data_5JLH
# 
_entry.id   5JLH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5JLH         
WWPDB D_1000219896 
EMDB  EMD-8164     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB 'The EM volume is the same reconstruction after post-processing with RELION without filtering of tropomyosin to 7 Angstrom.' 
EMD-8165 'other EM volume'      
PDB  'The PDB model belongs to both entries.'                                                                                     
5JLH     unspecified            
EMDB .                                                                                                                            
EMD-8164 'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5JLH 
_pdbx_database_status.recvd_initial_deposition_date   2016-04-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'von der Ecken, J.'   1 ? 
'Heissler, S.M.'      2 ? 
'Pathan-Chhatbar, S.' 3 ? 
'Manstein, D.J.'      4 ? 
'Raunser, S.'         5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            534 
_citation.language                  ? 
_citation.page_first                724 
_citation.page_last                 728 
_citation.title                     'Cryo-EM structure of a human cytoplasmic actomyosin complex at near-atomic resolution.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature18295 
_citation.pdbx_database_id_PubMed   27324845 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ecken, J.V.'         1 ? 
primary 'Heissler, S.M.'      2 ? 
primary 'Pathan-Chhatbar, S.' 3 ? 
primary 'Manstein, D.J.'      4 ? 
primary 'Raunser, S.'         5 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5JLH 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.0 
_cell.length_a_esd                 ? 
_cell.length_b                     1.0 
_cell.length_b_esd                 ? 
_cell.length_c                     1.0 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5JLH 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Actin, cytoplasmic 2'      41707.570  5 ? ? ? ? 
2 polymer     man 'Myosin-14,Alpha-actinin A' 117570.633 2 ? ? ? 
;NON MUSCLE MYOSIN 2C HEAVY CHAIN, MOTOR DOMAIN RESIDUES 1-799 LINKED TO ALPHA-ACTININ 3, REPEATS 1 AND 2 RESIDUES 800-1039
FRAGMENT: UNP Q7Z406-1 RESIDUES 1-799, UNP P05095 RESIDUES 265-502
;
3 polymer     man 'Tropomyosin alpha-3 chain' 11507.176  4 ? ? ? 
;Human TROPOMYSIN WAS USED (UNP P06753-2,TPM3_HUMAN, RESIDUES 62-196). DUE TO THE LIMITED RESOLUTION OF THE CRYO-EM DENSITY IN THE REGION OF TROPOMYOSIN, TROPOMYOSIN HAS BEEN REPRESENTED AS POLY(UNK).
;
4 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"  427.201    5 ? ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'             24.305     5 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 Gamma-actin 
2 
;Myosin heavy chain 14,Myosin heavy chain,non-muscle IIc,Non-muscle myosin heavy chain IIc,NMHC II-C, ALPHA-ACTININ,Actin-binding protein A,F-actin cross-linking protein
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDD
MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTH
TVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYE
LPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA
PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
;
;EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDD
MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTH
TVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYE
LPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA
PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
;
A,B,C,D,E ? 
2 'polypeptide(L)' no no 
;MAAVTMSVPGRKAPPRPGPVPEAAQPFLFTPRGPSAGGGPGSGTSPQVEWTARRLVWVPSELHGFEAAALRDEGEEEAEV
ELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEASVLHNLRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVE
MYRGKKRHEVPPHVYAVTEGAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGRKEPGVPGELERQLLQ
ANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDECSFHIFYQLLGGAGEQLKADLL
LEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEEIISMLRMVSAVLQFGNIALKRERNTDQATMPDNTAAQKL
CRLLGLGVTDFSRALLTPRIKVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRALDRSPRQGASFLGILDIA
GFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWTFLDFGLDLQPCIDLIERPANPPGLLALLDEECWF
PKATDKSFVEKVAQEQGGHPKFQRPRHLRDQADFSVLHYAGKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKD
VEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNHEKRAGKLEPRLVLDQLRCNG
VLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEKMIQALELDPNLYRVGQSKIFFRAGVLAQLEEERA
SEQTKSDYLKRANELVQWINDKQASLESRDFGDSIESVQSFMNAHKEYKKTEKPPKGQEVSELEAIYNSLQTKLRLIKRE
PFVAPAGLTPNEIDSTWSALEKAEQEHAEALRIELKRQKKIAVLLQKYNRILKKLENWATTKSVYLGSNETGDSITAVQA
KLKNLEAFDGECQSLEGQSNSDLLSILAQLTELNYNGVPELTERKDTFFAQQWTGVKSSAETYKNTLLAELERLQKIED
;
;MAAVTMSVPGRKAPPRPGPVPEAAQPFLFTPRGPSAGGGPGSGTSPQVEWTARRLVWVPSELHGFEAAALRDEGEEEAEV
ELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEASVLHNLRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVE
MYRGKKRHEVPPHVYAVTEGAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGRKEPGVPGELERQLLQ
ANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDECSFHIFYQLLGGAGEQLKADLL
LEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEEIISMLRMVSAVLQFGNIALKRERNTDQATMPDNTAAQKL
CRLLGLGVTDFSRALLTPRIKVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRALDRSPRQGASFLGILDIA
GFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWTFLDFGLDLQPCIDLIERPANPPGLLALLDEECWF
PKATDKSFVEKVAQEQGGHPKFQRPRHLRDQADFSVLHYAGKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKD
VEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNHEKRAGKLEPRLVLDQLRCNG
VLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEKMIQALELDPNLYRVGQSKIFFRAGVLAQLEEERA
SEQTKSDYLKRANELVQWINDKQASLESRDFGDSIESVQSFMNAHKEYKKTEKPPKGQEVSELEAIYNSLQTKLRLIKRE
PFVAPAGLTPNEIDSTWSALEKAEQEHAEALRIELKRQKKIAVLLQKYNRILKKLENWATTKSVYLGSNETGDSITAVQA
KLKNLEAFDGECQSLEGQSNSDLLSILAQLTELNYNGVPELTERKDTFFAQQWTGVKSSAETYKNTLLAELERLQKIED
;
F,G       ? 
3 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
;XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
;
H,I,J,K   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLU n 
1 2    GLU n 
1 3    GLU n 
1 4    ILE n 
1 5    ALA n 
1 6    ALA n 
1 7    LEU n 
1 8    VAL n 
1 9    ILE n 
1 10   ASP n 
1 11   ASN n 
1 12   GLY n 
1 13   SER n 
1 14   GLY n 
1 15   MET n 
1 16   CYS n 
1 17   LYS n 
1 18   ALA n 
1 19   GLY n 
1 20   PHE n 
1 21   ALA n 
1 22   GLY n 
1 23   ASP n 
1 24   ASP n 
1 25   ALA n 
1 26   PRO n 
1 27   ARG n 
1 28   ALA n 
1 29   VAL n 
1 30   PHE n 
1 31   PRO n 
1 32   SER n 
1 33   ILE n 
1 34   VAL n 
1 35   GLY n 
1 36   ARG n 
1 37   PRO n 
1 38   ARG n 
1 39   HIS n 
1 40   GLN n 
1 41   GLY n 
1 42   VAL n 
1 43   MET n 
1 44   VAL n 
1 45   GLY n 
1 46   MET n 
1 47   GLY n 
1 48   GLN n 
1 49   LYS n 
1 50   ASP n 
1 51   SER n 
1 52   TYR n 
1 53   VAL n 
1 54   GLY n 
1 55   ASP n 
1 56   GLU n 
1 57   ALA n 
1 58   GLN n 
1 59   SER n 
1 60   LYS n 
1 61   ARG n 
1 62   GLY n 
1 63   ILE n 
1 64   LEU n 
1 65   THR n 
1 66   LEU n 
1 67   LYS n 
1 68   TYR n 
1 69   PRO n 
1 70   ILE n 
1 71   GLU n 
1 72   HIS n 
1 73   GLY n 
1 74   ILE n 
1 75   VAL n 
1 76   THR n 
1 77   ASN n 
1 78   TRP n 
1 79   ASP n 
1 80   ASP n 
1 81   MET n 
1 82   GLU n 
1 83   LYS n 
1 84   ILE n 
1 85   TRP n 
1 86   HIS n 
1 87   HIS n 
1 88   THR n 
1 89   PHE n 
1 90   TYR n 
1 91   ASN n 
1 92   GLU n 
1 93   LEU n 
1 94   ARG n 
1 95   VAL n 
1 96   ALA n 
1 97   PRO n 
1 98   GLU n 
1 99   GLU n 
1 100  HIS n 
1 101  PRO n 
1 102  VAL n 
1 103  LEU n 
1 104  LEU n 
1 105  THR n 
1 106  GLU n 
1 107  ALA n 
1 108  PRO n 
1 109  LEU n 
1 110  ASN n 
1 111  PRO n 
1 112  LYS n 
1 113  ALA n 
1 114  ASN n 
1 115  ARG n 
1 116  GLU n 
1 117  LYS n 
1 118  MET n 
1 119  THR n 
1 120  GLN n 
1 121  ILE n 
1 122  MET n 
1 123  PHE n 
1 124  GLU n 
1 125  THR n 
1 126  PHE n 
1 127  ASN n 
1 128  THR n 
1 129  PRO n 
1 130  ALA n 
1 131  MET n 
1 132  TYR n 
1 133  VAL n 
1 134  ALA n 
1 135  ILE n 
1 136  GLN n 
1 137  ALA n 
1 138  VAL n 
1 139  LEU n 
1 140  SER n 
1 141  LEU n 
1 142  TYR n 
1 143  ALA n 
1 144  SER n 
1 145  GLY n 
1 146  ARG n 
1 147  THR n 
1 148  THR n 
1 149  GLY n 
1 150  ILE n 
1 151  VAL n 
1 152  MET n 
1 153  ASP n 
1 154  SER n 
1 155  GLY n 
1 156  ASP n 
1 157  GLY n 
1 158  VAL n 
1 159  THR n 
1 160  HIS n 
1 161  THR n 
1 162  VAL n 
1 163  PRO n 
1 164  ILE n 
1 165  TYR n 
1 166  GLU n 
1 167  GLY n 
1 168  TYR n 
1 169  ALA n 
1 170  LEU n 
1 171  PRO n 
1 172  HIS n 
1 173  ALA n 
1 174  ILE n 
1 175  LEU n 
1 176  ARG n 
1 177  LEU n 
1 178  ASP n 
1 179  LEU n 
1 180  ALA n 
1 181  GLY n 
1 182  ARG n 
1 183  ASP n 
1 184  LEU n 
1 185  THR n 
1 186  ASP n 
1 187  TYR n 
1 188  LEU n 
1 189  MET n 
1 190  LYS n 
1 191  ILE n 
1 192  LEU n 
1 193  THR n 
1 194  GLU n 
1 195  ARG n 
1 196  GLY n 
1 197  TYR n 
1 198  SER n 
1 199  PHE n 
1 200  THR n 
1 201  THR n 
1 202  THR n 
1 203  ALA n 
1 204  GLU n 
1 205  ARG n 
1 206  GLU n 
1 207  ILE n 
1 208  VAL n 
1 209  ARG n 
1 210  ASP n 
1 211  ILE n 
1 212  LYS n 
1 213  GLU n 
1 214  LYS n 
1 215  LEU n 
1 216  CYS n 
1 217  TYR n 
1 218  VAL n 
1 219  ALA n 
1 220  LEU n 
1 221  ASP n 
1 222  PHE n 
1 223  GLU n 
1 224  GLN n 
1 225  GLU n 
1 226  MET n 
1 227  ALA n 
1 228  THR n 
1 229  ALA n 
1 230  ALA n 
1 231  SER n 
1 232  SER n 
1 233  SER n 
1 234  SER n 
1 235  LEU n 
1 236  GLU n 
1 237  LYS n 
1 238  SER n 
1 239  TYR n 
1 240  GLU n 
1 241  LEU n 
1 242  PRO n 
1 243  ASP n 
1 244  GLY n 
1 245  GLN n 
1 246  VAL n 
1 247  ILE n 
1 248  THR n 
1 249  ILE n 
1 250  GLY n 
1 251  ASN n 
1 252  GLU n 
1 253  ARG n 
1 254  PHE n 
1 255  ARG n 
1 256  CYS n 
1 257  PRO n 
1 258  GLU n 
1 259  ALA n 
1 260  LEU n 
1 261  PHE n 
1 262  GLN n 
1 263  PRO n 
1 264  SER n 
1 265  PHE n 
1 266  LEU n 
1 267  GLY n 
1 268  MET n 
1 269  GLU n 
1 270  SER n 
1 271  CYS n 
1 272  GLY n 
1 273  ILE n 
1 274  HIS n 
1 275  GLU n 
1 276  THR n 
1 277  THR n 
1 278  PHE n 
1 279  ASN n 
1 280  SER n 
1 281  ILE n 
1 282  MET n 
1 283  LYS n 
1 284  CYS n 
1 285  ASP n 
1 286  VAL n 
1 287  ASP n 
1 288  ILE n 
1 289  ARG n 
1 290  LYS n 
1 291  ASP n 
1 292  LEU n 
1 293  TYR n 
1 294  ALA n 
1 295  ASN n 
1 296  THR n 
1 297  VAL n 
1 298  LEU n 
1 299  SER n 
1 300  GLY n 
1 301  GLY n 
1 302  THR n 
1 303  THR n 
1 304  MET n 
1 305  TYR n 
1 306  PRO n 
1 307  GLY n 
1 308  ILE n 
1 309  ALA n 
1 310  ASP n 
1 311  ARG n 
1 312  MET n 
1 313  GLN n 
1 314  LYS n 
1 315  GLU n 
1 316  ILE n 
1 317  THR n 
1 318  ALA n 
1 319  LEU n 
1 320  ALA n 
1 321  PRO n 
1 322  SER n 
1 323  THR n 
1 324  MET n 
1 325  LYS n 
1 326  ILE n 
1 327  LYS n 
1 328  ILE n 
1 329  ILE n 
1 330  ALA n 
1 331  PRO n 
1 332  PRO n 
1 333  GLU n 
1 334  ARG n 
1 335  LYS n 
1 336  TYR n 
1 337  SER n 
1 338  VAL n 
1 339  TRP n 
1 340  ILE n 
1 341  GLY n 
1 342  GLY n 
1 343  SER n 
1 344  ILE n 
1 345  LEU n 
1 346  ALA n 
1 347  SER n 
1 348  LEU n 
1 349  SER n 
1 350  THR n 
1 351  PHE n 
1 352  GLN n 
1 353  GLN n 
1 354  MET n 
1 355  TRP n 
1 356  ILE n 
1 357  SER n 
1 358  LYS n 
1 359  GLN n 
1 360  GLU n 
1 361  TYR n 
1 362  ASP n 
1 363  GLU n 
1 364  SER n 
1 365  GLY n 
1 366  PRO n 
1 367  SER n 
1 368  ILE n 
1 369  VAL n 
1 370  HIS n 
1 371  ARG n 
1 372  LYS n 
1 373  CYS n 
1 374  PHE n 
2 1    MET n 
2 2    ALA n 
2 3    ALA n 
2 4    VAL n 
2 5    THR n 
2 6    MET n 
2 7    SER n 
2 8    VAL n 
2 9    PRO n 
2 10   GLY n 
2 11   ARG n 
2 12   LYS n 
2 13   ALA n 
2 14   PRO n 
2 15   PRO n 
2 16   ARG n 
2 17   PRO n 
2 18   GLY n 
2 19   PRO n 
2 20   VAL n 
2 21   PRO n 
2 22   GLU n 
2 23   ALA n 
2 24   ALA n 
2 25   GLN n 
2 26   PRO n 
2 27   PHE n 
2 28   LEU n 
2 29   PHE n 
2 30   THR n 
2 31   PRO n 
2 32   ARG n 
2 33   GLY n 
2 34   PRO n 
2 35   SER n 
2 36   ALA n 
2 37   GLY n 
2 38   GLY n 
2 39   GLY n 
2 40   PRO n 
2 41   GLY n 
2 42   SER n 
2 43   GLY n 
2 44   THR n 
2 45   SER n 
2 46   PRO n 
2 47   GLN n 
2 48   VAL n 
2 49   GLU n 
2 50   TRP n 
2 51   THR n 
2 52   ALA n 
2 53   ARG n 
2 54   ARG n 
2 55   LEU n 
2 56   VAL n 
2 57   TRP n 
2 58   VAL n 
2 59   PRO n 
2 60   SER n 
2 61   GLU n 
2 62   LEU n 
2 63   HIS n 
2 64   GLY n 
2 65   PHE n 
2 66   GLU n 
2 67   ALA n 
2 68   ALA n 
2 69   ALA n 
2 70   LEU n 
2 71   ARG n 
2 72   ASP n 
2 73   GLU n 
2 74   GLY n 
2 75   GLU n 
2 76   GLU n 
2 77   GLU n 
2 78   ALA n 
2 79   GLU n 
2 80   VAL n 
2 81   GLU n 
2 82   LEU n 
2 83   ALA n 
2 84   GLU n 
2 85   SER n 
2 86   GLY n 
2 87   ARG n 
2 88   ARG n 
2 89   LEU n 
2 90   ARG n 
2 91   LEU n 
2 92   PRO n 
2 93   ARG n 
2 94   ASP n 
2 95   GLN n 
2 96   ILE n 
2 97   GLN n 
2 98   ARG n 
2 99   MET n 
2 100  ASN n 
2 101  PRO n 
2 102  PRO n 
2 103  LYS n 
2 104  PHE n 
2 105  SER n 
2 106  LYS n 
2 107  ALA n 
2 108  GLU n 
2 109  ASP n 
2 110  MET n 
2 111  ALA n 
2 112  GLU n 
2 113  LEU n 
2 114  THR n 
2 115  CYS n 
2 116  LEU n 
2 117  ASN n 
2 118  GLU n 
2 119  ALA n 
2 120  SER n 
2 121  VAL n 
2 122  LEU n 
2 123  HIS n 
2 124  ASN n 
2 125  LEU n 
2 126  ARG n 
2 127  GLU n 
2 128  ARG n 
2 129  TYR n 
2 130  TYR n 
2 131  SER n 
2 132  GLY n 
2 133  LEU n 
2 134  ILE n 
2 135  TYR n 
2 136  THR n 
2 137  TYR n 
2 138  SER n 
2 139  GLY n 
2 140  LEU n 
2 141  PHE n 
2 142  CYS n 
2 143  VAL n 
2 144  VAL n 
2 145  ILE n 
2 146  ASN n 
2 147  PRO n 
2 148  TYR n 
2 149  LYS n 
2 150  GLN n 
2 151  LEU n 
2 152  PRO n 
2 153  ILE n 
2 154  TYR n 
2 155  THR n 
2 156  GLU n 
2 157  ALA n 
2 158  ILE n 
2 159  VAL n 
2 160  GLU n 
2 161  MET n 
2 162  TYR n 
2 163  ARG n 
2 164  GLY n 
2 165  LYS n 
2 166  LYS n 
2 167  ARG n 
2 168  HIS n 
2 169  GLU n 
2 170  VAL n 
2 171  PRO n 
2 172  PRO n 
2 173  HIS n 
2 174  VAL n 
2 175  TYR n 
2 176  ALA n 
2 177  VAL n 
2 178  THR n 
2 179  GLU n 
2 180  GLY n 
2 181  ALA n 
2 182  TYR n 
2 183  ARG n 
2 184  SER n 
2 185  MET n 
2 186  LEU n 
2 187  GLN n 
2 188  ASP n 
2 189  ARG n 
2 190  GLU n 
2 191  ASP n 
2 192  GLN n 
2 193  SER n 
2 194  ILE n 
2 195  LEU n 
2 196  CYS n 
2 197  THR n 
2 198  GLY n 
2 199  GLU n 
2 200  SER n 
2 201  GLY n 
2 202  ALA n 
2 203  GLY n 
2 204  LYS n 
2 205  THR n 
2 206  GLU n 
2 207  ASN n 
2 208  THR n 
2 209  LYS n 
2 210  LYS n 
2 211  VAL n 
2 212  ILE n 
2 213  GLN n 
2 214  TYR n 
2 215  LEU n 
2 216  ALA n 
2 217  HIS n 
2 218  VAL n 
2 219  ALA n 
2 220  SER n 
2 221  SER n 
2 222  PRO n 
2 223  LYS n 
2 224  GLY n 
2 225  ARG n 
2 226  LYS n 
2 227  GLU n 
2 228  PRO n 
2 229  GLY n 
2 230  VAL n 
2 231  PRO n 
2 232  GLY n 
2 233  GLU n 
2 234  LEU n 
2 235  GLU n 
2 236  ARG n 
2 237  GLN n 
2 238  LEU n 
2 239  LEU n 
2 240  GLN n 
2 241  ALA n 
2 242  ASN n 
2 243  PRO n 
2 244  ILE n 
2 245  LEU n 
2 246  GLU n 
2 247  ALA n 
2 248  PHE n 
2 249  GLY n 
2 250  ASN n 
2 251  ALA n 
2 252  LYS n 
2 253  THR n 
2 254  VAL n 
2 255  LYS n 
2 256  ASN n 
2 257  ASP n 
2 258  ASN n 
2 259  SER n 
2 260  SER n 
2 261  ARG n 
2 262  PHE n 
2 263  GLY n 
2 264  LYS n 
2 265  PHE n 
2 266  ILE n 
2 267  ARG n 
2 268  ILE n 
2 269  ASN n 
2 270  PHE n 
2 271  ASP n 
2 272  VAL n 
2 273  ALA n 
2 274  GLY n 
2 275  TYR n 
2 276  ILE n 
2 277  VAL n 
2 278  GLY n 
2 279  ALA n 
2 280  ASN n 
2 281  ILE n 
2 282  GLU n 
2 283  THR n 
2 284  TYR n 
2 285  LEU n 
2 286  LEU n 
2 287  GLU n 
2 288  LYS n 
2 289  SER n 
2 290  ARG n 
2 291  ALA n 
2 292  ILE n 
2 293  ARG n 
2 294  GLN n 
2 295  ALA n 
2 296  LYS n 
2 297  ASP n 
2 298  GLU n 
2 299  CYS n 
2 300  SER n 
2 301  PHE n 
2 302  HIS n 
2 303  ILE n 
2 304  PHE n 
2 305  TYR n 
2 306  GLN n 
2 307  LEU n 
2 308  LEU n 
2 309  GLY n 
2 310  GLY n 
2 311  ALA n 
2 312  GLY n 
2 313  GLU n 
2 314  GLN n 
2 315  LEU n 
2 316  LYS n 
2 317  ALA n 
2 318  ASP n 
2 319  LEU n 
2 320  LEU n 
2 321  LEU n 
2 322  GLU n 
2 323  PRO n 
2 324  CYS n 
2 325  SER n 
2 326  HIS n 
2 327  TYR n 
2 328  ARG n 
2 329  PHE n 
2 330  LEU n 
2 331  THR n 
2 332  ASN n 
2 333  GLY n 
2 334  PRO n 
2 335  SER n 
2 336  SER n 
2 337  SER n 
2 338  PRO n 
2 339  GLY n 
2 340  GLN n 
2 341  GLU n 
2 342  ARG n 
2 343  GLU n 
2 344  LEU n 
2 345  PHE n 
2 346  GLN n 
2 347  GLU n 
2 348  THR n 
2 349  LEU n 
2 350  GLU n 
2 351  SER n 
2 352  LEU n 
2 353  ARG n 
2 354  VAL n 
2 355  LEU n 
2 356  GLY n 
2 357  PHE n 
2 358  SER n 
2 359  HIS n 
2 360  GLU n 
2 361  GLU n 
2 362  ILE n 
2 363  ILE n 
2 364  SER n 
2 365  MET n 
2 366  LEU n 
2 367  ARG n 
2 368  MET n 
2 369  VAL n 
2 370  SER n 
2 371  ALA n 
2 372  VAL n 
2 373  LEU n 
2 374  GLN n 
2 375  PHE n 
2 376  GLY n 
2 377  ASN n 
2 378  ILE n 
2 379  ALA n 
2 380  LEU n 
2 381  LYS n 
2 382  ARG n 
2 383  GLU n 
2 384  ARG n 
2 385  ASN n 
2 386  THR n 
2 387  ASP n 
2 388  GLN n 
2 389  ALA n 
2 390  THR n 
2 391  MET n 
2 392  PRO n 
2 393  ASP n 
2 394  ASN n 
2 395  THR n 
2 396  ALA n 
2 397  ALA n 
2 398  GLN n 
2 399  LYS n 
2 400  LEU n 
2 401  CYS n 
2 402  ARG n 
2 403  LEU n 
2 404  LEU n 
2 405  GLY n 
2 406  LEU n 
2 407  GLY n 
2 408  VAL n 
2 409  THR n 
2 410  ASP n 
2 411  PHE n 
2 412  SER n 
2 413  ARG n 
2 414  ALA n 
2 415  LEU n 
2 416  LEU n 
2 417  THR n 
2 418  PRO n 
2 419  ARG n 
2 420  ILE n 
2 421  LYS n 
2 422  VAL n 
2 423  GLY n 
2 424  ARG n 
2 425  ASP n 
2 426  TYR n 
2 427  VAL n 
2 428  GLN n 
2 429  LYS n 
2 430  ALA n 
2 431  GLN n 
2 432  THR n 
2 433  LYS n 
2 434  GLU n 
2 435  GLN n 
2 436  ALA n 
2 437  ASP n 
2 438  PHE n 
2 439  ALA n 
2 440  LEU n 
2 441  GLU n 
2 442  ALA n 
2 443  LEU n 
2 444  ALA n 
2 445  LYS n 
2 446  ALA n 
2 447  THR n 
2 448  TYR n 
2 449  GLU n 
2 450  ARG n 
2 451  LEU n 
2 452  PHE n 
2 453  ARG n 
2 454  TRP n 
2 455  LEU n 
2 456  VAL n 
2 457  LEU n 
2 458  ARG n 
2 459  LEU n 
2 460  ASN n 
2 461  ARG n 
2 462  ALA n 
2 463  LEU n 
2 464  ASP n 
2 465  ARG n 
2 466  SER n 
2 467  PRO n 
2 468  ARG n 
2 469  GLN n 
2 470  GLY n 
2 471  ALA n 
2 472  SER n 
2 473  PHE n 
2 474  LEU n 
2 475  GLY n 
2 476  ILE n 
2 477  LEU n 
2 478  ASP n 
2 479  ILE n 
2 480  ALA n 
2 481  GLY n 
2 482  PHE n 
2 483  GLU n 
2 484  ILE n 
2 485  PHE n 
2 486  GLN n 
2 487  LEU n 
2 488  ASN n 
2 489  SER n 
2 490  PHE n 
2 491  GLU n 
2 492  GLN n 
2 493  LEU n 
2 494  CYS n 
2 495  ILE n 
2 496  ASN n 
2 497  TYR n 
2 498  THR n 
2 499  ASN n 
2 500  GLU n 
2 501  LYS n 
2 502  LEU n 
2 503  GLN n 
2 504  GLN n 
2 505  LEU n 
2 506  PHE n 
2 507  ASN n 
2 508  HIS n 
2 509  THR n 
2 510  MET n 
2 511  PHE n 
2 512  VAL n 
2 513  LEU n 
2 514  GLU n 
2 515  GLN n 
2 516  GLU n 
2 517  GLU n 
2 518  TYR n 
2 519  GLN n 
2 520  ARG n 
2 521  GLU n 
2 522  GLY n 
2 523  ILE n 
2 524  PRO n 
2 525  TRP n 
2 526  THR n 
2 527  PHE n 
2 528  LEU n 
2 529  ASP n 
2 530  PHE n 
2 531  GLY n 
2 532  LEU n 
2 533  ASP n 
2 534  LEU n 
2 535  GLN n 
2 536  PRO n 
2 537  CYS n 
2 538  ILE n 
2 539  ASP n 
2 540  LEU n 
2 541  ILE n 
2 542  GLU n 
2 543  ARG n 
2 544  PRO n 
2 545  ALA n 
2 546  ASN n 
2 547  PRO n 
2 548  PRO n 
2 549  GLY n 
2 550  LEU n 
2 551  LEU n 
2 552  ALA n 
2 553  LEU n 
2 554  LEU n 
2 555  ASP n 
2 556  GLU n 
2 557  GLU n 
2 558  CYS n 
2 559  TRP n 
2 560  PHE n 
2 561  PRO n 
2 562  LYS n 
2 563  ALA n 
2 564  THR n 
2 565  ASP n 
2 566  LYS n 
2 567  SER n 
2 568  PHE n 
2 569  VAL n 
2 570  GLU n 
2 571  LYS n 
2 572  VAL n 
2 573  ALA n 
2 574  GLN n 
2 575  GLU n 
2 576  GLN n 
2 577  GLY n 
2 578  GLY n 
2 579  HIS n 
2 580  PRO n 
2 581  LYS n 
2 582  PHE n 
2 583  GLN n 
2 584  ARG n 
2 585  PRO n 
2 586  ARG n 
2 587  HIS n 
2 588  LEU n 
2 589  ARG n 
2 590  ASP n 
2 591  GLN n 
2 592  ALA n 
2 593  ASP n 
2 594  PHE n 
2 595  SER n 
2 596  VAL n 
2 597  LEU n 
2 598  HIS n 
2 599  TYR n 
2 600  ALA n 
2 601  GLY n 
2 602  LYS n 
2 603  VAL n 
2 604  ASP n 
2 605  TYR n 
2 606  LYS n 
2 607  ALA n 
2 608  ASN n 
2 609  GLU n 
2 610  TRP n 
2 611  LEU n 
2 612  MET n 
2 613  LYS n 
2 614  ASN n 
2 615  MET n 
2 616  ASP n 
2 617  PRO n 
2 618  LEU n 
2 619  ASN n 
2 620  ASP n 
2 621  ASN n 
2 622  VAL n 
2 623  ALA n 
2 624  ALA n 
2 625  LEU n 
2 626  LEU n 
2 627  HIS n 
2 628  GLN n 
2 629  SER n 
2 630  THR n 
2 631  ASP n 
2 632  ARG n 
2 633  LEU n 
2 634  THR n 
2 635  ALA n 
2 636  GLU n 
2 637  ILE n 
2 638  TRP n 
2 639  LYS n 
2 640  ASP n 
2 641  VAL n 
2 642  GLU n 
2 643  GLY n 
2 644  ILE n 
2 645  VAL n 
2 646  GLY n 
2 647  LEU n 
2 648  GLU n 
2 649  GLN n 
2 650  VAL n 
2 651  SER n 
2 652  SER n 
2 653  LEU n 
2 654  GLY n 
2 655  ASP n 
2 656  GLY n 
2 657  PRO n 
2 658  PRO n 
2 659  GLY n 
2 660  GLY n 
2 661  ARG n 
2 662  PRO n 
2 663  ARG n 
2 664  ARG n 
2 665  GLY n 
2 666  MET n 
2 667  PHE n 
2 668  ARG n 
2 669  THR n 
2 670  VAL n 
2 671  GLY n 
2 672  GLN n 
2 673  LEU n 
2 674  TYR n 
2 675  LYS n 
2 676  GLU n 
2 677  SER n 
2 678  LEU n 
2 679  SER n 
2 680  ARG n 
2 681  LEU n 
2 682  MET n 
2 683  ALA n 
2 684  THR n 
2 685  LEU n 
2 686  SER n 
2 687  ASN n 
2 688  THR n 
2 689  ASN n 
2 690  PRO n 
2 691  SER n 
2 692  PHE n 
2 693  VAL n 
2 694  ARG n 
2 695  CYS n 
2 696  ILE n 
2 697  VAL n 
2 698  PRO n 
2 699  ASN n 
2 700  HIS n 
2 701  GLU n 
2 702  LYS n 
2 703  ARG n 
2 704  ALA n 
2 705  GLY n 
2 706  LYS n 
2 707  LEU n 
2 708  GLU n 
2 709  PRO n 
2 710  ARG n 
2 711  LEU n 
2 712  VAL n 
2 713  LEU n 
2 714  ASP n 
2 715  GLN n 
2 716  LEU n 
2 717  ARG n 
2 718  CYS n 
2 719  ASN n 
2 720  GLY n 
2 721  VAL n 
2 722  LEU n 
2 723  GLU n 
2 724  GLY n 
2 725  ILE n 
2 726  ARG n 
2 727  ILE n 
2 728  CYS n 
2 729  ARG n 
2 730  GLN n 
2 731  GLY n 
2 732  PHE n 
2 733  PRO n 
2 734  ASN n 
2 735  ARG n 
2 736  ILE n 
2 737  LEU n 
2 738  PHE n 
2 739  GLN n 
2 740  GLU n 
2 741  PHE n 
2 742  ARG n 
2 743  GLN n 
2 744  ARG n 
2 745  TYR n 
2 746  GLU n 
2 747  ILE n 
2 748  LEU n 
2 749  THR n 
2 750  PRO n 
2 751  ASN n 
2 752  ALA n 
2 753  ILE n 
2 754  PRO n 
2 755  LYS n 
2 756  GLY n 
2 757  PHE n 
2 758  MET n 
2 759  ASP n 
2 760  GLY n 
2 761  LYS n 
2 762  GLN n 
2 763  ALA n 
2 764  CYS n 
2 765  GLU n 
2 766  LYS n 
2 767  MET n 
2 768  ILE n 
2 769  GLN n 
2 770  ALA n 
2 771  LEU n 
2 772  GLU n 
2 773  LEU n 
2 774  ASP n 
2 775  PRO n 
2 776  ASN n 
2 777  LEU n 
2 778  TYR n 
2 779  ARG n 
2 780  VAL n 
2 781  GLY n 
2 782  GLN n 
2 783  SER n 
2 784  LYS n 
2 785  ILE n 
2 786  PHE n 
2 787  PHE n 
2 788  ARG n 
2 789  ALA n 
2 790  GLY n 
2 791  VAL n 
2 792  LEU n 
2 793  ALA n 
2 794  GLN n 
2 795  LEU n 
2 796  GLU n 
2 797  GLU n 
2 798  GLU n 
2 799  ARG n 
2 800  ALA n 
2 801  SER n 
2 802  GLU n 
2 803  GLN n 
2 804  THR n 
2 805  LYS n 
2 806  SER n 
2 807  ASP n 
2 808  TYR n 
2 809  LEU n 
2 810  LYS n 
2 811  ARG n 
2 812  ALA n 
2 813  ASN n 
2 814  GLU n 
2 815  LEU n 
2 816  VAL n 
2 817  GLN n 
2 818  TRP n 
2 819  ILE n 
2 820  ASN n 
2 821  ASP n 
2 822  LYS n 
2 823  GLN n 
2 824  ALA n 
2 825  SER n 
2 826  LEU n 
2 827  GLU n 
2 828  SER n 
2 829  ARG n 
2 830  ASP n 
2 831  PHE n 
2 832  GLY n 
2 833  ASP n 
2 834  SER n 
2 835  ILE n 
2 836  GLU n 
2 837  SER n 
2 838  VAL n 
2 839  GLN n 
2 840  SER n 
2 841  PHE n 
2 842  MET n 
2 843  ASN n 
2 844  ALA n 
2 845  HIS n 
2 846  LYS n 
2 847  GLU n 
2 848  TYR n 
2 849  LYS n 
2 850  LYS n 
2 851  THR n 
2 852  GLU n 
2 853  LYS n 
2 854  PRO n 
2 855  PRO n 
2 856  LYS n 
2 857  GLY n 
2 858  GLN n 
2 859  GLU n 
2 860  VAL n 
2 861  SER n 
2 862  GLU n 
2 863  LEU n 
2 864  GLU n 
2 865  ALA n 
2 866  ILE n 
2 867  TYR n 
2 868  ASN n 
2 869  SER n 
2 870  LEU n 
2 871  GLN n 
2 872  THR n 
2 873  LYS n 
2 874  LEU n 
2 875  ARG n 
2 876  LEU n 
2 877  ILE n 
2 878  LYS n 
2 879  ARG n 
2 880  GLU n 
2 881  PRO n 
2 882  PHE n 
2 883  VAL n 
2 884  ALA n 
2 885  PRO n 
2 886  ALA n 
2 887  GLY n 
2 888  LEU n 
2 889  THR n 
2 890  PRO n 
2 891  ASN n 
2 892  GLU n 
2 893  ILE n 
2 894  ASP n 
2 895  SER n 
2 896  THR n 
2 897  TRP n 
2 898  SER n 
2 899  ALA n 
2 900  LEU n 
2 901  GLU n 
2 902  LYS n 
2 903  ALA n 
2 904  GLU n 
2 905  GLN n 
2 906  GLU n 
2 907  HIS n 
2 908  ALA n 
2 909  GLU n 
2 910  ALA n 
2 911  LEU n 
2 912  ARG n 
2 913  ILE n 
2 914  GLU n 
2 915  LEU n 
2 916  LYS n 
2 917  ARG n 
2 918  GLN n 
2 919  LYS n 
2 920  LYS n 
2 921  ILE n 
2 922  ALA n 
2 923  VAL n 
2 924  LEU n 
2 925  LEU n 
2 926  GLN n 
2 927  LYS n 
2 928  TYR n 
2 929  ASN n 
2 930  ARG n 
2 931  ILE n 
2 932  LEU n 
2 933  LYS n 
2 934  LYS n 
2 935  LEU n 
2 936  GLU n 
2 937  ASN n 
2 938  TRP n 
2 939  ALA n 
2 940  THR n 
2 941  THR n 
2 942  LYS n 
2 943  SER n 
2 944  VAL n 
2 945  TYR n 
2 946  LEU n 
2 947  GLY n 
2 948  SER n 
2 949  ASN n 
2 950  GLU n 
2 951  THR n 
2 952  GLY n 
2 953  ASP n 
2 954  SER n 
2 955  ILE n 
2 956  THR n 
2 957  ALA n 
2 958  VAL n 
2 959  GLN n 
2 960  ALA n 
2 961  LYS n 
2 962  LEU n 
2 963  LYS n 
2 964  ASN n 
2 965  LEU n 
2 966  GLU n 
2 967  ALA n 
2 968  PHE n 
2 969  ASP n 
2 970  GLY n 
2 971  GLU n 
2 972  CYS n 
2 973  GLN n 
2 974  SER n 
2 975  LEU n 
2 976  GLU n 
2 977  GLY n 
2 978  GLN n 
2 979  SER n 
2 980  ASN n 
2 981  SER n 
2 982  ASP n 
2 983  LEU n 
2 984  LEU n 
2 985  SER n 
2 986  ILE n 
2 987  LEU n 
2 988  ALA n 
2 989  GLN n 
2 990  LEU n 
2 991  THR n 
2 992  GLU n 
2 993  LEU n 
2 994  ASN n 
2 995  TYR n 
2 996  ASN n 
2 997  GLY n 
2 998  VAL n 
2 999  PRO n 
2 1000 GLU n 
2 1001 LEU n 
2 1002 THR n 
2 1003 GLU n 
2 1004 ARG n 
2 1005 LYS n 
2 1006 ASP n 
2 1007 THR n 
2 1008 PHE n 
2 1009 PHE n 
2 1010 ALA n 
2 1011 GLN n 
2 1012 GLN n 
2 1013 TRP n 
2 1014 THR n 
2 1015 GLY n 
2 1016 VAL n 
2 1017 LYS n 
2 1018 SER n 
2 1019 SER n 
2 1020 ALA n 
2 1021 GLU n 
2 1022 THR n 
2 1023 TYR n 
2 1024 LYS n 
2 1025 ASN n 
2 1026 THR n 
2 1027 LEU n 
2 1028 LEU n 
2 1029 ALA n 
2 1030 GLU n 
2 1031 LEU n 
2 1032 GLU n 
2 1033 ARG n 
2 1034 LEU n 
2 1035 GLN n 
2 1036 LYS n 
2 1037 ILE n 
2 1038 GLU n 
2 1039 ASP n 
3 1    UNK n 
3 2    UNK n 
3 3    UNK n 
3 4    UNK n 
3 5    UNK n 
3 6    UNK n 
3 7    UNK n 
3 8    UNK n 
3 9    UNK n 
3 10   UNK n 
3 11   UNK n 
3 12   UNK n 
3 13   UNK n 
3 14   UNK n 
3 15   UNK n 
3 16   UNK n 
3 17   UNK n 
3 18   UNK n 
3 19   UNK n 
3 20   UNK n 
3 21   UNK n 
3 22   UNK n 
3 23   UNK n 
3 24   UNK n 
3 25   UNK n 
3 26   UNK n 
3 27   UNK n 
3 28   UNK n 
3 29   UNK n 
3 30   UNK n 
3 31   UNK n 
3 32   UNK n 
3 33   UNK n 
3 34   UNK n 
3 35   UNK n 
3 36   UNK n 
3 37   UNK n 
3 38   UNK n 
3 39   UNK n 
3 40   UNK n 
3 41   UNK n 
3 42   UNK n 
3 43   UNK n 
3 44   UNK n 
3 45   UNK n 
3 46   UNK n 
3 47   UNK n 
3 48   UNK n 
3 49   UNK n 
3 50   UNK n 
3 51   UNK n 
3 52   UNK n 
3 53   UNK n 
3 54   UNK n 
3 55   UNK n 
3 56   UNK n 
3 57   UNK n 
3 58   UNK n 
3 59   UNK n 
3 60   UNK n 
3 61   UNK n 
3 62   UNK n 
3 63   UNK n 
3 64   UNK n 
3 65   UNK n 
3 66   UNK n 
3 67   UNK n 
3 68   UNK n 
3 69   UNK n 
3 70   UNK n 
3 71   UNK n 
3 72   UNK n 
3 73   UNK n 
3 74   UNK n 
3 75   UNK n 
3 76   UNK n 
3 77   UNK n 
3 78   UNK n 
3 79   UNK n 
3 80   UNK n 
3 81   UNK n 
3 82   UNK n 
3 83   UNK n 
3 84   UNK n 
3 85   UNK n 
3 86   UNK n 
3 87   UNK n 
3 88   UNK n 
3 89   UNK n 
3 90   UNK n 
3 91   UNK n 
3 92   UNK n 
3 93   UNK n 
3 94   UNK n 
3 95   UNK n 
3 96   UNK n 
3 97   UNK n 
3 98   UNK n 
3 99   UNK n 
3 100  UNK n 
3 101  UNK n 
3 102  UNK n 
3 103  UNK n 
3 104  UNK n 
3 105  UNK n 
3 106  UNK n 
3 107  UNK n 
3 108  UNK n 
3 109  UNK n 
3 110  UNK n 
3 111  UNK n 
3 112  UNK n 
3 113  UNK n 
3 114  UNK n 
3 115  UNK n 
3 116  UNK n 
3 117  UNK n 
3 118  UNK n 
3 119  UNK n 
3 120  UNK n 
3 121  UNK n 
3 122  UNK n 
3 123  UNK n 
3 124  UNK n 
3 125  UNK n 
3 126  UNK n 
3 127  UNK n 
3 128  UNK n 
3 129  UNK n 
3 130  UNK n 
3 131  UNK n 
3 132  UNK n 
3 133  UNK n 
3 134  UNK n 
3 135  UNK n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   374  Human        ? 'ACTG1, ACTG'               ? ? ? ? ? ? 'Homo sapiens'             9606  
? ? ? ? ? ? ? 'Fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   799  Human        ? 'MYH14, KIAA2034, FP17425'  ? ? ? ? ? ? 'Homo sapiens'             9606  
? ? ? ? ? ? ? 'Fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? ? ? ? 
2 2 sample 'Biological sequence' 800 1039 'Slime mold' ? 'abpA, actnA, DDB_G0268632' ? ? ? ? ? ? 'Dictyostelium discoideum' 44689 
? ? ? ? ? ? ? 'Fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1   135  Human        ? ?                           ? ? ? ? ? ? 'Homo sapiens'             9606  
? ? ? ? ? ? ? ?               'Escherichia coli'      562  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?           ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ACTG_HUMAN  P63261 ?        1 
;EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDD
MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTH
TVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYE
LPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA
PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
;
2   
2 UNP MYH14_HUMAN Q7Z406 Q7Z406-5 2 
;MAAVTMSVPGRKAPPRPGPVPEAAQPFLFTPRGPSAGGGPGSGTSPQVEWTARRLVWVPSELHGFEAAALRDEGEEEAEV
ELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEASVLHNLRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVE
MYRGKKRHEVPPHVYAVTEGAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGRKEPGVPGELERQLLQ
ANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDECSFHIFYQLLGGAGEQLKADLL
LEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEEIISMLRMVSAVLQFGNIALKRERNTDQATMPDNTAAQKL
CRLLGLGVTDFSRALLTPRIKVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRALDRSPRQGASFLGILDIA
GFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWTFLDFGLDLQPCIDLIERPANPPGLLALLDEECWF
PKATDKSFVEKVAQEQGGHPKFQRPRHLRDQADFSVLHYAGKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKD
VEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNHEKRAGKLEPRLVLDQLRCNG
VLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEKMIQALELDPNLYRVGQSKIFFRAGVLAQLEEER
;
1   
3 UNP ACTNA_DICDI P05095 ?        2 
;EQTKSDYLKRANELVQWINDKQASLESRDFGDSIESVQSFMNAHKEYKKTEKPPKGQEVSELEAIYNSLQTKLRLIKREP
FVAPAGLTPNEIDSTWSALEKAEQEHAEALRIELKRQKKIAVLLQKYNRILKKLENWATTKSVYLGSNETGDSITAVQAK
LKNLEAFDGECQSLEGQSNSDLLSILAQLTELNYNGVPELTERKDTFFAQQWTGVKSSAETYKNTLLAELERLQKIED
;
265 
4 PDB 5JLH        5JLH   ?        3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5JLH A 1   ? 374  ? P63261 2   ? 375 ? 1   374  
2  1 5JLH B 1   ? 374  ? P63261 2   ? 375 ? 1   374  
3  1 5JLH C 1   ? 374  ? P63261 2   ? 375 ? 1   374  
4  1 5JLH D 1   ? 374  ? P63261 2   ? 375 ? 1   374  
5  1 5JLH E 1   ? 374  ? P63261 2   ? 375 ? 1   374  
6  2 5JLH F 1   ? 799  ? Q7Z406 1   ? 799 ? 1   799  
7  3 5JLH F 802 ? 1039 ? P05095 265 ? 502 ? 802 1039 
8  2 5JLH G 1   ? 799  ? Q7Z406 1   ? 799 ? 1   799  
9  3 5JLH G 802 ? 1039 ? P05095 265 ? 502 ? 802 1039 
10 4 5JLH H 1   ? 135  ? 5JLH   62  ? 196 ? 62  196  
11 4 5JLH I 1   ? 135  ? 5JLH   62  ? 196 ? 62  196  
12 4 5JLH J 1   ? 135  ? 5JLH   62  ? 196 ? 62  196  
13 4 5JLH K 1   ? 135  ? 5JLH   62  ? 196 ? 62  196  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6 5JLH ALA F 800 ? UNP Q7Z406 ? ? linker 800 1 
6 5JLH SER F 801 ? UNP Q7Z406 ? ? linker 801 2 
8 5JLH ALA G 800 ? UNP Q7Z406 ? ? linker 800 3 
8 5JLH SER G 801 ? UNP Q7Z406 ? ? linker 801 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
UNK 'L-peptide linking' . UNKNOWN                    ? 'C4 H9 N O2'        103.120 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5JLH 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            0.15 
_refine.aniso_B[1][2]                            2.15 
_refine.aniso_B[1][3]                            -0.05 
_refine.aniso_B[2][2]                            1.80 
_refine.aniso_B[2][3]                            -0.18 
_refine.aniso_B[3][3]                            -1.95 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               180.474 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.907 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS
 MERGED WITH THE FINAL F-ACTIN-MUYOSIN MAP (3.9 ANGSTROM) TO OBTAIN
 MAP OF THE ENTIRE F-ACTIN TROPOMYOSIN COMPLEX.
;
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5JLH 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.90 
_refine.ls_d_res_low                             211.20 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     254196 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.33844 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.33844 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD WITH PHASES' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.558 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             27.204 
_refine.overall_SU_ML                            0.360 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        ? 
_refine_hist.pdbx_number_atoms_nucleic_acid   ? 
_refine_hist.pdbx_number_atoms_ligand         ? 
_refine_hist.number_atoms_solvent             ? 
_refine_hist.number_atoms_total               26477 
_refine_hist.d_res_high                       . 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.015  0.019  27025  ? r_bond_refined_d             ? ? 
'ELECTRON MICROSCOPY' ? 0.003  0.020  25619  ? r_bond_other_d               ? ? 
'ELECTRON MICROSCOPY' ? 1.833  1.972  36578  ? r_angle_refined_deg          ? ? 
'ELECTRON MICROSCOPY' ? 1.155  3.000  58972  ? r_angle_other_deg            ? ? 
'ELECTRON MICROSCOPY' ? 7.119  5.000  3333   ? r_dihedral_angle_1_deg       ? ? 
'ELECTRON MICROSCOPY' ? 27.036 23.865 1247   ? r_dihedral_angle_2_deg       ? ? 
'ELECTRON MICROSCOPY' ? 13.084 15.000 4706   ? r_dihedral_angle_3_deg       ? ? 
'ELECTRON MICROSCOPY' ? 11.793 15.000 200    ? r_dihedral_angle_4_deg       ? ? 
'ELECTRON MICROSCOPY' ? 0.117  0.200  4021   ? r_chiral_restr               ? ? 
'ELECTRON MICROSCOPY' ? 0.010  0.021  30490  ? r_gen_planes_refined         ? ? 
'ELECTRON MICROSCOPY' ? 0.003  0.020  6167   ? r_gen_planes_other           ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_nbd_refined                ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_nbd_other                  ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_nbtor_refined              ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_nbtor_other                ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_xyhbond_nbd_refined        ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_xyhbond_nbd_other          ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_metal_ion_refined          ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_metal_ion_other            ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_symmetry_vdw_refined       ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_symmetry_vdw_other         ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_symmetry_hbond_refined     ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_symmetry_hbond_other       ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_symmetry_metal_ion_refined ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_symmetry_metal_ion_other   ? ? 
'ELECTRON MICROSCOPY' ? 11.451 17.257 13365  ? r_mcbond_it                  ? ? 
'ELECTRON MICROSCOPY' ? 11.444 17.256 13364  ? r_mcbond_other               ? ? 
'ELECTRON MICROSCOPY' ? 18.921 25.859 16687  ? r_mcangle_it                 ? ? 
'ELECTRON MICROSCOPY' ? 18.922 25.860 16688  ? r_mcangle_other              ? ? 
'ELECTRON MICROSCOPY' ? 13.206 18.783 13660  ? r_scbond_it                  ? ? 
'ELECTRON MICROSCOPY' ? 13.204 18.784 13660  ? r_scbond_other               ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_scangle_it                 ? ? 
'ELECTRON MICROSCOPY' ? 22.840 27.541 19891  ? r_scangle_other              ? ? 
'ELECTRON MICROSCOPY' ? 37.635 ?      109964 ? r_long_range_B_refined       ? ? 
'ELECTRON MICROSCOPY' ? 37.636 ?      109965 ? r_long_range_B_other         ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_rigid_bond_restr           ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_sphericity_free            ? ? 
'ELECTRON MICROSCOPY' ? ?      ?      ?      ? r_sphericity_bonded          ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_type 
'ELECTRON MICROSCOPY' 1 1 1 ? 39.27 0.50 ? ? A 5786  'tight thermal' 
'ELECTRON MICROSCOPY' 1 1 2 ? 72.44 0.50 ? ? B 5786  'tight thermal' 
'ELECTRON MICROSCOPY' 1 1 3 ? 48.46 0.50 ? ? C 5786  'tight thermal' 
'ELECTRON MICROSCOPY' 1 1 4 ? 30.16 0.50 ? ? D 5786  'tight thermal' 
'ELECTRON MICROSCOPY' 1 1 5 ? 33.98 0.50 ? ? E 5786  'tight thermal' 
'ELECTRON MICROSCOPY' 2 2 6 ? 12.57 0.50 ? ? G 11583 'tight thermal' 
# 
_refine_ls_shell.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_ls_shell.d_res_high                       3.900 
_refine_ls_shell.d_res_low                        4.001 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             0 
_refine_ls_shell.number_reflns_R_work             18797 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.485 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 1.000000  0.000000  0.000000  ?        ?         ?         ?         ?         ?        0.00000   ?         ?         
2 given ? 0.891811  -0.452406 0.001274  ?        ?         ?         ?         ?         ?        51.60482  ?         ?         
3 given ? 0.893761  0.448534  0.003084  ?        ?         ?         ?         ?         ?        -34.04406 ?         ?         
4 given ? -0.973220 0.229878  -0.000060 ?        ?         ?         ?         ?         ?        140.99390 ?         ?         
5 given ? -0.972932 -0.231090 0.000652  ?        ?         ?         ?         ?         ?        184.70058 ?         ?         
6 given ? 1.000000  0.000000  0.000000  ?        ?         ?         ?         ?         ?        0.00000   ?         ?         
7 given ? -0.973697 -0.227845 -0.000584 0.227845 -0.973697 -0.000120 -0.000541 -0.000250 1.000000 184.48206 168.14206 -27.37182 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
3 C 1 
4 D 1 
5 E 1 
1 G 2 
2 F 2 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 1  A 377 1 1 ? ? ? ? ? ? ? ? 1 ? 
2 B 1  B 377 1 1 ? ? ? ? ? ? ? ? 1 ? 
3 C 1  C 377 1 1 ? ? ? ? ? ? ? ? 1 ? 
4 D 1  D 377 1 1 ? ? ? ? ? ? ? ? 1 ? 
5 E 1  E 377 1 1 ? ? ? ? ? ? ? ? 1 ? 
1 G 50 G 816 1 1 ? ? ? ? ? ? ? ? 2 ? 
2 F 50 F 816 1 1 ? ? ? ? ? ? ? ? 2 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                     5JLH 
_struct.title                        'Cryo-EM structure of a human cytoplasmic actomyosin complex at near-atomic resolution' 
_struct.pdbx_descriptor              'Actin, cytoplasmic 2, Myosin-14,Alpha-actinin A, Tropomyosin alpha-3 chain' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5JLH 
_struct_keywords.text            
;CONTRACTILE FILAMENT, MUSCLE, THIN FILAMENT, CYTOSKELETON, STRUCTURAL PROTEIN, HYDROLASE COMPLEX, F-actin, tropomyosin, filament, myosin, protein polymers, cryo EM, Contractile protein
;
_struct_keywords.pdbx_keywords   'CONTRACTILE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 4 ? 
M N N 5 ? 
N N N 4 ? 
O N N 5 ? 
P N N 4 ? 
Q N N 5 ? 
R N N 4 ? 
S N N 5 ? 
T N N 4 ? 
U N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 54  ? LYS A 60  ? GLY A 54  LYS A 60  1 ? 7   
HELX_P HELX_P2   AA2 ASN A 77  ? GLU A 92  ? ASN A 77  GLU A 92  1 ? 16  
HELX_P HELX_P3   AA3 ALA A 96  ? HIS A 100 ? ALA A 96  HIS A 100 5 ? 5   
HELX_P HELX_P4   AA4 PRO A 111 ? THR A 125 ? PRO A 111 THR A 125 1 ? 15  
HELX_P HELX_P5   AA5 GLN A 136 ? GLY A 145 ? GLN A 136 GLY A 145 1 ? 10  
HELX_P HELX_P6   AA6 ALA A 180 ? GLU A 194 ? ALA A 180 GLU A 194 1 ? 15  
HELX_P HELX_P7   AA7 THR A 201 ? LEU A 215 ? THR A 201 LEU A 215 1 ? 15  
HELX_P HELX_P8   AA8 ASP A 221 ? ALA A 229 ? ASP A 221 ALA A 229 1 ? 9   
HELX_P HELX_P9   AA9 ASN A 251 ? ALA A 259 ? ASN A 251 ALA A 259 1 ? 9   
HELX_P HELX_P10  AB1 LEU A 260 ? GLN A 262 ? LEU A 260 GLN A 262 5 ? 3   
HELX_P HELX_P11  AB2 GLY A 272 ? CYS A 284 ? GLY A 272 CYS A 284 1 ? 13  
HELX_P HELX_P12  AB3 ILE A 288 ? ASN A 295 ? ILE A 288 ASN A 295 1 ? 8   
HELX_P HELX_P13  AB4 GLY A 300 ? MET A 304 ? GLY A 300 MET A 304 5 ? 5   
HELX_P HELX_P14  AB5 GLY A 307 ? ALA A 320 ? GLY A 307 ALA A 320 1 ? 14  
HELX_P HELX_P15  AB6 GLU A 333 ? LYS A 335 ? GLU A 333 LYS A 335 5 ? 3   
HELX_P HELX_P16  AB7 TYR A 336 ? LEU A 348 ? TYR A 336 LEU A 348 1 ? 13  
HELX_P HELX_P17  AB8 SER A 349 ? MET A 354 ? SER A 349 MET A 354 5 ? 6   
HELX_P HELX_P18  AB9 LYS A 358 ? GLY A 365 ? LYS A 358 GLY A 365 1 ? 8   
HELX_P HELX_P19  AC1 SER A 367 ? CYS A 373 ? SER A 367 CYS A 373 1 ? 7   
HELX_P HELX_P20  AC2 GLY B 54  ? LYS B 60  ? GLY B 54  LYS B 60  1 ? 7   
HELX_P HELX_P21  AC3 ASN B 77  ? GLU B 92  ? ASN B 77  GLU B 92  1 ? 16  
HELX_P HELX_P22  AC4 ALA B 96  ? HIS B 100 ? ALA B 96  HIS B 100 5 ? 5   
HELX_P HELX_P23  AC5 PRO B 111 ? THR B 125 ? PRO B 111 THR B 125 1 ? 15  
HELX_P HELX_P24  AC6 GLN B 136 ? SER B 144 ? GLN B 136 SER B 144 1 ? 9   
HELX_P HELX_P25  AC7 ALA B 180 ? GLU B 194 ? ALA B 180 GLU B 194 1 ? 15  
HELX_P HELX_P26  AC8 THR B 201 ? LEU B 215 ? THR B 201 LEU B 215 1 ? 15  
HELX_P HELX_P27  AC9 ASP B 221 ? ALA B 229 ? ASP B 221 ALA B 229 1 ? 9   
HELX_P HELX_P28  AD1 ASN B 251 ? ALA B 259 ? ASN B 251 ALA B 259 1 ? 9   
HELX_P HELX_P29  AD2 LEU B 260 ? GLN B 262 ? LEU B 260 GLN B 262 5 ? 3   
HELX_P HELX_P30  AD3 GLY B 272 ? CYS B 284 ? GLY B 272 CYS B 284 1 ? 13  
HELX_P HELX_P31  AD4 ILE B 288 ? ASN B 295 ? ILE B 288 ASN B 295 1 ? 8   
HELX_P HELX_P32  AD5 GLY B 300 ? MET B 304 ? GLY B 300 MET B 304 5 ? 5   
HELX_P HELX_P33  AD6 GLY B 307 ? ALA B 320 ? GLY B 307 ALA B 320 1 ? 14  
HELX_P HELX_P34  AD7 GLU B 333 ? LYS B 335 ? GLU B 333 LYS B 335 5 ? 3   
HELX_P HELX_P35  AD8 TYR B 336 ? LEU B 348 ? TYR B 336 LEU B 348 1 ? 13  
HELX_P HELX_P36  AD9 SER B 349 ? MET B 354 ? SER B 349 MET B 354 5 ? 6   
HELX_P HELX_P37  AE1 LYS B 358 ? GLY B 365 ? LYS B 358 GLY B 365 1 ? 8   
HELX_P HELX_P38  AE2 SER B 367 ? CYS B 373 ? SER B 367 CYS B 373 1 ? 7   
HELX_P HELX_P39  AE3 ASP C 55  ? LYS C 60  ? ASP C 55  LYS C 60  1 ? 6   
HELX_P HELX_P40  AE4 ASN C 77  ? GLU C 92  ? ASN C 77  GLU C 92  1 ? 16  
HELX_P HELX_P41  AE5 ALA C 96  ? HIS C 100 ? ALA C 96  HIS C 100 5 ? 5   
HELX_P HELX_P42  AE6 PRO C 111 ? THR C 125 ? PRO C 111 THR C 125 1 ? 15  
HELX_P HELX_P43  AE7 GLN C 136 ? SER C 144 ? GLN C 136 SER C 144 1 ? 9   
HELX_P HELX_P44  AE8 ALA C 180 ? GLU C 194 ? ALA C 180 GLU C 194 1 ? 15  
HELX_P HELX_P45  AE9 THR C 201 ? LEU C 215 ? THR C 201 LEU C 215 1 ? 15  
HELX_P HELX_P46  AF1 ASP C 221 ? ALA C 229 ? ASP C 221 ALA C 229 1 ? 9   
HELX_P HELX_P47  AF2 ASN C 251 ? ALA C 259 ? ASN C 251 ALA C 259 1 ? 9   
HELX_P HELX_P48  AF3 LEU C 260 ? GLN C 262 ? LEU C 260 GLN C 262 5 ? 3   
HELX_P HELX_P49  AF4 GLY C 272 ? CYS C 284 ? GLY C 272 CYS C 284 1 ? 13  
HELX_P HELX_P50  AF5 ILE C 288 ? ASN C 295 ? ILE C 288 ASN C 295 1 ? 8   
HELX_P HELX_P51  AF6 GLY C 300 ? MET C 304 ? GLY C 300 MET C 304 5 ? 5   
HELX_P HELX_P52  AF7 GLY C 307 ? ALA C 320 ? GLY C 307 ALA C 320 1 ? 14  
HELX_P HELX_P53  AF8 GLU C 333 ? LYS C 335 ? GLU C 333 LYS C 335 5 ? 3   
HELX_P HELX_P54  AF9 TYR C 336 ? LEU C 348 ? TYR C 336 LEU C 348 1 ? 13  
HELX_P HELX_P55  AG1 SER C 349 ? MET C 354 ? SER C 349 MET C 354 5 ? 6   
HELX_P HELX_P56  AG2 LYS C 358 ? GLY C 365 ? LYS C 358 GLY C 365 1 ? 8   
HELX_P HELX_P57  AG3 SER C 367 ? CYS C 373 ? SER C 367 CYS C 373 1 ? 7   
HELX_P HELX_P58  AG4 GLY D 54  ? LYS D 60  ? GLY D 54  LYS D 60  1 ? 7   
HELX_P HELX_P59  AG5 ASN D 77  ? GLU D 92  ? ASN D 77  GLU D 92  1 ? 16  
HELX_P HELX_P60  AG6 ALA D 96  ? HIS D 100 ? ALA D 96  HIS D 100 5 ? 5   
HELX_P HELX_P61  AG7 PRO D 111 ? THR D 125 ? PRO D 111 THR D 125 1 ? 15  
HELX_P HELX_P62  AG8 GLN D 136 ? SER D 144 ? GLN D 136 SER D 144 1 ? 9   
HELX_P HELX_P63  AG9 ALA D 180 ? GLU D 194 ? ALA D 180 GLU D 194 1 ? 15  
HELX_P HELX_P64  AH1 THR D 201 ? LEU D 215 ? THR D 201 LEU D 215 1 ? 15  
HELX_P HELX_P65  AH2 ASP D 221 ? ALA D 229 ? ASP D 221 ALA D 229 1 ? 9   
HELX_P HELX_P66  AH3 ASN D 251 ? ALA D 259 ? ASN D 251 ALA D 259 1 ? 9   
HELX_P HELX_P67  AH4 LEU D 260 ? GLN D 262 ? LEU D 260 GLN D 262 5 ? 3   
HELX_P HELX_P68  AH5 GLY D 272 ? CYS D 284 ? GLY D 272 CYS D 284 1 ? 13  
HELX_P HELX_P69  AH6 ILE D 288 ? ASN D 295 ? ILE D 288 ASN D 295 1 ? 8   
HELX_P HELX_P70  AH7 GLY D 300 ? MET D 304 ? GLY D 300 MET D 304 5 ? 5   
HELX_P HELX_P71  AH8 GLY D 307 ? ALA D 320 ? GLY D 307 ALA D 320 1 ? 14  
HELX_P HELX_P72  AH9 GLU D 333 ? LYS D 335 ? GLU D 333 LYS D 335 5 ? 3   
HELX_P HELX_P73  AI1 TYR D 336 ? LEU D 348 ? TYR D 336 LEU D 348 1 ? 13  
HELX_P HELX_P74  AI2 SER D 349 ? MET D 354 ? SER D 349 MET D 354 5 ? 6   
HELX_P HELX_P75  AI3 LYS D 358 ? GLY D 365 ? LYS D 358 GLY D 365 1 ? 8   
HELX_P HELX_P76  AI4 SER D 367 ? CYS D 373 ? SER D 367 CYS D 373 1 ? 7   
HELX_P HELX_P77  AI5 GLY E 54  ? LYS E 60  ? GLY E 54  LYS E 60  1 ? 7   
HELX_P HELX_P78  AI6 ASN E 77  ? GLU E 92  ? ASN E 77  GLU E 92  1 ? 16  
HELX_P HELX_P79  AI7 ALA E 96  ? HIS E 100 ? ALA E 96  HIS E 100 5 ? 5   
HELX_P HELX_P80  AI8 PRO E 111 ? THR E 125 ? PRO E 111 THR E 125 1 ? 15  
HELX_P HELX_P81  AI9 GLN E 136 ? SER E 144 ? GLN E 136 SER E 144 1 ? 9   
HELX_P HELX_P82  AJ1 ALA E 180 ? GLU E 194 ? ALA E 180 GLU E 194 1 ? 15  
HELX_P HELX_P83  AJ2 THR E 201 ? LEU E 215 ? THR E 201 LEU E 215 1 ? 15  
HELX_P HELX_P84  AJ3 ASP E 221 ? ALA E 229 ? ASP E 221 ALA E 229 1 ? 9   
HELX_P HELX_P85  AJ4 ASN E 251 ? ALA E 259 ? ASN E 251 ALA E 259 1 ? 9   
HELX_P HELX_P86  AJ5 LEU E 260 ? GLN E 262 ? LEU E 260 GLN E 262 5 ? 3   
HELX_P HELX_P87  AJ6 GLY E 272 ? CYS E 284 ? GLY E 272 CYS E 284 1 ? 13  
HELX_P HELX_P88  AJ7 ILE E 288 ? ASN E 295 ? ILE E 288 ASN E 295 1 ? 8   
HELX_P HELX_P89  AJ8 GLY E 300 ? MET E 304 ? GLY E 300 MET E 304 5 ? 5   
HELX_P HELX_P90  AJ9 GLY E 307 ? ALA E 320 ? GLY E 307 ALA E 320 1 ? 14  
HELX_P HELX_P91  AK1 GLU E 333 ? LYS E 335 ? GLU E 333 LYS E 335 5 ? 3   
HELX_P HELX_P92  AK2 TYR E 336 ? LEU E 348 ? TYR E 336 LEU E 348 1 ? 13  
HELX_P HELX_P93  AK3 SER E 349 ? MET E 354 ? SER E 349 MET E 354 5 ? 6   
HELX_P HELX_P94  AK4 LYS E 358 ? GLY E 365 ? LYS E 358 GLY E 365 1 ? 8   
HELX_P HELX_P95  AK5 SER E 367 ? CYS E 373 ? SER E 367 CYS E 373 1 ? 7   
HELX_P HELX_P96  AK6 ASP F 94  ? ILE F 96  ? ASP F 94  ILE F 96  5 ? 3   
HELX_P HELX_P97  AK7 ASP F 109 ? LEU F 113 ? ASP F 109 LEU F 113 5 ? 5   
HELX_P HELX_P98  AK8 ASN F 117 ? GLY F 132 ? ASN F 117 GLY F 132 1 ? 16  
HELX_P HELX_P99  AK9 THR F 155 ? ARG F 163 ? THR F 155 ARG F 163 1 ? 9   
HELX_P HELX_P100 AL1 HIS F 173 ? ARG F 189 ? HIS F 173 ARG F 189 1 ? 17  
HELX_P HELX_P101 AL2 GLY F 203 ? ALA F 219 ? GLY F 203 ALA F 219 1 ? 17  
HELX_P HELX_P102 AL3 ARG F 236 ? GLY F 249 ? ARG F 236 GLY F 249 1 ? 14  
HELX_P HELX_P103 AL4 LYS F 288 ? ARG F 293 ? LYS F 288 ARG F 293 1 ? 6   
HELX_P HELX_P104 AL5 PHE F 301 ? ALA F 311 ? PHE F 301 ALA F 311 1 ? 11  
HELX_P HELX_P105 AL6 GLY F 312 ? LEU F 320 ? GLY F 312 LEU F 320 1 ? 9   
HELX_P HELX_P106 AL7 PRO F 323 ? TYR F 327 ? PRO F 323 TYR F 327 5 ? 5   
HELX_P HELX_P107 AL8 ARG F 342 ? GLY F 356 ? ARG F 342 GLY F 356 1 ? 15  
HELX_P HELX_P108 AL9 SER F 358 ? PHE F 375 ? SER F 358 PHE F 375 1 ? 18  
HELX_P HELX_P109 AM1 ASP F 393 ? LEU F 404 ? ASP F 393 LEU F 404 1 ? 12  
HELX_P HELX_P110 AM2 GLY F 407 ? THR F 417 ? GLY F 407 THR F 417 1 ? 11  
HELX_P HELX_P111 AM3 THR F 432 ? LEU F 463 ? THR F 432 LEU F 463 1 ? 32  
HELX_P HELX_P112 AM4 SER F 489 ? GLU F 521 ? SER F 489 GLU F 521 1 ? 33  
HELX_P HELX_P113 AM5 ASP F 529 ? ASP F 533 ? ASP F 529 ASP F 533 5 ? 5   
HELX_P HELX_P114 AM6 LEU F 534 ? ARG F 543 ? LEU F 534 ARG F 543 1 ? 10  
HELX_P HELX_P115 AM7 GLY F 549 ? PHE F 560 ? GLY F 549 PHE F 560 1 ? 12  
HELX_P HELX_P116 AM8 THR F 564 ? GLN F 576 ? THR F 564 GLN F 576 1 ? 13  
HELX_P HELX_P117 AM9 GLU F 609 ? MET F 615 ? GLU F 609 MET F 615 1 ? 7   
HELX_P HELX_P118 AN1 ASN F 619 ? GLN F 628 ? ASN F 619 GLN F 628 1 ? 10  
HELX_P HELX_P119 AN2 ASP F 631 ? TRP F 638 ? ASP F 631 TRP F 638 1 ? 8   
HELX_P HELX_P120 AN3 THR F 669 ? THR F 688 ? THR F 669 THR F 688 1 ? 20  
HELX_P HELX_P121 AN4 GLU F 708 ? ASN F 719 ? GLU F 708 ASN F 719 1 ? 12  
HELX_P HELX_P122 AN5 GLY F 720 ? ARG F 729 ? GLY F 720 ARG F 729 1 ? 10  
HELX_P HELX_P123 AN6 PHE F 738 ? GLU F 746 ? PHE F 738 GLU F 746 1 ? 9   
HELX_P HELX_P124 AN7 ILE F 747 ? THR F 749 ? ILE F 747 THR F 749 5 ? 3   
HELX_P HELX_P125 AN8 GLY F 760 ? LEU F 771 ? GLY F 760 LEU F 771 1 ? 12  
HELX_P HELX_P126 AN9 ASP F 774 ? ASN F 776 ? ASP F 774 ASN F 776 5 ? 3   
HELX_P HELX_P127 AO1 GLY F 790 ? VAL F 816 ? GLY F 790 VAL F 816 1 ? 27  
HELX_P HELX_P128 AO2 ASP G 94  ? ILE G 96  ? ASP G 94  ILE G 96  5 ? 3   
HELX_P HELX_P129 AO3 ASP G 109 ? LEU G 113 ? ASP G 109 LEU G 113 5 ? 5   
HELX_P HELX_P130 AO4 ASN G 117 ? GLY G 132 ? ASN G 117 GLY G 132 1 ? 16  
HELX_P HELX_P131 AO5 THR G 155 ? ARG G 163 ? THR G 155 ARG G 163 1 ? 9   
HELX_P HELX_P132 AO6 HIS G 173 ? ARG G 189 ? HIS G 173 ARG G 189 1 ? 17  
HELX_P HELX_P133 AO7 GLY G 203 ? ALA G 219 ? GLY G 203 ALA G 219 1 ? 17  
HELX_P HELX_P134 AO8 ARG G 236 ? GLY G 249 ? ARG G 236 GLY G 249 1 ? 14  
HELX_P HELX_P135 AO9 LYS G 288 ? ARG G 293 ? LYS G 288 ARG G 293 1 ? 6   
HELX_P HELX_P136 AP1 PHE G 301 ? ALA G 311 ? PHE G 301 ALA G 311 1 ? 11  
HELX_P HELX_P137 AP2 GLY G 312 ? LEU G 320 ? GLY G 312 LEU G 320 1 ? 9   
HELX_P HELX_P138 AP3 PRO G 323 ? TYR G 327 ? PRO G 323 TYR G 327 5 ? 5   
HELX_P HELX_P139 AP4 ARG G 342 ? GLY G 356 ? ARG G 342 GLY G 356 1 ? 15  
HELX_P HELX_P140 AP5 SER G 358 ? PHE G 375 ? SER G 358 PHE G 375 1 ? 18  
HELX_P HELX_P141 AP6 ASP G 393 ? LEU G 404 ? ASP G 393 LEU G 404 1 ? 12  
HELX_P HELX_P142 AP7 GLY G 407 ? THR G 417 ? GLY G 407 THR G 417 1 ? 11  
HELX_P HELX_P143 AP8 THR G 432 ? LEU G 463 ? THR G 432 LEU G 463 1 ? 32  
HELX_P HELX_P144 AP9 SER G 489 ? GLU G 521 ? SER G 489 GLU G 521 1 ? 33  
HELX_P HELX_P145 AQ1 ASP G 529 ? ASP G 533 ? ASP G 529 ASP G 533 5 ? 5   
HELX_P HELX_P146 AQ2 LEU G 534 ? ARG G 543 ? LEU G 534 ARG G 543 1 ? 10  
HELX_P HELX_P147 AQ3 GLY G 549 ? PHE G 560 ? GLY G 549 PHE G 560 1 ? 12  
HELX_P HELX_P148 AQ4 THR G 564 ? GLN G 576 ? THR G 564 GLN G 576 1 ? 13  
HELX_P HELX_P149 AQ5 GLU G 609 ? MET G 615 ? GLU G 609 MET G 615 1 ? 7   
HELX_P HELX_P150 AQ6 ASN G 619 ? GLN G 628 ? ASN G 619 GLN G 628 1 ? 10  
HELX_P HELX_P151 AQ7 ASP G 631 ? TRP G 638 ? ASP G 631 TRP G 638 1 ? 8   
HELX_P HELX_P152 AQ8 THR G 669 ? THR G 688 ? THR G 669 THR G 688 1 ? 20  
HELX_P HELX_P153 AQ9 GLU G 708 ? ASN G 719 ? GLU G 708 ASN G 719 1 ? 12  
HELX_P HELX_P154 AR1 GLY G 720 ? ARG G 729 ? GLY G 720 ARG G 729 1 ? 10  
HELX_P HELX_P155 AR2 PHE G 738 ? GLU G 746 ? PHE G 738 GLU G 746 1 ? 9   
HELX_P HELX_P156 AR3 ILE G 747 ? THR G 749 ? ILE G 747 THR G 749 5 ? 3   
HELX_P HELX_P157 AR4 GLY G 760 ? LEU G 771 ? GLY G 760 LEU G 771 1 ? 12  
HELX_P HELX_P158 AR5 ASP G 774 ? ASN G 776 ? ASP G 774 ASN G 776 5 ? 3   
HELX_P HELX_P159 AR6 GLY G 790 ? VAL G 816 ? GLY G 790 VAL G 816 1 ? 27  
HELX_P HELX_P160 AR7 UNK H 2   ? UNK H 135 ? UNK H 63  UNK H 196 1 ? 134 
HELX_P HELX_P161 AR8 UNK I 2   ? UNK I 135 ? UNK I 63  UNK I 196 1 ? 134 
HELX_P HELX_P162 AR9 UNK J 2   ? UNK J 135 ? UNK J 63  UNK J 196 1 ? 134 
HELX_P HELX_P163 AS1 UNK K 2   ? UNK K 135 ? UNK K 63  UNK K 196 1 ? 134 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? L ADP . O1B ? ? ? 1_555 M MG . MG ? ? A ADP 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc2  metalc ? ? L ADP . O3B ? ? ? 1_555 M MG . MG ? ? A ADP 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.134 ? 
metalc3  metalc ? ? N ADP . O1B ? ? ? 1_555 O MG . MG ? ? B ADP 401 B MG 402 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc4  metalc ? ? N ADP . O3B ? ? ? 1_555 O MG . MG ? ? B ADP 401 B MG 402 1_555 ? ? ? ? ? ? ? 2.136 ? 
metalc5  metalc ? ? P ADP . O1B ? ? ? 1_555 Q MG . MG ? ? C ADP 401 C MG 402 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc6  metalc ? ? P ADP . O3B ? ? ? 1_555 Q MG . MG ? ? C ADP 401 C MG 402 1_555 ? ? ? ? ? ? ? 2.136 ? 
metalc7  metalc ? ? R ADP . O1B ? ? ? 1_555 S MG . MG ? ? D ADP 401 D MG 402 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc8  metalc ? ? R ADP . O3B ? ? ? 1_555 S MG . MG ? ? D ADP 401 D MG 402 1_555 ? ? ? ? ? ? ? 2.136 ? 
metalc9  metalc ? ? T ADP . O1B ? ? ? 1_555 U MG . MG ? ? E ADP 401 E MG 402 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc10 metalc ? ? T ADP . O3B ? ? ? 1_555 U MG . MG ? ? E ADP 401 E MG 402 1_555 ? ? ? ? ? ? ? 2.134 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLY 47  A . ? GLY 47  A GLN 48  A ? GLN 48  A 1 1.36   
2  GLY 47  B . ? GLY 47  B GLN 48  B ? GLN 48  B 1 0.97   
3  GLY 47  C . ? GLY 47  C GLN 48  C ? GLN 48  C 1 1.07   
4  GLY 47  D . ? GLY 47  D GLN 48  D ? GLN 48  D 1 1.59   
5  GLY 47  E . ? GLY 47  E GLN 48  E ? GLN 48  E 1 0.67   
6  SER 200 F . ? SER 200 F GLY 201 F ? GLY 201 F 1 -15.38 
7  SER 220 F . ? SER 220 F SER 221 F ? SER 221 F 1 7.78   
8  SER 336 F . ? SER 336 F SER 337 F ? SER 337 F 1 9.04   
9  PRO 338 F . ? PRO 338 F GLY 339 F ? GLY 339 F 1 -0.87  
10 GLY 423 F . ? GLY 423 F ARG 424 F ? ARG 424 F 1 9.05   
11 GLY 470 F . ? GLY 470 F ALA 471 F ? ALA 471 F 1 -14.88 
12 ARG 589 F . ? ARG 589 F ASP 590 F ? ASP 590 F 1 -11.80 
13 SER 200 G . ? SER 200 G GLY 201 G ? GLY 201 G 1 -17.35 
14 SER 220 G . ? SER 220 G SER 221 G ? SER 221 G 1 7.97   
15 SER 336 G . ? SER 336 G SER 337 G ? SER 337 G 1 8.91   
16 PRO 338 G . ? PRO 338 G GLY 339 G ? GLY 339 G 1 -0.69  
17 GLY 423 G . ? GLY 423 G ARG 424 G ? ARG 424 G 1 9.08   
18 GLY 470 G . ? GLY 470 G ALA 471 G ? ALA 471 G 1 -14.71 
19 ARG 589 G . ? ARG 589 G ASP 590 G ? ASP 590 G 1 -11.11 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 5 ? 
AA5 ? 2 ? 
AA6 ? 6 ? 
AA7 ? 3 ? 
AA8 ? 2 ? 
AA9 ? 5 ? 
AB1 ? 2 ? 
AB2 ? 6 ? 
AB3 ? 3 ? 
AB4 ? 2 ? 
AB5 ? 5 ? 
AB6 ? 2 ? 
AB7 ? 6 ? 
AB8 ? 3 ? 
AB9 ? 2 ? 
AC1 ? 5 ? 
AC2 ? 2 ? 
AC3 ? 6 ? 
AC4 ? 3 ? 
AC5 ? 2 ? 
AC6 ? 5 ? 
AC7 ? 2 ? 
AC8 ? 5 ? 
AC9 ? 7 ? 
AD1 ? 2 ? 
AD2 ? 2 ? 
AD3 ? 3 ? 
AD4 ? 3 ? 
AD5 ? 5 ? 
AD6 ? 7 ? 
AD7 ? 2 ? 
AD8 ? 2 ? 
AD9 ? 3 ? 
