR A N   1 
ATOM   1580 C  CA  . THR A 1 200 ? 13.370  -12.865 21.825  1.00 98.21  ? 217 THR A CA  1 
ATOM   1581 C  C   . THR A 1 200 ? 13.739  -11.769 20.853  1.00 97.04  ? 217 THR A C   1 
ATOM   1582 O  O   . THR A 1 200 ? 14.378  -12.014 19.842  1.00 98.15  ? 217 THR A O   1 
ATOM   1583 C  CB  . THR A 1 200 ? 14.408  -12.894 22.959  1.00 97.57  ? 217 THR A CB  1 
ATOM   1584 O  OG1 . THR A 1 200 ? 15.709  -12.838 22.392  1.00 96.37  ? 217 THR A OG1 1 
ATOM   1585 C  CG2 . THR A 1 200 ? 14.295  -14.189 23.782  1.00 97.01  ? 217 THR A CG2 1 
ATOM   1586 N  N   . LEU A 1 201 ? 13.309  -10.562 21.151  1.00 98.94  ? 218 LEU A N   1 
ATOM   1587 C  CA  . LEU A 1 201 ? 13.835  -9.381  20.485  1.00 103.42 ? 218 LEU A CA  1 
ATOM   1588 C  C   . LEU A 1 201 ? 14.634  -8.597  21.506  1.00 104.90 ? 218 LEU A C   1 
ATOM   1589 O  O   . LEU A 1 201 ? 14.130  -8.308  22.590  1.00 106.77 ? 218 LEU A O   1 
ATOM   1590 C  CB  . LEU A 1 201 ? 12.692  -8.532  19.985  1.00 102.26 ? 218 LEU A CB  1 
ATOM   1591 C  CG  . LEU A 1 201 ? 13.092  -7.262  19.267  1.00 103.65 ? 218 LEU A CG  1 
ATOM   1592 C  CD1 . LEU A 1 201 ? 13.905  -7.573  18.011  1.00 106.68 ? 218 LEU A CD1 1 
ATOM   1593 C  CD2 . LEU A 1 201 ? 11.812  -6.513  18.942  1.00 102.70 ? 218 LEU A CD2 1 
ATOM   1594 N  N   . THR A 1 202 ? 15.879  -8.268  21.175  1.00 108.68 ? 219 THR A N   1 
ATOM   1595 C  CA  . THR A 1 202 ? 16.730  -7.434  22.042  1.00 109.75 ? 219 THR A CA  1 
ATOM   1596 C  C   . THR A 1 202 ? 16.902  -6.080  21.398  1.00 109.55 ? 219 THR A C   1 
ATOM   1597 O  O   . THR A 1 202 ? 17.205  -5.998  20.210  1.00 109.31 ? 219 THR A O   1 
ATOM   1598 C  CB  . THR A 1 202 ? 18.114  -8.071  22.278  1.00 109.83 ? 219 THR A CB  1 
ATOM   1599 O  OG1 . THR A 1 202 ? 17.930  -9.330  22.930  1.00 109.40 ? 219 THR A OG1 1 
ATOM   1600 C  CG2 . THR A 1 202 ? 19.028  -7.179  23.142  1.00 109.32 ? 219 THR A CG2 1 
ATOM   1601 N  N   . LYS A 1 203 ? 16.678  -5.024  22.181  1.00 115.59 ? 220 LYS A N   1 
ATOM   1602 C  CA  . LYS A 1 203 ? 16.929  -3.643  21.748  1.00 119.03 ? 220 LYS A CA  1 
ATOM   1603 C  C   . LYS A 1 203 ? 17.839  -2.976  22.775  1.00 116.90 ? 220 LYS A C   1 
ATOM   1604 O  O   . LYS A 1 203 ? 17.413  -2.726  23.913  1.00 115.51 ? 220 LYS A O   1 
ATOM   1605 C  CB  . LYS A 1 203 ? 15.632  -2.851  21.588  1.00 118.60 ? 220 LYS A CB  1 
ATOM   1606 C  CG  . LYS A 1 203 ? 15.866  -1.442  21.095  1.00 123.90 ? 220 LYS A CG  1 
ATOM   1607 C  CD  . LYS A 1 203 ? 16.246  -1.421  19.618  1.00 129.19 ? 220 LYS A CD  1 
ATOM   1608 C  CE  . LYS A 1 203 ? 15.072  -0.987  18.752  1.00 132.14 ? 220 LYS A CE  1 
ATOM   1609 N  NZ  . LYS A 1 203 ? 14.656  0.425   19.030  1.00 135.00 ? 220 LYS A NZ  1 
ATOM   1610 N  N   . PRO A 1 204 ? 19.096  -2.694  22.385  1.00 116.96 ? 221 PRO A N   1 
ATOM   1611 C  CA  . PRO A 1 204 ? 20.023  -2.249  23.414  1.00 121.08 ? 221 PRO A CA  1 
ATOM   1612 C  C   . PRO A 1 204 ? 19.888  -0.751  23.675  1.00 123.44 ? 221 PRO A C   1 
ATOM   1613 O  O   . PRO A 1 204 ? 19.328  -0.036  22.836  1.00 125.10 ? 221 PRO A O   1 
ATOM   1614 C  CB  . PRO A 1 204 ? 21.376  -2.590  22.807  1.00 121.17 ? 221 PRO A CB  1 
ATOM   1615 C  CG  . PRO A 1 204 ? 21.164  -2.512  21.319  1.00 118.26 ? 221 PRO A CG  1 
ATOM   1616 C  CD  . PRO A 1 204 ? 19.693  -2.592  21.039  1.00 114.45 ? 221 PRO A CD  1 
ATOM   1617 N  N   . MET A 1 205 ? 20.349  -0.301  24.841  1.00 125.75 ? 222 MET A N   1 
ATOM   1618 C  CA  . MET A 1 205 ? 20.495  1.141   25.154  1.00 129.09 ? 222 MET A CA  1 
ATOM   1619 C  C   . MET A 1 205 ? 19.273  2.002   24.790  1.00 129.48 ? 222 MET A C   1 
ATOM   1620 O  O   . MET A 1 205 ? 19.325  2.908   23.961  1.00 125.84 ? 222 MET A O   1 
ATOM   1621 C  CB  . MET A 1 205 ? 21.789  1.677   24.531  1.00 128.33 ? 222 MET A CB  1 
ATOM   1622 C  CG  . MET A 1 205 ? 23.018  1.209   25.294  1.00 129.11 ? 222 MET A CG  1 
ATOM   1623 S  SD  . MET A 1 205 ? 24.594  1.646   24.549  1.00 129.18 ? 222 MET A SD  1 
ATOM   1624 C  CE  . MET A 1 205 ? 24.828  0.301   23.398  1.00 129.66 ? 222 MET A CE  1 
ATOM   1625 N  N   . VAL A 1 206 ? 18.175  1.702   25.463  1.00 133.10 ? 223 VAL A N   1 
ATOM   1626 C  CA  . VAL A 1 206 ? 16.865  2.198   25.076  1.00 133.58 ? 223 VAL A CA  1 
ATOM   1627 C  C   . VAL A 1 206 ? 16.668  3.685   25.437  1.00 133.32 ? 223 VAL A C   1 
ATOM   1628 O  O   . VAL A 1 206 ? 17.231  4.150   26.423  1.00 134.17 ? 223 VAL A O   1 
ATOM   1629 C  CB  . VAL A 1 206 ? 15.780  1.286   25.705  1.00 133.38 ? 223 VAL A CB  1 
ATOM   1630 C  CG1 . VAL A 1 206 ? 15.533  1.594   27.184  1.00 135.42 ? 223 VAL A CG1 1 
ATOM   1631 C  CG2 . VAL A 1 206 ? 14.496  1.382   24.921  1.00 133.41 ? 223 VAL A CG2 1 
ATOM   1632 N  N   . GLY A 1 207 ? 15.893  4.417   24.628  1.00 132.60 ? 224 GLY A N   1 
ATOM   1633 C  CA  . GLY A 1 207 ? 15.445  5.796   24.948  1.00 135.99 ? 224 GLY A CA  1 
ATOM   1634 C  C   . GLY A 1 207 ? 13.921  5.919   24.904  1.00 137.70 ? 224 GLY A C   1 
ATOM   1635 O  O   . GLY A 1 207 ? 13.249  4.959   24.569  1.00 139.19 ? 224 GLY A O   1 
ATOM   1636 N  N   . PRO A 1 208 ? 13.359  7.102   25.233  1.00 144.28 ? 225 PRO A N   1 
ATOM   1637 C  CA  . PRO A 1 208 ? 11.881  7.259   25.271  1.00 142.12 ? 225 PRO A CA  1 
ATOM   1638 C  C   . PRO A 1 208 ? 11.146  6.903   23.970  1.00 137.95 ? 225 PRO A C   1 
ATOM   1639 O  O   . PRO A 1 208 ? 10.019  6.412   24.025  1.00 130.80 ? 225 PRO A O   1 
ATOM   1640 C  CB  . PRO A 1 208 ? 11.679  8.748   25.592  1.00 145.25 ? 225 PRO A CB  1 
ATOM   1641 C  CG  . PRO A 1 208 ? 12.971  9.216   26.161  1.00 147.35 ? 225 PRO A CG  1 
ATOM   1642 C  CD  . PRO A 1 208 ? 14.057  8.355   25.577  1.00 147.09 ? 225 PRO A CD  1 
ATOM   1643 N  N   . GLU A 1 209 ? 11.787  7.163   22.825  1.00 140.25 ? 226 GLU A N   1 
ATOM   1644 C  CA  . GLU A 1 209 ? 11.276  6.795   21.482  1.00 140.12 ? 226 GLU A CA  1 
ATOM   1645 C  C   . GLU A 1 209 ? 10.934  5.301   21.293  1.00 138.48 ? 226 GLU A C   1 
ATOM   1646 O  O   . GLU A 1 209 ? 10.171  4.942   20.388  1.00 143.28 ? 226 GLU A O   1 
ATOM   1647 C  CB  . GLU A 1 209 ? 12.250  7.276   20.369  1.00 140.59 ? 226 GLU A CB  1 
ATOM   1648 C  CG  . GLU A 1 209 ? 13.624  6.585   20.279  1.00 140.89 ? 226 GLU A CG  1 
ATOM   1649 C  CD  . GLU A 1 209 ? 14.652  7.054   21.307  1.00 139.95 ? 226 GLU A CD  1 
ATOM   1650 O  OE1 . GLU A 1 209 ? 14.309  7.828   22.219  1.00 139.14 ? 226 GLU A OE1 1 
ATOM   1651 O  OE2 . GLU A 1 209 ? 15.821  6.633   21.219  1.00 140.60 ? 226 GLU A OE2 1 
ATOM   1652 N  N   . ASP A 1 210 ? 11.507  4.450   22.143  1.00 136.72 ? 227 ASP A N   1 
ATOM   1653 C  CA  . ASP A 1 210 ? 11.230  3.007   22.150  1.00 132.49 ? 227 ASP A CA  1 
ATOM   1654 C  C   . ASP A 1 210 ? 10.037  2.574   23.043  1.00 130.74 ? 227 ASP A C   1 
ATOM   1655 O  O   . ASP A 1 210 ? 9.705   1.390   23.086  1.00 130.30 ? 227 ASP A O   1 
ATOM   1656 C  CB  . ASP A 1 210 ? 12.496  2.265   22.579  1.00 128.55 ? 227 ASP A CB  1 
ATOM   1657 C  CG  . ASP A 1 210 ? 13.693  2.558   21.677  1.00 125.91 ? 227 ASP A CG  1 
ATOM   1658 O  OD1 . ASP A 1 210 ? 13.592  2.300   20.470  1.00 125.37 ? 227 ASP A OD1 1 
ATOM   1659 O  OD2 . ASP A 1 210 ? 14.739  3.029   22.165  1.00 125.34 ? 227 ASP A OD2 1 
ATOM   1660 N  N   . ALA A 1 211 ? 9.403   3.517   23.747  1.00 130.37 ? 228 ALA A N   1 
ATOM   1661 C  CA  . ALA A 1 211 ? 8.173   3.246   24.512  1.00 129.49 ? 228 ALA A CA  1 
ATOM   1662 C  C   . ALA A 1 211 ? 6.991   3.004   23.573  1.00 129.97 ? 228 ALA A C   1 
ATOM   1663 O  O   . ALA A 1 211 ? 7.021   3.426   22.422  1.00 129.46 ? 228 ALA A O   1 
ATOM   1664 C  CB  . ALA A 1 211 ? 7.862   4.407   25.448  1.00 130.47 ? 228 ALA A CB  1 
ATOM   1665 N  N   . GLY A 1 212 ? 5.954   2.331   24.066  1.00 131.38 ? 229 GLY A N   1 
ATOM   1666 C  CA  . GLY A 1 212 ? 4.742   2.078   23.278  1.00 132.80 ? 229 GLY A CA  1 
ATOM   1667 C  C   . GLY A 1 212 ? 4.469   0.601   23.093  1.00 134.51 ? 229 GLY A C   1 
ATOM   1668 O  O   . GLY A 1 212 ? 4.899   -0.219  23.916  1.00 140.68 ? 229 GLY A O   1 
ATOM   1669 N  N   . SER A 1 213 ? 3.762   0.267   22.012  1.00 133.53 ? 230 SER A N   1 
ATOM   1670 C  CA  . SER A 1 213 ? 3.263   -1.093  21.792  1.00 133.93 ? 230 SER A CA  1 
ATOM   1671 C  C   . SER A 1 213 ? 4.113   -1.900  20.831  1.00 130.33 ? 230 SER A C   1 
ATOM   1672 O  O   . SER A 1 213 ? 4.582   -1.391  19.805  1.00 133.00 ? 230 SER A O   1 
ATOM   1673 C  CB  . SER A 1 213 ? 1.832   -1.065  21.269  1.00 135.78 ? 230 SER A CB  1 
ATOM   1674 O  OG  . SER A 1 213 ? 0.956   -0.678  22.300  1.00 141.31 ? 230 SER A OG  1 
ATOM   1675 N  N   . TYR A 1 214 ? 4.286   -3.169  21.190  1.00 126.22 ? 231 TYR A N   1 
ATOM   1676 C  CA  . TYR A 1 214 ? 4.916   -4.186  20.353  1.00 122.24 ? 231 TYR A CA  1 
ATOM   1677 C  C   . TYR A 1 214 ? 3.988   -5.436  20.317  1.00 117.25 ? 231 TYR A C   1 
ATOM   1678 O  O   . TYR A 1 214 ? 3.267   -5.698  21.280  1.00 111.83 ? 231 TYR A O   1 
ATOM   1679 C  CB  . TYR A 1 214 ? 6.297   -4.563  20.924  1.00 121.87 ? 231 TYR A CB  1 
ATOM   1680 C  CG  . TYR A 1 214 ? 7.322   -3.439  21.035  1.00 123.14 ? 231 TYR A CG  1 
ATOM   1681 C  CD1 . TYR A 1 214 ? 7.170   -2.397  21.961  1.00 123.48 ? 231 TYR A CD1 1 
ATOM   1682 C  CD2 . TYR A 1 214 ? 8.478   -3.447  20.246  1.00 123.80 ? 231 TYR A CD2 1 
ATOM   1683 C  CE1 . TYR A 1 214 ? 8.120   -1.388  22.070  1.00 125.37 ? 231 TYR A CE1 1 
ATOM   1684 C  CE2 . TYR A 1 214 ? 9.431   -2.437  20.344  1.00 124.41 ? 231 TYR A CE2 1 
ATOM   1685 C  CZ  . TYR A 1 214 ? 9.253   -1.415  21.258  1.00 126.58 ? 231 TYR A CZ  1 
ATOM   1686 O  OH  . TYR A 1 214 ? 10.199  -0.421  21.349  1.00 129.51 ? 231 TYR A OH  1 
ATOM   1687 N  N   . ARG A 1 215 ? 3.990   -6.188  19.214  1.00 117.67 ? 232 ARG A N   1 
ATOM   1688 C  CA  . ARG A 1 215 ? 3.253   -7.472  19.130  1.00 115.70 ? 232 ARG A CA  1 
ATOM   1689 C  C   . ARG A 1 215 ? 4.166   -8.566  18.575  1.00 109.05 ? 232 ARG A C   1 
ATOM   1690 O  O   . ARG A 1 215 ? 4.888   -8.347  17.597  1.00 108.27 ? 232 ARG A O   1 
ATOM   1691 C  CB  . ARG A 1 215 ? 1.978   -7.340  18.275  1.00 119.37 ? 232 ARG A CB  1 
ATOM   1692 C  CG  . ARG A 1 215 ? 1.053   -8.560  18.311  1.00 122.73 ? 232 ARG A CG  1 
ATOM   1693 C  CD  . ARG A 1 215 ? -0.227  -8.395  17.495  1.00 126.05 ? 232 ARG A CD  1 
ATOM   1694 N  NE  . ARG A 1 215 ? 0.037   -8.388  16.055  1.00 129.85 ? 232 ARG A NE  1 
ATOM   1695 C  CZ  . ARG A 1 215 ? 0.046   -7.316  15.255  1.00 136.55 ? 232 ARG A CZ  1 
ATOM   1696 N  NH1 . ARG A 1 215 ? -0.212  -6.088  15.712  1.00 140.88 ? 232 ARG A NH1 1 
ATOM   1697 N  NH2 . ARG A 1 215 ? 0.323   -7.480  13.961  1.00 142.30 ? 232 ARG A NH2 1 
ATOM   1698 N  N   . CYS A 1 216 ? 4.152   -9.729  19.224  1.00 104.65 ? 233 CYS A N   1 
ATOM   1699 C  CA  . CYS A 1 216 ? 4.839   -10.913 18.710  1.00 103.37 ? 233 CYS A CA  1 
ATOM   1700 C  C   . CYS A 1 216 ? 3.838   -11.872 18.083  1.00 100.99 ? 233 CYS A C   1 
ATOM   1701 O  O   . CYS A 1 216 ? 2.777   -12.120 18.649  1.00 98.69  ? 233 CYS A O   1 
ATOM   1702 C  CB  . CYS A 1 216 ? 5.598   -11.661 19.804  1.00 101.75 ? 233 CYS A CB  1 
ATOM   1703 S  SG  . CYS A 1 216 ? 6.204   -13.271 19.223  1.00 96.99  ? 233 CYS A SG  1 
ATOM   1704 N  N   . GLU A 1 217 ? 4.207   -12.408 16.924  1.00 100.52 ? 234 GLU A N   1 
ATOM   1705 C  CA  . GLU A 1 217 ? 3.435   -13.422 16.234  1.00 102.37 ? 234 GLU A CA  1 
ATOM   1706 C  C   . GLU A 1 217 ? 4.341   -14.584 15.879  1.00 100.46 ? 234 GLU A C   1 
ATOM   1707 O  O   . GLU A 1 217 ? 5.331   -14.420 15.161  1.00 98.42  ? 234 GLU A O   1 
ATOM   1708 C  CB  . GLU A 1 217 ? 2.804   -12.853 14.968  1.00 107.32 ? 234 GLU A CB  1 
ATOM   1709 C  CG  . GLU A 1 217 ? 1.605   -11.957 15.247  1.00 111.44 ? 234 GLU A CG  1 
ATOM   1710 C  CD  . GLU A 1 217 ? 0.928   -11.455 13.989  1.00 115.37 ? 234 GLU A CD  1 
ATOM   1711 O  OE1 . GLU A 1 217 ? 0.945   -12.172 12.963  1.00 117.11 ? 234 GLU A OE1 1 
ATOM   1712 O  OE2 . GLU A 1 217 ? 0.374   -10.336 14.034  1.00 116.98 ? 234 GLU A OE2 1 
ATOM   1713 N  N   . LEU A 1 218 ? 4.005   -15.760 16.394  1.00 100.64 ? 235 LEU A N   1 
ATOM   1714 C  CA  . LEU A 1 218 ? 4.738   -16.967 16.071  1.00 96.93  ? 235 LEU A CA  1 
ATOM   1715 C  C   . LEU A 1 218 ? 3.969   -17.641 14.996  1.00 95.39  ? 235 LEU A C   1 
ATOM   1716 O  O   . LEU A 1 218 ? 2.819   -18.015 15.208  1.00 94.87  ? 235 LEU A O   1 
ATOM   1717 C  CB  . LEU A 1 218 ? 4.836   -17.903 17.258  1.00 94.97  ? 235 LEU A CB  1 
ATOM   1718 C  CG  . LEU A 1 218 ? 5.542   -19.236 17.003  1.00 94.48  ? 235 LEU A CG  1 
ATOM   1719 C  CD1 . LEU A 1 218 ? 6.900   -19.056 16.330  1.00 96.36  ? 235 LEU A CD1 1 
ATOM   1720 C  CD2 . LEU A 1 218 ? 5.683   -19.952 18.335  1.00 94.20  ? 235 LEU A CD2 1 
ATOM   1721 N  N   . GLY A 1 219 ? 4.619   -17.796 13.852  1.00 97.50  ? 236 GLY A N   1 
ATOM   1722 C  CA  . GLY A 1 219 ? 3.981   -18.278 12.649  1.00 97.95  ? 236 GLY A CA  1 
ATOM   1723 C  C   . GLY A 1 219 ? 3.919   -19.772 12.596  1.00 97.64  ? 236 GLY A C   1 
ATOM   1724 O  O   . GLY A 1 219 ? 4.698   -20.450 13.253  1.00 97.45  ? 236 GLY A O   1 
ATOM   1725 N  N   . SER A 1 220 ? 3.001   -20.257 11.765  1.00 103.54 ? 237 SER A N   1 
ATOM   1726 C  CA  . SER A 1 220 ? 2.636   -21.662 11.650  1.00 105.94 ? 237 SER A CA  1 
ATOM   1727 C  C   . SER A 1 220 ? 2.646   -22.070 10.173  1.00 107.67 ? 237 SER A C   1 
ATOM   1728 O  O   . SER A 1 220 ? 2.430   -21.231 9.305   1.00 104.28 ? 237 SER A O   1 
ATOM   1729 C  CB  . SER A 1 220 ? 1.218   -21.819 12.201  1.00 108.26 ? 237 SER A CB  1 
ATOM   1730 O  OG  . SER A 1 220 ? 0.768   -23.148 12.118  1.00 111.24 ? 237 SER A OG  1 
ATOM   1731 N  N   . VAL A 1 221 ? 2.882   -23.350 9.888   1.00 110.35 ? 238 VAL A N   1 
ATOM   1732 C  CA  . VAL A 1 221 ? 2.679   -23.889 8.524   1.00 114.35 ? 238 VAL A CA  1 
ATOM   1733 C  C   . VAL A 1 221 ? 1.249   -23.697 8.001   1.00 117.03 ? 238 VAL A C   1 
ATOM   1734 O  O   . VAL A 1 221 ? 1.028   -23.645 6.781   1.00 119.55 ? 238 VAL A O   1 
ATOM   1735 C  CB  . VAL A 1 221 ? 3.038   -25.395 8.380   1.00 115.77 ? 238 VAL A CB  1 
ATOM   1736 C  CG1 . VAL A 1 221 ? 4.538   -25.605 8.529   1.00 117.96 ? 238 VAL A CG1 1 
ATOM   1737 C  CG2 . VAL A 1 221 ? 2.225   -26.287 9.326   1.00 112.84 ? 238 VAL A CG2 1 
ATOM   1738 N  N   . ASN A 1 222 ? 0.289   -23.626 8.927   1.00 118.34 ? 239 ASN A N   1 
ATOM   1739 C  CA  . ASN A 1 222 ? -1.113  -23.345 8.610   1.00 117.59 ? 239 ASN A CA  1 
ATOM   1740 C  C   . ASN A 1 222 ? -1.268  -21.871 8.268   1.00 114.97 ? 239 ASN A C   1 
ATOM   1741 O  O   . ASN A 1 222 ? -0.291  -21.146 8.061   1.00 114.73 ? 239 ASN A O   1 
ATOM   1742 C  CB  . ASN A 1 222 ? -2.051  -23.750 9.795   1.00 118.20 ? 239 ASN A CB  1 
ATOM   1743 C  CG  . ASN A 1 222 ? -2.157  -25.276 10.031  1.00 114.33 ? 239 ASN A CG  1 
ATOM   1744 O  OD1 . ASN A 1 222 ? -2.791  -25.703 10.999  1.00 105.71 ? 239 ASN A OD1 1 
ATOM   1745 N  ND2 . ASN A 1 222 ? -1.566  -26.089 9.156   1.00 116.30 ? 239 ASN A ND2 1 
ATOM   1746 N  N   . SER A 1 223 ? -2.510  -21.437 8.177   1.00 115.75 ? 240 SER A N   1 
ATOM   1747 C  CA  . SER A 1 223 ? -2.815  -20.083 7.782   1.00 115.25 ? 240 SER A CA  1 
ATOM   1748 C  C   . SER A 1 223 ? -2.480  -19.102 8.924   1.00 111.87 ? 240 SER A C   1 
ATOM   1749 O  O   . SER A 1 223 ? -1.521  -18.352 8.836   1.00 111.93 ? 240 SER A O   1 
ATOM   1750 C  CB  . SER A 1 223 ? -4.279  -20.017 7.344   1.00 113.30 ? 240 SER A CB  1 
ATOM   1751 O  OG  . SER A 1 223 ? -4.441  -18.972 6.446   1.00 119.72 ? 240 SER A OG  1 
ATOM   1752 N  N   . SER A 1 224 ? -3.202  -19.191 10.029  1.00 108.28 ? 241 SER A N   1 
ATOM   1753 C  CA  . SER A 1 224 ? -3.058  -18.242 11.144  1.00 105.72 ? 241 SER A CA  1 
ATOM   1754 C  C   . SER A 1 224 ? -1.910  -18.533 12.181  1.00 99.97  ? 241 SER A C   1 
ATOM   1755 O  O   . SER A 1 224 ? -1.236  -19.569 12.095  1.00 94.97  ? 241 SER A O   1 
ATOM   1756 C  CB  . SER A 1 224 ? -4.421  -18.159 11.807  1.00 105.94 ? 241 SER A CB  1 
ATOM   1757 O  OG  . SER A 1 224 ? -5.004  -19.413 11.716  1.00 98.64  ? 241 SER A OG  1 
ATOM   1758 N  N   . PRO A 1 225 ? -1.672  -17.596 13.147  1.00 95.32  ? 242 PRO A N   1 
ATOM   1759 C  CA  . PRO A 1 225 ? -0.525  -17.708 14.046  1.00 91.63  ? 242 PRO A CA  1 
ATOM   1760 C  C   . PRO A 1 225 ? -0.758  -18.601 15.250  1.00 88.61  ? 242 PRO A C   1 
ATOM   1761 O  O   . PRO A 1 225 ? -1.885  -18.751 15.705  1.00 89.70  ? 242 PRO A O   1 
ATOM   1762 C  CB  . PRO A 1 225 ? -0.306  -16.260 14.534  1.00 92.61  ? 242 PRO A CB  1 
ATOM   1763 C  CG  . PRO A 1 225 ? -1.438  -15.438 14.021  1.00 94.56  ? 242 PRO A CG  1 
ATOM   1764 C  CD  . PRO A 1 225 ? -2.455  -16.386 13.469  1.00 96.21  ? 242 PRO A CD  1 
ATOM   1765 N  N   . ALA A 1 226 ? 0.336   -19.120 15.790  1.00 86.56  ? 243 ALA A N   1 
ATOM   1766 C  CA  . ALA A 1 226 ? 0.324   -20.084 16.896  1.00 83.94  ? 243 ALA A CA  1 
ATOM   1767 C  C   . ALA A 1 226 ? 0.310   -19.392 18.248  1.00 82.12  ? 243 ALA A C   1 
ATOM   1768 O  O   . ALA A 1 226 ? -0.223  -19.920 19.226  1.00 83.95  ? 243 ALA A O   1 
ATOM   1769 C  CB  . ALA A 1 226 ? 1.535   -21.019 16.788  1.00 82.35  ? 243 ALA A CB  1 
ATOM   1770 N  N   . THR A 1 227 ? 0.910   -18.214 18.300  1.00 81.78  ? 244 THR A N   1 
ATOM   1771 C  CA  . THR A 1 227 ? 1.015   -17.447 19.528  1.00 81.06  ? 244 THR A CA  1 
ATOM   1772 C  C   . THR A 1 227 ? 1.022   -15.969 19.183  1.00 82.93  ? 244 THR A C   1 
ATOM   1773 O  O   . THR A 1 227 ? 1.758   -15.531 18.297  1.00 78.75  ? 244 THR A O   1 
ATOM   1774 C  CB  . THR A 1 227 ? 2.329   -17.784 20.248  1.00 80.30  ? 244 THR A CB  1 
ATOM   1775 O  OG1 . THR A 1 227 ? 2.269   -19.109 20.767  1.00 78.45  ? 244 THR A OG1 1 
ATOM   1776 C  CG2 . THR A 1 227 ? 2.616   -16.825 21.384  1.00 80.65  ? 244 THR A CG2 1 
ATOM   1777 N  N   . ILE A 1 228 ? 0.190   -15.213 19.875  1.00 89.33  ? 245 ILE A N   1 
ATOM   1778 C  CA  . ILE A 1 228 ? 0.231   -13.762 19.784  1.00 95.14  ? 245 ILE A CA  1 
ATOM   1779 C  C   . ILE A 1 228 ? 0.437   -13.228 21.180  1.00 94.28  ? 245 ILE A C   1 
ATOM   1780 O  O   . ILE A 1 228 ? -0.315  -13.594 22.061  1.00 101.02 ? 245 ILE A O   1 
ATOM   1781 C  CB  . ILE A 1 228 ? -1.084  -13.214 19.236  1.00 100.08 ? 245 ILE A CB  1 
ATOM   1782 C  CG1 . ILE A 1 228 ? -1.265  -13.664 17.775  1.00 103.91 ? 245 ILE A CG1 1 
ATOM   1783 C  CG2 . ILE A 1 228 ? -1.104  -11.688 19.347  1.00 103.44 ? 245 ILE A CG2 1 
ATOM   1784 C  CD1 . ILE A 1 228 ? -2.710  -13.696 17.309  1.00 106.61 ? 245 ILE A CD1 1 
ATOM   1785 N  N   . ILE A 1 229 ? 1.450   -12.394 21.385  1.00 90.90  ? 246 ILE A N   1 
ATOM   1786 C  CA  . ILE A 1 229 ? 1.693   -11.762 22.695  1.00 88.85  ? 246 ILE A CA  1 
ATOM   1787 C  C   . ILE A 1 229 ? 1.846   -10.280 22.434  1.00 87.22  ? 246 ILE A C   1 
ATOM   1788 O  O   . ILE A 1 229 ? 2.570   -9.910  21.517  1.00 81.04  ? 246 ILE A O   1 
ATOM   1789 C  CB  . ILE A 1 229 ? 2.985   -12.299 23.367  1.00 88.64  ? 246 ILE A CB  1 
ATOM   1790 C  CG1 . ILE A 1 229 ? 2.873   -13.792 23.705  1.00 86.98  ? 246 ILE A CG1 1 
ATOM   1791 C  CG2 . ILE A 1 229 ? 3.319   -11.532 24.637  1.00 86.96  ? 246 ILE A CG2 1 
ATOM   1792 C  CD1 . ILE A 1 229 ? 4.199   -14.450 24.034  1.00 85.90  ? 246 ILE A CD1 1 
ATOM   1793 N  N   . ASN A 1 230 ? 1.151   -9.446  23.206  1.00 94.84  ? 247 ASN A N   1 
ATOM   1794 C  CA  . ASN A 1 230 ? 1.348   -7.974  23.157  1.00 103.25 ? 247 ASN A CA  1 
ATOM   1795 C  C   . ASN A 1 230 ? 2.218   -7.505  24.332  1.00 102.91 ? 247 ASN A C   1 
ATOM   1796 O  O   . ASN A 1 230 ? 2.104   -8.036  25.438  1.00 101.41 ? 247 ASN A O   1 
ATOM   1797 C  CB  . ASN A 1 230 ? 0.008   -7.215  23.106  1.00 105.21 ? 247 ASN A CB  1 
ATOM   1798 C  CG  . ASN A 1 230 ? -0.613  -7.231  21.713  1.00 107.12 ? 247 ASN A CG  1 
ATOM   1799 O  OD1 . ASN A 1 230 ? -1.239  -8.217  21.305  1.00 111.71 ? 247 ASN A OD1 1 
ATOM   1800 N  ND2 . ASN A 1 230 ? -0.421  -6.152  20.969  1.00 108.08 ? 247 ASN A ND2 1 
ATOM   1801 N  N   . PHE A 1 231 ? 3.120   -6.562  24.059  1.00 101.76 ? 248 PHE A N   1 
ATOM   1802 C  CA  . PHE A 1 231 ? 4.008   -5.984  25.067  1.00 105.61 ? 248 PHE A CA  1 
ATOM   1803 C  C   . PHE A 1 231 ? 3.750   -4.471  25.086  1.00 110.10 ? 248 PHE A C   1 
ATOM   1804 O  O   . PHE A 1 231 ? 3.723   -3.837  24.017  1.00 111.95 ? 248 PHE A O   1 
ATOM   1805 C  CB  . PHE A 1 231 ? 5.496   -6.191  24.709  1.00 105.00 ? 248 PHE A CB  1 
ATOM   1806 C  CG  . PHE A 1 231 ? 5.933   -7.637  24.490  1.00 99.13  ? 248 PHE A CG  1 
ATOM   1807 C  CD1 . PHE A 1 231 ? 6.698   -8.299  25.451  1.00 97.67  ? 248 PHE A CD1 1 
ATOM   1808 C  CD2 . PHE A 1 231 ? 5.685   -8.295  23.289  1.00 95.54  ? 248 PHE A CD2 1 
ATOM   1809 C  CE1 . PHE A 1 231 ? 7.160   -9.599  25.247  1.00 94.05  ? 248 PHE A CE1 1 
ATOM   1810 C  CE2 . PHE A 1 231 ? 6.138   -9.597  23.088  1.00 94.72  ? 248 PHE A CE2 1 
ATOM   1811 C  CZ  . PHE A 1 231 ? 6.875   -10.249 24.073  1.00 92.55  ? 248 PHE A CZ  1 
ATOM   1812 N  N   . HIS A 1 232 ? 3.559   -3.889  26.274  1.00 114.45 ? 249 HIS A N   1 
ATOM   1813 C  CA  . HIS A 1 232 ? 3.530   -2.418  26.413  1.00 115.98 ? 249 HIS A CA  1 
ATOM   1814 C  C   . HIS A 1 232 ? 4.756   -1.937  27.166  1.00 112.42 ? 249 HIS A C   1 
ATOM   1815 O  O   . HIS A 1 232 ? 4.988   -2.330  28.311  1.00 112.47 ? 249 HIS A O   1 
ATOM   1816 C  CB  . HIS A 1 232 ? 2.240   -1.953  27.077  1.00 118.33 ? 249 HIS A CB  1 
ATOM   1817 C  CG  . HIS A 1 232 ? 1.031   -2.318  26.290  1.00 123.56 ? 249 HIS A CG  1 
ATOM   1818 N  ND1 . HIS A 1 232 ? 0.773   -1.795  25.038  1.00 126.51 ? 249 HIS A ND1 1 
ATOM   1819 C  CD2 . HIS A 1 232 ? 0.047   -3.210  26.539  1.00 125.57 ? 249 HIS A CD2 1 
ATOM   1820 C  CE1 . HIS A 1 232 ? -0.337  -2.333  24.565  1.00 128.32 ? 249 HIS A CE1 1 
ATOM   1821 N  NE2 . HIS A 1 232 ? -0.799  -3.191  25.458  1.00 126.57 ? 249 HIS A NE2 1 
ATOM   1822 N  N   . VAL A 1 233 ? 5.544   -1.098  26.507  1.00 110.52 ? 250 VAL A N   1 
ATOM   1823 C  CA  . VAL A 1 233 ? 6.808   -0.654  27.052  1.00 115.17 ? 250 VAL A CA  1 
ATOM   1824 C  C   . VAL A 1 233 ? 6.707   0.780   27.567  1.00 118.33 ? 250 VAL A C   1 
ATOM   1825 O  O   . VAL A 1 233 ? 6.326   1.687   26.821  1.00 116.60 ? 250 VAL A O   1 
ATOM   1826 C  CB  . VAL A 1 233 ? 7.926   -0.776  26.003  1.00 115.82 ? 250 VAL A CB  1 
ATOM   1827 C  CG1 . VAL A 1 233 ? 9.235   -0.201  26.527  1.00 116.46 ? 250 VAL A CG1 1 
ATOM   1828 C  CG2 . VAL A 1 233 ? 8.118   -2.240  25.623  1.00 115.46 ? 250 VAL A CG2 1 
ATOM   1829 N  N   . THR A 1 234 ? 7.039   0.945   28.849  1.00 121.80 ? 251 THR A N   1 
ATOM   1830 C  CA  . THR A 1 234 ? 7.261   2.238   29.499  1.00 126.22 ? 251 THR A CA  1 
ATOM   1831 C  C   . THR A 1 234 ? 8.765   2.407   29.666  1.00 128.35 ? 251 THR A C   1 
ATOM   1832 O  O   . THR A 1 234 ? 9.418   1.495   30.158  1.00 131.00 ? 251 THR A O   1 
ATOM   1833 C  CB  . THR A 1 234 ? 6.657   2.222   30.916  1.00 130.00 ? 251 THR A CB  1 
ATOM   1834 O  OG1 . THR A 1 234 ? 5.271   1.866   30.853  1.00 130.21 ? 251 THR A OG1 1 
ATOM   1835 C  CG2 . THR A 1 234 ? 6.827   3.565   31.622  1.00 134.81 ? 251 THR A CG2 1 
ATOM   1836 N  N   . VAL A 1 235 ? 9.327   3.550   29.278  1.00 131.56 ? 252 VAL A N   1 
ATOM   1837 C  CA  . VAL A 1 235 ? 10.769  3.811   29.493  1.00 133.22 ? 252 VAL A CA  1 
ATOM   1838 C  C   . VAL A 1 235 ? 10.950  4.773   30.664  1.00 132.43 ? 252 VAL A C   1 
ATOM   1839 O  O   . VAL A 1 235 ? 10.507  5.917   30.591  1.00 130.44 ? 252 VAL A O   1 
ATOM   1840 C  CB  . VAL A 1 235 ? 11.451  4.401   28.244  1.00 136.62 ? 252 VAL A CB  1 
ATOM   1841 C  CG1 . VAL A 1 235 ? 12.955  4.513   28.460  1.00 137.50 ? 252 VAL A CG1 1 
ATOM   1842 C  CG2 . VAL A 1 235 ? 11.170  3.538   27.019  1.00 137.73 ? 252 VAL A CG2 1 
ATOM   1843 N  N   . LEU A 1 236 ? 11.613  4.310   31.727  1.00 133.81 ? 253 LEU A N   1 
ATOM   1844 C  CA  . LEU A 1 236 ? 11.782  5.097   32.960  1.00 137.20 ? 253 LEU A CA  1 
ATOM   1845 C  C   . LEU A 1 236 ? 12.941  6.083   32.826  1.00 138.16 ? 253 LEU A C   1 
ATOM   1846 O  O   . LEU A 1 236 ? 14.100  5.648   32.827  1.00 140.56 ? 253 LEU A O   1 
ATOM   1847 C  CB  . LEU A 1 236 ? 12.040  4.177   34.169  1.00 137.55 ? 253 LEU A CB  1 
ATOM   1848 C  CG  . LEU A 1 236 ? 10.906  3.245   34.600  1.00 138.20 ? 253 LEU A CG  1 
ATOM   1849 C  CD1 . LEU A 1 236 ? 11.372  2.333   35.736  1.00 137.66 ? 253 LEU A CD1 1 
ATOM   1850 C  CD2 . LEU A 1 236 ? 9.663   4.043   34.987  1.00 138.03 ? 253 LEU A CD2 1 
ATOM   1851 N  N   . PRO A 1 237 ? 12.643  7.408   32.734  1.00 136.71 ? 254 PRO A N   1 
ATOM   1852 C  CA  . PRO A 1 237 ? 13.730  8.379   32.498  1.00 131.87 ? 254 PRO A CA  1 
ATOM   1853 C  C   . PRO A 1 237 ? 14.604  8.589   33.722  1.00 123.95 ? 254 PRO A C   1 
ATOM   1854 O  O   . PRO A 1 237 ? 14.266  8.073   34.779  1.00 113.43 ? 254 PRO A O   1 
ATOM   1855 C  CB  . PRO A 1 237 ? 12.982  9.659   32.115  1.00 132.41 ? 254 PRO A CB  1 
ATOM   1856 C  CG  . PRO A 1 237 ? 11.636  9.535   32.752  1.00 133.23 ? 254 PRO A CG  1 
ATOM   1857 C  CD  . PRO A 1 237 ? 11.339  8.077   32.945  1.00 133.71 ? 254 PRO A CD  1 
ATOM   1858 N  N   . PRO B 2 3   ? -39.682 -9.888  -8.724  1.00 129.45 ? 18  PRO B N   1 
ATOM   1859 C  CA  . PRO B 2 3   ? -39.075 -10.363 -9.976  1.00 131.53 ? 18  PRO B CA  1 
ATOM   1860 C  C   . PRO B 2 3   ? -37.677 -10.985 -9.757  1.00 131.84 ? 18  PRO B C   1 
ATOM   1861 O  O   . PRO B 2 3   ? -37.454 -12.193 -10.000 1.00 127.35 ? 18  PRO B O   1 
ATOM   1862 C  CB  . PRO B 2 3   ? -39.012 -9.084  -10.841 1.00 130.86 ? 18  PRO B CB  1 
ATOM   1863 C  CG  . PRO B 2 3   ? -39.203 -7.925  -9.893  1.00 129.98 ? 18  PRO B CG  1 
ATOM   1864 C  CD  . PRO B 2 3   ? -39.450 -8.451  -8.508  1.00 128.91 ? 18  PRO B CD  1 
ATOM   1865 N  N   . TRP B 2 4   ? -36.759 -10.132 -9.309  1.00 131.05 ? 19  TRP B N   1 
ATOM   1866 C  CA  . TRP B 2 4   ? -35.460 -10.520 -8.811  1.00 124.95 ? 19  TRP B CA  1 
ATOM   1867 C  C   . TRP B 2 4   ? -35.551 -10.323 -7.304  1.00 125.24 ? 19  TRP B C   1 
ATOM   1868 O  O   . TRP B 2 4   ? -35.910 -9.231  -6.851  1.00 134.07 ? 19  TRP B O   1 
ATOM   1869 C  CB  . TRP B 2 4   ? -34.381 -9.594  -9.367  1.00 120.79 ? 19  TRP B CB  1 
ATOM   1870 C  CG  . TRP B 2 4   ? -34.509 -9.276  -10.805 1.00 118.46 ? 19  TRP B CG  1 
ATOM   1871 C  CD1 . TRP B 2 4   ? -34.993 -8.134  -11.346 1.00 121.08 ? 19  TRP B CD1 1 
ATOM   1872 C  CD2 . TRP B 2 4   ? -34.126 -10.107 -11.894 1.00 117.08 ? 19  TRP B CD2 1 
ATOM   1873 N  NE1 . TRP B 2 4   ? -34.943 -8.200  -12.714 1.00 121.36 ? 19  TRP B NE1 1 
ATOM   1874 C  CE2 . TRP B 2 4   ? -34.399 -9.396  -13.079 1.00 117.85 ? 19  TRP B CE2 1 
ATOM   1875 C  CE3 . TRP B 2 4   ? -33.556 -11.380 -11.986 1.00 114.73 ? 19  TRP B CE3 1 
ATOM   1876 C  CZ2 . TRP B 2 4   ? -34.133 -9.917  -14.348 1.00 117.40 ? 19  TRP B CZ2 1 
ATOM   1877 C  CZ3 . TRP B 2 4   ? -33.294 -11.903 -13.236 1.00 114.32 ? 19  TRP B CZ3 1 
ATOM   1878 C  CH2 . TRP B 2 4   ? -33.579 -11.167 -14.410 1.00 115.77 ? 19  TRP B CH2 1 
ATOM   1879 N  N   . GLY B 2 5   ? -35.219 -11.343 -6.521  1.00 116.09 ? 20  GLY B N   1 
ATOM   1880 C  CA  . GLY B 2 5   ? -35.360 -11.253 -5.076  1.00 112.48 ? 20  GLY B CA  1 
ATOM   1881 C  C   . GLY B 2 5   ? -34.214 -10.546 -4.369  1.00 112.45 ? 20  GLY B C   1 
ATOM   1882 O  O   . GLY B 2 5   ? -33.553 -11.159 -3.540  1.00 111.98 ? 20  GLY B O   1 
ATOM   1883 N  N   . ASP B 2 6   ? -33.978 -9.264  -4.646  1.00 112.71 ? 21  ASP B N   1 
ATOM   1884 C  CA  . ASP B 2 6   ? -32.853 -8.532  -4.004  1.00 110.63 ? 21  ASP B CA  1 
ATOM   1885 C  C   . ASP B 2 6   ? -33.042 -8.387  -2.485  1.00 110.58 ? 21  ASP B C   1 
ATOM   1886 O  O   . ASP B 2 6   ? -32.088 -8.294  -1.712  1.00 105.20 ? 21  ASP B O   1 
ATOM   1887 C  CB  . ASP B 2 6   ? -32.646 -7.171  -4.661  1.00 111.31 ? 21  ASP B CB  1 
ATOM   1888 C  CG  . ASP B 2 6   ? -32.306 -7.290  -6.133  1.00 112.34 ? 21  ASP B CG  1 
ATOM   1889 O  OD1 . ASP B 2 6   ? -32.841 -8.217  -6.786  1.00 116.88 ? 21  ASP B OD1 1 
ATOM   1890 O  OD2 . ASP B 2 6   ? -31.512 -6.463  -6.632  1.00 108.47 ? 21  ASP B OD2 1 
ATOM   1891 N  N   . GLU B 2 7   ? -34.305 -8.400  -2.079  1.00 115.31 ? 22  GLU B N   1 
ATOM   1892 C  CA  . GLU B 2 7   ? -34.741 -8.611  -0.687  1.00 114.95 ? 22  GLU B CA  1 
ATOM   1893 C  C   . GLU B 2 7   ? -33.992 -9.811  -0.078  1.00 110.75 ? 22  GLU B C   1 
ATOM   1894 O  O   . GLU B 2 7   ? -33.656 -9.815  1.099   1.00 106.31 ? 22  GLU B O   1 
ATOM   1895 C  CB  . GLU B 2 7   ? -36.262 -8.922  -0.652  1.00 116.31 ? 22  GLU B CB  1 
ATOM   1896 C  CG  . GLU B 2 7   ? -37.209 -7.835  -1.204  1.00 123.07 ? 22  GLU B CG  1 
ATOM   1897 C  CD  . GLU B 2 7   ? -38.392 -8.356  -2.044  1.00 127.86 ? 22  GLU B CD  1 
ATOM   1898 O  OE1 . GLU B 2 7   ? -38.203 -9.283  -2.865  1.00 127.20 ? 22  GLU B OE1 1 
ATOM   1899 O  OE2 . GLU B 2 7   ? -39.520 -7.806  -1.908  1.00 132.05 ? 22  GLU B OE2 1 
ATOM   1900 N  N   . LEU B 2 8   ? -33.774 -10.830 -0.906  1.00 107.01 ? 23  LEU B N   1 
ATOM   1901 C  CA  . LEU B 2 8   ? -33.162 -12.071 -0.500  1.00 106.93 ? 23  LEU B CA  1 
ATOM   1902 C  C   . LEU B 2 8   ? -31.653 -12.181 -0.753  1.00 108.10 ? 23  LEU B C   1 
ATOM   1903 O  O   . LEU B 2 8   ? -31.106 -13.280 -0.627  1.00 107.45 ? 23  LEU B O   1 
ATOM   1904 C  CB  . LEU B 2 8   ? -33.878 -13.257 -1.196  1.00 106.10 ? 23  LEU B CB  1 
ATOM   1905 C  CG  . LEU B 2 8   ? -35.222 -13.682 -0.605  1.00 105.08 ? 23  LEU B CG  1 
ATOM   1906 C  CD1 . LEU B 2 8   ? -35.802 -14.893 -1.339  1.00 104.36 ? 23  LEU B CD1 1 
ATOM   1907 C  CD2 . LEU B 2 8   ? -35.048 -13.960 0.882   1.00 103.23 ? 23  LEU B CD2 1 
ATOM   1908 N  N   . LEU B 2 9   ? -30.963 -11.089 -1.092  1.00 107.00 ? 24  LEU B N   1 
ATOM   1909 C  CA  . LEU B 2 9   ? -29.520 -11.171 -1.389  1.00 106.45 ? 24  LEU B CA  1 
ATOM   1910 C  C   . LEU B 2 9   ? -28.683 -10.412 -0.400  1.00 105.27 ? 24  LEU B C   1 
ATOM   1911 O  O   . LEU B 2 9   ? -29.074 -9.369  0.067   1.00 106.72 ? 24  LEU B O   1 
ATOM   1912 C  CB  . LEU B 2 9   ? -29.184 -10.587 -2.763  1.00 108.15 ? 24  LEU B CB  1 
ATOM   1913 C  CG  . LEU B 2 9   ? -29.697 -11.203 -4.073  1.00 111.71 ? 24  LEU B CG  1 
ATOM   1914 C  CD1 . LEU B 2 9   ? -28.872 -10.608 -5.209  1.00 112.47 ? 24  LEU B CD1 1 
ATOM   1915 C  CD2 . LEU B 2 9   ? -29.653 -12.725 -4.130  1.00 109.44 ? 24  LEU B CD2 1 
ATOM   1916 N  N   . ASN B 2 10  ? -27.479 -10.900 -0.162  1.00 107.29 ? 25  ASN B N   1 
ATOM   1917 C  CA  . ASN B 2 10  ? -26.479 -10.110 0.536   1.00 108.58 ? 25  ASN B CA  1 
ATOM   1918 C  C   . ASN B 2 10  ? -26.904 -9.654  1.942   1.00 109.57 ? 25  ASN B C   1 
ATOM   1919 O  O   . ASN B 2 10  ? -26.686 -8.521  2.338   1.00 111.69 ? 25  ASN B O   1 
ATOM   1920 C  CB  . ASN B 2 10  ? -26.088 -8.912  -0.319  1.00 107.31 ? 25  ASN B CB  1 
ATOM   1921 C  CG  . ASN B 2 10  ? -24.738 -8.377  0.063   1.00 108.09 ? 25  ASN B CG  1 
ATOM   1922 O  OD1 . ASN B 2 10  ? -23.728 -8.837  -0.449  1.00 110.13 ? 25  ASN B OD1 1 
ATOM   1923 N  ND2 . ASN B 2 10  ? -24.701 -7.461  1.019   1.00 107.53 ? 25  ASN B ND2 1 
ATOM   1924 N  N   . ILE B 2 11  ? -27.496 -10.577 2.687   1.00 109.50 ? 26  ILE B N   1 
ATOM   1925 C  CA  . ILE B 2 11  ? -28.063 -10.324 4.013   1.00 109.47 ? 26  ILE B CA  1 
ATOM   1926 C  C   . ILE B 2 11  ? -27.566 -11.400 4.979   1.00 109.87 ? 26  ILE B C   1 
ATOM   1927 O  O   . ILE B 2 11  ? -27.108 -12.449 4.529   1.00 116.16 ? 26  ILE B O   1 
ATOM   1928 C  CB  . ILE B 2 11  ? -29.595 -10.376 3.931   1.00 109.09 ? 26  ILE B CB  1 
ATOM   1929 C  CG1 . ILE B 2 11  ? -30.096 -11.802 3.594   1.00 108.62 ? 26  ILE B CG1 1 
ATOM   1930 C  CG2 . ILE B 2 11  ? -30.079 -9.391  2.881   1.00 112.10 ? 26  ILE B CG2 1 
ATOM   1931 C  CD1 . ILE B 2 11  ? -31.592 -11.945 3.395   1.00 107.71 ? 26  ILE B CD1 1 
ATOM   1932 N  N   . CYS B 2 12  ? -27.677 -11.169 6.287   1.00 107.33 ? 27  CYS B N   1 
ATOM   1933 C  CA  . CYS B 2 12  ? -27.306 -12.173 7.297   1.00 104.24 ? 27  CYS B CA  1 
ATOM   1934 C  C   . CYS B 2 12  ? -28.538 -12.593 8.092   1.00 104.11 ? 27  CYS B C   1 
ATOM   1935 O  O   . CYS B 2 12  ? -29.371 -11.758 8.383   1.00 111.75 ? 27  CYS B O   1 
ATOM   1936 C  CB  . CYS B 2 12  ? -26.248 -11.586 8.226   1.00 105.58 ? 27  CYS B CB  1 
ATOM   1937 S  SG  . CYS B 2 12  ? -24.759 -10.984 7.377   1.00 104.79 ? 27  CYS B SG  1 
ATOM   1938 N  N   . MET B 2 13  ? -28.669 -13.875 8.435   1.00 103.63 ? 28  MET B N   1 
ATOM   1939 C  CA  . MET B 2 13  ? -29.828 -14.354 9.222   1.00 106.66 ? 28  MET B CA  1 
ATOM   1940 C  C   . MET B 2 13  ? -29.782 -13.754 10.627  1.00 108.42 ? 28  MET B C   1 
ATOM   1941 O  O   . MET B 2 13  ? -28.695 -13.448 11.114  1.00 106.69 ? 28  MET B O   1 
ATOM   1942 C  CB  . MET B 2 13  ? -29.869 -15.905 9.284   1.00 106.58 ? 28  MET B CB  1 
ATOM   1943 C  CG  . MET B 2 13  ? -28.883 -16.557 10.278  1.00 106.79 ? 28  MET B CG  1 
ATOM   1944 S  SD  . MET B 2 13  ? -28.688 -18.366 10.276  1.00 102.28 ? 28  MET B SD  1 
ATOM   1945 C  CE  . MET B 2 13  ? -27.887 -18.642 8.696   1.00 99.58  ? 28  MET B CE  1 
ATOM   1946 N  N   . ASN B 2 14  ? -30.949 -13.578 11.257  1.00 114.77 ? 29  ASN B N   1 
ATOM   1947 C  CA  . ASN B 2 14  ? -31.032 -13.150 12.666  1.00 121.98 ? 29  ASN B CA  1 
ATOM   1948 C  C   . ASN B 2 14  ? -30.988 -14.326 13.612  1.00 122.49 ? 29  ASN B C   1 
ATOM   1949 O  O   . ASN B 2 14  ? -32.015 -14.763 14.102  1.00 126.90 ? 29  ASN B O   1 
ATOM   1950 C  CB  . ASN B 2 14  ? -32.320 -12.371 12.950  1.00 129.27 ? 29  ASN B CB  1 
ATOM   1951 C  CG  . ASN B 2 14  ? -32.351 -11.019 12.277  1.00 135.13 ? 29  ASN B CG  1 
ATOM   1952 O  OD1 . ASN B 2 14  ? -31.505 -10.691 11.445  1.00 140.06 ? 29  ASN B OD1 1 
ATOM   1953 N  ND2 . ASN B 2 14  ? -33.327 -10.203 12.660  1.00 137.87 ? 29  ASN B ND2 1 
ATOM   1954 N  N   . ALA B 2 15  ? -29.803 -14.858 13.844  1.00 120.22 ? 30  ALA B N   1 
ATOM   1955 C  CA  . ALA B 2 15  ? -29.586 -15.781 14.932  1.00 120.99 ? 30  ALA B CA  1 
ATOM   1956 C  C   . ALA B 2 15  ? -28.573 -15.104 15.813  1.00 127.75 ? 30  ALA B C   1 
ATOM   1957 O  O   . ALA B 2 15  ? -28.049 -14.043 15.476  1.00 128.40 ? 30  ALA B O   1 
ATOM   1958 C  CB  . ALA B 2 15  ? -29.089 -17.111 14.424  1.00 120.14 ? 30  ALA B CB  1 
ATOM   1959 N  N   . LYS B 2 16  ? -28.311 -15.702 16.958  1.00 135.51 ? 31  LYS B N   1 
ATOM   1960 C  CA  . LYS B 2 16  ? -27.664 -14.963 18.031  1.00 145.44 ? 31  LYS B CA  1 
ATOM   1961 C  C   . LYS B 2 16  ? -26.259 -14.433 17.731  1.00 141.25 ? 31  LYS B C   1 
ATOM   1962 O  O   . LYS B 2 16  ? -25.889 -13.403 18.287  1.00 145.65 ? 31  LYS B O   1 
ATOM   1963 C  CB  . LYS B 2 16  ? -27.677 -15.760 19.345  1.00 156.61 ? 31  LYS B CB  1 
ATOM   1964 C  CG  . LYS B 2 16  ? -26.968 -17.105 19.296  1.00 160.05 ? 31  LYS B CG  1 
ATOM   1965 C  CD  . LYS B 2 16  ? -27.067 -17.843 20.625  1.00 164.58 ? 31  LYS B CD  1 
ATOM   1966 C  CE  . LYS B 2 16  ? -27.584 -19.260 20.428  1.00 164.49 ? 31  LYS B CE  1 
ATOM   1967 N  NZ  . LYS B 2 16  ? -28.083 -19.824 21.709  1.00 168.41 ? 31  LYS B NZ  1 
ATOM   1968 N  N   . HIS B 2 17  ? -25.496 -15.090 16.856  1.00 135.74 ? 32  HIS B N   1 
ATOM   1969 C  CA  . HIS B 2 17  ? -24.092 -14.695 16.638  1.00 133.83 ? 32  HIS B CA  1 
ATOM   1970 C  C   . HIS B 2 17  ? -23.851 -13.883 15.405  1.00 124.27 ? 32  HIS B C   1 
ATOM   1971 O  O   . HIS B 2 17  ? -22.785 -13.315 15.232  1.00 127.14 ? 32  HIS B O   1 
ATOM   1972 C  CB  . HIS B 2 17  ? -23.208 -15.904 16.483  1.00 136.50 ? 32  HIS B CB  1 
ATOM   1973 C  CG  . HIS B 2 17  ? -23.428 -16.944 17.517  1.00 144.90 ? 32  HIS B CG  1 
ATOM   1974 N  ND1 . HIS B 2 17  ? -23.257 -16.703 18.863  1.00 150.68 ? 32  HIS B ND1 1 
ATOM   1975 C  CD2 . HIS B 2 17  ? -23.794 -18.240 17.402  1.00 148.37 ? 32  HIS B CD2 1 
ATOM   1976 C  CE1 . HIS B 2 17  ? -23.512 -17.810 19.537  1.00 154.53 ? 32  HIS B CE1 1 
ATOM   1977 N  NE2 . HIS B 2 17  ? -23.841 -18.757 18.674  1.00 153.75 ? 32  HIS B NE2 1 
ATOM   1978 N  N   . HIS B 2 18  ? -24.813 -13.860 14.517  1.00 115.70 ? 33  HIS B N   1 
ATOM   1979 C  CA  . HIS B 2 18  ? -24.555 -13.280 13.235  1.00 111.49 ? 33  HIS B CA  1 
ATOM   1980 C  C   . HIS B 2 18  ? -24.377 -11.779 13.328  1.00 108.93 ? 33  HIS B C   1 
ATOM   1981 O  O   . HIS B 2 18  ? -24.972 -11.117 14.176  1.00 116.75 ? 33  HIS B O   1 
ATOM   1982 C  CB  . HIS B 2 18  ? -25.672 -13.667 12.288  1.00 112.24 ? 33  HIS B CB  1 
ATOM   1983 C  CG  . HIS B 2 18  ? -25.596 -15.098 11.886  1.00 110.37 ? 33  HIS B CG  1 
ATOM   1984 N  ND1 . HIS B 2 18  ? -25.942 -16.134 12.729  1.00 110.50 ? 33  HIS B ND1 1 
ATOM   1985 C  CD2 . HIS B 2 18  ? -25.113 -15.668 10.761  1.00 109.64 ? 33  HIS B CD2 1 
ATOM   1986 C  CE1 . HIS B 2 18  ? -25.722 -17.283 12.117  1.00 109.71 ? 33  HIS B CE1 1 
ATOM   1987 N  NE2 . HIS B 2 18  ? -25.207 -17.028 10.926  1.00 111.32 ? 33  HIS B NE2 1 
ATOM   1988 N  N   . LYS B 2 19  ? -23.512 -11.253 12.477  1.00 102.57 ? 34  LYS B N   1 
ATOM   1989 C  CA  . LYS B 2 19  ? -23.499 -9.830  12.219  1.00 103.33 ? 34  LYS B CA  1 
ATOM   1990 C  C   . LYS B 2 19  ? -24.868 -9.398  11.677  1.00 105.99 ? 34  LYS B C   1 
ATOM   1991 O  O   . LYS B 2 19  ? -25.553 -10.163 10.991  1.00 101.04 ? 34  LYS B O   1 
ATOM   1992 C  CB  . LYS B 2 19  ? -22.391 -9.474  11.226  1.00 101.79 ? 34  LYS B CB  1 
ATOM   1993 C  CG  . LYS B 2 19  ? -20.990 -9.612  11.812  1.00 101.16 ? 34  LYS B CG  1 
ATOM   1994 C  CD  . LYS B 2 19  ? -19.979 -8.656  11.183  1.00 102.69 ? 34  LYS B CD  1 
ATOM   1995 C  CE  . LYS B 2 19  ? -19.577 -9.097  9.793   1.00 102.43 ? 34  LYS B CE  1 
ATOM   1996 N  NZ  . LYS B 2 19  ? -18.828 -8.089  8.991   1.00 104.68 ? 34  LYS B NZ  1 
ATOM   1997 N  N   . ARG B 2 20  ? -25.287 -8.184  12.000  1.00 111.06 ? 35  ARG B N   1 
ATOM   1998 C  CA  . ARG B 2 20  ? -26.605 -7.743  11.548  1.00 112.77 ? 35  ARG B CA  1 
ATOM   1999 C  C   . ARG B 2 20  ? -26.613 -7.630  10.035  1.00 111.61 ? 35  ARG B C   1 
ATOM   2000 O  O   . ARG B 2 20  ? -27.549 -8.067  9.381   1.00 108.55 ? 35  ARG B O   1 
ATOM   2001 C  CB  . ARG B 2 20  ? -26.997 -6.438  12.204  1.00 117.04 ? 35  ARG B CB  1 
ATOM   2002 C  CG  . ARG B 2 20  ? -27.218 -6.580  13.702  1.00 118.76 ? 35  ARG B CG  1 
ATOM   2003 C  CD  . ARG B 2 20  ? -27.272 -5.212  14.356  1.00 122.53 ? 35  ARG B CD  1 
ATOM   2004 N  NE  . ARG B 2 20  ? -26.792 -5.225  15.735  1.00 126.79 ? 35  ARG B NE  1 
ATOM   2005 C  CZ  . ARG B 2 20  ? -25.560 -4.894  16.150  1.00 131.64 ? 35  ARG B CZ  1 
ATOM   2006 N  NH1 . ARG B 2 20  ? -25.282 -4.933  17.455  1.00 133.21 ? 35  ARG B NH1 1 
ATOM   2007 N  NH2 . ARG B 2 20  ? -24.594 -4.524  15.301  1.00 133.59 ? 35  ARG B NH2 1 
ATOM   2008 N  N   . VAL B 2 21  ? -25.532 -7.098  9.482   1.00 114.77 ? 36  VAL B N   1 
ATOM   2009 C  CA  . VAL B 2 21  ? -25.379 -6.987  8.030   1.00 116.60 ? 36  VAL B CA  1 
ATOM   2010 C  C   . VAL B 2 21  ? -23.959 -7.433  7.608   1.00 113.76 ? 36  VAL B C   1 
ATOM   2011 O  O   . VAL B 2 21  ? -23.019 -7.322  8.395   1.00 113.88 ? 36  VAL B O   1 
ATOM   2012 C  CB  . VAL B 2 21  ? -25.780 -5.546  7.580   1.00 119.71 ? 36  VAL B CB  1 
ATOM   2013 C  CG1 . VAL B 2 21  ? -24.762 -4.893  6.635   1.00 121.54 ? 36  VAL B CG1 1 
ATOM   2014 C  CG2 . VAL B 2 21  ? -27.188 -5.551  6.988   1.00 117.39 ? 36  VAL B CG2 1 
ATOM   2015 N  N   . PRO B 2 22  ? -23.801 -7.963  6.380   1.00 113.87 ? 37  PRO B N   1 
ATOM   2016 C  CA  . PRO B 2 22  ? -22.447 -8.387  5.994   1.00 115.89 ? 37  PRO B CA  1 
ATOM   2017 C  C   . PRO B 2 22  ? -21.512 -7.194  5.707   1.00 114.59 ? 37  PRO B C   1 
ATOM   2018 O  O   . PRO B 2 22  ? -22.005 -6.117  5.365   1.00 114.43 ? 37  PRO B O   1 
ATOM   2019 C  CB  . PRO B 2 22  ? -22.677 -9.242  4.727   1.00 114.48 ? 37  PRO B CB  1 
ATOM   2020 C  CG  . PRO B 2 22  ? -24.050 -8.937  4.245   1.00 114.25 ? 37  PRO B CG  1 
ATOM   2021 C  CD  . PRO B 2 22  ? -24.786 -8.166  5.299   1.00 115.68 ? 37  PRO B CD  1 
ATOM   2022 N  N   . SER B 2 23  ? -20.198 -7.393  5.870   1.00 110.33 ? 38  SER B N   1 
ATOM   2023 C  CA  . SER B 2 23  ? -19.157 -6.419  5.447   1.00 111.73 ? 38  SER B CA  1 
ATOM   2024 C  C   . SER B 2 23  ? -17.742 -7.025  5.535   1.00 111.21 ? 38  SER B C   1 
ATOM   2025 O  O   . SER B 2 23  ? -17.553 -8.031  6.232   1.00 110.78 ? 38  SER B O   1 
ATOM   2026 C  CB  . SER B 2 23  ? -19.200 -5.168  6.320   1.00 113.05 ? 38  SER B CB  1 
ATOM   2027 O  OG  . SER B 2 23  ? -18.950 -5.495  7.672   1.00 112.62 ? 38  SER B OG  1 
ATOM   2028 N  N   . PRO B 2 24  ? -16.738 -6.409  4.868   1.00 110.88 ? 39  PRO B N   1 
ATOM   2029 C  CA  . PRO B 2 24  ? -15.408 -7.056  4.865   1.00 111.66 ? 39  PRO B CA  1 
ATOM   2030 C  C   . PRO B 2 24  ? -14.760 -7.100  6.249   1.00 112.77 ? 39  PRO B C   1 
ATOM   2031 O  O   . PRO B 2 24  ? -15.145 -6.324  7.113   1.00 113.01 ? 39  PRO B O   1 
ATOM   2032 C  CB  . PRO B 2 24  ? -14.579 -6.199  3.894   1.00 111.11 ? 39  PRO B CB  1 
ATOM   2033 C  CG  . PRO B 2 24  ? -15.565 -5.346  3.165   1.00 112.90 ? 39  PRO B CG  1 
ATOM   2034 C  CD  . PRO B 2 24  ? -16.740 -5.169  4.077   1.00 111.36 ? 39  PRO B CD  1 
ATOM   2035 N  N   . GLU B 2 25  ? -13.823 -8.029  6.448   1.00 114.03 ? 40  GLU B N   1 
ATOM   2036 C  CA  . GLU B 2 25  ? -13.086 -8.192  7.711   1.00 114.95 ? 40  GLU B CA  1 
ATOM   2037 C  C   . GLU B 2 25  ? -11.575 -8.166  7.434   1.00 115.63 ? 40  GLU B C   1 
ATOM   2038 O  O   . GLU B 2 25  ? -11.112 -8.843  6.511   1.00 113.08 ? 40  GLU B O   1 
ATOM   2039 C  CB  . GLU B 2 25  ? -13.474 -9.526  8.366   1.00 114.71 ? 40  GLU B CB  1 
ATOM   2040 C  CG  . GLU B 2 25  ? -14.899 -9.590  8.903   1.00 114.99 ? 40  GLU B CG  1 
ATOM   2041 C  CD  . GLU B 2 25  ? -15.103 -8.774  10.171  1.00 121.48 ? 40  GLU B CD  1 
ATOM   2042 O  OE1 . GLU B 2 25  ? -16.277 -8.422  10.440  1.00 121.93 ? 40  GLU B OE1 1 
ATOM   2043 O  OE2 . GLU B 2 25  ? -14.109 -8.484  10.896  1.00 121.77 ? 40  GLU B OE2 1 
ATOM   2044 N  N   . ASP B 2 26  ? -10.811 -7.394  8.215   1.00 118.87 ? 41  ASP B N   1 
ATOM   2045 C  CA  . ASP B 2 26  ? -9.341  -7.396  8.101   1.00 124.82 ? 41  ASP B CA  1 
ATOM   2046 C  C   . ASP B 2 26  ? -8.774  -8.771  8.298   1.00 121.88 ? 41  ASP B C   1 
ATOM   2047 O  O   . ASP B 2 26  ? -7.823  -9.160  7.622   1.00 117.79 ? 41  ASP B O   1 
ATOM   2048 C  CB  . ASP B 2 26  ? -8.658  -6.480  9.131   1.00 132.21 ? 41  ASP B CB  1 
ATOM   2049 C  CG  . ASP B 2 26  ? -8.478  -5.066  8.628   1.00 138.51 ? 41  ASP B CG  1 
ATOM   2050 O  OD1 . ASP B 2 26  ? -9.149  -4.696  7.641   1.00 141.49 ? 41  ASP B OD1 1 
ATOM   2051 O  OD2 . ASP B 2 26  ? -7.670  -4.322  9.229   1.00 142.87 ? 41  ASP B OD2 1 
ATOM   2052 N  N   . LYS B 2 27  ? -9.334  -9.494  9.251   1.00 121.05 ? 42  LYS B N   1 
ATOM   2053 C  CA  . LYS B 2 27  ? -8.810  -10.802 9.561   1.00 123.89 ? 42  LYS B CA  1 
ATOM   2054 C  C   . LYS B 2 27  ? -9.905  -11.749 10.064  1.00 116.75 ? 42  LYS B C   1 
ATOM   2055 O  O   . LYS B 2 27  ? -10.726 -11.372 10.909  1.00 119.39 ? 42  LYS B O   1 
ATOM   2056 C  CB  . LYS B 2 27  ? -7.660  -10.671 10.580  1.00 132.39 ? 42  LYS B CB  1 
ATOM   2057 C  CG  . LYS B 2 27  ? -6.881  -11.974 10.793  1.00 137.36 ? 42  LYS B CG  1 
ATOM   2058 C  CD  . LYS B 2 27  ? -5.750  -11.852 11.813  1.00 139.09 ? 42  LYS B CD  1 
ATOM   2059 C  CE  . LYS B 2 27  ? -5.182  -13.220 12.187  1.00 136.79 ? 42  LYS B CE  1 
ATOM   2060 N  NZ  . LYS B 2 27  ? -4.424  -13.149 13.466  1.00 137.14 ? 42  LYS B NZ  1 
ATOM   2061 N  N   . LEU B 2 28  ? -9.910  -12.965 9.509   1.00 105.92 ? 43  LEU B N   1 
ATOM   2062 C  CA  . LEU B 2 28  ? -10.723 -14.081 9.991   1.00 96.63  ? 43  LEU B CA  1 
ATOM   2063 C  C   . LEU B 2 28  ? -9.828  -15.298 10.128  1.00 90.56  ? 43  LEU B C   1 
ATOM   2064 O  O   . LEU B 2 28  ? -8.900  -15.480 9.345   1.00 88.81  ? 43  LEU B O   1 
ATOM   2065 C  CB  . LEU B 2 28  ? -11.828 -14.425 8.993   1.00 93.52  ? 43  LEU B CB  1 
ATOM   2066 C  CG  . LEU B 2 28  ? -12.961 -13.452 8.713   1.00 93.48  ? 43  LEU B CG  1 
ATOM   2067 C  CD1 . LEU B 2 28  ? -13.912 -14.015 7.669   1.00 90.45  ? 43  LEU B CD1 1 
ATOM   2068 C  CD2 . LEU B 2 28  ? -13.704 -13.157 10.006  1.00 96.12  ? 43  LEU B CD2 1 
ATOM   2069 N  N   . TYR B 2 29  ? -10.159 -16.154 11.086  1.00 86.92  ? 44  TYR B N   1 
ATOM   2070 C  CA  . TYR B 2 29  ? -9.334  -17.305 11.440  1.00 85.57  ? 44  TYR B CA  1 
ATOM   2071 C  C   . TYR B 2 29  ? -9.465  -18.507 10.467  1.00 84.12  ? 44  TYR B C   1 
ATOM   2072 O  O   . TYR B 2 29  ? -10.571 -18.913 10.104  1.00 86.74  ? 44  TYR B O   1 
ATOM   2073 C  CB  . TYR B 2 29  ? -9.650  -17.710 12.885  1.00 84.88  ? 44  TYR B CB  1 
ATOM   2074 C  CG  . TYR B 2 29  ? -8.653  -18.681 13.475  1.00 81.76  ? 44  TYR B CG  1 
ATOM   2075 C  CD1 . TYR B 2 29  ? -7.332  -18.341 13.675  1.00 79.57  ? 44  TYR B CD1 1 
ATOM   2076 C  CD2 . TYR B 2 29  ? -9.046  -19.954 13.816  1.00 83.22  ? 44  TYR B CD2 1 
ATOM   2077 C  CE1 . TYR B 2 29  ? -6.438  -19.249 14.216  1.00 78.36  ? 44  TYR B CE1 1 
ATOM   2078 C  CE2 . TYR B 2 29  ? -8.161  -20.867 14.350  1.00 79.91  ? 44  TYR B CE2 1 
ATOM   2079 C  CZ  . TYR B 2 29  ? -6.867  -20.511 14.543  1.00 78.17  ? 44  TYR B CZ  1 
ATOM   2080 O  OH  . TYR B 2 29  ? -6.062  -21.470 15.068  1.00 78.48  ? 44  TYR B OH  1 
ATOM   2081 N  N   . GLU B 2 30  ? -8.315  -19.012 10.013  1.00 82.45  ? 45  GLU B N   1 
ATOM   2082 C  CA  . GLU B 2 30  ? -8.210  -20.272 9.251   1.00 79.75  ? 45  GLU B CA  1 
ATOM   2083 C  C   . GLU B 2 30  ? -9.318  -20.519 8.218   1.00 77.30  ? 45  GLU B C   1 
ATOM   2084 O  O   . GLU B 2 30  ? -9.397  -19.857 7.201   1.00 76.18  ? 45  GLU B O   1 
ATOM   2085 C  CB  . GLU B 2 30  ? -8.172  -21.474 10.211  1.00 77.81  ? 45  GLU B CB  1 
ATOM   2086 C  CG  . GLU B 2 30  ? -7.023  -21.584 11.150  1.00 78.97  ? 45  GLU B CG  1 
ATOM   2087 C  CD  . GLU B 2 30  ? -5.798  -22.207 10.577  1.00 74.83  ? 45  GLU B CD  1 
ATOM   2088 O  OE1 . GLU B 2 30  ? -5.742  -22.331 9.349   1.00 78.40  ? 45  GLU B OE1 1 
ATOM   2089 O  OE2 . GLU B 2 30  ? -4.896  -22.526 11.377  1.00 70.21  ? 45  GLU B OE2 1 
ATOM   2090 N  N   . GLU B 2 31  ? -10.177 -21.483 8.516   1.00 76.46  ? 46  GLU B N   1 
ATOM   2091 C  CA  . GLU B 2 31  ? -11.145 -21.990 7.610   1.00 74.75  ? 46  GLU B CA  1 
ATOM   2092 C  C   . GLU B 2 31  ? -12.154 -20.943 7.209   1.00 78.31  ? 46  GLU B C   1 
ATOM   2093 O  O   . GLU B 2 31  ? -12.683 -21.050 6.121   1.00 83.53  ? 46  GLU B O   1 
ATOM   2094 C  CB  . GLU B 2 31  ? -11.863 -23.180 8.219   1.00 73.19  ? 46  GLU B CB  1 
ATOM   2095 C  CG  . GLU B 2 31  ? -10.961 -24.350 8.590   1.00 73.47  ? 46  GLU B CG  1 
ATOM   2096 C  CD  . GLU B 2 31  ? -10.113 -24.888 7.450   1.00 73.60  ? 46  GLU B CD  1 
ATOM   2097 O  OE1 . GLU B 2 31  ? -10.506 -24.783 6.280   1.00 74.63  ? 46  GLU B OE1 1 
ATOM   2098 O  OE2 . GLU B 2 31  ? -9.043  -25.446 7.734   1.00 74.70  ? 46  GLU B OE2 1 
ATOM   2099 N  N   . CYS B 2 32  ? -12.406 -19.928 8.040   1.00 77.77  ? 47  CYS B N   1 
ATOM   2100 C  CA  . CYS B 2 32  ? -13.309 -18.851 7.652   1.00 77.49  ? 47  CYS B CA  1 
ATOM   2101 C  C   . CYS B 2 32  ? -12.704 -17.778 6.703   1.00 79.88  ? 47  CYS B C   1 
ATOM   2102 O  O   . CYS B 2 32  ? -13.411 -16.856 6.271   1.00 84.99  ? 47  CYS B O   1 
ATOM   2103 C  CB  . CYS B 2 32  ? -13.898 -18.204 8.894   1.00 77.88  ? 47  CYS B CB  1 
ATOM   2104 S  SG  . CYS B 2 32  ? -14.884 -19.254 10.014  1.00 80.46  ? 47  CYS B SG  1 
ATOM   2105 N  N   . ILE B 2 33  ? -11.436 -17.896 6.332   1.00 79.67  ? 48  ILE B N   1 
ATOM   2106 C  CA  . ILE B 2 33  ? -10.785 -16.877 5.490   1.00 82.40  ? 48  ILE B CA  1 
ATOM   2107 C  C   . ILE B 2 33  ? -11.454 -16.587 4.142   1.00 82.72  ? 48  ILE B C   1 
ATOM   2108 O  O   . ILE B 2 33  ? -11.494 -15.435 3.717   1.00 87.36  ? 48  ILE B O   1 
ATOM   2109 C  CB  . ILE B 2 33  ? -9.295  -17.207 5.301   1.00 85.06  ? 48  ILE B CB  1 
ATOM   2110 C  CG1 . ILE B 2 33  ? -8.556  -16.875 6.587   1.00 88.18  ? 48  ILE B CG1 1 
ATOM   2111 C  CG2 . ILE B 2 33  ? -8.655  -16.471 4.128   1.00 87.78  ? 48  ILE B CG2 1 
ATOM   2112 C  CD1 . ILE B 2 33  ? -7.188  -17.524 6.659   1.00 89.77  ? 48  ILE B CD1 1 
ATOM   2113 N  N   . PRO B 2 34  ? -11.993 -17.607 3.463   1.00 83.24  ? 49  PRO B N   1 
ATOM   2114 C  CA  . PRO B 2 34  ? -12.658 -17.341 2.169   1.00 84.84  ? 49  PRO B CA  1 
ATOM   2115 C  C   . PRO B 2 34  ? -13.766 -16.270 2.183   1.00 89.79  ? 49  PRO B C   1 
ATOM   2116 O  O   . PRO B 2 34  ? -14.028 -15.640 1.149   1.00 94.60  ? 49  PRO B O   1 
ATOM   2117 C  CB  . PRO B 2 34  ? -13.235 -18.700 1.800   1.00 82.73  ? 49  PRO B CB  1 
ATOM   2118 C  CG  . PRO B 2 34  ? -12.326 -19.675 2.474   1.00 82.42  ? 49  PRO B CG  1 
ATOM   2119 C  CD  . PRO B 2 34  ? -12.015 -19.039 3.792   1.00 81.69  ? 49  PRO B CD  1 
ATOM   2120 N  N   . TRP B 2 35  ? -14.375 -16.043 3.347   1.00 90.18  ? 50  TRP B N   1 
ATOM   2121 C  CA  . TRP B 2 35  ? -15.435 -15.057 3.474   1.00 90.84  ? 50  TRP B CA  1 
ATOM   2122 C  C   . TRP B 2 35  ? -14.975 -13.685 3.897   1.00 92.70  ? 50  TRP B C   1 
ATOM   2123 O  O   . TRP B 2 35  ? -15.814 -12.840 4.074   1.00 92.89  ? 50  TRP B O   1 
ATOM   2124 C  CB  . TRP B 2 35  ? -16.496 -15.566 4.454   1.00 88.19  ? 50  TRP B CB  1 
ATOM   2125 C  CG  . TRP B 2 35  ? -17.187 -16.737 3.909   1.00 86.58  ? 50  TRP B CG  1 
ATOM   2126 C  CD1 . TRP B 2 35  ? -18.279 -16.732 3.100   1.00 85.47  ? 50  TRP B CD1 1 
ATOM   2127 C  CD2 . TRP B 2 35  ? -16.813 -18.101 4.076   1.00 84.11  ? 50  TRP B CD2 1 
ATOM   2128 N  NE1 . TRP B 2 35  ? -18.623 -18.020 2.763   1.00 83.74  ? 50  TRP B NE1 1 
ATOM   2129 C  CE2 . TRP B 2 35  ? -17.740 -18.882 3.353   1.00 83.47  ? 50  TRP B CE2 1 
ATOM   2130 C  CE3 . TRP B 2 35  ? -15.787 -18.741 4.765   1.00 82.80  ? 50  TRP B CE3 1 
ATOM   2131 C  CZ2 . TRP B 2 35  ? -17.666 -20.272 3.302   1.00 83.59  ? 50  TRP B CZ2 1 
ATOM   2132 C  CZ3 . TRP B 2 35  ? -15.715 -20.103 4.729   1.00 82.56  ? 50  TRP B CZ3 1 
ATOM   2133 C  CH2 . TRP B 2 35  ? -16.644 -20.864 4.004   1.00 85.86  ? 50  TRP B CH2 1 
ATOM   2134 N  N   . LYS B 2 36  ? -13.679 -13.436 4.060   1.00 99.85  ? 51  LYS B N   1 
ATOM   2135 C  CA  . LYS B 2 36  ? -13.246 -12.150 4.651   1.00 107.84 ? 51  LYS B CA  1 
ATOM   2136 C  C   . LYS B 2 36  ? -13.566 -10.931 3.769   1.00 109.47 ? 51  LYS B C   1 
ATOM   2137 O  O   . LYS B 2 36  ? -13.737 -9.818  4.281   1.00 105.52 ? 51  LYS B O   1 
ATOM   2138 C  CB  . LYS B 2 36  ? -11.769 -12.176 5.069   1.00 109.30 ? 51  LYS B CB  1 
ATOM   2139 C  CG  . LYS B 2 36  ? -10.767 -12.142 3.937   1.00 112.02 ? 51  LYS B CG  1 
ATOM   2140 C  CD  . LYS B 2 36  ? -9.384  -12.567 4.421   1.00 119.75 ? 51  LYS B CD  1 
ATOM   2141 C  CE  . LYS B 2 36  ? -8.826  -11.726 5.567   1.00 123.95 ? 51  LYS B CE  1 
ATOM   2142 N  NZ  . LYS B 2 36  ? -8.743  -10.281 5.226   1.00 127.62 ? 51  LYS B NZ  1 
ATOM   2143 N  N   . ASP B 2 37  ? -13.658 -11.181 2.461   1.00 111.84 ? 52  ASP B N   1 
ATOM   2144 C  CA  . ASP B 2 37  ? -14.197 -10.238 1.465   1.00 117.26 ? 52  ASP B CA  1 
ATOM   2145 C  C   . ASP B 2 37  ? -15.484 -9.533  1.885   1.00 116.22 ? 52  ASP B C   1 
ATOM   2146 O  O   . ASP B 2 37  ? -15.647 -8.332  1.670   1.00 120.52 ? 52  ASP B O   1 
ATOM   2147 C  CB  . ASP B 2 37  ? -14.503 -10.984 0.163   1.00 119.85 ? 52  ASP B CB  1 
ATOM   2148 C  CG  . ASP B 2 37  ? -13.272 -11.578 -0.467  1.00 126.01 ? 52  ASP B CG  1 
ATOM   2149 O  OD1 . ASP B 2 37  ? -12.151 -11.184 -0.088  1.00 127.85 ? 52  ASP B OD1 1 
ATOM   2150 O  OD2 . ASP B 2 37  ? -13.427 -12.448 -1.339  1.00 132.00 ? 52  ASP B OD2 1 
ATOM   2151 N  N   . ASN B 2 38  ? -16.397 -10.304 2.460   1.00 111.55 ? 53  ASN B N   1 
ATOM   2152 C  CA  . ASN B 2 38  ? -17.716 -9.823  2.852   1.00 109.99 ? 53  ASN B CA  1 
ATOM   2153 C  C   . ASN B 2 38  ? -18.381 -10.891 3.742   1.00 103.97 ? 53  ASN B C   1 
ATOM   2154 O  O   . ASN B 2 38  ? -18.925 -11.875 3.241   1.00 101.94 ? 53  ASN B O   1 
ATOM   2155 C  CB  . ASN B 2 38  ? -18.553 -9.538  1.584   1.00 112.13 ? 53  ASN B CB  1 
ATOM   2156 C  CG  . ASN B 2 38  ? -19.956 -9.034  1.888   1.00 113.41 ? 53  ASN B CG  1 
ATOM   2157 O  OD1 . ASN B 2 38  ? -20.155 -8.253  2.828   1.00 117.78 ? 53  ASN B OD1 1 
ATOM   2158 N  ND2 . ASN B 2 38  ? -20.934 -9.463  1.077   1.00 109.01 ? 53  ASN B ND2 1 
ATOM   2159 N  N   . ALA B 2 39  ? -18.328 -10.702 5.055   1.00 102.73 ? 54  ALA B N   1 
ATOM   2160 C  CA  . ALA B 2 39  ? -18.701 -11.758 6.007   1.00 103.42 ? 54  ALA B CA  1 
ATOM   2161 C  C   . ALA B 2 39  ? -19.855 -11.406 6.952   1.00 103.34 ? 54  ALA B C   1 
ATOM   2162 O  O   . ALA B 2 39  ? -20.031 -10.239 7.292   1.00 104.79 ? 54  ALA B O   1 
ATOM   2163 C  CB  . ALA B 2 39  ? -17.483 -12.127 6.829   1.00 107.29 ? 54  ALA B CB  1 
ATOM   2164 N  N   . CYS B 2 40  ? -20.605 -12.440 7.366   1.00 101.36 ? 55  CYS B N   1 
ATOM   2165 C  CA  . CYS B 2 40  ? -21.636 -12.376 8.442   1.00 102.30 ? 55  CYS B CA  1 
ATOM   2166 C  C   . CYS B 2 40  ? -21.081 -12.812 9.812   1.00 99.72  ? 55  CYS B C   1 
ATOM   2167 O  O   . CYS B 2 40  ? -21.820 -12.902 10.809  1.00 101.10 ? 55  CYS B O   1 
ATOM   2168 C  CB  . CYS B 2 40  ? -22.862 -13.256 8.101   1.00 100.42 ? 55  CYS B CB  1 
ATOM   2169 S  SG  . CYS B 2 40  ? -23.874 -12.704 6.715   1.00 99.13  ? 55  CYS B SG  1 
ATOM   2170 N  N   . CYS B 2 41  ? -19.784 -13.090 9.842   1.00 96.16  ? 56  CYS B N   1 
ATOM   2171 C  CA  . CYS B 2 41  ? -19.087 -13.477 11.041  1.00 95.99  ? 56  CYS B CA  1 
ATOM   2172 C  C   . CYS B 2 41  ? -18.019 -12.437 11.394  1.00 99.73  ? 56  CYS B C   1 
ATOM   2173 O  O   . CYS B 2 41  ? -17.332 -11.912 10.507  1.00 102.04 ? 56  CYS B O   1 
ATOM   2174 C  CB  . CYS B 2 41  ? -18.431 -14.835 10.800  1.00 94.16  ? 56  CYS B CB  1 
ATOM   2175 S  SG  . CYS B 2 41  ? -17.352 -14.952 9.350   1.00 89.68  ? 56  CYS B SG  1 
ATOM   2176 N  N   . THR B 2 42  ? -17.887 -12.147 12.689  1.00 103.82 ? 57  THR B N   1 
ATOM   2177 C  CA  . THR B 2 42  ? -16.756 -11.375 13.227  1.00 105.72 ? 57  THR B CA  1 
ATOM   2178 C  C   . THR B 2 42  ? -15.536 -12.276 13.385  1.00 106.13 ? 57  THR B C   1 
ATOM   2179 O  O   . THR B 2 42  ? -15.637 -13.502 13.346  1.00 96.62  ? 57  THR B O   1 
ATOM   2180 C  CB  . THR B 2 42  ? -17.064 -10.824 14.630  1.00 108.07 ? 57  THR B CB  1 
ATOM   2181 O  OG1 . THR B 2 42  ? -17.452 -11.910 15.484  1.00 107.80 ? 57  THR B OG1 1 
ATOM   2182 C  CG2 . THR B 2 42  ? -18.179 -9.811  14.585  1.00 111.09 ? 57  THR B CG2 1 
ATOM   2183 N  N   . LEU B 2 43  ? -14.383 -11.651 13.605  1.00 110.50 ? 58  LEU B N   1 
ATOM   2184 C  CA  . LEU B 2 43  ? -13.153 -12.374 13.913  1.00 105.09 ? 58  LEU B CA  1 
ATOM   2185 C  C   . LEU B 2 43  ? -13.387 -13.343 15.042  1.00 100.97 ? 58  LEU B C   1 
ATOM   2186 O  O   . LEU B 2 43  ? -13.009 -14.504 14.955  1.00 103.18 ? 58  LEU B O   1 
ATOM   2187 C  CB  . LEU B 2 43  ? -12.064 -11.400 14.336  1.00 110.62 ? 58  LEU B CB  1 
ATOM   2188 C  CG  . LEU B 2 43  ? -10.798 -12.070 14.875  1.00 115.56 ? 58  LEU B CG  1 
ATOM   2189 C  CD1 . LEU B 2 43  ? -9.965  -12.602 13.714  1.00 115.71 ? 58  LEU B CD1 1 
ATOM   2190 C  CD2 . LEU B 2 43  ? -10.010 -11.125 15.778  1.00 119.61 ? 58  LEU B CD2 1 
ATOM   2191 N  N   . THR B 2 44  ? -13.983 -12.849 16.118  1.00 100.29 ? 59  THR B N   1 
ATOM   2192 C  CA  . THR B 2 44  ? -14.240 -13.673 17.295  1.00 99.64  ? 59  THR B CA  1 
ATOM   2193 C  C   . THR B 2 44  ? -15.010 -14.931 16.928  1.00 96.93  ? 59  THR B C   1 
ATOM   2194 O  O   . THR B 2 44  ? -14.657 -16.025 17.360  1.00 91.14  ? 59  THR B O   1 
ATOM   2195 C  CB  . THR B 2 44  ? -15.041 -12.902 18.360  1.00 98.68  ? 59  THR B CB  1 
ATOM   2196 O  OG1 . THR B 2 44  ? -14.423 -11.633 18.572  1.00 100.51 ? 59  THR B OG1 1 
ATOM   2197 C  CG2 . THR B 2 44  ? -15.129 -13.702 19.679  1.00 98.01  ? 59  THR B CG2 1 
ATOM   2198 N  N   . THR B 2 45  ? -16.056 -14.746 16.126  1.00 98.57  ? 60  THR B N   1 
ATOM   2199 C  CA  . THR B 2 45  ? -16.923 -15.840 15.705  1.00 98.50  ? 60  THR B CA  1 
ATOM   2200 C  C   . THR B 2 45  ? -16.123 -16.879 14.899  1.00 94.45  ? 60  THR B C   1 
ATOM   2201 O  O   . THR B 2 45  ? -16.242 -18.088 15.126  1.00 91.62  ? 60  THR B O   1 
ATOM   2202 C  CB  . THR B 2 45  ? -18.116 -15.301 14.886  1.00 100.77 ? 60  THR B CB  1 
ATOM   2203 O  OG1 . THR B 2 45  ? -18.971 -14.526 15.732  1.00 102.65 ? 60  THR B OG1 1 
ATOM   2204 C  CG2 . THR B 2 45  ? -18.928 -16.432 14.271  1.00 102.59 ? 60  THR B CG2 1 
ATOM   2205 N  N   . SER B 2 46  ? -15.289 -16.393 13.987  1.00 90.28  ? 61  SER B N   1 
ATOM   2206 C  CA  . SER B 2 46  ? -14.483 -17.267 13.171  1.00 86.72  ? 61  SER B CA  1 
ATOM   2207 C  C   . SER B 2 46  ? -13.523 -18.073 14.035  1.00 84.17  ? 61  SER B C   1 
ATOM   2208 O  O   . SER B 2 46  ? -13.347 -19.261 13.829  1.00 82.88  ? 61  SER B O   1 
ATOM   2209 C  CB  . SER B 2 46  ? -13.729 -16.465 12.118  1.00 88.19  ? 61  SER B CB  1 
ATOM   2210 O  OG  . SER B 2 46  ? -12.687 -15.712 12.688  1.00 93.37  ? 61  SER B OG  1 
ATOM   2211 N  N   . TRP B 2 47  ? -12.929 -17.437 15.026  1.00 85.16  ? 62  TRP B N   1 
ATOM   2212 C  CA  . TRP B 2 47  ? -12.092 -18.178 15.962  1.00 87.60  ? 62  TRP B CA  1 
ATOM   2213 C  C   . TRP B 2 47  ? -12.934 -19.218 16.756  1.00 88.08  ? 62  TRP B C   1 
ATOM   2214 O  O   . TRP B 2 47  ? -12.541 -20.395 16.913  1.00 83.40  ? 62  TRP B O   1 
ATOM   2215 C  CB  . TRP B 2 47  ? -11.316 -17.206 16.889  1.00 89.42  ? 62  TRP B CB  1 
ATOM   2216 C  CG  . TRP B 2 47  ? -10.954 -17.833 18.180  1.00 86.78  ? 62  TRP B CG  1 
ATOM   2217 C  CD1 . TRP B 2 47  ? -11.655 -17.762 19.333  1.00 86.90  ? 62  TRP B CD1 1 
ATOM   2218 C  CD2 . TRP B 2 47  ? -9.862  -18.707 18.426  1.00 84.50  ? 62  TRP B CD2 1 
ATOM   2219 N  NE1 . TRP B 2 47  ? -11.045 -18.511 20.303  1.00 86.62  ? 62  TRP B NE1 1 
ATOM   2220 C  CE2 . TRP B 2 47  ? -9.942  -19.106 19.763  1.00 84.99  ? 62  TRP B CE2 1 
ATOM   2221 C  CE3 . TRP B 2 47  ? -8.816  -19.193 17.643  1.00 82.74  ? 62  TRP B CE3 1 
ATOM   2222 C  CZ2 . TRP B 2 47  ? -9.026  -19.968 20.328  1.00 84.12  ? 62  TRP B CZ2 1 
ATOM   2223 C  CZ3 . TRP B 2 47  ? -7.903  -20.035 18.209  1.00 78.91  ? 62  TRP B CZ3 1 
ATOM   2224 C  CH2 . TRP B 2 47  ? -8.017  -20.424 19.526  1.00 82.03  ? 62  TRP B CH2 1 
ATOM   2225 N  N   . GLU B 2 48  ? -14.095 -18.783 17.241  1.00 92.65  ? 63  GLU B N   1 
ATOM   2226 C  CA  . GLU B 2 48  ? -14.912 -19.621 18.141  1.00 98.86  ? 63  GLU B CA  1 
ATOM   2227 C  C   . GLU B 2 48  ? -15.358 -20.911 17.457  1.00 97.32  ? 63  GLU B C   1 
ATOM   2228 O  O   . GLU B 2 48  ? -15.564 -21.946 18.119  1.00 96.72  ? 63  GLU B O   1 
ATOM   2229 C  CB  . GLU B 2 48  ? -16.116 -18.831 18.724  1.00 102.21 ? 63  GLU B CB  1 
ATOM   2230 C  CG  . GLU B 2 48  ? -15.703 -17.804 19.791  1.00 107.25 ? 63  GLU B CG  1 
ATOM   2231 C  CD  . GLU B 2 48  ? -16.855 -17.156 20.553  1.00 110.26 ? 63  GLU B CD  1 
ATOM   2232 O  OE1 . GLU B 2 48  ? -18.003 -17.132 20.067  1.00 108.94 ? 63  GLU B OE1 1 
ATOM   2233 O  OE2 . GLU B 2 48  ? -16.599 -16.656 21.667  1.00 117.86 ? 63  GLU B OE2 1 
ATOM   2234 N  N   . ALA B 2 49  ? -15.476 -20.831 16.130  1.00 93.54  ? 64  ALA B N   1 
ATOM   2235 C  CA  . ALA B 2 49  ? -15.903 -21.948 15.286  1.00 89.37  ? 64  ALA B CA  1 
ATOM   2236 C  C   . ALA B 2 49  ? -14.925 -23.114 15.308  1.00 84.76  ? 64  ALA B C   1 
ATOM   2237 O  O   . ALA B 2 49  ? -15.313 -24.286 15.184  1.00 81.72  ? 64  ALA B O   1 
ATOM   2238 C  CB  . ALA B 2 49  ? -16.089 -21.461 13.867  1.00 91.38  ? 64  ALA B CB  1 
ATOM   2239 N  N   . HIS B 2 50  ? -13.661 -22.796 15.526  1.00 81.70  ? 65  HIS B N   1 
ATOM   2240 C  CA  . HIS B 2 50  ? -12.645 -23.815 15.567  1.00 79.89  ? 65  HIS B CA  1 
ATOM   2241 C  C   . HIS B 2 50  ? -12.468 -24.466 16.928  1.00 84.71  ? 65  HIS B C   1 
ATOM   2242 O  O   . HIS B 2 50  ? -11.726 -25.431 17.029  1.00 89.59  ? 65  HIS B O   1 
ATOM   2243 C  CB  . HIS B 2 50  ? -11.334 -23.243 15.112  1.00 76.25  ? 65  HIS B CB  1 
ATOM   2244 C  CG  . HIS B 2 50  ? -11.381 -22.658 13.738  1.00 74.90  ? 65  HIS B CG  1 
ATOM   2245 N  ND1 . HIS B 2 50  ? -12.164 -21.570 13.412  1.00 74.31  ? 65  HIS B ND1 1 
ATOM   2246 C  CD2 . HIS B 2 50  ? -10.713 -22.996 12.607  1.00 71.79  ? 65  HIS B CD2 1 
ATOM   2247 C  CE1 . HIS B 2 50  ? -11.968 -21.261 12.144  1.00 74.49  ? 65  HIS B CE1 1 
ATOM   2248 N  NE2 . HIS B 2 50  ? -11.098 -22.115 11.634  1.00 70.96  ? 65  HIS B NE2 1 
ATOM   2249 N  N   . LEU B 2 51  ? -13.125 -23.956 17.966  1.00 91.09  ? 66  LEU B N   1 
ATOM   2250 C  CA  . LEU B 2 51  ? -12.966 -24.518 19.309  1.00 95.20  ? 66  LEU B CA  1 
ATOM   2251 C  C   . LEU B 2 51  ? -13.633 -25.851 19.449  1.00 99.69  ? 66  LEU B C   1 
ATOM   2252 O  O   . LEU B 2 51  ? -14.688 -26.079 18.885  1.00 102.45 ? 66  LEU B O   1 
ATOM   2253 C  CB  . LEU B 2 51  ? -13.558 -23.593 20.360  1.00 96.35  ? 66  LEU B CB  1 
ATOM   2254 C  CG  . LEU B 2 51  ? -12.814 -22.278 20.429  1.00 97.15  ? 66  LEU B CG  1 
ATOM   2255 C  CD1 . LEU B 2 51  ? -13.427 -21.446 21.542  1.00 101.73 ? 66  LEU B CD1 1 
ATOM   2256 C  CD2 . LEU B 2 51  ? -11.333 -22.521 20.660  1.00 96.66  ? 66  LEU B CD2 1 
ATOM   2257 N  N   . ASP B 2 52  ? -13.000 -26.717 20.223  1.00 111.15 ? 67  ASP B N   1 
ATOM   2258 C  CA  . ASP B 2 52  ? -13.590 -27.965 20.625  1.00 119.98 ? 67  ASP B CA  1 
ATOM   2259 C  C   . ASP B 2 52  ? -14.774 -27.574 21.484  1.00 126.37 ? 67  ASP B C   1 
ATOM   2260 O  O   . ASP B 2 52  ? -14.634 -26.738 22.361  1.00 131.41 ? 67  ASP B O   1 
ATOM   2261 C  CB  . ASP B 2 52  ? -12.533 -28.775 21.379  1.00 125.07 ? 67  ASP B CB  1 
ATOM   2262 C  CG  . ASP B 2 52  ? -11.542 -29.468 20.440  1.00 131.73 ? 67  ASP B CG  1 
ATOM   2263 O  OD1 . ASP B 2 52  ? -11.652 -29.403 19.166  1.00 143.44 ? 67  ASP B OD1 1 
ATOM   2264 O  OD2 . ASP B 2 52  ? -10.625 -30.087 21.013  1.00 130.98 ? 67  ASP B OD2 1 
ATOM   2265 N  N   . VAL B 2 53  ? -15.954 -28.107 21.180  1.00 131.59 ? 68  VAL B N   1 
ATOM   2266 C  CA  . VAL B 2 53  ? -17.165 -27.736 21.907  1.00 135.36 ? 68  VAL B CA  1 