AE1 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? parallel      
AA4 4 5 ? parallel      
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA6 5 6 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? parallel      
AA9 4 5 ? parallel      
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? parallel      
AB2 4 5 ? parallel      
AB2 5 6 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? parallel      
AB5 4 5 ? parallel      
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? parallel      
AB7 4 5 ? parallel      
AB7 5 6 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? parallel      
AC1 4 5 ? parallel      
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? parallel      
AC3 4 5 ? parallel      
AC3 5 6 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? parallel      
AC6 4 5 ? parallel      
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC8 4 5 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? parallel      
AC9 3 4 ? parallel      
AC9 4 5 ? parallel      
AC9 5 6 ? anti-parallel 
AC9 6 7 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD5 3 4 ? anti-parallel 
AD5 4 5 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? parallel      
AD6 3 4 ? parallel      
AD6 4 5 ? parallel      
AD6 5 6 ? anti-parallel 
AD6 6 7 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 28  ? PRO A 31  ? ALA A 28  PRO A 31  
AA1 2 MET A 15  ? PHE A 20  ? MET A 15  PHE A 20  
AA1 3 LEU A 7   ? ASP A 10  ? LEU A 7   ASP A 10  
AA1 4 VAL A 102 ? GLU A 106 ? VAL A 102 GLU A 106 
AA1 5 ALA A 130 ? ILE A 135 ? ALA A 130 ILE A 135 
AA1 6 ILE A 356 ? SER A 357 ? ILE A 356 SER A 357 
AA2 1 TYR A 52  ? VAL A 53  ? TYR A 52  VAL A 53  
AA2 2 VAL A 34  ? PRO A 37  ? VAL A 34  PRO A 37  
AA2 3 LEU A 64  ? LYS A 67  ? LEU A 64  LYS A 67  
AA3 1 ILE A 70  ? GLU A 71  ? ILE A 70  GLU A 71  
AA3 2 ILE A 74  ? VAL A 75  ? ILE A 74  VAL A 75  
AA4 1 LEU A 175 ? LEU A 177 ? LEU A 175 LEU A 177 
AA4 2 THR A 159 ? ILE A 164 ? THR A 159 ILE A 164 
AA4 3 GLY A 149 ? SER A 154 ? GLY A 149 SER A 154 
AA4 4 THR A 296 ? SER A 299 ? THR A 296 SER A 299 
AA4 5 ILE A 328 ? ILE A 329 ? ILE A 328 ILE A 329 
AA5 1 LYS A 237 ? GLU A 240 ? LYS A 237 GLU A 240 
AA5 2 VAL A 246 ? ILE A 249 ? VAL A 246 ILE A 249 
AA6 1 ALA B 28  ? PRO B 31  ? ALA B 28  PRO B 31  
AA6 2 MET B 15  ? PHE B 20  ? MET B 15  PHE B 20  
AA6 3 LEU B 7   ? ASP B 10  ? LEU B 7   ASP B 10  
AA6 4 VAL B 102 ? GLU B 106 ? VAL B 102 GLU B 106 
AA6 5 ALA B 130 ? ILE B 135 ? ALA B 130 ILE B 135 
AA6 6 ILE B 356 ? SER B 357 ? ILE B 356 SER B 357 
AA7 1 TYR B 52  ? VAL B 53  ? TYR B 52  VAL B 53  
AA7 2 VAL B 34  ? PRO B 37  ? VAL B 34  PRO B 37  
AA7 3 LEU B 64  ? LYS B 67  ? LEU B 64  LYS B 67  
AA8 1 ILE B 70  ? GLU B 71  ? ILE B 70  GLU B 71  
AA8 2 ILE B 74  ? VAL B 75  ? ILE B 74  VAL B 75  
AA9 1 LEU B 175 ? LEU B 177 ? LEU B 175 LEU B 177 
AA9 2 THR B 159 ? ILE B 164 ? THR B 159 ILE B 164 
AA9 3 GLY B 149 ? SER B 154 ? GLY B 149 SER B 154 
AA9 4 THR B 296 ? SER B 299 ? THR B 296 SER B 299 
AA9 5 ILE B 328 ? ILE B 329 ? ILE B 328 ILE B 329 
AB1 1 LYS B 237 ? GLU B 240 ? LYS B 237 GLU B 240 
AB1 2 VAL B 246 ? ILE B 249 ? VAL B 246 ILE B 249 
AB2 1 ALA C 28  ? PRO C 31  ? ALA C 28  PRO C 31  
AB2 2 MET C 15  ? PHE C 20  ? MET C 15  PHE C 20  
AB2 3 LEU C 7   ? ASP C 10  ? LEU C 7   ASP C 10  
AB2 4 VAL C 102 ? GLU C 106 ? VAL C 102 GLU C 106 
AB2 5 ALA C 130 ? ILE C 135 ? ALA C 130 ILE C 135 
AB2 6 ILE C 356 ? SER C 357 ? ILE C 356 SER C 357 
AB3 1 TYR C 52  ? VAL C 53  ? TYR C 52  VAL C 53  
AB3 2 VAL C 34  ? PRO C 37  ? VAL C 34  PRO C 37  
AB3 3 LEU C 64  ? LYS C 67  ? LEU C 64  LYS C 67  
AB4 1 ILE C 70  ? GLU C 71  ? ILE C 70  GLU C 71  
AB4 2 ILE C 74  ? VAL C 75  ? ILE C 74  VAL C 75  
AB5 1 LEU C 175 ? LEU C 177 ? LEU C 175 LEU C 177 
AB5 2 THR C 159 ? ILE C 164 ? THR C 159 ILE C 164 
AB5 3 GLY C 149 ? SER C 154 ? GLY C 149 SER C 154 
AB5 4 THR C 296 ? SER C 299 ? THR C 296 SER C 299 
AB5 5 ILE C 328 ? ILE C 329 ? ILE C 328 ILE C 329 
AB6 1 LYS C 237 ? GLU C 240 ? LYS C 237 GLU C 240 
AB6 2 VAL C 246 ? ILE C 249 ? VAL C 246 ILE C 249 
AB7 1 ALA D 28  ? PRO D 31  ? ALA D 28  PRO D 31  
AB7 2 MET D 15  ? PHE D 20  ? MET D 15  PHE D 20  
AB7 3 LEU D 7   ? ASP D 10  ? LEU D 7   ASP D 10  
AB7 4 VAL D 102 ? GLU D 106 ? VAL D 102 GLU D 106 
AB7 5 ALA D 130 ? ILE D 135 ? ALA D 130 ILE D 135 
AB7 6 ILE D 356 ? SER D 357 ? ILE D 356 SER D 357 
AB8 1 TYR D 52  ? VAL D 53  ? TYR D 52  VAL D 53  
AB8 2 VAL D 34  ? PRO D 37  ? VAL D 34  PRO D 37  
AB8 3 LEU D 64  ? LYS D 67  ? LEU D 64  LYS D 67  
AB9 1 ILE D 70  ? GLU D 71  ? ILE D 70  GLU D 71  
AB9 2 ILE D 74  ? VAL D 75  ? ILE D 74  VAL D 75  
AC1 1 LEU D 175 ? LEU D 177 ? LEU D 175 LEU D 177 
AC1 2 THR D 159 ? ILE D 164 ? THR D 159 ILE D 164 
AC1 3 GLY D 149 ? SER D 154 ? GLY D 149 SER D 154 
AC1 4 THR D 296 ? SER D 299 ? THR D 296 SER D 299 
AC1 5 ILE D 328 ? ILE D 329 ? ILE D 328 ILE D 329 
AC2 1 LYS D 237 ? GLU D 240 ? LYS D 237 GLU D 240 
AC2 2 VAL D 246 ? ILE D 249 ? VAL D 246 ILE D 249 
AC3 1 ALA E 28  ? PRO E 31  ? ALA E 28  PRO E 31  
AC3 2 MET E 15  ? PHE E 20  ? MET E 15  PHE E 20  
AC3 3 LEU E 7   ? ASP E 10  ? LEU E 7   ASP E 10  
AC3 4 VAL E 102 ? GLU E 106 ? VAL E 102 GLU E 106 
AC3 5 ALA E 130 ? ILE E 135 ? ALA E 130 ILE E 135 
AC3 6 ILE E 356 ? SER E 357 ? ILE E 356 SER E 357 
AC4 1 TYR E 52  ? VAL E 53  ? TYR E 52  VAL E 53  
AC4 2 VAL E 34  ? PRO E 37  ? VAL E 34  PRO E 37  
AC4 3 LEU E 64  ? LYS E 67  ? LEU E 64  LYS E 67  
AC5 1 ILE E 70  ? GLU E 71  ? ILE E 70  GLU E 71  
AC5 2 ILE E 74  ? VAL E 75  ? ILE E 74  VAL E 75  
AC6 1 LEU E 175 ? LEU E 177 ? LEU E 175 LEU E 177 
AC6 2 THR E 159 ? ILE E 164 ? THR E 159 ILE E 164 
AC6 3 GLY E 149 ? SER E 154 ? GLY E 149 SER E 154 
AC6 4 THR E 296 ? SER E 299 ? THR E 296 SER E 299 
AC6 5 ILE E 328 ? ILE E 329 ? ILE E 328 ILE E 329 
AC7 1 LYS E 237 ? GLU E 240 ? LYS E 237 GLU E 240 
AC7 2 VAL E 246 ? ILE E 249 ? VAL E 246 ILE E 249 
AC8 1 ARG F 88  ? PRO F 92  ? ARG F 88  PRO F 92  
AC8 2 GLU F 77  ? LEU F 82  ? GLU F 77  LEU F 82  
AC8 3 PHE F 65  ? GLY F 74  ? PHE F 65  GLY F 74  
AC8 4 LEU F 55  ? PRO F 59  ? LEU F 55  PRO F 59  
AC8 5 GLN F 97  ? ARG F 98  ? GLN F 97  ARG F 98  
AC9 1 TYR F 135 ? SER F 138 ? TYR F 135 SER F 138 
AC9 2 PHE F 141 ? ILE F 145 ? PHE F 141 ILE F 145 
AC9 3 ASN F 689 ? ILE F 696 ? ASN F 689 ILE F 696 
AC9 4 GLN F 192 ? THR F 197 ? GLN F 192 THR F 197 
AC9 5 SER F 472 ? ILE F 479 ? SER F 472 ILE F 479 
AC9 6 LYS F 264 ? PHE F 270 ? LYS F 264 PHE F 270 
AC9 7 ILE F 276 ? GLU F 282 ? ILE F 276 GLU F 282 
AD1 1 ASN F 250 ? ALA F 251 ? ASN F 250 ALA F 251 
AD1 2 SER F 259 ? SER F 260 ? SER F 259 SER F 260 
AD2 1 ILE F 420 ? VAL F 422 ? ILE F 420 VAL F 422 
AD2 2 ASP F 425 ? VAL F 427 ? ASP F 425 VAL F 427 
AD3 1 PHE F 582 ? GLN F 583 ? PHE F 582 GLN F 583 
AD3 2 PHE F 594 ? LEU F 597 ? PHE F 594 LEU F 597 
AD3 3 LYS F 602 ? TYR F 605 ? LYS F 602 TYR F 605 
AD4 1 ASN F 734 ? LEU F 737 ? ASN F 734 LEU F 737 
AD4 2 LYS F 784 ? PHE F 787 ? LYS F 784 PHE F 787 
AD4 3 TYR F 778 ? VAL F 780 ? TYR F 778 VAL F 780 
AD5 1 ARG G 88  ? PRO G 92  ? ARG G 88  PRO G 92  
AD5 2 GLU G 77  ? LEU G 82  ? GLU G 77  LEU G 82  
AD5 3 PHE G 65  ? GLY G 74  ? PHE G 65  GLY G 74  
AD5 4 LEU G 55  ? PRO G 59  ? LEU G 55  PRO G 59  
AD5 5 GLN G 97  ? ARG G 98  ? GLN G 97  ARG G 98  
AD6 1 TYR G 135 ? SER G 138 ? TYR G 135 SER G 138 
AD6 2 PHE G 141 ? ILE G 145 ? PHE G 141 ILE G 145 
AD6 3 ASN G 689 ? ILE G 696 ? ASN G 689 ILE G 696 
AD6 4 GLN G 192 ? THR G 197 ? GLN G 192 THR G 197 
AD6 5 SER G 472 ? ILE G 479 ? SER G 472 ILE G 479 
AD6 6 LYS G 264 ? PHE G 270 ? LYS G 264 PHE G 270 
AD6 7 ILE G 276 ? GLU G 282 ? ILE G 276 GLU G 282 
AD7 1 ASN G 250 ? ALA G 251 ? ASN G 250 ALA G 251 
AD7 2 SER G 259 ? SER G 260 ? SER G 259 SER G 260 
AD8 1 ILE G 420 ? VAL G 422 ? ILE G 420 VAL G 422 
AD8 2 ASP G 425 ? VAL G 427 ? ASP G 425 VAL G 427 
AD9 1 PHE G 582 ? GLN G 583 ? PHE G 582 GLN G 583 
AD9 2 PHE G 594 ? LEU G 597 ? PHE G 594 LEU G 597 
AD9 3 LYS G 602 ? TYR G 605 ? LYS G 602 TYR G 605 
AE1 1 ASN G 734 ? LEU G 737 ? ASN G 734 LEU G 737 
AE1 2 LYS G 784 ? PHE G 787 ? LYS G 784 PHE G 787 
AE1 3 TYR G 778 ? VAL G 780 ? TYR G 778 VAL G 780 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O PHE A 30  ? O PHE A 30  N CYS A 16  ? N CYS A 16  
AA1 2 3 O LYS A 17  ? O LYS A 17  N ASP A 10  ? N ASP A 10  
AA1 3 4 N ILE A 9   ? N ILE A 9   O LEU A 103 ? O LEU A 103 
AA1 4 5 N LEU A 104 ? N LEU A 104 O TYR A 132 ? O TYR A 132 
AA1 5 6 N MET A 131 ? N MET A 131 O ILE A 356 ? O ILE A 356 
AA2 1 2 O TYR A 52  ? O TYR A 52  N GLY A 35  ? N GLY A 35  
AA2 2 3 N ARG A 36  ? N ARG A 36  O THR A 65  ? O THR A 65  
AA3 1 2 N GLU A 71  ? N GLU A 71  O ILE A 74  ? O ILE A 74  
AA4 1 2 O LEU A 175 ? O LEU A 175 N THR A 161 ? N THR A 161 
AA4 2 3 O HIS A 160 ? O HIS A 160 N ASP A 153 ? N ASP A 153 
AA4 3 4 N MET A 152 ? N MET A 152 O SER A 299 ? O SER A 299 
AA4 4 5 N THR A 296 ? N THR A 296 O ILE A 329 ? O ILE A 329 
AA5 1 2 N TYR A 239 ? N TYR A 239 O ILE A 247 ? O ILE A 247 
AA6 1 2 O PHE B 30  ? O PHE B 30  N CYS B 16  ? N CYS B 16  
AA6 2 3 O LYS B 17  ? O LYS B 17  N ASP B 10  ? N ASP B 10  
AA6 3 4 N ILE B 9   ? N ILE B 9   O LEU B 103 ? O LEU B 103 
AA6 4 5 N LEU B 104 ? N LEU B 104 O TYR B 132 ? O TYR B 132 
AA6 5 6 N MET B 131 ? N MET B 131 O ILE B 356 ? O ILE B 356 
AA7 1 2 O TYR B 52  ? O TYR B 52  N GLY B 35  ? N GLY B 35  
AA7 2 3 N ARG B 36  ? N ARG B 36  O THR B 65  ? O THR B 65  
AA8 1 2 N GLU B 71  ? N GLU B 71  O ILE B 74  ? O ILE B 74  
AA9 1 2 O LEU B 175 ? O LEU B 175 N THR B 161 ? N THR B 161 
AA9 2 3 O HIS B 160 ? O HIS B 160 N ASP B 153 ? N ASP B 153 
AA9 3 4 N MET B 152 ? N MET B 152 O VAL B 297 ? O VAL B 297 
AA9 4 5 N THR B 296 ? N THR B 296 O ILE B 329 ? O ILE B 329 
AB1 1 2 N TYR B 239 ? N TYR B 239 O ILE B 247 ? O ILE B 247 
AB2 1 2 O PHE C 30  ? O PHE C 30  N CYS C 16  ? N CYS C 16  
AB2 2 3 O LYS C 17  ? O LYS C 17  N ASP C 10  ? N ASP C 10  
AB2 3 4 N ILE C 9   ? N ILE C 9   O LEU C 103 ? O LEU C 103 
AB2 4 5 N LEU C 104 ? N LEU C 104 O TYR C 132 ? O TYR C 132 
AB2 5 6 N MET C 131 ? N MET C 131 O ILE C 356 ? O ILE C 356 
AB3 1 2 O TYR C 52  ? O TYR C 52  N GLY C 35  ? N GLY C 35  
AB3 2 3 N ARG C 36  ? N ARG C 36  O THR C 65  ? O THR C 65  
AB4 1 2 N GLU C 71  ? N GLU C 71  O ILE C 74  ? O ILE C 74  
AB5 1 2 O LEU C 175 ? O LEU C 175 N THR C 161 ? N THR C 161 
AB5 2 3 O HIS C 160 ? O HIS C 160 N ASP C 153 ? N ASP C 153 
AB5 3 4 N MET C 152 ? N MET C 152 O VAL C 297 ? O VAL C 297 
AB5 4 5 N THR C 296 ? N THR C 296 O ILE C 329 ? O ILE C 329 
AB6 1 2 N TYR C 239 ? N TYR C 239 O ILE C 247 ? O ILE C 247 
AB7 1 2 O PHE D 30  ? O PHE D 30  N CYS D 16  ? N CYS D 16  
AB7 2 3 O LYS D 17  ? O LYS D 17  N ASP D 10  ? N ASP D 10  
AB7 3 4 N ILE D 9   ? N ILE D 9   O LEU D 103 ? O LEU D 103 
AB7 4 5 N LEU D 104 ? N LEU D 104 O TYR D 132 ? O TYR D 132 
AB7 5 6 N MET D 131 ? N MET D 131 O ILE D 356 ? O ILE D 356 
AB8 1 2 O TYR D 52  ? O TYR D 52  N GLY D 35  ? N GLY D 35  
AB8 2 3 N ARG D 36  ? N ARG D 36  O THR D 65  ? O THR D 65  
AB9 1 2 N GLU D 71  ? N GLU D 71  O ILE D 74  ? O ILE D 74  
AC1 1 2 O LEU D 175 ? O LEU D 175 N THR D 161 ? N THR D 161 
AC1 2 3 O HIS D 160 ? O HIS D 160 N ASP D 153 ? N ASP D 153 
AC1 3 4 N MET D 152 ? N MET D 152 O VAL D 297 ? O VAL D 297 
AC1 4 5 N THR D 296 ? N THR D 296 O ILE D 329 ? O ILE D 329 
AC2 1 2 N TYR D 239 ? N TYR D 239 O ILE D 247 ? O ILE D 247 
AC3 1 2 O PHE E 30  ? O PHE E 30  N CYS E 16  ? N CYS E 16  
AC3 2 3 O LYS E 17  ? O LYS E 17  N ASP E 10  ? N ASP E 10  
AC3 3 4 N ILE E 9   ? N ILE E 9   O LEU E 103 ? O LEU E 103 
AC3 4 5 N LEU E 104 ? N LEU E 104 O TYR E 132 ? O TYR E 132 
AC3 5 6 N MET E 131 ? N MET E 131 O ILE E 356 ? O ILE E 356 
AC4 1 2 O TYR E 52  ? O TYR E 52  N GLY E 35  ? N GLY E 35  
AC4 2 3 N ARG E 36  ? N ARG E 36  O THR E 65  ? O THR E 65  
AC5 1 2 N GLU E 71  ? N GLU E 71  O ILE E 74  ? O ILE E 74  
AC6 1 2 O LEU E 175 ? O LEU E 175 N THR E 161 ? N THR E 161 
AC6 2 3 O HIS E 160 ? O HIS E 160 N ASP E 153 ? N ASP E 153 
AC6 3 4 N MET E 152 ? N MET E 152 O VAL E 297 ? O VAL E 297 
AC6 4 5 N THR E 296 ? N THR E 296 O ILE E 329 ? O ILE E 329 
AC7 1 2 N TYR E 239 ? N TYR E 239 O ILE E 247 ? O ILE E 247 
AC8 1 2 O LEU F 89  ? O LEU F 89  N VAL F 80  ? N VAL F 80  
AC8 2 3 O GLU F 81  ? O GLU F 81  N ALA F 69  ? N ALA F 69  
AC8 3 4 O ALA F 68  ? O ALA F 68  N VAL F 56  ? N VAL F 56  
AC8 4 5 N TRP F 57  ? N TRP F 57  O GLN F 97  ? O GLN F 97  
AC9 1 2 N THR F 136 ? N THR F 136 O VAL F 143 ? O VAL F 143 
AC9 2 3 N VAL F 144 ? N VAL F 144 O ARG F 694 ? O ARG F 694 
AC9 3 4 O SER F 691 ? O SER F 691 N LEU F 195 ? N LEU F 195 
AC9 4 5 N ILE F 194 ? N ILE F 194 O LEU F 477 ? O LEU F 477 
AC9 5 6 O SER F 472 ? O SER F 472 N PHE F 270 ? N PHE F 270 
AC9 6 7 N PHE F 265 ? N PHE F 265 O GLU F 282 ? O GLU F 282 
AD1 1 2 N ALA F 251 ? N ALA F 251 O SER F 259 ? O SER F 259 
AD2 1 2 N ILE F 420 ? N ILE F 420 O VAL F 427 ? O VAL F 427 
AD3 1 2 N GLN F 583 ? N GLN F 583 O SER F 595 ? O SER F 595 
AD3 2 3 N PHE F 594 ? N PHE F 594 O TYR F 605 ? O TYR F 605 
AD4 1 2 N ASN F 734 ? N ASN F 734 O PHE F 787 ? O PHE F 787 
AD4 2 3 O PHE F 786 ? O PHE F 786 N ARG F 779 ? N ARG F 779 
AD5 1 2 O LEU G 89  ? O LEU G 89  N VAL G 80  ? N VAL G 80  
AD5 2 3 O GLU G 81  ? O GLU G 81  N ALA G 69  ? N ALA G 69  
AD5 3 4 O ALA G 68  ? O ALA G 68  N VAL G 56  ? N VAL G 56  
AD5 4 5 N TRP G 57  ? N TRP G 57  O GLN G 97  ? O GLN G 97  
AD6 1 2 N THR G 136 ? N THR G 136 O VAL G 143 ? O VAL G 143 
AD6 2 3 N VAL G 144 ? N VAL G 144 O ARG G 694 ? O ARG G 694 
AD6 3 4 O SER G 691 ? O SER G 691 N LEU G 195 ? N LEU G 195 
AD6 4 5 N ILE G 194 ? N ILE G 194 O LEU G 477 ? O LEU G 477 
AD6 5 6 O SER G 472 ? O SER G 472 N PHE G 270 ? N PHE G 270 
AD6 6 7 N PHE G 265 ? N PHE G 265 O GLU G 282 ? O GLU G 282 
AD7 1 2 N ALA G 251 ? N ALA G 251 O SER G 259 ? O SER G 259 
AD8 1 2 N ILE G 420 ? N ILE G 420 O VAL G 427 ? O VAL G 427 
AD9 1 2 N GLN G 583 ? N GLN G 583 O SER G 595 ? O SER G 595 
AD9 2 3 N VAL G 596 ? N VAL G 596 O VAL G 603 ? O VAL G 603 
AE1 1 2 N ASN G 734 ? N ASN G 734 O PHE G 787 ? O PHE G 787 
AE1 2 3 O PHE G 786 ? O PHE G 786 N ARG G 779 ? N ARG G 779 
# 
_atom_sites.entry_id                    5JLH 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLU A 1 1   ? 45.096  16.329  -4.938   1.00 223.27 ? 1   GLU A N     1 
ATOM   2     C  CA    . GLU A 1 1   ? 44.848  14.926  -5.399   1.00 222.49 ? 1   GLU A CA    1 
ATOM   3     C  C     . GLU A 1 1   ? 44.211  14.909  -6.772   1.00 226.81 ? 1   GLU A C     1 
ATOM   4     O  O     . GLU A 1 1   ? 43.624  15.906  -7.210   1.00 214.93 ? 1   GLU A O     1 
ATOM   5     C  CB    . GLU A 1 1   ? 44.022  14.134  -4.374   1.00 219.95 ? 1   GLU A CB    1 
ATOM   6     C  CG    . GLU A 1 1   ? 42.625  14.662  -4.133   1.00 222.29 ? 1   GLU A CG    1 
ATOM   7     C  CD    . GLU A 1 1   ? 42.532  15.719  -3.044   1.00 215.88 ? 1   GLU A CD    1 
ATOM   8     O  OE1   . GLU A 1 1   ? 43.545  16.376  -2.724   1.00 212.84 ? 1   GLU A OE1   1 
ATOM   9     O  OE2   . GLU A 1 1   ? 41.425  15.895  -2.505   1.00 210.55 ? 1   GLU A OE2   1 
ATOM   10    N  N     . GLU A 1 2   ? 44.365  13.787  -7.446   1.00 237.98 ? 2   GLU A N     1 
ATOM   11    C  CA    . GLU A 1 2   ? 43.777  13.613  -8.755   1.00 242.94 ? 2   GLU A CA    1 
ATOM   12    C  C     . GLU A 1 2   ? 42.380  13.026  -8.586   1.00 247.45 ? 2   GLU A C     1 
ATOM   13    O  O     . GLU A 1 2   ? 42.154  12.260  -7.649   1.00 252.34 ? 2   GLU A O     1 
ATOM   14    C  CB    . GLU A 1 2   ? 44.638  12.694  -9.614   1.00 240.44 ? 2   GLU A CB    1 
ATOM   15    C  CG    . GLU A 1 2   ? 45.909  13.320  -10.159  1.00 233.35 ? 2   GLU A CG    1 
ATOM   16    C  CD    . GLU A 1 2   ? 46.616  12.411  -11.118  1.00 227.30 ? 2   GLU A CD    1 
ATOM   17    O  OE1   . GLU A 1 2   ? 46.405  11.178  -11.073  1.00 236.62 ? 2   GLU A OE1   1 
ATOM   18    O  OE2   . GLU A 1 2   ? 47.388  12.940  -11.925  1.00 220.16 ? 2   GLU A OE2   1 
ATOM   19    N  N     . GLU A 1 3   ? 41.443  13.435  -9.449   1.00 242.95 ? 3   GLU A N     1 
ATOM   20    C  CA    . GLU A 1 3   ? 40.024  13.009  -9.412   1.00 236.79 ? 3   GLU A CA    1 
ATOM   21    C  C     . GLU A 1 3   ? 39.193  13.367  -8.155   1.00 227.52 ? 3   GLU A C     1 
ATOM   22    O  O     . GLU A 1 3   ? 37.966  13.256  -8.194   1.00 217.90 ? 3   GLU A O     1 
ATOM   23    C  CB    . GLU A 1 3   ? 39.894  11.528  -9.747   1.00 239.73 ? 3   GLU A CB    1 
ATOM   24    C  CG    . GLU A 1 3   ? 40.410  11.150  -11.136  1.00 251.62 ? 3   GLU A CG    1 
ATOM   25    C  CD    . GLU A 1 3   ? 40.330  9.680   -11.331  1.00 260.52 ? 3   GLU A CD    1 
ATOM   26    O  OE1   . GLU A 1 3   ? 40.133  9.011   -10.304  1.00 261.78 ? 3   GLU A OE1   1 
ATOM   27    O  OE2   . GLU A 1 3   ? 40.457  9.204   -12.479  1.00 255.12 ? 3   GLU A OE2   1 
ATOM   28    N  N     . ILE A 1 4   ? 39.848  13.787  -7.056   1.00 221.94 ? 4   ILE A N     1 
ATOM   29    C  CA    . ILE A 1 4   ? 39.223  14.236  -5.813   1.00 211.43 ? 4   ILE A CA    1 
ATOM   30    C  C     . ILE A 1 4   ? 38.440  13.147  -5.056   1.00 184.89 ? 4   ILE A C     1 
ATOM   31    O  O     . ILE A 1 4   ? 37.778  13.393  -4.056   1.00 181.11 ? 4   ILE A O     1 
ATOM   32    C  CB    . ILE A 1 4   ? 38.364  15.491  -6.058   1.00 224.17 ? 4   ILE A CB    1 
ATOM   33    C  CG1   . ILE A 1 4   ? 39.080  16.474  -6.980   1.00 222.09 ? 4   ILE A CG1   1 
ATOM   34    C  CG2   . ILE A 1 4   ? 38.054  16.168  -4.747   1.00 242.66 ? 4   ILE A CG2   1 
ATOM   35    C  CD1   . ILE A 1 4   ? 40.434  16.945  -6.491   1.00 236.64 ? 4   ILE A CD1   1 
ATOM   36    N  N     . ALA A 1 5   ? 38.542  11.918  -5.515   1.00 160.33 ? 5   ALA A N     1 
ATOM   37    C  CA    . ALA A 1 5   ? 37.534  10.954  -5.170   1.00 144.88 ? 5   ALA A CA    1 
ATOM   38    C  C     . ALA A 1 5   ? 36.101  11.441  -5.502   1.00 123.43 ? 5   ALA A C     1 
ATOM   39    O  O     . ALA A 1 5   ? 35.890  12.259  -6.374   1.00 113.26 ? 5   ALA A O     1 
ATOM   40    C  CB    . ALA A 1 5   ? 37.686  10.504  -3.711   1.00 145.87 ? 5   ALA A CB    1 
ATOM   41    N  N     . ALA A 1 6   ? 35.116  10.832  -4.885   1.00 115.33 ? 6   ALA A N     1 
ATOM   42    C  CA    . ALA A 1 6   ? 33.720  11.274  -4.956   1.00 111.00 ? 6   ALA A CA    1 
ATOM   43    C  C     . ALA A 1 6   ? 32.958  10.514  -3.888   1.00 103.28 ? 6   ALA A C     1 
ATOM   44    O  O     . ALA A 1 6   ? 33.397  9.476   -3.338   1.00 103.21 ? 6   ALA A O     1 
ATOM   45    C  CB    . ALA A 1 6   ? 33.081  10.994  -6.325   1.00 117.87 ? 6   ALA A CB    1 
ATOM   46    N  N     . LEU A 1 7   ? 31.796  11.019  -3.529   1.00 85.68  ? 7   LEU A N     1 
ATOM   47    C  CA    . LEU A 1 7   ? 31.073  10.473  -2.395   1.00 83.58  ? 7   LEU A CA    1 
ATOM   48    C  C     . LEU A 1 7   ? 29.818  9.854   -2.945   1.00 79.42  ? 7   LEU A C     1 
ATOM   49    O  O     . LEU A 1 7   ? 29.292  10.302  -3.977   1.00 81.07  ? 7   LEU A O     1 
ATOM   50    C  CB    . LEU A 1 7   ? 30.702  11.562  -1.360   1.00 92.17  ? 7   LEU A CB    1 
ATOM   51    C  CG    . LEU A 1 7   ? 31.881  12.031  -0.497   1.00 98.64  ? 7   LEU A CG    1 
ATOM   52    C  CD1   . LEU A 1 7   ? 31.499  13.154  0.451    1.00 103.73 ? 7   LEU A CD1   1 
ATOM   53    C  CD2   . LEU A 1 7   ? 32.600  10.864  0.179    1.00 94.90  ? 7   LEU A CD2   1 
ATOM   54    N  N     . VAL A 1 8   ? 29.334  8.816   -2.283   1.00 74.16  ? 8   VAL A N     1 
ATOM   55    C  CA    . VAL A 1 8   ? 28.127  8.155   -2.762   1.00 71.61  ? 8   VAL A CA    1 
ATOM   56    C  C     . VAL A 1 8   ? 27.206  7.903   -1.607   1.00 75.43  ? 8   VAL A C     1 
ATOM   57    O  O     . VAL A 1 8   ? 27.643  7.395   -0.577   1.00 76.54  ? 8   VAL A O     1 
ATOM   58    C  CB    . VAL A 1 8   ? 28.458  6.864   -3.519   1.00 68.94  ? 8   VAL A CB    1 
ATOM   59    C  CG1   . VAL A 1 8   ? 27.167  6.260   -4.035   1.00 68.88  ? 8   VAL A CG1   1 
ATOM   60    C  CG2   . VAL A 1 8   ? 29.454  7.148   -4.650   1.00 75.76  ? 8   VAL A CG2   1 
ATOM   61    N  N     . ILE A 1 9   ? 25.934  8.265   -1.747   1.00 84.05  ? 9   ILE A N     1 
ATOM   62    C  CA    . ILE A 1 9   ? 24.955  7.930   -0.719   1.00 82.83  ? 9   ILE A CA    1 
ATOM   63    C  C     . ILE A 1 9   ? 23.653  7.328   -1.259   1.00 85.14  ? 9   ILE A C     1 
ATOM   64    O  O     . ILE A 1 9   ? 23.069  7.860   -2.178   1.00 83.70  ? 9   ILE A O     1 
ATOM   65    C  CB    . ILE A 1 9   ? 24.656  9.184   0.117    1.00 78.43  ? 9   ILE A CB    1 
ATOM   66    C  CG1   . ILE A 1 9   ? 25.993  9.775   0.580    1.00 93.81  ? 9   ILE A CG1   1 
ATOM   67    C  CG2   . ILE A 1 9   ? 23.709  8.794   1.243    1.00 76.13  ? 9   ILE A CG2   1 
ATOM   68    C  CD1   . ILE A 1 9   ? 25.912  10.831  1.640    1.00 107.82 ? 9   ILE A CD1   1 
ATOM   69    N  N     . ASP A 1 10  ? 23.295  6.166   -0.705   1.00 91.92  ? 10  ASP A N     1 
ATOM   70    C  CA    . ASP A 1 10  ? 22.055  5.500   -1.041   1.00 106.82 ? 10  ASP A CA    1 
ATOM   71    C  C     . ASP A 1 10  ? 21.131  5.759   0.180    1.00 108.50 ? 10  ASP A C     1 
ATOM   72    O  O     . ASP A 1 10  ? 21.379  5.312   1.332    1.00 112.18 ? 10  ASP A O     1 
ATOM   73    C  CB    . ASP A 1 10  ? 22.240  4.015   -1.312   1.00 123.66 ? 10  ASP A CB    1 
ATOM   74    C  CG    . ASP A 1 10  ? 20.927  3.257   -1.340   1.00 121.22 ? 10  ASP A CG    1 
ATOM   75    O  OD1   . ASP A 1 10  ? 19.860  3.814   -1.040   1.00 118.63 ? 10  ASP A OD1   1 
ATOM   76    O  OD2   . ASP A 1 10  ? 20.912  2.066   -1.684   1.00 115.85 ? 10  ASP A OD2   1 
ATOM   77    N  N     . ASN A 1 11  ? 20.104  6.567   -0.070   1.00 98.71  ? 11  ASN A N     1 
ATOM   78    C  CA    . ASN A 1 11  ? 18.974  6.653   0.815    1.00 95.43  ? 11  ASN A CA    1 
ATOM   79    C  C     . ASN A 1 11  ? 17.609  6.237   0.233    1.00 121.71 ? 11  ASN A C     1 
ATOM   80    O  O     . ASN A 1 11  ? 16.721  7.043   -0.033   1.00 123.64 ? 11  ASN A O     1 
ATOM   81    C  CB    . ASN A 1 11  ? 18.856  8.041   1.350    1.00 95.10  ? 11  ASN A CB    1 
ATOM   82    C  CG    . ASN A 1 11  ? 19.584  8.189   2.636    1.00 99.13  ? 11  ASN A CG    1 
ATOM   83    O  OD1   . ASN A 1 11  ? 19.847  7.192   3.304    1.00 77.50  ? 11  ASN A OD1   1 
ATOM   84    N  ND2   . ASN A 1 11  ? 19.901  9.429   3.009    1.00 115.07 ? 11  ASN A ND2   1 
ATOM   85    N  N     . GLY A 1 12  ? 17.399  4.934   0.117    1.00 142.35 ? 12  GLY A N     1 
ATOM   86    C  CA    . GLY A 1 12  ? 16.011  4.381   0.200    1.00 123.22 ? 12  GLY A CA    1 
ATOM   87    C  C     . GLY A 1 12  ? 15.778  4.442   1.673    1.00 104.34 ? 12  GLY A C     1 
ATOM   88    O  O     . GLY A 1 12  ? 16.751  4.489   2.451    1.00 108.61 ? 12  GLY A O     1 
ATOM   89    N  N     . SER A 1 13  ? 14.513  4.415   2.086    1.00 90.65  ? 13  SER A N     1 
ATOM   90    C  CA    . SER A 1 13  ? 14.202  4.413   3.504    1.00 91.86  ? 13  SER A CA    1 
ATOM   91    C  C     . SER A 1 13  ? 15.018  3.320   4.190    1.00 92.87  ? 13  SER A C     1 
ATOM   92    O  O     . SER A 1 13  ? 15.449  2.332   3.574    1.00 77.30  ? 13  SER A O     1 
ATOM   93    C  CB    . SER A 1 13  ? 12.718  4.131   3.825    1.00 107.22 ? 13  SER A CB    1 
ATOM   94    O  OG    . SER A 1 13  ? 11.861  5.062   3.193    1.00 129.14 ? 13  SER A OG    1 
ATOM   95    N  N     . GLY A 1 14  ? 15.233  3.514   5.486    1.00 106.47 ? 14  GLY A N     1 
ATOM   96    C  CA    . GLY A 1 14  ? 15.687  2.432   6.386    1.00 121.81 ? 14  GLY A CA    1 
ATOM   97    C  C     . GLY A 1 14  ? 17.150  2.481   6.644    1.00 130.37 ? 14  GLY A C     1 
ATOM   98    O  O     . GLY A 1 14  ? 17.602  2.486   7.788    1.00 136.55 ? 14  GLY A O     1 
ATOM   99    N  N     . MET A 1 15  ? 17.935  2.583   5.574    1.00 135.60 ? 15  MET A N     1 
ATOM   100   C  CA    . MET A 1 15  ? 19.384  2.588   5.762    1.00 140.02 ? 15  MET A CA    1 
ATOM   101   C  C     . MET A 1 15  ? 20.028  3.631   4.917    1.00 130.53 ? 15  MET A C     1 
ATOM   102   O  O     . MET A 1 15  ? 19.668  3.808   3.758    1.00 117.54 ? 15  MET A O     1 
ATOM   103   C  CB    . MET A 1 15  ? 20.016  1.243   5.352    1.00 142.27 ? 15  MET A CB    1 
ATOM   104   C  CG    . MET A 1 15  ? 19.610  0.070   6.247    1.00 168.98 ? 15  MET A CG    1 
ATOM   105   S  SD    . MET A 1 15  ? 20.378  -1.507  5.830    1.00 193.94 ? 15  MET A SD    1 
ATOM   106   C  CE    . MET A 1 15  ? 21.891  -1.270  6.737    1.00 185.51 ? 15  MET A CE    1 
ATOM   107   N  N     . CYS A 1 16  ? 21.046  4.276   5.490    1.00 128.24 ? 16  CYS A N     1 
ATOM   108   C  CA    . CYS A 1 16  ? 21.941  5.119   4.701    1.00 118.78 ? 16  CYS A CA    1 
ATOM   109   C  C     . CYS A 1 16  ? 23.158  4.318   4.419    1.00 104.51 ? 16  CYS A C     1 
ATOM   110   O  O     . CYS A 1 16  ? 23.877  3.904   5.340    1.00 98.61  ? 16  CYS A O     1 
ATOM   111   C  CB    . CYS A 1 16  ? 22.494  6.342   5.444    1.00 112.92 ? 16  CYS A CB    1 
ATOM   112   S  SG    . CYS A 1 16  ? 21.556  7.836   5.239    1.00 118.82 ? 16  CYS A SG    1 
ATOM   113   N  N     . LYS A 1 17  ? 23.505  4.184   3.139    1.00 99.21  ? 17  LYS A N     1 
ATOM   114   C  CA    . LYS A 1 17  ? 24.684  3.398   2.769    1.00 96.62  ? 17  LYS A CA    1 
ATOM   115   C  C     . LYS A 1 17  ? 25.587  4.403   2.111    1.00 92.05  ? 17  LYS A C     1 
ATOM   116   O  O     . LYS A 1 17  ? 25.208  4.984   1.148    1.00 94.51  ? 17  LYS A O     1 
ATOM   117   C  CB    . LYS A 1 17  ? 24.364  2.182   1.859    1.00 90.54  ? 17  LYS A CB    1 
ATOM   118   C  CG    . LYS A 1 17  ? 23.578  1.054   2.538    1.00 96.74  ? 17  LYS A CG    1 
ATOM   119   C  CD    . LYS A 1 17  ? 23.100  -0.028  1.600    1.00 95.47  ? 17  LYS A CD    1 
ATOM   120   C  CE    . LYS A 1 17  ? 21.822  0.311   0.832    1.00 104.64 ? 17  LYS A CE    1 
ATOM   121   N  NZ    . LYS A 1 17  ? 21.198  -0.897  0.257    1.00 102.21 ? 17  LYS A NZ    1 
ATOM   122   N  N     . ALA A 1 18  ? 26.693  4.738   2.743    1.00 87.78  ? 18  ALA A N     1 
ATOM   123   C  CA    . ALA A 1 18  ? 27.518  5.828   2.253    1.00 82.68  ? 18  ALA A CA    1 
ATOM   124   C  C     . ALA A 1 18  ? 28.974  5.427   2.305    1.00 79.71  ? 18  ALA A C     1 
ATOM   125   O  O     . ALA A 1 18  ? 29.409  4.574   3.088    1.00 67.66  ? 18  ALA A O     1 
ATOM   126   C  CB    . ALA A 1 18  ? 27.333  7.112   3.072    1.00 77.99  ? 18  ALA A CB    1 
ATOM   127   N  N     . GLY A 1 19  ? 29.758  6.057   1.424    1.00 86.92  ? 19  GLY A N     1 
ATOM   128   C  CA    . GLY A 1 19  ? 31.161  5.779   1.390    1.00 106.66 ? 19  GLY A CA    1 
ATOM   129   C  C     . GLY A 1 19  ? 31.787  6.478   0.224    1.00 109.77 ? 19  GLY A C     1 
ATOM   130   O  O     . GLY A 1 19  ? 31.123  7.234   -0.490   1.00 98.74  ? 19  GLY A O     1 
ATOM   131   N  N     . PHE A 1 20  ? 33.079  6.225   0.030    1.00 106.10 ? 20  PHE A N     1 
ATOM   132   C  CA    . PHE A 1 20  ? 33.780  6.795   -1.109   1.00 94.12  ? 20  PHE A CA    1 
ATOM   133   C  C     . PHE A 1 20  ? 33.529  6.064   -2.397   1.00 90.32  ? 20  PHE A C     1 
ATOM   134   O  O     . PHE A 1 20  ? 33.701  4.859   -2.518   1.00 87.31  ? 20  PHE A O     1 
ATOM   135   C  CB    . PHE A 1 20  ? 35.239  6.854   -0.852   1.00 90.05  ? 20  PHE A CB    1 
ATOM   136   C  CG    . PHE A 1 20  ? 35.591  7.719   0.305    1.00 103.59 ? 20  PHE A CG    1 
ATOM   137   C  CD1   . PHE A 1 20  ? 35.683  9.090   0.163    1.00 115.43 ? 20  PHE A CD1   1 
ATOM   138   C  CD2   . PHE A 1 20  ? 35.836  7.167   1.543    1.00 120.43 ? 20  PHE A CD2   1 
ATOM   139   C  CE1   . PHE A 1 20  ? 36.009  9.891   1.226    1.00 146.80 ? 20  PHE A CE1   1 
ATOM   140   C  CE2   . PHE A 1 20  ? 36.180  7.961   2.617    1.00 143.91 ? 20  PHE A CE2   1 
ATOM   141   C  CZ    . PHE A 1 20  ? 36.263  9.323   2.458    1.00 166.88 ? 20  PHE A CZ    1 
ATOM   142   N  N     . ALA A 1 21  ? 33.255  6.831   -3.441   1.00 94.01  ? 21  ALA A N     1 
ATOM   143   C  CA    . ALA A 1 21  ? 33.241  6.286   -4.786   1.00 104.41 ? 21  ALA A CA    1 
ATOM   144   C  C     . ALA A 1 21  ? 34.610  5.764   -5.069   1.00 139.82 ? 21  ALA A C     1 
ATOM   145   O  O     . ALA A 1 21  ? 35.586  6.422   -4.731   1.00 150.16 ? 21  ALA A O     1 
ATOM   146   C  CB    . ALA A 1 21  ? 32.979  7.368   -5.778   1.00 91.84  ? 21  ALA A CB    1 
ATOM   147   N  N     . GLY A 1 22  ? 34.710  4.606   -5.714   1.00 151.53 ? 22  GLY A N     1 
ATOM   148   C  CA    . GLY A 1 22  ? 35.992  4.047   -6.034   1.00 150.76 ? 22  GLY A CA    1 
ATOM   149   C  C     . GLY A 1 22  ? 36.365  2.969   -5.030   1.00 146.14 ? 22  GLY A C     1 
ATOM   150   O  O     . GLY A 1 22  ? 37.519  2.636   -4.927   1.00 155.51 ? 22  GLY A O     1 
ATOM   151   N  N     . ASP A 1 23  ? 35.398  2.478   -4.261   1.00 132.98 ? 23  ASP A N     1 
ATOM   152   C  CA    . ASP A 1 23  ? 35.660  1.403   -3.351   1.00 130.00 ? 23  ASP A CA    1 
ATOM   153   C  C     . ASP A 1 23  ? 34.554  0.386   -3.522   1.00 120.79 ? 23  ASP A C     1 
ATOM   154   O  O     . ASP A 1 23  ? 33.498  0.701   -4.032   1.00 118.93 ? 23  ASP A O     1 
ATOM   155   C  CB    . ASP A 1 23  ? 35.733  1.891   -1.910   1.00 134.01 ? 23  ASP A CB    1 
ATOM   156   C  CG    . ASP A 1 23  ? 37.095  2.463   -1.576   1.00 148.97 ? 23  ASP A CG    1 
ATOM   157   O  OD1   . ASP A 1 23  ? 38.043  2.076   -2.283   1.00 145.86 ? 23  ASP A OD1   1 
ATOM   158   O  OD2   . ASP A 1 23  ? 37.239  3.297   -0.640   1.00 176.31 ? 23  ASP A OD2   1 
ATOM   159   N  N     . ASP A 1 24  ? 34.861  -0.859  -3.203   1.00 123.34 ? 24  ASP A N     1 
ATOM   160   C  CA    . ASP A 1 24  ? 33.942  -1.969  -3.427   1.00 132.65 ? 24  ASP A CA    1 
ATOM   161   C  C     . ASP A 1 24  ? 32.914  -2.074  -2.349   1.00 129.83 ? 24  ASP A C     1 
ATOM   162   O  O     . ASP A 1 24  ? 31.937  -2.750  -2.603   1.00 135.74 ? 24  ASP A O     1 
ATOM   163   C  CB    . ASP A 1 24  ? 34.675  -3.328  -3.620   1.00 161.12 ? 24  ASP A CB    1 
ATOM   164   C  CG    . ASP A 1 24  ? 35.731  -3.620  -2.528   1.00 188.51 ? 24  ASP A CG    1 
ATOM   165   O  OD1   . ASP A 1 24  ? 35.988  -2.748  -1.657   1.00 195.92 ? 24  ASP A OD1   1 
ATOM   166   O  OD2   . ASP A 1 24  ? 36.320  -4.726  -2.565   1.00 198.06 ? 24  ASP A OD2   1 
ATOM   167   N  N     . ALA A 1 25  ? 33.118  -1.472  -1.170   1.00 107.66 ? 25  ALA A N     1 
ATOM   168   C  CA    . ALA A 1 25  ? 32.063  -1.439  -0.169   1.00 103.48 ? 25  ALA A CA    1 
ATOM   169   C  C     . ALA A 1 25  ? 32.031  -0.097  0.507    1.00 98.25  ? 25  ALA A C     1 
ATOM   170   O  O     . ALA A 1 25  ? 33.051  0.562   0.682    1.00 107.72 ? 25  ALA A O     1 
ATOM   171   C  CB    . ALA A 1 25  ? 32.251  -2.503  0.902    1.00 121.74 ? 25  ALA A CB    1 
ATOM   172   N  N     . PRO A 1 26  ? 30.853  0.303   0.943    1.00 83.96  ? 26  PRO A N     1 
ATOM   173   C  CA    . PRO A 1 26  ? 30.695  1.542   1.665    1.00 84.88  ? 26  PRO A CA    1 
ATOM   174   C  C     . PRO A 1 26  ? 31.308  1.462   3.032    1.00 92.03  ? 26  PRO A C     1 
ATOM   175   O  O     . PRO A 1 26  ? 31.171  0.440   3.705    1.00 88.82  ? 26  PRO A O     1 
ATOM   176   C  CB    . PRO A 1 26  ? 29.187  1.685   1.847    1.00 84.70  ? 26  PRO A CB    1 
ATOM   177   C  CG    . PRO A 1 26  ? 28.631  0.338   1.544    1.00 87.30  ? 26  PRO A CG    1 
ATOM   178   C  CD    . PRO A 1 26  ? 29.604  -0.450  0.751    1.00 73.76  ? 26  PRO A CD    1 
ATOM   179   N  N     . ARG A 1 27  ? 31.801  2.577   3.512    1.00 113.64 ? 27  ARG A N     1 
ATOM   180   C  CA    . ARG A 1 27  ? 32.368  2.663   4.868    1.00 127.07 ? 27  ARG A CA    1 
ATOM   181   C  C     . ARG A 1 27  ? 31.305  2.625   5.904    1.00 114.49 ? 27  ARG A C     1 
ATOM   182   O  O     . ARG A 1 27  ? 31.439  1.964   6.929    1.00 114.77 ? 27  ARG A O     1 
ATOM   183   C  CB    . ARG A 1 27  ? 33.164  3.945   5.111    1.00 146.12 ? 27  ARG A CB    1 
ATOM   184   C  CG    . ARG A 1 27  ? 34.405  4.030   4.239    1.00 158.64 ? 27  ARG A CG    1 
ATOM   185   C  CD    . ARG A 1 27  ? 35.648  3.343   4.822    1.00 156.25 ? 27  ARG A CD    1 
ATOM   186   N  NE    . ARG A 1 27  ? 36.815  3.642   3.985    1.00 162.03 ? 27  ARG A NE    1 
ATOM   187   C  CZ    . ARG A 1 27  ? 37.038  3.113   2.775    1.00 173.86 ? 27  ARG A CZ    1 
ATOM   188   N  NH1   . ARG A 1 27  ? 36.153  2.262   2.254    1.00 178.98 ? 27  ARG A NH1   1 
ATOM   189   N  NH2   . ARG A 1 27  ? 38.138  3.434   2.049    1.00 182.60 ? 27  ARG A NH2   1 
ATOM   190   N  N     . ALA A 1 28  ? 30.264  3.421   5.710    1.00 104.01 ? 28  ALA A N     1 
ATOM   191   C  CA    . ALA A 1 28  ? 29.265  3.560   6.793    1.00 111.33 ? 28  ALA A CA    1 
ATOM   192   C  C     . ALA A 1 28  ? 27.934  3.111   6.280    1.00 107.51 ? 28  ALA A C     1 
ATOM   193   O  O     . ALA A 1 28  ? 27.503  3.555   5.242    1.00 123.30 ? 28  ALA A O     1 
ATOM   194   C  CB    . ALA A 1 28  ? 29.112  5.007   7.242    1.00 123.76 ? 28  ALA A CB    1 
ATOM   195   N  N     . VAL A 1 29  ? 27.251  2.280   7.063    1.00 94.47  ? 29  VAL A N     1 
ATOM   196   C  CA    . VAL A 1 29  ? 25.889  1.884   6.774    1.00 91.81  ? 29  VAL A CA    1 
ATOM   197   C  C     . VAL A 1 29  ? 25.171  1.852   8.079    1.00 96.36  ? 29  VAL A C     1 
ATOM   198   O  O     . VAL A 1 29  ? 25.559  1.126   9.008    1.00 110.02 ? 29  VAL A O     1 
ATOM   199   C  CB    . VAL A 1 29  ? 25.787  0.493   6.122    1.00 104.60 ? 29  VAL A CB    1 
ATOM   200   C  CG1   . VAL A 1 29  ? 26.422  0.554   4.742    1.00 109.02 ? 29  VAL A CG1   1 
ATOM   201   C  CG2   . VAL A 1 29  ? 26.477  -0.606  6.914    1.00 123.21 ? 29  VAL A CG2   1 
ATOM   202   N  N     . PHE A 1 30  ? 24.121  2.670   8.238    1.00 94.39  ? 30  PHE A N     1 
ATOM   203   C  CA    . PHE A 1 30  ? 23.438  2.745   9.532    1.00 91.19  ? 30  PHE A CA    1 
ATOM   204   C  C     . PHE A 1 30  ? 21.990  3.059   9.271    1.00 89.64  ? 30  PHE A C     1 
ATOM   205   O  O     . PHE A 1 30  ? 21.609  3.539   8.200    1.00 92.42  ? 30  PHE A O     1 
ATOM   206   C  CB    . PHE A 1 30  ? 24.040  3.828   10.425   1.00 86.99  ? 30  PHE A CB    1 
ATOM   207   C  CG    . PHE A 1 30  ? 24.013  5.153   9.768    1.00 85.94  ? 30  PHE A CG    1 
ATOM   208   C  CD1   . PHE A 1 30  ? 22.893  5.943   9.814    1.00 75.53  ? 30  PHE A CD1   1 
ATOM   209   C  CD2   . PHE A 1 30  ? 25.089  5.577   8.996    1.00 87.23  ? 30  PHE A CD2   1 
ATOM   210   C  CE1   . PHE A 1 30  ? 22.838  7.157   9.176    1.00 67.80  ? 30  PHE A CE1   1 
ATOM   211   C  CE2   . PHE A 1 30  ? 25.057  6.795   8.363    1.00 86.10  ? 30  PHE A CE2   1 
ATOM   212   C  CZ    . PHE A 1 30  ? 23.925  7.588   8.468    1.00 80.47  ? 30  PHE A CZ    1 
ATOM   213   N  N     . PRO A 1 31  ? 21.160  2.792   10.261   1.00 91.55  ? 31  PRO A N     1 
ATOM   214   C  CA    . PRO A 1 31  ? 19.727  3.004   10.030   1.00 92.72  ? 31  PRO A CA    1 
ATOM   215   C  C     . PRO A 1 31  ? 19.359  4.473   9.960    1.00 80.67  ? 31  PRO A C     1 
ATOM   216   O  O     . PRO A 1 31  ? 19.866  5.248   10.718   1.00 76.69  ? 31  PRO A O     1 
ATOM   217   C  CB    . PRO A 1 31  ? 19.076  2.295   11.224   1.00 111.47 ? 31  PRO A CB    1 
ATOM   218   C  CG    . PRO A 1 31  ? 20.198  2.170   12.218   1.00 108.98 ? 31  PRO A CG    1 
ATOM   219   C  CD    . PRO A 1 31  ? 21.389  1.903   11.408   1.00 95.75  ? 31  PRO A CD    1 
ATOM   220   N  N     . SER A 1 32  ? 18.434  4.840   9.065    1.00 80.64  ? 32  SER A N     1 
ATOM   221   C  CA    . SER A 1 32  ? 18.056  6.248   8.866    1.00 84.94  ? 32  SER A CA    1 
ATOM   222   C  C     . SER A 1 32  ? 16.960  6.513   9.820    1.00 99.77  ? 32  SER A C     1 
ATOM   223   O  O     . SER A 1 32  ? 15.765  6.388   9.428    1.00 120.52 ? 32  SER A O     1 
ATOM   224   C  CB    . SER A 1 32  ? 17.485  6.505   7.441    1.00 83.53  ? 32  SER A CB    1 
ATOM   225   O  OG    . SER A 1 32  ? 18.422  6.238   6.426    1.00 78.77  ? 32  SER A OG    1 
ATOM   226   N  N     . ILE A 1 33  ? 17.328  6.828   11.059   1.00 98.30  ? 33  ILE A N     1 
ATOM   227   C  CA    . ILE A 1 33  ? 16.317  7.032   12.076   1.00 99.83  ? 33  ILE A CA    1 
ATOM   228   C  C     . ILE A 1 33  ? 16.722  8.239   12.877   1.00 79.59  ? 33  ILE A C     1 
ATOM   229   O  O     . ILE A 1 33  ? 17.866  8.534   13.049   1.00 69.76  ? 33  ILE A O     1 
ATOM   230   C  CB    . ILE A 1 33  ? 16.038  5.815   12.974   1.00 125.41 ? 33  ILE A CB    1 
ATOM   231   C  CG1   . ILE A 1 33  ? 17.366  5.276   13.513   1.00 141.53 ? 33  ILE A CG1   1 
ATOM   232   C  CG2   . ILE A 1 33  ? 15.190  4.778   12.235   1.00 137.64 ? 33  ILE A CG2   1 
ATOM   233   C  CD1   . ILE A 1 33  ? 17.221  4.131   14.476   1.00 151.51 ? 33  ILE A CD1   1 
ATOM   234   N  N     . VAL A 1 34  ? 15.720  9.002   13.275   1.00 73.25  ? 34  VAL A N     1 
ATOM   235   C  CA    . VAL A 1 34  ? 15.890  10.141  14.156   1.00 73.80  ? 34  VAL A CA    1 
ATOM   236   C  C     . VAL A 1 34  ? 15.060  9.859   15.379   1.00 69.96  ? 34  VAL A C     1 
ATOM   237   O  O     . VAL A 1 34  ? 13.840  10.010  15.376   1.00 64.46  ? 34  VAL A O     1 
ATOM   238   C  CB    . VAL A 1 34  ? 15.371  11.426  13.471   1.00 86.31  ? 34  VAL A CB    1 
ATOM   239   C  CG1   . VAL A 1 34  ? 15.244  12.614  14.424   1.00 86.19  ? 34  VAL A CG1   1 
ATOM   240   C  CG2   . VAL A 1 34  ? 16.297  11.717  12.296   1.00 98.34  ? 34  VAL A CG2   1 
ATOM   241   N  N     . GLY A 1 35  ? 15.731  9.487   16.459   1.00 77.02  ? 35  GLY A N     1 
ATOM   242   C  CA    . GLY A 1 35  ? 15.000  9.224   17.673   1.00 87.07  ? 35  GLY A CA    1 
ATOM   243   C  C     . GLY A 1 35  ? 14.992  10.471  18.495   1.00 99.88  ? 35  GLY A C     1 
ATOM   244   O  O     . GLY A 1 35  ? 15.957  11.229  18.533   1.00 104.71 ? 35  GLY A O     1 
ATOM   245   N  N     . ARG A 1 36  ? 13.884  10.697  19.192   1.00 116.05 ? 36  ARG A N     1 
ATOM   246   C  CA    . ARG A 1 36  ? 13.737  11.859  20.063   1.00 130.12 ? 36  ARG A CA    1 
ATOM   247   C  C     . ARG A 1 36  ? 13.357  11.387  21.440   1.00 128.74 ? 36  ARG A C     1 
ATOM   248   O  O     . ARG A 1 36  ? 12.641  10.454  21.606   1.00 141.37 ? 36  ARG A O     1 
ATOM   249   C  CB    . ARG A 1 36  ? 12.643  12.834  19.567   1.00 127.89 ? 36  ARG A CB    1 
ATOM   250   C  CG    . ARG A 1 36  ? 12.925  13.488  18.217   1.00 131.15 ? 36  ARG A CG    1 
ATOM   251   C  CD    . ARG A 1 36  ? 11.961  14.551  17.767   1.00 134.06 ? 36  ARG A CD    1 
ATOM   252   N  NE    . ARG A 1 36  ? 12.320  14.933  16.381   1.00 135.35 ? 36  ARG A NE    1 
ATOM   253   C  CZ    . ARG A 1 36  ? 13.314  15.763  16.071   1.00 139.70 ? 36  ARG A CZ    1 
ATOM   254   N  NH1   . ARG A 1 36  ? 14.018  16.310  17.051   1.00 142.32 ? 36  ARG A NH1   1 
ATOM   255   N  NH2   . ARG A 1 36  ? 13.616  16.044  14.788   1.00 146.67 ? 36  ARG A NH2   1 
ATOM   256   N  N     . PRO A 1 37  ? 13.911  12.013  22.446   1.00 121.44 ? 37  PRO A N     1 
ATOM   257   C  CA    . PRO A 1 37  ? 13.583  11.705  23.801   1.00 106.97 ? 37  PRO A CA    1 
ATOM   258   C  C     . PRO A 1 37  ? 12.169  12.147  24.094   1.00 105.08 ? 37  PRO A C     1 
ATOM   259   O  O     . PRO A 1 37  ? 11.851  13.321  24.168   1.00 98.64  ? 37  PRO A O     1 
ATOM   260   C  CB    . PRO A 1 37  ? 14.606  12.493  24.627   1.00 124.05 ? 37  PRO A CB    1 
ATOM   261   C  CG    . PRO A 1 37  ? 15.215  13.444  23.670   1.00 152.29 ? 37  PRO A CG    1 
ATOM   262   C  CD    . PRO A 1 37  ? 15.141  12.773  22.342   1.00 141.59 ? 37  PRO A CD    1 
ATOM   263   N  N     . ARG A 1 38  ? 11.297  11.149  24.124   1.00 116.80 ? 38  ARG A N     1 
ATOM   264   C  CA    . ARG A 1 38  ? 9.865   11.316  24.425   1.00 114.27 ? 38  ARG A CA    1 
ATOM   265   C  C     . ARG A 1 38  ? 9.645   11.529  25.880   1.00 87.88  ? 38  ARG A C     1 
ATOM   266   O  O     . ARG A 1 38  ? 8.785   12.293  26.265   1.00 65.27  ? 38  ARG A O     1 
ATOM   267   C  CB    . ARG A 1 38  ? 9.074   10.082  23.881   1.00 133.84 ? 38  ARG A CB    1 
ATOM   268   C  CG    . ARG A 1 38  ? 7.768   9.681   24.567   1.00 151.22 ? 38  ARG A CG    1 
ATOM   269   C  CD    . ARG A 1 38  ? 7.514   8.166   24.526   1.00 146.59 ? 38  ARG A CD    1 
ATOM   270   N  NE    . ARG A 1 38  ? 8.697   7.409   24.991   1.00 139.21 ? 38  ARG A NE    1 
ATOM   271   C  CZ    . ARG A 1 38  ? 8.707   6.093   25.196   1.00 148.74 ? 38  ARG A CZ    1 
ATOM   272   N  NH1   . ARG A 1 38  ? 7.593   5.410   25.022   1.00 155.74 ? 38  ARG A NH1   1 
ATOM   273   N  NH2   . ARG A 1 38  ? 9.818   5.453   25.620   1.00 164.23 ? 38  ARG A NH2   1 
ATOM   274   N  N     . HIS A 1 39  ? 10.396  10.821  26.717   1.00 86.44  ? 39  HIS A N     1 
ATOM   275   C  CA    . HIS A 1 39  ? 10.291  11.043  28.176   1.00 89.02  ? 39  HIS A CA    1 
ATOM   276   C  C     . HIS A 1 39  ? 11.205  12.080  28.763   1.00 105.46 ? 39  HIS A C     1 
ATOM   277   O  O     . HIS A 1 39  ? 12.422  12.015  28.545   1.00 111.30 ? 39  HIS A O     1 
ATOM   278   C  CB    . HIS A 1 39  ? 10.679  9.764   28.920   1.00 89.60  ? 39  HIS A CB    1 
ATOM   279   C  CG    . HIS A 1 39  ? 9.728   8.616   28.723   1.00 106.39 ? 39  HIS A CG    1 
ATOM   280   N  ND1   . HIS A 1 39  ? 8.375   8.726   28.961   1.00 141.06 ? 39  HIS A ND1   1 
ATOM   281   C  CD2   . HIS A 1 39  ? 9.933   7.344   28.314   1.00 119.23 ? 39  HIS A CD2   1 
ATOM   282   C  CE1   . HIS A 1 39  ? 7.783   7.570   28.706   1.00 155.67 ? 39  HIS A CE1   1 
ATOM   283   N  NE2   . HIS A 1 39  ? 8.710   6.708   28.322   1.00 141.45 ? 39  HIS A NE2   1 
ATOM   284   N  N     . GLN A 1 40  ? 10.635  12.998  29.567   1.00 127.94 ? 40  GLN A N     1 
ATOM   285   C  CA    . GLN A 1 40  ? 11.407  14.109  30.110   1.00 139.33 ? 40  GLN A CA    1 
ATOM   286   C  C     . GLN A 1 40  ? 12.420  13.587  31.123   1.00 130.98 ? 40  GLN A C     1 
ATOM   287   O  O     . GLN A 1 40  ? 12.101  12.787  31.982   1.00 118.42 ? 40  GLN A O     1 
ATOM   288   C  CB    . GLN A 1 40  ? 10.576  15.244  30.712   1.00 152.52 ? 40  GLN A CB    1 
ATOM   289   C  CG    . GLN A 1 40  ? 9.760   14.859  31.919   1.00 166.51 ? 40  GLN A CG    1 
ATOM   290   C  CD    . GLN A 1 40  ? 9.099   16.062  32.571   1.00 195.27 ? 40  GLN A CD    1 
ATOM   291   O  OE1   . GLN A 1 40  ? 9.130   17.175  32.036   1.00 218.90 ? 40  GLN A OE1   1 
ATOM   292   N  NE2   . GLN A 1 40  ? 8.491   15.847  33.729   1.00 200.81 ? 40  GLN A NE2   1 
ATOM   293   N  N     . GLY A 1 41  ? 13.674  13.947  30.914   1.00 138.48 ? 41  GLY A N     1 
ATOM   294   C  CA    . GLY A 1 41  ? 14.732  13.408  31.724   1.00 149.64 ? 41  GLY A CA    1 
ATOM   295   C  C     . GLY A 1 41  ? 14.873  14.200  32.996   1.00 154.77 ? 41  GLY A C     1 
ATOM   296   O  O     . GLY A 1 41  ? 14.661  15.409  33.002   1.00 158.60 ? 41  GLY A O     1 
ATOM   297   N  N     . VAL A 1 42  ? 15.220  13.509  34.081   1.00 148.40 ? 42  VAL A N     1 
ATOM   298   C  CA    . VAL A 1 42  ? 15.482  14.159  35.336   1.00 135.79 ? 42  VAL A CA    1 
ATOM   299   C  C     . VAL A 1 42  ? 16.760  13.639  35.930   1.00 111.27 ? 42  VAL A C     1 
ATOM   300   O  O     . VAL A 1 42  ? 16.791  12.623  36.608   1.00 98.19  ? 42  VAL A O     1 
ATOM   301   C  CB    . VAL A 1 42  ? 14.334  13.976  36.301   1.00 166.84 ? 42  VAL A CB    1 
ATOM   302   C  CG1   . VAL A 1 42  ? 14.690  14.670  37.622   1.00 176.69 ? 42  VAL A CG1   1 
ATOM   303   C  CG2   . VAL A 1 42  ? 13.053  14.504  35.630   1.00 188.90 ? 42  VAL A CG2   1 
ATOM   304   N  N     . MET A 1 43  ? 17.811  14.375  35.615   1.00 118.71 ? 43  MET A N     1 
ATOM   305   C  CA    . MET A 1 43  ? 19.117  14.302  36.257   1.00 139.81 ? 43  MET A CA    1 
ATOM   306   C  C     . MET A 1 43  ? 19.700  15.711  36.055   1.00 149.40 ? 43  MET A C     1 
ATOM   307   O  O     . MET A 1 43  ? 18.978  16.667  35.777   1.00 161.57 ? 43  MET A O     1 
ATOM   308   C  CB    . MET A 1 43  ? 20.034  13.308  35.572   1.00 146.80 ? 43  MET A CB    1 
ATOM   309   C  CG    . MET A 1 43  ? 19.520  11.908  35.429   1.00 156.16 ? 43  MET A CG    1 
ATOM   310   S  SD    . MET A 1 43  ? 19.666  10.830  36.848   1.00 170.00 ? 43  MET A SD    1 
ATOM   311   C  CE    . MET A 1 43  ? 21.413  10.493  36.659   1.00 171.71 ? 43  MET A CE    1 
ATOM   312   N  N     . VAL A 1 44  ? 21.009  15.846  36.192   1.00 144.12 ? 44  VAL A N     1 
ATOM   313   C  CA    . VAL A 1 44  ? 21.710  16.992  35.707   1.00 148.21 ? 44  VAL A CA    1 
ATOM   314   C  C     . VAL A 1 44  ? 22.973  16.453  35.046   1.00 147.21 ? 44  VAL A C     1 
ATOM   315   O  O     . VAL A 1 44  ? 23.513  15.423  35.471   1.00 139.00 ? 44  VAL A O     1 
ATOM   316   C  CB    . VAL A 1 44  ? 22.057  17.925  36.867   1.00 171.24 ? 44  VAL A CB    1 
ATOM   317   C  CG1   . VAL A 1 44  ? 22.911  19.098  36.365   1.00 190.18 ? 44  VAL A CG1   1 
ATOM   318   C  CG2   . VAL A 1 44  ? 20.773  18.374  37.604   1.00 173.54 ? 44  VAL A CG2   1 
ATOM   319   N  N     . GLY A 1 45  ? 23.439  17.159  34.028   1.00 156.39 ? 45  GLY A N     1 
ATOM   320   C  CA    . GLY A 1 45  ? 24.612  16.712  33.297   1.00 175.64 ? 45  GLY A CA    1 
ATOM   321   C  C     . GLY A 1 45  ? 24.238  15.500  32.472   1.00 195.08 ? 45  GLY A C     1 
ATOM   322   O  O     . GLY A 1 45  ? 25.001  14.536  32.388   1.00 189.41 ? 45  GLY A O     1 
ATOM   323   N  N     . MET A 1 46  ? 23.023  15.531  31.916   1.00 203.73 ? 46  MET A N     1 
ATOM   324   C  CA    . MET A 1 46  ? 22.665  14.698  30.752   1.00 194.14 ? 46  MET A CA    1 
ATOM   325   C  C     . MET A 1 46  ? 22.760  15.511  29.489   1.00 192.48 ? 46  MET A C     1 
ATOM   326   O  O     . MET A 1 46  ? 22.460  16.706  29.493   1.00 195.73 ? 46  MET A O     1 
ATOM   327   C  CB    . MET A 1 46  ? 21.206  14.219  30.801   1.00 208.65 ? 46  MET A CB    1 
ATOM   328   C  CG    . MET A 1 46  ? 20.864  13.217  31.892   1.00 232.42 ? 46  MET A CG    1 
ATOM   329   S  SD    . MET A 1 46  ? 19.184  12.624  31.708   1.00 265.80 ? 46  MET A SD    1 
ATOM   330   C  CE    . MET A 1 46  ? 18.363  14.095  32.283   1.00 296.14 ? 46  MET A CE    1 
ATOM   331   N  N     . GLY A 1 47  ? 23.145  14.841  28.406   1.00 188.74 ? 47  GLY A N     1 
ATOM   332   C  CA    . GLY A 1 47  ? 22.998  15.357  27.045   1.00 198.43 ? 47  GLY A CA    1 
ATOM   333   C  C     . GLY A 1 47  ? 23.153  16.868  26.826   1.00 212.77 ? 47  GLY A C     1 
ATOM   334   O  O     . GLY A 1 47  ? 24.283  17.363  26.875   1.00 197.34 ? 47  GLY A O     1 
ATOM   335   N  N     . GLN A 1 48  ? 22.073  17.631  26.592   1.00 229.38 ? 48  GLN A N     1 
ATOM   336   C  CA    . GLN A 1 48  ? 20.668  17.136  26.549   1.00 222.89 ? 48  GLN A CA    1 
ATOM   337   C  C     . GLN A 1 48  ? 20.394  16.364  25.268   1.00 204.97 ? 48  GLN A C     1 
ATOM   338   O  O     . GLN A 1 48  ? 19.736  15.323  25.301   1.00 180.49 ? 48  GLN A O     1 
ATOM   339   C  CB    . GLN A 1 48  ? 19.650  18.283  26.684   1.00 219.53 ? 48  GLN A CB    1 
ATOM   340   C  CG    . GLN A 1 48  ? 19.573  18.892  28.077   1.00 222.66 ? 48  GLN A CG    1 
ATOM   341   C  CD    . GLN A 1 48  ? 18.448  19.876  28.194   1.00 229.50 ? 48  GLN A CD    1 
ATOM   342   O  OE1   . GLN A 1 48  ? 17.885  20.317  27.190   1.00 232.49 ? 48  GLN A OE1   1 
ATOM   343   N  NE2   . GLN A 1 48  ? 18.106  20.240  29.425   1.00 239.08 ? 48  GLN A NE2   1 
ATOM   344   N  N     . LYS A 1 49  ? 20.964  16.869  24.175   1.00 190.85 ? 49  LYS A N     1 
ATOM   345   C  CA    . LYS A 1 49  ? 20.845  16.279  22.830   1.00 155.64 ? 49  LYS A CA    1 
ATOM   346   C  C     . LYS A 1 49  ? 19.384  16.102  22.473   1.00 140.08 ? 49  LYS A C     1 
ATOM   347   O  O     . LYS A 1 49  ? 18.761  15.151  22.873   1.00 131.40 ? 49  LYS A O     1 
ATOM   348   C  CB    . LYS A 1 49  ? 21.583  14.945  22.693   1.00 150.27 ? 49  LYS A CB    1 
ATOM   349   C  CG    . LYS A 1 49  ? 23.103  15.029  22.660   1.00 169.80 ? 49  LYS A CG    1 
ATOM   350   C  CD    . LYS A 1 49  ? 23.776  13.649  22.874   1.00 192.77 ? 49  LYS A CD    1 
ATOM   351   C  CE    . LYS A 1 49  ? 25.289  13.762  23.127   1.00 205.04 ? 49  LYS A CE    1 
ATOM   352   N  NZ    . LYS A 1 49  ? 25.919  12.448  23.449   1.00 218.06 ? 49  LYS A NZ    1 
ATOM   353   N  N     . ASP A 1 50  ? 18.866  17.047  21.699   1.00 153.65 ? 50  ASP A N     1 
ATOM   354   C  CA    . ASP A 1 50  ? 17.498  17.111  21.294   1.00 159.59 ? 50  ASP A CA    1 
ATOM   355   C  C     . ASP A 1 50  ? 17.081  15.860  20.583   1.00 161.92 ? 50  ASP A C     1 
ATOM   356   O  O     . ASP A 1 50  ? 15.940  15.496  20.665   1.00 171.24 ? 50  ASP A O     1 
ATOM   357   C  CB    . ASP A 1 50  ? 17.331  18.284  20.308   1.00 180.20 ? 50  ASP A CB    1 
ATOM   358   C  CG    . ASP A 1 50  ? 15.903  18.473  19.809   1.00 186.25 ? 50  ASP A CG    1 
ATOM   359   O  OD1   . ASP A 1 50  ? 14.931  18.439  20.605   1.00 202.97 ? 50  ASP A OD1   1 
ATOM   360   O  OD2   . ASP A 1 50  ? 15.755  18.671  18.579   1.00 169.98 ? 50  ASP A OD2   1 
ATOM   361   N  N     . SER A 1 51  ? 17.992  15.218  19.890   1.00 153.92 ? 51  SER A N     1 
ATOM   362   C  CA    . SER A 1 51  ? 17.629  13.972  19.257   1.00 130.38 ? 51  SER A CA    1 
ATOM   363   C  C     . SER A 1 51  ? 18.845  13.206  18.908   1.00 110.99 ? 51  SER A C     1 
ATOM   364   O  O     . SER A 1 51  ? 19.922  13.777  18.815   1.00 116.51 ? 51  SER A O     1 
ATOM   365   C  CB    . SER A 1 51  ? 16.861  14.254  17.976   1.00 139.66 ? 51  SER A CB    1 
ATOM   366   O  OG    . SER A 1 51  ? 16.446  13.060  17.370   1.00 153.03 ? 51  SER A OG    1 
ATOM   367   N  N     . TYR A 1 52  ? 18.669  11.914  18.628   1.00 101.37 ? 52  TYR A N     1 
ATOM   368   C  CA    . TYR A 1 52  ? 19.726  11.029  18.221   1.00 110.39 ? 52  TYR A CA    1 
ATOM   369   C  C     . TYR A 1 52  ? 19.477  10.500  16.819   1.00 107.72 ? 52  TYR A C     1 
ATOM   370   O  O     . TYR A 1 52  ? 18.383  10.396  16.333   1.00 123.74 ? 52  TYR A O     1 
ATOM   371   C  CB    . TYR A 1 52  ? 19.836  9.872   19.191   1.00 127.63 ? 52  TYR A CB    1 
ATOM   372   C  CG    . TYR A 1 52  ? 20.099  10.249  20.610   1.00 155.55 ? 52  TYR A CG    1 
ATOM   373   C  CD1   . TYR A 1 52  ? 20.821  11.382  20.932   1.00 170.37 ? 52  TYR A CD1   1 
ATOM   374   C  CD2   . TYR A 1 52  ? 19.694  9.412   21.635   1.00 159.51 ? 52  TYR A CD2   1 
ATOM   375   C  CE1   . TYR A 1 52  ? 21.073  11.706  22.241   1.00 159.84 ? 52  TYR A CE1   1 
ATOM   376   C  CE2   . TYR A 1 52  ? 19.950  9.742   22.948   1.00 140.08 ? 52  TYR A CE2   1 
ATOM   377   C  CZ    . TYR A 1 52  ? 20.649  10.891  23.248   1.00 139.58 ? 52  TYR A CZ    1 
ATOM   378   O  OH    . TYR A 1 52  ? 20.895  11.203  24.593   1.00 140.89 ? 52  TYR A OH    1 
ATOM   379   N  N     . VAL A 1 53  ? 20.574  10.275  16.115   1.00 97.24  ? 53  VAL A N     1 
ATOM   380   C  CA    . VAL A 1 53  ? 20.513  9.850   14.716   1.00 98.31  ? 53  VAL A CA    1 
ATOM   381   C  C     . VAL A 1 53  ? 21.438  8.702   14.523   1.00 98.28  ? 53  VAL A C     1 
ATOM   382   O  O     . VAL A 1 53  ? 22.493  8.635   15.137   1.00 95.95  ? 53  VAL A O     1 
ATOM   383   C  CB    . VAL A 1 53  ? 20.989  10.957  13.787   1.00 113.36 ? 53  VAL A CB    1 
ATOM   384   C  CG1   . VAL A 1 53  ? 20.998  10.486  12.354   1.00 127.37 ? 53  VAL A CG1   1 
ATOM   385   C  CG2   . VAL A 1 53  ? 20.080  12.186  13.948   1.00 126.39 ? 53  VAL A CG2   1 
ATOM   386   N  N     . GLY A 1 54  ? 21.072  7.785   13.621   1.00 106.88 ? 54  GLY A N     1 
ATOM   387   C  CA    . GLY A 1 54  ? 21.900  6.607   13.311   1.00 106.66 ? 54  GLY A CA    1 
ATOM   388   C  C     . GLY A 1 54  ? 21.926  5.624   14.428   1.00 106.49 ? 54  GLY A C     1 
ATOM   389   O  O     . GLY A 1 54  ? 21.198  5.783   15.373   1.00 109.09 ? 54  GLY A O     1 
ATOM   390   N  N     . ASP A 1 55  ? 22.793  4.627   14.302   1.00 129.51 ? 55  ASP A N     1 
ATOM   391   C  CA    . ASP A 1 55  ? 22.788  3.471   15.206   1.00 160.53 ? 55  ASP A CA    1 
ATOM   392   C  C     . ASP A 1 55  ? 22.939  3.841   16.685   1.00 154.93 ? 55  ASP A C     1 
ATOM   393   O  O     . ASP A 1 55  ? 22.651  3.058   17.586   1.00 135.19 ? 55  ASP A O     1 
ATOM   394   C  CB    . ASP A 1 55  ? 23.780  2.368   14.784   1.00 187.09 ? 55  ASP A CB    1 
ATOM   395   C  CG    . ASP A 1 55  ? 25.159  2.893   14.626   1.00 213.45 ? 55  ASP A CG    1 
ATOM   396   O  OD1   . ASP A 1 55  ? 25.260  4.134   14.586   1.00 230.22 ? 55  ASP A OD1   1 
ATOM   397   O  OD2   . ASP A 1 55  ? 26.108  2.094   14.545   1.00 232.09 ? 55  ASP A OD2   1 
ATOM   398   N  N     . GLU A 1 56  ? 23.259  5.111   16.915   1.00 156.45 ? 56  GLU A N     1 
ATOM   399   C  CA    . GLU A 1 56  ? 23.101  5.691   18.244   1.00 165.08 ? 56  GLU A CA    1 
ATOM   400   C  C     . GLU A 1 56  ? 21.694  5.463   18.746   1.00 143.33 ? 56  GLU A C     1 
ATOM   401   O  O     . GLU A 1 56  ? 21.466  5.065   19.898   1.00 150.60 ? 56  GLU A O     1 
ATOM   402   C  CB    . GLU A 1 56  ? 23.364  7.202   18.238   1.00 195.36 ? 56  GLU A CB    1 
ATOM   403   C  CG    . GLU A 1 56  ? 23.287  7.884   19.600   1.00 225.09 ? 56  GLU A CG    1 
ATOM   404   C  CD    . GLU A 1 56  ? 23.603  9.366   19.538   1.00 255.56 ? 56  GLU A CD    1 
ATOM   405   O  OE1   . GLU A 1 56  ? 23.749  9.919   18.423   1.00 281.21 ? 56  GLU A OE1   1 
ATOM   406   O  OE2   . GLU A 1 56  ? 23.698  9.985   20.619   1.00 264.31 ? 56  GLU A OE2   1 
ATOM   407   N  N     . ALA A 1 57  ? 20.727  5.743   17.874   1.00 119.89 ? 57  ALA A N     1 
ATOM   408   C  CA    . ALA A 1 57  ? 19.323  5.588   18.225   1.00 110.56 ? 57  ALA A CA    1 
ATOM   409   C  C     . ALA A 1 57  ? 19.001  4.165   18.535   1.00 97.15  ? 57  ALA A C     1 
ATOM   410   O  O     . ALA A 1 57  ? 18.261  3.925   19.457   1.00 108.54 ? 57  ALA A O     1 
ATOM   411   C  CB    . ALA A 1 57  ? 18.411  6.069   17.092   1.00 109.08 ? 57  ALA A CB    1 
ATOM   412   N  N     . GLN A 1 58  ? 19.547  3.232   17.771   1.00 88.05  ? 58  GLN A N     1 
ATOM   413   C  CA    . GLN A 1 58  ? 19.355  1.814   18.030   1.00 105.20 ? 58  GLN A CA    1 
ATOM   414   C  C     . GLN A 1 58  ? 19.845  1.441   19.422   1.00 130.16 ? 58  GLN A C     1 
ATOM   415   O  O     . GLN A 1 58  ? 19.183  0.744   20.195   1.00 136.10 ? 58  GLN A O     1 
ATOM   416   C  CB    . GLN A 1 58  ? 20.173  0.942   17.054   1.00 122.94 ? 58  GLN A CB    1 
ATOM   417   C  CG    . GLN A 1 58  ? 19.731  1.043   15.625   1.00 124.22 ? 58  GLN A CG    1 
ATOM   418   C  CD    . GLN A 1 58  ? 18.389  0.380   15.389   1.00 133.47 ? 58  GLN A CD    1 
ATOM   419   O  OE1   . GLN A 1 58  ? 18.119  -0.734  15.841   1.00 154.75 ? 58  GLN A OE1   1 
ATOM   420   N  NE2   . GLN A 1 58  ? 17.544  1.064   14.675   1.00 131.84 ? 58  GLN A NE2   1 
ATOM   421   N  N     . SER A 1 59  ? 21.027  1.950   19.746   1.00 142.17 ? 59  SER A N     1 
ATOM   422   C  CA    . SER A 1 59  ? 21.595  1.712   21.087   1.00 151.58 ? 59  SER A CA    1 
ATOM   423   C  C     . SER A 1 59  ? 20.647  2.240   22.195   1.00 107.39 ? 59  SER A C     1 
ATOM   424   O  O     . SER A 1 59  ? 20.286  1.541   23.133   1.00 99.40  ? 59  SER A O     1 
ATOM   425   C  CB    . SER A 1 59  ? 22.998  2.305   21.267   1.00 165.22 ? 59  SER A CB    1 
ATOM   426   O  OG    . SER A 1 59  ? 23.543  1.894   22.485   1.00 168.42 ? 59  SER A OG    1 
ATOM   427   N  N     . LYS A 1 60  ? 20.201  3.476   22.091   1.00 78.34  ? 60  LYS A N     1 
ATOM   428   C  CA    . LYS A 1 60  ? 19.334  4.042   23.106   1.00 83.84  ? 60  LYS A CA    1 
ATOM   429   C  C     . LYS A 1 60  ? 17.929  4.083   22.582   1.00 91.76  ? 60  LYS A C     1 
ATOM   430   O  O     . LYS A 1 60  ? 17.430  5.155   22.295   1.00 87.29  ? 60  LYS A O     1 
ATOM   431   C  CB    . LYS A 1 60  ? 19.794  5.469   23.445   1.00 106.57 ? 60  LYS A CB    1 
ATOM   432   C  CG    . LYS A 1 60  ? 21.160  5.588   24.140   1.00 132.53 ? 60  LYS A CG    1 
ATOM   433   C  CD    . LYS A 1 60  ? 21.471  7.018   24.630   1.00 164.44 ? 60  LYS A CD    1 
ATOM   434   C  CE    . LYS A 1 60  ? 22.865  7.159   25.250   1.00 188.59 ? 60  LYS A CE    1 
ATOM   435   N  NZ    . LYS A 1 60  ? 23.133  8.562   25.675   1.00 203.95 ? 60  LYS A NZ    1 
ATOM   436   N  N     . ARG A 1 61  ? 17.276  2.930   22.479   1.00 106.40 ? 61  ARG A N     1 
ATOM   437   C  CA    . ARG A 1 61  ? 15.956  2.777   21.777   1.00 111.71 ? 61  ARG A CA    1 
ATOM   438   C  C     . ARG A 1 61  ? 14.738  3.087   22.658   1.00 99.59  ? 61  ARG A C     1 
ATOM   439   O  O     . ARG A 1 61  ? 13.742  3.706   22.217   1.00 93.59  ? 61  ARG A O     1 
ATOM   440   C  CB    . ARG A 1 61  ? 15.857  1.333   21.281   1.00 120.28 ? 61  ARG A CB    1 
ATOM   441   C  CG    . ARG A 1 61  ? 14.896  1.046   20.145   1.00 115.30 ? 61  ARG A CG    1 
ATOM   442   C  CD    . ARG A 1 61  ? 15.090  -0.345  19.657   1.00 136.99 ? 61  ARG A CD    1 
ATOM   443   N  NE    . ARG A 1 61  ? 16.510  -0.569  19.313   1.00 143.94 ? 61  ARG A NE    1 
ATOM   444   C  CZ    . ARG A 1 61  ? 17.046  -1.770  19.115   1.00 163.75 ? 61  ARG A CZ    1 
ATOM   445   N  NH1   . ARG A 1 61  ? 16.259  -2.823  19.195   1.00 176.36 ? 61  ARG A NH1   1 
ATOM   446   N  NH2   . ARG A 1 61  ? 18.352  -1.930  18.819   1.00 167.82 ? 61  ARG A NH2   1 
ATOM   447   N  N     . GLY A 1 62  ? 14.828  2.597   23.893   1.00 97.56  ? 62  GLY A N     1 
ATOM   448   C  CA    . GLY A 1 62  ? 13.691  2.534   24.790   1.00 102.15 ? 62  GLY A CA    1 
ATOM   449   C  C     . GLY A 1 62  ? 13.115  3.895   25.084   1.00 101.16 ? 62  GLY A C     1 
ATOM   450   O  O     . GLY A 1 62  ? 11.887  4.062   25.072   1.00 104.00 ? 62  GLY A O     1 
ATOM   451   N  N     . ILE A 1 63  ? 14.017  4.864   25.291   1.00 104.80 ? 63  ILE A N     1 
ATOM   452   C  CA    . ILE A 1 63  ? 13.690  6.223   25.660   1.00 115.08 ? 63  ILE A CA    1 
ATOM   453   C  C     . ILE A 1 63  ? 13.082  6.956   24.471   1.00 105.82 ? 63  ILE A C     1 
ATOM   454   O  O     . ILE A 1 63  ? 12.117  7.675   24.628   1.00 90.07  ? 63  ILE A O     1 
ATOM   455   C  CB    . ILE A 1 63  ? 14.954  6.960   26.068   1.00 136.09 ? 63  ILE A CB    1 
ATOM   456   C  CG1   . ILE A 1 63  ? 15.599  6.229   27.244   1.00 158.31 ? 63  ILE A CG1   1 
ATOM   457   C  CG2   . ILE A 1 63  ? 14.634  8.423   26.318   1.00 144.82 ? 63  ILE A CG2   1 
ATOM   458   C  CD1   . ILE A 1 63  ? 14.662  5.972   28.404   1.00 172.65 ? 63  ILE A CD1   1 
ATOM   459   N  N     . LEU A 1 64  ? 13.641  6.705   23.302   1.00 105.77 ? 64  LEU A N     1 
ATOM   460   C  CA    . LEU A 1 64  ? 13.311  7.471   22.139   1.00 102.77 ? 64  LEU A CA    1 
ATOM   461   C  C     . LEU A 1 64  ? 12.069  6.953   21.500   1.00 92.90  ? 64  LEU A C     1 
ATOM   462   O  O     . LEU A 1 64  ? 11.764  5.764   21.589   1.00 86.58  ? 64  LEU A O     1 
ATOM   463   C  CB    . LEU A 1 64  ? 14.411  7.306   21.135   1.00 113.43 ? 64  LEU A CB    1 
ATOM   464   C  CG    . LEU A 1 64  ? 15.754  7.987   21.412   1.00 112.81 ? 64  LEU A CG    1 
ATOM   465   C  CD1   . LEU A 1 64  ? 16.215  7.803   22.846   1.00 112.90 ? 64  LEU A CD1   1 
ATOM   466   C  CD2   . LEU A 1 64  ? 16.824  7.586   20.376   1.00 112.12 ? 64  LEU A CD2   1 
ATOM   467   N  N     . THR A 1 65  ? 11.429  7.836   20.750   1.00 96.05  ? 65  THR A N     1 
ATOM   468   C  CA    . THR A 1 65  ? 10.476  7.460   19.738   1.00 111.50 ? 65  THR A CA    1 
ATOM   469   C  C     . THR A 1 65  ? 11.243  7.644   18.490   1.00 100.18 ? 65  THR A C     1 
ATOM   470   O  O     . THR A 1 65  ? 11.952  8.637   18.311   1.00 88.91  ? 65  THR A O     1 
ATOM   471   C  CB    . THR A 1 65  ? 9.210   8.368   19.721   1.00 138.20 ? 65  THR A CB    1 
ATOM   472   O  OG1   . THR A 1 65  ? 8.385   8.069   18.583   1.00 156.88 ? 65  THR A OG1   1 
ATOM   473   C  CG2   . THR A 1 65  ? 9.546   9.847   19.690   1.00 131.79 ? 65  THR A CG2   1 
ATOM   474   N  N     . LEU A 1 66  ? 11.101  6.696   17.588   1.00 100.94 ? 66  LEU A N     1 
ATOM   475   C  CA    . LEU A 1 66  ? 11.874  6.767   16.375   1.00 95.09  ? 66  LEU A CA    1 
ATOM   476   C  C     . LEU A 1 66  ? 10.950  7.203   15.293   1.00 97.27  ? 66  LEU A C     1 
ATOM   477   O  O     . LEU A 1 66  ? 9.789   6.806   15.268   1.00 96.46  ? 66  LEU A O     1 
ATOM   478   C  CB    . LEU A 1 66  ? 12.497  5.435   16.042   1.00 78.40  ? 66  LEU A CB    1 
ATOM   479   C  CG    . LEU A 1 66  ? 13.331  4.874   17.201   1.00 85.17  ? 66  LEU A CG    1 
ATOM   480   C  CD1   . LEU A 1 66  ? 13.594  3.375   17.061   1.00 107.97 ? 66  LEU A CD1   1 
ATOM   481   C  CD2   . LEU A 1 66  ? 14.632  5.669   17.416   1.00 88.28  ? 66  LEU A CD2   1 
ATOM   482   N  N     . LYS A 1 67  ? 11.469  8.019   14.385   1.00 106.37 ? 67  LYS A N     1 
ATOM   483   C  CA    . LYS A 1 67  ? 10.746  8.443   13.253   1.00 111.83 ? 67  LYS A CA    1 
ATOM   484   C  C     . LYS A 1 67  ? 11.646  8.187   12.061   1.00 100.24 ? 67  LYS A C     1 
ATOM   485   O  O     . LYS A 1 67  ? 12.754  8.737   11.959   1.00 88.65  ? 67  LYS A O     1 
ATOM   486   C  CB    . LYS A 1 67  ? 10.436  9.955   13.383   1.00 135.79 ? 67  LYS A CB    1 
ATOM   487   C  CG    . LYS A 1 67  ? 9.440   10.488  12.372   1.00 160.56 ? 67  LYS A CG    1 
ATOM   488   C  CD    . LYS A 1 67  ? 9.089   11.957  12.631   1.00 182.18 ? 67  LYS A CD    1 
ATOM   489   C  CE    . LYS A 1 67  ? 8.458   12.628  11.404   1.00 213.47 ? 67  LYS A CE    1 
ATOM   490   N  NZ    . LYS A 1 67  ? 7.252   11.884  10.928   1.00 224.73 ? 67  LYS A NZ    1 
ATOM   491   N  N     . TYR A 1 68  ? 11.191  7.324   11.168   1.00 97.77  ? 68  TYR A N     1 
ATOM   492   C  CA    . TYR A 1 68  ? 11.816  7.201   9.858    1.00 99.30  ? 68  TYR A CA    1 
ATOM   493   C  C     . TYR A 1 68  ? 11.441  8.419   8.995    1.00 92.69  ? 68  TYR A C     1 
ATOM   494   O  O     . TYR A 1 68  ? 10.270  8.603   8.689    1.00 97.50  ? 68  TYR A O     1 
ATOM   495   C  CB    . TYR A 1 68  ? 11.299  5.956   9.149    1.00 101.95 ? 68  TYR A CB    1 
ATOM   496   C  CG    . TYR A 1 68  ? 11.853  4.669   9.644    1.00 108.41 ? 68  TYR A CG    1 
ATOM   497   C  CD1   . TYR A 1 68  ? 13.190  4.393   9.512    1.00 105.23 ? 68  TYR A CD1   1 
ATOM   498   C  CD2   . TYR A 1 68  ? 11.027  3.709   10.185   1.00 115.34 ? 68  TYR A CD2   1 
ATOM   499   C  CE1   . TYR A 1 68  ? 13.709  3.176   9.937    1.00 106.83 ? 68  TYR A CE1   1 
ATOM   500   C  CE2   . TYR A 1 68  ? 11.528  2.500   10.604   1.00 123.37 ? 68  TYR A CE2   1 
ATOM   501   C  CZ    . TYR A 1 68  ? 12.878  2.233   10.481   1.00 112.62 ? 68  TYR A CZ    1 
ATOM   502   O  OH    . TYR A 1 68  ? 13.403  1.003   10.902   1.00 114.24 ? 68  TYR A OH    1 
ATOM   503   N  N     . PRO A 1 69  ? 12.421  9.243   8.584    1.00 81.02  ? 69  PRO A N     1 
ATOM   504   C  CA    . PRO A 1 69  ? 12.110  10.426  7.833    1.00 75.34  ? 69  PRO A CA    1 
ATOM   505   C  C     . PRO A 1 69  ? 11.665  10.124  6.404    1.00 72.75  ? 69  PRO A C     1 
ATOM   506   O  O     . PRO A 1 69  ? 11.043  10.965  5.754    1.00 84.78  ? 69  PRO A O     1 
ATOM   507   C  CB    . PRO A 1 69  ? 13.442  11.197  7.869    1.00 76.09  ? 69  PRO A CB    1 
ATOM   508   C  CG    . PRO A 1 69  ? 14.438  10.111  7.888    1.00 74.21  ? 69  PRO A CG    1 
ATOM   509   C  CD    . PRO A 1 69  ? 13.867  9.064   8.754    1.00 79.03  ? 69  PRO A CD    1 
ATOM   510   N  N     . ILE A 1 70  ? 12.056  8.982   5.848    1.00 76.85  ? 70  ILE A N     1 
ATOM   511   C  CA    . ILE A 1 70  ? 11.634  8.617   4.493    1.00 88.20  ? 70  ILE A CA    1 
ATOM   512   C  C     . ILE A 1 70  ? 10.535  7.562   4.572    1.00 92.23  ? 70  ILE A C     1 
ATOM   513   O  O     . ILE A 1 70  ? 10.725  6.544   5.249    1.00 99.53  ? 70  ILE A O     1 
ATOM   514   C  CB    . ILE A 1 70  ? 12.819  8.072   3.619    1.00 102.09 ? 70  ILE A CB    1 
ATOM   515   C  CG1   . ILE A 1 70  ? 14.090  8.893   3.851    1.00 114.85 ? 70  ILE A CG1   1 
ATOM   516   C  CG2   . ILE A 1 70  ? 12.381  8.021   2.149    1.00 107.16 ? 70  ILE A CG2   1 
ATOM   517   C  CD1   . ILE A 1 70  ? 15.268  8.306   3.115    1.00 136.29 ? 70  ILE A CD1   1 
ATOM   518   N  N     . GLU A 1 71  ? 9.408   7.800   3.891    1.00 101.89 ? 71  GLU A N     1 
ATOM   519   C  CA    . GLU A 1 71  ? 8.402   6.775   3.668    1.00 124.61 ? 71  GLU A CA    1 
ATOM   520   C  C     . GLU A 1 71  ? 7.980   6.622   2.233    1.00 115.80 ? 71  GLU A C     1 
ATOM   521   O  O     . GLU A 1 71  ? 7.465   7.562   1.640    1.00 122.68 ? 71  GLU A O     1 
ATOM   522   C  CB    . GLU A 1 71  ? 7.154   7.051   4.526    1.00 149.42 ? 71  GLU A CB    1 
ATOM   523   C  CG    . GLU A 1 71  ? 7.244   6.508   5.934    1.00 172.88 ? 71  GLU A CG    1 
ATOM   524   C  CD    . GLU A 1 71  ? 7.876   5.134   5.930    1.00 196.04 ? 71  GLU A CD    1 
ATOM   525   O  OE1   . GLU A 1 71  ? 7.335   4.240   5.239    1.00 225.18 ? 71  GLU A OE1   1 
ATOM   526   O  OE2   . GLU A 1 71  ? 8.925   4.959   6.573    1.00 189.09 ? 71  GLU A OE2   1 
ATOM   527   N  N     . HIS A 1 72  ? 8.153   5.415   1.703    1.00 103.79 ? 72  HIS A N     1 
ATOM   528   C  CA    . HIS A 1 72  ? 7.765   5.089   0.359    1.00 107.24 ? 72  HIS A CA    1 
ATOM   529   C  C     . HIS A 1 72  ? 8.619   5.851   -0.641   1.00 95.61  ? 72  HIS A C     1 
ATOM   530   O  O     . HIS A 1 72  ? 8.148   6.317   -1.683   1.00 105.52 ? 72  HIS A O     1 
ATOM   531   C  CB    . HIS A 1 72  ? 6.295   5.336   0.105    1.00 114.58 ? 72  HIS A CB    1 
ATOM   532   C  CG    . HIS A 1 72  ? 5.404   4.588   1.052    1.00 132.56 ? 72  HIS A CG    1 
ATOM   533   N  ND1   . HIS A 1 72  ? 5.614   3.269   1.400    1.00 140.17 ? 72  HIS A ND1   1 
ATOM   534   C  CD2   . HIS A 1 72  ? 4.316   4.987   1.751    1.00 158.50 ? 72  HIS A CD2   1 
ATOM   535   C  CE1   . HIS A 1 72  ? 4.678   2.876   2.250    1.00 148.60 ? 72  HIS A CE1   1 
ATOM   536   N  NE2   . HIS A 1 72  ? 3.876   3.901   2.480    1.00 165.20 ? 72  HIS A NE2   1 
ATOM   537   N  N     . GLY A 1 73  ? 9.881   5.995   -0.296   1.00 85.04  ? 73  GLY A N     1 
ATOM   538   C  CA    . GLY A 1 73  ? 10.827  6.749   -1.134   1.00 94.50  ? 73  GLY A CA    1 
ATOM   539   C  C     . GLY A 1 73  ? 10.605  8.249   -1.077   1.00 103.23 ? 73  GLY A C     1 
ATOM   540   O  O     . GLY A 1 73  ? 11.352  8.993   -1.691   1.00 120.25 ? 73  GLY A O     1 
ATOM   541   N  N     . ILE A 1 74  ? 9.611   8.725   -0.322   1.00 89.73  ? 74  ILE A N     1 
ATOM   542   C  CA    . ILE A 1 74  ? 9.364   10.132  -0.175   1.00 84.35  ? 74  ILE A CA    1 
ATOM   543   C  C     . ILE A 1 74  ? 9.916   10.589  1.151    1.00 90.32  ? 74  ILE A C     1 
ATOM   544   O  O     . ILE A 1 74  ? 9.556   9.975   2.184    1.00 95.32  ? 74  ILE A O     1 
ATOM   545   C  CB    . ILE A 1 74  ? 7.884   10.426  -0.104   1.00 93.45  ? 74  ILE A CB    1 
ATOM   546   C  CG1   . ILE A 1 74  ? 7.114   9.653   -1.181   1.00 86.92  ? 74  ILE A CG1   1 
ATOM   547   C  CG2   . ILE A 1 74  ? 7.630   11.934  -0.122   1.00 114.65 ? 74  ILE A CG2   1 
ATOM   548   C  CD1   . ILE A 1 74  ? 7.569   9.887   -2.590   1.00 90.91  ? 74  ILE A CD1   1 
ATOM   549   N  N     . VAL A 1 75  ? 10.601  11.737  1.192    1.00 98.24  ? 75  VAL A N     1 
ATOM   550   C  CA    . VAL A 1 75  ? 11.016  12.257  2.489    1.00 107.09 ? 75  VAL A CA    1 
ATOM   551   C  C     . VAL A 1 75  ? 9.797   12.974  3.105    1.00 93.08  ? 75  VAL A C     1 
ATOM   552   O  O     . VAL A 1 75  ? 9.266   13.928  2.561    1.00 69.50  ? 75  VAL A O     1 
ATOM   553   C  CB    . VAL A 1 75  ? 12.287  13.106  2.484    1.00 116.32 ? 75  VAL A CB    1 
ATOM   554   C  CG1   . VAL A 1 75  ? 13.428  12.325  1.847    1.00 128.57 ? 75  VAL A CG1   1 
ATOM   555   C  CG2   . VAL A 1 75  ? 12.097  14.390  1.762    1.00 121.92 ? 75  VAL A CG2   1 
ATOM   556   N  N     . THR A 1 76  ? 9.363   12.442  4.231    1.00 103.57 ? 76  THR A N     1 
ATOM   557   C  CA    . THR A 1 76  ? 8.320   13.130  5.010    1.00 102.46 ? 76  THR A CA    1 
ATOM   558   C  C     . THR A 1 76  ? 8.922   14.434  5.603    1.00 113.90 ? 76  THR A C     1 
ATOM   559   O  O     . THR A 1 76  ? 8.392   15.507  5.379    1.00 136.92 ? 76  THR A O     1 
ATOM   560   C  CB    . THR A 1 76  ? 7.736   12.159  6.049    1.00 103.58 ? 76  THR A CB    1 
ATOM   561   O  OG1   . THR A 1 76  ? 8.726   11.777  7.004    1.00 96.02  ? 76  THR A OG1   1 
ATOM   562   C  CG2   . THR A 1 76  ? 7.319   10.869  5.378    1.00 112.05 ? 76  THR A CG2   1 
ATOM   563   N  N     . ASN A 1 77  ? 10.039  14.332  6.309    1.00 112.92 ? 77  ASN A N     1 
ATOM   564   C  CA    . ASN A 1 77  ? 10.530  15.426  7.083    1.00 112.35 ? 77  ASN A CA    1 
ATOM   565   C  C     . ASN A 1 77  ? 11.949  15.742  6.696    1.00 101.89 ? 77  ASN A C     1 
ATOM   566   O  O     . ASN A 1 77  ? 12.845  14.911  6.833    1.00 97.78  ? 77  ASN A O     1 
ATOM   567   C  CB    . ASN A 1 77  ? 10.486  15.088  8.574    1.00 122.19 ? 77  ASN A CB    1 
ATOM   568   C  CG    . ASN A 1 77  ? 10.590  16.314  9.485    1.00 161.12 ? 77  ASN A CG    1 
ATOM   569   O  OD1   . ASN A 1 77  ? 10.899  17.427  9.049    1.00 181.01 ? 77  ASN A OD1   1 
ATOM   570   N  ND2   . ASN A 1 77  ? 10.285  16.118  10.758   1.00 176.15 ? 77  ASN A ND2   1 
ATOM   571   N  N     . TRP A 1 78  ? 12.148  16.965  6.212    1.00 105.89 ? 78  TRP A N     1 
ATOM   572   C  CA    . TRP A 1 78  ? 13.397  17.355  5.577    1.00 112.10 ? 78  TRP A CA    1 
ATOM   573   C  C     . TRP A 1 78  ? 14.449  17.615  6.581    1.00 121.37 ? 78  TRP A C     1 
ATOM   574   O  O     . TRP A 1 78  ? 15.628  17.246  6.390    1.00 140.41 ? 78  TRP A O     1 
ATOM   575   C  CB    . TRP A 1 78  ? 13.266  18.637  4.782    1.00 103.81 ? 78  TRP A CB    1 
ATOM   576   C  CG    . TRP A 1 78  ? 12.618  18.269  3.475    1.00 103.63 ? 78  TRP A CG    1 
ATOM   577   C  CD1   . TRP A 1 78  ? 11.313  18.433  3.084    1.00 109.57 ? 78  TRP A CD1   1 
ATOM   578   C  CD2   . TRP A 1 78  ? 13.265  17.580  2.425    1.00 105.55 ? 78  TRP A CD2   1 
ATOM   579   N  NE1   . TRP A 1 78  ? 11.139  17.936  1.815    1.00 112.41 ? 78  TRP A NE1   1 
ATOM   580   C  CE2   . TRP A 1 78  ? 12.334  17.403  1.393    1.00 116.51 ? 78  TRP A CE2   1 
ATOM   581   C  CE3   . TRP A 1 78  ? 14.560  17.128  2.270    1.00 109.05 ? 78  TRP A CE3   1 
ATOM   582   C  CZ2   . TRP A 1 78  ? 12.662  16.752  0.228    1.00 135.48 ? 78  TRP A CZ2   1 
ATOM   583   C  CZ3   . TRP A 1 78  ? 14.892  16.488  1.098    1.00 104.97 ? 78  TRP A CZ3   1 
ATOM   584   C  CH2   . TRP A 1 78  ? 13.973  16.350  0.083    1.00 120.43 ? 78  TRP A CH2   1 
ATOM   585   N  N     . ASP A 1 79  ? 14.153  18.361  7.636    1.00 121.43 ? 79  ASP A N     1 
ATOM   586   C  CA    . ASP A 1 79  ? 15.197  18.651  8.654    1.00 124.66 ? 79  ASP A CA    1 
ATOM   587   C  C     . ASP A 1 79  ? 15.797  17.368  9.171    1.00 125.35 ? 79  ASP A C     1 
ATOM   588   O  O     . ASP A 1 79  ? 16.965  17.295  9.419    1.00 127.52 ? 79  ASP A O     1 
ATOM   589   C  CB    . ASP A 1 79  ? 14.652  19.445  9.830    1.00 142.17 ? 79  ASP A CB    1 
ATOM   590   C  CG    . ASP A 1 79  ? 13.329  18.917  10.334   1.00 152.64 ? 79  ASP A CG    1 
ATOM   591   O  OD1   . ASP A 1 79  ? 13.100  17.716  10.155   1.00 158.15 ? 79  ASP A OD1   1 
ATOM   592   O  OD2   . ASP A 1 79  ? 12.518  19.692  10.879   1.00 159.07 ? 79  ASP A OD2   1 
ATOM   593   N  N     . ASP A 1 80  ? 14.955  16.333  9.300    1.00 114.25 ? 80  ASP A N     1 
ATOM   594   C  CA    . ASP A 1 80  ? 15.412  15.043  9.760    1.00 109.56 ? 80  ASP A CA    1 
ATOM   595   C  C     . ASP A 1 80  ? 16.403  14.460  8.786    1.00 87.81  ? 80  ASP A C     1 
ATOM   596   O  O     . ASP A 1 80  ? 17.442  13.961  9.181    1.00 77.82  ? 80  ASP A O     1 
ATOM   597   C  CB    . ASP A 1 80  ? 14.243  14.062  9.950    1.00 131.69 ? 80  ASP A CB    1 
ATOM   598   C  CG    . ASP A 1 80  ? 13.296  14.534  10.999   1.00 161.72 ? 80  ASP A CG    1 
ATOM   599   O  OD1   . ASP A 1 80  ? 13.675  15.449  11.748   1.00 172.12 ? 80  ASP A OD1   1 
ATOM   600   O  OD2   . ASP A 1 80  ? 12.170  13.994  11.081   1.00 174.95 ? 80  ASP A OD2   1 
ATOM   601   N  N     . MET A 1 81  ? 16.061  14.518  7.494    1.00 87.35  ? 81  MET A N     1 
ATOM   602   C  CA    . MET A 1 81  ? 16.955  14.016  6.462    1.00 98.09  ? 81  MET A CA    1 
ATOM   603   C  C     . MET A 1 81  ? 18.286  14.738  6.494    1.00 95.08  ? 81  MET A C     1 
ATOM   604   O  O     . MET A 1 81  ? 19.368  14.162  6.407    1.00 101.26 ? 81  MET A O     1 
ATOM   605   C  CB    . MET A 1 81  ? 16.325  14.215  5.061    1.00 108.33 ? 81  MET A CB    1 
ATOM   606   C  CG    . MET A 1 81  ? 17.162  13.650  3.956    1.00 126.52 ? 81  MET A CG    1 
ATOM   607   S  SD    . MET A 1 81  ? 17.841  11.963  4.014    1.00 123.82 ? 81  MET A SD    1 
ATOM   608   C  CE    . MET A 1 81  ? 16.370  11.139  4.550    1.00 129.09 ? 81  MET A CE    1 
ATOM   609   N  N     . GLU A 1 82  ? 18.198  16.051  6.605    1.00 95.87  ? 82  GLU A N     1 
ATOM   610   C  CA    . GLU A 1 82  ? 19.408  16.869  6.688    1.00 103.20 ? 82  GLU A CA    1 
ATOM   611   C  C     . GLU A 1 82  ? 20.214  16.381  7.857    1.00 93.46  ? 82  GLU A C     1 
ATOM   612   O  O     . GLU A 1 82  ? 21.418  16.279  7.739    1.00 93.96  ? 82  GLU A O     1 
ATOM   613   C  CB    . GLU A 1 82  ? 19.105  18.376  6.833    1.00 123.94 ? 82  GLU A CB    1 
ATOM   614   C  CG    . GLU A 1 82  ? 20.316  19.269  6.998    1.00 147.99 ? 82  GLU A CG    1 
ATOM   615   C  CD    . GLU A 1 82  ? 20.690  19.545  8.449    1.00 174.55 ? 82  GLU A CD    1 
ATOM   616   O  OE1   . GLU A 1 82  ? 19.769  19.722  9.288    1.00 187.97 ? 82  GLU A OE1   1 
ATOM   617   O  OE2   . GLU A 1 82  ? 21.913  19.598  8.740    1.00 174.59 ? 82  GLU A OE2   1 
ATOM   618   N  N     . LYS A 1 83  ? 19.582  16.096  8.997    1.00 89.09  ? 83  LYS A N     1 
ATOM   619   C  CA    . LYS A 1 83  ? 20.322  15.650  10.170   1.00 90.23  ? 83  LYS A CA    1 
ATOM   620   C  C     . LYS A 1 83  ? 21.036  14.352  9.868    1.00 83.30  ? 83  LYS A C     1 
ATOM   621   O  O     . LYS A 1 83  ? 22.196  14.152  10.266   1.00 90.59  ? 83  LYS A O     1 
ATOM   622   C  CB    . LYS A 1 83  ? 19.396  15.370  11.351   1.00 93.56  ? 83  LYS A CB    1 
ATOM   623   C  CG    . LYS A 1 83  ? 18.876  16.606  12.029   1.00 115.45 ? 83  LYS A CG    1 
ATOM   624   C  CD    . LYS A 1 83  ? 17.918  16.270  13.189   1.00 126.52 ? 83  LYS A CD    1 
ATOM   625   C  CE    . LYS A 1 83  ? 17.628  17.473  14.071   1.00 143.76 ? 83  LYS A CE    1 
ATOM   626   N  NZ    . LYS A 1 83  ? 16.862  17.035  15.271   1.00 156.00 ? 83  LYS A NZ    1 
ATOM   627   N  N     . ILE A 1 84  ? 20.338  13.450  9.144    1.00 74.95  ? 84  ILE A N     1 
ATOM   628   C  CA    . ILE A 1 84  ? 20.940  12.161  8.838    1.00 70.44  ? 84  ILE A CA    1 
ATOM   629   C  C     . ILE A 1 84  ? 22.156  12.340  7.971    1.00 72.65  ? 84  ILE A C     1 
ATOM   630   O  O     . ILE A 1 84  ? 23.173  11.712  8.225    1.00 74.39  ? 84  ILE A O     1 
ATOM   631   C  CB    . ILE A 1 84  ? 19.935  11.274  8.130    1.00 74.37  ? 84  ILE A CB    1 
ATOM   632   C  CG1   . ILE A 1 84  ? 18.917  10.831  9.180    1.00 78.92  ? 84  ILE A CG1   1 
ATOM   633   C  CG2   . ILE A 1 84  ? 20.635  10.050  7.569    1.00 77.69  ? 84  ILE A CG2   1 
ATOM   634   C  CD1   . ILE A 1 84  ? 17.895  9.803   8.710    1.00 85.33  ? 84  ILE A CD1   1 
ATOM   635   N  N     . TRP A 1 85  ? 22.049  13.182  6.943    1.00 72.97  ? 85  TRP A N     1 
ATOM   636   C  CA    . TRP A 1 85  ? 23.192  13.449  6.085    1.00 74.35  ? 85  TRP A CA    1 
ATOM   637   C  C     . TRP A 1 85  ? 24.334  14.065  6.858    1.00 74.44  ? 85  TRP A C     1 
ATOM   638   O  O     . TRP A 1 85  ? 25.476  13.679  6.677    1.00 73.96  ? 85  TRP A O     1 
ATOM   639   C  CB    . TRP A 1 85  ? 22.824  14.310  4.906    1.00 74.54  ? 85  TRP A CB    1 
ATOM   640   C  CG    . TRP A 1 85  ? 22.103  13.570  3.792    1.00 68.96  ? 85  TRP A CG    1 
ATOM   641   C  CD1   . TRP A 1 85  ? 22.284  12.292  3.374    1.00 65.74  ? 85  TRP A CD1   1 
ATOM   642   C  CD2   . TRP A 1 85  ? 21.159  14.152  2.910    1.00 75.74  ? 85  TRP A CD2   1 
ATOM   643   N  NE1   . TRP A 1 85  ? 21.478  12.032  2.293    1.00 71.88  ? 85  TRP A NE1   1 
ATOM   644   C  CE2   . TRP A 1 85  ? 20.779  13.172  1.988    1.00 80.43  ? 85  TRP A CE2   1 
ATOM   645   C  CE3   . TRP A 1 85  ? 20.637  15.427  2.814    1.00 80.89  ? 85  TRP A CE3   1 
ATOM   646   C  CZ2   . TRP A 1 85  ? 19.832  13.411  1.022    1.00 96.70  ? 85  TRP A CZ2   1 
ATOM   647   C  CZ3   . TRP A 1 85  ? 19.703  15.677  1.853    1.00 84.06  ? 85  TRP A CZ3   1 
ATOM   648   C  CH2   . TRP A 1 85  ? 19.306  14.688  0.968    1.00 100.00 ? 85  TRP A CH2   1 
ATOM   649   N  N     . HIS A 1 86  ? 24.016  14.981  7.748    1.00 75.16  ? 86  HIS A N     1 
ATOM   650   C  CA    . HIS A 1 86  ? 24.966  15.653  8.632    1.00 84.48  ? 86  HIS A CA    1 
ATOM   651   C  C     . HIS A 1 86  ? 25.775  14.559  9.332    1.00 79.82  ? 86  HIS A C     1 
ATOM   652   O  O     . HIS A 1 86  ? 26.997  14.587  9.379    1.00 89.88  ? 86  HIS A O     1 
ATOM   653   C  CB    . HIS A 1 86  ? 24.211  16.552  9.636    1.00 100.13 ? 86  HIS A CB    1 
ATOM   654   C  CG    . HIS A 1 86  ? 25.118  17.443  10.423   1.00 139.12 ? 86  HIS A CG    1 
ATOM   655   N  ND1   . HIS A 1 86  ? 25.720  17.058  11.605   1.00 165.39 ? 86  HIS A ND1   1 
ATOM   656   C  CD2   . HIS A 1 86  ? 25.540  18.706  10.185   1.00 158.56 ? 86  HIS A CD2   1 
ATOM   657   C  CE1   . HIS A 1 86  ? 26.474  18.050  12.062   1.00 183.41 ? 86  HIS A CE1   1 
ATOM   658   N  NE2   . HIS A 1 86  ? 26.382  19.063  11.218   1.00 178.22 ? 86  HIS A NE2   1 
ATOM   659   N  N     . HIS A 1 87  ? 25.044  13.625  9.929    1.00 81.08  ? 87  HIS A N     1 
ATOM   660   C  CA    . HIS A 1 87  ? 25.623  12.544  10.666   1.00 94.76  ? 87  HIS A CA    1 
ATOM   661   C  C     . HIS A 1 87  ? 26.564  11.700  9.753    1.00 86.50  ? 87  HIS A C     1 
ATOM   662   O  O     . HIS A 1 87  ? 27.686  11.356  10.152   1.00 84.34  ? 87  HIS A O     1 
ATOM   663   C  CB    . HIS A 1 87  ? 24.520  11.712  11.369   1.00 102.94 ? 87  HIS A CB    1 
ATOM   664   C  CG    . HIS A 1 87  ? 25.042  10.499  12.097   1.00 105.37 ? 87  HIS A CG    1 
ATOM   665   N  ND1   . HIS A 1 87  ? 25.217  9.277   11.482   1.00 90.57  ? 87  HIS A ND1   1 
ATOM   666   C  CD2   . HIS A 1 87  ? 25.319  10.304  13.404   1.00 113.72 ? 87  HIS A CD2   1 
ATOM   667   C  CE1   . HIS A 1 87  ? 25.620  8.387   12.375   1.00 95.17  ? 87  HIS A CE1   1 
ATOM   668   N  NE2   . HIS A 1 87  ? 25.698  8.985   13.553   1.00 107.21 ? 87  HIS A NE2   1 
ATOM   669   N  N     . THR A 1 88  ? 26.099  11.461  8.542    1.00 79.72  ? 88  THR A N     1 
ATOM   670   C  CA    . THR A 1 88  ? 26.944  10.654  7.655    1.00 87.58  ? 88  THR A CA    1 
ATOM   671   C  C     . THR A 1 88  ? 28.271  11.332  7.388    1.00 87.32  ? 88  THR A C     1 
ATOM   672   O  O     . THR A 1 88  ? 29.350  10.726  7.548    1.00 77.78  ? 88  THR A O     1 
ATOM   673   C  CB    . THR A 1 88  ? 26.488  10.465  6.225    1.00 89.98  ? 88  THR A CB    1 
ATOM   674   O  OG1   . THR A 1 88  ? 26.520  11.694  5.477    1.00 85.99  ? 88  THR A OG1   1 
ATOM   675   C  CG2   . THR A 1 88  ? 25.147  9.804   6.125    1.00 103.45 ? 88  THR A CG2   1 
ATOM   676   N  N     . PHE A 1 89  ? 28.204  12.604  6.986    1.00 95.57  ? 89  PHE A N     1 
ATOM   677   C  CA    . PHE A 1 89  ? 29.426  13.276  6.619    1.00 97.21  ? 89  PHE A CA    1 
ATOM   678   C  C     . PHE A 1 89  ? 30.315  13.487  7.828    1.00 95.91  ? 89  PHE A C     1 
ATOM   679   O  O     . PHE A 1 89  ? 31.484  13.093  7.832    1.00 113.12 ? 89  PHE A O     1 
ATOM   680   C  CB    . PHE A 1 89  ? 29.162  14.595  5.947    1.00 110.18 ? 89  PHE A CB    1 
ATOM   681   C  CG    . PHE A 1 89  ? 28.470  14.451  4.640    1.00 114.02 ? 89  PHE A CG    1 
ATOM   682   C  CD1   . PHE A 1 89  ? 29.099  13.907  3.552    1.00 113.62 ? 89  PHE A CD1   1 
ATOM   683   C  CD2   . PHE A 1 89  ? 27.179  14.907  4.494    1.00 106.03 ? 89  PHE A CD2   1 
ATOM   684   C  CE1   . PHE A 1 89  ? 28.452  13.802  2.335    1.00 122.87 ? 89  PHE A CE1   1 
ATOM   685   C  CE2   . PHE A 1 89  ? 26.512  14.799  3.287    1.00 99.67  ? 89  PHE A CE2   1 
ATOM   686   C  CZ    . PHE A 1 89  ? 27.150  14.250  2.210    1.00 117.84 ? 89  PHE A CZ    1 
ATOM   687   N  N     . TYR A 1 90  ? 29.799  14.167  8.858    1.00 96.49  ? 90  TYR A N     1 
ATOM   688   C  CA    . TYR A 1 90  ? 30.641  14.524  9.978    1.00 106.37 ? 90  TYR A CA    1 
ATOM   689   C  C     . TYR A 1 90  ? 30.944  13.396  10.938   1.00 95.49  ? 90  TYR A C     1 
ATOM   690   O  O     . TYR A 1 90  ? 32.085  13.228  11.352   1.00 91.70  ? 90  TYR A O     1 
ATOM   691   C  CB    . TYR A 1 90  ? 30.114  15.765  10.719   1.00 122.33 ? 90  TYR A CB    1 
ATOM   692   C  CG    . TYR A 1 90  ? 29.987  16.893  9.751    1.00 139.03 ? 90  TYR A CG    1 
ATOM   693   C  CD1   . TYR A 1 90  ? 31.085  17.346  9.020    1.00 141.91 ? 90  TYR A CD1   1 
ATOM   694   C  CD2   . TYR A 1 90  ? 28.787  17.551  9.614    1.00 147.86 ? 90  TYR A CD2   1 
ATOM   695   C  CE1   . TYR A 1 90  ? 30.966  18.418  8.184    1.00 149.24 ? 90  TYR A CE1   1 
ATOM   696   C  CE2   . TYR A 1 90  ? 28.659  18.622  8.760    1.00 152.36 ? 90  TYR A CE2   1 
ATOM   697   C  CZ    . TYR A 1 90  ? 29.747  19.051  8.030    1.00 162.26 ? 90  TYR A CZ    1 
ATOM   698   O  OH    . TYR A 1 90  ? 29.612  20.136  7.147    1.00 169.27 ? 90  TYR A OH    1 
ATOM   699   N  N     . ASN A 1 91  ? 29.911  12.674  11.366   1.00 91.57  ? 91  ASN A N     1 
ATOM   700   C  CA    . ASN A 1 91  ? 30.118  11.582  12.294   1.00 97.14  ? 91  ASN A CA    1 
ATOM   701   C  C     . ASN A 1 91  ? 30.818  10.365  11.798   1.00 111.18 ? 91  ASN A C     1 
ATOM   702   O  O     . ASN A 1 91  ? 31.650  9.857   12.552   1.00 108.66 ? 91  ASN A O     1 
ATOM   703   C  CB    . ASN A 1 91  ? 28.798  11.213  13.023   1.00 105.21 ? 91  ASN A CB    1 
ATOM   704   C  CG    . ASN A 1 91  ? 28.212  12.398  13.740   1.00 121.53 ? 91  ASN A CG    1 
ATOM   705   O  OD1   . ASN A 1 91  ? 26.998  12.585  13.792   1.00 124.10 ? 91  ASN A OD1   1 
ATOM   706   N  ND2   . ASN A 1 91  ? 29.077  13.220  14.338   1.00 138.49 ? 91  ASN A ND2   1 
ATOM   707   N  N     . GLU A 1 92  ? 30.603  9.925   10.553   1.00 131.09 ? 92  GLU A N     1 
ATOM   708   C  CA    . GLU A 1 92  ? 31.260  8.739   10.061   1.00 139.25 ? 92  GLU A CA    1 
ATOM   709   C  C     . GLU A 1 92  ? 32.414  8.996   9.146    1.00 140.01 ? 92  GLU A C     1 
ATOM   710   O  O     . GLU A 1 92  ? 33.511  8.517   9.416    1.00 139.82 ? 92  GLU A O     1 
ATOM   711   C  CB    . GLU A 1 92  ? 30.314  7.791   9.297    1.00 124.48 ? 92  GLU A CB    1 
ATOM   712   C  CG    . GLU A 1 92  ? 29.680  6.723   10.179   1.00 133.86 ? 92  GLU A CG    1 
ATOM   713   C  CD    . GLU A 1 92  ? 28.579  7.285   11.009   1.00 143.00 ? 92  GLU A CD    1 
ATOM   714   O  OE1   . GLU A 1 92  ? 28.045  8.339   10.607   1.00 138.31 ? 92  GLU A OE1   1 
ATOM   715   O  OE2   . GLU A 1 92  ? 28.248  6.661   12.049   1.00 158.68 ? 92  GLU A OE2   1 
ATOM   716   N  N     . LEU A 1 93  ? 32.145  9.672   8.028    1.00 132.59 ? 93  LEU A N     1 
ATOM   717   C  CA    . LEU A 1 93  ? 33.129  9.814   6.930    1.00 128.13 ? 93  LEU A CA    1 
ATOM   718   C  C     . LEU A 1 93  ? 34.171  10.845  7.291    1.00 123.60 ? 93  LEU A C     1 
ATOM   719   O  O     . LEU A 1 93  ? 35.292  10.698  6.888    1.00 104.04 ? 93  LEU A O     1 
ATOM   720   C  CB    . LEU A 1 93  ? 32.459  10.062  5.549    1.00 122.70 ? 93  LEU A CB    1 
ATOM   721   C  CG    . LEU A 1 93  ? 31.524  8.896   5.148    1.00 122.89 ? 93  LEU A CG    1 
ATOM   722   C  CD1   . LEU A 1 93  ? 30.857  9.152   3.800    1.00 134.06 ? 93  LEU A CD1   1 
ATOM   723   C  CD2   . LEU A 1 93  ? 32.256  7.548   5.218    1.00 119.69 ? 93  LEU A CD2   1 
ATOM   724   N  N     . ARG A 1 94  ? 33.789  11.883  8.016    1.00 140.21 ? 94  ARG A N     1 
ATOM   725   C  CA    . ARG A 1 94  ? 34.703  12.917  8.392    1.00 140.00 ? 94  ARG A CA    1 
ATOM   726   C  C     . ARG A 1 94  ? 35.252  13.602  7.154    1.00 130.40 ? 94  ARG A C     1 
ATOM   727   O  O     . ARG A 1 94  ? 36.449  13.733  6.931    1.00 148.40 ? 94  ARG A O     1 
ATOM   728   C  CB    . ARG A 1 94  ? 35.830  12.355  9.272    1.00 147.28 ? 94  ARG A CB    1 
ATOM   729   C  CG    . ARG A 1 94  ? 35.318  11.645  10.497   1.00 148.98 ? 94  ARG A CG    1 
ATOM   730   C  CD    . ARG A 1 94  ? 36.472  11.216  11.376   1.00 153.19 ? 94  ARG A CD    1 
ATOM   731   N  NE    . ARG A 1 94  ? 35.966  10.449  12.522   1.00 174.05 ? 94  ARG A NE    1 
ATOM   732   C  CZ    . ARG A 1 94  ? 36.743  9.838   13.412   1.00 194.79 ? 94  ARG A CZ    1 
ATOM   733   N  NH1   . ARG A 1 94  ? 38.060  9.924   13.272   1.00 207.31 ? 94  ARG A NH1   1 
ATOM   734   N  NH2   . ARG A 1 94  ? 36.218  9.142   14.447   1.00 200.63 ? 94  ARG A NH2   1 
ATOM   735   N  N     . VAL A 1 95  ? 34.335  14.052  6.312    1.00 120.00 ? 95  VAL A N     1 
ATOM   736   C  CA    . VAL A 1 95  ? 34.670  14.764  5.094    1.00 114.59 ? 95  VAL A CA    1 
ATOM   737   C  C     . VAL A 1 95  ? 34.016  16.128  5.091    1.00 108.85 ? 95  VAL A C     1 
ATOM   738   O  O     . VAL A 1 95  ? 32.959  16.353  5.680    1.00 93.79  ? 95  VAL A O     1 
ATOM   739   C  CB    . VAL A 1 95  ? 34.194  13.971  3.859    1.00 113.30 ? 95  VAL A CB    1 
ATOM   740   C  CG1   . VAL A 1 95  ? 34.993  12.673  3.755    1.00 96.38  ? 95  VAL A CG1   1 
ATOM   741   C  CG2   . VAL A 1 95  ? 32.659  13.729  3.925    1.00 125.79 ? 95  VAL A CG2   1 
ATOM   742   N  N     . ALA A 1 96  ? 34.622  17.063  4.360    1.00 119.27 ? 96  ALA A N     1 
ATOM   743   C  CA    . ALA A 1 96  ? 34.015  18.329  4.063    1.00 146.80 ? 96  ALA A CA    1 
ATOM   744   C  C     . ALA A 1 96  ? 33.446  18.152  2.699    1.00 146.15 ? 96  ALA A C     1 
ATOM   745   O  O     . ALA A 1 96  ? 34.178  17.934  1.746    1.00 158.71 ? 96  ALA A O     1 
ATOM   746   C  CB    . ALA A 1 96  ? 35.050  19.487  4.037    1.00 165.20 ? 96  ALA A CB    1 
ATOM   747   N  N     . PRO A 1 97  ? 32.127  18.230  2.565    1.00 132.24 ? 97  PRO A N     1 
ATOM   748   C  CA    . PRO A 1 97  ? 31.508  17.983  1.293    1.00 124.05 ? 97  PRO A CA    1 
ATOM   749   C  C     . PRO A 1 97  ? 31.898  18.975  0.219    1.00 127.98 ? 97  PRO A C     1 
ATOM   750   O  O     . PRO A 1 97  ? 31.814  18.654  -0.947   1.00 135.17 ? 97  PRO A O     1 
ATOM   751   C  CB    . PRO A 1 97  ? 30.005  17.993  1.626    1.00 135.43 ? 97  PRO A CB    1 
ATOM   752   C  CG    . PRO A 1 97  ? 29.956  17.472  3.026    1.00 138.63 ? 97  PRO A CG    1 
ATOM   753   C  CD    . PRO A 1 97  ? 31.209  18.005  3.668    1.00 133.05 ? 97  PRO A CD    1 
ATOM   754   N  N     . GLU A 1 98  ? 32.321  20.182  0.595    1.00 131.69 ? 98  GLU A N     1 
ATOM   755   C  CA    . GLU A 1 98  ? 33.035  21.064  -0.313   1.00 131.83 ? 98  GLU A CA    1 
ATOM   756   C  C     . GLU A 1 98  ? 34.164  20.414  -1.070   1.00 124.00 ? 98  GLU A C     1 
ATOM   757   O  O     . GLU A 1 98  ? 34.491  20.880  -2.145   1.00 125.27 ? 98  GLU A O     1 
ATOM   758   C  CB    . GLU A 1 98  ? 33.643  22.302  0.385    1.00 148.58 ? 98  GLU A CB    1 
ATOM   759   C  CG    . GLU A 1 98  ? 32.656  23.232  1.044    1.00 172.86 ? 98  GLU A CG    1 
ATOM   760   C  CD    . GLU A 1 98  ? 32.303  22.814  2.444    1.00 184.28 ? 98  GLU A CD    1 
ATOM   761   O  OE1   . GLU A 1 98  ? 32.638  21.652  2.789    1.00 193.32 ? 98  GLU A OE1   1 
ATOM   762   O  OE2   . GLU A 1 98  ? 31.690  23.614  3.160    1.00 192.41 ? 98  GLU A OE2   1 
ATOM   763   N  N     . GLU A 1 99  ? 34.813  19.403  -0.491   1.00 128.54 ? 99  GLU A N     1 
ATOM   764   C  CA    . GLU A 1 99  ? 35.916  18.728  -1.113   1.00 127.46 ? 99  GLU A CA    1 
ATOM   765   C  C     . GLU A 1 99  ? 35.528  17.474  -1.900   1.00 107.71 ? 99  GLU A C     1 
ATOM   766   O  O     . GLU A 1 99  ? 36.424  16.736  -2.221   1.00 100.23 ? 99  GLU A O     1 
ATOM   767   C  CB    . GLU A 1 99  ? 36.944  18.361  -0.046   1.00 160.25 ? 99  GLU A CB    1 
ATOM   768   C  CG    . GLU A 1 99  ? 37.429  19.542  0.797    1.00 190.68 ? 99  GLU A CG    1 
ATOM   769   C  CD    . GLU A 1 99  ? 38.184  19.132  2.049    1.00 216.11 ? 99  GLU A CD    1 
ATOM   770   O  OE1   . GLU A 1 99  ? 38.142  17.955  2.489    1.00 213.14 ? 99  GLU A OE1   1 
ATOM   771   O  OE2   . GLU A 1 99  ? 38.839  20.020  2.636    1.00 224.48 ? 99  GLU A OE2   1 
ATOM   772   N  N     . HIS A 1 100 ? 34.270  17.213  -2.205   1.00 99.72  ? 100 HIS A N     1 
ATOM   773   C  CA    . HIS A 1 100 ? 33.864  16.009  -2.920   1.00 93.68  ? 100 HIS A CA    1 
ATOM   774   C  C     . HIS A 1 100 ? 32.557  16.211  -3.614   1.00 88.08  ? 100 HIS A C     1 
ATOM   775   O  O     . HIS A 1 100 ? 31.682  16.893  -3.122   1.00 96.90  ? 100 HIS A O     1 
ATOM   776   C  CB    . HIS A 1 100 ? 33.661  14.843  -1.975   1.00 100.36 ? 100 HIS A CB    1 
ATOM   777   C  CG    . HIS A 1 100 ? 34.897  14.444  -1.221   1.00 108.73 ? 100 HIS A CG    1 
ATOM   778   N  ND1   . HIS A 1 100 ? 35.905  13.684  -1.780   1.00 116.28 ? 100 HIS A ND1   1 
ATOM   779   C  CD2   . HIS A 1 100 ? 35.322  14.779  0.015    1.00 120.16 ? 100 HIS A CD2   1 
ATOM   780   C  CE1   . HIS A 1 100 ? 36.881  13.527  -0.900   1.00 134.24 ? 100 HIS A CE1   1 
ATOM   781   N  NE2   . HIS A 1 100 ? 36.550  14.181  0.202    1.00 136.64 ? 100 HIS A NE2   1 
ATOM   782   N  N     . PRO A 1 101 ? 32.434  15.649  -4.810   1.00 79.33  ? 101 PRO A N     1 
ATOM   783   C  CA    . PRO A 1 101 ? 31.200  15.615  -5.518   1.00 78.07  ? 101 PRO A CA    1 
ATOM   784   C  C     . PRO A 1 101 ? 30.406  14.518  -4.860   1.00 73.03  ? 101 PRO A C     1 
ATOM   785   O  O     . PRO A 1 101 ? 30.997  13.516  -4.440   1.00 63.13  ? 101 PRO A O     1 
ATOM   786   C  CB    . PRO A 1 101 ? 31.633  15.283  -6.990   1.00 78.36  ? 101 PRO A CB    1 
ATOM   787   C  CG    . PRO A 1 101 ? 33.066  15.592  -7.079   1.00 75.71  ? 101 PRO A CG    1 
ATOM   788   C  CD    . PRO A 1 101 ? 33.598  15.411  -5.675   1.00 78.17  ? 101 PRO A CD    1 
ATOM   789   N  N     . VAL A 1 102 ? 29.078  14.682  -4.751   1.00 73.55  ? 102 VAL A N     1 
ATOM   790   C  CA    . VAL A 1 102 ? 28.317  13.667  -4.085   1.00 80.32  ? 102 VAL A CA    1 
ATOM   791   C  C     . VAL A 1 102 ? 27.226  13.127  -4.968   1.00 82.72  ? 102 VAL A C     1 
ATOM   792   O  O     . VAL A 1 102 ? 26.496  13.849  -5.601   1.00 81.03  ? 102 VAL A O     1 
ATOM   793   C  CB    . VAL A 1 102 ? 27.696  14.186  -2.795   1.00 75.10  ? 102 VAL A CB    1 
ATOM   794   C  CG1   . VAL A 1 102 ? 26.761  15.394  -3.058   1.00 81.79  ? 102 VAL A CG1   1 
ATOM   795   C  CG2   . VAL A 1 102 ? 26.993  13.034  -2.068   1.00 75.46  ? 102 VAL A CG2   1 
ATOM   796   N  N     . LEU A 1 103 ? 27.128  11.800  -4.966   1.00 75.10  ? 103 LEU A N     1 
ATOM   797   C  CA    . LEU A 1 103 ? 26.082  11.117  -5.716   1.00 63.80  ? 103 LEU A CA    1 
ATOM   798   C  C     . LEU A 1 103 ? 25.025  10.683  -4.793   1.00 65.16  ? 103 LEU A C     1 
ATOM   799   O  O     . LEU A 1 103 ? 25.306  10.024  -3.831   1.00 54.91  ? 103 LEU A O     1 
ATOM   800   C  CB    . LEU A 1 103 ? 26.625  9.849   -6.356   1.00 63.62  ? 103 LEU A CB    1 
ATOM   801   C  CG    . LEU A 1 103 ? 25.611  8.838   -6.968   1.00 63.72  ? 103 LEU A CG    1 
ATOM   802   C  CD1   . LEU A 1 103 ? 24.766  9.541   -8.038   1.00 70.97  ? 103 LEU A CD1   1 
ATOM   803   C  CD2   . LEU A 1 103 ? 26.307  7.597   -7.554   1.00 63.02  ? 103 LEU A CD2   1 
ATOM   804   N  N     . LEU A 1 104 ? 23.757  10.971  -5.107   1.00 86.58  ? 104 LEU A N     1 
ATOM   805   C  CA    . LEU A 1 104 ? 22.641  10.414  -4.355   1.00 100.36 ? 104 LEU A CA    1 
ATOM   806   C  C     . LEU A 1 104 ? 21.830  9.458   -5.213   1.00 103.48 ? 104 LEU A C     1 
ATOM   807   O  O     . LEU A 1 104 ? 21.640  9.695   -6.424   1.00 111.12 ? 104 LEU A O     1 
ATOM   808   C  CB    . LEU A 1 104 ? 21.632  11.499  -3.869   1.00 101.57 ? 104 LEU A CB    1 
ATOM   809   C  CG    . LEU A 1 104 ? 22.207  12.443  -2.800   1.00 107.35 ? 104 LEU A CG    1 
ATOM   810   C  CD1   . LEU A 1 104 ? 21.419  13.736  -2.667   1.00 107.73 ? 104 LEU A CD1   1 
ATOM   811   C  CD2   . LEU A 1 104 ? 22.374  11.705  -1.456   1.00 113.21 ? 104 LEU A CD2   1 
ATOM   812   N  N     . THR A 1 105 ? 21.310  8.426   -4.574   1.00 114.56 ? 105 THR A N     1 
ATOM   813   C  CA    . THR A 1 105 ? 20.360  7.547   -5.202   1.00 135.90 ? 105 THR A CA    1 
ATOM   814   C  C     . THR A 1 105 ? 18.970  8.120   -4.977   1.00 116.85 ? 105 THR A C     1 
ATOM   815   O  O     . THR A 1 105 ? 18.757  8.996   -4.149   1.00 104.13 ? 105 THR A O     1 
ATOM   816   C  CB    . THR A 1 105 ? 20.474  6.091   -4.693   1.00 170.50 ? 105 THR A CB    1 
ATOM   817   O  OG1   . THR A 1 105 ? 19.916  5.224   -5.704   1.00 170.76 ? 105 THR A OG1   1 
ATOM   818   C  CG2   . THR A 1 105 ? 19.689  5.885   -3.451   1.00 197.24 ? 105 THR A CG2   1 
ATOM   819   N  N     . GLU A 1 106 ? 18.024  7.580   -5.711   1.00 115.47 ? 106 GLU A N     1 
ATOM   820   C  CA    . GLU A 1 106 ? 16.615  7.955   -5.532   1.00 123.02 ? 106 GLU A CA    1 
ATOM   821   C  C     . GLU A 1 106 ? 15.767  6.974   -6.356   1.00 99.93  ? 106 GLU A C     1 
ATOM   822   O  O     . GLU A 1 106 ? 16.246  6.393   -7.340   1.00 89.94  ? 106 GLU A O     1 
ATOM   823   C  CB    . GLU A 1 106 ? 16.393  9.420   -5.938   1.00 144.23 ? 106 GLU A CB    1 
ATOM   824   C  CG    . GLU A 1 106 ? 15.062  10.020  -5.532   1.00 148.93 ? 106 GLU A CG    1 
ATOM   825   C  CD    . GLU A 1 106 ? 14.187  10.247  -6.748   1.00 146.56 ? 106 GLU A CD    1 
ATOM   826   O  OE1   . GLU A 1 106 ? 14.456  9.560   -7.748   1.00 154.72 ? 106 GLU A OE1   1 
ATOM   827   O  OE2   . GLU A 1 106 ? 13.291  11.112  -6.750   1.00 130.20 ? 106 GLU A OE2   1 
ATOM   828   N  N     . ALA A 1 107 ? 14.532  6.776   -5.934   1.00 85.39  ? 107 ALA A N     1 
ATOM   829   C  CA    . ALA A 1 107 ? 13.697  5.748   -6.489   1.00 82.16  ? 107 ALA A CA    1 
ATOM   830   C  C     . ALA A 1 107 ? 12.989  6.268   -7.694   1.00 84.12  ? 107 ALA A C     1 
ATOM   831   O  O     . ALA A 1 107 ? 12.747  7.418   -7.801   1.00 94.79  ? 107 ALA A O     1 
ATOM   832   C  CB    . ALA A 1 107 ? 12.685  5.354   -5.473   1.00 100.51 ? 107 ALA A CB    1 
ATOM   833   N  N     . PRO A 1 108 ? 12.618  5.402   -8.600   1.00 86.76  ? 108 PRO A N     1 
ATOM   834   C  CA    . PRO A 1 108 ? 11.820  5.782   -9.761   1.00 83.38  ? 108 PRO A CA    1 
ATOM   835   C  C     . PRO A 1 108 ? 10.410  6.252   -9.518   1.00 83.01  ? 108 PRO A C     1 
ATOM   836   O  O     . PRO A 1 108 ? 9.867   5.996   -8.472   1.00 85.27  ? 108 PRO A O     1 
ATOM   837   C  CB    . PRO A 1 108 ? 11.691  4.475   -10.547  1.00 94.91  ? 108 PRO A CB    1 
ATOM   838   C  CG    . PRO A 1 108 ? 12.786  3.592   -10.073  1.00 107.90 ? 108 PRO A CG    1 
ATOM   839   C  CD    . PRO A 1 108 ? 13.116  4.032   -8.657   1.00 101.85 ? 108 PRO A CD    1 
ATOM   840   N  N     . LEU A 1 109 ? 9.837   6.936   -10.503  1.00 92.78  ? 109 LEU A N     1 
ATOM   841   C  CA    . LEU A 1 109 ? 8.463   7.393   -10.475  1.00 107.73 ? 109 LEU A CA    1 
ATOM   842   C  C     . LEU A 1 109 ? 8.150   8.278   -9.272   1.00 106.42 ? 109 LEU A C     1 
ATOM   843   O  O     . LEU A 1 109 ? 7.062   8.457   -8.894   1.00 91.50  ? 109 LEU A O     1 
ATOM   844   C  CB    . LEU A 1 109 ? 7.481   6.220   -10.564  1.00 110.13 ? 109 LEU A CB    1 
ATOM   845   C  CG    . LEU A 1 109 ? 6.975   5.960   -12.003  1.00 130.87 ? 109 LEU A CG    1 
ATOM   846   C  CD1   . LEU A 1 109 ? 8.142   5.588   -12.935  1.00 144.56 ? 109 LEU A CD1   1 
ATOM   847   C  CD2   . LEU A 1 109 ? 5.853   4.927   -12.025  1.00 139.32 ? 109 LEU A CD2   1 
ATOM   848   N  N     . ASN A 1 110 ? 9.165   8.887   -8.703   1.00 102.84 ? 110 ASN A N     1 
ATOM   849   C  CA    . ASN A 1 110 ? 9.089   9.450   -7.376   1.00 93.22  ? 110 ASN A CA    1 
ATOM   850   C  C     . ASN A 1 110 ? 8.778   10.883  -7.639   1.00 92.15  ? 110 ASN A C     1 
ATOM   851   O  O     . ASN A 1 110 ? 9.072   11.418  -8.701   1.00 110.52 ? 110 ASN A O     1 
ATOM   852   C  CB    . ASN A 1 110 ? 10.463  9.233   -6.720   1.00 99.67  ? 110 ASN A CB    1 
ATOM   853   C  CG    . ASN A 1 110 ? 10.546  9.727   -5.298   1.00 113.67 ? 110 ASN A CG    1 
ATOM   854   O  OD1   . ASN A 1 110 ? 9.856   10.667  -4.923   1.00 111.26 ? 110 ASN A OD1   1 
ATOM   855   N  ND2   . ASN A 1 110 ? 11.440  9.115   -4.500   1.00 136.40 ? 110 ASN A ND2   1 
ATOM   856   N  N     . PRO A 1 111 ? 8.092   11.534  -6.731   1.00 84.75  ? 111 PRO A N     1 
ATOM   857   C  CA    . PRO A 1 111 ? 7.810   12.940  -6.884   1.00 86.89  ? 111 PRO A CA    1 
ATOM   858   C  C     . PRO A 1 111 ? 8.970   13.849  -7.208   1.00 98.51  ? 111 PRO A C     1 
ATOM   859   O  O     . PRO A 1 111 ? 10.082  13.628  -6.762   1.00 111.80 ? 111 PRO A O     1 
ATOM   860   C  CB    . PRO A 1 111 ? 7.214   13.318  -5.528   1.00 87.88  ? 111 PRO A CB    1 
ATOM   861   C  CG    . PRO A 1 111 ? 6.471   12.081  -5.197   1.00 92.05  ? 111 PRO A CG    1 
ATOM   862   C  CD    . PRO A 1 111 ? 7.062   10.907  -5.899   1.00 89.64  ? 111 PRO A CD    1 
ATOM   863   N  N     . LYS A 1 112 ? 8.690   14.856  -8.028   1.00 108.23 ? 112 LYS A N     1 
ATOM   864   C  CA    . LYS A 1 112 ? 9.708   15.766  -8.520   1.00 123.78 ? 112 LYS A CA    1 
ATOM   865   C  C     . LYS A 1 112 ? 10.337  16.470  -7.346   1.00 110.04 ? 112 LYS A C     1 
ATOM   866   O  O     . LYS A 1 112 ? 11.534  16.648  -7.292   1.00 113.43 ? 112 LYS A O     1 
ATOM   867   C  CB    . LYS A 1 112 ? 9.094   16.818  -9.477   1.00 156.55 ? 112 LYS A CB    1 
ATOM   868   C  CG    . LYS A 1 112 ? 8.625   16.219  -10.801  1.00 182.29 ? 112 LYS A CG    1 
ATOM   869   C  CD    . LYS A 1 112 ? 8.000   17.253  -11.743  1.00 216.99 ? 112 LYS A CD    1 
ATOM   870   C  CE    . LYS A 1 112 ? 9.006   18.223  -12.351  1.00 236.60 ? 112 LYS A CE    1 
ATOM   871   N  NZ    . LYS A 1 112 ? 9.675   17.642  -13.548  1.00 255.26 ? 112 LYS A NZ    1 
ATOM   872   N  N     . ALA A 1 113 ? 9.475   16.882  -6.409   1.00 97.12  ? 113 ALA A N     1 
ATOM   873   C  CA    . ALA A 1 113 ? 9.825   17.716  -5.304   1.00 96.93  ? 113 ALA A CA    1 
ATOM   874   C  C     . ALA A 1 113 ? 10.999  17.113  -4.571   1.00 99.17  ? 113 ALA A C     1 
ATOM   875   O  O     . ALA A 1 113 ? 11.867  17.830  -4.108   1.00 105.94 ? 113 ALA A O     1 
ATOM   876   C  CB    . ALA A 1 113 ? 8.641   17.861  -4.324   1.00 109.30 ? 113 ALA A CB    1 
ATOM   877   N  N     . ASN A 1 114 ? 11.009  15.782  -4.473   1.00 99.43  ? 114 ASN A N     1 
ATOM   878   C  CA    . ASN A 1 114 ? 12.048  15.104  -3.726   1.00 101.11 ? 114 ASN A CA    1 
ATOM   879   C  C     . ASN A 1 114 ? 13.372  15.305  -4.394   1.00 102.53 ? 114 ASN A C     1 
ATOM   880   O  O     . ASN A 1 114 ? 14.361  15.599  -3.722   1.00 99.36  ? 114 ASN A O     1 
ATOM   881   C  CB    . ASN A 1 114 ? 11.844  13.615  -3.551   1.00 98.94  ? 114 ASN A CB    1 
ATOM   882   C  CG    . ASN A 1 114 ? 10.855  13.322  -2.491   1.00 114.39 ? 114 ASN A CG    1 
ATOM   883   O  OD1   . ASN A 1 114 ? 10.684  14.068  -1.517   1.00 102.16 ? 114 ASN A OD1   1 
ATOM   884   N  ND2   . ASN A 1 114 ? 10.172  12.229  -2.672   1.00 144.15 ? 114 ASN A ND2   1 
ATOM   885   N  N     . ARG A 1 115 ? 13.407  15.168  -5.713   1.00 104.66 ? 115 ARG A N     1 
ATOM   886   C  CA    . ARG A 1 115 ? 14.690  15.348  -6.413   1.00 100.22 ? 115 ARG A CA    1 
ATOM   887   C  C     . ARG A 1 115 ? 15.097  16.801  -6.253   1.00 91.85  ? 115 ARG A C     1 
ATOM   888   O  O     . ARG A 1 115 ? 16.228  17.129  -5.867   1.00 92.36  ? 115 ARG A O     1 
ATOM   889   C  CB    . ARG A 1 115 ? 14.565  15.030  -7.914   1.00 105.49 ? 115 ARG A CB    1 
ATOM   890   C  CG    . ARG A 1 115 ? 14.898  13.626  -8.366   1.00 107.74 ? 115 ARG A CG    1 
ATOM   891   C  CD    . ARG A 1 115 ? 14.975  13.537  -9.892   1.00 117.65 ? 115 ARG A CD    1 
ATOM   892   N  NE    . ARG A 1 115 ? 14.964  12.141  -10.353  1.00 142.15 ? 115 ARG A NE    1 
ATOM   893   C  CZ    . ARG A 1 115 ? 13.873  11.378  -10.344  1.00 177.52 ? 115 ARG A CZ    1 
ATOM   894   N  NH1   . ARG A 1 115 ? 12.712  11.922  -9.995   1.00 192.14 ? 115 ARG A NH1   1 
ATOM   895   N  NH2   . ARG A 1 115 ? 13.914  10.096  -10.773  1.00 189.12 ? 115 ARG A NH2   1 
ATOM   896   N  N     . GLU A 1 116 ? 14.159  17.695  -6.569   1.00 88.54  ? 116 GLU A N     1 
ATOM   897   C  CA    . GLU A 1 116 ? 14.462  19.103  -6.639   1.00 85.00  ? 116 GLU A CA    1 
ATOM   898   C  C     . GLU A 1 116 ? 14.932  19.578  -5.257   1.00 81.69  ? 116 GLU A C     1 
ATOM   899   O  O     . GLU A 1 116 ? 15.990  20.200  -5.098   1.00 91.28  ? 116 GLU A O     1 
ATOM   900   C  CB    . GLU A 1 116 ? 13.212  19.889  -7.160   1.00 110.17 ? 116 GLU A CB    1 
ATOM   901   C  CG    . GLU A 1 116 ? 13.109  19.923  -8.654   1.00 128.56 ? 116 GLU A CG    1 
ATOM   902   C  CD    . GLU A 1 116 ? 11.655  20.068  -9.110   1.00 149.92 ? 116 GLU A CD    1 
ATOM   903   O  OE1   . GLU A 1 116 ? 10.775  20.020  -8.218   1.00 158.51 ? 116 GLU A OE1   1 
ATOM   904   O  OE2   . GLU A 1 116 ? 11.419  20.211  -10.318  1.00 155.26 ? 116 GLU A OE2   1 
ATOM   905   N  N     . LYS A 1 117 ? 14.115  19.241  -4.261   1.00 77.12  ? 117 LYS A N     1 
ATOM   906   C  CA    . LYS A 1 117 ? 14.429  19.669  -2.906   1.00 79.99  ? 117 LYS A CA    1 
ATOM   907   C  C     . LYS A 1 117 ? 15.691  19.057  -2.402   1.00 80.25  ? 117 LYS A C     1 
ATOM   908   O  O     . LYS A 1 117 ? 16.482  19.673  -1.736   1.00 84.50  ? 117 LYS A O     1 
ATOM   909   C  CB    . LYS A 1 117 ? 13.308  19.362  -1.893   1.00 87.90  ? 117 LYS A CB    1 
ATOM   910   C  CG    . LYS A 1 117 ? 13.603  19.911  -0.505   1.00 109.57 ? 117 LYS A CG    1 
ATOM   911   C  CD    . LYS A 1 117 ? 13.632  21.443  -0.435   1.00 140.28 ? 117 LYS A CD    1 
ATOM   912   C  CE    . LYS A 1 117 ? 13.804  21.977  0.990    1.00 156.36 ? 117 LYS A CE    1 
ATOM   913   N  NZ    . LYS A 1 117 ? 14.235  23.403  0.977    1.00 157.91 ? 117 LYS A NZ    1 
ATOM   914   N  N     . MET A 1 118 ? 15.913  17.782  -2.749   1.00 91.30  ? 118 MET A N     1 
ATOM   915   C  CA    . MET A 1 118 ? 17.199  17.100  -2.451   1.00 102.52 ? 118 MET A CA    1 
ATOM   916   C  C     . MET A 1 118 ? 18.403  17.916  -2.946   1.00 89.17  ? 118 MET A C     1 
ATOM   917   O  O     . MET A 1 118 ? 19.319  18.219  -2.123   1.00 79.63  ? 118 MET A O     1 
ATOM   918   C  CB    . MET A 1 118 ? 17.175  15.709  -3.120   1.00 110.16 ? 118 MET A CB    1 
ATOM   919   C  CG    . MET A 1 118 ? 18.238  14.758  -2.685   1.00 120.17 ? 118 MET A CG    1 
ATOM   920   S  SD    . MET A 1 118 ? 17.952  12.996  -3.114   1.00 133.27 ? 118 MET A SD    1 
ATOM   921   C  CE    . MET A 1 118 ? 16.590  12.534  -2.044   1.00 143.91 ? 118 MET A CE    1 
ATOM   922   N  N     . THR A 1 119 ? 18.388  18.315  -4.205   1.00 83.29  ? 119 THR A N     1 
ATOM   923   C  CA    . THR A 1 119 ? 19.431  19.096  -4.760   1.00 75.31  ? 119 THR A CA    1 
ATOM   924   C  C     . THR A 1 119 ? 19.554  20.430  -4.074   1.00 83.81  ? 119 THR A C     1 
ATOM   925   O  O     . THR A 1 119 ? 20.634  20.871  -3.786   1.00 113.66 ? 119 THR A O     1 
ATOM   926   C  CB    . THR A 1 119 ? 19.267  19.416  -6.227   1.00 81.34  ? 119 THR A CB    1 
ATOM   927   O  OG1   . THR A 1 119 ? 17.986  20.030  -6.404   1.00 75.09  ? 119 THR A OG1   1 
ATOM   928   C  CG2   . THR A 1 119 ? 19.390  18.178  -7.045   1.00 98.42  ? 119 THR A CG2   1 
ATOM   929   N  N     . GLN A 1 120 ? 18.427  21.057  -3.777   1.00 87.03  ? 120 GLN A N     1 
ATOM   930   C  CA    . GLN A 1 120 ? 18.412  22.339  -3.079   1.00 94.03  ? 120 GLN A CA    1 
ATOM   931   C  C     . GLN A 1 120 ? 19.192  22.225  -1.774   1.00 88.68  ? 120 GLN A C     1 
ATOM   932   O  O     . GLN A 1 120 ? 20.035  23.112  -1.472   1.00 93.67  ? 120 GLN A O     1 
ATOM   933   C  CB    . GLN A 1 120 ? 16.973  22.796  -2.760   1.00 98.71  ? 120 GLN A CB    1 
ATOM   934   C  CG    . GLN A 1 120 ? 16.888  24.118  -2.045   1.00 106.82 ? 120 GLN A CG    1 
ATOM   935   C  CD    . GLN A 1 120 ? 15.497  24.693  -2.099   1.00 132.53 ? 120 GLN A CD    1 
ATOM   936   O  OE1   . GLN A 1 120 ? 14.578  24.097  -2.681   1.00 126.76 ? 120 GLN A OE1   1 
ATOM   937   N  NE2   . GLN A 1 120 ? 15.322  25.857  -1.476   1.00 160.58 ? 120 GLN A NE2   1 
ATOM   938   N  N     . ILE A 1 121 ? 18.911  21.170  -1.022   1.00 86.49  ? 121 ILE A N     1 
ATOM   939   C  CA    . ILE A 1 121 ? 19.693  20.930  0.166    1.00 89.02  ? 121 ILE A CA    1 
ATOM   940   C  C     . ILE A 1 121 ? 21.157  20.757  -0.093   1.00 88.95  ? 121 ILE A C     1 
ATOM   941   O  O     . ILE A 1 121 ? 21.958  21.389  0.579    1.00 84.06  ? 121 ILE A O     1 
ATOM   942   C  CB    . ILE A 1 121 ? 19.140  19.768  0.980    1.00 96.06  ? 121 ILE A CB    1 
ATOM   943   C  CG1   . ILE A 1 121 ? 17.839  20.268  1.628    1.00 96.65  ? 121 ILE A CG1   1 
ATOM   944   C  CG2   . ILE A 1 121 ? 20.194  19.296  1.975    1.00 104.30 ? 121 ILE A CG2   1 
ATOM   945   C  CD1   . ILE A 1 121 ? 17.175  19.270  2.564    1.00 110.30 ? 121 ILE A CD1   1 
ATOM   946   N  N     . MET A 1 122 ? 21.535  19.859  -0.965   1.00 102.75 ? 122 MET A N     1 
ATOM   947   C  CA    . MET A 1 122 ? 22.934  19.571  -1.155   1.00 111.20 ? 122 MET A CA    1 
ATOM   948   C  C     . MET A 1 122 ? 23.715  20.781  -1.520   1.00 107.62 ? 122 MET A C     1 
ATOM   949   O  O     . MET A 1 122 ? 24.839  20.837  -1.174   1.00 128.49 ? 122 MET A O     1 
ATOM   950   C  CB    . MET A 1 122 ? 23.141  18.539  -2.277   1.00 119.00 ? 122 MET A CB    1 
ATOM   951   C  CG    . MET A 1 122 ? 22.984  17.103  -1.791   1.00 135.24 ? 122 MET A CG    1 
ATOM   952   S  SD    . MET A 1 122 ? 24.188  16.765  -0.510   1.00 143.94 ? 122 MET A SD    1 
ATOM   953   C  CE    . MET A 1 122 ? 23.628  15.156  0.063    1.00 124.04 ? 122 MET A CE    1 
ATOM   954   N  N     . PHE A 1 123 ? 23.150  21.692  -2.300   1.00 91.83  ? 123 PHE A N     1 
ATOM   955   C  CA    . PHE A 1 123 ? 23.868  22.914  -2.632   1.00 89.11  ? 123 PHE A CA    1 
ATOM   956   C  C     . PHE A 1 123 ? 23.793  23.893  -1.519   1.00 104.20 ? 123 PHE A C     1 
ATOM   957   O  O     . PHE A 1 123 ? 24.844  24.432  -1.137   1.00 111.59 ? 123 PHE A O     1 
ATOM   958   C  CB    . PHE A 1 123 ? 23.446  23.519  -3.980   1.00 89.81  ? 123 PHE A CB    1 
ATOM   959   C  CG    . PHE A 1 123 ? 23.741  22.638  -5.149   1.00 98.87  ? 123 PHE A CG    1 
ATOM   960   C  CD1   . PHE A 1 123 ? 24.992  22.074  -5.292   1.00 101.81 ? 123 PHE A CD1   1 
ATOM   961   C  CD2   . PHE A 1 123 ? 22.763  22.335  -6.077   1.00 104.26 ? 123 PHE A CD2   1 
ATOM   962   C  CE1   . PHE A 1 123 ? 25.272  21.245  -6.346   1.00 103.40 ? 123 PHE A CE1   1 
ATOM   963   C  CE2   . PHE A 1 123 ? 23.034  21.487  -7.123   1.00 100.95 ? 123 PHE A CE2   1 
ATOM   964   C  CZ    . PHE A 1 123 ? 24.293  20.948  -7.265   1.00 105.92 ? 123 PHE A CZ    1 
ATOM   965   N  N     . GLU A 1 124 ? 22.610  24.123  -0.958   1.00 120.52 ? 124 GLU A N     1 
ATOM   966   C  CA    . GLU A 1 124 ? 22.503  25.204  0.043    1.00 142.44 ? 124 GLU A CA    1 
ATOM   967   C  C     . GLU A 1 124 ? 22.454  24.743  1.514    1.00 135.12 ? 124 GLU A C     1 
ATOM   968   O  O     . GLU A 1 124 ? 21.957  25.468  2.384    1.00 129.51 ? 124 GLU A O     1 
ATOM   969   C  CB    . GLU A 1 124 ? 21.251  26.023  -0.288   1.00 164.20 ? 124 GLU A CB    1 
ATOM   970   C  CG    . GLU A 1 124 ? 21.252  26.568  -1.694   1.00 174.07 ? 124 GLU A CG    1 
ATOM   971   C  CD    . GLU A 1 124 ? 20.133  27.555  -1.914   1.00 196.20 ? 124 GLU A CD    1 
ATOM   972   O  OE1   . GLU A 1 124 ? 19.020  27.352  -1.366   1.00 195.29 ? 124 GLU A OE1   1 
ATOM   973   O  OE2   . GLU A 1 124 ? 20.383  28.532  -2.635   1.00 199.65 ? 124 GLU A OE2   1 
ATOM   974   N  N     . THR A 1 125 ? 22.947  23.542  1.790    1.00 126.74 ? 125 THR A N     1 
ATOM   975   C  CA    . THR A 1 125 ? 23.174  23.143  3.142    1.00 128.14 ? 125 THR A CA    1 
ATOM   976   C  C     . THR A 1 125 ? 24.643  22.786  3.279    1.00 120.10 ? 125 THR A C     1 
ATOM   977   O  O     . THR A 1 125 ? 25.408  23.519  3.893    1.00 114.71 ? 125 THR A O     1 
ATOM   978   C  CB    . THR A 1 125 ? 22.250  22.007  3.580    1.00 155.30 ? 125 THR A CB    1 
ATOM   979   O  OG1   . THR A 1 125 ? 20.900  22.453  3.427    1.00 162.98 ? 125 THR A OG1   1 
ATOM   980   C  CG2   . THR A 1 125 ? 22.498  21.674  5.037    1.00 162.16 ? 125 THR A CG2   1 
ATOM   981   N  N     . PHE A 1 126 ? 25.041  21.703  2.640    1.00 118.85 ? 126 PHE A N     1 
ATOM   982   C  CA    . PHE A 1 126 ? 26.444  21.246  2.667    1.00 112.18 ? 126 PHE A CA    1 
ATOM   983   C  C     . PHE A 1 126 ? 27.020  21.805  1.384    1.00 101.18 ? 126 PHE A C     1 
ATOM   984   O  O     . PHE A 1 126 ? 26.756  21.269  0.312    1.00 96.61  ? 126 PHE A O     1 
ATOM   985   C  CB    . PHE A 1 126 ? 26.562  19.726  2.642    1.00 122.89 ? 126 PHE A CB    1 
ATOM   986   C  CG    . PHE A 1 126 ? 25.587  19.040  3.537    1.00 119.42 ? 126 PHE A CG    1 
ATOM   987   C  CD1   . PHE A 1 126 ? 25.547  19.359  4.864    1.00 139.35 ? 126 PHE A CD1   1 
ATOM   988   C  CD2   . PHE A 1 126 ? 24.736  18.078  3.051    1.00 107.60 ? 126 PHE A CD2   1 
ATOM   989   C  CE1   . PHE A 1 126 ? 24.665  18.720  5.718    1.00 140.55 ? 126 PHE A CE1   1 
ATOM   990   C  CE2   . PHE A 1 126 ? 23.856  17.436  3.885    1.00 122.83 ? 126 PHE A CE2   1 
ATOM   991   C  CZ    . PHE A 1 126 ? 23.839  17.734  5.237    1.00 131.58 ? 126 PHE A CZ    1 
ATOM   992   N  N     . ASN A 1 127 ? 27.786  22.876  1.444    1.00 114.23 ? 127 ASN A N     1 
ATOM   993   C  CA    . ASN A 1 127 ? 28.326  23.462  0.208    1.00 136.39 ? 127 ASN A CA    1 
ATOM   994   C  C     . ASN A 1 127 ? 29.183  22.412  -0.507   1.00 135.65 ? 127 ASN A C     1 
ATOM   995   O  O     . ASN A 1 127 ? 30.076  21.793  0.101    1.00 150.36 ? 127 ASN A O     1 
ATOM   996   C  CB    . ASN A 1 127 ? 29.110  24.749  0.539    1.00 160.86 ? 127 ASN A CB    1 
ATOM   997   C  CG    . ASN A 1 127 ? 29.216  25.712  -0.641   1.00 183.41 ? 127 ASN A CG    1 
ATOM   998   O  OD1   . ASN A 1 127 ? 28.224  25.996  -1.321   1.00 174.34 ? 127 ASN A OD1   1 
ATOM   999   N  ND2   . ASN A 1 127 ? 30.422  26.232  -0.872   1.00 200.58 ? 127 ASN A ND2   1 
ATOM   1000  N  N     . THR A 1 128 ? 28.866  22.158  -1.770   1.00 120.77 ? 128 THR A N     1 
ATOM   1001  C  CA    . THR A 1 128 ? 29.446  21.041  -2.450   1.00 111.84 ? 128 THR A CA    1 
ATOM   1002  C  C     . THR A 1 128 ? 29.655  21.447  -3.870   1.00 113.47 ? 128 THR A C     1 
ATOM   1003  O  O     . THR A 1 128 ? 28.839  22.195  -4.401   1.00 115.04 ? 128 THR A O     1 
ATOM   1004  C  CB    . THR A 1 128 ? 28.569  19.770  -2.388   1.00 104.74 ? 128 THR A CB    1 
ATOM   1005  O  OG1   . THR A 1 128 ? 29.182  18.771  -3.206   1.00 105.75 ? 128 THR A OG1   1 
ATOM   1006  C  CG2   . THR A 1 128 ? 27.138  19.987  -2.884   1.00 105.26 ? 128 THR A CG2   1 
ATOM   1007  N  N     . PRO A 1 129 ? 30.738  20.968  -4.494   1.00 123.25 ? 129 PRO A N     1 
ATOM   1008  C  CA    . PRO A 1 129 ? 31.069  21.402  -5.823   1.00 138.63 ? 129 PRO A CA    1 
ATOM   1009  C  C     . PRO A 1 129 ? 30.105  20.866  -6.868   1.00 126.62 ? 129 PRO A C     1 
ATOM   1010  O  O     . PRO A 1 129 ? 29.810  21.569  -7.848   1.00 154.24 ? 129 PRO A O     1 
ATOM   1011  C  CB    . PRO A 1 129 ? 32.444  20.796  -6.089   1.00 139.52 ? 129 PRO A CB    1 
ATOM   1012  C  CG    . PRO A 1 129 ? 33.036  20.537  -4.777   1.00 139.30 ? 129 PRO A CG    1 
ATOM   1013  C  CD    . PRO A 1 129 ? 31.870  20.264  -3.859   1.00 129.44 ? 129 PRO A CD    1 
ATOM   1014  N  N     . ALA A 1 130 ? 29.657  19.644  -6.670   1.00 99.09  ? 130 ALA A N     1 
ATOM   1015  C  CA    . ALA A 1 130 ? 28.830  19.007  -7.660   1.00 94.97  ? 130 ALA A CA    1 
ATOM   1016  C  C     . ALA A 1 130 ? 28.114  17.832  -7.065   1.00 80.99  ? 130 ALA A C     1 
ATOM   1017  O  O     . ALA A 1 130 ? 28.442  17.310  -6.025   1.00 66.83  ? 130 ALA A O     1 
ATOM   1018  C  CB    . ALA A 1 130 ? 29.630  18.567  -8.909   1.00 114.94 ? 130 ALA A CB    1 
ATOM   1019  N  N     . MET A 1 131 ? 27.039  17.446  -7.744   1.00 81.59  ? 131 MET A N     1 
ATOM   1020  C  CA    . MET A 1 131 ? 26.236  16.358  -7.285   1.00 85.62  ? 131 MET A CA    1 
ATOM   1021  C  C     . MET A 1 131 ? 25.465  15.757  -8.408   1.00 90.18  ? 131 MET A C     1 
ATOM   1022  O  O     . MET A 1 131 ? 25.400  16.339  -9.498   1.00 79.97  ? 131 MET A O     1 
ATOM   1023  C  CB    . MET A 1 131 ? 25.184  16.803  -6.255   1.00 88.38  ? 131 MET A CB    1 
ATOM   1024  C  CG    . MET A 1 131 ? 23.995  17.484  -6.913   1.00 91.17  ? 131 MET A CG    1 
ATOM   1025  S  SD    . MET A 1 131 ? 22.599  17.859  -5.873   1.00 120.63 ? 131 MET A SD    1 
ATOM   1026  C  CE    . MET A 1 131 ? 22.025  16.166  -5.634   1.00 151.36 ? 131 MET A CE    1 
ATOM   1027  N  N     . TYR A 1 132 ? 24.879  14.569  -8.149   1.00 93.02  ? 132 TYR A N     1 
ATOM   1028  C  CA    . TYR A 1 132 ? 24.036  13.935  -9.150   1.00 90.07  ? 132 TYR A CA    1 
ATOM   1029  C  C     . TYR A 1 132 ? 22.992  13.144  -8.425   1.00 80.92  ? 132 TYR A C     1 
ATOM   1030  O  O     . TYR A 1 132 ? 23.275  12.665  -7.347   1.00 74.00  ? 132 TYR A O     1 
ATOM   1031  C  CB    . TYR A 1 132 ? 24.887  12.994  -10.015  1.00 93.40  ? 132 TYR A CB    1 
ATOM   1032  C  CG    . TYR A 1 132 ? 24.112  12.451  -11.159  1.00 93.34  ? 132 TYR A CG    1 
ATOM   1033  C  CD1   . TYR A 1 132 ? 23.874  13.239  -12.264  1.00 97.30  ? 132 TYR A CD1   1 
ATOM   1034  C  CD2   . TYR A 1 132 ? 23.625  11.170  -11.147  1.00 90.52  ? 132 TYR A CD2   1 
ATOM   1035  C  CE1   . TYR A 1 132 ? 23.167  12.759  -13.347  1.00 96.34  ? 132 TYR A CE1   1 
ATOM   1036  C  CE2   . TYR A 1 132 ? 22.910  10.678  -12.208  1.00 105.53 ? 132 TYR A CE2   1 
ATOM   1037  C  CZ    . TYR A 1 132 ? 22.681  11.477  -13.319  1.00 107.98 ? 132 TYR A CZ    1 
ATOM   1038  O  OH    . TYR A 1 132 ? 21.966  10.967  -14.419  1.00 123.40 ? 132 TYR A OH    1 
ATOM   1039  N  N     . VAL A 1 133 ? 21.812  12.964  -9.013   1.00 95.76  ? 133 VAL A N     1 
ATOM   1040  C  CA    . VAL A 1 133 ? 20.797  12.135  -8.368   1.00 108.61 ? 133 VAL A CA    1 
ATOM   1041  C  C     . VAL A 1 133 ? 20.397  11.078  -9.359   1.00 100.52 ? 133 VAL A C     1 
ATOM   1042  O  O     . VAL A 1 133 ? 20.076  11.403  -10.518  1.00 112.44 ? 133 VAL A O     1 
ATOM   1043  C  CB    . VAL A 1 133 ? 19.543  12.885  -7.958   1.00 135.19 ? 133 VAL A CB    1 
ATOM   1044  C  CG1   . VAL A 1 133 ? 19.820  13.772  -6.766   1.00 152.78 ? 133 VAL A CG1   1 