ATOM   2267 C  C   . VAL B 2 53  ? -17.295 -26.227 21.860  1.00 130.03 ? 68  VAL B C   1 
ATOM   2268 O  O   . VAL B 2 53  ? -17.313 -25.529 22.884  1.00 129.03 ? 68  VAL B O   1 
ATOM   2269 C  CB  . VAL B 2 53  ? -17.092 -28.248 23.346  1.00 143.44 ? 68  VAL B CB  1 
ATOM   2270 C  CG1 . VAL B 2 53  ? -18.276 -27.783 24.170  1.00 148.14 ? 68  VAL B CG1 1 
ATOM   2271 C  CG2 . VAL B 2 53  ? -17.042 -29.762 23.325  1.00 144.38 ? 68  VAL B CG2 1 
ATOM   2272 N  N   . SER B 2 54  ? -17.333 -25.727 20.636  1.00 126.54 ? 69  SER B N   1 
ATOM   2273 C  CA  . SER B 2 54  ? -17.336 -24.298 20.427  1.00 124.95 ? 69  SER B CA  1 
ATOM   2274 C  C   . SER B 2 54  ? -18.523 -23.718 21.165  1.00 120.79 ? 69  SER B C   1 
ATOM   2275 O  O   . SER B 2 54  ? -19.634 -24.241 21.066  1.00 118.13 ? 69  SER B O   1 
ATOM   2276 C  CB  . SER B 2 54  ? -17.397 -23.907 18.940  1.00 121.97 ? 69  SER B CB  1 
ATOM   2277 O  OG  . SER B 2 54  ? -16.814 -22.637 18.728  1.00 120.84 ? 69  SER B OG  1 
ATOM   2278 N  N   . PRO B 2 55  ? -18.288 -22.622 21.889  1.00 119.43 ? 70  PRO B N   1 
ATOM   2279 C  CA  . PRO B 2 55  ? -19.297 -21.906 22.671  1.00 121.13 ? 70  PRO B CA  1 
ATOM   2280 C  C   . PRO B 2 55  ? -20.528 -21.518 21.845  1.00 121.36 ? 70  PRO B C   1 
ATOM   2281 O  O   . PRO B 2 55  ? -21.588 -21.266 22.420  1.00 123.53 ? 70  PRO B O   1 
ATOM   2282 C  CB  . PRO B 2 55  ? -18.552 -20.659 23.163  1.00 121.36 ? 70  PRO B CB  1 
ATOM   2283 C  CG  . PRO B 2 55  ? -17.392 -20.511 22.256  1.00 120.16 ? 70  PRO B CG  1 
ATOM   2284 C  CD  . PRO B 2 55  ? -17.039 -21.860 21.743  1.00 118.95 ? 70  PRO B CD  1 
ATOM   2285 N  N   . LEU B 2 56  ? -20.379 -21.486 20.517  1.00 121.98 ? 71  LEU B N   1 
ATOM   2286 C  CA  . LEU B 2 56  ? -21.461 -21.145 19.601  1.00 124.13 ? 71  LEU B CA  1 
ATOM   2287 C  C   . LEU B 2 56  ? -22.680 -22.062 19.734  1.00 129.12 ? 71  LEU B C   1 
ATOM   2288 O  O   . LEU B 2 56  ? -23.810 -21.583 19.678  1.00 139.14 ? 71  LEU B O   1 
ATOM   2289 C  CB  . LEU B 2 56  ? -20.970 -21.146 18.144  1.00 120.14 ? 71  LEU B CB  1 
ATOM   2290 C  CG  . LEU B 2 56  ? -19.801 -20.228 17.750  1.00 119.26 ? 71  LEU B CG  1 
ATOM   2291 C  CD1 . LEU B 2 56  ? -19.398 -20.438 16.302  1.00 116.74 ? 71  LEU B CD1 1 
ATOM   2292 C  CD2 . LEU B 2 56  ? -20.137 -18.769 17.978  1.00 120.83 ? 71  LEU B CD2 1 
ATOM   2293 N  N   . TYR B 2 57  ? -22.460 -23.368 19.891  1.00 132.12 ? 72  TYR B N   1 
ATOM   2294 C  CA  . TYR B 2 57  ? -23.572 -24.342 19.994  1.00 133.46 ? 72  TYR B CA  1 
ATOM   2295 C  C   . TYR B 2 57  ? -23.566 -25.255 21.227  1.00 134.35 ? 72  TYR B C   1 
ATOM   2296 O  O   . TYR B 2 57  ? -24.576 -25.884 21.514  1.00 133.85 ? 72  TYR B O   1 
ATOM   2297 C  CB  . TYR B 2 57  ? -23.611 -25.210 18.730  1.00 132.62 ? 72  TYR B CB  1 
ATOM   2298 C  CG  . TYR B 2 57  ? -23.391 -24.415 17.454  1.00 132.68 ? 72  TYR B CG  1 
ATOM   2299 C  CD1 . TYR B 2 57  ? -24.282 -23.403 17.070  1.00 134.15 ? 72  TYR B CD1 1 
ATOM   2300 C  CD2 . TYR B 2 57  ? -22.278 -24.649 16.646  1.00 132.38 ? 72  TYR B CD2 1 
ATOM   2301 C  CE1 . TYR B 2 57  ? -24.077 -22.657 15.910  1.00 133.72 ? 72  TYR B CE1 1 
ATOM   2302 C  CE2 . TYR B 2 57  ? -22.064 -23.913 15.483  1.00 132.74 ? 72  TYR B CE2 1 
ATOM   2303 C  CZ  . TYR B 2 57  ? -22.966 -22.919 15.118  1.00 134.32 ? 72  TYR B CZ  1 
ATOM   2304 O  OH  . TYR B 2 57  ? -22.748 -22.193 13.964  1.00 136.64 ? 72  TYR B OH  1 
ATOM   2305 N  N   . ASN B 2 58  ? -22.449 -25.315 21.951  1.00 138.08 ? 73  ASN B N   1 
ATOM   2306 C  CA  . ASN B 2 58  ? -22.182 -26.340 22.983  1.00 143.21 ? 73  ASN B CA  1 
ATOM   2307 C  C   . ASN B 2 58  ? -22.601 -27.765 22.630  1.00 139.10 ? 73  ASN B C   1 
ATOM   2308 O  O   . ASN B 2 58  ? -23.129 -28.523 23.459  1.00 144.29 ? 73  ASN B O   1 
ATOM   2309 C  CB  . ASN B 2 58  ? -22.743 -25.917 24.334  1.00 149.19 ? 73  ASN B CB  1 
ATOM   2310 C  CG  . ASN B 2 58  ? -22.093 -24.654 24.854  1.00 153.17 ? 73  ASN B CG  1 
ATOM   2311 O  OD1 . ASN B 2 58  ? -20.883 -24.418 24.672  1.00 150.37 ? 73  ASN B OD1 1 
ATOM   2312 N  ND2 . ASN B 2 58  ? -22.892 -23.838 25.508  1.00 158.70 ? 73  ASN B ND2 1 
ATOM   2313 N  N   . PHE B 2 59  ? -22.317 -28.115 21.384  1.00 129.26 ? 74  PHE B N   1 
ATOM   2314 C  CA  . PHE B 2 59  ? -22.480 -29.450 20.889  1.00 121.56 ? 74  PHE B CA  1 
ATOM   2315 C  C   . PHE B 2 59  ? -21.076 -30.033 20.721  1.00 115.59 ? 74  PHE B C   1 
ATOM   2316 O  O   . PHE B 2 59  ? -20.278 -29.496 19.967  1.00 112.01 ? 74  PHE B O   1 
ATOM   2317 C  CB  . PHE B 2 59  ? -23.207 -29.375 19.565  1.00 120.41 ? 74  PHE B CB  1 
ATOM   2318 C  CG  . PHE B 2 59  ? -23.460 -30.697 18.968  1.00 121.73 ? 74  PHE B CG  1 
ATOM   2319 C  CD1 . PHE B 2 59  ? -24.524 -31.478 19.407  1.00 127.14 ? 74  PHE B CD1 1 
ATOM   2320 C  CD2 . PHE B 2 59  ? -22.625 -31.182 17.991  1.00 119.90 ? 74  PHE B CD2 1 
ATOM   2321 C  CE1 . PHE B 2 59  ? -24.756 -32.730 18.866  1.00 128.94 ? 74  PHE B CE1 1 
ATOM   2322 C  CE2 . PHE B 2 59  ? -22.852 -32.426 17.436  1.00 124.86 ? 74  PHE B CE2 1 
ATOM   2323 C  CZ  . PHE B 2 59  ? -23.918 -33.206 17.875  1.00 127.83 ? 74  PHE B CZ  1 
ATOM   2324 N  N   . SER B 2 60  ? -20.759 -31.105 21.443  1.00 112.75 ? 75  SER B N   1 
ATOM   2325 C  CA  . SER B 2 60  ? -19.435 -31.737 21.345  1.00 107.76 ? 75  SER B CA  1 
ATOM   2326 C  C   . SER B 2 60  ? -19.311 -32.670 20.132  1.00 101.71 ? 75  SER B C   1 
ATOM   2327 O  O   . SER B 2 60  ? -20.118 -33.594 19.943  1.00 90.36  ? 75  SER B O   1 
ATOM   2328 C  CB  . SER B 2 60  ? -19.085 -32.537 22.606  1.00 110.28 ? 75  SER B CB  1 
ATOM   2329 O  OG  . SER B 2 60  ? -17.789 -33.108 22.482  1.00 109.03 ? 75  SER B OG  1 
ATOM   2330 N  N   . LEU B 2 61  ? -18.253 -32.430 19.352  1.00 100.14 ? 76  LEU B N   1 
ATOM   2331 C  CA  . LEU B 2 61  ? -17.845 -33.318 18.269  1.00 96.82  ? 76  LEU B CA  1 
ATOM   2332 C  C   . LEU B 2 61  ? -17.066 -34.536 18.783  1.00 98.77  ? 76  LEU B C   1 
ATOM   2333 O  O   . LEU B 2 61  ? -17.009 -35.567 18.099  1.00 90.99  ? 76  LEU B O   1 
ATOM   2334 C  CB  . LEU B 2 61  ? -17.018 -32.542 17.243  1.00 93.48  ? 76  LEU B CB  1 
ATOM   2335 C  CG  . LEU B 2 61  ? -17.741 -31.426 16.469  1.00 92.01  ? 76  LEU B CG  1 
ATOM   2336 C  CD1 . LEU B 2 61  ? -16.756 -30.622 15.632  1.00 89.06  ? 76  LEU B CD1 1 
ATOM   2337 C  CD2 . LEU B 2 61  ? -18.842 -31.966 15.553  1.00 93.22  ? 76  LEU B CD2 1 
ATOM   2338 N  N   . PHE B 2 62  ? -16.541 -34.451 20.007  1.00 104.80 ? 77  PHE B N   1 
ATOM   2339 C  CA  . PHE B 2 62  ? -15.725 -35.540 20.549  1.00 110.63 ? 77  PHE B CA  1 
ATOM   2340 C  C   . PHE B 2 62  ? -16.583 -36.655 21.108  1.00 110.82 ? 77  PHE B C   1 
ATOM   2341 O  O   . PHE B 2 62  ? -16.047 -37.708 21.389  1.00 112.40 ? 77  PHE B O   1 
ATOM   2342 C  CB  . PHE B 2 62  ? -14.738 -35.123 21.647  1.00 112.49 ? 77  PHE B CB  1 
ATOM   2343 C  CG  . PHE B 2 62  ? -14.592 -33.673 21.801  1.00 119.47 ? 77  PHE B CG  1 
ATOM   2344 C  CD1 . PHE B 2 62  ? -14.314 -32.864 20.699  1.00 122.35 ? 77  PHE B CD1 1 
ATOM   2345 C  CD2 . PHE B 2 62  ? -14.745 -33.096 23.058  1.00 125.82 ? 77  PHE B CD2 1 
ATOM   2346 C  CE1 . PHE B 2 62  ? -14.188 -31.490 20.863  1.00 130.86 ? 77  PHE B CE1 1 
ATOM   2347 C  CE2 . PHE B 2 62  ? -14.608 -31.739 23.225  1.00 130.79 ? 77  PHE B CE2 1 
ATOM   2348 C  CZ  . PHE B 2 62  ? -14.340 -30.941 22.137  1.00 133.30 ? 77  PHE B CZ  1 
ATOM   2349 N  N   . HIS B 2 63  ? -17.887 -36.442 21.288  1.00 109.32 ? 78  HIS B N   1 
ATOM   2350 C  CA  . HIS B 2 63  ? -18.773 -37.465 21.870  1.00 108.87 ? 78  HIS B CA  1 
ATOM   2351 C  C   . HIS B 2 63  ? -18.416 -38.954 21.655  1.00 108.47 ? 78  HIS B C   1 
ATOM   2352 O  O   . HIS B 2 63  ? -18.684 -39.756 22.524  1.00 118.55 ? 78  HIS B O   1 
ATOM   2353 C  CB  . HIS B 2 63  ? -20.225 -37.235 21.439  1.00 107.16 ? 78  HIS B CB  1 
ATOM   2354 C  CG  . HIS B 2 63  ? -20.441 -37.338 19.968  1.00 100.26 ? 78  HIS B CG  1 
ATOM   2355 N  ND1 . HIS B 2 63  ? -20.574 -36.226 19.167  1.00 97.07  ? 78  HIS B ND1 1 
ATOM   2356 C  CD2 . HIS B 2 63  ? -20.551 -38.415 19.152  1.00 97.77  ? 78  HIS B CD2 1 
ATOM   2357 C  CE1 . HIS B 2 63  ? -20.760 -36.615 17.919  1.00 96.74  ? 78  HIS B CE1 1 
ATOM   2358 N  NE2 . HIS B 2 63  ? -20.756 -37.936 17.883  1.00 95.66  ? 78  HIS B NE2 1 
ATOM   2359 N  N   . CYS B 2 64  ? -17.836 -39.349 20.535  1.00 104.18 ? 79  CYS B N   1 
ATOM   2360 C  CA  . CYS B 2 64  ? -17.393 -40.741 20.413  1.00 105.47 ? 79  CYS B CA  1 
ATOM   2361 C  C   . CYS B 2 64  ? -15.856 -40.834 20.376  1.00 101.14 ? 79  CYS B C   1 
ATOM   2362 O  O   . CYS B 2 64  ? -15.283 -41.804 19.860  1.00 103.04 ? 79  CYS B O   1 
ATOM   2363 C  CB  . CYS B 2 64  ? -18.064 -41.404 19.203  1.00 109.31 ? 79  CYS B CB  1 
ATOM   2364 S  SG  . CYS B 2 64  ? -19.590 -42.351 19.520  1.00 115.67 ? 79  CYS B SG  1 
ATOM   2365 N  N   . GLY B 2 65  ? -15.205 -39.858 21.007  1.00 95.60  ? 80  GLY B N   1 
ATOM   2366 C  CA  . GLY B 2 65  ? -13.777 -39.610 20.858  1.00 93.80  ? 80  GLY B CA  1 
ATOM   2367 C  C   . GLY B 2 65  ? -13.423 -38.576 19.782  1.00 92.55  ? 80  GLY B C   1 
ATOM   2368 O  O   . GLY B 2 65  ? -14.123 -38.410 18.782  1.00 97.32  ? 80  GLY B O   1 
ATOM   2369 N  N   . LEU B 2 66  ? -12.313 -37.890 19.995  1.00 87.69  ? 81  LEU B N   1 
ATOM   2370 C  CA  . LEU B 2 66  ? -11.712 -36.984 19.021  1.00 83.85  ? 81  LEU B CA  1 
ATOM   2371 C  C   . LEU B 2 66  ? -11.822 -37.465 17.574  1.00 80.02  ? 81  LEU B C   1 
ATOM   2372 O  O   . LEU B 2 66  ? -11.447 -38.593 17.271  1.00 75.82  ? 81  LEU B O   1 
ATOM   2373 C  CB  . LEU B 2 66  ? -10.221 -36.854 19.362  1.00 84.59  ? 81  LEU B CB  1 
ATOM   2374 C  CG  . LEU B 2 66  ? -9.513  -35.511 19.292  1.00 85.29  ? 81  LEU B CG  1 
ATOM   2375 C  CD1 . LEU B 2 66  ? -10.150 -34.456 20.187  1.00 89.13  ? 81  LEU B CD1 1 
ATOM   2376 C  CD2 . LEU B 2 66  ? -8.070  -35.702 19.711  1.00 85.11  ? 81  LEU B CD2 1 
ATOM   2377 N  N   . LEU B 2 67  ? -12.301 -36.595 16.692  1.00 78.53  ? 82  LEU B N   1 
ATOM   2378 C  CA  . LEU B 2 67  ? -12.382 -36.898 15.259  1.00 74.56  ? 82  LEU B CA  1 
ATOM   2379 C  C   . LEU B 2 67  ? -11.052 -36.821 14.610  1.00 71.95  ? 82  LEU B C   1 
ATOM   2380 O  O   . LEU B 2 67  ? -10.190 -36.048 15.062  1.00 75.92  ? 82  LEU B O   1 
ATOM   2381 C  CB  . LEU B 2 67  ? -13.218 -35.846 14.556  1.00 73.31  ? 82  LEU B CB  1 
ATOM   2382 C  CG  . LEU B 2 67  ? -14.670 -35.805 14.982  1.00 74.77  ? 82  LEU B CG  1 
ATOM   2383 C  CD1 . LEU B 2 67  ? -15.280 -34.554 14.388  1.00 75.73  ? 82  LEU B CD1 1 
ATOM   2384 C  CD2 . LEU B 2 67  ? -15.419 -37.052 14.525  1.00 75.33  ? 82  LEU B CD2 1 
ATOM   2385 N  N   . MET B 2 68  ? -10.902 -37.525 13.489  1.00 70.35  ? 83  MET B N   1 
ATOM   2386 C  CA  . MET B 2 68  ? -9.685  -37.338 12.648  1.00 68.32  ? 83  MET B CA  1 
ATOM   2387 C  C   . MET B 2 68  ? -9.657  -35.880 12.194  1.00 66.46  ? 83  MET B C   1 
ATOM   2388 O  O   . MET B 2 68  ? -10.708 -35.298 11.937  1.00 67.43  ? 83  MET B O   1 
ATOM   2389 C  CB  . MET B 2 68  ? -9.662  -38.179 11.384  1.00 67.43  ? 83  MET B CB  1 
ATOM   2390 C  CG  . MET B 2 68  ? -9.959  -39.654 11.516  1.00 68.30  ? 83  MET B CG  1 
ATOM   2391 S  SD  . MET B 2 68  ? -8.718  -40.515 12.427  1.00 70.22  ? 83  MET B SD  1 
ATOM   2392 C  CE  . MET B 2 68  ? -7.217  -40.027 11.616  1.00 72.09  ? 83  MET B CE  1 
ATOM   2393 N  N   . PRO B 2 69  ? -8.465  -35.282 12.086  1.00 64.08  ? 84  PRO B N   1 
ATOM   2394 C  CA  . PRO B 2 69  ? -8.427  -33.856 11.810  1.00 61.78  ? 84  PRO B CA  1 
ATOM   2395 C  C   . PRO B 2 69  ? -9.078  -33.470 10.506  1.00 64.02  ? 84  PRO B C   1 
ATOM   2396 O  O   . PRO B 2 69  ? -9.812  -32.468 10.484  1.00 68.78  ? 84  PRO B O   1 
ATOM   2397 C  CB  . PRO B 2 69  ? -6.952  -33.556 11.773  1.00 60.77  ? 84  PRO B CB  1 
ATOM   2398 C  CG  . PRO B 2 69  ? -6.346  -34.585 12.631  1.00 61.51  ? 84  PRO B CG  1 
ATOM   2399 C  CD  . PRO B 2 69  ? -7.128  -35.821 12.368  1.00 63.05  ? 84  PRO B CD  1 
ATOM   2400 N  N   . GLY B 2 70  ? -8.815  -34.251 9.445   1.00 62.84  ? 85  GLY B N   1 
ATOM   2401 C  CA  . GLY B 2 70  ? -9.516  -34.117 8.171   1.00 62.37  ? 85  GLY B CA  1 
ATOM   2402 C  C   . GLY B 2 70  ? -11.018 -33.987 8.335   1.00 64.39  ? 85  GLY B C   1 
ATOM   2403 O  O   . GLY B 2 70  ? -11.648 -33.119 7.757   1.00 69.82  ? 85  GLY B O   1 
ATOM   2404 N  N   . CYS B 2 71  ? -11.601 -34.846 9.143   1.00 66.34  ? 86  CYS B N   1 
ATOM   2405 C  CA  . CYS B 2 71  ? -13.026 -34.760 9.421   1.00 68.14  ? 86  CYS B CA  1 
ATOM   2406 C  C   . CYS B 2 71  ? -13.363 -33.469 10.194  1.00 66.26  ? 86  CYS B C   1 
ATOM   2407 O  O   . CYS B 2 71  ? -14.313 -32.767 9.872   1.00 65.71  ? 86  CYS B O   1 
ATOM   2408 C  CB  . CYS B 2 71  ? -13.474 -36.005 10.196  1.00 71.26  ? 86  CYS B CB  1 
ATOM   2409 S  SG  . CYS B 2 71  ? -15.240 -36.156 10.511  1.00 75.62  ? 86  CYS B SG  1 
ATOM   2410 N  N   . ARG B 2 72  ? -12.577 -33.153 11.205  1.00 64.26  ? 87  ARG B N   1 
ATOM   2411 C  CA  . ARG B 2 72  ? -12.866 -31.998 12.014  1.00 65.75  ? 87  ARG B CA  1 
ATOM   2412 C  C   . ARG B 2 72  ? -12.894 -30.752 11.138  1.00 64.41  ? 87  ARG B C   1 
ATOM   2413 O  O   . ARG B 2 72  ? -13.779 -29.886 11.269  1.00 61.58  ? 87  ARG B O   1 
ATOM   2414 C  CB  . ARG B 2 72  ? -11.859 -31.880 13.154  1.00 70.50  ? 87  ARG B CB  1 
ATOM   2415 C  CG  . ARG B 2 72  ? -11.928 -30.561 13.931  1.00 74.48  ? 87  ARG B CG  1 
ATOM   2416 C  CD  . ARG B 2 72  ? -11.615 -30.708 15.428  1.00 80.65  ? 87  ARG B CD  1 
ATOM   2417 N  NE  . ARG B 2 72  ? -10.259 -30.323 15.822  1.00 82.95  ? 87  ARG B NE  1 
ATOM   2418 C  CZ  . ARG B 2 72  ? -9.902  -29.172 16.408  1.00 86.20  ? 87  ARG B CZ  1 
ATOM   2419 N  NH1 . ARG B 2 72  ? -10.775 -28.190 16.683  1.00 85.02  ? 87  ARG B NH1 1 
ATOM   2420 N  NH2 . ARG B 2 72  ? -8.620  -28.996 16.711  1.00 88.46  ? 87  ARG B NH2 1 
ATOM   2421 N  N   . LYS B 2 73  ? -11.951 -30.706 10.210  1.00 63.59  ? 88  LYS B N   1 
ATOM   2422 C  CA  . LYS B 2 73  ? -11.854 -29.615 9.253   1.00 65.84  ? 88  LYS B CA  1 
ATOM   2423 C  C   . LYS B 2 73  ? -13.173 -29.390 8.456   1.00 67.46  ? 88  LYS B C   1 
ATOM   2424 O  O   . LYS B 2 73  ? -13.641 -28.266 8.264   1.00 68.77  ? 88  LYS B O   1 
ATOM   2425 C  CB  . LYS B 2 73  ? -10.670 -29.914 8.329   1.00 68.01  ? 88  LYS B CB  1 
ATOM   2426 C  CG  . LYS B 2 73  ? -10.385 -28.893 7.248   1.00 73.83  ? 88  LYS B CG  1 
ATOM   2427 C  CD  . LYS B 2 73  ? -8.903  -28.920 6.861   1.00 78.34  ? 88  LYS B CD  1 
ATOM   2428 C  CE  . LYS B 2 73  ? -8.621  -28.366 5.467   1.00 82.68  ? 88  LYS B CE  1 
ATOM   2429 N  NZ  . LYS B 2 73  ? -7.344  -27.575 5.447   1.00 85.45  ? 88  LYS B NZ  1 
ATOM   2430 N  N   . HIS B 2 74  ? -13.780 -30.479 8.009   1.00 66.72  ? 89  HIS B N   1 
ATOM   2431 C  CA  . HIS B 2 74  ? -15.032 -30.377 7.314   1.00 63.10  ? 89  HIS B CA  1 
ATOM   2432 C  C   . HIS B 2 74  ? -16.100 -29.732 8.171   1.00 62.24  ? 89  HIS B C   1 
ATOM   2433 O  O   . HIS B 2 74  ? -16.864 -28.903 7.678   1.00 64.14  ? 89  HIS B O   1 
ATOM   2434 C  CB  . HIS B 2 74  ? -15.484 -31.756 6.846   1.00 62.12  ? 89  HIS B CB  1 
ATOM   2435 C  CG  . HIS B 2 74  ? -14.827 -32.189 5.584   1.00 60.37  ? 89  HIS B CG  1 
ATOM   2436 N  ND1 . HIS B 2 74  ? -15.235 -31.728 4.352   1.00 58.98  ? 89  HIS B ND1 1 
ATOM   2437 C  CD2 . HIS B 2 74  ? -13.773 -33.002 5.357   1.00 59.09  ? 89  HIS B CD2 1 
ATOM   2438 C  CE1 . HIS B 2 74  ? -14.469 -32.253 3.418   1.00 59.42  ? 89  HIS B CE1 1 
ATOM   2439 N  NE2 . HIS B 2 74  ? -13.585 -33.045 4.000   1.00 59.20  ? 89  HIS B NE2 1 
ATOM   2440 N  N   . PHE B 2 75  ? -16.166 -30.132 9.438   1.00 60.69  ? 90  PHE B N   1 
ATOM   2441 C  CA  . PHE B 2 75  ? -17.214 -29.634 10.298  1.00 62.15  ? 90  PHE B CA  1 
ATOM   2442 C  C   . PHE B 2 75  ? -16.995 -28.148 10.596  1.00 62.43  ? 90  PHE B C   1 
ATOM   2443 O  O   . PHE B 2 75  ? -17.949 -27.387 10.752  1.00 59.74  ? 90  PHE B O   1 
ATOM   2444 C  CB  . PHE B 2 75  ? -17.286 -30.423 11.593  1.00 65.12  ? 90  PHE B CB  1 
ATOM   2445 C  CG  . PHE B 2 75  ? -18.008 -31.699 11.466  1.00 67.29  ? 90  PHE B CG  1 
ATOM   2446 C  CD1 . PHE B 2 75  ? -19.389 -31.711 11.494  1.00 69.64  ? 90  PHE B CD1 1 
ATOM   2447 C  CD2 . PHE B 2 75  ? -17.318 -32.902 11.312  1.00 70.32  ? 90  PHE B CD2 1 
ATOM   2448 C  CE1 . PHE B 2 75  ? -20.096 -32.902 11.356  1.00 72.30  ? 90  PHE B CE1 1 
ATOM   2449 C  CE2 . PHE B 2 75  ? -18.017 -34.105 11.177  1.00 72.73  ? 90  PHE B CE2 1 
ATOM   2450 C  CZ  . PHE B 2 75  ? -19.410 -34.102 11.206  1.00 73.88  ? 90  PHE B CZ  1 
ATOM   2451 N  N   . ILE B 2 76  ? -15.736 -27.740 10.675  1.00 62.68  ? 91  ILE B N   1 
ATOM   2452 C  CA  . ILE B 2 76  ? -15.443 -26.363 10.981  1.00 63.95  ? 91  ILE B CA  1 
ATOM   2453 C  C   . ILE B 2 76  ? -15.847 -25.513 9.811   1.00 65.47  ? 91  ILE B C   1 
ATOM   2454 O  O   . ILE B 2 76  ? -16.408 -24.406 10.005  1.00 67.52  ? 91  ILE B O   1 
ATOM   2455 C  CB  . ILE B 2 76  ? -13.959 -26.124 11.307  1.00 63.79  ? 91  ILE B CB  1 
ATOM   2456 C  CG1 . ILE B 2 76  ? -13.645 -26.702 12.681  1.00 62.74  ? 91  ILE B CG1 1 
ATOM   2457 C  CG2 . ILE B 2 76  ? -13.693 -24.637 11.370  1.00 66.33  ? 91  ILE B CG2 1 
ATOM   2458 C  CD1 . ILE B 2 76  ? -12.188 -26.746 13.026  1.00 62.70  ? 91  ILE B CD1 1 
ATOM   2459 N  N   . GLN B 2 77  ? -15.543 -26.020 8.614   1.00 62.77  ? 92  GLN B N   1 
ATOM   2460 C  CA  . GLN B 2 77  ? -15.904 -25.338 7.401   1.00 62.22  ? 92  GLN B CA  1 
ATOM   2461 C  C   . GLN B 2 77  ? -17.404 -25.192 7.335   1.00 63.42  ? 92  GLN B C   1 
ATOM   2462 O  O   . GLN B 2 77  ? -17.924 -24.144 6.940   1.00 65.21  ? 92  GLN B O   1 
ATOM   2463 C  CB  . GLN B 2 77  ? -15.392 -26.079 6.184   1.00 62.75  ? 92  GLN B CB  1 
ATOM   2464 C  CG  . GLN B 2 77  ? -13.886 -25.999 6.049   1.00 63.37  ? 92  GLN B CG  1 
ATOM   2465 C  CD  . GLN B 2 77  ? -13.324 -26.727 4.842   1.00 63.36  ? 92  GLN B CD  1 
ATOM   2466 O  OE1 . GLN B 2 77  ? -13.929 -27.662 4.271   1.00 62.38  ? 92  GLN B OE1 1 
ATOM   2467 N  NE2 . GLN B 2 77  ? -12.139 -26.304 4.448   1.00 65.08  ? 92  GLN B NE2 1 
ATOM   2468 N  N   . ALA B 2 78  ? -18.113 -26.231 7.742   1.00 64.49  ? 93  ALA B N   1 
ATOM   2469 C  CA  . ALA B 2 78  ? -19.566 -26.138 7.775   1.00 68.08  ? 93  ALA B CA  1 
ATOM   2470 C  C   . ALA B 2 78  ? -20.011 -24.938 8.620   1.00 68.83  ? 93  ALA B C   1 
ATOM   2471 O  O   . ALA B 2 78  ? -20.893 -24.170 8.207   1.00 67.71  ? 93  ALA B O   1 
ATOM   2472 C  CB  . ALA B 2 78  ? -20.200 -27.441 8.272   1.00 69.42  ? 93  ALA B CB  1 
ATOM   2473 N  N   . ILE B 2 79  ? -19.358 -24.778 9.770   1.00 70.50  ? 94  ILE B N   1 
ATOM   2474 C  CA  . ILE B 2 79  ? -19.657 -23.705 10.711  1.00 73.58  ? 94  ILE B CA  1 
ATOM   2475 C  C   . ILE B 2 79  ? -19.308 -22.352 10.100  1.00 76.12  ? 94  ILE B C   1 
ATOM   2476 O  O   . ILE B 2 79  ? -20.112 -21.406 10.188  1.00 75.68  ? 94  ILE B O   1 
ATOM   2477 C  CB  . ILE B 2 79  ? -18.914 -23.888 12.063  1.00 74.01  ? 94  ILE B CB  1 
ATOM   2478 C  CG1 . ILE B 2 79  ? -19.408 -25.156 12.769  1.00 73.19  ? 94  ILE B CG1 1 
ATOM   2479 C  CG2 . ILE B 2 79  ? -19.109 -22.672 12.987  1.00 76.22  ? 94  ILE B CG2 1 
ATOM   2480 C  CD1 . ILE B 2 79  ? -18.576 -25.580 13.959  1.00 73.88  ? 94  ILE B CD1 1 
ATOM   2481 N  N   . CYS B 2 80  ? -18.115 -22.259 9.499   1.00 78.50  ? 95  CYS B N   1 
ATOM   2482 C  CA  . CYS B 2 80  ? -17.660 -20.999 8.876   1.00 79.43  ? 95  CYS B CA  1 
ATOM   2483 C  C   . CYS B 2 80  ? -18.699 -20.511 7.873   1.00 78.72  ? 95  CYS B C   1 
ATOM   2484 O  O   . CYS B 2 80  ? -19.108 -19.361 7.917   1.00 77.90  ? 95  CYS B O   1 
ATOM   2485 C  CB  . CYS B 2 80  ? -16.302 -21.171 8.190   1.00 78.61  ? 95  CYS B CB  1 
ATOM   2486 S  SG  . CYS B 2 80  ? -14.908 -21.179 9.323   1.00 81.25  ? 95  CYS B SG  1 
ATOM   2487 N  N   . PHE B 2 81  ? -19.116 -21.433 7.009   1.00 77.28  ? 96  PHE B N   1 
ATOM   2488 C  CA  . PHE B 2 81  ? -20.151 -21.225 6.008   1.00 78.41  ? 96  PHE B CA  1 
ATOM   2489 C  C   . PHE B 2 81  ? -21.455 -20.722 6.608   1.00 80.31  ? 96  PHE B C   1 
ATOM   2490 O  O   . PHE B 2 81  ? -21.954 -19.685 6.196   1.00 81.78  ? 96  PHE B O   1 
ATOM   2491 C  CB  . PHE B 2 81  ? -20.396 -22.543 5.259   1.00 77.78  ? 96  PHE B CB  1 
ATOM   2492 C  CG  . PHE B 2 81  ? -21.465 -22.474 4.198   1.00 76.05  ? 96  PHE B CG  1 
ATOM   2493 C  CD1 . PHE B 2 81  ? -21.471 -21.472 3.254   1.00 76.85  ? 96  PHE B CD1 1 
ATOM   2494 C  CD2 . PHE B 2 81  ? -22.438 -23.446 4.122   1.00 76.74  ? 96  PHE B CD2 1 
ATOM   2495 C  CE1 . PHE B 2 81  ? -22.441 -21.419 2.274   1.00 77.57  ? 96  PHE B CE1 1 
ATOM   2496 C  CE2 . PHE B 2 81  ? -23.405 -23.409 3.141   1.00 79.26  ? 96  PHE B CE2 1 
ATOM   2497 C  CZ  . PHE B 2 81  ? -23.408 -22.390 2.213   1.00 79.02  ? 96  PHE B CZ  1 
ATOM   2498 N  N   . TYR B 2 82  ? -21.991 -21.458 7.576   1.00 81.45  ? 97  TYR B N   1 
ATOM   2499 C  CA  . TYR B 2 82  ? -23.250 -21.099 8.234   1.00 83.11  ? 97  TYR B CA  1 
ATOM   2500 C  C   . TYR B 2 82  ? -23.160 -19.704 8.876   1.00 86.17  ? 97  TYR B C   1 
ATOM   2501 O  O   . TYR B 2 82  ? -24.107 -18.885 8.811   1.00 82.99  ? 97  TYR B O   1 
ATOM   2502 C  CB  . TYR B 2 82  ? -23.591 -22.148 9.299   1.00 85.50  ? 97  TYR B CB  1 
ATOM   2503 C  CG  . TYR B 2 82  ? -24.958 -21.989 9.929   1.00 94.07  ? 97  TYR B CG  1 
ATOM   2504 C  CD1 . TYR B 2 82  ? -25.144 -21.223 11.088  1.00 99.50  ? 97  TYR B CD1 1 
ATOM   2505 C  CD2 . TYR B 2 82  ? -26.067 -22.634 9.390   1.00 99.41  ? 97  TYR B CD2 1 
ATOM   2506 C  CE1 . TYR B 2 82  ? -26.399 -21.093 11.667  1.00 105.07 ? 97  TYR B CE1 1 
ATOM   2507 C  CE2 . TYR B 2 82  ? -27.328 -22.509 9.959   1.00 103.77 ? 97  TYR B CE2 1 
ATOM   2508 C  CZ  . TYR B 2 82  ? -27.490 -21.741 11.093  1.00 106.74 ? 97  TYR B CZ  1 
ATOM   2509 O  OH  . TYR B 2 82  ? -28.743 -21.622 11.647  1.00 116.21 ? 97  TYR B OH  1 
ATOM   2510 N  N   . GLU B 2 83  ? -22.008 -19.433 9.489   1.00 86.72  ? 98  GLU B N   1 
ATOM   2511 C  CA  . GLU B 2 83  ? -21.844 -18.220 10.264  1.00 90.68  ? 98  GLU B CA  1 
ATOM   2512 C  C   . GLU B 2 83  ? -21.442 -17.051 9.389   1.00 93.02  ? 98  GLU B C   1 
ATOM   2513 O  O   . GLU B 2 83  ? -21.792 -15.919 9.709   1.00 99.58  ? 98  GLU B O   1 
ATOM   2514 C  CB  . GLU B 2 83  ? -20.847 -18.424 11.419  1.00 92.31  ? 98  GLU B CB  1 
ATOM   2515 C  CG  . GLU B 2 83  ? -21.313 -19.406 12.508  1.00 94.15  ? 98  GLU B CG  1 
ATOM   2516 C  CD  . GLU B 2 83  ? -22.394 -18.864 13.450  1.00 97.03  ? 98  GLU B CD  1 
ATOM   2517 O  OE1 . GLU B 2 83  ? -22.571 -17.624 13.535  1.00 99.12  ? 98  GLU B OE1 1 
ATOM   2518 O  OE2 . GLU B 2 83  ? -23.065 -19.689 14.127  1.00 98.99  ? 98  GLU B OE2 1 
ATOM   2519 N  N   . CYS B 2 84  ? -20.730 -17.317 8.290   1.00 93.81  ? 99  CYS B N   1 
ATOM   2520 C  CA  . CYS B 2 84  ? -20.075 -16.258 7.500   1.00 93.54  ? 99  CYS B CA  1 
ATOM   2521 C  C   . CYS B 2 84  ? -20.712 -15.905 6.159   1.00 92.29  ? 99  CYS B C   1 
ATOM   2522 O  O   . CYS B 2 84  ? -20.481 -14.791 5.672   1.00 92.13  ? 99  CYS B O   1 
ATOM   2523 C  CB  . CYS B 2 84  ? -18.606 -16.612 7.252   1.00 92.61  ? 99  CYS B CB  1 
ATOM   2524 S  SG  . CYS B 2 84  ? -17.664 -16.862 8.765   1.00 92.76  ? 99  CYS B SG  1 
ATOM   2525 N  N   . SER B 2 85  ? -21.485 -16.816 5.562   1.00 89.31  ? 100 SER B N   1 
ATOM   2526 C  CA  . SER B 2 85  ? -21.974 -16.616 4.190   1.00 89.97  ? 100 SER B CA  1 
ATOM   2527 C  C   . SER B 2 85  ? -22.991 -15.495 4.073   1.00 90.78  ? 100 SER B C   1 
ATOM   2528 O  O   . SER B 2 85  ? -23.979 -15.524 4.779   1.00 95.37  ? 100 SER B O   1 
ATOM   2529 C  CB  . SER B 2 85  ? -22.626 -17.875 3.642   1.00 88.97  ? 100 SER B CB  1 
ATOM   2530 O  OG  . SER B 2 85  ? -23.141 -17.652 2.339   1.00 88.13  ? 100 SER B OG  1 
ATOM   2531 N  N   . PRO B 2 86  ? -22.769 -14.530 3.151   1.00 92.74  ? 101 PRO B N   1 
ATOM   2532 C  CA  . PRO B 2 86  ? -23.753 -13.494 2.855   1.00 93.67  ? 101 PRO B CA  1 
ATOM   2533 C  C   . PRO B 2 86  ? -24.727 -13.892 1.743   1.00 90.71  ? 101 PRO B C   1 
ATOM   2534 O  O   . PRO B 2 86  ? -25.487 -13.061 1.267   1.00 93.96  ? 101 PRO B O   1 
ATOM   2535 C  CB  . PRO B 2 86  ? -22.870 -12.331 2.385   1.00 94.94  ? 101 PRO B CB  1 
ATOM   2536 C  CG  . PRO B 2 86  ? -21.767 -13.008 1.651   1.00 95.35  ? 101 PRO B CG  1 
ATOM   2537 C  CD  . PRO B 2 86  ? -21.546 -14.329 2.343   1.00 94.28  ? 101 PRO B CD  1 
ATOM   2538 N  N   . ASN B 2 87  ? -24.695 -15.147 1.328   1.00 87.12  ? 102 ASN B N   1 
ATOM   2539 C  CA  . ASN B 2 87  ? -25.410 -15.574 0.160   1.00 87.86  ? 102 ASN B CA  1 
ATOM   2540 C  C   . ASN B 2 87  ? -26.384 -16.684 0.571   1.00 88.28  ? 102 ASN B C   1 
ATOM   2541 O  O   . ASN B 2 87  ? -26.578 -17.647 -0.149  1.00 92.03  ? 102 ASN B O   1 
ATOM   2542 C  CB  . ASN B 2 87  ? -24.403 -16.040 -0.913  1.00 89.16  ? 102 ASN B CB  1 
ATOM   2543 C  CG  . ASN B 2 87  ? -23.346 -14.974 -1.269  1.00 92.12  ? 102 ASN B CG  1 
ATOM   2544 O  OD1 . ASN B 2 87  ? -22.145 -15.271 -1.346  1.00 99.02  ? 102 ASN B OD1 1 
ATOM   2545 N  ND2 . ASN B 2 87  ? -23.783 -13.750 -1.505  1.00 92.75  ? 102 ASN B ND2 1 
ATOM   2546 N  N   . LEU B 2 88  ? -27.009 -16.539 1.733   1.00 88.72  ? 103 LEU B N   1 
ATOM   2547 C  CA  . LEU B 2 88  ? -27.950 -17.542 2.219   1.00 89.69  ? 103 LEU B CA  1 
ATOM   2548 C  C   . LEU B 2 88  ? -29.429 -17.139 2.174   1.00 90.36  ? 103 LEU B C   1 
ATOM   2549 O  O   . LEU B 2 88  ? -30.318 -17.961 2.468   1.00 90.85  ? 103 LEU B O   1 
ATOM   2550 C  CB  . LEU B 2 88  ? -27.545 -17.936 3.637   1.00 91.68  ? 103 LEU B CB  1 
ATOM   2551 C  CG  . LEU B 2 88  ? -26.175 -18.616 3.759   1.00 93.60  ? 103 LEU B CG  1 
ATOM   2552 C  CD1 . LEU B 2 88  ? -26.015 -19.222 5.149   1.00 92.39  ? 103 LEU B CD1 1 
ATOM   2553 C  CD2 . LEU B 2 88  ? -25.925 -19.682 2.688   1.00 93.71  ? 103 LEU B CD2 1 
ATOM   2554 N  N   . GLY B 2 89  ? -29.709 -15.900 1.783   1.00 91.44  ? 104 GLY B N   1 
ATOM   2555 C  CA  . GLY B 2 89  ? -31.064 -15.369 1.901   1.00 95.57  ? 104 GLY B CA  1 
ATOM   2556 C  C   . GLY B 2 89  ? -32.206 -16.304 1.496   1.00 95.61  ? 104 GLY B C   1 
ATOM   2557 O  O   . GLY B 2 89  ? -33.126 -16.526 2.302   1.00 94.46  ? 104 GLY B O   1 
ATOM   2558 N  N   . PRO B 2 90  ? -32.136 -16.887 0.273   1.00 94.04  ? 105 PRO B N   1 
ATOM   2559 C  CA  . PRO B 2 90  ? -33.206 -17.748 -0.217  1.00 93.65  ? 105 PRO B CA  1 
ATOM   2560 C  C   . PRO B 2 90  ? -33.578 -18.887 0.701   1.00 95.45  ? 105 PRO B C   1 
ATOM   2561 O  O   . PRO B 2 90  ? -34.702 -19.380 0.607   1.00 97.36  ? 105 PRO B O   1 
ATOM   2562 C  CB  . PRO B 2 90  ? -32.661 -18.296 -1.533  1.00 91.53  ? 105 PRO B CB  1 
ATOM   2563 C  CG  . PRO B 2 90  ? -31.690 -17.285 -1.983  1.00 92.47  ? 105 PRO B CG  1 
ATOM   2564 C  CD  . PRO B 2 90  ? -31.078 -16.724 -0.740  1.00 93.37  ? 105 PRO B CD  1 
ATOM   2565 N  N   . TRP B 2 91  ? -32.687 -19.294 1.600   1.00 94.96  ? 106 TRP B N   1 
ATOM   2566 C  CA  . TRP B 2 91  ? -33.008 -20.425 2.454   1.00 96.69  ? 106 TRP B CA  1 
ATOM   2567 C  C   . TRP B 2 91  ? -33.280 -20.050 3.874   1.00 97.89  ? 106 TRP B C   1 
ATOM   2568 O  O   . TRP B 2 91  ? -33.584 -20.935 4.674   1.00 97.45  ? 106 TRP B O   1 
ATOM   2569 C  CB  . TRP B 2 91  ? -31.925 -21.486 2.389   1.00 95.20  ? 106 TRP B CB  1 
ATOM   2570 C  CG  . TRP B 2 91  ? -31.773 -21.985 1.036   1.00 91.25  ? 106 TRP B CG  1 
ATOM   2571 C  CD1 . TRP B 2 91  ? -32.350 -23.088 0.490   1.00 89.89  ? 106 TRP B CD1 1 
ATOM   2572 C  CD2 . TRP B 2 91  ? -31.028 -21.364 0.017   1.00 89.52  ? 106 TRP B CD2 1 
ATOM   2573 N  NE1 . TRP B 2 91  ? -31.997 -23.196 -0.814  1.00 91.16  ? 106 TRP B NE1 1 
ATOM   2574 C  CE2 . TRP B 2 91  ? -31.170 -22.149 -1.134  1.00 91.58  ? 106 TRP B CE2 1 
ATOM   2575 C  CE3 . TRP B 2 91  ? -30.240 -20.210 -0.038  1.00 88.86  ? 106 TRP B CE3 1 
ATOM   2576 C  CZ2 . TRP B 2 91  ? -30.521 -21.836 -2.343  1.00 90.88  ? 106 TRP B CZ2 1 
ATOM   2577 C  CZ3 . TRP B 2 91  ? -29.590 -19.892 -1.243  1.00 87.87  ? 106 TRP B CZ3 1 
ATOM   2578 C  CH2 . TRP B 2 91  ? -29.744 -20.700 -2.378  1.00 87.38  ? 106 TRP B CH2 1 
ATOM   2579 N  N   . ILE B 2 92  ? -33.207 -18.755 4.192   1.00 102.48 ? 107 ILE B N   1 
ATOM   2580 C  CA  . ILE B 2 92  ? -33.556 -18.289 5.546   1.00 106.59 ? 107 ILE B CA  1 
ATOM   2581 C  C   . ILE B 2 92  ? -35.057 -18.468 5.828   1.00 111.09 ? 107 ILE B C   1 
ATOM   2582 O  O   . ILE B 2 92  ? -35.903 -18.154 4.981   1.00 111.24 ? 107 ILE B O   1 
ATOM   2583 C  CB  . ILE B 2 92  ? -33.157 -16.819 5.812   1.00 103.52 ? 107 ILE B CB  1 
ATOM   2584 C  CG1 . ILE B 2 92  ? -31.637 -16.669 5.745   1.00 104.46 ? 107 ILE B CG1 1 
ATOM   2585 C  CG2 . ILE B 2 92  ? -33.631 -16.378 7.191   1.00 104.39 ? 107 ILE B CG2 1 
ATOM   2586 C  CD1 . ILE B 2 92  ? -31.101 -15.305 6.130   1.00 106.31 ? 107 ILE B CD1 1 
ATOM   2587 N  N   . GLN B 2 93  ? -35.365 -18.979 7.019   1.00 113.67 ? 108 GLN B N   1 
ATOM   2588 C  CA  . GLN B 2 93  ? -36.735 -19.086 7.488   1.00 117.94 ? 108 GLN B CA  1 
ATOM   2589 C  C   . GLN B 2 93  ? -36.777 -18.944 9.007   1.00 122.18 ? 108 GLN B C   1 
ATOM   2590 O  O   . GLN B 2 93  ? -35.786 -19.248 9.677   1.00 119.64 ? 108 GLN B O   1 
ATOM   2591 C  CB  . GLN B 2 93  ? -37.320 -20.425 7.083   1.00 119.05 ? 108 GLN B CB  1 
ATOM   2592 C  CG  . GLN B 2 93  ? -37.332 -20.661 5.589   1.00 119.30 ? 108 GLN B CG  1 
ATOM   2593 C  CD  . GLN B 2 93  ? -38.011 -21.952 5.212   1.00 122.52 ? 108 GLN B CD  1 
ATOM   2594 O  OE1 . GLN B 2 93  ? -38.464 -22.715 6.072   1.00 125.58 ? 108 GLN B OE1 1 
ATOM   2595 N  NE2 . GLN B 2 93  ? -38.073 -22.220 3.913   1.00 121.89 ? 108 GLN B NE2 1 
ATOM   2596 N  N   . PRO B 2 94  ? -37.912 -18.475 9.564   1.00 126.77 ? 109 PRO B N   1 
ATOM   2597 C  CA  . PRO B 2 94  ? -37.992 -18.412 11.028  1.00 129.31 ? 109 PRO B CA  1 
ATOM   2598 C  C   . PRO B 2 94  ? -38.279 -19.786 11.640  1.00 131.17 ? 109 PRO B C   1 
ATOM   2599 O  O   . PRO B 2 94  ? -38.923 -20.615 10.995  1.00 137.04 ? 109 PRO B O   1 
ATOM   2600 C  CB  . PRO B 2 94  ? -39.155 -17.437 11.278  1.00 130.43 ? 109 PRO B CB  1 
ATOM   2601 C  CG  . PRO B 2 94  ? -39.472 -16.832 9.947   1.00 129.09 ? 109 PRO B CG  1 
ATOM   2602 C  CD  . PRO B 2 94  ? -39.106 -17.875 8.948   1.00 126.11 ? 109 PRO B CD  1 
ATOM   2603 N  N   . VAL B 2 95  ? -37.813 -20.013 12.869  1.00 128.94 ? 110 VAL B N   1 
ATOM   2604 C  CA  . VAL B 2 95  ? -38.024 -21.291 13.558  1.00 125.73 ? 110 VAL B CA  1 
ATOM   2605 C  C   . VAL B 2 95  ? -39.330 -21.180 14.319  1.00 125.19 ? 110 VAL B C   1 
ATOM   2606 O  O   . VAL B 2 95  ? -39.967 -22.182 14.590  1.00 123.54 ? 110 VAL B O   1 
ATOM   2607 C  CB  . VAL B 2 95  ? -36.912 -21.650 14.578  1.00 125.22 ? 110 VAL B CB  1 
ATOM   2608 C  CG1 . VAL B 2 95  ? -36.980 -23.131 14.940  1.00 125.21 ? 110 VAL B CG1 1 
ATOM   2609 C  CG2 . VAL B 2 95  ? -35.514 -21.324 14.066  1.00 122.87 ? 110 VAL B CG2 1 
ATOM   2610 N  N   . GLY B 2 108 ? -35.635 -13.979 14.825  1.00 137.85 ? 123 GLY B N   1 
ATOM   2611 C  CA  . GLY B 2 108 ? -35.121 -15.290 15.208  1.00 136.16 ? 123 GLY B CA  1 
ATOM   2612 C  C   . GLY B 2 108 ? -35.252 -16.207 14.012  1.00 135.16 ? 123 GLY B C   1 
ATOM   2613 O  O   . GLY B 2 108 ? -36.349 -16.693 13.730  1.00 133.98 ? 123 GLY B O   1 
ATOM   2614 N  N   . GLU B 2 109 ? -34.138 -16.433 13.308  1.00 133.83 ? 124 GLU B N   1 
ATOM   2615 C  CA  . GLU B 2 109 ? -34.151 -17.141 12.013  1.00 127.99 ? 124 GLU B CA  1 
ATOM   2616 C  C   . GLU B 2 109 ? -33.108 -18.248 11.906  1.00 121.06 ? 124 GLU B C   1 
ATOM   2617 O  O   . GLU B 2 109 ? -32.074 -18.224 12.582  1.00 115.96 ? 124 GLU B O   1 
ATOM   2618 C  CB  . GLU B 2 109 ? -33.919 -16.178 10.845  1.00 121.35 ? 124 GLU B CB  1 
ATOM   2619 C  CG  . GLU B 2 109 ? -34.714 -14.895 10.864  1.00 117.87 ? 124 GLU B CG  1 
ATOM   2620 C  CD  . GLU B 2 109 ? -34.502 -14.105 9.586   1.00 112.75 ? 124 GLU B CD  1 
ATOM   2621 O  OE1 . GLU B 2 109 ? -33.345 -13.723 9.278   1.00 107.51 ? 124 GLU B OE1 1 
ATOM   2622 O  OE2 . GLU B 2 109 ? -35.498 -13.887 8.868   1.00 114.55 ? 124 GLU B OE2 1 
ATOM   2623 N  N   . ARG B 2 110 ? -33.405 -19.190 11.010  1.00 116.98 ? 125 ARG B N   1 
ATOM   2624 C  CA  . ARG B 2 110 ? -32.556 -20.332 10.708  1.00 111.61 ? 125 ARG B CA  1 
ATOM   2625 C  C   . ARG B 2 110 ? -32.581 -20.546 9.198   1.00 106.69 ? 125 ARG B C   1 
ATOM   2626 O  O   . ARG B 2 110 ? -33.147 -19.741 8.457   1.00 107.80 ? 125 ARG B O   1 
ATOM   2627 C  CB  . ARG B 2 110 ? -33.083 -21.564 11.441  1.00 111.84 ? 125 ARG B CB  1 
ATOM   2628 C  CG  . ARG B 2 110 ? -34.426 -22.055 10.922  1.00 114.97 ? 125 ARG B CG  1 
ATOM   2629 C  CD  . ARG B 2 110 ? -34.647 -23.506 11.296  1.00 117.00 ? 125 ARG B CD  1 
ATOM   2630 N  NE  . ARG B 2 110 ? -33.830 -24.399 10.472  1.00 114.91 ? 125 ARG B NE  1 
ATOM   2631 C  CZ  . ARG B 2 110 ? -33.784 -25.724 10.601  1.00 115.17 ? 125 ARG B CZ  1 
ATOM   2632 N  NH1 . ARG B 2 110 ? -34.514 -26.336 11.522  1.00 115.73 ? 125 ARG B NH1 1 
ATOM   2633 N  NH2 . ARG B 2 110 ? -33.001 -26.448 9.801   1.00 117.83 ? 125 ARG B NH2 1 
ATOM   2634 N  N   . VAL B 2 111 ? -32.020 -21.661 8.760   1.00 101.26 ? 126 VAL B N   1 
ATOM   2635 C  CA  . VAL B 2 111 ? -31.837 -21.937 7.362   1.00 93.54  ? 126 VAL B CA  1 
ATOM   2636 C  C   . VAL B 2 111 ? -32.244 -23.386 7.081   1.00 89.86  ? 126 VAL B C   1 
ATOM   2637 O  O   . VAL B 2 111 ? -32.023 -24.264 7.897   1.00 86.79  ? 126 VAL B O   1 
ATOM   2638 C  CB  . VAL B 2 111 ? -30.373 -21.591 7.042   1.00 92.64  ? 126 VAL B CB  1 
ATOM   2639 C  CG1 . VAL B 2 111 ? -29.606 -22.752 6.420   1.00 91.20  ? 126 VAL B CG1 1 
ATOM   2640 C  CG2 . VAL B 2 111 ? -30.315 -20.304 6.228   1.00 90.65  ? 126 VAL B CG2 1 
ATOM   2641 N  N   . VAL B 2 112 ? -32.871 -23.620 5.939   1.00 90.32  ? 127 VAL B N   1 
ATOM   2642 C  CA  . VAL B 2 112 ? -33.477 -24.919 5.659   1.00 96.45  ? 127 VAL B CA  1 
ATOM   2643 C  C   . VAL B 2 112 ? -33.183 -25.348 4.228   1.00 97.63  ? 127 VAL B C   1 
ATOM   2644 O  O   . VAL B 2 112 ? -33.469 -24.607 3.283   1.00 100.27 ? 127 VAL B O   1 
ATOM   2645 C  CB  . VAL B 2 112 ? -35.017 -24.901 5.890   1.00 97.99  ? 127 VAL B CB  1 
ATOM   2646 C  CG1 . VAL B 2 112 ? -35.634 -26.276 5.616   1.00 97.33  ? 127 VAL B CG1 1 
ATOM   2647 C  CG2 . VAL B 2 112 ? -35.316 -24.467 7.315   1.00 99.71  ? 127 VAL B CG2 1 
ATOM   2648 N  N   . ASN B 2 113 ? -32.625 -26.553 4.098   1.00 95.79  ? 128 ASN B N   1 
ATOM   2649 C  CA  . ASN B 2 113 ? -32.383 -27.192 2.819   1.00 95.40  ? 128 ASN B CA  1 
ATOM   2650 C  C   . ASN B 2 113 ? -31.561 -26.348 1.846   1.00 94.18  ? 128 ASN B C   1 
ATOM   2651 O  O   . ASN B 2 113 ? -31.905 -26.206 0.667   1.00 96.50  ? 128 ASN B O   1 
ATOM   2652 C  CB  . ASN B 2 113 ? -33.720 -27.653 2.220   1.00 97.49  ? 128 ASN B CB  1 
ATOM   2653 C  CG  . ASN B 2 113 ? -34.331 -28.812 2.988   1.00 99.47  ? 128 ASN B CG  1 
ATOM   2654 O  OD1 . ASN B 2 113 ? -33.623 -29.606 3.610   1.00 103.00 ? 128 ASN B OD1 1 
ATOM   2655 N  ND2 . ASN B 2 113 ? -35.643 -28.923 2.938   1.00 100.46 ? 128 ASN B ND2 1 
ATOM   2656 N  N   . VAL B 2 114 ? -30.464 -25.792 2.350   1.00 90.52  ? 129 VAL B N   1 
ATOM   2657 C  CA  . VAL B 2 114 ? -29.512 -25.155 1.471   1.00 88.92  ? 129 VAL B CA  1 
ATOM   2658 C  C   . VAL B 2 114 ? -28.884 -26.274 0.624   1.00 89.56  ? 129 VAL B C   1 
ATOM   2659 O  O   . VAL B 2 114 ? -28.342 -27.237 1.147   1.00 87.47  ? 129 VAL B O   1 
ATOM   2660 C  CB  . VAL B 2 114 ? -28.391 -24.452 2.217   1.00 87.20  ? 129 VAL B CB  1 
ATOM   2661 C  CG1 . VAL B 2 114 ? -27.379 -23.903 1.230   1.00 87.94  ? 129 VAL B CG1 1 
ATOM   2662 C  CG2 . VAL B 2 114 ? -28.930 -23.319 3.051   1.00 88.37  ? 129 VAL B CG2 1 
ATOM   2663 N  N   . PRO B 2 115 ? -28.966 -26.163 -0.690  1.00 89.71  ? 130 PRO B N   1 
ATOM   2664 C  CA  . PRO B 2 115 ? -28.381 -27.188 -1.557  1.00 89.17  ? 130 PRO B CA  1 
ATOM   2665 C  C   . PRO B 2 115 ? -26.846 -27.141 -1.591  1.00 87.77  ? 130 PRO B C   1 
ATOM   2666 O  O   . PRO B 2 115 ? -26.248 -26.239 -2.201  1.00 86.30  ? 130 PRO B O   1 
ATOM   2667 C  CB  . PRO B 2 115 ? -28.967 -26.851 -2.921  1.00 90.44  ? 130 PRO B CB  1 
ATOM   2668 C  CG  . PRO B 2 115 ? -29.255 -25.381 -2.852  1.00 90.94  ? 130 PRO B CG  1 
ATOM   2669 C  CD  . PRO B 2 115 ? -29.649 -25.103 -1.446  1.00 89.42  ? 130 PRO B CD  1 
ATOM   2670 N  N   . LEU B 2 116 ? -26.212 -28.099 -0.923  1.00 86.48  ? 131 LEU B N   1 
ATOM   2671 C  CA  . LEU B 2 116 ? -24.760 -28.200 -0.961  1.00 80.51  ? 131 LEU B CA  1 
ATOM   2672 C  C   . LEU B 2 116 ? -24.417 -29.075 -2.115  1.00 81.14  ? 131 LEU B C   1 
ATOM   2673 O  O   . LEU B 2 116 ? -24.964 -30.175 -2.225  1.00 81.70  ? 131 LEU B O   1 
ATOM   2674 C  CB  . LEU B 2 116 ? -24.208 -28.837 0.305   1.00 79.05  ? 131 LEU B CB  1 
ATOM   2675 C  CG  . LEU B 2 116 ? -24.132 -27.956 1.546   1.00 78.54  ? 131 LEU B CG  1 
ATOM   2676 C  CD1 . LEU B 2 116 ? -23.311 -28.663 2.603   1.00 77.59  ? 131 LEU B CD1 1 
ATOM   2677 C  CD2 . LEU B 2 116 ? -23.553 -26.572 1.270   1.00 78.30  ? 131 LEU B CD2 1 
ATOM   2678 N  N   . CYS B 2 117 ? -23.477 -28.623 -2.944  1.00 82.62  ? 132 CYS B N   1 
ATOM   2679 C  CA  . CYS B 2 117 ? -23.016 -29.412 -4.095  1.00 83.76  ? 132 CYS B CA  1 
ATOM   2680 C  C   . CYS B 2 117 ? -22.545 -30.794 -3.675  1.00 84.81  ? 132 CYS B C   1 
ATOM   2681 O  O   . CYS B 2 117 ? -22.075 -31.003 -2.561  1.00 84.52  ? 132 CYS B O   1 
ATOM   2682 C  CB  . CYS B 2 117 ? -21.901 -28.701 -4.861  1.00 82.62  ? 132 CYS B CB  1 
ATOM   2683 S  SG  . CYS B 2 117 ? -22.338 -27.063 -5.522  1.00 83.29  ? 132 CYS B SG  1 
ATOM   2684 N  N   . GLN B 2 118 ? -22.708 -31.736 -4.585  1.00 88.46  ? 133 GLN B N   1 
ATOM   2685 C  CA  . GLN B 2 118 ? -22.443 -33.136 -4.322  1.00 89.67  ? 133 GLN B CA  1 
ATOM   2686 C  C   . GLN B 2 118 ? -21.014 -33.380 -3.881  1.00 86.06  ? 133 GLN B C   1 
ATOM   2687 O  O   . GLN B 2 118 ? -20.782 -34.190 -2.982  1.00 88.55  ? 133 GLN B O   1 
ATOM   2688 C  CB  . GLN B 2 118 ? -22.723 -33.913 -5.596  1.00 98.79  ? 133 GLN B CB  1 
ATOM   2689 C  CG  . GLN B 2 118 ? -22.741 -35.424 -5.494  1.00 103.40 ? 133 GLN B CG  1 
ATOM   2690 C  CD  . GLN B 2 118 ? -23.340 -36.012 -6.757  1.00 110.74 ? 133 GLN B CD  1 
ATOM   2691 O  OE1 . GLN B 2 118 ? -22.722 -35.972 -7.831  1.00 118.49 ? 133 GLN B OE1 1 
ATOM   2692 N  NE2 . GLN B 2 118 ? -24.569 -36.505 -6.654  1.00 114.79 ? 133 GLN B NE2 1 
ATOM   2693 N  N   . GLU B 2 119 ? -20.058 -32.698 -4.515  1.00 82.36  ? 134 GLU B N   1 
ATOM   2694 C  CA  . GLU B 2 119 ? -18.643 -32.793 -4.102  1.00 81.36  ? 134 GLU B CA  1 
ATOM   2695 C  C   . GLU B 2 119 ? -18.408 -32.432 -2.617  1.00 81.70  ? 134 GLU B C   1 
ATOM   2696 O  O   . GLU B 2 119 ? -17.670 -33.127 -1.924  1.00 85.90  ? 134 GLU B O   1 
ATOM   2697 C  CB  . GLU B 2 119 ? -17.737 -31.889 -4.948  1.00 80.50  ? 134 GLU B CB  1 
ATOM   2698 C  CG  . GLU B 2 119 ? -17.602 -32.276 -6.413  1.00 79.39  ? 134 GLU B CG  1 
ATOM   2699 C  CD  . GLU B 2 119 ? -18.522 -31.496 -7.339  1.00 79.21  ? 134 GLU B CD  1 
ATOM   2700 O  OE1 . GLU B 2 119 ? -19.679 -31.167 -6.933  1.00 76.03  ? 134 GLU B OE1 1 
ATOM   2701 O  OE2 . GLU B 2 119 ? -18.083 -31.226 -8.491  1.00 76.21  ? 134 GLU B OE2 1 
ATOM   2702 N  N   . ASP B 2 120 ? -19.007 -31.335 -2.157  1.00 78.07  ? 135 ASP B N   1 
ATOM   2703 C  CA  . ASP B 2 120 ? -18.897 -30.927 -0.777  1.00 75.97  ? 135 ASP B CA  1 
ATOM   2704 C  C   . ASP B 2 120 ? -19.421 -32.031 0.104   1.00 75.84  ? 135 ASP B C   1 
ATOM   2705 O  O   . ASP B 2 120 ? -18.755 -32.421 1.020   1.00 76.76  ? 135 ASP B O   1 
ATOM   2706 C  CB  . ASP B 2 120 ? -19.634 -29.603 -0.494  1.00 79.91  ? 135 ASP B CB  1 
ATOM   2707 C  CG  . ASP B 2 120 ? -19.028 -28.407 -1.253  1.00 81.81  ? 135 ASP B CG  1 
ATOM   2708 O  OD1 . ASP B 2 120 ? -19.102 -28.386 -2.495  1.00 86.11  ? 135 ASP B OD1 1 
ATOM   2709 O  OD2 . ASP B 2 120 ? -18.439 -27.489 -0.641  1.00 82.33  ? 135 ASP B OD2 1 
ATOM   2710 N  N   . CYS B 2 121 ? -20.592 -32.579 -0.167  1.00 79.87  ? 136 CYS B N   1 
ATOM   2711 C  CA  . CYS B 2 121 ? -21.055 -33.703 0.666   1.00 83.73  ? 136 CYS B CA  1 
ATOM   2712 C  C   . CYS B 2 121 ? -20.210 -34.961 0.489   1.00 86.94  ? 136 CYS B C   1 
ATOM   2713 O  O   . CYS B 2 121 ? -19.951 -35.652 1.468   1.00 86.19  ? 136 CYS B O   1 
ATOM   2714 C  CB  . CYS B 2 121 ? -22.530 -34.010 0.425   1.00 86.52  ? 136 CYS B CB  1 
ATOM   2715 S  SG  . CYS B 2 121 ? -23.599 -32.632 0.906   1.00 86.22  ? 136 CYS B SG  1 
ATOM   2716 N  N   . GLU B 2 122 ? -19.754 -35.248 -0.734  1.00 93.01  ? 137 GLU B N   1 
ATOM   2717 C  CA  . GLU B 2 122 ? -18.941 -36.464 -0.975  1.00 97.20  ? 137 GLU B CA  1 
ATOM   2718 C  C   . GLU B 2 122 ? -17.590 -36.456 -0.254  1.00 92.91  ? 137 GLU B C   1 
ATOM   2719 O  O   . GLU B 2 122 ? -17.280 -37.380 0.514   1.00 89.85  ? 137 GLU B O   1 
ATOM   2720 C  CB  . GLU B 2 122 ? -18.776 -36.737 -2.462  1.00 99.23  ? 137 GLU B CB  1 
ATOM   2721 C  CG  . GLU B 2 122 ? -20.004 -37.429 -3.012  1.00 107.69 ? 137 GLU B CG  1 
ATOM   2722 C  CD  . GLU B 2 122 ? -19.965 -37.637 -4.515  1.00 116.59 ? 137 GLU B CD  1 
ATOM   2723 O  OE1 . GLU B 2 122 ? -18.968 -37.205 -5.144  1.00 118.68 ? 137 GLU B OE1 1 
ATOM   2724 O  OE2 . GLU B 2 122 ? -20.943 -38.225 -5.063  1.00 118.64 ? 137 GLU B OE2 1 
ATOM   2725 N  N   . GLU B 2 123 ? -16.827 -35.390 -0.471  1.00 88.33  ? 138 GLU B N   1 
ATOM   2726 C  CA  . GLU B 2 123 ? -15.553 -35.163 0.237   1.00 84.32  ? 138 GLU B CA  1 
ATOM   2727 C  C   . GLU B 2 123 ? -15.715 -35.221 1.775   1.00 76.70  ? 138 GLU B C   1 
ATOM   2728 O  O   . GLU B 2 123 ? -14.950 -35.879 2.476   1.00 71.84  ? 138 GLU B O   1 
ATOM   2729 C  CB  . GLU B 2 123 ? -14.918 -33.838 -0.235  1.00 83.95  ? 138 GLU B CB  1 
ATOM   2730 C  CG  . GLU B 2 123 ? -14.395 -33.920 -1.674  1.00 88.63  ? 138 GLU B CG  1 
ATOM   2731 C  CD  . GLU B 2 123 ? -14.011 -32.585 -2.310  1.00 91.84  ? 138 GLU B CD  1 
ATOM   2732 O  OE1 . GLU B 2 123 ? -13.844 -31.586 -1.581  1.00 98.67  ? 138 GLU B OE1 1 
ATOM   2733 O  OE2 . GLU B 2 123 ? -13.859 -32.531 -3.556  1.00 89.83  ? 138 GLU B OE2 1 
ATOM   2734 N  N   . TRP B 2 124 ? -16.754 -34.573 2.272   1.00 73.58  ? 139 TRP B N   1 
ATOM   2735 C  CA  . TRP B 2 124 ? -17.019 -34.518 3.697   1.00 74.87  ? 139 TRP B CA  1 
ATOM   2736 C  C   . TRP B 2 124 ? -17.200 -35.928 4.204   1.00 77.44  ? 139 TRP B C   1 
ATOM   2737 O  O   . TRP B 2 124 ? -16.553 -36.359 5.164   1.00 79.20  ? 139 TRP B O   1 
ATOM   2738 C  CB  . TRP B 2 124 ? -18.275 -33.674 3.942   1.00 74.49  ? 139 TRP B CB  1 
ATOM   2739 C  CG  . TRP B 2 124 ? -18.606 -33.369 5.348   1.00 75.19  ? 139 TRP B CG  1 
ATOM   2740 C  CD1 . TRP B 2 124 ? -18.070 -33.926 6.478   1.00 77.21  ? 139 TRP B CD1 1 
ATOM   2741 C  CD2 . TRP B 2 124 ? -19.613 -32.463 5.796   1.00 75.42  ? 139 TRP B CD2 1 
ATOM   2742 N  NE1 . TRP B 2 124 ? -18.664 -33.401 7.593   1.00 78.07  ? 139 TRP B NE1 1 
ATOM   2743 C  CE2 . TRP B 2 124 ? -19.624 -32.505 7.203   1.00 76.59  ? 139 TRP B CE2 1 
ATOM   2744 C  CE3 . TRP B 2 124 ? -20.500 -31.606 5.146   1.00 74.75  ? 139 TRP B CE3 1 
ATOM   2745 C  CZ2 . TRP B 2 124 ? -20.478 -31.711 7.969   1.00 75.19  ? 139 TRP B CZ2 1 
ATOM   2746 C  CZ3 . TRP B 2 124 ? -21.358 -30.836 5.907   1.00 74.27  ? 139 TRP B CZ3 1 
ATOM   2747 C  CH2 . TRP B 2 124 ? -21.336 -30.888 7.304   1.00 74.30  ? 139 TRP B CH2 1 
ATOM   2748 N  N   . TRP B 2 125 ? -18.070 -36.648 3.526   1.00 79.77  ? 140 TRP B N   1 
ATOM   2749 C  CA  . TRP B 2 125 ? -18.360 -38.015 3.873   1.00 82.41  ? 140 TRP B CA  1 
ATOM   2750 C  C   . TRP B 2 125 ? -17.117 -38.906 3.823   1.00 80.74  ? 140 TRP B C   1 
ATOM   2751 O  O   . TRP B 2 125 ? -16.890 -39.714 4.720   1.00 77.16  ? 140 TRP B O   1 
ATOM   2752 C  CB  . TRP B 2 125 ? -19.445 -38.548 2.931   1.00 86.45  ? 140 TRP B CB  1 
ATOM   2753 C  CG  . TRP B 2 125 ? -19.896 -39.895 3.332   1.00 87.73  ? 140 TRP B CG  1 
ATOM   2754 C  CD1 . TRP B 2 125 ? -20.808 -40.201 4.301   1.00 88.67  ? 140 TRP B CD1 1 
ATOM   2755 C  CD2 . TRP B 2 125 ? -19.407 -41.127 2.823   1.00 88.59  ? 140 TRP B CD2 1 
ATOM   2756 N  NE1 . TRP B 2 125 ? -20.929 -41.562 4.411   1.00 93.44  ? 140 TRP B NE1 1 
ATOM   2757 C  CE2 . TRP B 2 125 ? -20.072 -42.156 3.518   1.00 92.21  ? 140 TRP B CE2 1 
ATOM   2758 C  CE3 . TRP B 2 125 ? -18.465 -41.466 1.839   1.00 90.99  ? 140 TRP B CE3 1 
ATOM   2759 C  CZ2 . TRP B 2 125 ? -19.834 -43.509 3.256   1.00 92.82  ? 140 TRP B CZ2 1 
ATOM   2760 C  CZ3 . TRP B 2 125 ? -18.225 -42.810 1.579   1.00 93.79  ? 140 TRP B CZ3 1 
ATOM   2761 C  CH2 . TRP B 2 125 ? -18.913 -43.815 2.285   1.00 94.68  ? 140 TRP B CH2 1 
ATOM   2762 N  N   . GLU B 2 126 ? -16.344 -38.751 2.755   1.00 82.53  ? 141 GLU B N   1 
ATOM   2763 C  CA  . GLU B 2 126 ? -15.125 -39.507 2.538   1.00 88.06  ? 141 GLU B CA  1 
ATOM   2764 C  C   . GLU B 2 126 ? -14.172 -39.342 3.709   1.00 86.64  ? 141 GLU B C   1 
ATOM   2765 O  O   . GLU B 2 126 ? -13.702 -40.334 4.283   1.00 92.20  ? 141 GLU B O   1 
ATOM   2766 C  CB  . GLU B 2 126 ? -14.467 -39.017 1.242   1.00 94.14  ? 141 GLU B CB  1 
ATOM   2767 C  CG  . GLU B 2 126 ? -13.211 -39.750 0.805   1.00 103.96 ? 141 GLU B CG  1 
ATOM   2768 C  CD  . GLU B 2 126 ? -13.430 -41.236 0.584   1.00 115.47 ? 141 GLU B CD  1 
ATOM   2769 O  OE1 . GLU B 2 126 ? -14.577 -41.675 0.268   1.00 121.40 ? 141 GLU B OE1 1 
ATOM   2770 O  OE2 . GLU B 2 126 ? -12.448 -41.999 0.765   1.00 119.92 ? 141 GLU B OE2 1 
ATOM   2771 N  N   . ASP B 2 127 ? -13.926 -38.091 4.088   1.00 80.08  ? 142 ASP B N   1 
ATOM   2772 C  CA  . ASP B 2 127 ? -12.924 -37.794 5.092   1.00 74.24  ? 142 ASP B CA  1 
ATOM   2773 C  C   . ASP B 2 127 ? -13.377 -38.141 6.508   1.00 73.31  ? 142 ASP B C   1 
ATOM   2774 O  O   . ASP B 2 127 ? -12.559 -38.246 7.430   1.00 75.93  ? 142 ASP B O   1 
ATOM   2775 C  CB  . ASP B 2 127 ? -12.494 -36.333 4.972   1.00 72.54  ? 142 ASP B CB  1 
ATOM   2776 C  CG  . ASP B 2 127 ? -11.854 -36.027 3.621   1.00 73.12  ? 142 ASP B CG  1 
ATOM   2777 O  OD1 . ASP B 2 127 ? -11.326 -36.938 2.964   1.00 76.82  ? 142 ASP B OD1 1 
ATOM   2778 O  OD2 . ASP B 2 127 ? -11.872 -34.869 3.186   1.00 75.15  ? 142 ASP B OD2 1 
ATOM   2779 N  N   . CYS B 2 128 ? -14.668 -38.339 6.697   1.00 73.36  ? 143 CYS B N   1 
ATOM   2780 C  CA  . CYS B 2 128 ? -15.182 -38.671 8.021   1.00 76.67  ? 143 CYS B CA  1 
ATOM   2781 C  C   . CYS B 2 128 ? -15.475 -40.159 8.212   1.00 82.76  ? 143 CYS B C   1 
ATOM   2782 O  O   . CYS B 2 128 ? -15.824 -40.568 9.315   1.00 80.20  ? 143 CYS B O   1 
ATOM   2783 C  CB  . CYS B 2 128 ? -16.429 -37.842 8.320   1.00 76.74  ? 143 CYS B CB  1 
ATOM   2784 S  SG  . CYS B 2 128 ? -16.125 -36.096 8.691   1.00 77.06  ? 143 CYS B SG  1 
ATOM   2785 N  N   . ARG B 2 129 ? -15.301 -40.963 7.161   1.00 91.29  ? 144 ARG B N   1 
ATOM   2786 C  CA  . ARG B 2 129 ? -15.515 -42.411 7.234   1.00 102.73 ? 144 ARG B CA  1 
ATOM   2787 C  C   . ARG B 2 129 ? -14.860 -43.101 8.424   1.00 103.61 ? 144 ARG B C   1 
ATOM   2788 O  O   . ARG B 2 129 ? -15.475 -43.935 9.095   1.00 103.40 ? 144 ARG B O   1 
ATOM   2789 C  CB  . ARG B 2 129 ? -14.995 -43.081 5.965   1.00 111.36 ? 144 ARG B CB  1 
ATOM   2790 C  CG  . ARG B 2 129 ? -15.923 -42.950 4.765   1.00 120.33 ? 144 ARG B CG  1 
ATOM   2791 C  CD  . ARG B 2 129 ? -15.909 -44.256 3.996   1.00 129.90 ? 144 ARG B CD  1 
ATOM   2792 N  NE  . ARG B 2 129 ? -14.527 -44.694 3.809   1.00 134.14 ? 144 ARG B NE  1 
ATOM   2793 C  CZ  . ARG B 2 129 ? -13.717 -44.271 2.842   1.00 136.79 ? 144 ARG B CZ  1 
ATOM   2794 N  NH1 . ARG B 2 129 ? -12.477 -44.745 2.782   1.00 139.01 ? 144 ARG B NH1 1 
ATOM   2795 N  NH2 . ARG B 2 129 ? -14.131 -43.406 1.929   1.00 137.29 ? 144 ARG B NH2 1 
ATOM   2796 N  N   . MET B 2 130 ? -13.618 -42.726 8.672   1.00 104.66 ? 145 MET B N   1 
ATOM   2797 C  CA  . MET B 2 130 ? -12.800 -43.352 9.694   1.00 105.76 ? 145 MET B CA  1 
ATOM   2798 C  C   . MET B 2 130 ? -13.065 -42.825 11.083  1.00 104.17 ? 145 MET B C   1 
ATOM   2799 O  O   . MET B 2 130 ? -12.632 -43.435 12.045  1.00 102.74 ? 145 MET B O   1 
ATOM   2800 C  CB  . MET B 2 130 ? -11.328 -43.131 9.371   1.00 107.15 ? 145 MET B CB  1 
ATOM   2801 C  CG  . MET B 2 130 ? -10.905 -43.606 7.988   1.00 110.86 ? 145 MET B CG  1 
ATOM   2802 S  SD  . MET B 2 130 ? -10.862 -45.404 7.826   1.00 116.60 ? 145 MET B SD  1 
ATOM   2803 C  CE  . MET B 2 130 ? -12.592 -45.841 7.545   1.00 116.43 ? 145 MET B CE  1 
ATOM   2804 N  N   . SER B 2 131 ? -13.735 -41.679 11.193  1.00 104.49 ? 146 SER B N   1 
ATOM   2805 C  CA  . SER B 2 131 ? -14.052 -41.105 12.495  1.00 104.67 ? 146 SER B CA  1 
ATOM   2806 C  C   . SER B 2 131 ? -15.278 -41.846 13.049  1.00 106.61 ? 146 SER B C   1 
ATOM   2807 O  O   . SER B 2 131 ? -15.917 -42.616 12.317  1.00 105.50 ? 146 SER B O   1 
ATOM   2808 C  CB  . SER B 2 131 ? -14.280 -39.590 12.388  1.00 100.63 ? 146 SER B CB  1 
ATOM   2809 O  OG  . SER B 2 131 ? -13.292 -38.961 11.571  1.00 95.32  ? 146 SER B OG  1 
ATOM   2810 N  N   . TYR B 2 132 ? -15.573 -41.641 14.339  1.00 106.60 ? 147 TYR B N   1 
ATOM   2811 C  CA  . TYR B 2 132 ? -16.626 -42.387 15.044  1.00 107.50 ? 147 TYR B CA  1 
ATOM   2812 C  C   . TYR B 2 132 ? -17.720 -41.472 15.609  1.00 110.13 ? 147 TYR B C   1 
ATOM   2813 O  O   . TYR B 2 132 ? -17.432 -40.394 16.129  1.00 109.43 ? 147 TYR B O   1 
ATOM   2814 C  CB  . TYR B 2 132 ? -16.015 -43.261 16.159  1.00 110.17 ? 147 TYR B CB  1 
ATOM   2815 C  CG  . TYR B 2 132 ? -15.463 -44.590 15.654  1.00 113.14 ? 147 TYR B CG  1 
ATOM   2816 C  CD1 . TYR B 2 132 ? -14.433 -44.617 14.712  1.00 110.52 ? 147 TYR B CD1 1 
ATOM   2817 C  CD2 . TYR B 2 132 ? -15.962 -45.811 16.106  1.00 116.12 ? 147 TYR B CD2 1 
ATOM   2818 C  CE1 . TYR B 2 132 ? -13.911 -45.804 14.233  1.00 109.31 ? 147 TYR B CE1 1 
ATOM   2819 C  CE2 . TYR B 2 132 ? -15.450 -47.011 15.616  1.00 118.10 ? 147 TYR B CE2 1 
ATOM   2820 C  CZ  . TYR B 2 132 ? -14.423 -46.995 14.674  1.00 113.88 ? 147 TYR B CZ  1 
ATOM   2821 O  OH  . TYR B 2 132 ? -13.882 -48.157 14.162  1.00 111.53 ? 147 TYR B OH  1 
ATOM   2822 N  N   . THR B 2 133 ? -18.975 -41.902 15.465  1.00 114.25 ? 148 THR B N   1 
ATOM   2823 C  CA  . THR B 2 133 ? -20.134 -41.287 16.141  1.00 116.39 ? 148 THR B CA  1 
ATOM   2824 C  C   . THR B 2 133 ? -21.065 -42.377 16.705  1.00 122.10 ? 148 THR B C   1 
ATOM   2825 O  O   . THR B 2 133 ? -20.841 -43.567 16.467  1.00 128.09 ? 148 THR B O   1 
ATOM   2826 C  CB  . THR B 2 133 ? -20.922 -40.351 15.196  1.00 113.61 ? 148 THR B CB  1 
ATOM   2827 O  OG1 . THR B 2 133 ? -21.900 -39.618 15.944  1.00 111.17 ? 148 THR B OG1 1 
ATOM   2828 C  CG2 . THR B 2 133 ? -21.608 -41.124 14.070  1.00 113.80 ? 148 THR B CG2 1 
ATOM   2829 N  N   . CYS B 2 134 ? -22.089 -41.968 17.459  1.00 121.15 ? 149 CYS B N   1 
ATOM   2830 C  CA  . CYS B 2 134 ? -23.066 -42.900 18.068  1.00 121.57 ? 149 CYS B CA  1 
ATOM   2831 C  C   . CYS B 2 134 ? -24.521 -42.769 17.606  1.00 123.12 ? 149 CYS B C   1 
ATOM   2832 O  O   . CYS B 2 134 ? -25.354 -43.560 18.027  1.00 123.98 ? 149 CYS B O   1 
ATOM   2833 C  CB  . CYS B 2 134 ? -23.059 -42.732 19.586  1.00 121.79 ? 149 CYS B CB  1 
ATOM   2834 S  SG  . CYS B 2 134 ? -23.324 -41.029 20.126  1.00 118.92 ? 149 CYS B SG  1 
ATOM   2835 N  N   . LYS B 2 135 ? -24.820 -41.779 16.771  1.00 123.56 ? 150 LYS B N   1 
ATOM   2836 C  CA  . LYS B 2 135 ? -26.187 -41.451 16.365  1.00 125.06 ? 150 LYS B CA  1 
ATOM   2837 C  C   . LYS B 2 135 ? -26.192 -41.037 14.915  1.00 120.84 ? 150 LYS B C   1 
ATOM   2838 O  O   . LYS B 2 135 ? -25.180 -40.579 14.407  1.00 119.64 ? 150 LYS B O   1 
ATOM   2839 C  CB  . LYS B 2 135 ? -26.728 -40.280 17.189  1.00 127.74 ? 150 LYS B CB  1 
ATOM   2840 C  CG  . LYS B 2 135 ? -27.150 -40.652 18.600  1.00 132.67 ? 150 LYS B CG  1 
ATOM   2841 C  CD  . LYS B 2 135 ? -27.508 -39.431 19.452  1.00 134.83 ? 150 LYS B CD  1 
ATOM   2842 C  CE  . LYS B 2 135 ? -28.576 -38.511 18.850  1.00 135.16 ? 150 LYS B CE  1 
ATOM   2843 N  NZ  . LYS B 2 135 ? -29.843 -39.182 18.429  1.00 135.82 ? 150 LYS B NZ  1 
ATOM   2844 N  N   . SER B 2 136 ? -27.342 -41.175 14.263  1.00 120.65 ? 151 SER B N   1 
ATOM   2845 C  CA  . SER B 2 136 ? -27.523 -40.704 12.886  1.00 117.87 ? 151 SER B CA  1 
ATOM   2846 C  C   . SER B 2 136 ? -28.424 -39.451 12.758  1.00 117.74 ? 151 SER B C   1 
ATOM   2847 O  O   . SER B 2 136 ? -28.490 -38.844 11.681  1.00 112.46 ? 151 SER B O   1 
ATOM   2848 C  CB  . SER B 2 136 ? -28.031 -41.851 12.014  1.00 117.11 ? 151 SER B CB  1 
ATOM   2849 O  OG  . SER B 2 136 ? -29.264 -42.340 12.495  1.00 121.87 ? 151 SER B OG  1 
ATOM   2850 N  N   . ASN B 2 137 ? -29.112 -39.058 13.830  1.00 120.56 ? 152 ASN B N   1 
ATOM   2851 C  CA  . ASN B 2 137 ? -29.833 -37.792 13.833  1.00 122.27 ? 152 ASN B CA  1 
ATOM   2852 C  C   . ASN B 2 137 ? -29.310 -36.983 14.973  1.00 122.04 ? 152 ASN B C   1 
ATOM   2853 O  O   . ASN B 2 137 ? -29.739 -37.115 16.116  1.00 125.93 ? 152 ASN B O   1 
ATOM   2854 C  CB  . ASN B 2 137 ? -31.342 -37.991 13.938  1.00 126.94 ? 152 ASN B CB  1 
ATOM   2855 C  CG  . ASN B 2 137 ? -31.937 -38.553 12.665  1.00 128.94 ? 152 ASN B CG  1 
ATOM   2856 O  OD1 . ASN B 2 137 ? -32.458 -39.672 12.652  1.00 131.50 ? 152 ASN B OD1 1 
ATOM   2857 N  ND2 . ASN B 2 137 ? -31.840 -37.791 11.575  1.00 127.60 ? 152 ASN B ND2 1 
ATOM   2858 N  N   . TRP B 2 138 ? -28.349 -36.143 14.649  1.00 121.13 ? 153 TRP B N   1 
ATOM   2859 C  CA  . TRP B 2 138 ? -27.739 -35.270 15.643  1.00 125.61 ? 153 TRP B CA  1 
ATOM   2860 C  C   . TRP B 2 138 ? -28.603 -34.096 16.120  1.00 127.32 ? 153 TRP B C   1 
ATOM   2861 O  O   . TRP B 2 138 ? -28.272 -33.457 17.119  1.00 122.42 ? 153 TRP B O   1 
ATOM   2862 C  CB  . TRP B 2 138 ? -26.461 -34.704 15.073  1.00 125.81 ? 153 TRP B CB  1 
ATOM   2863 C  CG  . TRP B 2 138 ? -25.351 -35.683 14.909  1.00 127.17 ? 153 TRP B CG  1 
ATOM   2864 C  CD1 . TRP B 2 138 ? -25.415 -37.058 14.925  1.00 128.45 ? 153 TRP B CD1 1 
ATOM   2865 C  CD2 . TRP B 2 138 ? -23.986 -35.348 14.671  1.00 125.72 ? 153 TRP B CD2 1 
ATOM   2866 N  NE1 . TRP B 2 138 ? -24.161 -37.587 14.724  1.00 128.36 ? 153 TRP B NE1 1 
ATOM   2867 C  CE2 . TRP B 2 138 ? -23.265 -36.560 14.561  1.00 127.59 ? 153 TRP B CE2 1 
ATOM   2868 C  CE3 . TRP B 2 138 ? -23.297 -34.133 14.530  1.00 120.90 ? 153 TRP B CE3 1 
ATOM   2869 C  CZ2 . TRP B 2 138 ? -21.877 -36.588 14.330  1.00 124.21 ? 153 TRP B CZ2 1 
ATOM   2870 C  CZ3 . TRP B 2 138 ? -21.914 -34.161 14.314  1.00 116.74 ? 153 TRP B CZ3 1 
ATOM   2871 C  CH2 . TRP B 2 138 ? -21.225 -35.378 14.206  1.00 118.80 ? 153 TRP B CH2 1 
ATOM   2872 N  N   . ARG B 2 139 ? -29.678 -33.788 15.404  1.00 132.73 ? 154 ARG B N   1 
ATOM   2873 C  CA  . ARG B 2 139 ? -30.579 -32.709 15.818  1.00 139.50 ? 154 ARG B CA  1 
ATOM   2874 C  C   . ARG B 2 139 ? -31.199 -32.846 17.228  1.00 140.53 ? 154 ARG B C   1 
ATOM   2875 O  O   . ARG B 2 139 ? -31.573 -31.836 17.816  1.00 143.45 ? 154 ARG B O   1 
ATOM   2876 C  CB  . ARG B 2 139 ? -31.685 -32.512 14.786  1.00 146.25 ? 154 ARG B CB  1 
ATOM   2877 C  CG  . ARG B 2 139 ? -32.662 -33.670 14.696  1.00 155.05 ? 154 ARG B CG  1 
ATOM   2878 C  CD  . ARG B 2 139 ? -33.575 -33.518 13.490  1.00 161.37 ? 154 ARG B CD  1 
ATOM   2879 N  NE  . ARG B 2 139 ? -34.148 -34.798 13.076  1.00 167.34 ? 154 ARG B NE  1 
ATOM   2880 C  CZ  . ARG B 2 139 ? -35.135 -35.447 13.699  1.00 171.94 ? 154 ARG B CZ  1 
ATOM   2881 N  NH1 . ARG B 2 139 ? -35.701 -34.958 14.805  1.00 174.25 ? 154 ARG B NH1 1 
ATOM   2882 N  NH2 . ARG B 2 139 ? -35.564 -36.609 13.208  1.00 174.01 ? 154 ARG B NH2 1 
ATOM   2883 N  N   . GLY B 2 140 ? -31.320 -34.066 17.759  1.00 137.91 ? 155 GLY B N   1 
ATOM   2884 C  CA  . GLY B 2 140 ? -31.708 -34.248 19.168  1.00 134.52 ? 155 GLY B CA  1 
ATOM   2885 C  C   . GLY B 2 140 ? -31.645 -35.680 19.678  1.00 134.75 ? 155 GLY B C   1 
ATOM   2886 O  O   . GLY B 2 140 ? -31.333 -36.608 18.931  1.00 133.35 ? 155 GLY B O   1 
ATOM   2887 N  N   . GLY B 2 141 ? -31.951 -35.853 20.962  1.00 137.78 ? 156 GLY B N   1 
ATOM   2888 C  CA  . GLY B 2 141 ? -32.022 -37.179 21.594  1.00 141.12 ? 156 GLY B CA  1 
ATOM   2889 C  C   . GLY B 2 141 ? -30.715 -37.618 22.226  1.00 143.61 ? 156 GLY B C   1 
ATOM   2890 O  O   . GLY B 2 141 ? -30.381 -38.817 22.232  1.00 141.99 ? 156 GLY B O   1 
ATOM   2891 N  N   . TRP B 2 142 ? -29.997 -36.641 22.784  1.00 145.23 ? 157 TRP B N   1 
ATOM   2892 C  CA  . TRP B 2 142 ? -28.682 -36.847 23.395  1.00 148.66 ? 157 TRP B CA  1 
ATOM   2893 C  C   . TRP B 2 142 ? -28.823 -36.901 24.918  1.00 153.35 ? 157 TRP B C   1 
ATOM   2894 O  O   . TRP B 2 142 ? -29.820 -36.425 25.441  1.00 157.13 ? 157 TRP B O   1 
ATOM   2895 C  CB  . TRP B 2 142 ? -27.753 -35.688 23.005  1.00 148.41 ? 157 TRP B CB  1 
ATOM   2896 C  CG  . TRP B 2 142 ? -27.359 -35.666 21.552  1.00 143.79 ? 157 TRP B CG  1 
ATOM   2897 C  CD1 . TRP B 2 142 ? -27.986 -34.996 20.542  1.00 142.60 ? 157 TRP B CD1 1 
ATOM   2898 C  CD2 . TRP B 2 142 ? -26.238 -36.341 20.955  1.00 141.27 ? 157 TRP B CD2 1 
ATOM   2899 N  NE1 . TRP B 2 142 ? -27.331 -35.218 19.351  1.00 141.83 ? 157 TRP B NE1 1 
ATOM   2900 C  CE2 . TRP B 2 142 ? -26.252 -36.035 19.576  1.00 139.46 ? 157 TRP B CE2 1 
ATOM   2901 C  CE3 . TRP B 2 142 ? -25.217 -37.171 21.455  1.00 140.69 ? 157 TRP B CE3 1 
ATOM   2902 C  CZ2 . TRP B 2 142 ? -25.284 -36.538 18.685  1.00 135.64 ? 157 TRP B CZ2 1 
ATOM   2903 C  CZ3 . TRP B 2 142 ? -24.248 -37.673 20.566  1.00 134.79 ? 157 TRP B CZ3 1 
ATOM   2904 C  CH2 . TRP B 2 142 ? -24.297 -37.359 19.200  1.00 133.55 ? 157 TRP B CH2 1 
ATOM   2905 N  N   . ASP B 2 143 ? -27.842 -37.483 25.620  1.00 156.92 ? 158 ASP B N   1 
ATOM   2906 C  CA  . ASP B 2 143 ? -27.732 -37.355 27.090  1.00 161.53 ? 158 ASP B CA  1 
ATOM   2907 C  C   . ASP B 2 143 ? -26.990 -36.048 27.406  1.00 161.85 ? 158 ASP B C   1 
ATOM   2908 O  O   . ASP B 2 143 ? -25.795 -35.935 27.138  1.00 161.61 ? 158 ASP B O   1 
ATOM   2909 C  CB  . ASP B 2 143 ? -26.996 -38.555 27.697  1.00 162.81 ? 158 ASP B CB  1 
ATOM   2910 C  CG  . ASP B 2 143 ? -27.001 -38.551 29.222  1.00 168.48 ? 158 ASP B CG  1 
ATOM   2911 O  OD1 . ASP B 2 143 ? -27.114 -37.470 29.852  1.00 169.84 ? 158 ASP B OD1 1 
ATOM   2912 O  OD2 . ASP B 2 143 ? -26.882 -39.655 29.794  1.00 171.91 ? 158 ASP B OD2 1 
ATOM   2913 N  N   . TRP B 2 144 ? -27.691 -35.100 28.024  1.00 167.09 ? 159 TRP B N   1 
ATOM   2914 C  CA  . TRP B 2 144 ? -27.270 -33.691 28.079  1.00 167.17 ? 159 TRP B CA  1 
ATOM   2915 C  C   . TRP B 2 144 ? -26.735 -33.197 29.438  1.00 173.22 ? 159 TRP B C   1 
ATOM   2916 O  O   . TRP B 2 144 ? -26.524 -31.991 29.609  1.00 172.37 ? 159 TRP B O   1 
ATOM   2917 C  CB  . TRP B 2 144 ? -28.461 -32.818 27.637  1.00 165.84 ? 159 TRP B CB  1 
ATOM   2918 C  CG  . TRP B 2 144 ? -28.430 -32.503 26.208  1.00 159.37 ? 159 TRP B CG  1 
ATOM   2919 C  CD1 . TRP B 2 144 ? -29.188 -33.053 25.215  1.00 156.64 ? 159 TRP B CD1 1 
ATOM   2920 C  CD2 . TRP B 2 144 ? -27.578 -31.557 25.591  1.00 157.48 ? 159 TRP B CD2 1 
ATOM   2921 N  NE1 . TRP B 2 144 ? -28.861 -32.494 24.006  1.00 153.06 ? 159 TRP B NE1 1 
ATOM   2922 C  CE2 . TRP B 2 144 ? -27.866 -31.573 24.208  1.00 154.86 ? 159 TRP B CE2 1 
ATOM   2923 C  CE3 . TRP B 2 144 ? -26.590 -30.692 26.073  1.00 158.30 ? 159 TRP B CE3 1 
ATOM   2924 C  CZ2 . TRP B 2 144 ? -27.197 -30.754 23.297  1.00 153.26 ? 159 TRP B CZ2 1 
ATOM   2925 C  CZ3 . TRP B 2 144 ? -25.923 -29.875 25.171  1.00 156.42 ? 159 TRP B CZ3 1 
ATOM   2926 C  CH2 . TRP B 2 144 ? -26.231 -29.912 23.796  1.00 153.74 ? 159 TRP B CH2 1 
ATOM   2927 N  N   . SER B 2 145 ? -26.471 -34.126 30.363  1.00 178.69 ? 160 SER B N   1 
ATOM   2928 C  CA  . SER B 2 145 ? -26.306 -33.817 31.798  1.00 182.85 ? 160 SER B CA  1 
ATOM   2929 C  C   . SER B 2 145 ? -25.075 -32.982 32.181  1.00 183.59 ? 160 SER B C   1 
ATOM   2930 O  O   . SER B 2 145 ? -25.124 -32.189 33.121  1.00 181.54 ? 160 SER B O   1 
ATOM   2931 C  CB  . SER B 2 145 ? -26.282 -35.119 32.595  1.00 182.58 ? 160 SER B CB  1 
ATOM   2932 O  OG  . SER B 2 145 ? -25.277 -35.966 32.082  1.00 180.81 ? 160 SER B OG  1 
ATOM   2933 N  N   . GLN B 2 146 ? -23.979 -33.137 31.452  1.00 180.95 ? 161 GLN B N   1 
ATOM   2934 C  CA  . GLN B 2 146 ? -22.760 -32.404 31.781  1.00 179.87 ? 161 GLN B CA  1 
ATOM   2935 C  C   . GLN B 2 146 ? -22.732 -30.963 31.279  1.00 177.86 ? 161 GLN B C   1 
ATOM   2936 O  O   . GLN B 2 146 ? -21.767 -30.253 31.547  1.00 175.46 ? 161 GLN B O   1 
ATOM   2937 C  CB  . GLN B 2 146 ? -21.548 -33.185 31.270  1.00 179.44 ? 161 GLN B CB  1 
ATOM   2938 C  CG  . GLN B 2 146 ? -21.512 -34.616 31.796  1.00 183.56 ? 161 GLN B CG  1 
ATOM   2939 C  CD  . GLN B 2 146 ? -21.791 -34.694 33.290  1.00 188.87 ? 161 GLN B CD  1 
ATOM   2940 O  OE1 . GLN B 2 146 ? -21.225 -33.931 34.068  1.00 191.50 ? 161 GLN B OE1 1 
ATOM   2941 N  NE2 . GLN B 2 146 ? -22.674 -35.603 33.694  1.00 191.19 ? 161 GLN B NE2 1 
ATOM   2942 N  N   . GLY B 2 147 ? -23.785 -30.527 30.581  1.00 177.96 ? 162 GLY B N   1 
ATOM   2943 C  CA  . GLY B 2 147 ? -23.800 -29.240 29.887  1.00 176.24 ? 162 GLY B CA  1 
ATOM   2944 C  C   . GLY B 2 147 ? -23.512 -29.448 28.411  1.00 174.43 ? 162 GLY B C   1 
ATOM   2945 O  O   . GLY B 2 147 ? -23.907 -28.626 27.577  1.00 170.43 ? 162 GLY B O   1 
ATOM   2946 N  N   . LYS B 2 148 ? -22.789 -30.531 28.102  1.00 172.97 ? 163 LYS B N   1 
ATOM   2947 C  CA  . LYS B 2 148 ? -22.518 -30.971 26.743  1.00 167.77 ? 163 LYS B CA  1 
ATOM   2948 C  C   . LYS B 2 148 ? -23.158 -32.320 26.571  1.00 161.19 ? 163 LYS B C   1 
ATOM   2949 O  O   . LYS B 2 148 ? -23.207 -33.098 27.522  1.00 162.95 ? 163 LYS B O   1 
ATOM   2950 C  CB  . LYS B 2 148 ? -21.013 -31.132 26.512  1.00 170.14 ? 163 LYS B CB  1 
ATOM   2951 C  CG  . LYS B 2 148 ? -20.160 -29.949 26.947  1.00 177.39 ? 163 LYS B CG  1 
ATOM   2952 C  CD  . LYS B 2 148 ? -20.617 -28.637 26.304  1.00 184.07 ? 163 LYS B CD  1 
ATOM   2953 C  CE  . LYS B 2 148 ? -19.921 -27.388 26.856  1.00 188.50 ? 163 LYS B CE  1 
ATOM   2954 N  NZ  . LYS B 2 148 ? -18.674 -27.603 27.662  1.00 191.19 ? 163 LYS B NZ  1 