ATOM   1045  C  CG2   . VAL A 1 133 ? 18.991  13.720  -9.095   1.00 149.37 ? 133 VAL A CG2   1 
ATOM   1046  N  N     . ALA A 1 134 ? 20.413  9.812   -8.946   1.00 97.13  ? 134 ALA A N     1 
ATOM   1047  C  CA    . ALA A 1 134 ? 20.440  8.718   -9.937   1.00 103.74 ? 134 ALA A CA    1 
ATOM   1048  C  C     . ALA A 1 134 ? 19.394  7.704   -9.530   1.00 106.25 ? 134 ALA A C     1 
ATOM   1049  O  O     . ALA A 1 134 ? 18.956  7.626   -8.353   1.00 113.89 ? 134 ALA A O     1 
ATOM   1050  C  CB    . ALA A 1 134 ? 21.840  8.051   -10.047  1.00 101.91 ? 134 ALA A CB    1 
ATOM   1051  N  N     . ILE A 1 135 ? 18.943  6.935   -10.517  1.00 102.16 ? 135 ILE A N     1 
ATOM   1052  C  CA    . ILE A 1 135 ? 17.873  5.969   -10.283  1.00 104.05 ? 135 ILE A CA    1 
ATOM   1053  C  C     . ILE A 1 135 ? 18.487  4.771   -9.634   1.00 98.22  ? 135 ILE A C     1 
ATOM   1054  O  O     . ILE A 1 135 ? 19.521  4.283   -10.026  1.00 97.75  ? 135 ILE A O     1 
ATOM   1055  C  CB    . ILE A 1 135 ? 17.096  5.620   -11.553  1.00 109.55 ? 135 ILE A CB    1 
ATOM   1056  C  CG1   . ILE A 1 135 ? 15.623  5.340   -11.236  1.00 112.43 ? 135 ILE A CG1   1 
ATOM   1057  C  CG2   . ILE A 1 135 ? 17.788  4.591   -12.386  1.00 111.74 ? 135 ILE A CG2   1 
ATOM   1058  C  CD1   . ILE A 1 135 ? 14.765  6.607   -11.179  1.00 128.82 ? 135 ILE A CD1   1 
ATOM   1059  N  N     . GLN A 1 136 ? 17.821  4.254   -8.622   1.00 107.68 ? 136 GLN A N     1 
ATOM   1060  C  CA    . GLN A 1 136 ? 18.332  3.132   -7.854   1.00 116.68 ? 136 GLN A CA    1 
ATOM   1061  C  C     . GLN A 1 136 ? 18.570  1.903   -8.700   1.00 95.40  ? 136 GLN A C     1 
ATOM   1062  O  O     . GLN A 1 136 ? 19.588  1.245   -8.527   1.00 102.75 ? 136 GLN A O     1 
ATOM   1063  C  CB    . GLN A 1 136 ? 17.388  2.721   -6.714   1.00 131.61 ? 136 GLN A CB    1 
ATOM   1064  C  CG    . GLN A 1 136 ? 17.411  3.690   -5.554   1.00 130.57 ? 136 GLN A CG    1 
ATOM   1065  C  CD    . GLN A 1 136 ? 16.328  3.427   -4.551   1.00 133.69 ? 136 GLN A CD    1 
ATOM   1066  O  OE1   . GLN A 1 136 ? 15.520  2.515   -4.707   1.00 146.62 ? 136 GLN A OE1   1 
ATOM   1067  N  NE2   . GLN A 1 136 ? 16.254  4.267   -3.532   1.00 144.63 ? 136 GLN A NE2   1 
ATOM   1068  N  N     . ALA A 1 137 ? 17.656  1.578   -9.603   1.00 77.93  ? 137 ALA A N     1 
ATOM   1069  C  CA    . ALA A 1 137 ? 17.695  0.261   -10.244  1.00 80.38  ? 137 ALA A CA    1 
ATOM   1070  C  C     . ALA A 1 137 ? 18.919  0.155   -11.145  1.00 84.16  ? 137 ALA A C     1 
ATOM   1071  O  O     . ALA A 1 137 ? 19.615  -0.848  -11.127  1.00 84.08  ? 137 ALA A O     1 
ATOM   1072  C  CB    . ALA A 1 137 ? 16.410  -0.046  -11.031  1.00 82.89  ? 137 ALA A CB    1 
ATOM   1073  N  N     . VAL A 1 138 ? 19.108  1.171   -11.975  1.00 83.38  ? 138 VAL A N     1 
ATOM   1074  C  CA    . VAL A 1 138 ? 20.211  1.257   -12.920  1.00 78.42  ? 138 VAL A CA    1 
ATOM   1075  C  C     . VAL A 1 138 ? 21.539  0.971   -12.210  1.00 70.62  ? 138 VAL A C     1 
ATOM   1076  O  O     . VAL A 1 138 ? 22.388  0.218   -12.689  1.00 89.27  ? 138 VAL A O     1 
ATOM   1077  C  CB    . VAL A 1 138 ? 20.175  2.632   -13.653  1.00 87.19  ? 138 VAL A CB    1 
ATOM   1078  C  CG1   . VAL A 1 138 ? 21.506  3.013   -14.316  1.00 90.13  ? 138 VAL A CG1   1 
ATOM   1079  C  CG2   . VAL A 1 138 ? 18.993  2.610   -14.592  1.00 99.09  ? 138 VAL A CG2   1 
ATOM   1080  N  N     . LEU A 1 139 ? 21.691  1.582   -11.035  1.00 63.24  ? 139 LEU A N     1 
ATOM   1081  C  CA    . LEU A 1 139 ? 22.910  1.460   -10.282  1.00 68.57  ? 139 LEU A CA    1 
ATOM   1082  C  C     . LEU A 1 139 ? 23.153  0.004   -9.975   1.00 70.73  ? 139 LEU A C     1 
ATOM   1083  O  O     . LEU A 1 139 ? 24.280  -0.490  -10.204  1.00 86.85  ? 139 LEU A O     1 
ATOM   1084  C  CB    . LEU A 1 139 ? 22.874  2.321   -9.001   1.00 78.41  ? 139 LEU A CB    1 
ATOM   1085  C  CG    . LEU A 1 139 ? 23.422  3.754   -9.176   1.00 78.84  ? 139 LEU A CG    1 
ATOM   1086  C  CD1   . LEU A 1 139 ? 22.695  4.500   -10.293  1.00 80.60  ? 139 LEU A CD1   1 
ATOM   1087  C  CD2   . LEU A 1 139 ? 23.386  4.527   -7.838   1.00 89.38  ? 139 LEU A CD2   1 
ATOM   1088  N  N     . SER A 1 140 ? 22.123  -0.695  -9.506   1.00 69.16  ? 140 SER A N     1 
ATOM   1089  C  CA    . SER A 1 140 ? 22.313  -2.113  -9.201   1.00 82.29  ? 140 SER A CA    1 
ATOM   1090  C  C     . SER A 1 140 ? 22.646  -2.891  -10.434  1.00 75.47  ? 140 SER A C     1 
ATOM   1091  O  O     . SER A 1 140 ? 23.433  -3.830  -10.343  1.00 83.27  ? 140 SER A O     1 
ATOM   1092  C  CB    . SER A 1 140 ? 21.090  -2.775  -8.581   1.00 89.01  ? 140 SER A CB    1 
ATOM   1093  O  OG    . SER A 1 140 ? 20.214  -2.924  -9.647   1.00 85.22  ? 140 SER A OG    1 
ATOM   1094  N  N     . LEU A 1 141 ? 22.044  -2.524  -11.576  1.00 73.42  ? 141 LEU A N     1 
ATOM   1095  C  CA    . LEU A 1 141 ? 22.362  -3.231  -12.814  1.00 83.38  ? 141 LEU A CA    1 
ATOM   1096  C  C     . LEU A 1 141 ? 23.829  -3.082  -13.129  1.00 74.21  ? 141 LEU A C     1 
ATOM   1097  O  O     . LEU A 1 141 ? 24.479  -4.052  -13.522  1.00 65.62  ? 141 LEU A O     1 
ATOM   1098  C  CB    . LEU A 1 141 ? 21.551  -2.660  -13.994  1.00 92.93  ? 141 LEU A CB    1 
ATOM   1099  C  CG    . LEU A 1 141 ? 21.920  -3.152  -15.372  1.00 100.58 ? 141 LEU A CG    1 
ATOM   1100  C  CD1   . LEU A 1 141 ? 21.248  -4.499  -15.526  1.00 93.07  ? 141 LEU A CD1   1 
ATOM   1101  C  CD2   . LEU A 1 141 ? 21.575  -2.143  -16.483  1.00 113.66 ? 141 LEU A CD2   1 
ATOM   1102  N  N     . TYR A 1 142 ? 24.387  -1.887  -12.929  1.00 70.36  ? 142 TYR A N     1 
ATOM   1103  C  CA    . TYR A 1 142 ? 25.814  -1.656  -13.140  1.00 70.41  ? 142 TYR A CA    1 
ATOM   1104  C  C     . TYR A 1 142 ? 26.598  -2.541  -12.216  1.00 78.64  ? 142 TYR A C     1 
ATOM   1105  O  O     . TYR A 1 142 ? 27.600  -3.147  -12.596  1.00 78.79  ? 142 TYR A O     1 
ATOM   1106  C  CB    . TYR A 1 142 ? 26.260  -0.230  -12.714  1.00 66.32  ? 142 TYR A CB    1 
ATOM   1107  C  CG    . TYR A 1 142 ? 26.179  0.734   -13.822  1.00 69.53  ? 142 TYR A CG    1 
ATOM   1108  C  CD1   . TYR A 1 142 ? 27.198  0.841   -14.757  1.00 82.00  ? 142 TYR A CD1   1 
ATOM   1109  C  CD2   . TYR A 1 142 ? 25.104  1.573   -13.927  1.00 77.07  ? 142 TYR A CD2   1 
ATOM   1110  C  CE1   . TYR A 1 142 ? 27.108  1.750   -15.797  1.00 100.69 ? 142 TYR A CE1   1 
ATOM   1111  C  CE2   . TYR A 1 142 ? 25.002  2.490   -14.968  1.00 91.92  ? 142 TYR A CE2   1 
ATOM   1112  C  CZ    . TYR A 1 142 ? 26.004  2.568   -15.904  1.00 96.29  ? 142 TYR A CZ    1 
ATOM   1113  O  OH    . TYR A 1 142 ? 25.921  3.495   -16.945  1.00 71.72  ? 142 TYR A OH    1 
ATOM   1114  N  N     . ALA A 1 143 ? 26.228  -2.515  -10.948  1.00 82.21  ? 143 ALA A N     1 
ATOM   1115  C  CA    . ALA A 1 143 ? 26.923  -3.300  -9.921   1.00 93.06  ? 143 ALA A CA    1 
ATOM   1116  C  C     . ALA A 1 143 ? 26.971  -4.743  -10.302  1.00 106.71 ? 143 ALA A C     1 
ATOM   1117  O  O     . ALA A 1 143 ? 27.920  -5.412  -9.946   1.00 115.82 ? 143 ALA A O     1 
ATOM   1118  C  CB    . ALA A 1 143 ? 26.285  -3.215  -8.533   1.00 99.84  ? 143 ALA A CB    1 
ATOM   1119  N  N     . SER A 1 144 ? 25.911  -5.261  -10.957  1.00 117.94 ? 144 SER A N     1 
ATOM   1120  C  CA    . SER A 1 144 ? 25.889  -6.651  -11.384  1.00 119.94 ? 144 SER A CA    1 
ATOM   1121  C  C     . SER A 1 144 ? 26.754  -6.854  -12.606  1.00 116.89 ? 144 SER A C     1 
ATOM   1122  O  O     . SER A 1 144 ? 27.013  -7.998  -12.969  1.00 108.07 ? 144 SER A O     1 
ATOM   1123  C  CB    . SER A 1 144 ? 24.461  -7.176  -11.668  1.00 116.66 ? 144 SER A CB    1 
ATOM   1124  O  OG    . SER A 1 144 ? 23.792  -7.389  -10.441  1.00 123.99 ? 144 SER A OG    1 
ATOM   1125  N  N     . GLY A 1 145 ? 27.183  -5.770  -13.267  1.00 111.45 ? 145 GLY A N     1 
ATOM   1126  C  CA    . GLY A 1 145 ? 28.068  -5.912  -14.395  1.00 111.07 ? 145 GLY A CA    1 
ATOM   1127  C  C     . GLY A 1 145 ? 27.433  -6.436  -15.652  1.00 104.10 ? 145 GLY A C     1 
ATOM   1128  O  O     . GLY A 1 145 ? 28.141  -6.953  -16.515  1.00 89.69  ? 145 GLY A O     1 
ATOM   1129  N  N     . ARG A 1 146 ? 26.111  -6.252  -15.752  1.00 90.70  ? 146 ARG A N     1 
ATOM   1130  C  CA    . ARG A 1 146 ? 25.333  -6.646  -16.918  1.00 78.75  ? 146 ARG A CA    1 
ATOM   1131  C  C     . ARG A 1 146 ? 24.730  -5.422  -17.526  1.00 84.29  ? 146 ARG A C     1 
ATOM   1132  O  O     . ARG A 1 146 ? 24.384  -4.481  -16.799  1.00 88.09  ? 146 ARG A O     1 
ATOM   1133  C  CB    . ARG A 1 146 ? 24.187  -7.552  -16.541  1.00 74.78  ? 146 ARG A CB    1 
ATOM   1134  C  CG    . ARG A 1 146 ? 24.481  -8.496  -15.348  1.00 82.69  ? 146 ARG A CG    1 
ATOM   1135  C  CD    . ARG A 1 146 ? 23.226  -9.116  -14.803  1.00 95.18  ? 146 ARG A CD    1 
ATOM   1136  N  NE    . ARG A 1 146 ? 22.565  -9.792  -15.908  1.00 102.02 ? 146 ARG A NE    1 
ATOM   1137  C  CZ    . ARG A 1 146 ? 22.911  -10.986 -16.367  1.00 110.83 ? 146 ARG A CZ    1 
ATOM   1138  N  NH1   . ARG A 1 146 ? 23.911  -11.689 -15.813  1.00 116.81 ? 146 ARG A NH1   1 
ATOM   1139  N  NH2   . ARG A 1 146 ? 22.242  -11.486 -17.391  1.00 107.45 ? 146 ARG A NH2   1 
ATOM   1140  N  N     . THR A 1 147 ? 24.605  -5.449  -18.861  1.00 94.04  ? 147 THR A N     1 
ATOM   1141  C  CA    . THR A 1 147 ? 24.151  -4.306  -19.682  1.00 107.59 ? 147 THR A CA    1 
ATOM   1142  C  C     . THR A 1 147 ? 22.643  -4.356  -19.875  1.00 97.81  ? 147 THR A C     1 
ATOM   1143  O  O     . THR A 1 147 ? 22.041  -3.396  -20.276  1.00 91.66  ? 147 THR A O     1 
ATOM   1144  C  CB    . THR A 1 147 ? 24.769  -4.363  -21.076  1.00 135.45 ? 147 THR A CB    1 
ATOM   1145  O  OG1   . THR A 1 147 ? 24.400  -5.586  -21.750  1.00 125.45 ? 147 THR A OG1   1 
ATOM   1146  C  CG2   . THR A 1 147 ? 26.258  -4.301  -20.939  1.00 162.48 ? 147 THR A CG2   1 
ATOM   1147  N  N     . THR A 1 148 ? 22.057  -5.496  -19.550  1.00 95.62  ? 148 THR A N     1 
ATOM   1148  C  CA    . THR A 1 148 ? 20.656  -5.717  -19.852  1.00 93.60  ? 148 THR A CA    1 
ATOM   1149  C  C     . THR A 1 148 ? 20.037  -6.544  -18.757  1.00 76.58  ? 148 THR A C     1 
ATOM   1150  O  O     . THR A 1 148 ? 20.648  -7.484  -18.263  1.00 79.94  ? 148 THR A O     1 
ATOM   1151  C  CB    . THR A 1 148 ? 20.517  -6.559  -21.124  1.00 106.92 ? 148 THR A CB    1 
ATOM   1152  O  OG1   . THR A 1 148 ? 21.058  -5.835  -22.234  1.00 118.04 ? 148 THR A OG1   1 
ATOM   1153  C  CG2   . THR A 1 148 ? 19.033  -6.872  -21.360  1.00 111.58 ? 148 THR A CG2   1 
ATOM   1154  N  N     . GLY A 1 149 ? 18.794  -6.227  -18.402  1.00 66.53  ? 149 GLY A N     1 
ATOM   1155  C  CA    . GLY A 1 149 ? 18.116  -6.986  -17.370  1.00 65.97  ? 149 GLY A CA    1 
ATOM   1156  C  C     . GLY A 1 149 ? 16.925  -6.218  -16.877  1.00 69.64  ? 149 GLY A C     1 
ATOM   1157  O  O     . GLY A 1 149 ? 16.710  -5.077  -17.290  1.00 79.63  ? 149 GLY A O     1 
ATOM   1158  N  N     . ILE A 1 150 ? 16.069  -6.869  -16.081  1.00 65.38  ? 150 ILE A N     1 
ATOM   1159  C  CA    . ILE A 1 150 ? 14.948  -6.184  -15.520  1.00 63.81  ? 150 ILE A CA    1 
ATOM   1160  C  C     . ILE A 1 150 ? 15.211  -6.233  -14.039  1.00 58.48  ? 150 ILE A C     1 
ATOM   1161  O  O     . ILE A 1 150 ? 15.279  -7.258  -13.441  1.00 59.72  ? 150 ILE A O     1 
ATOM   1162  C  CB    . ILE A 1 150 ? 13.598  -6.802  -15.871  1.00 80.79  ? 150 ILE A CB    1 
ATOM   1163  C  CG1   . ILE A 1 150 ? 12.480  -5.994  -15.171  1.00 99.75  ? 150 ILE A CG1   1 
ATOM   1164  C  CG2   . ILE A 1 150 ? 13.569  -8.301  -15.557  1.00 86.62  ? 150 ILE A CG2   1 
ATOM   1165  C  CD1   . ILE A 1 150 ? 11.089  -6.273  -15.720  1.00 118.31 ? 150 ILE A CD1   1 
ATOM   1166  N  N     . VAL A 1 151 ? 15.453  -5.078  -13.471  1.00 63.76  ? 151 VAL A N     1 
ATOM   1167  C  CA    . VAL A 1 151 ? 15.942  -4.989  -12.110  1.00 69.29  ? 151 VAL A CA    1 
ATOM   1168  C  C     . VAL A 1 151 ? 14.747  -4.783  -11.270  1.00 70.25  ? 151 VAL A C     1 
ATOM   1169  O  O     . VAL A 1 151 ? 14.016  -3.807  -11.486  1.00 71.22  ? 151 VAL A O     1 
ATOM   1170  C  CB    . VAL A 1 151 ? 16.898  -3.854  -11.956  1.00 86.40  ? 151 VAL A CB    1 
ATOM   1171  C  CG1   . VAL A 1 151 ? 17.212  -3.617  -10.471  1.00 94.13  ? 151 VAL A CG1   1 
ATOM   1172  C  CG2   . VAL A 1 151 ? 18.140  -4.168  -12.809  1.00 92.72  ? 151 VAL A CG2   1 
ATOM   1173  N  N     . MET A 1 152 ? 14.540  -5.744  -10.401  1.00 85.89  ? 152 MET A N     1 
ATOM   1174  C  CA    . MET A 1 152 ? 13.527  -5.747  -9.334   1.00 93.92  ? 152 MET A CA    1 
ATOM   1175  C  C     . MET A 1 152 ? 14.188  -5.178  -8.083   1.00 93.95  ? 152 MET A C     1 
ATOM   1176  O  O     . MET A 1 152 ? 15.077  -5.742  -7.466   1.00 87.77  ? 152 MET A O     1 
ATOM   1177  C  CB    . MET A 1 152 ? 13.112  -7.181  -9.065   1.00 106.05 ? 152 MET A CB    1 
ATOM   1178  C  CG    . MET A 1 152 ? 12.197  -7.420  -7.905   1.00 115.25 ? 152 MET A CG    1 
ATOM   1179  S  SD    . MET A 1 152 ? 10.675  -6.653  -8.364   1.00 150.84 ? 152 MET A SD    1 
ATOM   1180  C  CE    . MET A 1 152 ? 9.827   -6.820  -6.794   1.00 161.23 ? 152 MET A CE    1 
ATOM   1181  N  N     . ASP A 1 153 ? 13.761  -3.987  -7.761   1.00 107.82 ? 153 ASP A N     1 
ATOM   1182  C  CA    . ASP A 1 153 ? 14.393  -3.195  -6.697   1.00 119.77 ? 153 ASP A CA    1 
ATOM   1183  C  C     . ASP A 1 153 ? 13.365  -3.032  -5.600   1.00 116.42 ? 153 ASP A C     1 
ATOM   1184  O  O     . ASP A 1 153 ? 12.324  -2.365  -5.817   1.00 151.70 ? 153 ASP A O     1 
ATOM   1185  C  CB    . ASP A 1 153 ? 14.792  -1.799  -7.230   1.00 149.82 ? 153 ASP A CB    1 
ATOM   1186  C  CG    . ASP A 1 153 ? 14.791  -0.681  -6.176   1.00 156.06 ? 153 ASP A CG    1 
ATOM   1187  O  OD1   . ASP A 1 153 ? 15.026  -0.965  -4.947   1.00 148.58 ? 153 ASP A OD1   1 
ATOM   1188  O  OD2   . ASP A 1 153 ? 14.507  0.467   -6.605   1.00 140.78 ? 153 ASP A OD2   1 
ATOM   1189  N  N     . SER A 1 154 ? 13.598  -3.656  -4.471   1.00 92.08  ? 154 SER A N     1 
ATOM   1190  C  CA    . SER A 1 154 ? 12.693  -3.497  -3.364   1.00 89.95  ? 154 SER A CA    1 
ATOM   1191  C  C     . SER A 1 154 ? 13.591  -3.232  -2.202   1.00 98.98  ? 154 SER A C     1 
ATOM   1192  O  O     . SER A 1 154 ? 14.428  -4.096  -1.811   1.00 113.56 ? 154 SER A O     1 
ATOM   1193  C  CB    . SER A 1 154 ? 11.781  -4.718  -3.181   1.00 78.41  ? 154 SER A CB    1 
ATOM   1194  O  OG    . SER A 1 154 ? 12.498  -5.921  -3.111   1.00 73.03  ? 154 SER A OG    1 
ATOM   1195  N  N     . GLY A 1 155 ? 13.489  -2.023  -1.667   1.00 96.94  ? 155 GLY A N     1 
ATOM   1196  C  CA    . GLY A 1 155 ? 14.108  -1.709  -0.397   1.00 98.38  ? 155 GLY A CA    1 
ATOM   1197  C  C     . GLY A 1 155 ? 13.088  -1.751  0.733    1.00 94.36  ? 155 GLY A C     1 
ATOM   1198  O  O     . GLY A 1 155 ? 12.095  -2.467  0.702    1.00 93.65  ? 155 GLY A O     1 
ATOM   1199  N  N     . ASP A 1 156 ? 13.382  -0.995  1.776    1.00 99.08  ? 156 ASP A N     1 
ATOM   1200  C  CA    . ASP A 1 156 ? 12.476  -0.797  2.865    1.00 110.66 ? 156 ASP A CA    1 
ATOM   1201  C  C     . ASP A 1 156 ? 11.482  0.247   2.411    1.00 93.42  ? 156 ASP A C     1 
ATOM   1202  O  O     . ASP A 1 156 ? 10.357  0.233   2.845    1.00 94.80  ? 156 ASP A O     1 
ATOM   1203  C  CB    . ASP A 1 156 ? 13.238  -0.281  4.092    1.00 147.07 ? 156 ASP A CB    1 
ATOM   1204  C  CG    . ASP A 1 156 ? 12.373  -0.197  5.311    1.00 174.90 ? 156 ASP A CG    1 
ATOM   1205  O  OD1   . ASP A 1 156 ? 12.054  -1.245  5.905    1.00 187.42 ? 156 ASP A OD1   1 
ATOM   1206  O  OD2   . ASP A 1 156 ? 12.022  0.932   5.729    1.00 179.06 ? 156 ASP A OD2   1 
ATOM   1207  N  N     . GLY A 1 157 ? 11.909  1.163   1.551    1.00 99.77  ? 157 GLY A N     1 
ATOM   1208  C  CA    . GLY A 1 157 ? 11.030  2.250   1.083    1.00 108.45 ? 157 GLY A CA    1 
ATOM   1209  C  C     . GLY A 1 157 ? 9.851   1.786   0.285    1.00 91.75  ? 157 GLY A C     1 
ATOM   1210  O  O     . GLY A 1 157 ? 8.741   1.692   0.806    1.00 76.12  ? 157 GLY A O     1 
ATOM   1211  N  N     . VAL A 1 158 ? 10.122  1.544   -0.997   1.00 90.25  ? 158 VAL A N     1 
ATOM   1212  C  CA    . VAL A 1 158 ? 9.130   0.952   -1.884   1.00 89.58  ? 158 VAL A CA    1 
ATOM   1213  C  C     . VAL A 1 158 ? 9.801   0.046   -2.867   1.00 75.69  ? 158 VAL A C     1 
ATOM   1214  O  O     . VAL A 1 158 ? 11.000  0.107   -3.056   1.00 77.85  ? 158 VAL A O     1 
ATOM   1215  C  CB    . VAL A 1 158 ? 8.260   2.053   -2.573   1.00 117.62 ? 158 VAL A CB    1 
ATOM   1216  C  CG1   . VAL A 1 158 ? 7.904   1.769   -4.022   1.00 122.12 ? 158 VAL A CG1   1 
ATOM   1217  C  CG2   . VAL A 1 158 ? 6.962   2.256   -1.782   1.00 143.50 ? 158 VAL A CG2   1 
ATOM   1218  N  N     . THR A 1 159 ? 9.005   -0.805  -3.510   1.00 69.11  ? 159 THR A N     1 
ATOM   1219  C  CA    . THR A 1 159 ? 9.445   -1.648  -4.593   1.00 73.43  ? 159 THR A CA    1 
ATOM   1220  C  C     . THR A 1 159 ? 9.292   -1.091  -6.004   1.00 67.36  ? 159 THR A C     1 
ATOM   1221  O  O     . THR A 1 159 ? 8.305   -0.460  -6.356   1.00 79.01  ? 159 THR A O     1 
ATOM   1222  C  CB    . THR A 1 159 ? 8.593   -2.913  -4.569   1.00 85.92  ? 159 THR A CB    1 
ATOM   1223  O  OG1   . THR A 1 159 ? 8.948   -3.671  -3.400   1.00 92.90  ? 159 THR A OG1   1 
ATOM   1224  C  CG2   . THR A 1 159 ? 8.742   -3.777  -5.830   1.00 90.82  ? 159 THR A CG2   1 
ATOM   1225  N  N     . HIS A 1 160 ? 10.270  -1.363  -6.831   1.00 68.72  ? 160 HIS A N     1 
ATOM   1226  C  CA    . HIS A 1 160 ? 10.411  -0.716  -8.122   1.00 80.11  ? 160 HIS A CA    1 
ATOM   1227  C  C     . HIS A 1 160 ? 10.898  -1.743  -9.115   1.00 77.38  ? 160 HIS A C     1 
ATOM   1228  O  O     . HIS A 1 160 ? 11.428  -2.811  -8.773   1.00 74.41  ? 160 HIS A O     1 
ATOM   1229  C  CB    . HIS A 1 160 ? 11.382  0.519   -8.063   1.00 89.71  ? 160 HIS A CB    1 
ATOM   1230  C  CG    . HIS A 1 160 ? 11.026  1.529   -7.003   1.00 145.37 ? 160 HIS A CG    1 
ATOM   1231  N  ND1   . HIS A 1 160 ? 11.442  1.431   -5.692   1.00 177.80 ? 160 HIS A ND1   1 
ATOM   1232  C  CD2   . HIS A 1 160 ? 10.267  2.653   -7.071   1.00 194.39 ? 160 HIS A CD2   1 
ATOM   1233  C  CE1   . HIS A 1 160 ? 10.972  2.458   -5.000   1.00 207.04 ? 160 HIS A CE1   1 
ATOM   1234  N  NE2   . HIS A 1 160 ? 10.243  3.212   -5.807   1.00 205.08 ? 160 HIS A NE2   1 
ATOM   1235  N  N     . THR A 1 161 ? 10.663  -1.429  -10.365  1.00 84.75  ? 161 THR A N     1 
ATOM   1236  C  CA    . THR A 1 161 ? 10.960  -2.408  -11.418  1.00 82.54  ? 161 THR A CA    1 
ATOM   1237  C  C     . THR A 1 161 ? 11.263  -1.686  -12.700  1.00 72.63  ? 161 THR A C     1 
ATOM   1238  O  O     . THR A 1 161 ? 10.447  -0.971  -13.229  1.00 78.68  ? 161 THR A O     1 
ATOM   1239  C  CB    . THR A 1 161 ? 9.811   -3.368  -11.664  1.00 93.12  ? 161 THR A CB    1 
ATOM   1240  O  OG1   . THR A 1 161 ? 9.415   -4.022  -10.443  1.00 91.31  ? 161 THR A OG1   1 
ATOM   1241  C  CG2   . THR A 1 161 ? 10.246  -4.414  -12.654  1.00 118.29 ? 161 THR A CG2   1 
ATOM   1242  N  N     . VAL A 1 162 ? 12.472  -1.827  -13.179  1.00 72.33  ? 162 VAL A N     1 
ATOM   1243  C  CA    . VAL A 1 162 ? 12.913  -1.061  -14.356  1.00 79.37  ? 162 VAL A CA    1 
ATOM   1244  C  C     . VAL A 1 162 ? 13.621  -1.957  -15.325  1.00 76.90  ? 162 VAL A C     1 
ATOM   1245  O  O     . VAL A 1 162 ? 14.700  -2.478  -15.063  1.00 92.18  ? 162 VAL A O     1 
ATOM   1246  C  CB    . VAL A 1 162 ? 13.844  0.119   -13.956  1.00 103.06 ? 162 VAL A CB    1 
ATOM   1247  C  CG1   . VAL A 1 162 ? 14.324  0.875   -15.206  1.00 113.61 ? 162 VAL A CG1   1 
ATOM   1248  C  CG2   . VAL A 1 162 ? 13.130  1.042   -12.976  1.00 112.97 ? 162 VAL A CG2   1 
ATOM   1249  N  N     . PRO A 1 163 ? 12.977  -2.193  -16.452  1.00 73.47  ? 163 PRO A N     1 
ATOM   1250  C  CA    . PRO A 1 163 ? 13.588  -3.018  -17.475  1.00 78.54  ? 163 PRO A CA    1 
ATOM   1251  C  C     . PRO A 1 163 ? 14.581  -2.220  -18.237  1.00 61.25  ? 163 PRO A C     1 
ATOM   1252  O  O     . PRO A 1 163 ? 14.290  -1.087  -18.539  1.00 72.16  ? 163 PRO A O     1 
ATOM   1253  C  CB    . PRO A 1 163 ? 12.400  -3.402  -18.371  1.00 97.31  ? 163 PRO A CB    1 
ATOM   1254  C  CG    . PRO A 1 163 ? 11.385  -2.312  -18.142  1.00 94.63  ? 163 PRO A CG    1 
ATOM   1255  C  CD    . PRO A 1 163 ? 11.576  -1.828  -16.735  1.00 72.86  ? 163 PRO A CD    1 
ATOM   1256  N  N     . ILE A 1 164 ? 15.724  -2.805  -18.594  1.00 53.97  ? 164 ILE A N     1 
ATOM   1257  C  CA    . ILE A 1 164 ? 16.744  -2.083  -19.313  1.00 60.52  ? 164 ILE A CA    1 
ATOM   1258  C  C     . ILE A 1 164 ? 17.278  -2.969  -20.408  1.00 73.96  ? 164 ILE A C     1 
ATOM   1259  O  O     . ILE A 1 164 ? 17.528  -4.156  -20.190  1.00 98.01  ? 164 ILE A O     1 
ATOM   1260  C  CB    . ILE A 1 164 ? 17.883  -1.703  -18.376  1.00 65.28  ? 164 ILE A CB    1 
ATOM   1261  C  CG1   . ILE A 1 164 ? 18.359  -0.272  -18.607  1.00 74.47  ? 164 ILE A CG1   1 
ATOM   1262  C  CG2   . ILE A 1 164 ? 18.979  -2.741  -18.360  1.00 72.36  ? 164 ILE A CG2   1 
ATOM   1263  C  CD1   . ILE A 1 164 ? 17.604  0.779   -17.786  1.00 87.76  ? 164 ILE A CD1   1 
ATOM   1264  N  N     . TYR A 1 165 ? 17.477  -2.451  -21.597  1.00 80.50  ? 165 TYR A N     1 
ATOM   1265  C  CA    . TYR A 1 165 ? 18.016  -3.307  -22.627  1.00 78.89  ? 165 TYR A CA    1 
ATOM   1266  C  C     . TYR A 1 165 ? 19.166  -2.593  -23.240  1.00 79.62  ? 165 TYR A C     1 
ATOM   1267  O  O     . TYR A 1 165 ? 18.991  -1.541  -23.798  1.00 84.13  ? 165 TYR A O     1 
ATOM   1268  C  CB    . TYR A 1 165 ? 16.957  -3.608  -23.692  1.00 80.04  ? 165 TYR A CB    1 
ATOM   1269  C  CG    . TYR A 1 165 ? 17.580  -4.327  -24.824  1.00 84.86  ? 165 TYR A CG    1 
ATOM   1270  C  CD1   . TYR A 1 165 ? 17.718  -5.668  -24.771  1.00 100.73 ? 165 TYR A CD1   1 
ATOM   1271  C  CD2   . TYR A 1 165 ? 18.024  -3.663  -25.964  1.00 104.95 ? 165 TYR A CD2   1 
ATOM   1272  C  CE1   . TYR A 1 165 ? 18.293  -6.392  -25.814  1.00 124.63 ? 165 TYR A CE1   1 
ATOM   1273  C  CE2   . TYR A 1 165 ? 18.619  -4.351  -26.993  1.00 119.31 ? 165 TYR A CE2   1 
ATOM   1274  C  CZ    . TYR A 1 165 ? 18.748  -5.720  -26.917  1.00 129.92 ? 165 TYR A CZ    1 
ATOM   1275  O  OH    . TYR A 1 165 ? 19.337  -6.446  -27.964  1.00 146.11 ? 165 TYR A OH    1 
ATOM   1276  N  N     . GLU A 1 166 ? 20.341  -3.196  -23.177  1.00 89.95  ? 166 GLU A N     1 
ATOM   1277  C  CA    . GLU A 1 166 ? 21.538  -2.702  -23.873  1.00 116.19 ? 166 GLU A CA    1 
ATOM   1278  C  C     . GLU A 1 166 ? 21.780  -1.245  -23.473  1.00 110.40 ? 166 GLU A C     1 
ATOM   1279  O  O     . GLU A 1 166 ? 21.987  -0.358  -24.291  1.00 108.18 ? 166 GLU A O     1 
ATOM   1280  C  CB    . GLU A 1 166 ? 21.450  -2.865  -25.389  1.00 146.93 ? 166 GLU A CB    1 
ATOM   1281  C  CG    . GLU A 1 166 ? 22.755  -2.702  -26.118  1.00 188.78 ? 166 GLU A CG    1 
ATOM   1282  C  CD    . GLU A 1 166 ? 23.750  -3.747  -25.691  1.00 212.31 ? 166 GLU A CD    1 
ATOM   1283  O  OE1   . GLU A 1 166 ? 23.287  -4.850  -25.346  1.00 233.76 ? 166 GLU A OE1   1 
ATOM   1284  O  OE2   . GLU A 1 166 ? 24.957  -3.456  -25.667  1.00 217.17 ? 166 GLU A OE2   1 
ATOM   1285  N  N     . GLY A 1 167 ? 21.786  -1.002  -22.181  1.00 112.08 ? 167 GLY A N     1 
ATOM   1286  C  CA    . GLY A 1 167 ? 21.581  0.353   -21.681  1.00 101.75 ? 167 GLY A CA    1 
ATOM   1287  C  C     . GLY A 1 167 ? 20.159  0.693   -22.043  1.00 95.75  ? 167 GLY A C     1 
ATOM   1288  O  O     . GLY A 1 167 ? 19.229  -0.069  -21.755  1.00 99.32  ? 167 GLY A O     1 
ATOM   1289  N  N     . TYR A 1 168 ? 19.951  1.811   -22.692  1.00 86.60  ? 168 TYR A N     1 
ATOM   1290  C  CA    . TYR A 1 168 ? 18.572  2.289   -22.847  1.00 91.08  ? 168 TYR A CA    1 
ATOM   1291  C  C     . TYR A 1 168 ? 17.678  2.157   -21.585  1.00 90.56  ? 168 TYR A C     1 
ATOM   1292  O  O     . TYR A 1 168 ? 18.217  2.327   -20.488  1.00 111.72 ? 168 TYR A O     1 
ATOM   1293  C  CB    . TYR A 1 168 ? 17.990  1.817   -24.172  1.00 95.47  ? 168 TYR A CB    1 
ATOM   1294  C  CG    . TYR A 1 168 ? 18.835  2.346   -25.285  1.00 119.79 ? 168 TYR A CG    1 
ATOM   1295  C  CD1   . TYR A 1 168 ? 18.889  3.703   -25.540  1.00 118.87 ? 168 TYR A CD1   1 
ATOM   1296  C  CD2   . TYR A 1 168 ? 19.635  1.500   -26.017  1.00 139.22 ? 168 TYR A CD2   1 
ATOM   1297  C  CE1   . TYR A 1 168 ? 19.705  4.195   -26.519  1.00 128.17 ? 168 TYR A CE1   1 
ATOM   1298  C  CE2   . TYR A 1 168 ? 20.436  1.977   -27.023  1.00 144.60 ? 168 TYR A CE2   1 
ATOM   1299  C  CZ    . TYR A 1 168 ? 20.485  3.336   -27.274  1.00 140.38 ? 168 TYR A CZ    1 
ATOM   1300  O  OH    . TYR A 1 168 ? 21.313  3.833   -28.291  1.00 131.32 ? 168 TYR A OH    1 
ATOM   1301  N  N     . ALA A 1 169 ? 16.362  1.980   -21.680  1.00 81.36  ? 169 ALA A N     1 
ATOM   1302  C  CA    . ALA A 1 169 ? 15.477  2.149   -20.502  1.00 78.03  ? 169 ALA A CA    1 
ATOM   1303  C  C     . ALA A 1 169 ? 14.113  2.433   -21.057  1.00 86.97  ? 169 ALA A C     1 
ATOM   1304  O  O     . ALA A 1 169 ? 13.998  3.148   -22.051  1.00 115.35 ? 169 ALA A O     1 
ATOM   1305  C  CB    . ALA A 1 169 ? 15.856  3.317   -19.589  1.00 67.63  ? 169 ALA A CB    1 
ATOM   1306  N  N     . LEU A 1 170 ? 13.082  1.927   -20.411  1.00 78.14  ? 170 LEU A N     1 
ATOM   1307  C  CA    . LEU A 1 170 ? 11.737  2.041   -21.003  1.00 76.77  ? 170 LEU A CA    1 
ATOM   1308  C  C     . LEU A 1 170 ? 10.880  2.679   -19.993  1.00 84.65  ? 170 LEU A C     1 
ATOM   1309  O  O     . LEU A 1 170 ? 10.478  2.042   -19.059  1.00 88.10  ? 170 LEU A O     1 
ATOM   1310  C  CB    . LEU A 1 170 ? 11.255  0.643   -21.333  1.00 77.48  ? 170 LEU A CB    1 
ATOM   1311  C  CG    . LEU A 1 170 ? 12.065  -0.099  -22.405  1.00 73.59  ? 170 LEU A CG    1 
ATOM   1312  C  CD1   . LEU A 1 170 ? 11.731  -1.603  -22.422  1.00 66.57  ? 170 LEU A CD1   1 
ATOM   1313  C  CD2   . LEU A 1 170 ? 11.890  0.559   -23.791  1.00 77.89  ? 170 LEU A CD2   1 
ATOM   1314  N  N     . PRO A 1 171 ? 10.586  3.962   -20.132  1.00 107.71 ? 171 PRO A N     1 
ATOM   1315  C  CA    . PRO A 1 171 ? 9.784   4.683   -19.179  1.00 115.05 ? 171 PRO A CA    1 
ATOM   1316  C  C     . PRO A 1 171 ? 8.398   4.144   -18.930  1.00 95.84  ? 171 PRO A C     1 
ATOM   1317  O  O     . PRO A 1 171 ? 7.928   4.103   -17.798  1.00 95.67  ? 171 PRO A O     1 
ATOM   1318  C  CB    . PRO A 1 171 ? 9.700   6.093   -19.799  1.00 135.29 ? 171 PRO A CB    1 
ATOM   1319  C  CG    . PRO A 1 171 ? 10.982  6.230   -20.543  1.00 134.61 ? 171 PRO A CG    1 
ATOM   1320  C  CD    . PRO A 1 171 ? 11.287  4.861   -21.061  1.00 129.42 ? 171 PRO A CD    1 
ATOM   1321  N  N     . HIS A 1 172 ? 7.705   3.752   -19.997  1.00 89.92  ? 172 HIS A N     1 
ATOM   1322  C  CA    . HIS A 1 172 ? 6.344   3.271   -19.888  1.00 94.61  ? 172 HIS A CA    1 
ATOM   1323  C  C     . HIS A 1 172 ? 6.325   1.994   -19.123  1.00 80.84  ? 172 HIS A C     1 
ATOM   1324  O  O     . HIS A 1 172 ? 5.356   1.714   -18.392  1.00 87.98  ? 172 HIS A O     1 
ATOM   1325  C  CB    . HIS A 1 172 ? 5.696   3.046   -21.254  1.00 118.48 ? 172 HIS A CB    1 
ATOM   1326  C  CG    . HIS A 1 172 ? 6.523   2.200   -22.175  1.00 134.94 ? 172 HIS A CG    1 
ATOM   1327  N  ND1   . HIS A 1 172 ? 7.625   2.686   -22.846  1.00 145.57 ? 172 HIS A ND1   1 
ATOM   1328  C  CD2   . HIS A 1 172 ? 6.408   0.900   -22.538  1.00 141.54 ? 172 HIS A CD2   1 
ATOM   1329  C  CE1   . HIS A 1 172 ? 8.135   1.733   -23.613  1.00 152.58 ? 172 HIS A CE1   1 
ATOM   1330  N  NE2   . HIS A 1 172 ? 7.426   0.634   -23.430  1.00 155.02 ? 172 HIS A NE2   1 
ATOM   1331  N  N     . ALA A 1 173 ? 7.379   1.174   -19.315  1.00 73.60  ? 173 ALA A N     1 
ATOM   1332  C  CA    . ALA A 1 173 ? 7.549   -0.152  -18.741  1.00 75.15  ? 173 ALA A CA    1 
ATOM   1333  C  C     . ALA A 1 173 ? 7.915   -0.134  -17.259  1.00 62.66  ? 173 ALA A C     1 
ATOM   1334  O  O     . ALA A 1 173 ? 7.723   -1.119  -16.576  1.00 53.64  ? 173 ALA A O     1 
ATOM   1335  C  CB    . ALA A 1 173 ? 8.605   -0.964  -19.485  1.00 81.72  ? 173 ALA A CB    1 
ATOM   1336  N  N     . ILE A 1 174 ? 8.545   0.929   -16.785  1.00 69.21  ? 174 ILE A N     1 
ATOM   1337  C  CA    . ILE A 1 174 ? 8.911   1.049   -15.406  1.00 78.82  ? 174 ILE A CA    1 
ATOM   1338  C  C     . ILE A 1 174 ? 7.708   0.908   -14.490  1.00 62.17  ? 174 ILE A C     1 
ATOM   1339  O  O     . ILE A 1 174 ? 6.703   1.584   -14.713  1.00 53.93  ? 174 ILE A O     1 
ATOM   1340  C  CB    . ILE A 1 174 ? 9.544   2.395   -15.074  1.00 98.94  ? 174 ILE A CB    1 
ATOM   1341  C  CG1   . ILE A 1 174 ? 10.962  2.467   -15.709  1.00 125.13 ? 174 ILE A CG1   1 
ATOM   1342  C  CG2   . ILE A 1 174 ? 9.582   2.563   -13.547  1.00 98.92  ? 174 ILE A CG2   1 
ATOM   1343  C  CD1   . ILE A 1 174 ? 11.535  3.873   -15.699  1.00 139.60 ? 174 ILE A CD1   1 
ATOM   1344  N  N     . LEU A 1 175 ? 7.854   0.085   -13.470  1.00 72.23  ? 175 LEU A N     1 
ATOM   1345  C  CA    . LEU A 1 175 ? 6.683   -0.170  -12.615  1.00 90.91  ? 175 LEU A CA    1 
ATOM   1346  C  C     . LEU A 1 175 ? 7.067   0.118   -11.201  1.00 95.68  ? 175 LEU A C     1 
ATOM   1347  O  O     . LEU A 1 175 ? 8.196   -0.172  -10.821  1.00 109.94 ? 175 LEU A O     1 
ATOM   1348  C  CB    . LEU A 1 175 ? 6.083   -1.559  -12.845  1.00 94.60  ? 175 LEU A CB    1 
ATOM   1349  C  CG    . LEU A 1 175 ? 4.754   -1.759  -12.149  1.00 118.96 ? 175 LEU A CG    1 
ATOM   1350  C  CD1   . LEU A 1 175 ? 3.737   -0.657  -12.514  1.00 133.46 ? 175 LEU A CD1   1 
ATOM   1351  C  CD2   . LEU A 1 175 ? 4.185   -3.167  -12.438  1.00 140.41 ? 175 LEU A CD2   1 
ATOM   1352  N  N     . ARG A 1 176 ? 6.147   0.681   -10.401  1.00 84.61  ? 176 ARG A N     1 
ATOM   1353  C  CA    . ARG A 1 176 ? 6.469   0.955   -9.006   1.00 79.48  ? 176 ARG A CA    1 
ATOM   1354  C  C     . ARG A 1 176 ? 5.309   0.471   -8.151   1.00 93.87  ? 176 ARG A C     1 
ATOM   1355  O  O     . ARG A 1 176 ? 4.182   0.933   -8.357   1.00 106.31 ? 176 ARG A O     1 
ATOM   1356  C  CB    . ARG A 1 176 ? 6.659   2.444   -8.731   1.00 75.91  ? 176 ARG A CB    1 
ATOM   1357  C  CG    . ARG A 1 176 ? 6.506   2.875   -7.261   1.00 87.23  ? 176 ARG A CG    1 
ATOM   1358  C  CD    . ARG A 1 176 ? 6.718   4.377   -7.079   1.00 104.51 ? 176 ARG A CD    1 
ATOM   1359  N  NE    . ARG A 1 176 ? 6.529   4.768   -5.706   1.00 110.35 ? 176 ARG A NE    1 
ATOM   1360  C  CZ    . ARG A 1 176 ? 6.694   6.007   -5.276   1.00 126.81 ? 176 ARG A CZ    1 
ATOM   1361  N  NH1   . ARG A 1 176 ? 7.021   6.969   -6.130   1.00 131.98 ? 176 ARG A NH1   1 
ATOM   1362  N  NH2   . ARG A 1 176 ? 6.507   6.296   -3.997   1.00 138.23 ? 176 ARG A NH2   1 
ATOM   1363  N  N     . LEU A 1 177 ? 5.605   -0.419  -7.229   1.00 100.13 ? 177 LEU A N     1 
ATOM   1364  C  CA    . LEU A 1 177 ? 4.615   -1.180  -6.468   1.00 101.44 ? 177 LEU A CA    1 
ATOM   1365  C  C     . LEU A 1 177 ? 4.762   -0.791  -5.025   1.00 99.72  ? 177 LEU A C     1 
ATOM   1366  O  O     . LEU A 1 177 ? 5.837   -0.853  -4.444   1.00 97.16  ? 177 LEU A O     1 
ATOM   1367  C  CB    . LEU A 1 177 ? 4.918   -2.683  -6.626   1.00 121.40 ? 177 LEU A CB    1 
ATOM   1368  C  CG    . LEU A 1 177 ? 4.055   -3.628  -5.760   1.00 144.38 ? 177 LEU A CG    1 
ATOM   1369  C  CD1   . LEU A 1 177 ? 2.569   -3.537  -6.140   1.00 147.13 ? 177 LEU A CD1   1 
ATOM   1370  C  CD2   . LEU A 1 177 ? 4.593   -5.069  -5.845   1.00 150.90 ? 177 LEU A CD2   1 
ATOM   1371  N  N     . ASP A 1 178 ? 3.668   -0.406  -4.396   1.00 121.91 ? 178 ASP A N     1 
ATOM   1372  C  CA    . ASP A 1 178 ? 3.749   -0.041  -2.964   1.00 143.98 ? 178 ASP A CA    1 
ATOM   1373  C  C     . ASP A 1 178 ? 3.732   -1.235  -1.973   1.00 131.32 ? 178 ASP A C     1 
ATOM   1374  O  O     . ASP A 1 178 ? 2.728   -1.576  -1.377   1.00 135.80 ? 178 ASP A O     1 
ATOM   1375  C  CB    . ASP A 1 178 ? 2.673   0.992   -2.581   1.00 157.64 ? 178 ASP A CB    1 
ATOM   1376  C  CG    . ASP A 1 178 ? 2.833   2.251   -3.339   1.00 187.86 ? 178 ASP A CG    1 
ATOM   1377  O  OD1   . ASP A 1 178 ? 3.723   2.273   -4.223   1.00 208.84 ? 178 ASP A OD1   1 
ATOM   1378  O  OD2   . ASP A 1 178 ? 2.091   3.190   -3.067   1.00 209.32 ? 178 ASP A OD2   1 
ATOM   1379  N  N     . LEU A 1 179 ? 4.896   -1.864  -1.862   1.00 119.24 ? 179 LEU A N     1 
ATOM   1380  C  CA    . LEU A 1 179 ? 5.141   -2.846  -0.863   1.00 122.00 ? 179 LEU A CA    1 
ATOM   1381  C  C     . LEU A 1 179 ? 6.560   -2.604  -0.485   1.00 138.26 ? 179 LEU A C     1 
ATOM   1382  O  O     . LEU A 1 179 ? 7.341   -2.025  -1.242   1.00 160.21 ? 179 LEU A O     1 
ATOM   1383  C  CB    . LEU A 1 179 ? 5.100   -4.247  -1.443   1.00 140.07 ? 179 LEU A CB    1 
ATOM   1384  C  CG    . LEU A 1 179 ? 3.773   -4.921  -1.809   1.00 167.87 ? 179 LEU A CG    1 
ATOM   1385  C  CD1   . LEU A 1 179 ? 4.027   -6.344  -2.362   1.00 175.07 ? 179 LEU A CD1   1 
ATOM   1386  C  CD2   . LEU A 1 179 ? 2.759   -4.961  -0.653   1.00 178.48 ? 179 LEU A CD2   1 
ATOM   1387  N  N     . ALA A 1 180 ? 6.955   -3.047  0.679    1.00 128.18 ? 180 ALA A N     1 
ATOM   1388  C  CA    . ALA A 1 180 ? 8.312   -2.791  1.184    1.00 116.19 ? 180 ALA A CA    1 
ATOM   1389  C  C     . ALA A 1 180 ? 8.589   -3.677  2.360    1.00 97.28  ? 180 ALA A C     1 
ATOM   1390  O  O     . ALA A 1 180 ? 7.696   -4.267  2.922    1.00 85.75  ? 180 ALA A O     1 
ATOM   1391  C  CB    . ALA A 1 180 ? 8.453   -1.345  1.671    1.00 138.15 ? 180 ALA A CB    1 
ATOM   1392  N  N     . GLY A 1 181 ? 9.832   -3.662  2.790    1.00 102.64 ? 181 GLY A N     1 
ATOM   1393  C  CA    . GLY A 1 181 ? 10.246  -4.245  4.064    1.00 113.26 ? 181 GLY A CA    1 
ATOM   1394  C  C     . GLY A 1 181 ? 9.385   -3.677  5.200    1.00 106.95 ? 181 GLY A C     1 
ATOM   1395  O  O     . GLY A 1 181 ? 8.987   -4.423  6.093    1.00 126.01 ? 181 GLY A O     1 
ATOM   1396  N  N     . ARG A 1 182 ? 9.120   -2.385  5.142    1.00 91.35  ? 182 ARG A N     1 
ATOM   1397  C  CA    . ARG A 1 182 ? 8.382   -1.771  6.227    1.00 98.22  ? 182 ARG A CA    1 
ATOM   1398  C  C     . ARG A 1 182 ? 6.962   -2.289  6.290    1.00 104.74 ? 182 ARG A C     1 
ATOM   1399  O  O     . ARG A 1 182 ? 6.453   -2.571  7.379    1.00 134.49 ? 182 ARG A O     1 
ATOM   1400  C  CB    . ARG A 1 182 ? 8.450   -0.233  6.184    1.00 118.85 ? 182 ARG A CB    1 
ATOM   1401  C  CG    . ARG A 1 182 ? 8.238   0.474   7.516    1.00 133.71 ? 182 ARG A CG    1 
ATOM   1402  C  CD    . ARG A 1 182 ? 8.728   1.912   7.446    1.00 158.65 ? 182 ARG A CD    1 
ATOM   1403  N  NE    . ARG A 1 182 ? 8.117   2.760   8.483    1.00 195.33 ? 182 ARG A NE    1 
ATOM   1404  C  CZ    . ARG A 1 182 ? 6.866   3.234   8.437    1.00 246.46 ? 182 ARG A CZ    1 
ATOM   1405  N  NH1   . ARG A 1 182 ? 6.095   2.916   7.402    1.00 265.17 ? 182 ARG A NH1   1 
ATOM   1406  N  NH2   . ARG A 1 182 ? 6.372   4.009   9.429    1.00 263.38 ? 182 ARG A NH2   1 
ATOM   1407  N  N     . ASP A 1 183 ? 6.352   -2.510  5.126    1.00 99.58  ? 183 ASP A N     1 
ATOM   1408  C  CA    . ASP A 1 183 ? 4.995   -3.037  5.120    1.00 101.43 ? 183 ASP A CA    1 
ATOM   1409  C  C     . ASP A 1 183 ? 4.991   -4.467  5.606    1.00 76.35  ? 183 ASP A C     1 
ATOM   1410  O  O     . ASP A 1 183 ? 4.059   -4.863  6.303    1.00 67.19  ? 183 ASP A O     1 
ATOM   1411  C  CB    . ASP A 1 183 ? 4.286   -2.801  3.756    1.00 147.09 ? 183 ASP A CB    1 
ATOM   1412  C  CG    . ASP A 1 183 ? 4.264   -1.286  3.346    1.00 185.74 ? 183 ASP A CG    1 
ATOM   1413  O  OD1   . ASP A 1 183 ? 4.274   -0.390  4.235    1.00 184.36 ? 183 ASP A OD1   1 
ATOM   1414  O  OD2   . ASP A 1 183 ? 4.268   -0.996  2.134    1.00 220.65 ? 183 ASP A OD2   1 
ATOM   1415  N  N     . LEU A 1 184 ? 6.022   -5.236  5.270    1.00 76.11  ? 184 LEU A N     1 
ATOM   1416  C  CA    . LEU A 1 184 ? 6.134   -6.588  5.797    1.00 85.78  ? 184 LEU A CA    1 
ATOM   1417  C  C     . LEU A 1 184 ? 6.229   -6.585  7.318    1.00 87.96  ? 184 LEU A C     1 
ATOM   1418  O  O     . LEU A 1 184 ? 5.606   -7.370  7.997    1.00 88.66  ? 184 LEU A O     1 
ATOM   1419  C  CB    . LEU A 1 184 ? 7.310   -7.395  5.200    1.00 88.21  ? 184 LEU A CB    1 
ATOM   1420  C  CG    . LEU A 1 184 ? 7.152   -7.682  3.723    1.00 101.09 ? 184 LEU A CG    1 
ATOM   1421  C  CD1   . LEU A 1 184 ? 8.366   -8.363  3.100    1.00 94.04  ? 184 LEU A CD1   1 
ATOM   1422  C  CD2   . LEU A 1 184 ? 5.862   -8.485  3.589    1.00 115.41 ? 184 LEU A CD2   1 
ATOM   1423  N  N     . THR A 1 185 ? 7.000   -5.656  7.845    1.00 84.77  ? 185 THR A N     1 
ATOM   1424  C  CA    . THR A 1 185 ? 7.167   -5.509  9.269    1.00 81.72  ? 185 THR A CA    1 
ATOM   1425  C  C     . THR A 1 185 ? 5.826   -5.225  9.899    1.00 73.42  ? 185 THR A C     1 
ATOM   1426  O  O     . THR A 1 185 ? 5.469   -5.842  10.902   1.00 74.60  ? 185 THR A O     1 
ATOM   1427  C  CB    . THR A 1 185 ? 8.143   -4.371  9.596    1.00 93.35  ? 185 THR A CB    1 
ATOM   1428  O  OG1   . THR A 1 185 ? 9.445   -4.797  9.198    1.00 86.69  ? 185 THR A OG1   1 
ATOM   1429  C  CG2   . THR A 1 185 ? 8.199   -4.066  11.065   1.00 118.20 ? 185 THR A CG2   1 
ATOM   1430  N  N     . ASP A 1 186 ? 5.091   -4.285  9.319    1.00 83.89  ? 186 ASP A N     1 
ATOM   1431  C  CA    . ASP A 1 186 ? 3.764   -3.947  9.874    1.00 97.30  ? 186 ASP A CA    1 
ATOM   1432  C  C     . ASP A 1 186 ? 2.850   -5.142  9.861    1.00 75.18  ? 186 ASP A C     1 
ATOM   1433  O  O     . ASP A 1 186 ? 2.125   -5.383  10.810   1.00 58.57  ? 186 ASP A O     1 
ATOM   1434  C  CB    . ASP A 1 186 ? 3.085   -2.787  9.136    1.00 130.43 ? 186 ASP A CB    1 
ATOM   1435  C  CG    . ASP A 1 186 ? 3.449   -1.425  9.714    1.00 146.74 ? 186 ASP A CG    1 
ATOM   1436  O  OD1   . ASP A 1 186 ? 3.735   -1.319  10.927   1.00 154.98 ? 186 ASP A OD1   1 
ATOM   1437  O  OD2   . ASP A 1 186 ? 3.449   -0.454  8.945    1.00 155.35 ? 186 ASP A OD2   1 
ATOM   1438  N  N     . TYR A 1 187 ? 2.891   -5.910  8.774    1.00 78.91  ? 187 TYR A N     1 
ATOM   1439  C  CA    . TYR A 1 187 ? 2.122   -7.143  8.663    1.00 87.66  ? 187 TYR A CA    1 
ATOM   1440  C  C     . TYR A 1 187 ? 2.592   -8.115  9.744    1.00 88.55  ? 187 TYR A C     1 
ATOM   1441  O  O     . TYR A 1 187 ? 1.764   -8.788  10.387   1.00 95.92  ? 187 TYR A O     1 
ATOM   1442  C  CB    . TYR A 1 187 ? 2.315   -7.829  7.309    1.00 101.95 ? 187 TYR A CB    1 
ATOM   1443  C  CG    . TYR A 1 187 ? 1.544   -9.102  7.215    1.00 104.34 ? 187 TYR A CG    1 
ATOM   1444  C  CD1   . TYR A 1 187 ? 0.173   -9.071  7.127    1.00 102.16 ? 187 TYR A CD1   1 
ATOM   1445  C  CD2   . TYR A 1 187 ? 2.179   -10.338 7.224    1.00 103.68 ? 187 TYR A CD2   1 
ATOM   1446  C  CE1   . TYR A 1 187 ? -0.557  -10.243 7.037    1.00 96.39  ? 187 TYR A CE1   1 
ATOM   1447  C  CE2   . TYR A 1 187 ? 1.456   -11.493 7.161    1.00 98.01  ? 187 TYR A CE2   1 
ATOM   1448  C  CZ    . TYR A 1 187 ? 0.082   -11.454 7.053    1.00 92.90  ? 187 TYR A CZ    1 
ATOM   1449  O  OH    . TYR A 1 187 ? -0.671  -12.637 6.963    1.00 96.76  ? 187 TYR A OH    1 
ATOM   1450  N  N     . LEU A 1 188 ? 3.907   -8.191  9.975    1.00 76.57  ? 188 LEU A N     1 
ATOM   1451  C  CA    . LEU A 1 188 ? 4.450   -9.237  10.788   1.00 70.99  ? 188 LEU A CA    1 
ATOM   1452  C  C     . LEU A 1 188 ? 4.013   -9.000  12.229   1.00 75.72  ? 188 LEU A C     1 
ATOM   1453  O  O     . LEU A 1 188 ? 3.555   -9.888  12.870   1.00 78.42  ? 188 LEU A O     1 
ATOM   1454  C  CB    . LEU A 1 188 ? 5.968   -9.247  10.738   1.00 67.95  ? 188 LEU A CB    1 
ATOM   1455  C  CG    . LEU A 1 188 ? 6.645   -10.396 11.503   1.00 78.92  ? 188 LEU A CG    1 
ATOM   1456  C  CD1   . LEU A 1 188 ? 6.209   -11.762 10.947   1.00 80.53  ? 188 LEU A CD1   1 
ATOM   1457  C  CD2   . LEU A 1 188 ? 8.177   -10.238 11.488   1.00 102.48 ? 188 LEU A CD2   1 
ATOM   1458  N  N     . MET A 1 189 ? 4.191   -7.779  12.709   1.00 85.03  ? 189 MET A N     1 
ATOM   1459  C  CA    . MET A 1 189 ? 3.773   -7.486  14.089   1.00 86.06  ? 189 MET A CA    1 
ATOM   1460  C  C     . MET A 1 189 ? 2.310   -7.765  14.234   1.00 79.29  ? 189 MET A C     1 
ATOM   1461  O  O     . MET A 1 189 ? 1.886   -8.221  15.292   1.00 78.33  ? 189 MET A O     1 
ATOM   1462  C  CB    . MET A 1 189 ? 4.233   -6.108  14.570   1.00 101.50 ? 189 MET A CB    1 
ATOM   1463  C  CG    . MET A 1 189 ? 3.719   -4.918  13.792   1.00 138.23 ? 189 MET A CG    1 
ATOM   1464  S  SD    . MET A 1 189 ? 4.284   -3.314  14.431   1.00 204.46 ? 189 MET A SD    1 
ATOM   1465  C  CE    . MET A 1 189 ? 2.919   -3.044  15.541   1.00 216.75 ? 189 MET A CE    1 
ATOM   1466  N  N     . LYS A 1 190 ? 1.506   -7.554  13.194   1.00 92.35  ? 190 LYS A N     1 
ATOM   1467  C  CA    . LYS A 1 190 ? 0.091   -7.926  13.233   1.00 107.70 ? 190 LYS A CA    1 
ATOM   1468  C  C     . LYS A 1 190 ? -0.084  -9.426  13.435   1.00 91.53  ? 190 LYS A C     1 
ATOM   1469  O  O     . LYS A 1 190 ? -0.887  -9.865  14.241   1.00 101.55 ? 190 LYS A O     1 
ATOM   1470  C  CB    . LYS A 1 190 ? -0.651  -7.488  11.960   1.00 121.05 ? 190 LYS A CB    1 
ATOM   1471  C  CG    . LYS A 1 190 ? -2.172  -7.516  12.094   1.00 127.24 ? 190 LYS A CG    1 
ATOM   1472  C  CD    . LYS A 1 190 ? -2.902  -6.793  10.953   1.00 147.59 ? 190 LYS A CD    1 
ATOM   1473  C  CE    . LYS A 1 190 ? -2.780  -7.494  9.597    1.00 161.94 ? 190 LYS A CE    1 
ATOM   1474  N  NZ    . LYS A 1 190 ? -3.504  -8.796  9.525    1.00 160.12 ? 190 LYS A NZ    1 
ATOM   1475  N  N     . ILE A 1 191 ? 0.666   -10.214 12.687   1.00 73.56  ? 191 ILE A N     1 
ATOM   1476  C  CA    . ILE A 1 191 ? 0.493   -11.647 12.684   1.00 79.43  ? 191 ILE A CA    1 
ATOM   1477  C  C     . ILE A 1 191 ? 0.988   -12.300 13.963   1.00 67.01  ? 191 ILE A C     1 
ATOM   1478  O  O     . ILE A 1 191 ? 0.527   -13.347 14.286   1.00 65.24  ? 191 ILE A O     1 
ATOM   1479  C  CB    . ILE A 1 191 ? 1.037   -12.321 11.395   1.00 100.31 ? 191 ILE A CB    1 
ATOM   1480  C  CG1   . ILE A 1 191 ? 0.294   -13.621 11.119   1.00 121.48 ? 191 ILE A CG1   1 
ATOM   1481  C  CG2   . ILE A 1 191 ? 2.554   -12.437 11.435   1.00 112.38 ? 191 ILE A CG2   1 
ATOM   1482  C  CD1   . ILE A 1 191 ? -1.036  -13.436 10.418   1.00 127.29 ? 191 ILE A CD1   1 
ATOM   1483  N  N     . LEU A 1 192 ? 1.937   -11.685 14.670   1.00 64.21  ? 192 LEU A N     1 
ATOM   1484  C  CA    . LEU A 1 192 ? 2.446   -12.195 15.910   1.00 70.20  ? 192 LEU A CA    1 
ATOM   1485  C  C     . LEU A 1 192 ? 1.309   -12.161 16.935   1.00 89.11  ? 192 LEU A C     1 
ATOM   1486  O  O     . LEU A 1 192 ? 1.272   -13.022 17.803   1.00 91.28  ? 192 LEU A O     1 
ATOM   1487  C  CB    . LEU A 1 192 ? 3.604   -11.383 16.489   1.00 70.02  ? 192 LEU A CB    1 
ATOM   1488  C  CG    . LEU A 1 192 ? 4.997   -11.875 16.130   1.00 77.00  ? 192 LEU A CG    1 
ATOM   1489  C  CD1   . LEU A 1 192 ? 5.363   -11.671 14.671   1.00 78.57  ? 192 LEU A CD1   1 
ATOM   1490  C  CD2   . LEU A 1 192 ? 6.079   -11.187 16.970   1.00 81.58  ? 192 LEU A CD2   1 
ATOM   1491  N  N     . THR A 1 193 ? 0.448   -11.169 16.848   1.00 103.56 ? 193 THR A N     1 
ATOM   1492  C  CA    . THR A 1 193 ? -0.472  -10.873 17.886   1.00 110.78 ? 193 THR A CA    1 
ATOM   1493  C  C     . THR A 1 193 ? -1.417  -12.007 18.086   1.00 120.39 ? 193 THR A C     1 
ATOM   1494  O  O     . THR A 1 193 ? -1.875  -12.252 19.209   1.00 135.30 ? 193 THR A O     1 
ATOM   1495  C  CB    . THR A 1 193 ? -1.322  -9.625  17.589   1.00 107.58 ? 193 THR A CB    1 
ATOM   1496  O  OG1   . THR A 1 193 ? -1.960  -9.770  16.315   1.00 99.80  ? 193 THR A OG1   1 
ATOM   1497  C  CG2   . THR A 1 193 ? -0.481  -8.360  17.642   1.00 114.93 ? 193 THR A CG2   1 
ATOM   1498  N  N     . GLU A 1 194 ? -1.655  -12.801 17.025   1.00 123.56 ? 194 GLU A N     1 
ATOM   1499  C  CA    . GLU A 1 194 ? -2.479  -14.005 17.140   1.00 132.13 ? 194 GLU A CA    1 
ATOM   1500  C  C     . GLU A 1 194 ? -1.844  -15.099 18.027   1.00 135.86 ? 194 GLU A C     1 
ATOM   1501  O  O     . GLU A 1 194 ? -2.540  -16.015 18.497   1.00 141.01 ? 194 GLU A O     1 
ATOM   1502  C  CB    . GLU A 1 194 ? -2.821  -14.594 15.782   1.00 137.60 ? 194 GLU A CB    1 
ATOM   1503  C  CG    . GLU A 1 194 ? -1.639  -15.195 15.030   1.00 144.30 ? 194 GLU A CG    1 
ATOM   1504  C  CD    . GLU A 1 194 ? -2.059  -15.678 13.682   1.00 170.43 ? 194 GLU A CD    1 
ATOM   1505  O  OE1   . GLU A 1 194 ? -3.243  -15.468 13.351   1.00 180.00 ? 194 GLU A OE1   1 
ATOM   1506  O  OE2   . GLU A 1 194 ? -1.207  -16.261 12.981   1.00 192.84 ? 194 GLU A OE2   1 
ATOM   1507  N  N     . ARG A 1 195 ? -0.529  -14.999 18.214   1.00 126.90 ? 195 ARG A N     1 
ATOM   1508  C  CA    . ARG A 1 195 ? 0.238   -15.857 19.072   1.00 128.68 ? 195 ARG A CA    1 
ATOM   1509  C  C     . ARG A 1 195 ? 0.337   -15.318 20.481   1.00 120.70 ? 195 ARG A C     1 
ATOM   1510  O  O     . ARG A 1 195 ? 0.698   -16.078 21.363   1.00 127.57 ? 195 ARG A O     1 
ATOM   1511  C  CB    . ARG A 1 195 ? 1.654   -15.999 18.522   1.00 128.08 ? 195 ARG A CB    1 
ATOM   1512  C  CG    . ARG A 1 195 ? 2.404   -17.236 19.024   1.00 139.80 ? 195 ARG A CG    1 
ATOM   1513  C  CD    . ARG A 1 195 ? 3.691   -17.541 18.252   1.00 143.93 ? 195 ARG A CD    1 
ATOM   1514  N  NE    . ARG A 1 195 ? 3.333   -18.120 16.955   1.00 143.71 ? 195 ARG A NE    1 
ATOM   1515  C  CZ    . ARG A 1 195 ? 3.198   -19.429 16.701   1.00 139.95 ? 195 ARG A CZ    1 
ATOM   1516  N  NH1   . ARG A 1 195 ? 3.423   -20.300 17.685   1.00 136.85 ? 195 ARG A NH1   1 
ATOM   1517  N  NH2   . ARG A 1 195 ? 2.866   -19.872 15.466   1.00 130.62 ? 195 ARG A NH2   1 
ATOM   1518  N  N     . GLY A 1 196 ? -0.007  -14.058 20.704   1.00 110.87 ? 196 GLY A N     1 
ATOM   1519  C  CA    . GLY A 1 196 ? -0.024  -13.570 22.065   1.00 125.70 ? 196 GLY A CA    1 
ATOM   1520  C  C     . GLY A 1 196 ? 0.969   -12.467 22.231   1.00 140.76 ? 196 GLY A C     1 
ATOM   1521  O  O     . GLY A 1 196 ? 0.858   -11.704 23.187   1.00 147.79 ? 196 GLY A O     1 
ATOM   1522  N  N     . TYR A 1 197 ? 1.962   -12.427 21.358   1.00 150.88 ? 197 TYR A N     1 
ATOM   1523  C  CA    . TYR A 1 197 ? 3.061   -11.480 21.518   1.00 150.94 ? 197 TYR A CA    1 
ATOM   1524  C  C     . TYR A 1 197 ? 2.574   -10.198 20.923   1.00 143.13 ? 197 TYR A C     1 
ATOM   1525  O  O     . TYR A 1 197 ? 2.121   -10.163 19.772   1.00 133.42 ? 197 TYR A O     1 
ATOM   1526  C  CB    . TYR A 1 197 ? 4.355   -11.963 20.843   1.00 151.62 ? 197 TYR A CB    1 
ATOM   1527  C  CG    . TYR A 1 197 ? 4.692   -13.381 21.180   1.00 145.54 ? 197 TYR A CG    1 
ATOM   1528  C  CD1   . TYR A 1 197 ? 4.778   -13.807 22.498   1.00 139.79 ? 197 TYR A CD1   1 
ATOM   1529  C  CD2   . TYR A 1 197 ? 4.912   -14.293 20.181   1.00 133.12 ? 197 TYR A CD2   1 
ATOM   1530  C  CE1   . TYR A 1 197 ? 5.087   -15.102 22.794   1.00 134.52 ? 197 TYR A CE1   1 
ATOM   1531  C  CE2   . TYR A 1 197 ? 5.246   -15.598 20.473   1.00 112.91 ? 197 TYR A CE2   1 
ATOM   1532  C  CZ    . TYR A 1 197 ? 5.335   -16.008 21.774   1.00 128.94 ? 197 TYR A CZ    1 
ATOM   1533  O  OH    . TYR A 1 197 ? 5.664   -17.347 22.065   1.00 161.76 ? 197 TYR A OH    1 
ATOM   1534  N  N     . SER A 1 198 ? 2.678   -9.138  21.711   1.00 139.47 ? 198 SER A N     1 
ATOM   1535  C  CA    . SER A 1 198 ? 2.132   -7.852  21.285   1.00 148.89 ? 198 SER A CA    1 
ATOM   1536  C  C     . SER A 1 198 ? 3.244   -6.820  21.285   1.00 153.17 ? 198 SER A C     1 
ATOM   1537  O  O     . SER A 1 198 ? 3.853   -6.515  22.303   1.00 143.65 ? 198 SER A O     1 
ATOM   1538  C  CB    . SER A 1 198 ? 0.977   -7.386  22.175   1.00 167.86 ? 198 SER A CB    1 
ATOM   1539  O  OG    . SER A 1 198 ? -0.185  -8.166  21.941   1.00 164.09 ? 198 SER A OG    1 
ATOM   1540  N  N     . PHE A 1 199 ? 3.524   -6.280  20.114   1.00 141.81 ? 199 PHE A N     1 
ATOM   1541  C  CA    . PHE A 1 199 ? 4.569   -5.303  19.931   1.00 130.28 ? 199 PHE A CA    1 
ATOM   1542  C  C     . PHE A 1 199 ? 3.932   -4.000  19.426   1.00 121.18 ? 199 PHE A C     1 
ATOM   1543  O  O     . PHE A 1 199 ? 3.575   -3.840  18.273   1.00 97.55  ? 199 PHE A O     1 
ATOM   1544  C  CB    . PHE A 1 199 ? 5.646   -5.872  18.968   1.00 131.93 ? 199 PHE A CB    1 
ATOM   1545  C  CG    . PHE A 1 199 ? 6.386   -7.043  19.531   1.00 130.14 ? 199 PHE A CG    1 
ATOM   1546  C  CD1   . PHE A 1 199 ? 6.508   -7.198  20.899   1.00 154.59 ? 199 PHE A CD1   1 
ATOM   1547  C  CD2   . PHE A 1 199 ? 6.926   -7.998  18.711   1.00 109.54 ? 199 PHE A CD2   1 
ATOM   1548  C  CE1   . PHE A 1 199 ? 7.183   -8.279  21.425   1.00 159.32 ? 199 PHE A CE1   1 
ATOM   1549  C  CE2   . PHE A 1 199 ? 7.588   -9.087  19.228   1.00 125.83 ? 199 PHE A CE2   1 
ATOM   1550  C  CZ    . PHE A 1 199 ? 7.723   -9.230  20.590   1.00 141.42 ? 199 PHE A CZ    1 
ATOM   1551  N  N     . THR A 1 200 ? 3.782   -3.033  20.325   1.00 141.88 ? 200 THR A N     1 
ATOM   1552  C  CA    . THR A 1 200 ? 2.887   -1.893  20.086   1.00 163.30 ? 200 THR A CA    1 
ATOM   1553  C  C     . THR A 1 200 ? 3.627   -0.596  19.722   1.00 161.05 ? 200 THR A C     1 
ATOM   1554  O  O     . THR A 1 200 ? 3.013   0.391   19.309   1.00 156.48 ? 200 THR A O     1 
ATOM   1555  C  CB    . THR A 1 200 ? 2.050   -1.641  21.352   1.00 183.41 ? 200 THR A CB    1 
ATOM   1556  O  OG1   . THR A 1 200 ? 2.908   -1.533  22.500   1.00 167.15 ? 200 THR A OG1   1 
ATOM   1557  C  CG2   . THR A 1 200 ? 1.043   -2.767  21.606   1.00 186.49 ? 200 THR A CG2   1 
ATOM   1558  N  N     . THR A 1 201 ? 4.948   -0.626  19.836   1.00 145.79 ? 201 THR A N     1 
ATOM   1559  C  CA    . THR A 1 201 ? 5.753   0.601   19.914   1.00 131.24 ? 201 THR A CA    1 
ATOM   1560  C  C     . THR A 1 201 ? 6.967   0.531   18.963   1.00 122.31 ? 201 THR A C     1 
ATOM   1561  O  O     . THR A 1 201 ? 7.334   -0.552  18.514   1.00 121.10 ? 201 THR A O     1 
ATOM   1562  C  CB    . THR A 1 201 ? 6.168   0.872   21.379   1.00 132.37 ? 201 THR A CB    1 
ATOM   1563  O  OG1   . THR A 1 201 ? 4.994   0.931   22.190   1.00 139.71 ? 201 THR A OG1   1 
ATOM   1564  C  CG2   . THR A 1 201 ? 6.925   2.171   21.537   1.00 146.24 ? 201 THR A CG2   1 
ATOM   1565  N  N     . THR A 1 202 ? 7.468   1.725   18.619   1.00 109.66 ? 202 THR A N     1 
ATOM   1566  C  CA    . THR A 1 202 ? 8.419   1.868   17.569   1.00 104.15 ? 202 THR A CA    1 
ATOM   1567  C  C     . THR A 1 202 ? 9.652   1.135   17.933   1.00 116.32 ? 202 THR A C     1 
ATOM   1568  O  O     . THR A 1 202 ? 10.209  0.421   17.130   1.00 130.75 ? 202 THR A O     1 
ATOM   1569  C  CB    . THR A 1 202 ? 8.857   3.302   17.318   1.00 103.00 ? 202 THR A CB    1 
ATOM   1570  O  OG1   . THR A 1 202 ? 7.755   4.229   17.290   1.00 101.19 ? 202 THR A OG1   1 
ATOM   1571  C  CG2   . THR A 1 202 ? 9.572   3.346   15.945   1.00 115.72 ? 202 THR A CG2   1 
ATOM   1572  N  N     . ALA A 1 203 ? 10.070  1.280   19.189   1.00 113.41 ? 203 ALA A N     1 
ATOM   1573  C  CA    . ALA A 1 203 ? 11.206  0.501   19.709   1.00 113.21 ? 203 ALA A CA    1 
ATOM   1574  C  C     . ALA A 1 203 ? 11.200  -0.959  19.292   1.00 123.01 ? 203 ALA A C     1 
ATOM   1575  O  O     . ALA A 1 203 ? 12.075  -1.429  18.549   1.00 138.29 ? 203 ALA A O     1 
ATOM   1576  C  CB    . ALA A 1 203 ? 11.332  0.629   21.237   1.00 117.60 ? 203 ALA A CB    1 
ATOM   1577  N  N     . GLU A 1 204 ? 10.174  -1.660  19.754   1.00 132.42 ? 204 GLU A N     1 
ATOM   1578  C  CA    . GLU A 1 204 ? 10.076  -3.104  19.482   1.00 148.75 ? 204 GLU A CA    1 
ATOM   1579  C  C     . GLU A 1 204 ? 9.656   -3.429  18.051   1.00 135.26 ? 204 GLU A C     1 
ATOM   1580  O  O     . GLU A 1 204 ? 9.843   -4.532  17.567   1.00 152.43 ? 204 GLU A O     1 
ATOM   1581  C  CB    . GLU A 1 204 ? 9.226   -3.883  20.495   1.00 171.72 ? 204 GLU A CB    1 
ATOM   1582  C  CG    . GLU A 1 204 ? 7.762   -3.564  20.411   1.00 192.39 ? 204 GLU A CG    1 
ATOM   1583  C  CD    . GLU A 1 204 ? 7.295   -2.482  21.367   1.00 209.63 ? 204 GLU A CD    1 
ATOM   1584  O  OE1   . GLU A 1 204 ? 8.051   -1.507  21.584   1.00 218.68 ? 204 GLU A OE1   1 
ATOM   1585  O  OE2   . GLU A 1 204 ? 6.169   -2.589  21.897   1.00 225.88 ? 204 GLU A OE2   1 
ATOM   1586  N  N     . ARG A 1 205 ? 9.098   -2.435  17.367   1.00 125.97 ? 205 ARG A N     1 
ATOM   1587  C  CA    . ARG A 1 205 ? 8.878   -2.589  15.932   1.00 127.42 ? 205 ARG A CA    1 
ATOM   1588  C  C     . ARG A 1 205 ? 10.212  -2.910  15.239   1.00 107.71 ? 205 ARG A C     1 
ATOM   1589  O  O     . ARG A 1 205 ? 10.323  -3.757  14.373   1.00 97.54  ? 205 ARG A O     1 
ATOM   1590  C  CB    . ARG A 1 205 ? 8.288   -1.296  15.339   1.00 150.75 ? 205 ARG A CB    1 
ATOM   1591  C  CG    . ARG A 1 205 ? 7.517   -1.420  14.063   1.00 151.03 ? 205 ARG A CG    1 
ATOM   1592  C  CD    . ARG A 1 205 ? 6.762   -0.114  13.896   1.00 158.50 ? 205 ARG A CD    1 
ATOM   1593  N  NE    . ARG A 1 205 ? 6.271   0.053   12.555   1.00 172.53 ? 205 ARG A NE    1 
ATOM   1594  C  CZ    . ARG A 1 205 ? 6.975   0.551   11.546   1.00 192.03 ? 205 ARG A CZ    1 
ATOM   1595  N  NH1   . ARG A 1 205 ? 8.245   0.928   11.723   1.00 188.75 ? 205 ARG A NH1   1 
ATOM   1596  N  NH2   . ARG A 1 205 ? 6.398   0.645   10.360   1.00 207.09 ? 205 ARG A NH2   1 
ATOM   1597  N  N     . GLU A 1 206 ? 11.252  -2.268  15.690   1.00 111.68 ? 206 GLU A N     1 
ATOM   1598  C  CA    . GLU A 1 206 ? 12.566  -2.584  15.172   1.00 136.85 ? 206 GLU A CA    1 
ATOM   1599  C  C     . GLU A 1 206 ? 12.995  -3.943  15.649   1.00 132.39 ? 206 GLU A C     1 
ATOM   1600  O  O     . GLU A 1 206 ? 13.735  -4.591  14.922   1.00 146.42 ? 206 GLU A O     1 
ATOM   1601  C  CB    . GLU A 1 206 ? 13.571  -1.458  15.455   1.00 167.82 ? 206 GLU A CB    1 
ATOM   1602  C  CG    . GLU A 1 206 ? 13.326  -0.230  14.558   1.00 192.93 ? 206 GLU A CG    1 
ATOM   1603  C  CD    . GLU A 1 206 ? 14.571  0.568   14.324   1.00 209.93 ? 206 GLU A CD    1 
ATOM   1604  O  OE1   . GLU A 1 206 ? 15.309  0.755   15.312   1.00 223.09 ? 206 GLU A OE1   1 
ATOM   1605  O  OE2   . GLU A 1 206 ? 14.816  1.008   13.179   1.00 192.80 ? 206 GLU A OE2   1 
ATOM   1606  N  N     . ILE A 1 207 ? 12.589  -4.426  16.819   1.00 123.00 ? 207 ILE A N     1 
ATOM   1607  C  CA    . ILE A 1 207 ? 12.898  -5.777  17.219   1.00 128.07 ? 207 ILE A CA    1 
ATOM   1608  C  C     . ILE A 1 207 ? 12.282  -6.733  16.200   1.00 109.21 ? 207 ILE A C     1 
ATOM   1609  O  O     . ILE A 1 207 ? 12.960  -7.649  15.757   1.00 107.44 ? 207 ILE A O     1 
ATOM   1610  C  CB    . ILE A 1 207 ? 12.428  -6.048  18.642   1.00 143.86 ? 207 ILE A CB    1 
ATOM   1611  C  CG1   . ILE A 1 207 ? 13.268  -5.193  19.623   1.00 147.55 ? 207 ILE A CG1   1 
ATOM   1612  C  CG2   . ILE A 1 207 ? 12.479  -7.539  18.926   1.00 139.85 ? 207 ILE A CG2   1 
ATOM   1613  C  CD1   . ILE A 1 207 ? 14.742  -5.527  19.618   1.00 154.54 ? 207 ILE A CD1   1 
ATOM   1614  N  N     . VAL A 1 208 ? 11.050  -6.498  15.791   1.00 96.42  ? 208 VAL A N     1 
ATOM   1615  C  CA    . VAL A 1 208 ? 10.492  -7.429  14.808   1.00 89.67  ? 208 VAL A CA    1 
ATOM   1616  C  C     . VAL A 1 208 ? 11.131  -7.281  13.481   1.00 93.00  ? 208 VAL A C     1 
ATOM   1617  O  O     . VAL A 1 208 ? 11.269  -8.264  12.786   1.00 106.93 ? 208 VAL A O     1 
ATOM   1618  C  CB    . VAL A 1 208 ? 8.999   -7.373  14.557   1.00 93.51  ? 208 VAL A CB    1 
ATOM   1619  C  CG1   . VAL A 1 208 ? 8.277   -8.011  15.736   1.00 112.19 ? 208 VAL A CG1   1 
ATOM   1620  C  CG2   . VAL A 1 208 ? 8.487   -5.978  14.215   1.00 92.34  ? 208 VAL A CG2   1 
ATOM   1621  N  N     . ARG A 1 209 ? 11.575  -6.080  13.128   1.00 99.59  ? 209 ARG A N     1 
ATOM   1622  C  CA    . ARG A 1 209 ? 12.376  -5.918  11.916   1.00 106.15 ? 209 ARG A CA    1 
ATOM   1623  C  C     . ARG A 1 209 ? 13.586  -6.854  11.975   1.00 90.66  ? 209 ARG A C     1 
ATOM   1624  O  O     . ARG A 1 209 ? 13.935  -7.486  10.992   1.00 90.25  ? 209 ARG A O     1 
ATOM   1625  C  CB    . ARG A 1 209 ? 12.860  -4.454  11.756   1.00 130.54 ? 209 ARG A CB    1 
ATOM   1626  C  CG    . ARG A 1 209 ? 13.640  -4.215  10.466   1.00 140.76 ? 209 ARG A CG    1 
ATOM   1627  C  CD    . ARG A 1 209 ? 13.944  -2.742  10.202   1.00 158.40 ? 209 ARG A CD    1 
ATOM   1628  N  NE    . ARG A 1 209 ? 14.832  -2.271  11.267   1.00 173.62 ? 209 ARG A NE    1 
ATOM   1629  C  CZ    . ARG A 1 209 ? 16.162  -2.418  11.260   1.00 169.67 ? 209 ARG A CZ    1 
ATOM   1630  N  NH1   . ARG A 1 209 ? 16.725  -3.042  10.236   1.00 156.86 ? 209 ARG A NH1   1 
ATOM   1631  N  NH2   . ARG A 1 209 ? 16.935  -1.964  12.278   1.00 167.99 ? 209 ARG A NH2   1 
ATOM   1632  N  N     . ASP A 1 210 ? 14.225  -6.900  13.138   1.00 90.85  ? 210 ASP A N     1 
ATOM   1633  C  CA    . ASP A 1 210 ? 15.404  -7.735  13.316   1.00 107.32 ? 210 ASP A CA    1 
ATOM   1634  C  C     . ASP A 1 210 ? 15.030  -9.206  13.135   1.00 101.66 ? 210 ASP A C     1 
ATOM   1635  O  O     . ASP A 1 210 ? 15.752  -9.959  12.442   1.00 111.46 ? 210 ASP A O     1 
ATOM   1636  C  CB    . ASP A 1 210 ? 16.023  -7.584  14.720   1.00 118.45 ? 210 ASP A CB    1 
ATOM   1637  C  CG    . ASP A 1 210 ? 17.364  -8.183  14.794   1.00 129.90 ? 210 ASP A CG    1 
ATOM   1638  O  OD1   . ASP A 1 210 ? 18.002  -8.253  13.721   1.00 128.02 ? 210 ASP A OD1   1 
ATOM   1639  O  OD2   . ASP A 1 210 ? 17.793  -8.578  15.905   1.00 133.91 ? 210 ASP A OD2   1 
ATOM   1640  N  N     . ILE A 1 211 ? 13.892  -9.589  13.729   1.00 82.99  ? 211 ILE A N     1 
ATOM   1641  C  CA    . ILE A 1 211 ? 13.456  -10.979 13.602   1.00 73.88  ? 211 ILE A CA    1 
ATOM   1642  C  C     . ILE A 1 211 ? 13.328  -11.297 12.136   1.00 75.46  ? 211 ILE A C     1 
ATOM   1643  O  O     . ILE A 1 211 ? 13.895  -12.296 11.655   1.00 91.78  ? 211 ILE A O     1 
ATOM   1644  C  CB    . ILE A 1 211 ? 12.075  -11.169 14.226   1.00 72.63  ? 211 ILE A CB    1 
ATOM   1645  C  CG1   . ILE A 1 211 ? 12.237  -11.238 15.751   1.00 87.31  ? 211 ILE A CG1   1 
ATOM   1646  C  CG2   . ILE A 1 211 ? 11.394  -12.420 13.629   1.00 71.28  ? 211 ILE A CG2   1 
ATOM   1647  C  CD1   . ILE A 1 211 ? 10.944  -11.139 16.527   1.00 96.21  ? 211 ILE A CD1   1 
ATOM   1648  N  N     . LYS A 1 212 ? 12.592  -10.470 11.428   1.00 70.54  ? 212 LYS A N     1 
ATOM   1649  C  CA    . LYS A 1 212 ? 12.301  -10.726 10.045   1.00 75.96  ? 212 LYS A CA    1 
ATOM   1650  C  C     . LYS A 1 212 ? 13.612  -10.849 9.241    1.00 75.67  ? 212 LYS A C     1 
ATOM   1651  O  O     . LYS A 1 212 ? 13.762  -11.737 8.432    1.00 64.93  ? 212 LYS A O     1 
ATOM   1652  C  CB    . LYS A 1 212 ? 11.372  -9.635  9.605    1.00 85.10  ? 212 LYS A CB    1 
ATOM   1653  C  CG    . LYS A 1 212 ? 10.825  -9.639  8.194    1.00 96.99  ? 212 LYS A CG    1 
ATOM   1654  C  CD    . LYS A 1 212 ? 10.162  -8.276  7.851    1.00 100.18 ? 212 LYS A CD    1 
ATOM   1655  C  CE    . LYS A 1 212 ? 11.146  -7.104  7.957    1.00 112.52 ? 212 LYS A CE    1 
ATOM   1656  N  NZ    . LYS A 1 212 ? 10.596  -5.894  7.325    1.00 119.71 ? 212 LYS A NZ    1 
ATOM   1657  N  N     . GLU A 1 213 ? 14.549  -9.948  9.524    1.00 99.18  ? 213 GLU A N     1 
ATOM   1658  C  CA    . GLU A 1 213 ? 15.855  -9.990  8.887    1.00 132.23 ? 213 GLU A CA    1 
ATOM   1659  C  C     . GLU A 1 213 ? 16.571  -11.299 9.065    1.00 129.28 ? 213 GLU A C     1 
ATOM   1660  O  O     . GLU A 1 213 ? 17.529  -11.519 8.295    1.00 140.89 ? 213 GLU A O     1 
ATOM   1661  C  CB    . GLU A 1 213 ? 16.768  -8.845  9.375    1.00 160.05 ? 213 GLU A CB    1 
ATOM   1662  C  CG    . GLU A 1 213 ? 16.330  -7.451  8.920    1.00 174.18 ? 213 GLU A CG    1 
ATOM   1663  C  CD    . GLU A 1 213 ? 17.175  -6.328  9.489    1.00 182.36 ? 213 GLU A CD    1 
ATOM   1664  O  OE1   . GLU A 1 213 ? 18.022  -6.560  10.382   1.00 174.83 ? 213 GLU A OE1   1 
ATOM   1665  O  OE2   . GLU A 1 213 ? 16.965  -5.198  9.023    1.00 184.11 ? 213 GLU A OE2   1 
ATOM   1666  N  N     . LYS A 1 214 ? 16.226  -12.134 10.049   1.00 109.39 ? 214 LYS A N     1 
ATOM   1667  C  CA    . LYS A 1 214 ? 16.761  -13.485 10.021   1.00 117.66 ? 214 LYS A CA    1 
ATOM   1668  C  C     . LYS A 1 214 ? 15.780  -14.635 9.927    1.00 117.10 ? 214 LYS A C     1 
ATOM   1669  O  O     . LYS A 1 214 ? 15.821  -15.434 8.975    1.00 131.88 ? 214 LYS A O     1 
ATOM   1670  C  CB    . LYS A 1 214 ? 17.751  -13.746 11.086   1.00 130.02 ? 214 LYS A CB    1 
ATOM   1671  C  CG    . LYS A 1 214 ? 17.353  -13.458 12.526   1.00 141.83 ? 214 LYS A CG    1 
ATOM   1672  C  CD    . LYS A 1 214 ? 18.495  -13.788 13.518   1.00 171.85 ? 214 LYS A CD    1 
ATOM   1673  C  CE    . LYS A 1 214 ? 18.228  -13.303 14.938   1.00 189.61 ? 214 LYS A CE    1 
ATOM   1674  N  NZ    . LYS A 1 214 ? 18.204  -11.810 15.023   1.00 205.43 ? 214 LYS A NZ    1 
ATOM   1675  N  N     . LEU A 1 215 ? 14.911  -14.751 10.907   1.00 108.94 ? 215 LEU A N     1 
ATOM   1676  C  CA    . LEU A 1 215 ? 13.961  -15.903 10.952   1.00 115.03 ? 215 LEU A CA    1 
ATOM   1677  C  C     . LEU A 1 215 ? 13.069  -16.139 9.790    1.00 97.57  ? 215 LEU A C     1 
ATOM   1678  O  O     . LEU A 1 215 ? 12.883  -17.255 9.454    1.00 106.39 ? 215 LEU A O     1 
ATOM   1679  C  CB    . LEU A 1 215 ? 13.122  -15.847 12.226   1.00 134.71 ? 215 LEU A CB    1 
ATOM   1680  C  CG    . LEU A 1 215 ? 13.969  -15.821 13.504   1.00 156.71 ? 215 LEU A CG    1 
ATOM   1681  C  CD1   . LEU A 1 215 ? 13.078  -16.042 14.756   1.00 170.96 ? 215 LEU A CD1   1 
ATOM   1682  C  CD2   . LEU A 1 215 ? 15.130  -16.828 13.449   1.00 162.81 ? 215 LEU A CD2   1 
ATOM   1683  N  N     . CYS A 1 216 ? 12.528  -15.110 9.147    1.00 95.35  ? 216 CYS A N     1 
ATOM   1684  C  CA    . CYS A 1 216 ? 11.571  -15.289 8.054    1.00 95.15  ? 216 CYS A CA    1 
ATOM   1685  C  C     . CYS A 1 216 ? 12.197  -15.853 6.822    1.00 88.38  ? 216 CYS A C     1 
ATOM   1686  O  O     . CYS A 1 216 ? 13.372  -15.602 6.577    1.00 88.61  ? 216 CYS A O     1 
ATOM   1687  C  CB    . CYS A 1 216 ? 10.986  -13.958 7.593    1.00 100.61 ? 216 CYS A CB    1 
ATOM   1688  S  SG    . CYS A 1 216 ? 10.034  -13.058 8.848    1.00 104.78 ? 216 CYS A SG    1 
ATOM   1689  N  N     . TYR A 1 217 ? 11.437  -16.640 6.039    1.00 84.29  ? 217 TYR A N     1 
ATOM   1690  C  CA    . TYR A 1 217 ? 11.923  -17.151 4.778    1.00 94.12  ? 217 TYR A CA    1 
ATOM   1691  C  C     . TYR A 1 217 ? 10.734  -17.346 3.869    1.00 91.04  ? 217 TYR A C     1 
ATOM   1692  O  O     . TYR A 1 217 ? 9.597   -17.380 4.343    1.00 106.01 ? 217 TYR A O     1 
ATOM   1693  C  CB    . TYR A 1 217 ? 12.688  -18.473 4.877    1.00 102.79 ? 217 TYR A CB    1 
ATOM   1694  C  CG    . TYR A 1 217 ? 11.807  -19.597 5.270    1.00 103.30 ? 217 TYR A CG    1 
ATOM   1695  C  CD1   . TYR A 1 217 ? 11.147  -20.331 4.320    1.00 121.97 ? 217 TYR A CD1   1 
ATOM   1696  C  CD2   . TYR A 1 217 ? 11.660  -19.941 6.580    1.00 105.30 ? 217 TYR A CD2   1 
ATOM   1697  C  CE1   . TYR A 1 217 ? 10.339  -21.399 4.673    1.00 129.98 ? 217 TYR A CE1   1 
ATOM   1698  C  CE2   . TYR A 1 217 ? 10.879  -21.022 6.959    1.00 112.58 ? 217 TYR A CE2   1 
ATOM   1699  C  CZ    . TYR A 1 217 ? 10.197  -21.737 6.000    1.00 126.56 ? 217 TYR A CZ    1 
ATOM   1700  O  OH    . TYR A 1 217 ? 9.390   -22.827 6.356    1.00 127.50 ? 217 TYR A OH    1 
ATOM   1701  N  N     . VAL A 1 218 ? 10.978  -17.509 2.559    1.00 91.76  ? 218 VAL A N     1 
ATOM   1702  C  CA    . VAL A 1 218 ? 9.898   -17.627 1.624    1.00 99.02  ? 218 VAL A CA    1 
ATOM   1703  C  C     . VAL A 1 218 ? 9.743   -19.054 1.218    1.00 99.58  ? 218 VAL A C     1 
ATOM   1704  O  O     . VAL A 1 218 ? 10.691  -19.760 0.882    1.00 109.57 ? 218 VAL A O     1 
ATOM   1705  C  CB    . VAL A 1 218 ? 10.058  -16.822 0.368    1.00 123.93 ? 218 VAL A CB    1 
ATOM   1706  C  CG1   . VAL A 1 218 ? 8.783   -16.993 -0.483   1.00 112.47 ? 218 VAL A CG1   1 
ATOM   1707  C  CG2   . VAL A 1 218 ? 10.362  -15.354 0.709    1.00 145.72 ? 218 VAL A CG2   1 
ATOM   1708  N  N     . ALA A 1 219 ? 8.488   -19.475 1.260    1.00 97.29  ? 219 ALA A N     1 
ATOM   1709  C  CA    . ALA A 1 219 ? 8.089   -20.828 0.807    1.00 99.53  ? 219 ALA A CA    1 
ATOM   1710  C  C     . ALA A 1 219 ? 8.223   -21.094 -0.678   1.00 110.23 ? 219 ALA A C     1 
ATOM   1711  O  O     . ALA A 1 219 ? 7.810   -20.340 -1.544   1.00 112.58 ? 219 ALA A O     1 
ATOM   1712  C  CB    . ALA A 1 219 ? 6.639   -21.123 1.215    1.00 98.62  ? 219 ALA A CB    1 
ATOM   1713  N  N     . LEU A 1 220 ? 8.783   -22.256 -0.981   1.00 131.81 ? 220 LEU A N     1 
ATOM   1714  C  CA    . LEU A 1 220 ? 8.859   -22.721 -2.366   1.00 143.94 ? 220 LEU A CA    1 
ATOM   1715  C  C     . LEU A 1 220 ? 7.515   -23.307 -2.830   1.00 123.78 ? 220 LEU A C     1 
ATOM   1716  O  O     . LEU A 1 220 ? 7.366   -23.580 -4.016   1.00 114.61 ? 220 LEU A O     1 
ATOM   1717  C  CB    . LEU A 1 220 ? 9.948   -23.797 -2.569   1.00 177.71 ? 220 LEU A CB    1 
ATOM   1718  C  CG    . LEU A 1 220 ? 11.372  -23.255 -2.620   1.00 190.41 ? 220 LEU A CG    1 
ATOM   1719  C  CD1   . LEU A 1 220 ? 11.770  -22.602 -1.285   1.00 184.59 ? 220 LEU A CD1   1 
ATOM   1720  C  CD2   . LEU A 1 220 ? 12.372  -24.371 -3.047   1.00 204.76 ? 220 LEU A CD2   1 
ATOM   1721  N  N     . ASP A 1 221 ? 6.620   -23.611 -1.899   1.00 114.08 ? 221 ASP A N     1 
ATOM   1722  C  CA    . ASP A 1 221 ? 5.212   -23.573 -2.125   1.00 128.24 ? 221 ASP A CA    1 
ATOM   1723  C  C     . ASP A 1 221 ? 4.558   -23.235 -0.815   1.00 124.78 ? 221 ASP A C     1 
ATOM   1724  O  O     . ASP A 1 221 ? 4.771   -23.907 0.171    1.00 125.06 ? 221 ASP A O     1 
ATOM   1725  C  CB    . ASP A 1 221 ? 4.643   -24.881 -2.633   1.00 135.09 ? 221 ASP A CB    1 
ATOM   1726  C  CG    . ASP A 1 221 ? 3.192   -24.728 -3.015   1.00 160.29 ? 221 ASP A CG    1 
ATOM   1727  O  OD1   . ASP A 1 221 ? 2.665   -23.586 -3.098   1.00 162.42 ? 221 ASP A OD1   1 
ATOM   1728  O  OD2   . ASP A 1 221 ? 2.544   -25.752 -3.296   1.00 179.56 ? 221 ASP A OD2   1 
ATOM   1729  N  N     . PHE A 1 222 ? 3.751   -22.162 -0.804   1.00 120.86 ? 222 PHE A N     1 
ATOM   1730  C  CA    . PHE A 1 222 ? 3.147   -21.649 0.395    1.00 114.96 ? 222 PHE A CA    1 
ATOM   1731  C  C     . PHE A 1 222 ? 2.229   -22.677 1.048    1.00 149.48 ? 222 PHE A C     1 
ATOM   1732  O  O     . PHE A 1 222 ? 2.349   -22.946 2.236    1.00 181.13 ? 222 PHE A O     1 
ATOM   1733  C  CB    . PHE A 1 222 ? 2.348   -20.376 0.089    1.00 111.84 ? 222 PHE A CB    1 
ATOM   1734  C  CG    . PHE A 1 222 ? 1.545   -19.893 1.237    1.00 121.43 ? 222 PHE A CG    1 
ATOM   1735  C  CD1   . PHE A 1 222 ? 2.135   -19.270 2.316    1.00 117.09 ? 222 PHE A CD1   1 
ATOM   1736  C  CD2   . PHE A 1 222 ? 0.173   -20.073 1.247    1.00 138.14 ? 222 PHE A CD2   1 
ATOM   1737  C  CE1   . PHE A 1 222 ? 1.381   -18.803 3.366    1.00 123.21 ? 222 PHE A CE1   1 
ATOM   1738  C  CE2   . PHE A 1 222 ? -0.594  -19.594 2.286    1.00 136.14 ? 222 PHE A CE2   1 
ATOM   1739  C  CZ    . PHE A 1 222 ? 0.017   -18.985 3.361    1.00 133.07 ? 222 PHE A CZ    1 
ATOM   1740  N  N     . GLU A 1 223 ? 1.308   -23.241 0.276    1.00 159.81 ? 223 GLU A N     1 
ATOM   1741  C  CA    . GLU A 1 223 ? 0.294   -24.115 0.861    1.00 153.32 ? 223 GLU A CA    1 
ATOM   1742  C  C     . GLU A 1 223 ? 0.941   -25.358 1.408    1.00 150.58 ? 223 GLU A C     1 
ATOM   1743  O  O     . GLU A 1 223 ? 0.466   -25.900 2.371    1.00 142.96 ? 223 GLU A O     1 
ATOM   1744  C  CB    . GLU A 1 223 ? -0.778  -24.549 -0.151   1.00 158.10 ? 223 GLU A CB    1 
ATOM   1745  C  CG    . GLU A 1 223 ? -1.716  -23.450 -0.585   1.00 167.49 ? 223 GLU A CG    1 
ATOM   1746  C  CD    . GLU A 1 223 ? -1.133  -22.614 -1.689   1.00 192.40 ? 223 GLU A CD    1 
ATOM   1747  O  OE1   . GLU A 1 223 ? 0.063   -22.798 -2.010   1.00 193.86 ? 223 GLU A OE1   1 
ATOM   1748  O  OE2   . GLU A 1 223 ? -1.884  -21.808 -2.267   1.00 229.31 ? 223 GLU A OE2   1 
ATOM   1749  N  N     . GLN A 1 224 ? 1.978   -25.889 0.751    1.00 151.11 ? 224 GLN A N     1 
ATOM   1750  C  CA    . GLN A 1 224 ? 2.634   -27.090 1.211    1.00 163.79 ? 224 GLN A CA    1 
ATOM   1751  C  C     . GLN A 1 224 ? 3.268   -26.848 2.560    1.00 146.34 ? 224 GLN A C     1 
ATOM   1752  O  O     . GLN A 1 224 ? 3.137   -27.654 3.502    1.00 154.91 ? 224 GLN A O     1 
ATOM   1753  C  CB    . GLN A 1 224 ? 3.709   -27.533 0.200    1.00 197.89 ? 224 GLN A CB    1 
ATOM   1754  C  CG    . GLN A 1 224 ? 3.120   -28.055 -1.105   1.00 233.98 ? 224 GLN A CG    1 
ATOM   1755  C  CD    . GLN A 1 224 ? 4.182   -28.415 -2.082   1.00 277.22 ? 224 GLN A CD    1 
ATOM   1756  O  OE1   . GLN A 1 224 ? 5.378   -28.270 -1.815   1.00 314.96 ? 224 GLN A OE1   1 
ATOM   1757  N  NE2   . GLN A 1 224 ? 3.763   -28.900 -3.252   1.00 285.86 ? 224 GLN A NE2   1 
ATOM   1758  N  N     . GLU A 1 225 ? 4.000   -25.736 2.648    1.00 127.26 ? 225 GLU A N     1 
ATOM   1759  C  CA    . GLU A 1 225 ? 4.663   -25.409 3.914    1.00 130.09 ? 225 GLU A CA    1 
ATOM   1760  C  C     . GLU A 1 225 ? 3.654   -25.155 5.003    1.00 121.05 ? 225 GLU A C     1 
ATOM   1761  O  O     . GLU A 1 225 ? 3.838   -25.592 6.130    1.00 123.17 ? 225 GLU A O     1 
ATOM   1762  C  CB    . GLU A 1 225 ? 5.783   -24.366 3.791    1.00 154.31 ? 225 GLU A CB    1 
ATOM   1763  C  CG    . GLU A 1 225 ? 7.046   -24.910 3.123    1.00 187.60 ? 225 GLU A CG    1 
ATOM   1764  C  CD    . GLU A 1 225 ? 8.191   -23.943 3.236    1.00 208.61 ? 225 GLU A CD    1 
ATOM   1765  O  OE1   . GLU A 1 225 ? 7.947   -22.783 3.612    1.00 215.88 ? 225 GLU A OE1   1 
ATOM   1766  O  OE2   . GLU A 1 225 ? 9.322   -24.351 2.933    1.00 221.06 ? 225 GLU A OE2   1 
ATOM   1767  N  N     . MET A 1 226 ? 2.549   -24.509 4.673    1.00 126.63 ? 226 MET A N     1 
ATOM   1768  C  CA    . MET A 1 226 ? 1.512   -24.253 5.649    1.00 136.01 ? 226 MET A CA    1 
ATOM   1769  C  C     . MET A 1 226 ? 0.871   -25.547 6.056    1.00 142.73 ? 226 MET A C     1 
ATOM   1770  O  O     . MET A 1 226 ? 0.456   -25.675 7.211    1.00 149.19 ? 226 MET A O     1 
ATOM   1771  C  CB    . MET A 1 226 ? 0.472   -23.217 5.161    1.00 138.64 ? 226 MET A CB    1 
ATOM   1772  C  CG    . MET A 1 226 ? -0.316  -22.541 6.295    1.00 147.98 ? 226 MET A CG    1 
ATOM   1773  S  SD    . MET A 1 226 ? -1.133  -21.006 5.852    1.00 175.18 ? 226 MET A SD    1 
ATOM   1774  C  CE    . MET A 1 226 ? -2.200  -21.668 4.558    1.00 208.83 ? 226 MET A CE    1 
ATOM   1775  N  N     . ALA A 1 227 ? 0.763   -26.520 5.147    1.00 141.57 ? 227 ALA A N     1 
ATOM   1776  C  CA    . ALA A 1 227 ? 0.197   -27.820 5.485    1.00 137.31 ? 227 ALA A CA    1 
ATOM   1777  C  C     . ALA A 1 227 ? 1.099   -28.500 6.499    1.00 125.82 ? 227 ALA A C     1 
ATOM   1778  O  O     . ALA A 1 227 ? 0.603   -29.055 7.510    1.00 117.69 ? 227 ALA A O     1 
ATOM   1779  C  CB    . ALA A 1 227 ? -0.006  -28.710 4.248    1.00 146.90 ? 227 ALA A CB    1 
ATOM   1780  N  N     . THR A 1 228 ? 2.413   -28.476 6.210    1.00 118.47 ? 228 THR A N     1 
ATOM   1781  C  CA    . THR A 1 228 ? 3.399   -29.113 7.080    1.00 122.43 ? 228 THR A CA    1 
ATOM   1782  C  C     . THR A 1 228 ? 3.568   -28.397 8.415    1.00 115.06 ? 228 THR A C     1 
ATOM   1783  O  O     . THR A 1 228 ? 4.093   -28.989 9.322    1.00 116.32 ? 228 THR A O     1 
ATOM   1784  C  CB    . THR A 1 228 ? 4.759   -29.411 6.398    1.00 120.62 ? 228 THR A CB    1 
ATOM   1785  O  OG1   . THR A 1 228 ? 5.592   -30.178 7.284    1.00 122.24 ? 228 THR A OG1   1 
ATOM   1786  C  CG2   . THR A 1 228 ? 5.526   -28.193 6.050    1.00 122.38 ? 228 THR A CG2   1 
ATOM   1787  N  N     . ALA A 1 229 ? 3.142   -27.138 8.523    1.00 113.61 ? 229 ALA A N     1 
ATOM   1788  C  CA    . ALA A 1 229 ? 2.959   -26.540 9.842    1.00 120.95 ? 229 ALA A CA    1 
ATOM   1789  C  C     . ALA A 1 229 ? 2.111   -27.306 10.797   1.00 138.22 ? 229 ALA A C     1 
ATOM   1790  O  O     . ALA A 1 229 ? 2.166   -27.053 12.002   1.00 139.57 ? 229 ALA A O     1 
ATOM   1791  C  CB    . ALA A 1 229 ? 2.421   -25.102 9.768    1.00 113.55 ? 229 ALA A CB    1 
ATOM   1792  N  N     . ALA A 1 230 ? 1.257   -28.234 10.367   1.00 156.61 ? 230 ALA A N     1 
ATOM   1793  C  CA    . ALA A 1 230 ? 0.515   -29.027 11.310   1.00 179.44 ? 230 ALA A CA    1 
ATOM   1794  C  C     . ALA A 1 230 ? 1.449   -29.727 12.301   1.00 202.00 ? 230 ALA A C     1 
ATOM   1795  O  O     . ALA A 1 230 ? 1.220   -29.666 13.519   1.00 210.61 ? 230 ALA A O     1 
ATOM   1796  C  CB    . ALA A 1 230 ? -0.385  -30.055 10.594   1.00 183.22 ? 230 ALA A CB    1 
ATOM   1797  N  N     . SER A 1 231 ? 2.437   -30.432 11.757   1.00 202.24 ? 231 SER A N     1 
ATOM   1798  C  CA    . SER A 1 231 ? 3.410   -31.146 12.592   1.00 188.10 ? 231 SER A CA    1 
ATOM   1799  C  C     . SER A 1 231 ? 4.596   -30.255 12.780   1.00 198.34 ? 231 SER A C     1 
ATOM   1800  O  O     . SER A 1 231 ? 5.533   -30.281 11.987   1.00 180.58 ? 231 SER A O     1 
ATOM   1801  C  CB    . SER A 1 231 ? 3.849   -32.470 11.958   1.00 169.06 ? 231 SER A CB    1 
ATOM   1802  O  OG    . SER A 1 231 ? 4.429   -32.258 10.687   1.00 153.74 ? 231 SER A OG    1 
ATOM   1803  N  N     . SER A 1 232 ? 4.583   -29.430 13.838   1.00 213.58 ? 232 SER A N     1 
ATOM   1804  C  CA    . SER A 1 232 ? 5.597   -28.365 14.001   1.00 210.20 ? 232 SER A CA    1 
ATOM   1805  C  C     . SER A 1 232 ? 6.877   -28.924 14.580   1.00 196.70 ? 232 SER A C     1 
ATOM   1806  O  O     . SER A 1 232 ? 6.839   -29.475 15.681   1.00 187.61 ? 232 SER A O     1 
ATOM   1807  C  CB    . SER A 1 232 ? 5.105   -27.220 14.932   1.00 204.58 ? 232 SER A CB    1 
ATOM   1808  O  OG    . SER A 1 232 ? 3.957   -26.576 14.403   1.00 206.76 ? 232 SER A OG    1 
ATOM   1809  N  N     . SER A 1 233 ? 7.969   -28.804 13.830   1.00 191.18 ? 233 SER A N     1 
ATOM   1810  C  CA    . SER A 1 233 ? 9.243   -29.334 14.244   1.00 201.10 ? 233 SER A CA    1 
ATOM   1811  C  C     . SER A 1 233 ? 10.279  -28.313 13.890   1.00 214.38 ? 233 SER A C     1 
ATOM   1812  O  O     . SER A 1 233 ? 10.705  -27.575 14.762   1.00 241.38 ? 233 SER A O     1 
ATOM   1813  C  CB    . SER A 1 233 ? 9.510   -30.694 13.596   1.00 207.95 ? 233 SER A CB    1 
ATOM   1814  O  OG    . SER A 1 233 ? 10.812  -31.155 13.910   1.00 209.72 ? 233 SER A OG    1 
ATOM   1815  N  N     . SER A 1 234 ? 10.600  -28.209 12.594   1.00 221.38 ? 234 SER A N     1 
ATOM   1816  C  CA    . SER A 1 234 ? 11.580  -27.257 12.064   1.00 224.35 ? 234 SER A CA    1 
ATOM   1817  C  C     . SER A 1 234 ? 11.052  -25.853 11.838   1.00 199.60 ? 234 SER A C     1 
ATOM   1818  O  O     . SER A 1 234 ? 11.825  -24.927 11.827   1.00 186.41 ? 234 SER A O     1 
ATOM   1819  C  CB    . SER A 1 234 ? 12.179  -27.746 10.726   1.00 223.65 ? 234 SER A CB    1 
ATOM   1820  O  OG    . SER A 1 234 ? 12.887  -28.965 10.878   1.00 222.48 ? 234 SER A OG    1 
ATOM   1821  N  N     . LEU A 1 235 ? 9.757   -25.688 11.612   1.00 168.79 ? 235 LEU A N     1 
ATOM   1822  C  CA    . LEU A 1 235 ? 9.207   -24.406 11.278   1.00 152.09 ? 235 LEU A CA    1 
ATOM   1823  C  C     . LEU A 1 235 ? 9.110   -23.475 12.463   1.00 130.99 ? 235 LEU A C     1 
ATOM   1824  O  O     . LEU A 1 235 ? 8.979   -22.276 12.305   1.00 123.37 ? 235 LEU A O     1 
ATOM   1825  C  CB    . LEU A 1 235 ? 7.821   -24.609 10.658   1.00 169.37 ? 235 LEU A CB    1 
ATOM   1826  C  CG    . LEU A 1 235 ? 7.814   -25.614 9.485    1.00 207.95 ? 235 LEU A CG    1 
ATOM   1827  C  CD1   . LEU A 1 235 ? 6.409   -26.173 9.234    1.00 237.31 ? 235 LEU A CD1   1 
ATOM   1828  C  CD2   . LEU A 1 235 ? 8.465   -25.014 8.236    1.00 201.59 ? 235 LEU A CD2   1 
ATOM   1829  N  N     . GLU A 1 236 ? 9.167   -24.013 13.673   1.00 115.83 ? 236 GLU A N     1 
ATOM   1830  C  CA    . GLU A 1 236 ? 9.256   -23.156 14.837   1.00 97.89  ? 236 GLU A CA    1 
ATOM   1831  C  C     . GLU A 1 236 ? 10.689  -22.810 15.137   1.00 91.04  ? 236 GLU A C     1 
ATOM   1832  O  O     . GLU A 1 236 ? 11.561  -23.655 15.062   1.00 82.08  ? 236 GLU A O     1 
ATOM   1833  C  CB    . GLU A 1 236 ? 8.636   -23.818 16.105   1.00 108.38 ? 236 GLU A CB    1 
ATOM   1834  C  CG    . GLU A 1 236 ? 7.138   -24.039 16.002   1.00 136.71 ? 236 GLU A CG    1 
ATOM   1835  C  CD    . GLU A 1 236 ? 6.624   -24.817 17.173   1.00 162.12 ? 236 GLU A CD    1 
ATOM   1836  O  OE1   . GLU A 1 236 ? 7.450   -25.109 18.058   1.00 191.44 ? 236 GLU A OE1   1 
ATOM   1837  O  OE2   . GLU A 1 236 ? 5.423   -25.123 17.208   1.00 163.15 ? 236 GLU A OE2   1 
ATOM   1838  N  N     . LYS A 1 237 ? 10.906  -21.580 15.540   1.00 99.29  ? 237 LYS A N     1 
ATOM   1839  C  CA    . LYS A 1 237 ? 12.213  -21.191 15.995   1.00 100.58 ? 237 LYS A CA    1 
ATOM   1840  C  C     . LYS A 1 237 ? 12.059  -20.339 17.244   1.00 96.26  ? 237 LYS A C     1 
ATOM   1841  O  O     . LYS A 1 237 ? 11.247  -19.427 17.315   1.00 76.70  ? 237 LYS A O     1 
ATOM   1842  C  CB    . LYS A 1 237 ? 13.048  -20.459 14.915   1.00 102.42 ? 237 LYS A CB    1 
ATOM   1843  C  CG    . LYS A 1 237 ? 14.156  -21.282 14.279   1.00 117.71 ? 237 LYS A CG    1 
ATOM   1844  C  CD    . LYS A 1 237 ? 14.689  -20.608 13.013   1.00 136.89 ? 237 LYS A CD    1 
ATOM   1845  C  CE    . LYS A 1 237 ? 15.378  -21.587 12.049   1.00 156.94 ? 237 LYS A CE    1 
ATOM   1846  N  NZ    . LYS A 1 237 ? 15.955  -20.918 10.854   1.00 164.82 ? 237 LYS A NZ    1 
ATOM   1847  N  N     . SER A 1 238 ? 12.883  -20.639 18.222   1.00 114.37 ? 238 SER A N     1 
ATOM   1848  C  CA    . SER A 1 238 ? 13.042  -19.760 19.340   1.00 135.93 ? 238 SER A CA    1 
ATOM   1849  C  C     . SER A 1 238 ? 13.858  -18.521 18.954   1.00 126.27 ? 238 SER A C     1 
ATOM   1850  O  O     . SER A 1 238 ? 14.907  -18.565 18.291   1.00 109.80 ? 238 SER A O     1 
ATOM   1851  C  CB    . SER A 1 238 ? 13.735  -20.543 20.440   1.00 159.18 ? 238 SER A CB    1 
ATOM   1852  O  OG    . SER A 1 238 ? 13.899  -19.776 21.621   1.00 179.53 ? 238 SER A OG    1 
ATOM   1853  N  N     . TYR A 1 239 ? 13.337  -17.381 19.388   1.00 106.13 ? 239 TYR A N     1 
ATOM   1854  C  CA    . TYR A 1 239 ? 14.047  -16.128 19.294   1.00 104.04 ? 239 TYR A CA    1 
ATOM   1855  C  C     . TYR A 1 239 ? 14.130  -15.507 20.680   1.00 109.07 ? 239 TYR A C     1 
ATOM   1856  O  O     . TYR A 1 239 ? 13.245  -15.660 21.509   1.00 103.82 ? 239 TYR A O     1 
ATOM   1857  C  CB    . TYR A 1 239 ? 13.318  -15.184 18.341   1.00 110.78 ? 239 TYR A CB    1 
ATOM   1858  C  CG    . TYR A 1 239 ? 14.009  -13.872 18.159   1.00 124.06 ? 239 TYR A CG    1 
ATOM   1859  C  CD1   . TYR A 1 239 ? 15.159  -13.777 17.398   1.00 131.45 ? 239 TYR A CD1   1 
ATOM   1860  C  CD2   . TYR A 1 239 ? 13.546  -12.745 18.796   1.00 119.58 ? 239 TYR A CD2   1 
ATOM   1861  C  CE1   . TYR A 1 239 ? 15.805  -12.566 17.248   1.00 111.47 ? 239 TYR A CE1   1 
ATOM   1862  C  CE2   . TYR A 1 239 ? 14.174  -11.530 18.623   1.00 112.79 ? 239 TYR A CE2   1 
ATOM   1863  C  CZ    . TYR A 1 239 ? 15.316  -11.442 17.861   1.00 102.47 ? 239 TYR A CZ    1 
ATOM   1864  O  OH    . TYR A 1 239 ? 15.956  -10.206 17.713   1.00 84.02  ? 239 TYR A OH    1 
ATOM   1865  N  N     . GLU A 1 240 ? 15.251  -14.863 20.913   1.00 114.39 ? 240 GLU A N     1 
ATOM   1866  C  CA    . GLU A 1 240 ? 15.522  -14.209 22.188   1.00 118.13 ? 240 GLU A CA    1 
ATOM   1867  C  C     . GLU A 1 240 ? 15.316  -12.756 22.029   1.00 97.43  ? 240 GLU A C     1 
ATOM   1868  O  O     . GLU A 1 240 ? 15.974  -12.187 21.179   1.00 98.30  ? 240 GLU A O     1 
ATOM   1869  C  CB    . GLU A 1 240 ? 16.982  -14.444 22.565   1.00 145.87 ? 240 GLU A CB    1 
ATOM   1870  C  CG    . GLU A 1 240 ? 17.409  -13.840 23.896   1.00 190.29 ? 240 GLU A CG    1 
ATOM   1871  C  CD    . GLU A 1 240 ? 16.804  -14.550 25.091   1.00 233.76 ? 240 GLU A CD    1 
ATOM   1872  O  OE1   . GLU A 1 240 ? 16.380  -15.722 24.964   1.00 254.42 ? 240 GLU A OE1   1 
ATOM   1873  O  OE2   . GLU A 1 240 ? 16.764  -13.930 26.168   1.00 261.28 ? 240 GLU A OE2   1 
ATOM   1874  N  N     . LEU A 1 241 ? 14.488  -12.131 22.884   1.00 97.58  ? 241 LEU A N     1 
ATOM   1875  C  CA    . LEU A 1 241 ? 14.323  -10.681 22.861   1.00 108.14 ? 241 LEU A CA    1 
ATOM   1876  C  C     . LEU A 1 241 ? 15.393  -10.088 23.707   1.00 127.97 ? 241 LEU A C     1 
ATOM   1877  O  O     . LEU A 1 241 ? 15.973  -10.774 24.557   1.00 132.19 ? 241 LEU A O     1 
ATOM   1878  C  CB    . LEU A 1 241 ? 12.986  -10.199 23.409   1.00 112.34 ? 241 LEU A CB    1 
ATOM   1879  C  CG    . LEU A 1 241 ? 11.944  -9.851  22.328   1.00 119.94 ? 241 LEU A CG    1 
ATOM   1880  C  CD1   . LEU A 1 241 ? 11.653  -11.056 21.422   1.00 119.87 ? 241 LEU A CD1   1 
ATOM   1881  C  CD2   . LEU A 1 241 ? 10.662  -9.264  22.945   1.00 132.26 ? 241 LEU A CD2   1 
ATOM   1882  N  N     . PRO A 1 242 ? 15.615  -8.794  23.543   1.00 158.15 ? 242 PRO A N     1 
ATOM   1883  C  CA    . PRO A 1 242 ? 16.571  -8.133  24.431   1.00 170.64 ? 242 PRO A CA    1 
ATOM   1884  C  C     . PRO A 1 242 ? 16.097  -8.113  25.859   1.00 170.69 ? 242 PRO A C     1 
ATOM   1885  O  O     . PRO A 1 242 ? 16.916  -7.995  26.735   1.00 163.38 ? 242 PRO A O     1 
ATOM   1886  C  CB    . PRO A 1 242 ? 16.719  -6.730  23.823   1.00 184.20 ? 242 PRO A CB    1 
ATOM   1887  C  CG    . PRO A 1 242 ? 15.455  -6.549  23.071   1.00 187.62 ? 242 PRO A CG    1 
ATOM   1888  C  CD    . PRO A 1 242 ? 15.158  -7.881  22.485   1.00 176.56 ? 242 PRO A CD    1 
ATOM   1889  N  N     . ASP A 1 243 ? 14.779  -8.188  26.091   1.00 180.15 ? 243 ASP A N     1 
ATOM   1890  C  CA    . ASP A 1 243 ? 14.168  -8.213  27.389   1.00 186.78 ? 243 ASP A CA    1 
ATOM   1891  C  C     . ASP A 1 243 ? 14.544  -9.516  28.085   1.00 177.44 ? 243 ASP A C     1 
ATOM   1892  O  O     . ASP A 1 243 ? 14.564  -9.585  29.320   1.00 188.07 ? 243 ASP A O     1 
ATOM   1893  C  CB    . ASP A 1 243 ? 12.609  -8.000  27.224   1.00 191.96 ? 243 ASP A CB    1 
ATOM   1894  C  CG    . ASP A 1 243 ? 11.868  -8.279  28.466   1.00 196.69 ? 243 ASP A CG    1 
ATOM   1895  O  OD1   . ASP A 1 243 ? 12.492  -8.097  29.520   1.00 211.77 ? 243 ASP A OD1   1 
ATOM   1896  O  OD2   . ASP A 1 243 ? 10.656  -8.644  28.423   1.00 178.89 ? 243 ASP A OD2   1 
ATOM   1897  N  N     . GLY A 1 244 ? 14.823  -10.578 27.312   1.00 159.88 ? 244 GLY A N     1 
ATOM   1898  C  CA    . GLY A 1 244 ? 15.144  -11.832 27.926   1.00 147.99 ? 244 GLY A CA    1 
ATOM   1899  C  C     . GLY A 1 244 ? 14.002  -12.787 27.713   1.00 133.27 ? 244 GLY A C     1 
ATOM   1900  O  O     . GLY A 1 244 ? 14.109  -13.973 28.009   1.00 121.92 ? 244 GLY A O     1 
ATOM   1901  N  N     . GLN A 1 245 ? 12.891  -12.269 27.174   1.00 130.25 ? 245 GLN A N     1 
ATOM   1902  C  CA    . GLN A 1 245 ? 11.734  -13.064 26.869   1.00 130.77 ? 245 GLN A CA    1 
ATOM   1903  C  C     . GLN A 1 245 ? 12.108  -13.864 25.637   1.00 131.57 ? 245 GLN A C     1 
ATOM   1904  O  O     . GLN A 1 245 ? 12.965  -13.453 24.870   1.00 140.59 ? 245 GLN A O     1 
ATOM   1905  C  CB    . GLN A 1 245 ? 10.487  -12.191 26.622   1.00 140.44 ? 245 GLN A CB    1 
ATOM   1906  C  CG    . GLN A 1 245 ? 9.168   -12.932 26.669   1.00 164.16 ? 245 GLN A CG    1 
ATOM   1907  C  CD    . GLN A 1 245 ? 7.973   -11.997 26.603   1.00 184.77 ? 245 GLN A CD    1 
ATOM   1908  O  OE1   . GLN A 1 245 ? 8.099   -10.785 26.808   1.00 185.36 ? 245 GLN A OE1   1 
ATOM   1909  N  NE2   . GLN A 1 245 ? 6.800   -12.558 26.313   1.00 192.41 ? 245 GLN A NE2   1 
ATOM   1910  N  N     . VAL A 1 246 ? 11.428  -14.989 25.453   1.00 130.20 ? 246 VAL A N     1 
ATOM   1911  C  CA    . VAL A 1 246 ? 11.660  -15.870 24.341   1.00 122.36 ? 246 VAL A CA    1 
ATOM   1912  C  C     . VAL A 1 246 ? 10.390  -15.962 23.528   1.00 103.90 ? 246 VAL A C     1 
ATOM   1913  O  O     . VAL A 1 246 ? 9.289   -16.036 24.036   1.00 99.61  ? 246 VAL A O     1 
ATOM   1914  C  CB    . VAL A 1 246 ? 12.102  -17.255 24.844   1.00 141.47 ? 246 VAL A CB    1 
ATOM   1915  C  CG1   . VAL A 1 246 ? 12.161  -18.242 23.671   1.00 155.26 ? 246 VAL A CG1   1 
ATOM   1916  C  CG2   . VAL A 1 246 ? 13.422  -17.108 25.600   1.00 132.57 ? 246 VAL A CG2   1 
ATOM   1917  N  N     . ILE A 1 247 ? 10.554  -15.943 22.225   1.00 101.02 ? 247 ILE A N     1 
ATOM   1918  C  CA    . ILE A 1 247 ? 9.408   -15.974 21.306   1.00 112.09 ? 247 ILE A CA    1 
ATOM   1919  C  C     . ILE A 1 247 ? 9.539   -17.226 20.483   1.00 124.78 ? 247 ILE A C     1 
ATOM   1920  O  O     . ILE A 1 247 ? 10.666  -17.630 20.207   1.00 118.09 ? 247 ILE A O     1 
ATOM   1921  C  CB    . ILE A 1 247 ? 9.441   -14.740 20.370   1.00 119.80 ? 247 ILE A CB    1 
ATOM   1922  C  CG1   . ILE A 1 247 ? 9.375   -13.420 21.162   1.00 130.44 ? 247 ILE A CG1   1 
ATOM   1923  C  CG2   . ILE A 1 247 ? 8.390   -14.841 19.263   1.00 117.54 ? 247 ILE A CG2   1 
ATOM   1924  C  CD1   . ILE A 1 247 ? 8.148   -13.266 22.020   1.00 149.26 ? 247 ILE A CD1   1 
ATOM   1925  N  N     . THR A 1 248 ? 8.430   -17.830 20.081   1.00 137.86 ? 248 THR A N     1 
ATOM   1926  C  CA    . THR A 1 248 ? 8.492   -19.049 19.326   1.00 150.57 ? 248 THR A CA    1 
ATOM   1927  C  C     . THR A 1 248 ? 7.542   -18.948 18.155   1.00 140.82 ? 248 THR A C     1 
ATOM   1928  O  O     . THR A 1 248 ? 6.326   -18.954 18.342   1.00 129.61 ? 248 THR A O     1 
ATOM   1929  C  CB    . THR A 1 248 ? 8.084   -20.240 20.231   1.00 163.50 ? 248 THR A CB    1 
ATOM   1930  O  OG1   . THR A 1 248 ? 8.990   -20.324 21.334   1.00 181.27 ? 248 THR A OG1   1 
ATOM   1931  C  CG2   . THR A 1 248 ? 8.111   -21.570 19.483   1.00 178.25 ? 248 THR A CG2   1 
ATOM   1932  N  N     . ILE A 1 249 ? 8.080   -18.897 16.924   1.00 126.63 ? 249 ILE A N     1 
ATOM   1933  C  CA    . ILE A 1 249 ? 7.286   -18.523 15.795   1.00 121.99 ? 249 ILE A CA    1 
ATOM   1934  C  C     . ILE A 1 249 ? 7.307   -19.602 14.747   1.00 126.86 ? 249 ILE A C     1 
ATOM   1935  O  O     . ILE A 1 249 ? 8.381   -19.951 14.286   1.00 122.52 ? 249 ILE A O     1 
ATOM   1936  C  CB    . ILE A 1 249 ? 7.762   -17.212 15.180   1.00 113.61 ? 249 ILE A CB    1 
ATOM   1937  C  CG1   . ILE A 1 249 ? 9.266   -17.239 14.868   1.00 129.05 ? 249 ILE A CG1   1 
ATOM   1938  C  CG2   . ILE A 1 249 ? 7.504   -16.106 16.158   1.00 106.35 ? 249 ILE A CG2   1 
ATOM   1939  C  CD1   . ILE A 1 249 ? 9.689   -16.190 13.854   1.00 147.82 ? 249 ILE A CD1   1 
ATOM   1940  N  N     . GLY A 1 250 ? 6.128   -20.130 14.456   1.00 130.45 ? 250 GLY A N     1 
ATOM   1941  C  CA    . GLY A 1 250 ? 5.970   -21.252 13.534   1.00 147.25 ? 250 GLY A CA    1 
ATOM   1942  C  C     . GLY A 1 250 ? 5.762   -20.918 12.078   1.00 150.03 ? 250 GLY A C     1 
ATOM   1943  O  O     . GLY A 1 250 ? 6.666   -20.435 11.396   1.00 148.82 ? 250 GLY A O     1 
ATOM   1944  N  N     . ASN A 1 251 ? 4.497   -21.107 11.636   1.00 135.17 ? 251 ASN A N     1 
ATOM   1945  C  CA    . ASN A 1 251 ? 4.042   -20.866 10.262   1.00 118.79 ? 251 ASN A CA    1 
ATOM   1946  C  C     . ASN A 1 251 ? 3.992   -19.378 9.984    1.00 107.92 ? 251 ASN A C     1 
ATOM   1947  O  O     . ASN A 1 251 ? 4.175   -18.917 8.887    1.00 111.60 ? 251 ASN A O     1 
ATOM   1948  C  CB    . ASN A 1 251 ? 2.657   -21.485 9.991    1.00 127.24 ? 251 ASN A CB    1 
ATOM   1949  C  CG    . ASN A 1 251 ? 1.579   -20.821 10.801   1.00 124.11 ? 251 ASN A CG    1 
ATOM   1950  O  OD1   . ASN A 1 251 ? 1.803   -20.352 11.912   1.00 115.10 ? 251 ASN A OD1   1 
ATOM   1951  N  ND2   . ASN A 1 251 ? 0.363   -20.847 10.276   1.00 142.25 ? 251 ASN A ND2   1 
ATOM   1952  N  N     . GLU A 1 252 ? 3.793   -18.640 11.063   1.00 117.36 ? 252 GLU A N     1 
ATOM   1953  C  CA    . GLU A 1 252 ? 3.757   -17.206 11.050   1.00 145.31 ? 252 GLU A CA    1 
ATOM   1954  C  C     . GLU A 1 252 ? 5.061   -16.702 10.476   1.00 136.36 ? 252 GLU A C     1 
ATOM   1955  O  O     . GLU A 1 252 ? 5.109   -15.636 9.876    1.00 137.02 ? 252 GLU A O     1 
ATOM   1956  C  CB    . GLU A 1 252 ? 3.520   -16.728 12.486   1.00 164.64 ? 252 GLU A CB    1 
ATOM   1957  C  CG    . GLU A 1 252 ? 4.034   -15.331 12.803   1.00 161.51 ? 252 GLU A CG    1 
ATOM   1958  C  CD    . GLU A 1 252 ? 4.185   -15.126 14.291   1.00 185.17 ? 252 GLU A CD    1 
ATOM   1959  O  OE1   . GLU A 1 252 ? 3.314   -15.690 14.975   1.00 214.56 ? 252 GLU A OE1   1 
ATOM   1960  O  OE2   . GLU A 1 252 ? 5.173   -14.518 14.726   1.00 178.60 ? 252 GLU A OE2   1 
ATOM   1961  N  N     . ARG A 1 253 ? 6.131   -17.456 10.676   1.00 108.79 ? 253 ARG A N     1 
ATOM   1962  C  CA    . ARG A 1 253 ? 7.395   -17.100 10.055   1.00 89.11  ? 253 ARG A CA    1 
ATOM   1963  C  C     . ARG A 1 253 ? 7.251   -16.830 8.547    1.00 72.16  ? 253 ARG A C     1 
ATOM   1964  O  O     . ARG A 1 253 ? 7.502   -15.693 8.080    1.00 65.49  ? 253 ARG A O     1 
ATOM   1965  C  CB    . ARG A 1 253 ? 8.477   -18.184 10.337   1.00 86.97  ? 253 ARG A CB    1 
ATOM   1966  C  CG    . ARG A 1 253 ? 9.855   -17.778 9.816    1.00 85.54  ? 253 ARG A CG    1 
ATOM   1967  C  CD    . ARG A 1 253 ? 10.774  -18.951 9.596    1.00 83.07  ? 253 ARG A CD    1 
ATOM   1968  N  NE    . ARG A 1 253 ? 10.913  -19.717 10.794   1.00 87.25  ? 253 ARG A NE    1 
ATOM   1969  C  CZ    . ARG A 1 253 ? 11.815  -20.697 10.935   1.00 103.26 ? 253 ARG A CZ    1 
ATOM   1970  N  NH1   . ARG A 1 253 ? 11.831  -21.384 12.070   1.00 128.86 ? 253 ARG A NH1   1 
ATOM   1971  N  NH2   . ARG A 1 253 ? 12.672  -21.021 9.953    1.00 92.41  ? 253 ARG A NH2   1 
ATOM   1972  N  N     . PHE A 1 254 ? 6.895   -17.866 7.773    1.00 67.97  ? 254 PHE A N     1 
ATOM   1973  C  CA    . PHE A 1 254 ? 7.115   -17.790 6.327    1.00 76.95  ? 254 PHE A CA    1 
ATOM   1974  C  C     . PHE A 1 254 ? 5.992   -17.041 5.592    1.00 74.28  ? 254 PHE A C     1 
ATOM   1975  O  O     . PHE A 1 254 ? 6.225   -16.536 4.516    1.00 68.98  ? 254 PHE A O     1 
ATOM   1976  C  CB    . PHE A 1 254 ? 7.362   -19.177 5.696    1.00 86.67  ? 254 PHE A CB    1 
ATOM   1977  C  CG    . PHE A 1 254 ? 6.227   -20.095 5.912    1.00 96.94  ? 254 PHE A CG    1 
ATOM   1978  C  CD1   . PHE A 1 254 ? 5.121   -20.091 5.071    1.00 100.67 ? 254 PHE A CD1   1 
ATOM   1979  C  CD2   . PHE A 1 254 ? 6.241   -20.954 6.966    1.00 108.44 ? 254 PHE A CD2   1 
ATOM   1980  C  CE1   . PHE A 1 254 ? 4.061   -20.916 5.301    1.00 101.93 ? 254 PHE A CE1   1 
ATOM   1981  C  CE2   . PHE A 1 254 ? 5.188   -21.826 7.197    1.00 117.46 ? 254 PHE A CE2   1 
ATOM   1982  C  CZ    . PHE A 1 254 ? 4.099   -21.807 6.342    1.00 111.57 ? 254 PHE A CZ    1 
ATOM   1983  N  N     . ARG A 1 255 ? 4.763   -17.066 6.128    1.00 86.88  ? 255 ARG A N     1 
ATOM   1984  C  CA    . ARG A 1 255 ? 3.706   -16.281 5.549    1.00 96.77  ? 255 ARG A CA    1 
ATOM   1985  C  C     . ARG A 1 255 ? 3.997   -14.821 5.585    1.00 77.70  ? 255 ARG A C     1 
ATOM   1986  O  O     . ARG A 1 255 ? 3.392   -14.101 4.803    1.00 76.04  ? 255 ARG A O     1 
ATOM   1987  C  CB    . ARG A 1 255 ? 2.320   -16.621 6.108    1.00 102.29 ? 255 ARG A CB    1 
ATOM   1988  C  CG    . ARG A 1 255 ? 2.012   -16.239 7.521    1.00 99.47  ? 255 ARG A CG    1 
ATOM   1989  C  CD    . ARG A 1 255 ? 0.589   -16.707 7.746    1.00 111.79 ? 255 ARG A CD    1 
ATOM   1990  N  NE    . ARG A 1 255 ? 0.227   -16.829 9.142    1.00 122.16 ? 255 ARG A NE    1 
ATOM   1991  C  CZ    . ARG A 1 255 ? -0.970  -17.237 9.551    1.00 127.03 ? 255 ARG A CZ    1 
ATOM   1992  N  NH1   . ARG A 1 255 ? -1.914  -17.548 8.668    1.00 129.64 ? 255 ARG A NH1   1 
ATOM   1993  N  NH2   . ARG A 1 255 ? -1.224  -17.342 10.851   1.00 126.53 ? 255 ARG A NH2   1 
ATOM   1994  N  N     . CYS A 1 256 ? 4.943   -14.338 6.390    1.00 72.37  ? 256 CYS A N     1 
ATOM   1995  C  CA    . CYS A 1 256 ? 5.265   -12.930 6.339    1.00 81.47  ? 256 CYS A CA    1 
ATOM   1996  C  C     . CYS A 1 256 ? 5.763   -12.484 4.989    1.00 82.74  ? 256 CYS A C     1 
ATOM   1997  O  O     . CYS A 1 256 ? 5.232   -11.571 4.423    1.00 79.52  ? 256 CYS A O     1 
ATOM   1998  C  CB    . CYS A 1 256 ? 6.181   -12.447 7.471    1.00 90.79  ? 256 CYS A CB    1 
ATOM   1999  S  SG    . CYS A 1 256 ? 6.540   -10.670 7.320    1.00 108.79 ? 256 CYS A SG    1 
ATOM   2000  N  N     . PRO A 1 257 ? 6.798   -13.123 4.438    1.00 93.44  ? 257 PRO A N     1 
ATOM   2001  C  CA    . PRO A 1 257 ? 7.266   -12.762 3.095    1.00 87.87  ? 257 PRO A CA    1 
ATOM   2002  C  C     . PRO A 1 257 ? 6.326   -13.178 2.008    1.00 83.80  ? 257 PRO A C     1 
ATOM   2003  O  O     . PRO A 1 257 ? 6.433   -12.697 0.889    1.00 82.55  ? 257 PRO A O     1 
ATOM   2004  C  CB    . PRO A 1 257 ? 8.538   -13.577 2.930    1.00 81.00  ? 257 PRO A CB    1 
ATOM   2005  C  CG    . PRO A 1 257 ? 9.057   -13.841 4.293    1.00 88.33  ? 257 PRO A CG    1 
ATOM   2006  C  CD    . PRO A 1 257 ? 7.810   -13.849 5.200    1.00 100.57 ? 257 PRO A CD    1 
ATOM   2007  N  N     . GLU A 1 258 ? 5.424   -14.114 2.300    1.00 77.86  ? 258 GLU A N     1 
ATOM   2008  C  CA    . GLU A 1 258 ? 4.446   -14.561 1.334    1.00 82.85  ? 258 GLU A CA    1 
ATOM   2009  C  C     . GLU A 1 258 ? 3.692   -13.386 0.805    1.00 78.13  ? 258 GLU A C     1 
ATOM   2010  O  O     . GLU A 1 258 ? 3.230   -13.407 -0.324   1.00 69.15  ? 258 GLU A O     1 
ATOM   2011  C  CB    . GLU A 1 258 ? 3.454   -15.581 1.917    1.00 85.13  ? 258 GLU A CB    1 
ATOM   2012  C  CG    . GLU A 1 258 ? 2.419   -16.097 0.940    1.00 96.85  ? 258 GLU A CG    1 
ATOM   2013  C  CD    . GLU A 1 258 ? 3.050   -16.852 -0.231   1.00 108.19 ? 258 GLU A CD    1 
ATOM   2014  O  OE1   . GLU A 1 258 ? 4.267   -17.209 -0.210   1.00 109.59 ? 258 GLU A OE1   1 
ATOM   2015  O  OE2   . GLU A 1 258 ? 2.352   -17.014 -1.255   1.00 112.49 ? 258 GLU A OE2   1 
ATOM   2016  N  N     . ALA A 1 259 ? 3.587   -12.341 1.616    1.00 82.12  ? 259 ALA A N     1 
ATOM   2017  C  CA    . ALA A 1 259 ? 2.813   -11.160 1.275    1.00 87.86  ? 259 ALA A CA    1 
ATOM   2018  C  C     . ALA A 1 259 ? 3.264   -10.590 -0.041   1.00 81.60  ? 259 ALA A C     1 
ATOM   2019  O  O     . ALA A 1 259 ? 2.422   -10.103 -0.821   1.00 94.37  ? 259 ALA A O     1 
ATOM   2020  C  CB    . ALA A 1 259 ? 2.859   -10.079 2.347    1.00 90.88  ? 259 ALA A CB    1 
ATOM   2021  N  N     . LEU A 1 260 ? 4.554   -10.641 -0.328   1.00 81.67  ? 260 LEU A N     1 
ATOM   2022  C  CA    . LEU A 1 260 ? 5.044   -10.103 -1.596   1.00 96.55  ? 260 LEU A CA    1 
ATOM   2023  C  C     . LEU A 1 260 ? 4.344   -10.736 -2.753   1.00 84.15  ? 260 LEU A C     1 
ATOM   2024  O  O     . LEU A 1 260 ? 4.102   -10.065 -3.702   1.00 86.82  ? 260 LEU A O     1 
ATOM   2025  C  CB    . LEU A 1 260 ? 6.569   -10.299 -1.751   1.00 111.97 ? 260 LEU A CB    1 
ATOM   2026  C  CG    . LEU A 1 260 ? 7.418   -9.592  -0.681   1.00 132.06 ? 260 LEU A CG    1 
ATOM   2027  C  CD1   . LEU A 1 260 ? 8.926   -9.790  -0.943   1.00 117.96 ? 260 LEU A CD1   1 
ATOM   2028  C  CD2   . LEU A 1 260 ? 7.062   -8.083  -0.584   1.00 158.16 ? 260 LEU A CD2   1 
ATOM   2029  N  N     . PHE A 1 261 ? 3.970   -11.969 -2.649   1.00 77.78  ? 261 PHE A N     1 
ATOM   2030  C  CA    . PHE A 1 261 ? 3.321   -12.714 -3.670   1.00 89.66  ? 261 PHE A CA    1 
ATOM   2031  C  C     . PHE A 1 261 ? 1.775   -12.724 -3.499   1.00 82.29  ? 261 PHE A C     1 
ATOM   2032  O  O     . PHE A 1 261 ? 1.070   -13.197 -4.406   1.00 68.27  ? 261 PHE A O     1 
ATOM   2033  C  CB    . PHE A 1 261 ? 3.953   -14.121 -3.644   1.00 96.62  ? 261 PHE A CB    1 
ATOM   2034  C  CG    . PHE A 1 261 ? 5.455   -14.121 -3.760   1.00 97.10  ? 261 PHE A CG    1 
ATOM   2035  C  CD1   . PHE A 1 261 ? 6.049   -14.103 -4.986   1.00 90.36  ? 261 PHE A CD1   1 
ATOM   2036  C  CD2   . PHE A 1 261 ? 6.253   -14.082 -2.632   1.00 106.46 ? 261 PHE A CD2   1 
ATOM   2037  C  CE1   . PHE A 1 261 ? 7.420   -14.119 -5.111   1.00 86.70  ? 261 PHE A CE1   1 
ATOM   2038  C  CE2   . PHE A 1 261 ? 7.612   -14.037 -2.728   1.00 101.52 ? 261 PHE A CE2   1 
ATOM   2039  C  CZ    . PHE A 1 261 ? 8.218   -14.098 -3.972   1.00 91.10  ? 261 PHE A CZ    1 
ATOM   2040  N  N     . GLN A 1 262 ? 1.262   -12.253 -2.382   1.00 84.59  ? 262 GLN A N     1 
ATOM   2041  C  CA    . GLN A 1 262 ? -0.174  -12.286 -2.161   1.00 96.41  ? 262 GLN A CA    1 
ATOM   2042  C  C     . GLN A 1 262 ? -0.533  -11.078 -1.408   1.00 104.82 ? 262 GLN A C     1 
ATOM   2043  O  O     . GLN A 1 262 ? -0.771  -11.155 -0.176   1.00 132.32 ? 262 GLN A O     1 
ATOM   2044  C  CB    . GLN A 1 262 ? -0.597  -13.486 -1.331   1.00 120.08 ? 262 GLN A CB    1 
ATOM   2045  C  CG    . GLN A 1 262 ? -0.283  -14.839 -1.934   1.00 157.15 ? 262 GLN A CG    1 
ATOM   2046  C  CD    . GLN A 1 262 ? -1.210  -15.284 -3.063   1.00 183.59 ? 262 GLN A CD    1 
ATOM   2047  O  OE1   . GLN A 1 262 ? -2.435  -15.103 -3.004   1.00 196.50 ? 262 GLN A OE1   1 
ATOM   2048  N  NE2   . GLN A 1 262 ? -0.623  -15.909 -4.089   1.00 184.88 ? 262 GLN A NE2   1 
ATOM   2049  N  N     . PRO A 1 263 ? -0.588  -9.929  -2.105   1.00 94.52  ? 263 PRO A N     1 
ATOM   2050  C  CA    . PRO A 1 263 ? -0.812  -8.689  -1.351   1.00 96.49  ? 263 PRO A CA    1 
ATOM   2051  C  C     . PRO A 1 263 ? -2.210  -8.619  -0.843   1.00 120.49 ? 263 PRO A C     1 
ATOM   2052  O  O     . PRO A 1 263 ? -2.516  -7.724  -0.086   1.00 130.47 ? 263 PRO A O     1 
ATOM   2053  C  CB    . PRO A 1 263 ? -0.504  -7.582  -2.330   1.00 86.55  ? 263 PRO A CB    1 
ATOM   2054  C  CG    . PRO A 1 263 ? 0.374   -8.203  -3.305   1.00 87.41  ? 263 PRO A CG    1 
ATOM   2055  C  CD    . PRO A 1 263 ? -0.183  -9.613  -3.471   1.00 87.49  ? 263 PRO A CD    1 
ATOM   2056  N  N     . SER A 1 264 ? -3.087  -9.560  -1.203   1.00 130.77 ? 264 SER A N     1 
ATOM   2057  C  CA    . SER A 1 264 ? -4.412  -9.641  -0.631   1.00 132.86 ? 264 SER A CA    1 
ATOM   2058  C  C     . SER A 1 264 ? -4.309  -9.849  0.861    1.00 133.83 ? 264 SER A C     1 
ATOM   2059  O  O     . SER A 1 264 ? -5.230  -9.537  1.582    1.00 136.20 ? 264 SER A O     1 
ATOM   2060  C  CB    . SER A 1 264 ? -5.186  -10.844 -1.204   1.00 163.45 ? 264 SER A CB    1 
ATOM   2061  O  OG    . SER A 1 264 ? -5.203  -10.809 -2.619   1.00 189.35 ? 264 SER A OG    1 
ATOM   2062  N  N     . PHE A 1 265 ? -3.184  -10.403 1.321    1.00 125.69 ? 265 PHE A N     1 
ATOM   2063  C  CA    . PHE A 1 265 ? -2.971  -10.597 2.733    1.00 109.08 ? 265 PHE A CA    1 
ATOM   2064  C  C     . PHE A 1 265 ? -2.954  -9.272  3.440    1.00 95.51  ? 265 PHE A C     1 
ATOM   2065  O  O     . PHE A 1 265 ? -3.527  -9.130  4.520    1.00 103.76 ? 265 PHE A O     1 
ATOM   2066  C  CB    . PHE A 1 265 ? -1.678  -11.374 3.051    1.00 109.69 ? 265 PHE A CB    1 
ATOM   2067  C  CG    . PHE A 1 265 ? -1.730  -12.810 2.656    1.00 127.76 ? 265 PHE A CG    1 
ATOM   2068  C  CD1   . PHE A 1 265 ? -2.903  -13.408 2.244    1.00 134.57 ? 265 PHE A CD1   1 
ATOM   2069  C  CD2   . PHE A 1 265 ? -0.603  -13.599 2.775    1.00 139.41 ? 265 PHE A CD2   1 
ATOM   2070  C  CE1   . PHE A 1 265 ? -2.935  -14.733 1.893    1.00 145.18 ? 265 PHE A CE1   1 
ATOM   2071  C  CE2   . PHE A 1 265 ? -0.632  -14.938 2.436    1.00 150.04 ? 265 PHE A CE2   1 
ATOM   2072  C  CZ    . PHE A 1 265 ? -1.805  -15.504 1.992    1.00 153.21 ? 265 PHE A CZ    1 
ATOM   2073  N  N     . LEU A 1 266 ? -2.253  -8.321  2.832    1.00 91.34  ? 266 LEU A N     1 
ATOM   2074  C  CA    . LEU A 1 266 ? -2.166  -6.935  3.268    1.00 113.45 ? 266 LEU A CA    1 
ATOM   2075  C  C     . LEU A 1 266 ? -3.433  -6.197  2.954    1.00 129.39 ? 266 LEU A C     1 
ATOM   2076  O  O     . LEU A 1 266 ? -3.709  -5.226  3.617    1.00 129.08 ? 266 LEU A O     1 
ATOM   2077  C  CB    . LEU A 1 266 ? -0.972  -6.206  2.615    1.00 131.78 ? 266 LEU A CB    1 
ATOM   2078  C  CG    . LEU A 1 266 ? 0.376   -6.656  3.225    1.00 150.85 ? 266 LEU A CG    1 
ATOM   2079  C  CD1   . LEU A 1 266 ? 1.571   -6.108  2.422    1.00 171.91 ? 266 LEU A CD1   1 
ATOM   2080  C  CD2   . LEU A 1 266 ? 0.435   -6.288  4.719    1.00 153.29 ? 266 LEU A CD2   1 
ATOM   2081  N  N     . GLY A 1 267 ? -4.179  -6.610  1.936    1.00 144.07 ? 267 GLY A N     1 
ATOM   2082  C  CA    . GLY A 1 267 ? -5.480  -5.998  1.706    1.00 134.86 ? 267 GLY A CA    1 
ATOM   2083  C  C     . GLY A 1 267 ? -5.412  -5.091  0.524    1.00 131.18 ? 267 GLY A C     1 
ATOM   2084  O  O     . GLY A 1 267 ? -6.358  -4.420  0.228    1.00 139.19 ? 267 GLY A O     1 
ATOM   2085  N  N     . MET A 1 268 ? -4.271  -5.068  -0.180   1.00 135.15 ? 268 MET A N     1 
ATOM   2086  C  CA    . MET A 1 268 ? -4.102  -4.305  -1.391   1.00 134.52 ? 268 MET A CA    1 
ATOM   2087  C  C     . MET A 1 268 ? -4.376  -5.204  -2.580   1.00 134.49 ? 268 MET A C     1 
ATOM   2088  O  O     . MET A 1 268 ? -4.109  -6.414  -2.549   1.00 139.69 ? 268 MET A O     1 
ATOM   2089  C  CB    . MET A 1 268 ? -2.684  -3.674  -1.457   1.00 139.70 ? 268 MET A CB    1 
ATOM   2090  C  CG    . MET A 1 268 ? -2.498  -2.528  -0.453   1.00 158.89 ? 268 MET A CG    1 
ATOM   2091  S  SD    . MET A 1 268 ? -0.874  -1.771  -0.434   1.00 204.23 ? 268 MET A SD    1 
ATOM   2092  C  CE    . MET A 1 268 ? 0.062   -3.185  0.097    1.00 191.99 ? 268 MET A CE    1 
ATOM   2093  N  N     . GLU A 1 269 ? -4.941  -4.591  -3.602   1.00 138.01 ? 269 GLU A N     1 
ATOM   2094  C  CA    . GLU A 1 269 ? -5.281  -5.263  -4.879   1.00 154.75 ? 269 GLU A CA    1 
ATOM   2095  C  C     . GLU A 1 269 ? -4.022  -5.440  -5.715   1.00 143.57 ? 269 GLU A C     1 
ATOM   2096  O  O     . GLU A 1 269 ? -3.841  -6.460  -6.412   1.00 138.77 ? 269 GLU A O     1 
ATOM   2097  C  CB    . GLU A 1 269 ? -6.236  -4.445  -5.755   1.00 186.67 ? 269 GLU A CB    1 
ATOM   2098  C  CG    . GLU A 1 269 ? -7.556  -4.190  -5.104   1.00 205.61 ? 269 GLU A CG    1 
ATOM   2099  C  CD    . GLU A 1 269 ? -8.623  -3.689  -6.072   1.00 231.05 ? 269 GLU A CD    1 
ATOM   2100  O  OE1   . GLU A 1 269 ? -8.319  -3.525  -7.274   1.00 235.47 ? 269 GLU A OE1   1 
ATOM   2101  O  OE2   . GLU A 1 269 ? -9.763  -3.429  -5.625   1.00 237.61 ? 269 GLU A OE2   1 
ATOM   2102  N  N     . SER A 1 270 ? -3.131  -4.460  -5.564   1.00 130.13 ? 270 SER A N     1 
ATOM   2103  C  CA    . SER A 1 270 ? -1.907  -4.390  -6.361   1.00 127.59 ? 270 SER A CA    1 
ATOM   2104  C  C     . SER A 1 270 ? -1.302  -5.758  -6.452   1.00 117.72 ? 270 SER A C     1 
ATOM   2105  O  O     . SER A 1 270 ? -1.194  -6.459  -5.456   1.00 128.66 ? 270 SER A O     1 
ATOM   2106  C  CB    . SER A 1 270 ? -0.892  -3.366  -5.823   1.00 127.71 ? 270 SER A CB    1 
ATOM   2107  O  OG    . SER A 1 270 ? -1.524  -2.107  -5.730   1.00 133.54 ? 270 SER A OG    1 
ATOM   2108  N  N     . CYS A 1 271 ? -0.965  -6.171  -7.672   1.00 114.77 ? 271 CYS A N     1 
ATOM   2109  C  CA    . CYS A 1 271 ? -0.567  -7.556  -7.918   1.00 115.16 ? 271 CYS A CA    1 
ATOM   2110  C  C     . CYS A 1 271 ? 0.709   -7.855  -7.183   1.00 93.21  ? 271 CYS A C     1 
ATOM   2111  O  O     . CYS A 1 271 ? 1.440   -6.956  -6.788   1.00 90.67  ? 271 CYS A O     1 
ATOM   2112  C  CB    . CYS A 1 271 ? -0.394  -7.853  -9.416   1.00 145.82 ? 271 CYS A CB    1 
ATOM   2113  S  SG    . CYS A 1 271 ? -1.926  -7.830  -10.358  1.00 222.96 ? 271 CYS A SG    1 
ATOM   2114  N  N     . GLY A 1 272 ? 0.959   -9.131  -6.982   1.00 88.61  ? 272 GLY A N     1 
ATOM   2115  C  CA    . GLY A 1 272 ? 2.202   -9.563  -6.409   1.00 86.92  ? 272 GLY A CA    1 
ATOM   2116  C  C     . GLY A 1 272 ? 3.383   -9.206  -7.243   1.00 95.94  ? 272 GLY A C     1 
ATOM   2117  O  O     . GLY A 1 272 ? 3.245   -8.970  -8.451   1.00 117.76 ? 272 GLY A O     1 
ATOM   2118  N  N     . ILE A 1 273 ? 4.583   -9.312  -6.665   1.00 95.96  ? 273 ILE A N     1 
ATOM   2119  C  CA    . ILE A 1 273 ? 5.795   -8.875  -7.309   1.00 100.34 ? 273 ILE A CA    1 
ATOM   2120  C  C     . ILE A 1 273 ? 6.077   -9.596  -8.623   1.00 102.51 ? 273 ILE A C     1 
ATOM   2121  O  O     . ILE A 1 273 ? 6.485   -8.954  -9.611   1.00 126.11 ? 273 ILE A O     1 
ATOM   2122  C  CB    . ILE A 1 273 ? 6.997   -8.966  -6.392   1.00 97.82  ? 273 ILE A CB    1 
ATOM   2123  C  CG1   . ILE A 1 273 ? 7.272   -10.418 -5.964   1.00 104.14 ? 273 ILE A CG1   1 
ATOM   2124  C  CG2   . ILE A 1 273 ? 6.771   -8.015  -5.220   1.00 112.16 ? 273 ILE A CG2   1 
ATOM   2125  C  CD1   . ILE A 1 273 ? 8.602   -10.594 -5.242   1.00 123.95 ? 273 ILE A CD1   1 
ATOM   2126  N  N     . HIS A 1 274 ? 5.844   -10.887 -8.683   1.00 75.28  ? 274 HIS A N     1 
ATOM   2127  C  CA    . HIS A 1 274 ? 6.080   -11.628 -9.890   1.00 67.31  ? 274 HIS A CA    1 
ATOM   2128  C  C     . HIS A 1 274 ? 5.163   -11.155 -11.002  1.00 66.76  ? 274 HIS A C     1 
ATOM   2129  O  O     . HIS A 1 274 ? 5.660   -10.957 -12.156  1.00 65.89  ? 274 HIS A O     1 
ATOM   2130  C  CB    . HIS A 1 274 ? 5.987   -13.108 -9.687   1.00 80.91  ? 274 HIS A CB    1 
ATOM   2131  C  CG    . HIS A 1 274 ? 4.686   -13.577 -9.109   1.00 99.25  ? 274 HIS A CG    1 
ATOM   2132  N  ND1   . HIS A 1 274 ? 4.275   -13.254 -7.836   1.00 111.22 ? 274 HIS A ND1   1 
ATOM   2133  C  CD2   . HIS A 1 274 ? 3.740   -14.399 -9.614   1.00 117.42 ? 274 HIS A CD2   1 
ATOM   2134  C  CE1   . HIS A 1 274 ? 3.127   -13.870 -7.573   1.00 123.92 ? 274 HIS A CE1   1 
ATOM   2135  N  NE2   . HIS A 1 274 ? 2.769   -14.556 -8.645   1.00 126.51 ? 274 HIS A NE2   1 
ATOM   2136  N  N     . GLU A 1 275 ? 3.902   -10.904 -10.674  1.00 81.85  ? 275 GLU A N     1 
ATOM   2137  C  CA    . GLU A 1 275 ? 2.966   -10.394 -11.667  1.00 112.61 ? 275 GLU A CA    1 
ATOM   2138  C  C     . GLU A 1 275 ? 3.334   -9.015  -12.117  1.00 121.17 ? 275 GLU A C     1 
ATOM   2139  O  O     . GLU A 1 275 ? 2.961   -8.653  -13.182  1.00 133.86 ? 275 GLU A O     1 
ATOM   2140  C  CB    . GLU A 1 275 ? 1.489   -10.424 -11.271  1.00 119.02 ? 275 GLU A CB    1 
ATOM   2141  C  CG    . GLU A 1 275 ? 0.907   -11.797 -11.049  1.00 123.13 ? 275 GLU A CG    1 
ATOM   2142  C  CD    . GLU A 1 275 ? 1.146   -12.279 -9.653   1.00 144.08 ? 275 GLU A CD    1 
ATOM   2143  O  OE1   . GLU A 1 275 ? 2.024   -11.736 -8.947   1.00 161.94 ? 275 GLU A OE1   1 
ATOM   2144  O  OE2   . GLU A 1 275 ? 0.442   -13.224 -9.225   1.00 149.27 ? 275 GLU A OE2   1 
ATOM   2145  N  N     . THR A 1 276 ? 3.896   -8.185  -11.250  1.00 106.70 ? 276 THR A N     1 
ATOM   2146  C  CA    . THR A 1 276 ? 4.371   -6.875  -11.603  1.00 108.92 ? 276 THR A CA    1 
ATOM   2147  C  C     . THR A 1 276 ? 5.547   -6.957  -12.538  1.00 113.48 ? 276 THR A C     1 
ATOM   2148  O  O     . THR A 1 276 ? 5.712   -6.136  -13.416  1.00 139.82 ? 276 THR A O     1 
ATOM   2149  C  CB    . THR A 1 276 ? 4.808   -6.057  -10.397  1.00 110.96 ? 276 THR A CB    1 
ATOM   2150  O  OG1   . THR A 1 276 ? 5.901   -6.717  -9.741   1.00 100.19 ? 276 THR A OG1   1 
ATOM   2151  C  CG2   . THR A 1 276 ? 3.638   -5.878  -9.462   1.00 109.54 ? 276 THR A CG2   1 
ATOM   2152  N  N     . THR A 1 277 ? 6.387   -7.958  -12.343  1.00 103.71 ? 277 THR A N     1 
ATOM   2153  C  CA    . THR A 1 277 ? 7.482   -8.187  -13.269  1.00 105.00 ? 277 THR A CA    1 
ATOM   2154  C  C     . THR A 1 277 ? 6.954   -8.514  -14.665  1.00 110.69 ? 277 THR A C     1 
ATOM   2155  O  O     . THR A 1 277 ? 7.346   -7.853  -15.614  1.00 112.07 ? 277 THR A O     1 
ATOM   2156  C  CB    . THR A 1 277 ? 8.426   -9.270  -12.833  1.00 109.94 ? 277 THR A CB    1 
ATOM   2157  O  OG1   . THR A 1 277 ? 8.955   -8.928  -11.557  1.00 99.46  ? 277 THR A OG1   1 
ATOM   2158  C  CG2   . THR A 1 277 ? 9.522   -9.433  -13.841  1.00 104.37 ? 277 THR A CG2   1 
ATOM   2159  N  N     . PHE A 1 278 ? 5.981   -9.403  -14.772  1.00 94.98  ? 278 PHE A N     1 
ATOM   2160  C  CA    . PHE A 1 278 ? 5.257   -9.644  -15.999  1.00 93.45  ? 278 PHE A CA    1 
ATOM   2161  C  C     . PHE A 1 278 ? 4.606   -8.427  -16.524  1.00 92.69  ? 278 PHE A C     1 
ATOM   2162  O  O     . PHE A 1 278 ? 4.668   -8.198  -17.686  1.00 106.27 ? 278 PHE A O     1 
ATOM   2163  C  CB    . PHE A 1 278 ? 4.104   -10.651 -15.836  1.00 105.29 ? 278 PHE A CB    1 
ATOM   2164  C  CG    . PHE A 1 278 ? 4.295   -11.916 -16.544  1.00 121.75 ? 278 PHE A CG    1 
ATOM   2165  C  CD1   . PHE A 1 278 ? 3.711   -12.170 -17.785  1.00 113.89 ? 278 PHE A CD1   1 
ATOM   2166  C  CD2   . PHE A 1 278 ? 5.025   -12.895 -15.945  1.00 162.81 ? 278 PHE A CD2   1 
ATOM   2167  C  CE1   . PHE A 1 278 ? 3.881   -13.396 -18.395  1.00 137.40 ? 278 PHE A CE1   1 
ATOM   2168  C  CE2   . PHE A 1 278 ? 5.214   -14.114 -16.551  1.00 197.69 ? 278 PHE A CE2   1 
ATOM   2169  C  CZ    . PHE A 1 278 ? 4.645   -14.361 -17.781  1.00 184.76 ? 278 PHE A CZ    1 
ATOM   2170  N  N     . ASN A 1 279 ? 4.025   -7.599  -15.680  1.00 92.65  ? 279 ASN A N     1 
ATOM   2171  C  CA    . ASN A 1 279 ? 3.431   -6.364  -16.135  1.00 110.66 ? 279 ASN A CA    1 
ATOM   2172  C  C     . ASN A 1 279 ? 4.498   -5.508  -16.814  1.00 104.27 ? 279 ASN A C     1 
ATOM   2173  O  O     . ASN A 1 279 ? 4.239   -4.863  -17.838  1.00 115.18 ? 279 ASN A O     1 
ATOM   2174  C  CB    . ASN A 1 279 ? 2.718   -5.624  -14.908  1.00 145.77 ? 279 ASN A CB    1 
ATOM   2175  C  CG    . ASN A 1 279 ? 1.753   -4.535  -15.320  1.00 183.96 ? 279 ASN A CG    1 
ATOM   2176  O  OD1   . ASN A 1 279 ? 1.383   -4.424  -16.490  1.00 214.51 ? 279 ASN A OD1   1 
ATOM   2177  N  ND2   . ASN A 1 279 ? 1.283   -3.759  -14.347  1.00 200.54 ? 279 ASN A ND2   1 
ATOM   2178  N  N     . SER A 1 280 ? 5.715   -5.508  -16.254  1.00 91.27  ? 280 SER A N     1 
ATOM   2179  C  CA    . SER A 1 280 ? 6.776   -4.699  -16.843  1.00 93.00  ? 280 SER A CA    1 
ATOM   2180  C  C     . SER A 1 280 ? 7.180   -5.269  -18.170  1.00 85.71  ? 280 SER A C     1 
ATOM   2181  O  O     . SER A 1 280 ? 7.282   -4.568  -19.168  1.00 93.57  ? 280 SER A O     1 
ATOM   2182  C  CB    . SER A 1 280 ? 8.014   -4.615  -15.959  1.00 106.46 ? 280 SER A CB    1 
ATOM   2183  O  OG    . SER A 1 280 ? 7.687   -3.940  -14.749  1.00 136.86 ? 280 SER A OG    1 
ATOM   2184  N  N     . ILE A 1 281 ? 7.563   -6.551  -18.178  1.00 83.73  ? 281 ILE A N     1 
ATOM   2185  C  CA    . ILE A 1 281 ? 8.046   -7.203  -19.379  1.00 84.67  ? 281 ILE A CA    1 
ATOM   2186  C  C     . ILE A 1 281 ? 7.025   -7.130  -20.482  1.00 92.68  ? 281 ILE A C     1 
ATOM   2187  O  O     . ILE A 1 281 ? 7.400   -6.920  -21.636  1.00 87.25  ? 281 ILE A O     1 
ATOM   2188  C  CB    . ILE A 1 281 ? 8.452   -8.654  -19.048  1.00 73.18  ? 281 ILE A CB    1 
ATOM   2189  C  CG1   . ILE A 1 281 ? 9.740   -8.565  -18.247  1.00 83.52  ? 281 ILE A CG1   1 
ATOM   2190  C  CG2   . ILE A 1 281 ? 8.544   -9.509  -20.305  1.00 64.48  ? 281 ILE A CG2   1 
ATOM   2191  C  CD1   . ILE A 1 281 ? 10.167  -9.866  -17.572  1.00 95.17  ? 281 ILE A CD1   1 
ATOM   2192  N  N     . MET A 1 282 ? 5.734   -7.265  -20.150  1.00 101.13 ? 282 MET A N     1 
ATOM   2193  C  CA    . MET A 1 282 ? 4.709   -7.288  -21.174  1.00 99.17  ? 282 MET A CA    1 
ATOM   2194  C  C     . MET A 1 282 ? 4.543   -5.956  -21.814  1.00 90.24  ? 282 MET A C     1 
ATOM   2195  O  O     . MET A 1 282 ? 4.110   -5.892  -22.960  1.00 86.65  ? 282 MET A O     1 
ATOM   2196  C  CB    . MET A 1 282 ? 3.335   -7.694  -20.639  1.00 112.67 ? 282 MET A CB    1 
ATOM   2197  C  CG    . MET A 1 282 ? 3.157   -9.199  -20.505  1.00 119.36 ? 282 MET A CG    1 
ATOM   2198  S  SD    . MET A 1 282 ? 3.221   -10.079 -22.084  1.00 109.14 ? 282 MET A SD    1 
ATOM   2199  C  CE    . MET A 1 282 ? 4.883   -10.712 -21.905  1.00 104.06 ? 282 MET A CE    1 
ATOM   2200  N  N     . LYS A 1 283 ? 4.884   -4.887  -21.096  1.00 96.79  ? 283 LYS A N     1 
ATOM   2201  C  CA    . LYS A 1 283 ? 4.854   -3.523  -21.619  1.00 118.34 ? 283 LYS A CA    1 
ATOM   2202  C  C     . LYS A 1 283 ? 5.959   -3.299  -22.619  1.00 118.08 ? 283 LYS A C     1 
ATOM   2203  O  O     . LYS A 1 283 ? 5.932   -2.347  -23.386  1.00 120.63 ? 283 LYS A O     1 
ATOM   2204  C  CB    . LYS A 1 283 ? 4.958   -2.484  -20.472  1.00 120.32 ? 283 LYS A CB    1 
ATOM   2205  C  CG    . LYS A 1 283 ? 3.601   -2.279  -19.785  1.00 126.89 ? 283 LYS A CG    1 
ATOM   2206  C  CD    . LYS A 1 283 ? 3.637   -1.280  -18.640  1.00 146.84 ? 283 LYS A CD    1 
ATOM   2207  C  CE    . LYS A 1 283 ? 2.365   -1.301  -17.774  1.00 171.47 ? 283 LYS A CE    1 
ATOM   2208  N  NZ    . LYS A 1 283 ? 1.182   -0.839  -18.575  1.00 181.42 ? 283 LYS A NZ    1 
ATOM   2209  N  N     . CYS A 1 284 ? 6.998   -4.130  -22.588  1.00 92.62  ? 284 CYS A N     1 
ATOM   2210  C  CA    . CYS A 1 284 ? 8.186   -3.924  -23.413  1.00 83.78  ? 284 CYS A CA    1 
ATOM   2211  C  C     . CYS A 1 284 ? 7.977   -4.543  -24.782  1.00 95.94  ? 284 CYS A C     1 
ATOM   2212  O  O     . CYS A 1 284 ? 7.051   -5.365  -24.999  1.00 100.53 ? 284 CYS A O     1 
ATOM   2213  C  CB    . CYS A 1 284 ? 9.386   -4.627  -22.851  1.00 87.51  ? 284 CYS A CB    1 
ATOM   2214  S  SG    . CYS A 1 284 ? 9.838   -4.239  -21.164  1.00 107.95 ? 284 CYS A SG    1 
ATOM   2215  N  N     . ASP A 1 285 ? 8.856   -4.154  -25.718  1.00 120.36 ? 285 ASP A N     1 
ATOM   2216  C  CA    . ASP A 1 285 ? 8.746   -4.583  -27.097  1.00 144.94 ? 285 ASP A CA    1 
ATOM   2217  C  C     . ASP A 1 285 ? 8.947   -6.089  -27.149  1.00 126.43 ? 285 ASP A C     1 
ATOM   2218  O  O     . ASP A 1 285 ? 9.655   -6.665  -26.297  1.00 130.60 ? 285 ASP A O     1 
ATOM   2219  C  CB    . ASP A 1 285 ? 9.743   -3.819  -28.020  1.00 167.08 ? 285 ASP A CB    1 
ATOM   2220  C  CG    . ASP A 1 285 ? 9.267   -2.395  -28.337  1.00 173.28 ? 285 ASP A CG    1 
ATOM   2221  O  OD1   . ASP A 1 285 ? 8.449   -1.854  -27.550  1.00 167.49 ? 285 ASP A OD1   1 
ATOM   2222  O  OD2   . ASP A 1 285 ? 9.717   -1.807  -29.360  1.00 161.46 ? 285 ASP A OD2   1 
ATOM   2223  N  N     . VAL A 1 286 ? 8.317   -6.710  -28.129  1.00 112.57 ? 286 VAL A N     1 
ATOM   2224  C  CA    . VAL A 1 286 ? 8.270   -8.148  -28.210  1.00 109.85 ? 286 VAL A CA    1 
ATOM   2225  C  C     . VAL A 1 286 ? 9.655   -8.695  -28.373  1.00 115.85 ? 286 VAL A C     1 
ATOM   2226  O  O     . VAL A 1 286 ? 9.956   -9.746  -27.867  1.00 123.64 ? 286 VAL A O     1 
ATOM   2227  C  CB    . VAL A 1 286 ? 7.389   -8.654  -29.336  1.00 120.39 ? 286 VAL A CB    1 
ATOM   2228  C  CG1   . VAL A 1 286 ? 5.941   -8.154  -29.138  1.00 144.12 ? 286 VAL A CG1   1 
ATOM   2229  C  CG2   . VAL A 1 286 ? 7.966   -8.340  -30.733  1.00 114.16 ? 286 VAL A CG2   1 
ATOM   2230  N  N     . ASP A 1 287 ? 10.509  -7.981  -29.106  1.00 120.71 ? 287 ASP A N     1 
ATOM   2231  C  CA    . ASP A 1 287 ? 11.813  -8.458  -29.460  1.00 128.26 ? 287 ASP A CA    1 
ATOM   2232  C  C     . ASP A 1 287 ? 12.720  -8.769  -28.277  1.00 114.19 ? 287 ASP A C     1 
ATOM   2233  O  O     . ASP A 1 287 ? 13.346  -9.834  -28.285  1.00 105.83 ? 287 ASP A O     1 
ATOM   2234  C  CB    . ASP A 1 287 ? 12.506  -7.435  -30.427  1.00 135.09 ? 287 ASP A CB    1 
ATOM   2235  C  CG    . ASP A 1 287 ? 13.884  -7.892  -30.892  1.00 163.53 ? 287 ASP A CG    1 