ATOM   2955 N  N   . ASN B 2 149 ? -23.639 -32.573 25.358  1.00 154.74 ? 164 ASN B N   1 
ATOM   2956 C  CA  . ASN B 2 149 ? -24.169 -33.875 24.939  1.00 150.27 ? 164 ASN B CA  1 
ATOM   2957 C  C   . ASN B 2 149 ? -23.163 -35.006 25.087  1.00 147.24 ? 164 ASN B C   1 
ATOM   2958 O  O   . ASN B 2 149 ? -22.000 -34.866 24.714  1.00 148.01 ? 164 ASN B O   1 
ATOM   2959 C  CB  . ASN B 2 149 ? -24.589 -33.826 23.460  1.00 147.10 ? 164 ASN B CB  1 
ATOM   2960 C  CG  . ASN B 2 149 ? -23.459 -33.357 22.549  1.00 141.85 ? 164 ASN B CG  1 
ATOM   2961 O  OD1 . ASN B 2 149 ? -22.750 -32.410 22.891  1.00 147.24 ? 164 ASN B OD1 1 
ATOM   2962 N  ND2 . ASN B 2 149 ? -23.265 -34.021 21.417  1.00 133.29 ? 164 ASN B ND2 1 
ATOM   2963 N  N   . ARG B 2 150 ? -23.620 -36.123 25.626  1.00 146.95 ? 165 ARG B N   1 
ATOM   2964 C  CA  . ARG B 2 150 ? -22.895 -37.372 25.545  1.00 146.80 ? 165 ARG B CA  1 
ATOM   2965 C  C   . ARG B 2 150 ? -23.823 -38.372 24.917  1.00 147.32 ? 165 ARG B C   1 
ATOM   2966 O  O   . ARG B 2 150 ? -25.039 -38.185 24.914  1.00 149.83 ? 165 ARG B O   1 
ATOM   2967 C  CB  . ARG B 2 150 ? -22.502 -37.839 26.927  1.00 151.11 ? 165 ARG B CB  1 
ATOM   2968 C  CG  . ARG B 2 150 ? -21.548 -36.881 27.619  1.00 153.74 ? 165 ARG B CG  1 
ATOM   2969 C  CD  . ARG B 2 150 ? -21.214 -37.354 29.014  1.00 158.09 ? 165 ARG B CD  1 
ATOM   2970 N  NE  . ARG B 2 150 ? -22.414 -37.443 29.846  1.00 163.86 ? 165 ARG B NE  1 
ATOM   2971 C  CZ  . ARG B 2 150 ? -22.457 -37.993 31.058  1.00 168.55 ? 165 ARG B CZ  1 
ATOM   2972 N  NH1 . ARG B 2 150 ? -21.364 -38.505 31.617  1.00 169.23 ? 165 ARG B NH1 1 
ATOM   2973 N  NH2 . ARG B 2 150 ? -23.604 -38.023 31.725  1.00 173.78 ? 165 ARG B NH2 1 
ATOM   2974 N  N   . CYS B 2 151 ? -23.259 -39.443 24.378  1.00 145.21 ? 166 CYS B N   1 
ATOM   2975 C  CA  . CYS B 2 151 ? -24.084 -40.491 23.779  1.00 143.05 ? 166 CYS B CA  1 
ATOM   2976 C  C   . CYS B 2 151 ? -25.071 -41.064 24.843  1.00 147.58 ? 166 CYS B C   1 
ATOM   2977 O  O   . CYS B 2 151 ? -24.671 -41.273 25.995  1.00 145.73 ? 166 CYS B O   1 
ATOM   2978 C  CB  . CYS B 2 151 ? -23.179 -41.559 23.135  1.00 136.07 ? 166 CYS B CB  1 
ATOM   2979 S  SG  . CYS B 2 151 ? -22.150 -40.894 21.793  1.00 121.40 ? 166 CYS B SG  1 
ATOM   2980 N  N   . PRO B 2 152 ? -26.375 -41.242 24.487  1.00 152.56 ? 167 PRO B N   1 
ATOM   2981 C  CA  . PRO B 2 152 ? -27.334 -41.752 25.485  1.00 155.63 ? 167 PRO B CA  1 
ATOM   2982 C  C   . PRO B 2 152 ? -27.054 -43.204 25.844  1.00 155.93 ? 167 PRO B C   1 
ATOM   2983 O  O   . PRO B 2 152 ? -26.251 -43.852 25.171  1.00 155.72 ? 167 PRO B O   1 
ATOM   2984 C  CB  . PRO B 2 152 ? -28.697 -41.602 24.784  1.00 157.67 ? 167 PRO B CB  1 
ATOM   2985 C  CG  . PRO B 2 152 ? -28.389 -41.632 23.330  1.00 155.37 ? 167 PRO B CG  1 
ATOM   2986 C  CD  . PRO B 2 152 ? -27.039 -40.976 23.192  1.00 153.27 ? 167 PRO B CD  1 
ATOM   2987 N  N   . LYS B 2 153 ? -27.707 -43.700 26.893  1.00 156.17 ? 168 LYS B N   1 
ATOM   2988 C  CA  . LYS B 2 153 ? -27.495 -45.070 27.372  1.00 154.83 ? 168 LYS B CA  1 
ATOM   2989 C  C   . LYS B 2 153 ? -27.509 -46.112 26.234  1.00 150.45 ? 168 LYS B C   1 
ATOM   2990 O  O   . LYS B 2 153 ? -28.485 -46.217 25.491  1.00 151.47 ? 168 LYS B O   1 
ATOM   2991 C  CB  . LYS B 2 153 ? -28.554 -45.422 28.418  1.00 160.18 ? 168 LYS B CB  1 
ATOM   2992 C  CG  . LYS B 2 153 ? -28.397 -44.695 29.748  1.00 161.06 ? 168 LYS B CG  1 
ATOM   2993 C  CD  . LYS B 2 153 ? -29.399 -45.212 30.782  1.00 163.33 ? 168 LYS B CD  1 
ATOM   2994 C  CE  . LYS B 2 153 ? -29.117 -44.660 32.171  1.00 164.33 ? 168 LYS B CE  1 
ATOM   2995 N  NZ  . LYS B 2 153 ? -30.167 -45.018 33.168  1.00 168.68 ? 168 LYS B NZ  1 
ATOM   2996 N  N   . GLY B 2 154 ? -26.407 -46.844 26.086  1.00 146.30 ? 169 GLY B N   1 
ATOM   2997 C  CA  . GLY B 2 154 ? -26.308 -47.924 25.105  1.00 147.11 ? 169 GLY B CA  1 
ATOM   2998 C  C   . GLY B 2 154 ? -26.115 -47.552 23.637  1.00 146.29 ? 169 GLY B C   1 
ATOM   2999 O  O   . GLY B 2 154 ? -26.172 -48.430 22.771  1.00 146.28 ? 169 GLY B O   1 
ATOM   3000 N  N   . ALA B 2 155 ? -25.874 -46.274 23.338  1.00 147.50 ? 170 ALA B N   1 
ATOM   3001 C  CA  . ALA B 2 155 ? -25.587 -45.838 21.958  1.00 144.95 ? 170 ALA B CA  1 
ATOM   3002 C  C   . ALA B 2 155 ? -24.122 -46.158 21.561  1.00 143.37 ? 170 ALA B C   1 
ATOM   3003 O  O   . ALA B 2 155 ? -23.165 -45.585 22.103  1.00 139.25 ? 170 ALA B O   1 
ATOM   3004 C  CB  . ALA B 2 155 ? -25.898 -44.352 21.786  1.00 141.78 ? 170 ALA B CB  1 
ATOM   3005 N  N   . GLN B 2 156 ? -23.977 -47.071 20.601  1.00 142.15 ? 171 GLN B N   1 
ATOM   3006 C  CA  . GLN B 2 156 ? -22.673 -47.625 20.199  1.00 138.81 ? 171 GLN B CA  1 
ATOM   3007 C  C   . GLN B 2 156 ? -21.850 -46.694 19.316  1.00 131.00 ? 171 GLN B C   1 
ATOM   3008 O  O   . GLN B 2 156 ? -22.362 -46.168 18.328  1.00 127.69 ? 171 GLN B O   1 
ATOM   3009 C  CB  . GLN B 2 156 ? -22.869 -48.919 19.402  1.00 144.46 ? 171 GLN B CB  1 
ATOM   3010 C  CG  . GLN B 2 156 ? -23.051 -50.188 20.212  1.00 148.92 ? 171 GLN B CG  1 
ATOM   3011 C  CD  . GLN B 2 156 ? -22.379 -51.350 19.520  1.00 149.72 ? 171 GLN B CD  1 
ATOM   3012 O  OE1 . GLN B 2 156 ? -22.843 -51.821 18.477  1.00 149.42 ? 171 GLN B OE1 1 
ATOM   3013 N  NE2 . GLN B 2 156 ? -21.241 -51.778 20.058  1.00 149.56 ? 171 GLN B NE2 1 
ATOM   3014 N  N   . CYS B 2 157 ? -20.567 -46.535 19.637  1.00 127.31 ? 172 CYS B N   1 
ATOM   3015 C  CA  . CYS B 2 157 ? -19.671 -45.718 18.821  1.00 120.29 ? 172 CYS B CA  1 
ATOM   3016 C  C   . CYS B 2 157 ? -19.193 -46.535 17.660  1.00 121.01 ? 172 CYS B C   1 
ATOM   3017 O  O   . CYS B 2 157 ? -18.637 -47.592 17.868  1.00 127.43 ? 172 CYS B O   1 
ATOM   3018 C  CB  . CYS B 2 157 ? -18.502 -45.220 19.642  1.00 115.70 ? 172 CYS B CB  1 
ATOM   3019 S  SG  . CYS B 2 157 ? -19.053 -43.916 20.754  1.00 117.78 ? 172 CYS B SG  1 
ATOM   3020 N  N   . LEU B 2 158 ? -19.438 -46.070 16.440  1.00 119.31 ? 173 LEU B N   1 
ATOM   3021 C  CA  . LEU B 2 158 ? -19.141 -46.853 15.232  1.00 119.68 ? 173 LEU B CA  1 
ATOM   3022 C  C   . LEU B 2 158 ? -18.726 -45.892 14.130  1.00 110.91 ? 173 LEU B C   1 
ATOM   3023 O  O   . LEU B 2 158 ? -18.933 -44.686 14.276  1.00 103.16 ? 173 LEU B O   1 
ATOM   3024 C  CB  . LEU B 2 158 ? -20.375 -47.688 14.794  1.00 126.96 ? 173 LEU B CB  1 
ATOM   3025 C  CG  . LEU B 2 158 ? -21.033 -48.659 15.798  1.00 133.10 ? 173 LEU B CG  1 
ATOM   3026 C  CD1 . LEU B 2 158 ? -22.369 -49.181 15.267  1.00 135.20 ? 173 LEU B CD1 1 
ATOM   3027 C  CD2 . LEU B 2 158 ? -20.125 -49.835 16.143  1.00 134.37 ? 173 LEU B CD2 1 
ATOM   3028 N  N   . PRO B 2 159 ? -18.146 -46.413 13.019  1.00 111.12 ? 174 PRO B N   1 
ATOM   3029 C  CA  . PRO B 2 159 ? -17.807 -45.519 11.906  1.00 109.59 ? 174 PRO B CA  1 
ATOM   3030 C  C   . PRO B 2 159 ? -18.963 -44.649 11.447  1.00 110.29 ? 174 PRO B C   1 
ATOM   3031 O  O   . PRO B 2 159 ? -20.100 -45.110 11.374  1.00 116.07 ? 174 PRO B O   1 
ATOM   3032 C  CB  . PRO B 2 159 ? -17.419 -46.484 10.769  1.00 107.09 ? 174 PRO B CB  1 
ATOM   3033 C  CG  . PRO B 2 159 ? -16.921 -47.685 11.469  1.00 108.30 ? 174 PRO B CG  1 
ATOM   3034 C  CD  . PRO B 2 159 ? -17.791 -47.811 12.695  1.00 111.41 ? 174 PRO B CD  1 
ATOM   3035 N  N   . PHE B 2 160 ? -18.655 -43.401 11.138  1.00 108.13 ? 175 PHE B N   1 
ATOM   3036 C  CA  . PHE B 2 160 ? -19.581 -42.519 10.452  1.00 105.19 ? 175 PHE B CA  1 
ATOM   3037 C  C   . PHE B 2 160 ? -20.281 -43.229 9.272   1.00 111.25 ? 175 PHE B C   1 
ATOM   3038 O  O   . PHE B 2 160 ? -21.485 -43.077 9.107   1.00 112.40 ? 175 PHE B O   1 
ATOM   3039 C  CB  . PHE B 2 160 ? -18.824 -41.297 9.923   1.00 100.18 ? 175 PHE B CB  1 
ATOM   3040 C  CG  . PHE B 2 160 ? -18.732 -40.138 10.892  1.00 92.85  ? 175 PHE B CG  1 
ATOM   3041 C  CD1 . PHE B 2 160 ? -18.247 -40.280 12.178  1.00 91.53  ? 175 PHE B CD1 1 
ATOM   3042 C  CD2 . PHE B 2 160 ? -19.103 -38.875 10.478  1.00 91.82  ? 175 PHE B CD2 1 
ATOM   3043 C  CE1 . PHE B 2 160 ? -18.171 -39.181 13.030  1.00 90.64  ? 175 PHE B CE1 1 
ATOM   3044 C  CE2 . PHE B 2 160 ? -19.008 -37.780 11.316  1.00 89.12  ? 175 PHE B CE2 1 
ATOM   3045 C  CZ  . PHE B 2 160 ? -18.545 -37.929 12.592  1.00 88.55  ? 175 PHE B CZ  1 
ATOM   3046 N  N   . SER B 2 161 ? -19.548 -44.012 8.464   1.00 116.38 ? 176 SER B N   1 
ATOM   3047 C  CA  . SER B 2 161 ? -20.181 -44.746 7.336   1.00 119.14 ? 176 SER B CA  1 
ATOM   3048 C  C   . SER B 2 161 ? -21.296 -45.729 7.776   1.00 121.14 ? 176 SER B C   1 
ATOM   3049 O  O   . SER B 2 161 ? -22.210 -46.011 6.999   1.00 125.58 ? 176 SER B O   1 
ATOM   3050 C  CB  . SER B 2 161 ? -19.144 -45.434 6.424   1.00 120.55 ? 176 SER B CB  1 
ATOM   3051 O  OG  . SER B 2 161 ? -18.296 -46.331 7.125   1.00 127.14 ? 176 SER B OG  1 
ATOM   3052 N  N   . HIS B 2 162 ? -21.250 -46.226 9.011   1.00 119.73 ? 177 HIS B N   1 
ATOM   3053 C  CA  . HIS B 2 162 ? -22.403 -46.956 9.565   1.00 122.34 ? 177 HIS B CA  1 
ATOM   3054 C  C   . HIS B 2 162 ? -23.622 -46.033 9.769   1.00 120.61 ? 177 HIS B C   1 
ATOM   3055 O  O   . HIS B 2 162 ? -24.684 -46.334 9.239   1.00 129.37 ? 177 HIS B O   1 
ATOM   3056 C  CB  . HIS B 2 162 ? -22.052 -47.711 10.864  1.00 124.22 ? 177 HIS B CB  1 
ATOM   3057 C  CG  . HIS B 2 162 ? -23.242 -48.271 11.587  1.00 125.06 ? 177 HIS B CG  1 
ATOM   3058 N  ND1 . HIS B 2 162 ? -23.834 -49.466 11.241  1.00 127.28 ? 177 HIS B ND1 1 
ATOM   3059 C  CD2 . HIS B 2 162 ? -23.940 -47.796 12.646  1.00 125.93 ? 177 HIS B CD2 1 
ATOM   3060 C  CE1 . HIS B 2 162 ? -24.853 -49.699 12.049  1.00 129.31 ? 177 HIS B CE1 1 
ATOM   3061 N  NE2 . HIS B 2 162 ? -24.942 -48.699 12.907  1.00 128.59 ? 177 HIS B NE2 1 
ATOM   3062 N  N   . TYR B 2 163 ? -23.481 -44.939 10.523  1.00 109.96 ? 178 TYR B N   1 
ATOM   3063 C  CA  . TYR B 2 163 ? -24.633 -44.097 10.899  1.00 105.10 ? 178 TYR B CA  1 
ATOM   3064 C  C   . TYR B 2 163 ? -25.130 -43.193 9.789   1.00 105.30 ? 178 TYR B C   1 
ATOM   3065 O  O   . TYR B 2 163 ? -26.313 -42.820 9.756   1.00 102.65 ? 178 TYR B O   1 
ATOM   3066 C  CB  . TYR B 2 163 ? -24.296 -43.245 12.112  1.00 101.45 ? 178 TYR B CB  1 
ATOM   3067 C  CG  . TYR B 2 163 ? -24.306 -44.049 13.353  1.00 100.60 ? 178 TYR B CG  1 
ATOM   3068 C  CD1 . TYR B 2 163 ? -23.138 -44.496 13.935  1.00 98.52  ? 178 TYR B CD1 1 
ATOM   3069 C  CD2 . TYR B 2 163 ? -25.506 -44.394 13.936  1.00 106.01 ? 178 TYR B CD2 1 
ATOM   3070 C  CE1 . TYR B 2 163 ? -23.168 -45.242 15.094  1.00 101.68 ? 178 TYR B CE1 1 
ATOM   3071 C  CE2 . TYR B 2 163 ? -25.551 -45.154 15.086  1.00 107.32 ? 178 TYR B CE2 1 
ATOM   3072 C  CZ  . TYR B 2 163 ? -24.379 -45.589 15.651  1.00 105.08 ? 178 TYR B CZ  1 
ATOM   3073 O  OH  . TYR B 2 163 ? -24.435 -46.340 16.788  1.00 102.95 ? 178 TYR B OH  1 
ATOM   3074 N  N   . PHE B 2 164 ? -24.210 -42.833 8.898   1.00 105.19 ? 179 PHE B N   1 
ATOM   3075 C  CA  . PHE B 2 164 ? -24.508 -42.054 7.705   1.00 105.87 ? 179 PHE B CA  1 
ATOM   3076 C  C   . PHE B 2 164 ? -24.072 -42.878 6.485   1.00 108.87 ? 179 PHE B C   1 
ATOM   3077 O  O   . PHE B 2 164 ? -23.000 -42.653 5.906   1.00 108.21 ? 179 PHE B O   1 
ATOM   3078 C  CB  . PHE B 2 164 ? -23.766 -40.715 7.737   1.00 103.10 ? 179 PHE B CB  1 
ATOM   3079 C  CG  . PHE B 2 164 ? -23.957 -39.928 9.000   1.00 101.08 ? 179 PHE B CG  1 
ATOM   3080 C  CD1 . PHE B 2 164 ? -22.928 -39.822 9.945   1.00 101.63 ? 179 PHE B CD1 1 
ATOM   3081 C  CD2 . PHE B 2 164 ? -25.139 -39.262 9.231   1.00 102.32 ? 179 PHE B CD2 1 
ATOM   3082 C  CE1 . PHE B 2 164 ? -23.092 -39.083 11.100  1.00 101.65 ? 179 PHE B CE1 1 
ATOM   3083 C  CE2 . PHE B 2 164 ? -25.315 -38.521 10.389  1.00 104.04 ? 179 PHE B CE2 1 
ATOM   3084 C  CZ  . PHE B 2 164 ? -24.292 -38.433 11.326  1.00 102.95 ? 179 PHE B CZ  1 
ATOM   3085 N  N   . PRO B 2 165 ? -24.903 -43.853 6.084   1.00 114.53 ? 180 PRO B N   1 
ATOM   3086 C  CA  . PRO B 2 165 ? -24.510 -44.698 4.960   1.00 112.78 ? 180 PRO B CA  1 
ATOM   3087 C  C   . PRO B 2 165 ? -24.157 -43.911 3.712   1.00 108.42 ? 180 PRO B C   1 
ATOM   3088 O  O   . PRO B 2 165 ? -23.337 -44.368 2.927   1.00 107.57 ? 180 PRO B O   1 
ATOM   3089 C  CB  . PRO B 2 165 ? -25.758 -45.544 4.702   1.00 118.07 ? 180 PRO B CB  1 
ATOM   3090 C  CG  . PRO B 2 165 ? -26.500 -45.549 5.992   1.00 120.08 ? 180 PRO B CG  1 
ATOM   3091 C  CD  . PRO B 2 165 ? -26.241 -44.209 6.599   1.00 117.53 ? 180 PRO B CD  1 
ATOM   3092 N  N   . THR B 2 166 ? -24.772 -42.747 3.527   1.00 105.74 ? 181 THR B N   1 
ATOM   3093 C  CA  . THR B 2 166 ? -24.488 -41.931 2.365   1.00 104.86 ? 181 THR B CA  1 
ATOM   3094 C  C   . THR B 2 166 ? -24.044 -40.531 2.742   1.00 100.62 ? 181 THR B C   1 
ATOM   3095 O  O   . THR B 2 166 ? -24.417 -40.016 3.809   1.00 97.78  ? 181 THR B O   1 
ATOM   3096 C  CB  . THR B 2 166 ? -25.715 -41.781 1.441   1.00 105.92 ? 181 THR B CB  1 
ATOM   3097 O  OG1 . THR B 2 166 ? -26.767 -41.097 2.135   1.00 106.41 ? 181 THR B OG1 1 
ATOM   3098 C  CG2 . THR B 2 166 ? -26.200 -43.130 0.974   1.00 109.84 ? 181 THR B CG2 1 
ATOM   3099 N  N   . PRO B 2 167 ? -23.279 -39.895 1.833   1.00 96.61  ? 182 PRO B N   1 
ATOM   3100 C  CA  . PRO B 2 167 ? -22.993 -38.479 1.942   1.00 94.95  ? 182 PRO B CA  1 
ATOM   3101 C  C   . PRO B 2 167 ? -24.233 -37.653 2.273   1.00 96.52  ? 182 PRO B C   1 
ATOM   3102 O  O   . PRO B 2 167 ? -24.187 -36.787 3.145   1.00 94.91  ? 182 PRO B O   1 
ATOM   3103 C  CB  . PRO B 2 167 ? -22.462 -38.132 0.549   1.00 94.19  ? 182 PRO B CB  1 
ATOM   3104 C  CG  . PRO B 2 167 ? -21.822 -39.390 0.060   1.00 92.21  ? 182 PRO B CG  1 
ATOM   3105 C  CD  . PRO B 2 167 ? -22.586 -40.514 0.679   1.00 94.35  ? 182 PRO B CD  1 
ATOM   3106 N  N   . ALA B 2 168 ? -25.338 -37.952 1.596   1.00 102.52 ? 183 ALA B N   1 
ATOM   3107 C  CA  . ALA B 2 168 ? -26.601 -37.252 1.832   1.00 103.18 ? 183 ALA B CA  1 
ATOM   3108 C  C   . ALA B 2 168 ? -27.014 -37.297 3.295   1.00 103.65 ? 183 ALA B C   1 
ATOM   3109 O  O   . ALA B 2 168 ? -27.375 -36.276 3.858   1.00 106.17 ? 183 ALA B O   1 
ATOM   3110 C  CB  . ALA B 2 168 ? -27.698 -37.811 0.942   1.00 105.01 ? 183 ALA B CB  1 
ATOM   3111 N  N   . ASP B 2 169 ? -26.911 -38.460 3.922   1.00 105.75 ? 184 ASP B N   1 
ATOM   3112 C  CA  . ASP B 2 169 ? -27.273 -38.577 5.332   1.00 109.99 ? 184 ASP B CA  1 
ATOM   3113 C  C   . ASP B 2 169 ? -26.476 -37.608 6.185   1.00 110.27 ? 184 ASP B C   1 
ATOM   3114 O  O   . ASP B 2 169 ? -27.028 -36.957 7.085   1.00 114.63 ? 184 ASP B O   1 
ATOM   3115 C  CB  . ASP B 2 169 ? -27.040 -39.994 5.836   1.00 113.44 ? 184 ASP B CB  1 
ATOM   3116 C  CG  . ASP B 2 169 ? -27.859 -40.992 5.096   1.00 120.38 ? 184 ASP B CG  1 
ATOM   3117 O  OD1 . ASP B 2 169 ? -29.095 -40.849 5.106   1.00 132.79 ? 184 ASP B OD1 1 
ATOM   3118 O  OD2 . ASP B 2 169 ? -27.281 -41.892 4.470   1.00 120.02 ? 184 ASP B OD2 1 
ATOM   3119 N  N   . LEU B 2 170 ? -25.183 -37.511 5.879   1.00 106.14 ? 185 LEU B N   1 
ATOM   3120 C  CA  . LEU B 2 170 ? -24.246 -36.709 6.660   1.00 103.75 ? 185 LEU B CA  1 
ATOM   3121 C  C   . LEU B 2 170 ? -24.532 -35.228 6.557   1.00 96.21  ? 185 LEU B C   1 
ATOM   3122 O  O   . LEU B 2 170 ? -24.663 -34.549 7.567   1.00 94.95  ? 185 LEU B O   1 
ATOM   3123 C  CB  . LEU B 2 170 ? -22.805 -36.986 6.203   1.00 106.23 ? 185 LEU B CB  1 
ATOM   3124 C  CG  . LEU B 2 170 ? -21.643 -36.299 6.939   1.00 104.56 ? 185 LEU B CG  1 
ATOM   3125 C  CD1 . LEU B 2 170 ? -21.802 -36.407 8.449   1.00 103.85 ? 185 LEU B CD1 1 
ATOM   3126 C  CD2 . LEU B 2 170 ? -20.321 -36.900 6.475   1.00 105.41 ? 185 LEU B CD2 1 
ATOM   3127 N  N   . CYS B 2 171 ? -24.619 -34.749 5.324   1.00 92.52  ? 186 CYS B N   1 
ATOM   3128 C  CA  . CYS B 2 171 ? -24.901 -33.351 5.046   1.00 90.52  ? 186 CYS B CA  1 
ATOM   3129 C  C   . CYS B 2 171 ? -26.153 -32.862 5.687   1.00 94.05  ? 186 CYS B C   1 
ATOM   3130 O  O   . CYS B 2 171 ? -26.210 -31.746 6.205   1.00 92.67  ? 186 CYS B O   1 
ATOM   3131 C  CB  . CYS B 2 171 ? -25.031 -33.125 3.548   1.00 88.97  ? 186 CYS B CB  1 
ATOM   3132 S  SG  . CYS B 2 171 ? -23.434 -32.640 2.920   1.00 84.74  ? 186 CYS B SG  1 
ATOM   3133 N  N   . GLU B 2 172 ? -27.165 -33.713 5.642   1.00 98.98  ? 187 GLU B N   1 
ATOM   3134 C  CA  . GLU B 2 172 ? -28.505 -33.302 5.989   1.00 101.44 ? 187 GLU B CA  1 
ATOM   3135 C  C   . GLU B 2 172 ? -28.727 -33.384 7.485   1.00 102.65 ? 187 GLU B C   1 
ATOM   3136 O  O   . GLU B 2 172 ? -29.151 -32.400 8.086   1.00 101.92 ? 187 GLU B O   1 
ATOM   3137 C  CB  . GLU B 2 172 ? -29.519 -34.113 5.172   1.00 102.87 ? 187 GLU B CB  1 
ATOM   3138 C  CG  . GLU B 2 172 ? -29.391 -33.784 3.683   1.00 101.60 ? 187 GLU B CG  1 
ATOM   3139 C  CD  . GLU B 2 172 ? -30.309 -34.545 2.762   1.00 101.35 ? 187 GLU B CD  1 
ATOM   3140 O  OE1 . GLU B 2 172 ? -31.007 -35.486 3.206   1.00 107.69 ? 187 GLU B OE1 1 
ATOM   3141 O  OE2 . GLU B 2 172 ? -30.323 -34.164 1.573   1.00 95.50  ? 187 GLU B OE2 1 
ATOM   3142 N  N   . LYS B 2 173 ? -28.377 -34.520 8.088   1.00 103.93 ? 188 LYS B N   1 
ATOM   3143 C  CA  . LYS B 2 173 ? -28.812 -34.829 9.461   1.00 108.52 ? 188 LYS B CA  1 
ATOM   3144 C  C   . LYS B 2 173 ? -27.974 -34.260 10.603  1.00 110.67 ? 188 LYS B C   1 
ATOM   3145 O  O   . LYS B 2 173 ? -28.507 -34.025 11.700  1.00 116.15 ? 188 LYS B O   1 
ATOM   3146 C  CB  . LYS B 2 173 ? -28.967 -36.334 9.627   1.00 109.46 ? 188 LYS B CB  1 
ATOM   3147 C  CG  . LYS B 2 173 ? -30.145 -36.827 8.821   1.00 112.82 ? 188 LYS B CG  1 
ATOM   3148 C  CD  . LYS B 2 173 ? -30.155 -38.315 8.587   1.00 115.27 ? 188 LYS B CD  1 
ATOM   3149 C  CE  . LYS B 2 173 ? -31.289 -38.650 7.641   1.00 115.39 ? 188 LYS B CE  1 
ATOM   3150 N  NZ  . LYS B 2 173 ? -31.673 -40.065 7.804   1.00 119.09 ? 188 LYS B NZ  1 
ATOM   3151 N  N   . THR B 2 174 ? -26.687 -34.013 10.356  1.00 108.24 ? 189 THR B N   1 
ATOM   3152 C  CA  . THR B 2 174 ? -25.812 -33.427 11.385  1.00 105.03 ? 189 THR B CA  1 
ATOM   3153 C  C   . THR B 2 174 ? -26.259 -32.050 11.831  1.00 105.83 ? 189 THR B C   1 
ATOM   3154 O  O   . THR B 2 174 ? -26.080 -31.685 12.992  1.00 104.28 ? 189 THR B O   1 
ATOM   3155 C  CB  . THR B 2 174 ? -24.345 -33.324 10.936  1.00 101.07 ? 189 THR B CB  1 
ATOM   3156 O  OG1 . THR B 2 174 ? -24.247 -32.655 9.664   1.00 94.77  ? 189 THR B OG1 1 
ATOM   3157 C  CG2 . THR B 2 174 ? -23.762 -34.705 10.855  1.00 103.47 ? 189 THR B CG2 1 
ATOM   3158 N  N   . TRP B 2 175 ? -26.864 -31.310 10.911  1.00 107.50 ? 190 TRP B N   1 
ATOM   3159 C  CA  . TRP B 2 175 ? -27.151 -29.908 11.110  1.00 109.01 ? 190 TRP B CA  1 
ATOM   3160 C  C   . TRP B 2 175 ? -28.641 -29.659 11.030  1.00 108.29 ? 190 TRP B C   1 
ATOM   3161 O  O   . TRP B 2 175 ? -29.075 -28.578 10.623  1.00 108.57 ? 190 TRP B O   1 
ATOM   3162 C  CB  . TRP B 2 175 ? -26.397 -29.105 10.045  1.00 111.72 ? 190 TRP B CB  1 
ATOM   3163 C  CG  . TRP B 2 175 ? -24.997 -28.643 10.442  1.00 113.95 ? 190 TRP B CG  1 
ATOM   3164 C  CD1 . TRP B 2 175 ? -23.805 -29.366 10.424  1.00 111.71 ? 190 TRP B CD1 1 
ATOM   3165 C  CD2 . TRP B 2 175 ? -24.653 -27.326 10.863  1.00 114.04 ? 190 TRP B CD2 1 
ATOM   3166 N  NE1 . TRP B 2 175 ? -22.757 -28.564 10.835  1.00 106.27 ? 190 TRP B NE1 1 
ATOM   3167 C  CE2 . TRP B 2 175 ? -23.250 -27.311 11.106  1.00 111.07 ? 190 TRP B CE2 1 
ATOM   3168 C  CE3 . TRP B 2 175 ? -25.402 -26.150 11.070  1.00 112.74 ? 190 TRP B CE3 1 
ATOM   3169 C  CZ2 . TRP B 2 175 ? -22.592 -26.165 11.539  1.00 113.51 ? 190 TRP B CZ2 1 
ATOM   3170 C  CZ3 . TRP B 2 175 ? -24.749 -25.018 11.496  1.00 114.28 ? 190 TRP B CZ3 1 
ATOM   3171 C  CH2 . TRP B 2 175 ? -23.352 -25.029 11.733  1.00 115.37 ? 190 TRP B CH2 1 
ATOM   3172 N  N   . SER B 2 176 ? -29.428 -30.661 11.418  1.00 108.88 ? 191 SER B N   1 
ATOM   3173 C  CA  . SER B 2 176 ? -30.863 -30.486 11.527  1.00 110.38 ? 191 SER B CA  1 
ATOM   3174 C  C   . SER B 2 176 ? -31.507 -30.008 10.205  1.00 105.33 ? 191 SER B C   1 
ATOM   3175 O  O   . SER B 2 176 ? -32.350 -29.116 10.209  1.00 104.11 ? 191 SER B O   1 
ATOM   3176 C  CB  . SER B 2 176 ? -31.121 -29.486 12.661  1.00 112.94 ? 191 SER B CB  1 
ATOM   3177 O  OG  . SER B 2 176 ? -32.437 -29.582 13.123  1.00 121.69 ? 191 SER B OG  1 
ATOM   3178 N  N   . ASN B 2 177 ? -31.072 -30.588 9.084   1.00 101.36 ? 192 ASN B N   1 
ATOM   3179 C  CA  . ASN B 2 177 ? -31.556 -30.232 7.724   1.00 99.92  ? 192 ASN B CA  1 
ATOM   3180 C  C   . ASN B 2 177 ? -31.375 -28.762 7.325   1.00 97.05  ? 192 ASN B C   1 
ATOM   3181 O  O   . ASN B 2 177 ? -32.165 -28.185 6.562   1.00 95.57  ? 192 ASN B O   1 
ATOM   3182 C  CB  . ASN B 2 177 ? -33.003 -30.687 7.536   1.00 101.07 ? 192 ASN B CB  1 
ATOM   3183 C  CG  . ASN B 2 177 ? -33.195 -32.140 7.920   1.00 101.94 ? 192 ASN B CG  1 
ATOM   3184 O  OD1 . ASN B 2 177 ? -32.878 -33.043 7.146   1.00 101.79 ? 192 ASN B OD1 1 
ATOM   3185 N  ND2 . ASN B 2 177 ? -33.676 -32.378 9.134   1.00 102.41 ? 192 ASN B ND2 1 
ATOM   3186 N  N   . SER B 2 178 ? -30.306 -28.174 7.847   1.00 95.00  ? 193 SER B N   1 
ATOM   3187 C  CA  . SER B 2 178 ? -29.826 -26.897 7.366   1.00 95.12  ? 193 SER B CA  1 
ATOM   3188 C  C   . SER B 2 178 ? -29.336 -27.036 5.913   1.00 93.78  ? 193 SER B C   1 
ATOM   3189 O  O   . SER B 2 178 ? -29.504 -26.126 5.089   1.00 91.13  ? 193 SER B O   1 
ATOM   3190 C  CB  . SER B 2 178 ? -28.708 -26.379 8.281   1.00 96.58  ? 193 SER B CB  1 
ATOM   3191 O  OG  . SER B 2 178 ? -29.206 -26.027 9.574   1.00 99.34  ? 193 SER B OG  1 
ATOM   3192 N  N   . PHE B 2 179 ? -28.756 -28.188 5.594   1.00 93.51  ? 194 PHE B N   1 
ATOM   3193 C  CA  . PHE B 2 179 ? -28.289 -28.462 4.251   1.00 92.95  ? 194 PHE B CA  1 
ATOM   3194 C  C   . PHE B 2 179 ? -29.077 -29.593 3.605   1.00 94.78  ? 194 PHE B C   1 
ATOM   3195 O  O   . PHE B 2 179 ? -29.544 -30.510 4.279   1.00 97.65  ? 194 PHE B O   1 
ATOM   3196 C  CB  . PHE B 2 179 ? -26.809 -28.838 4.274   1.00 93.81  ? 194 PHE B CB  1 
ATOM   3197 C  CG  . PHE B 2 179 ? -25.967 -27.933 5.120   1.00 92.92  ? 194 PHE B CG  1 
ATOM   3198 C  CD1 . PHE B 2 179 ? -25.935 -26.571 4.871   1.00 92.60  ? 194 PHE B CD1 1 
ATOM   3199 C  CD2 . PHE B 2 179 ? -25.204 -28.444 6.170   1.00 95.55  ? 194 PHE B CD2 1 
ATOM   3200 C  CE1 . PHE B 2 179 ? -25.156 -25.724 5.647   1.00 93.17  ? 194 PHE B CE1 1 
ATOM   3201 C  CE2 . PHE B 2 179 ? -24.426 -27.604 6.957   1.00 94.63  ? 194 PHE B CE2 1 
ATOM   3202 C  CZ  . PHE B 2 179 ? -24.398 -26.240 6.691   1.00 93.96  ? 194 PHE B CZ  1 
ATOM   3203 N  N   . LYS B 2 180 ? -29.182 -29.507 2.284   1.00 94.43  ? 195 LYS B N   1 
ATOM   3204 C  CA  . LYS B 2 180 ? -29.745 -30.531 1.431   1.00 98.12  ? 195 LYS B CA  1 
ATOM   3205 C  C   . LYS B 2 180 ? -28.578 -30.993 0.569   1.00 94.30  ? 195 LYS B C   1 
ATOM   3206 O  O   . LYS B 2 180 ? -27.882 -30.164 -0.025  1.00 92.73  ? 195 LYS B O   1 
ATOM   3207 C  CB  . LYS B 2 180 ? -30.825 -29.911 0.526   1.00 103.27 ? 195 LYS B CB  1 
ATOM   3208 C  CG  . LYS B 2 180 ? -32.191 -30.568 0.595   1.00 108.82 ? 195 LYS B CG  1 
ATOM   3209 C  CD  . LYS B 2 180 ? -32.250 -32.029 0.161   1.00 111.20 ? 195 LYS B CD  1 
ATOM   3210 C  CE  . LYS B 2 180 ? -33.222 -32.779 1.084   1.00 116.50 ? 195 LYS B CE  1 
ATOM   3211 N  NZ  . LYS B 2 180 ? -33.695 -34.099 0.599   1.00 118.97 ? 195 LYS B NZ  1 
ATOM   3212 N  N   . ALA B 2 181 ? -28.351 -32.299 0.500   1.00 90.22  ? 196 ALA B N   1 
ATOM   3213 C  CA  . ALA B 2 181 ? -27.388 -32.834 -0.438  1.00 87.03  ? 196 ALA B CA  1 
ATOM   3214 C  C   . ALA B 2 181 ? -28.013 -32.742 -1.811  1.00 87.93  ? 196 ALA B C   1 
ATOM   3215 O  O   . ALA B 2 181 ? -29.035 -33.334 -2.052  1.00 91.91  ? 196 ALA B O   1 
ATOM   3216 C  CB  . ALA B 2 181 ? -27.056 -34.266 -0.095  1.00 86.81  ? 196 ALA B CB  1 
ATOM   3217 N  N   . SER B 2 182 ? -27.407 -31.972 -2.697  1.00 91.93  ? 197 SER B N   1 
ATOM   3218 C  CA  . SER B 2 182 ? -27.931 -31.748 -4.030  1.00 92.63  ? 197 SER B CA  1 
ATOM   3219 C  C   . SER B 2 182 ? -27.352 -32.785 -4.962  1.00 94.75  ? 197 SER B C   1 
ATOM   3220 O  O   . SER B 2 182 ? -26.165 -33.084 -4.880  1.00 92.70  ? 197 SER B O   1 
ATOM   3221 C  CB  . SER B 2 182 ? -27.506 -30.370 -4.535  1.00 93.80  ? 197 SER B CB  1 
ATOM   3222 O  OG  . SER B 2 182 ? -27.958 -30.153 -5.859  1.00 94.99  ? 197 SER B OG  1 
ATOM   3223 N  N   . PRO B 2 183 ? -28.171 -33.306 -5.890  1.00 100.22 ? 198 PRO B N   1 
ATOM   3224 C  CA  . PRO B 2 183 ? -27.555 -34.088 -6.957  1.00 97.92  ? 198 PRO B CA  1 
ATOM   3225 C  C   . PRO B 2 183 ? -26.685 -33.223 -7.852  1.00 94.21  ? 198 PRO B C   1 
ATOM   3226 O  O   . PRO B 2 183 ? -25.766 -33.758 -8.434  1.00 93.29  ? 198 PRO B O   1 
ATOM   3227 C  CB  . PRO B 2 183 ? -28.743 -34.583 -7.745  1.00 103.89 ? 198 PRO B CB  1 
ATOM   3228 C  CG  . PRO B 2 183 ? -29.755 -33.487 -7.590  1.00 105.56 ? 198 PRO B CG  1 
ATOM   3229 C  CD  . PRO B 2 183 ? -29.602 -33.053 -6.158  1.00 102.21 ? 198 PRO B CD  1 
ATOM   3230 N  N   . GLU B 2 184 ? -26.967 -31.911 -7.950  1.00 90.36  ? 199 GLU B N   1 
ATOM   3231 C  CA  . GLU B 2 184 ? -26.122 -30.984 -8.719  1.00 90.26  ? 199 GLU B CA  1 
ATOM   3232 C  C   . GLU B 2 184 ? -24.676 -30.941 -8.201  1.00 88.34  ? 199 GLU B C   1 
ATOM   3233 O  O   . GLU B 2 184 ? -24.402 -31.014 -6.986  1.00 79.98  ? 199 GLU B O   1 
ATOM   3234 C  CB  . GLU B 2 184 ? -26.639 -29.533 -8.722  1.00 91.92  ? 199 GLU B CB  1 
ATOM   3235 C  CG  . GLU B 2 184 ? -28.056 -29.279 -9.211  1.00 94.92  ? 199 GLU B CG  1 
ATOM   3236 C  CD  . GLU B 2 184 ? -28.205 -29.214 -10.718 1.00 98.94  ? 199 GLU B CD  1 
ATOM   3237 O  OE1 . GLU B 2 184 ? -29.219 -28.642 -11.155 1.00 99.80  ? 199 GLU B OE1 1 
ATOM   3238 O  OE2 . GLU B 2 184 ? -27.342 -29.732 -11.468 1.00 104.19 ? 199 GLU B OE2 1 
ATOM   3239 N  N   . ARG B 2 185 ? -23.774 -30.789 -9.170  1.00 92.54  ? 200 ARG B N   1 
ATOM   3240 C  CA  . ARG B 2 185 ? -22.335 -30.774 -8.954  1.00 90.64  ? 200 ARG B CA  1 
ATOM   3241 C  C   . ARG B 2 185 ? -21.881 -29.331 -9.003  1.00 86.06  ? 200 ARG B C   1 
ATOM   3242 O  O   . ARG B 2 185 ? -22.663 -28.421 -9.244  1.00 83.80  ? 200 ARG B O   1 
ATOM   3243 C  CB  . ARG B 2 185 ? -21.611 -31.612 -10.024 1.00 94.06  ? 200 ARG B CB  1 
ATOM   3244 C  CG  . ARG B 2 185 ? -22.159 -33.030 -10.210 1.00 99.77  ? 200 ARG B CG  1 
ATOM   3245 C  CD  . ARG B 2 185 ? -21.070 -34.084 -10.408 1.00 101.46 ? 200 ARG B CD  1 
ATOM   3246 N  NE  . ARG B 2 185 ? -20.614 -34.591 -9.111  1.00 101.23 ? 200 ARG B NE  1 
ATOM   3247 C  CZ  . ARG B 2 185 ? -19.353 -34.872 -8.782  1.00 104.55 ? 200 ARG B CZ  1 
ATOM   3248 N  NH1 . ARG B 2 185 ? -18.354 -34.713 -9.651  1.00 106.73 ? 200 ARG B NH1 1 
ATOM   3249 N  NH2 . ARG B 2 185 ? -19.087 -35.307 -7.548  1.00 105.70 ? 200 ARG B NH2 1 
ATOM   3250 N  N   . ARG B 2 186 ? -20.597 -29.143 -8.781  1.00 83.11  ? 201 ARG B N   1 
ATOM   3251 C  CA  . ARG B 2 186 ? -20.020 -27.837 -8.573  1.00 80.32  ? 201 ARG B CA  1 
ATOM   3252 C  C   . ARG B 2 186 ? -19.904 -27.136 -9.878  1.00 83.44  ? 201 ARG B C   1 
ATOM   3253 O  O   . ARG B 2 186 ? -19.622 -27.766 -10.874 1.00 84.34  ? 201 ARG B O   1 
ATOM   3254 C  CB  . ARG B 2 186 ? -18.619 -27.971 -8.035  1.00 78.22  ? 201 ARG B CB  1 
ATOM   3255 C  CG  . ARG B 2 186 ? -18.473 -27.483 -6.633  1.00 77.79  ? 201 ARG B CG  1 
ATOM   3256 C  CD  . ARG B 2 186 ? -17.178 -27.997 -6.066  1.00 76.01  ? 201 ARG B CD  1 
ATOM   3257 N  NE  . ARG B 2 186 ? -17.166 -27.966 -4.620  1.00 76.26  ? 201 ARG B NE  1 
ATOM   3258 C  CZ  . ARG B 2 186 ? -16.065 -28.084 -3.878  1.00 77.28  ? 201 ARG B CZ  1 
ATOM   3259 N  NH1 . ARG B 2 186 ? -16.145 -28.019 -2.558  1.00 78.18  ? 201 ARG B NH1 1 
ATOM   3260 N  NH2 . ARG B 2 186 ? -14.878 -28.265 -4.434  1.00 79.27  ? 201 ARG B NH2 1 
ATOM   3261 N  N   . ASN B 2 187 ? -20.084 -25.822 -9.869  1.00 88.59  ? 202 ASN B N   1 
ATOM   3262 C  CA  . ASN B 2 187 ? -20.117 -25.009 -11.106 1.00 93.58  ? 202 ASN B CA  1 
ATOM   3263 C  C   . ASN B 2 187 ? -21.312 -25.228 -12.050 1.00 93.51  ? 202 ASN B C   1 
ATOM   3264 O  O   . ASN B 2 187 ? -21.285 -24.766 -13.183 1.00 94.44  ? 202 ASN B O   1 
ATOM   3265 C  CB  . ASN B 2 187 ? -18.823 -25.164 -11.919 1.00 96.26  ? 202 ASN B CB  1 
ATOM   3266 C  CG  . ASN B 2 187 ? -17.606 -24.872 -11.103 1.00 98.44  ? 202 ASN B CG  1 
ATOM   3267 O  OD1 . ASN B 2 187 ? -17.577 -23.881 -10.367 1.00 107.45 ? 202 ASN B OD1 1 
ATOM   3268 N  ND2 . ASN B 2 187 ? -16.589 -25.716 -11.218 1.00 98.75  ? 202 ASN B ND2 1 
ATOM   3269 N  N   . SER B 2 188 ? -22.354 -25.909 -11.581 1.00 90.45  ? 203 SER B N   1 
ATOM   3270 C  CA  . SER B 2 188 ? -23.619 -25.975 -12.296 1.00 88.25  ? 203 SER B CA  1 
ATOM   3271 C  C   . SER B 2 188 ? -24.393 -24.636 -12.208 1.00 88.95  ? 203 SER B C   1 
ATOM   3272 O  O   . SER B 2 188 ? -25.331 -24.383 -13.000 1.00 94.95  ? 203 SER B O   1 
ATOM   3273 C  CB  . SER B 2 188 ? -24.467 -27.107 -11.730 1.00 85.44  ? 203 SER B CB  1 
ATOM   3274 O  OG  . SER B 2 188 ? -25.024 -26.706 -10.495 1.00 79.98  ? 203 SER B OG  1 
ATOM   3275 N  N   . GLY B 2 189 ? -24.000 -23.788 -11.259 1.00 86.27  ? 204 GLY B N   1 
ATOM   3276 C  CA  . GLY B 2 189 ? -24.719 -22.558 -10.949 1.00 85.53  ? 204 GLY B CA  1 
ATOM   3277 C  C   . GLY B 2 189 ? -25.899 -22.767 -10.020 1.00 85.44  ? 204 GLY B C   1 
ATOM   3278 O  O   . GLY B 2 189 ? -26.540 -21.783 -9.659  1.00 84.30  ? 204 GLY B O   1 
ATOM   3279 N  N   . ARG B 2 190 ? -26.161 -24.019 -9.594  1.00 88.70  ? 205 ARG B N   1 
ATOM   3280 C  CA  . ARG B 2 190 ? -27.402 -24.395 -8.861  1.00 93.13  ? 205 ARG B CA  1 
ATOM   3281 C  C   . ARG B 2 190 ? -27.251 -25.146 -7.500  1.00 90.77  ? 205 ARG B C   1 
ATOM   3282 O  O   . ARG B 2 190 ? -28.105 -25.958 -7.134  1.00 91.65  ? 205 ARG B O   1 
ATOM   3283 C  CB  . ARG B 2 190 ? -28.281 -25.226 -9.801  1.00 100.01 ? 205 ARG B CB  1 
ATOM   3284 C  CG  . ARG B 2 190 ? -28.568 -24.557 -11.148 1.00 105.90 ? 205 ARG B CG  1 
ATOM   3285 C  CD  . ARG B 2 190 ? -29.976 -24.844 -11.665 1.00 114.52 ? 205 ARG B CD  1 
ATOM   3286 N  NE  . ARG B 2 190 ? -30.148 -26.242 -12.077 1.00 120.88 ? 205 ARG B NE  1 
ATOM   3287 C  CZ  . ARG B 2 190 ? -31.146 -26.705 -12.838 1.00 124.96 ? 205 ARG B CZ  1 
ATOM   3288 N  NH1 . ARG B 2 190 ? -31.178 -27.991 -13.150 1.00 123.66 ? 205 ARG B NH1 1 
ATOM   3289 N  NH2 . ARG B 2 190 ? -32.108 -25.901 -13.300 1.00 128.19 ? 205 ARG B NH2 1 
ATOM   3290 N  N   . CYS B 2 191 ? -26.175 -24.861 -6.765  1.00 88.47  ? 206 CYS B N   1 
ATOM   3291 C  CA  . CYS B 2 191 ? -25.827 -25.498 -5.455  1.00 85.70  ? 206 CYS B CA  1 
ATOM   3292 C  C   . CYS B 2 191 ? -24.624 -24.747 -4.923  1.00 83.15  ? 206 CYS B C   1 
ATOM   3293 O  O   . CYS B 2 191 ? -23.857 -24.165 -5.698  1.00 82.55  ? 206 CYS B O   1 
ATOM   3294 C  CB  . CYS B 2 191 ? -25.465 -27.003 -5.538  1.00 83.93  ? 206 CYS B CB  1 
ATOM   3295 S  SG  . CYS B 2 191 ? -24.056 -27.369 -6.606  1.00 85.87  ? 206 CYS B SG  1 
ATOM   3296 N  N   . LEU B 2 192 ? -24.433 -24.790 -3.613  1.00 81.19  ? 207 LEU B N   1 
ATOM   3297 C  CA  . LEU B 2 192 ? -23.430 -23.955 -2.979  1.00 78.91  ? 207 LEU B CA  1 
ATOM   3298 C  C   . LEU B 2 192 ? -22.375 -24.817 -2.424  1.00 76.52  ? 207 LEU B C   1 
ATOM   3299 O  O   . LEU B 2 192 ? -22.631 -25.984 -2.099  1.00 72.51  ? 207 LEU B O   1 
ATOM   3300 C  CB  . LEU B 2 192 ? -24.012 -23.171 -1.825  1.00 81.69  ? 207 LEU B CB  1 
ATOM   3301 C  CG  . LEU B 2 192 ? -25.001 -22.076 -2.216  1.00 84.78  ? 207 LEU B CG  1 
ATOM   3302 C  CD1 . LEU B 2 192 ? -26.430 -22.603 -2.191  1.00 87.71  ? 207 LEU B CD1 1 
ATOM   3303 C  CD2 . LEU B 2 192 ? -24.883 -20.880 -1.279  1.00 86.14  ? 207 LEU B CD2 1 
ATOM   3304 N  N   . GLN B 2 193 ? -21.204 -24.203 -2.279  1.00 75.41  ? 208 GLN B N   1 
ATOM   3305 C  CA  . GLN B 2 193 ? -20.065 -24.835 -1.658  1.00 75.99  ? 208 GLN B CA  1 
ATOM   3306 C  C   . GLN B 2 193 ? -19.934 -24.340 -0.251  1.00 74.04  ? 208 GLN B C   1 
ATOM   3307 O  O   . GLN B 2 193 ? -20.125 -23.147 -0.008  1.00 74.67  ? 208 GLN B O   1 
ATOM   3308 C  CB  . GLN B 2 193 ? -18.809 -24.474 -2.398  1.00 78.23  ? 208 GLN B CB  1 
ATOM   3309 C  CG  . GLN B 2 193 ? -18.760 -25.110 -3.755  1.00 79.48  ? 208 GLN B CG  1 
ATOM   3310 C  CD  . GLN B 2 193 ? -17.535 -24.736 -4.545  1.00 79.95  ? 208 GLN B CD  1 
ATOM   3311 O  OE1 . GLN B 2 193 ? -17.629 -24.538 -5.747  1.00 88.27  ? 208 GLN B OE1 1 
ATOM   3312 N  NE2 . GLN B 2 193 ? -16.387 -24.629 -3.889  1.00 78.17  ? 208 GLN B NE2 1 
ATOM   3313 N  N   . LYS B 2 194 ? -19.620 -25.248 0.676   1.00 72.07  ? 209 LYS B N   1 
ATOM   3314 C  CA  . LYS B 2 194 ? -19.407 -24.863 2.077   1.00 71.29  ? 209 LYS B CA  1 
ATOM   3315 C  C   . LYS B 2 194 ? -18.012 -24.341 2.299   1.00 68.54  ? 209 LYS B C   1 
ATOM   3316 O  O   . LYS B 2 194 ? -17.764 -23.728 3.331   1.00 68.06  ? 209 LYS B O   1 
ATOM   3317 C  CB  . LYS B 2 194 ? -19.724 -25.986 3.075   1.00 71.22  ? 209 LYS B CB  1 
ATOM   3318 C  CG  . LYS B 2 194 ? -18.770 -27.154 3.078   1.00 75.46  ? 209 LYS B CG  1 
ATOM   3319 C  CD  . LYS B 2 194 ? -18.948 -28.013 4.326   1.00 77.20  ? 209 LYS B CD  1 
ATOM   3320 C  CE  . LYS B 2 194 ? -18.080 -29.264 4.288   1.00 79.45  ? 209 LYS B CE  1 
ATOM   3321 N  NZ  . LYS B 2 194 ? -16.653 -28.950 3.991   1.00 80.37  ? 209 LYS B NZ  1 
ATOM   3322 N  N   . TRP B 2 195 ? -17.111 -24.596 1.351   1.00 66.04  ? 210 TRP B N   1 
ATOM   3323 C  CA  . TRP B 2 195 ? -15.792 -23.953 1.332   1.00 67.21  ? 210 TRP B CA  1 
ATOM   3324 C  C   . TRP B 2 195 ? -15.305 -23.804 -0.087  1.00 68.04  ? 210 TRP B C   1 
ATOM   3325 O  O   . TRP B 2 195 ? -15.686 -24.549 -0.962  1.00 67.49  ? 210 TRP B O   1 
ATOM   3326 C  CB  . TRP B 2 195 ? -14.797 -24.793 2.099   1.00 67.53  ? 210 TRP B CB  1 
ATOM   3327 C  CG  . TRP B 2 195 ? -13.594 -24.077 2.592   1.00 68.14  ? 210 TRP B CG  1 
ATOM   3328 C  CD1 . TRP B 2 195 ? -13.460 -23.398 3.777   1.00 68.72  ? 210 TRP B CD1 1 
ATOM   3329 C  CD2 . TRP B 2 195 ? -12.329 -24.029 1.964   1.00 67.48  ? 210 TRP B CD2 1 
ATOM   3330 N  NE1 . TRP B 2 195 ? -12.186 -22.916 3.903   1.00 66.70  ? 210 TRP B NE1 1 
ATOM   3331 C  CE2 . TRP B 2 195 ? -11.473 -23.289 2.799   1.00 67.42  ? 210 TRP B CE2 1 
ATOM   3332 C  CE3 . TRP B 2 195 ? -11.834 -24.527 0.764   1.00 69.98  ? 210 TRP B CE3 1 
ATOM   3333 C  CZ2 . TRP B 2 195 ? -10.158 -23.040 2.470   1.00 69.13  ? 210 TRP B CZ2 1 
ATOM   3334 C  CZ3 . TRP B 2 195 ? -10.529 -24.292 0.443   1.00 69.37  ? 210 TRP B CZ3 1 
ATOM   3335 C  CH2 . TRP B 2 195 ? -9.701  -23.548 1.287   1.00 69.91  ? 210 TRP B CH2 1 
ATOM   3336 N  N   . PHE B 2 196 ? -14.457 -22.824 -0.304  1.00 71.90  ? 211 PHE B N   1 
ATOM   3337 C  CA  . PHE B 2 196 ? -13.912 -22.570 -1.622  1.00 73.57  ? 211 PHE B CA  1 
ATOM   3338 C  C   . PHE B 2 196 ? -12.587 -21.879 -1.450  1.00 74.25  ? 211 PHE B C   1 
ATOM   3339 O  O   . PHE B 2 196 ? -12.347 -21.269 -0.428  1.00 71.57  ? 211 PHE B O   1 
ATOM   3340 C  CB  . PHE B 2 196 ? -14.877 -21.715 -2.434  1.00 73.50  ? 211 PHE B CB  1 
ATOM   3341 C  CG  . PHE B 2 196 ? -15.310 -20.463 -1.735  1.00 73.63  ? 211 PHE B CG  1 
ATOM   3342 C  CD1 . PHE B 2 196 ? -16.446 -20.453 -0.940  1.00 70.90  ? 211 PHE B CD1 1 
ATOM   3343 C  CD2 . PHE B 2 196 ? -14.587 -19.288 -1.881  1.00 75.43  ? 211 PHE B CD2 1 
ATOM   3344 C  CE1 . PHE B 2 196 ? -16.852 -19.297 -0.297  1.00 71.64  ? 211 PHE B CE1 1 
ATOM   3345 C  CE2 . PHE B 2 196 ? -14.987 -18.125 -1.240  1.00 75.23  ? 211 PHE B CE2 1 
ATOM   3346 C  CZ  . PHE B 2 196 ? -16.119 -18.127 -0.446  1.00 73.64  ? 211 PHE B CZ  1 
ATOM   3347 N  N   . GLU B 2 197 ? -11.719 -21.983 -2.443  1.00 81.05  ? 212 GLU B N   1 
ATOM   3348 C  CA  . GLU B 2 197 ? -10.387 -21.406 -2.313  1.00 87.95  ? 212 GLU B CA  1 
ATOM   3349 C  C   . GLU B 2 197 ? -10.499 -19.878 -2.444  1.00 92.16  ? 212 GLU B C   1 
ATOM   3350 O  O   . GLU B 2 197 ? -11.076 -19.394 -3.427  1.00 92.19  ? 212 GLU B O   1 
ATOM   3351 C  CB  . GLU B 2 197 ? -9.405  -21.978 -3.349  1.00 88.91  ? 212 GLU B CB  1 
ATOM   3352 C  CG  . GLU B 2 197 ? -7.956  -22.011 -2.872  1.00 88.94  ? 212 GLU B CG  1 
ATOM   3353 C  CD  . GLU B 2 197 ? -7.670  -23.163 -1.923  1.00 88.61  ? 212 GLU B CD  1 
ATOM   3354 O  OE1 . GLU B 2 197 ? -8.047  -24.319 -2.242  1.00 84.55  ? 212 GLU B OE1 1 
ATOM   3355 O  OE2 . GLU B 2 197 ? -7.049  -22.915 -0.863  1.00 92.51  ? 212 GLU B OE2 1 
ATOM   3356 N  N   . PRO B 2 198 ? -9.952  -19.119 -1.464  1.00 97.76  ? 213 PRO B N   1 
ATOM   3357 C  CA  . PRO B 2 198 ? -10.116 -17.662 -1.505  1.00 101.78 ? 213 PRO B CA  1 
ATOM   3358 C  C   . PRO B 2 198 ? -9.509  -17.038 -2.748  1.00 107.60 ? 213 PRO B C   1 
ATOM   3359 O  O   . PRO B 2 198 ? -10.103 -16.122 -3.323  1.00 111.07 ? 213 PRO B O   1 
ATOM   3360 C  CB  . PRO B 2 198 ? -9.364  -17.166 -0.261  1.00 103.36 ? 213 PRO B CB  1 
ATOM   3361 C  CG  . PRO B 2 198 ? -8.996  -18.364 0.536   1.00 101.32 ? 213 PRO B CG  1 
ATOM   3362 C  CD  . PRO B 2 198 ? -9.023  -19.535 -0.393  1.00 101.05 ? 213 PRO B CD  1 
ATOM   3363 N  N   . ALA B 2 199 ? -8.342  -17.533 -3.160  1.00 110.25 ? 214 ALA B N   1 
ATOM   3364 C  CA  . ALA B 2 199 ? -7.735  -17.081 -4.399  1.00 115.56 ? 214 ALA B CA  1 
ATOM   3365 C  C   . ALA B 2 199 ? -8.758  -17.053 -5.563  1.00 116.56 ? 214 ALA B C   1 
ATOM   3366 O  O   . ALA B 2 199 ? -8.803  -16.067 -6.303  1.00 117.14 ? 214 ALA B O   1 
ATOM   3367 C  CB  . ALA B 2 199 ? -6.516  -17.933 -4.741  1.00 113.87 ? 214 ALA B CB  1 
ATOM   3368 N  N   . GLN B 2 200 ? -9.605  -18.087 -5.672  1.00 116.02 ? 215 GLN B N   1 
ATOM   3369 C  CA  . GLN B 2 200 ? -10.483 -18.280 -6.852  1.00 119.31 ? 215 GLN B CA  1 
ATOM   3370 C  C   . GLN B 2 200 ? -11.804 -17.492 -6.861  1.00 116.14 ? 215 GLN B C   1 
ATOM   3371 O  O   . GLN B 2 200 ? -12.530 -17.547 -7.849  1.00 119.78 ? 215 GLN B O   1 
ATOM   3372 C  CB  . GLN B 2 200 ? -10.848 -19.764 -7.078  1.00 123.20 ? 215 GLN B CB  1 
ATOM   3373 C  CG  . GLN B 2 200 ? -9.772  -20.835 -6.867  1.00 127.89 ? 215 GLN B CG  1 
ATOM   3374 C  CD  . GLN B 2 200 ? -8.364  -20.477 -7.334  1.00 131.63 ? 215 GLN B CD  1 
ATOM   3375 O  OE1 . GLN B 2 200 ? -7.378  -20.772 -6.643  1.00 129.48 ? 215 GLN B OE1 1 
ATOM   3376 N  NE2 . GLN B 2 200 ? -8.258  -19.862 -8.508  1.00 134.47 ? 215 GLN B NE2 1 
ATOM   3377 N  N   . GLY B 2 201 ? -12.145 -16.796 -5.782  1.00 110.48 ? 216 GLY B N   1 
ATOM   3378 C  CA  . GLY B 2 201 ? -13.349 -15.963 -5.772  1.00 104.20 ? 216 GLY B CA  1 
ATOM   3379 C  C   . GLY B 2 201 ? -14.596 -16.778 -5.522  1.00 97.86  ? 216 GLY B C   1 
ATOM   3380 O  O   . GLY B 2 201 ? -14.662 -17.962 -5.867  1.00 95.94  ? 216 GLY B O   1 
ATOM   3381 N  N   . ASN B 2 202 ? -15.590 -16.116 -4.938  1.00 93.95  ? 217 ASN B N   1 
ATOM   3382 C  CA  . ASN B 2 202 ? -16.751 -16.778 -4.342  1.00 89.58  ? 217 ASN B CA  1 
ATOM   3383 C  C   . ASN B 2 202 ? -17.716 -17.316 -5.406  1.00 86.88  ? 217 ASN B C   1 
ATOM   3384 O  O   . ASN B 2 202 ? -18.332 -16.540 -6.123  1.00 88.63  ? 217 ASN B O   1 
ATOM   3385 C  CB  . ASN B 2 202 ? -17.472 -15.811 -3.385  1.00 88.46  ? 217 ASN B CB  1 
ATOM   3386 C  CG  . ASN B 2 202 ? -18.492 -16.503 -2.508  1.00 88.12  ? 217 ASN B CG  1 
ATOM   3387 O  OD1 . ASN B 2 202 ? -19.134 -17.460 -2.929  1.00 91.11  ? 217 ASN B OD1 1 
ATOM   3388 N  ND2 . ASN B 2 202 ? -18.653 -16.022 -1.287  1.00 87.89  ? 217 ASN B ND2 1 
ATOM   3389 N  N   . PRO B 2 203 ? -17.870 -18.646 -5.489  1.00 85.43  ? 218 PRO B N   1 
ATOM   3390 C  CA  . PRO B 2 203 ? -18.755 -19.215 -6.483  1.00 87.06  ? 218 PRO B CA  1 
ATOM   3391 C  C   . PRO B 2 203 ? -20.217 -19.226 -6.040  1.00 87.61  ? 218 PRO B C   1 
ATOM   3392 O  O   . PRO B 2 203 ? -21.057 -19.674 -6.806  1.00 86.54  ? 218 PRO B O   1 
ATOM   3393 C  CB  . PRO B 2 203 ? -18.258 -20.654 -6.581  1.00 85.67  ? 218 PRO B CB  1 
ATOM   3394 C  CG  . PRO B 2 203 ? -17.915 -20.975 -5.167  1.00 85.30  ? 218 PRO B CG  1 
ATOM   3395 C  CD  . PRO B 2 203 ? -17.422 -19.685 -4.544  1.00 85.41  ? 218 PRO B CD  1 
ATOM   3396 N  N   . ASN B 2 204 ? -20.513 -18.798 -4.812  1.00 86.80  ? 219 ASN B N   1 
ATOM   3397 C  CA  . ASN B 2 204 ? -21.874 -18.855 -4.291  1.00 87.10  ? 219 ASN B CA  1 
ATOM   3398 C  C   . ASN B 2 204 ? -22.699 -17.577 -4.583  1.00 91.25  ? 219 ASN B C   1 
ATOM   3399 O  O   . ASN B 2 204 ? -23.945 -17.626 -4.561  1.00 88.35  ? 219 ASN B O   1 
ATOM   3400 C  CB  . ASN B 2 204 ? -21.873 -19.095 -2.778  1.00 84.45  ? 219 ASN B CB  1 
ATOM   3401 C  CG  . ASN B 2 204 ? -21.316 -20.446 -2.370  1.00 81.01  ? 219 ASN B CG  1 
ATOM   3402 O  OD1 . ASN B 2 204 ? -21.266 -21.407 -3.145  1.00 81.27  ? 219 ASN B OD1 1 
ATOM   3403 N  ND2 . ASN B 2 204 ? -20.933 -20.534 -1.098  1.00 79.03  ? 219 ASN B ND2 1 
ATOM   3404 N  N   . VAL B 2 205 ? -22.030 -16.447 -4.836  1.00 91.12  ? 220 VAL B N   1 
ATOM   3405 C  CA  . VAL B 2 205 ? -22.723 -15.178 -5.183  1.00 93.87  ? 220 VAL B CA  1 
ATOM   3406 C  C   . VAL B 2 205 ? -23.819 -15.361 -6.261  1.00 92.36  ? 220 VAL B C   1 
ATOM   3407 O  O   . VAL B 2 205 ? -24.991 -14.986 -6.068  1.00 95.15  ? 220 VAL B O   1 
ATOM   3408 C  CB  . VAL B 2 205 ? -21.663 -14.110 -5.597  1.00 95.12  ? 220 VAL B CB  1 
ATOM   3409 C  CG1 . VAL B 2 205 ? -22.203 -13.049 -6.535  1.00 96.10  ? 220 VAL B CG1 1 
ATOM   3410 C  CG2 . VAL B 2 205 ? -21.066 -13.465 -4.357  1.00 95.04  ? 220 VAL B CG2 1 
ATOM   3411 N  N   . ALA B 2 206 ? -23.417 -15.949 -7.378  1.00 92.93  ? 221 ALA B N   1 
ATOM   3412 C  CA  . ALA B 2 206 ? -24.303 -16.137 -8.516  1.00 96.60  ? 221 ALA B CA  1 
ATOM   3413 C  C   . ALA B 2 206 ? -25.439 -17.170 -8.283  1.00 100.02 ? 221 ALA B C   1 
ATOM   3414 O  O   . ALA B 2 206 ? -26.507 -17.099 -8.915  1.00 102.94 ? 221 ALA B O   1 
ATOM   3415 C  CB  . ALA B 2 206 ? -23.492 -16.481 -9.751  1.00 96.23  ? 221 ALA B CB  1 
ATOM   3416 N  N   . VAL B 2 207 ? -25.231 -18.110 -7.371  1.00 98.36  ? 222 VAL B N   1 
ATOM   3417 C  CA  . VAL B 2 207 ? -26.292 -19.056 -7.060  1.00 98.79  ? 222 VAL B CA  1 
ATOM   3418 C  C   . VAL B 2 207 ? -27.351 -18.309 -6.301  1.00 98.94  ? 222 VAL B C   1 
ATOM   3419 O  O   . VAL B 2 207 ? -28.542 -18.516 -6.492  1.00 96.07  ? 222 VAL B O   1 
ATOM   3420 C  CB  . VAL B 2 207 ? -25.827 -20.227 -6.196  1.00 96.31  ? 222 VAL B CB  1 
ATOM   3421 C  CG1 . VAL B 2 207 ? -26.931 -21.269 -6.124  1.00 96.18  ? 222 VAL B CG1 1 
ATOM   3422 C  CG2 . VAL B 2 207 ? -24.564 -20.847 -6.770  1.00 97.20  ? 222 VAL B CG2 1 
ATOM   3423 N  N   . ALA B 2 208 ? -26.906 -17.427 -5.428  1.00 103.72 ? 223 ALA B N   1 
ATOM   3424 C  CA  . ALA B 2 208 ? -27.847 -16.624 -4.660  1.00 108.88 ? 223 ALA B CA  1 
ATOM   3425 C  C   . ALA B 2 208 ? -28.739 -15.887 -5.622  1.00 111.43 ? 223 ALA B C   1 
ATOM   3426 O  O   . ALA B 2 208 ? -29.965 -16.005 -5.552  1.00 113.19 ? 223 ALA B O   1 
ATOM   3427 C  CB  . ALA B 2 208 ? -27.129 -15.639 -3.752  1.00 107.68 ? 223 ALA B CB  1 
ATOM   3428 N  N   . ARG B 2 209 ? -28.106 -15.163 -6.540  1.00 111.74 ? 224 ARG B N   1 
ATOM   3429 C  CA  . ARG B 2 209 ? -28.848 -14.364 -7.501  1.00 113.69 ? 224 ARG B CA  1 
ATOM   3430 C  C   . ARG B 2 209 ? -29.860 -15.202 -8.234  1.00 110.68 ? 224 ARG B C   1 
ATOM   3431 O  O   . ARG B 2 209 ? -31.024 -14.802 -8.354  1.00 117.58 ? 224 ARG B O   1 
ATOM   3432 C  CB  . ARG B 2 209 ? -27.918 -13.670 -8.492  1.00 113.15 ? 224 ARG B CB  1 
ATOM   3433 C  CG  . ARG B 2 209 ? -27.245 -12.491 -7.843  1.00 112.32 ? 224 ARG B CG  1 
ATOM   3434 C  CD  . ARG B 2 209 ? -26.310 -11.747 -8.755  1.00 112.71 ? 224 ARG B CD  1 
ATOM   3435 N  NE  . ARG B 2 209 ? -25.404 -10.956 -7.925  1.00 113.72 ? 224 ARG B NE  1 
ATOM   3436 C  CZ  . ARG B 2 209 ? -24.231 -10.461 -8.315  1.00 111.91 ? 224 ARG B CZ  1 
ATOM   3437 N  NH1 . ARG B 2 209 ? -23.503 -9.771  -7.447  1.00 110.03 ? 224 ARG B NH1 1 
ATOM   3438 N  NH2 . ARG B 2 209 ? -23.775 -10.638 -9.553  1.00 112.19 ? 224 ARG B NH2 1 
ATOM   3439 N  N   . LEU B 2 210 ? -29.415 -16.362 -8.702  1.00 103.27 ? 225 LEU B N   1 
ATOM   3440 C  CA  . LEU B 2 210 ? -30.293 -17.237 -9.415  1.00 103.19 ? 225 LEU B CA  1 
ATOM   3441 C  C   . LEU B 2 210 ? -31.473 -17.519 -8.538  1.00 103.48 ? 225 LEU B C   1 
ATOM   3442 O  O   . LEU B 2 210 ? -32.616 -17.336 -8.949  1.00 109.06 ? 225 LEU B O   1 
ATOM   3443 C  CB  . LEU B 2 210 ? -29.609 -18.539 -9.789  1.00 105.14 ? 225 LEU B CB  1 
ATOM   3444 C  CG  . LEU B 2 210 ? -30.524 -19.746 -10.027 1.00 108.78 ? 225 LEU B CG  1 
ATOM   3445 C  CD1 . LEU B 2 210 ? -31.809 -19.436 -10.791 1.00 114.76 ? 225 LEU B CD1 1 
ATOM   3446 C  CD2 . LEU B 2 210 ? -29.748 -20.802 -10.785 1.00 109.82 ? 225 LEU B CD2 1 
ATOM   3447 N  N   . PHE B 2 211 ? -31.200 -17.953 -7.322  1.00 99.75  ? 226 PHE B N   1 
ATOM   3448 C  CA  . PHE B 2 211 ? -32.285 -18.371 -6.452  1.00 99.98  ? 226 PHE B CA  1 
ATOM   3449 C  C   . PHE B 2 211 ? -33.184 -17.253 -5.936  1.00 102.25 ? 226 PHE B C   1 
ATOM   3450 O  O   . PHE B 2 211 ? -34.367 -17.485 -5.758  1.00 103.70 ? 226 PHE B O   1 
ATOM   3451 C  CB  . PHE B 2 211 ? -31.762 -19.218 -5.307  1.00 97.34  ? 226 PHE B CB  1 
ATOM   3452 C  CG  . PHE B 2 211 ? -31.642 -20.672 -5.653  1.00 96.97  ? 226 PHE B CG  1 
ATOM   3453 C  CD1 . PHE B 2 211 ? -30.474 -21.188 -6.203  1.00 97.51  ? 226 PHE B CD1 1 
ATOM   3454 C  CD2 . PHE B 2 211 ? -32.708 -21.543 -5.443  1.00 96.55  ? 226 PHE B CD2 1 
ATOM   3455 C  CE1 . PHE B 2 211 ? -30.377 -22.545 -6.514  1.00 94.02  ? 226 PHE B CE1 1 
ATOM   3456 C  CE2 . PHE B 2 211 ? -32.619 -22.897 -5.766  1.00 92.82  ? 226 PHE B CE2 1 
ATOM   3457 C  CZ  . PHE B 2 211 ? -31.454 -23.401 -6.299  1.00 91.88  ? 226 PHE B CZ  1 
ATOM   3458 N  N   . ALA B 2 212 ? -32.646 -16.053 -5.723  1.00 107.55 ? 227 ALA B N   1 
ATOM   3459 C  CA  . ALA B 2 212 ? -33.469 -14.926 -5.275  1.00 112.62 ? 227 ALA B CA  1 
ATOM   3460 C  C   . ALA B 2 212 ? -34.628 -14.747 -6.242  1.00 118.88 ? 227 ALA B C   1 
ATOM   3461 O  O   . ALA B 2 212 ? -35.788 -14.683 -5.847  1.00 112.95 ? 227 ALA B O   1 
ATOM   3462 C  CB  . ALA B 2 212 ? -32.645 -13.650 -5.187  1.00 111.11 ? 227 ALA B CB  1 
ATOM   3463 N  N   . SER B 2 213 ? -34.288 -14.673 -7.517  1.00 126.65 ? 228 SER B N   1 
ATOM   3464 C  CA  . SER B 2 213 ? -35.296 -14.665 -8.556  1.00 134.45 ? 228 SER B CA  1 
ATOM   3465 C  C   . SER B 2 213 ? -35.984 -16.012 -8.555  1.00 136.77 ? 228 SER B C   1 
ATOM   3466 O  O   . SER B 2 213 ? -37.180 -16.115 -8.789  1.00 133.74 ? 228 SER B O   1 
ATOM   3467 C  CB  . SER B 2 213 ? -34.644 -14.427 -9.916  1.00 137.56 ? 228 SER B CB  1 
ATOM   3468 O  OG  . SER B 2 213 ? -34.302 -13.083 -10.065 1.00 143.40 ? 228 SER B OG  1 
ATOM   3469 N  N   . GLU B 2 214 ? -35.174 -17.036 -8.326  1.00 145.74 ? 229 GLU B N   1 
ATOM   3470 C  CA  . GLU B 2 214 ? -35.562 -18.440 -8.387  1.00 151.69 ? 229 GLU B CA  1 
ATOM   3471 C  C   . GLU B 2 214 ? -36.309 -18.775 -9.686  1.00 154.62 ? 229 GLU B C   1 
ATOM   3472 O  O   . GLU B 2 214 ? -37.323 -19.465 -9.687  1.00 169.09 ? 229 GLU B O   1 
ATOM   3473 C  CB  . GLU B 2 214 ? -36.365 -18.932 -7.172  1.00 152.42 ? 229 GLU B CB  1 
ATOM   3474 C  CG  . GLU B 2 214 ? -36.334 -20.476 -7.134  1.00 150.87 ? 229 GLU B CG  1 
ATOM   3475 C  CD  . GLU B 2 214 ? -36.826 -21.130 -5.865  1.00 153.80 ? 229 GLU B CD  1 
ATOM   3476 O  OE1 . GLU B 2 214 ? -37.248 -20.421 -4.921  1.00 158.05 ? 229 GLU B OE1 1 
ATOM   3477 O  OE2 . GLU B 2 214 ? -36.754 -22.383 -5.834  1.00 146.51 ? 229 GLU B OE2 1 
ATOM   3478 N  N   . PHE B 2 215 ? -35.810 -18.279 -10.798 1.00 144.40 ? 230 PHE B N   1 
ATOM   3479 C  CA  . PHE B 2 215 ? -36.355 -18.691 -12.076 1.00 137.82 ? 230 PHE B CA  1 
ATOM   3480 C  C   . PHE B 2 215 ? -36.260 -20.203 -12.213 1.00 139.98 ? 230 PHE B C   1 
ATOM   3481 O  O   . PHE B 2 215 ? -37.277 -20.891 -12.242 1.00 140.05 ? 230 PHE B O   1 
ATOM   3482 C  CB  . PHE B 2 215 ? -35.606 -18.043 -13.219 1.00 133.33 ? 230 PHE B CB  1 
ATOM   3483 C  CG  . PHE B 2 215 ? -36.242 -16.795 -13.713 1.00 127.01 ? 230 PHE B CG  1 
ATOM   3484 C  CD1 . PHE B 2 215 ? -35.734 -15.549 -13.359 1.00 122.37 ? 230 PHE B CD1 1 
ATOM   3485 C  CD2 . PHE B 2 215 ? -37.349 -16.867 -14.552 1.00 122.69 ? 230 PHE B CD2 1 
ATOM   3486 C  CE1 . PHE B 2 215 ? -36.315 -14.389 -13.834 1.00 121.14 ? 230 PHE B CE1 1 
ATOM   3487 C  CE2 . PHE B 2 215 ? -37.934 -15.718 -15.036 1.00 120.00 ? 230 PHE B CE2 1 
ATOM   3488 C  CZ  . PHE B 2 215 ? -37.419 -14.477 -14.675 1.00 121.33 ? 230 PHE B CZ  1 
HETATM 3489 C  C1  . NAG C 3 .   ? 2.596   6.720   11.234  1.00 142.65 ? 300 NAG A C1  1 
HETATM 3490 C  C2  . NAG C 3 .   ? 3.330   7.208   9.981   1.00 140.38 ? 300 NAG A C2  1 
HETATM 3491 C  C3  . NAG C 3 .   ? 4.861   7.115   10.093  1.00 137.78 ? 300 NAG A C3  1 
HETATM 3492 C  C4  . NAG C 3 .   ? 5.405   7.543   11.449  1.00 136.74 ? 300 NAG A C4  1 
HETATM 3493 C  C5  . NAG C 3 .   ? 4.664   6.731   12.514  1.00 137.15 ? 300 NAG A C5  1 
HETATM 3494 C  C6  . NAG C 3 .   ? 5.097   6.932   13.971  1.00 135.08 ? 300 NAG A C6  1 
HETATM 3495 C  C7  . NAG C 3 .   ? 2.114   6.752   7.844   1.00 145.35 ? 300 NAG A C7  1 
HETATM 3496 C  C8  . NAG C 3 .   ? 1.858   5.706   6.786   1.00 144.22 ? 300 NAG A C8  1 
HETATM 3497 N  N2  . NAG C 3 .   ? 2.923   6.382   8.848   1.00 143.07 ? 300 NAG A N2  1 
HETATM 3498 O  O3  . NAG C 3 .   ? 5.474   7.915   9.082   1.00 139.67 ? 300 NAG A O3  1 
HETATM 3499 O  O4  . NAG C 3 .   ? 6.820   7.320   11.432  1.00 132.88 ? 300 NAG A O4  1 
HETATM 3500 O  O5  . NAG C 3 .   ? 3.295   7.111   12.420  1.00 140.78 ? 300 NAG A O5  1 
HETATM 3501 O  O6  . NAG C 3 .   ? 4.653   8.216   14.444  1.00 129.94 ? 300 NAG A O6  1 
HETATM 3502 O  O7  . NAG C 3 .   ? 1.604   7.856   7.758   1.00 147.36 ? 300 NAG A O7  1 
HETATM 3503 C  C1  . NAG D 3 .   ? -22.420 -22.591 26.061  1.00 158.64 ? 301 NAG B C1  1 
HETATM 3504 C  C2  . NAG D 3 .   ? -23.790 -21.885 26.089  1.00 156.28 ? 301 NAG B C2  1 
HETATM 3505 C  C3  . NAG D 3 .   ? -23.927 -20.816 27.162  1.00 157.16 ? 301 NAG B C3  1 
HETATM 3506 C  C4  . NAG D 3 .   ? -23.153 -21.168 28.438  1.00 160.67 ? 301 NAG B C4  1 
HETATM 3507 C  C5  . NAG D 3 .   ? -21.701 -21.511 28.071  1.00 161.33 ? 301 NAG B C5  1 
HETATM 3508 C  C6  . NAG D 3 .   ? -20.686 -21.624 29.228  1.00 162.55 ? 301 NAG B C6  1 
HETATM 3509 C  C7  . NAG D 3 .   ? -25.102 -21.474 24.025  1.00 152.20 ? 301 NAG B C7  1 
HETATM 3510 C  C8  . NAG D 3 .   ? -25.043 -20.804 22.685  1.00 147.44 ? 301 NAG B C8  1 
HETATM 3511 N  N2  . NAG D 3 .   ? -23.995 -21.327 24.759  1.00 154.83 ? 301 NAG B N2  1 
HETATM 3512 O  O3  . NAG D 3 .   ? -25.321 -20.696 27.457  1.00 156.56 ? 301 NAG B O3  1 
HETATM 3513 O  O4  . NAG D 3 .   ? -23.245 -20.078 29.361  1.00 160.56 ? 301 NAG B O4  1 
HETATM 3514 O  O5  . NAG D 3 .   ? -21.775 -22.736 27.333  1.00 161.99 ? 301 NAG B O5  1 
HETATM 3515 O  O6  . NAG D 3 .   ? -21.041 -22.608 30.209  1.00 161.59 ? 301 NAG B O6  1 
HETATM 3516 O  O7  . NAG D 3 .   ? -26.096 -22.087 24.388  1.00 153.63 ? 301 NAG B O7  1 
HETATM 3517 CL CL  . CL  E 4 .   ? -20.778 -18.022 0.516   1.00 84.69  ? 302 CL  B CL  1 
HETATM 3518 O  O   . HOH F 5 .   ? -6.995  -39.782 24.720  1.00 78.43  ? 401 HOH A O   1 
HETATM 3519 O  O   . HOH F 5 .   ? -7.389  -31.454 14.480  1.00 45.14  ? 402 HOH A O   1 
HETATM 3520 O  O   . HOH G 5 .   ? -18.364 -41.014 6.563   1.00 97.73  ? 401 HOH B O   1 
HETATM 3521 O  O   . HOH G 5 .   ? -17.629 -38.257 17.852  1.00 88.61  ? 402 HOH B O   1 
HETATM 3522 O  O   . HOH G 5 .   ? -12.756 -32.808 17.744  1.00 62.67  ? 403 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ARG A 1   ? 1.5707 1.5371 1.9256 -0.1048 -0.0476 -0.2356 18  ARG A N   
2    C CA  . ARG A 1   ? 1.6484 1.6078 1.9833 -0.1059 -0.0367 -0.2269 18  ARG A CA  
3    C C   . ARG A 1   ? 1.5394 1.4863 1.8280 -0.1010 -0.0480 -0.2124 18  ARG A C   
4    O O   . ARG A 1   ? 1.5445 1.4794 1.8259 -0.0972 -0.0678 -0.2179 18  ARG A O   
5    C CB  . ARG A 1   ? 1.7475 1.7054 2.1178 -0.1075 -0.0388 -0.2429 18  ARG A CB  
6    C CG  . ARG A 1   ? 1.8212 1.7700 2.1729 -0.1088 -0.0272 -0.2357 18  ARG A CG  
7    C CD  . ARG A 1   ? 1.9145 1.8645 2.3058 -0.1131 -0.0207 -0.2515 18  ARG A CD  
8    N NE  . ARG A 1   ? 2.0510 1.9876 2.4207 -0.1130 -0.0180 -0.2466 18  ARG A NE  
9    C CZ  . ARG A 1   ? 2.0926 2.0258 2.4444 -0.1151 0.0056  -0.2343 18  ARG A CZ  
10   N NH1 . ARG A 1   ? 2.0878 2.0288 2.4383 -0.1181 0.0279  -0.2251 18  ARG A NH1 
11   N NH2 . ARG A 1   ? 2.1245 2.0436 2.4584 -0.1146 0.0067  -0.2313 18  ARG A NH2 
12   N N   . SER A 2   ? 1.3506 1.2979 1.6084 -0.1017 -0.0346 -0.1941 19  SER A N   
13   C CA  . SER A 2   ? 1.2307 1.1690 1.4495 -0.0972 -0.0438 -0.1800 19  SER A CA  
14   C C   . SER A 2   ? 1.1045 1.0398 1.3005 -0.0978 -0.0268 -0.1620 19  SER A C   
15   O O   . SER A 2   ? 1.1001 1.0432 1.3033 -0.1020 -0.0089 -0.1559 19  SER A O   
16   C CB  . SER A 2   ? 1.2436 1.1881 1.4522 -0.0966 -0.0504 -0.1752 19  SER A CB  
17   O OG  . SER A 2   ? 1.3014 1.2560 1.5091 -0.1019 -0.0327 -0.1661 19  SER A OG  
18   N N   . PRO A 3   ? 0.9888 0.9107 1.1569 -0.0938 -0.0319 -0.1530 20  PRO A N   
19   C CA  . PRO A 3   ? 0.9634 0.8835 1.1170 -0.0938 -0.0150 -0.1356 20  PRO A CA  
20   C C   . PRO A 3   ? 0.9403 0.8725 1.0861 -0.0955 -0.0074 -0.1188 20  PRO A C   
21   O O   . PRO A 3   ? 0.9852 0.9238 1.1263 -0.0961 -0.0167 -0.1187 20  PRO A O   
22   C CB  . PRO A 3   ? 0.9587 0.8588 1.0854 -0.0894 -0.0215 -0.1316 20  PRO A CB  
23   C CG  . PRO A 3   ? 0.9791 0.8672 1.1046 -0.0879 -0.0419 -0.1487 20  PRO A CG  
24   C CD  . PRO A 3   ? 0.9842 0.8891 1.1327 -0.0894 -0.0512 -0.1580 20  PRO A CD  
25   N N   . TRP A 4   ? 0.8906 0.8243 1.0350 -0.0964 0.0084  -0.1047 21  TRP A N   
26   C CA  . TRP A 4   ? 0.9082 0.8505 1.0438 -0.0980 0.0133  -0.0861 21  TRP A CA  
27   C C   . TRP A 4   ? 0.9427 0.8797 1.0610 -0.0936 0.0063  -0.0762 21  TRP A C   
28   O O   . TRP A 4   ? 0.9757 0.9012 1.0884 -0.0899 0.0120  -0.0715 21  TRP A O   
29   C CB  . TRP A 4   ? 0.8853 0.8285 1.0265 -0.0994 0.0300  -0.0735 21  TRP A CB  
30   C CG  . TRP A 4   ? 0.8576 0.8082 0.9915 -0.1015 0.0325  -0.0535 21  TRP A CG  
31   C CD1 . TRP A 4   ? 0.8651 0.8226 0.9887 -0.1042 0.0226  -0.0473 21  TRP A CD1 
32   C CD2 . TRP A 4   ? 0.8727 0.8228 1.0099 -0.1018 0.0444  -0.0372 21  TRP A CD2 
33   N NE1 . TRP A 4   ? 0.8492 0.8104 0.9687 -0.1066 0.0259  -0.0280 21  TRP A NE1 
34   C CE2 . TRP A 4   ? 0.8584 0.8153 0.9869 -0.1047 0.0386  -0.0210 21  TRP A CE2 
35   C CE3 . TRP A 4   ? 0.8885 0.8320 1.0354 -0.1000 0.0590  -0.0347 21  TRP A CE3 
36   C CZ2 . TRP A 4   ? 0.8834 0.8407 1.0135 -0.1054 0.0444  -0.0017 21  TRP A CZ2 
37   C CZ3 . TRP A 4   ? 0.9068 0.8507 1.0557 -0.1001 0.0671  -0.0153 21  TRP A CZ3 
38   C CH2 . TRP A 4   ? 0.9131 0.8640 1.0542 -0.1025 0.0586  0.0012  21  TRP A CH2 
39   N N   . CYS A 5   ? 0.9568 0.9000 1.0664 -0.0947 -0.0040 -0.0733 22  CYS A N   
40   C CA  . CYS A 5   ? 0.9462 0.8828 1.0393 -0.0911 -0.0126 -0.0685 22  CYS A CA  
41   C C   . CYS A 5   ? 0.9226 0.8547 1.0114 -0.0882 -0.0026 -0.0508 22  CYS A C   
42   O O   . CYS A 5   ? 0.9018 0.8208 0.9775 -0.0847 -0.0038 -0.0493 22  CYS A O   
43   C CB  . CYS A 5   ? 0.9342 0.8804 1.0214 -0.0940 -0.0227 -0.0671 22  CYS A CB  
44   S SG  . CYS A 5   ? 0.9629 0.8957 1.0319 -0.0896 -0.0373 -0.0751 22  CYS A SG  
45   N N   . VAL A 6   ? 0.8994 0.8405 1.0006 -0.0900 0.0079  -0.0380 23  VAL A N   
46   C CA  . VAL A 6   ? 0.9179 0.8578 1.0262 -0.0874 0.0196  -0.0208 23  VAL A CA  
47   C C   . VAL A 6   ? 0.9214 0.8423 1.0259 -0.0827 0.0300  -0.0243 23  VAL A C   
48   O O   . VAL A 6   ? 0.9108 0.8263 1.0188 -0.0798 0.0396  -0.0117 23  VAL A O   
49   C CB  . VAL A 6   ? 0.9750 0.9247 1.0969 -0.0905 0.0274  -0.0115 23  VAL A CB  
50   C CG1 . VAL A 6   ? 1.0078 0.9573 1.1430 -0.0874 0.0390  0.0069  23  VAL A CG1 
51   C CG2 . VAL A 6   ? 1.0209 0.9833 1.1389 -0.0964 0.0176  -0.0053 23  VAL A CG2 
52   N N   . ILE A 7   ? 0.9479 0.8569 1.0462 -0.0826 0.0285  -0.0415 24  ILE A N   
53   C CA  . ILE A 7   ? 0.9906 0.8763 1.0786 -0.0796 0.0375  -0.0458 24  ILE A CA  
54   C C   . ILE A 7   ? 0.9955 0.8624 1.0596 -0.0775 0.0315  -0.0491 24  ILE A C   
55   O O   . ILE A 7   ? 1.0288 0.8720 1.0793 -0.0756 0.0420  -0.0490 24  ILE A O   
56   C CB  . ILE A 7   ? 1.0566 0.9319 1.1449 -0.0809 0.0376  -0.0629 24  ILE A CB  
57   C CG1 . ILE A 7   ? 1.0902 0.9707 1.1772 -0.0830 0.0185  -0.0799 24  ILE A CG1 
58   C CG2 . ILE A 7   ? 1.0801 0.9642 1.1888 -0.0820 0.0529  -0.0562 24  ILE A CG2 
59   C CD1 . ILE A 7   ? 1.1720 1.0430 1.2639 -0.0847 0.0145  -0.0984 24  ILE A CD1 
60   N N   . CYS A 8   ? 0.9744 0.8486 1.0309 -0.0782 0.0163  -0.0515 25  CYS A N   
61   C CA  . CYS A 8   ? 0.9632 0.8199 0.9965 -0.0763 0.0123  -0.0511 25  CYS A CA  
62   C C   . CYS A 8   ? 0.9799 0.8367 1.0190 -0.0749 0.0270  -0.0330 25  CYS A C   
63   O O   . CYS A 8   ? 1.0608 0.8998 1.0811 -0.0737 0.0283  -0.0320 25  CYS A O   
64   C CB  . CYS A 8   ? 0.9633 0.8281 0.9890 -0.0774 -0.0073 -0.0589 25  CYS A CB  
65   S SG  . CYS A 8   ? 0.9680 0.8296 0.9943 -0.0783 -0.0236 -0.0813 25  CYS A SG  
66   N N   . ASP A 9   ? 0.9680 0.8426 1.0340 -0.0750 0.0383  -0.0186 26  ASP A N   
67   C CA  . ASP A 9   ? 0.9816 0.8574 1.0623 -0.0731 0.0525  -0.0011 26  ASP A CA  
68   C C   . ASP A 9   ? 0.9872 0.8421 1.0693 -0.0705 0.0734  0.0006  26  ASP A C   
69   O O   . ASP A 9   ? 0.9899 0.8484 1.0832 -0.0704 0.0794  -0.0001 26  ASP A O   
70   C CB  . ASP A 9   ? 0.9871 0.8919 1.0978 -0.0745 0.0509  0.0148  26  ASP A CB  
71   C CG  . ASP A 9   ? 1.0198 0.9287 1.1546 -0.0723 0.0632  0.0341  26  ASP A CG  
72   O OD1 . ASP A 9   ? 1.0033 0.9053 1.1546 -0.0692 0.0807  0.0417  26  ASP A OD1 
73   O OD2 . ASP A 9   ? 1.0157 0.9345 1.1557 -0.0737 0.0557  0.0416  26  ASP A OD2 
74   N N   . PRO A 10  ? 1.0167 0.8487 1.0886 -0.0687 0.0871  0.0039  27  PRO A N   
75   C CA  . PRO A 10  ? 1.0431 0.8479 1.1105 -0.0670 0.1099  0.0036  27  PRO A CA  
76   C C   . PRO A 10  ? 1.0360 0.8556 1.1411 -0.0647 0.1261  0.0186  27  PRO A C   
77   O O   . PRO A 10  ? 0.9867 0.7914 1.0909 -0.0640 0.1404  0.0153  27  PRO A O   
78   C CB  . PRO A 10  ? 1.0715 0.8509 1.1241 -0.0663 0.1232  0.0068  27  PRO A CB  
79   C CG  . PRO A 10  ? 1.0736 0.8616 1.1131 -0.0678 0.1037  0.0039  27  PRO A CG  
80   C CD  . PRO A 10  ? 1.0314 0.8583 1.0937 -0.0689 0.0842  0.0073  27  PRO A CD  
81   N N   . SER A 11  ? 1.0627 0.9100 1.2006 -0.0638 0.1229  0.0352  28  SER A N   
82   C CA  . SER A 11  ? 1.0886 0.9503 1.2651 -0.0611 0.1352  0.0519  28  SER A CA  
83   C C   . SER A 11  ? 1.0502 0.9231 1.2289 -0.0623 0.1288  0.0480  28  SER A C   
84   O O   . SER A 11  ? 1.0784 0.9484 1.2745 -0.0599 0.1436  0.0544  28  SER A O   
85   C CB  . SER A 11  ? 1.1092 0.9977 1.3194 -0.0607 0.1275  0.0707  28  SER A CB  
86   O OG  . SER A 11  ? 1.1610 1.0432 1.3626 -0.0616 0.1257  0.0697  28  SER A OG  
87   N N   . VAL A 12  ? 1.0265 0.9104 1.1883 -0.0659 0.1086  0.0371  29  VAL A N   
88   C CA  . VAL A 12  ? 1.0376 0.9290 1.1999 -0.0679 0.1046  0.0308  29  VAL A CA  
89   C C   . VAL A 12  ? 1.0728 0.9399 1.2206 -0.0675 0.1174  0.0168  29  VAL A C   
90   O O   . VAL A 12  ? 1.1139 0.9806 1.2747 -0.0668 0.1288  0.0196  29  VAL A O   
91   C CB  . VAL A 12  ? 1.0223 0.9274 1.1707 -0.0724 0.0829  0.0198  29  VAL A CB  
92   C CG1 . VAL A 12  ? 0.9892 0.8946 1.1350 -0.0750 0.0825  0.0076  29  VAL A CG1 
93   C CG2 . VAL A 12  ? 1.0056 0.9340 1.1681 -0.0744 0.0715  0.0349  29  VAL A CG2 
94   N N   . VAL A 13  ? 1.0629 0.9074 1.1822 -0.0682 0.1151  0.0021  30  VAL A N   
95   C CA  . VAL A 13  ? 1.0937 0.9131 1.1964 -0.0692 0.1242  -0.0117 30  VAL A CA  
96   C C   . VAL A 13  ? 1.1054 0.9088 1.2199 -0.0663 0.1511  -0.0010 30  VAL A C   
97   O O   . VAL A 13  ? 1.1766 0.9712 1.2943 -0.0668 0.1624  -0.0049 30  VAL A O   
98   C CB  . VAL A 13  ? 1.1318 0.9265 1.1969 -0.0717 0.1113  -0.0318 30  VAL A CB  
99   C CG1 . VAL A 13  ? 1.1501 0.9493 1.2011 -0.0718 0.0939  -0.0333 30  VAL A CG1 
100  C CG2 . VAL A 13  ? 1.1939 0.9487 1.2333 -0.0720 0.1277  -0.0377 30  VAL A CG2 
101  N N   . LEU A 14  ? 1.1131 0.9138 1.2383 -0.0634 0.1623  0.0128  31  LEU A N   
102  C CA  . LEU A 14  ? 1.1403 0.9252 1.2817 -0.0603 0.1901  0.0230  31  LEU A CA  
103  C C   . LEU A 14  ? 1.1032 0.9127 1.2838 -0.0576 0.1952  0.0382  31  LEU A C   
104  O O   . LEU A 14  ? 1.1370 0.9333 1.3259 -0.0562 0.2147  0.0398  31  LEU A O   
105  C CB  . LEU A 14  ? 1.1988 0.9722 1.3454 -0.0581 0.2033  0.0328  31  LEU A CB  
106  C CG  . LEU A 14  ? 1.2757 1.0170 1.3769 -0.0611 0.2008  0.0184  31  LEU A CG  
107  C CD1 . LEU A 14  ? 1.3141 1.0495 1.4261 -0.0593 0.2134  0.0296  31  LEU A CD1 
108  C CD2 . LEU A 14  ? 1.3046 1.0020 1.3656 -0.0641 0.2134  0.0026  31  LEU A CD2 
109  N N   . ALA A 15  ? 1.0335 0.8750 1.2335 -0.0576 0.1774  0.0483  32  ALA A N   
110  C CA  . ALA A 15  ? 1.0059 0.8669 1.2356 -0.0558 0.1785  0.0624  32  ALA A CA  
111  C C   . ALA A 15  ? 1.0460 0.8994 1.2632 -0.0583 0.1817  0.0495  32  ALA A C   
112  O O   . ALA A 15  ? 1.0776 0.9281 1.3120 -0.0561 0.1966  0.0570  32  ALA A O   
113  C CB  . ALA A 15  ? 0.9460 0.8359 1.1864 -0.0575 0.1560  0.0724  32  ALA A CB  
114  N N   . LEU A 16  ? 1.0545 0.9039 1.2439 -0.0628 0.1681  0.0299  33  LEU A N   
115  C CA  . LEU A 16  ? 1.0707 0.9133 1.2518 -0.0658 0.1706  0.0159  33  LEU A CA  
116  C C   . LEU A 16  ? 1.1223 0.9354 1.2943 -0.0653 0.1916  0.0085  33  LEU A C   
117  O O   . LEU A 16  ? 1.1530 0.9616 1.3322 -0.0661 0.2028  0.0062  33  LEU A O   
118  C CB  . LEU A 16  ? 1.0781 0.9252 1.2389 -0.0707 0.1498  -0.0033 33  LEU A CB  
119  C CG  . LEU A 16  ? 1.0528 0.9264 1.2207 -0.0728 0.1319  0.0012  33  LEU A CG  
120  C CD1 . LEU A 16  ? 1.0435 0.9189 1.1959 -0.0771 0.1150  -0.0192 33  LEU A CD1 
121  C CD2 . LEU A 16  ? 1.0574 0.9435 1.2439 -0.0734 0.1378  0.0125  33  LEU A CD2 
122  N N   . LYS A 17  ? 1.1296 0.9193 1.2834 -0.0647 0.1986  0.0048  34  LYS A N   
123  C CA  . LYS A 17  ? 1.1630 0.9200 1.3036 -0.0654 0.2201  -0.0018 34  LYS A CA  
124  C C   . LYS A 17  ? 1.1814 0.9403 1.3545 -0.0604 0.2443  0.0171  34  LYS A C   
125  O O   . LYS A 17  ? 1.2023 0.9459 1.3775 -0.0608 0.2620  0.0145  34  LYS A O   
126  C CB  . LYS A 17  ? 1.2386 0.9635 1.3454 -0.0669 0.2233  -0.0105 34  LYS A CB  
127  C CG  . LYS A 17  ? 1.3193 1.0044 1.3951 -0.0712 0.2361  -0.0261 34  LYS A CG  
128  C CD  . LYS A 17  ? 1.4030 1.0540 1.4312 -0.0752 0.2272  -0.0406 34  LYS A CD  
129  C CE  . LYS A 17  ? 1.4475 1.0565 1.4532 -0.0755 0.2539  -0.0375 34  LYS A CE  
130  N NZ  . LYS A 17  ? 1.4662 1.0325 1.4145 -0.0816 0.2437  -0.0560 34  LYS A NZ  
131  N N   . SER A 18  ? 1.1908 0.9691 1.3920 -0.0558 0.2443  0.0365  35  SER A N   
132  C CA  . SER A 18  ? 1.2055 0.9872 1.4443 -0.0502 0.2651  0.0563  35  SER A CA  
133  C C   . SER A 18  ? 1.1755 0.9725 1.4313 -0.0497 0.2634  0.0614  35  SER A C   
134  O O   . SER A 18  ? 1.1784 0.9649 1.4508 -0.0469 0.2845  0.0680  35  SER A O   
135  C CB  . SER A 18  ? 1.2089 1.0110 1.4795 -0.0457 0.2609  0.0763  35  SER A CB  
136  O OG  . SER A 18  ? 1.2432 1.0502 1.5557 -0.0398 0.2782  0.0960  35  SER A OG  
137  N N   . LEU A 19  ? 1.1456 0.9646 1.3957 -0.0528 0.2401  0.0580  36  LEU A N   
138  C CA  . LEU A 19  ? 1.1455 0.9733 1.4030 -0.0541 0.2393  0.0590  36  LEU A CA  
139  C C   . LEU A 19  ? 1.2474 1.0514 1.4909 -0.0568 0.2563  0.0431  36  LEU A C   
140  O O   . LEU A 19  ? 1.3059 1.1043 1.5657 -0.0546 0.2735  0.0509  36  LEU A O   
141  C CB  . LEU A 19  ? 1.1024 0.9497 1.3475 -0.0589 0.2146  0.0518  36  LEU A CB  
142  C CG  . LEU A 19  ? 1.1162 0.9716 1.3682 -0.0608 0.2144  0.0554  36  LEU A CG  
143  C CD1 . LEU A 19  ? 1.1247 0.9927 1.4017 -0.0563 0.2132  0.0817  36  LEU A CD1 
144  C CD2 . LEU A 19  ? 1.0954 0.9612 1.3299 -0.0674 0.1965  0.0408  36  LEU A CD2 
145  N N   . GLU A 20  ? 1.3023 1.0906 1.5159 -0.0617 0.2509  0.0214  37  GLU A N   
146  C CA  . GLU A 20  ? 1.3690 1.1338 1.5679 -0.0658 0.2636  0.0048  37  GLU A CA  
147  C C   . GLU A 20  ? 1.4270 1.1662 1.6319 -0.0628 0.2931  0.0117  37  GLU A C   
148  O O   . GLU A 20  ? 1.4878 1.2178 1.6994 -0.0635 0.3087  0.0101  37  GLU A O   
149  C CB  . GLU A 20  ? 1.3944 1.1433 1.5595 -0.0718 0.2497  -0.0190 37  GLU A CB  
150  C CG  . GLU A 20  ? 1.4659 1.1915 1.6185 -0.0771 0.2601  -0.0361 37  GLU A CG  
151  C CD  . GLU A 20  ? 1.5350 1.2432 1.6562 -0.0836 0.2430  -0.0600 37  GLU A CD  
152  O OE1 . GLU A 20  ? 1.6647 1.3668 1.7653 -0.0836 0.2291  -0.0633 37  GLU A OE1 
153  O OE2 . GLU A 20  ? 1.5597 1.2588 1.6774 -0.0891 0.2429  -0.0756 37  GLU A OE2 
154  N N   . LYS A 21  ? 1.4455 1.1706 1.6468 -0.0599 0.3026  0.0180  38  LYS A N   
155  C CA  . LYS A 21  ? 1.4967 1.1897 1.6971 -0.0586 0.3333  0.0200  38  LYS A CA  
156  C C   . LYS A 21  ? 1.4557 1.1598 1.7005 -0.0507 0.3521  0.0446  38  LYS A C   
157  O O   . LYS A 21  ? 1.5120 1.1984 1.7668 -0.0492 0.3770  0.0476  38  LYS A O   
158  C CB  . LYS A 21  ? 1.5592 1.2219 1.7298 -0.0606 0.3400  0.0126  38  LYS A CB  
159  C CG  . LYS A 21  ? 1.6211 1.2685 1.7452 -0.0677 0.3184  -0.0095 38  LYS A CG  
160  C CD  . LYS A 21  ? 1.6415 1.2886 1.7486 -0.0741 0.3030  -0.0289 38  LYS A CD  
161  C CE  . LYS A 21  ? 1.7044 1.3223 1.8023 -0.0779 0.3246  -0.0374 38  LYS A CE  
162  N NZ  . LYS A 21  ? 1.7892 1.3600 1.8404 -0.0838 0.3314  -0.0518 38  LYS A NZ  
163  N N   . ASP A 22  ? 1.3774 1.1096 1.6495 -0.0457 0.3396  0.0622  39  ASP A N   
164  C CA  . ASP A 22  ? 1.3352 1.0798 1.6546 -0.0377 0.3527  0.0872  39  ASP A CA  
165  C C   . ASP A 22  ? 1.3042 1.0718 1.6456 -0.0354 0.3429  0.0993  39  ASP A C   
166  O O   . ASP A 22  ? 1.2523 1.0188 1.6258 -0.0296 0.3592  0.1155  39  ASP A O   
167  C CB  . ASP A 22  ? 1.3107 1.0727 1.6533 -0.0337 0.3436  0.1020  39  ASP A CB  
168  C CG  . ASP A 22  ? 1.2930 1.0307 1.6114 -0.0362 0.3531  0.0911  39  ASP A CG  
169  O OD1 . ASP A 22  ? 1.3023 1.0040 1.5960 -0.0391 0.3757  0.0785  39  ASP A OD1 
170  O OD2 . ASP A 22  ? 1.2204 0.9726 1.5423 -0.0359 0.3380  0.0953  39  ASP A OD2 
171  N N   . TYR A 23  ? 1.3098 1.0963 1.6346 -0.0398 0.3172  0.0924  40  TYR A N   
172  C CA  . TYR A 23  ? 1.3185 1.1230 1.6596 -0.0383 0.3080  0.1053  40  TYR A CA  
173  C C   . TYR A 23  ? 1.3689 1.1607 1.6964 -0.0421 0.3186  0.0933  40  TYR A C   
174  O O   . TYR A 23  ? 1.4252 1.2164 1.7718 -0.0386 0.3286  0.1067  40  TYR A O   
175  C CB  . TYR A 23  ? 1.2861 1.1160 1.6198 -0.0412 0.2775  0.1078  40  TYR A CB  
176  C CG  . TYR A 23  ? 1.3280 1.1724 1.6812 -0.0387 0.2686  0.1284  40  TYR A CG  
177  C CD1 . TYR A 23  ? 1.3309 1.1846 1.7205 -0.0316 0.2679  0.1538  40  TYR A CD1 
178  C CD2 . TYR A 23  ? 1.3602 1.2064 1.6955 -0.0437 0.2610  0.1225  40  TYR A CD2 
179  C CE1 . TYR A 23  ? 1.3472 1.2104 1.7511 -0.0295 0.2565  0.1736  40  TYR A CE1 
180  C CE2 . TYR A 23  ? 1.3595 1.2125 1.7052 -0.0421 0.2529  0.1417  40  TYR A CE2 
181  C CZ  . TYR A 23  ? 1.3675 1.2285 1.7457 -0.0350 0.2490  0.1676  40  TYR A CZ  
182  O OH  . TYR A 23  ? 1.3955 1.2600 1.7813 -0.0336 0.2376  0.1880  40  TYR A OH  
183  N N   . LEU A 24  ? 1.3909 1.1718 1.6872 -0.0492 0.3159  0.0686  41  LEU A N   
184  C CA  . LEU A 24  ? 1.4260 1.1968 1.7120 -0.0540 0.3242  0.0552  41  LEU A CA  
185  C C   . LEU A 24  ? 1.4488 1.1975 1.7469 -0.0513 0.3540  0.0595  41  LEU A C   
186  O O   . LEU A 24  ? 1.3842 1.1327 1.6893 -0.0517 0.3609  0.0626  41  LEU A O   
187  C CB  . LEU A 24  ? 1.4463 1.2094 1.7019 -0.0622 0.3139  0.0272  41  LEU A CB  
188  C CG  . LEU A 24  ? 1.4130 1.1968 1.6566 -0.0660 0.2855  0.0190  41  LEU A CG  
189  C CD1 . LEU A 24  ? 1.4133 1.1892 1.6367 -0.0739 0.2779  -0.0081 41  LEU A CD1 
190  C CD2 . LEU A 24  ? 1.3972 1.2037 1.6533 -0.0652 0.2741  0.0329  41  LEU A CD2 
191  N N   . PRO A 25  ? 1.5137 1.2413 1.8131 -0.0488 0.3734  0.0599  42  PRO A N   
192  C CA  . PRO A 25  ? 1.5551 1.2593 1.8654 -0.0466 0.4038  0.0631  42  PRO A CA  
193  C C   . PRO A 25  ? 1.5577 1.2720 1.9039 -0.0389 0.4127  0.0879  42  PRO A C   
194  O O   . PRO A 25  ? 1.5486 1.2524 1.8965 -0.0399 0.4269  0.0862  42  PRO A O   
195  C CB  . PRO A 25  ? 1.5758 1.2560 1.8817 -0.0451 0.4222  0.0619  42  PRO A CB  
196  C CG  . PRO A 25  ? 1.5591 1.2410 1.8347 -0.0503 0.4009  0.0467  42  PRO A CG  
197  C CD  . PRO A 25  ? 1.5132 1.2316 1.8000 -0.0488 0.3718  0.0553  42  PRO A CD  
198  N N   . GLY A 26  ? 1.5378 1.2718 1.9118 -0.0318 0.4025  0.1103  43  GLY A N   
199  C CA  . GLY A 26  ? 1.5632 1.3070 1.9711 -0.0243 0.4046  0.1355  43  GLY A CA  
200  C C   . GLY A 26  ? 1.6012 1.3619 2.0017 -0.0265 0.3829  0.1410  43  GLY A C   
201  O O   . GLY A 26  ? 1.6829 1.4458 2.1047 -0.0211 0.3844  0.1612  43  GLY A O   
202  N N   . HIS A 27  ? 1.6150 1.3853 1.9854 -0.0345 0.3630  0.1240  44  HIS A N   
203  C CA  . HIS A 27  ? 1.6324 1.4173 1.9941 -0.0372 0.3421  0.1304  44  HIS A CA  
204  C C   . HIS A 27  ? 1.6395 1.4189 1.9730 -0.0463 0.3415  0.1093  44  HIS A C   
205  O O   . HIS A 27  ? 1.6413 1.4250 1.9667 -0.0488 0.3319  0.1152  44  HIS A O   
206  C CB  . HIS A 27  ? 1.6202 1.4273 1.9815 -0.0372 0.3144  0.1380  44  HIS A CB  
207  C CG  . HIS A 27  ? 1.6353 1.4503 2.0311 -0.0286 0.3134  0.1610  44  HIS A CG  
208  N ND1 . HIS A 27  ? 1.6569 1.4669 2.0655 -0.0254 0.3259  0.1577  44  HIS A ND1 
209  C CD2 . HIS A 27  ? 1.6292 1.4545 2.0518 -0.0226 0.3026  0.1877  44  HIS A CD2 
210  C CE1 . HIS A 27  ? 1.6584 1.4775 2.1047 -0.0177 0.3245  0.1809  44  HIS A CE1 
211  N NE2 . HIS A 27  ? 1.6393 1.4691 2.0963 -0.0157 0.3085  0.1996  44  HIS A NE2 
212  N N   . LEU A 28  ? 1.6515 1.4189 1.9704 -0.0515 0.3521  0.0850  45  LEU A N   
213  C CA  . LEU A 28  ? 1.6626 1.4253 1.9625 -0.0603 0.3525  0.0631  45  LEU A CA  
214  C C   . LEU A 28  ? 1.6973 1.4376 1.9953 -0.0627 0.3761  0.0480  45  LEU A C   
215  O O   . LEU A 28  ? 1.7370 1.4662 2.0346 -0.0609 0.3845  0.0442  45  LEU A O   
216  C CB  . LEU A 28  ? 1.6847 1.4599 1.9670 -0.0664 0.3310  0.0444  45  LEU A CB  
217  C CG  . LEU A 28  ? 1.7200 1.4944 1.9890 -0.0757 0.3279  0.0204  45  LEU A CG  
218  C CD1 . LEU A 28  ? 1.7331 1.5125 2.0009 -0.0781 0.3260  0.0284  45  LEU A CD1 
219  C CD2 . LEU A 28  ? 1.7331 1.5183 1.9897 -0.0800 0.3068  0.0026  45  LEU A CD2 
220  N N   . ASP A 29  ? 1.7611 1.4921 2.0554 -0.0678 0.3873  0.0385  46  ASP A N   
221  C CA  . ASP A 29  ? 1.8296 1.5383 2.1211 -0.0718 0.4093  0.0222  46  ASP A CA  
222  C C   . ASP A 29  ? 1.7968 1.5005 2.0723 -0.0777 0.4011  -0.0012 46  ASP A C   
223  O O   . ASP A 29  ? 1.7330 1.4509 1.9992 -0.0823 0.3796  -0.0139 46  ASP A O   
224  C CB  . ASP A 29  ? 1.8965 1.6002 2.1855 -0.0788 0.4174  0.0107  46  ASP A CB  
225  C CG  . ASP A 29  ? 2.0090 1.7099 2.3071 -0.0741 0.4275  0.0327  46  ASP A CG  
226  O OD1 . ASP A 29  ? 2.0535 1.7522 2.3648 -0.0649 0.4331  0.0564  46  ASP A OD1 
227  O OD2 . ASP A 29  ? 2.1385 1.8374 2.4308 -0.0799 0.4301  0.0263  46  ASP A OD2 
228  N N   . ALA A 30  ? 1.8574 1.5380 2.1281 -0.0777 0.4183  -0.0069 47  ALA A N   
229  C CA  . ALA A 30  ? 1.8781 1.5454 2.1268 -0.0835 0.4110  -0.0279 47  ALA A CA  
230  C C   . ALA A 30  ? 1.8454 1.5160 2.0834 -0.0937 0.3954  -0.0544 47  ALA A C   
231  O O   . ALA A 30  ? 1.9064 1.5797 2.1291 -0.0974 0.3745  -0.0685 47  ALA A O   
232  C CB  . ALA A 30  ? 1.8966 1.5310 2.1379 -0.0838 0.4371  -0.0302 47  ALA A CB  
233  N N   . LYS A 31  ? 1.8119 1.4820 2.0603 -0.0980 0.4055  -0.0608 48  LYS A N   
234  C CA  . LYS A 31  ? 1.8137 1.4887 2.0615 -0.1076 0.3933  -0.0854 48  LYS A CA  
235  C C   . LYS A 31  ? 1.7476 1.4498 1.9986 -0.1084 0.3668  -0.0887 48  LYS A C   
236  O O   . LYS A 31  ? 1.7074 1.4150 1.9605 -0.1157 0.3529  -0.1100 48  LYS A O   
237  C CB  . LYS A 31  ? 1.8677 1.5359 2.1294 -0.1117 0.4138  -0.0895 48  LYS A CB  
238  C CG  . LYS A 31  ? 1.8974 1.5796 2.1718 -0.1074 0.4198  -0.0710 48  LYS A CG  
239  C CD  . LYS A 31  ? 1.9647 1.6313 2.2482 -0.1106 0.4460  -0.0726 48  LYS A CD  
240  C CE  . LYS A 31  ? 1.9793 1.6560 2.2697 -0.1118 0.4480  -0.0665 48  LYS A CE  
241  N NZ  . LYS A 31  ? 1.9666 1.6301 2.2654 -0.1202 0.4673  -0.0827 48  LYS A NZ  
242  N N   . HIS A 32  ? 1.6825 1.4012 1.9358 -0.1011 0.3598  -0.0678 49  HIS A N   
243  C CA  . HIS A 32  ? 1.6340 1.3759 1.8873 -0.1020 0.3362  -0.0697 49  HIS A CA  
244  C C   . HIS A 32  ? 1.5999 1.3488 1.8406 -0.0990 0.3151  -0.0690 49  HIS A C   
245  O O   . HIS A 32  ? 1.5543 1.3205 1.7939 -0.1007 0.2946  -0.0746 49  HIS A O   
246  C CB  . HIS A 32  ? 1.6218 1.3759 1.8823 -0.0979 0.3395  -0.0484 49  HIS A CB  
247  C CG  . HIS A 32  ? 1.6163 1.3642 1.8849 -0.1025 0.3562  -0.0518 49  HIS A CG  
248  N ND1 . HIS A 32  ? 1.6115 1.3624 1.8858 -0.1113 0.3541  -0.0741 49  HIS A ND1 
249  C CD2 . HIS A 32  ? 1.6213 1.3589 1.8940 -0.0996 0.3758  -0.0357 49  HIS A CD2 
250  C CE1 . HIS A 32  ? 1.5912 1.3327 1.8713 -0.1141 0.3736  -0.0722 49  HIS A CE1 
251  N NE2 . HIS A 32  ? 1.6191 1.3516 1.8959 -0.1071 0.3864  -0.0487 49  HIS A NE2 
252  N N   . HIS A 33  ? 1.6026 1.3359 1.8331 -0.0950 0.3219  -0.0627 50  HIS A N   
253  C CA  . HIS A 33  ? 1.6380 1.3751 1.8556 -0.0914 0.3059  -0.0584 50  HIS A CA  
254  C C   . HIS A 33  ? 1.6134 1.3545 1.8184 -0.0971 0.2814  -0.0797 50  HIS A C   
255  O O   . HIS A 33  ? 1.4946 1.2535 1.6977 -0.0954 0.2619  -0.0769 50  HIS A O   
256  C CB  . HIS A 33  ? 1.6716 1.3833 1.8775 -0.0884 0.3214  -0.0533 50  HIS A CB  
257  C CG  . HIS A 33  ? 1.7294 1.4399 1.9531 -0.0807 0.3429  -0.0290 50  HIS A CG  
258  N ND1 . HIS A 33  ? 1.8003 1.4920 2.0214 -0.0762 0.3592  -0.0193 50  HIS A ND1 
259  C CD2 . HIS A 33  ? 1.7337 1.4577 1.9788 -0.0767 0.3503  -0.0119 50  HIS A CD2 
260  C CE1 . HIS A 33  ? 1.7873 1.4838 2.0332 -0.0692 0.3754  0.0026  50  HIS A CE1 
261  N NE2 . HIS A 33  ? 1.7572 1.4726 2.0161 -0.0693 0.3688  0.0080  50  HIS A NE2 
262  N N   . LYS A 34  ? 1.6476 1.3712 1.8455 -0.1039 0.2822  -0.1006 51  LYS A N   
263  C CA  . LYS A 34  ? 1.6644 1.3865 1.8513 -0.1096 0.2578  -0.1223 51  LYS A CA  
264  C C   . LYS A 34  ? 1.6515 1.4027 1.8556 -0.1106 0.2394  -0.1266 51  LYS A C   
265  O O   . LYS A 34  ? 1.6127 1.3745 1.8092 -0.1089 0.2185  -0.1273 51  LYS A O   
266  C CB  . LYS A 34  ? 1.6955 1.3959 1.8795 -0.1178 0.2621  -0.1434 51  LYS A CB  
267  C CG  . LYS A 34  ? 1.7510 1.4155 1.9083 -0.1185 0.2771  -0.1428 51  LYS A CG  
268  C CD  . LYS A 34  ? 1.7821 1.4255 1.9420 -0.1252 0.2949  -0.1546 51  LYS A CD  
269  C CE  . LYS A 34  ? 1.8183 1.4274 1.9552 -0.1240 0.3194  -0.1466 51  LYS A CE  
270  N NZ  . LYS A 34  ? 1.8107 1.3974 1.9488 -0.1306 0.3395  -0.1568 51  LYS A NZ  
271  N N   . ALA A 35  ? 1.6543 1.4162 1.8804 -0.1134 0.2501  -0.1285 52  ALA A N   
272  C CA  . ALA A 35  ? 1.6157 1.4001 1.8588 -0.1162 0.2375  -0.1358 52  ALA A CA  
273  C C   . ALA A 35  ? 1.5811 1.3836 1.8210 -0.1108 0.2316  -0.1167 52  ALA A C   
274  O O   . ALA A 35  ? 1.5261 1.3443 1.7705 -0.1123 0.2150  -0.1228 52  ALA A O   
275  C CB  . ALA A 35  ? 1.6205 1.4060 1.8850 -0.1215 0.2546  -0.1430 52  ALA A CB  
276  N N   . MET A 36  ? 1.6135 1.4133 1.8479 -0.1049 0.2450  -0.0939 53  MET A N   
277  C CA  . MET A 36  ? 1.6034 1.4185 1.8343 -0.0999 0.2374  -0.0740 53  MET A CA  
278  C C   . MET A 36  ? 1.6149 1.4366 1.8337 -0.0981 0.2154  -0.0772 53  MET A C   
279  O O   . MET A 36  ? 1.4787 1.3166 1.6971 -0.0986 0.2003  -0.0761 53  MET A O   
280  C CB  . MET A 36  ? 1.5899 1.3988 1.8209 -0.0931 0.2528  -0.0495 53  MET A CB  
281  C CG  . MET A 36  ? 1.5483 1.3707 1.7763 -0.0876 0.2411  -0.0295 53  MET A CG  
282  S SD  . MET A 36  ? 1.4558 1.2948 1.6862 -0.0891 0.2341  -0.0160 53  MET A SD  
283  C CE  . MET A 36  ? 1.4631 1.2974 1.7032 -0.0817 0.2474  0.0141  53  MET A CE  
284  N N   . MET A 37  ? 1.7184 1.5238 1.9243 -0.0964 0.2152  -0.0809 54  MET A N   
285  C CA  . MET A 37  ? 1.7665 1.5722 1.9564 -0.0945 0.1968  -0.0828 54  MET A CA  
286  C C   . MET A 37  ? 1.7202 1.5330 1.9101 -0.0991 0.1753  -0.1033 54  MET A C   
287  O O   . MET A 37  ? 1.7511 1.5765 1.9366 -0.0977 0.1589  -0.1013 54  MET A O   
288  C CB  . MET A 37  ? 1.8655 1.6455 2.0365 -0.0926 0.2042  -0.0826 54  MET A CB  
289  C CG  . MET A 37  ? 1.9077 1.6858 2.0840 -0.0861 0.2224  -0.0589 54  MET A CG  
290  S SD  . MET A 37  ? 1.8858 1.6883 2.0686 -0.0806 0.2102  -0.0380 54  MET A SD  
291  C CE  . MET A 37  ? 1.8790 1.6767 2.0369 -0.0822 0.1868  -0.0523 54  MET A CE  
292  N N   . GLU A 38  ? 1.7355 1.5413 1.9338 -0.1048 0.1753  -0.1226 55  GLU A N   
293  C CA  . GLU A 38  ? 1.7480 1.5632 1.9561 -0.1091 0.1544  -0.1424 55  GLU A CA  
294  C C   . GLU A 38  ? 1.6846 1.5244 1.9075 -0.1091 0.1500  -0.1376 55  GLU A C   
295  O O   . GLU A 38  ? 1.5745 1.4246 1.7972 -0.1090 0.1306  -0.1437 55  GLU A O   
296  C CB  . GLU A 38  ? 1.8242 1.6317 2.0495 -0.1157 0.1586  -0.1621 55  GLU A CB  
297  C CG  . GLU A 38  ? 1.9395 1.7193 2.1462 -0.1180 0.1565  -0.1722 55  GLU A CG  
298  C CD  . GLU A 38  ? 2.0467 1.8188 2.2723 -0.1252 0.1629  -0.1899 55  GLU A CD  
299  O OE1 . GLU A 38  ? 2.0252 1.8148 2.2820 -0.1286 0.1663  -0.1977 55  GLU A OE1 
300  O OE2 . GLU A 38  ? 2.2128 1.9589 2.4212 -0.1282 0.1657  -0.1967 55  GLU A OE2 
301  N N   . ARG A 39  ? 1.6869 1.5328 1.9194 -0.1094 0.1687  -0.1258 56  ARG A N   
302  C CA  . ARG A 39  ? 1.6950 1.5576 1.9350 -0.1108 0.1680  -0.1201 56  ARG A CA  
303  C C   . ARG A 39  ? 1.6195 1.4914 1.8436 -0.1062 0.1555  -0.1041 56  ARG A C   
304  O O   . ARG A 39  ? 1.5528 1.4368 1.7781 -0.1079 0.1428  -0.1083 56  ARG A O   
305  C CB  . ARG A 39  ? 1.7688 1.6285 2.0149 -0.1124 0.1909  -0.1094 56  ARG A CB  
306  C CG  . ARG A 39  ? 1.8961 1.7648 2.1484 -0.1171 0.1938  -0.1101 56  ARG A CG  
307  C CD  . ARG A 39  ? 2.0245 1.8849 2.2731 -0.1181 0.2149  -0.0951 56  ARG A CD  
308  N NE  . ARG A 39  ? 2.1754 2.0398 2.4158 -0.1219 0.2149  -0.0886 56  ARG A NE  
309  C CZ  . ARG A 39  ? 2.2884 2.1437 2.5165 -0.1231 0.2277  -0.0721 56  ARG A CZ  
310  N NH1 . ARG A 39  ? 2.2885 2.1326 2.5158 -0.1200 0.2421  -0.0599 56  ARG A NH1 
311  N NH2 . ARG A 39  ? 2.3675 2.2221 2.5821 -0.1280 0.2261  -0.0680 56  ARG A NH2 
312  N N   . VAL A 40  ? 1.5937 1.4594 1.8051 -0.1007 0.1598  -0.0869 57  VAL A N   
313  C CA  . VAL A 40  ? 1.5119 1.3861 1.7114 -0.0966 0.1482  -0.0719 57  VAL A CA  
314  C C   . VAL A 40  ? 1.4580 1.3324 1.6473 -0.0961 0.1278  -0.0843 57  VAL A C   
315  O O   . VAL A 40  ? 1.4189 1.3058 1.6050 -0.0964 0.1147  -0.0823 57  VAL A O   
316  C CB  . VAL A 40  ? 1.5139 1.3809 1.7085 -0.0907 0.1584  -0.0517 57  VAL A CB  
317  C CG1 . VAL A 40  ? 1.4882 1.3652 1.6751 -0.0873 0.1455  -0.0383 57  VAL A CG1 
318  C CG2 . VAL A 40  ? 1.5337 1.4003 1.7388 -0.0898 0.1761  -0.0359 57  VAL A CG2 
319  N N   . GLU A 41  ? 1.4599 1.3178 1.6414 -0.0959 0.1250  -0.0966 58  GLU A N   
320  C CA  . GLU A 41  ? 1.4740 1.3266 1.6420 -0.0958 0.1037  -0.1095 58  GLU A CA  
321  C C   . GLU A 41  ? 1.4317 1.3014 1.6143 -0.0990 0.0889  -0.1219 58  GLU A C   
322  O O   . GLU A 41  ? 1.4174 1.2941 1.5926 -0.0976 0.0733  -0.1216 58  GLU A O   
323  C CB  . GLU A 41  ? 1.6200 1.4483 1.7762 -0.0975 0.0998  -0.1253 58  GLU A CB  
324  C CG  . GLU A 41  ? 1.7637 1.5710 1.9110 -0.0969 0.1208  -0.1190 58  GLU A CG  
325  C CD  . GLU A 41  ? 1.9021 1.6793 2.0184 -0.0961 0.1187  -0.1218 58  GLU A CD  
326  O OE1 . GLU A 41  ? 2.0520 1.8192 2.1502 -0.0971 0.0975  -0.1332 58  GLU A OE1 
327  O OE2 . GLU A 41  ? 1.8901 1.6505 1.9990 -0.0947 0.1399  -0.1124 58  GLU A OE2 
328  N N   . ASN A 42  ? 1.4258 1.3007 1.6306 -0.1036 0.0959  -0.1331 59  ASN A N   
329  C CA  . ASN A 42  ? 1.4213 1.3107 1.6456 -0.1072 0.0862  -0.1463 59  ASN A CA  
330  C C   . ASN A 42  ? 1.3532 1.2574 1.5761 -0.1077 0.0886  -0.1343 59  ASN A C   
331  O O   . ASN A 42  ? 1.3303 1.2438 1.5597 -0.1091 0.0764  -0.1425 59  ASN A O   
332  C CB  . ASN A 42  ? 1.4639 1.3535 1.7157 -0.1128 0.0963  -0.1621 59  ASN A CB  
333  C CG  . ASN A 42  ? 1.5124 1.3896 1.7706 -0.1142 0.0850  -0.1803 59  ASN A CG  
334  O OD1 . ASN A 42  ? 1.5747 1.4408 1.8134 -0.1113 0.0677  -0.1824 59  ASN A OD1 
335  N ND2 . ASN A 42  ? 1.5601 1.4365 1.8440 -0.1193 0.0945  -0.1938 59  ASN A ND2 
336  N N   . ALA A 43  ? 1.3421 1.2468 1.5564 -0.1068 0.1033  -0.1150 60  ALA A N   
337  C CA  . ALA A 43  ? 1.3374 1.2524 1.5428 -0.1077 0.1021  -0.1007 60  ALA A CA  
338  C C   . ALA A 43  ? 1.3136 1.2341 1.5050 -0.1045 0.0832  -0.0970 60  ALA A C   
339  O O   . ALA A 43  ? 1.2222 1.1514 1.4112 -0.1068 0.0751  -0.0977 60  ALA A O   
340  C CB  . ALA A 43  ? 1.3279 1.2400 1.5253 -0.1063 0.1160  -0.0786 60  ALA A CB  
341  N N   . VAL A 44  ? 1.3114 1.2237 1.4922 -0.0996 0.0779  -0.0939 61  VAL A N   
342  C CA  . VAL A 44  ? 1.2676 1.1811 1.4331 -0.0964 0.0629  -0.0897 61  VAL A CA  
343  C C   . VAL A 44  ? 1.2954 1.2060 1.4610 -0.0965 0.0451  -0.1091 61  VAL A C   
344  O O   . VAL A 44  ? 1.3353 1.2501 1.4913 -0.0952 0.0316  -0.1081 61  VAL A O   
345  C CB  . VAL A 44  ? 1.2639 1.1660 1.4168 -0.0915 0.0686  -0.0767 61  VAL A CB  
346  C CG1 . VAL A 44  ? 1.2791 1.1795 1.4156 -0.0886 0.0554  -0.0731 61  VAL A CG1 
347  C CG2 . VAL A 44  ? 1.2652 1.1722 1.4238 -0.0905 0.0837  -0.0558 61  VAL A CG2 
348  N N   . LYS A 45  ? 1.3406 1.2435 1.5177 -0.0980 0.0436  -0.1261 62  LYS A N   
349  C CA  . LYS A 45  ? 1.3616 1.2611 1.5428 -0.0980 0.0231  -0.1447 62  LYS A CA  
350  C C   . LYS A 45  ? 1.3693 1.2849 1.5732 -0.1010 0.0162  -0.1556 62  LYS A C   
351  O O   . LYS A 45  ? 1.2939 1.2086 1.5028 -0.0999 -0.0028 -0.1682 62  LYS A O   
352  C CB  . LYS A 45  ? 1.4004 1.2848 1.5876 -0.0993 0.0208  -0.1596 62  LYS A CB  
353  C CG  . LYS A 45  ? 1.4466 1.3072 1.6041 -0.0966 0.0214  -0.1541 62  LYS A CG  
354  C CD  . LYS A 45  ? 1.5169 1.3594 1.6766 -0.0994 0.0164  -0.1703 62  LYS A CD  
355  C CE  . LYS A 45  ? 1.5718 1.3900 1.7064 -0.0988 0.0308  -0.1628 62  LYS A CE  
356  N NZ  . LYS A 45  ? 1.6000 1.3963 1.7304 -0.1027 0.0226  -0.1797 62  LYS A NZ  
357  N N   . ASP A 46  ? 1.4106 1.3375 1.6272 -0.1050 0.0318  -0.1509 63  ASP A N   
358  C CA  . ASP A 46  ? 1.4777 1.4162 1.7113 -0.1086 0.0297  -0.1594 63  ASP A CA  
359  C C   . ASP A 46  ? 1.5054 1.4503 1.7252 -0.1116 0.0406  -0.1437 63  ASP A C   
360  O O   . ASP A 46  ? 1.5747 1.5173 1.7878 -0.1136 0.0564  -0.1316 63  ASP A O   
361  C CB  . ASP A 46  ? 1.5370 1.4780 1.8059 -0.1133 0.0376  -0.1778 63  ASP A CB  
362  C CG  . ASP A 46  ? 1.5835 1.5341 1.8749 -0.1166 0.0353  -0.1897 63  ASP A CG  
363  O OD1 . ASP A 46  ? 1.6158 1.5698 1.9002 -0.1138 0.0190  -0.1902 63  ASP A OD1 
364  O OD2 . ASP A 46  ? 1.6258 1.5786 1.9422 -0.1222 0.0516  -0.1990 63  ASP A OD2 
365  N N   . PHE A 47  ? 1.4876 1.4385 1.7031 -0.1123 0.0308  -0.1448 64  PHE A N   
366  C CA  . PHE A 47  ? 1.4783 1.4327 1.6756 -0.1159 0.0357  -0.1310 64  PHE A CA  
367  C C   . PHE A 47  ? 1.5394 1.4968 1.7515 -0.1216 0.0393  -0.1442 64  PHE A C   
368  O O   . PHE A 47  ? 1.5525 1.5138 1.7708 -0.1200 0.0260  -0.1534 64  PHE A O   
369  C CB  . PHE A 47  ? 1.4684 1.4242 1.6429 -0.1115 0.0205  -0.1193 64  PHE A CB  
370  C CG  . PHE A 47  ? 1.4113 1.3709 1.5671 -0.1156 0.0207  -0.1060 64  PHE A CG  
371  C CD1 . PHE A 47  ? 1.3566 1.3149 1.4981 -0.1181 0.0296  -0.0872 64  PHE A CD1 
372  C CD2 . PHE A 47  ? 1.3473 1.3101 1.4994 -0.1172 0.0107  -0.1118 64  PHE A CD2 
373  C CE1 . PHE A 47  ? 1.3137 1.2732 1.4363 -0.1229 0.0267  -0.0749 64  PHE A CE1 
374  C CE2 . PHE A 47  ? 1.3343 1.2982 1.4665 -0.1221 0.0105  -0.1002 64  PHE A CE2 
375  C CZ  . PHE A 47  ? 1.3210 1.2829 1.4376 -0.1254 0.0176  -0.0817 64  PHE A CZ  
376  N N   . GLN A 48  ? 1.5913 1.5445 1.8086 -0.1283 0.0587  -0.1453 65  GLN A N   
377  C CA  . GLN A 48  ? 1.6541 1.6063 1.8918 -0.1344 0.0686  -0.1612 65  GLN A CA  
378  C C   . GLN A 48  ? 1.6070 1.5540 1.8206 -0.1410 0.0738  -0.1537 65  GLN A C   
379  O O   . GLN A 48  ? 1.6367 1.5819 1.8642 -0.1455 0.0799  -0.1669 65  GLN A O   
380  C CB  . GLN A 48  ? 1.6878 1.6337 1.9457 -0.1390 0.0899  -0.1695 65  GLN A CB  
381  C CG  . GLN A 48  ? 1.7168 1.6665 1.9999 -0.1337 0.0837  -0.1792 65  GLN A CG  
382  C CD  . GLN A 48  ? 1.7414 1.6855 2.0479 -0.1384 0.1045  -0.1888 65  GLN A CD  
383  O OE1 . GLN A 48  ? 1.7296 1.6679 2.0252 -0.1377 0.1131  -0.1795 65  GLN A OE1 
384  N NE2 . GLN A 48  ? 1.7488 1.6943 2.0905 -0.1431 0.1137  -0.2079 65  GLN A NE2 
385  N N   . GLU A 49  ? 1.5712 1.5151 1.7501 -0.1416 0.0706  -0.1330 66  GLU A N   
386  C CA  . GLU A 49  ? 1.5693 1.5038 1.7184 -0.1497 0.0756  -0.1235 66  GLU A CA  
387  C C   . GLU A 49  ? 1.6493 1.5860 1.7994 -0.1517 0.0683  -0.1331 66  GLU A C   
388  O O   . GLU A 49  ? 1.7141 1.6386 1.8522 -0.1607 0.0807  -0.1366 66  GLU A O   
389  C CB  . GLU A 49  ? 1.4823 1.4159 1.5999 -0.1488 0.0672  -0.0990 66  GLU A CB  
390  C CG  . GLU A 49  ? 1.4825 1.4053 1.5890 -0.1517 0.0808  -0.0866 66  GLU A CG  
391  C CD  . GLU A 49  ? 1.4417 1.3687 1.5720 -0.1452 0.0868  -0.0901 66  GLU A CD  
392  O OE1 . GLU A 49  ? 1.4757 1.4128 1.6298 -0.1387 0.0793  -0.1023 66  GLU A OE1 
393  O OE2 . GLU A 49  ? 1.3434 1.2610 1.4664 -0.1469 0.0985  -0.0802 66  GLU A OE2 
394  N N   . LEU A 50  ? 1.7084 1.6572 1.8714 -0.1437 0.0498  -0.1380 67  LEU A N   
395  C CA  . LEU A 50  ? 1.7412 1.6929 1.9132 -0.1436 0.0420  -0.1498 67  LEU A CA  
396  C C   . LEU A 50  ? 1.5987 1.5589 1.8109 -0.1363 0.0330  -0.1681 67  LEU A C   
397  O O   . LEU A 50  ? 1.4224 1.3858 1.6505 -0.1342 0.0242  -0.1795 67  LEU A O   
398  C CB  . LEU A 50  ? 1.8222 1.7774 1.9665 -0.1413 0.0245  -0.1366 67  LEU A CB  
399  C CG  . LEU A 50  ? 1.8071 1.7578 1.9136 -0.1461 0.0232  -0.1148 67  LEU A CG  
400  C CD1 . LEU A 50  ? 1.7406 1.6982 1.8319 -0.1415 0.0042  -0.1046 67  LEU A CD1 
401  C CD2 . LEU A 50  ? 1.8510 1.7872 1.9363 -0.1580 0.0369  -0.1139 67  LEU A CD2 
402  N N   . ASP A 55  ? 1.8616 1.7666 1.9634 -0.1789 0.0628  -0.1708 72  ASP A N   
403  C CA  . ASP A 55  ? 1.8985 1.8186 2.0046 -0.1694 0.0385  -0.1679 72  ASP A CA  
404  C C   . ASP A 55  ? 1.7817 1.7194 1.9218 -0.1563 0.0244  -0.1716 72  ASP A C   
405  O O   . ASP A 55  ? 1.8051 1.7483 1.9348 -0.1531 0.0179  -0.1597 72  ASP A O   
406  C CB  . ASP A 55  ? 1.9865 1.9046 2.0465 -0.1730 0.0257  -0.1474 72  ASP A CB  
407  C CG  . ASP A 55  ? 2.0144 1.9445 2.0742 -0.1644 0.0033  -0.1437 72  ASP A CG  
408  O OD1 . ASP A 55  ? 2.1458 2.0801 2.2313 -0.1581 -0.0014 -0.1571 72  ASP A OD1 
409  O OD2 . ASP A 55  ? 1.9183 1.8524 1.9530 -0.1641 -0.0092 -0.1271 72  ASP A OD2 
410  N N   . ALA A 56  ? 1.6796 1.6241 1.8600 -0.1493 0.0193  -0.1880 73  ALA A N   
411  C CA  . ALA A 56  ? 1.5386 1.4951 1.7498 -0.1385 0.0052  -0.1935 73  ALA A CA  
412  C C   . ALA A 56  ? 1.4732 1.4348 1.6573 -0.1316 -0.0152 -0.1781 73  ALA A C   
413  O O   . ALA A 56  ? 1.3542 1.3145 1.5123 -0.1311 -0.0255 -0.1693 73  ALA A O   
414  C CB  . ALA A 56  ? 1.4839 1.4452 1.7400 -0.1320 -0.0029 -0.2119 73  ALA A CB  
415  N N   . TYR A 57  ? 1.3855 1.3512 1.5760 -0.1273 -0.0178 -0.1751 74  TYR A N   
416  C CA  . TYR A 57  ? 1.2817 1.2493 1.4495 -0.1215 -0.0313 -0.1610 74  TYR A CA  
417  C C   . TYR A 57  ? 1.2318 1.1993 1.4074 -0.1121 -0.0524 -0.1676 74  TYR A C   
418  O O   . TYR A 57  ? 1.2261 1.1945 1.4332 -0.1081 -0.0584 -0.1826 74  TYR A O   
419  C CB  . TYR A 57  ? 1.2593 1.2279 1.4356 -0.1210 -0.0231 -0.1589 74  TYR A CB  
420  C CG  . TYR A 57  ? 1.1930 1.1614 1.3536 -0.1153 -0.0311 -0.1469 74  TYR A CG  
421  C CD1 . TYR A 57  ? 1.1915 1.1594 1.3223 -0.1154 -0.0349 -0.1291 74  TYR A CD1 
422  C CD2 . TYR A 57  ? 1.1488 1.1163 1.3270 -0.1111 -0.0319 -0.1534 74  TYR A CD2 
423  C CE1 . TYR A 57  ? 1.2074 1.1736 1.3285 -0.1104 -0.0379 -0.1187 74  TYR A CE1 
424  C CE2 . TYR A 57  ? 1.1538 1.1176 1.3175 -0.1068 -0.0351 -0.1434 74  TYR A CE2 
425  C CZ  . TYR A 57  ? 1.2015 1.1644 1.3378 -0.1062 -0.0370 -0.1261 74  TYR A CZ  
426  O OH  . TYR A 57  ? 1.2594 1.2169 1.3859 -0.1019 -0.0370 -0.1174 74  TYR A OH  
427  N N   . MET A 58  ? 1.1745 1.1390 1.3223 -0.1087 -0.0644 -0.1565 75  MET A N   
428  C CA  . MET A 58  ? 1.1252 1.0837 1.2735 -0.1000 -0.0846 -0.1623 75  MET A CA  
429  C C   . MET A 58  ? 0.9953 0.9468 1.1316 -0.0943 -0.0923 -0.1571 75  MET A C   
430  O O   . MET A 58  ? 0.9351 0.8761 1.0657 -0.0879 -0.1091 -0.1618 75  MET A O   
431  C CB  . MET A 58  ? 1.2221 1.1768 1.3478 -0.0996 -0.0928 -0.1568 75  MET A CB  
432  C CG  . MET A 58  ? 1.2613 1.2186 1.3972 -0.1047 -0.0867 -0.1639 75  MET A CG  
433  S SD  . MET A 58  ? 1.4374 1.3902 1.5382 -0.1071 -0.0916 -0.1527 75  MET A SD  
434  C CE  . MET A 58  ? 1.3741 1.3306 1.4461 -0.1131 -0.0828 -0.1319 75  MET A CE  
435  N N   . GLY A 59  ? 0.9211 0.8751 1.0515 -0.0969 -0.0799 -0.1476 76  GLY A N   
436  C CA  . GLY A 59  ? 0.8912 0.8365 1.0132 -0.0923 -0.0832 -0.1444 76  GLY A CA  
437  C C   . GLY A 59  ? 0.9007 0.8364 0.9909 -0.0893 -0.0872 -0.1308 76  GLY A C   
438  O O   . GLY A 59  ? 0.9268 0.8485 1.0048 -0.0850 -0.0919 -0.1304 76  GLY A O   
439  N N   . VAL A 60  ? 0.9185 0.8602 0.9952 -0.0926 -0.0836 -0.1196 77  VAL A N   
440  C CA  . VAL A 60  ? 0.8949 0.8293 0.9462 -0.0907 -0.0860 -0.1068 77  VAL A CA  
441  C C   . VAL A 60  ? 0.8958 0.8418 0.9427 -0.0963 -0.0755 -0.0905 77  VAL A C   
442  O O   . VAL A 60  ? 0.9020 0.8586 0.9574 -0.1024 -0.0694 -0.0896 77  VAL A O   
443  C CB  . VAL A 60  ? 0.8879 0.8151 0.9262 -0.0887 -0.0993 -0.1114 77  VAL A CB  
444  C CG1 . VAL A 60  ? 0.9183 0.8301 0.9573 -0.0824 -0.1143 -0.1257 77  VAL A CG1 
445  C CG2 . VAL A 60  ? 0.8584 0.7976 0.9062 -0.0940 -0.0981 -0.1147 77  VAL A CG2 
446  N N   . VAL A 61  ? 0.9113 0.8527 0.9439 -0.0948 -0.0740 -0.0777 78  VAL A N   
447  C CA  . VAL A 61  ? 0.8974 0.8493 0.9311 -0.0992 -0.0657 -0.0607 78  VAL A CA  
448  C C   . VAL A 61  ? 0.9157 0.8601 0.9353 -0.0969 -0.0681 -0.0520 78  VAL A C   
449  O O   . VAL A 61  ? 0.9994 0.9273 1.0076 -0.0915 -0.0714 -0.0585 78  VAL A O   
450  C CB  . VAL A 61  ? 0.9210 0.8738 0.9665 -0.0978 -0.0546 -0.0557 78  VAL A CB  
451  C CG1 . VAL A 61  ? 0.9541 0.9171 1.0048 -0.1013 -0.0477 -0.0372 78  VAL A CG1 
452  C CG2 . VAL A 61  ? 0.9664 0.9238 1.0257 -0.1001 -0.0512 -0.0667 78  VAL A CG2 
453  N N   . ASP A 62  ? 0.9240 0.8778 0.9432 -0.1014 -0.0673 -0.0383 79  ASP A N   
454  C CA  . ASP A 62  ? 0.9102 0.8580 0.9232 -0.0996 -0.0654 -0.0280 79  ASP A CA  
455  C C   . ASP A 62  ? 0.9312 0.8811 0.9586 -0.0978 -0.0536 -0.0145 79  ASP A C   
456  O O   . ASP A 62  ? 0.9249 0.8835 0.9665 -0.0988 -0.0483 -0.0101 79  ASP A O   
457  C CB  . ASP A 62  ? 0.9358 0.8920 0.9443 -0.1055 -0.0719 -0.0210 79  ASP A CB  
458  C CG  . ASP A 62  ? 0.9582 0.9319 0.9776 -0.1134 -0.0729 -0.0095 79  ASP A CG  
459  O OD1 . ASP A 62  ? 0.9804 0.9597 1.0122 -0.1134 -0.0671 -0.0038 79  ASP A OD1 
460  O OD2 . ASP A 62  ? 0.9679 0.9472 0.9807 -0.1201 -0.0801 -0.0060 79  ASP A OD2 
461  N N   . GLU A 63  ? 0.9594 0.8994 0.9841 -0.0951 -0.0478 -0.0079 80  GLU A N   
462  C CA  . GLU A 63  ? 0.9814 0.9206 1.0231 -0.0926 -0.0339 0.0043  80  GLU A CA  
463  C C   . GLU A 63  ? 0.9405 0.9027 1.0076 -0.0971 -0.0345 0.0202  80  GLU A C   
464  O O   . GLU A 63  ? 0.8821 0.8482 0.9662 -0.0953 -0.0260 0.0275  80  GLU A O   
465  C CB  . GLU A 63  ? 1.0302 0.9529 1.0659 -0.0901 -0.0250 0.0085  80  GLU A CB  
466  C CG  . GLU A 63  ? 1.1130 1.0307 1.1685 -0.0871 -0.0067 0.0202  80  GLU A CG  
467  C CD  . GLU A 63  ? 1.1882 1.0921 1.2401 -0.0828 0.0035  0.0142  80  GLU A CD  
468  O OE1 . GLU A 63  ? 1.2032 1.0870 1.2280 -0.0807 0.0000  -0.0009 80  GLU A OE1 
469  O OE2 . GLU A 63  ? 1.2036 1.1154 1.2805 -0.0817 0.0146  0.0248  80  GLU A OE2 
470  N N   . ALA A 64  ? 0.9367 0.9116 1.0033 -0.1034 -0.0458 0.0249  81  ALA A N   
471  C CA  . ALA A 64  ? 0.9022 0.8949 0.9866 -0.1091 -0.0510 0.0404  81  ALA A CA  
472  C C   . ALA A 64  ? 0.8848 0.8815 0.9695 -0.1106 -0.0509 0.0389  81  ALA A C   
473  O O   . ALA A 64  ? 0.9032 0.9069 1.0060 -0.1107 -0.0478 0.0522  81  ALA A O   
474  C CB  . ALA A 64  ? 0.9045 0.9046 0.9793 -0.1169 -0.0648 0.0421  81  ALA A CB  
475  N N   . THR A 65  ? 0.8585 0.8500 0.9250 -0.1118 -0.0539 0.0230  82  THR A N   
476  C CA  . THR A 65  ? 0.8472 0.8398 0.9132 -0.1139 -0.0512 0.0188  82  THR A CA  
477  C C   . THR A 65  ? 0.8471 0.8350 0.9262 -0.1074 -0.0387 0.0190  82  THR A C   
478  O O   . THR A 65  ? 0.8110 0.8027 0.8992 -0.1089 -0.0342 0.0267  82  THR A O   
479  C CB  . THR A 65  ? 0.8354 0.8221 0.8866 -0.1153 -0.0539 -0.0004 82  THR A CB  
480  O OG1 . THR A 65  ? 0.8116 0.7997 0.8491 -0.1207 -0.0636 -0.0030 82  THR A OG1 
481  C CG2 . THR A 65  ? 0.8201 0.8071 0.8730 -0.1189 -0.0482 -0.0049 82  THR A CG2 
482  N N   . LEU A 66  ? 0.8457 0.8223 0.9223 -0.1009 -0.0332 0.0104  83  LEU A N   
483  C CA  . LEU A 66  ? 0.8577 0.8260 0.9428 -0.0955 -0.0208 0.0092  83  LEU A CA  
484  C C   . LEU A 66  ? 0.8547 0.8290 0.9605 -0.0942 -0.0126 0.0281  83  LEU A C   
485  O O   . LEU A 66  ? 0.8680 0.8427 0.9849 -0.0929 -0.0042 0.0319  83  LEU A O   
486  C CB  . LEU A 66  ? 0.9191 0.8688 0.9914 -0.0901 -0.0176 -0.0015 83  LEU A CB  
487  C CG  . LEU A 66  ? 0.9186 0.8532 0.9936 -0.0851 -0.0038 -0.0037 83  LEU A CG  
488  C CD1 . LEU A 66  ? 0.9195 0.8562 1.0006 -0.0857 -0.0009 -0.0115 83  LEU A CD1 
489  C CD2 . LEU A 66  ? 0.9389 0.8492 0.9903 -0.0816 -0.0047 -0.0159 83  LEU A CD2 
490  N N   . GLN A 67  ? 0.8916 0.8704 1.0054 -0.0946 -0.0149 0.0398  84  GLN A N   
491  C CA  . GLN A 67  ? 0.9466 0.9331 1.0881 -0.0932 -0.0085 0.0590  84  GLN A CA  
492  C C   . GLN A 67  ? 0.9284 0.9289 1.0802 -0.0979 -0.0167 0.0715  84  GLN A C   
493  O O   . GLN A 67  ? 0.9165 0.9196 1.0889 -0.0954 -0.0096 0.0835  84  GLN A O   
494  C CB  . GLN A 67  ? 1.0650 1.0546 1.2181 -0.0934 -0.0097 0.0684  84  GLN A CB  
495  C CG  . GLN A 67  ? 1.1886 1.1598 1.3411 -0.0877 0.0064  0.0641  84  GLN A CG  
496  C CD  . GLN A 67  ? 1.2649 1.2262 1.4321 -0.0821 0.0253  0.0675  84  GLN A CD  
497  O OE1 . GLN A 67  ? 1.3088 1.2503 1.4556 -0.0791 0.0342  0.0543  84  GLN A OE1 
498  N NE2 . GLN A 67  ? 1.3196 1.2932 1.5221 -0.0809 0.0305  0.0853  84  GLN A NE2 
499  N N   . LYS A 68  ? 0.9359 0.9423 1.0711 -0.1052 -0.0312 0.0689  85  LYS A N   
500  C CA  . LYS A 68  ? 0.9800 0.9933 1.1157 -0.1114 -0.0402 0.0806  85  LYS A CA  
501  C C   . LYS A 68  ? 0.9882 0.9954 1.1225 -0.1098 -0.0302 0.0776  85  LYS A C   
502  O O   . LYS A 68  ? 1.0013 1.0107 1.1484 -0.1100 -0.0298 0.0925  85  LYS A O   
503  C CB  . LYS A 68  ? 1.0398 1.0537 1.1499 -0.1204 -0.0541 0.0744  85  LYS A CB  
504  C CG  . LYS A 68  ? 1.1261 1.1422 1.2293 -0.1290 -0.0663 0.0883  85  LYS A CG  
505  C CD  . LYS A 68  ? 1.1794 1.1925 1.2545 -0.1390 -0.0788 0.0821  85  LYS A CD  
506  C CE  . LYS A 68  ? 1.2425 1.2549 1.3084 -0.1488 -0.0948 0.0990  85  LYS A CE  
507  N NZ  . LYS A 68  ? 1.2636 1.2751 1.3094 -0.1582 -0.1088 0.0974  85  LYS A NZ  
508  N N   . GLY A 69  ? 0.9506 0.9494 1.0710 -0.1082 -0.0229 0.0581  86  GLY A N   
509  C CA  . GLY A 69  ? 0.9371 0.9291 1.0585 -0.1062 -0.0112 0.0514  86  GLY A CA  
510  C C   . GLY A 69  ? 0.9068 0.8954 1.0487 -0.0988 0.0025  0.0582  86  GLY A C   
511  O O   . GLY A 69  ? 0.8698 0.8572 1.0206 -0.0983 0.0092  0.0663  86  GLY A O   
512  N N   . SER A 70  ? 0.9160 0.8999 1.0631 -0.0933 0.0082  0.0545  87  SER A N   
513  C CA  . SER A 70  ? 0.9614 0.9379 1.1259 -0.0868 0.0244  0.0598  87  SER A CA  
514  C C   . SER A 70  ? 0.9899 0.9752 1.1817 -0.0853 0.0264  0.0828  87  SER A C   
515  O O   . SER A 70  ? 0.9865 0.9681 1.1930 -0.0819 0.0383  0.0893  87  SER A O   
516  C CB  . SER A 70  ? 0.9632 0.9281 1.1239 -0.0824 0.0312  0.0531  87  SER A CB  
517  O OG  . SER A 70  ? 0.9846 0.9406 1.1203 -0.0836 0.0251  0.0334  87  SER A OG  
518  N N   . TRP A 71  ? 1.0424 1.0391 1.2429 -0.0880 0.0139  0.0950  88  TRP A N   
519  C CA  . TRP A 71  ? 1.1262 1.1327 1.3580 -0.0866 0.0118  0.1176  88  TRP A CA  
520  C C   . TRP A 71  ? 1.0594 1.0671 1.2895 -0.0893 0.0070  0.1265  88  TRP A C   
521  O O   . TRP A 71  ? 1.0358 1.0421 1.2891 -0.0845 0.0165  0.1385  88  TRP A O   
522  C CB  . TRP A 71  ? 1.2852 1.3038 1.5257 -0.0905 -0.0041 0.1275  88  TRP A CB  
523  C CG  . TRP A 71  ? 1.4560 1.4863 1.7319 -0.0901 -0.0117 0.1514  88  TRP A CG  
524  C CD1 . TRP A 71  ? 1.5199 1.5568 1.7936 -0.0960 -0.0308 0.1646  88  TRP A CD1 
525  C CD2 . TRP A 71  ? 1.5978 1.6329 1.9177 -0.0838 -0.0016 0.1652  88  TRP A CD2 
526  N NE1 . TRP A 71  ? 1.5747 1.6217 1.8899 -0.0934 -0.0365 0.1866  88  TRP A NE1 
527  C CE2 . TRP A 71  ? 1.6207 1.6685 1.9688 -0.0856 -0.0177 0.1872  88  TRP A CE2 
528  C CE3 . TRP A 71  ? 1.6646 1.6918 2.0024 -0.0773 0.0202  0.1610  88  TRP A CE3 
529  C CZ2 . TRP A 71  ? 1.6502 1.7069 2.0513 -0.0802 -0.0133 0.2053  88  TRP A CZ2 
530  C CZ3 . TRP A 71  ? 1.6735 1.7074 2.0615 -0.0726 0.0284  0.1783  88  TRP A CZ3 
531  C CH2 . TRP A 71  ? 1.6801 1.7306 2.1029 -0.0737 0.0113  0.2003  88  TRP A CH2 
532  N N   . SER A 72  ? 0.9864 0.9933 1.1875 -0.0970 -0.0053 0.1198  89  SER A N   
533  C CA  . SER A 72  ? 0.9557 0.9567 1.1441 -0.1011 -0.0072 0.1243  89  SER A CA  
534  C C   . SER A 72  ? 0.9356 0.9271 1.1307 -0.0956 0.0123  0.1193  89  SER A C   
535  O O   . SER A 72  ? 0.9329 0.9221 1.1420 -0.0934 0.0156  0.1342  89  SER A O   
536  C CB  . SER A 72  ? 0.9609 0.9563 1.1135 -0.1098 -0.0148 0.1101  89  SER A CB  
537  O OG  . SER A 72  ? 0.9376 0.9228 1.0736 -0.1150 -0.0145 0.1137  89  SER A OG  
538  N N   . LEU A 73  ? 0.9054 0.8905 1.0911 -0.0935 0.0241  0.0988  90  LEU A N   
539  C CA  . LEU A 73  ? 0.8825 0.8575 1.0725 -0.0895 0.0422  0.0916  90  LEU A CA  
540  C C   . LEU A 73  ? 0.8897 0.8635 1.1089 -0.0818 0.0548  0.1051  90  LEU A C   
541  O O   . LEU A 73  ? 0.8905 0.8603 1.1201 -0.0800 0.0624  0.1150  90  LEU A O   
542  C CB  . LEU A 73  ? 0.8685 0.8362 1.0438 -0.0895 0.0488  0.0666  90  LEU A CB  
543  C CG  . LEU A 73  ? 0.8909 0.8468 1.0736 -0.0843 0.0672  0.0573  90  LEU A CG  
544  C CD1 . LEU A 73  ? 0.8995 0.8494 1.0898 -0.0840 0.0798  0.0624  90  LEU A CD1 
545  C CD2 . LEU A 73  ? 0.8778 0.8264 1.0447 -0.0855 0.0668  0.0327  90  LEU A CD2 
546  N N   . LEU A 74  ? 0.9341 0.9091 1.1659 -0.0774 0.0587  0.1054  91  LEU A N   
547  C CA  . LEU A 74  ? 0.9752 0.9465 1.2374 -0.0701 0.0746  0.1175  91  LEU A CA  
548  C C   . LEU A 74  ? 0.9993 0.9791 1.2904 -0.0682 0.0708  0.1418  91  LEU A C   
549  O O   . LEU A 74  ? 0.9218 0.8955 1.2342 -0.0628 0.0863  0.1500  91  LEU A O   
550  C CB  . LEU A 74  ? 0.9630 0.9350 1.2352 -0.0677 0.0766  0.1181  91  LEU A CB  
551  C CG  . LEU A 74  ? 0.9807 0.9355 1.2297 -0.0667 0.0876  0.0973  91  LEU A CG  
552  C CD1 . LEU A 74  ? 1.0040 0.9593 1.2469 -0.0675 0.0814  0.0944  91  LEU A CD1 
553  C CD2 . LEU A 74  ? 1.0062 0.9436 1.2672 -0.0612 0.1123  0.0973  91  LEU A CD2 
554  N N   . LYS A 75  ? 1.0745 1.0671 1.3665 -0.0727 0.0493  0.1535  92  LYS A N   
555  C CA  . LYS A 75  ? 1.1739 1.1736 1.4904 -0.0720 0.0386  0.1778  92  LYS A CA  
556  C C   . LYS A 75  ? 1.1720 1.1610 1.4771 -0.0724 0.0440  0.1801  92  LYS A C   
557  O O   . LYS A 75  ? 1.1827 1.1684 1.5145 -0.0662 0.0550  0.1928  92  LYS A O   
558  C CB  . LYS A 75  ? 1.2555 1.2665 1.5645 -0.0792 0.0114  0.1871  92  LYS A CB  
559  C CG  . LYS A 75  ? 1.3694 1.3858 1.7012 -0.0795 -0.0055 0.2132  92  LYS A CG  
560  C CD  . LYS A 75  ? 1.4709 1.5035 1.8347 -0.0801 -0.0228 0.2284  92  LYS A CD  
561  C CE  . LYS A 75  ? 1.5323 1.5703 1.8694 -0.0884 -0.0381 0.2178  92  LYS A CE  
562  N NZ  . LYS A 75  ? 1.5803 1.6082 1.8663 -0.0981 -0.0510 0.2096  92  LYS A NZ  
563  N N   . ASP A 76  ? 1.1371 1.1192 1.4037 -0.0796 0.0387  0.1671  93  ASP A N   
564  C CA  . ASP A 76  ? 1.0989 1.0679 1.3504 -0.0813 0.0456  0.1673  93  ASP A CA  
565  C C   . ASP A 76  ? 1.0679 1.0277 1.3315 -0.0749 0.0711  0.1591  93  ASP A C   
566  O O   . ASP A 76  ? 1.0723 1.0237 1.3430 -0.0726 0.0787  0.1691  93  ASP A O   
567  C CB  . ASP A 76  ? 1.0885 1.0499 1.2985 -0.0908 0.0400  0.1514  93  ASP A CB  
568  C CG  . ASP A 76  ? 1.0889 1.0487 1.2787 -0.0989 0.0175  0.1645  93  ASP A CG  
569  O OD1 . ASP A 76  ? 1.0622 1.0253 1.2694 -0.0972 0.0047  0.1874  93  ASP A OD1 
570  O OD2 . ASP A 76  ? 1.0914 1.0453 1.2480 -0.1075 0.0123  0.1517  93  ASP A OD2 
571  N N   . LEU A 77  ? 1.0466 1.0050 1.3097 -0.0725 0.0835  0.1412  94  LEU A N   
572  C CA  . LEU A 77  ? 1.0527 0.9994 1.3248 -0.0674 0.1070  0.1333  94  LEU A CA  
573  C C   . LEU A 77  ? 1.1193 1.0655 1.4288 -0.0593 0.1184  0.1530  94  LEU A C   
574  O O   . LEU A 77  ? 1.1383 1.0740 1.4573 -0.0558 0.1346  0.1566  94  LEU A O   
575  C CB  . LEU A 77  ? 1.0119 0.9539 1.2732 -0.0670 0.1143  0.1122  94  LEU A CB  
576  C CG  . LEU A 77  ? 1.0179 0.9441 1.2833 -0.0631 0.1374  0.1023  94  LEU A CG  
577  C CD1 . LEU A 77  ? 1.0370 0.9550 1.2912 -0.0662 0.1448  0.0942  94  LEU A CD1 
578  C CD2 . LEU A 77  ? 1.0419 0.9600 1.2899 -0.0639 0.1394  0.0820  94  LEU A CD2 
579  N N   . LYS A 78  ? 1.1594 1.1164 1.4930 -0.0562 0.1114  0.1655  95  LYS A N   
580  C CA  . LYS A 78  ? 1.2049 1.1623 1.5806 -0.0484 0.1230  0.1841  95  LYS A CA  
581  C C   . LYS A 78  ? 1.2369 1.1978 1.6277 -0.0474 0.1116  0.2065  95  LYS A C   
582  O O   . LYS A 78  ? 1.2691 1.2250 1.6898 -0.0408 0.1248  0.2197  95  LYS A O   
583  C CB  . LYS A 78  ? 1.2456 1.2130 1.6482 -0.0457 0.1205  0.1911  95  LYS A CB  
584  C CG  . LYS A 78  ? 1.2519 1.2191 1.7056 -0.0373 0.1365  0.2093  95  LYS A CG  
585  C CD  . LYS A 78  ? 1.2659 1.2406 1.7488 -0.0351 0.1389  0.2139  95  LYS A CD  
586  C CE  . LYS A 78  ? 1.2785 1.2606 1.8229 -0.0276 0.1454  0.2378  95  LYS A CE  
587  N NZ  . LYS A 78  ? 1.2783 1.2793 1.8432 -0.0289 0.1148  0.2593  95  LYS A NZ  
588  N N   . ARG A 79  ? 1.2387 1.2049 1.6066 -0.0543 0.0873  0.2108  96  ARG A N   
589  C CA  . ARG A 79  ? 1.2468 1.2092 1.6147 -0.0554 0.0738  0.2304  96  ARG A CA  
590  C C   . ARG A 79  ? 1.2353 1.1801 1.5926 -0.0535 0.0937  0.2260  96  ARG A C   
591  O O   . ARG A 79  ? 1.2995 1.2386 1.6777 -0.0486 0.0961  0.2444  96  ARG A O   
592  C CB  . ARG A 79  ? 1.2723 1.2352 1.6016 -0.0658 0.0483  0.2294  96  ARG A CB  
593  C CG  . ARG A 79  ? 1.3507 1.3143 1.6848 -0.0682 0.0220  0.2547  96  ARG A CG  
594  C CD  . ARG A 79  ? 1.4248 1.3876 1.7174 -0.0798 -0.0016 0.2500  96  ARG A CD  
595  N NE  . ARG A 79  ? 1.5485 1.5137 1.8448 -0.0839 -0.0327 0.2732  96  ARG A NE  
596  C CZ  . ARG A 79  ? 1.6193 1.5667 1.8773 -0.0925 -0.0516 0.2828  96  ARG A CZ  
597  N NH1 . ARG A 79  ? 1.6237 1.5483 1.8361 -0.0982 -0.0406 0.2717  96  ARG A NH1 
598  N NH2 . ARG A 79  ? 1.6155 1.5655 1.8803 -0.0961 -0.0825 0.3041  96  ARG A NH2 
599  N N   . ILE A 80  ? 1.2350 1.1711 1.5623 -0.0574 0.1076  0.2015  97  ILE A N   
600  C CA  . ILE A 80  ? 1.2912 1.2108 1.6100 -0.0564 0.1292  0.1933  97  ILE A CA  
601  C C   . ILE A 80  ? 1.2998 1.2149 1.6540 -0.0471 0.1521  0.1986  97  ILE A C   
602  O O   . ILE A 80  ? 1.3058 1.2108 1.6725 -0.0431 0.1622  0.2107  97  ILE A O   
603  C CB  . ILE A 80  ? 1.3072 1.2205 1.5927 -0.0629 0.1376  0.1642  97  ILE A CB  
604  C CG1 . ILE A 80  ? 1.3485 1.2595 1.5993 -0.0724 0.1213  0.1606  97  ILE A CG1 
605  C CG2 . ILE A 80  ? 1.3055 1.2031 1.5905 -0.0612 0.1629  0.1532  97  ILE A CG2 
606  C CD1 . ILE A 80  ? 1.3733 1.2816 1.5979 -0.0791 0.1259  0.1329  97  ILE A CD1 
607  N N   . THR A 81  ? 1.2998 1.2193 1.6678 -0.0440 0.1615  0.1898  98  THR A N   
608  C CA  . THR A 81  ? 1.3072 1.2171 1.7036 -0.0364 0.1875  0.1919  98  THR A CA  
609  C C   . THR A 81  ? 1.3132 1.2293 1.7566 -0.0284 0.1866  0.2200  98  THR A C   
610  O O   . THR A 81  ? 1.3068 1.2120 1.7722 -0.0225 0.2062  0.2279  98  THR A O   
611  C CB  . THR A 81  ? 1.2901 1.1956 1.6816 -0.0364 0.2002  0.1739  98  THR A CB  
612  O OG1 . THR A 81  ? 1.2775 1.1976 1.6785 -0.0366 0.1848  0.1790  98  THR A OG1 
613  C CG2 . THR A 81  ? 1.2733 1.1702 1.6234 -0.0433 0.2011  0.1471  98  THR A CG2 
614  N N   . ASP A 82  ? 1.3059 1.2392 1.7659 -0.0286 0.1631  0.2352  99  ASP A N   
615  C CA  . ASP A 82  ? 1.3371 1.2786 1.8465 -0.0215 0.1562  0.2634  99  ASP A CA  
616  C C   . ASP A 82  ? 1.3833 1.3157 1.8910 -0.0200 0.1510  0.2788  99  ASP A C   
617  O O   . ASP A 82  ? 1.3514 1.2805 1.8995 -0.0117 0.1609  0.2966  99  ASP A O   
618  C CB  . ASP A 82  ? 1.3039 1.2655 1.8279 -0.0239 0.1268  0.2760  99  ASP A CB  
619  C CG  . ASP A 82  ? 1.2637 1.2339 1.8057 -0.0229 0.1348  0.2676  99  ASP A CG  
620  O OD1 . ASP A 82  ? 1.2498 1.2087 1.7998 -0.0190 0.1639  0.2564  99  ASP A OD1 
621  O OD2 . ASP A 82  ? 1.2281 1.2135 1.7733 -0.0267 0.1126  0.2718  99  ASP A OD2 
622  N N   . SER A 83  ? 1.4529 1.3786 1.9135 -0.0281 0.1375  0.2716  100 SER A N   
623  C CA  . SER A 83  ? 1.5107 1.4217 1.9594 -0.0280 0.1341  0.2843  100 SER A CA  
624  C C   . SER A 83  ? 1.5397 1.4334 1.9955 -0.0227 0.1657  0.2794  100 SER A C   
625  O O   . SER A 83  ? 1.6014 1.4820 2.0569 -0.0206 0.1657  0.2937  100 SER A O   
626  C CB  . SER A 83  ? 1.5174 1.4200 1.9098 -0.0392 0.1181  0.2748  100 SER A CB  
627  O OG  . SER A 83  ? 1.5459 1.4373 1.9064 -0.0437 0.1389  0.2488  100 SER A OG  
628  N N   . ASP A 84  ? 1.5404 1.4308 1.9984 -0.0214 0.1917  0.2595  101 ASP A N   
629  C CA  . ASP A 84  ? 1.5817 1.4545 2.0487 -0.0168 0.2230  0.2544  101 ASP A CA  
630  C C   . ASP A 84  ? 1.5867 1.4424 2.0132 -0.0230 0.2296  0.2423  101 ASP A C   
631  O O   . ASP A 84  ? 1.5408 1.3802 1.9725 -0.0198 0.2521  0.2420  101 ASP A O   
632  C CB  . ASP A 84  ? 1.6192 1.4907 2.1376 -0.0060 0.2295  0.2814  101 ASP A CB  
633  C CG  . ASP A 84  ? 1.6372 1.4926 2.1759 0.0000  0.2662  0.2758  101 ASP A CG  
634  O OD1 . ASP A 84  ? 1.6272 1.4762 2.1517 -0.0028 0.2854  0.2534  101 ASP A OD1 
635  O OD2 . ASP A 84  ? 1.6291 1.4760 2.1971 0.0073  0.2752  0.2945  101 ASP A OD2 
636  N N   . VAL A 85  ? 1.5962 1.4548 1.9834 -0.0322 0.2121  0.2312  102 VAL A N   
637  C CA  . VAL A 85  ? 1.6547 1.4972 2.0039 -0.0395 0.2173  0.2196  102 VAL A CA  
638  C C   . VAL A 85  ? 1.6403 1.4722 1.9824 -0.0411 0.2452  0.1942  102 VAL A C   
639  O O   . VAL A 85  ? 1.6464 1.4850 1.9949 -0.0406 0.2513  0.1799  102 VAL A O   
640  C CB  . VAL A 85  ? 1.6716 1.5197 1.9841 -0.0493 0.1934  0.2127  102 VAL A CB  
641  C CG1 . VAL A 85  ? 1.6752 1.5359 1.9773 -0.0537 0.1919  0.1885  102 VAL A CG1 
642  C CG2 . VAL A 85  ? 1.7352 1.5635 2.0111 -0.0569 0.1973  0.2072  102 VAL A CG2 
643  N N   . LYS A 86  ? 1.6237 1.4371 1.9522 -0.0435 0.2617  0.1890  103 LYS A N   
644  C CA  . LYS A 86  ? 1.5994 1.4010 1.9259 -0.0450 0.2886  0.1667  103 LYS A CA  
645  C C   . LYS A 86  ? 1.5511 1.3416 1.8474 -0.0545 0.2953  0.1466  103 LYS A C   
646  O O   . LYS A 86  ? 1.5154 1.3016 1.7910 -0.0593 0.2847  0.1522  103 LYS A O   
647  C CB  . LYS A 86  ? 1.6578 1.4441 2.0086 -0.0374 0.3119  0.1793  103 LYS A CB  
648  C CG  . LYS A 86  ? 1.7174 1.5101 2.1081 -0.0268 0.3130  0.2014  103 LYS A CG  
649  C CD  . LYS A 86  ? 1.7148 1.4898 2.1270 -0.0210 0.3446  0.2020  103 LYS A CD  
650  C CE  . LYS A 86  ? 1.7096 1.4843 2.1643 -0.0096 0.3479  0.2315  103 LYS A CE  
651  N NZ  . LYS A 86  ? 1.7087 1.4987 2.1952 -0.0042 0.3431  0.2389  103 LYS A NZ  
652  N N   . GLY A 87  ? 1.5143 1.2974 1.8084 -0.0577 0.3138  0.1234  104 GLY A N   
653  C CA  . GLY A 87  ? 1.5275 1.2981 1.8028 -0.0661 0.3256  0.1042  104 GLY A CA  
654  C C   . GLY A 87  ? 1.5520 1.3294 1.8036 -0.0749 0.3096  0.0934  104 GLY A C   
655  O O   . GLY A 87  ? 1.5975 1.3913 1.8452 -0.0757 0.2900  0.0910  104 GLY A O   
656  N N   . ASP A 88  ? 1.5462 1.3093 1.7816 -0.0817 0.3193  0.0868  105 ASP A N   
657  C CA  . ASP A 88  ? 1.5574 1.3233 1.7702 -0.0906 0.3075  0.0766  105 ASP A CA  
658  C C   . ASP A 88  ? 1.5860 1.3590 1.7841 -0.0901 0.2831  0.0957  105 ASP A C   
659  O O   . ASP A 88  ? 1.5958 1.3783 1.7810 -0.0960 0.2699  0.0847  105 ASP A O   
660  C CB  . ASP A 88  ? 1.5602 1.3048 1.7575 -0.0985 0.3259  0.0674  105 ASP A CB  
661  C CG  . ASP A 88  ? 1.5120 1.2574 1.7204 -0.1045 0.3409  0.0370  105 ASP A CG  
662  O OD1 . ASP A 88  ? 1.4712 1.2273 1.6980 -0.1010 0.3406  0.0265  105 ASP A OD1 
663  O OD2 . ASP A 88  ? 1.4211 1.1545 1.6194 -0.1132 0.3527  0.0237  105 ASP A OD2 
664  N N   . LEU A 89  ? 1.6303 1.3983 1.8317 -0.0835 0.2766  0.1237  106 LEU A N   
665  C CA  . LEU A 89  ? 1.6562 1.4322 1.8490 -0.0823 0.2498  0.1444  106 LEU A CA  
666  C C   . LEU A 89  ? 1.5905 1.3923 1.7939 -0.0813 0.2331  0.1359  106 LEU A C   
667  O O   . LEU A 89  ? 1.5193 1.3283 1.7043 -0.0869 0.2149  0.1334  106 LEU A O   
668  C CB  . LEU A 89  ? 1.7237 1.4964 1.9363 -0.0723 0.2452  0.1749  106 LEU A CB  
669  C CG  . LEU A 89  ? 1.7527 1.4999 1.9595 -0.0698 0.2555  0.1934  106 LEU A CG  
670  C CD1 . LEU A 89  ? 1.7199 1.4708 1.9636 -0.0575 0.2547  0.2182  106 LEU A CD1 
671  C CD2 . LEU A 89  ? 1.8103 1.5401 1.9781 -0.0770 0.2383  0.2062  106 LEU A CD2 
672  N N   . PHE A 90  ? 1.5553 1.3671 1.7866 -0.0743 0.2415  0.1316  107 PHE A N   
673  C CA  . PHE A 90  ? 1.4613 1.2924 1.7041 -0.0721 0.2309  0.1236  107 PHE A CA  
674  C C   . PHE A 90  ? 1.4218 1.2576 1.6473 -0.0802 0.2281  0.0965  107 PHE A C   
675  O O   . PHE A 90  ? 1.4241 1.2727 1.6412 -0.0828 0.2099  0.0935  107 PHE A O   
676  C CB  . PHE A 90  ? 1.4589 1.2895 1.7288 -0.0642 0.2473  0.1229  107 PHE A CB  
677  C CG  . PHE A 90  ? 1.3994 1.2399 1.6718 -0.0644 0.2446  0.1050  107 PHE A CG  
678  C CD1 . PHE A 90  ? 1.3502 1.2066 1.6205 -0.0644 0.2241  0.1077  107 PHE A CD1 
679  C CD2 . PHE A 90  ? 1.3640 1.1945 1.6389 -0.0647 0.2625  0.0863  107 PHE A CD2 
680  C CE1 . PHE A 90  ? 1.3278 1.1891 1.5968 -0.0645 0.2221  0.0919  107 PHE A CE1 
681  C CE2 . PHE A 90  ? 1.3039 1.1378 1.5753 -0.0652 0.2587  0.0708  107 PHE A CE2 
682  C CZ  . PHE A 90  ? 1.2948 1.1435 1.5629 -0.0648 0.2389  0.0739  107 PHE A CZ  
683  N N   . VAL A 91  ? 1.3940 1.2192 1.6165 -0.0844 0.2457  0.0771  108 VAL A N   
684  C CA  . VAL A 91  ? 1.3885 1.2193 1.6036 -0.0912 0.2431  0.0503  108 VAL A CA  
685  C C   . VAL A 91  ? 1.4041 1.2378 1.5983 -0.0981 0.2290  0.0501  108 VAL A C   
686  O O   . VAL A 91  ? 1.3859 1.2327 1.5759 -0.1005 0.2142  0.0400  108 VAL A O   
687  C CB  . VAL A 91  ? 1.3902 1.2086 1.6095 -0.0955 0.2639  0.0300  108 VAL A CB  
688  C CG1 . VAL A 91  ? 1.3738 1.1994 1.5911 -0.1027 0.2581  0.0032  108 VAL A CG1 
689  C CG2 . VAL A 91  ? 1.4040 1.2170 1.6397 -0.0900 0.2773  0.0277  108 VAL A CG2 
690  N N   . LYS A 92  ? 1.4427 1.2612 1.6211 -0.1016 0.2341  0.0621  109 LYS A N   
691  C CA  . LYS A 92  ? 1.4881 1.3018 1.6401 -0.1097 0.2242  0.0623  109 LYS A CA  
692  C C   . LYS A 92  ? 1.4242 1.2523 1.5702 -0.1078 0.1986  0.0765  109 LYS A C   
693  O O   . LYS A 92  ? 1.3408 1.1766 1.4762 -0.1130 0.1880  0.0650  109 LYS A O   
694  C CB  . LYS A 92  ? 1.6359 1.4233 1.7655 -0.1143 0.2357  0.0736  109 LYS A CB  
695  C CG  . LYS A 92  ? 1.7204 1.4925 1.8533 -0.1191 0.2625  0.0549  109 LYS A CG  
696  C CD  . LYS A 92  ? 1.8013 1.5426 1.9087 -0.1237 0.2765  0.0666  109 LYS A CD  
697  C CE  . LYS A 92  ? 1.8463 1.5737 1.9618 -0.1285 0.3051  0.0463  109 LYS A CE  
698  N NZ  . LYS A 92  ? 1.8839 1.5811 1.9828 -0.1294 0.3229  0.0599  109 LYS A NZ  
699  N N   . GLU A 93  ? 1.3798 1.2125 1.5367 -0.1003 0.1892  0.1001  110 GLU A N   
700  C CA  . GLU A 93  ? 1.3507 1.1975 1.5057 -0.0990 0.1645  0.1137  110 GLU A CA  
701  C C   . GLU A 93  ? 1.3112 1.1776 1.4762 -0.0982 0.1574  0.0965  110 GLU A C   
702  O O   . GLU A 93  ? 1.2725 1.1472 1.4245 -0.1024 0.1407  0.0945  110 GLU A O   
703  C CB  . GLU A 93  ? 1.3995 1.2505 1.5762 -0.0901 0.1571  0.1409  110 GLU A CB  
704  C CG  . GLU A 93  ? 1.4814 1.3216 1.6404 -0.0926 0.1398  0.1657  110 GLU A CG  
705  C CD  . GLU A 93  ? 1.5540 1.3943 1.7408 -0.0832 0.1365  0.1923  110 GLU A CD  
706  O OE1 . GLU A 93  ? 1.6229 1.4819 1.8437 -0.0754 0.1319  0.1991  110 GLU A OE1 
707  O OE2 . GLU A 93  ? 1.6106 1.4307 1.7863 -0.0833 0.1394  0.2068  110 GLU A OE2 
708  N N   . LEU A 94  ? 1.2781 1.1487 1.4633 -0.0932 0.1700  0.0840  111 LEU A N   
709  C CA  . LEU A 94  ? 1.2202 1.1048 1.4128 -0.0915 0.1629  0.0696  111 LEU A CA  
710  C C   . LEU A 94  ? 1.1793 1.0668 1.3561 -0.0992 0.1569  0.0483  111 LEU A C   
711  O O   . LEU A 94  ? 1.1594 1.0578 1.3301 -0.1004 0.1408  0.0465  111 LEU A O   
712  C CB  . LEU A 94  ? 1.2333 1.1142 1.4432 -0.0863 0.1788  0.0594  111 LEU A CB  
713  C CG  . LEU A 94  ? 1.2249 1.1111 1.4349 -0.0865 0.1748  0.0381  111 LEU A CG  
714  C CD1 . LEU A 94  ? 1.1914 1.0891 1.4027 -0.0830 0.1594  0.0462  111 LEU A CD1 
715  C CD2 . LEU A 94  ? 1.2405 1.1151 1.4607 -0.0835 0.1923  0.0284  111 LEU A CD2 
716  N N   . PHE A 95  ? 1.1727 1.0502 1.3460 -0.1044 0.1707  0.0319  112 PHE A N   
717  C CA  . PHE A 95  ? 1.1270 1.0076 1.2934 -0.1113 0.1670  0.0100  112 PHE A CA  
718  C C   . PHE A 95  ? 1.1465 1.0243 1.2900 -0.1182 0.1577  0.0162  112 PHE A C   
719  O O   . PHE A 95  ? 1.1404 1.0259 1.2781 -0.1217 0.1471  0.0055  112 PHE A O   
720  C CB  . PHE A 95  ? 1.0751 0.9469 1.2510 -0.1150 0.1849  -0.0100 112 PHE A CB  
721  C CG  . PHE A 95  ? 1.0454 0.9206 1.2397 -0.1104 0.1882  -0.0227 112 PHE A CG  
722  C CD1 . PHE A 95  ? 1.0340 0.9181 1.2349 -0.1110 0.1773  -0.0420 112 PHE A CD1 
723  C CD2 . PHE A 95  ? 1.0662 0.9337 1.2691 -0.1053 0.2005  -0.0142 112 PHE A CD2 
724  C CE1 . PHE A 95  ? 1.0231 0.9055 1.2347 -0.1076 0.1776  -0.0535 112 PHE A CE1 
725  C CE2 . PHE A 95  ? 1.0820 0.9480 1.2961 -0.1021 0.2036  -0.0263 112 PHE A CE2 
726  C CZ  . PHE A 95  ? 1.0379 0.9102 1.2541 -0.1036 0.1912  -0.0459 112 PHE A CZ  
727  N N   . TRP A 96  ? 1.1740 1.0384 1.3025 -0.1200 0.1609  0.0349  113 TRP A N   
728  C CA  . TRP A 96  ? 1.2115 1.0674 1.3115 -0.1271 0.1506  0.0449  113 TRP A CA  
729  C C   . TRP A 96  ? 1.1944 1.0673 1.2941 -0.1248 0.1279  0.0526  113 TRP A C   
730  O O   . TRP A 96  ? 1.1838 1.0595 1.2693 -0.1307 0.1188  0.0439  113 TRP A O   
731  C CB  . TRP A 96  ? 1.2612 1.0988 1.3468 -0.1272 0.1538  0.0678  113 TRP A CB  
732  C CG  . TRP A 96  ? 1.3131 1.1306 1.3617 -0.1366 0.1486  0.0762  113 TRP A CG  
733  C CD1 . TRP A 96  ? 1.3603 1.1684 1.3895 -0.1373 0.1326  0.1013  113 TRP A CD1 
734  C CD2 . TRP A 96  ? 1.3327 1.1326 1.3566 -0.1476 0.1602  0.0599  113 TRP A CD2 
735  N NE1 . TRP A 96  ? 1.4052 1.1881 1.3925 -0.1488 0.1320  0.1019  113 TRP A NE1 
736  C CE2 . TRP A 96  ? 1.3798 1.1567 1.3628 -0.1554 0.1508  0.0764  113 TRP A CE2 
737  C CE3 . TRP A 96  ? 1.3366 1.1372 1.3706 -0.1519 0.1770  0.0329  113 TRP A CE3 
738  C CZ2 . TRP A 96  ? 1.3957 1.1471 1.3432 -0.1678 0.1608  0.0664  113 TRP A CZ2 
739  C CZ3 . TRP A 96  ? 1.4037 1.1826 1.4100 -0.1634 0.1874  0.0230  113 TRP A CZ3 
740  C CH2 . TRP A 96  ? 1.4210 1.1739 1.3820 -0.1715 0.1808  0.0396  113 TRP A CH2 
741  N N   . MET A 97  ? 1.2068 1.0906 1.3253 -0.1160 0.1212  0.0676  114 MET A N   
742  C CA  . MET A 97  ? 1.2050 1.1049 1.3287 -0.1130 0.1015  0.0769  114 MET A CA  
743  C C   . MET A 97  ? 1.1488 1.0608 1.2755 -0.1135 0.0969  0.0563  114 MET A C   
744  O O   . MET A 97  ? 1.1365 1.0551 1.2519 -0.1168 0.0817  0.0572  114 MET A O   
745  C CB  . MET A 97  ? 1.2212 1.1294 1.3722 -0.1029 0.1019  0.0923  114 MET A CB  
746  C CG  . MET A 97  ? 1.2130 1.1365 1.3735 -0.0999 0.0835  0.1047  114 MET A CG  
747  S SD  . MET A 97  ? 1.1649 1.1011 1.3390 -0.0950 0.0844  0.0871  114 MET A SD  
748  C CE  . MET A 97  ? 1.1475 1.0773 1.3459 -0.0865 0.1062  0.0867  114 MET A CE  
749  N N   . LEU A 98  ? 1.1316 1.0447 1.2727 -0.1104 0.1088  0.0381  115 LEU A N   
750  C CA  . LEU A 98  ? 1.1228 1.0451 1.2675 -0.1100 0.1023  0.0191  115 LEU A CA  
751  C C   . LEU A 98  ? 1.1099 1.0308 1.2391 -0.1183 0.0977  0.0064  115 LEU A C   
752  O O   . LEU A 98  ? 1.1070 1.0364 1.2318 -0.1190 0.0847  0.0009  115 LEU A O   
753  C CB  . LEU A 98  ? 1.1204 1.0399 1.2807 -0.1066 0.1141  0.0018  115 LEU A CB  
754  C CG  . LEU A 98  ? 1.1265 1.0442 1.3000 -0.0987 0.1207  0.0130  115 LEU A CG  
755  C CD1 . LEU A 98  ? 1.1441 1.0530 1.3279 -0.0974 0.1350  -0.0033 115 LEU A CD1 
756  C CD2 . LEU A 98  ? 1.0816 1.0076 1.2570 -0.0938 0.1088  0.0192  115 LEU A CD2 
757  N N   . HIS A 99  ? 1.1616 1.0695 1.2822 -0.1247 0.1104  0.0018  116 HIS A N   
758  C CA  . HIS A 99  ? 1.1958 1.0982 1.3023 -0.1335 0.1111  -0.0109 116 HIS A CA  
759  C C   . HIS A 99  ? 1.2168 1.1193 1.2992 -0.1378 0.0952  0.0027  116 HIS A C   
760  O O   . HIS A 99  ? 1.1215 1.0286 1.1974 -0.1413 0.0869  -0.0068 116 HIS A O   
761  C CB  . HIS A 99  ? 1.2250 1.1082 1.3238 -0.1403 0.1312  -0.0157 116 HIS A CB  
762  C CG  . HIS A 99  ? 1.2637 1.1346 1.3425 -0.1508 0.1357  -0.0251 116 HIS A CG  
763  N ND1 . HIS A 99  ? 1.2795 1.1576 1.3704 -0.1533 0.1354  -0.0463 116 HIS A ND1 
764  C CD2 . HIS A 99  ? 1.2891 1.1380 1.3350 -0.1598 0.1411  -0.0158 116 HIS A CD2 
765  C CE1 . HIS A 99  ? 1.3003 1.1622 1.3689 -0.1633 0.1429  -0.0502 116 HIS A CE1 
766  N NE2 . HIS A 99  ? 1.3505 1.1927 1.3884 -0.1679 0.1467  -0.0321 116 HIS A NE2 
767  N N   . LEU A 100 ? 1.3057 1.2020 1.3758 -0.1376 0.0902  0.0256  117 LEU A N   
768  C CA  . LEU A 100 ? 1.3746 1.2689 1.4210 -0.1426 0.0730  0.0403  117 LEU A CA  
769  C C   . LEU A 100 ? 1.2900 1.2046 1.3482 -0.1379 0.0561  0.0407  117 LEU A C   
770  O O   . LEU A 100 ? 1.2218 1.1374 1.2635 -0.1435 0.0446  0.0390  117 LEU A O   
771  C CB  . LEU A 100 ? 1.4712 1.3566 1.5091 -0.1419 0.0674  0.0661  117 LEU A CB  
772  C CG  . LEU A 100 ? 1.6092 1.4673 1.6209 -0.1488 0.0780  0.0737  117 LEU A CG  
773  C CD1 . LEU A 100 ? 1.6648 1.5028 1.6475 -0.1605 0.0899  0.0568  117 LEU A CD1 
774  C CD2 . LEU A 100 ? 1.5983 1.4521 1.6289 -0.1421 0.0937  0.0780  117 LEU A CD2 
775  N N   . GLN A 101 ? 1.2072 1.1348 1.2918 -0.1280 0.0565  0.0423  118 GLN A N   
776  C CA  . GLN A 101 ? 1.1803 1.1231 1.2754 -0.1233 0.0443  0.0414  118 GLN A CA  
777  C C   . GLN A 101 ? 1.1523 1.0985 1.2434 -0.1256 0.0420  0.0198  118 GLN A C   
778  O O   . GLN A 101 ? 1.1265 1.0796 1.2104 -0.1270 0.0286  0.0204  118 GLN A O   
779  C CB  . GLN A 101 ? 1.2109 1.1602 1.3312 -0.1132 0.0501  0.0440  118 GLN A CB  
780  C CG  . GLN A 101 ? 1.2213 1.1741 1.3541 -0.1087 0.0462  0.0685  118 GLN A CG  
781  C CD  . GLN A 101 ? 1.2413 1.2020 1.3678 -0.1120 0.0269  0.0829  118 GLN A CD  
782  O OE1 . GLN A 101 ? 1.2596 1.2214 1.3941 -0.1111 0.0200  0.1042  118 GLN A OE1 
783  N NE2 . GLN A 101 ? 1.1932 1.1588 1.3067 -0.1159 0.0170  0.0717  118 GLN A NE2 
784  N N   . LYS A 102 ? 1.1388 1.0804 1.2373 -0.1259 0.0545  0.0008  119 LYS A N   
785  C CA  . LYS A 102 ? 1.1279 1.0729 1.2284 -0.1275 0.0514  -0.0200 119 LYS A CA  
786  C C   . LYS A 102 ? 1.1131 1.0533 1.1922 -0.1364 0.0464  -0.0203 119 LYS A C   
787  O O   . LYS A 102 ? 1.0737 1.0198 1.1500 -0.1369 0.0364  -0.0274 119 LYS A O   
788  C CB  . LYS A 102 ? 1.1801 1.1204 1.2963 -0.1278 0.0651  -0.0401 119 LYS A CB  
789  C CG  . LYS A 102 ? 1.2062 1.1489 1.3418 -0.1200 0.0686  -0.0454 119 LYS A CG  
790  C CD  . LYS A 102 ? 1.2306 1.1743 1.3829 -0.1198 0.0688  -0.0700 119 LYS A CD  
791  C CE  . LYS A 102 ? 1.2280 1.1673 1.3974 -0.1164 0.0781  -0.0782 119 LYS A CE  
792  N NZ  . LYS A 102 ? 1.2503 1.1911 1.4379 -0.1167 0.0731  -0.1018 119 LYS A NZ  
793  N N   . GLU A 103 ? 1.1757 1.1020 1.2366 -0.1439 0.0540  -0.0124 120 GLU A N   
794  C CA  . GLU A 103 ? 1.2348 1.1503 1.2683 -0.1541 0.0509  -0.0122 120 GLU A CA  
795  C C   . GLU A 103 ? 1.1963 1.1191 1.2165 -0.1548 0.0310  0.0019  120 GLU A C   
796  O O   . GLU A 103 ? 1.1293 1.0527 1.1387 -0.1591 0.0243  -0.0054 120 GLU A O   
797  C CB  . GLU A 103 ? 1.3655 1.2583 1.3743 -0.1626 0.0622  -0.0038 120 GLU A CB  
798  C CG  . GLU A 103 ? 1.4400 1.3174 1.4470 -0.1695 0.0831  -0.0235 120 GLU A CG  
799  C CD  . GLU A 103 ? 1.4569 1.3353 1.4616 -0.1743 0.0818  -0.0399 120 GLU A CD  
800  O OE1 . GLU A 103 ? 1.3968 1.2793 1.3852 -0.1763 0.0655  -0.0325 120 GLU A OE1 
801  O OE2 . GLU A 103 ? 1.4641 1.3396 1.4869 -0.1760 0.0975  -0.0604 120 GLU A OE2 
802  N N   . THR A 104 ? 1.1576 1.0863 1.1821 -0.1502 0.0221  0.0221  121 THR A N   
803  C CA  . THR A 104 ? 1.1022 1.0390 1.1199 -0.1510 0.0030  0.0366  121 THR A CA  
804  C C   . THR A 104 ? 0.9923 0.9437 1.0238 -0.1457 -0.0030 0.0251  121 THR A C   
805  O O   . THR A 104 ? 0.9971 0.9505 1.0159 -0.1500 -0.0142 0.0254  121 THR A O   
806  C CB  . THR A 104 ? 1.1344 1.0779 1.1666 -0.1452 -0.0040 0.0593  121 THR A CB  
807  O OG1 . THR A 104 ? 1.1828 1.1101 1.1998 -0.1499 -0.0005 0.0718  121 THR A OG1 
808  C CG2 . THR A 104 ? 1.1103 1.0640 1.1426 -0.1461 -0.0236 0.0734  121 THR A CG2 
809  N N   . PHE A 105 ? 0.9329 0.8916 0.9876 -0.1367 0.0042  0.0150  122 PHE A N   
810  C CA  . PHE A 105 ? 0.8847 0.8527 0.9491 -0.1312 -0.0019 0.0043  122 PHE A CA  
811  C C   . PHE A 105 ? 0.8531 0.8179 0.9080 -0.1361 -0.0030 -0.0137 122 PHE A C   
812  O O   . PHE A 105 ? 0.8340 0.8034 0.8844 -0.1358 -0.0131 -0.0168 122 PHE A O   
813  C CB  . PHE A 105 ? 0.8952 0.8649 0.9800 -0.1223 0.0063  -0.0036 122 PHE A CB  
814  C CG  . PHE A 105 ? 0.9036 0.8776 0.9933 -0.1161 -0.0010 -0.0109 122 PHE A CG  
815  C CD1 . PHE A 105 ? 0.9184 0.8963 1.0125 -0.1115 -0.0052 0.0023  122 PHE A CD1 
816  C CD2 . PHE A 105 ? 0.8885 0.8607 0.9785 -0.1153 -0.0037 -0.0308 122 PHE A CD2 
817  C CE1 . PHE A 105 ? 0.9117 0.8885 1.0048 -0.1066 -0.0104 -0.0041 122 PHE A CE1 
818  C CE2 . PHE A 105 ? 0.8923 0.8640 0.9814 -0.1099 -0.0120 -0.0366 122 PHE A CE2 
819  C CZ  . PHE A 105 ? 0.9054 0.8778 0.9932 -0.1058 -0.0144 -0.0234 122 PHE A CZ  
820  N N   . ALA A 106 ? 0.9012 0.8572 0.9549 -0.1407 0.0089  -0.0256 123 ALA A N   
821  C CA  . ALA A 106 ? 0.9299 0.8814 0.9794 -0.1458 0.0113  -0.0431 123 ALA A CA  
822  C C   . ALA A 106 ? 0.9459 0.8938 0.9708 -0.1533 0.0021  -0.0359 123 ALA A C   
823  O O   . ALA A 106 ? 0.9505 0.9009 0.9739 -0.1538 -0.0039 -0.0455 123 ALA A O   
824  C CB  . ALA A 106 ? 0.9729 0.9121 1.0233 -0.1518 0.0289  -0.0531 123 ALA A CB  
825  N N   . THR A 107 ? 1.0021 0.9428 1.0068 -0.1593 -0.0004 -0.0181 124 THR A N   
826  C CA  . THR A 107 ? 1.0469 0.9820 1.0253 -0.1678 -0.0112 -0.0103 124 THR A CA  
827  C C   . THR A 107 ? 0.9889 0.9389 0.9750 -0.1626 -0.0265 -0.0061 124 THR A C   
828  O O   . THR A 107 ? 0.9819 0.9306 0.9572 -0.1666 -0.0317 -0.0132 124 THR A O   
829  C CB  . THR A 107 ? 1.1294 1.0529 1.0833 -0.1755 -0.0167 0.0101  124 THR A CB  
830  O OG1 . THR A 107 ? 1.1481 1.0550 1.0936 -0.1793 -0.0011 0.0086  124 THR A OG1 
831  C CG2 . THR A 107 ? 1.1808 1.0918 1.1011 -0.1874 -0.0255 0.0121  124 THR A CG2 
832  N N   . TYR A 108 ? 0.9430 0.9051 0.9478 -0.1539 -0.0317 0.0049  125 TYR A N   
833  C CA  . TYR A 108 ? 0.9063 0.8802 0.9194 -0.1488 -0.0434 0.0084  125 TYR A CA  
834  C C   . TYR A 108 ? 0.8927 0.8681 0.9103 -0.1448 -0.0428 -0.0106 125 TYR A C   
835  O O   . TYR A 108 ? 0.8992 0.8776 0.9107 -0.1453 -0.0521 -0.0108 125 TYR A O   
836  C CB  . TYR A 108 ? 0.8809 0.8641 0.9163 -0.1393 -0.0433 0.0191  125 TYR A CB  
837  C CG  . TYR A 108 ? 0.9184 0.9026 0.9578 -0.1409 -0.0458 0.0400  125 TYR A CG  
838  C CD1 . TYR A 108 ? 0.9352 0.9150 0.9563 -0.1505 -0.0567 0.0530  125 TYR A CD1 
839  C CD2 . TYR A 108 ? 0.9536 0.9416 1.0154 -0.1327 -0.0382 0.0476  125 TYR A CD2 
840  C CE1 . TYR A 108 ? 0.9648 0.9446 0.9913 -0.1515 -0.0623 0.0734  125 TYR A CE1 
841  C CE2 . TYR A 108 ? 0.9637 0.9529 1.0339 -0.1331 -0.0411 0.0680  125 TYR A CE2 
842  C CZ  . TYR A 108 ? 0.9655 0.9511 1.0187 -0.1423 -0.0547 0.0813  125 TYR A CZ  
843  O OH  . TYR A 108 ? 0.9716 0.9570 1.0327 -0.1432 -0.0618 0.1026  125 TYR A OH  
844  N N   . VAL A 109 ? 0.8868 0.8594 0.9163 -0.1408 -0.0329 -0.0263 126 VAL A N   
845  C CA  . VAL A 109 ? 0.9058 0.8790 0.9421 -0.1366 -0.0354 -0.0440 126 VAL A CA  
846  C C   . VAL A 109 ? 0.9659 0.9336 0.9879 -0.1446 -0.0368 -0.0524 126 VAL A C   
847  O O   . VAL A 109 ? 0.9241 0.8935 0.9416 -0.1432 -0.0459 -0.0558 126 VAL A O   
848  C CB  . VAL A 109 ? 0.9115 0.8831 0.9679 -0.1313 -0.0269 -0.0594 126 VAL A CB  
849  C CG1 . VAL A 109 ? 0.9061 0.8768 0.9712 -0.1282 -0.0321 -0.0782 126 VAL A CG1 
850  C CG2 . VAL A 109 ? 0.8904 0.8644 0.9579 -0.1230 -0.0261 -0.0532 126 VAL A CG2 
851  N N   . ALA A 110 ? 1.0127 0.9709 1.0257 -0.1532 -0.0262 -0.0556 127 ALA A N   
852  C CA  . ALA A 110 ? 1.0201 0.9684 1.0178 -0.1621 -0.0233 -0.0646 127 ALA A CA  
853  C C   . ALA A 110 ? 1.0096 0.9578 0.9841 -0.1673 -0.0362 -0.0533 127 ALA A C   
854  O O   . ALA A 110 ? 1.0286 0.9737 0.9966 -0.1698 -0.0389 -0.0618 127 ALA A O   