ATOM   2236  O  OD1   . ASP A 1 287 ? 13.941  -8.924  -31.598  1.00 169.10 ? 287 ASP A OD1   1 
ATOM   2237  O  OD2   . ASP A 1 287 ? 14.913  -7.208  -30.593  1.00 190.91 ? 287 ASP A OD2   1 
ATOM   2238  N  N     . ILE A 1 288 ? 12.837  -7.819  -27.341  1.00 110.15 ? 288 ILE A N     1 
ATOM   2239  C  CA    . ILE A 1 288 ? 13.794  -7.891  -26.240  1.00 111.27 ? 288 ILE A CA    1 
ATOM   2240  C  C     . ILE A 1 288 ? 13.405  -8.833  -25.128  1.00 90.50  ? 288 ILE A C     1 
ATOM   2241  O  O     . ILE A 1 288 ? 14.286  -9.287  -24.398  1.00 81.87  ? 288 ILE A O     1 
ATOM   2242  C  CB    . ILE A 1 288 ? 14.123  -6.541  -25.616  1.00 107.88 ? 288 ILE A CB    1 
ATOM   2243  C  CG1   . ILE A 1 288 ? 12.892  -5.901  -24.956  1.00 96.75  ? 288 ILE A CG1   1 
ATOM   2244  C  CG2   . ILE A 1 288 ? 14.783  -5.693  -26.685  1.00 118.35 ? 288 ILE A CG2   1 
ATOM   2245  C  CD1   . ILE A 1 288 ? 13.243  -4.711  -24.087  1.00 106.54 ? 288 ILE A CD1   1 
ATOM   2246  N  N     . ARG A 1 289 ? 12.116  -9.143  -24.980  1.00 83.11  ? 289 ARG A N     1 
ATOM   2247  C  CA    . ARG A 1 289 ? 11.659  -9.903  -23.835  1.00 93.05  ? 289 ARG A CA    1 
ATOM   2248  C  C     . ARG A 1 289 ? 12.510  -11.098 -23.547  1.00 109.13 ? 289 ARG A C     1 
ATOM   2249  O  O     . ARG A 1 289 ? 12.660  -11.438 -22.386  1.00 125.83 ? 289 ARG A O     1 
ATOM   2250  C  CB    . ARG A 1 289 ? 10.209  -10.382 -24.024  1.00 97.80  ? 289 ARG A CB    1 
ATOM   2251  C  CG    . ARG A 1 289 ? 9.194   -9.229  -23.952  1.00 101.31 ? 289 ARG A CG    1 
ATOM   2252  C  CD    . ARG A 1 289 ? 7.730   -9.697  -23.807  1.00 102.85 ? 289 ARG A CD    1 
ATOM   2253  N  NE    . ARG A 1 289 ? 6.828   -8.556  -23.984  1.00 103.29 ? 289 ARG A NE    1 
ATOM   2254  C  CZ    . ARG A 1 289 ? 5.863   -8.456  -24.894  1.00 91.71  ? 289 ARG A CZ    1 
ATOM   2255  N  NH1   . ARG A 1 289 ? 5.723   -9.431  -25.758  1.00 90.35  ? 289 ARG A NH1   1 
ATOM   2256  N  NH2   . ARG A 1 289 ? 5.106   -7.359  -25.038  1.00 92.71  ? 289 ARG A NH2   1 
ATOM   2257  N  N     . LYS A 1 290 ? 13.060  -11.747 -24.568  1.00 116.49 ? 290 LYS A N     1 
ATOM   2258  C  CA    . LYS A 1 290 ? 13.716  -13.035 -24.382  1.00 136.41 ? 290 LYS A CA    1 
ATOM   2259  C  C     . LYS A 1 290 ? 14.779  -12.891 -23.331  1.00 131.36 ? 290 LYS A C     1 
ATOM   2260  O  O     . LYS A 1 290 ? 14.879  -13.741 -22.448  1.00 147.52 ? 290 LYS A O     1 
ATOM   2261  C  CB    . LYS A 1 290 ? 14.338  -13.590 -25.662  1.00 173.30 ? 290 LYS A CB    1 
ATOM   2262  C  CG    . LYS A 1 290 ? 15.481  -12.774 -26.298  1.00 216.37 ? 290 LYS A CG    1 
ATOM   2263  C  CD    . LYS A 1 290 ? 15.937  -13.268 -27.690  1.00 244.62 ? 290 LYS A CD    1 
ATOM   2264  C  CE    . LYS A 1 290 ? 17.095  -12.442 -28.267  1.00 268.17 ? 290 LYS A CE    1 
ATOM   2265  N  NZ    . LYS A 1 290 ? 16.727  -11.029 -28.588  1.00 282.06 ? 290 LYS A NZ    1 
ATOM   2266  N  N     . ASP A 1 291 ? 15.570  -11.833 -23.405  1.00 119.68 ? 291 ASP A N     1 
ATOM   2267  C  CA    . ASP A 1 291 ? 16.671  -11.668 -22.482  1.00 118.39 ? 291 ASP A CA    1 
ATOM   2268  C  C     . ASP A 1 291 ? 16.239  -11.095 -21.155  1.00 103.59 ? 291 ASP A C     1 
ATOM   2269  O  O     . ASP A 1 291 ? 16.826  -11.423 -20.164  1.00 87.15  ? 291 ASP A O     1 
ATOM   2270  C  CB    . ASP A 1 291 ? 17.830  -10.935 -23.122  1.00 124.58 ? 291 ASP A CB    1 
ATOM   2271  C  CG    . ASP A 1 291 ? 17.549  -9.527  -23.359  1.00 126.95 ? 291 ASP A CG    1 
ATOM   2272  O  OD1   . ASP A 1 291 ? 16.404  -9.093  -23.123  1.00 138.83 ? 291 ASP A OD1   1 
ATOM   2273  O  OD2   . ASP A 1 291 ? 18.486  -8.879  -23.813  1.00 141.62 ? 291 ASP A OD2   1 
ATOM   2274  N  N     . LEU A 1 292 ? 15.140  -10.324 -21.131  1.00 98.61  ? 292 LEU A N     1 
ATOM   2275  C  CA    . LEU A 1 292 ? 14.621  -9.869  -19.859  1.00 89.95  ? 292 LEU A CA    1 
ATOM   2276  C  C     . LEU A 1 292 ? 14.117  -10.974 -19.004  1.00 82.67  ? 292 LEU A C     1 
ATOM   2277  O  O     . LEU A 1 292 ? 14.388  -11.021 -17.829  1.00 88.46  ? 292 LEU A O     1 
ATOM   2278  C  CB    . LEU A 1 292 ? 13.469  -8.856  -20.045  1.00 86.99  ? 292 LEU A CB    1 
ATOM   2279  C  CG    . LEU A 1 292 ? 13.982  -7.511  -20.605  1.00 89.99  ? 292 LEU A CG    1 
ATOM   2280  C  CD1   . LEU A 1 292 ? 12.832  -6.511  -20.811  1.00 84.37  ? 292 LEU A CD1   1 
ATOM   2281  C  CD2   . LEU A 1 292 ? 15.107  -6.941  -19.705  1.00 91.18  ? 292 LEU A CD2   1 
ATOM   2282  N  N     . TYR A 1 293 ? 13.467  -11.981 -19.605  1.00 84.59  ? 293 TYR A N     1 
ATOM   2283  C  CA    . TYR A 1 293 ? 13.040  -13.174 -18.893  1.00 98.04  ? 293 TYR A CA    1 
ATOM   2284  C  C     . TYR A 1 293 ? 14.285  -13.844 -18.310  1.00 99.02  ? 293 TYR A C     1 
ATOM   2285  O  O     . TYR A 1 293 ? 14.232  -14.381 -17.207  1.00 108.43 ? 293 TYR A O     1 
ATOM   2286  C  CB    . TYR A 1 293 ? 12.359  -14.182 -19.752  1.00 105.84 ? 293 TYR A CB    1 
ATOM   2287  C  CG    . TYR A 1 293 ? 10.951  -13.807 -20.015  1.00 111.51 ? 293 TYR A CG    1 
ATOM   2288  C  CD1   . TYR A 1 293 ? 10.003  -13.915 -19.009  1.00 109.11 ? 293 TYR A CD1   1 
ATOM   2289  C  CD2   . TYR A 1 293 ? 10.542  -13.369 -21.252  1.00 113.09 ? 293 TYR A CD2   1 
ATOM   2290  C  CE1   . TYR A 1 293 ? 8.682   -13.609 -19.239  1.00 113.86 ? 293 TYR A CE1   1 
ATOM   2291  C  CE2   . TYR A 1 293 ? 9.209   -13.108 -21.508  1.00 124.52 ? 293 TYR A CE2   1 
ATOM   2292  C  CZ    . TYR A 1 293 ? 8.275   -13.243 -20.491  1.00 135.90 ? 293 TYR A CZ    1 
ATOM   2293  O  OH    . TYR A 1 293 ? 6.935   -12.903 -20.752  1.00 160.48 ? 293 TYR A OH    1 
ATOM   2294  N  N     . ALA A 1 294 ? 15.365  -13.863 -19.087  1.00 86.09  ? 294 ALA A N     1 
ATOM   2295  C  CA    . ALA A 1 294 ? 16.574  -14.484 -18.657  1.00 83.88  ? 294 ALA A CA    1 
ATOM   2296  C  C     . ALA A 1 294 ? 17.427  -13.621 -17.838  1.00 67.46  ? 294 ALA A C     1 
ATOM   2297  O  O     . ALA A 1 294 ? 18.342  -14.170 -17.232  1.00 91.53  ? 294 ALA A O     1 
ATOM   2298  C  CB    . ALA A 1 294 ? 17.359  -15.043 -19.833  1.00 104.53 ? 294 ALA A CB    1 
ATOM   2299  N  N     . ASN A 1 295 ? 17.222  -12.319 -17.770  1.00 62.56  ? 295 ASN A N     1 
ATOM   2300  C  CA    . ASN A 1 295 ? 18.206  -11.518 -16.991  1.00 72.58  ? 295 ASN A CA    1 
ATOM   2301  C  C     . ASN A 1 295 ? 17.691  -10.721 -15.791  1.00 59.47  ? 295 ASN A C     1 
ATOM   2302  O  O     . ASN A 1 295 ? 18.211  -9.671  -15.474  1.00 49.17  ? 295 ASN A O     1 
ATOM   2303  C  CB    . ASN A 1 295 ? 19.013  -10.559 -17.898  1.00 88.58  ? 295 ASN A CB    1 
ATOM   2304  C  CG    . ASN A 1 295 ? 19.572  -11.262 -19.166  1.00 90.00  ? 295 ASN A CG    1 
ATOM   2305  O  OD1   . ASN A 1 295 ? 19.546  -10.665 -20.235  1.00 105.10 ? 295 ASN A OD1   1 
ATOM   2306  N  ND2   . ASN A 1 295 ? 20.089  -12.481 -19.053  1.00 81.04  ? 295 ASN A ND2   1 
ATOM   2307  N  N     . THR A 1 296 ? 16.774  -11.279 -15.054  1.00 57.62  ? 296 THR A N     1 
ATOM   2308  C  CA    . THR A 1 296 ? 16.106  -10.537 -14.007  1.00 60.72  ? 296 THR A CA    1 
ATOM   2309  C  C     . THR A 1 296 ? 17.062  -10.361 -12.874  1.00 59.13  ? 296 THR A C     1 
ATOM   2310  O  O     . THR A 1 296 ? 17.584  -11.353 -12.331  1.00 64.96  ? 296 THR A O     1 
ATOM   2311  C  CB    . THR A 1 296 ? 14.910  -11.391 -13.521  1.00 72.72  ? 296 THR A CB    1 
ATOM   2312  O  OG1   . THR A 1 296 ? 13.923  -11.492 -14.557  1.00 75.77  ? 296 THR A OG1   1 
ATOM   2313  C  CG2   . THR A 1 296 ? 14.214  -10.823 -12.269  1.00 74.34  ? 296 THR A CG2   1 
ATOM   2314  N  N     . VAL A 1 297 ? 17.305  -9.122  -12.454  1.00 62.06  ? 297 VAL A N     1 
ATOM   2315  C  CA    . VAL A 1 297 ? 18.218  -8.897  -11.347  1.00 70.34  ? 297 VAL A CA    1 
ATOM   2316  C  C     . VAL A 1 297 ? 17.492  -8.441  -10.158  1.00 58.61  ? 297 VAL A C     1 
ATOM   2317  O  O     . VAL A 1 297 ? 16.749  -7.488  -10.253  1.00 66.46  ? 297 VAL A O     1 
ATOM   2318  C  CB    . VAL A 1 297 ? 19.206  -7.802  -11.702  1.00 91.84  ? 297 VAL A CB    1 
ATOM   2319  C  CG1   . VAL A 1 297 ? 19.972  -7.333  -10.466  1.00 109.93 ? 297 VAL A CG1   1 
ATOM   2320  C  CG2   . VAL A 1 297 ? 20.071  -8.344  -12.828  1.00 97.55  ? 297 VAL A CG2   1 
ATOM   2321  N  N     . LEU A 1 298 ? 17.755  -9.041  -9.003   1.00 57.95  ? 298 LEU A N     1 
ATOM   2322  C  CA    . LEU A 1 298 ? 17.086  -8.624  -7.758   1.00 63.81  ? 298 LEU A CA    1 
ATOM   2323  C  C     . LEU A 1 298 ? 18.058  -7.732  -7.016   1.00 64.19  ? 298 LEU A C     1 
ATOM   2324  O  O     . LEU A 1 298 ? 19.262  -8.011  -6.947   1.00 66.78  ? 298 LEU A O     1 
ATOM   2325  C  CB    . LEU A 1 298 ? 16.783  -9.779  -6.818   1.00 71.86  ? 298 LEU A CB    1 
ATOM   2326  C  CG    . LEU A 1 298 ? 15.777  -10.814 -7.302   1.00 87.22  ? 298 LEU A CG    1 
ATOM   2327  C  CD1   . LEU A 1 298 ? 15.544  -11.923 -6.246   1.00 104.69 ? 298 LEU A CD1   1 
ATOM   2328  C  CD2   . LEU A 1 298 ? 14.472  -10.183 -7.771   1.00 84.31  ? 298 LEU A CD2   1 
ATOM   2329  N  N     . SER A 1 299 ? 17.524  -6.662  -6.430   1.00 72.91  ? 299 SER A N     1 
ATOM   2330  C  CA    . SER A 1 299 ? 18.314  -5.810  -5.593   1.00 90.87  ? 299 SER A CA    1 
ATOM   2331  C  C     . SER A 1 299 ? 17.564  -5.371  -4.354   1.00 91.98  ? 299 SER A C     1 
ATOM   2332  O  O     . SER A 1 299 ? 16.377  -5.603  -4.254   1.00 124.17 ? 299 SER A O     1 
ATOM   2333  C  CB    . SER A 1 299 ? 18.754  -4.568  -6.346   1.00 107.30 ? 299 SER A CB    1 
ATOM   2334  O  OG    . SER A 1 299 ? 17.754  -3.546  -6.294   1.00 103.49 ? 299 SER A OG    1 
ATOM   2335  N  N     . GLY A 1 300 ? 18.271  -4.736  -3.440   1.00 88.99  ? 300 GLY A N     1 
ATOM   2336  C  CA    . GLY A 1 300 ? 17.624  -4.076  -2.319   1.00 101.71 ? 300 GLY A CA    1 
ATOM   2337  C  C     . GLY A 1 300 ? 17.489  -5.032  -1.147   1.00 105.29 ? 300 GLY A C     1 
ATOM   2338  O  O     . GLY A 1 300 ? 17.646  -6.250  -1.270   1.00 86.94  ? 300 GLY A O     1 
ATOM   2339  N  N     . GLY A 1 301 ? 17.201  -4.454  0.012    1.00 112.89 ? 301 GLY A N     1 
ATOM   2340  C  CA    . GLY A 1 301 ? 17.331  -5.193  1.274    1.00 115.14 ? 301 GLY A CA    1 
ATOM   2341  C  C     . GLY A 1 301 ? 16.293  -6.288  1.345    1.00 102.17 ? 301 GLY A C     1 
ATOM   2342  O  O     . GLY A 1 301 ? 16.554  -7.344  1.897    1.00 95.94  ? 301 GLY A O     1 
ATOM   2343  N  N     . THR A 1 302 ? 15.091  -5.973  0.834    1.00 95.88  ? 302 THR A N     1 
ATOM   2344  C  CA    . THR A 1 302 ? 13.940  -6.848  1.060    1.00 97.69  ? 302 THR A CA    1 
ATOM   2345  C  C     . THR A 1 302 ? 13.872  -7.911  -0.028   1.00 84.30  ? 302 THR A C     1 
ATOM   2346  O  O     . THR A 1 302 ? 12.849  -8.553  -0.144   1.00 75.52  ? 302 THR A O     1 
ATOM   2347  C  CB    . THR A 1 302 ? 12.579  -6.148  1.282    1.00 98.74  ? 302 THR A CB    1 
ATOM   2348  O  OG1   . THR A 1 302 ? 11.676  -7.144  1.804    1.00 90.86  ? 302 THR A OG1   1 
ATOM   2349  C  CG2   . THR A 1 302 ? 12.013  -5.559  0.002    1.00 107.71 ? 302 THR A CG2   1 
ATOM   2350  N  N     . THR A 1 303 ? 14.943  -8.108  -0.798   1.00 76.83  ? 303 THR A N     1 
ATOM   2351  C  CA    . THR A 1 303 ? 15.102  -9.342  -1.541   1.00 88.39  ? 303 THR A CA    1 
ATOM   2352  C  C     . THR A 1 303 ? 15.996  -10.341 -0.842   1.00 97.62  ? 303 THR A C     1 
ATOM   2353  O  O     . THR A 1 303 ? 16.188  -11.432 -1.371   1.00 102.58 ? 303 THR A O     1 
ATOM   2354  C  CB    . THR A 1 303 ? 15.635  -9.082  -2.928   1.00 92.99  ? 303 THR A CB    1 
ATOM   2355  O  OG1   . THR A 1 303 ? 16.660  -8.086  -2.852   1.00 105.81 ? 303 THR A OG1   1 
ATOM   2356  C  CG2   . THR A 1 303 ? 14.487  -8.582  -3.814   1.00 95.45  ? 303 THR A CG2   1 
ATOM   2357  N  N     . MET A 1 304 ? 16.532  -10.000 0.335    1.00 102.25 ? 304 MET A N     1 
ATOM   2358  C  CA    . MET A 1 304 ? 17.480  -10.845 1.046    1.00 124.10 ? 304 MET A CA    1 
ATOM   2359  C  C     . MET A 1 304 ? 16.903  -12.180 1.518    1.00 103.03 ? 304 MET A C     1 
ATOM   2360  O  O     . MET A 1 304 ? 17.662  -13.133 1.697    1.00 95.28  ? 304 MET A O     1 
ATOM   2361  C  CB    . MET A 1 304 ? 18.177  -10.108 2.211    1.00 154.53 ? 304 MET A CB    1 
ATOM   2362  C  CG    . MET A 1 304 ? 19.179  -9.063  1.720    1.00 162.78 ? 304 MET A CG    1 
ATOM   2363  S  SD    . MET A 1 304 ? 20.566  -9.784  0.786    1.00 160.81 ? 304 MET A SD    1 
ATOM   2364  C  CE    . MET A 1 304 ? 21.499  -10.619 2.075    1.00 160.57 ? 304 MET A CE    1 
ATOM   2365  N  N     . TYR A 1 305 ? 15.607  -12.274 1.754    1.00 88.14  ? 305 TYR A N     1 
ATOM   2366  C  CA    . TYR A 1 305 ? 15.025  -13.475 2.342    1.00 86.58  ? 305 TYR A CA    1 
ATOM   2367  C  C     . TYR A 1 305 ? 15.419  -14.725 1.621    1.00 88.45  ? 305 TYR A C     1 
ATOM   2368  O  O     . TYR A 1 305 ? 15.354  -14.798 0.390    1.00 105.62 ? 305 TYR A O     1 
ATOM   2369  C  CB    . TYR A 1 305 ? 13.479  -13.485 2.354    1.00 93.83  ? 305 TYR A CB    1 
ATOM   2370  C  CG    . TYR A 1 305 ? 12.824  -12.332 3.027    1.00 109.03 ? 305 TYR A CG    1 
ATOM   2371  C  CD1   . TYR A 1 305 ? 13.269  -11.890 4.243    1.00 110.90 ? 305 TYR A CD1   1 
ATOM   2372  C  CD2   . TYR A 1 305 ? 11.735  -11.695 2.449    1.00 127.48 ? 305 TYR A CD2   1 
ATOM   2373  C  CE1   . TYR A 1 305 ? 12.682  -10.817 4.872    1.00 110.45 ? 305 TYR A CE1   1 
ATOM   2374  C  CE2   . TYR A 1 305 ? 11.134  -10.631 3.074    1.00 127.28 ? 305 TYR A CE2   1 
ATOM   2375  C  CZ    . TYR A 1 305 ? 11.632  -10.174 4.286    1.00 113.06 ? 305 TYR A CZ    1 
ATOM   2376  O  OH    . TYR A 1 305 ? 10.999  -9.090  4.919    1.00 105.93 ? 305 TYR A OH    1 
ATOM   2377  N  N     . PRO A 1 306 ? 15.816  -15.730 2.387    1.00 97.27  ? 306 PRO A N     1 
ATOM   2378  C  CA    . PRO A 1 306 ? 16.126  -16.994 1.726    1.00 110.14 ? 306 PRO A CA    1 
ATOM   2379  C  C     . PRO A 1 306 ? 14.939  -17.551 0.943    1.00 112.83 ? 306 PRO A C     1 
ATOM   2380  O  O     . PRO A 1 306 ? 13.791  -17.580 1.419    1.00 97.83  ? 306 PRO A O     1 
ATOM   2381  C  CB    . PRO A 1 306 ? 16.526  -17.926 2.866    1.00 116.09 ? 306 PRO A CB    1 
ATOM   2382  C  CG    . PRO A 1 306 ? 17.062  -16.993 3.870    1.00 118.25 ? 306 PRO A CG    1 
ATOM   2383  C  CD    . PRO A 1 306 ? 16.225  -15.767 3.800    1.00 107.28 ? 306 PRO A CD    1 
ATOM   2384  N  N     . GLY A 1 307 ? 15.243  -17.988 -0.270   1.00 114.65 ? 307 GLY A N     1 
ATOM   2385  C  CA    . GLY A 1 307 ? 14.260  -18.642 -1.110   1.00 120.11 ? 307 GLY A CA    1 
ATOM   2386  C  C     . GLY A 1 307 ? 13.391  -17.779 -2.015   1.00 101.50 ? 307 GLY A C     1 
ATOM   2387  O  O     . GLY A 1 307 ? 12.571  -18.291 -2.790   1.00 102.71 ? 307 GLY A O     1 
ATOM   2388  N  N     . ILE A 1 308 ? 13.596  -16.468 -1.985   1.00 89.56  ? 308 ILE A N     1 
ATOM   2389  C  CA    . ILE A 1 308 ? 12.845  -15.583 -2.833   1.00 98.59  ? 308 ILE A CA    1 
ATOM   2390  C  C     . ILE A 1 308 ? 13.094  -15.828 -4.284   1.00 101.05 ? 308 ILE A C     1 
ATOM   2391  O  O     . ILE A 1 308 ? 12.151  -15.850 -5.083   1.00 126.45 ? 308 ILE A O     1 
ATOM   2392  C  CB    . ILE A 1 308 ? 13.240  -14.111 -2.643   1.00 105.48 ? 308 ILE A CB    1 
ATOM   2393  C  CG1   . ILE A 1 308 ? 12.684  -13.579 -1.337   1.00 123.82 ? 308 ILE A CG1   1 
ATOM   2394  C  CG2   . ILE A 1 308 ? 12.624  -13.268 -3.722   1.00 96.71  ? 308 ILE A CG2   1 
ATOM   2395  C  CD1   . ILE A 1 308 ? 13.292  -12.300 -0.848   1.00 144.68 ? 308 ILE A CD1   1 
ATOM   2396  N  N     . ALA A 1 309 ? 14.370  -15.982 -4.655   1.00 92.09  ? 309 ALA A N     1 
ATOM   2397  C  CA    . ALA A 1 309 ? 14.786  -16.196 -6.036   1.00 98.01  ? 309 ALA A CA    1 
ATOM   2398  C  C     . ALA A 1 309 ? 14.056  -17.397 -6.584   1.00 85.14  ? 309 ALA A C     1 
ATOM   2399  O  O     . ALA A 1 309 ? 13.538  -17.367 -7.675   1.00 82.19  ? 309 ALA A O     1 
ATOM   2400  C  CB    . ALA A 1 309 ? 16.303  -16.379 -6.130   1.00 128.94 ? 309 ALA A CB    1 
ATOM   2401  N  N     . ASP A 1 310 ? 14.081  -18.496 -5.823   1.00 93.28  ? 310 ASP A N     1 
ATOM   2402  C  CA    . ASP A 1 310 ? 13.522  -19.744 -6.277   1.00 111.32 ? 310 ASP A CA    1 
ATOM   2403  C  C     . ASP A 1 310 ? 12.037  -19.569 -6.521   1.00 99.84  ? 310 ASP A C     1 
ATOM   2404  O  O     . ASP A 1 310 ? 11.506  -20.038 -7.533   1.00 118.12 ? 310 ASP A O     1 
ATOM   2405  C  CB    . ASP A 1 310 ? 13.701  -20.864 -5.271   1.00 129.04 ? 310 ASP A CB    1 
ATOM   2406  C  CG    . ASP A 1 310 ? 15.170  -21.198 -5.088   1.00 140.37 ? 310 ASP A CG    1 
ATOM   2407  O  OD1   . ASP A 1 310 ? 15.913  -21.093 -6.088   1.00 121.35 ? 310 ASP A OD1   1 
ATOM   2408  O  OD2   . ASP A 1 310 ? 15.585  -21.544 -3.957   1.00 158.28 ? 310 ASP A OD2   1 
ATOM   2409  N  N     . ARG A 1 311 ? 11.357  -18.896 -5.591   1.00 79.24  ? 311 ARG A N     1 
ATOM   2410  C  CA    . ARG A 1 311 ? 9.908   -18.744 -5.752   1.00 83.45  ? 311 ARG A CA    1 
ATOM   2411  C  C     . ARG A 1 311 ? 9.597   -17.908 -6.977   1.00 82.25  ? 311 ARG A C     1 
ATOM   2412  O  O     . ARG A 1 311 ? 8.683   -18.238 -7.741   1.00 93.61  ? 311 ARG A O     1 
ATOM   2413  C  CB    . ARG A 1 311 ? 9.228   -18.174 -4.515   1.00 85.64  ? 311 ARG A CB    1 
ATOM   2414  C  CG    . ARG A 1 311 ? 7.698   -18.214 -4.603   1.00 89.92  ? 311 ARG A CG    1 
ATOM   2415  C  CD    . ARG A 1 311 ? 6.990   -17.743 -3.330   1.00 105.60 ? 311 ARG A CD    1 
ATOM   2416  N  NE    . ARG A 1 311 ? 5.573   -17.475 -3.590   1.00 116.60 ? 311 ARG A NE    1 
ATOM   2417  C  CZ    . ARG A 1 311 ? 4.645   -18.422 -3.729   1.00 127.03 ? 311 ARG A CZ    1 
ATOM   2418  N  NH1   . ARG A 1 311 ? 4.991   -19.699 -3.602   1.00 128.87 ? 311 ARG A NH1   1 
ATOM   2419  N  NH2   . ARG A 1 311 ? 3.346   -18.095 -3.959   1.00 130.22 ? 311 ARG A NH2   1 
ATOM   2420  N  N     . MET A 1 312 ? 10.372  -16.831 -7.151   1.00 78.69  ? 312 MET A N     1 
ATOM   2421  C  CA    . MET A 1 312 ? 10.165  -15.988 -8.338   1.00 77.21  ? 312 MET A CA    1 
ATOM   2422  C  C     . MET A 1 312 ? 10.385  -16.767 -9.586   1.00 75.16  ? 312 MET A C     1 
ATOM   2423  O  O     . MET A 1 312 ? 9.612   -16.578 -10.548  1.00 69.19  ? 312 MET A O     1 
ATOM   2424  C  CB    . MET A 1 312 ? 11.098  -14.769 -8.368   1.00 92.22  ? 312 MET A CB    1 
ATOM   2425  C  CG    . MET A 1 312 ? 10.790  -13.706 -7.335   1.00 101.77 ? 312 MET A CG    1 
ATOM   2426  S  SD    . MET A 1 312 ? 9.334   -12.801 -7.857   1.00 116.96 ? 312 MET A SD    1 
ATOM   2427  C  CE    . MET A 1 312 ? 10.033  -11.832 -9.195   1.00 97.84  ? 312 MET A CE    1 
ATOM   2428  N  N     . GLN A 1 313 ? 11.375  -17.665 -9.596   1.00 88.04  ? 313 GLN A N     1 
ATOM   2429  C  CA    . GLN A 1 313 ? 11.681  -18.482 -10.743  1.00 95.04  ? 313 GLN A CA    1 
ATOM   2430  C  C     . GLN A 1 313 ? 10.506  -19.367 -11.049  1.00 94.91  ? 313 GLN A C     1 
ATOM   2431  O  O     . GLN A 1 313 ? 10.123  -19.490 -12.212  1.00 108.02 ? 313 GLN A O     1 
ATOM   2432  C  CB    . GLN A 1 313 ? 12.915  -19.352 -10.562  1.00 91.84  ? 313 GLN A CB    1 
ATOM   2433  C  CG    . GLN A 1 313 ? 13.407  -20.038 -11.827  1.00 100.24 ? 313 GLN A CG    1 
ATOM   2434  C  CD    . GLN A 1 313 ? 14.892  -20.284 -11.773  1.00 124.17 ? 313 GLN A CD    1 
ATOM   2435  O  OE1   . GLN A 1 313 ? 15.553  -19.791 -10.871  1.00 128.78 ? 313 GLN A OE1   1 
ATOM   2436  N  NE2   . GLN A 1 313 ? 15.431  -21.037 -12.742  1.00 144.00 ? 313 GLN A NE2   1 
ATOM   2437  N  N     . LYS A 1 314 ? 9.972   -20.024 -10.011  1.00 81.79  ? 314 LYS A N     1 
ATOM   2438  C  CA    . LYS A 1 314 ? 8.893   -20.971 -10.228  1.00 84.62  ? 314 LYS A CA    1 
ATOM   2439  C  C     . LYS A 1 314 ? 7.667   -20.236 -10.735  1.00 76.21  ? 314 LYS A C     1 
ATOM   2440  O  O     . LYS A 1 314 ? 7.015   -20.742 -11.709  1.00 80.88  ? 314 LYS A O     1 
ATOM   2441  C  CB    . LYS A 1 314 ? 8.586   -21.874 -9.036   1.00 116.52 ? 314 LYS A CB    1 
ATOM   2442  C  CG    . LYS A 1 314 ? 7.685   -21.281 -7.978   1.00 140.37 ? 314 LYS A CG    1 
ATOM   2443  C  CD    . LYS A 1 314 ? 7.168   -22.291 -6.944   1.00 155.18 ? 314 LYS A CD    1 
ATOM   2444  C  CE    . LYS A 1 314 ? 6.191   -21.612 -5.985   1.00 169.20 ? 314 LYS A CE    1 
ATOM   2445  N  NZ    . LYS A 1 314 ? 4.922   -21.165 -6.625   1.00 171.70 ? 314 LYS A NZ    1 
ATOM   2446  N  N     . GLU A 1 315 ? 7.394   -19.033 -10.226  1.00 87.40  ? 315 GLU A N     1 
ATOM   2447  C  CA    . GLU A 1 315 ? 6.170   -18.355 -10.599  1.00 102.26 ? 315 GLU A CA    1 
ATOM   2448  C  C     . GLU A 1 315 ? 6.259   -17.768 -11.992  1.00 100.83 ? 315 GLU A C     1 
ATOM   2449  O  O     . GLU A 1 315 ? 5.340   -17.959 -12.790  1.00 110.95 ? 315 GLU A O     1 
ATOM   2450  C  CB    . GLU A 1 315 ? 5.841   -17.255 -9.627   1.00 106.66 ? 315 GLU A CB    1 
ATOM   2451  C  CG    . GLU A 1 315 ? 5.478   -17.753 -8.232   1.00 140.76 ? 315 GLU A CG    1 
ATOM   2452  C  CD    . GLU A 1 315 ? 5.475   -16.620 -7.244   1.00 168.18 ? 315 GLU A CD    1 
ATOM   2453  O  OE1   . GLU A 1 315 ? 6.127   -15.615 -7.576   1.00 177.07 ? 315 GLU A OE1   1 
ATOM   2454  O  OE2   . GLU A 1 315 ? 4.845   -16.728 -6.161   1.00 182.84 ? 315 GLU A OE2   1 
ATOM   2455  N  N     . ILE A 1 316 ? 7.386   -17.143 -12.309  1.00 94.11  ? 316 ILE A N     1 
ATOM   2456  C  CA    . ILE A 1 316 ? 7.564   -16.550 -13.595  1.00 89.40  ? 316 ILE A CA    1 
ATOM   2457  C  C     . ILE A 1 316 ? 7.551   -17.672 -14.663  1.00 84.45  ? 316 ILE A C     1 
ATOM   2458  O  O     . ILE A 1 316 ? 6.834   -17.556 -15.672  1.00 76.17  ? 316 ILE A O     1 
ATOM   2459  C  CB    . ILE A 1 316 ? 8.760   -15.558 -13.628  1.00 96.82  ? 316 ILE A CB    1 
ATOM   2460  C  CG1   . ILE A 1 316 ? 8.362   -14.276 -12.870  1.00 98.46  ? 316 ILE A CG1   1 
ATOM   2461  C  CG2   . ILE A 1 316 ? 9.173   -15.302 -15.078  1.00 112.24 ? 316 ILE A CG2   1 
ATOM   2462  C  CD1   . ILE A 1 316 ? 9.433   -13.223 -12.803  1.00 112.75 ? 316 ILE A CD1   1 
ATOM   2463  N  N     . THR A 1 317 ? 8.309   -18.721 -14.454  1.00 90.14  ? 317 THR A N     1 
ATOM   2464  C  CA    . THR A 1 317 ? 8.334   -19.826 -15.370  1.00 107.17 ? 317 THR A CA    1 
ATOM   2465  C  C     . THR A 1 317 ? 6.928   -20.361 -15.577  1.00 109.90 ? 317 THR A C     1 
ATOM   2466  O  O     . THR A 1 317 ? 6.547   -20.739 -16.687  1.00 119.44 ? 317 THR A O     1 
ATOM   2467  C  CB    . THR A 1 317 ? 9.207   -20.975 -14.832  1.00 127.26 ? 317 THR A CB    1 
ATOM   2468  O  OG1   . THR A 1 317 ? 10.536  -20.498 -14.549  1.00 123.76 ? 317 THR A OG1   1 
ATOM   2469  C  CG2   . THR A 1 317 ? 9.271   -22.095 -15.838  1.00 136.04 ? 317 THR A CG2   1 
ATOM   2470  N  N     . ALA A 1 318 ? 6.157   -20.466 -14.500  1.00 106.35 ? 318 ALA A N     1 
ATOM   2471  C  CA    . ALA A 1 318 ? 4.804   -20.989 -14.584  1.00 103.94 ? 318 ALA A CA    1 
ATOM   2472  C  C     . ALA A 1 318 ? 3.941   -20.121 -15.469  1.00 105.12 ? 318 ALA A C     1 
ATOM   2473  O  O     . ALA A 1 318 ? 3.217   -20.632 -16.333  1.00 104.54 ? 318 ALA A O     1 
ATOM   2474  C  CB    . ALA A 1 318 ? 4.145   -21.112 -13.203  1.00 102.91 ? 318 ALA A CB    1 
ATOM   2475  N  N     . LEU A 1 319 ? 4.063   -18.798 -15.275  1.00 113.47 ? 319 LEU A N     1 
ATOM   2476  C  CA    . LEU A 1 319 ? 3.255   -17.849 -16.046  1.00 118.67 ? 319 LEU A CA    1 
ATOM   2477  C  C     . LEU A 1 319 ? 3.672   -17.697 -17.488  1.00 116.51 ? 319 LEU A C     1 
ATOM   2478  O  O     . LEU A 1 319 ? 2.857   -17.605 -18.369  1.00 104.03 ? 319 LEU A O     1 
ATOM   2479  C  CB    . LEU A 1 319 ? 3.241   -16.450 -15.402  1.00 116.90 ? 319 LEU A CB    1 
ATOM   2480  C  CG    . LEU A 1 319 ? 2.572   -16.405 -14.023  1.00 140.40 ? 319 LEU A CG    1 
ATOM   2481  C  CD1   . LEU A 1 319 ? 2.576   -14.976 -13.444  1.00 138.49 ? 319 LEU A CD1   1 
ATOM   2482  C  CD2   . LEU A 1 319 ? 1.148   -16.995 -14.063  1.00 154.25 ? 319 LEU A CD2   1 
ATOM   2483  N  N     . ALA A 1 320 ? 4.982   -17.639 -17.741  1.00 127.36 ? 320 ALA A N     1 
ATOM   2484  C  CA    . ALA A 1 320 ? 5.561   -17.346 -19.041  1.00 135.11 ? 320 ALA A CA    1 
ATOM   2485  C  C     . ALA A 1 320 ? 5.533   -18.491 -19.985  1.00 152.18 ? 320 ALA A C     1 
ATOM   2486  O  O     . ALA A 1 320 ? 5.234   -19.635 -19.620  1.00 173.56 ? 320 ALA A O     1 
ATOM   2487  C  CB    . ALA A 1 320 ? 7.025   -16.872 -18.898  1.00 117.95 ? 320 ALA A CB    1 
ATOM   2488  N  N     . PRO A 1 321 ? 5.864   -18.196 -21.231  1.00 146.07 ? 321 PRO A N     1 
ATOM   2489  C  CA    . PRO A 1 321 ? 6.194   -19.293 -22.172  1.00 142.97 ? 321 PRO A CA    1 
ATOM   2490  C  C     . PRO A 1 321 ? 7.358   -20.116 -21.669  1.00 162.61 ? 321 PRO A C     1 
ATOM   2491  O  O     . PRO A 1 321 ? 8.424   -19.567 -21.388  1.00 171.08 ? 321 PRO A O     1 
ATOM   2492  C  CB    . PRO A 1 321 ? 6.549   -18.555 -23.465  1.00 137.65 ? 321 PRO A CB    1 
ATOM   2493  C  CG    . PRO A 1 321 ? 5.858   -17.242 -23.345  1.00 139.07 ? 321 PRO A CG    1 
ATOM   2494  C  CD    . PRO A 1 321 ? 5.909   -16.881 -21.904  1.00 137.43 ? 321 PRO A CD    1 
ATOM   2495  N  N     . SER A 1 322 ? 7.128   -21.422 -21.494  1.00 164.09 ? 322 SER A N     1 
ATOM   2496  C  CA    . SER A 1 322 ? 8.232   -22.372 -21.278  1.00 149.90 ? 322 SER A CA    1 
ATOM   2497  C  C     . SER A 1 322 ? 9.100   -22.658 -22.492  1.00 128.59 ? 322 SER A C     1 
ATOM   2498  O  O     . SER A 1 322 ? 10.052  -23.431 -22.423  1.00 124.22 ? 322 SER A O     1 
ATOM   2499  C  CB    . SER A 1 322 ? 7.721   -23.723 -20.717  1.00 165.47 ? 322 SER A CB    1 
ATOM   2500  O  OG    . SER A 1 322 ? 6.908   -24.390 -21.673  1.00 172.09 ? 322 SER A OG    1 
ATOM   2501  N  N     . THR A 1 323 ? 8.851   -21.957 -23.590  1.00 140.06 ? 323 THR A N     1 
ATOM   2502  C  CA    . THR A 1 323 ? 9.683   -21.943 -24.756  1.00 168.53 ? 323 THR A CA    1 
ATOM   2503  C  C     . THR A 1 323 ? 11.061  -21.367 -24.505  1.00 172.77 ? 323 THR A C     1 
ATOM   2504  O  O     . THR A 1 323 ? 12.010  -21.763 -25.153  1.00 180.54 ? 323 THR A O     1 
ATOM   2505  C  CB    . THR A 1 323 ? 9.004   -21.118 -25.865  1.00 208.99 ? 323 THR A CB    1 
ATOM   2506  O  OG1   . THR A 1 323 ? 8.899   -19.741 -25.476  1.00 231.85 ? 323 THR A OG1   1 
ATOM   2507  C  CG2   . THR A 1 323 ? 7.594   -21.656 -26.129  1.00 227.84 ? 323 THR A CG2   1 
ATOM   2508  N  N     . MET A 1 324 ? 11.161  -20.454 -23.542  1.00 173.76 ? 324 MET A N     1 
ATOM   2509  C  CA    . MET A 1 324 ? 12.418  -19.793 -23.235  1.00 166.58 ? 324 MET A CA    1 
ATOM   2510  C  C     . MET A 1 324 ? 12.683  -19.934 -21.748  1.00 148.85 ? 324 MET A C     1 
ATOM   2511  O  O     . MET A 1 324 ? 11.758  -20.040 -20.949  1.00 134.04 ? 324 MET A O     1 
ATOM   2512  C  CB    . MET A 1 324 ? 12.437  -18.312 -23.657  1.00 175.36 ? 324 MET A CB    1 
ATOM   2513  C  CG    . MET A 1 324 ? 11.365  -17.466 -23.006  1.00 179.41 ? 324 MET A CG    1 
ATOM   2514  S  SD    . MET A 1 324 ? 11.502  -15.776 -23.574  1.00 199.18 ? 324 MET A SD    1 
ATOM   2515  C  CE    . MET A 1 324 ? 11.420  -15.982 -25.345  1.00 197.19 ? 324 MET A CE    1 
ATOM   2516  N  N     . LYS A 1 325 ? 13.968  -20.070 -21.435  1.00 160.57 ? 325 LYS A N     1 
ATOM   2517  C  CA    . LYS A 1 325 ? 14.416  -20.355 -20.101  1.00 173.51 ? 325 LYS A CA    1 
ATOM   2518  C  C     . LYS A 1 325 ? 14.521  -19.021 -19.413  1.00 139.99 ? 325 LYS A C     1 
ATOM   2519  O  O     . LYS A 1 325 ? 15.132  -18.074 -19.966  1.00 114.09 ? 325 LYS A O     1 
ATOM   2520  C  CB    . LYS A 1 325 ? 15.751  -21.184 -20.069  1.00 213.20 ? 325 LYS A CB    1 
ATOM   2521  C  CG    . LYS A 1 325 ? 15.550  -22.610 -20.590  1.00 243.54 ? 325 LYS A CG    1 
ATOM   2522  C  CD    . LYS A 1 325 ? 16.804  -23.468 -20.486  1.00 251.58 ? 325 LYS A CD    1 
ATOM   2523  C  CE    . LYS A 1 325 ? 16.593  -24.907 -20.972  1.00 252.28 ? 325 LYS A CE    1 
ATOM   2524  N  NZ    . LYS A 1 325 ? 17.844  -25.709 -20.982  1.00 256.66 ? 325 LYS A NZ    1 
ATOM   2525  N  N     . ILE A 1 326 ? 14.030  -19.035 -18.170  1.00 125.61 ? 326 ILE A N     1 
ATOM   2526  C  CA    . ILE A 1 326 ? 13.976  -17.915 -17.249  1.00 113.40 ? 326 ILE A CA    1 
ATOM   2527  C  C     . ILE A 1 326 ? 14.990  -17.992 -16.139  1.00 109.86 ? 326 ILE A C     1 
ATOM   2528  O  O     . ILE A 1 326 ? 14.738  -18.520 -15.070  1.00 110.99 ? 326 ILE A O     1 
ATOM   2529  C  CB    . ILE A 1 326 ? 12.620  -17.857 -16.561  1.00 115.20 ? 326 ILE A CB    1 
ATOM   2530  C  CG1   . ILE A 1 326 ? 11.502  -18.091 -17.597  1.00 149.93 ? 326 ILE A CG1   1 
ATOM   2531  C  CG2   . ILE A 1 326 ? 12.483  -16.523 -15.818  1.00 116.16 ? 326 ILE A CG2   1 
ATOM   2532  C  CD1   . ILE A 1 326 ? 11.491  -17.090 -18.740  1.00 156.49 ? 326 ILE A CD1   1 
ATOM   2533  N  N     . LYS A 1 327 ? 16.156  -17.451 -16.394  1.00 111.08 ? 327 LYS A N     1 
ATOM   2534  C  CA    . LYS A 1 327 ? 17.191  -17.380 -15.363  1.00 114.80 ? 327 LYS A CA    1 
ATOM   2535  C  C     . LYS A 1 327 ? 16.907  -16.137 -14.555  1.00 117.58 ? 327 LYS A C     1 
ATOM   2536  O  O     . LYS A 1 327 ? 16.648  -15.077 -15.080  1.00 100.80 ? 327 LYS A O     1 
ATOM   2537  C  CB    . LYS A 1 327 ? 18.552  -17.304 -16.011  1.00 136.68 ? 327 LYS A CB    1 
ATOM   2538  C  CG    . LYS A 1 327 ? 19.741  -17.151 -15.064  1.00 156.86 ? 327 LYS A CG    1 
ATOM   2539  C  CD    . LYS A 1 327 ? 21.098  -17.330 -15.759  1.00 177.52 ? 327 LYS A CD    1 
ATOM   2540  C  CE    . LYS A 1 327 ? 21.483  -16.148 -16.660  1.00 194.80 ? 327 LYS A CE    1 
ATOM   2541  N  NZ    . LYS A 1 327 ? 22.780  -16.350 -17.359  1.00 207.47 ? 327 LYS A NZ    1 
ATOM   2542  N  N     . ILE A 1 328 ? 17.081  -16.254 -13.255  1.00 127.30 ? 328 ILE A N     1 
ATOM   2543  C  CA    . ILE A 1 328 ? 17.041  -15.077 -12.406  1.00 107.84 ? 328 ILE A CA    1 
ATOM   2544  C  C     . ILE A 1 328 ? 18.362  -14.937 -11.769  1.00 94.90  ? 328 ILE A C     1 
ATOM   2545  O  O     . ILE A 1 328 ? 18.833  -15.894 -11.185  1.00 88.33  ? 328 ILE A O     1 
ATOM   2546  C  CB    . ILE A 1 328 ? 16.014  -15.244 -11.317  1.00 100.89 ? 328 ILE A CB    1 
ATOM   2547  C  CG1   . ILE A 1 328 ? 14.658  -15.253 -11.993  1.00 105.75 ? 328 ILE A CG1   1 
ATOM   2548  C  CG2   . ILE A 1 328 ? 16.218  -14.169 -10.252  1.00 89.10  ? 328 ILE A CG2   1 
ATOM   2549  C  CD1   . ILE A 1 328 ? 13.503  -15.630 -11.136  1.00 112.54 ? 328 ILE A CD1   1 
ATOM   2550  N  N     . ILE A 1 329 ? 18.945  -13.744 -11.823  1.00 103.20 ? 329 ILE A N     1 
ATOM   2551  C  CA    . ILE A 1 329 ? 20.309  -13.593 -11.319  1.00 135.62 ? 329 ILE A CA    1 
ATOM   2552  C  C     . ILE A 1 329 ? 20.170  -12.772 -10.084  1.00 128.81 ? 329 ILE A C     1 
ATOM   2553  O  O     . ILE A 1 329 ? 19.814  -11.640 -10.160  1.00 113.70 ? 329 ILE A O     1 
ATOM   2554  C  CB    . ILE A 1 329 ? 21.335  -13.065 -12.355  1.00 159.13 ? 329 ILE A CB    1 
ATOM   2555  C  CG1   . ILE A 1 329 ? 22.638  -12.679 -11.636  1.00 176.68 ? 329 ILE A CG1   1 
ATOM   2556  C  CG2   . ILE A 1 329 ? 20.755  -11.957 -13.215  1.00 159.01 ? 329 ILE A CG2   1 
ATOM   2557  C  CD1   . ILE A 1 329 ? 23.846  -12.569 -12.549  1.00 181.79 ? 329 ILE A CD1   1 
ATOM   2558  N  N     . ALA A 1 330 ? 20.356  -13.389 -8.911   1.00 128.51 ? 330 ALA A N     1 
ATOM   2559  C  CA    . ALA A 1 330 ? 20.232  -12.669 -7.671   1.00 125.06 ? 330 ALA A CA    1 
ATOM   2560  C  C     . ALA A 1 330 ? 21.481  -12.911 -6.888   1.00 129.95 ? 330 ALA A C     1 
ATOM   2561  O  O     . ALA A 1 330 ? 21.618  -13.929 -6.229   1.00 140.77 ? 330 ALA A O     1 
ATOM   2562  C  CB    . ALA A 1 330 ? 19.058  -13.154 -6.835   1.00 122.78 ? 330 ALA A CB    1 
ATOM   2563  N  N     . PRO A 1 331 ? 22.391  -11.945 -6.897   1.00 123.23 ? 331 PRO A N     1 
ATOM   2564  C  CA    . PRO A 1 331 ? 23.645  -12.164 -6.201   1.00 119.14 ? 331 PRO A CA    1 
ATOM   2565  C  C     . PRO A 1 331 ? 23.423  -12.045 -4.702   1.00 107.12 ? 331 PRO A C     1 
ATOM   2566  O  O     . PRO A 1 331 ? 22.527  -11.335 -4.262   1.00 102.57 ? 331 PRO A O     1 
ATOM   2567  C  CB    . PRO A 1 331 ? 24.536  -11.031 -6.707   1.00 117.64 ? 331 PRO A CB    1 
ATOM   2568  C  CG    . PRO A 1 331 ? 23.560  -9.943  -6.997   1.00 116.14 ? 331 PRO A CG    1 
ATOM   2569  C  CD    . PRO A 1 331 ? 22.294  -10.586 -7.443   1.00 112.28 ? 331 PRO A CD    1 
ATOM   2570  N  N     . PRO A 1 332 ? 24.211  -12.753 -3.910   1.00 108.57 ? 332 PRO A N     1 
ATOM   2571  C  CA    . PRO A 1 332 ? 24.416  -12.332 -2.520   1.00 109.86 ? 332 PRO A CA    1 
ATOM   2572  C  C     . PRO A 1 332 ? 25.247  -11.091 -2.582   1.00 104.54 ? 332 PRO A C     1 
ATOM   2573  O  O     . PRO A 1 332 ? 25.948  -10.900 -3.583   1.00 104.67 ? 332 PRO A O     1 
ATOM   2574  C  CB    . PRO A 1 332 ? 25.203  -13.499 -1.924   1.00 126.63 ? 332 PRO A CB    1 
ATOM   2575  C  CG    . PRO A 1 332 ? 25.966  -14.008 -3.100   1.00 144.88 ? 332 PRO A CG    1 
ATOM   2576  C  CD    . PRO A 1 332 ? 25.046  -13.900 -4.270   1.00 130.97 ? 332 PRO A CD    1 
ATOM   2577  N  N     . GLU A 1 333 ? 25.162  -10.227 -1.550   1.00 104.43 ? 333 GLU A N     1 
ATOM   2578  C  CA    . GLU A 1 333 ? 25.659  -8.831  -1.609   1.00 110.36 ? 333 GLU A CA    1 
ATOM   2579  C  C     . GLU A 1 333 ? 24.725  -7.952  -2.400   1.00 97.28  ? 333 GLU A C     1 
ATOM   2580  O  O     . GLU A 1 333 ? 24.941  -6.765  -2.521   1.00 95.43  ? 333 GLU A O     1 
ATOM   2581  C  CB    . GLU A 1 333 ? 27.045  -8.739  -2.237   1.00 139.46 ? 333 GLU A CB    1 
ATOM   2582  C  CG    . GLU A 1 333 ? 27.819  -7.502  -1.824   1.00 173.50 ? 333 GLU A CG    1 
ATOM   2583  C  CD    . GLU A 1 333 ? 29.253  -7.531  -2.274   1.00 199.26 ? 333 GLU A CD    1 
ATOM   2584  O  OE1   . GLU A 1 333 ? 29.664  -8.535  -2.851   1.00 186.96 ? 333 GLU A OE1   1 
ATOM   2585  O  OE2   . GLU A 1 333 ? 29.988  -6.539  -2.054   1.00 217.92 ? 333 GLU A OE2   1 
ATOM   2586  N  N     . ARG A 1 334 ? 23.586  -8.481  -2.854   1.00 92.89  ? 334 ARG A N     1 
ATOM   2587  C  CA    . ARG A 1 334 ? 22.507  -7.684  -3.431   1.00 85.16  ? 334 ARG A CA    1 
ATOM   2588  C  C     . ARG A 1 334 ? 22.052  -6.495  -2.578   1.00 72.10  ? 334 ARG A C     1 
ATOM   2589  O  O     . ARG A 1 334 ? 21.632  -5.494  -3.119   1.00 62.20  ? 334 ARG A O     1 
ATOM   2590  C  CB    . ARG A 1 334 ? 21.272  -8.536  -3.813   1.00 90.62  ? 334 ARG A CB    1 
ATOM   2591  C  CG    . ARG A 1 334 ? 20.636  -9.256  -2.605   1.00 91.21  ? 334 ARG A CG    1 
ATOM   2592  C  CD    . ARG A 1 334 ? 19.286  -9.900  -2.908   1.00 95.08  ? 334 ARG A CD    1 
ATOM   2593  N  NE    . ARG A 1 334 ? 19.431  -11.243 -3.498   1.00 88.15  ? 334 ARG A NE    1 
ATOM   2594  C  CZ    . ARG A 1 334 ? 19.448  -12.367 -2.805   1.00 96.42  ? 334 ARG A CZ    1 
ATOM   2595  N  NH1   . ARG A 1 334 ? 19.355  -12.305 -1.484   1.00 94.11  ? 334 ARG A NH1   1 
ATOM   2596  N  NH2   . ARG A 1 334 ? 19.676  -13.544 -3.436   1.00 106.92 ? 334 ARG A NH2   1 
ATOM   2597  N  N     . LYS A 1 335 ? 22.119  -6.615  -1.247   1.00 71.37  ? 335 LYS A N     1 
ATOM   2598  C  CA    . LYS A 1 335 ? 21.641  -5.573  -0.399   1.00 73.18  ? 335 LYS A CA    1 
ATOM   2599  C  C     . LYS A 1 335 ? 22.310  -4.279  -0.757   1.00 72.52  ? 335 LYS A C     1 
ATOM   2600  O  O     . LYS A 1 335 ? 21.657  -3.185  -0.691   1.00 93.29  ? 335 LYS A O     1 
ATOM   2601  C  CB    . LYS A 1 335 ? 21.921  -5.861  1.099    1.00 83.52  ? 335 LYS A CB    1 
ATOM   2602  C  CG    . LYS A 1 335 ? 21.466  -4.712  2.011    1.00 102.10 ? 335 LYS A CG    1 
ATOM   2603  C  CD    . LYS A 1 335 ? 21.614  -5.023  3.491    1.00 123.92 ? 335 LYS A CD    1 
ATOM   2604  C  CE    . LYS A 1 335 ? 20.659  -6.090  4.003    1.00 136.82 ? 335 LYS A CE    1 
ATOM   2605  N  NZ    . LYS A 1 335 ? 20.773  -6.197  5.484    1.00 147.93 ? 335 LYS A NZ    1 
ATOM   2606  N  N     . TYR A 1 336 ? 23.647  -4.370  -1.032   1.00 63.38  ? 336 TYR A N     1 
ATOM   2607  C  CA    . TYR A 1 336 ? 24.509  -3.194  -1.240   1.00 63.76  ? 336 TYR A CA    1 
ATOM   2608  C  C     . TYR A 1 336 ? 24.645  -2.793  -2.714   1.00 65.13  ? 336 TYR A C     1 
ATOM   2609  O  O     . TYR A 1 336 ? 25.170  -1.741  -3.024   1.00 67.28  ? 336 TYR A O     1 
ATOM   2610  C  CB    . TYR A 1 336 ? 25.877  -3.356  -0.581   1.00 58.82  ? 336 TYR A CB    1 
ATOM   2611  C  CG    . TYR A 1 336 ? 25.657  -3.758  0.828    1.00 61.69  ? 336 TYR A CG    1 
ATOM   2612  C  CD1   . TYR A 1 336 ? 25.024  -2.897  1.687    1.00 69.83  ? 336 TYR A CD1   1 
ATOM   2613  C  CD2   . TYR A 1 336 ? 25.984  -5.003  1.268    1.00 67.98  ? 336 TYR A CD2   1 
ATOM   2614  C  CE1   . TYR A 1 336 ? 24.776  -3.253  3.007    1.00 73.47  ? 336 TYR A CE1   1 
ATOM   2615  C  CE2   . TYR A 1 336 ? 25.752  -5.388  2.571    1.00 75.73  ? 336 TYR A CE2   1 
ATOM   2616  C  CZ    . TYR A 1 336 ? 25.150  -4.504  3.446    1.00 75.98  ? 336 TYR A CZ    1 
ATOM   2617  O  OH    . TYR A 1 336 ? 24.904  -4.879  4.773    1.00 69.87  ? 336 TYR A OH    1 
ATOM   2618  N  N     . SER A 1 337 ? 23.859  -3.441  -3.570   1.00 75.09  ? 337 SER A N     1 
ATOM   2619  C  CA    . SER A 1 337 ? 24.047  -3.336  -5.010   1.00 82.39  ? 337 SER A CA    1 
ATOM   2620  C  C     . SER A 1 337 ? 23.916  -1.874  -5.457   1.00 81.50  ? 337 SER A C     1 
ATOM   2621  O  O     . SER A 1 337 ? 24.722  -1.392  -6.251   1.00 68.46  ? 337 SER A O     1 
ATOM   2622  C  CB    . SER A 1 337 ? 23.050  -4.262  -5.778   1.00 81.71  ? 337 SER A CB    1 
ATOM   2623  O  OG    . SER A 1 337 ? 23.327  -5.586  -5.460   1.00 81.38  ? 337 SER A OG    1 
ATOM   2624  N  N     . VAL A 1 338 ? 22.956  -1.157  -4.887   1.00 77.80  ? 338 VAL A N     1 
ATOM   2625  C  CA    . VAL A 1 338 ? 22.750  0.197   -5.313   1.00 79.39  ? 338 VAL A CA    1 
ATOM   2626  C  C     . VAL A 1 338 ? 24.016  1.002   -5.030   1.00 77.23  ? 338 VAL A C     1 
ATOM   2627  O  O     . VAL A 1 338 ? 24.515  1.765   -5.861   1.00 77.05  ? 338 VAL A O     1 
ATOM   2628  C  CB    . VAL A 1 338 ? 21.528  0.808   -4.594   1.00 103.22 ? 338 VAL A CB    1 
ATOM   2629  C  CG1   . VAL A 1 338 ? 21.416  2.335   -4.827   1.00 104.66 ? 338 VAL A CG1   1 
ATOM   2630  C  CG2   . VAL A 1 338 ? 20.265  0.029   -5.013   1.00 129.53 ? 338 VAL A CG2   1 
ATOM   2631  N  N     . TRP A 1 339 ? 24.515  0.860   -3.796   1.00 78.91  ? 339 TRP A N     1 
ATOM   2632  C  CA    . TRP A 1 339 ? 25.662  1.661   -3.407   1.00 73.44  ? 339 TRP A CA    1 
ATOM   2633  C  C     . TRP A 1 339 ? 26.882  1.319   -4.248   1.00 65.80  ? 339 TRP A C     1 
ATOM   2634  O  O     . TRP A 1 339 ? 27.602  2.229   -4.685   1.00 63.38  ? 339 TRP A O     1 
ATOM   2635  C  CB    . TRP A 1 339 ? 26.053  1.505   -1.936   1.00 74.01  ? 339 TRP A CB    1 
ATOM   2636  C  CG    . TRP A 1 339 ? 27.125  2.511   -1.559   1.00 73.32  ? 339 TRP A CG    1 
ATOM   2637  C  CD1   . TRP A 1 339 ? 26.956  3.795   -1.109   1.00 76.29  ? 339 TRP A CD1   1 
ATOM   2638  C  CD2   . TRP A 1 339 ? 28.523  2.300   -1.657   1.00 59.96  ? 339 TRP A CD2   1 
ATOM   2639  N  NE1   . TRP A 1 339 ? 28.162  4.383   -0.892   1.00 68.49  ? 339 TRP A NE1   1 
ATOM   2640  C  CE2   . TRP A 1 339 ? 29.147  3.487   -1.253   1.00 70.60  ? 339 TRP A CE2   1 
ATOM   2641  C  CE3   . TRP A 1 339 ? 29.281  1.238   -2.078   1.00 46.42  ? 339 TRP A CE3   1 
ATOM   2642  C  CZ2   . TRP A 1 339 ? 30.521  3.603   -1.186   1.00 73.69  ? 339 TRP A CZ2   1 
ATOM   2643  C  CZ3   . TRP A 1 339 ? 30.622  1.338   -2.043   1.00 53.28  ? 339 TRP A CZ3   1 
ATOM   2644  C  CH2   . TRP A 1 339 ? 31.245  2.515   -1.607   1.00 68.80  ? 339 TRP A CH2   1 
ATOM   2645  N  N     . ILE A 1 340 ? 27.056  0.022   -4.534   1.00 65.22  ? 340 ILE A N     1 
ATOM   2646  C  CA    . ILE A 1 340 ? 28.181  -0.379  -5.356   1.00 65.74  ? 340 ILE A CA    1 
ATOM   2647  C  C     . ILE A 1 340 ? 28.083  0.280   -6.750   1.00 62.13  ? 340 ILE A C     1 
ATOM   2648  O  O     . ILE A 1 340 ? 29.018  0.784   -7.321   1.00 59.79  ? 340 ILE A O     1 
ATOM   2649  C  CB    . ILE A 1 340 ? 28.298  -1.892  -5.501   1.00 75.01  ? 340 ILE A CB    1 
ATOM   2650  C  CG1   . ILE A 1 340 ? 28.483  -2.559  -4.126   1.00 82.50  ? 340 ILE A CG1   1 
ATOM   2651  C  CG2   . ILE A 1 340 ? 29.406  -2.184  -6.494   1.00 81.94  ? 340 ILE A CG2   1 
ATOM   2652  C  CD1   . ILE A 1 340 ? 28.368  -4.045  -4.120   1.00 92.09  ? 340 ILE A CD1   1 
ATOM   2653  N  N     . GLY A 1 341 ? 26.890  0.213   -7.292   1.00 58.13  ? 341 GLY A N     1 
ATOM   2654  C  CA    . GLY A 1 341 ? 26.620  0.829   -8.574   1.00 59.78  ? 341 GLY A CA    1 
ATOM   2655  C  C     . GLY A 1 341 ? 26.994  2.279   -8.557   1.00 52.50  ? 341 GLY A C     1 
ATOM   2656  O  O     . GLY A 1 341 ? 27.530  2.822   -9.523   1.00 52.55  ? 341 GLY A O     1 
ATOM   2657  N  N     . GLY A 1 342 ? 26.646  2.955   -7.463   1.00 55.12  ? 342 GLY A N     1 
ATOM   2658  C  CA    . GLY A 1 342 ? 27.004  4.376   -7.325   1.00 60.95  ? 342 GLY A CA    1 
ATOM   2659  C  C     . GLY A 1 342 ? 28.501  4.536   -7.363   1.00 62.56  ? 342 GLY A C     1 
ATOM   2660  O  O     . GLY A 1 342 ? 29.004  5.468   -7.998   1.00 63.23  ? 342 GLY A O     1 
ATOM   2661  N  N     . SER A 1 343 ? 29.211  3.639   -6.668   1.00 65.08  ? 343 SER A N     1 
ATOM   2662  C  CA    . SER A 1 343 ? 30.666  3.717   -6.613   1.00 64.60  ? 343 SER A CA    1 
ATOM   2663  C  C     . SER A 1 343 ? 31.250  3.605   -8.024   1.00 53.96  ? 343 SER A C     1 
ATOM   2664  O  O     . SER A 1 343 ? 32.153  4.373   -8.417   1.00 49.07  ? 343 SER A O     1 
ATOM   2665  C  CB    . SER A 1 343 ? 31.254  2.589   -5.724   1.00 74.48  ? 343 SER A CB    1 
ATOM   2666  O  OG    . SER A 1 343 ? 31.295  1.354   -6.423   1.00 88.07  ? 343 SER A OG    1 
ATOM   2667  N  N     . ILE A 1 344 ? 30.734  2.641   -8.760   1.00 56.26  ? 344 ILE A N     1 
ATOM   2668  C  CA    . ILE A 1 344 ? 31.264  2.408   -10.094  1.00 65.41  ? 344 ILE A CA    1 
ATOM   2669  C  C     . ILE A 1 344 ? 30.940  3.603   -10.997  1.00 58.57  ? 344 ILE A C     1 
ATOM   2670  O  O     . ILE A 1 344 ? 31.819  4.019   -11.770  1.00 52.34  ? 344 ILE A O     1 
ATOM   2671  C  CB    . ILE A 1 344 ? 30.808  1.039   -10.665  1.00 90.34  ? 344 ILE A CB    1 
ATOM   2672  C  CG1   . ILE A 1 344 ? 31.558  0.707   -11.933  1.00 128.42 ? 344 ILE A CG1   1 
ATOM   2673  C  CG2   . ILE A 1 344 ? 29.317  0.980   -10.926  1.00 90.30  ? 344 ILE A CG2   1 
ATOM   2674  C  CD1   . ILE A 1 344 ? 31.431  -0.757  -12.398  1.00 145.67 ? 344 ILE A CD1   1 
ATOM   2675  N  N     . LEU A 1 345 ? 29.766  4.204   -10.835  1.00 69.92  ? 345 LEU A N     1 
ATOM   2676  C  CA    . LEU A 1 345 ? 29.413  5.333   -11.674  1.00 74.83  ? 345 LEU A CA    1 
ATOM   2677  C  C     . LEU A 1 345 ? 30.241  6.493   -11.385  1.00 77.60  ? 345 LEU A C     1 
ATOM   2678  O  O     . LEU A 1 345 ? 30.664  7.153   -12.343  1.00 99.80  ? 345 LEU A O     1 
ATOM   2679  C  CB    . LEU A 1 345 ? 27.984  5.803   -11.486  1.00 79.49  ? 345 LEU A CB    1 
ATOM   2680  C  CG    . LEU A 1 345 ? 27.262  5.871   -12.839  1.00 92.51  ? 345 LEU A CG    1 
ATOM   2681  C  CD1   . LEU A 1 345 ? 27.132  4.446   -13.426  1.00 111.98 ? 345 LEU A CD1   1 
ATOM   2682  C  CD2   . LEU A 1 345 ? 25.878  6.538   -12.724  1.00 94.06  ? 345 LEU A CD2   1 
ATOM   2683  N  N     . ALA A 1 346 ? 30.467  6.824   -10.117  1.00 78.04  ? 346 ALA A N     1 
ATOM   2684  C  CA    . ALA A 1 346 ? 31.281  7.992   -9.923   1.00 78.69  ? 346 ALA A CA    1 
ATOM   2685  C  C     . ALA A 1 346 ? 32.747  7.747   -10.331  1.00 66.69  ? 346 ALA A C     1 
ATOM   2686  O  O     . ALA A 1 346 ? 33.422  8.652   -10.751  1.00 51.88  ? 346 ALA A O     1 
ATOM   2687  C  CB    . ALA A 1 346 ? 31.151  8.518   -8.514   1.00 93.69  ? 346 ALA A CB    1 
ATOM   2688  N  N     . SER A 1 347 ? 33.179  6.493   -10.321  1.00 78.20  ? 347 SER A N     1 
ATOM   2689  C  CA    . SER A 1 347 ? 34.500  6.140   -10.734  1.00 89.30  ? 347 SER A CA    1 
ATOM   2690  C  C     . SER A 1 347 ? 34.652  6.391   -12.213  1.00 74.50  ? 347 SER A C     1 
ATOM   2691  O  O     . SER A 1 347 ? 35.765  6.606   -12.662  1.00 78.30  ? 347 SER A O     1 
ATOM   2692  C  CB    . SER A 1 347 ? 34.880  4.680   -10.311  1.00 108.51 ? 347 SER A CB    1 
ATOM   2693  O  OG    . SER A 1 347 ? 34.713  4.517   -8.911   1.00 112.98 ? 347 SER A OG    1 
ATOM   2694  N  N     . LEU A 1 348 ? 33.597  6.272   -12.994  1.00 79.32  ? 348 LEU A N     1 
ATOM   2695  C  CA    . LEU A 1 348 ? 33.725  6.325   -14.441  1.00 96.59  ? 348 LEU A CA    1 
ATOM   2696  C  C     . LEU A 1 348 ? 34.210  7.711   -14.835  1.00 106.78 ? 348 LEU A C     1 
ATOM   2697  O  O     . LEU A 1 348 ? 33.776  8.732   -14.262  1.00 111.57 ? 348 LEU A O     1 
ATOM   2698  C  CB    . LEU A 1 348 ? 32.375  6.007   -15.106  1.00 114.62 ? 348 LEU A CB    1 
ATOM   2699  C  CG    . LEU A 1 348 ? 32.249  4.589   -15.656  1.00 111.55 ? 348 LEU A CG    1 
ATOM   2700  C  CD1   . LEU A 1 348 ? 32.383  3.515   -14.595  1.00 106.67 ? 348 LEU A CD1   1 
ATOM   2701  C  CD2   . LEU A 1 348 ? 30.928  4.387   -16.424  1.00 117.56 ? 348 LEU A CD2   1 
ATOM   2702  N  N     . SER A 1 349 ? 35.137  7.726   -15.791  1.00 111.18 ? 349 SER A N     1 
ATOM   2703  C  CA    . SER A 1 349 ? 35.750  8.975   -16.232  1.00 112.99 ? 349 SER A CA    1 
ATOM   2704  C  C     . SER A 1 349 ? 34.744  9.917   -16.924  1.00 112.70 ? 349 SER A C     1 
ATOM   2705  O  O     . SER A 1 349 ? 34.667  11.126  -16.620  1.00 108.35 ? 349 SER A O     1 
ATOM   2706  C  CB    . SER A 1 349 ? 36.974  8.715   -17.151  1.00 102.30 ? 349 SER A CB    1 
ATOM   2707  O  OG    . SER A 1 349 ? 37.960  7.993   -16.436  1.00 101.63 ? 349 SER A OG    1 
ATOM   2708  N  N     . THR A 1 350 ? 34.039  9.387   -17.909  1.00 102.28 ? 350 THR A N     1 
ATOM   2709  C  CA    . THR A 1 350 ? 33.133  10.175  -18.709  1.00 98.80  ? 350 THR A CA    1 
ATOM   2710  C  C     . THR A 1 350 ? 32.087  10.755  -17.819  1.00 93.78  ? 350 THR A C     1 
ATOM   2711  O  O     . THR A 1 350 ? 31.652  11.882  -18.041  1.00 98.40  ? 350 THR A O     1 
ATOM   2712  C  CB    . THR A 1 350 ? 32.371  9.308   -19.723  1.00 113.48 ? 350 THR A CB    1 
ATOM   2713  O  OG1   . THR A 1 350 ? 33.300  8.643   -20.596  1.00 125.06 ? 350 THR A OG1   1 
ATOM   2714  C  CG2   . THR A 1 350 ? 31.400  10.159  -20.570  1.00 110.97 ? 350 THR A CG2   1 
ATOM   2715  N  N     . PHE A 1 351 ? 31.682  9.980   -16.798  1.00 88.76  ? 351 PHE A N     1 
ATOM   2716  C  CA    . PHE A 1 351 ? 30.619  10.455  -15.879  1.00 90.40  ? 351 PHE A CA    1 
ATOM   2717  C  C     . PHE A 1 351 ? 30.999  11.802  -15.281  1.00 90.42  ? 351 PHE A C     1 
ATOM   2718  O  O     . PHE A 1 351 ? 30.138  12.711  -15.105  1.00 95.00  ? 351 PHE A O     1 
ATOM   2719  C  CB    . PHE A 1 351 ? 30.276  9.472   -14.751  1.00 101.85 ? 351 PHE A CB    1 
ATOM   2720  C  CG    . PHE A 1 351 ? 29.197  9.940   -13.827  1.00 133.04 ? 351 PHE A CG    1 
ATOM   2721  C  CD1   . PHE A 1 351 ? 27.888  10.097  -14.276  1.00 149.89 ? 351 PHE A CD1   1 
ATOM   2722  C  CD2   . PHE A 1 351 ? 29.475  10.155  -12.493  1.00 144.74 ? 351 PHE A CD2   1 
ATOM   2723  C  CE1   . PHE A 1 351 ? 26.915  10.503  -13.417  1.00 150.58 ? 351 PHE A CE1   1 
ATOM   2724  C  CE2   . PHE A 1 351 ? 28.497  10.546  -11.627  1.00 148.16 ? 351 PHE A CE2   1 
ATOM   2725  C  CZ    . PHE A 1 351 ? 27.209  10.726  -12.087  1.00 152.85 ? 351 PHE A CZ    1 
ATOM   2726  N  N     . GLN A 1 352 ? 32.319  11.987  -15.117  1.00 105.84 ? 352 GLN A N     1 
ATOM   2727  C  CA    . GLN A 1 352 ? 32.854  13.199  -14.499  1.00 133.65 ? 352 GLN A CA    1 
ATOM   2728  C  C     . GLN A 1 352 ? 32.499  14.518  -15.197  1.00 141.88 ? 352 GLN A C     1 
ATOM   2729  O  O     . GLN A 1 352 ? 32.691  15.590  -14.620  1.00 140.68 ? 352 GLN A O     1 
ATOM   2730  C  CB    . GLN A 1 352 ? 34.352  13.074  -14.215  1.00 141.45 ? 352 GLN A CB    1 
ATOM   2731  C  CG    . GLN A 1 352 ? 34.657  12.063  -13.106  1.00 166.56 ? 352 GLN A CG    1 
ATOM   2732  C  CD    . GLN A 1 352 ? 36.036  12.237  -12.536  1.00 194.25 ? 352 GLN A CD    1 
ATOM   2733  O  OE1   . GLN A 1 352 ? 36.948  12.708  -13.222  1.00 214.61 ? 352 GLN A OE1   1 
ATOM   2734  N  NE2   . GLN A 1 352 ? 36.219  11.836  -11.272  1.00 206.23 ? 352 GLN A NE2   1 
ATOM   2735  N  N     . GLN A 1 353 ? 31.903  14.438  -16.384  1.00 143.08 ? 353 GLN A N     1 
ATOM   2736  C  CA    . GLN A 1 353 ? 31.379  15.592  -17.044  1.00 131.33 ? 353 GLN A CA    1 
ATOM   2737  C  C     . GLN A 1 353 ? 29.883  15.770  -16.918  1.00 112.12 ? 353 GLN A C     1 
ATOM   2738  O  O     . GLN A 1 353 ? 29.380  16.855  -17.155  1.00 108.79 ? 353 GLN A O     1 
ATOM   2739  C  CB    . GLN A 1 353 ? 31.713  15.529  -18.539  1.00 136.12 ? 353 GLN A CB    1 
ATOM   2740  C  CG    . GLN A 1 353 ? 31.613  16.837  -19.305  1.00 138.45 ? 353 GLN A CG    1 
ATOM   2741  C  CD    . GLN A 1 353 ? 32.382  16.790  -20.606  1.00 161.55 ? 353 GLN A CD    1 
ATOM   2742  O  OE1   . GLN A 1 353 ? 32.890  15.746  -21.025  1.00 172.67 ? 353 GLN A OE1   1 
ATOM   2743  N  NE2   . GLN A 1 353 ? 32.472  17.936  -21.270  1.00 180.15 ? 353 GLN A NE2   1 
ATOM   2744  N  N     . MET A 1 354 ? 29.192  14.691  -16.561  1.00 113.92 ? 354 MET A N     1 
ATOM   2745  C  CA    . MET A 1 354 ? 27.727  14.737  -16.396  1.00 129.65 ? 354 MET A CA    1 
ATOM   2746  C  C     . MET A 1 354 ? 27.238  15.261  -15.049  1.00 110.06 ? 354 MET A C     1 
ATOM   2747  O  O     . MET A 1 354 ? 26.025  15.368  -14.820  1.00 86.81  ? 354 MET A O     1 
ATOM   2748  C  CB    . MET A 1 354 ? 27.116  13.345  -16.641  1.00 163.46 ? 354 MET A CB    1 
ATOM   2749  C  CG    . MET A 1 354 ? 27.377  12.784  -18.034  1.00 184.11 ? 354 MET A CG    1 
ATOM   2750  S  SD    . MET A 1 354 ? 26.854  11.059  -18.239  1.00 205.99 ? 354 MET A SD    1 
ATOM   2751  C  CE    . MET A 1 354 ? 25.083  11.146  -18.031  1.00 187.27 ? 354 MET A CE    1 
ATOM   2752  N  N     . TRP A 1 355 ? 28.171  15.578  -14.142  1.00 107.36 ? 355 TRP A N     1 
ATOM   2753  C  CA    . TRP A 1 355 ? 27.749  16.014  -12.844  1.00 109.97 ? 355 TRP A CA    1 
ATOM   2754  C  C     . TRP A 1 355 ? 26.894  17.247  -12.997  1.00 97.16  ? 355 TRP A C     1 
ATOM   2755  O  O     . TRP A 1 355 ? 27.099  18.016  -13.941  1.00 112.98 ? 355 TRP A O     1 
ATOM   2756  C  CB    . TRP A 1 355 ? 28.931  16.385  -11.907  1.00 115.30 ? 355 TRP A CB    1 
ATOM   2757  C  CG    . TRP A 1 355 ? 29.773  15.209  -11.458  1.00 103.45 ? 355 TRP A CG    1 
ATOM   2758  C  CD1   . TRP A 1 355 ? 30.986  14.809  -11.929  1.00 97.19  ? 355 TRP A CD1   1 
ATOM   2759  C  CD2   . TRP A 1 355 ? 29.440  14.325  -10.401  1.00 97.32  ? 355 TRP A CD2   1 
ATOM   2760  N  NE1   . TRP A 1 355 ? 31.413  13.704  -11.233  1.00 91.97  ? 355 TRP A NE1   1 
ATOM   2761  C  CE2   . TRP A 1 355 ? 30.447  13.370  -10.318  1.00 91.70  ? 355 TRP A CE2   1 
ATOM   2762  C  CE3   . TRP A 1 355 ? 28.331  14.240  -9.580   1.00 110.51 ? 355 TRP A CE3   1 
ATOM   2763  C  CZ2   . TRP A 1 355 ? 30.408  12.354  -9.395   1.00 107.27 ? 355 TRP A CZ2   1 
ATOM   2764  C  CZ3   . TRP A 1 355 ? 28.265  13.215  -8.681   1.00 119.33 ? 355 TRP A CZ3   1 
ATOM   2765  C  CH2   . TRP A 1 355 ? 29.295  12.276  -8.591   1.00 109.92 ? 355 TRP A CH2   1 
ATOM   2766  N  N     . ILE A 1 356 ? 25.981  17.462  -12.068  1.00 77.68  ? 356 ILE A N     1 
ATOM   2767  C  CA    . ILE A 1 356 ? 25.339  18.759  -11.955  1.00 80.31  ? 356 ILE A CA    1 
ATOM   2768  C  C     . ILE A 1 356 ? 26.337  19.579  -11.181  1.00 86.11  ? 356 ILE A C     1 
ATOM   2769  O  O     . ILE A 1 356 ? 26.696  19.265  -10.055  1.00 91.17  ? 356 ILE A O     1 
ATOM   2770  C  CB    . ILE A 1 356 ? 24.028  18.705  -11.251  1.00 96.45  ? 356 ILE A CB    1 
ATOM   2771  C  CG1   . ILE A 1 356 ? 23.040  17.759  -11.963  1.00 133.65 ? 356 ILE A CG1   1 
ATOM   2772  C  CG2   . ILE A 1 356 ? 23.504  20.137  -11.129  1.00 92.15  ? 356 ILE A CG2   1 
ATOM   2773  C  CD1   . ILE A 1 356 ? 21.817  17.413  -11.118  1.00 150.55 ? 356 ILE A CD1   1 
ATOM   2774  N  N     . SER A 1 357 ? 26.808  20.653  -11.805  1.00 100.59 ? 357 SER A N     1 
ATOM   2775  C  CA    . SER A 1 357 ? 27.827  21.489  -11.196  1.00 116.54 ? 357 SER A CA    1 
ATOM   2776  C  C     . SER A 1 357 ? 27.107  22.502  -10.347  1.00 106.99 ? 357 SER A C     1 
ATOM   2777  O  O     . SER A 1 357 ? 25.978  22.887  -10.624  1.00 95.59  ? 357 SER A O     1 
ATOM   2778  C  CB    . SER A 1 357 ? 28.730  22.191  -12.252  1.00 142.92 ? 357 SER A CB    1 
ATOM   2779  O  OG    . SER A 1 357 ? 29.450  21.207  -12.992  1.00 140.53 ? 357 SER A OG    1 
ATOM   2780  N  N     . LYS A 1 358 ? 27.786  22.901  -9.256   1.00 123.53 ? 358 LYS A N     1 
ATOM   2781  C  CA    . LYS A 1 358 ? 27.347  23.972  -8.395   1.00 138.58 ? 358 LYS A CA    1 
ATOM   2782  C  C     . LYS A 1 358 ? 27.035  25.213  -9.213   1.00 146.55 ? 358 LYS A C     1 
ATOM   2783  O  O     . LYS A 1 358 ? 26.034  25.900  -8.990   1.00 142.79 ? 358 LYS A O     1 
ATOM   2784  C  CB    . LYS A 1 358 ? 28.445  24.270  -7.334   1.00 150.62 ? 358 LYS A CB    1 
ATOM   2785  C  CG    . LYS A 1 358 ? 28.070  25.370  -6.364   1.00 157.33 ? 358 LYS A CG    1 
ATOM   2786  C  CD    . LYS A 1 358 ? 26.740  25.192  -5.632   1.00 175.51 ? 358 LYS A CD    1 
ATOM   2787  C  CE    . LYS A 1 358 ? 26.640  26.061  -4.363   1.00 197.22 ? 358 LYS A CE    1 
ATOM   2788  N  NZ    . LYS A 1 358 ? 26.584  27.534  -4.616   1.00 194.31 ? 358 LYS A NZ    1 
ATOM   2789  N  N     . GLN A 1 359 ? 27.936  25.531  -10.136  1.00 150.10 ? 359 GLN A N     1 
ATOM   2790  C  CA    . GLN A 1 359 ? 27.836  26.705  -10.972  1.00 159.64 ? 359 GLN A CA    1 
ATOM   2791  C  C     . GLN A 1 359 ? 26.523  26.665  -11.743  1.00 137.06 ? 359 GLN A C     1 
ATOM   2792  O  O     . GLN A 1 359 ? 25.751  27.640  -11.733  1.00 128.77 ? 359 GLN A O     1 
ATOM   2793  C  CB    . GLN A 1 359 ? 29.029  26.762  -11.963  1.00 160.75 ? 359 GLN A CB    1 
ATOM   2794  C  CG    . GLN A 1 359 ? 29.060  27.978  -12.881  1.00 170.16 ? 359 GLN A CG    1 
ATOM   2795  C  CD    . GLN A 1 359 ? 30.331  28.022  -13.673  1.00 186.92 ? 359 GLN A CD    1 
ATOM   2796  O  OE1   . GLN A 1 359 ? 31.219  27.216  -13.425  1.00 209.35 ? 359 GLN A OE1   1 
ATOM   2797  N  NE2   . GLN A 1 359 ? 30.430  28.944  -14.642  1.00 194.84 ? 359 GLN A NE2   1 
ATOM   2798  N  N     . GLU A 1 360 ? 26.284  25.503  -12.359  1.00 122.28 ? 360 GLU A N     1 
ATOM   2799  C  CA    . GLU A 1 360 ? 25.114  25.319  -13.228  1.00 133.13 ? 360 GLU A CA    1 
ATOM   2800  C  C     . GLU A 1 360 ? 23.848  25.530  -12.435  1.00 125.05 ? 360 GLU A C     1 
ATOM   2801  O  O     . GLU A 1 360 ? 22.900  26.211  -12.865  1.00 119.60 ? 360 GLU A O     1 
ATOM   2802  C  CB    . GLU A 1 360 ? 25.176  23.949  -13.891  1.00 152.63 ? 360 GLU A CB    1 
ATOM   2803  C  CG    . GLU A 1 360 ? 26.324  23.874  -14.913  1.00 177.64 ? 360 GLU A CG    1 
ATOM   2804  C  CD    . GLU A 1 360 ? 26.419  22.548  -15.576  1.00 198.51 ? 360 GLU A CD    1 
ATOM   2805  O  OE1   . GLU A 1 360 ? 25.987  21.541  -14.984  1.00 221.74 ? 360 GLU A OE1   1 
ATOM   2806  O  OE2   . GLU A 1 360 ? 26.944  22.491  -16.711  1.00 193.42 ? 360 GLU A OE2   1 
ATOM   2807  N  N     . TYR A 1 361 ? 23.809  24.932  -11.251  1.00 124.26 ? 361 TYR A N     1 
ATOM   2808  C  CA    . TYR A 1 361 ? 22.699  25.154  -10.319  1.00 117.62 ? 361 TYR A CA    1 
ATOM   2809  C  C     . TYR A 1 361 ? 22.531  26.644  -10.009  1.00 124.52 ? 361 TYR A C     1 
ATOM   2810  O  O     . TYR A 1 361 ? 21.434  27.154  -10.023  1.00 143.13 ? 361 TYR A O     1 
ATOM   2811  C  CB    . TYR A 1 361 ? 22.926  24.427  -9.025   1.00 115.89 ? 361 TYR A CB    1 
ATOM   2812  C  CG    . TYR A 1 361 ? 21.987  24.816  -7.950   1.00 119.53 ? 361 TYR A CG    1 
ATOM   2813  C  CD1   . TYR A 1 361 ? 20.650  24.484  -8.020   1.00 139.45 ? 361 TYR A CD1   1 
ATOM   2814  C  CD2   . TYR A 1 361 ? 22.431  25.530  -6.874   1.00 120.63 ? 361 TYR A CD2   1 
ATOM   2815  C  CE1   . TYR A 1 361 ? 19.785  24.830  -6.992   1.00 126.96 ? 361 TYR A CE1   1 
ATOM   2816  C  CE2   . TYR A 1 361 ? 21.565  25.889  -5.839   1.00 122.97 ? 361 TYR A CE2   1 
ATOM   2817  C  CZ    . TYR A 1 361 ? 20.245  25.536  -5.917   1.00 115.99 ? 361 TYR A CZ    1 
ATOM   2818  O  OH    . TYR A 1 361 ? 19.368  25.898  -4.888   1.00 123.22 ? 361 TYR A OH    1 
ATOM   2819  N  N     . ASP A 1 362 ? 23.612  27.350  -9.710   1.00 123.67 ? 362 ASP A N     1 
ATOM   2820  C  CA    . ASP A 1 362 ? 23.485  28.723  -9.285   1.00 139.81 ? 362 ASP A CA    1 
ATOM   2821  C  C     . ASP A 1 362 ? 22.884  29.593  -10.351  1.00 130.59 ? 362 ASP A C     1 
ATOM   2822  O  O     . ASP A 1 362 ? 22.034  30.438  -10.069  1.00 115.29 ? 362 ASP A O     1 
ATOM   2823  C  CB    . ASP A 1 362 ? 24.815  29.347  -8.886   1.00 153.21 ? 362 ASP A CB    1 
ATOM   2824  C  CG    . ASP A 1 362 ? 25.446  28.683  -7.681   1.00 162.96 ? 362 ASP A CG    1 
ATOM   2825  O  OD1   . ASP A 1 362 ? 24.759  28.310  -6.702   1.00 172.60 ? 362 ASP A OD1   1 
ATOM   2826  O  OD2   . ASP A 1 362 ? 26.680  28.564  -7.688   1.00 158.79 ? 362 ASP A OD2   1 
ATOM   2827  N  N     . GLU A 1 363 ? 23.260  29.375  -11.594  1.00 143.53 ? 363 GLU A N     1 
ATOM   2828  C  CA    . GLU A 1 363 ? 22.663  30.094  -12.718  1.00 158.13 ? 363 GLU A CA    1 
ATOM   2829  C  C     . GLU A 1 363 ? 21.211  29.674  -12.932  1.00 145.37 ? 363 GLU A C     1 
ATOM   2830  O  O     . GLU A 1 363 ? 20.311  30.504  -12.946  1.00 129.14 ? 363 GLU A O     1 
ATOM   2831  C  CB    . GLU A 1 363 ? 23.417  29.838  -14.030  1.00 182.20 ? 363 GLU A CB    1 