855  C CB  . ALA A 110 ? 1.0273 0.9598 1.0118 -0.1721 -0.0077 -0.0666 127 ALA A CB  
856  N N   . ARG A 111 ? 0.9982 0.9501 0.9637 -0.1686 -0.0444 -0.0340 128 ARG A N   
857  C CA  . ARG A 111 ? 1.0075 0.9618 0.9572 -0.1732 -0.0586 -0.0213 128 ARG A CA  
858  C C   . ARG A 111 ? 0.9660 0.9309 0.9293 -0.1645 -0.0661 -0.0262 128 ARG A C   
859  O O   . ARG A 111 ? 0.9522 0.9145 0.9036 -0.1684 -0.0718 -0.0295 128 ARG A O   
860  C CB  . ARG A 111 ? 1.0094 0.9680 0.9577 -0.1746 -0.0667 0.0009  128 ARG A CB  
861  C CG  . ARG A 111 ? 0.9811 0.9385 0.9107 -0.1835 -0.0820 0.0150  128 ARG A CG  
862  C CD  . ARG A 111 ? 0.9769 0.9383 0.9097 -0.1854 -0.0928 0.0376  128 ARG A CD  
863  N NE  . ARG A 111 ? 1.0039 0.9707 0.9323 -0.1907 -0.1100 0.0493  128 ARG A NE  
864  C CZ  . ARG A 111 ? 1.0205 0.9936 0.9571 -0.1931 -0.1246 0.0694  128 ARG A CZ  
865  N NH1 . ARG A 111 ? 1.0340 1.0077 0.9814 -0.1905 -0.1250 0.0825  128 ARG A NH1 
866  N NH2 . ARG A 111 ? 1.0492 1.0279 0.9853 -0.1984 -0.1396 0.0769  128 ARG A NH2 
867  N N   . PHE A 112 ? 0.9706 0.9438 0.9557 -0.1533 -0.0652 -0.0269 129 PHE A N   
868  C CA  . PHE A 112 ? 0.9306 0.9080 0.9230 -0.1453 -0.0715 -0.0316 129 PHE A CA  
869  C C   . PHE A 112 ? 0.9184 0.8898 0.9079 -0.1450 -0.0714 -0.0500 129 PHE A C   
870  O O   . PHE A 112 ? 0.9061 0.8760 0.8865 -0.1456 -0.0785 -0.0512 129 PHE A O   
871  C CB  . PHE A 112 ? 0.9096 0.8901 0.9201 -0.1343 -0.0685 -0.0318 129 PHE A CB  
872  C CG  . PHE A 112 ? 0.8927 0.8689 0.9051 -0.1264 -0.0730 -0.0435 129 PHE A CG  
873  C CD1 . PHE A 112 ? 0.8882 0.8636 0.8937 -0.1243 -0.0794 -0.0371 129 PHE A CD1 
874  C CD2 . PHE A 112 ? 0.8802 0.8514 0.9008 -0.1219 -0.0716 -0.0611 129 PHE A CD2 
875  C CE1 . PHE A 112 ? 0.8845 0.8510 0.8855 -0.1176 -0.0840 -0.0472 129 PHE A CE1 
876  C CE2 . PHE A 112 ? 0.8824 0.8465 0.9016 -0.1150 -0.0792 -0.0709 129 PHE A CE2 
877  C CZ  . PHE A 112 ? 0.8884 0.8485 0.8946 -0.1128 -0.0852 -0.0637 129 PHE A CZ  
878  N N   . GLN A 113 ? 0.9054 0.8730 0.9053 -0.1442 -0.0629 -0.0640 130 GLN A N   
879  C CA  . GLN A 113 ? 0.9187 0.8815 0.9239 -0.1430 -0.0627 -0.0814 130 GLN A CA  
880  C C   . GLN A 113 ? 0.9575 0.9139 0.9432 -0.1523 -0.0632 -0.0818 130 GLN A C   
881  O O   . GLN A 113 ? 0.9972 0.9514 0.9828 -0.1496 -0.0687 -0.0896 130 GLN A O   
882  C CB  . GLN A 113 ? 0.9661 0.9259 0.9896 -0.1433 -0.0511 -0.0959 130 GLN A CB  
883  C CG  . GLN A 113 ? 1.0074 0.9717 1.0518 -0.1354 -0.0491 -0.0986 130 GLN A CG  
884  C CD  . GLN A 113 ? 1.0581 1.0211 1.1301 -0.1322 -0.0440 -0.1180 130 GLN A CD  
885  O OE1 . GLN A 113 ? 1.0530 1.0184 1.1427 -0.1269 -0.0428 -0.1224 130 GLN A OE1 
886  N NE2 . GLN A 113 ? 1.1650 1.1238 1.2429 -0.1359 -0.0405 -0.1301 130 GLN A NE2 
887  N N   . LYS A 114 ? 0.9947 0.9451 0.9617 -0.1636 -0.0575 -0.0740 131 LYS A N   
888  C CA  . LYS A 114 ? 1.0064 0.9462 0.9497 -0.1744 -0.0570 -0.0752 131 LYS A CA  
889  C C   . LYS A 114 ? 0.9720 0.9149 0.8972 -0.1779 -0.0706 -0.0615 131 LYS A C   
890  O O   . LYS A 114 ? 1.0007 0.9355 0.9083 -0.1851 -0.0722 -0.0644 131 LYS A O   
891  C CB  . LYS A 114 ? 1.0915 1.0166 1.0154 -0.1869 -0.0449 -0.0742 131 LYS A CB  
892  C CG  . LYS A 114 ? 1.1970 1.1060 1.0906 -0.1997 -0.0434 -0.0758 131 LYS A CG  
893  C CD  . LYS A 114 ? 1.2728 1.1595 1.1498 -0.2111 -0.0245 -0.0849 131 LYS A CD  
894  C CE  . LYS A 114 ? 1.3346 1.2026 1.1814 -0.2233 -0.0214 -0.0893 131 LYS A CE  
895  N NZ  . LYS A 114 ? 1.3807 1.2204 1.1846 -0.2406 -0.0119 -0.0848 131 LYS A NZ  
896  N N   . GLU A 115 ? 0.9157 0.8696 0.8476 -0.1730 -0.0792 -0.0475 132 GLU A N   
897  C CA  . GLU A 115 ? 0.8973 0.8550 0.8179 -0.1772 -0.0909 -0.0338 132 GLU A CA  
898  C C   . GLU A 115 ? 0.9075 0.8743 0.8420 -0.1673 -0.0977 -0.0307 132 GLU A C   
899  O O   . GLU A 115 ? 0.9717 0.9394 0.8978 -0.1711 -0.1053 -0.0247 132 GLU A O   
900  C CB  . GLU A 115 ? 0.8797 0.8403 0.7958 -0.1830 -0.0955 -0.0157 132 GLU A CB  
901  C CG  . GLU A 115 ? 0.8667 0.8128 0.7598 -0.1950 -0.0905 -0.0146 132 GLU A CG  
902  C CD  . GLU A 115 ? 0.8684 0.8157 0.7551 -0.2008 -0.1001 0.0059  132 GLU A CD  
903  O OE1 . GLU A 115 ? 0.7950 0.7567 0.6991 -0.1961 -0.1109 0.0192  132 GLU A OE1 
904  O OE2 . GLU A 115 ? 0.8841 0.8160 0.7491 -0.2099 -0.0964 0.0089  132 GLU A OE2 
905  N N   . ALA A 116 ? 0.9221 0.8934 0.8754 -0.1559 -0.0945 -0.0336 133 ALA A N   
906  C CA  . ALA A 116 ? 0.9283 0.9022 0.8894 -0.1472 -0.0986 -0.0306 133 ALA A CA  
907  C C   . ALA A 116 ? 0.9140 0.8803 0.8788 -0.1372 -0.0980 -0.0460 133 ALA A C   
908  O O   . ALA A 116 ? 0.9067 0.8682 0.8687 -0.1314 -0.1014 -0.0454 133 ALA A O   
909  C CB  . ALA A 116 ? 0.9432 0.9246 0.9194 -0.1430 -0.0965 -0.0168 133 ALA A CB  
910  N N   . TYR A 117 ? 0.9185 0.8816 0.8896 -0.1354 -0.0942 -0.0597 134 TYR A N   
911  C CA  . TYR A 117 ? 0.9274 0.8828 0.9043 -0.1263 -0.0977 -0.0744 134 TYR A CA  
912  C C   . TYR A 117 ? 0.9293 0.8777 0.8947 -0.1282 -0.1029 -0.0813 134 TYR A C   
913  O O   . TYR A 117 ? 0.9273 0.8755 0.8888 -0.1360 -0.0993 -0.0853 134 TYR A O   
914  C CB  . TYR A 117 ? 0.9088 0.8647 0.9038 -0.1240 -0.0924 -0.0869 134 TYR A CB  
915  C CG  . TYR A 117 ? 0.9426 0.8911 0.9481 -0.1160 -0.0991 -0.1031 134 TYR A CG  
916  C CD1 . TYR A 117 ? 0.9957 0.9366 1.0021 -0.1064 -0.1071 -0.1056 134 TYR A CD1 
917  C CD2 . TYR A 117 ? 0.9541 0.9006 0.9687 -0.1184 -0.0978 -0.1158 134 TYR A CD2 
918  C CE1 . TYR A 117 ? 0.9922 0.9240 1.0072 -0.0993 -0.1173 -0.1197 134 TYR A CE1 
919  C CE2 . TYR A 117 ? 0.9770 0.9175 1.0068 -0.1105 -0.1063 -0.1299 134 TYR A CE2 
920  C CZ  . TYR A 117 ? 0.9909 0.9243 1.0205 -0.1009 -0.1178 -0.1314 134 TYR A CZ  
921  O OH  . TYR A 117 ? 1.0213 0.9467 1.0650 -0.0934 -0.1299 -0.1446 134 TYR A OH  
922  N N   . CYS A 118 ? 0.9669 0.9067 0.9246 -0.1215 -0.1102 -0.0827 135 CYS A N   
923  C CA  . CYS A 118 ? 0.9893 0.9201 0.9371 -0.1213 -0.1156 -0.0902 135 CYS A CA  
924  C C   . CYS A 118 ? 0.9996 0.9339 0.9372 -0.1328 -0.1119 -0.0868 135 CYS A C   
925  O O   . CYS A 118 ? 1.0359 0.9671 0.9758 -0.1364 -0.1089 -0.0968 135 CYS A O   
926  C CB  . CYS A 118 ? 1.0210 0.9458 0.9833 -0.1148 -0.1194 -0.1069 135 CYS A CB  
927  S SG  . CYS A 118 ? 0.9855 0.9004 0.9549 -0.1018 -0.1288 -0.1128 135 CYS A SG  
928  N N   . PRO A 119 ? 0.9958 0.9356 0.9236 -0.1394 -0.1117 -0.0724 136 PRO A N   
929  C CA  . PRO A 119 ? 0.9906 0.9315 0.9050 -0.1519 -0.1107 -0.0681 136 PRO A CA  
930  C C   . PRO A 119 ? 0.9871 0.9186 0.8869 -0.1539 -0.1143 -0.0722 136 PRO A C   
931  O O   . PRO A 119 ? 0.9891 0.9184 0.8750 -0.1651 -0.1135 -0.0704 136 PRO A O   
932  C CB  . PRO A 119 ? 0.9988 0.9492 0.9131 -0.1566 -0.1127 -0.0507 136 PRO A CB  
933  C CG  . PRO A 119 ? 0.9874 0.9370 0.9095 -0.1460 -0.1142 -0.0473 136 PRO A CG  
934  C CD  . PRO A 119 ? 0.9739 0.9190 0.9053 -0.1365 -0.1120 -0.0593 136 PRO A CD  
935  N N   . ASN A 120 ? 1.0044 0.9278 0.9039 -0.1442 -0.1184 -0.0773 137 ASN A N   
936  C CA  . ASN A 120 ? 1.0594 0.9720 0.9447 -0.1459 -0.1208 -0.0820 137 ASN A CA  
937  C C   . ASN A 120 ? 1.0809 0.9886 0.9663 -0.1507 -0.1165 -0.0940 137 ASN A C   
938  O O   . ASN A 120 ? 1.0691 0.9788 0.9700 -0.1478 -0.1126 -0.1024 137 ASN A O   
939  C CB  . ASN A 120 ? 1.0682 0.9675 0.9502 -0.1337 -0.1264 -0.0867 137 ASN A CB  
940  C CG  . ASN A 120 ? 1.0540 0.9489 0.9503 -0.1231 -0.1298 -0.0982 137 ASN A CG  
941  O OD1 . ASN A 120 ? 1.0697 0.9737 0.9809 -0.1217 -0.1275 -0.0982 137 ASN A OD1 
942  N ND2 . ASN A 120 ? 1.0579 0.9381 0.9509 -0.1157 -0.1365 -0.1078 137 ASN A ND2 
943  N N   . LYS A 121 ? 1.1218 1.0220 0.9912 -0.1584 -0.1155 -0.0951 138 LYS A N   
944  C CA  . LYS A 121 ? 1.1076 0.9996 0.9759 -0.1637 -0.1084 -0.1069 138 LYS A CA  
945  C C   . LYS A 121 ? 1.0628 0.9423 0.9333 -0.1556 -0.1109 -0.1176 138 LYS A C   
946  O O   . LYS A 121 ? 1.0369 0.9090 0.9133 -0.1574 -0.1041 -0.1287 138 LYS A O   
947  C CB  . LYS A 121 ? 1.1536 1.0424 0.9995 -0.1803 -0.1041 -0.1013 138 LYS A CB  
948  C CG  . LYS A 121 ? 1.2243 1.1211 1.0666 -0.1894 -0.1022 -0.0923 138 LYS A CG  
949  C CD  . LYS A 121 ? 1.3278 1.2235 1.1463 -0.2041 -0.1072 -0.0800 138 LYS A CD  
950  C CE  . LYS A 121 ? 1.3604 1.2554 1.1670 -0.2163 -0.1052 -0.0732 138 LYS A CE  
951  N NZ  . LYS A 121 ? 1.3848 1.2814 1.1737 -0.2289 -0.1159 -0.0587 138 LYS A NZ  
952  N N   . CYS A 122 ? 1.0511 0.9257 0.9155 -0.1472 -0.1195 -0.1138 139 CYS A N   
953  C CA  . CYS A 122 ? 1.0958 0.9556 0.9604 -0.1375 -0.1248 -0.1225 139 CYS A CA  
954  C C   . CYS A 122 ? 1.0727 0.9276 0.9333 -0.1265 -0.1342 -0.1174 139 CYS A C   
955  O O   . CYS A 122 ? 1.0164 0.8803 0.8752 -0.1281 -0.1335 -0.1074 139 CYS A O   
956  C CB  . CYS A 122 ? 1.1601 1.0092 1.0036 -0.1450 -0.1220 -0.1216 139 CYS A CB  
957  S SG  . CYS A 122 ? 1.1395 0.9894 0.9601 -0.1515 -0.1242 -0.1064 139 CYS A SG  
958  N N   . GLY A 123 ? 1.0962 0.9342 0.9538 -0.1157 -0.1425 -0.1238 140 GLY A N   
959  C CA  . GLY A 123 ? 1.1056 0.9289 0.9481 -0.1063 -0.1510 -0.1194 140 GLY A CA  
960  C C   . GLY A 123 ? 1.0774 0.9055 0.9326 -0.0995 -0.1557 -0.1196 140 GLY A C   
961  O O   . GLY A 123 ? 1.0528 0.8920 0.9326 -0.0983 -0.1561 -0.1269 140 GLY A O   
962  N N   . VAL A 124 ? 1.0638 0.8825 0.9024 -0.0960 -0.1569 -0.1118 141 VAL A N   
963  C CA  . VAL A 124 ? 1.0638 0.8807 0.9077 -0.0894 -0.1612 -0.1118 141 VAL A CA  
964  C C   . VAL A 124 ? 1.0121 0.8344 0.8486 -0.0937 -0.1515 -0.0994 141 VAL A C   
965  O O   . VAL A 124 ? 1.0237 0.8315 0.8390 -0.0941 -0.1477 -0.0929 141 VAL A O   
966  C CB  . VAL A 124 ? 1.1202 0.9070 0.9458 -0.0779 -0.1752 -0.1173 141 VAL A CB  
967  C CG1 . VAL A 124 ? 1.1334 0.9146 0.9598 -0.0723 -0.1799 -0.1175 141 VAL A CG1 
968  C CG2 . VAL A 124 ? 1.1197 0.9008 0.9582 -0.0723 -0.1873 -0.1290 141 VAL A CG2 
969  N N   . MET A 125 ? 0.9964 0.8380 0.8521 -0.0965 -0.1465 -0.0965 142 MET A N   
970  C CA  . MET A 125 ? 1.0051 0.8529 0.8604 -0.0994 -0.1376 -0.0848 142 MET A CA  
971  C C   . MET A 125 ? 0.9683 0.8071 0.8249 -0.0916 -0.1401 -0.0875 142 MET A C   
972  O O   . MET A 125 ? 0.9629 0.8081 0.8353 -0.0887 -0.1455 -0.0956 142 MET A O   
973  C CB  . MET A 125 ? 1.0431 0.9183 0.9184 -0.1089 -0.1308 -0.0786 142 MET A CB  
974  C CG  . MET A 125 ? 1.0597 0.9454 0.9426 -0.1121 -0.1226 -0.0654 142 MET A CG  
975  S SD  . MET A 125 ? 1.0832 0.9961 0.9841 -0.1239 -0.1190 -0.0574 142 MET A SD  
976  C CE  . MET A 125 ? 1.1205 1.0415 1.0347 -0.1232 -0.1117 -0.0425 142 MET A CE  
977  N N   . LEU A 126 ? 0.9535 0.7759 0.7937 -0.0890 -0.1347 -0.0810 143 LEU A N   
978  C CA  . LEU A 126 ? 0.9401 0.7506 0.7773 -0.0831 -0.1352 -0.0829 143 LEU A CA  
979  C C   . LEU A 126 ? 0.9351 0.7662 0.7923 -0.0876 -0.1225 -0.0729 143 LEU A C   
980  O O   . LEU A 126 ? 0.9265 0.7640 0.7860 -0.0926 -0.1120 -0.0617 143 LEU A O   
981  C CB  . LEU A 126 ? 0.9543 0.7276 0.7565 -0.0781 -0.1348 -0.0824 143 LEU A CB  
982  C CG  . LEU A 126 ? 0.9799 0.7260 0.7554 -0.0734 -0.1479 -0.0902 143 LEU A CG  
983  C CD1 . LEU A 126 ? 1.0153 0.7190 0.7495 -0.0698 -0.1446 -0.0882 143 LEU A CD1 
984  C CD2 . LEU A 126 ? 0.9851 0.7311 0.7707 -0.0676 -0.1667 -0.1026 143 LEU A CD2 
985  N N   . GLN A 127 ? 0.9213 0.7625 0.7954 -0.0858 -0.1235 -0.0766 144 GLN A N   
986  C CA  . GLN A 127 ? 0.9417 0.8002 0.8342 -0.0893 -0.1117 -0.0665 144 GLN A CA  
987  C C   . GLN A 127 ? 0.9372 0.7877 0.8322 -0.0845 -0.1097 -0.0699 144 GLN A C   
988  O O   . GLN A 127 ? 0.9582 0.8047 0.8560 -0.0808 -0.1193 -0.0813 144 GLN A O   
989  C CB  . GLN A 127 ? 0.9700 0.8579 0.8854 -0.0966 -0.1107 -0.0631 144 GLN A CB  
990  C CG  . GLN A 127 ? 1.0301 0.9319 0.9652 -0.0968 -0.1106 -0.0682 144 GLN A CG  
991  C CD  . GLN A 127 ? 1.0716 0.9944 1.0199 -0.1052 -0.1091 -0.0656 144 GLN A CD  
992  O OE1 . GLN A 127 ? 1.1799 1.1035 1.1271 -0.1074 -0.1141 -0.0744 144 GLN A OE1 
993  N NE2 . GLN A 127 ? 1.0236 0.9607 0.9830 -0.1103 -0.1019 -0.0535 144 GLN A NE2 
994  N N   . THR A 128 ? 0.9284 0.7772 0.8259 -0.0851 -0.0965 -0.0598 145 THR A N   
995  C CA  . THR A 128 ? 0.9320 0.7698 0.8289 -0.0813 -0.0913 -0.0616 145 THR A CA  
996  C C   . THR A 128 ? 0.9290 0.7926 0.8544 -0.0835 -0.0905 -0.0619 145 THR A C   
997  O O   . THR A 128 ? 0.9119 0.7991 0.8568 -0.0886 -0.0850 -0.0523 145 THR A O   
998  C CB  . THR A 128 ? 0.9313 0.7587 0.8249 -0.0817 -0.0739 -0.0498 145 THR A CB  
999  O OG1 . THR A 128 ? 0.9380 0.7355 0.8010 -0.0800 -0.0726 -0.0510 145 THR A OG1 
1000 C CG2 . THR A 128 ? 0.9584 0.7751 0.8531 -0.0788 -0.0653 -0.0506 145 THR A CG2 
1001 N N   . LEU A 129 ? 0.9375 0.7947 0.8643 -0.0800 -0.0968 -0.0731 146 LEU A N   
1002 C CA  . LEU A 129 ? 0.9399 0.8175 0.8926 -0.0820 -0.0938 -0.0747 146 LEU A CA  
1003 C C   . LEU A 129 ? 0.9206 0.7839 0.8706 -0.0786 -0.0884 -0.0772 146 LEU A C   
1004 O O   . LEU A 129 ? 0.9712 0.8070 0.8968 -0.0750 -0.0910 -0.0810 146 LEU A O   
1005 C CB  . LEU A 129 ? 0.9378 0.8238 0.9024 -0.0821 -0.1060 -0.0884 146 LEU A CB  
1006 C CG  . LEU A 129 ? 0.9219 0.8189 0.8879 -0.0858 -0.1109 -0.0887 146 LEU A CG  
1007 C CD1 . LEU A 129 ? 0.9230 0.8234 0.9034 -0.0848 -0.1209 -0.1039 146 LEU A CD1 
1008 C CD2 . LEU A 129 ? 0.9061 0.8241 0.8832 -0.0931 -0.1006 -0.0763 146 LEU A CD2 
1009 N N   . ILE A 130 ? 0.8850 0.7641 0.8571 -0.0804 -0.0807 -0.0753 147 ILE A N   
1010 C CA  . ILE A 130 ? 0.9167 0.7841 0.8892 -0.0780 -0.0753 -0.0789 147 ILE A CA  
1011 C C   . ILE A 130 ? 0.9068 0.7838 0.8979 -0.0784 -0.0833 -0.0923 147 ILE A C   
1012 O O   . ILE A 130 ? 0.9330 0.8323 0.9449 -0.0821 -0.0808 -0.0914 147 ILE A O   
1013 C CB  . ILE A 130 ? 0.8964 0.7750 0.8838 -0.0798 -0.0575 -0.0648 147 ILE A CB  
1014 C CG1 . ILE A 130 ? 0.9104 0.7793 0.8865 -0.0793 -0.0480 -0.0520 147 ILE A CG1 
1015 C CG2 . ILE A 130 ? 0.9186 0.7876 0.9102 -0.0781 -0.0505 -0.0697 147 ILE A CG2 
1016 C CD1 . ILE A 130 ? 0.9119 0.8038 0.9116 -0.0825 -0.0377 -0.0352 147 ILE A CD1 
1017 N N   . TRP A 131 ? 0.9008 0.7588 0.8838 -0.0752 -0.0926 -0.1047 148 TRP A N   
1018 C CA  . TRP A 131 ? 0.8867 0.7531 0.8926 -0.0754 -0.1016 -0.1189 148 TRP A CA  
1019 C C   . TRP A 131 ? 0.9498 0.8195 0.9694 -0.0769 -0.0886 -0.1181 148 TRP A C   
1020 O O   . TRP A 131 ? 0.9627 0.8122 0.9648 -0.0754 -0.0834 -0.1158 148 TRP A O   
1021 C CB  . TRP A 131 ? 0.8786 0.7227 0.8715 -0.0715 -0.1225 -0.1328 148 TRP A CB  
1022 C CG  . TRP A 131 ? 0.8619 0.7098 0.8580 -0.0700 -0.1377 -0.1388 148 TRP A CG  
1023 C CD1 . TRP A 131 ? 0.8559 0.7147 0.8802 -0.0695 -0.1495 -0.1518 148 TRP A CD1 
1024 C CD2 . TRP A 131 ? 0.8470 0.6869 0.8198 -0.0688 -0.1416 -0.1326 148 TRP A CD2 
1025 N NE1 . TRP A 131 ? 0.8450 0.7032 0.8655 -0.0677 -0.1604 -0.1538 148 TRP A NE1 
1026 C CE2 . TRP A 131 ? 0.8287 0.6751 0.8160 -0.0674 -0.1562 -0.1422 148 TRP A CE2 
1027 C CE3 . TRP A 131 ? 0.8474 0.6751 0.7914 -0.0690 -0.1327 -0.1202 148 TRP A CE3 
1028 C CZ2 . TRP A 131 ? 0.8444 0.6844 0.8150 -0.0660 -0.1631 -0.1398 148 TRP A CZ2 
1029 C CZ3 . TRP A 131 ? 0.8482 0.6701 0.7763 -0.0681 -0.1393 -0.1181 148 TRP A CZ3 
1030 C CH2 . TRP A 131 ? 0.8529 0.6810 0.7929 -0.0666 -0.1546 -0.1277 148 TRP A CH2 
1031 N N   . CYS A 132 ? 0.9927 0.8846 1.0412 -0.0803 -0.0818 -0.1200 149 CYS A N   
1032 C CA  . CYS A 132 ? 1.0235 0.9209 1.0855 -0.0823 -0.0661 -0.1162 149 CYS A CA  
1033 C C   . CYS A 132 ? 1.0338 0.9175 1.1008 -0.0810 -0.0714 -0.1299 149 CYS A C   
1034 O O   . CYS A 132 ? 1.0046 0.8820 1.0709 -0.0814 -0.0598 -0.1266 149 CYS A O   
1035 C CB  . CYS A 132 ? 1.0245 0.9452 1.1110 -0.0871 -0.0565 -0.1143 149 CYS A CB  
1036 S SG  . CYS A 132 ? 0.9885 0.9237 1.0674 -0.0907 -0.0525 -0.0984 149 CYS A SG  
1037 N N   . LYS A 133 ? 1.1188 0.9992 1.1944 -0.0799 -0.0893 -0.1452 150 LYS A N   
1038 C CA  . LYS A 133 ? 1.1806 1.0469 1.2625 -0.0791 -0.1003 -0.1598 150 LYS A CA  
1039 C C   . LYS A 133 ? 1.1602 0.9960 1.2078 -0.0775 -0.1016 -0.1576 150 LYS A C   
1040 O O   . LYS A 133 ? 1.2387 1.0646 1.2901 -0.0790 -0.0997 -0.1642 150 LYS A O   
1041 C CB  . LYS A 133 ? 1.2786 1.1431 1.3727 -0.0770 -0.1244 -0.1744 150 LYS A CB  
1042 C CG  . LYS A 133 ? 1.3649 1.2196 1.4324 -0.0736 -0.1368 -0.1696 150 LYS A CG  
1043 C CD  . LYS A 133 ? 1.3229 1.1957 1.4150 -0.0732 -0.1450 -0.1755 150 LYS A CD  
1044 C CE  . LYS A 133 ? 1.3388 1.1956 1.4309 -0.0687 -0.1731 -0.1881 150 LYS A CE  
1045 N NZ  . LYS A 133 ? 1.3423 1.2152 1.4661 -0.0677 -0.1817 -0.1963 150 LYS A NZ  
1046 N N   . ASN A 134 ? 1.0843 0.9030 1.0975 -0.0752 -0.1034 -0.1488 151 ASN A N   
1047 C CA  . ASN A 134 ? 1.0919 0.8741 1.0659 -0.0743 -0.1039 -0.1480 151 ASN A CA  
1048 C C   . ASN A 134 ? 1.0658 0.8383 1.0150 -0.0737 -0.0846 -0.1315 151 ASN A C   
1049 O O   . ASN A 134 ? 1.0757 0.8137 0.9882 -0.0733 -0.0824 -0.1305 151 ASN A O   
1050 C CB  . ASN A 134 ? 1.1563 0.9132 1.1068 -0.0720 -0.1314 -0.1590 151 ASN A CB  
1051 C CG  . ASN A 134 ? 1.1960 0.9604 1.1410 -0.0693 -0.1396 -0.1546 151 ASN A CG  
1052 O OD1 . ASN A 134 ? 1.2476 1.0234 1.1898 -0.0696 -0.1236 -0.1416 151 ASN A OD1 
1053 N ND2 . ASN A 134 ? 1.2019 0.9603 1.1483 -0.0669 -0.1650 -0.1654 151 ASN A ND2 
1054 N N   . CYS A 135 ? 1.0288 0.8295 0.9982 -0.0743 -0.0708 -0.1189 152 CYS A N   
1055 C CA  . CYS A 135 ? 1.0065 0.8053 0.9636 -0.0737 -0.0550 -0.1025 152 CYS A CA  
1056 C C   . CYS A 135 ? 1.0515 0.8270 0.9749 -0.0719 -0.0621 -0.1009 152 CYS A C   
1057 O O   . CYS A 135 ? 1.0582 0.8250 0.9695 -0.0717 -0.0475 -0.0892 152 CYS A O   
1058 C CB  . CYS A 135 ? 0.9899 0.7780 0.9455 -0.0742 -0.0330 -0.0944 152 CYS A CB  
1059 S SG  . CYS A 135 ? 0.9723 0.7909 0.9689 -0.0764 -0.0215 -0.0922 152 CYS A SG  
1060 N N   . LYS A 136 ? 1.0812 0.8480 0.9930 -0.0706 -0.0843 -0.1122 153 LYS A N   
1061 C CA  . LYS A 136 ? 1.1981 0.9347 1.0715 -0.0688 -0.0924 -0.1126 153 LYS A CA  
1062 C C   . LYS A 136 ? 1.1313 0.8896 1.0140 -0.0687 -0.0912 -0.1038 153 LYS A C   
1063 O O   . LYS A 136 ? 1.1087 0.8959 1.0184 -0.0693 -0.0995 -0.1064 153 LYS A O   
1064 C CB  . LYS A 136 ? 1.3405 1.0540 1.1964 -0.0670 -0.1192 -0.1285 153 LYS A CB  
1065 C CG  . LYS A 136 ? 1.5311 1.2079 1.3423 -0.0649 -0.1335 -0.1308 153 LYS A CG  
1066 C CD  . LYS A 136 ? 1.6475 1.2875 1.4153 -0.0660 -0.1151 -0.1219 153 LYS A CD  
1067 C CE  . LYS A 136 ? 1.7312 1.3243 1.4462 -0.0645 -0.1316 -0.1270 153 LYS A CE  
1068 N NZ  . LYS A 136 ? 1.7724 1.3406 1.4542 -0.0653 -0.1123 -0.1167 153 LYS A NZ  
1069 N N   . LYS A 137 ? 1.0892 0.8316 0.9498 -0.0688 -0.0792 -0.0936 154 LYS A N   
1070 C CA  . LYS A 137 ? 1.0330 0.7935 0.9015 -0.0697 -0.0763 -0.0844 154 LYS A CA  
1071 C C   . LYS A 137 ? 1.0037 0.7398 0.8396 -0.0679 -0.0899 -0.0891 154 LYS A C   
1072 O O   . LYS A 137 ? 1.0204 0.7198 0.8198 -0.0671 -0.0851 -0.0884 154 LYS A O   
1073 C CB  . LYS A 137 ? 1.0521 0.8152 0.9269 -0.0714 -0.0523 -0.0690 154 LYS A CB  
1074 C CG  . LYS A 137 ? 1.0625 0.8479 0.9527 -0.0736 -0.0480 -0.0576 154 LYS A CG  
1075 C CD  . LYS A 137 ? 1.1124 0.8913 1.0070 -0.0745 -0.0253 -0.0439 154 LYS A CD  
1076 C CE  . LYS A 137 ? 1.1387 0.9401 1.0678 -0.0753 -0.0119 -0.0342 154 LYS A CE  
1077 N NZ  . LYS A 137 ? 1.1467 0.9789 1.1078 -0.0781 -0.0075 -0.0196 154 LYS A NZ  
1078 N N   . GLU A 138 ? 0.9717 0.7256 0.8194 -0.0675 -0.1053 -0.0938 155 GLU A N   
1079 C CA  . GLU A 138 ? 1.0302 0.7608 0.8489 -0.0650 -0.1205 -0.0993 155 GLU A CA  
1080 C C   . GLU A 138 ? 0.9751 0.7310 0.8102 -0.0667 -0.1231 -0.0958 155 GLU A C   
1081 O O   . GLU A 138 ? 0.9460 0.7360 0.8131 -0.0701 -0.1159 -0.0905 155 GLU A O   
1082 C CB  . GLU A 138 ? 1.1119 0.8254 0.9219 -0.0615 -0.1444 -0.1142 155 GLU A CB  
1083 C CG  . GLU A 138 ? 1.1918 0.8568 0.9567 -0.0599 -0.1489 -0.1185 155 GLU A CG  
1084 C CD  . GLU A 138 ? 1.2597 0.9123 1.0235 -0.0572 -0.1754 -0.1325 155 GLU A CD  
1085 O OE1 . GLU A 138 ? 1.2912 0.9380 1.0512 -0.0539 -0.1973 -0.1390 155 GLU A OE1 
1086 O OE2 . GLU A 138 ? 1.3155 0.9649 1.0853 -0.0585 -0.1745 -0.1370 155 GLU A OE2 
1087 N N   . VAL A 139 ? 0.9872 0.7226 0.7965 -0.0647 -0.1331 -0.0984 156 VAL A N   
1088 C CA  . VAL A 139 ? 0.9929 0.7469 0.8119 -0.0668 -0.1340 -0.0948 156 VAL A CA  
1089 C C   . VAL A 139 ? 0.9787 0.7453 0.8147 -0.0648 -0.1529 -0.1060 156 VAL A C   
1090 O O   . VAL A 139 ? 1.0234 0.7661 0.8424 -0.0599 -0.1703 -0.1152 156 VAL A O   
1091 C CB  . VAL A 139 ? 1.0226 0.7454 0.8040 -0.0661 -0.1316 -0.0910 156 VAL A CB  
1092 C CG1 . VAL A 139 ? 1.0100 0.7490 0.7991 -0.0685 -0.1336 -0.0885 156 VAL A CG1 
1093 C CG2 . VAL A 139 ? 1.0494 0.7602 0.8204 -0.0686 -0.1092 -0.0802 156 VAL A CG2 
1094 N N   . HIS A 140 ? 0.9414 0.7424 0.8098 -0.0687 -0.1494 -0.1050 157 HIS A N   
1095 C CA  . HIS A 140 ? 0.9286 0.7419 0.8171 -0.0677 -0.1625 -0.1155 157 HIS A CA  
1096 C C   . HIS A 140 ? 0.9339 0.7479 0.8141 -0.0694 -0.1640 -0.1135 157 HIS A C   
1097 O O   . HIS A 140 ? 0.9849 0.8083 0.8612 -0.0748 -0.1515 -0.1030 157 HIS A O   
1098 C CB  . HIS A 140 ? 0.9292 0.7744 0.8536 -0.0724 -0.1540 -0.1161 157 HIS A CB  
1099 C CG  . HIS A 140 ? 0.9466 0.8054 0.8952 -0.0730 -0.1611 -0.1263 157 HIS A CG  
1100 N ND1 . HIS A 140 ? 0.9849 0.8392 0.9512 -0.0679 -0.1751 -0.1399 157 HIS A ND1 
1101 C CD2 . HIS A 140 ? 0.9538 0.8293 0.9135 -0.0786 -0.1549 -0.1253 157 HIS A CD2 
1102 C CE1 . HIS A 140 ? 0.9889 0.8574 0.9795 -0.0699 -0.1753 -0.1468 157 HIS A CE1 
1103 N NE2 . HIS A 140 ? 0.9670 0.8469 0.9509 -0.0766 -0.1624 -0.1383 157 HIS A NE2 
1104 N N   . ALA A 141 ? 0.9553 0.7604 0.8363 -0.0652 -0.1795 -0.1235 158 ALA A N   
1105 C CA  . ALA A 141 ? 0.9465 0.7521 0.8221 -0.0667 -0.1810 -0.1232 158 ALA A CA  
1106 C C   . ALA A 141 ? 0.9478 0.7813 0.8566 -0.0715 -0.1765 -0.1278 158 ALA A C   
1107 O O   . ALA A 141 ? 0.9691 0.8081 0.9031 -0.0685 -0.1843 -0.1385 158 ALA A O   
1108 C CB  . ALA A 141 ? 0.9782 0.7560 0.8365 -0.0590 -0.1999 -0.1310 158 ALA A CB  
1109 N N   . CYS A 142 ? 0.9757 0.8244 0.8842 -0.0797 -0.1637 -0.1199 159 CYS A N   
1110 C CA  . CYS A 142 ? 0.9652 0.8346 0.8958 -0.0865 -0.1567 -0.1232 159 CYS A CA  
1111 C C   . CYS A 142 ? 1.0139 0.8754 0.9397 -0.0863 -0.1615 -0.1288 159 CYS A C   
1112 O O   . CYS A 142 ? 0.9741 0.8319 0.8799 -0.0910 -0.1572 -0.1217 159 CYS A O   
1113 C CB  . CYS A 142 ? 0.9519 0.8367 0.8783 -0.0964 -0.1431 -0.1107 159 CYS A CB  
1114 S SG  . CYS A 142 ? 0.9817 0.8776 0.9177 -0.0972 -0.1353 -0.1027 159 CYS A SG  
1115 N N   . ARG A 143 ? 1.0780 0.9363 1.0243 -0.0809 -0.1702 -0.1416 160 ARG A N   
1116 C CA  . ARG A 143 ? 1.1261 0.9749 1.0708 -0.0793 -0.1750 -0.1474 160 ARG A CA  
1117 C C   . ARG A 143 ? 1.1747 1.0380 1.1393 -0.0877 -0.1619 -0.1525 160 ARG A C   
1118 O O   . ARG A 143 ? 1.1900 1.0640 1.1855 -0.0882 -0.1577 -0.1610 160 ARG A O   
1119 C CB  . ARG A 143 ? 1.1361 0.9682 1.0906 -0.0675 -0.1945 -0.1574 160 ARG A CB  
1120 C CG  . ARG A 143 ? 1.1314 0.9395 1.0548 -0.0603 -0.2080 -0.1526 160 ARG A CG  
1121 C CD  . ARG A 143 ? 1.1401 0.9254 1.0646 -0.0493 -0.2311 -0.1610 160 ARG A CD  
1122 N NE  . ARG A 143 ? 1.1714 0.9450 1.0913 -0.0439 -0.2443 -0.1627 160 ARG A NE  
1123 C CZ  . ARG A 143 ? 1.1241 0.8711 1.0027 -0.0415 -0.2498 -0.1564 160 ARG A CZ  
1124 N NH1 . ARG A 143 ? 1.1019 0.8386 0.9787 -0.0380 -0.2607 -0.1593 160 ARG A NH1 
1125 N NH2 . ARG A 143 ? 1.1303 0.8592 0.9697 -0.0432 -0.2431 -0.1478 160 ARG A NH2 
1126 N N   . LYS A 144 ? 1.2584 1.1197 1.2031 -0.0953 -0.1541 -0.1473 161 LYS A N   
1127 C CA  . LYS A 144 ? 1.2598 1.1251 1.2127 -0.1037 -0.1424 -0.1528 161 LYS A CA  
1128 C C   . LYS A 144 ? 1.3181 1.1671 1.2607 -0.0996 -0.1486 -0.1563 161 LYS A C   
1129 O O   . LYS A 144 ? 1.3359 1.1711 1.2601 -0.0923 -0.1604 -0.1524 161 LYS A O   
1130 C CB  . LYS A 144 ? 1.2828 1.1558 1.2147 -0.1173 -0.1303 -0.1424 161 LYS A CB  
1131 C CG  . LYS A 144 ? 1.3364 1.2237 1.2731 -0.1221 -0.1245 -0.1359 161 LYS A CG  
1132 C CD  . LYS A 144 ? 1.3947 1.2887 1.3546 -0.1266 -0.1134 -0.1450 161 LYS A CD  
1133 C CE  . LYS A 144 ? 1.4258 1.3307 1.3804 -0.1355 -0.1047 -0.1361 161 LYS A CE  
1134 N NZ  . LYS A 144 ? 1.3890 1.3011 1.3430 -0.1296 -0.1118 -0.1266 161 LYS A NZ  
1135 N N   . SER A 145 ? 1.4043 1.2513 1.3544 -0.1050 -0.1392 -0.1630 162 SER A N   
1136 C CA  . SER A 145 ? 1.4676 1.2978 1.4130 -0.0991 -0.1459 -0.1675 162 SER A CA  
1137 C C   . SER A 145 ? 1.4317 1.2473 1.3429 -0.0947 -0.1568 -0.1583 162 SER A C   
1138 O O   . SER A 145 ? 1.4821 1.3012 1.3683 -0.1016 -0.1522 -0.1473 162 SER A O   
1139 C CB  . SER A 145 ? 1.5431 1.3699 1.4856 -0.1093 -0.1306 -0.1718 162 SER A CB  
1140 O OG  . SER A 145 ? 1.6407 1.4692 1.5501 -0.1222 -0.1222 -0.1616 162 SER A OG  
1141 N N   . TYR A 146 ? 1.3825 1.1806 1.2961 -0.0828 -0.1712 -0.1633 163 TYR A N   
1142 C CA  . TYR A 146 ? 1.4023 1.1772 1.2832 -0.0768 -0.1815 -0.1579 163 TYR A CA  
1143 C C   . TYR A 146 ? 1.4171 1.1882 1.2683 -0.0872 -0.1693 -0.1505 163 TYR A C   
1144 O O   . TYR A 146 ? 1.4325 1.1914 1.2535 -0.0872 -0.1710 -0.1420 163 TYR A O   
1145 C CB  . TYR A 146 ? 1.4457 1.2032 1.3412 -0.0654 -0.1951 -0.1670 163 TYR A CB  
1146 C CG  . TYR A 146 ? 1.5052 1.2324 1.3675 -0.0569 -0.2092 -0.1630 163 TYR A CG  
1147 C CD1 . TYR A 146 ? 1.5772 1.2897 1.4121 -0.0520 -0.2197 -0.1565 163 TYR A CD1 
1148 C CD2 . TYR A 146 ? 1.5171 1.2264 1.3737 -0.0535 -0.2114 -0.1661 163 TYR A CD2 
1149 C CE1 . TYR A 146 ? 1.5936 1.2722 1.3919 -0.0449 -0.2313 -0.1530 163 TYR A CE1 
1150 C CE2 . TYR A 146 ? 1.5789 1.2563 1.4008 -0.0458 -0.2242 -0.1620 163 TYR A CE2 
1151 C CZ  . TYR A 146 ? 1.6001 1.2612 1.3914 -0.0417 -0.2341 -0.1555 163 TYR A CZ  
1152 O OH  . TYR A 146 ? 1.6414 1.2654 1.3922 -0.0349 -0.2452 -0.1514 163 TYR A OH  
1153 N N   . ASP A 147 ? 1.4318 1.2116 1.2923 -0.0968 -0.1562 -0.1544 164 ASP A N   
1154 C CA  . ASP A 147 ? 1.4445 1.2220 1.2801 -0.1089 -0.1449 -0.1488 164 ASP A CA  
1155 C C   . ASP A 147 ? 1.4243 1.2202 1.2526 -0.1221 -0.1355 -0.1401 164 ASP A C   
1156 O O   . ASP A 147 ? 1.3750 1.1866 1.2192 -0.1230 -0.1344 -0.1394 164 ASP A O   
1157 C CB  . ASP A 147 ? 1.4678 1.2410 1.3132 -0.1141 -0.1349 -0.1580 164 ASP A CB  
1158 C CG  . ASP A 147 ? 1.4521 1.2026 1.2821 -0.1090 -0.1385 -0.1598 164 ASP A CG  
1159 O OD1 . ASP A 147 ? 1.3910 1.1264 1.2068 -0.0985 -0.1515 -0.1562 164 ASP A OD1 
1160 O OD2 . ASP A 147 ? 1.4706 1.2158 1.2999 -0.1163 -0.1272 -0.1650 164 ASP A OD2 
1161 N N   . CYS A 148 ? 1.4106 1.2035 1.2154 -0.1324 -0.1296 -0.1333 165 CYS A N   
1162 C CA  . CYS A 148 ? 1.3758 1.1835 1.1740 -0.1480 -0.1214 -0.1262 165 CYS A CA  
1163 C C   . CYS A 148 ? 1.4066 1.2074 1.1892 -0.1614 -0.1127 -0.1283 165 CYS A C   
1164 O O   . CYS A 148 ? 1.3990 1.2085 1.1724 -0.1759 -0.1081 -0.1225 165 CYS A O   
1165 C CB  . CYS A 148 ? 1.3382 1.1517 1.1259 -0.1494 -0.1248 -0.1134 165 CYS A CB  
1166 S SG  . CYS A 148 ? 1.2589 1.0830 1.0626 -0.1389 -0.1308 -0.1093 165 CYS A SG  
1167 N N   . GLY A 149 ? 1.4586 1.2417 1.2362 -0.1568 -0.1117 -0.1357 166 GLY A N   
1168 C CA  . GLY A 149 ? 1.5206 1.2941 1.2892 -0.1675 -0.1011 -0.1420 166 GLY A CA  
1169 C C   . GLY A 149 ? 1.5892 1.3543 1.3308 -0.1781 -0.0990 -0.1361 166 GLY A C   
1170 O O   . GLY A 149 ? 1.6358 1.4080 1.3685 -0.1813 -0.1037 -0.1256 166 GLY A O   
1171 N N   . GLU A 150 ? 1.6796 1.4297 1.4110 -0.1846 -0.0903 -0.1432 167 GLU A N   
1172 C CA  . GLU A 150 ? 1.6815 1.4196 1.3886 -0.1930 -0.0879 -0.1400 167 GLU A CA  
1173 C C   . GLU A 150 ? 1.5772 1.3244 1.2680 -0.2126 -0.0863 -0.1323 167 GLU A C   
1174 O O   . GLU A 150 ? 1.5071 1.2606 1.1974 -0.2229 -0.0824 -0.1333 167 GLU A O   
1175 C CB  . GLU A 150 ? 1.8149 1.5324 1.5172 -0.1938 -0.0781 -0.1510 167 GLU A CB  
1176 C CG  . GLU A 150 ? 1.9111 1.6169 1.6299 -0.1740 -0.0832 -0.1574 167 GLU A CG  
1177 C CD  . GLU A 150 ? 2.0468 1.7337 1.7693 -0.1734 -0.0728 -0.1685 167 GLU A CD  
1178 O OE1 . GLU A 150 ? 2.1263 1.8069 1.8351 -0.1892 -0.0590 -0.1724 167 GLU A OE1 
1179 O OE2 . GLU A 150 ? 2.1313 1.8079 1.8703 -0.1570 -0.0789 -0.1734 167 GLU A OE2 
1180 N N   . ARG A 151 ? 1.5734 1.3199 1.2515 -0.2176 -0.0899 -0.1242 168 ARG A N   
1181 C CA  . ARG A 151 ? 1.5746 1.3241 1.2358 -0.2380 -0.0896 -0.1183 168 ARG A CA  
1182 C C   . ARG A 151 ? 1.5734 1.3018 1.2132 -0.2469 -0.0819 -0.1243 168 ARG A C   
1183 O O   . ARG A 151 ? 1.4871 1.2036 1.1237 -0.2386 -0.0806 -0.1252 168 ARG A O   
1184 C CB  . ARG A 151 ? 1.5229 1.2880 1.1910 -0.2398 -0.0984 -0.1050 168 ARG A CB  
1185 C CG  . ARG A 151 ? 1.4321 1.2164 1.1215 -0.2300 -0.1050 -0.0980 168 ARG A CG  
1186 C CD  . ARG A 151 ? 1.4157 1.2106 1.1093 -0.2360 -0.1059 -0.0987 168 ARG A CD  
1187 N NE  . ARG A 151 ? 1.4505 1.2648 1.1635 -0.2297 -0.1124 -0.0903 168 ARG A NE  
1188 C CZ  . ARG A 151 ? 1.4304 1.2503 1.1588 -0.2170 -0.1121 -0.0937 168 ARG A CZ  
1189 N NH1 . ARG A 151 ? 1.4198 1.2288 1.1514 -0.2077 -0.1069 -0.1058 168 ARG A NH1 
1190 N NH2 . ARG A 151 ? 1.3612 1.1980 1.1052 -0.2136 -0.1174 -0.0846 168 ARG A NH2 
1191 N N   . ASN A 152 ? 1.6547 1.3750 1.2764 -0.2644 -0.0761 -0.1283 169 ASN A N   
1192 C CA  . ASN A 152 ? 1.7549 1.4581 1.3529 -0.2785 -0.0710 -0.1307 169 ASN A CA  
1193 C C   . ASN A 152 ? 1.6804 1.3957 1.2749 -0.2911 -0.0814 -0.1189 169 ASN A C   
1194 O O   . ASN A 152 ? 1.6529 1.3817 1.2475 -0.3023 -0.0900 -0.1117 169 ASN A O   
1195 C CB  . ASN A 152 ? 1.8905 1.5762 1.4655 -0.2951 -0.0605 -0.1394 169 ASN A CB  
1196 C CG  . ASN A 152 ? 2.0513 1.7188 1.5982 -0.3130 -0.0565 -0.1412 169 ASN A CG  
1197 O OD1 . ASN A 152 ? 2.1685 1.8219 1.7127 -0.3071 -0.0496 -0.1462 169 ASN A OD1 
1198 N ND2 . ASN A 152 ? 2.0683 1.7341 1.5929 -0.3352 -0.0618 -0.1372 169 ASN A ND2 
1199 N N   . VAL A 153 ? 1.6491 1.3586 1.2421 -0.2898 -0.0808 -0.1167 170 VAL A N   
1200 C CA  . VAL A 153 ? 1.6665 1.3852 1.2591 -0.3048 -0.0887 -0.1073 170 VAL A CA  
1201 C C   . VAL A 153 ? 1.6908 1.3887 1.2609 -0.3179 -0.0817 -0.1130 170 VAL A C   
1202 O O   . VAL A 153 ? 1.6306 1.3118 1.1960 -0.3080 -0.0721 -0.1189 170 VAL A O   
1203 C CB  . VAL A 153 ? 1.6492 1.3816 1.2655 -0.2931 -0.0927 -0.0979 170 VAL A CB  
1204 C CG1 . VAL A 153 ? 1.6495 1.3966 1.2763 -0.3088 -0.1018 -0.0875 170 VAL A CG1 
1205 C CG2 . VAL A 153 ? 1.6492 1.3978 1.2860 -0.2777 -0.0972 -0.0938 170 VAL A CG2 
1206 N N   . GLU A 154 ? 1.7600 1.4564 1.3143 -0.3404 -0.0873 -0.1112 171 GLU A N   
1207 C CA  . GLU A 154 ? 1.8147 1.4944 1.3507 -0.3553 -0.0832 -0.1146 171 GLU A CA  
1208 C C   . GLU A 154 ? 1.7017 1.3989 1.2546 -0.3665 -0.0960 -0.1034 171 GLU A C   
1209 O O   . GLU A 154 ? 1.6244 1.3367 1.1824 -0.3786 -0.1109 -0.0955 171 GLU A O   
1210 C CB  . GLU A 154 ? 1.9711 1.6303 1.4726 -0.3756 -0.0799 -0.1223 171 GLU A CB  
1211 C CG  . GLU A 154 ? 2.0963 1.7365 1.5831 -0.3683 -0.0648 -0.1343 171 GLU A CG  
1212 C CD  . GLU A 154 ? 2.1956 1.8170 1.6482 -0.3900 -0.0621 -0.1397 171 GLU A CD  
1213 O OE1 . GLU A 154 ? 2.1588 1.7692 1.5879 -0.4115 -0.0672 -0.1389 171 GLU A OE1 
1214 O OE2 . GLU A 154 ? 2.2855 1.9010 1.7336 -0.3861 -0.0545 -0.1451 171 GLU A OE2 
1215 N N   . VAL A 155 ? 1.6911 1.3848 1.2538 -0.3630 -0.0903 -0.1025 172 VAL A N   
1216 C CA  . VAL A 155 ? 1.7067 1.4173 1.2931 -0.3735 -0.1001 -0.0924 172 VAL A CA  
1217 C C   . VAL A 155 ? 1.7111 1.4057 1.2817 -0.3920 -0.0972 -0.0969 172 VAL A C   
1218 O O   . VAL A 155 ? 1.6423 1.3138 1.1958 -0.3871 -0.0815 -0.1057 172 VAL A O   
1219 C CB  . VAL A 155 ? 1.6965 1.4173 1.3130 -0.3554 -0.0943 -0.0864 172 VAL A CB  
1220 C CG1 . VAL A 155 ? 1.6825 1.4235 1.3325 -0.3659 -0.1030 -0.0756 172 VAL A CG1 
1221 C CG2 . VAL A 155 ? 1.6578 1.3902 1.2852 -0.3369 -0.0961 -0.0837 172 VAL A CG2 
1222 N N   . PRO A 156 ? 1.7361 1.4413 1.3115 -0.4138 -0.1135 -0.0909 173 PRO A N   
1223 C CA  . PRO A 156 ? 1.7911 1.4845 1.3587 -0.4320 -0.1129 -0.0940 173 PRO A CA  
1224 C C   . PRO A 156 ? 1.7991 1.4934 1.3918 -0.4226 -0.1003 -0.0928 173 PRO A C   
1225 O O   . PRO A 156 ? 1.7510 1.4657 1.3802 -0.4125 -0.1025 -0.0839 173 PRO A O   
1226 C CB  . PRO A 156 ? 1.7903 1.5022 1.3716 -0.4530 -0.1378 -0.0843 173 PRO A CB  
1227 C CG  . PRO A 156 ? 1.7942 1.5090 1.3588 -0.4521 -0.1476 -0.0823 173 PRO A CG  
1228 C CD  . PRO A 156 ? 1.7668 1.4879 1.3442 -0.4249 -0.1339 -0.0832 173 PRO A CD  
1229 N N   . GLN A 157 ? 1.8626 1.5315 1.4336 -0.4262 -0.0854 -0.1021 174 GLN A N   
1230 C CA  . GLN A 157 ? 1.8641 1.5267 1.4518 -0.4191 -0.0708 -0.1021 174 GLN A CA  
1231 C C   . GLN A 157 ? 1.8300 1.5183 1.4625 -0.4286 -0.0814 -0.0915 174 GLN A C   
1232 O O   . GLN A 157 ? 1.7301 1.4334 1.3733 -0.4482 -0.1006 -0.0869 174 GLN A O   
1233 C CB  . GLN A 157 ? 1.9358 1.5683 1.4941 -0.4287 -0.0570 -0.1127 174 GLN A CB  
1234 C CG  . GLN A 157 ? 1.9694 1.5809 1.5245 -0.4118 -0.0351 -0.1164 174 GLN A CG  
1235 C CD  . GLN A 157 ? 2.0258 1.6028 1.5423 -0.4136 -0.0202 -0.1282 174 GLN A CD  
1236 O OE1 . GLN A 157 ? 2.0566 1.6170 1.5684 -0.4215 -0.0090 -0.1319 174 GLN A OE1 
1237 N NE2 . GLN A 157 ? 2.0672 1.6328 1.5583 -0.4062 -0.0188 -0.1344 174 GLN A NE2 
1238 N N   . MET A 158 ? 1.8878 1.5800 1.5469 -0.4138 -0.0691 -0.0874 175 MET A N   
1239 C CA  . MET A 158 ? 1.9622 1.6754 1.6701 -0.4200 -0.0721 -0.0783 175 MET A CA  
1240 C C   . MET A 158 ? 1.9089 1.6571 1.6557 -0.4213 -0.0925 -0.0661 175 MET A C   
1241 O O   . MET A 158 ? 1.8381 1.6051 1.6323 -0.4241 -0.0937 -0.0580 175 MET A O   
1242 C CB  . MET A 158 ? 2.0702 1.7776 1.7847 -0.4420 -0.0721 -0.0816 175 MET A CB  
1243 C CG  . MET A 158 ? 2.1962 1.8675 1.8743 -0.4402 -0.0497 -0.0932 175 MET A CG  
1244 S SD  . MET A 158 ? 2.3593 2.0087 2.0392 -0.4163 -0.0199 -0.0943 175 MET A SD  
1245 C CE  . MET A 158 ? 2.3537 1.9584 1.9771 -0.4123 -0.0011 -0.1077 175 MET A CE  
1246 N N   . GLU A 159 ? 1.9164 1.6723 1.6462 -0.4184 -0.1066 -0.0645 176 GLU A N   
1247 C CA  . GLU A 159 ? 1.8760 1.6605 1.6394 -0.4119 -0.1201 -0.0529 176 GLU A CA  
1248 C C   . GLU A 159 ? 1.7703 1.5525 1.5396 -0.3865 -0.1035 -0.0520 176 GLU A C   
1249 O O   . GLU A 159 ? 1.7163 1.4734 1.4607 -0.3742 -0.0841 -0.0600 176 GLU A O   
1250 C CB  . GLU A 159 ? 1.9466 1.7371 1.6871 -0.4188 -0.1401 -0.0516 176 GLU A CB  
1251 C CG  . GLU A 159 ? 2.0161 1.8047 1.7429 -0.4449 -0.1596 -0.0518 176 GLU A CG  
1252 C CD  . GLU A 159 ? 2.0842 1.8773 1.7896 -0.4514 -0.1795 -0.0482 176 GLU A CD  
1253 O OE1 . GLU A 159 ? 2.0648 1.8613 1.7640 -0.4352 -0.1753 -0.0475 176 GLU A OE1 
1254 O OE2 . GLU A 159 ? 2.2214 2.0124 1.9143 -0.4736 -0.1998 -0.0461 176 GLU A OE2 
1255 N N   . ASP A 160 ? 1.7167 1.5226 1.5169 -0.3790 -0.1122 -0.0421 177 ASP A N   
1256 C CA  . ASP A 160 ? 1.7052 1.5087 1.5084 -0.3561 -0.0991 -0.0409 177 ASP A CA  
1257 C C   . ASP A 160 ? 1.6325 1.4297 1.4010 -0.3449 -0.1030 -0.0458 177 ASP A C   
1258 O O   . ASP A 160 ? 1.5690 1.3772 1.3298 -0.3536 -0.1198 -0.0440 177 ASP A O   
1259 C CB  . ASP A 160 ? 1.6793 1.5099 1.5351 -0.3530 -0.1035 -0.0282 177 ASP A CB  
1260 C CG  . ASP A 160 ? 1.6834 1.5181 1.5809 -0.3601 -0.0932 -0.0242 177 ASP A CG  
1261 O OD1 . ASP A 160 ? 1.7385 1.5551 1.6234 -0.3681 -0.0829 -0.0311 177 ASP A OD1 
1262 O OD2 . ASP A 160 ? 1.6117 1.4671 1.5570 -0.3576 -0.0939 -0.0142 177 ASP A OD2 
1263 N N   . MET A 161 ? 1.6073 1.3844 1.3547 -0.3264 -0.0876 -0.0520 178 MET A N   
1264 C CA  . MET A 161 ? 1.5932 1.3656 1.3176 -0.3129 -0.0897 -0.0565 178 MET A CA  
1265 C C   . MET A 161 ? 1.5100 1.2980 1.2598 -0.2993 -0.0903 -0.0486 178 MET A C   
1266 O O   . MET A 161 ? 1.4806 1.2628 1.2445 -0.2906 -0.0781 -0.0456 178 MET A O   
1267 C CB  . MET A 161 ? 1.6377 1.3785 1.3285 -0.3000 -0.0752 -0.0672 178 MET A CB  
1268 C CG  . MET A 161 ? 1.6619 1.3953 1.3318 -0.2864 -0.0772 -0.0736 178 MET A CG  
1269 S SD  . MET A 161 ? 1.8216 1.5178 1.4622 -0.2678 -0.0626 -0.0827 178 MET A SD  
1270 C CE  . MET A 161 ? 1.7695 1.4637 1.4255 -0.2526 -0.0559 -0.0752 178 MET A CE  
1271 N N   . ILE A 162 ? 1.4977 1.3032 1.2521 -0.2983 -0.1030 -0.0452 179 ILE A N   
1272 C CA  . ILE A 162 ? 1.4436 1.2625 1.2196 -0.2847 -0.1030 -0.0385 179 ILE A CA  
1273 C C   . ILE A 162 ? 1.3931 1.2043 1.1453 -0.2724 -0.1039 -0.0457 179 ILE A C   
1274 O O   . ILE A 162 ? 1.4245 1.2399 1.1634 -0.2793 -0.1130 -0.0488 179 ILE A O   
1275 C CB  . ILE A 162 ? 1.4411 1.2904 1.2511 -0.2939 -0.1183 -0.0264 179 ILE A CB  
1276 C CG1 . ILE A 162 ? 1.4387 1.2993 1.2747 -0.3115 -0.1247 -0.0198 179 ILE A CG1 
1277 C CG2 . ILE A 162 ? 1.4079 1.2683 1.2436 -0.2793 -0.1138 -0.0194 179 ILE A CG2 
1278 C CD1 . ILE A 162 ? 1.4574 1.3155 1.3227 -0.3074 -0.1092 -0.0162 179 ILE A CD1 
1279 N N   . LEU A 163 ? 1.3360 1.1335 1.0818 -0.2548 -0.0943 -0.0487 180 LEU A N   
1280 C CA  . LEU A 163 ? 1.3077 1.1000 1.0379 -0.2425 -0.0968 -0.0553 180 LEU A CA  
1281 C C   . LEU A 163 ? 1.2527 1.0622 1.0051 -0.2342 -0.1002 -0.0481 180 LEU A C   
1282 O O   . LEU A 163 ? 1.2487 1.0535 1.0112 -0.2255 -0.0924 -0.0440 180 LEU A O   
1283 C CB  . LEU A 163 ? 1.3170 1.0789 1.0219 -0.2289 -0.0874 -0.0642 180 LEU A CB  
1284 C CG  . LEU A 163 ? 1.3281 1.0696 1.0101 -0.2358 -0.0821 -0.0716 180 LEU A CG  
1285 C CD1 . LEU A 163 ? 1.3624 1.0728 1.0190 -0.2201 -0.0761 -0.0799 180 LEU A CD1 
1286 C CD2 . LEU A 163 ? 1.3143 1.0635 0.9887 -0.2490 -0.0889 -0.0762 180 LEU A CD2 
1287 N N   . ASP A 164 ? 1.2406 1.0677 0.9990 -0.2375 -0.1103 -0.0465 181 ASP A N   
1288 C CA  . ASP A 164 ? 1.2169 1.0617 0.9977 -0.2306 -0.1138 -0.0391 181 ASP A CA  
1289 C C   . ASP A 164 ? 1.1965 1.0327 0.9652 -0.2161 -0.1127 -0.0472 181 ASP A C   
1290 O O   . ASP A 164 ? 1.2021 1.0373 0.9586 -0.2180 -0.1166 -0.0543 181 ASP A O   
1291 C CB  . ASP A 164 ? 1.1992 1.0678 0.9954 -0.2441 -0.1265 -0.0308 181 ASP A CB  
1292 C CG  . ASP A 164 ? 1.1338 1.0216 0.9580 -0.2380 -0.1296 -0.0208 181 ASP A CG  
1293 O OD1 . ASP A 164 ? 1.0541 0.9374 0.8866 -0.2243 -0.1209 -0.0203 181 ASP A OD1 
1294 O OD2 . ASP A 164 ? 1.1411 1.0461 0.9769 -0.2475 -0.1411 -0.0130 181 ASP A OD2 
1295 N N   . CYS A 165 ? 1.2397 1.0679 1.0121 -0.2023 -0.1068 -0.0464 182 CYS A N   
1296 C CA  . CYS A 165 ? 1.2530 1.0733 1.0175 -0.1881 -0.1080 -0.0533 182 CYS A CA  
1297 C C   . CYS A 165 ? 1.2175 1.0584 1.0027 -0.1856 -0.1122 -0.0477 182 CYS A C   
1298 O O   . CYS A 165 ? 1.2847 1.1221 1.0672 -0.1754 -0.1141 -0.0534 182 CYS A O   
1299 C CB  . CYS A 165 ? 1.2851 1.0794 1.0353 -0.1750 -0.1008 -0.0559 182 CYS A CB  
1300 S SG  . CYS A 165 ? 1.3631 1.1405 1.0979 -0.1587 -0.1067 -0.0669 182 CYS A SG  
1301 N N   . GLU A 166 ? 1.2058 1.0675 1.0131 -0.1947 -0.1145 -0.0365 183 GLU A N   
1302 C CA  . GLU A 166 ? 1.2259 1.1050 1.0542 -0.1912 -0.1170 -0.0296 183 GLU A CA  
1303 C C   . GLU A 166 ? 1.2300 1.1197 1.0555 -0.1950 -0.1247 -0.0328 183 GLU A C   
1304 O O   . GLU A 166 ? 1.3166 1.2096 1.1335 -0.2074 -0.1300 -0.0335 183 GLU A O   
1305 C CB  . GLU A 166 ? 1.2497 1.1472 1.1067 -0.1992 -0.1179 -0.0155 183 GLU A CB  
1306 C CG  . GLU A 166 ? 1.2809 1.1944 1.1608 -0.1942 -0.1191 -0.0077 183 GLU A CG  
1307 C CD  . GLU A 166 ? 1.3046 1.2331 1.2187 -0.1987 -0.1176 0.0062  183 GLU A CD  
1308 O OE1 . GLU A 166 ? 1.3270 1.2513 1.2556 -0.1898 -0.1063 0.0096  183 GLU A OE1 
1309 O OE2 . GLU A 166 ? 1.3237 1.2666 1.2508 -0.2117 -0.1277 0.0136  183 GLU A OE2 
1310 N N   . LEU A 167 ? 1.1798 1.0725 1.0112 -0.1852 -0.1242 -0.0350 184 LEU A N   
1311 C CA  . LEU A 167 ? 1.1531 1.0558 0.9860 -0.1883 -0.1287 -0.0372 184 LEU A CA  
1312 C C   . LEU A 167 ? 1.1271 1.0464 0.9825 -0.1865 -0.1299 -0.0263 184 LEU A C   
1313 O O   . LEU A 167 ? 1.0879 1.0075 0.9567 -0.1787 -0.1251 -0.0209 184 LEU A O   
1314 C CB  . LEU A 167 ? 1.1486 1.0397 0.9722 -0.1781 -0.1266 -0.0508 184 LEU A CB  
1315 C CG  . LEU A 167 ? 1.1300 1.0024 0.9351 -0.1763 -0.1251 -0.0620 184 LEU A CG  
1316 C CD1 . LEU A 167 ? 1.1523 1.0151 0.9574 -0.1642 -0.1253 -0.0742 184 LEU A CD1 
1317 C CD2 . LEU A 167 ? 1.1516 1.0241 0.9448 -0.1909 -0.1257 -0.0639 184 LEU A CD2 
1318 N N   . ASN A 168 ? 1.1419 1.0722 0.9993 -0.1945 -0.1353 -0.0229 185 ASN A N   
1319 C CA  . ASN A 168 ? 1.1828 1.1288 1.0605 -0.1947 -0.1380 -0.0114 185 ASN A CA  
1320 C C   . ASN A 168 ? 1.1619 1.1086 1.0549 -0.1802 -0.1309 -0.0113 185 ASN A C   
1321 O O   . ASN A 168 ? 1.1543 1.1096 1.0687 -0.1779 -0.1289 -0.0003 185 ASN A O   
1322 C CB  . ASN A 168 ? 1.2268 1.1757 1.0950 -0.2024 -0.1422 -0.0125 185 ASN A CB  
1323 C CG  . ASN A 168 ? 1.3143 1.2492 1.1628 -0.2007 -0.1367 -0.0288 185 ASN A CG  
1324 O OD1 . ASN A 168 ? 1.4282 1.3521 1.2596 -0.2060 -0.1361 -0.0359 185 ASN A OD1 
1325 N ND2 . ASN A 168 ? 1.2979 1.2332 1.1519 -0.1934 -0.1318 -0.0350 185 ASN A ND2 
1326 N N   . TRP A 169 ? 1.1384 1.0742 1.0211 -0.1710 -0.1270 -0.0240 186 TRP A N   
1327 C CA  . TRP A 169 ? 1.0415 0.9752 0.9335 -0.1586 -0.1222 -0.0263 186 TRP A CA  
1328 C C   . TRP A 169 ? 1.0439 0.9640 0.9342 -0.1494 -0.1163 -0.0261 186 TRP A C   
1329 O O   . TRP A 169 ? 1.0904 1.0070 0.9872 -0.1409 -0.1117 -0.0257 186 TRP A O   
1330 C CB  . TRP A 169 ? 0.9995 0.9268 0.8843 -0.1533 -0.1225 -0.0403 186 TRP A CB  
1331 C CG  . TRP A 169 ? 0.9876 0.8994 0.8560 -0.1508 -0.1239 -0.0526 186 TRP A CG  
1332 C CD1 . TRP A 169 ? 1.0042 0.9131 0.8617 -0.1586 -0.1251 -0.0590 186 TRP A CD1 
1333 C CD2 . TRP A 169 ? 0.9756 0.8694 0.8349 -0.1398 -0.1244 -0.0598 186 TRP A CD2 
1334 N NE1 . TRP A 169 ? 0.9860 0.8787 0.8327 -0.1523 -0.1260 -0.0694 186 TRP A NE1 
1335 C CE2 . TRP A 169 ? 0.9625 0.8453 0.8091 -0.1406 -0.1269 -0.0698 186 TRP A CE2 
1336 C CE3 . TRP A 169 ? 0.9647 0.8471 0.8223 -0.1296 -0.1228 -0.0588 186 TRP A CE3 
1337 C CZ2 . TRP A 169 ? 0.9376 0.7998 0.7719 -0.1309 -0.1301 -0.0778 186 TRP A CZ2 
1338 C CZ3 . TRP A 169 ? 0.9575 0.8165 0.7975 -0.1211 -0.1260 -0.0671 186 TRP A CZ3 
1339 C CH2 . TRP A 169 ? 0.9339 0.7836 0.7633 -0.1214 -0.1307 -0.0761 186 TRP A CH2 
1340 N N   . HIS A 170 ? 1.0486 0.9583 0.9277 -0.1519 -0.1153 -0.0267 187 HIS A N   
1341 C CA  . HIS A 170 ? 1.0838 0.9744 0.9552 -0.1443 -0.1076 -0.0269 187 HIS A CA  
1342 C C   . HIS A 170 ? 1.1011 0.9965 0.9927 -0.1423 -0.0987 -0.0158 187 HIS A C   
1343 O O   . HIS A 170 ? 1.0752 0.9534 0.9593 -0.1334 -0.0913 -0.0182 187 HIS A O   
1344 C CB  . HIS A 170 ? 1.1307 1.0103 0.9893 -0.1495 -0.1060 -0.0274 187 HIS A CB  
1345 C CG  . HIS A 170 ? 1.1635 1.0303 0.9991 -0.1489 -0.1117 -0.0394 187 HIS A CG  
1346 N ND1 . HIS A 170 ? 1.1704 1.0282 0.9932 -0.1547 -0.1111 -0.0410 187 HIS A ND1 
1347 C CD2 . HIS A 170 ? 1.1653 1.0269 0.9924 -0.1431 -0.1174 -0.0504 187 HIS A CD2 
1348 C CE1 . HIS A 170 ? 1.1886 1.0352 0.9944 -0.1520 -0.1157 -0.0522 187 HIS A CE1 
1349 N NE2 . HIS A 170 ? 1.1553 1.0046 0.9655 -0.1449 -0.1198 -0.0580 187 HIS A NE2 
1350 N N   . GLN A 171 ? 1.1868 1.1035 1.1038 -0.1507 -0.0996 -0.0036 188 GLN A N   
1351 C CA  . GLN A 171 ? 1.2609 1.1833 1.2045 -0.1485 -0.0899 0.0077  188 GLN A CA  
1352 C C   . GLN A 171 ? 1.2678 1.1890 1.2155 -0.1397 -0.0858 0.0066  188 GLN A C   
1353 O O   . GLN A 171 ? 1.2959 1.2086 1.2534 -0.1343 -0.0732 0.0109  188 GLN A O   
1354 C CB  . GLN A 171 ? 1.3520 1.2990 1.3285 -0.1588 -0.0949 0.0222  188 GLN A CB  
1355 C CG  . GLN A 171 ? 1.4474 1.4144 1.4281 -0.1673 -0.1104 0.0260  188 GLN A CG  
1356 C CD  . GLN A 171 ? 1.5253 1.4982 1.5086 -0.1619 -0.1113 0.0257  188 GLN A CD  
1357 O OE1 . GLN A 171 ? 1.5847 1.5630 1.5905 -0.1567 -0.1046 0.0334  188 GLN A OE1 
1358 N NE2 . GLN A 171 ? 1.5163 1.4873 1.4781 -0.1636 -0.1180 0.0164  188 GLN A NE2 
1359 N N   . ALA A 172 ? 1.2449 1.1721 1.1844 -0.1387 -0.0944 0.0000  189 ALA A N   
1360 C CA  . ALA A 172 ? 1.2142 1.1407 1.1576 -0.1312 -0.0914 -0.0023 189 ALA A CA  
1361 C C   . ALA A 172 ? 1.1847 1.0868 1.1036 -0.1216 -0.0897 -0.0155 189 ALA A C   
1362 O O   . ALA A 172 ? 1.2127 1.1088 1.1336 -0.1151 -0.0851 -0.0171 189 ALA A O   
1363 C CB  . ALA A 172 ? 1.2257 1.1701 1.1753 -0.1358 -0.1003 -0.0027 189 ALA A CB  
1364 N N   . SER A 173 ? 1.1577 1.0448 1.0534 -0.1208 -0.0949 -0.0249 190 SER A N   
1365 C CA  . SER A 173 ? 1.1353 0.9971 1.0068 -0.1118 -0.0976 -0.0369 190 SER A CA  
1366 C C   . SER A 173 ? 1.1097 0.9463 0.9682 -0.1063 -0.0866 -0.0345 190 SER A C   
1367 O O   . SER A 173 ? 1.1260 0.9594 0.9890 -0.1096 -0.0759 -0.0261 190 SER A O   
1368 C CB  . SER A 173 ? 1.1589 1.0082 1.0095 -0.1121 -0.1055 -0.0458 190 SER A CB  
1369 O OG  . SER A 173 ? 1.1769 1.0020 1.0067 -0.1029 -0.1123 -0.0571 190 SER A OG  
1370 N N   . GLU A 174 ? 1.1503 0.9667 0.9922 -0.0985 -0.0890 -0.0425 191 GLU A N   
1371 C CA  . GLU A 174 ? 1.2048 0.9899 1.0262 -0.0939 -0.0780 -0.0416 191 GLU A CA  
1372 C C   . GLU A 174 ? 1.2236 0.9741 1.0064 -0.0895 -0.0851 -0.0507 191 GLU A C   
1373 O O   . GLU A 174 ? 1.1981 0.9519 0.9761 -0.0881 -0.1002 -0.0587 191 GLU A O   
1374 C CB  . GLU A 174 ? 1.2075 0.9891 1.0324 -0.0892 -0.0763 -0.0438 191 GLU A CB  
1375 C CG  . GLU A 174 ? 1.2034 1.0163 1.0657 -0.0928 -0.0682 -0.0336 191 GLU A CG  
1376 C CD  . GLU A 174 ? 1.2914 1.1016 1.1573 -0.0885 -0.0670 -0.0369 191 GLU A CD  
1377 O OE1 . GLU A 174 ? 1.4067 1.1950 1.2486 -0.0835 -0.0763 -0.0483 191 GLU A OE1 
1378 O OE2 . GLU A 174 ? 1.3226 1.1509 1.2152 -0.0902 -0.0575 -0.0280 191 GLU A OE2 
1379 N N   . GLY A 175 ? 1.2961 1.0109 1.0513 -0.0875 -0.0731 -0.0491 192 GLY A N   
1380 C CA  . GLY A 175 ? 1.3442 1.0167 1.0542 -0.0832 -0.0790 -0.0566 192 GLY A CA  
1381 C C   . GLY A 175 ? 1.3622 1.0353 1.0648 -0.0854 -0.0855 -0.0584 192 GLY A C   
1382 O O   . GLY A 175 ? 1.4202 1.0770 1.1010 -0.0809 -0.1017 -0.0670 192 GLY A O   
1383 N N   . LEU A 176 ? 1.3859 1.0778 1.1088 -0.0926 -0.0738 -0.0502 193 LEU A N   
1384 C CA  . LEU A 176 ? 1.3809 1.0707 1.0952 -0.0959 -0.0770 -0.0515 193 LEU A CA  
1385 C C   . LEU A 176 ? 1.4089 1.0648 1.0984 -0.0976 -0.0596 -0.0478 193 LEU A C   
1386 O O   . LEU A 176 ? 1.3938 1.0419 1.0892 -0.0991 -0.0413 -0.0414 193 LEU A O   
1387 C CB  . LEU A 176 ? 1.3470 1.0805 1.0999 -0.1044 -0.0784 -0.0459 193 LEU A CB  
1388 C CG  . LEU A 176 ? 1.3366 1.1026 1.1148 -0.1045 -0.0910 -0.0484 193 LEU A CG  
1389 C CD1 . LEU A 176 ? 1.2906 1.0844 1.0870 -0.1133 -0.0960 -0.0465 193 LEU A CD1 
1390 C CD2 . LEU A 176 ? 1.3300 1.0827 1.0923 -0.0960 -0.1060 -0.0602 193 LEU A CD2 
1391 N N   . THR A 177 ? 1.4564 1.0906 1.1191 -0.0973 -0.0636 -0.0521 194 THR A N   
1392 C CA  . THR A 177 ? 1.5168 1.1133 1.1507 -0.0990 -0.0463 -0.0499 194 THR A CA  
1393 C C   . THR A 177 ? 1.5011 1.1180 1.1557 -0.1075 -0.0404 -0.0458 194 THR A C   
1394 O O   . THR A 177 ? 1.4255 1.0718 1.1190 -0.1149 -0.0293 -0.0374 194 THR A O   
1395 C CB  . THR A 177 ? 1.5737 1.1177 1.1506 -0.0913 -0.0553 -0.0581 194 THR A CB  
1396 O OG1 . THR A 177 ? 1.5676 1.1155 1.1381 -0.0899 -0.0722 -0.0636 194 THR A OG1 
1397 C CG2 . THR A 177 ? 1.5628 1.0942 1.1253 -0.0838 -0.0684 -0.0631 194 THR A CG2 
1398 N N   . ASP A 178 ? 1.5337 1.1354 1.1644 -0.1068 -0.0492 -0.0514 195 ASP A N   
1399 C CA  . ASP A 178 ? 1.5288 1.1367 1.1679 -0.1150 -0.0407 -0.0485 195 ASP A CA  
1400 C C   . ASP A 178 ? 1.4878 1.1167 1.1336 -0.1172 -0.0574 -0.0534 195 ASP A C   
1401 O O   . ASP A 178 ? 1.4533 1.0785 1.0865 -0.1103 -0.0746 -0.0607 195 ASP A O   
1402 C CB  . ASP A 178 ? 1.6068 1.1632 1.2029 -0.1137 -0.0257 -0.0499 195 ASP A CB  
1403 C CG  . ASP A 178 ? 1.6463 1.1844 1.2442 -0.1160 -0.0002 -0.0437 195 ASP A CG  
1404 O OD1 . ASP A 178 ? 1.6957 1.2672 1.3371 -0.1199 0.0066  -0.0369 195 ASP A OD1 
1405 O OD2 . ASP A 178 ? 1.7069 1.1941 1.2618 -0.1139 0.0138  -0.0455 195 ASP A OD2 
1406 N N   . TYR A 179 ? 1.4913 1.1417 1.1595 -0.1275 -0.0515 -0.0492 196 TYR A N   
1407 C CA  . TYR A 179 ? 1.5026 1.1686 1.1745 -0.1323 -0.0628 -0.0535 196 TYR A CA  
1408 C C   . TYR A 179 ? 1.5278 1.1548 1.1625 -0.1306 -0.0575 -0.0579 196 TYR A C   
1409 O O   . TYR A 179 ? 1.5564 1.1682 1.1869 -0.1356 -0.0408 -0.0538 196 TYR A O   
1410 C CB  . TYR A 179 ? 1.4492 1.1535 1.1595 -0.1457 -0.0599 -0.0465 196 TYR A CB  
1411 C CG  . TYR A 179 ? 1.3910 1.1342 1.1349 -0.1484 -0.0691 -0.0423 196 TYR A CG  
1412 C CD1 . TYR A 179 ? 1.3662 1.1278 1.1137 -0.1497 -0.0838 -0.0476 196 TYR A CD1 
1413 C CD2 . TYR A 179 ? 1.3430 1.1022 1.1152 -0.1499 -0.0616 -0.0331 196 TYR A CD2 
1414 C CE1 . TYR A 179 ? 1.3388 1.1311 1.1121 -0.1526 -0.0908 -0.0439 196 TYR A CE1 
1415 C CE2 . TYR A 179 ? 1.3068 1.0985 1.1068 -0.1521 -0.0703 -0.0288 196 TYR A CE2 
1416 C CZ  . TYR A 179 ? 1.2879 1.0951 1.0863 -0.1536 -0.0849 -0.0342 196 TYR A CZ  
1417 O OH  . TYR A 179 ? 1.1911 1.0266 1.0133 -0.1565 -0.0921 -0.0299 196 TYR A OH  
1418 N N   . SER A 180 ? 1.5426 1.1522 1.1526 -0.1232 -0.0711 -0.0661 197 SER A N   
1419 C CA  . SER A 180 ? 1.6873 1.2605 1.2623 -0.1213 -0.0686 -0.0702 197 SER A CA  
1420 C C   . SER A 180 ? 1.7830 1.3775 1.3719 -0.1285 -0.0740 -0.0735 197 SER A C   
1421 O O   . SER A 180 ? 1.8395 1.4578 1.4454 -0.1275 -0.0873 -0.0776 197 SER A O   
1422 C CB  . SER A 180 ? 1.7287 1.2657 1.2676 -0.1077 -0.0826 -0.0768 197 SER A CB  
1423 O OG  . SER A 180 ? 1.7602 1.2708 1.2781 -0.1016 -0.0787 -0.0747 197 SER A OG  
1424 N N   . PHE A 181 ? 1.8419 1.4255 1.4225 -0.1363 -0.0626 -0.0724 198 PHE A N   
1425 C CA  . PHE A 181 ? 1.8114 1.4067 1.3970 -0.1432 -0.0669 -0.0766 198 PHE A CA  
1426 C C   . PHE A 181 ? 1.8319 1.3843 1.3783 -0.1366 -0.0664 -0.0822 198 PHE A C   
1427 O O   . PHE A 181 ? 1.8112 1.3298 1.3316 -0.1359 -0.0535 -0.0800 198 PHE A O   
1428 C CB  . PHE A 181 ? 1.7928 1.4136 1.4043 -0.1592 -0.0567 -0.0711 198 PHE A CB  
1429 C CG  . PHE A 181 ? 1.7208 1.3859 1.3714 -0.1668 -0.0626 -0.0658 198 PHE A CG  
1430 C CD1 . PHE A 181 ? 1.7085 1.3866 1.3812 -0.1680 -0.0558 -0.0575 198 PHE A CD1 
1431 C CD2 . PHE A 181 ? 1.6604 1.3515 1.3247 -0.1736 -0.0734 -0.0688 198 PHE A CD2 
1432 C CE1 . PHE A 181 ? 1.6459 1.3630 1.3541 -0.1750 -0.0623 -0.0516 198 PHE A CE1 
1433 C CE2 . PHE A 181 ? 1.5893 1.3161 1.2838 -0.1814 -0.0791 -0.0633 198 PHE A CE2 
1434 C CZ  . PHE A 181 ? 1.5749 1.3153 1.2918 -0.1817 -0.0748 -0.0543 198 PHE A CZ  
1435 N N   . TYR A 182 ? 1.8635 1.4155 1.4066 -0.1317 -0.0793 -0.0894 199 TYR A N   
1436 C CA  . TYR A 182 ? 1.9941 1.5081 1.5046 -0.1247 -0.0818 -0.0947 199 TYR A CA  
1437 C C   . TYR A 182 ? 2.0426 1.5680 1.5616 -0.1340 -0.0789 -0.0988 199 TYR A C   
1438 O O   . TYR A 182 ? 2.0490 1.6086 1.5961 -0.1406 -0.0833 -0.1009 199 TYR A O   
1439 C CB  . TYR A 182 ? 2.0415 1.5419 1.5441 -0.1095 -0.1009 -0.1001 199 TYR A CB  
1440 C CG  . TYR A 182 ? 2.1225 1.6030 1.6083 -0.0994 -0.1071 -0.0975 199 TYR A CG  
1441 C CD1 . TYR A 182 ? 2.1409 1.6504 1.6531 -0.0980 -0.1137 -0.0965 199 TYR A CD1 
1442 C CD2 . TYR A 182 ? 2.1647 1.5936 1.6044 -0.0918 -0.1059 -0.0963 199 TYR A CD2 
1443 C CE1 . TYR A 182 ? 2.1822 1.6715 1.6772 -0.0896 -0.1191 -0.0947 199 TYR A CE1 
1444 C CE2 . TYR A 182 ? 2.2042 1.6098 1.6227 -0.0839 -0.1115 -0.0943 199 TYR A CE2 
1445 C CZ  . TYR A 182 ? 2.1996 1.6363 1.6466 -0.0829 -0.1180 -0.0937 199 TYR A CZ  
1446 O OH  . TYR A 182 ? 2.2009 1.6133 1.6257 -0.0760 -0.1231 -0.0923 199 TYR A OH  
1447 N N   . ARG A 183 ? 2.0842 1.5783 1.5765 -0.1352 -0.0705 -0.1002 200 ARG A N   
1448 C CA  . ARG A 183 ? 2.1197 1.6156 1.6135 -0.1414 -0.0689 -0.1059 200 ARG A CA  
1449 C C   . ARG A 183 ? 2.1270 1.5969 1.6053 -0.1267 -0.0815 -0.1121 200 ARG A C   
1450 O O   . ARG A 183 ? 2.1565 1.5895 1.6053 -0.1146 -0.0863 -0.1109 200 ARG A O   
1451 C CB  . ARG A 183 ? 2.1738 1.6504 1.6499 -0.1515 -0.0521 -0.1043 200 ARG A CB  
1452 C CG  . ARG A 183 ? 2.1911 1.6983 1.6921 -0.1687 -0.0412 -0.0991 200 ARG A CG  
1453 C CD  . ARG A 183 ? 2.1875 1.6858 1.6815 -0.1819 -0.0281 -0.1005 200 ARG A CD  
1454 N NE  . ARG A 183 ? 2.2037 1.7110 1.7011 -0.1875 -0.0328 -0.1073 200 ARG A NE  
1455 C CZ  . ARG A 183 ? 2.2406 1.7411 1.7313 -0.1997 -0.0234 -0.1103 200 ARG A CZ  
1456 N NH1 . ARG A 183 ? 2.2775 1.7640 1.7607 -0.2077 -0.0093 -0.1072 200 ARG A NH1 
1457 N NH2 . ARG A 183 ? 2.2280 1.7341 1.7200 -0.2046 -0.0265 -0.1171 200 ARG A NH2 
1458 N N   . VAL A 184 ? 2.1195 1.6060 1.6171 -0.1281 -0.0865 -0.1186 201 VAL A N   
1459 C CA  . VAL A 184 ? 2.1859 1.6539 1.6815 -0.1136 -0.0997 -0.1249 201 VAL A CA  
1460 C C   . VAL A 184 ? 2.2232 1.6691 1.7051 -0.1158 -0.0923 -0.1294 201 VAL A C   
1461 O O   . VAL A 184 ? 2.1569 1.6217 1.6543 -0.1277 -0.0835 -0.1335 201 VAL A O   
1462 C CB  . VAL A 184 ? 2.1569 1.6575 1.6899 -0.1109 -0.1101 -0.1298 201 VAL A CB  
1463 C CG1 . VAL A 184 ? 2.1620 1.6491 1.7049 -0.0990 -0.1203 -0.1375 201 VAL A CG1 
1464 C CG2 . VAL A 184 ? 2.1377 1.6491 1.6783 -0.1040 -0.1204 -0.1258 201 VAL A CG2 
1465 N N   . TRP A 185 ? 2.2999 1.7025 1.7497 -0.1044 -0.0963 -0.1286 202 TRP A N   
1466 C CA  . TRP A 185 ? 2.3264 1.7004 1.7564 -0.1052 -0.0882 -0.1315 202 TRP A CA  
1467 C C   . TRP A 185 ? 2.3437 1.7128 1.7909 -0.0950 -0.0985 -0.1386 202 TRP A C   
1468 O O   . TRP A 185 ? 2.3611 1.7350 1.8267 -0.0821 -0.1163 -0.1404 202 TRP A O   
1469 C CB  . TRP A 185 ? 2.3194 1.6441 1.7026 -0.0985 -0.0858 -0.1265 202 TRP A CB  
1470 C CG  . TRP A 185 ? 2.3014 1.6278 1.6710 -0.1090 -0.0713 -0.1203 202 TRP A CG  
1471 C CD1 . TRP A 185 ? 2.3007 1.6056 1.6463 -0.1030 -0.0731 -0.1147 202 TRP A CD1 
1472 C CD2 . TRP A 185 ? 2.2706 1.6222 1.6539 -0.1278 -0.0528 -0.1191 202 TRP A CD2 
1473 N NE1 . TRP A 185 ? 2.2702 1.5859 1.6173 -0.1165 -0.0543 -0.1102 202 TRP A NE1 
1474 C CE2 . TRP A 185 ? 2.2703 1.6161 1.6425 -0.1316 -0.0434 -0.1126 202 TRP A CE2 
1475 C CE3 . TRP A 185 ? 2.2087 1.5853 1.6124 -0.1425 -0.0437 -0.1231 202 TRP A CE3 
1476 C CZ2 . TRP A 185 ? 2.2349 1.6024 1.6225 -0.1487 -0.0266 -0.1096 202 TRP A CZ2 
1477 C CZ3 . TRP A 185 ? 2.1789 1.5754 1.5925 -0.1601 -0.0294 -0.1200 202 TRP A CZ3 
1478 C CH2 . TRP A 185 ? 2.1985 1.5920 1.6073 -0.1626 -0.0217 -0.1132 202 TRP A CH2 
1479 N N   . GLY A 186 ? 2.3093 1.6684 1.7528 -0.1012 -0.0865 -0.1429 203 GLY A N   
1480 C CA  . GLY A 186 ? 2.2908 1.6410 1.7512 -0.0925 -0.0914 -0.1498 203 GLY A CA  
1481 C C   . GLY A 186 ? 2.3382 1.6525 1.7878 -0.0711 -0.1114 -0.1487 203 GLY A C   
1482 O O   . GLY A 186 ? 2.3419 1.6578 1.8202 -0.0612 -0.1209 -0.1541 203 GLY A O   
1483 N N   . ASN A 187 ? 2.3673 1.6471 1.7759 -0.0644 -0.1177 -0.1418 204 ASN A N   
1484 C CA  . ASN A 187 ? 2.4077 1.6482 1.7977 -0.0443 -0.1413 -0.1392 204 ASN A CA  
1485 C C   . ASN A 187 ? 2.4221 1.6711 1.8209 -0.0345 -0.1636 -0.1368 204 ASN A C   
1486 O O   . ASN A 187 ? 2.4375 1.6477 1.8063 -0.0210 -0.1828 -0.1327 204 ASN A O   
1487 C CB  . ASN A 187 ? 2.4439 1.6304 1.7747 -0.0421 -0.1362 -0.1332 204 ASN A CB  
1488 C CG  . ASN A 187 ? 2.4171 1.6020 1.7185 -0.0533 -0.1216 -0.1277 204 ASN A CG  
1489 O OD1 . ASN A 187 ? 2.4048 1.6174 1.7215 -0.0561 -0.1252 -0.1262 204 ASN A OD1 
1490 N ND2 . ASN A 187 ? 2.4021 1.5541 1.6639 -0.0600 -0.1035 -0.1249 204 ASN A ND2 
1491 N N   . ASN A 188 ? 2.3987 1.6949 1.8349 -0.0417 -0.1611 -0.1392 205 ASN A N   
1492 C CA  . ASN A 188 ? 2.3594 1.6694 1.8085 -0.0346 -0.1794 -0.1378 205 ASN A CA  
1493 C C   . ASN A 188 ? 2.3313 1.6137 1.7353 -0.0328 -0.1835 -0.1303 205 ASN A C   
1494 O O   . ASN A 188 ? 2.3166 1.5860 1.7148 -0.0217 -0.2051 -0.1288 205 ASN A O   
1495 C CB  . ASN A 188 ? 2.4012 1.7060 1.8788 -0.0179 -0.2053 -0.1419 205 ASN A CB  
1496 C CG  . ASN A 188 ? 2.4624 1.7963 1.9908 -0.0200 -0.1982 -0.1502 205 ASN A CG  
1497 O OD1 . ASN A 188 ? 2.4277 1.8030 1.9884 -0.0310 -0.1853 -0.1541 205 ASN A OD1 
1498 N ND2 . ASN A 188 ? 2.5518 1.8614 2.0856 -0.0103 -0.2045 -0.1528 205 ASN A ND2 
1499 N N   . THR A 189 ? 2.3155 1.5875 1.6884 -0.0444 -0.1619 -0.1260 206 THR A N   
1500 C CA  . THR A 189 ? 2.2690 1.5236 1.6073 -0.0471 -0.1568 -0.1196 206 THR A CA  
1501 C C   . THR A 189 ? 2.2222 1.5226 1.5871 -0.0633 -0.1371 -0.1186 206 THR A C   
1502 O O   . THR A 189 ? 2.1555 1.4920 1.5541 -0.0732 -0.1273 -0.1223 206 THR A O   
1503 C CB  . THR A 189 ? 2.2724 1.4710 1.5522 -0.0470 -0.1463 -0.1151 206 THR A CB  
1504 O OG1 . THR A 189 ? 2.1684 1.3746 1.4511 -0.0595 -0.1230 -0.1163 206 THR A OG1 
1505 C CG2 . THR A 189 ? 2.3091 1.4581 1.5587 -0.0304 -0.1691 -0.1150 206 THR A CG2 
1506 N N   . GLU A 190 ? 2.2095 1.5049 1.5577 -0.0658 -0.1321 -0.1133 207 GLU A N   
1507 C CA  . GLU A 190 ? 2.1346 1.4705 1.5083 -0.0793 -0.1164 -0.1106 207 GLU A CA  
1508 C C   . GLU A 190 ? 2.1058 1.4143 1.4456 -0.0852 -0.0981 -0.1045 207 GLU A C   
1509 O O   . GLU A 190 ? 2.1882 1.4475 1.4830 -0.0769 -0.1013 -0.1022 207 GLU A O   
1510 C CB  . GLU A 190 ? 2.1253 1.4906 1.5266 -0.0750 -0.1299 -0.1108 207 GLU A CB  
1511 C CG  . GLU A 190 ? 2.1147 1.4955 1.5452 -0.0652 -0.1510 -0.1173 207 GLU A CG  
1512 C CD  . GLU A 190 ? 2.0617 1.4742 1.5226 -0.0629 -0.1615 -0.1180 207 GLU A CD  
1513 O OE1 . GLU A 190 ? 2.0163 1.4279 1.4663 -0.0648 -0.1573 -0.1131 207 GLU A OE1 
1514 O OE2 . GLU A 190 ? 2.0824 1.5202 1.5799 -0.0592 -0.1723 -0.1238 207 GLU A OE2 
1515 N N   . THR A 191 ? 2.0434 1.3816 1.4048 -0.0997 -0.0790 -0.1017 208 THR A N   
1516 C CA  . THR A 191 ? 2.0899 1.4088 1.4313 -0.1058 -0.0594 -0.0960 208 THR A CA  
1517 C C   . THR A 191 ? 2.0318 1.3933 1.4103 -0.1122 -0.0559 -0.0924 208 THR A C   
1518 O O   . THR A 191 ? 2.0089 1.4181 1.4294 -0.1211 -0.0566 -0.0929 208 THR A O   
1519 C CB  . THR A 191 ? 2.1317 1.4435 1.4684 -0.1183 -0.0376 -0.0954 208 THR A CB  
1520 O OG1 . THR A 191 ? 2.2769 1.5572 1.5869 -0.1130 -0.0421 -0.0995 208 THR A OG1 
1521 C CG2 . THR A 191 ? 2.1160 1.3964 1.4278 -0.1229 -0.0150 -0.0903 208 THR A CG2 
1522 N N   . LEU A 192 ? 2.0326 1.3735 1.3928 -0.1077 -0.0525 -0.0886 209 LEU A N   
1523 C CA  . LEU A 192 ? 2.0186 1.3925 1.4105 -0.1141 -0.0441 -0.0839 209 LEU A CA  
1524 C C   . LEU A 192 ? 1.9702 1.3551 1.3792 -0.1285 -0.0196 -0.0797 209 LEU A C   
1525 O O   . LEU A 192 ? 2.0635 1.4087 1.4424 -0.1303 -0.0014 -0.0782 209 LEU A O   
1526 C CB  . LEU A 192 ? 2.0595 1.3988 1.4205 -0.1058 -0.0436 -0.0816 209 LEU A CB  
1527 C CG  . LEU A 192 ? 2.0012 1.3669 1.3911 -0.1106 -0.0329 -0.0764 209 LEU A CG  
1528 C CD1 . LEU A 192 ? 1.9718 1.3882 1.4040 -0.1088 -0.0517 -0.0776 209 LEU A CD1 
1529 C CD2 . LEU A 192 ? 2.0166 1.3329 1.3633 -0.1045 -0.0250 -0.0746 209 LEU A CD2 
1530 N N   . VAL A 193 ? 1.8705 1.3069 1.3275 -0.1393 -0.0193 -0.0779 210 VAL A N   
1531 C CA  . VAL A 193 ? 1.8524 1.3017 1.3312 -0.1538 0.0002  -0.0740 210 VAL A CA  
1532 C C   . VAL A 193 ? 1.8001 1.2733 1.3133 -0.1596 0.0117  -0.0668 210 VAL A C   
1533 O O   . VAL A 193 ? 1.7261 1.2016 1.2570 -0.1699 0.0304  -0.0630 210 VAL A O   
1534 C CB  . VAL A 193 ? 1.8643 1.3470 1.3687 -0.1647 -0.0059 -0.0766 210 VAL A CB  
1535 C CG1 . VAL A 193 ? 1.8953 1.3483 1.3656 -0.1594 -0.0115 -0.0835 210 VAL A CG1 
1536 C CG2 . VAL A 193 ? 1.8397 1.3707 1.3803 -0.1669 -0.0227 -0.0762 210 VAL A CG2 
1537 N N   . SER A 194 ? 1.8064 1.2983 1.3329 -0.1531 0.0004  -0.0651 211 SER A N   
1538 C CA  . SER A 194 ? 1.7483 1.2612 1.3071 -0.1563 0.0101  -0.0580 211 SER A CA  
1539 C C   . SER A 194 ? 1.7113 1.2258 1.2641 -0.1451 -0.0028 -0.0585 211 SER A C   
1540 O O   . SER A 194 ? 1.6984 1.2207 1.2443 -0.1384 -0.0232 -0.0635 211 SER A O   
1541 C CB  . SER A 194 ? 1.7095 1.2762 1.3238 -0.1696 0.0076  -0.0530 211 SER A CB  
1542 O OG  . SER A 194 ? 1.6228 1.2248 1.2543 -0.1690 -0.0139 -0.0544 211 SER A OG  
1543 N N   . LYS A 195 ? 1.6967 1.2025 1.2538 -0.1433 0.0104  -0.0538 212 LYS A N   
1544 C CA  . LYS A 195 ? 1.7158 1.2212 1.2678 -0.1340 0.0010  -0.0539 212 LYS A CA  
1545 C C   . LYS A 195 ? 1.7167 1.2354 1.2997 -0.1378 0.0183  -0.0464 212 LYS A C   
1546 O O   . LYS A 195 ? 1.7674 1.2524 1.3349 -0.1390 0.0414  -0.0443 212 LYS A O   
1547 C CB  . LYS A 195 ? 1.7871 1.2352 1.2790 -0.1227 -0.0017 -0.0590 212 LYS A CB  
1548 C CG  . LYS A 195 ? 1.8285 1.2736 1.3122 -0.1135 -0.0144 -0.0603 212 LYS A CG  
1549 C CD  . LYS A 195 ? 1.8858 1.2788 1.3112 -0.1024 -0.0280 -0.0664 212 LYS A CD  
1550 C CE  . LYS A 195 ? 1.9078 1.2998 1.3276 -0.0938 -0.0447 -0.0687 212 LYS A CE  
1551 N NZ  . LYS A 195 ? 1.9393 1.3423 1.3786 -0.0967 -0.0292 -0.0636 212 LYS A NZ  
1552 N N   . GLY A 196 ? 1.7076 1.2727 1.3340 -0.1397 0.0086  -0.0424 213 GLY A N   
1553 C CA  . GLY A 196 ? 1.7015 1.2871 1.3691 -0.1446 0.0242  -0.0338 213 GLY A CA  
1554 C C   . GLY A 196 ? 1.6529 1.2875 1.3626 -0.1456 0.0092  -0.0295 213 GLY A C   
1555 O O   . GLY A 196 ? 1.6622 1.3124 1.3665 -0.1423 -0.0116 -0.0340 213 GLY A O   
1556 N N   . LYS A 197 ? 1.6646 1.3218 1.4173 -0.1500 0.0207  -0.0208 214 LYS A N   
1557 C CA  . LYS A 197 ? 1.6268 1.3271 1.4182 -0.1506 0.0074  -0.0154 214 LYS A CA  
1558 C C   . LYS A 197 ? 1.5516 1.2936 1.3764 -0.1609 -0.0077 -0.0117 214 LYS A C   
1559 O O   . LYS A 197 ? 1.5078 1.2813 1.3545 -0.1617 -0.0221 -0.0085 214 LYS A O   
1560 C CB  . LYS A 197 ? 1.6629 1.3691 1.4877 -0.1502 0.0247  -0.0068 214 LYS A CB  
1561 C CG  . LYS A 197 ? 1.7645 1.4315 1.5544 -0.1402 0.0369  -0.0106 214 LYS A CG  
1562 C CD  . LYS A 197 ? 1.8053 1.4765 1.5753 -0.1320 0.0168  -0.0160 214 LYS A CD  
1563 C CE  . LYS A 197 ? 1.8794 1.5139 1.6190 -0.1236 0.0275  -0.0188 214 LYS A CE  
1564 N NZ  . LYS A 197 ? 1.9929 1.5696 1.6723 -0.1194 0.0354  -0.0262 214 LYS A NZ  
1565 N N   . GLU A 198 ? 1.5770 1.3159 1.4015 -0.1691 -0.0047 -0.0125 215 GLU A N   
1566 C CA  . GLU A 198 ? 1.5272 1.3007 1.3779 -0.1808 -0.0196 -0.0095 215 GLU A CA  
1567 C C   . GLU A 198 ? 1.4580 1.2374 1.2834 -0.1791 -0.0396 -0.0171 215 GLU A C   
1568 O O   . GLU A 198 ? 1.4506 1.2020 1.2366 -0.1730 -0.0401 -0.0263 215 GLU A O   
1569 C CB  . GLU A 198 ? 1.6123 1.3757 1.4644 -0.1902 -0.0102 -0.0102 215 GLU A CB  
1570 C CG  . GLU A 198 ? 1.6675 1.4216 1.5473 -0.1932 0.0134  -0.0041 215 GLU A CG  
1571 C CD  . GLU A 198 ? 1.6624 1.4564 1.6059 -0.2026 0.0103  0.0075  215 GLU A CD  
1572 O OE1 . GLU A 198 ? 1.6843 1.4729 1.6586 -0.2044 0.0308  0.0126  215 GLU A OE1 
1573 O OE2 . GLU A 198 ? 1.6305 1.4589 1.5940 -0.2083 -0.0118 0.0117  215 GLU A OE2 
1574 N N   . ALA A 199 ? 1.4025 1.2155 1.2505 -0.1846 -0.0554 -0.0133 216 ALA A N   
1575 C CA  . ALA A 199 ? 1.3637 1.1821 1.1913 -0.1834 -0.0713 -0.0208 216 ALA A CA  
1576 C C   . ALA A 199 ? 1.3442 1.1624 1.1592 -0.1937 -0.0777 -0.0254 216 ALA A C   
1577 O O   . ALA A 199 ? 1.2900 1.1061 1.0853 -0.1928 -0.0868 -0.0332 216 ALA A O   
1578 C CB  . ALA A 199 ? 1.3372 1.1854 1.1881 -0.1851 -0.0828 -0.0153 216 ALA A CB  
1579 N N   . THR A 200 ? 1.3631 1.1833 1.1918 -0.2039 -0.0720 -0.0210 217 THR A N   
1580 C CA  . THR A 200 ? 1.3660 1.1836 1.1819 -0.2149 -0.0766 -0.0255 217 THR A CA  
1581 C C   . THR A 200 ? 1.3675 1.1550 1.1643 -0.2131 -0.0617 -0.0299 217 THR A C   
1582 O O   . THR A 200 ? 1.3840 1.1580 1.1873 -0.2081 -0.0469 -0.0266 217 THR A O   
1583 C CB  . THR A 200 ? 1.3378 1.1834 1.1858 -0.2314 -0.0859 -0.0167 217 THR A CB  
1584 O OG1 . THR A 200 ? 1.3127 1.1593 1.1894 -0.2348 -0.0744 -0.0097 217 THR A OG1 
1585 C CG2 . THR A 200 ? 1.3142 1.1872 1.1843 -0.2327 -0.0992 -0.0091 217 THR A CG2 
1586 N N   . LEU A 201 ? 1.4047 1.1786 1.1759 -0.2173 -0.0639 -0.0377 218 LEU A N   
1587 C CA  . LEU A 201 ? 1.4753 1.2231 1.2308 -0.2195 -0.0505 -0.0410 218 LEU A CA  
1588 C C   . LEU A 201 ? 1.4837 1.2471 1.2548 -0.2374 -0.0549 -0.0392 218 LEU A C   
1589 O O   . LEU A 201 ? 1.5060 1.2808 1.2698 -0.2451 -0.0679 -0.0423 218 LEU A O   
1590 C CB  . LEU A 201 ? 1.4852 1.2019 1.1981 -0.2100 -0.0499 -0.0516 218 LEU A CB  
1591 C CG  . LEU A 201 ? 1.5215 1.2056 1.2109 -0.2110 -0.0361 -0.0556 218 LEU A CG  
1592 C CD1 . LEU A 201 ? 1.5666 1.2297 1.2568 -0.2057 -0.0181 -0.0512 218 LEU A CD1 
1593 C CD2 . LEU A 201 ? 1.5316 1.1884 1.1821 -0.2008 -0.0404 -0.0653 218 LEU A CD2 
1594 N N   . THR A 202 ? 1.5248 1.2871 1.3172 -0.2448 -0.0435 -0.0344 219 THR A N   
1595 C CA  . THR A 202 ? 1.5289 1.3035 1.3375 -0.2628 -0.0478 -0.0330 219 THR A CA  
1596 C C   . THR A 202 ? 1.5453 1.2881 1.3287 -0.2641 -0.0324 -0.0402 219 THR A C   
1597 O O   . THR A 202 ? 1.5526 1.2709 1.3295 -0.2559 -0.0139 -0.0405 219 THR A O   
1598 C CB  . THR A 202 ? 1.5031 1.3045 1.3653 -0.2723 -0.0483 -0.0217 219 THR A CB  
1599 O OG1 . THR A 202 ? 1.4811 1.3107 1.3648 -0.2710 -0.0640 -0.0145 219 THR A OG1 
1600 C CG2 . THR A 202 ? 1.4866 1.2997 1.3674 -0.2919 -0.0553 -0.0205 219 THR A CG2 
1601 N N   . LYS A 203 ? 1.6289 1.3685 1.3945 -0.2747 -0.0390 -0.0461 220 LYS A N   
1602 C CA  . LYS A 203 ? 1.6891 1.4002 1.4330 -0.2787 -0.0252 -0.0526 220 LYS A CA  
1603 C C   . LYS A 203 ? 1.6495 1.3776 1.4144 -0.2999 -0.0320 -0.0512 220 LYS A C   
1604 O O   . LYS A 203 ? 1.6316 1.3706 1.3864 -0.3097 -0.0475 -0.0539 220 LYS A O   
1605 C CB  . LYS A 203 ? 1.7090 1.3923 1.4050 -0.2698 -0.0251 -0.0629 220 LYS A CB  
1606 C CG  . LYS A 203 ? 1.7949 1.4460 1.4665 -0.2728 -0.0103 -0.0692 220 LYS A CG  
1607 C CD  . LYS A 203 ? 1.8756 1.4961 1.5370 -0.2617 0.0096  -0.0680 220 LYS A CD  
1608 C CE  . LYS A 203 ? 1.9416 1.5238 1.5554 -0.2449 0.0127  -0.0748 220 LYS A CE  
1609 N NZ  . LYS A 203 ? 1.9945 1.5552 1.5795 -0.2490 0.0145  -0.0828 220 LYS A NZ  
1610 N N   . PRO A 204 ? 1.6403 1.3689 1.4347 -0.3078 -0.0200 -0.0474 221 PRO A N   
1611 C CA  . PRO A 204 ? 1.6760 1.4258 1.4987 -0.3287 -0.0309 -0.0447 221 PRO A CA  
1612 C C   . PRO A 204 ? 1.7240 1.4511 1.5149 -0.3385 -0.0260 -0.0542 221 PRO A C   
1613 O O   . PRO A 204 ? 1.7683 1.4618 1.5229 -0.3282 -0.0097 -0.0615 221 PRO A O   
1614 C CB  . PRO A 204 ? 1.6572 1.4165 1.5301 -0.3319 -0.0182 -0.0373 221 PRO A CB  
1615 C CG  . PRO A 204 ? 1.6390 1.3640 1.4900 -0.3155 0.0083  -0.0407 221 PRO A CG  
1616 C CD  . PRO A 204 ? 1.6149 1.3198 1.4139 -0.2999 0.0048  -0.0468 221 PRO A CD  
1617 N N   . MET A 205 ? 1.7445 1.4874 1.5460 -0.3582 -0.0414 -0.0540 222 MET A N   
1618 C CA  . MET A 205 ? 1.8009 1.5242 1.5798 -0.3715 -0.0360 -0.0624 222 MET A CA  
1619 C C   . MET A 205 ? 1.8360 1.5244 1.5591 -0.3608 -0.0249 -0.0733 222 MET A C   
1620 O O   . MET A 205 ? 1.8059 1.4648 1.5104 -0.3564 -0.0054 -0.0788 222 MET A O   
1621 C CB  . MET A 205 ? 1.7816 1.5008 1.5934 -0.3792 -0.0197 -0.0609 222 MET A CB  
1622 C CG  . MET A 205 ? 1.7606 1.5153 1.6296 -0.3965 -0.0364 -0.0520 222 MET A CG  
1623 S SD  . MET A 205 ? 1.7434 1.4985 1.6663 -0.4050 -0.0162 -0.0495 222 MET A SD  
1624 C CE  . MET A 205 ? 1.7360 1.4978 1.6925 -0.3855 -0.0007 -0.0409 222 MET A CE  
1625 N N   . VAL A 206 ? 1.8891 1.5806 1.5874 -0.3571 -0.0377 -0.0761 223 VAL A N   
1626 C CA  . VAL A 206 ? 1.9189 1.5824 1.5739 -0.3428 -0.0297 -0.0849 223 VAL A CA  
1627 C C   . VAL A 206 ? 1.9344 1.5726 1.5582 -0.3529 -0.0223 -0.0947 223 VAL A C   
1628 O O   . VAL A 206 ? 1.9408 1.5876 1.5693 -0.3733 -0.0301 -0.0956 223 VAL A O   
1629 C CB  . VAL A 206 ? 1.9144 1.5919 1.5612 -0.3360 -0.0444 -0.0847 223 VAL A CB  
1630 C CG1 . VAL A 206 ? 1.9423 1.6269 1.5760 -0.3538 -0.0578 -0.0883 223 VAL A CG1 
1631 C CG2 . VAL A 206 ? 1.9322 1.5861 1.5504 -0.3152 -0.0364 -0.0910 223 VAL A CG2 
1632 N N   . GLY A 207 ? 1.9469 1.5523 1.5388 -0.3390 -0.0081 -0.1016 224 GLY A N   
1633 C CA  . GLY A 207 ? 2.0099 1.5881 1.5689 -0.3451 -0.0002 -0.1115 224 GLY A CA  
1634 C C   . GLY A 207 ? 2.0470 1.6082 1.5769 -0.3297 -0.0005 -0.1182 224 GLY A C   
1635 O O   . GLY A 207 ? 2.0610 1.6311 1.5962 -0.3147 -0.0070 -0.1154 224 GLY A O   
1636 N N   . PRO A 208 ? 2.1478 1.6842 1.6496 -0.3334 0.0070  -0.1273 225 PRO A N   
1637 C CA  . PRO A 208 ? 2.1325 1.6537 1.6137 -0.3193 0.0070  -0.1341 225 PRO A CA  
1638 C C   . PRO A 208 ? 2.0865 1.5923 1.5625 -0.2936 0.0089  -0.1325 225 PRO A C   
1639 O O   . PRO A 208 ? 1.9952 1.5038 1.4708 -0.2810 0.0019  -0.1347 225 PRO A O   
1640 C CB  . PRO A 208 ? 2.1906 1.6826 1.6455 -0.3275 0.0192  -0.1433 225 PRO A CB  
1641 C CG  . PRO A 208 ? 2.2127 1.7120 1.6739 -0.3510 0.0209  -0.1421 225 PRO A CG  
1642 C CD  . PRO A 208 ? 2.1924 1.7131 1.6832 -0.3508 0.0166  -0.1321 225 PRO A CD  
1643 N N   . GLU A 209 ? 2.1235 1.6108 1.5944 -0.2870 0.0186  -0.1290 226 GLU A N   
1644 C CA  . GLU A 209 ? 2.1322 1.5993 1.5922 -0.2644 0.0197  -0.1263 226 GLU A CA  
1645 C C   . GLU A 209 ? 2.0968 1.5885 1.5763 -0.2538 0.0068  -0.1206 226 GLU A C   
1646 O O   . GLU A 209 ? 2.1666 1.6423 1.6349 -0.2349 0.0031  -0.1201 226 GLU A O   
1647 C CB  . GLU A 209 ? 2.1508 1.5914 1.5995 -0.2634 0.0351  -0.1230 226 GLU A CB  
1648 C CG  . GLU A 209 ? 2.1377 1.6004 1.6151 -0.2743 0.0392  -0.1156 226 GLU A CG  
1649 C CD  . GLU A 209 ? 2.1120 1.5951 1.6101 -0.2984 0.0411  -0.1162 226 GLU A CD  
1650 O OE1 . GLU A 209 ? 2.1056 1.5877 1.5932 -0.3087 0.0386  -0.1226 226 GLU A OE1 
1651 O OE2 . GLU A 209 ? 2.1054 1.6049 1.6317 -0.3078 0.0449  -0.1104 226 GLU A OE2 
1652 N N   . ASP A 210 ? 2.0529 1.5814 1.5604 -0.2664 -0.0010 -0.1162 227 ASP A N   
1653 C CA  . ASP A 210 ? 1.9836 1.5383 1.5118 -0.2588 -0.0130 -0.1107 227 ASP A CA  
1654 C C   . ASP A 210 ? 1.9556 1.5253 1.4866 -0.2562 -0.0248 -0.1152 227 ASP A C   
1655 O O   . ASP A 210 ? 1.9377 1.5280 1.4849 -0.2497 -0.0343 -0.1115 227 ASP A O   
1656 C CB  . ASP A 210 ? 1.9132 1.4987 1.4725 -0.2730 -0.0157 -0.1025 227 ASP A CB  
1657 C CG  . ASP A 210 ? 1.8823 1.4548 1.4468 -0.2753 -0.0016 -0.0981 227 ASP A CG  
1658 O OD1 . ASP A 210 ? 1.8859 1.4376 1.4397 -0.2604 0.0058  -0.0962 227 ASP A OD1 
1659 O OD2 . ASP A 210 ? 1.8672 1.4484 1.4466 -0.2926 0.0022  -0.0968 227 ASP A OD2 
1660 N N   . ALA A 211 ? 1.9598 1.5177 1.4757 -0.2616 -0.0220 -0.1235 228 ALA A N   
1661 C CA  . ALA A 211 ? 1.9458 1.5108 1.4634 -0.2583 -0.0283 -0.1294 228 ALA A CA  
1662 C C   . ALA A 211 ? 1.9574 1.5080 1.4725 -0.2348 -0.0318 -0.1319 228 ALA A C   
1663 O O   . ALA A 211 ? 1.9639 1.4896 1.4651 -0.2227 -0.0284 -0.1309 228 ALA A O   
1664 C CB  . ALA A 211 ? 1.9683 1.5193 1.4696 -0.2708 -0.0207 -0.1382 228 ALA A CB  
1665 N N   . GLY A 212 ? 1.9667 1.5306 1.4944 -0.2291 -0.0389 -0.1353 229 GLY A N   
1666 C CA  . GLY A 212 ? 1.9874 1.5399 1.5185 -0.2077 -0.0450 -0.1383 229 GLY A CA  
1667 C C   . GLY A 212 ? 1.9944 1.5704 1.5458 -0.1997 -0.0561 -0.1338 229 GLY A C   
1668 O O   . GLY A 212 ? 2.0588 1.6621 1.6239 -0.2112 -0.0586 -0.1303 229 GLY A O   
1669 N N   . SER A 213 ? 1.9862 1.5496 1.5376 -0.1804 -0.0638 -0.1337 230 SER A N   
1670 C CA  . SER A 213 ? 1.9786 1.5609 1.5492 -0.1711 -0.0747 -0.1313 230 SER A CA  
1671 C C   . SER A 213 ? 1.9341 1.5173 1.5005 -0.1669 -0.0774 -0.1223 230 SER A C   
1672 O O   . SER A 213 ? 1.9841 1.5406 1.5287 -0.1615 -0.0739 -0.1196 230 SER A O   
1673 C CB  . SER A 213 ? 2.0042 1.5731 1.5816 -0.1530 -0.0839 -0.1376 230 SER A CB  
1674 O OG  . SER A 213 ? 2.0672 1.6425 1.6594 -0.1570 -0.0799 -0.1461 230 SER A OG  
1675 N N   . TYR A 214 ? 1.8658 1.4775 1.4524 -0.1697 -0.0821 -0.1179 231 TYR A N   
1676 C CA  . TYR A 214 ? 1.8133 1.4290 1.4022 -0.1646 -0.0844 -0.1099 231 TYR A CA  
1677 C C   . TYR A 214 ? 1.7384 1.3703 1.3459 -0.1546 -0.0955 -0.1110 231 TYR A C   
1678 O O   . TYR A 214 ? 1.6578 1.3083 1.2828 -0.1578 -0.0986 -0.1156 231 TYR A O   
1679 C CB  . TYR A 214 ? 1.7972 1.4354 1.3978 -0.1807 -0.0779 -0.1020 231 TYR A CB  
1680 C CG  . TYR A 214 ? 1.8211 1.4477 1.4097 -0.1928 -0.0671 -0.1008 231 TYR A CG  
1681 C CD1 . TYR A 214 ? 1.8282 1.4528 1.4105 -0.2037 -0.0641 -0.1067 231 TYR A CD1 
1682 C CD2 . TYR A 214 ? 1.8337 1.4511 1.4189 -0.1947 -0.0584 -0.0942 231 TYR A CD2 
1683 C CE1 . TYR A 214 ? 1.8590 1.4732 1.4311 -0.2158 -0.0546 -0.1059 231 TYR A CE1 
1684 C CE2 . TYR A 214 ? 1.8471 1.4546 1.4252 -0.2064 -0.0477 -0.0935 231 TYR A CE2 
1685 C CZ  . TYR A 214 ? 1.8770 1.4838 1.4486 -0.2170 -0.0468 -0.0994 231 TYR A CZ  
1686 O OH  . TYR A 214 ? 1.9196 1.5163 1.4848 -0.2293 -0.0365 -0.0992 231 TYR A OH  
1687 N N   . ARG A 215 ? 1.7489 1.3708 1.3511 -0.1431 -0.1002 -0.1073 232 ARG A N   
1688 C CA  . ARG A 215 ? 1.7126 1.3503 1.3330 -0.1349 -0.1102 -0.1076 232 ARG A CA  
1689 C C   . ARG A 215 ? 1.6252 1.2699 1.2480 -0.1353 -0.1071 -0.0988 232 ARG A C   
1690 O O   . ARG A 215 ? 1.6303 1.2512 1.2322 -0.1329 -0.1007 -0.0946 232 ARG A O   
1691 C CB  . ARG A 215 ? 1.7694 1.3839 1.3820 -0.1179 -0.1227 -0.1141 232 ARG A CB  
1692 C CG  . ARG A 215 ? 1.7984 1.4303 1.4342 -0.1102 -0.1339 -0.1165 232 ARG A CG  
1693 C CD  . ARG A 215 ? 1.8488 1.4585 1.4820 -0.0941 -0.1495 -0.1230 232 ARG A CD  
1694 N NE  . ARG A 215 ? 1.9196 1.4942 1.5196 -0.0847 -0.1554 -0.1192 232 ARG A NE  
1695 C CZ  . ARG A 215 ? 2.0275 1.5644 1.5961 -0.0789 -0.1577 -0.1196 232 ARG A CZ  
1696 N NH1 . ARG A 215 ? 2.0847 1.6148 1.6530 -0.0805 -0.1547 -0.1238 232 ARG A NH1 
1697 N NH2 . ARG A 215 ? 2.1236 1.6256 1.6574 -0.0716 -0.1621 -0.1157 232 ARG A NH2 
1698 N N   . CYS A 216 ? 1.5509 1.2263 1.1990 -0.1390 -0.1097 -0.0960 233 CYS A N   
1699 C CA  . CYS A 216 ? 1.5296 1.2127 1.1850 -0.1376 -0.1072 -0.0881 233 CYS A CA  
1700 C C   . CYS A 216 ? 1.5000 1.1792 1.1577 -0.1245 -0.1174 -0.0913 233 CYS A C   
1701 O O   . CYS A 216 ? 1.4614 1.1537 1.1346 -0.1215 -0.1259 -0.0975 233 CYS A O   
1702 C CB  . CYS A 216 ? 1.4882 1.2070 1.1707 -0.1504 -0.1041 -0.0813 233 CYS A CB  
1703 S SG  . CYS A 216 ? 1.4189 1.1491 1.1170 -0.1465 -0.1016 -0.0723 233 CYS A SG  
1704 N N   . GLU A 217 ? 1.5057 1.1652 1.1484 -0.1176 -0.1153 -0.0874 234 GLU A N   
1705 C CA  . GLU A 217 ? 1.5314 1.1847 1.1734 -0.1066 -0.1247 -0.0895 234 GLU A CA  
1706 C C   . GLU A 217 ? 1.5026 1.1630 1.1512 -0.1088 -0.1155 -0.0812 234 GLU A C   
1707 O O   . GLU A 217 ? 1.4891 1.1294 1.1207 -0.1107 -0.1032 -0.0759 234 GLU A O   
1708 C CB  . GLU A 217 ? 1.6201 1.2302 1.2273 -0.0946 -0.1333 -0.0942 234 GLU A CB  
1709 C CG  . GLU A 217 ? 1.6734 1.2782 1.2827 -0.0889 -0.1465 -0.1030 234 GLU A CG  
1710 C CD  . GLU A 217 ? 1.7487 1.3097 1.3249 -0.0761 -0.1595 -0.1066 234 GLU A CD  
1711 O OE1 . GLU A 217 ? 1.7851 1.3239 1.3406 -0.0700 -0.1640 -0.1046 234 GLU A OE1 
1712 O OE2 . GLU A 217 ? 1.7763 1.3229 1.3455 -0.0726 -0.1657 -0.1114 234 GLU A OE2 
1713 N N   . LEU A 218 ? 1.4872 1.1749 1.1618 -0.1088 -0.1195 -0.0804 235 LEU A N   
1714 C CA  . LEU A 218 ? 1.4345 1.1294 1.1187 -0.1097 -0.1113 -0.0728 235 LEU A CA  
1715 C C   . LEU A 218 ? 1.4288 1.1000 1.0954 -0.0983 -0.1188 -0.0770 235 LEU A C   
1716 O O   . LEU A 218 ? 1.4160 1.0956 1.0927 -0.0928 -0.1323 -0.0836 235 LEU A O   
1717 C CB  . LEU A 218 ? 1.3838 1.1199 1.1045 -0.1166 -0.1116 -0.0688 235 LEU A CB  
1718 C CG  . LEU A 218 ? 1.3693 1.1153 1.1052 -0.1168 -0.1035 -0.0605 235 LEU A CG  
1719 C CD1 . LEU A 218 ? 1.4003 1.1313 1.1296 -0.1202 -0.0876 -0.0526 235 LEU A CD1 
1720 C CD2 . LEU A 218 ? 1.3413 1.1267 1.1111 -0.1248 -0.1054 -0.0557 235 LEU A CD2 
1721 N N   . GLY A 219 ? 1.4747 1.1144 1.1152 -0.0956 -0.1093 -0.0734 236 GLY A N   
1722 C CA  . GLY A 219 ? 1.5016 1.1070 1.1128 -0.0857 -0.1166 -0.0774 236 GLY A CA  
1723 C C   . GLY A 219 ? 1.4872 1.1070 1.1157 -0.0844 -0.1150 -0.0751 236 GLY A C   
1724 O O   . GLY A 219 ? 1.4649 1.1143 1.1232 -0.0910 -0.1033 -0.0681 236 GLY A O   
1725 N N   . SER A 220 ? 1.5766 1.1725 1.1849 -0.0759 -0.1279 -0.0810 237 SER A N   
1726 C CA  . SER A 220 ? 1.5991 1.2051 1.2209 -0.0734 -0.1303 -0.0814 237 SER A CA  
1727 C C   . SER A 220 ? 1.6525 1.2089 1.2295 -0.0683 -0.1294 -0.0825 237 SER A C   
1728 O O   . SER A 220 ? 1.6374 1.1519 1.1727 -0.0643 -0.1363 -0.0857 237 SER A O   
1729 C CB  . SER A 220 ? 1.6142 1.2406 1.2584 -0.0687 -0.1515 -0.0900 237 SER A CB  
1730 O OG  . SER A 220 ? 1.6438 1.2802 1.3025 -0.0665 -0.1547 -0.0915 237 SER A OG  
1731 N N   . VAL A 221 ? 1.6843 1.2419 1.2666 -0.0687 -0.1209 -0.0798 238 VAL A N   
1732 C CA  . VAL A 221 ? 1.7661 1.2747 1.3036 -0.0644 -0.1225 -0.0826 238 VAL A CA  
1733 C C   . VAL A 221 ? 1.8143 1.3012 1.3308 -0.0565 -0.1521 -0.0924 238 VAL A C   
1734 O O   . VAL A 221 ? 1.8809 1.3153 1.3463 -0.0530 -0.1591 -0.0952 238 VAL A O   
1735 C CB  . VAL A 221 ? 1.7774 1.2931 1.3279 -0.0662 -0.1090 -0.0792 238 VAL A CB  
1736 C CG1 . VAL A 221 ? 1.7982 1.3213 1.3624 -0.0729 -0.0788 -0.0690 238 VAL A CG1 
1737 C CG2 . VAL A 221 ? 1.7096 1.2714 1.3063 -0.0652 -0.1210 -0.0820 238 VAL A CG2 
1738 N N   . ASN A 222 ? 1.8048 1.3301 1.3611 -0.0542 -0.1693 -0.0976 239 ASN A N   
1739 C CA  . ASN A 222 ? 1.8013 1.3142 1.3523 -0.0466 -0.1987 -0.1070 239 ASN A CA  
1740 C C   . ASN A 222 ? 1.7866 1.2719 1.3097 -0.0432 -0.2088 -0.1086 239 ASN A C   
1741 O O   . ASN A 222 ? 1.7979 1.2651 1.2959 -0.0467 -0.1925 -0.1030 239 ASN A O   
1742 C CB  . ASN A 222 ? 1.7725 1.3368 1.3817 -0.0460 -0.2089 -0.1124 239 ASN A CB  
1743 C CG  . ASN A 222 ? 1.7076 1.2943 1.3421 -0.0480 -0.2033 -0.1123 239 ASN A CG  
1744 O OD1 . ASN A 222 ? 1.5705 1.1963 1.2497 -0.0487 -0.2069 -0.1160 239 ASN A OD1 
1745 N ND2 . ASN A 222 ? 1.7514 1.3108 1.3564 -0.0491 -0.1932 -0.1087 239 ASN A ND2 
1746 N N   . SER A 223 ? 1.7961 1.2768 1.3250 -0.0361 -0.2357 -0.1164 240 SER A N   
1747 C CA  . SER A 223 ? 1.8083 1.2596 1.3111 -0.0313 -0.2491 -0.1182 240 SER A CA  
1748 C C   . SER A 223 ? 1.7438 1.2291 1.2773 -0.0352 -0.2372 -0.1165 240 SER A C   
1749 O O   . SER A 223 ? 1.7572 1.2283 1.2671 -0.0393 -0.2210 -0.1110 240 SER A O   
1750 C CB  . SER A 223 ? 1.7866 1.2244 1.2938 -0.0221 -0.2834 -0.1267 240 SER A CB  
1751 O OG  . SER A 223 ? 1.8996 1.2884 1.3604 -0.0166 -0.2983 -0.1267 240 SER A OG  
1752 N N   . SER A 224 ? 1.6658 1.1959 1.2521 -0.0353 -0.2424 -0.1213 241 SER A N   
1753 C CA  . SER A 224 ? 1.6150 1.1736 1.2281 -0.0395 -0.2333 -0.1212 241 SER A CA  
1754 C C   . SER A 224 ? 1.5235 1.1179 1.1569 -0.0508 -0.2070 -0.1141 241 SER A C   
1755 O O   . SER A 224 ? 1.4575 1.0594 1.0914 -0.0548 -0.1951 -0.1089 241 SER A O   
1756 C CB  . SER A 224 ? 1.5949 1.1781 1.2521 -0.0347 -0.2501 -0.1304 241 SER A CB  
1757 O OG  . SER A 224 ? 1.4916 1.0873 1.1689 -0.0328 -0.2577 -0.1338 241 SER A OG  
1758 N N   . PRO A 225 ? 1.4528 1.0668 1.1021 -0.0563 -0.1989 -0.1138 242 PRO A N   
1759 C CA  . PRO A 225 ? 1.3924 1.0338 1.0551 -0.0677 -0.1779 -0.1064 242 PRO A CA  
1760 C C   . PRO A 225 ? 1.3256 1.0106 1.0305 -0.0732 -0.1740 -0.1068 242 PRO A C   
1761 O O   . PRO A 225 ? 1.3266 1.0253 1.0562 -0.0698 -0.1843 -0.1146 242 PRO A O   
1762 C CB  . PRO A 225 ? 1.4075 1.0462 1.0648 -0.0715 -0.1740 -0.1071 242 PRO A CB  
1763 C CG  . PRO A 225 ? 1.4436 1.0581 1.0911 -0.0615 -0.1920 -0.1151 242 PRO A CG  
1764 C CD  . PRO A 225 ? 1.4628 1.0735 1.1191 -0.0527 -0.2091 -0.1202 242 PRO A CD  
1765 N N   . ALA A 226 ? 1.2900 0.9949 1.0037 -0.0822 -0.1585 -0.0982 243 ALA A N   
1766 C CA  . ALA A 226 ? 1.2330 0.9753 0.9807 -0.0885 -0.1536 -0.0962 243 ALA A CA  
1767 C C   . ALA A 226 ? 1.1968 0.9620 0.9614 -0.0975 -0.1498 -0.0972 243 ALA A C   
1768 O O   . ALA A 226 ? 1.2037 0.9928 0.9930 -0.1011 -0.1498 -0.0999 243 ALA A O   
1769 C CB  . ALA A 226 ? 1.2095 0.9598 0.9593 -0.0933 -0.1406 -0.0853 243 ALA A CB  
1770 N N   . THR A 227 ? 1.2013 0.9559 0.9498 -0.1018 -0.1455 -0.0953 244 THR A N   
1771 C CA  . THR A 227 ? 1.1838 0.9545 0.9415 -0.1119 -0.1411 -0.0962 244 THR A CA  
1772 C C   . THR A 227 ? 1.2225 0.9699 0.9586 -0.1107 -0.1418 -0.0998 244 THR A C   
1773 O O   . THR A 227 ? 1.1844 0.9100 0.8974 -0.1088 -0.1385 -0.0956 244 THR A O   
1774 C CB  . THR A 227 ? 1.1652 0.9556 0.9300 -0.1242 -0.1312 -0.0853 244 THR A CB  
1775 O OG1 . THR A 227 ? 1.1272 0.9402 0.9133 -0.1260 -0.1308 -0.0817 244 THR A OG1 
1776 C CG2 . THR A 227 ? 1.1667 0.9661 0.9315 -0.1362 -0.1278 -0.0855 244 THR A CG2 
1777 N N   . ILE A 228 ? 1.3002 1.0501 1.0437 -0.1119 -0.1444 -0.1078 245 ILE A N   
1778 C CA  . ILE A 228 ? 1.3861 1.1167 1.1120 -0.1126 -0.1431 -0.1110 245 ILE A CA  
1779 C C   . ILE A 228 ? 1.3667 1.1143 1.1009 -0.1263 -0.1347 -0.1119 245 ILE A C   
1780 O O   . ILE A 228 ? 1.4406 1.2037 1.1940 -0.1291 -0.1343 -0.1171 245 ILE A O   
1781 C CB  . ILE A 228 ? 1.4546 1.1665 1.1814 -0.1002 -0.1545 -0.1209 245 ILE A CB  
1782 C CG1 . ILE A 228 ? 1.5167 1.2045 1.2268 -0.0875 -0.1658 -0.1198 245 ILE A CG1 
1783 C CG2 . ILE A 228 ? 1.5080 1.2019 1.2201 -0.1018 -0.1517 -0.1245 245 ILE A CG2 
1784 C CD1 . ILE A 228 ? 1.5500 1.2278 1.2729 -0.0748 -0.1826 -0.1289 245 ILE A CD1 
1785 N N   . ILE A 229 ? 1.3308 1.0734 1.0494 -0.1356 -0.1275 -0.1072 246 ILE A N   
1786 C CA  . ILE A 229 ? 1.3009 1.0542 1.0209 -0.1503 -0.1207 -0.1083 246 ILE A CA  
1787 C C   . ILE A 229 ? 1.2945 1.0250 0.9943 -0.1512 -0.1171 -0.1117 246 ILE A C   
1788 O O   . ILE A 229 ? 1.2270 0.9414 0.9105 -0.1480 -0.1159 -0.1071 246 ILE A O   
1789 C CB  . ILE A 229 ? 1.2903 1.0634 1.0140 -0.1642 -0.1167 -0.0976 246 ILE A CB  
1790 C CG1 . ILE A 229 ? 1.2553 1.0506 0.9988 -0.1638 -0.1197 -0.0934 246 ILE A CG1 
1791 C CG2 . ILE A 229 ? 1.2694 1.0473 0.9871 -0.1806 -0.1121 -0.0985 246 ILE A CG2 
1792 C CD1 . ILE A 229 ? 1.2334 1.0459 0.9842 -0.1735 -0.1184 -0.0809 246 ILE A CD1 
1793 N N   . ASN A 230 ? 1.3922 1.1186 1.0925 -0.1553 -0.1138 -0.1199 247 ASN A N   
1794 C CA  . ASN A 230 ? 1.5122 1.2175 1.1933 -0.1585 -0.1084 -0.1231 247 ASN A CA  
1795 C C   . ASN A 230 ? 1.5074 1.2217 1.1810 -0.1782 -0.1001 -0.1205 247 ASN A C   
1796 O O   . ASN A 230 ? 1.4797 1.2109 1.1621 -0.1884 -0.0985 -0.1209 247 ASN A O   
1797 C CB  . ASN A 230 ? 1.5406 1.2302 1.2268 -0.1492 -0.1096 -0.1343 247 ASN A CB  
1798 C CG  . ASN A 230 ? 1.5718 1.2421 1.2560 -0.1303 -0.1211 -0.1356 247 ASN A CG  
1799 O OD1 . ASN A 230 ? 1.6221 1.3000 1.3222 -0.1208 -0.1303 -0.1364 247 ASN A OD1 
1800 N ND2 . ASN A 230 ? 1.6005 1.2435 1.2625 -0.1254 -0.1213 -0.1357 247 ASN A ND2 
1801 N N   . PHE A 231 ? 1.5031 1.2042 1.1589 -0.1839 -0.0955 -0.1175 248 PHE A N   
1802 C CA  . PHE A 231 ? 1.5531 1.2593 1.2001 -0.2031 -0.0898 -0.1152 248 PHE A CA  
1803 C C   . PHE A 231 ? 1.6243 1.3058 1.2531 -0.2049 -0.0824 -0.1228 248 PHE A C   
1804 O O   . PHE A 231 ? 1.6583 1.3188 1.2764 -0.1940 -0.0816 -0.1236 248 PHE A O   
1805 C CB  . PHE A 231 ? 1.5429 1.2565 1.1899 -0.2099 -0.0898 -0.1044 248 PHE A CB  
1806 C CG  . PHE A 231 ? 1.4549 1.1902 1.1212 -0.2069 -0.0956 -0.0955 248 PHE A CG  
1807 C CD1 . PHE A 231 ? 1.4244 1.1831 1.1032 -0.2209 -0.0992 -0.0880 248 PHE A CD1 
1808 C CD2 . PHE A 231 ? 1.4101 1.1396 1.0802 -0.1908 -0.0976 -0.0937 248 PHE A CD2 
1809 C CE1 . PHE A 231 ? 1.3656 1.1436 1.0642 -0.2180 -0.1038 -0.0791 248 PHE A CE1 
1810 C CE2 . PHE A 231 ? 1.3879 1.1355 1.0754 -0.1887 -0.1007 -0.0856 248 PHE A CE2 
1811 C CZ  . PHE A 231 ? 1.3465 1.1195 1.0503 -0.2019 -0.1033 -0.0782 248 PHE A CZ  
1812 N N   . HIS A 232 ? 1.6820 1.3625 1.3041 -0.2188 -0.0764 -0.1283 249 HIS A N   
1813 C CA  . HIS A 232 ? 1.7153 1.3724 1.3187 -0.2240 -0.0674 -0.1347 249 HIS A CA  
1814 C C   . HIS A 232 ? 1.6739 1.3340 1.2636 -0.2450 -0.0644 -0.1304 249 HIS A C   
1815 O O   . HIS A 232 ? 1.6706 1.3434 1.2593 -0.2604 -0.0659 -0.1292 249 HIS A O   
1816 C CB  . HIS A 232 ? 1.7480 1.3946 1.3534 -0.2226 -0.0604 -0.1461 249 HIS A CB  
1817 C CG  . HIS A 232 ? 1.8090 1.4523 1.4331 -0.2018 -0.0653 -0.1506 249 HIS A CG  
1818 N ND1 . HIS A 232 ? 1.8536 1.4783 1.4747 -0.1854 -0.0698 -0.1509 249 HIS A ND1 
1819 C CD2 . HIS A 232 ? 1.8229 1.4785 1.4694 -0.1950 -0.0681 -0.1544 249 HIS A CD2 
1820 C CE1 . HIS A 232 ? 1.8692 1.4953 1.5108 -0.1695 -0.0773 -0.1546 249 HIS A CE1 
1821 N NE2 . HIS A 232 ? 1.8344 1.4804 1.4941 -0.1750 -0.0756 -0.1572 249 HIS A NE2 
1822 N N   . VAL A 233 ? 1.6580 1.3045 1.2366 -0.2458 -0.0607 -0.1281 250 VAL A N   
1823 C CA  . VAL A 233 ? 1.7181 1.3684 1.2891 -0.2650 -0.0593 -0.1236 250 VAL A CA  
1824 C C   . VAL A 233 ? 1.7732 1.4005 1.3221 -0.2756 -0.0492 -0.1318 250 VAL A C   
1825 O O   . VAL A 233 ? 1.7625 1.3665 1.3011 -0.2653 -0.0418 -0.1367 250 VAL A O   
1826 C CB  . VAL A 233 ? 1.7235 1.3756 1.3013 -0.2612 -0.0598 -0.1150 250 VAL A CB  
1827 C CG1 . VAL A 233 ? 1.7311 1.3868 1.3069 -0.2812 -0.0582 -0.1111 250 VAL A CG1 
1828 C CG2 . VAL A 233 ? 1.7039 1.3789 1.3040 -0.2533 -0.0683 -0.1066 250 VAL A CG2 
1829 N N   . THR A 234 ? 1.8189 1.4506 1.3583 -0.2963 -0.0496 -0.1331 251 THR A N   
1830 C CA  . THR A 234 ? 1.8894 1.5007 1.4055 -0.3121 -0.0406 -0.1397 251 THR A CA  
1831 C C   . THR A 234 ? 1.9132 1.5335 1.4300 -0.3290 -0.0462 -0.1321 251 THR A C   
1832 O O   . THR A 234 ? 1.9350 1.5780 1.4643 -0.3380 -0.0584 -0.1241 251 THR A O   
1833 C CB  . THR A 234 ? 1.9438 1.5508 1.4449 -0.3269 -0.0380 -0.1462 251 THR A CB  
1834 O OG1 . THR A 234 ? 1.9450 1.5482 1.4540 -0.3120 -0.0327 -0.1529 251 THR A OG1 
1835 C CG2 . THR A 234 ? 2.0223 1.6042 1.4955 -0.3443 -0.0274 -0.1540 251 THR A CG2 
1836 N N   . VAL A 235 ? 1.9633 1.5661 1.4693 -0.3335 -0.0379 -0.1344 252 VAL A N   
1837 C CA  . VAL A 235 ? 1.9799 1.5908 1.4909 -0.3513 -0.0425 -0.1284 252 VAL A CA  
1838 C C   . VAL A 235 ? 1.9832 1.5792 1.4690 -0.3744 -0.0400 -0.1351 252 VAL A C   
1839 O O   . VAL A 235 ? 1.9738 1.5433 1.4387 -0.3743 -0.0263 -0.1440 252 VAL A O   
1840 C CB  . VAL A 235 ? 2.0243 1.6248 1.5415 -0.3430 -0.0336 -0.1261 252 VAL A CB  
1841 C CG1 . VAL A 235 ? 2.0261 1.6396 1.5587 -0.3610 -0.0384 -0.1196 252 VAL A CG1 
1842 C CG2 . VAL A 235 ? 2.0311 1.6376 1.5644 -0.3200 -0.0341 -0.1209 252 VAL A CG2 
1843 N N   . LEU A 236 ? 1.9956 1.6064 1.4819 -0.3944 -0.0539 -0.1304 253 LEU A N   
1844 C CA  . LEU A 236 ? 2.0541 1.6481 1.5108 -0.4191 -0.0544 -0.1364 253 LEU A CA  
1845 C C   . LEU A 236 ? 2.0681 1.6558 1.5253 -0.4335 -0.0533 -0.1360 253 LEU A C   
1846 O O   . LEU A 236 ? 2.0833 1.6924 1.5649 -0.4425 -0.0672 -0.1267 253 LEU A O   
1847 C CB  . LEU A 236 ? 2.0553 1.6634 1.5074 -0.4357 -0.0727 -0.1307 253 LEU A CB  
1848 C CG  . LEU A 236 ? 2.0649 1.6752 1.5106 -0.4270 -0.0726 -0.1323 253 LEU A CG  
1849 C CD1 . LEU A 236 ? 2.0563 1.6783 1.4956 -0.4447 -0.0924 -0.1247 253 LEU A CD1 
1850 C CD2 . LEU A 236 ? 2.0832 1.6625 1.4987 -0.4259 -0.0532 -0.1462 253 LEU A CD2 
1851 N N   . PRO A 237 ? 2.0675 1.6258 1.5006 -0.4362 -0.0364 -0.1462 254 PRO A N   
1852 C CA  . PRO A 237 ? 2.0081 1.5590 1.4432 -0.4489 -0.0330 -0.1465 254 PRO A CA  
1853 C C   . PRO A 237 ? 1.9109 1.4635 1.3351 -0.4789 -0.0475 -0.1457 254 PRO A C   
1854 O O   . PRO A 237 ? 1.7832 1.3365 1.1900 -0.4899 -0.0585 -0.1457 254 PRO A O   
1855 C CB  . PRO A 237 ? 2.0348 1.5516 1.4442 -0.4419 -0.0108 -0.1578 254 PRO A CB  
1856 C CG  . PRO A 237 ? 2.0569 1.5606 1.4444 -0.4373 -0.0052 -0.1652 254 PRO A CG  
1857 C CD  . PRO A 237 ? 2.0483 1.5785 1.4533 -0.4299 -0.0197 -0.1579 254 PRO A CD  
1858 N N   . PRO B 3   ? 1.3507 2.0479 1.5198 0.3409  -0.1294 -0.1873 18  PRO B N   
1859 C CA  . PRO B 3   ? 1.3891 2.0732 1.5350 0.3401  -0.1312 -0.1793 18  PRO B CA  
1860 C C   . PRO B 3   ? 1.4071 2.0596 1.5426 0.3244  -0.1203 -0.1743 18  PRO B C   
1861 O O   . PRO B 3   ? 1.3517 2.0078 1.4792 0.3100  -0.1203 -0.1803 18  PRO B O   
1862 C CB  . PRO B 3   ? 1.3881 2.0591 1.5246 0.3635  -0.1345 -0.1641 18  PRO B CB  
1863 C CG  . PRO B 3   ? 1.3728 2.0368 1.5290 0.3729  -0.1331 -0.1639 18  PRO B CG  
1864 C CD  . PRO B 3   ? 1.3495 2.0258 1.5224 0.3586  -0.1286 -0.1791 18  PRO B CD  
1865 N N   . TRP B 4   ? 1.4064 2.0280 1.5448 0.3279  -0.1128 -0.1638 19  TRP B N   
1866 C CA  . TRP B 4   ? 1.3395 1.9318 1.4760 0.3136  -0.1028 -0.1592 19  TRP B CA  
1867 C C   . TRP B 4   ? 1.3372 1.9288 1.4924 0.3068  -0.1004 -0.1693 19  TRP B C   
1868 O O   . TRP B 4   ? 1.4461 2.0354 1.6123 0.3204  -0.1038 -0.1698 19  TRP B O   
1869 C CB  . TRP B 4   ? 1.2996 1.8586 1.4312 0.3238  -0.0979 -0.1386 19  TRP B CB  
1870 C CG  . TRP B 4   ? 1.2745 1.8376 1.3887 0.3401  -0.1005 -0.1249 19  TRP B CG  
1871 C CD1 . TRP B 4   ? 1.3063 1.8713 1.4228 0.3601  -0.1060 -0.1144 19  TRP B CD1 
1872 C CD2 . TRP B 4   ? 1.2645 1.8300 1.3538 0.3399  -0.0979 -0.1200 19  TRP B CD2 
1873 N NE1 . TRP B 4   ? 1.3158 1.8859 1.4094 0.3726  -0.1064 -0.1015 19  TRP B NE1 
1874 C CE2 . TRP B 4   ? 1.2774 1.8478 1.3524 0.3614  -0.1014 -0.1054 19  TRP B CE2 
1875 C CE3 . TRP B 4   ? 1.2398 1.8029 1.3165 0.3252  -0.0933 -0.1265 19  TRP B CE3 
1876 C CZ2 . TRP B 4   ? 1.2801 1.8549 1.3253 0.3703  -0.1002 -0.0980 19  TRP B CZ2 
1877 C CZ3 . TRP B 4   ? 1.2430 1.8087 1.2919 0.3337  -0.0929 -0.1209 19  TRP B CZ3 
1878 C CH2 . TRP B 4   ? 1.2650 1.8371 1.2966 0.3569  -0.0961 -0.1069 19  TRP B CH2 
1879 N N   . GLY B 5   ? 1.2201 1.8129 1.3778 0.2880  -0.0950 -0.1773 20  GLY B N   
1880 C CA  . GLY B 5   ? 1.1686 1.7652 1.3398 0.2833  -0.0924 -0.1870 20  GLY B CA  
1881 C C   . GLY B 5   ? 1.1795 1.7390 1.3538 0.2842  -0.0892 -0.1822 20  GLY B C   
1882 O O   . GLY B 5   ? 1.1766 1.7262 1.3519 0.2702  -0.0841 -0.1856 20  GLY B O   
1883 N N   . ASP B 6   ? 1.1883 1.7271 1.3669 0.3002  -0.0938 -0.1742 21  ASP B N   
1884 C CA  . ASP B 6   ? 1.1717 1.6724 1.3591 0.3008  -0.0942 -0.1696 21  ASP B CA  
1885 C C   . ASP B 6   ? 1.1683 1.6709 1.3622 0.3013  -0.0964 -0.1861 21  ASP B C   
1886 O O   . ASP B 6   ? 1.1076 1.5838 1.3057 0.2954  -0.0968 -0.1875 21  ASP B O   
1887 C CB  . ASP B 6   ? 1.1847 1.6634 1.3808 0.3180  -0.1004 -0.1562 21  ASP B CB  
1888 C CG  . ASP B 6   ? 1.2019 1.6779 1.3886 0.3195  -0.0963 -0.1366 21  ASP B CG  
1889 O OD1 . ASP B 6   ? 1.2560 1.7578 1.4270 0.3151  -0.0934 -0.1394 21  ASP B OD1 
1890 O OD2 . ASP B 6   ? 1.1589 1.6077 1.3548 0.3260  -0.0966 -0.1181 21  ASP B OD2 
1891 N N   . GLU B 7   ? 1.2168 1.7533 1.4110 0.3096  -0.0979 -0.1984 22  GLU B N   
1892 C CA  . GLU B 7   ? 1.2063 1.7597 1.4015 0.3104  -0.0962 -0.2140 22  GLU B CA  
1893 C C   . GLU B 7   ? 1.1561 1.7060 1.3459 0.2889  -0.0882 -0.2144 22  GLU B C   
1894 O O   . GLU B 7   ? 1.1027 1.6457 1.2908 0.2886  -0.0876 -0.2227 22  GLU B O   
1895 C CB  . GLU B 7   ? 1.2061 1.8084 1.4043 0.3166  -0.0944 -0.2213 22  GLU B CB  
1896 C CG  . GLU B 7   ? 1.2858 1.8996 1.4903 0.3390  -0.1022 -0.2221 22  GLU B CG  
1897 C CD  . GLU B 7   ? 1.3314 1.9865 1.5399 0.3385  -0.1022 -0.2201 22  GLU B CD  
1898 O OE1 . GLU B 7   ? 1.3232 1.9824 1.5271 0.3229  -0.1004 -0.2133 22  GLU B OE1 
1899 O OE2 . GLU B 7   ? 1.3723 2.0554 1.5895 0.3552  -0.1056 -0.2262 22  GLU B OE2 
1900 N N   . LEU B 8   ? 1.1083 1.6635 1.2941 0.2726  -0.0831 -0.2060 23  LEU B N   
1901 C CA  . LEU B 8   ? 1.1088 1.6628 1.2911 0.2520  -0.0759 -0.2054 23  LEU B CA  
1902 C C   . LEU B 8   ? 1.1377 1.6522 1.3170 0.2420  -0.0743 -0.1957 23  LEU B C   
1903 O O   . LEU B 8   ? 1.1313 1.6437 1.3074 0.2248  -0.0685 -0.1938 23  LEU B O   
1904 C CB  . LEU B 8   ? 1.0882 1.6727 1.2704 0.2398  -0.0729 -0.2043 23  LEU B CB  
1905 C CG  . LEU B 8   ? 1.0571 1.6861 1.2491 0.2403  -0.0715 -0.2122 23  LEU B CG  
1906 C CD1 . LEU B 8   ? 1.0377 1.6916 1.2356 0.2258  -0.0720 -0.2108 23  LEU B CD1 
1907 C CD2 . LEU B 8   ? 1.0317 1.6654 1.2252 0.2362  -0.0651 -0.2170 23  LEU B CD2 
1908 N N   . LEU B 9   ? 1.1325 1.6164 1.3163 0.2522  -0.0794 -0.1884 24  LEU B N   
1909 C CA  . LEU B 9   ? 1.1361 1.5857 1.3225 0.2430  -0.0770 -0.1761 24  LEU B CA  
1910 C C   . LEU B 9   ? 1.1276 1.5473 1.3249 0.2459  -0.0835 -0.1789 24  LEU B C   
1911 O O   . LEU B 9   ? 1.1455 1.5602 1.3491 0.2610  -0.0924 -0.1864 24  LEU B O   
1912 C CB  . LEU B 9   ? 1.1615 1.5980 1.3494 0.2506  -0.0769 -0.1590 24  LEU B CB  
1913 C CG  . LEU B 9   ? 1.2043 1.6615 1.3784 0.2509  -0.0726 -0.1529 24  LEU B CG  
1914 C CD1 . LEU B 9   ? 1.2207 1.6566 1.3957 0.2582  -0.0699 -0.1318 24  LEU B CD1 
1915 C CD2 . LEU B 9   ? 1.1745 1.6459 1.3378 0.2339  -0.0664 -0.1581 24  LEU B CD2 
1916 N N   . ASN B 10  ? 1.1593 1.5570 1.3601 0.2325  -0.0806 -0.1729 25  ASN B N   
1917 C CA  . ASN B 10  ? 1.1819 1.5456 1.3978 0.2347  -0.0894 -0.1724 25  ASN B CA  
1918 C C   . ASN B 10  ? 1.1948 1.5597 1.4084 0.2442  -0.0991 -0.1925 25  ASN B C   
1919 O O   . ASN B 10  ? 1.2252 1.5674 1.4509 0.2567  -0.1119 -0.1972 25  ASN B O   
1920 C CB  . ASN B 10  ? 1.1676 1.5083 1.4011 0.2453  -0.0950 -0.1574 25  ASN B CB  
1921 C CG  . ASN B 10  ? 1.1824 1.4855 1.4388 0.2410  -0.1025 -0.1496 25  ASN B CG  
1922 O OD1 . ASN B 10  ? 1.2096 1.5013 1.4736 0.2294  -0.0951 -0.1333 25  ASN B OD1 
1923 N ND2 . ASN B 10  ? 1.1776 1.4621 1.4456 0.2506  -0.1179 -0.1625 25  ASN B ND2 
1924 N N   . ILE B 11  ? 1.1899 1.5819 1.3884 0.2389  -0.0930 -0.2036 26  ILE B N   
1925 C CA  . ILE B 11  ? 1.1887 1.5918 1.3786 0.2502  -0.0984 -0.2219 26  ILE B CA  
1926 C C   . ILE B 11  ? 1.1955 1.6029 1.3760 0.2367  -0.0931 -0.2253 26  ILE B C   
1927 O O   . ILE B 11  ? 1.2744 1.6840 1.4549 0.2183  -0.0839 -0.2147 26  ILE B O   
1928 C CB  . ILE B 11  ? 1.1730 1.6171 1.3548 0.2606  -0.0933 -0.2286 26  ILE B CB  
1929 C CG1 . ILE B 11  ? 1.1580 1.6351 1.3340 0.2436  -0.0797 -0.2226 26  ILE B CG1 
1930 C CG2 . ILE B 11  ? 1.2092 1.6500 1.3999 0.2735  -0.0984 -0.2234 26  ILE B CG2 
1931 C CD1 . ILE B 11  ? 1.1324 1.6524 1.3074 0.2509  -0.0752 -0.2264 26  ILE B CD1 
1932 N N   . CYS B 12  ? 1.1659 1.5752 1.3368 0.2471  -0.0990 -0.2401 27  CYS B N   
1933 C CA  . CYS B 12  ? 1.1281 1.5451 1.2874 0.2369  -0.0938 -0.2426 27  CYS B CA  
1934 C C   . CYS B 12  ? 1.1170 1.5773 1.2612 0.2457  -0.0852 -0.2505 27  CYS B C   
1935 O O   . CYS B 12  ? 1.2111 1.6840 1.3507 0.2663  -0.0895 -0.2615 27  CYS B O   
1936 C CB  . CYS B 12  ? 1.1565 1.5388 1.3160 0.2430  -0.1087 -0.2518 27  CYS B CB  
1937 S SG  . CYS B 12  ? 1.1540 1.4869 1.3404 0.2333  -0.1195 -0.2396 27  CYS B SG  
1938 N N   . MET B 13  ? 1.1049 1.5889 1.2437 0.2308  -0.0729 -0.2437 28  MET B N   
1939 C CA  . MET B 13  ? 1.1312 1.6607 1.2605 0.2379  -0.0625 -0.2464 28  MET B CA  
1940 C C   . MET B 13  ? 1.1602 1.6888 1.2706 0.2593  -0.0688 -0.2610 28  MET B C   
1941 O O   . MET B 13  ? 1.1517 1.6454 1.2566 0.2605  -0.0801 -0.2670 28  MET B O   
1942 C CB  . MET B 13  ? 1.1216 1.6732 1.2544 0.2152  -0.0489 -0.2328 28  MET B CB  
1943 C CG  . MET B 13  ? 1.1325 1.6697 1.2552 0.2072  -0.0486 -0.2309 28  MET B CG  
1944 S SD  . MET B 13  ? 1.0675 1.6201 1.1984 0.1789  -0.0353 -0.2134 28  MET B SD  
1945 C CE  . MET B 13  ? 1.0388 1.5592 1.1855 0.1598  -0.0388 -0.2065 28  MET B CE  
1946 N N   . ASN B 14  ? 1.2307 1.7981 1.3317 0.2774  -0.0622 -0.2669 29  ASN B N   
1947 C CA  . ASN B 14  ? 1.3276 1.9022 1.4049 0.3012  -0.0657 -0.2810 29  ASN B CA  
1948 C C   . ASN B 14  ? 1.3293 1.9296 1.3949 0.2929  -0.0526 -0.2714 29  ASN B C   
1949 O O   . ASN B 14  ? 1.3707 2.0180 1.4326 0.2999  -0.0379 -0.2655 29  ASN B O   
1950 C CB  . ASN B 14  ? 1.4111 2.0185 1.4820 0.3288  -0.0632 -0.2913 29  ASN B CB  
1951 C CG  . ASN B 14  ? 1.4921 2.0712 1.5710 0.3436  -0.0790 -0.3039 29  ASN B CG  
1952 O OD1 . ASN B 14  ? 1.5633 2.1020 1.6562 0.3312  -0.0899 -0.3012 29  ASN B OD1 
1953 N ND2 . ASN B 14  ? 1.5222 2.1231 1.5931 0.3718  -0.0801 -0.3166 29  ASN B ND2 
1954 N N   . ALA B 15  ? 1.3112 1.8825 1.3740 0.2777  -0.0572 -0.2675 30  ALA B N   
1955 C CA  . ALA B 15  ? 1.3204 1.9088 1.3676 0.2748  -0.0486 -0.2607 30  ALA B CA  
1956 C C   . ALA B 15  ? 1.4250 1.9776 1.4513 0.2902  -0.0666 -0.2775 30  ALA B C   
1957 O O   . ALA B 15  ? 1.4443 1.9592 1.4749 0.2984  -0.0848 -0.2917 30  ALA B O   
1958 C CB  . ALA B 15  ? 1.3048 1.8912 1.3688 0.2427  -0.0394 -0.2409 30  ALA B CB  
1959 N N   . LYS B 16  ? 1.5264 2.0909 1.5314 0.2949  -0.0626 -0.2753 31  LYS B N   
1960 C CA  . LYS B 16  ? 1.6690 2.2100 1.6469 0.3186  -0.0805 -0.2956 31  LYS B CA  
1961 C C   . LYS B 16  ? 1.6317 2.1146 1.6204 0.3102  -0.1040 -0.3053 31  LYS B C   
1962 O O   . LYS B 16  ? 1.7005 2.1574 1.6761 0.3324  -0.1250 -0.3274 31  LYS B O   
1963 C CB  . LYS B 16  ? 1.8107 2.3795 1.7602 0.3271  -0.0709 -0.2896 31  LYS B CB  
1964 C CG  . LYS B 16  ? 1.8514 2.4180 1.8117 0.2975  -0.0618 -0.2677 31  LYS B CG  
1965 C CD  . LYS B 16  ? 1.9081 2.5052 1.8397 0.3086  -0.0515 -0.2595 31  LYS B CD  
1966 C CE  . LYS B 16  ? 1.8885 2.5230 1.8383 0.2846  -0.0269 -0.2292 31  LYS B CE  
1967 N NZ  . LYS B 16  ? 1.9324 2.6102 1.8559 0.3012  -0.0120 -0.2177 31  LYS B NZ  
1968 N N   . HIS B 17  ? 1.5602 2.0230 1.5744 0.2801  -0.1014 -0.2895 32  HIS B N   
1969 C CA  . HIS B 17  ? 1.5483 1.9602 1.5764 0.2711  -0.1216 -0.2947 32  HIS B CA  
1970 C C   . HIS B 17  ? 1.4270 1.8102 1.4842 0.2642  -0.1300 -0.2948 32  HIS B C   
1971 O O   . HIS B 17  ? 1.4717 1.8140 1.5448 0.2608  -0.1481 -0.2993 32  HIS B O   
1972 C CB  . HIS B 17  ? 1.5809 1.9856 1.6196 0.2441  -0.1142 -0.2764 32  HIS B CB  
1973 C CG  . HIS B 17  ? 1.6848 2.1198 1.7006 0.2448  -0.1020 -0.2685 32  HIS B CG  
1974 N ND1 . HIS B 17  ? 1.7676 2.2047 1.7527 0.2670  -0.1119 -0.2817 32  HIS B ND1 
1975 C CD2 . HIS B 17  ? 1.7177 2.1819 1.7378 0.2266  -0.0813 -0.2478 32  HIS B CD2 
1976 C CE1 . HIS B 17  ? 1.8108 2.2793 1.7812 0.2627  -0.0957 -0.2670 32  HIS B CE1 
1977 N NE2 . HIS B 17  ? 1.7878 2.2725 1.7815 0.2373  -0.0773 -0.2459 32  HIS B NE2 
1978 N N   . HIS B 18  ? 1.3078 1.7134 1.3748 0.2614  -0.1170 -0.2875 33  HIS B N   
1979 C CA  . HIS B 18  ? 1.2534 1.6351 1.3474 0.2524  -0.1216 -0.2823 33  HIS B CA  
1980 C C   . HIS B 18  ? 1.2293 1.5805 1.3288 0.2730  -0.1437 -0.2999 33  HIS B C   
1981 O O   . HIS B 18  ? 1.3321 1.6918 1.4118 0.2983  -0.1516 -0.3184 33  HIS B O   
1982 C CB  . HIS B 18  ? 1.2496 1.6645 1.3503 0.2456  -0.1037 -0.2710 33  HIS B CB  
1983 C CG  . HIS B 18  ? 1.2184 1.6506 1.3244 0.2207  -0.0868 -0.2526 33  HIS B CG  
1984 N ND1 . HIS B 18  ? 1.2148 1.6767 1.3068 0.2167  -0.0750 -0.2475 33  HIS B ND1 
1985 C CD2 . HIS B 18  ? 1.2069 1.6277 1.3311 0.1994  -0.0811 -0.2383 33  HIS B CD2 
1986 C CE1 . HIS B 18  ? 1.1991 1.6659 1.3034 0.1928  -0.0639 -0.2314 33  HIS B CE1 
1987 N NE2 . HIS B 18  ? 1.2219 1.6638 1.3438 0.1828  -0.0677 -0.2270 33  HIS B NE2 
1988 N N   . LYS B 19  ? 1.1515 1.4666 1.2790 0.2628  -0.1539 -0.2934 34  LYS B N   
1989 C CA  . LYS B 19  ? 1.1652 1.4530 1.3076 0.2789  -0.1726 -0.3045 34  LYS B CA  
1990 C C   . LYS B 19  ? 1.1913 1.5066 1.3289 0.2918  -0.1634 -0.3063 34  LYS B C   
1991 O O   . LYS B 19  ? 1.1186 1.4653 1.2548 0.2805  -0.1433 -0.2924 34  LYS B O   
1992 C CB  . LYS B 19  ? 1.1460 1.3968 1.3248 0.2626  -0.1801 -0.2894 34  LYS B CB  
1993 C CG  . LYS B 19  ? 1.1446 1.3638 1.3351 0.2535  -0.1948 -0.2901 34  LYS B CG  
1994 C CD  . LYS B 19  ? 1.1644 1.3413 1.3960 0.2489  -0.2122 -0.2827 34  LYS B CD  
1995 C CE  . LYS B 19  ? 1.1526 1.3308 1.4083 0.2279  -0.1950 -0.2544 34  LYS B CE  
1996 N NZ  . LYS B 19  ? 1.1781 1.3232 1.4760 0.2255  -0.2069 -0.2415 34  LYS B NZ  
1997 N N   . ARG B 20  ? 1.2599 1.5637 1.3961 0.3165  -0.1794 -0.3243 35  ARG B N   
1998 C CA  . ARG B 20  ? 1.2738 1.6049 1.4058 0.3309  -0.1714 -0.3267 35  ARG B CA  
1999 C C   . ARG B 20  ? 1.2522 1.5778 1.4104 0.3160  -0.1645 -0.3066 35  ARG B C   
2000 O O   . ARG B 20  ? 1.2033 1.5626 1.3583 0.3125  -0.1480 -0.2974 35  ARG B O   
2001 C CB  . ARG B 20  ? 1.3348 1.6515 1.4604 0.3621  -0.1915 -0.3513 35  ARG B CB  
2002 C CG  . ARG B 20  ? 1.3632 1.6943 1.4546 0.3827  -0.1957 -0.3726 35  ARG B CG  
2003 C CD  . ARG B 20  ? 1.4216 1.7251 1.5086 0.4141  -0.2222 -0.4004 35  ARG B CD  
2004 N NE  . ARG B 20  ? 1.4879 1.7815 1.5479 0.4301  -0.2367 -0.4218 35  ARG B NE  
2005 C CZ  . ARG B 20  ? 1.5609 1.8095 1.6311 0.4270  -0.2615 -0.4312 35  ARG B CZ  
2006 N NH1 . ARG B 20  ? 1.5922 1.8375 1.6316 0.4456  -0.2747 -0.4527 35  ARG B NH1 
2007 N NH2 . ARG B 20  ? 1.5853 1.7936 1.6967 0.4066  -0.2737 -0.4187 35  ARG B NH2 
2008 N N   . VAL B 21  ? 1.2970 1.5817 1.4820 0.3071  -0.1770 -0.2982 36  VAL B N   
2009 C CA  . VAL B 21  ? 1.3143 1.5924 1.5232 0.2941  -0.1698 -0.2761 36  VAL B CA  
2010 C C   . VAL B 21  ? 1.2804 1.5317 1.5100 0.2716  -0.1697 -0.2584 36  VAL B C   
2011 O O   . VAL B 21  ? 1.2885 1.5141 1.5243 0.2699  -0.1836 -0.2656 36  VAL B O   
2012 C CB  . VAL B 21  ? 1.3541 1.6139 1.5803 0.3130  -0.1842 -0.2803 36  VAL B CB  
2013 C CG1 . VAL B 21  ? 1.3776 1.5997 1.6404 0.3035  -0.1926 -0.2611 36  VAL B CG1 
2014 C CG2 . VAL B 21  ? 1.3161 1.6133 1.5307 0.3226  -0.1712 -0.2790 36  VAL B CG2 
2015 N N   . PRO B 22  ? 1.2761 1.5349 1.5154 0.2557  -0.1543 -0.2358 37  PRO B N   
2016 C CA  . PRO B 22  ? 1.3027 1.5388 1.5617 0.2368  -0.1526 -0.2184 37  PRO B CA  
2017 C C   . PRO B 22  ? 1.2875 1.4829 1.5834 0.2399  -0.1700 -0.2103 37  PRO B C   
2018 O O   . PRO B 22  ? 1.2846 1.4716 1.5917 0.2543  -0.1789 -0.2118 37  PRO B O   
2019 C CB  . PRO B 22  ? 1.2787 1.5372 1.5335 0.2238  -0.1312 -0.1986 37  PRO B CB  
2020 C CG  . PRO B 22  ? 1.2713 1.5561 1.5134 0.2366  -0.1263 -0.2029 37  PRO B CG  
2021 C CD  . PRO B 22  ? 1.2917 1.5788 1.5248 0.2561  -0.1394 -0.2256 37  PRO B CD  
2022 N N   . SER B 23  ? 1.2345 1.4057 1.5516 0.2266  -0.1753 -0.2012 38  SER B N   
2023 C CA  . SER B 23  ? 1.2496 1.3844 1.6112 0.2246  -0.1893 -0.1862 38  SER B CA  
2024 C C   . SER B 23  ? 1.2410 1.3604 1.6239 0.2062  -0.1885 -0.1724 38  SER B C   
2025 O O   . SER B 23  ? 1.2391 1.3695 1.6005 0.1983  -0.1837 -0.1814 38  SER B O   
2026 C CB  . SER B 23  ? 1.2710 1.3774 1.6469 0.2415  -0.2180 -0.2069 38  SER B CB  
2027 O OG  . SER B 23  ? 1.2730 1.3742 1.6317 0.2440  -0.2309 -0.2305 38  SER B OG  
2028 N N   . PRO B 24  ? 1.2302 1.3250 1.6577 0.1998  -0.1934 -0.1494 39  PRO B N   
2029 C CA  . PRO B 24  ? 1.2359 1.3212 1.6855 0.1824  -0.1898 -0.1337 39  PRO B CA  
2030 C C   . PRO B 24  ? 1.2550 1.3208 1.7089 0.1808  -0.2119 -0.1544 39  PRO B C   
2031 O O   . PRO B 24  ? 1.2641 1.3152 1.7144 0.1947  -0.2343 -0.1782 39  PRO B O   
2032 C CB  . PRO B 24  ? 1.2182 1.2835 1.7197 0.1790  -0.1915 -0.1034 39  PRO B CB  
2033 C CG  . PRO B 24  ? 1.2402 1.3106 1.7388 0.1930  -0.1895 -0.0995 39  PRO B CG  
2034 C CD  . PRO B 24  ? 1.2305 1.3079 1.6927 0.2076  -0.2008 -0.1337 39  PRO B CD  
2035 N N   . GLU B 25  ? 1.2691 1.3360 1.7275 0.1658  -0.2057 -0.1464 40  GLU B N   
2036 C CA  . GLU B 25  ? 1.2851 1.3348 1.7477 0.1632  -0.2261 -0.1633 40  GLU B CA  
2037 C C   . GLU B 25  ? 1.2834 1.3127 1.7971 0.1483  -0.2312 -0.1405 40  GLU B C   
2038 O O   . GLU B 25  ? 1.2436 1.2863 1.7663 0.1364  -0.2083 -0.1148 40  GLU B O   
2039 C CB  . GLU B 25  ? 1.2892 1.3648 1.7043 0.1594  -0.2128 -0.1762 40  GLU B CB  
2040 C CG  . GLU B 25  ? 1.3010 1.3988 1.6692 0.1744  -0.2100 -0.1995 40  GLU B CG  
2041 C CD  . GLU B 25  ? 1.3917 1.4725 1.7513 0.1921  -0.2380 -0.2285 40  GLU B CD  
2042 O OE1 . GLU B 25  ? 1.4021 1.4973 1.7332 0.2088  -0.2380 -0.2454 40  GLU B OE1 
2043 O OE2 . GLU B 25  ? 1.3973 1.4512 1.7782 0.1907  -0.2607 -0.2353 40  GLU B OE2 
2044 N N   . ASP B 26  ? 1.3234 1.3214 1.8717 0.1500  -0.2616 -0.1500 41  ASP B N   
2045 C CA  . ASP B 26  ? 1.3870 1.3669 1.9886 0.1353  -0.2692 -0.1293 41  ASP B CA  
2046 C C   . ASP B 26  ? 1.3500 1.3469 1.9338 0.1225  -0.2532 -0.1240 41  ASP B C   
2047 O O   . ASP B 26  ? 1.2865 1.2858 1.9030 0.1093  -0.2403 -0.0966 41  ASP B O   
2048 C CB  . ASP B 26  ? 1.4808 1.4243 2.1182 0.1394  -0.3094 -0.1469 41  ASP B CB  
2049 C CG  . ASP B 26  ? 1.5511 1.4679 2.2436 0.1433  -0.3273 -0.1355 41  ASP B CG  
2050 O OD1 . ASP B 26  ? 1.5858 1.5132 2.2767 0.1476  -0.3099 -0.1200 41  ASP B OD1 
2051 O OD2 . ASP B 26  ? 1.6016 1.4862 2.3404 0.1423  -0.3603 -0.1419 41  ASP B OD2 
2052 N N   . LYS B 27  ? 1.3521 1.3611 1.8859 0.1274  -0.2542 -0.1492 42  LYS B N   
2053 C CA  . LYS B 27  ? 1.3891 1.4119 1.9062 0.1159  -0.2418 -0.1456 42  LYS B CA  
2054 C C   . LYS B 27  ? 1.3105 1.3604 1.7649 0.1213  -0.2276 -0.1635 42  LYS B C   
2055 O O   . LYS B 27  ? 1.3537 1.4044 1.7779 0.1358  -0.2405 -0.1888 42  LYS B O   
2056 C CB  . LYS B 27  ? 1.4954 1.4939 2.0407 0.1121  -0.2699 -0.1537 42  LYS B CB  
2057 C CG  . LYS B 27  ? 1.5565 1.5662 2.0963 0.0987  -0.2579 -0.1443 42  LYS B CG  
2058 C CD  . LYS B 27  ? 1.5766 1.5636 2.1444 0.0956  -0.2872 -0.1526 42  LYS B CD  
2059 C CE  . LYS B 27  ? 1.5486 1.5491 2.0998 0.0854  -0.2756 -0.1476 42  LYS B CE  
2060 N NZ  . LYS B 27  ? 1.5566 1.5385 2.1156 0.0878  -0.3071 -0.1647 42  LYS B NZ  
2061 N N   . LEU B 28  ? 1.1714 1.2439 1.6090 0.1102  -0.2008 -0.1492 43  LEU B N   
2062 C CA  . LEU B 28  ? 1.0619 1.1599 1.4497 0.1106  -0.1869 -0.1608 43  LEU B CA  
2063 C C   . LEU B 28  ? 0.9828 1.0844 1.3735 0.0962  -0.1778 -0.1498 43  LEU B C   
2064 O O   . LEU B 28  ? 0.9518 1.0473 1.3751 0.0859  -0.1697 -0.1285 43  LEU B O   
2065 C CB  . LEU B 28  ? 1.0218 1.1453 1.3862 0.1115  -0.1623 -0.1543 43  LEU B CB  
2066 C CG  . LEU B 28  ? 1.0230 1.1515 1.3772 0.1258  -0.1650 -0.1637 43  LEU B CG  
2067 C CD1 . LEU B 28  ? 0.9826 1.1382 1.3158 0.1242  -0.1404 -0.1551 43  LEU B CD1 
2068 C CD2 . LEU B 28  ? 1.0652 1.1968 1.3898 0.1401  -0.1805 -0.1909 43  LEU B CD2 
2069 N N   . TYR B 29  ? 0.9441 1.0582 1.3002 0.0968  -0.1772 -0.1626 44  TYR B N   
2070 C CA  . TYR B 29  ? 0.9262 1.0419 1.2829 0.0849  -0.1723 -0.1549 44  TYR B CA  
2071 C C   . TYR B 29  ? 0.9042 1.0387 1.2532 0.0731  -0.1439 -0.1380 44  TYR B C   
2072 O O   . TYR B 29  ? 0.9396 1.0952 1.2608 0.0748  -0.1287 -0.1410 44  TYR B O   
2073 C CB  . TYR B 29  ? 0.9269 1.0486 1.2492 0.0919  -0.1836 -0.1736 44  TYR B CB  
2074 C CG  . TYR B 29  ? 0.8873 1.0048 1.2142 0.0821  -0.1859 -0.1674 44  TYR B CG  
2075 C CD1 . TYR B 29  ? 0.8550 0.9488 1.2193 0.0777  -0.2038 -0.1626 44  TYR B CD1 
2076 C CD2 . TYR B 29  ? 0.9089 1.0467 1.2060 0.0769  -0.1706 -0.1649 44  TYR B CD2 
2077 C CE1 . TYR B 29  ? 0.8391 0.9304 1.2077 0.0694  -0.2062 -0.1566 44  TYR B CE1 
2078 C CE2 . TYR B 29  ? 0.8670 1.0009 1.1682 0.0686  -0.1726 -0.1582 44  TYR B CE2 
2079 C CZ  . TYR B 29  ? 0.8412 0.9523 1.1766 0.0653  -0.1901 -0.1546 44  TYR B CZ  
2080 O OH  . TYR B 29  ? 0.8449 0.9544 1.1825 0.0578  -0.1913 -0.1478 44  TYR B OH  
2081 N N   . GLU B 30  ? 0.8765 1.0028 1.2534 0.0622  -0.1385 -0.1209 45  GLU B N   
2082 C CA  . GLU B 30  ? 0.8401 0.9799 1.2102 0.0522  -0.1153 -0.1073 45  GLU B CA  
2083 C C   . GLU B 30  ? 0.8098 0.9688 1.1582 0.0542  -0.0957 -0.1056 45  GLU B C   
2084 O O   . GLU B 30  ? 0.7915 0.9497 1.1532 0.0582  -0.0897 -0.0967 45  GLU B O   
2085 C CB  . GLU B 30  ? 0.8206 0.9674 1.1682 0.0465  -0.1149 -0.1132 45  GLU B CB  
2086 C CG  . GLU B 30  ? 0.8347 0.9657 1.2000 0.0433  -0.1314 -0.1129 45  GLU B CG  
2087 C CD  . GLU B 30  ? 0.7744 0.8983 1.1703 0.0333  -0.1236 -0.0945 45  GLU B CD  
2088 O OE1 . GLU B 30  ? 0.8144 0.9432 1.2213 0.0310  -0.1061 -0.0811 45  GLU B OE1 
2089 O OE2 . GLU B 30  ? 0.7152 0.8291 1.1233 0.0297  -0.1358 -0.0938 45  GLU B OE2 
2090 N N   . GLU B 31  ? 0.8039 0.9808 1.1203 0.0517  -0.0870 -0.1135 46  GLU B N   
2091 C CA  . GLU B 31  ? 0.7822 0.9776 1.0801 0.0512  -0.0703 -0.1125 46  GLU B CA  
2092 C C   . GLU B 31  ? 0.8274 1.0302 1.1177 0.0620  -0.0721 -0.1192 46  GLU B C   
2093 O O   . GLU B 31  ? 0.8919 1.1052 1.1767 0.0633  -0.0599 -0.1144 46  GLU B O   
2094 C CB  . GLU B 31  ? 0.7655 0.9778 1.0374 0.0454  -0.0646 -0.1193 46  GLU B CB  
2095 C CG  . GLU B 31  ? 0.7693 0.9751 1.0471 0.0347  -0.0620 -0.1121 46  GLU B CG  
2096 C CD  . GLU B 31  ? 0.7677 0.9657 1.0629 0.0295  -0.0505 -0.0986 46  GLU B CD  
2097 O OE1 . GLU B 31  ? 0.7794 0.9836 1.0724 0.0328  -0.0400 -0.0953 46  GLU B OE1 
2098 O OE2 . GLU B 31  ? 0.7805 0.9673 1.0904 0.0236  -0.0518 -0.0912 46  GLU B OE2 
2099 N N   . CYS B 32  ? 0.8228 1.0195 1.1124 0.0711  -0.0881 -0.1307 47  CYS B N   
2100 C CA  . CYS B 32  ? 0.8191 1.0205 1.1047 0.0828  -0.0909 -0.1368 47  CYS B CA  
2101 C C   . CYS B 32  ? 0.8447 1.0293 1.1611 0.0867  -0.0936 -0.1241 47  CYS B C   
2102 O O   . CYS B 32  ? 0.9087 1.0957 1.2245 0.0966  -0.0957 -0.1267 47  CYS B O   
2103 C CB  . CYS B 32  ? 0.8288 1.0311 1.0992 0.0938  -0.1068 -0.1557 47  CYS B CB  
2104 S SG  . CYS B 32  ? 0.8649 1.0945 1.0977 0.0939  -0.1014 -0.1676 47  CYS B SG  
2105 N N   . ILE B 33  ? 0.8373 1.0071 1.1825 0.0795  -0.0921 -0.1081 48  ILE B N   
2106 C CA  . ILE B 33  ? 0.8648 1.0205 1.2452 0.0828  -0.0939 -0.0915 48  ILE B CA  
2107 C C   . ILE B 33  ? 0.8668 1.0352 1.2409 0.0893  -0.0787 -0.0810 48  ILE B C   
2108 O O   . ILE B 33  ? 0.9218 1.0817 1.3156 0.0970  -0.0844 -0.0740 48  ILE B O   
2109 C CB  . ILE B 33  ? 0.8914 1.0345 1.3058 0.0737  -0.0917 -0.0730 48  ILE B CB  
2110 C CG1 . ILE B 33  ? 0.9312 1.0549 1.3644 0.0711  -0.1149 -0.0823 48  ILE B CG1 
2111 C CG2 . ILE B 33  ? 0.9159 1.0535 1.3658 0.0763  -0.0842 -0.0481 48  ILE B CG2 
2112 C CD1 . ILE B 33  ? 0.9447 1.0607 1.4053 0.0607  -0.1132 -0.0680 48  ILE B CD1 
2113 N N   . PRO B 34  ? 0.8758 1.0637 1.2232 0.0871  -0.0611 -0.0802 49  PRO B N   
2114 C CA  . PRO B 34  ? 0.8948 1.0957 1.2327 0.0953  -0.0486 -0.0719 49  PRO B CA  
2115 C C   . PRO B 34  ? 0.9588 1.1638 1.2888 0.1066  -0.0570 -0.0814 49  PRO B C   
2116 O O   . PRO B 34  ? 1.0171 1.2258 1.3513 0.1151  -0.0510 -0.0697 49  PRO B O   
2117 C CB  . PRO B 34  ? 0.8722 1.0921 1.1789 0.0909  -0.0352 -0.0783 49  PRO B CB  
2118 C CG  . PRO B 34  ? 0.8688 1.0812 1.1816 0.0794  -0.0351 -0.0780 49  PRO B CG  
2119 C CD  . PRO B 34  ? 0.8596 1.0577 1.1862 0.0778  -0.0532 -0.0865 49  PRO B CD  
2120 N N   . TRP B 35  ? 0.9676 1.1723 1.2865 0.1083  -0.0707 -0.1014 50  TRP B N   
2121 C CA  . TRP B 35  ? 0.9771 1.1863 1.2881 0.1206  -0.0793 -0.1126 50  TRP B CA  
2122 C C   . TRP B 35  ? 0.9992 1.1839 1.3390 0.1279  -0.0977 -0.1126 50  TRP B C   
2123 O O   . TRP B 35  ? 1.0031 1.1890 1.3372 0.1395  -0.1065 -0.1234 50  TRP B O   
2124 C CB  . TRP B 35  ? 0.9475 1.1748 1.2283 0.1220  -0.0821 -0.1344 50  TRP B CB  
2125 C CG  . TRP B 35  ? 0.9265 1.1785 1.1843 0.1160  -0.0665 -0.1343 50  TRP B CG  
2126 C CD1 . TRP B 35  ? 0.9107 1.1829 1.1538 0.1219  -0.0592 -0.1356 50  TRP B CD1 
2127 C CD2 . TRP B 35  ? 0.8960 1.1537 1.1458 0.1030  -0.0579 -0.1325 50  TRP B CD2 
2128 N NE1 . TRP B 35  ? 0.8882 1.1779 1.1156 0.1129  -0.0480 -0.1361 50  TRP B NE1 
2129 C CE2 . TRP B 35  ? 0.8865 1.1670 1.1180 0.1012  -0.0468 -0.1341 50  TRP B CE2 
2130 C CE3 . TRP B 35  ? 0.8810 1.1261 1.1389 0.0931  -0.0600 -0.1300 50  TRP B CE3 
2131 C CZ2 . TRP B 35  ? 0.8882 1.1770 1.1108 0.0895  -0.0384 -0.1336 50  TRP B CZ2 
2132 C CZ3 . TRP B 35  ? 0.8783 1.1326 1.1258 0.0821  -0.0502 -0.1285 50  TRP B CZ3 
2133 C CH2 . TRP B 35  ? 0.9188 1.1938 1.1496 0.0802  -0.0398 -0.1304 50  TRP B CH2 
2134 N N   . LYS B 36  ? 1.0859 1.2484 1.4592 0.1217  -0.1050 -0.1010 51  LYS B N   
2135 C CA  . LYS B 36  ? 1.1856 1.3217 1.5900 0.1277  -0.1280 -0.1047 51  LYS B CA  
2136 C C   . LYS B 36  ? 1.2016 1.3311 1.6264 0.1379  -0.1300 -0.0926 51  LYS B C   
2137 O O   . LYS B 36  ? 1.1524 1.2639 1.5927 0.1470  -0.1503 -0.1029 51  LYS B O   
2138 C CB  . LYS B 36  ? 1.1990 1.3132 1.6404 0.1177  -0.1379 -0.0947 51  LYS B CB  
2139 C CG  . LYS B 36  ? 1.2227 1.3334 1.7001 0.1111  -0.1249 -0.0629 51  LYS B CG  
2140 C CD  . LYS B 36  ? 1.3149 1.4123 1.8226 0.0993  -0.1306 -0.0545 51  LYS B CD  
2141 C CE  . LYS B 36  ? 1.3674 1.4373 1.9048 0.0998  -0.1616 -0.0673 51  LYS B CE  
2142 N NZ  . LYS B 36  ? 1.4068 1.4573 1.9846 0.1064  -0.1762 -0.0582 51  LYS B NZ  
2143 N N   . ASP B 37  ? 1.2274 1.3716 1.6502 0.1376  -0.1095 -0.0717 52  ASP B N   
2144 C CA  . ASP B 37  ? 1.2927 1.4389 1.7238 0.1487  -0.1061 -0.0586 52  ASP B CA  
2145 C C   . ASP B 37  ? 1.2848 1.4347 1.6963 0.1620  -0.1178 -0.0804 52  ASP B C   
2146 O O   . ASP B 37  ? 1.3365 1.4722 1.7703 0.1717  -0.1288 -0.0756 52  ASP B O   
2147 C CB  . ASP B 37  ? 1.3246 1.4956 1.7333 0.1494  -0.0811 -0.0429 52  ASP B CB  
2148 C CG  . ASP B 37  ? 1.3966 1.5667 1.8242 0.1408  -0.0667 -0.0185 52  ASP B CG  
2149 O OD1 . ASP B 37  ? 1.4133 1.5634 1.8810 0.1345  -0.0754 -0.0072 52  ASP B OD1 
2150 O OD2 . ASP B 37  ? 1.4742 1.6638 1.8773 0.1413  -0.0476 -0.0113 52  ASP B OD2 
2151 N N   . ASN B 38  ? 1.2320 1.4020 1.6040 0.1626  -0.1145 -0.1026 53  ASN B N   
2152 C CA  . ASN B 38  ? 1.2162 1.3974 1.5656 0.1760  -0.1217 -0.1231 53  ASN B CA  
2153 C C   . ASN B 38  ? 1.1446 1.3479 1.4578 0.1726  -0.1176 -0.1442 53  ASN B C   
2154 O O   . ASN B 38  ? 1.1181 1.3466 1.4085 0.1673  -0.1013 -0.1420 53  ASN B O   
2155 C CB  . ASN B 38  ? 1.2403 1.4387 1.5814 0.1845  -0.1097 -0.1112 53  ASN B CB  
2156 C CG  . ASN B 38  ? 1.2585 1.4714 1.5790 0.1991  -0.1161 -0.1306 53  ASN B CG  
2157 O OD1 . ASN B 38  ? 1.3166 1.5159 1.6426 0.2085  -0.1337 -0.1476 53  ASN B OD1 
2158 N ND2 . ASN B 38  ? 1.2010 1.4420 1.4985 0.2025  -0.1028 -0.1287 53  ASN B ND2 
2159 N N   . ALA B 39  ? 1.1335 1.3273 1.4426 0.1764  -0.1331 -0.1637 54  ALA B N   
2160 C CA  . ALA B 39  ? 1.1456 1.3587 1.4251 0.1721  -0.1286 -0.1787 54  ALA B CA  
2161 C C   . ALA B 39  ? 1.1477 1.3760 1.4026 0.1880  -0.1361 -0.2019 54  ALA B C   
2162 O O   . ALA B 39  ? 1.1685 1.3813 1.4318 0.2031  -0.1526 -0.2127 54  ALA B O   
2163 C CB  . ALA B 39  ? 1.1974 1.3907 1.4883 0.1626  -0.1374 -0.1792 54  ALA B CB  
2164 N N   . CYS B 40  ? 1.1216 1.3806 1.3488 0.1847  -0.1239 -0.2082 55  CYS B N   
2165 C CA  . CYS B 40  ? 1.1349 1.4154 1.3364 0.1990  -0.1270 -0.2278 55  CYS B CA  
2166 C C   . CYS B 40  ? 1.1082 1.3835 1.2972 0.1989  -0.1347 -0.2384 55  CYS B C   
2167 O O   . CYS B 40  ? 1.1270 1.4226 1.2915 0.2114  -0.1353 -0.2527 55  CYS B O   
2168 C CB  . CYS B 40  ? 1.1034 1.4253 1.2866 0.1957  -0.1084 -0.2253 55  CYS B CB  
2169 S SG  . CYS B 40  ? 1.0801 1.4167 1.2694 0.2021  -0.1019 -0.2187 55  CYS B SG  
2170 N N   . CYS B 41  ? 1.0659 1.3161 1.2715 0.1860  -0.1400 -0.2302 56  CYS B N   
2171 C CA  . CYS B 41  ? 1.0697 1.3108 1.2664 0.1852  -0.1495 -0.2384 56  CYS B CA  
2172 C C   . CYS B 41  ? 1.1225 1.3237 1.3430 0.1909  -0.1745 -0.2451 56  CYS B C   
2173 O O   . CYS B 41  ? 1.1482 1.3270 1.4017 0.1839  -0.1783 -0.2321 56  CYS B O   
2174 C CB  . CYS B 41  ? 1.0438 1.2905 1.2430 0.1637  -0.1352 -0.2222 56  CYS B CB  
2175 S SG  . CYS B 41  ? 0.9824 1.2083 1.2166 0.1461  -0.1285 -0.1989 56  CYS B SG  
2176 N N   . THR B 42  ? 1.1821 1.3754 1.3869 0.2045  -0.1922 -0.2647 57  THR B N   
2177 C CA  . THR B 42  ? 1.2115 1.3663 1.4390 0.2082  -0.2197 -0.2734 57  THR B CA  
2178 C C   . THR B 42  ? 1.2157 1.3607 1.4560 0.1893  -0.2187 -0.2607 57  THR B C   
2179 O O   . THR B 42  ? 1.0930 1.2608 1.3171 0.1771  -0.1988 -0.2499 57  THR B O   
2180 C CB  . THR B 42  ? 1.2519 1.4027 1.4516 0.2324  -0.2408 -0.3022 57  THR B CB  
2181 O OG1 . THR B 42  ? 1.2512 1.4322 1.4125 0.2337  -0.2278 -0.3049 57  THR B OG1 
2182 C CG2 . THR B 42  ? 1.2917 1.4483 1.4807 0.2545  -0.2456 -0.3176 57  THR B CG2 
2183 N N   . LEU B 43  ? 1.2721 1.3823 1.5441 0.1875  -0.2420 -0.2626 58  LEU B N   
2184 C CA  . LEU B 43  ? 1.2024 1.3012 1.4893 0.1725  -0.2459 -0.2533 58  LEU B CA  
2185 C C   . LEU B 43  ? 1.1573 1.2761 1.4027 0.1765  -0.2422 -0.2634 58  LEU B C   
2186 O O   . LEU B 43  ? 1.1824 1.3134 1.4244 0.1611  -0.2265 -0.2488 58  LEU B O   
2187 C CB  . LEU B 43  ? 1.2731 1.3330 1.5966 0.1759  -0.2787 -0.2613 58  LEU B CB  
2188 C CG  . LEU B 43  ? 1.3348 1.3829 1.6729 0.1636  -0.2879 -0.2557 58  LEU B CG  
2189 C CD1 . LEU B 43  ? 1.3240 1.3714 1.7007 0.1408  -0.2696 -0.2246 58  LEU B CD1 
2190 C CD2 . LEU B 43  ? 1.3905 1.4040 1.7498 0.1740  -0.3272 -0.2751 58  LEU B CD2 
2191 N N   . THR B 44  ? 1.1581 1.2798 1.3723 0.1989  -0.2572 -0.2881 59  THR B N   
2192 C CA  . THR B 44  ? 1.1570 1.2997 1.3288 0.2069  -0.2543 -0.2971 59  THR B CA  
2193 C C   . THR B 44  ? 1.1169 1.2979 1.2680 0.1952  -0.2209 -0.2798 59  THR B C   
2194 O O   . THR B 44  ? 1.0436 1.2358 1.1834 0.1854  -0.2121 -0.2705 59  THR B O   
2195 C CB  . THR B 44  ? 1.1554 1.3031 1.2909 0.2375  -0.2701 -0.3255 59  THR B CB  
2196 O OG1 . THR B 44  ? 1.1838 1.2924 1.3427 0.2490  -0.3037 -0.3436 59  THR B OG1 
2197 C CG2 . THR B 44  ? 1.1547 1.3227 1.2463 0.2485  -0.2694 -0.3333 59  THR B CG2 
2198 N N   . THR B 45  ? 1.1320 1.3320 1.2812 0.1964  -0.2043 -0.2756 60  THR B N   
2199 C CA  . THR B 45  ? 1.1239 1.3604 1.2580 0.1860  -0.1753 -0.2609 60  THR B CA  
2200 C C   . THR B 45  ? 1.0666 1.2984 1.2235 0.1598  -0.1617 -0.2384 60  THR B C   
2201 O O   . THR B 45  ? 1.0284 1.2802 1.1725 0.1495  -0.1466 -0.2282 60  THR B O   
2202 C CB  . THR B 45  ? 1.1470 1.4007 1.2808 0.1926  -0.1643 -0.2617 60  THR B CB  
2203 O OG1 . THR B 45  ? 1.1758 1.4403 1.2838 0.2186  -0.1735 -0.2824 60  THR B OG1 
2204 C CG2 . THR B 45  ? 1.1608 1.4489 1.2881 0.1787  -0.1372 -0.2456 60  THR B CG2 
2205 N N   . SER B 46  ? 1.0109 1.2163 1.2028 0.1504  -0.1675 -0.2301 61  SER B N   
2206 C CA  . SER B 46  ? 0.9602 1.1606 1.1740 0.1291  -0.1549 -0.2096 61  SER B CA  
2207 C C   . SER B 46  ? 0.9311 1.1240 1.1429 0.1219  -0.1609 -0.2072 61  SER B C   
2208 O O   . SER B 46  ? 0.9117 1.1157 1.1215 0.1078  -0.1454 -0.1940 61  SER B O   
2209 C CB  . SER B 46  ? 0.9743 1.1497 1.2269 0.1241  -0.1603 -0.1997 61  SER B CB  
2210 O OG  . SER B 46  ? 1.0422 1.1877 1.3176 0.1277  -0.1847 -0.2057 61  SER B OG  
2211 N N   . TRP B 47  ? 0.9499 1.1237 1.1619 0.1327  -0.1848 -0.2210 62  TRP B N   
2212 C CA  . TRP B 47  ? 0.9846 1.1532 1.1904 0.1286  -0.1925 -0.2203 62  TRP B CA  
2213 C C   . TRP B 47  ? 0.9936 1.1943 1.1587 0.1319  -0.1779 -0.2206 62  TRP B C   
2214 O O   . TRP B 47  ? 0.9324 1.1406 1.0955 0.1191  -0.1675 -0.2074 62  TRP B O   
2215 C CB  . TRP B 47  ? 1.0144 1.1552 1.2279 0.1419  -0.2252 -0.2380 62  TRP B CB  
2216 C CG  . TRP B 47  ? 0.9883 1.1328 1.1761 0.1476  -0.2349 -0.2450 62  TRP B CG  
2217 C CD1 . TRP B 47  ? 0.9990 1.1587 1.1438 0.1680  -0.2411 -0.2619 62  TRP B CD1 
2218 C CD2 . TRP B 47  ? 0.9578 1.0944 1.1585 0.1341  -0.2367 -0.2329 62  TRP B CD2 
2219 N NE1 . TRP B 47  ? 1.0003 1.1614 1.1292 0.1684  -0.2478 -0.2609 62  TRP B NE1 
2220 C CE2 . TRP B 47  ? 0.9729 1.1192 1.1368 0.1470  -0.2456 -0.2434 62  TRP B CE2 
2221 C CE3 . TRP B 47  ? 0.9267 1.0505 1.1663 0.1138  -0.2310 -0.2136 62  TRP B CE3 
2222 C CZ2 . TRP B 47  ? 0.9628 1.1049 1.1282 0.1392  -0.2501 -0.2351 62  TRP B CZ2 
2223 C CZ3 . TRP B 47  ? 0.8785 0.9982 1.1213 0.1063  -0.2355 -0.2065 62  TRP B CZ3 
2224 C CH2 . TRP B 47  ? 0.9274 1.0556 1.1338 0.1182  -0.2452 -0.2169 62  TRP B CH2 
2225 N N   . GLU B 48  ? 1.0546 1.2753 1.1902 0.1496  -0.1765 -0.2338 63  GLU B N   
2226 C CA  . GLU B 48  ? 1.1346 1.3884 1.2333 0.1563  -0.1639 -0.2329 63  GLU B CA  
2227 C C   . GLU B 48  ? 1.1057 1.3829 1.2091 0.1365  -0.1370 -0.2117 63  GLU B C   
2228 O O   . GLU B 48  ? 1.0969 1.3947 1.1831 0.1332  -0.1266 -0.2025 63  GLU B O   
2229 C CB  . GLU B 48  ? 1.1803 1.4543 1.2489 0.1813  -0.1659 -0.2502 63  GLU B CB  
2230 C CG  . GLU B 48  ? 1.2562 1.5100 1.3088 0.2054  -0.1948 -0.2744 63  GLU B CG  
2231 C CD  . GLU B 48  ? 1.2988 1.5753 1.3149 0.2343  -0.1963 -0.2926 63  GLU B CD  
2232 O OE1 . GLU B 48  ? 1.2748 1.5781 1.2862 0.2366  -0.1780 -0.2886 63  GLU B OE1 
2233 O OE2 . GLU B 48  ? 1.4064 1.6742 1.3975 0.2568  -0.2171 -0.3121 63  GLU B OE2 
2234 N N   . ALA B 49  ? 1.0511 1.3239 1.1788 0.1241  -0.1273 -0.2039 64  ALA B N   
2235 C CA  . ALA B 49  ? 0.9899 1.2804 1.1252 0.1062  -0.1052 -0.1871 64  ALA B CA  
2236 C C   . ALA B 49  ? 0.9310 1.2118 1.0776 0.0890  -0.1012 -0.1729 64  ALA B C   
2237 O O   . ALA B 49  ? 0.8872 1.1859 1.0315 0.0772  -0.0858 -0.1608 64  ALA B O   
2238 C CB  . ALA B 49  ? 1.0108 1.2943 1.1669 0.1008  -0.0998 -0.1844 64  ALA B CB  
2239 N N   . HIS B 50  ? 0.8969 1.1494 1.0579 0.0882  -0.1165 -0.1745 65  HIS B N   
2240 C CA  . HIS B 50  ? 0.8733 1.1150 1.0471 0.0737  -0.1144 -0.1616 65  HIS B CA  
2241 C C   . HIS B 50  ? 0.9388 1.1885 1.0910 0.0779  -0.1193 -0.1611 65  HIS B C   
2242 O O   . HIS B 50  ? 0.9997 1.2433 1.1608 0.0660  -0.1164 -0.1492 65  HIS B O   
2243 C CB  . HIS B 50  ? 0.8272 1.0378 1.0319 0.0698  -0.1273 -0.1603 65  HIS B CB  
2244 C CG  . HIS B 50  ? 0.8051 1.0084 1.0323 0.0661  -0.1208 -0.1562 65  HIS B CG  
2245 N ND1 . HIS B 50  ? 0.7977 1.0042 1.0212 0.0773  -0.1239 -0.1659 65  HIS B ND1 
2246 C CD2 . HIS B 50  ? 0.7603 0.9539 1.0133 0.0543  -0.1112 -0.1425 65  HIS B CD2 
2247 C CE1 . HIS B 50  ? 0.7951 0.9940 1.0412 0.0719  -0.1167 -0.1571 65  HIS B CE1 
2248 N NE2 . HIS B 50  ? 0.7469 0.9390 1.0099 0.0587  -0.1084 -0.1429 65  HIS B NE2 
2249 N N   . LEU B 51  ? 1.0247 1.2884 1.1478 0.0961  -0.1265 -0.1733 66  LEU B N   
2250 C CA  . LEU B 51  ? 1.0818 1.3553 1.1797 0.1038  -0.1313 -0.1720 66  LEU B CA  
2251 C C   . LEU B 51  ? 1.1324 1.4341 1.2213 0.0936  -0.1099 -0.1540 66  LEU B C   
2252 O O   . LEU B 51  ? 1.1598 1.4834 1.2494 0.0893  -0.0934 -0.1490 66  LEU B O   
2253 C CB  . LEU B 51  ? 1.1039 1.3877 1.1689 0.1300  -0.1436 -0.1905 66  LEU B CB  
2254 C CG  . LEU B 51  ? 1.1213 1.3733 1.1964 0.1415  -0.1704 -0.2103 66  LEU B CG  
2255 C CD1 . LEU B 51  ? 1.1884 1.4504 1.2263 0.1704  -0.1838 -0.2311 66  LEU B CD1 
2256 C CD2 . LEU B 51  ? 1.1178 1.3415 1.2130 0.1328  -0.1870 -0.2069 66  LEU B CD2 
2257 N N   . ASP B 52  ? 1.2798 1.5806 1.3628 0.0900  -0.1117 -0.1438 67  ASP B N   
2258 C CA  . ASP B 52  ? 1.3858 1.7132 1.4595 0.0828  -0.0942 -0.1251 67  ASP B CA  
2259 C C   . ASP B 52  ? 1.4666 1.8273 1.5075 0.1029  -0.0890 -0.1298 67  ASP B C   
2260 O O   . ASP B 52  ? 1.5397 1.8980 1.5551 0.1245  -0.1041 -0.1451 67  ASP B O   
2261 C CB  . ASP B 52  ? 1.4545 1.7702 1.5273 0.0786  -0.1013 -0.1147 67  ASP B CB  
2262 C CG  . ASP B 52  ? 1.5354 1.8260 1.6437 0.0569  -0.0998 -0.1050 67  ASP B CG  
2263 O OD1 . ASP B 52  ? 1.6785 1.9610 1.8105 0.0451  -0.0921 -0.1054 67  ASP B OD1 
2264 O OD2 . ASP B 52  ? 1.5288 1.8084 1.6392 0.0538  -0.1067 -0.0969 67  ASP B OD2 
2265 N N   . VAL B 53  ? 1.5218 1.9132 1.5648 0.0969  -0.0688 -0.1180 68  VAL B N   
2266 C CA  . VAL B 53  ? 1.5662 1.9945 1.5821 0.1164  -0.0607 -0.1200 68  VAL B CA  
2267 C C   . VAL B 53  ? 1.5067 1.9244 1.5094 0.1367  -0.0752 -0.1460 68  VAL B C   
2268 O O   . VAL B 53  ? 1.5030 1.9253 1.4740 0.1616  -0.0865 -0.1596 68  VAL B O   
2269 C CB  . VAL B 53  ? 1.6721 2.1196 1.6581 0.1300  -0.0597 -0.1096 68  VAL B CB  
2270 C CG1 . VAL B 53  ? 1.7289 2.2165 1.6831 0.1549  -0.0509 -0.1119 68  VAL B CG1 
2271 C CG2 . VAL B 53  ? 1.6744 2.1323 1.6789 0.1085  -0.0447 -0.0813 68  VAL B CG2 
2272 N N   . SER B 54  ? 1.4597 1.8610 1.4871 0.1266  -0.0762 -0.1533 69  SER B N   
2273 C CA  . SER B 54  ? 1.4464 1.8316 1.4696 0.1426  -0.0914 -0.1761 69  SER B CA  
2274 C C   . SER B 54  ? 1.3928 1.8107 1.3859 0.1674  -0.0870 -0.1850 69  SER B C   
2275 O O   . SER B 54  ? 1.3473 1.8012 1.3398 0.1647  -0.0670 -0.1724 69  SER B O   
2276 C CB  . SER B 54  ? 1.4036 1.7733 1.4572 0.1289  -0.0889 -0.1781 69  SER B CB  
2277 O OG  . SER B 54  ? 1.3974 1.7371 1.4567 0.1392  -0.1087 -0.1962 69  SER B OG  
2278 N N   . PRO B 55  ? 1.3874 1.7926 1.3576 0.1921  -0.1065 -0.2070 70  PRO B N   
2279 C CA  . PRO B 55  ? 1.4108 1.8434 1.3480 0.2217  -0.1057 -0.2202 70  PRO B CA  
2280 C C   . PRO B 55  ? 1.4025 1.8575 1.3509 0.2220  -0.0914 -0.2204 70  PRO B C   
2281 O O   . PRO B 55  ? 1.4261 1.9161 1.3513 0.2428  -0.0821 -0.2233 70  PRO B O   
2282 C CB  . PRO B 55  ? 1.4297 1.8278 1.3536 0.2430  -0.1361 -0.2485 70  PRO B CB  
2283 C CG  . PRO B 55  ? 1.4163 1.7714 1.3779 0.2211  -0.1496 -0.2486 70  PRO B CG  
2284 C CD  . PRO B 55  ? 1.3922 1.7521 1.3752 0.1922  -0.1322 -0.2225 70  PRO B CD  
2285 N N   . LEU B 56  ? 1.4049 1.8417 1.3879 0.2005  -0.0894 -0.2164 71  LEU B N   
2286 C CA  . LEU B 56  ? 1.4215 1.8765 1.4181 0.1989  -0.0779 -0.2161 71  LEU B CA  
2287 C C   . LEU B 56  ? 1.4690 1.9731 1.4639 0.1948  -0.0532 -0.1976 71  LEU B C   
2288 O O   . LEU B 56  ? 1.5882 2.1205 1.5779 0.2083  -0.0455 -0.2017 71  LEU B O   
2289 C CB  . LEU B 56  ? 1.3684 1.7958 1.4003 0.1758  -0.0792 -0.2118 71  LEU B CB  
2290 C CG  . LEU B 56  ? 1.3682 1.7490 1.4140 0.1760  -0.1009 -0.2246 71  LEU B CG  
2291 C CD1 . LEU B 56  ? 1.3313 1.6940 1.4101 0.1536  -0.0961 -0.2142 71  LEU B CD1 
2292 C CD2 . LEU B 56  ? 1.3945 1.7664 1.4299 0.2009  -0.1166 -0.2469 71  LEU B CD2 
2293 N N   . TYR B 57  ? 1.5009 2.0152 1.5039 0.1760  -0.0416 -0.1763 72  TYR B N   
2294 C CA  . TYR B 57  ? 1.5001 2.0603 1.5104 0.1685  -0.0189 -0.1548 72  TYR B CA  
2295 C C   . TYR B 57  ? 1.5088 2.0943 1.5017 0.1725  -0.0091 -0.1370 72  TYR B C   
2296 O O   . TYR B 57  ? 1.4865 2.1151 1.4841 0.1717  0.0094  -0.1186 72  TYR B O   
2297 C CB  . TYR B 57  ? 1.4791 2.0330 1.5266 0.1379  -0.0112 -0.1412 72  TYR B CB  
2298 C CG  . TYR B 57  ? 1.4842 2.0093 1.5476 0.1330  -0.0210 -0.1558 72  TYR B CG  
2299 C CD1 . TYR B 57  ? 1.4993 2.0372 1.5605 0.1477  -0.0217 -0.1682 72  TYR B CD1 
2300 C CD2 . TYR B 57  ? 1.4877 1.9739 1.5681 0.1155  -0.0291 -0.1559 72  TYR B CD2 
2301 C CE1 . TYR B 57  ? 1.4977 2.0098 1.5730 0.1444  -0.0304 -0.1790 72  TYR B CE1 
2302 C CE2 . TYR B 57  ? 1.4955 1.9581 1.5898 0.1129  -0.0363 -0.1659 72  TYR B CE2 
2303 C CZ  . TYR B 57  ? 1.5123 1.9874 1.6037 0.1270  -0.0371 -0.1769 72  TYR B CZ  
2304 O OH  . TYR B 57  ? 1.5447 1.9971 1.6498 0.1251  -0.0438 -0.1841 72  TYR B OH  
2305 N N   . ASN B 58  ? 1.5703 2.1307 1.5452 0.1771  -0.0218 -0.1410 73  ASN B N   
2306 C CA  . ASN B 58  ? 1.6341 2.2108 1.5961 0.1762  -0.0141 -0.1209 73  ASN B CA  
2307 C C   . ASN B 58  ? 1.5649 2.1630 1.5573 0.1498  0.0050  -0.0908 73  ASN B C   
2308 O O   . ASN B 58  ? 1.6207 2.2552 1.6065 0.1532  0.0202  -0.0686 73  ASN B O   
2309 C CB  . ASN B 58  ? 1.7127 2.3229 1.6328 0.2094  -0.0106 -0.1237 73  ASN B CB  
2310 C CG  . ASN B 58  ? 1.7833 2.3650 1.6714 0.2361  -0.0349 -0.1549 73  ASN B CG  