ATOM   2832  C  CG    . GLU A 1 363 ? 24.759  30.541  -14.139  1.00 201.61 ? 363 GLU A CG    1 
ATOM   2833  C  CD    . GLU A 1 363 ? 25.969  29.632  -14.438  1.00 202.17 ? 363 GLU A CD    1 
ATOM   2834  O  OE1   . GLU A 1 363 ? 25.943  28.378  -14.234  1.00 209.90 ? 363 GLU A OE1   1 
ATOM   2835  O  OE2   . GLU A 1 363 ? 27.001  30.198  -14.857  1.00 200.51 ? 363 GLU A OE2   1 
ATOM   2836  N  N     . SER A 1 364 ? 21.019  28.370  -13.129  1.00 160.89 ? 364 SER A N     1 
ATOM   2837  C  CA    . SER A 1 364 ? 19.761  27.785  -13.610  1.00 167.64 ? 364 SER A CA    1 
ATOM   2838  C  C     . SER A 1 364 ? 18.706  27.329  -12.590  1.00 168.63 ? 364 SER A C     1 
ATOM   2839  O  O     . SER A 1 364 ? 17.560  27.075  -12.970  1.00 167.41 ? 364 SER A O     1 
ATOM   2840  C  CB    . SER A 1 364 ? 20.099  26.698  -14.620  1.00 169.41 ? 364 SER A CB    1 
ATOM   2841  O  OG    . SER A 1 364 ? 21.060  27.171  -15.550  1.00 168.47 ? 364 SER A OG    1 
ATOM   2842  N  N     . GLY A 1 365 ? 19.068  27.283  -11.314  1.00 161.37 ? 365 GLY A N     1 
ATOM   2843  C  CA    . GLY A 1 365 ? 18.150  26.924  -10.282  1.00 153.91 ? 365 GLY A CA    1 
ATOM   2844  C  C     . GLY A 1 365 ? 18.055  25.447  -10.018  1.00 161.33 ? 365 GLY A C     1 
ATOM   2845  O  O     . GLY A 1 365 ? 18.670  24.640  -10.677  1.00 166.50 ? 365 GLY A O     1 
ATOM   2846  N  N     . PRO A 1 366 ? 17.264  25.086  -9.017   1.00 168.86 ? 366 PRO A N     1 
ATOM   2847  C  CA    . PRO A 1 366 ? 17.015  23.715  -8.625   1.00 149.69 ? 366 PRO A CA    1 
ATOM   2848  C  C     . PRO A 1 366 ? 16.253  22.865  -9.620   1.00 118.32 ? 366 PRO A C     1 
ATOM   2849  O  O     . PRO A 1 366 ? 16.346  21.657  -9.545   1.00 107.08 ? 366 PRO A O     1 
ATOM   2850  C  CB    . PRO A 1 366 ? 16.170  23.846  -7.345   1.00 162.22 ? 366 PRO A CB    1 
ATOM   2851  C  CG    . PRO A 1 366 ? 16.240  25.257  -6.893   1.00 169.71 ? 366 PRO A CG    1 
ATOM   2852  C  CD    . PRO A 1 366 ? 16.745  26.072  -8.059   1.00 178.94 ? 366 PRO A CD    1 
ATOM   2853  N  N     . SER A 1 367 ? 15.453  23.477  -10.502  1.00 110.27 ? 367 SER A N     1 
ATOM   2854  C  CA    . SER A 1 367 ? 14.552  22.776  -11.368  1.00 109.33 ? 367 SER A CA    1 
ATOM   2855  C  C     . SER A 1 367 ? 15.355  21.985  -12.394  1.00 107.65 ? 367 SER A C     1 
ATOM   2856  O  O     . SER A 1 367 ? 14.790  21.033  -12.989  1.00 111.88 ? 367 SER A O     1 
ATOM   2857  C  CB    . SER A 1 367 ? 13.629  23.758  -12.128  1.00 113.19 ? 367 SER A CB    1 
ATOM   2858  O  OG    . SER A 1 367 ? 14.378  24.549  -13.040  1.00 116.58 ? 367 SER A OG    1 
ATOM   2859  N  N     . ILE A 1 368 ? 16.625  22.349  -12.558  1.00 109.15 ? 368 ILE A N     1 
ATOM   2860  C  CA    . ILE A 1 368 ? 17.442  21.742  -13.582  1.00 131.50 ? 368 ILE A CA    1 
ATOM   2861  C  C     . ILE A 1 368 ? 17.717  20.272  -13.347  1.00 136.90 ? 368 ILE A C     1 
ATOM   2862  O  O     . ILE A 1 368 ? 18.432  19.694  -14.181  1.00 143.22 ? 368 ILE A O     1 
ATOM   2863  C  CB    . ILE A 1 368 ? 18.788  22.428  -13.772  1.00 147.62 ? 368 ILE A CB    1 
ATOM   2864  C  CG1   . ILE A 1 368 ? 19.702  22.241  -12.537  1.00 142.49 ? 368 ILE A CG1   1 
ATOM   2865  C  CG2   . ILE A 1 368 ? 18.617  23.876  -14.209  1.00 174.80 ? 368 ILE A CG2   1 
ATOM   2866  C  CD1   . ILE A 1 368 ? 20.852  21.271  -12.733  1.00 131.52 ? 368 ILE A CD1   1 
ATOM   2867  N  N     . VAL A 1 369 ? 17.211  19.656  -12.268  1.00 138.04 ? 369 VAL A N     1 
ATOM   2868  C  CA    . VAL A 1 369 ? 17.540  18.286  -11.984  1.00 118.49 ? 369 VAL A CA    1 
ATOM   2869  C  C     . VAL A 1 369 ? 16.991  17.418  -13.092  1.00 112.30 ? 369 VAL A C     1 
ATOM   2870  O  O     . VAL A 1 369 ? 17.686  16.592  -13.660  1.00 114.24 ? 369 VAL A O     1 
ATOM   2871  C  CB    . VAL A 1 369 ? 16.977  17.813  -10.650  1.00 117.64 ? 369 VAL A CB    1 
ATOM   2872  C  CG1   . VAL A 1 369 ? 17.394  16.381  -10.381  1.00 117.12 ? 369 VAL A CG1   1 
ATOM   2873  C  CG2   . VAL A 1 369 ? 17.466  18.692  -9.520   1.00 126.34 ? 369 VAL A CG2   1 
ATOM   2874  N  N     . HIS A 1 370 ? 15.746  17.670  -13.470  1.00 111.78 ? 370 HIS A N     1 
ATOM   2875  C  CA    . HIS A 1 370 ? 15.068  16.851  -14.479  1.00 122.97 ? 370 HIS A CA    1 
ATOM   2876  C  C     . HIS A 1 370 ? 15.566  17.050  -15.904  1.00 120.38 ? 370 HIS A C     1 
ATOM   2877  O  O     . HIS A 1 370 ? 15.699  16.118  -16.683  1.00 110.28 ? 370 HIS A O     1 
ATOM   2878  C  CB    . HIS A 1 370 ? 13.557  17.169  -14.444  1.00 137.11 ? 370 HIS A CB    1 
ATOM   2879  C  CG    . HIS A 1 370 ? 12.958  16.964  -13.086  1.00 154.52 ? 370 HIS A CG    1 
ATOM   2880  N  ND1   . HIS A 1 370 ? 12.815  15.711  -12.516  1.00 170.12 ? 370 HIS A ND1   1 
ATOM   2881  C  CD2   . HIS A 1 370 ? 12.457  17.844  -12.188  1.00 143.77 ? 370 HIS A CD2   1 
ATOM   2882  C  CE1   . HIS A 1 370 ? 12.267  15.829  -11.317  1.00 173.61 ? 370 HIS A CE1   1 
ATOM   2883  N  NE2   . HIS A 1 370 ? 12.025  17.112  -11.106  1.00 167.52 ? 370 HIS A NE2   1 
ATOM   2884  N  N     . ARG A 1 371 ? 15.810  18.301  -16.217  1.00 139.14 ? 371 ARG A N     1 
ATOM   2885  C  CA    . ARG A 1 371 ? 16.436  18.719  -17.461  1.00 168.64 ? 371 ARG A CA    1 
ATOM   2886  C  C     . ARG A 1 371 ? 17.656  17.913  -17.805  1.00 155.22 ? 371 ARG A C     1 
ATOM   2887  O  O     . ARG A 1 371 ? 17.777  17.391  -18.908  1.00 160.83 ? 371 ARG A O     1 
ATOM   2888  C  CB    . ARG A 1 371 ? 16.785  20.171  -17.260  1.00 207.95 ? 371 ARG A CB    1 
ATOM   2889  C  CG    . ARG A 1 371 ? 17.452  20.868  -18.404  1.00 223.19 ? 371 ARG A CG    1 
ATOM   2890  C  CD    . ARG A 1 371 ? 17.644  22.314  -17.979  1.00 228.86 ? 371 ARG A CD    1 
ATOM   2891  N  NE    . ARG A 1 371 ? 18.359  23.126  -18.977  1.00 246.79 ? 371 ARG A NE    1 
ATOM   2892  C  CZ    . ARG A 1 371 ? 18.577  24.443  -18.875  1.00 275.88 ? 371 ARG A CZ    1 
ATOM   2893  N  NH1   . ARG A 1 371 ? 18.126  25.105  -17.810  1.00 274.27 ? 371 ARG A NH1   1 
ATOM   2894  N  NH2   . ARG A 1 371 ? 19.243  25.117  -19.840  1.00 301.27 ? 371 ARG A NH2   1 
ATOM   2895  N  N     . LYS A 1 372 ? 18.569  17.787  -16.854  1.00 131.54 ? 372 LYS A N     1 
ATOM   2896  C  CA    . LYS A 1 372 ? 19.836  17.152  -17.160  1.00 119.53 ? 372 LYS A CA    1 
ATOM   2897  C  C     . LYS A 1 372 ? 19.817  15.645  -16.996  1.00 124.41 ? 372 LYS A C     1 
ATOM   2898  O  O     . LYS A 1 372 ? 20.187  14.908  -17.922  1.00 140.86 ? 372 LYS A O     1 
ATOM   2899  C  CB    . LYS A 1 372 ? 20.980  17.723  -16.314  1.00 123.12 ? 372 LYS A CB    1 
ATOM   2900  C  CG    . LYS A 1 372 ? 22.372  17.331  -16.828  1.00 132.98 ? 372 LYS A CG    1 
ATOM   2901  C  CD    . LYS A 1 372 ? 23.505  17.915  -15.981  1.00 135.24 ? 372 LYS A CD    1 
ATOM   2902  C  CE    . LYS A 1 372 ? 23.738  19.407  -16.208  1.00 127.61 ? 372 LYS A CE    1 
ATOM   2903  N  NZ    . LYS A 1 372 ? 24.473  19.659  -17.479  1.00 133.79 ? 372 LYS A NZ    1 
ATOM   2904  N  N     . CYS A 1 373 ? 19.433  15.178  -15.816  1.00 140.24 ? 373 CYS A N     1 
ATOM   2905  C  CA    . CYS A 1 373 ? 19.545  13.781  -15.520  1.00 156.43 ? 373 CYS A CA    1 
ATOM   2906  C  C     . CYS A 1 373 ? 18.178  13.178  -15.663  1.00 170.29 ? 373 CYS A C     1 
ATOM   2907  O  O     . CYS A 1 373 ? 17.167  13.879  -15.688  1.00 191.90 ? 373 CYS A O     1 
ATOM   2908  C  CB    . CYS A 1 373 ? 20.146  13.605  -14.119  1.00 146.16 ? 373 CYS A CB    1 
ATOM   2909  S  SG    . CYS A 1 373 ? 19.042  13.994  -12.772  1.00 147.54 ? 373 CYS A SG    1 
ATOM   2910  N  N     . PHE A 1 374 ? 18.168  11.857  -15.795  1.00 172.98 ? 374 PHE A N     1 
ATOM   2911  C  CA    . PHE A 1 374 ? 16.976  11.046  -15.765  1.00 185.64 ? 374 PHE A CA    1 
ATOM   2912  C  C     . PHE A 1 374 ? 16.348  10.934  -14.344  1.00 204.35 ? 374 PHE A C     1 
ATOM   2913  O  O     . PHE A 1 374 ? 15.145  10.717  -14.179  1.00 211.62 ? 374 PHE A O     1 
ATOM   2914  C  CB    . PHE A 1 374 ? 17.366  9.660   -16.310  1.00 179.89 ? 374 PHE A CB    1 
ATOM   2915  C  CG    . PHE A 1 374 ? 16.251  8.675   -16.381  1.00 172.32 ? 374 PHE A CG    1 
ATOM   2916  C  CD1   . PHE A 1 374 ? 15.384  8.668   -17.454  1.00 163.32 ? 374 PHE A CD1   1 
ATOM   2917  C  CD2   . PHE A 1 374 ? 16.118  7.684   -15.420  1.00 165.06 ? 374 PHE A CD2   1 
ATOM   2918  C  CE1   . PHE A 1 374 ? 14.375  7.733   -17.547  1.00 147.27 ? 374 PHE A CE1   1 
ATOM   2919  C  CE2   . PHE A 1 374 ? 15.110  6.750   -15.509  1.00 150.19 ? 374 PHE A CE2   1 
ATOM   2920  C  CZ    . PHE A 1 374 ? 14.239  6.775   -16.571  1.00 142.90 ? 374 PHE A CZ    1 
ATOM   2921  O  OXT   . PHE A 1 374 ? 17.026  11.095  -13.323  1.00 199.90 ? 374 PHE A OXT   1 
ATOM   2922  N  N     . GLU B 1 1   ? 32.978  34.519  49.895   1.00 398.78 ? 1   GLU B N     1 
ATOM   2923  C  CA    . GLU B 1 1   ? 33.395  33.154  49.428   1.00 390.83 ? 1   GLU B CA    1 
ATOM   2924  C  C     . GLU B 1 1   ? 32.835  32.851  48.053   1.00 387.69 ? 1   GLU B C     1 
ATOM   2925  O  O     . GLU B 1 1   ? 31.850  33.463  47.622   1.00 396.23 ? 1   GLU B O     1 
ATOM   2926  C  CB    . GLU B 1 1   ? 33.014  32.071  50.446   1.00 379.66 ? 1   GLU B CB    1 
ATOM   2927  C  CG    . GLU B 1 1   ? 31.528  31.908  50.685   1.00 372.87 ? 1   GLU B CG    1 
ATOM   2928  C  CD    . GLU B 1 1   ? 30.968  32.802  51.780   1.00 366.43 ? 1   GLU B CD    1 
ATOM   2929  O  OE1   . GLU B 1 1   ? 31.572  33.848  52.104   1.00 363.69 ? 1   GLU B OE1   1 
ATOM   2930  O  OE2   . GLU B 1 1   ? 29.901  32.453  52.316   1.00 361.68 ? 1   GLU B OE2   1 
ATOM   2931  N  N     . GLU B 1 2   ? 33.487  31.927  47.374   1.00 373.13 ? 2   GLU B N     1 
ATOM   2932  C  CA    . GLU B 1 2   ? 33.043  31.510  46.064   1.00 363.89 ? 2   GLU B CA    1 
ATOM   2933  C  C     . GLU B 1 2   ? 32.056  30.356  46.229   1.00 371.02 ? 2   GLU B C     1 
ATOM   2934  O  O     . GLU B 1 2   ? 32.200  29.564  47.161   1.00 375.57 ? 2   GLU B O     1 
ATOM   2935  C  CB    . GLU B 1 2   ? 34.226  31.082  45.207   1.00 349.43 ? 2   GLU B CB    1 
ATOM   2936  C  CG    . GLU B 1 2   ? 35.078  32.216  44.662   1.00 338.91 ? 2   GLU B CG    1 
ATOM   2937  C  CD    . GLU B 1 2   ? 36.118  31.723  43.697   1.00 329.17 ? 2   GLU B CD    1 
ATOM   2938  O  OE1   . GLU B 1 2   ? 36.482  30.527  43.735   1.00 321.97 ? 2   GLU B OE1   1 
ATOM   2939  O  OE2   . GLU B 1 2   ? 36.578  32.541  42.889   1.00 325.68 ? 2   GLU B OE2   1 
ATOM   2940  N  N     . GLU B 1 3   ? 31.037  30.307  45.365   1.00 374.04 ? 3   GLU B N     1 
ATOM   2941  C  CA    . GLU B 1 3   ? 29.962  29.292  45.393   1.00 367.31 ? 3   GLU B CA    1 
ATOM   2942  C  C     . GLU B 1 3   ? 29.056  29.239  46.650   1.00 360.36 ? 3   GLU B C     1 
ATOM   2943  O  O     . GLU B 1 3   ? 28.007  28.592  46.606   1.00 355.06 ? 3   GLU B O     1 
ATOM   2944  C  CB    . GLU B 1 3   ? 30.520  27.905  45.064   1.00 359.74 ? 3   GLU B CB    1 
ATOM   2945  C  CG    . GLU B 1 3   ? 31.152  27.800  43.679   1.00 348.73 ? 3   GLU B CG    1 
ATOM   2946  C  CD    . GLU B 1 3   ? 31.737  26.451  43.475   1.00 332.57 ? 3   GLU B CD    1 
ATOM   2947  O  OE1   . GLU B 1 3   ? 31.872  25.723  44.475   1.00 328.13 ? 3   GLU B OE1   1 
ATOM   2948  O  OE2   . GLU B 1 3   ? 32.069  26.103  42.321   1.00 317.31 ? 3   GLU B OE2   1 
ATOM   2949  N  N     . ILE B 1 4   ? 29.452  29.898  47.753   1.00 355.87 ? 4   ILE B N     1 
ATOM   2950  C  CA    . ILE B 1 4   ? 28.689  30.002  48.998   1.00 348.96 ? 4   ILE B CA    1 
ATOM   2951  C  C     . ILE B 1 4   ? 28.478  28.671  49.741   1.00 330.01 ? 4   ILE B C     1 
ATOM   2952  O  O     . ILE B 1 4   ? 27.767  28.584  50.727   1.00 328.21 ? 4   ILE B O     1 
ATOM   2953  C  CB    . ILE B 1 4   ? 27.359  30.735  48.758   1.00 349.35 ? 4   ILE B CB    1 
ATOM   2954  C  CG1   . ILE B 1 4   ? 27.556  31.938  47.839   1.00 346.84 ? 4   ILE B CG1   1 
ATOM   2955  C  CG2   . ILE B 1 4   ? 26.773  31.190  50.068   1.00 347.32 ? 4   ILE B CG2   1 
ATOM   2956  C  CD1   . ILE B 1 4   ? 28.549  32.969  48.331   1.00 349.01 ? 4   ILE B CD1   1 
ATOM   2957  N  N     . ALA B 1 5   ? 29.129  27.624  49.276   1.00 304.92 ? 5   ALA B N     1 
ATOM   2958  C  CA    . ALA B 1 5   ? 28.678  26.303  49.617   1.00 286.05 ? 5   ALA B CA    1 
ATOM   2959  C  C     . ALA B 1 5   ? 27.184  26.050  49.269   1.00 266.92 ? 5   ALA B C     1 
ATOM   2960  O  O     . ALA B 1 5   ? 26.608  26.720  48.427   1.00 265.44 ? 5   ALA B O     1 
ATOM   2961  C  CB    . ALA B 1 5   ? 29.002  25.976  51.084   1.00 288.48 ? 5   ALA B CB    1 
ATOM   2962  N  N     . ALA B 1 6   ? 26.584  25.042  49.880   1.00 242.91 ? 6   ALA B N     1 
ATOM   2963  C  CA    . ALA B 1 6   ? 25.131  24.835  49.819   1.00 219.21 ? 6   ALA B CA    1 
ATOM   2964  C  C     . ALA B 1 6   ? 24.790  23.841  50.891   1.00 213.66 ? 6   ALA B C     1 
ATOM   2965  O  O     . ALA B 1 6   ? 25.711  23.179  51.445   1.00 200.55 ? 6   ALA B O     1 
ATOM   2966  C  CB    . ALA B 1 6   ? 24.692  24.313  48.462   1.00 207.04 ? 6   ALA B CB    1 
ATOM   2967  N  N     . LEU B 1 7   ? 23.524  23.777  51.262   1.00 215.22 ? 7   LEU B N     1 
ATOM   2968  C  CA    . LEU B 1 7   ? 23.090  22.961  52.378   1.00 215.16 ? 7   LEU B CA    1 
ATOM   2969  C  C     . LEU B 1 7   ? 22.256  21.852  51.826   1.00 202.81 ? 7   LEU B C     1 
ATOM   2970  O  O     . LEU B 1 7   ? 21.590  22.025  50.815   1.00 192.00 ? 7   LEU B O     1 
ATOM   2971  C  CB    . LEU B 1 7   ? 22.279  23.763  53.415   1.00 226.70 ? 7   LEU B CB    1 
ATOM   2972  C  CG    . LEU B 1 7   ? 23.130  24.710  54.279   1.00 244.06 ? 7   LEU B CG    1 
ATOM   2973  C  CD1   . LEU B 1 7   ? 22.283  25.527  55.242   1.00 257.25 ? 7   LEU B CD1   1 
ATOM   2974  C  CD2   . LEU B 1 7   ? 24.288  23.967  54.955   1.00 241.80 ? 7   LEU B CD2   1 
ATOM   2975  N  N     . VAL B 1 8   ? 22.294  20.697  52.464   1.00 186.32 ? 8   VAL B N     1 
ATOM   2976  C  CA    . VAL B 1 8   ? 21.532  19.555  51.986   1.00 170.00 ? 8   VAL B CA    1 
ATOM   2977  C  C     . VAL B 1 8   ? 20.823  18.900  53.144   1.00 162.68 ? 8   VAL B C     1 
ATOM   2978  O  O     . VAL B 1 8   ? 21.445  18.651  54.173   1.00 161.06 ? 8   VAL B O     1 
ATOM   2979  C  CB    . VAL B 1 8   ? 22.419  18.550  51.235   1.00 169.67 ? 8   VAL B CB    1 
ATOM   2980  C  CG1   . VAL B 1 8   ? 21.518  17.433  50.714   1.00 172.16 ? 8   VAL B CG1   1 
ATOM   2981  C  CG2   . VAL B 1 8   ? 23.213  19.266  50.110   1.00 176.44 ? 8   VAL B CG2   1 
ATOM   2982  N  N     . ILE B 1 9   ? 19.528  18.650  53.006   1.00 174.82 ? 9   ILE B N     1 
ATOM   2983  C  CA    . ILE B 1 9   ? 18.818  17.912  54.039   1.00 197.96 ? 9   ILE B CA    1 
ATOM   2984  C  C     . ILE B 1 9   ? 17.939  16.783  53.498   1.00 217.81 ? 9   ILE B C     1 
ATOM   2985  O  O     . ILE B 1 9   ? 17.156  16.996  52.581   1.00 232.19 ? 9   ILE B O     1 
ATOM   2986  C  CB    . ILE B 1 9   ? 17.992  18.891  54.893   1.00 210.66 ? 9   ILE B CB    1 
ATOM   2987  C  CG1   . ILE B 1 9   ? 18.908  20.027  55.368   1.00 227.27 ? 9   ILE B CG1   1 
ATOM   2988  C  CG2   . ILE B 1 9   ? 17.323  18.113  56.018   1.00 217.64 ? 9   ILE B CG2   1 
ATOM   2989  C  CD1   . ILE B 1 9   ? 18.332  20.920  56.419   1.00 231.18 ? 9   ILE B CD1   1 
ATOM   2990  N  N     . ASP B 1 10  ? 18.139  15.589  54.058   1.00 230.65 ? 10  ASP B N     1 
ATOM   2991  C  CA    . ASP B 1 10  ? 17.332  14.434  53.715   1.00 239.28 ? 10  ASP B CA    1 
ATOM   2992  C  C     . ASP B 1 10  ? 16.390  14.247  54.932   1.00 234.34 ? 10  ASP B C     1 
ATOM   2993  O  O     . ASP B 1 10  ? 16.798  13.975  56.095   1.00 231.12 ? 10  ASP B O     1 
ATOM   2994  C  CB    . ASP B 1 10  ? 18.170  13.199  53.425   1.00 252.37 ? 10  ASP B CB    1 
ATOM   2995  C  CG    . ASP B 1 10  ? 17.352  11.938  53.373   1.00 264.97 ? 10  ASP B CG    1 
ATOM   2996  O  OD1   . ASP B 1 10  ? 16.136  11.944  53.660   1.00 274.67 ? 10  ASP B OD1   1 
ATOM   2997  O  OD2   . ASP B 1 10  ? 17.923  10.915  53.035   1.00 273.41 ? 10  ASP B OD2   1 
ATOM   2998  N  N     . ASN B 1 11  ? 15.111  14.494  54.679   1.00 241.17 ? 11  ASN B N     1 
ATOM   2999  C  CA    . ASN B 1 11  ? 14.057  14.061  55.565   1.00 249.52 ? 11  ASN B CA    1 
ATOM   3000  C  C     . ASN B 1 11  ? 13.027  13.068  54.986   1.00 266.88 ? 11  ASN B C     1 
ATOM   3001  O  O     . ASN B 1 11  ? 11.869  13.395  54.713   1.00 277.48 ? 11  ASN B O     1 
ATOM   3002  C  CB    . ASN B 1 11  ? 13.294  15.247  56.103   1.00 239.32 ? 11  ASN B CB    1 
ATOM   3003  C  CG    . ASN B 1 11  ? 13.864  15.727  57.389   1.00 237.84 ? 11  ASN B CG    1 
ATOM   3004  O  OD1   . ASN B 1 11  ? 14.574  14.982  58.046   1.00 237.88 ? 11  ASN B OD1   1 
ATOM   3005  N  ND2   . ASN B 1 11  ? 13.581  16.965  57.753   1.00 233.45 ? 11  ASN B ND2   1 
ATOM   3006  N  N     . GLY B 1 12  ? 13.431  11.818  54.859   1.00 261.42 ? 12  GLY B N     1 
ATOM   3007  C  CA    . GLY B 1 12  ? 12.445  10.701  54.941   1.00 241.33 ? 12  GLY B CA    1 
ATOM   3008  C  C     . GLY B 1 12  ? 12.206  10.654  56.418   1.00 226.55 ? 12  GLY B C     1 
ATOM   3009  O  O     . GLY B 1 12  ? 13.053  11.146  57.203   1.00 216.42 ? 12  GLY B O     1 
ATOM   3010  N  N     . SER B 1 13  ? 11.088  10.039  56.808   1.00 228.38 ? 13  SER B N     1 
ATOM   3011  C  CA    . SER B 1 13  ? 10.785  9.855   58.218   1.00 234.91 ? 13  SER B CA    1 
ATOM   3012  C  C     . SER B 1 13  ? 11.952  9.192   58.922   1.00 240.44 ? 13  SER B C     1 
ATOM   3013  O  O     . SER B 1 13  ? 12.670  8.397   58.318   1.00 229.71 ? 13  SER B O     1 
ATOM   3014  C  CB    . SER B 1 13  ? 9.575   8.944   58.482   1.00 244.39 ? 13  SER B CB    1 
ATOM   3015  O  OG    . SER B 1 13  ? 8.405   9.389   57.826   1.00 250.16 ? 13  SER B OG    1 
ATOM   3016  N  N     . GLY B 1 14  ? 12.116  9.519   60.196   1.00 257.75 ? 14  GLY B N     1 
ATOM   3017  C  CA    . GLY B 1 14  ? 13.014  8.776   61.104   1.00 278.27 ? 14  GLY B CA    1 
ATOM   3018  C  C     . GLY B 1 14  ? 14.304  9.495   61.421   1.00 279.90 ? 14  GLY B C     1 
ATOM   3019  O  O     . GLY B 1 14  ? 14.727  9.674   62.565   1.00 289.56 ? 14  GLY B O     1 
ATOM   3020  N  N     . MET B 1 15  ? 14.947  9.945   60.350   1.00 270.94 ? 15  MET B N     1 
ATOM   3021  C  CA    . MET B 1 15  ? 16.245  10.587  60.524   1.00 267.65 ? 15  MET B CA    1 
ATOM   3022  C  C     . MET B 1 15  ? 16.353  11.820  59.699   1.00 269.92 ? 15  MET B C     1 
ATOM   3023  O  O     . MET B 1 15  ? 15.961  11.821  58.542   1.00 261.13 ? 15  MET B O     1 
ATOM   3024  C  CB    . MET B 1 15  ? 17.408  9.672   60.094   1.00 264.58 ? 15  MET B CB    1 
ATOM   3025  C  CG    . MET B 1 15  ? 17.571  8.425   60.967   1.00 266.32 ? 15  MET B CG    1 
ATOM   3026  S  SD    . MET B 1 15  ? 18.955  7.368   60.574   1.00 276.05 ? 15  MET B SD    1 
ATOM   3027  C  CE    . MET B 1 15  ? 20.215  8.284   61.446   1.00 282.05 ? 15  MET B CE    1 
ATOM   3028  N  N     . CYS B 1 16  ? 16.972  12.846  60.282   1.00 274.08 ? 16  CYS B N     1 
ATOM   3029  C  CA    . CYS B 1 16  ? 17.385  14.003  59.473   1.00 265.15 ? 16  CYS B CA    1 
ATOM   3030  C  C     . CYS B 1 16  ? 18.846  13.868  59.174   1.00 257.71 ? 16  CYS B C     1 
ATOM   3031  O  O     . CYS B 1 16  ? 19.683  13.827  60.102   1.00 264.32 ? 16  CYS B O     1 
ATOM   3032  C  CB    . CYS B 1 16  ? 17.301  15.361  60.212   1.00 263.60 ? 16  CYS B CB    1 
ATOM   3033  S  SG    . CYS B 1 16  ? 15.722  16.171  60.074   1.00 262.56 ? 16  CYS B SG    1 
ATOM   3034  N  N     . LYS B 1 17  ? 19.204  13.921  57.901   1.00 246.25 ? 17  LYS B N     1 
ATOM   3035  C  CA    . LYS B 1 17  ? 20.609  13.738  57.525   1.00 242.23 ? 17  LYS B CA    1 
ATOM   3036  C  C     . LYS B 1 17  ? 20.980  15.033  56.865   1.00 228.02 ? 17  LYS B C     1 
ATOM   3037  O  O     . LYS B 1 17  ? 20.383  15.380  55.898   1.00 221.16 ? 17  LYS B O     1 
ATOM   3038  C  CB    . LYS B 1 17  ? 20.844  12.510  56.607   1.00 246.00 ? 17  LYS B CB    1 
ATOM   3039  C  CG    . LYS B 1 17  ? 20.647  11.146  57.286   1.00 244.49 ? 17  LYS B CG    1 
ATOM   3040  C  CD    . LYS B 1 17  ? 20.716  9.972   56.323   1.00 249.24 ? 17  LYS B CD    1 
ATOM   3041  C  CE    . LYS B 1 17  ? 19.437  9.721   55.532   1.00 255.62 ? 17  LYS B CE    1 
ATOM   3042  N  NZ    . LYS B 1 17  ? 19.454  8.364   54.943   1.00 256.37 ? 17  LYS B NZ    1 
ATOM   3043  N  N     . ALA B 1 18  ? 21.823  15.826  57.493   1.00 216.12 ? 18  ALA B N     1 
ATOM   3044  C  CA    . ALA B 1 18  ? 22.062  17.178  57.007   1.00 204.94 ? 18  ALA B CA    1 
ATOM   3045  C  C     . ALA B 1 18  ? 23.532  17.484  57.064   1.00 199.91 ? 18  ALA B C     1 
ATOM   3046  O  O     . ALA B 1 18  ? 24.297  16.920  57.848   1.00 201.32 ? 18  ALA B O     1 
ATOM   3047  C  CB    . ALA B 1 18  ? 21.337  18.240  57.818   1.00 209.79 ? 18  ALA B CB    1 
ATOM   3048  N  N     . GLY B 1 19  ? 23.954  18.404  56.195   1.00 202.94 ? 19  GLY B N     1 
ATOM   3049  C  CA    . GLY B 1 19  ? 25.340  18.781  56.160   1.00 204.82 ? 19  GLY B CA    1 
ATOM   3050  C  C     . GLY B 1 19  ? 25.572  19.702  54.999   1.00 198.58 ? 19  GLY B C     1 
ATOM   3051  O  O     . GLY B 1 19  ? 24.632  20.063  54.268   1.00 201.94 ? 19  GLY B O     1 
ATOM   3052  N  N     . PHE B 1 20  ? 26.829  20.077  54.811   1.00 197.45 ? 20  PHE B N     1 
ATOM   3053  C  CA    . PHE B 1 20  ? 27.197  20.908  53.676   1.00 203.51 ? 20  PHE B CA    1 
ATOM   3054  C  C     . PHE B 1 20  ? 27.323  20.134  52.382   1.00 190.95 ? 20  PHE B C     1 
ATOM   3055  O  O     . PHE B 1 20  ? 28.014  19.123  52.262   1.00 175.68 ? 20  PHE B O     1 
ATOM   3056  C  CB    . PHE B 1 20  ? 28.484  21.612  53.962   1.00 226.17 ? 20  PHE B CB    1 
ATOM   3057  C  CG    . PHE B 1 20  ? 28.404  22.535  55.128   1.00 241.87 ? 20  PHE B CG    1 
ATOM   3058  C  CD1   . PHE B 1 20  ? 27.865  23.800  54.982   1.00 253.22 ? 20  PHE B CD1   1 
ATOM   3059  C  CD2   . PHE B 1 20  ? 28.884  22.160  56.362   1.00 243.70 ? 20  PHE B CD2   1 
ATOM   3060  C  CE1   . PHE B 1 20  ? 27.793  24.665  56.048   1.00 253.67 ? 20  PHE B CE1   1 
ATOM   3061  C  CE2   . PHE B 1 20  ? 28.819  23.022  57.435   1.00 246.68 ? 20  PHE B CE2   1 
ATOM   3062  C  CZ    . PHE B 1 20  ? 28.272  24.277  57.277   1.00 249.65 ? 20  PHE B CZ    1 
ATOM   3063  N  N     . ALA B 1 21  ? 26.730  20.690  51.338   1.00 195.83 ? 21  ALA B N     1 
ATOM   3064  C  CA    . ALA B 1 21  ? 26.968  20.203  49.999   1.00 207.66 ? 21  ALA B CA    1 
ATOM   3065  C  C     . ALA B 1 21  ? 28.428  20.347  49.715   1.00 217.22 ? 21  ALA B C     1 
ATOM   3066  O  O     . ALA B 1 21  ? 29.005  21.364  50.058   1.00 223.01 ? 21  ALA B O     1 
ATOM   3067  C  CB    . ALA B 1 21  ? 26.233  21.050  49.010   1.00 214.36 ? 21  ALA B CB    1 
ATOM   3068  N  N     . GLY B 1 22  ? 29.023  19.358  49.061   1.00 223.92 ? 22  GLY B N     1 
ATOM   3069  C  CA    . GLY B 1 22  ? 30.422  19.442  48.726   1.00 228.97 ? 22  GLY B CA    1 
ATOM   3070  C  C     . GLY B 1 22  ? 31.252  18.634  49.701   1.00 235.81 ? 22  GLY B C     1 
ATOM   3071  O  O     . GLY B 1 22  ? 32.434  18.831  49.767   1.00 231.65 ? 22  GLY B O     1 
ATOM   3072  N  N     . ASP B 1 23  ? 30.623  17.771  50.490   1.00 238.53 ? 23  ASP B N     1 
ATOM   3073  C  CA    . ASP B 1 23  ? 31.343  16.935  51.404   1.00 240.06 ? 23  ASP B CA    1 
ATOM   3074  C  C     . ASP B 1 23  ? 30.802  15.530  51.218   1.00 219.23 ? 23  ASP B C     1 
ATOM   3075  O  O     . ASP B 1 23  ? 29.707  15.334  50.720   1.00 216.70 ? 23  ASP B O     1 
ATOM   3076  C  CB    . ASP B 1 23  ? 31.167  17.411  52.844   1.00 255.26 ? 23  ASP B CB    1 
ATOM   3077  C  CG    . ASP B 1 23  ? 32.112  18.539  53.186   1.00 266.74 ? 23  ASP B CG    1 
ATOM   3078  O  OD1   . ASP B 1 23  ? 33.142  18.622  52.492   1.00 261.12 ? 23  ASP B OD1   1 
ATOM   3079  O  OD2   . ASP B 1 23  ? 31.853  19.343  54.122   1.00 277.47 ? 23  ASP B OD2   1 
ATOM   3080  N  N     . ASP B 1 24  ? 31.612  14.548  51.580   1.00 213.79 ? 24  ASP B N     1 
ATOM   3081  C  CA    . ASP B 1 24  ? 31.298  13.150  51.347   1.00 215.17 ? 24  ASP B CA    1 
ATOM   3082  C  C     . ASP B 1 24  ? 30.420  12.568  52.415   1.00 205.19 ? 24  ASP B C     1 
ATOM   3083  O  O     . ASP B 1 24  ? 29.853  11.535  52.156   1.00 210.01 ? 24  ASP B O     1 
ATOM   3084  C  CB    . ASP B 1 24  ? 32.575  12.277  51.140   1.00 231.93 ? 24  ASP B CB    1 
ATOM   3085  C  CG    . ASP B 1 24  ? 33.648  12.479  52.226   1.00 245.70 ? 24  ASP B CG    1 
ATOM   3086  O  OD1   . ASP B 1 24  ? 33.491  13.366  53.096   1.00 255.72 ? 24  ASP B OD1   1 
ATOM   3087  O  OD2   . ASP B 1 24  ? 34.666  11.758  52.186   1.00 249.94 ? 24  ASP B OD2   1 
ATOM   3088  N  N     . ALA B 1 25  ? 30.327  13.183  53.596   1.00 198.61 ? 25  ALA B N     1 
ATOM   3089  C  CA    . ALA B 1 25  ? 29.378  12.736  54.600   1.00 200.69 ? 25  ALA B CA    1 
ATOM   3090  C  C     . ALA B 1 25  ? 28.739  13.926  55.275   1.00 207.76 ? 25  ALA B C     1 
ATOM   3091  O  O     . ALA B 1 25  ? 29.342  14.977  55.441   1.00 219.32 ? 25  ALA B O     1 
ATOM   3092  C  CB    . ALA B 1 25  ? 30.052  11.867  55.665   1.00 198.64 ? 25  ALA B CB    1 
ATOM   3093  N  N     . PRO B 1 26  ? 27.508  13.755  55.716   1.00 195.48 ? 26  PRO B N     1 
ATOM   3094  C  CA    . PRO B 1 26  ? 26.800  14.775  56.426   1.00 194.46 ? 26  PRO B CA    1 
ATOM   3095  C  C     . PRO B 1 26  ? 27.381  14.985  57.793   1.00 212.03 ? 26  PRO B C     1 
ATOM   3096  O  O     . PRO B 1 26  ? 27.735  14.012  58.474   1.00 207.06 ? 26  PRO B O     1 
ATOM   3097  C  CB    . PRO B 1 26  ? 25.391  14.217  56.604   1.00 181.59 ? 26  PRO B CB    1 
ATOM   3098  C  CG    . PRO B 1 26  ? 25.500  12.783  56.299   1.00 179.78 ? 26  PRO B CG    1 
ATOM   3099  C  CD    . PRO B 1 26  ? 26.727  12.532  55.520   1.00 183.86 ? 26  PRO B CD    1 
ATOM   3100  N  N     . ARG B 1 27  ? 27.296  16.215  58.274   1.00 228.55 ? 27  ARG B N     1 
ATOM   3101  C  CA    . ARG B 1 27  ? 27.780  16.547  59.619   1.00 230.10 ? 27  ARG B CA    1 
ATOM   3102  C  C     . ARG B 1 27  ? 26.858  16.001  60.663   1.00 219.75 ? 27  ARG B C     1 
ATOM   3103  O  O     . ARG B 1 27  ? 27.276  15.441  61.674   1.00 206.14 ? 27  ARG B O     1 
ATOM   3104  C  CB    . ARG B 1 27  ? 27.909  18.055  59.846   1.00 239.58 ? 27  ARG B CB    1 
ATOM   3105  C  CG    . ARG B 1 27  ? 28.978  18.686  58.980   1.00 240.68 ? 27  ARG B CG    1 
ATOM   3106  C  CD    . ARG B 1 27  ? 30.401  18.630  59.569   1.00 238.31 ? 27  ARG B CD    1 
ATOM   3107  N  NE    . ARG B 1 27  ? 31.310  19.432  58.741   1.00 248.56 ? 27  ARG B NE    1 
ATOM   3108  C  CZ    . ARG B 1 27  ? 31.762  19.070  57.535   1.00 260.69 ? 27  ARG B CZ    1 
ATOM   3109  N  NH1   . ARG B 1 27  ? 31.383  17.906  57.016   1.00 266.93 ? 27  ARG B NH1   1 
ATOM   3110  N  NH2   . ARG B 1 27  ? 32.590  19.864  56.817   1.00 262.16 ? 27  ARG B NH2   1 
ATOM   3111  N  N     . ALA B 1 28  ? 25.569  16.254  60.472   1.00 215.49 ? 28  ALA B N     1 
ATOM   3112  C  CA    . ALA B 1 28  ? 24.618  15.926  61.551   1.00 207.79 ? 28  ALA B CA    1 
ATOM   3113  C  C     . ALA B 1 28  ? 23.624  14.926  61.049   1.00 202.97 ? 28  ALA B C     1 
ATOM   3114  O  O     . ALA B 1 28  ? 23.034  15.136  60.016   1.00 215.00 ? 28  ALA B O     1 
ATOM   3115  C  CB    . ALA B 1 28  ? 23.839  17.142  62.012   1.00 208.67 ? 28  ALA B CB    1 
ATOM   3116  N  N     . VAL B 1 29  ? 23.418  13.865  61.827   1.00 199.77 ? 29  VAL B N     1 
ATOM   3117  C  CA    . VAL B 1 29  ? 22.381  12.889  61.525   1.00 211.08 ? 29  VAL B CA    1 
ATOM   3118  C  C     . VAL B 1 29  ? 21.743  12.524  62.828   1.00 202.66 ? 29  VAL B C     1 
ATOM   3119  O  O     . VAL B 1 29  ? 22.412  12.046  63.745   1.00 214.38 ? 29  VAL B O     1 
ATOM   3120  C  CB    . VAL B 1 29  ? 22.921  11.616  60.864   1.00 229.42 ? 29  VAL B CB    1 
ATOM   3121  C  CG1   . VAL B 1 29  ? 23.463  11.952  59.480   1.00 245.79 ? 29  VAL B CG1   1 
ATOM   3122  C  CG2   . VAL B 1 29  ? 24.047  10.961  61.662   1.00 223.73 ? 29  VAL B CG2   1 
ATOM   3123  N  N     . PHE B 1 30  ? 20.442  12.785  62.986   1.00 192.58 ? 30  PHE B N     1 
ATOM   3124  C  CA    . PHE B 1 30  ? 19.792  12.554  64.267   1.00 190.24 ? 30  PHE B CA    1 
ATOM   3125  C  C     . PHE B 1 30  ? 18.354  12.183  64.006   1.00 191.57 ? 30  PHE B C     1 
ATOM   3126  O  O     . PHE B 1 30  ? 17.803  12.440  62.930   1.00 194.56 ? 30  PHE B O     1 
ATOM   3127  C  CB    . PHE B 1 30  ? 19.838  13.786  65.152   1.00 191.58 ? 30  PHE B CB    1 
ATOM   3128  C  CG    . PHE B 1 30  ? 19.213  14.959  64.500   1.00 184.73 ? 30  PHE B CG    1 
ATOM   3129  C  CD1   . PHE B 1 30  ? 17.863  15.159  64.571   1.00 184.97 ? 30  PHE B CD1   1 
ATOM   3130  C  CD2   . PHE B 1 30  ? 19.977  15.835  63.755   1.00 184.28 ? 30  PHE B CD2   1 
ATOM   3131  C  CE1   . PHE B 1 30  ? 17.262  16.238  63.954   1.00 192.34 ? 30  PHE B CE1   1 
ATOM   3132  C  CE2   . PHE B 1 30  ? 19.391  16.921  63.132   1.00 192.75 ? 30  PHE B CE2   1 
ATOM   3133  C  CZ    . PHE B 1 30  ? 18.028  17.115  63.233   1.00 195.37 ? 30  PHE B CZ    1 
ATOM   3134  N  N     . PRO B 1 31  ? 17.727  11.573  64.996   1.00 200.68 ? 31  PRO B N     1 
ATOM   3135  C  CA    . PRO B 1 31  ? 16.361  11.112  64.758   1.00 206.69 ? 31  PRO B CA    1 
ATOM   3136  C  C     . PRO B 1 31  ? 15.372  12.279  64.684   1.00 200.44 ? 31  PRO B C     1 
ATOM   3137  O  O     . PRO B 1 31  ? 15.472  13.208  65.432   1.00 192.10 ? 31  PRO B O     1 
ATOM   3138  C  CB    . PRO B 1 31  ? 16.095  10.163  65.936   1.00 210.51 ? 31  PRO B CB    1 
ATOM   3139  C  CG    . PRO B 1 31  ? 17.147  10.532  66.926   1.00 213.29 ? 31  PRO B CG    1 
ATOM   3140  C  CD    . PRO B 1 31  ? 18.337  10.862  66.126   1.00 203.64 ? 31  PRO B CD    1 
ATOM   3141  N  N     . SER B 1 32  ? 14.380  12.170  63.793   1.00 195.35 ? 32  SER B N     1 
ATOM   3142  C  CA    . SER B 1 32  ? 13.393  13.238  63.595   1.00 184.83 ? 32  SER B CA    1 
ATOM   3143  C  C     . SER B 1 32  ? 12.299  12.978  64.553   1.00 182.08 ? 32  SER B C     1 
ATOM   3144  O  O     . SER B 1 32  ? 11.298  12.336  64.154   1.00 177.89 ? 32  SER B O     1 
ATOM   3145  C  CB    . SER B 1 32  ? 12.782  13.232  62.175   1.00 185.36 ? 32  SER B CB    1 
ATOM   3146  O  OG    . SER B 1 32  ? 13.752  13.484  61.188   1.00 192.26 ? 32  SER B OG    1 
ATOM   3147  N  N     . ILE B 1 33  ? 12.487  13.417  65.793   1.00 189.85 ? 33  ILE B N     1 
ATOM   3148  C  CA    . ILE B 1 33  ? 11.494  13.139  66.810   1.00 204.06 ? 33  ILE B CA    1 
ATOM   3149  C  C     . ILE B 1 33  ? 11.305  14.390  67.619   1.00 205.71 ? 33  ILE B C     1 
ATOM   3150  O  O     . ILE B 1 33  ? 12.199  15.161  67.802   1.00 199.28 ? 33  ILE B O     1 
ATOM   3151  C  CB    . ILE B 1 33  ? 11.805  11.934  67.707   1.00 214.85 ? 33  ILE B CB    1 
ATOM   3152  C  CG1   . ILE B 1 33  ? 13.238  12.054  68.245   1.00 234.22 ? 33  ILE B CG1   1 
ATOM   3153  C  CG2   . ILE B 1 33  ? 11.513  10.641  66.959   1.00 208.45 ? 33  ILE B CG2   1 
ATOM   3154  C  CD1   . ILE B 1 33  ? 13.632  10.976  69.206   1.00 252.50 ? 33  ILE B CD1   1 
ATOM   3155  N  N     . VAL B 1 34  ? 10.064  14.626  68.003   1.00 215.06 ? 34  VAL B N     1 
ATOM   3156  C  CA    . VAL B 1 34  ? 9.703   15.726  68.886   1.00 227.58 ? 34  VAL B CA    1 
ATOM   3157  C  C     . VAL B 1 34  ? 9.089   15.101  70.114   1.00 236.02 ? 34  VAL B C     1 
ATOM   3158  O  O     . VAL B 1 34  ? 7.949   14.654  70.101   1.00 235.46 ? 34  VAL B O     1 
ATOM   3159  C  CB    . VAL B 1 34  ? 8.678   16.661  68.193   1.00 233.50 ? 34  VAL B CB    1 
ATOM   3160  C  CG1   . VAL B 1 34  ? 8.029   17.672  69.158   1.00 234.53 ? 34  VAL B CG1   1 
ATOM   3161  C  CG2   . VAL B 1 34  ? 9.358   17.350  67.018   1.00 241.39 ? 34  VAL B CG2   1 
ATOM   3162  N  N     . GLY B 1 35  ? 9.858   15.075  71.192   1.00 251.01 ? 35  GLY B N     1 
ATOM   3163  C  CA    . GLY B 1 35  ? 9.332   14.495  72.405   1.00 260.22 ? 35  GLY B CA    1 
ATOM   3164  C  C     . GLY B 1 35  ? 8.754   15.603  73.230   1.00 264.01 ? 35  GLY B C     1 
ATOM   3165  O  O     . GLY B 1 35  ? 9.272   16.726  73.267   1.00 270.27 ? 35  GLY B O     1 
ATOM   3166  N  N     . ARG B 1 36  ? 7.662   15.297  73.921   1.00 261.11 ? 36  ARG B N     1 
ATOM   3167  C  CA    . ARG B 1 36  ? 7.007   16.266  74.792   1.00 255.55 ? 36  ARG B CA    1 
ATOM   3168  C  C     . ARG B 1 36  ? 6.876   15.682  76.172   1.00 254.70 ? 36  ARG B C     1 
ATOM   3169  O  O     . ARG B 1 36  ? 6.662   14.520  76.341   1.00 258.36 ? 36  ARG B O     1 
ATOM   3170  C  CB    . ARG B 1 36  ? 5.589   16.645  74.293   1.00 251.27 ? 36  ARG B CB    1 
ATOM   3171  C  CG    . ARG B 1 36  ? 5.545   17.358  72.950   1.00 253.95 ? 36  ARG B CG    1 
ATOM   3172  C  CD    . ARG B 1 36  ? 4.196   17.875  72.505   1.00 254.69 ? 36  ARG B CD    1 
ATOM   3173  N  NE    . ARG B 1 36  ? 4.330   18.386  71.120   1.00 266.28 ? 36  ARG B NE    1 
ATOM   3174  C  CZ    . ARG B 1 36  ? 4.860   19.570  70.811   1.00 281.61 ? 36  ARG B CZ    1 
ATOM   3175  N  NH1   . ARG B 1 36  ? 5.239   20.375  71.795   1.00 291.92 ? 36  ARG B NH1   1 
ATOM   3176  N  NH2   . ARG B 1 36  ? 4.999   19.964  69.533   1.00 285.57 ? 36  ARG B NH2   1 
ATOM   3177  N  N     . PRO B 1 37  ? 7.086   16.503  77.168   1.00 260.91 ? 37  PRO B N     1 
ATOM   3178  C  CA    . PRO B 1 37  ? 6.919   16.076  78.529   1.00 266.47 ? 37  PRO B CA    1 
ATOM   3179  C  C     . PRO B 1 37  ? 5.452   15.809  78.820   1.00 267.03 ? 37  PRO B C     1 
ATOM   3180  O  O     . PRO B 1 37  ? 4.633   16.715  78.924   1.00 262.66 ? 37  PRO B O     1 
ATOM   3181  C  CB    . PRO B 1 37  ? 7.479   17.242  79.356   1.00 273.21 ? 37  PRO B CB    1 
ATOM   3182  C  CG    . PRO B 1 37  ? 7.589   18.369  78.398   1.00 273.41 ? 37  PRO B CG    1 
ATOM   3183  C  CD    . PRO B 1 37  ? 7.827   17.748  77.067   1.00 266.38 ? 37  PRO B CD    1 
ATOM   3184  N  N     . ARG B 1 38  ? 5.130   14.520  78.841   1.00 275.24 ? 38  ARG B N     1 
ATOM   3185  C  CA    . ARG B 1 38  ? 3.798   14.012  79.146   1.00 290.99 ? 38  ARG B CA    1 
ATOM   3186  C  C     . ARG B 1 38  ? 3.512   14.088  80.609   1.00 301.91 ? 38  ARG B C     1 
ATOM   3187  O  O     . ARG B 1 38  ? 2.395   14.374  81.008   1.00 303.21 ? 38  ARG B O     1 
ATOM   3188  C  CB    . ARG B 1 38  ? 3.646   12.554  78.601   1.00 295.68 ? 38  ARG B CB    1 
ATOM   3189  C  CG    . ARG B 1 38  ? 2.654   11.605  79.290   1.00 298.45 ? 38  ARG B CG    1 
ATOM   3190  C  CD    . ARG B 1 38  ? 3.107   10.141  79.250   1.00 298.97 ? 38  ARG B CD    1 
ATOM   3191  N  NE    . ARG B 1 38  ? 4.500   9.991   79.728   1.00 307.89 ? 38  ARG B NE    1 
ATOM   3192  C  CZ    . ARG B 1 38  ? 5.109   8.822   79.913   1.00 316.82 ? 38  ARG B CZ    1 
ATOM   3193  N  NH1   . ARG B 1 38  ? 4.424   7.709   79.704   1.00 313.89 ? 38  ARG B NH1   1 
ATOM   3194  N  NH2   . ARG B 1 38  ? 6.389   8.756   80.341   1.00 324.43 ? 38  ARG B NH2   1 
ATOM   3195  N  N     . HIS B 1 39  ? 4.507   13.798  81.436   1.00 323.17 ? 39  HIS B N     1 
ATOM   3196  C  CA    . HIS B 1 39  ? 4.320   13.956  82.899   1.00 338.73 ? 39  HIS B CA    1 
ATOM   3197  C  C     . HIS B 1 39  ? 4.655   15.319  83.462   1.00 344.48 ? 39  HIS B C     1 
ATOM   3198  O  O     . HIS B 1 39  ? 5.772   15.823  83.245   1.00 348.32 ? 39  HIS B O     1 
ATOM   3199  C  CB    . HIS B 1 39  ? 5.229   12.972  83.656   1.00 341.41 ? 39  HIS B CB    1 
ATOM   3200  C  CG    . HIS B 1 39  ? 4.881   11.522  83.451   1.00 340.28 ? 39  HIS B CG    1 
ATOM   3201  N  ND1   . HIS B 1 39  ? 3.617   11.017  83.674   1.00 335.34 ? 39  HIS B ND1   1 
ATOM   3202  C  CD2   . HIS B 1 39  ? 5.640   10.472  83.060   1.00 345.55 ? 39  HIS B CD2   1 
ATOM   3203  C  CE1   . HIS B 1 39  ? 3.610   9.718   83.420   1.00 335.93 ? 39  HIS B CE1   1 
ATOM   3204  N  NE2   . HIS B 1 39  ? 4.825   9.361   83.048   1.00 344.15 ? 39  HIS B NE2   1 
ATOM   3205  N  N     . GLN B 1 40  ? 3.726   15.872  84.266   1.00 341.60 ? 40  GLN B N     1 
ATOM   3206  C  CA    . GLN B 1 40  ? 3.918   17.194  84.843   1.00 333.37 ? 40  GLN B CA    1 
ATOM   3207  C  C     . GLN B 1 40  ? 5.063   17.165  85.857   1.00 315.81 ? 40  GLN B C     1 
ATOM   3208  O  O     . GLN B 1 40  ? 5.134   16.296  86.708   1.00 301.15 ? 40  GLN B O     1 
ATOM   3209  C  CB    . GLN B 1 40  ? 2.645   17.824  85.435   1.00 336.29 ? 40  GLN B CB    1 
ATOM   3210  C  CG    . GLN B 1 40  ? 2.085   17.108  86.633   1.00 338.31 ? 40  GLN B CG    1 
ATOM   3211  C  CD    . GLN B 1 40  ? 0.943   17.875  87.289   1.00 340.12 ? 40  GLN B CD    1 
ATOM   3212  O  OE1   . GLN B 1 40  ? 0.460   18.878  86.758   1.00 341.77 ? 40  GLN B OE1   1 
ATOM   3213  N  NE2   . GLN B 1 40  ? 0.507   17.407  88.455   1.00 341.73 ? 40  GLN B NE2   1 
ATOM   3214  N  N     . GLY B 1 41  ? 6.031   18.040  85.650   1.00 309.43 ? 41  GLY B N     1 
ATOM   3215  C  CA    . GLY B 1 41  ? 7.218   18.019  86.465   1.00 305.72 ? 41  GLY B CA    1 
ATOM   3216  C  C     . GLY B 1 41  ? 6.969   18.788  87.737   1.00 325.70 ? 41  GLY B C     1 
ATOM   3217  O  O     . GLY B 1 41  ? 6.237   19.779  87.737   1.00 344.93 ? 41  GLY B O     1 
ATOM   3218  N  N     . VAL B 1 42  ? 7.569   18.327  88.830   1.00 332.76 ? 42  VAL B N     1 
ATOM   3219  C  CA    . VAL B 1 42  ? 7.517   19.037  90.080   1.00 345.48 ? 42  VAL B CA    1 
ATOM   3220  C  C     . VAL B 1 42  ? 8.894   19.161  90.692   1.00 349.62 ? 42  VAL B C     1 
ATOM   3221  O  O     . VAL B 1 42  ? 9.385   18.274  91.395   1.00 347.67 ? 42  VAL B O     1 
ATOM   3222  C  CB    . VAL B 1 42  ? 6.558   18.362  91.045   1.00 342.98 ? 42  VAL B CB    1 
ATOM   3223  C  CG1   . VAL B 1 42  ? 6.562   19.145  92.363   1.00 344.25 ? 42  VAL B CG1   1 
ATOM   3224  C  CG2   . VAL B 1 42  ? 5.180   18.252  90.372   1.00 338.71 ? 42  VAL B CG2   1 
ATOM   3225  N  N     . MET B 1 43  ? 9.495   20.295  90.378   1.00 353.03 ? 43  MET B N     1 
ATOM   3226  C  CA    . MET B 1 43  ? 10.698  20.813  91.012   1.00 347.95 ? 43  MET B CA    1 
ATOM   3227  C  C     . MET B 1 43  ? 10.582  22.340  90.834   1.00 346.33 ? 43  MET B C     1 
ATOM   3228  O  O     . MET B 1 43  ? 9.504   22.865  90.553   1.00 347.96 ? 43  MET B O     1 
ATOM   3229  C  CB    . MET B 1 43  ? 11.975  20.343  90.330   1.00 338.27 ? 43  MET B CB    1 
ATOM   3230  C  CG    . MET B 1 43  ? 12.149  18.860  90.176   1.00 325.53 ? 43  MET B CG    1 
ATOM   3231  S  SD    . MET B 1 43  ? 12.773  17.960  91.596   1.00 304.47 ? 43  MET B SD    1 
ATOM   3232  C  CE    . MET B 1 43  ? 14.471  18.452  91.417   1.00 284.84 ? 43  MET B CE    1 
ATOM   3233  N  N     . VAL B 1 44  ? 11.684  23.058  90.998   1.00 340.75 ? 44  VAL B N     1 
ATOM   3234  C  CA    . VAL B 1 44  ? 11.790  24.398  90.507   1.00 329.34 ? 44  VAL B CA    1 
ATOM   3235  C  C     . VAL B 1 44  ? 13.160  24.494  89.841   1.00 318.81 ? 44  VAL B C     1 
ATOM   3236  O  O     . VAL B 1 44  ? 14.109  23.827  90.262   1.00 311.17 ? 44  VAL B O     1 
ATOM   3237  C  CB    . VAL B 1 44  ? 11.669  25.397  91.669   1.00 316.97 ? 44  VAL B CB    1 
ATOM   3238  C  CG1   . VAL B 1 44  ? 11.901  26.825  91.167   1.00 304.53 ? 44  VAL B CG1   1 
ATOM   3239  C  CG2   . VAL B 1 44  ? 10.318  25.212  92.397   1.00 307.27 ? 44  VAL B CG2   1 
ATOM   3240  N  N     . GLY B 1 45  ? 13.256  25.326  88.810   1.00 305.22 ? 45  GLY B N     1 
ATOM   3241  C  CA    . GLY B 1 45  ? 14.492  25.464  88.079   1.00 290.02 ? 45  GLY B CA    1 
ATOM   3242  C  C     . GLY B 1 45  ? 14.710  24.239  87.223   1.00 285.06 ? 45  GLY B C     1 
ATOM   3243  O  O     . GLY B 1 45  ? 15.835  23.750  87.110   1.00 269.57 ? 45  GLY B O     1 
ATOM   3244  N  N     . MET B 1 46  ? 13.612  23.705  86.681   1.00 293.42 ? 46  MET B N     1 
ATOM   3245  C  CA    . MET B 1 46  ? 13.661  22.805  85.517   1.00 297.71 ? 46  MET B CA    1 
ATOM   3246  C  C     . MET B 1 46  ? 13.399  23.594  84.264   1.00 303.68 ? 46  MET B C     1 
ATOM   3247  O  O     . MET B 1 46  ? 12.601  24.533  84.274   1.00 308.49 ? 46  MET B O     1 
ATOM   3248  C  CB    . MET B 1 46  ? 12.572  21.718  85.567   1.00 294.42 ? 46  MET B CB    1 
ATOM   3249  C  CG    . MET B 1 46  ? 12.729  20.659  86.655   1.00 290.08 ? 46  MET B CG    1 
ATOM   3250  S  SD    . MET B 1 46  ? 11.518  19.325  86.541   1.00 274.72 ? 46  MET B SD    1 
ATOM   3251  C  CE    . MET B 1 46  ? 10.105  20.289  87.040   1.00 292.01 ? 46  MET B CE    1 
ATOM   3252  N  N     . GLY B 1 47  ? 14.046  23.178  83.178   1.00 303.93 ? 47  GLY B N     1 
ATOM   3253  C  CA    . GLY B 1 47  ? 13.680  23.572  81.817   1.00 304.35 ? 47  GLY B CA    1 
ATOM   3254  C  C     . GLY B 1 47  ? 13.141  24.991  81.596   1.00 305.31 ? 47  GLY B C     1 
ATOM   3255  O  O     . GLY B 1 47  ? 13.930  25.935  81.638   1.00 297.07 ? 47  GLY B O     1 
ATOM   3256  N  N     . GLN B 1 48  ? 11.832  25.185  81.370   1.00 309.90 ? 48  GLN B N     1 
ATOM   3257  C  CA    . GLN B 1 48  ? 10.810  24.107  81.332   1.00 309.53 ? 48  GLN B CA    1 
ATOM   3258  C  C     . GLN B 1 48  ? 10.931  23.305  80.053   1.00 310.85 ? 48  GLN B C     1 
ATOM   3259  O  O     . GLN B 1 48  ? 10.793  22.074  80.069   1.00 306.65 ? 48  GLN B O     1 
ATOM   3260  C  CB    . GLN B 1 48  ? 9.379   24.656  81.457   1.00 304.11 ? 48  GLN B CB    1 
ATOM   3261  C  CG    . GLN B 1 48  ? 9.029   25.151  82.850   1.00 296.33 ? 48  GLN B CG    1 
ATOM   3262  C  CD    . GLN B 1 48  ? 7.574   25.515  82.968   1.00 297.85 ? 48  GLN B CD    1 
ATOM   3263  O  OE1   . GLN B 1 48  ? 6.869   25.653  81.968   1.00 306.34 ? 48  GLN B OE1   1 
ATOM   3264  N  NE2   . GLN B 1 48  ? 7.108   25.683  84.200   1.00 297.28 ? 48  GLN B NE2   1 
ATOM   3265  N  N     . LYS B 1 49  ? 11.190  24.018  78.950   1.00 312.13 ? 49  LYS B N     1 
ATOM   3266  C  CA    . LYS B 1 49  ? 11.350  23.441  77.599   1.00 312.57 ? 49  LYS B CA    1 
ATOM   3267  C  C     . LYS B 1 49  ? 10.129  22.620  77.206   1.00 308.17 ? 49  LYS B C     1 
ATOM   3268  O  O     . LYS B 1 49  ? 10.001  21.481  77.613   1.00 305.52 ? 49  LYS B O     1 
ATOM   3269  C  CB    . LYS B 1 49  ? 12.612  22.576  77.472   1.00 317.89 ? 49  LYS B CB    1 
ATOM   3270  C  CG    . LYS B 1 49  ? 13.930  23.329  77.445   1.00 329.91 ? 49  LYS B CG    1 
ATOM   3271  C  CD    . LYS B 1 49  ? 15.153  22.401  77.650   1.00 335.68 ? 49  LYS B CD    1 
ATOM   3272  C  CE    . LYS B 1 49  ? 16.454  23.171  77.907   1.00 340.67 ? 49  LYS B CE    1 
ATOM   3273  N  NZ    . LYS B 1 49  ? 17.607  22.282  78.222   1.00 341.99 ? 49  LYS B NZ    1 
ATOM   3274  N  N     . ASP B 1 50  ? 9.244   23.232  76.429   1.00 307.80 ? 50  ASP B N     1 
ATOM   3275  C  CA    . ASP B 1 50  ? 7.997   22.669  76.038   1.00 308.57 ? 50  ASP B CA    1 
ATOM   3276  C  C     . ASP B 1 50  ? 8.181   21.361  75.325   1.00 314.29 ? 50  ASP B C     1 
ATOM   3277  O  O     . ASP B 1 50  ? 7.328   20.520  75.408   1.00 324.10 ? 50  ASP B O     1 
ATOM   3278  C  CB    . ASP B 1 50  ? 7.305   23.638  75.070   1.00 303.10 ? 50  ASP B CB    1 
ATOM   3279  C  CG    . ASP B 1 50  ? 5.937   23.153  74.585   1.00 304.45 ? 50  ASP B CG    1 
ATOM   3280  O  OD1   . ASP B 1 50  ? 5.094   22.690  75.390   1.00 305.03 ? 50  ASP B OD1   1 
ATOM   3281  O  OD2   . ASP B 1 50  ? 5.705   23.244  73.360   1.00 311.15 ? 50  ASP B OD2   1 
ATOM   3282  N  N     . SER B 1 51  ? 9.278   21.203  74.625   1.00 295.61 ? 51  SER B N     1 
ATOM   3283  C  CA    . SER B 1 51  ? 9.522   19.927  73.991   1.00 281.12 ? 51  SER B CA    1 
ATOM   3284  C  C     . SER B 1 51  ? 10.961  19.801  73.652   1.00 270.95 ? 51  SER B C     1 
ATOM   3285  O  O     . SER B 1 51  ? 11.677  20.790  73.603   1.00 258.58 ? 51  SER B O     1 
ATOM   3286  C  CB    . SER B 1 51  ? 8.707   19.819  72.714   1.00 282.57 ? 51  SER B CB    1 
ATOM   3287  O  OG    . SER B 1 51  ? 8.877   18.569  72.093   1.00 285.18 ? 51  SER B OG    1 
ATOM   3288  N  N     . TYR B 1 52  ? 11.382  18.564  73.361   1.00 273.86 ? 52  TYR B N     1 
ATOM   3289  C  CA    . TYR B 1 52  ? 12.726  18.251  72.954   1.00 272.76 ? 52  TYR B CA    1 
ATOM   3290  C  C     . TYR B 1 52  ? 12.742  17.664  71.546   1.00 265.81 ? 52  TYR B C     1 
ATOM   3291  O  O     . TYR B 1 52  ? 11.805  17.093  71.058   1.00 270.80 ? 52  TYR B O     1 
ATOM   3292  C  CB    . TYR B 1 52  ? 13.344  17.268  73.927   1.00 274.64 ? 52  TYR B CB    1 
ATOM   3293  C  CG    . TYR B 1 52  ? 13.402  17.719  75.350   1.00 271.30 ? 52  TYR B CG    1 
ATOM   3294  C  CD1   . TYR B 1 52  ? 13.546  19.054  75.674   1.00 263.11 ? 52  TYR B CD1   1 
ATOM   3295  C  CD2   . TYR B 1 52  ? 13.407  16.785  76.373   1.00 270.89 ? 52  TYR B CD2   1 
ATOM   3296  C  CE1   . TYR B 1 52  ? 13.621  19.453  76.984   1.00 259.05 ? 52  TYR B CE1   1 
ATOM   3297  C  CE2   . TYR B 1 52  ? 13.487  17.187  77.684   1.00 265.07 ? 52  TYR B CE2   1 
ATOM   3298  C  CZ    . TYR B 1 52  ? 13.607  18.529  77.992   1.00 259.29 ? 52  TYR B CZ    1 
ATOM   3299  O  OH    . TYR B 1 52  ? 13.688  18.923  79.336   1.00 253.39 ? 52  TYR B OH    1 
ATOM   3300  N  N     . VAL B 1 53  ? 13.821  17.953  70.846   1.00 255.11 ? 53  VAL B N     1 
ATOM   3301  C  CA    . VAL B 1 53  ? 13.958  17.557  69.443   1.00 250.51 ? 53  VAL B CA    1 
ATOM   3302  C  C     . VAL B 1 53  ? 15.303  16.952  69.245   1.00 238.16 ? 53  VAL B C     1 
ATOM   3303  O  O     . VAL B 1 53  ? 16.279  17.358  69.875   1.00 219.67 ? 53  VAL B O     1 
ATOM   3304  C  CB    . VAL B 1 53  ? 13.887  18.777  68.522   1.00 258.30 ? 53  VAL B CB    1 
ATOM   3305  C  CG1   . VAL B 1 53  ? 14.116  18.370  67.092   1.00 257.56 ? 53  VAL B CG1   1 
ATOM   3306  C  CG2   . VAL B 1 53  ? 12.532  19.472  68.692   1.00 262.60 ? 53  VAL B CG2   1 
ATOM   3307  N  N     . GLY B 1 54  ? 15.394  15.983  68.332   1.00 248.54 ? 54  GLY B N     1 
ATOM   3308  C  CA    . GLY B 1 54  ? 16.662  15.287  68.045   1.00 255.81 ? 54  GLY B CA    1 
ATOM   3309  C  C     . GLY B 1 54  ? 17.122  14.411  69.171   1.00 256.15 ? 54  GLY B C     1 
ATOM   3310  O  O     . GLY B 1 54  ? 16.398  14.213  70.110   1.00 244.05 ? 54  GLY B O     1 
ATOM   3311  N  N     . ASP B 1 55  ? 18.351  13.919  69.051   1.00 271.89 ? 55  ASP B N     1 
ATOM   3312  C  CA    . ASP B 1 55  ? 18.870  12.891  69.953   1.00 280.89 ? 55  ASP B CA    1 
ATOM   3313  C  C     . ASP B 1 55  ? 18.838  13.292  71.427   1.00 278.53 ? 55  ASP B C     1 
ATOM   3314  O  O     . ASP B 1 55  ? 18.939  12.462  72.330   1.00 286.98 ? 55  ASP B O     1 
ATOM   3315  C  CB    . ASP B 1 55  ? 20.263  12.372  69.537   1.00 278.25 ? 55  ASP B CB    1 
ATOM   3316  C  CG    . ASP B 1 55  ? 21.271  13.472  69.409   1.00 277.24 ? 55  ASP B CG    1 
ATOM   3317  O  OD1   . ASP B 1 55  ? 20.859  14.651  69.365   1.00 277.15 ? 55  ASP B OD1   1 
ATOM   3318  O  OD2   . ASP B 1 55  ? 22.465  13.158  69.342   1.00 275.00 ? 55  ASP B OD2   1 
ATOM   3319  N  N     . GLU B 1 56  ? 18.548  14.568  71.662   1.00 268.90 ? 56  GLU B N     1 
ATOM   3320  C  CA    . GLU B 1 56  ? 18.143  15.010  72.993   1.00 267.82 ? 56  GLU B CA    1 
ATOM   3321  C  C     . GLU B 1 56  ? 16.995  14.167  73.495   1.00 265.05 ? 56  GLU B C     1 
ATOM   3322  O  O     . GLU B 1 56  ? 16.972  13.709  74.644   1.00 271.55 ? 56  GLU B O     1 
ATOM   3323  C  CB    . GLU B 1 56  ? 17.689  16.477  72.985   1.00 272.55 ? 56  GLU B CB    1 
ATOM   3324  C  CG    . GLU B 1 56  ? 17.316  17.054  74.345   1.00 282.27 ? 56  GLU B CG    1 
ATOM   3325  C  CD    . GLU B 1 56  ? 16.931  18.523  74.281   1.00 290.08 ? 56  GLU B CD    1 
ATOM   3326  O  OE1   . GLU B 1 56  ? 16.813  19.082  73.168   1.00 296.66 ? 56  GLU B OE1   1 
ATOM   3327  O  OE2   . GLU B 1 56  ? 16.738  19.123  75.358   1.00 292.48 ? 56  GLU B OE2   1 
ATOM   3328  N  N     . ALA B 1 57  ? 16.005  13.978  72.620   1.00 247.28 ? 57  ALA B N     1 
ATOM   3329  C  CA    . ALA B 1 57  ? 14.823  13.201  72.971   1.00 241.25 ? 57  ALA B CA    1 
ATOM   3330  C  C     . ALA B 1 57  ? 15.189  11.784  73.282   1.00 249.43 ? 57  ALA B C     1 
ATOM   3331  O  O     . ALA B 1 57  ? 14.643  11.230  74.198   1.00 247.71 ? 57  ALA B O     1 
ATOM   3332  C  CB    . ALA B 1 57  ? 13.793  13.201  71.830   1.00 236.29 ? 57  ALA B CB    1 
ATOM   3333  N  N     . GLN B 1 58  ? 16.100  11.204  72.514   1.00 266.31 ? 58  GLN B N     1 
ATOM   3334  C  CA    . GLN B 1 58  ? 16.584  9.839   72.775   1.00 283.41 ? 58  GLN B CA    1 
ATOM   3335  C  C     . GLN B 1 58  ? 17.185  9.738   74.165   1.00 285.56 ? 58  GLN B C     1 
ATOM   3336  O  O     . GLN B 1 58  ? 16.915  8.818   74.930   1.00 267.39 ? 58  GLN B O     1 
ATOM   3337  C  CB    . GLN B 1 58  ? 17.707  9.443   71.797   1.00 300.87 ? 58  GLN B CB    1 
ATOM   3338  C  CG    . GLN B 1 58  ? 17.270  9.350   70.362   1.00 306.99 ? 58  GLN B CG    1 
ATOM   3339  C  CD    . GLN B 1 58  ? 16.382  8.155   70.106   1.00 312.75 ? 58  GLN B CD    1 
ATOM   3340  O  OE1   . GLN B 1 58  ? 16.641  7.041   70.568   1.00 315.45 ? 58  GLN B OE1   1 
ATOM   3341  N  NE2   . GLN B 1 58  ? 15.316  8.387   69.380   1.00 322.17 ? 58  GLN B NE2   1 
ATOM   3342  N  N     . SER B 1 59  ? 18.006  10.729  74.482   1.00 297.21 ? 59  SER B N     1 
ATOM   3343  C  CA    . SER B 1 59  ? 18.613  10.781  75.830   1.00 300.86 ? 59  SER B CA    1 
ATOM   3344  C  C     . SER B 1 59  ? 17.540  10.811  76.927   1.00 289.31 ? 59  SER B C     1 
ATOM   3345  O  O     . SER B 1 59  ? 17.537  10.000  77.858   1.00 290.57 ? 59  SER B O     1 
ATOM   3346  C  CB    . SER B 1 59  ? 19.599  11.941  76.012   1.00 307.58 ? 59  SER B CB    1 
ATOM   3347  O  OG    . SER B 1 59  ? 20.270  11.803  77.230   1.00 315.76 ? 59  SER B OG    1 
ATOM   3348  N  N     . LYS B 1 60  ? 16.577  11.723  76.835   1.00 274.09 ? 60  LYS B N     1 
ATOM   3349  C  CA    . LYS B 1 60  ? 15.534  11.829  77.855   1.00 262.24 ? 60  LYS B CA    1 
ATOM   3350  C  C     . LYS B 1 60  ? 14.268  11.193  77.323   1.00 260.32 ? 60  LYS B C     1 
ATOM   3351  O  O     . LYS B 1 60  ? 13.339  11.907  76.994   1.00 254.09 ? 60  LYS B O     1 
ATOM   3352  C  CB    . LYS B 1 60  ? 15.291  13.307  78.206   1.00 265.22 ? 60  LYS B CB    1 
ATOM   3353  C  CG    . LYS B 1 60  ? 16.456  14.025  78.910   1.00 273.86 ? 60  LYS B CG    1 
ATOM   3354  C  CD    . LYS B 1 60  ? 16.092  15.436  79.407   1.00 285.60 ? 60  LYS B CD    1 
ATOM   3355  C  CE    . LYS B 1 60  ? 17.264  16.192  80.030   1.00 298.83 ? 60  LYS B CE    1 
ATOM   3356  N  NZ    . LYS B 1 60  ? 16.859  17.564  80.439   1.00 305.31 ? 60  LYS B NZ    1 
ATOM   3357  N  N     . ARG B 1 61  ? 14.211  9.868   77.242   1.00 260.85 ? 61  ARG B N     1 
ATOM   3358  C  CA    . ARG B 1 61  ? 13.119  9.142   76.541   1.00 260.54 ? 61  ARG B CA    1 
ATOM   3359  C  C     . ARG B 1 61  ? 11.873  8.856   77.401   1.00 257.41 ? 61  ARG B C     1 
ATOM   3360  O  O     . ARG B 1 61  ? 10.724  8.930   76.896   1.00 261.02 ? 61  ARG B O     1 
ATOM   3361  C  CB    . ARG B 1 61  ? 13.696  7.820   76.038   1.00 265.71 ? 61  ARG B CB    1 
ATOM   3362  C  CG    . ARG B 1 61  ? 12.958  7.131   74.896   1.00 280.25 ? 61  ARG B CG    1 
ATOM   3363  C  CD    . ARG B 1 61  ? 13.747  5.970   74.387   1.00 284.51 ? 61  ARG B CD    1 
ATOM   3364  N  NE    . ARG B 1 61  ? 15.110  6.416   74.034   1.00 281.64 ? 61  ARG B NE    1 
ATOM   3365  C  CZ    . ARG B 1 61  ? 16.132  5.595   73.817   1.00 284.27 ? 61  ARG B CZ    1 
ATOM   3366  N  NH1   . ARG B 1 61  ? 15.913  4.304   73.901   1.00 281.77 ? 61  ARG B NH1   1 
ATOM   3367  N  NH2   . ARG B 1 61  ? 17.363  6.053   73.507   1.00 292.41 ? 61  ARG B NH2   1 
ATOM   3368  N  N     . GLY B 1 62  ? 12.172  8.453   78.635   1.00 253.10 ? 62  GLY B N     1 
ATOM   3369  C  CA    . GLY B 1 62  ? 11.193  7.882   79.537   1.00 255.35 ? 62  GLY B CA    1 
ATOM   3370  C  C     . GLY B 1 62  ? 10.075  8.840   79.849   1.00 279.38 ? 62  GLY B C     1 
ATOM   3371  O  O     . GLY B 1 62  ? 8.905   8.430   79.856   1.00 279.06 ? 62  GLY B O     1 
ATOM   3372  N  N     . ILE B 1 63  ? 10.435  10.119  80.039   1.00 305.91 ? 63  ILE B N     1 
ATOM   3373  C  CA    . ILE B 1 63  ? 9.527   11.182  80.388   1.00 316.88 ? 63  ILE B CA    1 
ATOM   3374  C  C     . ILE B 1 63  ? 8.652   11.523  79.189   1.00 304.14 ? 63  ILE B C     1 
ATOM   3375  O  O     . ILE B 1 63  ? 7.461   11.741  79.364   1.00 294.61 ? 63  ILE B O     1 
ATOM   3376  C  CB    . ILE B 1 63  ? 10.327  12.416  80.809   1.00 325.18 ? 63  ILE B CB    1 
ATOM   3377  C  CG1   . ILE B 1 63  ? 11.236  12.054  81.992   1.00 321.55 ? 63  ILE B CG1   1 
ATOM   3378  C  CG2   . ILE B 1 63  ? 9.387   13.582  81.061   1.00 326.59 ? 63  ILE B CG2   1 
ATOM   3379  C  CD1   . ILE B 1 63  ? 10.512  11.401  83.145   1.00 314.37 ? 63  ILE B CD1   1 
ATOM   3380  N  N     . LEU B 1 64  ? 9.264   11.600  78.019   1.00 302.59 ? 64  LEU B N     1 
ATOM   3381  C  CA    . LEU B 1 64  ? 8.614   12.154  76.874   1.00 299.13 ? 64  LEU B CA    1 
ATOM   3382  C  C     . LEU B 1 64  ? 7.751   11.142  76.228   1.00 299.41 ? 64  LEU B C     1 
ATOM   3383  O  O     . LEU B 1 64  ? 8.005   9.950   76.383   1.00 301.04 ? 64  LEU B O     1 
ATOM   3384  C  CB    . LEU B 1 64  ? 9.667   12.521  75.876   1.00 300.94 ? 64  LEU B CB    1 
ATOM   3385  C  CG    . LEU B 1 64  ? 10.537  13.749  76.150   1.00 298.99 ? 64  LEU B CG    1 
ATOM   3386  C  CD1   . LEU B 1 64  ? 11.026  13.809  77.587   1.00 291.09 ? 64  LEU B CD1   1 
ATOM   3387  C  CD2   . LEU B 1 64  ? 11.686  13.872  75.120   1.00 305.08 ? 64  LEU B CD2   1 
ATOM   3388  N  N     . THR B 1 65  ? 6.769   11.636  75.481   1.00 302.53 ? 65  THR B N     1 
ATOM   3389  C  CA    . THR B 1 65  ? 6.076   10.862  74.477   1.00 295.41 ? 65  THR B CA    1 
ATOM   3390  C  C     . THR B 1 65  ? 6.669   11.385  73.214   1.00 285.19 ? 65  THR B C     1 
ATOM   3391  O  O     . THR B 1 65  ? 6.891   12.579  73.040   1.00 283.37 ? 65  THR B O     1 
ATOM   3392  C  CB    . THR B 1 65  ? 4.549   11.070  74.481   1.00 296.95 ? 65  THR B CB    1 
ATOM   3393  O  OG1   . THR B 1 65  ? 3.967   10.418  73.342   1.00 287.80 ? 65  THR B OG1   1 
ATOM   3394  C  CG2   . THR B 1 65  ? 4.171   12.546  74.445   1.00 304.11 ? 65  THR B CG2   1 
ATOM   3395  N  N     . LEU B 1 66  ? 6.964   10.484  72.306   1.00 279.38 ? 66  LEU B N     1 
ATOM   3396  C  CA    . LEU B 1 66  ? 7.644   10.924  71.120   1.00 278.68 ? 66  LEU B CA    1 
ATOM   3397  C  C     . LEU B 1 66  ? 6.647   10.877  70.014   1.00 275.23 ? 66  LEU B C     1 
ATOM   3398  O  O     . LEU B 1 66  ? 5.809   9.981   69.977   1.00 275.21 ? 66  LEU B O     1 
ATOM   3399  C  CB    . LEU B 1 66  ? 8.811   10.012  70.782   1.00 283.23 ? 66  LEU B CB    1 
ATOM   3400  C  CG    . LEU B 1 66  ? 9.804   9.878   71.938   1.00 288.94 ? 66  LEU B CG    1 
ATOM   3401  C  CD1   . LEU B 1 66  ? 10.733  8.663   71.770   1.00 293.01 ? 66  LEU B CD1   1 
ATOM   3402  C  CD2   . LEU B 1 66  ? 10.601  11.170  72.174   1.00 291.68 ? 66  LEU B CD2   1 
ATOM   3403  N  N     . LYS B 1 67  ? 6.734   11.851  69.110   1.00 268.21 ? 67  LYS B N     1 
ATOM   3404  C  CA    . LYS B 1 67  ? 5.900   11.897  67.979   1.00 255.45 ? 67  LYS B CA    1 
ATOM   3405  C  C     . LYS B 1 67  ? 6.809   12.078  66.784   1.00 242.53 ? 67  LYS B C     1 
ATOM   3406  O  O     . LYS B 1 67  ? 7.530   13.074  66.677   1.00 232.20 ? 67  LYS B O     1 
ATOM   3407  C  CB    . LYS B 1 67  ? 4.933   13.090  68.106   1.00 256.62 ? 67  LYS B CB    1 
ATOM   3408  C  CG    . LYS B 1 67  ? 3.812   13.128  67.084   1.00 254.52 ? 67  LYS B CG    1 
ATOM   3409  C  CD    . LYS B 1 67  ? 2.824   14.272  67.344   1.00 257.04 ? 67  LYS B CD    1 
ATOM   3410  C  CE    . LYS B 1 67  ? 1.957   14.588  66.127   1.00 263.95 ? 67  LYS B CE    1 
ATOM   3411  N  NZ    . LYS B 1 67  ? 1.212   13.389  65.650   1.00 268.26 ? 67  LYS B NZ    1 
ATOM   3412  N  N     . TYR B 1 68  ? 6.803   11.100  65.889   1.00 232.48 ? 68  TYR B N     1 
ATOM   3413  C  CA    . TYR B 1 68  ? 7.412   11.270  64.580   1.00 231.74 ? 68  TYR B CA    1 
ATOM   3414  C  C     . TYR B 1 68  ? 6.526   12.210  63.727   1.00 211.49 ? 68  TYR B C     1 
ATOM   3415  O  O     . TYR B 1 68  ? 5.395   11.852  63.420   1.00 208.04 ? 68  TYR B O     1 
ATOM   3416  C  CB    . TYR B 1 68  ? 7.504   9.916   63.861   1.00 257.11 ? 68  TYR B CB    1 
ATOM   3417  C  CG    . TYR B 1 68  ? 8.578   9.008   64.339   1.00 282.94 ? 68  TYR B CG    1 
ATOM   3418  C  CD1   . TYR B 1 68  ? 9.896   9.369   64.229   1.00 296.43 ? 68  TYR B CD1   1 
ATOM   3419  C  CD2   . TYR B 1 68  ? 8.272   7.770   64.853   1.00 293.83 ? 68  TYR B CD2   1 
ATOM   3420  C  CE1   . TYR B 1 68  ? 10.906  8.513   64.640   1.00 304.88 ? 68  TYR B CE1   1 
ATOM   3421  C  CE2   . TYR B 1 68  ? 9.262   6.910   65.271   1.00 299.25 ? 68  TYR B CE2   1 
ATOM   3422  C  CZ    . TYR B 1 68  ? 10.585  7.283   65.167   1.00 304.51 ? 68  TYR B CZ    1 
ATOM   3423  O  OH    . TYR B 1 68  ? 11.602  6.417   65.590   1.00 301.20 ? 68  TYR B OH    1 
ATOM   3424  N  N     . PRO B 1 69  ? 7.031   13.384  63.315   1.00 207.42 ? 69  PRO B N     1 
ATOM   3425  C  CA    . PRO B 1 69  ? 6.218   14.305  62.553   1.00 206.04 ? 69  PRO B CA    1 
ATOM   3426  C  C     . PRO B 1 69  ? 5.965   13.831  61.132   1.00 199.25 ? 69  PRO B C     1 
ATOM   3427  O  O     . PRO B 1 69  ? 5.028   14.305  60.483   1.00 197.09 ? 69  PRO B O     1 