2311 O OD1 . ASN B 58  ? 1.7610 2.2982 1.6541 0.2290  -0.0554 -0.1672 73  ASN B OD1 
2312 N ND2 . ASN B 58  ? 1.8550 2.4624 1.7124 0.2674  -0.0336 -0.1678 73  ASN B ND2 
2313 N N   . PHE B 59  ? 1.4369 2.0108 1.4635 0.1242  0.0031  -0.0902 74  PHE B N   
2314 C CA  . PHE B 59  ? 1.3261 1.9074 1.3853 0.0972  0.0150  -0.0670 74  PHE B CA  
2315 C C   . PHE B 59  ? 1.2616 1.8016 1.3287 0.0818  0.0042  -0.0654 74  PHE B C   
2316 O O   . PHE B 59  ? 1.2264 1.7299 1.2995 0.0778  -0.0088 -0.0819 74  PHE B O   
2317 C CB  . PHE B 59  ? 1.3007 1.8846 1.3893 0.0833  0.0188  -0.0709 74  PHE B CB  
2318 C CG  . PHE B 59  ? 1.3037 1.8935 1.4279 0.0565  0.0277  -0.0508 74  PHE B CG  
2319 C CD1 . PHE B 59  ? 1.3528 1.9858 1.4922 0.0519  0.0435  -0.0277 74  PHE B CD1 
2320 C CD2 . PHE B 59  ? 1.2863 1.8389 1.4304 0.0369  0.0199  -0.0542 74  PHE B CD2 
2321 C CE1 . PHE B 59  ? 1.3620 1.9978 1.5393 0.0262  0.0488  -0.0095 74  PHE B CE1 
2322 C CE2 . PHE B 59  ? 1.3374 1.8925 1.5142 0.0136  0.0255  -0.0384 74  PHE B CE2 
2323 C CZ  . PHE B 59  ? 1.3556 1.9507 1.5504 0.0074  0.0387  -0.0165 74  PHE B CZ  
2324 N N   . SER B 60  ? 1.2229 1.7699 1.2911 0.0746  0.0099  -0.0443 75  SER B N   
2325 C CA  . SER B 60  ? 1.1690 1.6791 1.2459 0.0608  0.0002  -0.0411 75  SER B CA  
2326 C C   . SER B 60  ? 1.0849 1.5783 1.2011 0.0329  0.0037  -0.0333 75  SER B C   
2327 O O   . SER B 60  ? 0.9260 1.4420 1.0650 0.0190  0.0161  -0.0151 75  SER B O   
2328 C CB  . SER B 60  ? 1.2019 1.7242 1.2639 0.0651  0.0037  -0.0210 75  SER B CB  
2329 O OG  . SER B 60  ? 1.1947 1.6808 1.2668 0.0525  -0.0066 -0.0189 75  SER B OG  
2330 N N   . LEU B 61  ? 1.0755 1.5291 1.2003 0.0260  -0.0082 -0.0468 76  LEU B N   
2331 C CA  . LEU B 61  ? 1.0304 1.4620 1.1863 0.0036  -0.0074 -0.0420 76  LEU B CA  
2332 C C   . LEU B 61  ? 1.0557 1.4760 1.2208 -0.0078 -0.0072 -0.0240 76  LEU B C   
2333 O O   . LEU B 61  ? 0.9513 1.3622 1.1436 -0.0263 -0.0038 -0.0149 76  LEU B O   
2334 C CB  . LEU B 61  ? 0.9979 1.3953 1.1585 0.0037  -0.0180 -0.0612 76  LEU B CB  
2335 C CG  . LEU B 61  ? 0.9781 1.3819 1.1357 0.0121  -0.0185 -0.0774 76  LEU B CG  
2336 C CD1 . LEU B 61  ? 0.9505 1.3203 1.1127 0.0141  -0.0290 -0.0920 76  LEU B CD1 
2337 C CD2 . LEU B 61  ? 0.9809 1.4029 1.1581 0.0002  -0.0086 -0.0730 76  LEU B CD2 
2338 N N   . PHE B 62  ? 1.1389 1.5617 1.2812 0.0043  -0.0115 -0.0187 77  PHE B N   
2339 C CA  . PHE B 62  ? 1.2142 1.6253 1.3637 -0.0045 -0.0127 -0.0014 77  PHE B CA  
2340 C C   . PHE B 62  ? 1.2029 1.6446 1.3630 -0.0127 0.0013  0.0256  77  PHE B C   
2341 O O   . PHE B 62  ? 1.2217 1.6538 1.3950 -0.0234 0.0017  0.0428  77  PHE B O   
2342 C CB  . PHE B 62  ? 1.2505 1.6509 1.3726 0.0113  -0.0248 -0.0048 77  PHE B CB  
2343 C CG  . PHE B 62  ? 1.3487 1.7436 1.4469 0.0308  -0.0365 -0.0286 77  PHE B CG  
2344 C CD1 . PHE B 62  ? 1.3884 1.7607 1.4996 0.0280  -0.0434 -0.0479 77  PHE B CD1 
2345 C CD2 . PHE B 62  ? 1.4352 1.8478 1.4975 0.0537  -0.0413 -0.0317 77  PHE B CD2 
2346 C CE1 . PHE B 62  ? 1.5045 1.8699 1.5974 0.0459  -0.0558 -0.0691 77  PHE B CE1 
2347 C CE2 . PHE B 62  ? 1.5079 1.9123 1.5491 0.0730  -0.0552 -0.0561 77  PHE B CE2 
2348 C CZ  . PHE B 62  ? 1.5419 1.9222 1.6007 0.0681  -0.0627 -0.0742 77  PHE B CZ  
2349 N N   . HIS B 63  ? 1.1724 1.6514 1.3299 -0.0075 0.0129  0.0313  78  HIS B N   
2350 C CA  . HIS B 63  ? 1.1501 1.6634 1.3228 -0.0150 0.0276  0.0611  78  HIS B CA  
2351 C C   . HIS B 63  ? 1.1382 1.6371 1.3460 -0.0382 0.0292  0.0825  78  HIS B C   
2352 O O   . HIS B 63  ? 1.2569 1.7775 1.4699 -0.0401 0.0380  0.1101  78  HIS B O   
2353 C CB  . HIS B 63  ? 1.1122 1.6600 1.2992 -0.0165 0.0389  0.0627  78  HIS B CB  
2354 C CG  . HIS B 63  ? 1.0209 1.5501 1.2382 -0.0337 0.0346  0.0491  78  HIS B CG  
2355 N ND1 . HIS B 63  ? 0.9868 1.5072 1.1939 -0.0257 0.0287  0.0230  78  HIS B ND1 
2356 C CD2 . HIS B 63  ? 0.9804 1.4978 1.2366 -0.0568 0.0342  0.0574  78  HIS B CD2 
2357 C CE1 . HIS B 63  ? 0.9779 1.4838 1.2137 -0.0423 0.0259  0.0165  78  HIS B CE1 
2358 N NE2 . HIS B 63  ? 0.9553 1.4586 1.2206 -0.0609 0.0283  0.0355  78  HIS B NE2 
2359 N N   . CYS B 64  ? 1.0875 1.5512 1.3195 -0.0544 0.0211  0.0715  79  CYS B N   
2360 C CA  . CYS B 64  ? 1.0994 1.5457 1.3622 -0.0733 0.0204  0.0896  79  CYS B CA  
2361 C C   . CYS B 64  ? 1.0606 1.4667 1.3154 -0.0723 0.0084  0.0808  79  CYS B C   
2362 O O   . CYS B 64  ? 1.0847 1.4648 1.3654 -0.0871 0.0044  0.0855  79  CYS B O   
2363 C CB  . CYS B 64  ? 1.1364 1.5777 1.4389 -0.0931 0.0209  0.0877  79  CYS B CB  
2364 S SG  . CYS B 64  ? 1.1906 1.6740 1.5303 -0.1070 0.0336  0.1182  79  CYS B SG  
2365 N N   . GLY B 65  ? 1.0032 1.4055 1.2234 -0.0537 0.0020  0.0691  80  GLY B N   
2366 C CA  . GLY B 65  ? 0.9947 1.3609 1.2084 -0.0505 -0.0111 0.0558  80  GLY B CA  
2367 C C   . GLY B 65  ? 0.9862 1.3316 1.1985 -0.0471 -0.0184 0.0280  80  GLY B C   
2368 O O   . GLY B 65  ? 1.0413 1.3899 1.2663 -0.0533 -0.0140 0.0189  80  GLY B O   
2369 N N   . LEU B 66  ? 0.9361 1.2605 1.1349 -0.0370 -0.0303 0.0159  81  LEU B N   
2370 C CA  . LEU B 66  ? 0.8938 1.1950 1.0969 -0.0345 -0.0379 -0.0056 81  LEU B CA  
2371 C C   . LEU B 66  ? 0.8410 1.1284 1.0707 -0.0487 -0.0326 -0.0098 81  LEU B C   
2372 O O   . LEU B 66  ? 0.7855 1.0597 1.0356 -0.0610 -0.0307 0.0000  81  LEU B O   
2373 C CB  . LEU B 66  ? 0.9118 1.1866 1.1153 -0.0303 -0.0511 -0.0082 81  LEU B CB  
2374 C CG  . LEU B 66  ? 0.9283 1.1887 1.1237 -0.0179 -0.0644 -0.0270 81  LEU B CG  
2375 C CD1 . LEU B 66  ? 0.9807 1.2605 1.1451 0.0000  -0.0697 -0.0365 81  LEU B CD1 
2376 C CD2 . LEU B 66  ? 0.9308 1.1682 1.1344 -0.0170 -0.0772 -0.0241 81  LEU B CD2 
2377 N N   . LEU B 67  ? 0.8219 1.1114 1.0502 -0.0452 -0.0313 -0.0254 82  LEU B N   
2378 C CA  . LEU B 67  ? 0.7695 1.0461 1.0172 -0.0545 -0.0276 -0.0323 82  LEU B CA  
2379 C C   . LEU B 67  ? 0.7428 0.9896 1.0011 -0.0542 -0.0330 -0.0379 82  LEU B C   
2380 O O   . LEU B 67  ? 0.7986 1.0356 1.0501 -0.0452 -0.0410 -0.0418 82  LEU B O   
2381 C CB  . LEU B 67  ? 0.7524 1.0409 0.9922 -0.0477 -0.0255 -0.0465 82  LEU B CB  
2382 C CG  . LEU B 67  ? 0.7622 1.0839 0.9948 -0.0469 -0.0189 -0.0425 82  LEU B CG  
2383 C CD1 . LEU B 67  ? 0.7749 1.1051 0.9971 -0.0367 -0.0192 -0.0583 82  LEU B CD1 
2384 C CD2 . LEU B 67  ? 0.7591 1.0891 1.0139 -0.0626 -0.0126 -0.0326 82  LEU B CD2 
2385 N N   . MET B 68  ? 0.7214 0.9544 0.9970 -0.0623 -0.0293 -0.0398 83  MET B N   
2386 C CA  . MET B 68  ? 0.7006 0.9086 0.9865 -0.0592 -0.0314 -0.0455 83  MET B CA  
2387 C C   . MET B 68  ? 0.6793 0.8890 0.9568 -0.0483 -0.0331 -0.0570 83  MET B C   
2388 O O   . MET B 68  ? 0.6896 0.9155 0.9567 -0.0453 -0.0304 -0.0640 83  MET B O   
2389 C CB  . MET B 68  ? 0.6888 0.8844 0.9888 -0.0649 -0.0266 -0.0492 83  MET B CB  
2390 C CG  . MET B 68  ? 0.6966 0.8889 1.0096 -0.0768 -0.0259 -0.0408 83  MET B CG  
2391 S SD  . MET B 68  ? 0.7228 0.8981 1.0471 -0.0801 -0.0302 -0.0264 83  MET B SD  
2392 C CE  . MET B 68  ? 0.7515 0.9044 1.0829 -0.0706 -0.0308 -0.0331 83  MET B CE  
2393 N N   . PRO B 69  ? 0.6520 0.8455 0.9372 -0.0424 -0.0379 -0.0578 84  PRO B N   
2394 C CA  . PRO B 69  ? 0.6238 0.8183 0.9052 -0.0325 -0.0414 -0.0662 84  PRO B CA  
2395 C C   . PRO B 69  ? 0.6511 0.8502 0.9312 -0.0300 -0.0335 -0.0735 84  PRO B C   
2396 O O   . PRO B 69  ? 0.7112 0.9215 0.9806 -0.0235 -0.0350 -0.0807 84  PRO B O   
2397 C CB  . PRO B 69  ? 0.6112 0.7865 0.9110 -0.0296 -0.0472 -0.0620 84  PRO B CB  
2398 C CG  . PRO B 69  ? 0.6212 0.7904 0.9256 -0.0355 -0.0509 -0.0528 84  PRO B CG  
2399 C CD  . PRO B 69  ? 0.6398 0.8152 0.9404 -0.0443 -0.0420 -0.0497 84  PRO B CD  
2400 N N   . GLY B 70  ? 0.6359 0.8263 0.9254 -0.0333 -0.0261 -0.0723 85  GLY B N   
2401 C CA  . GLY B 70  ? 0.6298 0.8255 0.9142 -0.0301 -0.0192 -0.0797 85  GLY B CA  
2402 C C   . GLY B 70  ? 0.6531 0.8696 0.9236 -0.0321 -0.0191 -0.0861 85  GLY B C   
2403 O O   . GLY B 70  ? 0.7214 0.9471 0.9842 -0.0253 -0.0178 -0.0928 85  GLY B O   
2404 N N   . CYS B 71  ? 0.6750 0.9007 0.9447 -0.0410 -0.0203 -0.0820 86  CYS B N   
2405 C CA  . CYS B 71  ? 0.6927 0.9423 0.9539 -0.0432 -0.0194 -0.0849 86  CYS B CA  
2406 C C   . CYS B 71  ? 0.6690 0.9319 0.9164 -0.0335 -0.0226 -0.0878 86  CYS B C   
2407 O O   . CYS B 71  ? 0.6596 0.9381 0.8990 -0.0281 -0.0213 -0.0948 86  CYS B O   
2408 C CB  . CYS B 71  ? 0.7270 0.9847 0.9956 -0.0552 -0.0190 -0.0751 86  CYS B CB  
2409 S SG  . CYS B 71  ? 0.7714 1.0625 1.0390 -0.0601 -0.0161 -0.0735 86  CYS B SG  
2410 N N   . ARG B 72  ? 0.6470 0.9029 0.8915 -0.0299 -0.0282 -0.0837 87  ARG B N   
2411 C CA  . ARG B 72  ? 0.6674 0.9333 0.8974 -0.0189 -0.0339 -0.0889 87  ARG B CA  
2412 C C   . ARG B 72  ? 0.6520 0.9130 0.8821 -0.0096 -0.0356 -0.0987 87  ARG B C   
2413 O O   . ARG B 72  ? 0.6151 0.8911 0.8336 -0.0012 -0.0367 -0.1061 87  ARG B O   
2414 C CB  . ARG B 72  ? 0.7320 0.9869 0.9597 -0.0154 -0.0432 -0.0850 87  ARG B CB  
2415 C CG  . ARG B 72  ? 0.7862 1.0445 0.9992 -0.0010 -0.0535 -0.0944 87  ARG B CG  
2416 C CD  . ARG B 72  ? 0.8678 1.1296 1.0666 0.0043  -0.0619 -0.0913 87  ARG B CD  
2417 N NE  . ARG B 72  ? 0.9020 1.1403 1.1092 0.0078  -0.0759 -0.0928 87  ARG B NE  
2418 C CZ  . ARG B 72  ? 0.9480 1.1785 1.1487 0.0207  -0.0915 -0.1040 87  ARG B CZ  
2419 N NH1 . ARG B 72  ? 0.9350 1.1777 1.1176 0.0338  -0.0952 -0.1163 87  ARG B NH1 
2420 N NH2 . ARG B 72  ? 0.9789 1.1879 1.1941 0.0211  -0.1052 -0.1035 87  ARG B NH2 
2421 N N   . LYS B 73  ? 0.6434 0.8849 0.8876 -0.0104 -0.0345 -0.0971 88  LYS B N   
2422 C CA  . LYS B 73  ? 0.6724 0.9084 0.9205 -0.0021 -0.0344 -0.1018 88  LYS B CA  
2423 C C   . LYS B 73  ? 0.6904 0.9443 0.9284 0.0006  -0.0285 -0.1085 88  LYS B C   
2424 O O   . LYS B 73  ? 0.7069 0.9661 0.9398 0.0099  -0.0311 -0.1143 88  LYS B O   
2425 C CB  . LYS B 73  ? 0.7004 0.9175 0.9659 -0.0038 -0.0302 -0.0948 88  LYS B CB  
2426 C CG  . LYS B 73  ? 0.7733 0.9849 1.0468 0.0048  -0.0275 -0.0941 88  LYS B CG  
2427 C CD  . LYS B 73  ? 0.8289 1.0227 1.1249 0.0052  -0.0259 -0.0833 88  LYS B CD  
2428 C CE  . LYS B 73  ? 0.8818 1.0737 1.1858 0.0133  -0.0169 -0.0775 88  LYS B CE  
2429 N NZ  . LYS B 73  ? 0.9119 1.0909 1.2440 0.0168  -0.0200 -0.0656 88  LYS B NZ  
2430 N N   . HIS B 74  ? 0.6785 0.9409 0.9155 -0.0074 -0.0223 -0.1080 89  HIS B N   
2431 C CA  . HIS B 74  ? 0.6291 0.9093 0.8591 -0.0058 -0.0190 -0.1145 89  HIS B CA  
2432 C C   . HIS B 74  ? 0.6142 0.9167 0.8339 -0.0011 -0.0215 -0.1185 89  HIS B C   
2433 O O   . HIS B 74  ? 0.6365 0.9500 0.8505 0.0069  -0.0215 -0.1250 89  HIS B O   
2434 C CB  . HIS B 74  ? 0.6135 0.8978 0.8487 -0.0166 -0.0157 -0.1140 89  HIS B CB  
2435 C CG  . HIS B 74  ? 0.5957 0.8630 0.8348 -0.0152 -0.0128 -0.1156 89  HIS B CG  
2436 N ND1 . HIS B 74  ? 0.5794 0.8499 0.8115 -0.0068 -0.0108 -0.1223 89  HIS B ND1 
2437 C CD2 . HIS B 74  ? 0.5833 0.8314 0.8305 -0.0187 -0.0111 -0.1112 89  HIS B CD2 
2438 C CE1 . HIS B 74  ? 0.5896 0.8445 0.8233 -0.0041 -0.0076 -0.1221 89  HIS B CE1 
2439 N NE2 . HIS B 74  ? 0.5881 0.8293 0.8318 -0.0114 -0.0075 -0.1159 89  HIS B NE2 
2440 N N   . PHE B 75  ? 0.5929 0.9034 0.8095 -0.0045 -0.0230 -0.1139 90  PHE B N   
2441 C CA  . PHE B 75  ? 0.6068 0.9424 0.8118 0.0020  -0.0234 -0.1165 90  PHE B CA  
2442 C C   . PHE B 75  ? 0.6157 0.9454 0.8109 0.0174  -0.0307 -0.1252 90  PHE B C   
2443 O O   . PHE B 75  ? 0.5787 0.9266 0.7645 0.0273  -0.0310 -0.1319 90  PHE B O   
2444 C CB  . PHE B 75  ? 0.6417 0.9890 0.8434 -0.0028 -0.0220 -0.1073 90  PHE B CB  
2445 C CG  . PHE B 75  ? 0.6601 1.0229 0.8737 -0.0165 -0.0153 -0.0983 90  PHE B CG  
2446 C CD1 . PHE B 75  ? 0.6791 1.0728 0.8941 -0.0163 -0.0104 -0.0977 90  PHE B CD1 
2447 C CD2 . PHE B 75  ? 0.6993 1.0458 0.9265 -0.0295 -0.0147 -0.0901 90  PHE B CD2 
2448 C CE1 . PHE B 75  ? 0.7019 1.1102 0.9350 -0.0305 -0.0060 -0.0882 90  PHE B CE1 
2449 C CE2 . PHE B 75  ? 0.7206 1.0791 0.9637 -0.0430 -0.0108 -0.0820 90  PHE B CE2 
2450 C CZ  . PHE B 75  ? 0.7233 1.1128 0.9710 -0.0442 -0.0069 -0.0806 90  PHE B CZ  
2451 N N   . ILE B 76  ? 0.6257 0.9297 0.8261 0.0197  -0.0376 -0.1249 91  ILE B N   
2452 C CA  . ILE B 76  ? 0.6461 0.9405 0.8430 0.0332  -0.0478 -0.1330 91  ILE B CA  
2453 C C   . ILE B 76  ? 0.6640 0.9576 0.8657 0.0390  -0.0460 -0.1373 91  ILE B C   
2454 O O   . ILE B 76  ? 0.6905 0.9896 0.8851 0.0516  -0.0517 -0.1460 91  ILE B O   
2455 C CB  . ILE B 76  ? 0.6493 0.9162 0.8581 0.0330  -0.0576 -0.1303 91  ILE B CB  
2456 C CG1 . ILE B 76  ? 0.6386 0.9078 0.8373 0.0321  -0.0628 -0.1284 91  ILE B CG1 
2457 C CG2 . ILE B 76  ? 0.6845 0.9385 0.8972 0.0459  -0.0700 -0.1389 91  ILE B CG2 
2458 C CD1 . ILE B 76  ? 0.6417 0.8861 0.8544 0.0295  -0.0727 -0.1244 91  ILE B CD1 
2459 N N   . GLN B 77  ? 0.6287 0.9150 0.8411 0.0317  -0.0387 -0.1314 92  GLN B N   
2460 C CA  . GLN B 77  ? 0.6208 0.9077 0.8356 0.0378  -0.0357 -0.1331 92  GLN B CA  
2461 C C   . GLN B 77  ? 0.6312 0.9444 0.8339 0.0420  -0.0332 -0.1403 92  GLN B C   
2462 O O   . GLN B 77  ? 0.6533 0.9707 0.8534 0.0528  -0.0357 -0.1453 92  GLN B O   
2463 C CB  . GLN B 77  ? 0.6277 0.9060 0.8502 0.0316  -0.0276 -0.1263 92  GLN B CB  
2464 C CG  . GLN B 77  ? 0.6383 0.8926 0.8768 0.0304  -0.0285 -0.1173 92  GLN B CG  
2465 C CD  . GLN B 77  ? 0.6387 0.8859 0.8826 0.0279  -0.0190 -0.1104 92  GLN B CD  
2466 O OE1 . GLN B 77  ? 0.6263 0.8826 0.8612 0.0238  -0.0135 -0.1139 92  GLN B OE1 
2467 N NE2 . GLN B 77  ? 0.6604 0.8915 0.9206 0.0312  -0.0177 -0.1006 92  GLN B NE2 
2468 N N   . ALA B 78  ? 0.6399 0.9718 0.8383 0.0336  -0.0285 -0.1394 93  ALA B N   
2469 C CA  . ALA B 78  ? 0.6779 1.0390 0.8698 0.0369  -0.0260 -0.1443 93  ALA B CA  
2470 C C   . ALA B 78  ? 0.6879 1.0578 0.8694 0.0519  -0.0315 -0.1516 93  ALA B C   
2471 O O   . ALA B 78  ? 0.6704 1.0536 0.8485 0.0615  -0.0319 -0.1576 93  ALA B O   
2472 C CB  . ALA B 78  ? 0.6872 1.0681 0.8823 0.0246  -0.0207 -0.1388 93  ALA B CB  
2473 N N   . ILE B 79  ? 0.7139 1.0748 0.8899 0.0552  -0.0370 -0.1519 94  ILE B N   
2474 C CA  . ILE B 79  ? 0.7555 1.1215 0.9187 0.0718  -0.0447 -0.1614 94  ILE B CA  
2475 C C   . ILE B 79  ? 0.7925 1.1382 0.9613 0.0828  -0.0537 -0.1685 94  ILE B C   
2476 O O   . ILE B 79  ? 0.7858 1.1422 0.9474 0.0969  -0.0572 -0.1775 94  ILE B O   
2477 C CB  . ILE B 79  ? 0.7666 1.1246 0.9207 0.0741  -0.0512 -0.1614 94  ILE B CB  
2478 C CG1 . ILE B 79  ? 0.7501 1.1325 0.8984 0.0654  -0.0413 -0.1516 94  ILE B CG1 
2479 C CG2 . ILE B 79  ? 0.7998 1.1580 0.9382 0.0948  -0.0628 -0.1751 94  ILE B CG2 
2480 C CD1 . ILE B 79  ? 0.7644 1.1384 0.9040 0.0655  -0.0463 -0.1479 94  ILE B CD1 
2481 N N   . CYS B 80  ? 0.8271 1.1445 1.0110 0.0770  -0.0571 -0.1629 95  CYS B N   
2482 C CA  . CYS B 80  ? 0.8416 1.1385 1.0376 0.0858  -0.0653 -0.1648 95  CYS B CA  
2483 C C   . CYS B 80  ? 0.8284 1.1400 1.0224 0.0920  -0.0598 -0.1664 95  CYS B C   
2484 O O   . CYS B 80  ? 0.8187 1.1288 1.0121 0.1056  -0.0673 -0.1738 95  CYS B O   
2485 C CB  . CYS B 80  ? 0.8329 1.1042 1.0496 0.0770  -0.0650 -0.1532 95  CYS B CB  
2486 S SG  . CYS B 80  ? 0.8709 1.1182 1.0979 0.0743  -0.0781 -0.1528 95  CYS B SG  
2487 N N   . PHE B 81  ? 0.8060 1.1310 0.9990 0.0826  -0.0483 -0.1604 96  PHE B N   
2488 C CA  . PHE B 81  ? 0.8157 1.1579 1.0055 0.0871  -0.0433 -0.1617 96  PHE B CA  
2489 C C   . PHE B 81  ? 0.8349 1.2024 1.0141 0.0977  -0.0454 -0.1716 96  PHE B C   
2490 O O   . PHE B 81  ? 0.8529 1.2221 1.0321 0.1101  -0.0492 -0.1759 96  PHE B O   
2491 C CB  . PHE B 81  ? 0.8043 1.1574 0.9935 0.0743  -0.0340 -0.1568 96  PHE B CB  
2492 C CG  . PHE B 81  ? 0.7775 1.1490 0.9631 0.0783  -0.0309 -0.1593 96  PHE B CG  
2493 C CD1 . PHE B 81  ? 0.7896 1.1543 0.9758 0.0896  -0.0326 -0.1579 96  PHE B CD1 
2494 C CD2 . PHE B 81  ? 0.7786 1.1743 0.9626 0.0705  -0.0274 -0.1618 96  PHE B CD2 
2495 C CE1 . PHE B 81  ? 0.7947 1.1767 0.9758 0.0946  -0.0311 -0.1603 96  PHE B CE1 
2496 C CE2 . PHE B 81  ? 0.8055 1.2180 0.9878 0.0742  -0.0273 -0.1652 96  PHE B CE2 
2497 C CZ  . PHE B 81  ? 0.8059 1.2117 0.9847 0.0870  -0.0293 -0.1651 96  PHE B CZ  
2498 N N   . TYR B 82  ? 0.8450 1.2332 1.0165 0.0937  -0.0420 -0.1736 97  TYR B N   
2499 C CA  . TYR B 82  ? 0.8591 1.2772 1.0212 0.1047  -0.0413 -0.1809 97  TYR B CA  
2500 C C   . TYR B 82  ? 0.9039 1.3111 1.0590 0.1240  -0.0521 -0.1918 97  TYR B C   
2501 O O   . TYR B 82  ? 0.8599 1.2824 1.0108 0.1384  -0.0538 -0.1993 97  TYR B O   
2502 C CB  . TYR B 82  ? 0.8838 1.3242 1.0405 0.0976  -0.0348 -0.1769 97  TYR B CB  
2503 C CG  . TYR B 82  ? 0.9819 1.4606 1.1318 0.1080  -0.0300 -0.1802 97  TYR B CG  
2504 C CD1 . TYR B 82  ? 1.0535 1.5395 1.1874 0.1264  -0.0339 -0.1885 97  TYR B CD1 
2505 C CD2 . TYR B 82  ? 1.0358 1.5449 1.1963 0.1006  -0.0220 -0.1750 97  TYR B CD2 
2506 C CE1 . TYR B 82  ? 1.1133 1.6381 1.2408 0.1382  -0.0273 -0.1902 97  TYR B CE1 
2507 C CE2 . TYR B 82  ? 1.0785 1.6267 1.2377 0.1100  -0.0163 -0.1754 97  TYR B CE2 
2508 C CZ  . TYR B 82  ? 1.1188 1.6759 1.2608 0.1293  -0.0176 -0.1822 97  TYR B CZ  
2509 O OH  . TYR B 82  ? 1.2252 1.8243 1.3657 0.1408  -0.0099 -0.1813 97  TYR B OH  
2510 N N   . GLU B 83  ? 0.9199 1.2995 1.0754 0.1249  -0.0610 -0.1934 98  GLU B N   
2511 C CA  . GLU B 83  ? 0.9766 1.3427 1.1260 0.1430  -0.0750 -0.2061 98  GLU B CA  
2512 C C   . GLU B 83  ? 1.0096 1.3499 1.1747 0.1493  -0.0842 -0.2071 98  GLU B C   
2513 O O   . GLU B 83  ? 1.0951 1.4307 1.2576 0.1667  -0.0950 -0.2187 98  GLU B O   
2514 C CB  . GLU B 83  ? 1.0048 1.3539 1.1483 0.1427  -0.0839 -0.2090 98  GLU B CB  
2515 C CG  . GLU B 83  ? 1.0252 1.4019 1.1498 0.1416  -0.0756 -0.2076 98  GLU B CG  
2516 C CD  . GLU B 83  ? 1.0600 1.4636 1.1628 0.1630  -0.0762 -0.2194 98  GLU B CD  
2517 O OE1 . GLU B 83  ? 1.0911 1.4844 1.1904 0.1813  -0.0882 -0.2336 98  GLU B OE1 
2518 O OE2 . GLU B 83  ? 1.0782 1.5142 1.1686 0.1623  -0.0645 -0.2136 98  GLU B OE2 
2519 N N   . CYS B 84  ? 1.0193 1.3439 1.2010 0.1368  -0.0798 -0.1942 99  CYS B N   
2520 C CA  . CYS B 84  ? 1.0183 1.3160 1.2198 0.1413  -0.0878 -0.1895 99  CYS B CA  
2521 C C   . CYS B 84  ? 0.9980 1.3044 1.2041 0.1443  -0.0807 -0.1825 99  CYS B C   
2522 O O   . CYS B 84  ? 0.9970 1.2859 1.2175 0.1532  -0.0883 -0.1798 99  CYS B O   
2523 C CB  . CYS B 84  ? 1.0089 1.2806 1.2291 0.1286  -0.0887 -0.1771 99  CYS B CB  
2524 S SG  . CYS B 84  ? 1.0165 1.2725 1.2353 0.1263  -0.1014 -0.1847 99  CYS B SG  
2525 N N   . SER B 85  ? 0.9551 1.2871 1.1509 0.1375  -0.0678 -0.1792 100 SER B N   
2526 C CA  . SER B 85  ? 0.9603 1.2998 1.1584 0.1402  -0.0618 -0.1720 100 SER B CA  
2527 C C   . SER B 85  ? 0.9679 1.3174 1.1638 0.1570  -0.0677 -0.1794 100 SER B C   
2528 O O   . SER B 85  ? 1.0221 1.3943 1.2070 0.1632  -0.0682 -0.1907 100 SER B O   
2529 C CB  . SER B 85  ? 0.9426 1.3068 1.1309 0.1298  -0.0507 -0.1701 100 SER B CB  
2530 O OG  . SER B 85  ? 0.9298 1.3019 1.1169 0.1349  -0.0473 -0.1654 100 SER B OG  
2531 N N   . PRO B 86  ? 0.9939 1.3285 1.2013 0.1652  -0.0709 -0.1713 101 PRO B N   
2532 C CA  . PRO B 86  ? 1.0028 1.3466 1.2095 0.1815  -0.0760 -0.1763 101 PRO B CA  
2533 C C   . PRO B 86  ? 0.9597 1.3297 1.1569 0.1824  -0.0674 -0.1724 101 PRO B C   
2534 O O   . PRO B 86  ? 0.9982 1.3757 1.1959 0.1958  -0.0709 -0.1735 101 PRO B O   
2535 C CB  . PRO B 86  ? 1.0224 1.3343 1.2505 0.1880  -0.0841 -0.1655 101 PRO B CB  
2536 C CG  . PRO B 86  ? 1.0289 1.3290 1.2650 0.1748  -0.0750 -0.1482 101 PRO B CG  
2537 C CD  . PRO B 86  ? 1.0162 1.3253 1.2406 0.1605  -0.0693 -0.1544 101 PRO B CD  
2538 N N   . ASN B 87  ? 0.9128 1.2951 1.1023 0.1690  -0.0579 -0.1687 102 ASN B N   
2539 C CA  . ASN B 87  ? 0.9183 1.3201 1.0999 0.1696  -0.0526 -0.1653 102 ASN B CA  
2540 C C   . ASN B 87  ? 0.9159 1.3483 1.0899 0.1608  -0.0494 -0.1751 102 ASN B C   
2541 O O   . ASN B 87  ? 0.9614 1.4045 1.1308 0.1525  -0.0453 -0.1734 102 ASN B O   
2542 C CB  . ASN B 87  ? 0.9401 1.3258 1.1216 0.1636  -0.0459 -0.1512 102 ASN B CB  
2543 C CG  . ASN B 87  ? 0.9823 1.3396 1.1782 0.1708  -0.0475 -0.1367 102 ASN B CG  
2544 O OD1 . ASN B 87  ? 1.0733 1.4115 1.2776 0.1633  -0.0433 -0.1262 102 ASN B OD1 
2545 N ND2 . ASN B 87  ? 0.9890 1.3439 1.1911 0.1851  -0.0537 -0.1345 102 ASN B ND2 
2546 N N   . LEU B 88  ? 0.9164 1.3637 1.0906 0.1638  -0.0517 -0.1848 103 LEU B N   
2547 C CA  . LEU B 88  ? 0.9184 1.3979 1.0912 0.1555  -0.0475 -0.1903 103 LEU B CA  
2548 C C   . LEU B 88  ? 0.9152 1.4285 1.0895 0.1666  -0.0491 -0.1967 103 LEU B C   
2549 O O   . LEU B 88  ? 0.9094 1.4540 1.0884 0.1596  -0.0455 -0.1986 103 LEU B O   
2550 C CB  . LEU B 88  ? 0.9446 1.4224 1.1162 0.1497  -0.0457 -0.1931 103 LEU B CB  
2551 C CG  . LEU B 88  ? 0.9779 1.4279 1.1504 0.1359  -0.0438 -0.1866 103 LEU B CG  
2552 C CD1 . LEU B 88  ? 0.9614 1.4177 1.1310 0.1298  -0.0417 -0.1888 103 LEU B CD1 
2553 C CD2 . LEU B 88  ? 0.9793 1.4275 1.1535 0.1225  -0.0391 -0.1799 103 LEU B CD2 
2554 N N   . GLY B 89  ? 0.9307 1.4389 1.1046 0.1837  -0.0547 -0.1985 104 GLY B N   
2555 C CA  . GLY B 89  ? 0.9717 1.5111 1.1481 0.1972  -0.0568 -0.2053 104 GLY B CA  
2556 C C   . GLY B 89  ? 0.9574 1.5349 1.1402 0.1894  -0.0538 -0.2056 104 GLY B C   
2557 O O   . GLY B 89  ? 0.9300 1.5398 1.1191 0.1911  -0.0505 -0.2095 104 GLY B O   
2558 N N   . PRO B 90  ? 0.9386 1.5135 1.1208 0.1813  -0.0553 -0.2012 105 PRO B N   
2559 C CA  . PRO B 90  ? 0.9196 1.5276 1.1111 0.1740  -0.0568 -0.2031 105 PRO B CA  
2560 C C   . PRO B 90  ? 0.9304 1.5614 1.1346 0.1584  -0.0515 -0.2029 105 PRO B C   
2561 O O   . PRO B 90  ? 0.9379 1.6037 1.1577 0.1547  -0.0532 -0.2041 105 PRO B O   
2562 C CB  . PRO B 90  ? 0.9013 1.4917 1.0846 0.1678  -0.0601 -0.2000 105 PRO B CB  
2563 C CG  . PRO B 90  ? 0.9283 1.4858 1.0994 0.1793  -0.0599 -0.1942 105 PRO B CG  
2564 C CD  . PRO B 90  ? 0.9440 1.4860 1.1174 0.1809  -0.0565 -0.1942 105 PRO B CD  
2565 N N   . TRP B 91  ? 0.9311 1.5452 1.1316 0.1495  -0.0457 -0.2002 106 TRP B N   
2566 C CA  . TRP B 91  ? 0.9415 1.5775 1.1548 0.1344  -0.0399 -0.1967 106 TRP B CA  
2567 C C   . TRP B 91  ? 0.9512 1.6041 1.1639 0.1425  -0.0332 -0.1965 106 TRP B C   
2568 O O   . TRP B 91  ? 0.9348 1.6096 1.1583 0.1320  -0.0265 -0.1905 106 TRP B O   
2569 C CB  . TRP B 91  ? 0.9318 1.5420 1.1431 0.1164  -0.0383 -0.1923 106 TRP B CB  
2570 C CG  . TRP B 91  ? 0.8859 1.4845 1.0964 0.1105  -0.0446 -0.1939 106 TRP B CG  
2571 C CD1 . TRP B 91  ? 0.8588 1.4727 1.0836 0.0975  -0.0494 -0.1949 106 TRP B CD1 
2572 C CD2 . TRP B 91  ? 0.8788 1.4490 1.0733 0.1195  -0.0479 -0.1946 106 TRP B CD2 
2573 N NE1 . TRP B 91  ? 0.8847 1.4804 1.0986 0.0997  -0.0563 -0.1990 106 TRP B NE1 
2574 C CE2 . TRP B 91  ? 0.9050 1.4751 1.0994 0.1135  -0.0539 -0.1973 106 TRP B CE2 
2575 C CE3 . TRP B 91  ? 0.8831 1.4279 1.0651 0.1327  -0.0470 -0.1924 106 TRP B CE3 
2576 C CZ2 . TRP B 91  ? 0.9095 1.4568 1.0868 0.1221  -0.0564 -0.1968 106 TRP B CZ2 
2577 C CZ3 . TRP B 91  ? 0.8817 1.4043 1.0525 0.1389  -0.0490 -0.1891 106 TRP B CZ3 
2578 C CH2 . TRP B 91  ? 0.8760 1.4015 1.0423 0.1347  -0.0525 -0.1909 106 TRP B CH2 
2579 N N   . ILE B 92  ? 1.0165 1.6603 1.2170 0.1625  -0.0353 -0.2027 107 ILE B N   
2580 C CA  . ILE B 92  ? 1.0642 1.7258 1.2596 0.1758  -0.0302 -0.2057 107 ILE B CA  
2581 C C   . ILE B 92  ? 1.0986 1.8123 1.3099 0.1809  -0.0245 -0.2036 107 ILE B C   
2582 O O   . ILE B 92  ? 1.0914 1.8219 1.3132 0.1860  -0.0289 -0.2055 107 ILE B O   
2583 C CB  . ILE B 92  ? 1.0386 1.6758 1.2188 0.1980  -0.0369 -0.2156 107 ILE B CB  
2584 C CG1 . ILE B 92  ? 1.0698 1.6588 1.2404 0.1921  -0.0421 -0.2153 107 ILE B CG1 
2585 C CG2 . ILE B 92  ? 1.0453 1.7039 1.2169 0.2153  -0.0328 -0.2217 107 ILE B CG2 
2586 C CD1 . ILE B 92  ? 1.1058 1.6663 1.2670 0.2112  -0.0513 -0.2245 107 ILE B CD1 
2587 N N   . GLN B 93  ? 1.1215 1.8619 1.3353 0.1802  -0.0145 -0.1981 108 GLN B N   
2588 C CA  . GLN B 93  ? 1.1523 1.9459 1.3828 0.1875  -0.0064 -0.1933 108 GLN B CA  
2589 C C   . GLN B 93  ? 1.2043 2.0163 1.4215 0.2015  0.0040  -0.1916 108 GLN B C   
2590 O O   . GLN B 93  ? 1.1856 1.9734 1.3866 0.1968  0.0054  -0.1906 108 GLN B O   
2591 C CB  . GLN B 93  ? 1.1473 1.9679 1.4083 0.1639  -0.0033 -0.1804 108 GLN B CB  
2592 C CG  . GLN B 93  ? 1.1522 1.9569 1.4237 0.1521  -0.0153 -0.1839 108 GLN B CG  
2593 C CD  . GLN B 93  ? 1.1728 2.0046 1.4777 0.1303  -0.0160 -0.1740 108 GLN B CD  
2594 O OE1 . GLN B 93  ? 1.1944 2.0576 1.5191 0.1218  -0.0062 -0.1613 108 GLN B OE1 
2595 N NE2 . GLN B 93  ? 1.1665 1.9859 1.4787 0.1217  -0.0284 -0.1792 108 GLN B NE2 
2596 N N   . PRO B 94  ? 1.2462 2.1020 1.4685 0.2207  0.0114  -0.1915 109 PRO B N   
2597 C CA  . PRO B 94  ? 1.2764 2.1542 1.4826 0.2368  0.0230  -0.1891 109 PRO B CA  
2598 C C   . PRO B 94  ? 1.2819 2.1944 1.5074 0.2185  0.0374  -0.1675 109 PRO B C   
2599 O O   . PRO B 94  ? 1.3369 2.2729 1.5967 0.1989  0.0392  -0.1551 109 PRO B O   
2600 C CB  . PRO B 94  ? 1.2780 2.1929 1.4848 0.2653  0.0266  -0.1958 109 PRO B CB  
2601 C CG  . PRO B 94  ? 1.2613 2.1627 1.4805 0.2645  0.0141  -0.2039 109 PRO B CG  
2602 C CD  . PRO B 94  ? 1.2221 2.1082 1.4610 0.2328  0.0094  -0.1946 109 PRO B CD  
2603 N N   . VAL B 95  ? 1.2595 2.1750 1.4645 0.2257  0.0461  -0.1628 110 VAL B N   
2604 C CA  . VAL B 95  ? 1.2023 2.1502 1.4247 0.2099  0.0608  -0.1393 110 VAL B CA  
2605 C C   . VAL B 95  ? 1.1700 2.1825 1.4040 0.2286  0.0775  -0.1275 110 VAL B C   
2606 O O   . VAL B 95  ? 1.1249 2.1788 1.3902 0.2146  0.0906  -0.1037 110 VAL B O   
2607 C CB  . VAL B 95  ? 1.2131 2.1375 1.4069 0.2101  0.0634  -0.1366 110 VAL B CB  
2608 C CG1 . VAL B 95  ? 1.1969 2.1444 1.4161 0.1859  0.0754  -0.1100 110 VAL B CG1 
2609 C CG2 . VAL B 95  ? 1.2119 2.0710 1.3853 0.2028  0.0464  -0.1531 110 VAL B CG2 
2610 N N   . GLY B 108 ? 1.4666 2.2419 1.5290 0.3539  -0.0098 -0.2676 123 GLY B N   
2611 C CA  . GLY B 108 ? 1.4425 2.2244 1.5066 0.3304  0.0004  -0.2498 123 GLY B CA  
2612 C C   . GLY B 108 ? 1.4174 2.2028 1.5151 0.2970  0.0051  -0.2324 123 GLY B C   
2613 O O   . GLY B 108 ? 1.3801 2.2103 1.5002 0.2917  0.0173  -0.2196 123 GLY B O   
2614 N N   . GLU B 109 ? 1.4145 2.1533 1.5167 0.2757  -0.0054 -0.2324 124 GLU B N   
2615 C CA  . GLU B 109 ? 1.3332 2.0668 1.4628 0.2478  -0.0049 -0.2208 124 GLU B CA  
2616 C C   . GLU B 109 ? 1.2522 1.9617 1.3857 0.2208  -0.0043 -0.2100 124 GLU B C   
2617 O O   . GLU B 109 ? 1.2030 1.8843 1.3187 0.2222  -0.0091 -0.2140 124 GLU B O   
2618 C CB  . GLU B 109 ? 1.2587 1.9589 1.3931 0.2507  -0.0189 -0.2313 124 GLU B CB  
2619 C CG  . GLU B 109 ? 1.2127 1.9234 1.3422 0.2788  -0.0240 -0.2447 124 GLU B CG  
2620 C CD  . GLU B 109 ? 1.1551 1.8348 1.2939 0.2780  -0.0364 -0.2495 124 GLU B CD  
2621 O OE1 . GLU B 109 ? 1.1061 1.7386 1.2403 0.2732  -0.0475 -0.2532 124 GLU B OE1 
2622 O OE2 . GLU B 109 ? 1.1650 1.8694 1.3178 0.2820  -0.0349 -0.2477 124 GLU B OE2 
2623 N N   . ARG B 110 ? 1.1888 1.9088 1.3469 0.1974  -0.0001 -0.1976 125 ARG B N   
2624 C CA  . ARG B 110 ? 1.1249 1.8242 1.2914 0.1712  0.0003  -0.1872 125 ARG B CA  
2625 C C   . ARG B 110 ? 1.0614 1.7467 1.2454 0.1561  -0.0058 -0.1868 125 ARG B C   
2626 O O   . ARG B 110 ? 1.0733 1.7622 1.2604 0.1666  -0.0110 -0.1941 125 ARG B O   
2627 C CB  . ARG B 110 ? 1.1108 1.8480 1.2906 0.1592  0.0139  -0.1699 125 ARG B CB  
2628 C CG  . ARG B 110 ? 1.1257 1.9069 1.3358 0.1518  0.0203  -0.1602 125 ARG B CG  
2629 C CD  . ARG B 110 ? 1.1354 1.9407 1.3690 0.1303  0.0301  -0.1399 125 ARG B CD  
2630 N NE  . ARG B 110 ? 1.1169 1.8880 1.3612 0.1054  0.0226  -0.1377 125 ARG B NE  
2631 C CZ  . ARG B 110 ? 1.1103 1.8889 1.3767 0.0835  0.0268  -0.1220 125 ARG B CZ  
2632 N NH1 . ARG B 110 ? 1.0977 1.9186 1.3809 0.0815  0.0395  -0.1039 125 ARG B NH1 
2633 N NH2 . ARG B 110 ? 1.1534 1.8973 1.4264 0.0643  0.0185  -0.1234 125 ARG B NH2 
2634 N N   . VAL B 111 ? 0.9936 1.6653 1.1885 0.1330  -0.0053 -0.1782 126 VAL B N   
2635 C CA  . VAL B 111 ? 0.8984 1.5519 1.1036 0.1206  -0.0121 -0.1793 126 VAL B CA  
2636 C C   . VAL B 111 ? 0.8378 1.5096 1.0667 0.0982  -0.0088 -0.1685 126 VAL B C   
2637 O O   . VAL B 111 ? 0.7949 1.4733 1.0292 0.0874  -0.0023 -0.1585 126 VAL B O   
2638 C CB  . VAL B 111 ? 0.9085 1.5125 1.0986 0.1195  -0.0187 -0.1837 126 VAL B CB  
2639 C CG1 . VAL B 111 ? 0.8946 1.4782 1.0923 0.0981  -0.0191 -0.1773 126 VAL B CG1 
2640 C CG2 . VAL B 111 ? 0.8917 1.4781 1.0744 0.1349  -0.0266 -0.1927 126 VAL B CG2 
2641 N N   . VAL B 112 ? 0.8357 1.5159 1.0799 0.0922  -0.0146 -0.1706 127 VAL B N   
2642 C CA  . VAL B 112 ? 0.8970 1.5980 1.1694 0.0725  -0.0150 -0.1624 127 VAL B CA  
2643 C C   . VAL B 112 ? 0.9189 1.5964 1.1940 0.0632  -0.0263 -0.1692 127 VAL B C   
2644 O O   . VAL B 112 ? 0.9559 1.6302 1.2236 0.0742  -0.0333 -0.1780 127 VAL B O   
2645 C CB  . VAL B 112 ? 0.8909 1.6438 1.1883 0.0760  -0.0116 -0.1572 127 VAL B CB  
2646 C CG1 . VAL B 112 ? 0.8634 1.6370 1.1977 0.0536  -0.0144 -0.1474 127 VAL B CG1 
2647 C CG2 . VAL B 112 ? 0.9061 1.6855 1.1969 0.0893  0.0012  -0.1502 127 VAL B CG2 
2648 N N   . ASN B 113 ? 0.8978 1.5593 1.1824 0.0446  -0.0281 -0.1649 128 ASN B N   
2649 C CA  . ASN B 113 ? 0.8986 1.5399 1.1862 0.0359  -0.0392 -0.1721 128 ASN B CA  
2650 C C   . ASN B 113 ? 0.9036 1.5122 1.1626 0.0493  -0.0432 -0.1817 128 ASN B C   
2651 O O   . ASN B 113 ? 0.9344 1.5419 1.1903 0.0545  -0.0523 -0.1897 128 ASN B O   
2652 C CB  . ASN B 113 ? 0.9048 1.5785 1.2209 0.0300  -0.0483 -0.1740 128 ASN B CB  
2653 C CG  . ASN B 113 ? 0.9089 1.6089 1.2614 0.0114  -0.0458 -0.1613 128 ASN B CG  
2654 O OD1 . ASN B 113 ? 0.9574 1.6428 1.3133 -0.0007 -0.0409 -0.1530 128 ASN B OD1 
2655 N ND2 . ASN B 113 ? 0.8980 1.6379 1.2810 0.0090  -0.0494 -0.1579 128 ASN B ND2 
2656 N N   . VAL B 114 ? 0.8724 1.4552 1.1118 0.0554  -0.0369 -0.1795 129 VAL B N   
2657 C CA  . VAL B 114 ? 0.8699 1.4203 1.0883 0.0650  -0.0392 -0.1839 129 VAL B CA  
2658 C C   . VAL B 114 ? 0.8848 1.4143 1.1035 0.0537  -0.0435 -0.1858 129 VAL B C   
2659 O O   . VAL B 114 ? 0.8591 1.3789 1.0855 0.0400  -0.0410 -0.1814 129 VAL B O   
2660 C CB  . VAL B 114 ? 0.8608 1.3868 1.0655 0.0711  -0.0334 -0.1802 129 VAL B CB  
2661 C CG1 . VAL B 114 ? 0.8855 1.3800 1.0757 0.0791  -0.0349 -0.1807 129 VAL B CG1 
2662 C CG2 . VAL B 114 ? 0.8713 1.4133 1.0727 0.0852  -0.0313 -0.1815 129 VAL B CG2 
2663 N N   . PRO B 115 ? 0.8921 1.4150 1.1011 0.0611  -0.0503 -0.1926 130 PRO B N   
2664 C CA  . PRO B 115 ? 0.8933 1.3963 1.0984 0.0546  -0.0553 -0.1970 130 PRO B CA  
2665 C C   . PRO B 115 ? 0.8919 1.3609 1.0818 0.0567  -0.0478 -0.1918 130 PRO B C   
2666 O O   . PRO B 115 ? 0.8836 1.3386 1.0565 0.0709  -0.0444 -0.1894 130 PRO B O   
2667 C CB  . PRO B 115 ? 0.9111 1.4202 1.1048 0.0674  -0.0645 -0.2059 130 PRO B CB  
2668 C CG  . PRO B 115 ? 0.9174 1.4356 1.1022 0.0833  -0.0604 -0.2022 130 PRO B CG  
2669 C CD  . PRO B 115 ? 0.8875 1.4224 1.0876 0.0776  -0.0544 -0.1968 130 PRO B CD  
2670 N N   . LEU B 116 ? 0.8766 1.3336 1.0757 0.0426  -0.0450 -0.1881 131 LEU B N   
2671 C CA  . LEU B 116 ? 0.8145 1.2411 1.0035 0.0434  -0.0387 -0.1830 131 LEU B CA  
2672 C C   . LEU B 116 ? 0.8297 1.2419 1.0111 0.0443  -0.0436 -0.1902 131 LEU B C   
2673 O O   . LEU B 116 ? 0.8309 1.2487 1.0244 0.0336  -0.0520 -0.1972 131 LEU B O   
2674 C CB  . LEU B 116 ? 0.7939 1.2140 0.9954 0.0293  -0.0341 -0.1756 131 LEU B CB  
2675 C CG  . LEU B 116 ? 0.7851 1.2116 0.9875 0.0318  -0.0286 -0.1687 131 LEU B CG  
2676 C CD1 . LEU B 116 ? 0.7747 1.1890 0.9840 0.0203  -0.0248 -0.1613 131 LEU B CD1 
2677 C CD2 . LEU B 116 ? 0.7905 1.2044 0.9798 0.0475  -0.0262 -0.1671 131 LEU B CD2 
2678 N N   . CYS B 117 ? 0.8607 1.2544 1.0238 0.0576  -0.0387 -0.1878 132 CYS B N   
2679 C CA  . CYS B 117 ? 0.8844 1.2636 1.0343 0.0634  -0.0418 -0.1950 132 CYS B CA  
2680 C C   . CYS B 117 ? 0.8982 1.2635 1.0604 0.0486  -0.0442 -0.1979 132 CYS B C   
2681 O O   . CYS B 117 ? 0.8916 1.2515 1.0680 0.0364  -0.0390 -0.1893 132 CYS B O   
2682 C CB  . CYS B 117 ? 0.8815 1.2448 1.0126 0.0803  -0.0317 -0.1865 132 CYS B CB  
2683 S SG  . CYS B 117 ? 0.8904 1.2664 1.0079 0.0997  -0.0289 -0.1801 132 CYS B SG  
2684 N N   . GLN B 118 ? 0.9486 1.3078 1.1047 0.0508  -0.0537 -0.2108 133 GLN B N   
2685 C CA  . GLN B 118 ? 0.9637 1.3091 1.1340 0.0373  -0.0598 -0.2162 133 GLN B CA  
2686 C C   . GLN B 118 ? 0.9259 1.2484 1.0955 0.0357  -0.0484 -0.2061 133 GLN B C   
2687 O O   . GLN B 118 ? 0.9533 1.2689 1.1424 0.0197  -0.0491 -0.2021 133 GLN B O   
2688 C CB  . GLN B 118 ? 1.0858 1.4242 1.2435 0.0465  -0.0735 -0.2346 133 GLN B CB  
2689 C CG  . GLN B 118 ? 1.1429 1.4672 1.3186 0.0332  -0.0860 -0.2449 133 GLN B CG  
2690 C CD  . GLN B 118 ? 1.2406 1.5623 1.4045 0.0438  -0.1046 -0.2671 133 GLN B CD  
2691 O OE1 . GLN B 118 ? 1.3534 1.6623 1.4861 0.0649  -0.1036 -0.2756 133 GLN B OE1 
2692 N NE2 . GLN B 118 ? 1.2790 1.6151 1.4675 0.0311  -0.1220 -0.2759 133 GLN B NE2 
2693 N N   . GLU B 119 ? 0.8890 1.2014 1.0388 0.0524  -0.0379 -0.2004 134 GLU B N   
2694 C CA  . GLU B 119 ? 0.8817 1.1749 1.0344 0.0519  -0.0264 -0.1886 134 GLU B CA  
2695 C C   . GLU B 119 ? 0.8789 1.1739 1.0513 0.0372  -0.0215 -0.1755 134 GLU B C   
2696 O O   . GLU B 119 ? 0.9326 1.2143 1.1170 0.0272  -0.0195 -0.1705 134 GLU B O   
2697 C CB  . GLU B 119 ? 0.8787 1.1667 1.0132 0.0720  -0.0144 -0.1794 134 GLU B CB  
2698 C CG  . GLU B 119 ? 0.8744 1.1582 0.9837 0.0914  -0.0154 -0.1894 134 GLU B CG  
2699 C CD  . GLU B 119 ? 0.8729 1.1737 0.9626 0.1063  -0.0195 -0.1946 134 GLU B CD  
2700 O OE1 . GLU B 119 ? 0.8246 1.1413 0.9229 0.0975  -0.0284 -0.1993 134 GLU B OE1 
2701 O OE2 . GLU B 119 ? 0.8434 1.1433 0.9088 0.1282  -0.0132 -0.1929 134 GLU B OE2 
2702 N N   . ASP B 120 ? 0.8271 1.1382 1.0008 0.0381  -0.0203 -0.1707 135 ASP B N   
2703 C CA  . ASP B 120 ? 0.7948 1.1093 0.9822 0.0280  -0.0177 -0.1614 135 ASP B CA  
2704 C C   . ASP B 120 ? 0.7860 1.1061 0.9894 0.0105  -0.0232 -0.1634 135 ASP B C   
2705 O O   . ASP B 120 ? 0.7975 1.1084 1.0105 0.0018  -0.0205 -0.1557 135 ASP B O   
2706 C CB  . ASP B 120 ? 0.8399 1.1718 1.0245 0.0345  -0.0177 -0.1597 135 ASP B CB  
2707 C CG  . ASP B 120 ? 0.8698 1.1945 1.0439 0.0510  -0.0120 -0.1535 135 ASP B CG  
2708 O OD1 . ASP B 120 ? 0.9287 1.2536 1.0893 0.0626  -0.0113 -0.1567 135 ASP B OD1 
2709 O OD2 . ASP B 120 ? 0.8765 1.1950 1.0566 0.0535  -0.0088 -0.1445 135 ASP B OD2 
2710 N N   . CYS B 121 ? 0.8299 1.1654 1.0390 0.0051  -0.0315 -0.1721 136 CYS B N   
2711 C CA  . CYS B 121 ? 0.8699 1.2109 1.1004 -0.0128 -0.0363 -0.1701 136 CYS B CA  
2712 C C   . CYS B 121 ? 0.9165 1.2332 1.1535 -0.0194 -0.0388 -0.1715 136 CYS B C   
2713 O O   . CYS B 121 ? 0.9030 1.2160 1.1559 -0.0325 -0.0378 -0.1626 136 CYS B O   
2714 C CB  . CYS B 121 ? 0.8932 1.2580 1.1362 -0.0184 -0.0459 -0.1774 136 CYS B CB  
2715 S SG  . CYS B 121 ? 0.8795 1.2766 1.1198 -0.0116 -0.0423 -0.1739 136 CYS B SG  
2716 N N   . GLU B 122 ? 1.0032 1.3038 1.2268 -0.0087 -0.0416 -0.1819 137 GLU B N   
2717 C CA  . GLU B 122 ? 1.0628 1.3389 1.2913 -0.0120 -0.0446 -0.1855 137 GLU B CA  
2718 C C   . GLU B 122 ? 1.0133 1.2729 1.2438 -0.0134 -0.0342 -0.1724 137 GLU B C   
2719 O O   . GLU B 122 ? 0.9719 1.2222 1.2197 -0.0265 -0.0361 -0.1668 137 GLU B O   
2720 C CB  . GLU B 122 ? 1.0988 1.3633 1.3081 0.0038  -0.0498 -0.2011 137 GLU B CB  
2721 C CG  . GLU B 122 ? 1.2007 1.4731 1.4179 -0.0007 -0.0669 -0.2170 137 GLU B CG  
2722 C CD  . GLU B 122 ? 1.3247 1.5874 1.5176 0.0184  -0.0749 -0.2356 137 GLU B CD  
2723 O OE1 . GLU B 122 ? 1.3628 1.6150 1.5313 0.0364  -0.0639 -0.2336 137 GLU B OE1 
2724 O OE2 . GLU B 122 ? 1.3472 1.6141 1.5463 0.0162  -0.0925 -0.2516 137 GLU B OE2 
2725 N N   . GLU B 123 ? 0.9609 1.2181 1.1771 -0.0004 -0.0242 -0.1662 138 GLU B N   
2726 C CA  . GLU B 123 ? 0.9127 1.1569 1.1341 -0.0011 -0.0156 -0.1529 138 GLU B CA  
2727 C C   . GLU B 123 ? 0.8087 1.0599 1.0455 -0.0162 -0.0165 -0.1429 138 GLU B C   
2728 O O   . GLU B 123 ? 0.7477 0.9863 0.9953 -0.0238 -0.0157 -0.1355 138 GLU B O   
2729 C CB  . GLU B 123 ? 0.9116 1.1564 1.1215 0.0142  -0.0066 -0.1464 138 GLU B CB  
2730 C CG  . GLU B 123 ? 0.9788 1.2152 1.1733 0.0313  -0.0019 -0.1510 138 GLU B CG  
2731 C CD  . GLU B 123 ? 1.0210 1.2627 1.2057 0.0473  0.0070  -0.1422 138 GLU B CD  
2732 O OE1 . GLU B 123 ? 1.1030 1.3486 1.2971 0.0445  0.0093  -0.1319 138 GLU B OE1 
2733 O OE2 . GLU B 123 ? 1.0012 1.2428 1.1690 0.0638  0.0114  -0.1452 138 GLU B OE2 
2734 N N   . TRP B 124 ? 0.7622 1.0348 0.9986 -0.0189 -0.0184 -0.1427 139 TRP B N   
2735 C CA  . TRP B 124 ? 0.7717 1.0556 1.0173 -0.0288 -0.0182 -0.1334 139 TRP B CA  
2736 C C   . TRP B 124 ? 0.7995 1.0807 1.0621 -0.0440 -0.0222 -0.1298 139 TRP B C   
2737 O O   . TRP B 124 ? 0.8218 1.0955 1.0919 -0.0508 -0.0205 -0.1194 139 TRP B O   
2738 C CB  . TRP B 124 ? 0.7593 1.0701 1.0008 -0.0264 -0.0192 -0.1359 139 TRP B CB  
2739 C CG  . TRP B 124 ? 0.7619 1.0884 1.0064 -0.0306 -0.0175 -0.1273 139 TRP B CG  
2740 C CD1 . TRP B 124 ? 0.7868 1.1087 1.0379 -0.0385 -0.0163 -0.1170 139 TRP B CD1 
2741 C CD2 . TRP B 124 ? 0.7582 1.1099 0.9974 -0.0251 -0.0169 -0.1285 139 TRP B CD2 
2742 N NE1 . TRP B 124 ? 0.7919 1.1352 1.0392 -0.0368 -0.0146 -0.1118 139 TRP B NE1 
2743 C CE2 . TRP B 124 ? 0.7692 1.1312 1.0097 -0.0285 -0.0147 -0.1192 139 TRP B CE2 
2744 C CE3 . TRP B 124 ? 0.7468 1.1140 0.9792 -0.0159 -0.0180 -0.1364 139 TRP B CE3 
2745 C CZ2 . TRP B 124 ? 0.7453 1.1326 0.9790 -0.0215 -0.0130 -0.1186 139 TRP B CZ2 
2746 C CZ3 . TRP B 124 ? 0.7337 1.1254 0.9628 -0.0107 -0.0167 -0.1355 139 TRP B CZ3 
2747 C CH2 . TRP B 124 ? 0.7307 1.1323 0.9597 -0.0128 -0.0138 -0.1272 139 TRP B CH2 
2748 N N   . TRP B 125 ? 0.8246 1.1112 1.0949 -0.0489 -0.0288 -0.1382 140 TRP B N   
2749 C CA  . TRP B 125 ? 0.8519 1.1351 1.1442 -0.0641 -0.0348 -0.1348 140 TRP B CA  
2750 C C   . TRP B 125 ? 0.8390 1.0929 1.1356 -0.0658 -0.0350 -0.1329 140 TRP B C   
2751 O O   . TRP B 125 ? 0.7898 1.0392 1.1028 -0.0776 -0.0356 -0.1215 140 TRP B O   
2752 C CB  . TRP B 125 ? 0.8976 1.1878 1.1991 -0.0670 -0.0455 -0.1477 140 TRP B CB  
2753 C CG  . TRP B 125 ? 0.9044 1.1931 1.2358 -0.0844 -0.0537 -0.1429 140 TRP B CG  
2754 C CD1 . TRP B 125 ? 0.9005 1.2129 1.2557 -0.0985 -0.0536 -0.1291 140 TRP B CD1 
2755 C CD2 . TRP B 125 ? 0.9202 1.1820 1.2635 -0.0889 -0.0628 -0.1498 140 TRP B CD2 
2756 N NE1 . TRP B 125 ? 0.9546 1.2562 1.3394 -0.1133 -0.0626 -0.1252 140 TRP B NE1 
2757 C CE2 . TRP B 125 ? 0.9524 1.2209 1.3302 -0.1078 -0.0695 -0.1392 140 TRP B CE2 
2758 C CE3 . TRP B 125 ? 0.9650 1.1982 1.2938 -0.0774 -0.0658 -0.1634 140 TRP B CE3 
2759 C CZ2 . TRP B 125 ? 0.9607 1.2050 1.3608 -0.1167 -0.0813 -0.1431 140 TRP B CZ2 
2760 C CZ3 . TRP B 125 ? 1.0022 1.2121 1.3491 -0.0842 -0.0769 -0.1692 140 TRP B CZ3 
2761 C CH2 . TRP B 125 ? 1.0000 1.2139 1.3832 -0.1043 -0.0856 -0.1597 140 TRP B CH2 
2762 N N   . GLU B 126 ? 0.8725 1.1085 1.1545 -0.0527 -0.0339 -0.1428 141 GLU B N   
2763 C CA  . GLU B 126 ? 0.9507 1.1602 1.2350 -0.0503 -0.0329 -0.1425 141 GLU B CA  
2764 C C   . GLU B 126 ? 0.9326 1.1372 1.2222 -0.0544 -0.0264 -0.1263 141 GLU B C   
2765 O O   . GLU B 126 ? 1.0022 1.1939 1.3068 -0.0635 -0.0287 -0.1194 141 GLU B O   
2766 C CB  . GLU B 126 ? 1.0380 1.2372 1.3017 -0.0311 -0.0286 -0.1525 141 GLU B CB  
2767 C CG  . GLU B 126 ? 1.1705 1.3449 1.4344 -0.0239 -0.0261 -0.1537 141 GLU B CG  
2768 C CD  . GLU B 126 ? 1.3173 1.4755 1.5945 -0.0312 -0.0376 -0.1634 141 GLU B CD  
2769 O OE1 . GLU B 126 ? 1.3884 1.5529 1.6711 -0.0373 -0.0492 -0.1742 141 GLU B OE1 
2770 O OE2 . GLU B 126 ? 1.3775 1.5158 1.6631 -0.0312 -0.0365 -0.1598 141 GLU B OE2 
2771 N N   . ASP B 127 ? 0.8498 1.0643 1.1285 -0.0476 -0.0200 -0.1207 142 ASP B N   
2772 C CA  . ASP B 127 ? 0.7768 0.9851 1.0589 -0.0485 -0.0163 -0.1082 142 ASP B CA  
2773 C C   . ASP B 127 ? 0.7582 0.9781 1.0490 -0.0609 -0.0187 -0.0971 142 ASP B C   
2774 O O   . ASP B 127 ? 0.7924 1.0051 1.0872 -0.0631 -0.0183 -0.0866 142 ASP B O   
2775 C CB  . ASP B 127 ? 0.7576 0.9699 1.0283 -0.0364 -0.0116 -0.1072 142 ASP B CB  
2776 C CG  . ASP B 127 ? 0.7707 0.9725 1.0348 -0.0229 -0.0066 -0.1125 142 ASP B CG  
2777 O OD1 . ASP B 127 ? 0.8215 1.0087 1.0884 -0.0207 -0.0057 -0.1157 142 ASP B OD1 
2778 O OD2 . ASP B 127 ? 0.7970 1.0054 1.0527 -0.0128 -0.0031 -0.1128 142 ASP B OD2 
2779 N N   . CYS B 128 ? 0.7510 0.9906 1.0456 -0.0681 -0.0211 -0.0979 143 CYS B N   
2780 C CA  . CYS B 128 ? 0.7848 1.0405 1.0875 -0.0781 -0.0209 -0.0844 143 CYS B CA  
2781 C C   . CYS B 128 ? 0.8559 1.1069 1.1816 -0.0928 -0.0250 -0.0771 143 CYS B C   
2782 O O   . CYS B 128 ? 0.8158 1.0804 1.1510 -0.1013 -0.0236 -0.0617 143 CYS B O   
2783 C CB  . CYS B 128 ? 0.7780 1.0640 1.0736 -0.0758 -0.0190 -0.0854 143 CYS B CB  
2784 S SG  . CYS B 128 ? 0.7876 1.0806 1.0595 -0.0597 -0.0160 -0.0893 143 CYS B SG  
2785 N N   . ARG B 129 ? 0.9673 1.1988 1.3022 -0.0945 -0.0304 -0.0873 144 ARG B N   
2786 C CA  . ARG B 129 ? 1.1069 1.3283 1.4677 -0.1082 -0.0373 -0.0824 144 ARG B CA  
2787 C C   . ARG B 129 ? 1.1165 1.3311 1.4891 -0.1163 -0.0355 -0.0631 144 ARG B C   
2788 O O   . ARG B 129 ? 1.1034 1.3269 1.4982 -0.1297 -0.0377 -0.0490 144 ARG B O   
2789 C CB  . ARG B 129 ? 1.2251 1.4185 1.5876 -0.1033 -0.0441 -0.0989 144 ARG B CB  
2790 C CG  . ARG B 129 ? 1.3379 1.5370 1.6969 -0.0991 -0.0510 -0.1175 144 ARG B CG  
2791 C CD  . ARG B 129 ? 1.4616 1.6367 1.8374 -0.1029 -0.0638 -0.1291 144 ARG B CD  
2792 N NE  . ARG B 129 ? 1.5265 1.6735 1.8966 -0.0949 -0.0613 -0.1306 144 ARG B NE  
2793 C CZ  . ARG B 129 ? 1.5720 1.7063 1.9190 -0.0767 -0.0572 -0.1433 144 ARG B CZ  
2794 N NH1 . ARG B 129 ? 1.6076 1.7194 1.9545 -0.0701 -0.0541 -0.1418 144 ARG B NH1 
2795 N NH2 . ARG B 129 ? 1.5817 1.7271 1.9073 -0.0643 -0.0555 -0.1559 144 ARG B NH2 
2796 N N   . MET B 130 ? 1.1390 1.3391 1.4985 -0.1078 -0.0317 -0.0612 145 MET B N   
2797 C CA  . MET B 130 ? 1.1533 1.3435 1.5213 -0.1127 -0.0314 -0.0448 145 MET B CA  
2798 C C   . MET B 130 ? 1.1281 1.3418 1.4878 -0.1135 -0.0269 -0.0286 145 MET B C   
2799 O O   . MET B 130 ? 1.1086 1.3193 1.4755 -0.1185 -0.0271 -0.0122 145 MET B O   
2800 C CB  . MET B 130 ? 1.1815 1.3482 1.5415 -0.1021 -0.0303 -0.0495 145 MET B CB  
2801 C CG  . MET B 130 ? 1.2349 1.3791 1.5981 -0.0963 -0.0328 -0.0655 145 MET B CG  
2802 S SD  . MET B 130 ? 1.3062 1.4269 1.6970 -0.1072 -0.0418 -0.0639 145 MET B SD  
2803 C CE  . MET B 130 ? 1.2938 1.4306 1.6991 -0.1198 -0.0491 -0.0683 145 MET B CE  
2804 N N   . SER B 131 ? 1.1303 1.3669 1.4727 -0.1066 -0.0231 -0.0335 146 SER B N   
2805 C CA  . SER B 131 ? 1.1289 1.3893 1.4585 -0.1035 -0.0192 -0.0210 146 SER B CA  
2806 C C   . SER B 131 ? 1.1395 1.4249 1.4862 -0.1150 -0.0163 -0.0055 146 SER B C   
2807 O O   . SER B 131 ? 1.1186 1.4017 1.4880 -0.1255 -0.0194 -0.0079 146 SER B O   
2808 C CB  . SER B 131 ? 1.0813 1.3548 1.3872 -0.0899 -0.0173 -0.0333 146 SER B CB  
2809 O OG  . SER B 131 ? 1.0239 1.2751 1.3226 -0.0813 -0.0197 -0.0465 146 SER B OG  
2810 N N   . TYR B 132 ? 1.1346 1.4437 1.4718 -0.1122 -0.0112 0.0107  147 TYR B N   
2811 C CA  . TYR B 132 ? 1.1306 1.4671 1.4865 -0.1222 -0.0059 0.0321  147 TYR B CA  
2812 C C   . TYR B 132 ? 1.1558 1.5318 1.4966 -0.1134 0.0020  0.0350  147 TYR B C   
2813 O O   . TYR B 132 ? 1.1551 1.5377 1.4650 -0.0976 0.0033  0.0281  147 TYR B O   
2814 C CB  . TYR B 132 ? 1.1638 1.4964 1.5255 -0.1264 -0.0047 0.0558  147 TYR B CB  
2815 C CG  . TYR B 132 ? 1.2015 1.5037 1.5935 -0.1405 -0.0114 0.0603  147 TYR B CG  
2816 C CD1 . TYR B 132 ? 1.1808 1.4475 1.5709 -0.1380 -0.0187 0.0412  147 TYR B CD1 
2817 C CD2 . TYR B 132 ? 1.2262 1.5354 1.6503 -0.1552 -0.0103 0.0843  147 TYR B CD2 
2818 C CE1 . TYR B 132 ? 1.1666 1.4047 1.5820 -0.1479 -0.0253 0.0428  147 TYR B CE1 
2819 C CE2 . TYR B 132 ? 1.2521 1.5300 1.7050 -0.1670 -0.0186 0.0861  147 TYR B CE2 
2820 C CZ  . TYR B 132 ? 1.2128 1.4547 1.6594 -0.1624 -0.0264 0.0637  147 TYR B CZ  
2821 O OH  . TYR B 132 ? 1.1850 1.3950 1.6575 -0.1709 -0.0350 0.0628  147 TYR B OH  
2822 N N   . THR B 133 ? 1.1915 1.5930 1.5565 -0.1231 0.0059  0.0442  148 THR B N   
2823 C CA  . THR B 133 ? 1.2063 1.6518 1.5642 -0.1158 0.0158  0.0536  148 THR B CA  
2824 C C   . THR B 133 ? 1.2573 1.7306 1.6511 -0.1302 0.0227  0.0832  148 THR B C   
2825 O O   . THR B 133 ? 1.3286 1.7835 1.7544 -0.1467 0.0174  0.0935  148 THR B O   
2826 C CB  . THR B 133 ? 1.1691 1.6252 1.5223 -0.1102 0.0144  0.0323  148 THR B CB  
2827 O OG1 . THR B 133 ? 1.1282 1.6262 1.4694 -0.0989 0.0244  0.0399  148 THR B OG1 
2828 C CG2 . THR B 133 ? 1.1607 1.6123 1.5508 -0.1267 0.0079  0.0279  148 THR B CG2 
2829 N N   . CYS B 134 ? 1.2315 1.7495 1.6221 -0.1231 0.0344  0.0977  149 CYS B N   
2830 C CA  . CYS B 134 ? 1.2129 1.7653 1.6408 -0.1354 0.0437  0.1306  149 CYS B CA  
2831 C C   . CYS B 134 ? 1.2109 1.7989 1.6680 -0.1411 0.0475  0.1330  149 CYS B C   
2832 O O   . CYS B 134 ? 1.1990 1.8165 1.6950 -0.1531 0.0546  0.1617  149 CYS B O   
2833 C CB  . CYS B 134 ? 1.2134 1.7970 1.6170 -0.1209 0.0577  0.1555  149 CYS B CB  
2834 S SG  . CYS B 134 ? 1.1864 1.7967 1.5352 -0.0903 0.0648  0.1379  149 CYS B SG  
2835 N N   . LYS B 135 ? 1.2223 1.8087 1.6634 -0.1325 0.0428  0.1052  150 LYS B N   
2836 C CA  . LYS B 135 ? 1.2220 1.8445 1.6851 -0.1340 0.0461  0.1049  150 LYS B CA  
2837 C C   . LYS B 135 ? 1.1772 1.7739 1.6403 -0.1361 0.0319  0.0726  150 LYS B C   
2838 O O   . LYS B 135 ? 1.1842 1.7439 1.6174 -0.1288 0.0243  0.0500  150 LYS B O   
2839 C CB  . LYS B 135 ? 1.2539 1.9160 1.6835 -0.1109 0.0600  0.1068  150 LYS B CB  
2840 C CG  . LYS B 135 ? 1.3012 2.0050 1.7344 -0.1059 0.0773  0.1422  150 LYS B CG  
2841 C CD  . LYS B 135 ? 1.3317 2.0697 1.7215 -0.0775 0.0897  0.1393  150 LYS B CD  
2842 C CE  . LYS B 135 ? 1.3262 2.0904 1.7189 -0.0692 0.0910  0.1236  150 LYS B CE  
2843 N NZ  . LYS B 135 ? 1.3043 2.1022 1.7540 -0.0868 0.0947  0.1418  150 LYS B NZ  
2844 N N   . SER B 136 ? 1.1561 1.7748 1.6533 -0.1450 0.0284  0.0719  151 SER B N   
2845 C CA  . SER B 136 ? 1.1275 1.7285 1.6224 -0.1442 0.0151  0.0419  151 SER B CA  
2846 C C   . SER B 136 ? 1.1204 1.7544 1.5988 -0.1281 0.0207  0.0315  151 SER B C   
2847 O O   . SER B 136 ? 1.0619 1.6817 1.5292 -0.1228 0.0110  0.0064  151 SER B O   
2848 C CB  . SER B 136 ? 1.1041 1.6957 1.6498 -0.1661 0.0006  0.0423  151 SER B CB  
2849 O OG  . SER B 136 ? 1.1344 1.7698 1.7260 -0.1773 0.0062  0.0678  151 SER B OG  
2850 N N   . ASN B 137 ? 1.1421 1.8203 1.6180 -0.1187 0.0364  0.0509  152 ASN B N   
2851 C CA  . ASN B 137 ? 1.1612 1.8685 1.6158 -0.0996 0.0424  0.0400  152 ASN B CA  
2852 C C   . ASN B 137 ? 1.1710 1.8854 1.5804 -0.0779 0.0543  0.0429  152 ASN B C   
2853 O O   . ASN B 137 ? 1.2077 1.9585 1.6185 -0.0718 0.0689  0.0667  152 ASN B O   
2854 C CB  . ASN B 137 ? 1.1892 1.9484 1.6855 -0.1051 0.0489  0.0576  152 ASN B CB  
2855 C CG  . ASN B 137 ? 1.2032 1.9545 1.7414 -0.1232 0.0324  0.0474  152 ASN B CG  
2856 O OD1 . ASN B 137 ? 1.2147 1.9775 1.8042 -0.1438 0.0289  0.0664  152 ASN B OD1 
2857 N ND2 . ASN B 137 ? 1.2003 1.9305 1.7174 -0.1151 0.0207  0.0175  152 ASN B ND2 
2858 N N   . TRP B 138 ? 1.1846 1.8635 1.5542 -0.0654 0.0471  0.0186  153 TRP B N   
2859 C CA  . TRP B 138 ? 1.2564 1.9347 1.5815 -0.0436 0.0532  0.0154  153 TRP B CA  
2860 C C   . TRP B 138 ? 1.2725 1.9878 1.5771 -0.0205 0.0615  0.0106  153 TRP B C   
2861 O O   . TRP B 138 ? 1.2200 1.9417 1.4895 -0.0004 0.0668  0.0101  153 TRP B O   
2862 C CB  . TRP B 138 ? 1.2849 1.9135 1.5815 -0.0386 0.0411  -0.0085 153 TRP B CB  
2863 C CG  . TRP B 138 ? 1.3119 1.9032 1.6167 -0.0539 0.0347  -0.0044 153 TRP B CG  
2864 C CD1 . TRP B 138 ? 1.3169 1.9076 1.6559 -0.0744 0.0351  0.0142  153 TRP B CD1 
2865 C CD2 . TRP B 138 ? 1.3157 1.8640 1.5971 -0.0496 0.0261  -0.0193 153 TRP B CD2 
2866 N NE1 . TRP B 138 ? 1.3311 1.8802 1.6657 -0.0815 0.0276  0.0104  153 TRP B NE1 
2867 C CE2 . TRP B 138 ? 1.3411 1.8652 1.6412 -0.0666 0.0225  -0.0095 153 TRP B CE2 
2868 C CE3 . TRP B 138 ? 1.2718 1.7996 1.5220 -0.0331 0.0203  -0.0393 153 TRP B CE3 
2869 C CZ2 . TRP B 138 ? 1.3165 1.7994 1.6035 -0.0665 0.0150  -0.0187 153 TRP B CZ2 
2870 C CZ3 . TRP B 138 ? 1.2360 1.7233 1.4763 -0.0344 0.0124  -0.0468 153 TRP B CZ3 
2871 C CH2 . TRP B 138 ? 1.2630 1.7295 1.5211 -0.0506 0.0105  -0.0366 153 TRP B CH2 
2872 N N   . ARG B 139 ? 1.3265 2.0647 1.6516 -0.0214 0.0612  0.0053  154 ARG B N   
2873 C CA  . ARG B 139 ? 1.4051 2.1808 1.7144 0.0011  0.0695  0.0012  154 ARG B CA  
2874 C C   . ARG B 139 ? 1.4031 2.2276 1.7088 0.0136  0.0878  0.0262  154 ARG B C   
2875 O O   . ARG B 139 ? 1.4421 2.2891 1.7191 0.0392  0.0942  0.0191  154 ARG B O   
2876 C CB  . ARG B 139 ? 1.4744 2.2694 1.8129 -0.0041 0.0657  -0.0056 154 ARG B CB  
2877 C CG  . ARG B 139 ? 1.5567 2.3853 1.9491 -0.0251 0.0704  0.0186  154 ARG B CG  
2878 C CD  . ARG B 139 ? 1.6239 2.4619 2.0454 -0.0322 0.0608  0.0071  154 ARG B CD  
2879 N NE  . ARG B 139 ? 1.6772 2.5265 2.1543 -0.0585 0.0562  0.0238  154 ARG B NE  
2880 C CZ  . ARG B 139 ? 1.7055 2.6027 2.2248 -0.0667 0.0674  0.0527  154 ARG B CZ  
2881 N NH1 . ARG B 139 ? 1.7227 2.6658 2.2318 -0.0486 0.0867  0.0696  154 ARG B NH1 
2882 N NH2 . ARG B 139 ? 1.7126 2.6124 2.2866 -0.0925 0.0587  0.0653  154 ARG B NH2 
2883 N N   . GLY B 140 ? 1.3547 2.1960 1.6891 -0.0024 0.0962  0.0555  155 GLY B N   
2884 C CA  . GLY B 140 ? 1.3000 2.1853 1.6259 0.0111  0.1150  0.0826  155 GLY B CA  
2885 C C   . GLY B 140 ? 1.2880 2.1837 1.6481 -0.0094 0.1227  0.1172  155 GLY B C   
2886 O O   . GLY B 140 ? 1.2682 2.1358 1.6626 -0.0358 0.1121  0.1196  155 GLY B O   
2887 N N   . GLY B 141 ? 1.3160 2.2528 1.6661 0.0044  0.1410  0.1444  156 GLY B N   
2888 C CA  . GLY B 141 ? 1.3406 2.2960 1.7252 -0.0124 0.1516  0.1840  156 GLY B CA  
2889 C C   . GLY B 141 ? 1.3939 2.3136 1.7488 -0.0121 0.1475  0.1876  156 GLY B C   
2890 O O   . GLY B 141 ? 1.3666 2.2733 1.7548 -0.0350 0.1460  0.2095  156 GLY B O   
2891 N N   . TRP B 142 ? 1.4397 2.3443 1.7340 0.0146  0.1445  0.1662  157 TRP B N   
2892 C CA  . TRP B 142 ? 1.5064 2.3755 1.7663 0.0191  0.1375  0.1641  157 TRP B CA  
2893 C C   . TRP B 142 ? 1.5622 2.4723 1.7919 0.0427  0.1550  0.1904  157 TRP B C   
2894 O O   . TRP B 142 ? 1.5957 2.5564 1.8181 0.0622  0.1708  0.2001  157 TRP B O   
2895 C CB  . TRP B 142 ? 1.5332 2.3572 1.7482 0.0338  0.1196  0.1221  157 TRP B CB  
2896 C CG  . TRP B 142 ? 1.4822 2.2614 1.7198 0.0131  0.1026  0.0977  157 TRP B CG  
2897 C CD1 . TRP B 142 ? 1.4631 2.2427 1.7122 0.0120  0.0976  0.0774  157 TRP B CD1 
2898 C CD2 . TRP B 142 ? 1.4632 2.1921 1.7122 -0.0069 0.0889  0.0918  157 TRP B CD2 
2899 N NE1 . TRP B 142 ? 1.4635 2.1970 1.7282 -0.0067 0.0822  0.0598  157 TRP B NE1 
2900 C CE2 . TRP B 142 ? 1.4439 2.1460 1.7089 -0.0182 0.0770  0.0678  157 TRP B CE2 
2901 C CE3 . TRP B 142 ? 1.4648 2.1695 1.7110 -0.0149 0.0857  0.1048  157 TRP B CE3 
2902 C CZ2 . TRP B 142 ? 1.4075 2.0612 1.6848 -0.0358 0.0633  0.0564  157 TRP B CZ2 
2903 C CZ3 . TRP B 142 ? 1.4016 2.0569 1.6628 -0.0336 0.0714  0.0929  157 TRP B CZ3 
2904 C CH2 . TRP B 142 ? 1.3889 2.0203 1.6649 -0.0433 0.0611  0.0690  157 TRP B CH2 
2905 N N   . ASP B 143 ? 1.6200 2.5104 1.8318 0.0425  0.1525  0.2024  158 ASP B N   
2906 C CA  . ASP B 143 ? 1.6828 2.6042 1.8503 0.0711  0.1650  0.2203  158 ASP B CA  
2907 C C   . ASP B 143 ? 1.7167 2.6128 1.8200 0.1012  0.1507  0.1814  158 ASP B C   
2908 O O   . ASP B 143 ? 1.7362 2.5803 1.8239 0.0960  0.1312  0.1596  158 ASP B O   
2909 C CB  . ASP B 143 ? 1.6995 2.6099 1.8763 0.0584  0.1668  0.2506  158 ASP B CB  
2910 C CG  . ASP B 143 ? 1.7729 2.7220 1.9065 0.0881  0.1819  0.2751  158 ASP B CG  
2911 O OD1 . ASP B 143 ? 1.8022 2.7685 1.8821 0.1228  0.1833  0.2565  158 ASP B OD1 
2912 O OD2 . ASP B 143 ? 1.8055 2.7672 1.9588 0.0777  0.1917  0.3134  158 ASP B OD2 
2913 N N   . TRP B 144 ? 1.7821 2.7160 1.8505 0.1333  0.1600  0.1741  159 TRP B N   
2914 C CA  . TRP B 144 ? 1.8076 2.7185 1.8252 0.1609  0.1441  0.1319  159 TRP B CA  
2915 C C   . TRP B 144 ? 1.9033 2.8213 1.8566 0.1976  0.1418  0.1267  159 TRP B C   
2916 O O   . TRP B 144 ? 1.9112 2.8155 1.8225 0.2243  0.1285  0.0922  159 TRP B O   
2917 C CB  . TRP B 144 ? 1.7782 2.7203 1.8023 0.1728  0.1517  0.1192  159 TRP B CB  
2918 C CG  . TRP B 144 ? 1.6977 2.6042 1.7534 0.1504  0.1375  0.0949  159 TRP B CG  
2919 C CD1 . TRP B 144 ? 1.6412 2.5583 1.7520 0.1232  0.1431  0.1064  159 TRP B CD1 
2920 C CD2 . TRP B 144 ? 1.6982 2.5525 1.7328 0.1540  0.1143  0.0555  159 TRP B CD2 
2921 N NE1 . TRP B 144 ? 1.6068 2.4819 1.7269 0.1115  0.1254  0.0756  159 TRP B NE1 
2922 C CE2 . TRP B 144 ? 1.6572 2.4938 1.7327 0.1295  0.1086  0.0457  159 TRP B CE2 
2923 C CE3 . TRP B 144 ? 1.7355 2.5563 1.7227 0.1759  0.0966  0.0279  159 TRP B CE3 
2924 C CZ2 . TRP B 144 ? 1.6550 2.4437 1.7241 0.1270  0.0886  0.0122  159 TRP B CZ2 
2925 C CZ3 . TRP B 144 ? 1.7281 2.5003 1.7145 0.1712  0.0755  -0.0052 159 TRP B CZ3 
2926 C CH2 . TRP B 144 ? 1.6857 2.4433 1.7124 0.1472  0.0730  -0.0113 159 TRP B CH2 
2927 N N   . SER B 145 ? 1.9690 2.9047 1.9154 0.1989  0.1522  0.1594  160 SER B N   
2928 C CA  . SER B 145 ? 2.0333 2.9948 1.9192 0.2378  0.1568  0.1643  160 SER B CA  
2929 C C   . SER B 145 ? 2.0761 2.9908 1.9085 0.2587  0.1289  0.1261  160 SER B C   
2930 O O   . SER B 145 ? 2.0633 2.9949 1.8395 0.2982  0.1263  0.1116  160 SER B O   
2931 C CB  . SER B 145 ? 2.0165 3.0064 1.9139 0.2305  0.1745  0.2126  160 SER B CB  
2932 O OG  . SER B 145 ? 2.0002 2.9422 1.9273 0.1979  0.1606  0.2168  160 SER B OG  
2933 N N   . GLN B 146 ? 2.0560 2.9125 1.9068 0.2338  0.1071  0.1092  161 GLN B N   
2934 C CA  . GLN B 146 ? 2.0710 2.8825 1.8805 0.2502  0.0790  0.0755  161 GLN B CA  
2935 C C   . GLN B 146 ? 2.0595 2.8458 1.8523 0.2651  0.0602  0.0305  161 GLN B C   
2936 O O   . GLN B 146 ? 2.0516 2.8007 1.8141 0.2796  0.0348  0.0010  161 GLN B O   
2937 C CB  . GLN B 146 ? 2.0723 2.8349 1.9105 0.2190  0.0644  0.0789  161 GLN B CB  
2938 C CG  . GLN B 146 ? 2.1119 2.8951 1.9674 0.2048  0.0807  0.1234  161 GLN B CG  
2939 C CD  . GLN B 146 ? 2.1807 3.0083 1.9870 0.2393  0.0927  0.1437  161 GLN B CD  
2940 O OE1 . GLN B 146 ? 2.2353 3.0532 1.9876 0.2705  0.0763  0.1203  161 GLN B OE1 
2941 N NE2 . GLN B 146 ? 2.1872 3.0645 2.0125 0.2351  0.1206  0.1875  161 GLN B NE2 
2942 N N   . GLY B 147 ? 2.0468 2.8537 1.8612 0.2622  0.0714  0.0258  162 GLY B N   
2943 C CA  . GLY B 147 ? 2.0355 2.8156 1.8453 0.2704  0.0543  -0.0135 162 GLY B CA  
2944 C C   . GLY B 147 ? 2.0076 2.7504 1.8694 0.2326  0.0476  -0.0192 162 GLY B C   
2945 O O   . GLY B 147 ? 1.9561 2.6893 1.8300 0.2318  0.0424  -0.0404 162 GLY B O   
2946 N N   . LYS B 148 ? 1.9867 2.7080 1.8770 0.2035  0.0469  -0.0007 163 LYS B N   
2947 C CA  . LYS B 148 ? 1.9151 2.6051 1.8542 0.1679  0.0433  -0.0012 163 LYS B CA  
2948 C C   . LYS B 148 ? 1.8093 2.5279 1.7872 0.1437  0.0642  0.0357  163 LYS B C   
2949 O O   . LYS B 148 ? 1.8259 2.5700 1.7950 0.1482  0.0757  0.0632  163 LYS B O   
2950 C CB  . LYS B 148 ? 1.9619 2.5986 1.9038 0.1551  0.0225  -0.0123 163 LYS B CB  
2951 C CG  . LYS B 148 ? 2.0761 2.6827 1.9812 0.1790  -0.0016 -0.0446 163 LYS B CG  
2952 C CD  . LYS B 148 ? 2.1640 2.7629 2.0667 0.1903  -0.0096 -0.0737 163 LYS B CD  
2953 C CE  . LYS B 148 ? 2.2408 2.8131 2.1080 0.2175  -0.0350 -0.1062 163 LYS B CE  
2954 N NZ  . LYS B 148 ? 2.2898 2.8369 2.1374 0.2232  -0.0528 -0.1088 163 LYS B NZ  
2955 N N   . ASN B 149 ? 1.7148 2.4284 1.7359 0.1190  0.0677  0.0362  164 ASN B N   
2956 C CA  . ASN B 149 ? 1.6368 2.3673 1.7052 0.0908  0.0819  0.0670  164 ASN B CA  
2957 C C   . ASN B 149 ? 1.6030 2.3066 1.6849 0.0718  0.0774  0.0838  164 ASN B C   
2958 O O   . ASN B 149 ? 1.6299 2.2872 1.7063 0.0661  0.0602  0.0657  164 ASN B O   
2959 C CB  . ASN B 149 ? 1.5883 2.3044 1.6962 0.0688  0.0783  0.0549  164 ASN B CB  
2960 C CG  . ASN B 149 ? 1.5415 2.2011 1.6471 0.0609  0.0579  0.0262  164 ASN B CG  
2961 O OD1 . ASN B 149 ? 1.6282 2.2666 1.6995 0.0797  0.0453  0.0044  164 ASN B OD1 
2962 N ND2 . ASN B 149 ? 1.4287 2.0642 1.5713 0.0344  0.0540  0.0268  164 ASN B ND2 
2963 N N   . ARG B 150 ? 1.5822 2.3161 1.6850 0.0623  0.0930  0.1201  165 ARG B N   
2964 C CA  . ARG B 150 ? 1.5792 2.2895 1.7090 0.0387  0.0904  0.1399  165 ARG B CA  
2965 C C   . ARG B 150 ? 1.5604 2.2904 1.7466 0.0125  0.1018  0.1641  165 ARG B C   
2966 O O   . ARG B 150 ? 1.5736 2.3457 1.7734 0.0162  0.1152  0.1737  165 ARG B O   
2967 C CB  . ARG B 150 ? 1.6372 2.3644 1.7399 0.0533  0.0966  0.1644  165 ARG B CB  
2968 C CG  . ARG B 150 ? 1.6960 2.4027 1.7427 0.0805  0.0816  0.1391  165 ARG B CG  
2969 C CD  . ARG B 150 ? 1.7547 2.4811 1.7707 0.0975  0.0873  0.1638  165 ARG B CD  
2970 N NE  . ARG B 150 ? 1.8105 2.5980 1.8172 0.1144  0.1107  0.1910  165 ARG B NE  
2971 C CZ  . ARG B 150 ? 1.8664 2.6857 1.8518 0.1295  0.1230  0.2224  165 ARG B CZ  
2972 N NH1 . ARG B 150 ? 1.8886 2.6831 1.8580 0.1299  0.1126  0.2295  165 ARG B NH1 
2973 N NH2 . ARG B 150 ? 1.9148 2.7932 1.8947 0.1456  0.1465  0.2482  165 ARG B NH2 
2974 N N   . CYS B 151 ? 1.5320 2.2315 1.7535 -0.0136 0.0954  0.1735  166 CYS B N   
2975 C CA  . CYS B 151 ? 1.4807 2.1940 1.7606 -0.0401 0.1023  0.1958  166 CYS B CA  
2976 C C   . CYS B 151 ? 1.5142 2.2850 1.8082 -0.0357 0.1239  0.2383  166 CYS B C   
2977 O O   . CYS B 151 ? 1.4955 2.2789 1.7626 -0.0216 0.1309  0.2583  166 CYS B O   
2978 C CB  . CYS B 151 ? 1.3974 2.0642 1.7081 -0.0653 0.0897  0.1973  166 CYS B CB  
2979 S SG  . CYS B 151 ? 1.2353 1.8430 1.5340 -0.0690 0.0683  0.1515  166 CYS B SG  
2980 N N   . PRO B 152 ? 1.5511 2.3597 1.8855 -0.0452 0.1347  0.2526  167 PRO B N   
2981 C CA  . PRO B 152 ? 1.5644 2.4321 1.9166 -0.0404 0.1573  0.2962  167 PRO B CA  
2982 C C   . PRO B 152 ? 1.5565 2.4195 1.9485 -0.0618 0.1604  0.3344  167 PRO B C   
2983 O O   . PRO B 152 ? 1.5635 2.3773 1.9755 -0.0825 0.1440  0.3244  167 PRO B O   
2984 C CB  . PRO B 152 ? 1.5645 2.4664 1.9598 -0.0497 0.1636  0.2981  167 PRO B CB  
2985 C CG  . PRO B 152 ? 1.5437 2.3971 1.9624 -0.0711 0.1423  0.2658  167 PRO B CG  
2986 C CD  . PRO B 152 ? 1.5517 2.3539 1.9180 -0.0593 0.1270  0.2313  167 PRO B CD  
2987 N N   . LYS B 153 ? 1.5385 2.4530 1.9421 -0.0553 0.1816  0.3785  168 LYS B N   
2988 C CA  . LYS B 153 ? 1.5085 2.4233 1.9508 -0.0736 0.1865  0.4208  168 LYS B CA  
2989 C C   . LYS B 153 ? 1.4417 2.3207 1.9538 -0.1118 0.1712  0.4211  168 LYS B C   
2990 O O   . LYS B 153 ? 1.4332 2.3283 1.9934 -0.1275 0.1707  0.4213  168 LYS B O   
2991 C CB  . LYS B 153 ? 1.5464 2.5318 2.0075 -0.0646 0.2143  0.4718  168 LYS B CB  
2992 C CG  . LYS B 153 ? 1.5696 2.5897 1.9599 -0.0250 0.2301  0.4796  168 LYS B CG  
2993 C CD  . LYS B 153 ? 1.5669 2.6588 1.9798 -0.0165 0.2599  0.5365  168 LYS B CD  
2994 C CE  . LYS B 153 ? 1.5938 2.7176 1.9323 0.0247  0.2748  0.5470  168 LYS B CE  
2995 N NZ  . LYS B 153 ? 1.6178 2.8187 1.9724 0.0385  0.3072  0.6021  168 LYS B NZ  
2996 N N   . GLY B 154 ? 1.4045 2.2339 1.9203 -0.1247 0.1568  0.4184  169 GLY B N   
2997 C CA  . GLY B 154 ? 1.4064 2.1982 1.9847 -0.1579 0.1408  0.4187  169 GLY B CA  
2998 C C   . GLY B 154 ? 1.4086 2.1568 1.9928 -0.1690 0.1196  0.3714  169 GLY B C   
2999 O O   . GLY B 154 ? 1.4003 2.1206 2.0369 -0.1945 0.1055  0.3696  169 GLY B O   
3000 N N   . ALA B 155 ? 1.4438 2.1848 1.9754 -0.1491 0.1162  0.3333  170 ALA B N   
3001 C CA  . ALA B 155 ? 1.4258 2.1254 1.9562 -0.1561 0.0972  0.2892  170 ALA B CA  
3002 C C   . ALA B 155 ? 1.4316 2.0705 1.9449 -0.1603 0.0805  0.2687  170 ALA B C   
3003 O O   . ALA B 155 ? 1.4011 2.0256 1.8642 -0.1423 0.0801  0.2580  170 ALA B O   
3004 C CB  . ALA B 155 ? 1.3954 2.1108 1.8807 -0.1335 0.1001  0.2596  170 ALA B CB  
3005 N N   . GLN B 156 ? 1.4131 2.0176 1.9702 -0.1832 0.0658  0.2625  171 GLN B N   
3006 C CA  . GLN B 156 ? 1.3906 1.9402 1.9431 -0.1894 0.0511  0.2485  171 GLN B CA  
3007 C C   . GLN B 156 ? 1.3169 1.8307 1.8295 -0.1782 0.0397  0.2046  171 GLN B C   
3008 O O   . GLN B 156 ? 1.2742 1.7868 1.7903 -0.1792 0.0341  0.1802  171 GLN B O   
3009 C CB  . GLN B 156 ? 1.4500 1.9746 2.0639 -0.2157 0.0379  0.2542  171 GLN B CB  
3010 C CG  . GLN B 156 ? 1.4881 2.0234 2.1465 -0.2307 0.0429  0.2982  171 GLN B CG  
3011 C CD  . GLN B 156 ? 1.5032 1.9876 2.1977 -0.2488 0.0244  0.2924  171 GLN B CD  
3012 O OE1 . GLN B 156 ? 1.4917 1.9590 2.2264 -0.2644 0.0098  0.2777  171 GLN B OE1 
3013 N NE2 . GLN B 156 ? 1.5156 1.9736 2.1931 -0.2447 0.0230  0.3005  171 GLN B NE2 
3014 N N   . CYS B 157 ? 1.2912 1.7759 1.7699 -0.1681 0.0357  0.1963  172 CYS B N   
3015 C CA  . CYS B 157 ? 1.2244 1.6746 1.6712 -0.1584 0.0254  0.1591  172 CYS B CA  
3016 C C   . CYS B 157 ? 1.2379 1.6460 1.7137 -0.1735 0.0113  0.1443  172 CYS B C   
3017 O O   . CYS B 157 ? 1.3189 1.7062 1.8164 -0.1836 0.0069  0.1589  172 CYS B O   
3018 C CB  . CYS B 157 ? 1.1844 1.6226 1.5888 -0.1417 0.0255  0.1571  172 CYS B CB  
3019 S SG  . CYS B 157 ? 1.2110 1.6940 1.5699 -0.1171 0.0379  0.1602  172 CYS B SG  
3020 N N   . LEU B 158 ? 1.2202 1.6165 1.6963 -0.1738 0.0040  0.1158  173 LEU B N   
3021 C CA  . LEU B 158 ? 1.2285 1.5876 1.7309 -0.1858 -0.0100 0.0992  173 LEU B CA  
3022 C C   . LEU B 158 ? 1.1332 1.4736 1.6070 -0.1739 -0.0154 0.0643  173 LEU B C   
3023 O O   . LEU B 158 ? 1.0388 1.3985 1.4820 -0.1602 -0.0090 0.0555  173 LEU B O   
3024 C CB  . LEU B 158 ? 1.2995 1.6724 1.8519 -0.2040 -0.0150 0.1084  173 LEU B CB  
3025 C CG  . LEU B 158 ? 1.3555 1.7535 1.9479 -0.2183 -0.0087 0.1478  173 LEU B CG  
3026 C CD1 . LEU B 158 ? 1.3591 1.7759 2.0020 -0.2350 -0.0145 0.1535  173 LEU B CD1 
3027 C CD2 . LEU B 158 ? 1.3758 1.7421 1.9873 -0.2273 -0.0145 0.1632  173 LEU B CD2 
3028 N N   . PRO B 159 ? 1.1451 1.4484 1.6285 -0.1774 -0.0272 0.0450  174 PRO B N   
3029 C CA  . PRO B 159 ? 1.1392 1.4280 1.5964 -0.1651 -0.0308 0.0148  174 PRO B CA  
3030 C C   . PRO B 159 ? 1.1407 1.4576 1.5922 -0.1613 -0.0288 0.0043  174 PRO B C   
3031 O O   . PRO B 159 ? 1.1974 1.5343 1.6784 -0.1727 -0.0313 0.0118  174 PRO B O   
3032 C CB  . PRO B 159 ? 1.1130 1.3658 1.5900 -0.1711 -0.0440 -0.0007 174 PRO B CB  
3033 C CG  . PRO B 159 ? 1.1252 1.3626 1.6270 -0.1819 -0.0465 0.0194  174 PRO B CG  
3034 C CD  . PRO B 159 ? 1.1474 1.4208 1.6649 -0.1908 -0.0379 0.0493  174 PRO B CD  
3035 N N   . PHE B 160 ? 1.1243 1.4426 1.5415 -0.1457 -0.0251 -0.0118 175 PHE B N   
3036 C CA  . PHE B 160 ? 1.0833 1.4211 1.4923 -0.1396 -0.0251 -0.0264 175 PHE B CA  
3037 C C   . PHE B 160 ? 1.1540 1.4841 1.5889 -0.1489 -0.0370 -0.0391 175 PHE B C   
3038 O O   . PHE B 160 ? 1.1548 1.5115 1.6044 -0.1530 -0.0383 -0.0387 175 PHE B O   
3039 C CB  . PHE B 160 ? 1.0360 1.3611 1.4093 -0.1222 -0.0234 -0.0450 175 PHE B CB  
3040 C CG  . PHE B 160 ? 0.9454 1.2895 1.2927 -0.1101 -0.0148 -0.0395 175 PHE B CG  
3041 C CD1 . PHE B 160 ? 0.9291 1.2776 1.2707 -0.1095 -0.0101 -0.0224 175 PHE B CD1 
3042 C CD2 . PHE B 160 ? 0.9353 1.2909 1.2624 -0.0974 -0.0132 -0.0531 175 PHE B CD2 
3043 C CE1 . PHE B 160 ? 0.9216 1.2858 1.2366 -0.0957 -0.0051 -0.0213 175 PHE B CE1 
3044 C CE2 . PHE B 160 ? 0.9043 1.2736 1.2080 -0.0847 -0.0081 -0.0514 175 PHE B CE2 
3045 C CZ  . PHE B 160 ? 0.8981 1.2714 1.1949 -0.0833 -0.0047 -0.0368 175 PHE B CZ  
3046 N N   . SER B 161 ? 1.2284 1.5233 1.6699 -0.1510 -0.0467 -0.0509 176 SER B N   
3047 C CA  . SER B 161 ? 1.2593 1.5436 1.7239 -0.1579 -0.0616 -0.0662 176 SER B CA  
3048 C C   . SER B 161 ? 1.2630 1.5650 1.7747 -0.1776 -0.0680 -0.0495 176 SER B C   
3049 O O   . SER B 161 ? 1.3104 1.6175 1.8435 -0.1833 -0.0804 -0.0606 176 SER B O   
3050 C CB  . SER B 161 ? 1.2925 1.5349 1.7527 -0.1532 -0.0711 -0.0833 176 SER B CB  
3051 O OG  . SER B 161 ? 1.3782 1.6007 1.8518 -0.1603 -0.0704 -0.0687 176 SER B OG  
3052 N N   . HIS B 162 ? 1.2355 1.5487 1.7649 -0.1876 -0.0603 -0.0216 177 HIS B N   
3053 C CA  . HIS B 162 ? 1.2443 1.5840 1.8200 -0.2054 -0.0621 0.0006  177 HIS B CA  
3054 C C   . HIS B 162 ? 1.2075 1.5928 1.7820 -0.2024 -0.0540 0.0052  177 HIS B C   
3055 O O   . HIS B 162 ? 1.3029 1.7023 1.9102 -0.2119 -0.0638 0.0021  177 HIS B O   
3056 C CB  . HIS B 162 ? 1.2607 1.6041 1.8547 -0.2151 -0.0538 0.0333  177 HIS B CB  
3057 C CG  . HIS B 162 ? 1.2441 1.6233 1.8840 -0.2312 -0.0505 0.0628  177 HIS B CG  
3058 N ND1 . HIS B 162 ? 1.2563 1.6275 1.9520 -0.2506 -0.0653 0.0698  177 HIS B ND1 
3059 C CD2 . HIS B 162 ? 1.2400 1.6645 1.8800 -0.2296 -0.0338 0.0883  177 HIS B CD2 
3060 C CE1 . HIS B 162 ? 1.2565 1.6681 1.9885 -0.2620 -0.0570 0.1009  177 HIS B CE1 
3061 N NE2 . HIS B 162 ? 1.2474 1.6934 1.9447 -0.2485 -0.0368 0.1128  177 HIS B NE2 
3062 N N   . TYR B 163 ? 1.0770 1.4846 1.6162 -0.1886 -0.0378 0.0115  178 TYR B N   
3063 C CA  . TYR B 163 ? 1.0003 1.4538 1.5389 -0.1840 -0.0283 0.0188  178 TYR B CA  
3064 C C   . TYR B 163 ? 1.0071 1.4640 1.5296 -0.1741 -0.0346 -0.0080 178 TYR B C   
3065 O O   . TYR B 163 ? 0.9568 1.4489 1.4946 -0.1749 -0.0328 -0.0047 178 TYR B O   
3066 C CB  . TYR B 163 ? 0.9588 1.4327 1.4629 -0.1700 -0.0109 0.0325  178 TYR B CB  
3067 C CG  . TYR B 163 ? 0.9362 1.4254 1.4605 -0.1789 -0.0020 0.0656  178 TYR B CG  
3068 C CD1 . TYR B 163 ? 0.9227 1.3863 1.4341 -0.1782 -0.0007 0.0738  178 TYR B CD1 
3069 C CD2 . TYR B 163 ? 0.9789 1.5105 1.5383 -0.1878 0.0053  0.0909  178 TYR B CD2 
3070 C CE1 . TYR B 163 ? 0.9517 1.4309 1.4807 -0.1852 0.0076  0.1066  178 TYR B CE1 
3071 C CE2 . TYR B 163 ? 0.9829 1.5320 1.5625 -0.1952 0.0152  0.1256  178 TYR B CE2 
3072 C CZ  . TYR B 163 ? 0.9692 1.4909 1.5324 -0.1938 0.0160  0.1332  178 TYR B CZ  
3073 O OH  . TYR B 163 ? 0.9299 1.4699 1.5118 -0.2000 0.0259  0.1693  178 TYR B OH  
3074 N N   . PHE B 164 ? 1.0275 1.4496 1.5196 -0.1636 -0.0409 -0.0327 179 PHE B N   
3075 C CA  . PHE B 164 ? 1.0431 1.4623 1.5172 -0.1528 -0.0480 -0.0585 179 PHE B CA  
3076 C C   . PHE B 164 ? 1.0908 1.4726 1.5729 -0.1564 -0.0650 -0.0784 179 PHE B C   
3077 O O   . PHE B 164 ? 1.1023 1.4538 1.5552 -0.1451 -0.0657 -0.0933 179 PHE B O   
3078 C CB  . PHE B 164 ? 1.0254 1.4396 1.4521 -0.1329 -0.0384 -0.0685 179 PHE B CB  
3079 C CG  . PHE B 164 ? 0.9948 1.4381 1.4076 -0.1260 -0.0237 -0.0523 179 PHE B CG  
3080 C CD1 . PHE B 164 ? 1.0120 1.4439 1.4056 -0.1212 -0.0160 -0.0423 179 PHE B CD1 
3081 C CD2 . PHE B 164 ? 0.9962 1.4782 1.4131 -0.1219 -0.0187 -0.0487 179 PHE B CD2 
3082 C CE1 . PHE B 164 ? 1.0094 1.4668 1.3857 -0.1117 -0.0047 -0.0304 179 PHE B CE1 
3083 C CE2 . PHE B 164 ? 1.0145 1.5234 1.4148 -0.1119 -0.0056 -0.0360 179 PHE B CE2 
3084 C CZ  . PHE B 164 ? 1.0123 1.5083 1.3908 -0.1063 0.0008  -0.0277 179 PHE B CZ  
3085 N N   . PRO B 165 ? 1.1478 1.5321 1.6714 -0.1713 -0.0794 -0.0787 180 PRO B N   
3086 C CA  . PRO B 165 ? 1.1357 1.4830 1.6662 -0.1728 -0.0981 -0.0999 180 PRO B CA  
3087 C C   . PRO B 165 ? 1.0990 1.4312 1.5893 -0.1532 -0.1024 -0.1283 180 PRO B C   
3088 O O   . PRO B 165 ? 1.1040 1.4017 1.5812 -0.1465 -0.1107 -0.1450 180 PRO B O   
3089 C CB  . PRO B 165 ? 1.1810 1.5421 1.7631 -0.1899 -0.1149 -0.0978 180 PRO B CB  
3090 C CG  . PRO B 165 ? 1.1834 1.5839 1.7949 -0.2024 -0.1016 -0.0655 180 PRO B CG  
3091 C CD  . PRO B 165 ? 1.1588 1.5802 1.7266 -0.1862 -0.0806 -0.0603 180 PRO B CD  
3092 N N   . THR B 166 ? 1.0626 1.4212 1.5338 -0.1429 -0.0963 -0.1327 181 THR B N   
3093 C CA  . THR B 166 ? 1.0676 1.4153 1.5013 -0.1235 -0.0990 -0.1559 181 THR B CA  
3094 C C   . THR B 166 ? 1.0222 1.3811 1.4195 -0.1086 -0.0812 -0.1511 181 THR B C   
3095 O O   . THR B 166 ? 0.9761 1.3612 1.3777 -0.1118 -0.0695 -0.1340 181 THR B O   
3096 C CB  . THR B 166 ? 1.0716 1.4368 1.5160 -0.1220 -0.1139 -0.1711 181 THR B CB  
3097 O OG1 . THR B 166 ? 1.0596 1.4660 1.5175 -0.1261 -0.1059 -0.1569 181 THR B OG1 
3098 C CG2 . THR B 166 ? 1.1127 1.4647 1.5960 -0.1362 -0.1362 -0.1793 181 THR B CG2 
3099 N N   . PRO B 167 ? 0.9896 1.3295 1.3517 -0.0908 -0.0797 -0.1663 182 PRO B N   
3100 C CA  . PRO B 167 ? 0.9753 1.3251 1.3070 -0.0758 -0.0668 -0.1644 182 PRO B CA  
3101 C C   . PRO B 167 ? 0.9812 1.3677 1.3185 -0.0753 -0.0645 -0.1603 182 PRO B C   
3102 O O   . PRO B 167 ? 0.9590 1.3605 1.2867 -0.0711 -0.0527 -0.1495 182 PRO B O   
3103 C CB  . PRO B 167 ? 0.9816 1.3118 1.2851 -0.0583 -0.0707 -0.1827 182 PRO B CB  
3104 C CG  . PRO B 167 ? 0.9639 1.2648 1.2747 -0.0619 -0.0798 -0.1909 182 PRO B CG  
3105 C CD  . PRO B 167 ? 0.9757 1.2833 1.3259 -0.0829 -0.0899 -0.1846 182 PRO B CD  
3106 N N   . ALA B 168 ? 1.0468 1.4476 1.4008 -0.0788 -0.0772 -0.1697 183 ALA B N   
3107 C CA  . ALA B 168 ? 1.0392 1.4775 1.4033 -0.0783 -0.0762 -0.1660 183 ALA B CA  
3108 C C   . ALA B 168 ? 1.0296 1.4942 1.4144 -0.0889 -0.0650 -0.1439 183 ALA B C   
3109 O O   . ALA B 168 ? 1.0575 1.5455 1.4308 -0.0802 -0.0547 -0.1379 183 ALA B O   
3110 C CB  . ALA B 168 ? 1.0511 1.4998 1.4387 -0.0837 -0.0945 -0.1783 183 ALA B CB  
3111 N N   . ASP B 169 ? 1.0482 1.5082 1.4614 -0.1058 -0.0665 -0.1314 184 ASP B N   
3112 C CA  . ASP B 169 ? 1.0868 1.5738 1.5184 -0.1145 -0.0544 -0.1074 184 ASP B CA  
3113 C C   . ASP B 169 ? 1.1024 1.5878 1.4996 -0.1014 -0.0390 -0.1011 184 ASP B C   
3114 O O   . ASP B 169 ? 1.1481 1.6645 1.5427 -0.0962 -0.0283 -0.0897 184 ASP B O   
3115 C CB  . ASP B 169 ? 1.1232 1.5990 1.5878 -0.1334 -0.0581 -0.0931 184 ASP B CB  
3116 C CG  . ASP B 169 ? 1.1974 1.6738 1.7026 -0.1477 -0.0761 -0.0988 184 ASP B CG  
3117 O OD1 . ASP B 169 ? 1.3343 1.8453 1.8655 -0.1522 -0.0788 -0.0940 184 ASP B OD1 
3118 O OD2 . ASP B 169 ? 1.2019 1.6442 1.7139 -0.1533 -0.0890 -0.1094 184 ASP B OD2 
3119 N N   . LEU B 170 ? 1.0702 1.5202 1.4422 -0.0948 -0.0388 -0.1092 185 LEU B N   
3120 C CA  . LEU B 170 ? 1.0521 1.4941 1.3959 -0.0840 -0.0279 -0.1042 185 LEU B CA  
3121 C C   . LEU B 170 ? 0.9601 1.4159 1.2793 -0.0667 -0.0235 -0.1121 185 LEU B C   
3122 O O   . LEU B 170 ? 0.9416 1.4151 1.2509 -0.0597 -0.0153 -0.1041 185 LEU B O   
3123 C CB  . LEU B 170 ? 1.1019 1.5033 1.4309 -0.0815 -0.0301 -0.1109 185 LEU B CB  
3124 C CG  . LEU B 170 ? 1.0931 1.4806 1.3990 -0.0723 -0.0223 -0.1061 185 LEU B CG  
3125 C CD1 . LEU B 170 ? 1.0763 1.4831 1.3865 -0.0763 -0.0151 -0.0883 185 LEU B CD1 
3126 C CD2 . LEU B 170 ? 1.1170 1.4681 1.4197 -0.0735 -0.0250 -0.1095 185 LEU B CD2 
3127 N N   . CYS B 171 ? 0.9200 1.3667 1.2287 -0.0584 -0.0299 -0.1281 186 CYS B N   
3128 C CA  . CYS B 171 ? 0.8982 1.3550 1.1861 -0.0418 -0.0274 -0.1358 186 CYS B CA  
3129 C C   . CYS B 171 ? 0.9269 1.4227 1.2237 -0.0394 -0.0236 -0.1304 186 CYS B C   
3130 O O   . CYS B 171 ? 0.9118 1.4175 1.1915 -0.0260 -0.0180 -0.1306 186 CYS B O   
3131 C CB  . CYS B 171 ? 0.8846 1.3311 1.1644 -0.0345 -0.0356 -0.1513 186 CYS B CB  
3132 S SG  . CYS B 171 ? 0.8526 1.2608 1.1060 -0.0229 -0.0328 -0.1563 186 CYS B SG  
3133 N N   . GLU B 172 ? 0.9722 1.4901 1.2983 -0.0520 -0.0276 -0.1255 187 GLU B N   
3134 C CA  . GLU B 172 ? 0.9849 1.5441 1.3251 -0.0495 -0.0248 -0.1207 187 GLU B CA  
3135 C C   . GLU B 172 ? 0.9896 1.5742 1.3361 -0.0511 -0.0124 -0.1019 187 GLU B C   
3136 O O   . GLU B 172 ? 0.9775 1.5846 1.3102 -0.0368 -0.0049 -0.1007 187 GLU B O   
3137 C CB  . GLU B 172 ? 0.9873 1.5607 1.3604 -0.0616 -0.0364 -0.1239 187 GLU B CB  
3138 C CG  . GLU B 172 ? 0.9832 1.5360 1.3408 -0.0534 -0.0486 -0.1446 187 GLU B CG  
3139 C CD  . GLU B 172 ? 0.9677 1.5295 1.3535 -0.0629 -0.0644 -0.1526 187 GLU B CD  
3140 O OE1 . GLU B 172 ? 1.0286 1.6094 1.4537 -0.0796 -0.0679 -0.1416 187 GLU B OE1 
3141 O OE2 . GLU B 172 ? 0.9031 1.4533 1.2721 -0.0525 -0.0742 -0.1696 187 GLU B OE2 
3142 N N   . LYS B 173 ? 1.0017 1.5809 1.3661 -0.0662 -0.0105 -0.0875 188 LYS B N   
3143 C CA  . LYS B 173 ? 1.0451 1.6558 1.4221 -0.0692 0.0014  -0.0652 188 LYS B CA  
3144 C C   . LYS B 173 ? 1.0851 1.6898 1.4300 -0.0566 0.0112  -0.0598 188 LYS B C   
3145 O O   . LYS B 173 ? 1.1442 1.7821 1.4869 -0.0492 0.0223  -0.0459 188 LYS B O   
3146 C CB  . LYS B 173 ? 1.0434 1.6556 1.4597 -0.0915 -0.0011 -0.0486 188 LYS B CB  
3147 C CG  . LYS B 173 ? 1.0663 1.6983 1.5219 -0.1030 -0.0108 -0.0501 188 LYS B CG  
3148 C CD  . LYS B 173 ? 1.0877 1.7073 1.5844 -0.1258 -0.0206 -0.0413 188 LYS B CD  
3149 C CE  . LYS B 173 ? 1.0716 1.7072 1.6055 -0.1350 -0.0349 -0.0486 188 LYS B CE  
3150 N NZ  . LYS B 173 ? 1.0994 1.7386 1.6867 -0.1583 -0.0425 -0.0317 188 LYS B NZ  
3151 N N   . THR B 174 ? 1.0759 1.6404 1.3961 -0.0524 0.0067  -0.0707 189 THR B N   
3152 C CA  . THR B 174 ? 1.0482 1.6033 1.3391 -0.0399 0.0120  -0.0685 189 THR B CA  
3153 C C   . THR B 174 ? 1.0598 1.6344 1.3267 -0.0185 0.0158  -0.0762 189 THR B C   
3154 O O   . THR B 174 ? 1.0430 1.6280 1.2912 -0.0070 0.0215  -0.0703 189 THR B O   
3155 C CB  . THR B 174 ? 1.0189 1.5280 1.2930 -0.0392 0.0051  -0.0791 189 THR B CB  
3156 O OG1 . THR B 174 ? 0.9470 1.4391 1.2144 -0.0336 -0.0016 -0.0968 189 THR B OG1 
3157 C CG2 . THR B 174 ? 1.0492 1.5393 1.3428 -0.0570 0.0028  -0.0695 189 THR B CG2 
3158 N N   . TRP B 175 ? 1.0794 1.6588 1.3462 -0.0120 0.0116  -0.0898 190 TRP B N   
3159 C CA  . TRP B 175 ? 1.1030 1.6919 1.3470 0.0092  0.0123  -0.1010 190 TRP B CA  
3160 C C   . TRP B 175 ? 1.0747 1.7063 1.3333 0.0138  0.0168  -0.0987 190 TRP B C   
3161 O O   . TRP B 175 ? 1.0800 1.7170 1.3279 0.0286  0.0142  -0.1113 190 TRP B O   
3162 C CB  . TRP B 175 ? 1.1537 1.7069 1.3840 0.0153  0.0029  -0.1183 190 TRP B CB  
3163 C CG  . TRP B 175 ? 1.2006 1.7188 1.4101 0.0217  -0.0008 -0.1227 190 TRP B CG  
3164 C CD1 . TRP B 175 ? 1.1816 1.6698 1.3928 0.0109  -0.0031 -0.1185 190 TRP B CD1 
3165 C CD2 . TRP B 175 ? 1.2120 1.7213 1.3997 0.0408  -0.0046 -0.1329 190 TRP B CD2 
3166 N NE1 . TRP B 175 ? 1.1268 1.5905 1.3204 0.0215  -0.0079 -0.1244 190 TRP B NE1 
3167 C CE2 . TRP B 175 ? 1.1886 1.6633 1.3681 0.0395  -0.0099 -0.1338 190 TRP B CE2 
3168 C CE3 . TRP B 175 ? 1.1935 1.7202 1.3698 0.0594  -0.0053 -0.1420 190 TRP B CE3 
3169 C CZ2 . TRP B 175 ? 1.2309 1.6876 1.3941 0.0549  -0.0174 -0.1434 190 TRP B CZ2 
3170 C CZ3 . TRP B 175 ? 1.2258 1.7327 1.3836 0.0757  -0.0127 -0.1525 190 TRP B CZ3 
3171 C CH2 . TRP B 175 ? 1.2531 1.7248 1.4056 0.0728  -0.0195 -0.1532 190 TRP B CH2 
3172 N N   . SER B 176 ? 1.0625 1.7252 1.3489 0.0011  0.0235  -0.0811 191 SER B N   
3173 C CA  . SER B 176 ? 1.0595 1.7692 1.3649 0.0054  0.0296  -0.0747 191 SER B CA  
3174 C C   . SER B 176 ? 0.9922 1.7021 1.3076 0.0063  0.0200  -0.0899 191 SER B C   
3175 O O   . SER B 176 ? 0.9692 1.7054 1.2810 0.0215  0.0225  -0.0950 191 SER B O   
3176 C CB  . SER B 176 ? 1.0928 1.8266 1.3714 0.0297  0.0393  -0.0743 191 SER B CB  
3177 O OG  . SER B 176 ? 1.1793 1.9655 1.4787 0.0335  0.0501  -0.0603 191 SER B OG  
3178 N N   . ASN B 177 ? 0.9485 1.6288 1.2740 -0.0077 0.0088  -0.0976 192 ASN B N   
3179 C CA  . ASN B 177 ? 0.9298 1.6059 1.2608 -0.0063 -0.0021 -0.1126 192 ASN B CA  
3180 C C   . ASN B 177 ? 0.9073 1.5721 1.2078 0.0151  -0.0043 -0.1285 192 ASN B C   
3181 O O   . ASN B 177 ? 0.8827 1.5613 1.1872 0.0225  -0.0095 -0.1369 192 ASN B O   
3182 C CB  . ASN B 177 ? 0.9174 1.6361 1.2865 -0.0142 -0.0033 -0.1050 192 ASN B CB  
3183 C CG  . ASN B 177 ? 0.9126 1.6416 1.3188 -0.0367 -0.0025 -0.0871 192 ASN B CG  
3184 O OD1 . ASN B 177 ? 0.9136 1.6185 1.3352 -0.0522 -0.0141 -0.0916 192 ASN B OD1 
3185 N ND2 . ASN B 177 ? 0.9023 1.6664 1.3223 -0.0372 0.0113  -0.0663 192 ASN B ND2 
3186 N N   . SER B 178 ? 0.8996 1.5379 1.1718 0.0246  -0.0017 -0.1318 193 SER B N   
3187 C CA  . SER B 178 ? 0.9170 1.5329 1.1642 0.0416  -0.0064 -0.1457 193 SER B CA  
3188 C C   . SER B 178 ? 0.9100 1.4969 1.1564 0.0364  -0.0155 -0.1544 193 SER B C   
3189 O O   . SER B 178 ? 0.8812 1.4630 1.1181 0.0484  -0.0203 -0.1636 193 SER B O   
3190 C CB  . SER B 178 ? 0.9513 1.5433 1.1750 0.0503  -0.0041 -0.1464 193 SER B CB  
3191 O OG  . SER B 178 ? 0.9794 1.5989 1.1959 0.0619  0.0032  -0.1418 193 SER B OG  
3192 N N   . PHE B 179 ? 0.9093 1.4784 1.1652 0.0199  -0.0178 -0.1508 194 PHE B N   
3193 C CA  . PHE B 179 ? 0.9117 1.4553 1.1646 0.0168  -0.0258 -0.1591 194 PHE B CA  
3194 C C   . PHE B 179 ? 0.9221 1.4791 1.1997 0.0027  -0.0331 -0.1599 194 PHE B C   
3195 O O   . PHE B 179 ? 0.9446 1.5196 1.2460 -0.0110 -0.0313 -0.1501 194 PHE B O   
3196 C CB  . PHE B 179 ? 0.9388 1.4448 1.1808 0.0122  -0.0247 -0.1574 194 PHE B CB  
3197 C CG  . PHE B 179 ? 0.9378 1.4300 1.1627 0.0224  -0.0198 -0.1552 194 PHE B CG  
3198 C CD1 . PHE B 179 ? 0.9399 1.4279 1.1505 0.0393  -0.0211 -0.1613 194 PHE B CD1 
3199 C CD2 . PHE B 179 ? 0.9743 1.4569 1.1991 0.0156  -0.0159 -0.1470 194 PHE B CD2 
3200 C CE1 . PHE B 179 ? 0.9561 1.4290 1.1547 0.0486  -0.0202 -0.1610 194 PHE B CE1 
3201 C CE2 . PHE B 179 ? 0.9722 1.4413 1.1820 0.0257  -0.0148 -0.1471 194 PHE B CE2 
3202 C CZ  . PHE B 179 ? 0.9696 1.4329 1.1673 0.0420  -0.0178 -0.1548 194 PHE B CZ  
3203 N N   . LYS B 180 ? 0.9229 1.4701 1.1949 0.0071  -0.0423 -0.1712 195 LYS B N   
3204 C CA  . LYS B 180 ? 0.9621 1.5129 1.2530 -0.0035 -0.0541 -0.1772 195 LYS B CA  
3205 C C   . LYS B 180 ? 0.9323 1.4445 1.2061 -0.0029 -0.0582 -0.1845 195 LYS B C   
3206 O O   . LYS B 180 ? 0.9273 1.4212 1.1748 0.0115  -0.0555 -0.1888 195 LYS B O   
3207 C CB  . LYS B 180 ? 1.0200 1.5919 1.3117 0.0068  -0.0627 -0.1866 195 LYS B CB  
3208 C CG  . LYS B 180 ? 1.0665 1.6733 1.3946 -0.0045 -0.0708 -0.1849 195 LYS B CG  
3209 C CD  . LYS B 180 ? 1.0915 1.6888 1.4446 -0.0223 -0.0838 -0.1883 195 LYS B CD  
3210 C CE  . LYS B 180 ? 1.1323 1.7635 1.5304 -0.0396 -0.0828 -0.1739 195 LYS B CE  
3211 N NZ  . LYS B 180 ? 1.1516 1.7822 1.5865 -0.0574 -0.1001 -0.1773 195 LYS B NZ  
3212 N N   . ALA B 181 ? 0.8792 1.3793 1.1693 -0.0177 -0.0642 -0.1849 196 ALA B N   
3213 C CA  . ALA B 181 ? 0.8550 1.3216 1.1298 -0.0150 -0.0696 -0.1943 196 ALA B CA  
3214 C C   . ALA B 181 ? 0.8681 1.3379 1.1349 -0.0051 -0.0830 -0.2099 196 ALA B C   
3215 O O   . ALA B 181 ? 0.9050 1.3919 1.1950 -0.0133 -0.0957 -0.2156 196 ALA B O   
3216 C CB  . ALA B 181 ? 0.8497 1.3024 1.1462 -0.0326 -0.0741 -0.1915 196 ALA B CB  
3217 N N   . SER B 182 ? 0.9342 1.3892 1.1694 0.0129  -0.0804 -0.2156 197 SER B N   
3218 C CA  . SER B 182 ? 0.9468 1.4054 1.1672 0.0266  -0.0920 -0.2295 197 SER B CA  
3219 C C   . SER B 182 ? 0.9853 1.4187 1.1959 0.0285  -0.1020 -0.2423 197 SER B C   
3220 O O   . SER B 182 ? 0.9714 1.3798 1.1708 0.0294  -0.0936 -0.2386 197 SER B O   
3221 C CB  . SER B 182 ? 0.9727 1.4282 1.1630 0.0474  -0.0827 -0.2260 197 SER B CB  
3222 O OG  . SER B 182 ? 0.9926 1.4518 1.1647 0.0630  -0.0932 -0.2378 197 SER B OG  
3223 N N   . PRO B 183 ? 1.0515 1.4911 1.2652 0.0311  -0.1210 -0.2586 198 PRO B N   
3224 C CA  . PRO B 183 ? 1.0376 1.4514 1.2314 0.0406  -0.1310 -0.2741 198 PRO B CA  
3225 C C   . PRO B 183 ? 1.0090 1.4108 1.1597 0.0657  -0.1201 -0.2733 198 PRO B C   
3226 O O   . PRO B 183 ? 1.0115 1.3898 1.1430 0.0747  -0.1192 -0.2794 198 PRO B O   
3227 C CB  . PRO B 183 ? 1.1053 1.5319 1.3100 0.0410  -0.1555 -0.2924 198 PRO B CB  
3228 C CG  . PRO B 183 ? 1.1139 1.5728 1.3239 0.0445  -0.1534 -0.2859 198 PRO B CG  
3229 C CD  . PRO B 183 ? 1.0615 1.5309 1.2909 0.0308  -0.1344 -0.2649 198 PRO B CD  
3230 N N   . GLU B 184 ? 0.9591 1.3774 1.0968 0.0775  -0.1115 -0.2646 199 GLU B N   
3231 C CA  . GLU B 184 ? 0.9727 1.3816 1.0749 0.1004  -0.0989 -0.2580 199 GLU B CA  
3232 C C   . GLU B 184 ? 0.9569 1.3441 1.0555 0.0988  -0.0805 -0.2438 199 GLU B C   
3233 O O   . GLU B 184 ? 0.8441 1.2292 0.9653 0.0817  -0.0730 -0.2335 199 GLU B O   
3234 C CB  . GLU B 184 ? 0.9892 1.4178 1.0855 0.1108  -0.0924 -0.2477 199 GLU B CB  
3235 C CG  . GLU B 184 ? 1.0175 1.4715 1.1172 0.1152  -0.1083 -0.2582 199 GLU B CG  
3236 C CD  . GLU B 184 ? 1.0796 1.5330 1.1463 0.1385  -0.1186 -0.2700 199 GLU B CD  
3237 O OE1 . GLU B 184 ? 1.0842 1.5587 1.1489 0.1468  -0.1283 -0.2742 199 GLU B OE1 
3238 O OE2 . GLU B 184 ? 1.1611 1.5946 1.2029 0.1502  -0.1173 -0.2752 199 GLU B OE2 
3239 N N   . ARG B 185 ? 1.0245 1.3978 1.0937 0.1186  -0.0735 -0.2426 200 ARG B N   
3240 C CA  . ARG B 185 ? 1.0084 1.3620 1.0732 0.1211  -0.0567 -0.2293 200 ARG B CA  
3241 C C   . ARG B 185 ? 0.9514 1.3098 1.0084 0.1330  -0.0413 -0.2098 200 ARG B C   
3242 O O   . ARG B 185 ? 0.9188 1.2938 0.9714 0.1403  -0.0439 -0.2079 200 ARG B O   
3243 C CB  . ARG B 185 ? 1.0656 1.4027 1.1055 0.1370  -0.0581 -0.2396 200 ARG B CB  
3244 C CG  . ARG B 185 ? 1.1383 1.4681 1.1843 0.1289  -0.0783 -0.2629 200 ARG B CG  
3245 C CD  . ARG B 185 ? 1.1701 1.4751 1.2098 0.1323  -0.0758 -0.2684 200 ARG B CD  
3246 N NE  . ARG B 185 ? 1.1599 1.4546 1.2319 0.1082  -0.0708 -0.2590 200 ARG B NE  
3247 C CZ  . ARG B 185 ? 1.2069 1.4843 1.2811 0.1079  -0.0576 -0.2489 200 ARG B CZ  
3248 N NH1 . ARG B 185 ? 1.2460 1.5150 1.2940 0.1305  -0.0458 -0.2454 200 ARG B NH1 
3249 N NH2 . ARG B 185 ? 1.2139 1.4843 1.3176 0.0855  -0.0554 -0.2406 200 ARG B NH2 
3250 N N   . ARG B 186 ? 0.9186 1.2621 0.9771 0.1350  -0.0262 -0.1949 201 ARG B N   
3251 C CA  . ARG B 186 ? 0.8816 1.2259 0.9444 0.1412  -0.0126 -0.1739 201 ARG B CA  
3252 C C   . ARG B 186 ? 0.9276 1.2780 0.9645 0.1664  -0.0067 -0.1669 201 ARG B C   
3253 O O   . ARG B 186 ? 0.9480 1.2951 0.9613 0.1811  -0.0064 -0.1736 201 ARG B O   
3254 C CB  . ARG B 186 ? 0.8565 1.1831 0.9322 0.1359  0.0000  -0.1600 201 ARG B CB  
3255 C CG  . ARG B 186 ? 0.8429 1.1667 0.9458 0.1186  0.0013  -0.1515 201 ARG B CG  
3256 C CD  . ARG B 186 ? 0.8218 1.1277 0.9384 0.1108  0.0092  -0.1429 201 ARG B CD  
3257 N NE  . ARG B 186 ? 0.8186 1.1212 0.9578 0.0922  0.0059  -0.1411 201 ARG B NE  
3258 C CZ  . ARG B 186 ? 0.8308 1.1191 0.9862 0.0846  0.0112  -0.1311 201 ARG B CZ  
3259 N NH1 . ARG B 186 ? 0.8372 1.1244 1.0088 0.0701  0.0067  -0.1307 201 ARG B NH1 
3260 N NH2 . ARG B 186 ? 0.8598 1.1365 1.0153 0.0927  0.0210  -0.1210 201 ARG B NH2 
3261 N N   . ASN B 187 ? 0.9888 1.3475 1.0295 0.1729  -0.0018 -0.1525 202 ASN B N   
3262 C CA  . ASN B 187 ? 1.0569 1.4246 1.0741 0.1977  0.0037  -0.1422 202 ASN B CA  
3263 C C   . ASN B 187 ? 1.0593 1.4429 1.0506 0.2104  -0.0100 -0.1596 202 ASN B C   
3264 O O   . ASN B 187 ? 1.0773 1.4682 1.0428 0.2336  -0.0059 -0.1526 202 ASN B O   
3265 C CB  . ASN B 187 ? 1.0983 1.4574 1.1015 0.2142  0.0197  -0.1275 202 ASN B CB  
3266 C CG  . ASN B 187 ? 1.1210 1.4663 1.1527 0.2035  0.0326  -0.1084 202 ASN B CG  
3267 O OD1 . ASN B 187 ? 1.2275 1.5714 1.2834 0.1950  0.0339  -0.0958 202 ASN B OD1 
3268 N ND2 . ASN B 187 ? 1.1291 1.4636 1.1593 0.2046  0.0408  -0.1068 202 ASN B ND2 
3269 N N   . SER B 188 ? 1.0156 1.4056 1.0153 0.1957  -0.0267 -0.1806 203 SER B N   
3270 C CA  . SER B 188 ? 0.9872 1.3944 0.9715 0.2044  -0.0429 -0.1967 203 SER B CA  
3271 C C   . SER B 188 ? 0.9886 1.4121 0.9788 0.2095  -0.0433 -0.1868 203 SER B C   
3272 O O   . SER B 188 ? 1.0647 1.5041 1.0387 0.2229  -0.0543 -0.1947 203 SER B O   
3273 C CB  . SER B 188 ? 0.9449 1.3552 0.9461 0.1846  -0.0604 -0.2190 203 SER B CB  
3274 O OG  . SER B 188 ? 0.8625 1.2815 0.8948 0.1653  -0.0610 -0.2148 203 SER B OG  
3275 N N   . GLY B 189 ? 0.9485 1.3672 0.9620 0.2002  -0.0332 -0.1708 204 GLY B N   
3276 C CA  . GLY B 189 ? 0.9315 1.3624 0.9559 0.2028  -0.0349 -0.1633 204 GLY B CA  
3277 C C   . GLY B 189 ? 0.9184 1.3643 0.9634 0.1865  -0.0472 -0.1779 204 GLY B C   
3278 O O   . GLY B 189 ? 0.8969 1.3538 0.9521 0.1890  -0.0489 -0.1737 204 GLY B O   
3279 N N   . ARG B 190 ? 0.9565 1.4032 1.0102 0.1702  -0.0550 -0.1933 205 ARG B N   
3280 C CA  . ARG B 190 ? 0.9989 1.4654 1.0739 0.1554  -0.0670 -0.2060 205 ARG B CA  
3281 C C   . ARG B 190 ? 0.9616 1.4245 1.0626 0.1318  -0.0649 -0.2075 205 ARG B C   
3282 O O   . ARG B 190 ? 0.9624 1.4396 1.0802 0.1186  -0.0751 -0.2181 205 ARG B O   
3283 C CB  . ARG B 190 ? 1.0852 1.5640 1.1506 0.1594  -0.0840 -0.2238 205 ARG B CB  
3284 C CG  . ARG B 190 ? 1.1670 1.6529 1.2036 0.1844  -0.0884 -0.2238 205 ARG B CG  
3285 C CD  . ARG B 190 ? 1.2675 1.7770 1.3065 0.1869  -0.1089 -0.2406 205 ARG B CD  
3286 N NE  . ARG B 190 ? 1.3499 1.8551 1.3878 0.1803  -0.1243 -0.2600 205 ARG B NE  
3287 C CZ  . ARG B 190 ? 1.3978 1.9174 1.4325 0.1856  -0.1459 -0.2778 205 ARG B CZ  
3288 N NH1 . ARG B 190 ? 1.3837 1.8942 1.4203 0.1790  -0.1612 -0.2960 205 ARG B NH1 
3289 N NH2 . ARG B 190 ? 1.4325 1.9744 1.4637 0.1980  -0.1542 -0.2783 205 ARG B NH2 
3290 N N   . CYS B 191 ? 0.9368 1.3817 1.0428 0.1271  -0.0524 -0.1954 206 CYS B N   
3291 C CA  . CYS B 191 ? 0.8968 1.3359 1.0232 0.1074  -0.0489 -0.1941 206 CYS B CA  
3292 C C   . CYS B 191 ? 0.8708 1.2903 0.9980 0.1097  -0.0370 -0.1799 206 CYS B C   
3293 O O   . CYS B 191 ? 0.8718 1.2785 0.9862 0.1231  -0.0307 -0.1709 206 CYS B O   
3294 C CB  . CYS B 191 ? 0.8771 1.3053 1.0065 0.0951  -0.0528 -0.2019 206 CYS B CB  
3295 S SG  . CYS B 191 ? 0.9184 1.3196 1.0244 0.1072  -0.0459 -0.1990 206 CYS B SG  
3296 N N   . LEU B 192 ? 0.8414 1.2589 0.9846 0.0971  -0.0342 -0.1769 207 LEU B N   
3297 C CA  . LEU B 192 ? 0.8167 1.2170 0.9643 0.0994  -0.0269 -0.1655 207 LEU B CA  
3298 C C   . LEU B 192 ? 0.7903 1.1728 0.9443 0.0874  -0.0225 -0.1620 207 LEU B C   
3299 O O   . LEU B 192 ? 0.7363 1.1230 0.8955 0.0746  -0.0254 -0.1684 207 LEU B O   
3300 C CB  . LEU B 192 ? 0.8447 1.2563 1.0027 0.0984  -0.0289 -0.1662 207 LEU B CB  
3301 C CG  . LEU B 192 ? 0.8796 1.3076 1.0340 0.1124  -0.0330 -0.1685 207 LEU B CG  
3302 C CD1 . LEU B 192 ? 0.9055 1.3634 1.0637 0.1084  -0.0392 -0.1788 207 LEU B CD1 
3303 C CD2 . LEU B 192 ? 0.8960 1.3193 1.0576 0.1186  -0.0333 -0.1654 207 LEU B CD2 
3304 N N   . GLN B 193 ? 0.7817 1.1446 0.9390 0.0913  -0.0165 -0.1507 208 GLN B N   
3305 C CA  . GLN B 193 ? 0.7921 1.1369 0.9581 0.0812  -0.0125 -0.1455 208 GLN B CA  
3306 C C   . GLN B 193 ? 0.7641 1.1067 0.9421 0.0752  -0.0150 -0.1439 208 GLN B C   
3307 O O   . GLN B 193 ? 0.7709 1.1146 0.9515 0.0838  -0.0176 -0.1422 208 GLN B O   
3308 C CB  . GLN B 193 ? 0.8266 1.1531 0.9926 0.0899  -0.0048 -0.1327 208 GLN B CB  
3309 C CG  . GLN B 193 ? 0.8474 1.1752 0.9970 0.0983  -0.0011 -0.1344 208 GLN B CG  
3310 C CD  . GLN B 193 ? 0.8579 1.1725 1.0071 0.1098  0.0094  -0.1186 208 GLN B CD  
3311 O OE1 . GLN B 193 ? 0.9670 1.2869 1.0999 0.1249  0.0135  -0.1154 208 GLN B OE1 
3312 N NE2 . GLN B 193 ? 0.8343 1.1336 1.0018 0.1037  0.0139  -0.1075 208 GLN B NE2 
3313 N N   . LYS B 194 ? 0.7383 1.0773 0.9227 0.0620  -0.0153 -0.1451 209 LYS B N   
3314 C CA  . LYS B 194 ? 0.7267 1.0633 0.9185 0.0581  -0.0183 -0.1441 209 LYS B CA  
3315 C C   . LYS B 194 ? 0.6968 1.0090 0.8981 0.0601  -0.0178 -0.1350 209 LYS B C   
3316 O O   . LYS B 194 ? 0.6907 0.9977 0.8974 0.0610  -0.0233 -0.1355 209 LYS B O   
3317 C CB  . LYS B 194 ? 0.7218 1.0677 0.9164 0.0445  -0.0189 -0.1468 209 LYS B CB  
3318 C CG  . LYS B 194 ? 0.7789 1.1089 0.9790 0.0337  -0.0161 -0.1420 209 LYS B CG  
3319 C CD  . LYS B 194 ? 0.7969 1.1343 1.0021 0.0216  -0.0171 -0.1408 209 LYS B CD  
3320 C CE  . LYS B 194 ? 0.8283 1.1496 1.0407 0.0108  -0.0152 -0.1361 209 LYS B CE  
3321 N NZ  . LYS B 194 ? 0.8472 1.1438 1.0626 0.0151  -0.0132 -0.1302 209 LYS B NZ  
3322 N N   . TRP B 195 ? 0.6687 0.9674 0.8729 0.0617  -0.0120 -0.1270 210 TRP B N   
3323 C CA  . TRP B 195 ? 0.6853 0.9638 0.9045 0.0651  -0.0106 -0.1149 210 TRP B CA  
3324 C C   . TRP B 195 ? 0.6974 0.9720 0.9156 0.0745  -0.0018 -0.1047 210 TRP B C   
3325 O O   . TRP B 195 ? 0.6927 0.9751 0.8963 0.0767  0.0029  -0.1086 210 TRP B O   
3326 C CB  . TRP B 195 ? 0.6904 0.9560 0.9194 0.0542  -0.0106 -0.1115 210 TRP B CB  
3327 C CG  . TRP B 195 ? 0.6972 0.9446 0.9469 0.0550  -0.0143 -0.1018 210 TRP B CG  
3328 C CD1 . TRP B 195 ? 0.7040 0.9451 0.9617 0.0543  -0.0256 -0.1054 210 TRP B CD1 
3329 C CD2 . TRP B 195 ? 0.6877 0.9214 0.9546 0.0570  -0.0081 -0.0872 210 TRP B CD2 
3330 N NE1 . TRP B 195 ? 0.6767 0.8992 0.9582 0.0543  -0.0289 -0.0946 210 TRP B NE1 
3331 C CE2 . TRP B 195 ? 0.6842 0.9034 0.9738 0.0554  -0.0171 -0.0817 210 TRP B CE2 
3332 C CE3 . TRP B 195 ? 0.7199 0.9535 0.9854 0.0615  0.0040  -0.0781 210 TRP B CE3 
3333 C CZ2 . TRP B 195 ? 0.7015 0.9075 1.0176 0.0561  -0.0140 -0.0654 210 TRP B CZ2 
3334 C CZ3 . TRP B 195 ? 0.7085 0.9307 0.9966 0.0640  0.0095  -0.0614 210 TRP B CZ3 
3335 C CH2 . TRP B 195 ? 0.7104 0.9195 1.0263 0.0603  0.0007  -0.0540 210 TRP B CH2 
3336 N N   . PHE B 196 ? 0.7447 1.0076 0.9795 0.0811  -0.0003 -0.0910 211 PHE B N   
3337 C CA  . PHE B 196 ? 0.7659 1.0275 1.0017 0.0922  0.0102  -0.0765 211 PHE B CA  
3338 C C   . PHE B 196 ? 0.7697 1.0155 1.0356 0.0926  0.0118  -0.0582 211 PHE B C   
3339 O O   . PHE B 196 ? 0.7332 0.9690 1.0171 0.0872  0.0012  -0.0596 211 PHE B O   
3340 C CB  . PHE B 196 ? 0.7650 1.0388 0.9885 0.1049  0.0101  -0.0767 211 PHE B CB  
3341 C CG  . PHE B 196 ? 0.7634 1.0349 0.9991 0.1069  -0.0001 -0.0783 211 PHE B CG  
3342 C CD1 . PHE B 196 ? 0.7290 1.0110 0.9539 0.1035  -0.0094 -0.0958 211 PHE B CD1 
3343 C CD2 . PHE B 196 ? 0.7823 1.0413 1.0422 0.1131  -0.0009 -0.0618 211 PHE B CD2 
3344 C CE1 . PHE B 196 ? 0.7363 1.0157 0.9699 0.1083  -0.0194 -0.0993 211 PHE B CE1 
3345 C CE2 . PHE B 196 ? 0.7776 1.0311 1.0496 0.1162  -0.0130 -0.0655 211 PHE B CE2 
3346 C CZ  . PHE B 196 ? 0.7594 1.0227 1.0159 0.1148  -0.0223 -0.0856 211 PHE B CZ  
3347 N N   . GLU B 197 ? 0.8542 1.0987 1.1265 0.1000  0.0245  -0.0412 212 GLU B N   
3348 C CA  . GLU B 197 ? 0.9340 1.1658 1.2417 0.0993  0.0270  -0.0206 212 GLU B CA  
3349 C C   . GLU B 197 ? 0.9816 1.2102 1.3097 0.1062  0.0218  -0.0087 212 GLU B C   
3350 O O   . GLU B 197 ? 0.9828 1.2219 1.2979 0.1185  0.0283  -0.0025 212 GLU B O   
3351 C CB  . GLU B 197 ? 0.9441 1.1792 1.2548 0.1070  0.0445  -0.0031 212 GLU B CB  
3352 C CG  . GLU B 197 ? 0.9360 1.1594 1.2840 0.1003  0.0461  0.0128  212 GLU B CG  
3353 C CD  . GLU B 197 ? 0.9353 1.1511 1.2801 0.0872  0.0402  -0.0015 212 GLU B CD  
3354 O OE1 . GLU B 197 ? 0.8914 1.1128 1.2081 0.0877  0.0455  -0.0139 212 GLU B OE1 
3355 O OE2 . GLU B 197 ? 0.9799 1.1834 1.3514 0.0768  0.0290  -0.0003 212 GLU B OE2 
3356 N N   . PRO B 198 ? 1.0470 1.2600 1.4072 0.0992  0.0086  -0.0059 213 PRO B N   
3357 C CA  . PRO B 198 ? 1.0929 1.2991 1.4751 0.1053  0.0001  0.0027  213 PRO B CA  
3358 C C   . PRO B 198 ? 1.1585 1.3687 1.5610 0.1159  0.0141  0.0326  213 PRO B C   
3359 O O   . PRO B 198 ? 1.2013 1.4153 1.6032 0.1259  0.0140  0.0395  213 PRO B O   
3360 C CB  . PRO B 198 ? 1.1081 1.2942 1.5248 0.0957  -0.0177 0.0005  213 PRO B CB  
3361 C CG  . PRO B 198 ? 1.0863 1.2709 1.4925 0.0848  -0.0190 -0.0117 213 PRO B CG  
3362 C CD  . PRO B 198 ? 1.0861 1.2856 1.4675 0.0869  0.0004  -0.0081 213 PRO B CD  
3363 N N   . ALA B 199 ? 1.1856 1.3967 1.6065 0.1149  0.0270  0.0517  214 ALA B N   
3364 C CA  . ALA B 199 ? 1.2443 1.4645 1.6820 0.1271  0.0446  0.0833  214 ALA B CA  
3365 C C   . ALA B 199 ? 1.2644 1.5024 1.6619 0.1432  0.0558  0.0828  214 ALA B C   
3366 O O   . ALA B 199 ? 1.2658 1.5081 1.6766 0.1541  0.0610  0.1042  214 ALA B O   
3367 C CB  . ALA B 199 ? 1.2170 1.4419 1.6676 0.1266  0.0603  0.0994  214 ALA B CB  
3368 N N   . GLN B 200 ? 1.2698 1.5173 1.6212 0.1442  0.0571  0.0583  215 GLN B N   
3369 C CA  . GLN B 200 ? 1.3188 1.5843 1.6298 0.1603  0.0669  0.0560  215 GLN B CA  
3370 C C   . GLN B 200 ? 1.2825 1.5520 1.5781 0.1649  0.0558  0.0443  215 GLN B C   
3371 O O   . GLN B 200 ? 1.3338 1.6184 1.5986 0.1790  0.0620  0.0435  215 GLN B O   
3372 C CB  . GLN B 200 ? 1.3787 1.6524 1.6498 0.1603  0.0710  0.0343  215 GLN B CB  
3373 C CG  . GLN B 200 ? 1.4373 1.7058 1.7160 0.1542  0.0785  0.0359  215 GLN B CG  
3374 C CD  . GLN B 200 ? 1.4736 1.7422 1.7855 0.1606  0.0937  0.0684  215 GLN B CD  
3375 O OE1 . GLN B 200 ? 1.4400 1.6985 1.7811 0.1496  0.0928  0.0737  215 GLN B OE1 
3376 N NE2 . GLN B 200 ? 1.5062 1.7880 1.8150 0.1791  0.1081  0.0917  215 GLN B NE2 
3377 N N   . GLY B 201 ? 1.2087 1.4657 1.5232 0.1549  0.0387  0.0337  216 GLY B N   
3378 C CA  . GLY B 201 ? 1.1314 1.3924 1.4351 0.1610  0.0284  0.0240  216 GLY B CA  
3379 C C   . GLY B 201 ? 1.0598 1.3331 1.3253 0.1584  0.0224  -0.0055 216 GLY B C   
3380 O O   . GLY B 201 ? 1.0406 1.3230 1.2814 0.1571  0.0293  -0.0146 216 GLY B O   
3381 N N   . ASN B 202 ? 1.0107 1.2847 1.2743 0.1585  0.0091  -0.0198 217 ASN B N   
3382 C CA  . ASN B 202 ? 0.9598 1.2455 1.1982 0.1529  0.0011  -0.0471 217 ASN B CA  
3383 C C   . ASN B 202 ? 0.9295 1.2364 1.1349 0.1623  0.0063  -0.0537 217 ASN B C   
3384 O O   . ASN B 202 ? 0.9511 1.2662 1.1502 0.1755  0.0059  -0.0479 217 ASN B O   
3385 C CB  . ASN B 202 ? 0.9436 1.2254 1.1920 0.1532  -0.0138 -0.0589 217 ASN B CB  
3386 C CG  . ASN B 202 ? 0.9412 1.2361 1.1707 0.1460  -0.0208 -0.0840 217 ASN B CG  
3387 O OD1 . ASN B 202 ? 0.9809 1.2928 1.1880 0.1442  -0.0162 -0.0928 217 ASN B OD1 
3388 N ND2 . ASN B 202 ? 0.9373 1.2249 1.1769 0.1429  -0.0324 -0.0951 217 ASN B ND2 
3389 N N   . PRO B 203 ? 0.9152 1.2300 1.1007 0.1558  0.0092  -0.0666 218 PRO B N   
3390 C CA  . PRO B 203 ? 0.9396 1.2725 1.0957 0.1645  0.0106  -0.0754 218 PRO B CA  
3391 C C   . PRO B 203 ? 0.9443 1.2931 1.0912 0.1617  -0.0010 -0.0955 218 PRO B C   
3392 O O   . PRO B 203 ? 0.9324 1.2971 1.0583 0.1681  -0.0032 -0.1046 218 PRO B O   
3393 C CB  . PRO B 203 ? 0.9263 1.2570 1.0717 0.1569  0.0153  -0.0826 218 PRO B CB  
3394 C CG  . PRO B 203 ? 0.9188 1.2388 1.0832 0.1389  0.0103  -0.0894 218 PRO B CG  
3395 C CD  . PRO B 203 ? 0.9158 1.2235 1.1058 0.1395  0.0077  -0.0769 218 PRO B CD  
3396 N N   . ASN B 204 ? 0.9299 1.2759 1.0922 0.1532  -0.0088 -0.1028 219 ASN B N   
3397 C CA  . ASN B 204 ? 0.9294 1.2941 1.0856 0.1510  -0.0178 -0.1202 219 ASN B CA  
3398 C C   . ASN B 204 ? 0.9789 1.3520 1.1360 0.1654  -0.0231 -0.1183 219 ASN B C   
3399 O O   . ASN B 204 ? 0.9379 1.3319 1.0871 0.1679  -0.0292 -0.1308 219 ASN B O   
3400 C CB  . ASN B 204 ? 0.8928 1.2547 1.0610 0.1377  -0.0226 -0.1299 219 ASN B CB  
3401 C CG  . ASN B 204 ? 0.8511 1.2084 1.0185 0.1227  -0.0192 -0.1335 219 ASN B CG  
3402 O OD1 . ASN B 204 ? 0.8569 1.2176 1.0134 0.1206  -0.0155 -0.1351 219 ASN B OD1 
3403 N ND2 . ASN B 204 ? 0.8249 1.1744 1.0033 0.1131  -0.0218 -0.1362 219 ASN B ND2 
3404 N N   . VAL B 205 ? 0.9782 1.3355 1.1482 0.1745  -0.0214 -0.1020 220 VAL B N   
3405 C CA  . VAL B 205 ? 1.0104 1.3722 1.1838 0.1894  -0.0268 -0.0977 220 VAL B CA  
3406 C C   . VAL B 205 ? 0.9910 1.3764 1.1418 0.2004  -0.0274 -0.1020 220 VAL B C   
3407 O O   . VAL B 205 ? 1.0217 1.4235 1.1700 0.2055  -0.0353 -0.1132 220 VAL B O   
3408 C CB  . VAL B 205 ? 1.0268 1.3670 1.2202 0.1971  -0.0231 -0.0737 220 VAL B CB  
3409 C CG1 . VAL B 205 ? 1.0378 1.3837 1.2297 0.2149  -0.0241 -0.0616 220 VAL B CG1 
3410 C CG2 . VAL B 205 ? 1.0238 1.3427 1.2444 0.1902  -0.0312 -0.0752 220 VAL B CG2 
3411 N N   . ALA B 206 ? 1.0028 1.3905 1.1373 0.2051  -0.0196 -0.0937 221 ALA B N   
3412 C CA  . ALA B 206 ? 1.0507 1.4584 1.1613 0.2178  -0.0216 -0.0974 221 ALA B CA  
3413 C C   . ALA B 206 ? 1.0905 1.5193 1.1903 0.2094  -0.0305 -0.1214 221 ALA B C   
3414 O O   . ALA B 206 ? 1.1250 1.5735 1.2125 0.2189  -0.0378 -0.1287 221 ALA B O   
3415 C CB  . ALA B 206 ? 1.0530 1.4569 1.1461 0.2283  -0.0111 -0.0826 221 ALA B CB  
3416 N N   . VAL B 207 ? 1.0680 1.4936 1.1755 0.1916  -0.0307 -0.1322 222 VAL B N   
3417 C CA  . VAL B 207 ? 1.0675 1.5133 1.1728 0.1819  -0.0390 -0.1513 222 VAL B CA  
3418 C C   . VAL B 207 ? 1.0597 1.5217 1.1776 0.1833  -0.0456 -0.1576 222 VAL B C   
3419 O O   . VAL B 207 ? 1.0158 1.5019 1.1323 0.1850  -0.0534 -0.1682 222 VAL B O   
3420 C CB  . VAL B 207 ? 1.0355 1.4746 1.1490 0.1624  -0.0371 -0.1584 222 VAL B CB  
3421 C CG1 . VAL B 207 ? 1.0263 1.4873 1.1407 0.1531  -0.0460 -0.1747 222 VAL B CG1 
3422 C CG2 . VAL B 207 ? 1.0565 1.4757 1.1610 0.1619  -0.0290 -0.1506 222 VAL B CG2 
3423 N N   . ALA B 208 ? 1.1201 1.5689 1.2518 0.1835  -0.0433 -0.1515 223 ALA B N   
3424 C CA  . ALA B 208 ? 1.1775 1.6399 1.3194 0.1884  -0.0493 -0.1583 223 ALA B CA  
3425 C C   . ALA B 208 ? 1.2072 1.6845 1.3421 0.2052  -0.0545 -0.1568 223 ALA B C   
3426 O O   . ALA B 208 ? 1.2200 1.7240 1.3563 0.2071  -0.0608 -0.1675 223 ALA B O   
3427 C CB  . ALA B 208 ? 1.1650 1.6057 1.3204 0.1907  -0.0489 -0.1528 223 ALA B CB  
3428 N N   . ARG B 209 ? 1.2183 1.6800 1.3473 0.2175  -0.0514 -0.1416 224 ARG B N   
3429 C CA  . ARG B 209 ? 1.2414 1.7151 1.3629 0.2356  -0.0560 -0.1367 224 ARG B CA  
3430 C C   . ARG B 209 ? 1.1994 1.6997 1.3059 0.2367  -0.0622 -0.1484 224 ARG B C   
3431 O O   . ARG B 209 ? 1.2789 1.8011 1.3873 0.2451  -0.0704 -0.1552 224 ARG B O   
3432 C CB  . ARG B 209 ? 1.2427 1.6975 1.3588 0.2481  -0.0494 -0.1147 224 ARG B CB  
3433 C CG  . ARG B 209 ? 1.2324 1.6638 1.3712 0.2505  -0.0486 -0.1027 224 ARG B CG  
3434 C CD  . ARG B 209 ? 1.2421 1.6560 1.3841 0.2617  -0.0414 -0.0765 224 ARG B CD  
3435 N NE  . ARG B 209 ? 1.2543 1.6414 1.4250 0.2568  -0.0418 -0.0672 224 ARG B NE  
3436 C CZ  . ARG B 209 ? 1.2331 1.5997 1.4193 0.2589  -0.0347 -0.0429 224 ARG B CZ  
3437 N NH1 . ARG B 209 ? 1.2073 1.5494 1.4237 0.2530  -0.0392 -0.0382 224 ARG B NH1 
3438 N NH2 . ARG B 209 ? 1.2395 1.6106 1.4124 0.2678  -0.0236 -0.0230 224 ARG B NH2 
3439 N N   . LEU B 210 ? 1.1107 1.6086 1.2045 0.2288  -0.0597 -0.1517 225 LEU B N   
3440 C CA  . LEU B 210 ? 1.1067 1.6261 1.1880 0.2293  -0.0688 -0.1648 225 LEU B CA  
3441 C C   . LEU B 210 ? 1.0959 1.6398 1.1960 0.2191  -0.0768 -0.1795 225 LEU B C   
3442 O O   . LEU B 210 ? 1.1583 1.7262 1.2591 0.2270  -0.0867 -0.1862 225 LEU B O   
3443 C CB  . LEU B 210 ? 1.1386 1.6485 1.2076 0.2201  -0.0666 -0.1698 225 LEU B CB  
3444 C CG  . LEU B 210 ? 1.1786 1.7079 1.2464 0.2119  -0.0794 -0.1890 225 LEU B CG  
3445 C CD1 . LEU B 210 ? 1.2476 1.8026 1.3099 0.2249  -0.0931 -0.1966 225 LEU B CD1 
3446 C CD2 . LEU B 210 ? 1.2031 1.7182 1.2512 0.2115  -0.0786 -0.1928 225 LEU B CD2 
3447 N N   . PHE B 211 ? 1.0447 1.5843 1.1608 0.2026  -0.0722 -0.1829 226 PHE B N   
3448 C CA  . PHE B 211 ? 1.0324 1.5987 1.1674 0.1925  -0.0773 -0.1941 226 PHE B CA  
3449 C C   . PHE B 211 ? 1.0515 1.6356 1.1979 0.2038  -0.0795 -0.1945 226 PHE B C   
3450 O O   . PHE B 211 ? 1.0553 1.6702 1.2144 0.2024  -0.0858 -0.2024 226 PHE B O   
3451 C CB  . PHE B 211 ? 0.9973 1.5567 1.1442 0.1732  -0.0711 -0.1960 226 PHE B CB  
3452 C CG  . PHE B 211 ? 0.9929 1.5523 1.1392 0.1588  -0.0745 -0.2023 226 PHE B CG  
3453 C CD1 . PHE B 211 ? 1.0136 1.5463 1.1449 0.1567  -0.0703 -0.1988 226 PHE B CD1 
3454 C CD2 . PHE B 211 ? 0.9726 1.5592 1.1365 0.1477  -0.0826 -0.2115 226 PHE B CD2 
3455 C CE1 . PHE B 211 ? 0.9701 1.5008 1.1012 0.1449  -0.0752 -0.2068 226 PHE B CE1 
3456 C CE2 . PHE B 211 ? 0.9250 1.5089 1.0925 0.1341  -0.0886 -0.2183 226 PHE B CE2 
3457 C CZ  . PHE B 211 ? 0.9288 1.4835 1.0785 0.1332  -0.0854 -0.2173 226 PHE B CZ  
3458 N N   . ALA B 212 ? 1.1255 1.6908 1.2698 0.2154  -0.0753 -0.1859 227 ALA B N   
3459 C CA  . ALA B 212 ? 1.1820 1.7609 1.3360 0.2291  -0.0786 -0.1877 227 ALA B CA  
3460 C C   . ALA B 212 ? 1.2533 1.8585 1.4050 0.2408  -0.0878 -0.1907 227 ALA B C   
3461 O O   . ALA B 212 ? 1.1636 1.7992 1.3288 0.2432  -0.0924 -0.1984 227 ALA B O   
3462 C CB  . ALA B 212 ? 1.1730 1.7223 1.3261 0.2412  -0.0762 -0.1774 227 ALA B CB  
3463 N N   . SER B 213 ? 1.3609 1.9558 1.4952 0.2492  -0.0902 -0.1838 228 SER B N   
3464 C CA  . SER B 213 ? 1.4539 2.0725 1.5817 0.2604  -0.1008 -0.1874 228 SER B CA  
3465 C C   . SER B 213 ? 1.4730 2.1155 1.6081 0.2455  -0.1080 -0.2009 228 SER B C   
3466 O O   . SER B 213 ? 1.4210 2.0938 1.5664 0.2487  -0.1185 -0.2087 228 SER B O   
3467 C CB  . SER B 213 ? 1.5075 2.1090 1.6101 0.2736  -0.1007 -0.1762 228 SER B CB  
3468 O OG  . SER B 213 ? 1.5868 2.1729 1.6888 0.2894  -0.0970 -0.1615 228 SER B OG  
3469 N N   . GLU B 214 ? 1.5927 2.2197 1.7248 0.2291  -0.1030 -0.2027 229 GLU B N   
3470 C CA  . GLU B 214 ? 1.6609 2.3017 1.8008 0.2130  -0.1103 -0.2142 229 GLU B CA  
3471 C C   . GLU B 214 ? 1.6962 2.3527 1.8256 0.2222  -0.1262 -0.2223 229 GLU B C   
3472 O O   . GLU B 214 ? 1.8646 2.5474 2.0126 0.2143  -0.1384 -0.2332 229 GLU B O   
3473 C CB  . GLU B 214 ? 1.6512 2.3178 1.8221 0.1975  -0.1099 -0.2197 229 GLU B CB  
3474 C CG  . GLU B 214 ? 1.6273 2.2964 1.8088 0.1770  -0.1150 -0.2273 229 GLU B CG  
3475 C CD  . GLU B 214 ? 1.6470 2.3368 1.8596 0.1589  -0.1109 -0.2274 229 GLU B CD  
3476 O OE1 . GLU B 214 ? 1.6914 2.3974 1.9161 0.1630  -0.1032 -0.2229 229 GLU B OE1 
3477 O OE2 . GLU B 214 ? 1.5510 2.2402 1.7754 0.1415  -0.1155 -0.2316 229 GLU B OE2 
3478 N N   . PHE B 215 ? 1.5815 2.2228 1.6821 0.2398  -0.1267 -0.2163 230 PHE B N   
3479 C CA  . PHE B 215 ? 1.5002 2.1528 1.5836 0.2506  -0.1425 -0.2253 230 PHE B CA  
3480 C C   . PHE B 215 ? 1.5276 2.1778 1.6131 0.2348  -0.1514 -0.2399 230 PHE B C   
3481 O O   . PHE B 215 ? 1.5141 2.1875 1.6193 0.2266  -0.1675 -0.2534 230 PHE B O   
3482 C CB  . PHE B 215 ? 1.4613 2.0957 1.5087 0.2727  -0.1381 -0.2138 230 PHE B CB  
3483 C CG  . PHE B 215 ? 1.3787 2.0258 1.4212 0.2936  -0.1416 -0.2051 230 PHE B CG  
3484 C CD1 . PHE B 215 ? 1.3237 1.9566 1.3690 0.3021  -0.1284 -0.1869 230 PHE B CD1 
3485 C CD2 . PHE B 215 ? 1.3175 1.9897 1.3544 0.3052  -0.1600 -0.2152 230 PHE B CD2 
3486 C CE1 . PHE B 215 ? 1.3058 1.9486 1.3483 0.3221  -0.1323 -0.1779 230 PHE B CE1 
3487 C CE2 . PHE B 215 ? 1.2812 1.9651 1.3131 0.3257  -0.1636 -0.2062 230 PHE B CE2 
3488 C CZ  . PHE B 215 ? 1.3020 1.9709 1.3368 0.3341  -0.1492 -0.1871 230 PHE B CZ  
3489 C C1  . NAG C .   ? 2.3445 1.4925 1.5828 -0.0718 -0.0849 -0.1203 300 NAG A C1  
3490 C C2  . NAG C .   ? 2.3556 1.4443 1.5336 -0.0698 -0.0752 -0.1149 300 NAG A C2  
3491 C C3  . NAG C .   ? 2.3227 1.4183 1.4940 -0.0872 -0.0465 -0.1126 300 NAG A C3  
3492 C C4  . NAG C .   ? 2.2815 1.4216 1.4922 -0.1040 -0.0302 -0.1169 300 NAG A C4  
3493 C C5  . NAG C .   ? 2.2509 1.4468 1.5132 -0.1044 -0.0446 -0.1204 300 NAG A C5  
3494 C C6  . NAG C .   ? 2.1966 1.4386 1.4972 -0.1220 -0.0324 -0.1246 300 NAG A C6  
3495 C C7  . NAG C .   ? 2.4672 1.4761 1.5790 -0.0413 -0.1143 -0.1085 300 NAG A C7  
3496 C C8  . NAG C .   ? 2.4708 1.4547 1.5539 -0.0323 -0.1320 -0.1043 300 NAG A C8  
3497 N N2  . NAG C .   ? 2.4088 1.4686 1.5585 -0.0571 -0.0937 -0.1106 300 NAG A N2  
3498 O O3  . NAG C .   ? 2.3845 1.4208 1.5011 -0.0865 -0.0326 -0.1095 300 NAG A O3  
3499 O O4  . NAG C .   ? 2.2311 1.3775 1.4400 -0.1190 -0.0074 -0.1139 300 NAG A O4  
3500 O O5  . NAG C .   ? 2.3002 1.4833 1.5652 -0.0892 -0.0644 -0.1237 300 NAG A O5  
3501 O O6  . NAG C .   ? 2.1368 1.3656 1.4344 -0.1228 -0.0282 -0.1301 300 NAG A O6  
3502 O O7  . NAG C .   ? 2.5058 1.4876 1.6054 -0.0344 -0.1197 -0.1096 300 NAG A O7  
3503 C C1  . NAG D .   ? 1.8731 2.4552 1.6991 0.2965  -0.0585 -0.2001 301 NAG B C1  
3504 C C2  . NAG D .   ? 1.8347 2.4540 1.6491 0.3194  -0.0465 -0.2074 301 NAG B C2  
3505 C C3  . NAG D .   ? 1.8607 2.4837 1.6267 0.3629  -0.0611 -0.2345 301 NAG B C3  
3506 C C4  . NAG D .   ? 1.9191 2.5394 1.6461 0.3797  -0.0708 -0.2348 301 NAG B C4  
3507 C C5  . NAG D .   ? 1.9369 2.5065 1.6862 0.3531  -0.0906 -0.2355 301 NAG B C5  
3508 C C6  . NAG D .   ? 1.9696 2.5228 1.6836 0.3697  -0.1102 -0.2435 301 NAG B C6  
3509 C C7  . NAG D .   ? 1.7603 2.3895 1.6331 0.2941  -0.0313 -0.2048 301 NAG B C7  
3510 C C8  . NAG D .   ? 1.6996 2.2986 1.6036 0.2797  -0.0408 -0.2170 301 NAG B C8  
3511 N N2  . NAG D .   ? 1.8113 2.4102 1.6610 0.3031  -0.0502 -0.2163 301 NAG B N2  
3512 O O3  . NAG D .   ? 1.8398 2.5160 1.5925 0.3834  -0.0389 -0.2276 301 NAG B O3  
3513 O O4  . NAG D .   ? 1.9338 2.5524 1.6143 0.4225  -0.0887 -0.2654 301 NAG B O4  
3514 O O5  . NAG D .   ? 1.9288 2.5095 1.7165 0.3163  -0.0689 -0.2032 301 NAG B O5  
3515 O O6  . NAG D .   ? 1.9524 2.5488 1.6383 0.3792  -0.0898 -0.2179 301 NAG B O6  
3516 O O7  . NAG D .   ? 1.7626 2.4411 1.6334 0.2976  -0.0083 -0.1848 301 NAG B O7  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   18  18  ARG ARG A . n 
A 1 2   SER 2   19  19  SER SER A . n 
A 1 3   PRO 3   20  20  PRO PRO A . n 
A 1 4   TRP 4   21  21  TRP TRP A . n 
A 1 5   CYS 5   22  22  CYS CYS A . n 
A 1 6   VAL 6   23  23  VAL VAL A . n 
A 1 7   ILE 7   24  24  ILE ILE A . n 
A 1 8   CYS 8   25  25  CYS CYS A . n 
A 1 9   ASP 9   26  26  ASP ASP A . n 
A 1 10  PRO 10  27  27  PRO PRO A . n 
A 1 11  SER 11  28  28  SER SER A . n 
A 1 12  VAL 12  29  29  VAL VAL A . n 
A 1 13  VAL 13  30  30  VAL VAL A . n 
A 1 14  LEU 14  31  31  LEU LEU A . n 
A 1 15  ALA 15  32  32  ALA ALA A . n 
A 1 16  LEU 16  33  33  LEU LEU A . n 
A 1 17  LYS 17  34  34  LYS LYS A . n 
A 1 18  SER 18  35  35  SER SER A . n 
A 1 19  LEU 19  36  36  LEU LEU A . n 
A 1 20  GLU 20  37  37  GLU GLU A . n 
A 1 21  LYS 21  38  38  LYS LYS A . n 
A 1 22  ASP 22  39  39  ASP ASP A . n 
A 1 23  TYR 23  40  40  TYR TYR A . n 
A 1 24  LEU 24  41  41  LEU LEU A . n 
A 1 25  PRO 25  42  42  PRO PRO A . n 
A 1 26  GLY 26  43  43  GLY GLY A . n 
A 1 27  HIS 27  44  44  HIS HIS A . n 
A 1 28  LEU 28  45  45  LEU LEU A . n 
A 1 29  ASP 29  46  46  ASP ASP A . n 
A 1 30  ALA 30  47  47  ALA ALA A . n 
A 1 31  LYS 31  48  48  LYS LYS A . n 
A 1 32  HIS 32  49  49  HIS HIS A . n 
A 1 33  HIS 33  50  50  HIS HIS A . n 
A 1 34  LYS 34  51  51  LYS LYS A . n 
A 1 35  ALA 35  52  52  ALA ALA A . n 
A 1 36  MET 36  53  53  MET MET A . n 
A 1 37  MET 37  54  54  MET MET A . n 
A 1 38  GLU 38  55  55  GLU GLU A . n 
A 1 39  ARG 39  56  56  ARG ARG A . n 
A 1 40  VAL 40  57  57  VAL VAL A . n 
A 1 41  GLU 41  58  58  GLU GLU A . n 
A 1 42  ASN 42  59  59  ASN ASN A . n 
A 1 43  ALA 43  60  60  ALA ALA A . n 
A 1 44  VAL 44  61  61  VAL VAL A . n 
A 1 45  LYS 45  62  62  LYS LYS A . n 
A 1 46  ASP 46  63  63  ASP ASP A . n 
A 1 47  PHE 47  64  64  PHE PHE A . n 
A 1 48  GLN 48  65  65  GLN GLN A . n 
A 1 49  GLU 49  66  66  GLU GLU A . n 
A 1 50  LEU 50  67  67  LEU LEU A . n 
A 1 51  SER 51  68  ?   ?   ?   A . n 
A 1 52  LEU 52  69  ?   ?   ?   A . n 
A 1 53  ASN 53  70  ?   ?   ?   A . n 
A 1 54  GLU 54  71  ?   ?   ?   A . n 
A 1 55  ASP 55  72  72  ASP ASP A . n 
A 1 56  ALA 56  73  73  ALA ALA A . n 
A 1 57  TYR 57  74  74  TYR TYR A . n 
A 1 58  MET 58  75  75  MET MET A . n 
A 1 59  GLY 59  76  76  GLY GLY A . n 
A 1 60  VAL 60  77  77  VAL VAL A . n 
A 1 61  VAL 61  78  78  VAL VAL A . n 
A 1 62  ASP 62  79  79  ASP ASP A . n 
A 1 63  GLU 63  80  80  GLU GLU A . n 
A 1 64  ALA 64  81  81  ALA ALA A . n 
A 1 65  THR 65  82  82  THR THR A . n 
A 1 66  LEU 66  83  83  LEU LEU A . n 
A 1 67  GLN 67  84  84  GLN GLN A . n 
A 1 68  LYS 68  85  85  LYS LYS A . n 
A 1 69  GLY 69  86  86  GLY GLY A . n 
A 1 70  SER 70  87  87  SER SER A . n 
A 1 71  TRP 71  88  88  TRP TRP A . n 
A 1 72  SER 72  89  89  SER SER A . n 
A 1 73  LEU 73  90  90  LEU LEU A . n 
A 1 74  LEU 74  91  91  LEU LEU A . n 
A 1 75  LYS 75  92  92  LYS LYS A . n 
A 1 76  ASP 76  93  93  ASP ASP A . n 
A 1 77  LEU 77  94  94  LEU LEU A . n 
A 1 78  LYS 78  95  95  LYS LYS A . n 
A 1 79  ARG 79  96  96  ARG ARG A . n 
A 1 80  ILE 80  97  97  ILE ILE A . n 
A 1 81  THR 81  98  98  THR THR A . n 
A 1 82  ASP 82  99  99  ASP ASP A . n 
A 1 83  SER 83  100 100 SER SER A . n 
A 1 84  ASP 84  101 101 ASP ASP A . n 
A 1 85  VAL 85  102 102 VAL VAL A . n 
A 1 86  LYS 86  103 103 LYS LYS A . n 
A 1 87  GLY 87  104 104 GLY GLY A . n 
A 1 88  ASP 88  105 105 ASP ASP A . n 
A 1 89  LEU 89  106 106 LEU LEU A . n 
A 1 90  PHE 90  107 107 PHE PHE A . n 
A 1 91  VAL 91  108 108 VAL VAL A . n 
A 1 92  LYS 92  109 109 LYS LYS A . n 
A 1 93  GLU 93  110 110 GLU GLU A . n 
A 1 94  LEU 94  111 111 LEU LEU A . n 
A 1 95  PHE 95  112 112 PHE PHE A . n 
A 1 96  TRP 96  113 113 TRP TRP A . n 
A 1 97  MET 97  114 114 MET MET A . n 
A 1 98  LEU 98  115 115 LEU LEU A . n 
A 1 99  HIS 99  116 116 HIS HIS A . n 
A 1 100 LEU 100 117 117 LEU LEU A . n 
A 1 101 GLN 101 118 118 GLN GLN A . n 
A 1 102 LYS 102 119 119 LYS LYS A . n 
A 1 103 GLU 103 120 120 GLU GLU A . n 
A 1 104 THR 104 121 121 THR THR A . n 
A 1 105 PHE 105 122 122 PHE PHE A . n 
A 1 106 ALA 106 123 123 ALA ALA A . n 
A 1 107 THR 107 124 124 THR THR A . n 
A 1 108 TYR 108 125 125 TYR TYR A . n 
A 1 109 VAL 109 126 126 VAL VAL A . n 
A 1 110 ALA 110 127 127 ALA ALA A . n 
A 1 111 ARG 111 128 128 ARG ARG A . n 
A 1 112 PHE 112 129 129 PHE PHE A . n 
A 1 113 GLN 113 130 130 GLN GLN A . n 
A 1 114 LYS 114 131 131 LYS LYS A . n 
A 1 115 GLU 115 132 132 GLU GLU A . n 
A 1 116 ALA 116 133 133 ALA ALA A . n 
A 1 117 TYR 117 134 134 TYR TYR A . n 
A 1 118 CYS 118 135 135 CYS CYS A . n 
A 1 119 PRO 119 136 136 PRO PRO A . n 
A 1 120 ASN 120 137 137 ASN ASN A . n 
A 1 121 LYS 121 138 138 LYS LYS A . n 
A 1 122 CYS 122 139 139 CYS CYS A . n 
A 1 123 GLY 123 140 140 GLY GLY A . n 
A 1 124 VAL 124 141 141 VAL VAL A . n 
A 1 125 MET 125 142 142 MET MET A . n 
A 1 126 LEU 126 143 143 LEU LEU A . n 
A 1 127 GLN 127 144 144 GLN GLN A . n 
A 1 128 THR 128 145 145 THR THR A . n 
A 1 129 LEU 129 146 146 LEU LEU A . n 
A 1 130 ILE 130 147 147 ILE ILE A . n 
A 1 131 TRP 131 148 148 TRP TRP A . n 
A 1 132 CYS 132 149 149 CYS CYS A . n 
A 1 133 LYS 133 150 150 LYS LYS A . n 
A 1 134 ASN 134 151 151 ASN ASN A . n 
A 1 135 CYS 135 152 152 CYS CYS A . n 
A 1 136 LYS 136 153 153 LYS LYS A . n 
A 1 137 LYS 137 154 154 LYS LYS A . n 
A 1 138 GLU 138 155 155 GLU GLU A . n 
A 1 139 VAL 139 156 156 VAL VAL A . n 
A 1 140 HIS 140 157 157 HIS HIS A . n 
A 1 141 ALA 141 158 158 ALA ALA A . n 
A 1 142 CYS 142 159 159 CYS CYS A . n 
A 1 143 ARG 143 160 160 ARG ARG A . n 
A 1 144 LYS 144 161 161 LYS LYS A . n 
A 1 145 SER 145 162 162 SER SER A . n 
A 1 146 TYR 146 163 163 TYR TYR A . n 
A 1 147 ASP 147 164 164 ASP ASP A . n 
A 1 148 CYS 148 165 165 CYS CYS A . n 
A 1 149 GLY 149 166 166 GLY GLY A . n 
A 1 150 GLU 150 167 167 GLU GLU A . n 
A 1 151 ARG 151 168 168 ARG ARG A . n 
A 1 152 ASN 152 169 169 ASN ASN A . n 
A 1 153 VAL 153 170 170 VAL VAL A . n 
A 1 154 GLU 154 171 171 GLU GLU A . n 
A 1 155 VAL 155 172 172 VAL VAL A . n 
A 1 156 PRO 156 173 173 PRO PRO A . n 
A 1 157 GLN 157 174 174 GLN GLN A . n 
A 1 158 MET 158 175 175 MET MET A . n 
A 1 159 GLU 159 176 176 GLU GLU A . n 
A 1 160 ASP 160 177 177 ASP ASP A . n 
A 1 161 MET 161 178 178 MET MET A . n 
A 1 162 ILE 162 179 179 ILE ILE A . n 
A 1 163 LEU 163 180 180 LEU LEU A . n 
A 1 164 ASP 164 181 181 ASP ASP A . n 
A 1 165 CYS 165 182 182 CYS CYS A . n 
A 1 166 GLU 166 183 183 GLU GLU A . n 
A 1 167 LEU 167 184 184 LEU LEU A . n 
A 1 168 ASN 168 185 185 ASN ASN A . n 
A 1 169 TRP 169 186 186 TRP TRP A . n 
A 1 170 HIS 170 187 187 HIS HIS A . n 
A 1 171 GLN 171 188 188 GLN GLN A . n 
A 1 172 ALA 172 189 189 ALA ALA A . n 
A 1 173 SER 173 190 190 SER SER A . n 
A 1 174 GLU 174 191 191 GLU GLU A . n 
A 1 175 GLY 175 192 192 GLY GLY A . n 
A 1 176 LEU 176 193 193 LEU LEU A . n 
A 1 177 THR 177 194 194 THR THR A . n 
A 1 178 ASP 178 195 195 ASP ASP A . n 
A 1 179 TYR 179 196 196 TYR TYR A . n 
A 1 180 SER 180 197 197 SER SER A . n 
A 1 181 PHE 181 198 198 PHE PHE A . n 
A 1 182 TYR 182 199 199 TYR TYR A . n 
A 1 183 ARG 183 200 200 ARG ARG A . n 
A 1 184 VAL 184 201 201 VAL VAL A . n 
A 1 185 TRP 185 202 202 TRP TRP A . n 
A 1 186 GLY 186 203 203 GLY GLY A . n 
A 1 187 ASN 187 204 204 ASN ASN A . n 
A 1 188 ASN 188 205 205 ASN ASN A . n 
A 1 189 THR 189 206 206 THR THR A . n 
A 1 190 GLU 190 207 207 GLU GLU A . n 
A 1 191 THR 191 208 208 THR THR A . n 
A 1 192 LEU 192 209 209 LEU LEU A . n 
A 1 193 VAL 193 210 210 VAL VAL A . n 
A 1 194 SER 194 211 211 SER SER A . n 
A 1 195 LYS 195 212 212 LYS LYS A . n 
A 1 196 GLY 196 213 213 GLY GLY A . n 
A 1 197 LYS 197 214 214 LYS LYS A . n 
A 1 198 GLU 198 215 215 GLU GLU A . n 
A 1 199 ALA 199 216 216 ALA ALA A . n 
A 1 200 THR 200 217 217 THR THR A . n 
A 1 201 LEU 201 218 218 LEU LEU A . n 
A 1 202 THR 202 219 219 THR THR A . n 
A 1 203 LYS 203 220 220 LYS LYS A . n 
A 1 204 PRO 204 221 221 PRO PRO A . n 
A 1 205 MET 205 222 222 MET MET A . n 
A 1 206 VAL 206 223 223 VAL VAL A . n 
A 1 207 GLY 207 224 224 GLY GLY A . n 
A 1 208 PRO 208 225 225 PRO PRO A . n 
A 1 209 GLU 209 226 226 GLU GLU A . n 
A 1 210 ASP 210 227 227 ASP ASP A . n 
A 1 211 ALA 211 228 228 ALA ALA A . n 
A 1 212 GLY 212 229 229 GLY GLY A . n 
A 1 213 SER 213 230 230 SER SER A . n 
A 1 214 TYR 214 231 231 TYR TYR A . n 
A 1 215 ARG 215 232 232 ARG ARG A . n 
A 1 216 CYS 216 233 233 CYS CYS A . n 
A 1 217 GLU 217 234 234 GLU GLU A . n 
A 1 218 LEU 218 235 235 LEU LEU A . n 
A 1 219 GLY 219 236 236 GLY GLY A . n 
A 1 220 SER 220 237 237 SER SER A . n 
A 1 221 VAL 221 238 238 VAL VAL A . n 
A 1 222 ASN 222 239 239 ASN ASN A . n 
A 1 223 SER 223 240 240 SER SER A . n 
A 1 224 SER 224 241 241 SER SER A . n 
A 1 225 PRO 225 242 242 PRO PRO A . n 
A 1 226 ALA 226 243 243 ALA ALA A . n 
A 1 227 THR 227 244 244 THR THR A . n 
A 1 228 ILE 228 245 245 ILE ILE A . n 
A 1 229 ILE 229 246 246 ILE ILE A . n 
A 1 230 ASN 230 247 247 ASN ASN A . n 
A 1 231 PHE 231 248 248 PHE PHE A . n 
A 1 232 HIS 232 249 249 HIS HIS A . n 
A 1 233 VAL 233 250 250 VAL VAL A . n 
A 1 234 THR 234 251 251 THR THR A . n 
A 1 235 VAL 235 252 252 VAL VAL A . n 
A 1 236 LEU 236 253 253 LEU LEU A . n 
A 1 237 PRO 237 254 254 PRO PRO A . n 
A 1 238 LYS 238 255 ?   ?   ?   A . n 
A 1 239 GLU 239 256 ?   ?   ?   A . n 
A 1 240 PHE 240 257 ?   ?   ?   A . n 
A 1 241 LEU 241 258 ?   ?   ?   A . n 
A 1 242 GLU 242 259 ?   ?   ?   A . n 
A 1 243 VAL 243 260 ?   ?   ?   A . n 
A 1 244 LEU 244 261 ?   ?   ?   A . n 
A 1 245 PHE 245 262 ?   ?   ?   A . n 
A 1 246 GLN 246 263 ?   ?   ?   A . n 
B 2 1   ARG 1   16  ?   ?   ?   B . n 
B 2 2   SER 2   17  ?   ?   ?   B . n 
B 2 3   PRO 3   18  18  PRO PRO B . n 
B 2 4   TRP 4   19  19  TRP TRP B . n 
B 2 5   GLY 5   20  20  GLY GLY B . n 
B 2 6   ASP 6   21  21  ASP ASP B . n 
B 2 7   GLU 7   22  22  GLU GLU B . n 
B 2 8   LEU 8   23  23  LEU LEU B . n 
B 2 9   LEU 9   24  24  LEU LEU B . n 
B 2 10  ASN 10  25  25  ASN ASN B . n 
B 2 11  ILE 11  26  26  ILE ILE B . n 
B 2 12  CYS 12  27  27  CYS CYS B . n 
B 2 13  MET 13  28  28  MET MET B . n 
B 2 14  ASN 14  29  29  ASN ASN B . n 
B 2 15  ALA 15  30  30  ALA ALA B . n 
B 2 16  LYS 16  31  31  LYS LYS B . n 
B 2 17  HIS 17  32  32  HIS HIS B . n 
B 2 18  HIS 18  33  33  HIS HIS B . n 
B 2 19  LYS 19  34  34  LYS LYS B . n 
B 2 20  ARG 20  35  35  ARG ARG B . n 
B 2 21  VAL 21  36  36  VAL VAL B . n 
B 2 22  PRO 22  37  37  PRO PRO B . n 
B 2 23  SER 23  38  38  SER SER B . n 
B 2 24  PRO 24  39  39  PRO PRO B . n 
B 2 25  GLU 25  40  40  GLU GLU B . n 
B 2 26  ASP 26  41  41  ASP ASP B . n 
B 2 27  LYS 27  42  42  LYS LYS B . n 
B 2 28  LEU 28  43  43  LEU LEU B . n 
B 2 29  TYR 29  44  44  TYR TYR B . n 
B 2 30  GLU 30  45  45  GLU GLU B . n 
B 2 31  GLU 31  46  46  GLU GLU B . n 
B 2 32  CYS 32  47  47  CYS CYS B . n 
B 2 33  ILE 33  48  48  ILE ILE B . n 
B 2 34  PRO 34  49  49  PRO PRO B . n 
B 2 35  TRP 35  50  50  TRP TRP B . n 
B 2 36  LYS 36  51  51  LYS LYS B . n 
B 2 37  ASP 37  52  52  ASP ASP B . n 
B 2 38  ASN 38  53  53  ASN ASN B . n 
B 2 39  ALA 39  54  54  ALA ALA B . n 
B 2 40  CYS 40  55  55  CYS CYS B . n 
B 2 41  CYS 41  56  56  CYS CYS B . n 
B 2 42  THR 42  57  57  THR THR B . n 
B 2 43  LEU 43  58  58  LEU LEU B . n 
B 2 44  THR 44  59  59  THR THR B . n 
B 2 45  THR 45  60  60  THR THR B . n 
B 2 46  SER 46  61  61  SER SER B . n 
B 2 47  TRP 47  62  62  TRP TRP B . n 
B 2 48  GLU 48  63  63  GLU GLU B . n 
B 2 49  ALA 49  64  64  ALA ALA B . n 
B 2 50  HIS 50  65  65  HIS HIS B . n 
B 2 51  LEU 51  66  66  LEU LEU B . n 
B 2 52  ASP 52  67  67  ASP ASP B . n 
B 2 53  VAL 53  68  68  VAL VAL B . n 
B 2 54  SER 54  69  69  SER SER B . n 
B 2 55  PRO 55  70  70  PRO PRO B . n 
B 2 56  LEU 56  71  71  LEU LEU B . n 
B 2 57  TYR 57  72  72  TYR TYR B . n 
B 2 58  ASN 58  73  73  ASN ASN B . n 
B 2 59  PHE 59  74  74  PHE PHE B . n 
B 2 60  SER 60  75  75  SER SER B . n 
B 2 61  LEU 61  76  76  LEU LEU B . n 
B 2 62  PHE 62  77  77  PHE PHE B . n 
B 2 63  HIS 63  78  78  HIS HIS B . n 
B 2 64  CYS 64  79  79  CYS CYS B . n 
B 2 65  GLY 65  80  80  GLY GLY B . n 
B 2 66  LEU 66  81  81  LEU LEU B . n 
B 2 67  LEU 67  82  82  LEU LEU B . n 
B 2 68  MET 68  83  83  MET MET B . n 
B 2 69  PRO 69  84  84  PRO PRO B . n 
B 2 70  GLY 70  85  85  GLY GLY B . n 
B 2 71  CYS 71  86  86  CYS CYS B . n 
B 2 72  ARG 72  87  87  ARG ARG B . n 
B 2 73  LYS 73  88  88  LYS LYS B . n 
B 2 74  HIS 74  89  89  HIS HIS B . n 
B 2 75  PHE 75  90  90  PHE PHE B . n 
B 2 76  ILE 76  91  91  ILE ILE B . n 
B 2 77  GLN 77  92  92  GLN GLN B . n 
B 2 78  ALA 78  93  93  ALA ALA B . n 
B 2 79  ILE 79  94  94  ILE ILE B . n 
B 2 80  CYS 80  95  95  CYS CYS B . n 
B 2 81  PHE 81  96  96  PHE PHE B . n 
B 2 82  TYR 82  97  97  TYR TYR B . n 
B 2 83  GLU 83  98  98  GLU GLU B . n 
B 2 84  CYS 84  99  99  CYS CYS B . n 
B 2 85  SER 85  100 100 SER SER B . n 
B 2 86  PRO 86  101 101 PRO PRO B . n 
B 2 87  ASN 87  102 102 ASN ASN B . n 
B 2 88  LEU 88  103 103 LEU LEU B . n 
B 2 89  GLY 89  104 104 GLY GLY B . n 
B 2 90  PRO 90  105 105 PRO PRO B . n 
B 2 91  TRP 91  106 106 TRP TRP B . n 
B 2 92  ILE 92  107 107 ILE ILE B . n 
B 2 93  GLN 93  108 108 GLN GLN B . n 
B 2 94  PRO 94  109 109 PRO PRO B . n 
B 2 95  VAL 95  110 110 VAL VAL B . n 
B 2 96  GLY 96  111 ?   ?   ?   B . n 
B 2 97  SER 97  112 ?   ?   ?   B . n 
B 2 98  LEU 98  113 ?   ?   ?   B . n 
B 2 99  GLY 99  114 ?   ?   ?   B . n 
B 2 100 TRP 100 115 ?   ?   ?   B . n 
B 2 101 GLU 101 116 ?   ?   ?   B . n 
B 2 102 VAL 102 117 ?   ?   ?   B . n 
B 2 103 ALA 103 118 ?   ?   ?   B . n 
B 2 104 PRO 104 119 ?   ?   ?   B . n 
B 2 105 SER 105 120 ?   ?   ?   B . n 
B 2 106 GLY 106 121 ?   ?   ?   B . n 
B 2 107 GLN 107 122 ?   ?   ?   B . n 
B 2 108 GLY 108 123 123 GLY GLY B . n 
B 2 109 GLU 109 124 124 GLU GLU B . n 
B 2 110 ARG 110 125 125 ARG ARG B . n 
B 2 111 VAL 111 126 126 VAL VAL B . n 
B 2 112 VAL 112 127 127 VAL VAL B . n 
B 2 113 ASN 113 128 128 ASN ASN B . n 
B 2 114 VAL 114 129 129 VAL VAL B . n 
B 2 115 PRO 115 130 130 PRO PRO B . n 
B 2 116 LEU 116 131 131 LEU LEU B . n 
B 2 117 CYS 117 132 132 CYS CYS B . n 
B 2 118 GLN 118 133 133 GLN GLN B . n 
B 2 119 GLU 119 134 134 GLU GLU B . n 
B 2 120 ASP 120 135 135 ASP ASP B . n 
B 2 121 CYS 121 136 136 CYS CYS B . n 
B 2 122 GLU 122 137 137 GLU GLU B . n 
B 2 123 GLU 123 138 138 GLU GLU B . n 
B 2 124 TRP 124 139 139 TRP TRP B . n 
B 2 125 TRP 125 140 140 TRP TRP B . n 
B 2 126 GLU 126 141 141 GLU GLU B . n 
B 2 127 ASP 127 142 142 ASP ASP B . n 
B 2 128 CYS 128 143 143 CYS CYS B . n 
B 2 129 ARG 129 144 144 ARG ARG B . n 
B 2 130 MET 130 145 145 MET MET B . n 
B 2 131 SER 131 146 146 SER SER B . n 
B 2 132 TYR 132 147 147 TYR TYR B . n 
B 2 133 THR 133 148 148 THR THR B . n 
B 2 134 CYS 134 149 149 CYS CYS B . n 
B 2 135 LYS 135 150 150 LYS LYS B . n 
B 2 136 SER 136 151 151 SER SER B . n 
B 2 137 ASN 137 152 152 ASN ASN B . n 
B 2 138 TRP 138 153 153 TRP TRP B . n 
B 2 139 ARG 139 154 154 ARG ARG B . n 
B 2 140 GLY 140 155 155 GLY GLY B . n 
B 2 141 GLY 141 156 156 GLY GLY B . n 
B 2 142 TRP 142 157 157 TRP TRP B . n 
B 2 143 ASP 143 158 158 ASP ASP B . n 
B 2 144 TRP 144 159 159 TRP TRP B . n 
B 2 145 SER 145 160 160 SER SER B . n 
B 2 146 GLN 146 161 161 GLN GLN B . n 
B 2 147 GLY 147 162 162 GLY GLY B . n 
B 2 148 LYS 148 163 163 LYS LYS B . n 
B 2 149 ASN 149 164 164 ASN ASN B . n 
B 2 150 ARG 150 165 165 ARG ARG B . n 
B 2 151 CYS 151 166 166 CYS CYS B . n 
B 2 152 PRO 152 167 167 PRO PRO B . n 
B 2 153 LYS 153 168 168 LYS LYS B . n 
B 2 154 GLY 154 169 169 GLY GLY B . n 
B 2 155 ALA 155 170 170 ALA ALA B . n 
B 2 156 GLN 156 171 171 GLN GLN B . n 
B 2 157 CYS 157 172 172 CYS CYS B . n 
B 2 158 LEU 158 173 173 LEU LEU B . n 
B 2 159 PRO 159 174 174 PRO PRO B . n 
B 2 160 PHE 160 175 175 PHE PHE B . n 
B 2 161 SER 161 176 176 SER SER B . n 
B 2 162 HIS 162 177 177 HIS HIS B . n 
B 2 163 TYR 163 178 178 TYR TYR B . n 
B 2 164 PHE 164 179 179 PHE PHE B . n 
B 2 165 PRO 165 180 180 PRO PRO B . n 
B 2 166 THR 166 181 181 THR THR B . n 
B 2 167 PRO 167 182 182 PRO PRO B . n 
B 2 168 ALA 168 183 183 ALA ALA B . n 
B 2 169 ASP 169 184 184 ASP ASP B . n 
B 2 170 LEU 170 185 185 LEU LEU B . n 
B 2 171 CYS 171 186 186 CYS CYS B . n 
B 2 172 GLU 172 187 187 GLU GLU B . n 
B 2 173 LYS 173 188 188 LYS LYS B . n 
B 2 174 THR 174 189 189 THR THR B . n 
B 2 175 TRP 175 190 190 TRP TRP B . n 
B 2 176 SER 176 191 191 SER SER B . n 
B 2 177 ASN 177 192 192 ASN ASN B . n 
B 2 178 SER 178 193 193 SER SER B . n 
B 2 179 PHE 179 194 194 PHE PHE B . n 
B 2 180 LYS 180 195 195 LYS LYS B . n 
B 2 181 ALA 181 196 196 ALA ALA B . n 
B 2 182 SER 182 197 197 SER SER B . n 
B 2 183 PRO 183 198 198 PRO PRO B . n 
B 2 184 GLU 184 199 199 GLU GLU B . n 
B 2 185 ARG 185 200 200 ARG ARG B . n 
B 2 186 ARG 186 201 201 ARG ARG B . n 
B 2 187 ASN 187 202 202 ASN ASN B . n 
B 2 188 SER 188 203 203 SER SER B . n 
B 2 189 GLY 189 204 204 GLY GLY B . n 
B 2 190 ARG 190 205 205 ARG ARG B . n 
B 2 191 CYS 191 206 206 CYS CYS B . n 
B 2 192 LEU 192 207 207 LEU LEU B . n 
B 2 193 GLN 193 208 208 GLN GLN B . n 
B 2 194 LYS 194 209 209 LYS LYS B . n 
B 2 195 TRP 195 210 210 TRP TRP B . n 
B 2 196 PHE 196 211 211 PHE PHE B . n 
B 2 197 GLU 197 212 212 GLU GLU B . n 
B 2 198 PRO 198 213 213 PRO PRO B . n 
B 2 199 ALA 199 214 214 ALA ALA B . n 
B 2 200 GLN 200 215 215 GLN GLN B . n 
B 2 201 GLY 201 216 216 GLY GLY B . n 
B 2 202 ASN 202 217 217 ASN ASN B . n 
B 2 203 PRO 203 218 218 PRO PRO B . n 
B 2 204 ASN 204 219 219 ASN ASN B . n 
B 2 205 VAL 205 220 220 VAL VAL B . n 
B 2 206 ALA 206 221 221 ALA ALA B . n 
B 2 207 VAL 207 222 222 VAL VAL B . n 
B 2 208 ALA 208 223 223 ALA ALA B . n 
B 2 209 ARG 209 224 224 ARG ARG B . n 
B 2 210 LEU 210 225 225 LEU LEU B . n 
B 2 211 PHE 211 226 226 PHE PHE B . n 
B 2 212 ALA 212 227 227 ALA ALA B . n 
B 2 213 SER 213 228 228 SER SER B . n 
B 2 214 GLU 214 229 229 GLU GLU B . n 
B 2 215 PHE 215 230 230 PHE PHE B . n 
B 2 216 LEU 216 231 ?   ?   ?   B . n 
B 2 217 GLU 217 232 ?   ?   ?   B . n 
B 2 218 VAL 218 233 ?   ?   ?   B . n 
B 2 219 LEU 219 234 ?   ?   ?   B . n 
B 2 220 PHE 220 235 ?   ?   ?   B . n 
B 2 221 GLN 221 236 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 NAG 1 300 300 NAG NAG A . 
D 3 NAG 1 301 300 NAG NAG B . 
E 4 CL  1 302 1   CL  CL  B . 
F 5 HOH 1 401 2   HOH HOH A . 
F 5 HOH 2 402 4   HOH HOH A . 
G 5 HOH 1 401 5   HOH HOH B . 
G 5 HOH 2 402 1   HOH HOH B . 
G 5 HOH 3 403 3   HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2470  ? 
1 MORE         -12   ? 
1 'SSA (A^2)'  21940 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-22 
2 'Structure model' 1 1 2016-06-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 1.8710   -35.9115 22.3744 0.2640 0.2132 0.2449 -0.1103 -0.0879 -0.0316 0.5547 3.8942 0.6651 0.6152 
-0.5085 0.1078  0.0108  -0.1785 -0.1936 -0.1607 -0.3148 -0.0822 -0.0965 0.0906  0.3040 
'X-RAY DIFFRACTION' 2 ? refined -22.1270 -25.9117 7.8949  0.0116 0.4286 0.1980 0.0440  -0.0215 -0.1509 3.1830 2.3602 1.3799 
-1.6166 0.9568  -0.7380 -0.0985 -0.3097 -0.0802 0.1264  0.0030  0.0076  -0.1021 -0.6582 0.0954 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 18 ? ? A 254 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 18 ? ? B 230 ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC   ? ? ? 5.8.0103 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? MOLREP   ? ? ? .        4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O B GLU 63 ? ? OG B SER 69  ? ? 1.55 
2 1 O A ASP 63 ? ? NZ A LYS 119 ? ? 2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 152 ? ? 54.25   19.29   
2 1 SER A 162 ? ? -35.62  139.10  
3 1 MET A 175 ? ? 72.07   -3.08   
4 1 THR A 194 ? ? -114.29 -96.96  
5 1 ASN A 239 ? ? -74.32  -169.32 
6 1 GLU B 45  ? ? 39.73   -109.48 
7 1 ASN B 53  ? ? -168.20 99.02   
8 1 HIS B 78  ? ? -29.33  -33.58  
9 1 LEU B 81  ? ? -37.06  129.44  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 68  ? A SER 51  
2  1 Y 1 A LEU 69  ? A LEU 52  
3  1 Y 1 A ASN 70  ? A ASN 53  
4  1 Y 1 A GLU 71  ? A GLU 54  
5  1 Y 1 A LYS 255 ? A LYS 238 
6  1 Y 1 A GLU 256 ? A GLU 239 
7  1 Y 1 A PHE 257 ? A PHE 240 
8  1 Y 1 A LEU 258 ? A LEU 241 
9  1 Y 1 A GLU 259 ? A GLU 242 
10 1 Y 1 A VAL 260 ? A VAL 243 
11 1 Y 1 A LEU 261 ? A LEU 244 
12 1 Y 1 A PHE 262 ? A PHE 245 
13 1 Y 1 A GLN 263 ? A GLN 246 
14 1 Y 1 B ARG 16  ? B ARG 1   
15 1 Y 1 B SER 17  ? B SER 2   
16 1 Y 1 B GLY 111 ? B GLY 96  
17 1 Y 1 B SER 112 ? B SER 97  
18 1 Y 1 B LEU 113 ? B LEU 98  
19 1 Y 1 B GLY 114 ? B GLY 99  
20 1 Y 1 B TRP 115 ? B TRP 100 
21 1 Y 1 B GLU 116 ? B GLU 101 
22 1 Y 1 B VAL 117 ? B VAL 102 
23 1 Y 1 B ALA 118 ? B ALA 103 
24 1 Y 1 B PRO 119 ? B PRO 104 
25 1 Y 1 B SER 120 ? B SER 105 
26 1 Y 1 B GLY 121 ? B GLY 106 
27 1 Y 1 B GLN 122 ? B GLN 107 
28 1 Y 1 B LEU 231 ? B LEU 216 
29 1 Y 1 B GLU 232 ? B GLU 217 
30 1 Y 1 B VAL 233 ? B VAL 218 
31 1 Y 1 B LEU 234 ? B LEU 219 
32 1 Y 1 B PHE 235 ? B PHE 220 
33 1 Y 1 B GLN 236 ? B GLN 221 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 N-ACETYL-D-GLUCOSAMINE NAG 
4 'CHLORIDE ION'         CL  
5 water                  HOH 
#