ATOM   3428  C  CB    . PRO B 1 69  ? 7.053   15.592  62.583   1.00 216.36 ? 69  PRO B CB    1 
ATOM   3429  C  CG    . PRO B 1 69  ? 8.438   15.073  62.615   1.00 219.85 ? 69  PRO B CG    1 
ATOM   3430  C  CD    . PRO B 1 69  ? 8.407   13.867  63.483   1.00 215.19 ? 69  PRO B CD    1 
ATOM   3431  N  N     . ILE B 1 70  ? 6.833   12.979  60.579   1.00 200.24 ? 70  ILE B N     1 
ATOM   3432  C  CA    . ILE B 1 70  ? 6.635   12.463  59.220   1.00 214.08 ? 70  ILE B CA    1 
ATOM   3433  C  C     . ILE B 1 70  ? 6.150   11.020  59.271   1.00 206.36 ? 70  ILE B C     1 
ATOM   3434  O  O     . ILE B 1 70  ? 6.805   10.188  59.897   1.00 198.33 ? 70  ILE B O     1 
ATOM   3435  C  CB    . ILE B 1 70  ? 7.933   12.528  58.344   1.00 249.10 ? 70  ILE B CB    1 
ATOM   3436  C  CG1   . ILE B 1 70  ? 8.699   13.835  58.571   1.00 268.18 ? 70  ILE B CG1   1 
ATOM   3437  C  CG2   . ILE B 1 70  ? 7.567   12.288  56.866   1.00 265.27 ? 70  ILE B CG2   1 
ATOM   3438  C  CD1   . ILE B 1 70  ? 10.016  13.840  57.839   1.00 283.90 ? 70  ILE B CD1   1 
ATOM   3439  N  N     . GLU B 1 71  ? 5.011   10.740  58.618   1.00 215.24 ? 71  GLU B N     1 
ATOM   3440  C  CA    . GLU B 1 71  ? 4.563   9.372   58.387   1.00 222.36 ? 71  GLU B CA    1 
ATOM   3441  C  C     . GLU B 1 71  ? 4.237   9.062   56.951   1.00 214.18 ? 71  GLU B C     1 
ATOM   3442  O  O     . GLU B 1 71  ? 3.353   9.679   56.362   1.00 213.37 ? 71  GLU B O     1 
ATOM   3443  C  CB    . GLU B 1 71  ? 3.326   9.044   59.239   1.00 232.78 ? 71  GLU B CB    1 
ATOM   3444  C  CG    . GLU B 1 71  ? 3.638   8.601   60.646   1.00 252.77 ? 71  GLU B CG    1 
ATOM   3445  C  CD    . GLU B 1 71  ? 4.799   7.640   60.667   1.00 274.15 ? 71  GLU B CD    1 
ATOM   3446  O  OE1   . GLU B 1 71  ? 4.710   6.600   59.983   1.00 288.09 ? 71  GLU B OE1   1 
ATOM   3447  O  OE2   . GLU B 1 71  ? 5.806   7.948   61.327   1.00 284.72 ? 71  GLU B OE2   1 
ATOM   3448  N  N     . HIS B 1 72  ? 4.940   8.068   56.411   1.00 215.93 ? 72  HIS B N     1 
ATOM   3449  C  CA    . HIS B 1 72  ? 4.750   7.601   55.060   1.00 217.45 ? 72  HIS B CA    1 
ATOM   3450  C  C     . HIS B 1 72  ? 5.172   8.662   54.068   1.00 222.77 ? 72  HIS B C     1 
ATOM   3451  O  O     . HIS B 1 72  ? 4.553   8.868   53.025   1.00 228.11 ? 72  HIS B O     1 
ATOM   3452  C  CB    . HIS B 1 72  ? 3.328   7.158   54.799   1.00 213.52 ? 72  HIS B CB    1 
ATOM   3453  C  CG    . HIS B 1 72  ? 2.864   6.093   55.748   1.00 209.36 ? 72  HIS B CG    1 
ATOM   3454  N  ND1   . HIS B 1 72  ? 3.642   5.009   56.096   1.00 210.99 ? 72  HIS B ND1   1 
ATOM   3455  C  CD2   . HIS B 1 72  ? 1.710   5.957   56.443   1.00 205.12 ? 72  HIS B CD2   1 
ATOM   3456  C  CE1   . HIS B 1 72  ? 2.982   4.236   56.946   1.00 206.40 ? 72  HIS B CE1   1 
ATOM   3457  N  NE2   . HIS B 1 72  ? 1.805   4.791   57.174   1.00 205.57 ? 72  HIS B NE2   1 
ATOM   3458  N  N     . GLY B 1 73  ? 6.236   9.363   54.422   1.00 229.47 ? 73  GLY B N     1 
ATOM   3459  C  CA    . GLY B 1 73  ? 6.743   10.473  53.593   1.00 234.79 ? 73  GLY B CA    1 
ATOM   3460  C  C     . GLY B 1 73  ? 5.876   11.715  53.655   1.00 236.54 ? 73  GLY B C     1 
ATOM   3461  O  O     . GLY B 1 73  ? 6.196   12.712  53.039   1.00 234.65 ? 73  GLY B O     1 
ATOM   3462  N  N     . ILE B 1 74  ? 4.773   11.682  54.408   1.00 236.65 ? 74  ILE B N     1 
ATOM   3463  C  CA    . ILE B 1 74  ? 3.904   12.821  54.554   1.00 237.84 ? 74  ILE B CA    1 
ATOM   3464  C  C     . ILE B 1 74  ? 4.186   13.469  55.882   1.00 241.11 ? 74  ILE B C     1 
ATOM   3465  O  O     . ILE B 1 74  ? 4.136   12.756  56.913   1.00 253.51 ? 74  ILE B O     1 
ATOM   3466  C  CB    . ILE B 1 74  ? 2.454   12.415  54.621   1.00 237.99 ? 74  ILE B CB    1 
ATOM   3467  C  CG1   . ILE B 1 74  ? 2.118   11.376  53.540   1.00 228.75 ? 74  ILE B CG1   1 
ATOM   3468  C  CG2   . ILE B 1 74  ? 1.551   13.645  54.604   1.00 234.55 ? 74  ILE B CG2   1 
ATOM   3469  C  CD1   . ILE B 1 74  ? 2.423   11.799  52.130   1.00 237.14 ? 74  ILE B CD1   1 
ATOM   3470  N  N     . VAL B 1 75  ? 4.284   14.807  55.930   1.00 237.35 ? 75  VAL B N     1 
ATOM   3471  C  CA    . VAL B 1 75  ? 4.423   15.449  57.230   1.00 232.64 ? 75  VAL B CA    1 
ATOM   3472  C  C     . VAL B 1 75  ? 3.012   15.544  57.841   1.00 212.67 ? 75  VAL B C     1 
ATOM   3473  O  O     . VAL B 1 75  ? 2.103   16.158  57.298   1.00 201.12 ? 75  VAL B O     1 
ATOM   3474  C  CB    . VAL B 1 75  ? 5.171   16.782  57.214   1.00 240.93 ? 75  VAL B CB    1 
ATOM   3475  C  CG1   . VAL B 1 75  ? 6.546   16.603  56.580   1.00 250.77 ? 75  VAL B CG1   1 
ATOM   3476  C  CG2   . VAL B 1 75  ? 4.418   17.845  56.487   1.00 233.29 ? 75  VAL B CG2   1 
ATOM   3477  N  N     . THR B 1 76  ? 2.864   14.873  58.968   1.00 199.94 ? 76  THR B N     1 
ATOM   3478  C  CA    . THR B 1 76  ? 1.619   15.008  59.746   1.00 197.09 ? 76  THR B CA    1 
ATOM   3479  C  C     . THR B 1 76  ? 1.542   16.443  60.348   1.00 201.54 ? 76  THR B C     1 
ATOM   3480  O  O     . THR B 1 76  ? 0.576   17.168  60.131   1.00 195.36 ? 76  THR B O     1 
ATOM   3481  C  CB    . THR B 1 76  ? 1.538   13.867  60.771   1.00 198.19 ? 76  THR B CB    1 
ATOM   3482  O  OG1   . THR B 1 76  ? 2.587   13.980  61.728   1.00 196.49 ? 76  THR B OG1   1 
ATOM   3483  C  CG2   . THR B 1 76  ? 1.754   12.531  60.092   1.00 197.87 ? 76  THR B CG2   1 
ATOM   3484  N  N     . ASN B 1 77  ? 2.586   16.855  61.054   1.00 212.54 ? 77  ASN B N     1 
ATOM   3485  C  CA    . ASN B 1 77  ? 2.525   18.055  61.831   1.00 222.70 ? 77  ASN B CA    1 
ATOM   3486  C  C     . ASN B 1 77  ? 3.653   18.975  61.444   1.00 238.18 ? 77  ASN B C     1 
ATOM   3487  O  O     . ASN B 1 77  ? 4.826   18.636  61.590   1.00 251.64 ? 77  ASN B O     1 
ATOM   3488  C  CB    . ASN B 1 77  ? 2.642   17.739  63.322   1.00 224.31 ? 77  ASN B CB    1 
ATOM   3489  C  CG    . ASN B 1 77  ? 2.182   18.869  64.232   1.00 230.82 ? 77  ASN B CG    1 
ATOM   3490  O  OD1   . ASN B 1 77  ? 1.948   19.997  63.805   1.00 226.37 ? 77  ASN B OD1   1 
ATOM   3491  N  ND2   . ASN B 1 77  ? 2.012   18.549  65.504   1.00 241.69 ? 77  ASN B ND2   1 
ATOM   3492  N  N     . TRP B 1 78  ? 3.283   20.156  60.952   1.00 243.92 ? 78  TRP B N     1 
ATOM   3493  C  CA    . TRP B 1 78  ? 4.222   21.066  60.323   1.00 247.13 ? 78  TRP B CA    1 
ATOM   3494  C  C     . TRP B 1 78  ? 5.055   21.767  61.337   1.00 252.80 ? 78  TRP B C     1 
ATOM   3495  O  O     . TRP B 1 78  ? 6.269   21.970  61.148   1.00 240.03 ? 78  TRP B O     1 
ATOM   3496  C  CB    . TRP B 1 78  ? 3.510   22.150  59.530   1.00 243.44 ? 78  TRP B CB    1 
ATOM   3497  C  CG    . TRP B 1 78  ? 3.092   21.536  58.217   1.00 237.57 ? 78  TRP B CG    1 
ATOM   3498  C  CD1   . TRP B 1 78  ? 1.856   21.096  57.832   1.00 230.29 ? 78  TRP B CD1   1 
ATOM   3499  C  CD2   . TRP B 1 78  ? 3.982   21.209  57.170   1.00 240.33 ? 78  TRP B CD2   1 
ATOM   3500  N  NE1   . TRP B 1 78  ? 1.924   20.568  56.563   1.00 237.08 ? 78  TRP B NE1   1 
ATOM   3501  C  CE2   . TRP B 1 78  ? 3.230   20.629  56.137   1.00 239.53 ? 78  TRP B CE2   1 
ATOM   3502  C  CE3   . TRP B 1 78  ? 5.339   21.399  57.008   1.00 237.74 ? 78  TRP B CE3   1 
ATOM   3503  C  CZ2   . TRP B 1 78  ? 3.812   20.204  54.969   1.00 238.76 ? 78  TRP B CZ2   1 
ATOM   3504  C  CZ3   . TRP B 1 78  ? 5.923   20.976  55.837   1.00 226.51 ? 78  TRP B CZ3   1 
ATOM   3505  C  CH2   . TRP B 1 78  ? 5.161   20.432  54.820   1.00 229.86 ? 78  TRP B CH2   1 
ATOM   3506  N  N     . ASP B 1 79  ? 4.452   22.292  62.390   1.00 262.73 ? 79  ASP B N     1 
ATOM   3507  C  CA    . ASP B 1 79  ? 5.243   23.022  63.412   1.00 263.61 ? 79  ASP B CA    1 
ATOM   3508  C  C     . ASP B 1 79  ? 6.361   22.155  63.932   1.00 260.12 ? 79  ASP B C     1 
ATOM   3509  O  O     . ASP B 1 79  ? 7.439   22.622  64.178   1.00 238.77 ? 79  ASP B O     1 
ATOM   3510  C  CB    . ASP B 1 79  ? 4.393   23.484  64.587   1.00 270.99 ? 79  ASP B CB    1 
ATOM   3511  C  CG    . ASP B 1 79  ? 3.445   22.425  65.084   1.00 270.02 ? 79  ASP B CG    1 
ATOM   3512  O  OD1   . ASP B 1 79  ? 3.778   21.244  64.902   1.00 276.17 ? 79  ASP B OD1   1 
ATOM   3513  O  OD2   . ASP B 1 79  ? 2.374   22.766  65.627   1.00 260.83 ? 79  ASP B OD2   1 
ATOM   3514  N  N     . ASP B 1 80  ? 6.083   20.852  64.060   1.00 263.58 ? 80  ASP B N     1 
ATOM   3515  C  CA    . ASP B 1 80  ? 7.074   19.911  64.528   1.00 264.73 ? 80  ASP B CA    1 
ATOM   3516  C  C     . ASP B 1 80  ? 8.219   19.840  63.552   1.00 256.31 ? 80  ASP B C     1 
ATOM   3517  O  O     . ASP B 1 80  ? 9.373   19.869  63.950   1.00 259.27 ? 80  ASP B O     1 
ATOM   3518  C  CB    . ASP B 1 80  ? 6.473   18.505  64.713   1.00 275.52 ? 80  ASP B CB    1 
ATOM   3519  C  CG    . ASP B 1 80  ? 5.402   18.495  65.751   1.00 286.71 ? 80  ASP B CG    1 
ATOM   3520  O  OD1   . ASP B 1 80  ? 5.325   19.478  66.500   1.00 296.81 ? 80  ASP B OD1   1 
ATOM   3521  O  OD2   . ASP B 1 80  ? 4.641   17.510  65.827   1.00 292.36 ? 80  ASP B OD2   1 
ATOM   3522  N  N     . MET B 1 81  ? 7.890   19.736  62.255   1.00 246.22 ? 81  MET B N     1 
ATOM   3523  C  CA    . MET B 1 81  ? 8.924   19.694  61.230   1.00 255.66 ? 81  MET B CA    1 
ATOM   3524  C  C     . MET B 1 81  ? 9.775   20.943  61.259   1.00 259.45 ? 81  MET B C     1 
ATOM   3525  O  O     . MET B 1 81  ? 10.998  20.920  61.172   1.00 264.05 ? 81  MET B O     1 
ATOM   3526  C  CB    . MET B 1 81  ? 8.281   19.587  59.826   1.00 264.75 ? 81  MET B CB    1 
ATOM   3527  C  CG    . MET B 1 81  ? 9.280   19.494  58.724   1.00 279.29 ? 81  MET B CG    1 
ATOM   3528  S  SD    . MET B 1 81  ? 10.625  18.340  58.924   1.00 291.48 ? 81  MET B SD    1 
ATOM   3529  C  CE    . MET B 1 81  ? 9.676   16.890  59.312   1.00 298.26 ? 81  MET B CE    1 
ATOM   3530  N  N     . GLU B 1 82  ? 9.101   22.073  61.372   1.00 250.49 ? 82  GLU B N     1 
ATOM   3531  C  CA    . GLU B 1 82  ? 9.810   23.352  61.454   1.00 242.42 ? 82  GLU B CA    1 
ATOM   3532  C  C     . GLU B 1 82  ? 10.755  23.281  62.625   1.00 231.51 ? 82  GLU B C     1 
ATOM   3533  O  O     . GLU B 1 82  ? 11.873  23.733  62.512   1.00 218.78 ? 82  GLU B O     1 
ATOM   3534  C  CB    . GLU B 1 82  ? 8.860   24.558  61.594   1.00 248.14 ? 82  GLU B CB    1 
ATOM   3535  C  CG    . GLU B 1 82  ? 9.535   25.902  61.770   1.00 268.50 ? 82  GLU B CG    1 
ATOM   3536  C  CD    . GLU B 1 82  ? 9.739   26.309  63.222   1.00 292.00 ? 82  GLU B CD    1 
ATOM   3537  O  OE1   . GLU B 1 82  ? 8.846   26.057  64.062   1.00 304.42 ? 82  GLU B OE1   1 
ATOM   3538  O  OE2   . GLU B 1 82  ? 10.797  26.901  63.524   1.00 302.20 ? 82  GLU B OE2   1 
ATOM   3539  N  N     . LYS B 1 83  ? 10.319  22.751  63.762   1.00 229.20 ? 83  LYS B N     1 
ATOM   3540  C  CA    . LYS B 1 83  ? 11.176  22.678  64.938   1.00 231.14 ? 83  LYS B CA    1 
ATOM   3541  C  C     . LYS B 1 83  ? 12.398  21.829  64.636   1.00 215.18 ? 83  LYS B C     1 
ATOM   3542  O  O     . LYS B 1 83  ? 13.524  22.177  65.036   1.00 206.50 ? 83  LYS B O     1 
ATOM   3543  C  CB    . LYS B 1 83  ? 10.467  22.015  66.120   1.00 240.69 ? 83  LYS B CB    1 
ATOM   3544  C  CG    . LYS B 1 83  ? 9.449   22.879  66.799   1.00 248.25 ? 83  LYS B CG    1 
ATOM   3545  C  CD    . LYS B 1 83  ? 8.747   22.129  67.949   1.00 251.37 ? 83  LYS B CD    1 
ATOM   3546  C  CE    . LYS B 1 83  ? 7.945   23.054  68.845   1.00 255.10 ? 83  LYS B CE    1 
ATOM   3547  N  NZ    . LYS B 1 83  ? 7.447   22.314  70.026   1.00 259.54 ? 83  LYS B NZ    1 
ATOM   3548  N  N     . ILE B 1 84  ? 12.188  20.714  63.908   1.00 207.78 ? 84  ILE B N     1 
ATOM   3549  C  CA    . ILE B 1 84  ? 13.301  19.842  63.600   1.00 206.27 ? 84  ILE B CA    1 
ATOM   3550  C  C     . ILE B 1 84  ? 14.311  20.552  62.739   1.00 198.78 ? 84  ILE B C     1 
ATOM   3551  O  O     . ILE B 1 84  ? 15.502  20.454  62.990   1.00 195.97 ? 84  ILE B O     1 
ATOM   3552  C  CB    . ILE B 1 84  ? 12.809  18.593  62.879   1.00 212.39 ? 84  ILE B CB    1 
ATOM   3553  C  CG1   . ILE B 1 84  ? 12.087  17.733  63.917   1.00 212.61 ? 84  ILE B CG1   1 
ATOM   3554  C  CG2   . ILE B 1 84  ? 13.987  17.820  62.312   1.00 211.90 ? 84  ILE B CG2   1 
ATOM   3555  C  CD1   . ILE B 1 84  ? 11.637  16.365  63.442   1.00 205.73 ? 84  ILE B CD1   1 
ATOM   3556  N  N     . TRP B 1 85  ? 13.833  21.261  61.712   1.00 208.06 ? 85  TRP B N     1 
ATOM   3557  C  CA    . TRP B 1 85  ? 14.726  22.024  60.853   1.00 225.62 ? 85  TRP B CA    1 
ATOM   3558  C  C     . TRP B 1 85  ? 15.469  23.083  61.635   1.00 233.75 ? 85  TRP B C     1 
ATOM   3559  O  O     . TRP B 1 85  ? 16.664  23.256  61.455   1.00 230.42 ? 85  TRP B O     1 
ATOM   3560  C  CB    . TRP B 1 85  ? 14.001  22.639  59.660   1.00 227.10 ? 85  TRP B CB    1 
ATOM   3561  C  CG    . TRP B 1 85  ? 13.689  21.653  58.559   1.00 211.69 ? 85  TRP B CG    1 
ATOM   3562  C  CD1   . TRP B 1 85  ? 14.430  20.581  58.143   1.00 198.28 ? 85  TRP B CD1   1 
ATOM   3563  C  CD2   . TRP B 1 85  ? 12.571  21.725  57.689   1.00 203.35 ? 85  TRP B CD2   1 
ATOM   3564  N  NE1   . TRP B 1 85  ? 13.819  19.971  57.075   1.00 185.75 ? 85  TRP B NE1   1 
ATOM   3565  C  CE2   . TRP B 1 85  ? 12.684  20.680  56.760   1.00 195.85 ? 85  TRP B CE2   1 
ATOM   3566  C  CE3   . TRP B 1 85  ? 11.559  22.651  57.557   1.00 208.38 ? 85  TRP B CE3   1 
ATOM   3567  C  CZ2   . TRP B 1 85  ? 11.749  20.478  55.779   1.00 217.39 ? 85  TRP B CZ2   1 
ATOM   3568  C  CZ3   . TRP B 1 85  ? 10.612  22.440  56.596   1.00 211.39 ? 85  TRP B CZ3   1 
ATOM   3569  C  CH2   . TRP B 1 85  ? 10.708  21.376  55.714   1.00 222.98 ? 85  TRP B CH2   1 
ATOM   3570  N  N     . HIS B 1 86  ? 14.772  23.751  62.531   1.00 227.47 ? 86  HIS B N     1 
ATOM   3571  C  CA    . HIS B 1 86  ? 15.318  24.779  63.416   1.00 216.40 ? 86  HIS B CA    1 
ATOM   3572  C  C     . HIS B 1 86  ? 16.533  24.166  64.115   1.00 201.82 ? 86  HIS B C     1 
ATOM   3573  O  O     . HIS B 1 86  ? 17.610  24.741  64.167   1.00 196.90 ? 86  HIS B O     1 
ATOM   3574  C  CB    . HIS B 1 86  ? 14.244  25.244  64.417   1.00 222.71 ? 86  HIS B CB    1 
ATOM   3575  C  CG    . HIS B 1 86  ? 14.656  26.443  65.210   1.00 243.36 ? 86  HIS B CG    1 
ATOM   3576  N  ND1   . HIS B 1 86  ? 15.357  26.365  66.396   1.00 252.57 ? 86  HIS B ND1   1 
ATOM   3577  C  CD2   . HIS B 1 86  ? 14.462  27.761  64.978   1.00 259.28 ? 86  HIS B CD2   1 
ATOM   3578  C  CE1   . HIS B 1 86  ? 15.579  27.586  66.861   1.00 264.78 ? 86  HIS B CE1   1 
ATOM   3579  N  NE2   . HIS B 1 86  ? 15.041  28.452  66.020   1.00 268.44 ? 86  HIS B NE2   1 
ATOM   3580  N  N     . HIS B 1 87  ? 16.301  22.998  64.708   1.00 200.30 ? 87  HIS B N     1 
ATOM   3581  C  CA    . HIS B 1 87  ? 17.305  22.296  65.447   1.00 213.10 ? 87  HIS B CA    1 
ATOM   3582  C  C     . HIS B 1 87  ? 18.526  21.970  64.537   1.00 219.32 ? 87  HIS B C     1 
ATOM   3583  O  O     . HIS B 1 87  ? 19.681  22.170  64.937   1.00 222.71 ? 87  HIS B O     1 
ATOM   3584  C  CB    . HIS B 1 87  ? 16.701  21.047  66.141   1.00 213.19 ? 87  HIS B CB    1 
ATOM   3585  C  CG    . HIS B 1 87  ? 17.718  20.211  66.880   1.00 218.06 ? 87  HIS B CG    1 
ATOM   3586  N  ND1   . HIS B 1 87  ? 18.440  19.207  66.269   1.00 217.76 ? 87  HIS B ND1   1 
ATOM   3587  C  CD2   . HIS B 1 87  ? 18.043  20.162  68.186   1.00 217.27 ? 87  HIS B CD2   1 
ATOM   3588  C  CE1   . HIS B 1 87  ? 19.204  18.606  67.164   1.00 217.28 ? 87  HIS B CE1   1 
ATOM   3589  N  NE2   . HIS B 1 87  ? 18.984  19.166  68.340   1.00 219.10 ? 87  HIS B NE2   1 
ATOM   3590  N  N     . THR B 1 88  ? 18.225  21.548  63.325   1.00 207.46 ? 88  THR B N     1 
ATOM   3591  C  CA    . THR B 1 88  ? 19.337  21.203  62.439   1.00 190.44 ? 88  THR B CA    1 
ATOM   3592  C  C     . THR B 1 88  ? 20.212  22.414  62.173   1.00 200.28 ? 88  THR B C     1 
ATOM   3593  O  O     . THR B 1 88  ? 21.455  22.359  62.340   1.00 199.58 ? 88  THR B O     1 
ATOM   3594  C  CB    . THR B 1 88  ? 18.980  20.827  61.022   1.00 171.85 ? 88  THR B CB    1 
ATOM   3595  O  OG1   . THR B 1 88  ? 18.401  21.935  60.313   1.00 151.83 ? 88  THR B OG1   1 
ATOM   3596  C  CG2   . THR B 1 88  ? 18.106  19.636  60.911   1.00 168.39 ? 88  THR B CG2   1 
ATOM   3597  N  N     . PHE B 1 89  ? 19.579  23.523  61.772   1.00 215.23 ? 89  PHE B N     1 
ATOM   3598  C  CA    . PHE B 1 89  ? 20.367  24.672  61.409   1.00 234.89 ? 89  PHE B CA    1 
ATOM   3599  C  C     . PHE B 1 89  ? 21.067  25.260  62.617   1.00 247.81 ? 89  PHE B C     1 
ATOM   3600  O  O     . PHE B 1 89  ? 22.293  25.434  62.622   1.00 252.54 ? 89  PHE B O     1 
ATOM   3601  C  CB    . PHE B 1 89  ? 19.541  25.731  60.735   1.00 233.34 ? 89  PHE B CB    1 
ATOM   3602  C  CG    . PHE B 1 89  ? 18.997  25.294  59.425   1.00 222.94 ? 89  PHE B CG    1 
ATOM   3603  C  CD1   . PHE B 1 89  ? 19.813  25.101  58.337   1.00 214.55 ? 89  PHE B CD1   1 
ATOM   3604  C  CD2   . PHE B 1 89  ? 17.648  25.123  59.269   1.00 221.04 ? 89  PHE B CD2   1 
ATOM   3605  C  CE1   . PHE B 1 89  ? 19.293  24.715  57.115   1.00 211.24 ? 89  PHE B CE1   1 
ATOM   3606  C  CE2   . PHE B 1 89  ? 17.108  24.738  58.046   1.00 221.98 ? 89  PHE B CE2   1 
ATOM   3607  C  CZ    . PHE B 1 89  ? 17.935  24.530  56.977   1.00 218.23 ? 89  PHE B CZ    1 
ATOM   3608  N  N     . TYR B 1 90  ? 20.298  25.634  63.646   1.00 247.10 ? 90  TYR B N     1 
ATOM   3609  C  CA    . TYR B 1 90  ? 20.890  26.330  64.768   1.00 239.78 ? 90  TYR B CA    1 
ATOM   3610  C  C     . TYR B 1 90  ? 21.668  25.461  65.730   1.00 254.57 ? 90  TYR B C     1 
ATOM   3611  O  O     . TYR B 1 90  ? 22.757  25.825  66.145   1.00 254.52 ? 90  TYR B O     1 
ATOM   3612  C  CB    . TYR B 1 90  ? 19.861  27.198  65.512   1.00 220.52 ? 90  TYR B CB    1 
ATOM   3613  C  CG    . TYR B 1 90  ? 19.237  28.147  64.551   1.00 214.43 ? 90  TYR B CG    1 
ATOM   3614  C  CD1   . TYR B 1 90  ? 20.008  29.040  63.812   1.00 203.60 ? 90  TYR B CD1   1 
ATOM   3615  C  CD2   . TYR B 1 90  ? 17.870  28.192  64.416   1.00 227.76 ? 90  TYR B CD2   1 
ATOM   3616  C  CE1   . TYR B 1 90  ? 19.416  29.946  62.975   1.00 211.11 ? 90  TYR B CE1   1 
ATOM   3617  C  CE2   . TYR B 1 90  ? 17.271  29.086  63.558   1.00 232.24 ? 90  TYR B CE2   1 
ATOM   3618  C  CZ    . TYR B 1 90  ? 18.045  29.960  62.827   1.00 225.09 ? 90  TYR B CZ    1 
ATOM   3619  O  OH    . TYR B 1 90  ? 17.431  30.869  61.949   1.00 232.35 ? 90  TYR B OH    1 
ATOM   3620  N  N     . ASN B 1 91  ? 21.071  24.348  66.153   1.00 259.93 ? 91  ASN B N     1 
ATOM   3621  C  CA    . ASN B 1 91  ? 21.747  23.465  67.082   1.00 258.78 ? 91  ASN B CA    1 
ATOM   3622  C  C     . ASN B 1 91  ? 22.927  22.692  66.585   1.00 255.58 ? 91  ASN B C     1 
ATOM   3623  O  O     . ASN B 1 91  ? 23.886  22.569  67.358   1.00 258.83 ? 91  ASN B O     1 
ATOM   3624  C  CB    . ASN B 1 91  ? 20.732  22.542  67.812   1.00 257.36 ? 91  ASN B CB    1 
ATOM   3625  C  CG    . ASN B 1 91  ? 19.673  23.341  68.524   1.00 257.36 ? 91  ASN B CG    1 
ATOM   3626  O  OD1   . ASN B 1 91  ? 18.506  22.969  68.550   1.00 267.71 ? 91  ASN B OD1   1 
ATOM   3627  N  ND2   . ASN B 1 91  ? 20.074  24.460  69.125   1.00 250.56 ? 91  ASN B ND2   1 
ATOM   3628  N  N     . GLU B 1 92  ? 22.939  22.208  65.344   1.00 249.22 ? 92  GLU B N     1 
ATOM   3629  C  CA    . GLU B 1 92  ? 24.066  21.449  64.852   1.00 245.14 ? 92  GLU B CA    1 
ATOM   3630  C  C     . GLU B 1 92  ? 24.968  22.208  63.939   1.00 239.22 ? 92  GLU B C     1 
ATOM   3631  O  O     . GLU B 1 92  ? 26.162  22.272  64.207   1.00 233.05 ? 92  GLU B O     1 
ATOM   3632  C  CB    . GLU B 1 92  ? 23.649  20.182  64.091   1.00 245.00 ? 92  GLU B CB    1 
ATOM   3633  C  CG    . GLU B 1 92  ? 23.578  18.935  64.972   1.00 244.73 ? 92  GLU B CG    1 
ATOM   3634  C  CD    . GLU B 1 92  ? 22.341  18.938  65.811   1.00 241.57 ? 92  GLU B CD    1 
ATOM   3635  O  OE1   . GLU B 1 92  ? 21.386  19.632  65.412   1.00 238.18 ? 92  GLU B OE1   1 
ATOM   3636  O  OE2   . GLU B 1 92  ? 22.322  18.235  66.843   1.00 238.50 ? 92  GLU B OE2   1 
ATOM   3637  N  N     . LEU B 1 93  ? 24.423  22.691  62.820   1.00 226.26 ? 93  LEU B N     1 
ATOM   3638  C  CA    . LEU B 1 93  ? 25.231  23.265  61.725   1.00 219.75 ? 93  LEU B CA    1 
ATOM   3639  C  C     . LEU B 1 93  ? 25.692  24.652  62.091   1.00 224.95 ? 93  LEU B C     1 
ATOM   3640  O  O     . LEU B 1 93  ? 26.766  25.029  61.683   1.00 214.27 ? 93  LEU B O     1 
ATOM   3641  C  CB    . LEU B 1 93  ? 24.518  23.192  60.346   1.00 212.93 ? 93  LEU B CB    1 
ATOM   3642  C  CG    . LEU B 1 93  ? 24.206  21.738  59.931   1.00 210.13 ? 93  LEU B CG    1 
ATOM   3643  C  CD1   . LEU B 1 93  ? 23.499  21.681  58.578   1.00 208.18 ? 93  LEU B CD1   1 
ATOM   3644  C  CD2   . LEU B 1 93  ? 25.467  20.859  59.995   1.00 218.30 ? 93  LEU B CD2   1 
ATOM   3645  N  N     . ARG B 1 94  ? 24.884  25.406  62.811   1.00 241.80 ? 94  ARG B N     1 
ATOM   3646  C  CA    . ARG B 1 94  ? 25.239  26.741  63.187   1.00 254.56 ? 94  ARG B CA    1 
ATOM   3647  C  C     . ARG B 1 94  ? 25.421  27.600  61.951   1.00 258.39 ? 94  ARG B C     1 
ATOM   3648  O  O     . ARG B 1 94  ? 26.430  28.258  61.729   1.00 260.90 ? 94  ARG B O     1 
ATOM   3649  C  CB    . ARG B 1 94  ? 26.502  26.748  64.063   1.00 255.53 ? 94  ARG B CB    1 
ATOM   3650  C  CG    . ARG B 1 94  ? 26.367  25.877  65.287   1.00 256.83 ? 94  ARG B CG    1 
ATOM   3651  C  CD    . ARG B 1 94  ? 27.588  26.002  66.180   1.00 255.07 ? 94  ARG B CD    1 
ATOM   3652  N  NE    . ARG B 1 94  ? 27.483  25.089  67.325   1.00 252.59 ? 94  ARG B NE    1 
ATOM   3653  C  CZ    . ARG B 1 94  ? 28.454  24.897  68.217   1.00 254.76 ? 94  ARG B CZ    1 
ATOM   3654  N  NH1   . ARG B 1 94  ? 29.589  25.570  68.077   1.00 254.08 ? 94  ARG B NH1   1 
ATOM   3655  N  NH2   . ARG B 1 94  ? 28.299  24.039  69.249   1.00 258.48 ? 94  ARG B NH2   1 
ATOM   3656  N  N     . VAL B 1 95  ? 24.399  27.589  61.107   1.00 254.82 ? 95  VAL B N     1 
ATOM   3657  C  CA    . VAL B 1 95  ? 24.376  28.378  59.891   1.00 253.09 ? 95  VAL B CA    1 
ATOM   3658  C  C     . VAL B 1 95  ? 23.177  29.295  59.884   1.00 243.97 ? 95  VAL B C     1 
ATOM   3659  O  O     . VAL B 1 95  ? 22.133  29.013  60.475   1.00 227.25 ? 95  VAL B O     1 
ATOM   3660  C  CB    . VAL B 1 95  ? 24.304  27.456  58.662   1.00 266.47 ? 95  VAL B CB    1 
ATOM   3661  C  CG1   . VAL B 1 95  ? 25.614  26.667  58.549   1.00 262.09 ? 95  VAL B CG1   1 
ATOM   3662  C  CG2   . VAL B 1 95  ? 23.045  26.550  58.720   1.00 280.14 ? 95  VAL B CG2   1 
ATOM   3663  N  N     . ALA B 1 96  ? 23.293  30.410  59.162   1.00 247.51 ? 96  ALA B N     1 
ATOM   3664  C  CA    . ALA B 1 96  ? 22.176  31.265  58.871   1.00 251.87 ? 96  ALA B CA    1 
ATOM   3665  C  C     . ALA B 1 96  ? 21.748  30.858  57.506   1.00 245.10 ? 96  ALA B C     1 
ATOM   3666  O  O     . ALA B 1 96  ? 22.499  31.001  56.553   1.00 250.14 ? 96  ALA B O     1 
ATOM   3667  C  CB    . ALA B 1 96  ? 22.567  32.764  58.851   1.00 261.25 ? 96  ALA B CB    1 
ATOM   3668  N  N     . PRO B 1 97  ? 20.538  30.332  57.370   1.00 230.81 ? 97  PRO B N     1 
ATOM   3669  C  CA    . PRO B 1 97  ? 20.097  29.834  56.097   1.00 222.25 ? 97  PRO B CA    1 
ATOM   3670  C  C     . PRO B 1 97  ? 19.996  30.893  55.024   1.00 218.16 ? 97  PRO B C     1 
ATOM   3671  O  O     . PRO B 1 97  ? 20.070  30.567  53.858   1.00 216.52 ? 97  PRO B O     1 
ATOM   3672  C  CB    . PRO B 1 97  ? 18.750  29.166  56.427   1.00 226.58 ? 97  PRO B CB    1 
ATOM   3673  C  CG    . PRO B 1 97  ? 18.944  28.669  57.825   1.00 228.90 ? 97  PRO B CG    1 
ATOM   3674  C  CD    . PRO B 1 97  ? 19.821  29.715  58.471   1.00 226.84 ? 97  PRO B CD    1 
ATOM   3675  N  N     . GLU B 1 98  ? 19.830  32.162  55.400   1.00 214.97 ? 98  GLU B N     1 
ATOM   3676  C  CA    . GLU B 1 98  ? 20.066  33.270  54.493   1.00 215.53 ? 98  GLU B CA    1 
ATOM   3677  C  C     . GLU B 1 98  ? 21.364  33.200  53.733   1.00 213.69 ? 98  GLU B C     1 
ATOM   3678  O  O     . GLU B 1 98  ? 21.440  33.768  52.660   1.00 217.67 ? 98  GLU B O     1 
ATOM   3679  C  CB    . GLU B 1 98  ? 20.047  34.649  55.192   1.00 227.74 ? 98  GLU B CB    1 
ATOM   3680  C  CG    . GLU B 1 98  ? 18.752  35.035  55.855   1.00 248.25 ? 98  GLU B CG    1 
ATOM   3681  C  CD    . GLU B 1 98  ? 18.632  34.500  57.255   1.00 259.70 ? 98  GLU B CD    1 
ATOM   3682  O  OE1   . GLU B 1 98  ? 19.454  33.617  57.597   1.00 264.35 ? 98  GLU B OE1   1 
ATOM   3683  O  OE2   . GLU B 1 98  ? 17.725  34.932  57.978   1.00 267.61 ? 98  GLU B OE2   1 
ATOM   3684  N  N     . GLU B 1 99  ? 22.403  32.592  54.323   1.00 219.90 ? 99  GLU B N     1 
ATOM   3685  C  CA    . GLU B 1 99  ? 23.700  32.484  53.713   1.00 227.67 ? 99  GLU B CA    1 
ATOM   3686  C  C     . GLU B 1 99  ? 23.915  31.212  52.895   1.00 209.21 ? 99  GLU B C     1 
ATOM   3687  O  O     . GLU B 1 99  ? 25.038  30.988  52.529   1.00 203.77 ? 99  GLU B O     1 
ATOM   3688  C  CB    . GLU B 1 99  ? 24.788  32.624  54.776   1.00 257.91 ? 99  GLU B CB    1 
ATOM   3689  C  CG    . GLU B 1 99  ? 24.687  33.898  55.616   1.00 278.30 ? 99  GLU B CG    1 
ATOM   3690  C  CD    . GLU B 1 99  ? 25.538  33.873  56.863   1.00 293.44 ? 99  GLU B CD    1 
ATOM   3691  O  OE1   . GLU B 1 99  ? 26.024  32.807  57.316   1.00 297.85 ? 99  GLU B OE1   1 
ATOM   3692  O  OE2   . GLU B 1 99  ? 25.724  34.964  57.443   1.00 300.26 ? 99  GLU B OE2   1 
ATOM   3693  N  N     . HIS B 1 100 ? 22.914  30.398  52.603   1.00 201.81 ? 100 HIS B N     1 
ATOM   3694  C  CA    . HIS B 1 100 ? 23.090  29.148  51.883   1.00 208.06 ? 100 HIS B CA    1 
ATOM   3695  C  C     . HIS B 1 100 ? 21.830  28.764  51.177   1.00 204.91 ? 100 HIS B C     1 
ATOM   3696  O  O     . HIS B 1 100 ? 20.740  28.980  51.663   1.00 206.63 ? 100 HIS B O     1 
ATOM   3697  C  CB    . HIS B 1 100 ? 23.444  28.009  52.825   1.00 213.36 ? 100 HIS B CB    1 
ATOM   3698  C  CG    . HIS B 1 100 ? 24.729  28.214  53.582   1.00 227.82 ? 100 HIS B CG    1 
ATOM   3699  N  ND1   . HIS B 1 100 ? 25.973  27.990  53.031   1.00 234.45 ? 100 HIS B ND1   1 
ATOM   3700  C  CD2   . HIS B 1 100 ? 24.953  28.687  54.826   1.00 239.91 ? 100 HIS B CD2   1 
ATOM   3701  C  CE1   . HIS B 1 100 ? 26.911  28.280  53.921   1.00 246.25 ? 100 HIS B CE1   1 
ATOM   3702  N  NE2   . HIS B 1 100 ? 26.319  28.702  55.025   1.00 248.15 ? 100 HIS B NE2   1 
ATOM   3703  N  N     . PRO B 1 101 ? 21.981  28.188  49.986   1.00 196.10 ? 101 PRO B N     1 
ATOM   3704  C  CA    . PRO B 1 101 ? 20.903  27.604  49.258   1.00 173.43 ? 101 PRO B CA    1 
ATOM   3705  C  C     . PRO B 1 101 ? 20.694  26.251  49.885   1.00 170.55 ? 101 PRO B C     1 
ATOM   3706  O  O     . PRO B 1 101 ? 21.676  25.623  50.295   1.00 149.37 ? 101 PRO B O     1 
ATOM   3707  C  CB    . PRO B 1 101 ? 21.444  27.515  47.798   1.00 173.76 ? 101 PRO B CB    1 
ATOM   3708  C  CG    . PRO B 1 101 ? 22.586  28.436  47.733   1.00 189.25 ? 101 PRO B CG    1 
ATOM   3709  C  CD    . PRO B 1 101 ? 23.140  28.502  49.128   1.00 204.94 ? 101 PRO B CD    1 
ATOM   3710  N  N     . VAL B 1 102 ? 19.428  25.792  49.998   1.00 178.10 ? 102 VAL B N     1 
ATOM   3711  C  CA    . VAL B 1 102 ? 19.220  24.545  50.662   1.00 176.75 ? 102 VAL B CA    1 
ATOM   3712  C  C     . VAL B 1 102 ? 18.493  23.570  49.787   1.00 181.85 ? 102 VAL B C     1 
ATOM   3713  O  O     . VAL B 1 102 ? 17.514  23.897  49.156   1.00 198.65 ? 102 VAL B O     1 
ATOM   3714  C  CB    . VAL B 1 102 ? 18.433  24.731  51.958   1.00 178.94 ? 102 VAL B CB    1 
ATOM   3715  C  CG1   . VAL B 1 102 ? 17.053  25.405  51.722   1.00 169.86 ? 102 VAL B CG1   1 
ATOM   3716  C  CG2   . VAL B 1 102 ? 18.313  23.387  52.690   1.00 188.33 ? 102 VAL B CG2   1 
ATOM   3717  N  N     . LEU B 1 103 ? 18.994  22.342  49.793   1.00 173.45 ? 103 LEU B N     1 
ATOM   3718  C  CA    . LEU B 1 103 ? 18.364  21.270  49.023   1.00 174.41 ? 103 LEU B CA    1 
ATOM   3719  C  C     . LEU B 1 103 ? 17.594  20.408  49.950   1.00 189.50 ? 103 LEU B C     1 
ATOM   3720  O  O     . LEU B 1 103 ? 18.150  19.939  50.929   1.00 195.97 ? 103 LEU B O     1 
ATOM   3721  C  CB    . LEU B 1 103 ? 19.439  20.398  48.362   1.00 172.68 ? 103 LEU B CB    1 
ATOM   3722  C  CG    . LEU B 1 103 ? 18.988  19.039  47.750   1.00 169.14 ? 103 LEU B CG    1 
ATOM   3723  C  CD1   . LEU B 1 103 ? 17.907  19.267  46.700   1.00 168.27 ? 103 LEU B CD1   1 
ATOM   3724  C  CD2   . LEU B 1 103 ? 20.161  18.235  47.179   1.00 175.40 ? 103 LEU B CD2   1 
ATOM   3725  N  N     . LEU B 1 104 ? 16.342  20.089  49.636   1.00 209.53 ? 104 LEU B N     1 
ATOM   3726  C  CA    . LEU B 1 104 ? 15.604  19.089  50.383   1.00 228.57 ? 104 LEU B CA    1 
ATOM   3727  C  C     . LEU B 1 104 ? 15.332  17.854  49.526   1.00 220.79 ? 104 LEU B C     1 
ATOM   3728  O  O     . LEU B 1 104 ? 15.073  17.960  48.299   1.00 219.71 ? 104 LEU B O     1 
ATOM   3729  C  CB    . LEU B 1 104 ? 14.220  19.602  50.894   1.00 239.50 ? 104 LEU B CB    1 
ATOM   3730  C  CG    . LEU B 1 104 ? 14.329  20.701  51.966   1.00 252.99 ? 104 LEU B CG    1 
ATOM   3731  C  CD1   . LEU B 1 104 ? 13.032  21.497  52.114   1.00 261.32 ? 104 LEU B CD1   1 
ATOM   3732  C  CD2   . LEU B 1 104 ? 14.820  20.120  53.300   1.00 259.43 ? 104 LEU B CD2   1 
ATOM   3733  N  N     . THR B 1 105 ? 15.341  16.706  50.176   1.00 218.13 ? 105 THR B N     1 
ATOM   3734  C  CA    . THR B 1 105 ? 14.899  15.486  49.554   1.00 219.56 ? 105 THR B CA    1 
ATOM   3735  C  C     . THR B 1 105 ? 13.405  15.350  49.784   1.00 211.03 ? 105 THR B C     1 
ATOM   3736  O  O     . THR B 1 105 ? 12.821  16.020  50.631   1.00 210.24 ? 105 THR B O     1 
ATOM   3737  C  CB    . THR B 1 105 ? 15.656  14.240  50.066   1.00 225.61 ? 105 THR B CB    1 
ATOM   3738  O  OG1   . THR B 1 105 ? 15.548  13.218  49.057   1.00 226.39 ? 105 THR B OG1   1 
ATOM   3739  C  CG2   . THR B 1 105 ? 15.050  13.705  51.302   1.00 236.56 ? 105 THR B CG2   1 
ATOM   3740  N  N     . GLU B 1 106 ? 12.796  14.465  49.027   1.00 206.99 ? 106 GLU B N     1 
ATOM   3741  C  CA    . GLU B 1 106 ? 11.368  14.172  49.199   1.00 212.39 ? 106 GLU B CA    1 
ATOM   3742  C  C     . GLU B 1 106 ? 11.037  12.938  48.369   1.00 212.03 ? 106 GLU B C     1 
ATOM   3743  O  O     . GLU B 1 106 ? 11.719  12.642  47.381   1.00 219.34 ? 106 GLU B O     1 
ATOM   3744  C  CB    . GLU B 1 106 ? 10.515  15.384  48.797   1.00 226.40 ? 106 GLU B CB    1 
ATOM   3745  C  CG    . GLU B 1 106 ? 9.055   15.314  49.192   1.00 237.19 ? 106 GLU B CG    1 
ATOM   3746  C  CD    . GLU B 1 106 ? 8.181   15.119  47.978   1.00 244.39 ? 106 GLU B CD    1 
ATOM   3747  O  OE1   . GLU B 1 106 ? 8.738   14.649  46.974   1.00 257.55 ? 106 GLU B OE1   1 
ATOM   3748  O  OE2   . GLU B 1 106 ? 6.984   15.469  47.981   1.00 233.58 ? 106 GLU B OE2   1 
ATOM   3749  N  N     . ALA B 1 107 ? 10.021  12.202  48.789   1.00 204.51 ? 107 ALA B N     1 
ATOM   3750  C  CA    . ALA B 1 107 ? 9.744   10.895  48.239   1.00 195.16 ? 107 ALA B CA    1 
ATOM   3751  C  C     . ALA B 1 107 ? 8.874   11.036  47.033   1.00 192.85 ? 107 ALA B C     1 
ATOM   3752  O  O     . ALA B 1 107 ? 8.144   11.955  46.918   1.00 206.72 ? 107 ALA B O     1 
ATOM   3753  C  CB    . ALA B 1 107 ? 9.035   10.058  49.276   1.00 191.40 ? 107 ALA B CB    1 
ATOM   3754  N  N     . PRO B 1 108 ? 8.955   10.101  46.119   1.00 172.56 ? 108 PRO B N     1 
ATOM   3755  C  CA    . PRO B 1 108 ? 8.080   10.077  44.958   1.00 153.21 ? 108 PRO B CA    1 
ATOM   3756  C  C     . PRO B 1 108 ? 6.599   9.867   45.201   1.00 151.26 ? 108 PRO B C     1 
ATOM   3757  O  O     . PRO B 1 108 ? 6.219   9.386   46.247   1.00 142.90 ? 108 PRO B O     1 
ATOM   3758  C  CB    . PRO B 1 108 ? 8.570   8.855   44.175   1.00 155.50 ? 108 PRO B CB    1 
ATOM   3759  C  CG    . PRO B 1 108 ? 9.944   8.581   44.646   1.00 166.62 ? 108 PRO B CG    1 
ATOM   3760  C  CD    . PRO B 1 108 ? 10.026  9.112   46.061   1.00 174.59 ? 108 PRO B CD    1 
ATOM   3761  N  N     . LEU B 1 109 ? 5.784   10.221  44.209   1.00 154.71 ? 109 LEU B N     1 
ATOM   3762  C  CA    . LEU B 1 109 ? 4.357   10.014  44.225   1.00 163.01 ? 109 LEU B CA    1 
ATOM   3763  C  C     . LEU B 1 109 ? 3.669   10.657  45.429   1.00 150.76 ? 109 LEU B C     1 
ATOM   3764  O  O     . LEU B 1 109 ? 2.613   10.321  45.801   1.00 131.78 ? 109 LEU B O     1 
ATOM   3765  C  CB    . LEU B 1 109 ? 4.010   8.527   44.129   1.00 200.62 ? 109 LEU B CB    1 
ATOM   3766  C  CG    . LEU B 1 109 ? 3.688   8.062   42.691   1.00 232.57 ? 109 LEU B CG    1 
ATOM   3767  C  CD1   . LEU B 1 109 ? 4.892   8.259   41.763   1.00 235.19 ? 109 LEU B CD1   1 
ATOM   3768  C  CD2   . LEU B 1 109 ? 3.159   6.625   42.673   1.00 249.31 ? 109 LEU B CD2   1 
ATOM   3769  N  N     . ASN B 1 110 ? 4.305   11.650  46.012   1.00 158.56 ? 110 ASN B N     1 
ATOM   3770  C  CA    . ASN B 1 110 ? 3.971   12.125  47.324   1.00 151.66 ? 110 ASN B CA    1 
ATOM   3771  C  C     . ASN B 1 110 ? 3.025   13.250  47.048   1.00 130.86 ? 110 ASN B C     1 
ATOM   3772  O  O     . ASN B 1 110 ? 3.042   13.873  45.993   1.00 136.58 ? 110 ASN B O     1 
ATOM   3773  C  CB    . ASN B 1 110 ? 5.288   12.564  47.999   1.00 158.52 ? 110 ASN B CB    1 
ATOM   3774  C  CG    . ASN B 1 110 ? 5.120   13.009  49.437   1.00 161.47 ? 110 ASN B CG    1 
ATOM   3775  O  OD1   . ASN B 1 110 ? 4.072   13.487  49.847   1.00 164.73 ? 110 ASN B OD1   1 
ATOM   3776  N  ND2   . ASN B 1 110 ? 6.205   12.870  50.220   1.00 168.43 ? 110 ASN B ND2   1 
ATOM   3777  N  N     . PRO B 1 111 ? 2.121   13.503  47.961   1.00 113.56 ? 111 PRO B N     1 
ATOM   3778  C  CA    . PRO B 1 111 ? 1.224   14.631  47.815   1.00 125.74 ? 111 PRO B CA    1 
ATOM   3779  C  C     . PRO B 1 111 ? 1.858   15.977  47.517   1.00 153.30 ? 111 PRO B C     1 
ATOM   3780  O  O     . PRO B 1 111 ? 2.957   16.277  47.960   1.00 179.58 ? 111 PRO B O     1 
ATOM   3781  C  CB    . PRO B 1 111 ? 0.518   14.682  49.171   1.00 123.07 ? 111 PRO B CB    1 
ATOM   3782  C  CG    . PRO B 1 111 ? 0.422   13.238  49.486   1.00 118.04 ? 111 PRO B CG    1 
ATOM   3783  C  CD    . PRO B 1 111 ? 1.490   12.474  48.786   1.00 108.02 ? 111 PRO B CD    1 
ATOM   3784  N  N     . LYS B 1 112 ? 1.155   16.755  46.706   1.00 163.35 ? 112 LYS B N     1 
ATOM   3785  C  CA    . LYS B 1 112 ? 1.652   18.030  46.224   1.00 176.92 ? 112 LYS B CA    1 
ATOM   3786  C  C     . LYS B 1 112 ? 1.899   18.930  47.398   1.00 163.15 ? 112 LYS B C     1 
ATOM   3787  O  O     . LYS B 1 112 ? 2.887   19.630  47.450   1.00 176.83 ? 112 LYS B O     1 
ATOM   3788  C  CB    . LYS B 1 112 ? 0.633   18.700  45.268   1.00 198.33 ? 112 LYS B CB    1 
ATOM   3789  C  CG    . LYS B 1 112 ? 0.496   17.964  43.938   1.00 212.97 ? 112 LYS B CG    1 
ATOM   3790  C  CD    . LYS B 1 112 ? -0.518  18.599  42.991   1.00 224.96 ? 112 LYS B CD    1 
ATOM   3791  C  CE    . LYS B 1 112 ? -0.059  19.917  42.381   1.00 225.26 ? 112 LYS B CE    1 
ATOM   3792  N  NZ    . LYS B 1 112 ? 0.803   19.697  41.189   1.00 231.46 ? 112 LYS B NZ    1 
ATOM   3793  N  N     . ALA B 1 113 ? 0.946   18.903  48.340   1.00 138.98 ? 113 ALA B N     1 
ATOM   3794  C  CA    . ALA B 1 113 ? 0.882   19.797  49.453   1.00 141.88 ? 113 ALA B CA    1 
ATOM   3795  C  C     . ALA B 1 113 ? 2.201   19.795  50.179   1.00 147.58 ? 113 ALA B C     1 
ATOM   3796  O  O     . ALA B 1 113 ? 2.651   20.838  50.634   1.00 150.07 ? 113 ALA B O     1 
ATOM   3797  C  CB    . ALA B 1 113 ? -0.235  19.384  50.430   1.00 150.57 ? 113 ALA B CB    1 
ATOM   3798  N  N     . ASN B 1 114 ? 2.819   18.620  50.271   1.00 163.44 ? 114 ASN B N     1 
ATOM   3799  C  CA    . ASN B 1 114 ? 4.059   18.496  51.024   1.00 180.84 ? 114 ASN B CA    1 
ATOM   3800  C  C     . ASN B 1 114 ? 5.139   19.275  50.344   1.00 179.72 ? 114 ASN B C     1 
ATOM   3801  O  O     . ASN B 1 114 ? 5.886   19.983  51.020   1.00 197.59 ? 114 ASN B O     1 
ATOM   3802  C  CB    . ASN B 1 114 ? 4.559   17.067  51.186   1.00 187.14 ? 114 ASN B CB    1 
ATOM   3803  C  CG    . ASN B 1 114 ? 3.821   16.317  52.260   1.00 204.94 ? 114 ASN B CG    1 
ATOM   3804  O  OD1   . ASN B 1 114 ? 3.360   16.882  53.258   1.00 219.81 ? 114 ASN B OD1   1 
ATOM   3805  N  ND2   . ASN B 1 114 ? 3.703   15.035  52.060   1.00 219.83 ? 114 ASN B ND2   1 
ATOM   3806  N  N     . ARG B 1 115 ? 5.228   19.173  49.021   1.00 172.78 ? 115 ARG B N     1 
ATOM   3807  C  CA    . ARG B 1 115 ? 6.289   19.905  48.322   1.00 169.11 ? 115 ARG B CA    1 
ATOM   3808  C  C     . ARG B 1 115 ? 5.976   21.402  48.489   1.00 181.93 ? 115 ARG B C     1 
ATOM   3809  O  O     . ARG B 1 115 ? 6.838   22.210  48.881   1.00 201.03 ? 115 ARG B O     1 
ATOM   3810  C  CB    . ARG B 1 115 ? 6.345   19.567  46.828   1.00 173.39 ? 115 ARG B CB    1 
ATOM   3811  C  CG    . ARG B 1 115 ? 7.296   18.472  46.386   1.00 183.10 ? 115 ARG B CG    1 
ATOM   3812  C  CD    . ARG B 1 115 ? 7.410   18.427  44.857   1.00 187.64 ? 115 ARG B CD    1 
ATOM   3813  N  NE    . ARG B 1 115 ? 8.024   17.173  44.395   1.00 196.91 ? 115 ARG B NE    1 
ATOM   3814  C  CZ    . ARG B 1 115 ? 7.386   16.001  44.396   1.00 214.59 ? 115 ARG B CZ    1 
ATOM   3815  N  NH1   . ARG B 1 115 ? 6.103   15.969  44.741   1.00 216.20 ? 115 ARG B NH1   1 
ATOM   3816  N  NH2   . ARG B 1 115 ? 7.998   14.875  43.966   1.00 222.13 ? 115 ARG B NH2   1 
ATOM   3817  N  N     . GLU B 1 116 ? 4.727   21.770  48.192   1.00 193.84 ? 116 GLU B N     1 
ATOM   3818  C  CA    . GLU B 1 116 ? 4.365   23.168  48.113   1.00 210.04 ? 116 GLU B CA    1 
ATOM   3819  C  C     . GLU B 1 116 ? 4.572   23.806  49.505   1.00 214.64 ? 116 GLU B C     1 
ATOM   3820  O  O     . GLU B 1 116 ? 5.250   24.826  49.673   1.00 222.15 ? 116 GLU B O     1 
ATOM   3821  C  CB    . GLU B 1 116 ? 2.904   23.322  47.604   1.00 213.30 ? 116 GLU B CB    1 
ATOM   3822  C  CG    . GLU B 1 116 ? 2.793   23.285  46.105   1.00 214.95 ? 116 GLU B CG    1 
ATOM   3823  C  CD    . GLU B 1 116 ? 1.447   22.748  45.652   1.00 221.04 ? 116 GLU B CD    1 
ATOM   3824  O  OE1   . GLU B 1 116 ? 0.694   22.294  46.545   1.00 231.25 ? 116 GLU B OE1   1 
ATOM   3825  O  OE2   . GLU B 1 116 ? 1.188   22.758  44.438   1.00 208.71 ? 116 GLU B OE2   1 
ATOM   3826  N  N     . LYS B 1 117 ? 4.004   23.134  50.504   1.00 210.69 ? 117 LYS B N     1 
ATOM   3827  C  CA    . LYS B 1 117 ? 4.099   23.647  51.867   1.00 215.85 ? 117 LYS B CA    1 
ATOM   3828  C  C     . LYS B 1 117 ? 5.504   23.664  52.362   1.00 207.89 ? 117 LYS B C     1 
ATOM   3829  O  O     . LYS B 1 117 ? 5.942   24.557  53.028   1.00 216.39 ? 117 LYS B O     1 
ATOM   3830  C  CB    . LYS B 1 117 ? 3.261   22.849  52.874   1.00 225.20 ? 117 LYS B CB    1 
ATOM   3831  C  CG    . LYS B 1 117 ? 3.241   23.459  54.266   1.00 246.74 ? 117 LYS B CG    1 
ATOM   3832  C  CD    . LYS B 1 117 ? 2.584   24.839  54.347   1.00 264.99 ? 117 LYS B CD    1 
ATOM   3833  C  CE    . LYS B 1 117 ? 2.506   25.394  55.768   1.00 287.61 ? 117 LYS B CE    1 
ATOM   3834  N  NZ    . LYS B 1 117 ? 2.251   26.863  55.754   1.00 300.99 ? 117 LYS B NZ    1 
ATOM   3835  N  N     . MET B 1 118 ? 6.299   22.656  51.983   1.00 193.47 ? 118 MET B N     1 
ATOM   3836  C  CA    . MET B 1 118 ? 7.729   22.597  52.301   1.00 186.54 ? 118 MET B CA    1 
ATOM   3837  C  C     . MET B 1 118 ? 8.426   23.863  51.817   1.00 175.25 ? 118 MET B C     1 
ATOM   3838  O  O     . MET B 1 118 ? 9.098   24.535  52.640   1.00 183.52 ? 118 MET B O     1 
ATOM   3839  C  CB    . MET B 1 118 ? 8.341   21.347  51.643   1.00 204.16 ? 118 MET B CB    1 
ATOM   3840  C  CG    . MET B 1 118 ? 9.724   20.982  52.085   1.00 215.62 ? 118 MET B CG    1 
ATOM   3841  S  SD    . MET B 1 118 ? 10.273  19.291  51.648   1.00 241.27 ? 118 MET B SD    1 
ATOM   3842  C  CE    . MET B 1 118 ? 9.263   18.253  52.709   1.00 240.12 ? 118 MET B CE    1 
ATOM   3843  N  N     . THR B 1 119 ? 8.239   24.216  50.555   1.00 166.73 ? 119 THR B N     1 
ATOM   3844  C  CA    . THR B 1 119 ? 8.817   25.390  50.003   1.00 170.04 ? 119 THR B CA    1 
ATOM   3845  C  C     . THR B 1 119 ? 8.333   26.634  50.699   1.00 195.26 ? 119 THR B C     1 
ATOM   3846  O  O     . THR B 1 119 ? 9.103   27.509  50.995   1.00 214.15 ? 119 THR B O     1 
ATOM   3847  C  CB    . THR B 1 119 ? 8.529   25.591  48.535   1.00 156.21 ? 119 THR B CB    1 
ATOM   3848  O  OG1   . THR B 1 119 ? 7.115   25.563  48.354   1.00 143.72 ? 119 THR B OG1   1 
ATOM   3849  C  CG2   . THR B 1 119 ? 9.207   24.540  47.721   1.00 171.17 ? 119 THR B CG2   1 
ATOM   3850  N  N     . GLN B 1 120 ? 7.044   26.684  50.992   1.00 212.35 ? 120 GLN B N     1 
ATOM   3851  C  CA    . GLN B 1 120 ? 6.450   27.817  51.702   1.00 222.68 ? 120 GLN B CA    1 
ATOM   3852  C  C     . GLN B 1 120 ? 7.200   28.061  53.007   1.00 209.14 ? 120 GLN B C     1 
ATOM   3853  O  O     . GLN B 1 120 ? 7.554   29.227  53.317   1.00 195.38 ? 120 GLN B O     1 
ATOM   3854  C  CB    . GLN B 1 120 ? 4.962   27.564  52.021   1.00 225.75 ? 120 GLN B CB    1 
ATOM   3855  C  CG    . GLN B 1 120 ? 4.283   28.698  52.738   1.00 223.40 ? 120 GLN B CG    1 
ATOM   3856  C  CD    . GLN B 1 120 ? 2.779   28.584  52.683   1.00 230.47 ? 120 GLN B CD    1 
ATOM   3857  O  OE1   . GLN B 1 120 ? 2.222   27.645  52.099   1.00 219.14 ? 120 GLN B OE1   1 
ATOM   3858  N  NE2   . GLN B 1 120 ? 2.099   29.541  53.307   1.00 240.60 ? 120 GLN B NE2   1 
ATOM   3859  N  N     . ILE B 1 121 ? 7.426   26.989  53.756   1.00 210.57 ? 121 ILE B N     1 
ATOM   3860  C  CA    . ILE B 1 121 ? 8.236   27.115  54.941   1.00 219.67 ? 121 ILE B CA    1 
ATOM   3861  C  C     . ILE B 1 121 ? 9.622   27.613  54.681   1.00 216.35 ? 121 ILE B C     1 
ATOM   3862  O  O     . ILE B 1 121 ? 10.068  28.521  55.382   1.00 231.73 ? 121 ILE B O     1 
ATOM   3863  C  CB    . ILE B 1 121 ? 8.266   25.814  55.740   1.00 215.22 ? 121 ILE B CB    1 
ATOM   3864  C  CG1   . ILE B 1 121 ? 6.874   25.658  56.377   1.00 216.83 ? 121 ILE B CG1   1 
ATOM   3865  C  CG2   . ILE B 1 121 ? 9.407   25.881  56.756   1.00 211.17 ? 121 ILE B CG2   1 
ATOM   3866  C  CD1   . ILE B 1 121 ? 6.737   24.476  57.317   1.00 226.37 ? 121 ILE B CD1   1 
ATOM   3867  N  N     . MET B 1 122 ? 10.366  26.985  53.807   1.00 190.31 ? 122 MET B N     1 
ATOM   3868  C  CA    . MET B 1 122 ? 11.742  27.360  53.621   1.00 177.35 ? 122 MET B CA    1 
ATOM   3869  C  C     . MET B 1 122 ? 11.902  28.798  53.279   1.00 170.02 ? 122 MET B C     1 
ATOM   3870  O  O     . MET B 1 122 ? 12.849  29.367  53.652   1.00 176.35 ? 122 MET B O     1 
ATOM   3871  C  CB    . MET B 1 122 ? 12.381  26.521  52.503   1.00 190.69 ? 122 MET B CB    1 
ATOM   3872  C  CG    . MET B 1 122 ? 12.897  25.178  52.988   1.00 210.96 ? 122 MET B CG    1 
ATOM   3873  S  SD    . MET B 1 122 ? 14.145  25.435  54.250   1.00 239.96 ? 122 MET B SD    1 
ATOM   3874  C  CE    . MET B 1 122 ? 14.373  23.754  54.839   1.00 243.70 ? 122 MET B CE    1 
ATOM   3875  N  N     . PHE B 1 123 ? 11.002  29.351  52.477   1.00 178.66 ? 123 PHE B N     1 
ATOM   3876  C  CA    . PHE B 1 123 ? 11.058  30.783  52.178   1.00 206.27 ? 123 PHE B CA    1 
ATOM   3877  C  C     . PHE B 1 123 ? 10.541  31.618  53.307   1.00 208.47 ? 123 PHE B C     1 
ATOM   3878  O  O     . PHE B 1 123 ? 11.251  32.544  53.706   1.00 205.82 ? 123 PHE B O     1 
ATOM   3879  C  CB    . PHE B 1 123 ? 10.405  31.151  50.805   1.00 224.05 ? 123 PHE B CB    1 
ATOM   3880  C  CG    . PHE B 1 123 ? 11.070  30.495  49.639   1.00 236.00 ? 123 PHE B CG    1 
ATOM   3881  C  CD1   . PHE B 1 123 ? 12.444  30.564  49.499   1.00 247.54 ? 123 PHE B CD1   1 
ATOM   3882  C  CD2   . PHE B 1 123 ? 10.347  29.761  48.729   1.00 239.66 ? 123 PHE B CD2   1 
ATOM   3883  C  CE1   . PHE B 1 123 ? 13.073  29.954  48.451   1.00 253.36 ? 123 PHE B CE1   1 
ATOM   3884  C  CE2   . PHE B 1 123 ? 10.975  29.143  47.675   1.00 244.50 ? 123 PHE B CE2   1 
ATOM   3885  C  CZ    . PHE B 1 123 ? 12.343  29.244  47.531   1.00 252.46 ? 123 PHE B CZ    1 
ATOM   3886  N  N     . GLU B 1 124 ? 9.373   31.302  53.862   1.00 203.95 ? 124 GLU B N     1 
ATOM   3887  C  CA    . GLU B 1 124 ? 8.795   32.203  54.849   1.00 201.13 ? 124 GLU B CA    1 
ATOM   3888  C  C     . GLU B 1 124 ? 8.969   31.753  56.299   1.00 194.43 ? 124 GLU B C     1 
ATOM   3889  O  O     . GLU B 1 124 ? 8.204   32.170  57.168   1.00 190.16 ? 124 GLU B O     1 
ATOM   3890  C  CB    . GLU B 1 124 ? 7.310   32.365  54.515   1.00 212.49 ? 124 GLU B CB    1 
ATOM   3891  C  CG    . GLU B 1 124 ? 7.068   32.856  53.106   1.00 222.54 ? 124 GLU B CG    1 
ATOM   3892  C  CD    . GLU B 1 124 ? 5.627   33.233  52.879   1.00 233.75 ? 124 GLU B CD    1 
ATOM   3893  O  OE1   . GLU B 1 124 ? 4.729   32.544  53.410   1.00 243.65 ? 124 GLU B OE1   1 
ATOM   3894  O  OE2   . GLU B 1 124 ? 5.403   34.225  52.176   1.00 233.62 ? 124 GLU B OE2   1 
ATOM   3895  N  N     . THR B 1 125 ? 9.958   30.902  56.573   1.00 201.88 ? 125 THR B N     1 
ATOM   3896  C  CA    . THR B 1 125 ? 10.342  30.649  57.931   1.00 211.22 ? 125 THR B CA    1 
ATOM   3897  C  C     . THR B 1 125 ? 11.815  30.990  58.077   1.00 215.41 ? 125 THR B C     1 
ATOM   3898  O  O     . THR B 1 125 ? 12.166  31.992  58.708   1.00 212.78 ? 125 THR B O     1 
ATOM   3899  C  CB    . THR B 1 125 ? 10.030  29.218  58.376   1.00 217.62 ? 125 THR B CB    1 
ATOM   3900  O  OG1   . THR B 1 125 ? 8.625   29.012  58.222   1.00 226.96 ? 125 THR B OG1   1 
ATOM   3901  C  CG2   . THR B 1 125 ? 10.396  29.028  59.820   1.00 220.12 ? 125 THR B CG2   1 
ATOM   3902  N  N     . PHE B 1 126 ? 12.657  30.205  57.431   1.00 224.57 ? 126 PHE B N     1 
ATOM   3903  C  CA    . PHE B 1 126 ? 14.115  30.436  57.465   1.00 232.80 ? 126 PHE B CA    1 
ATOM   3904  C  C     . PHE B 1 126 ? 14.381  31.201  56.202   1.00 235.30 ? 126 PHE B C     1 
ATOM   3905  O  O     . PHE B 1 126 ? 14.379  30.593  55.131   1.00 234.03 ? 126 PHE B O     1 
ATOM   3906  C  CB    . PHE B 1 126 ? 14.914  29.136  57.436   1.00 236.77 ? 126 PHE B CB    1 
ATOM   3907  C  CG    . PHE B 1 126 ? 14.362  28.088  58.334   1.00 241.82 ? 126 PHE B CG    1 
ATOM   3908  C  CD1   . PHE B 1 126 ? 14.172  28.349  59.662   1.00 247.57 ? 126 PHE B CD1   1 
ATOM   3909  C  CD2   . PHE B 1 126 ? 14.057  26.832  57.847   1.00 247.75 ? 126 PHE B CD2   1 
ATOM   3910  C  CE1   . PHE B 1 126 ? 13.679  27.377  60.512   1.00 252.70 ? 126 PHE B CE1   1 
ATOM   3911  C  CE2   . PHE B 1 126 ? 13.557  25.860  58.679   1.00 257.37 ? 126 PHE B CE2   1 
ATOM   3912  C  CZ    . PHE B 1 126 ? 13.379  26.126  60.020   1.00 255.66 ? 126 PHE B CZ    1 
ATOM   3913  N  N     . ASN B 1 127 ? 14.582  32.510  56.260   1.00 241.81 ? 127 ASN B N     1 
ATOM   3914  C  CA    . ASN B 1 127 ? 14.810  33.282  55.021   1.00 249.17 ? 127 ASN B CA    1 
ATOM   3915  C  C     . ASN B 1 127 ? 16.048  32.749  54.294   1.00 255.06 ? 127 ASN B C     1 
ATOM   3916  O  O     . ASN B 1 127 ? 17.102  32.569  54.908   1.00 260.13 ? 127 ASN B O     1 
ATOM   3917  C  CB    . ASN B 1 127 ? 14.916  34.787  55.346   1.00 250.78 ? 127 ASN B CB    1 
ATOM   3918  C  CG    . ASN B 1 127 ? 14.588  35.687  54.156   1.00 251.15 ? 127 ASN B CG    1 
ATOM   3919  O  OD1   . ASN B 1 127 ? 13.591  35.485  53.460   1.00 234.40 ? 127 ASN B OD1   1 
ATOM   3920  N  ND2   . ASN B 1 127 ? 15.418  36.702  53.942   1.00 263.36 ? 127 ASN B ND2   1 
ATOM   3921  N  N     . THR B 1 128 ? 15.878  32.378  53.029   1.00 246.61 ? 128 THR B N     1 
ATOM   3922  C  CA    . THR B 1 128 ? 16.896  31.650  52.342   1.00 246.48 ? 128 THR B CA    1 
ATOM   3923  C  C     . THR B 1 128 ? 16.889  32.106  50.920   1.00 260.41 ? 128 THR B C     1 
ATOM   3924  O  O     . THR B 1 128 ? 15.825  32.391  50.397   1.00 251.98 ? 128 THR B O     1 
ATOM   3925  C  CB    . THR B 1 128 ? 16.695  30.120  52.385   1.00 230.51 ? 128 THR B CB    1 
ATOM   3926  O  OG1   . THR B 1 128 ? 17.705  29.515  51.578   1.00 220.99 ? 128 THR B OG1   1 
ATOM   3927  C  CG2   . THR B 1 128 ? 15.324  29.683  51.859   1.00 224.52 ? 128 THR B CG2   1 
ATOM   3928  N  N     . PRO B 1 129 ? 18.072  32.185  50.292   1.00 281.75 ? 129 PRO B N     1 
ATOM   3929  C  CA    . PRO B 1 129 ? 18.167  32.725  48.970   1.00 283.64 ? 129 PRO B CA    1 
ATOM   3930  C  C     . PRO B 1 129 ? 17.561  31.816  47.920   1.00 278.19 ? 129 PRO B C     1 
ATOM   3931  O  O     . PRO B 1 129 ? 17.001  32.305  46.929   1.00 284.01 ? 129 PRO B O     1 
ATOM   3932  C  CB    . PRO B 1 129 ? 19.670  32.798  48.707   1.00 284.62 ? 129 PRO B CB    1 
ATOM   3933  C  CG    . PRO B 1 129 ? 20.314  32.832  50.016   1.00 290.78 ? 129 PRO B CG    1 
ATOM   3934  C  CD    . PRO B 1 129 ? 19.398  32.076  50.928   1.00 292.64 ? 129 PRO B CD    1 
ATOM   3935  N  N     . ALA B 1 130 ? 17.719  30.517  48.112   1.00 263.74 ? 130 ALA B N     1 
ATOM   3936  C  CA    . ALA B 1 130 ? 17.268  29.574  47.121   1.00 260.27 ? 130 ALA B CA    1 
ATOM   3937  C  C     . ALA B 1 130 ? 17.139  28.203  47.726   1.00 246.94 ? 130 ALA B C     1 
ATOM   3938  O  O     . ALA B 1 130 ? 17.676  27.872  48.761   1.00 232.76 ? 130 ALA B O     1 
ATOM   3939  C  CB    . ALA B 1 130 ? 18.176  29.530  45.876   1.00 274.00 ? 130 ALA B CB    1 
ATOM   3940  N  N     . MET B 1 131 ? 16.343  27.381  47.049   1.00 243.16 ? 131 MET B N     1 
ATOM   3941  C  CA    . MET B 1 131 ? 16.137  26.030  47.499   1.00 236.29 ? 131 MET B CA    1 
ATOM   3942  C  C     . MET B 1 131 ? 15.740  25.151  46.355   1.00 225.39 ? 131 MET B C     1 
ATOM   3943  O  O     . MET B 1 131 ? 15.425  25.648  45.276   1.00 218.08 ? 131 MET B O     1 
ATOM   3944  C  CB    . MET B 1 131 ? 15.002  25.939  48.526   1.00 222.16 ? 131 MET B CB    1 
ATOM   3945  C  CG    . MET B 1 131 ? 13.629  25.988  47.865   1.00 218.11 ? 131 MET B CG    1 
ATOM   3946  S  SD    . MET B 1 131 ? 12.219  25.657  48.906   1.00 237.95 ? 131 MET B SD    1 
ATOM   3947  C  CE    . MET B 1 131 ? 12.495  23.905  49.143   1.00 220.46 ? 131 MET B CE    1 
ATOM   3948  N  N     . TYR B 1 132 ? 15.748  23.834  46.605   1.00 215.09 ? 132 TYR B N     1 
ATOM   3949  C  CA    . TYR B 1 132 ? 15.291  22.890  45.597   1.00 205.26 ? 132 TYR B CA    1 
ATOM   3950  C  C     . TYR B 1 132 ? 14.711  21.706  46.323   1.00 191.40 ? 132 TYR B C     1 
ATOM   3951  O  O     . TYR B 1 132 ? 15.197  21.370  47.416   1.00 194.15 ? 132 TYR B O     1 
ATOM   3952  C  CB    . TYR B 1 132 ? 16.474  22.437  44.733   1.00 213.14 ? 132 TYR B CB    1 
ATOM   3953  C  CG    . TYR B 1 132 ? 16.029  21.603  43.589   1.00 206.88 ? 132 TYR B CG    1 
ATOM   3954  C  CD1   . TYR B 1 132 ? 15.470  22.193  42.484   1.00 210.15 ? 132 TYR B CD1   1 
ATOM   3955  C  CD2   . TYR B 1 132 ? 16.182  20.238  43.602   1.00 198.85 ? 132 TYR B CD2   1 
ATOM   3956  C  CE1   . TYR B 1 132 ? 15.074  21.441  41.390   1.00 197.16 ? 132 TYR B CE1   1 
ATOM   3957  C  CE2   . TYR B 1 132 ? 15.774  19.473  42.533   1.00 192.44 ? 132 TYR B CE2   1 
ATOM   3958  C  CZ    . TYR B 1 132 ? 15.224  20.075  41.421   1.00 190.38 ? 132 TYR B CZ    1 
ATOM   3959  O  OH    . TYR B 1 132 ? 14.812  19.297  40.328   1.00 185.55 ? 132 TYR B OH    1 
ATOM   3960  N  N     . VAL B 1 133 ? 13.733  21.024  45.723   1.00 181.11 ? 133 VAL B N     1 
ATOM   3961  C  CA    . VAL B 1 133 ? 13.204  19.824  46.360   1.00 179.55 ? 133 VAL B CA    1 
ATOM   3962  C  C     . VAL B 1 133 ? 13.330  18.699  45.363   1.00 165.94 ? 133 VAL B C     1 
ATOM   3963  O  O     . VAL B 1 133 ? 12.906  18.847  44.204   1.00 175.30 ? 133 VAL B O     1 
ATOM   3964  C  CB    . VAL B 1 133 ? 11.761  19.903  46.798   1.00 201.94 ? 133 VAL B CB    1 
ATOM   3965  C  CG1   . VAL B 1 133 ? 11.606  20.811  48.003   1.00 218.10 ? 133 VAL B CG1   1 
ATOM   3966  C  CG2   . VAL B 1 133 ? 10.882  20.401  45.663   1.00 212.29 ? 133 VAL B CG2   1 
ATOM   3967  N  N     . ALA B 1 134 ? 13.939  17.586  45.765   1.00 157.75 ? 134 ALA B N     1 
ATOM   3968  C  CA    . ALA B 1 134 ? 14.444  16.620  44.790   1.00 149.26 ? 134 ALA B CA    1 
ATOM   3969  C  C     . ALA B 1 134 ? 13.956  15.243  45.216   1.00 152.89 ? 134 ALA B C     1 
ATOM   3970  O  O     . ALA B 1 134 ? 13.650  14.982  46.407   1.00 161.52 ? 134 ALA B O     1 
ATOM   3971  C  CB    . ALA B 1 134 ? 15.983  16.640  44.704   1.00 147.95 ? 134 ALA B CB    1 
ATOM   3972  N  N     . ILE B 1 135 ? 13.877  14.349  44.232   1.00 148.33 ? 135 ILE B N     1 
ATOM   3973  C  CA    . ILE B 1 135 ? 13.356  13.018  44.472   1.00 152.83 ? 135 ILE B CA    1 
ATOM   3974  C  C     . ILE B 1 135 ? 14.457  12.213  45.103   1.00 163.62 ? 135 ILE B C     1 
ATOM   3975  O  O     . ILE B 1 135 ? 15.603  12.245  44.683   1.00 180.18 ? 135 ILE B O     1 
ATOM   3976  C  CB    . ILE B 1 135 ? 12.843  12.354  43.186   1.00 159.16 ? 135 ILE B CB    1 
ATOM   3977  C  CG1   . ILE B 1 135 ? 11.653  11.431  43.474   1.00 172.90 ? 135 ILE B CG1   1 
ATOM   3978  C  CG2   . ILE B 1 135 ? 13.940  11.740  42.353   1.00 153.33 ? 135 ILE B CG2   1 
ATOM   3979  C  CD1   . ILE B 1 135 ? 10.315  12.162  43.539   1.00 184.58 ? 135 ILE B CD1   1 
ATOM   3980  N  N     . GLN B 1 136 ? 14.105  11.451  46.127   1.00 173.81 ? 136 GLN B N     1 
ATOM   3981  C  CA    . GLN B 1 136 ? 15.060  10.670  46.864   1.00 186.92 ? 136 GLN B CA    1 
ATOM   3982  C  C     . GLN B 1 136 ? 15.860  9.701   46.009   1.00 184.69 ? 136 GLN B C     1 
ATOM   3983  O  O     . GLN B 1 136 ? 17.055  9.583   46.192   1.00 189.97 ? 136 GLN B O     1 
ATOM   3984  C  CB    . GLN B 1 136 ? 14.396  9.843   47.980   1.00 194.09 ? 136 GLN B CB    1 
ATOM   3985  C  CG    . GLN B 1 136 ? 13.977  10.718  49.120   1.00 216.83 ? 136 GLN B CG    1 
ATOM   3986  C  CD    . GLN B 1 136 ? 13.131  9.992   50.150   1.00 231.63 ? 136 GLN B CD    1 
ATOM   3987  O  OE1   . GLN B 1 136 ? 12.824  8.813   50.000   1.00 235.49 ? 136 GLN B OE1   1 
ATOM   3988  N  NE2   . GLN B 1 136 ? 12.694  10.719  51.176   1.00 243.18 ? 136 GLN B NE2   1 
ATOM   3989  N  N     . ALA B 1 137 ? 15.198  8.992   45.107   1.00 171.82 ? 137 ALA B N     1 
ATOM   3990  C  CA    . ALA B 1 137 ? 15.833  7.824   44.477   1.00 162.67 ? 137 ALA B CA    1 
ATOM   3991  C  C     . ALA B 1 137 ? 16.975  8.285   43.579   1.00 157.64 ? 137 ALA B C     1 
ATOM   3992  O  O     . ALA B 1 137 ? 18.041  7.678   43.561   1.00 164.75 ? 137 ALA B O     1 
ATOM   3993  C  CB    . ALA B 1 137 ? 14.813  6.978   43.690   1.00 164.57 ? 137 ALA B CB    1 
ATOM   3994  N  N     . VAL B 1 138 ? 16.670  9.289   42.764   1.00 150.33 ? 138 VAL B N     1 
ATOM   3995  C  CA    . VAL B 1 138 ? 17.617  9.866   41.811   1.00 142.40 ? 138 VAL B CA    1 
ATOM   3996  C  C     . VAL B 1 138 ? 18.936  10.200  42.517   1.00 123.15 ? 138 VAL B C     1 
ATOM   3997  O  O     . VAL B 1 138 ? 20.023  9.916   42.047   1.00 109.21 ? 138 VAL B O     1 
ATOM   3998  C  CB    . VAL B 1 138 ? 16.954  11.072  41.079   1.00 155.33 ? 138 VAL B CB    1 
ATOM   3999  C  CG1   . VAL B 1 138 ? 17.977  11.997  40.410   1.00 163.75 ? 138 VAL B CG1   1 
ATOM   4000  C  CG2   . VAL B 1 138 ? 15.904  10.518  40.142   1.00 161.10 ? 138 VAL B CG2   1 
ATOM   4001  N  N     . LEU B 1 139 ? 18.795  10.824  43.687   1.00 116.78 ? 139 LEU B N     1 
ATOM   4002  C  CA    . LEU B 1 139 ? 19.933  11.264  44.455   1.00 128.49 ? 139 LEU B CA    1 
ATOM   4003  C  C     . LEU B 1 139 ? 20.812  10.082  44.758   1.00 142.71 ? 139 LEU B C     1 
ATOM   4004  O  O     . LEU B 1 139 ? 22.037  10.143  44.545   1.00 150.45 ? 139 LEU B O     1 
ATOM   4005  C  CB    . LEU B 1 139 ? 19.496  11.998  45.746   1.00 141.01 ? 139 LEU B CB    1 
ATOM   4006  C  CG    . LEU B 1 139 ? 19.347  13.530  45.576   1.00 163.93 ? 139 LEU B CG    1 
ATOM   4007  C  CD1   . LEU B 1 139 ? 18.373  13.877  44.450   1.00 157.39 ? 139 LEU B CD1   1 
ATOM   4008  C  CD2   . LEU B 1 139 ? 18.977  14.198  46.914   1.00 185.24 ? 139 LEU B CD2   1 
ATOM   4009  N  N     . SER B 1 140 ? 20.206  8.998   45.232   1.00 156.64 ? 140 SER B N     1 
ATOM   4010  C  CA    . SER B 1 140 ? 20.998  7.804   45.541   1.00 160.69 ? 140 SER B CA    1 
ATOM   4011  C  C     . SER B 1 140 ? 21.657  7.258   44.322   1.00 149.01 ? 140 SER B C     1 
ATOM   4012  O  O     . SER B 1 140 ? 22.780  6.780   44.407   1.00 155.57 ? 140 SER B O     1 
ATOM   4013  C  CB    . SER B 1 140 ? 20.191  6.680   46.158   1.00 154.44 ? 140 SER B CB    1 
ATOM   4014  O  OG    . SER B 1 140 ? 19.378  6.188   45.149   1.00 168.93 ? 140 SER B OG    1 
ATOM   4015  N  N     . LEU B 1 141 ? 20.977  7.320   43.166   1.00 139.29 ? 141 LEU B N     1 
ATOM   4016  C  CA    . LEU B 1 141 ? 21.570  6.838   41.930   1.00 139.04 ? 141 LEU B CA    1 
ATOM   4017  C  C     . LEU B 1 141 ? 22.795  7.629   41.622   1.00 123.31 ? 141 LEU B C     1 
ATOM   4018  O  O     . LEU B 1 141 ? 23.800  7.064   41.230   1.00 124.96 ? 141 LEU B O     1 
ATOM   4019  C  CB    . LEU B 1 141 ? 20.588  6.980   40.752   1.00 149.55 ? 141 LEU B CB    1 
ATOM   4020  C  CG    . LEU B 1 141 ? 21.141  6.687   39.370   1.00 150.91 ? 141 LEU B CG    1 
ATOM   4021  C  CD1   . LEU B 1 141 ? 21.179  5.174   39.156   1.00 144.39 ? 141 LEU B CD1   1 
ATOM   4022  C  CD2   . LEU B 1 141 ? 20.376  7.438   38.258   1.00 160.56 ? 141 LEU B CD2   1 
ATOM   4023  N  N     . TYR B 1 142 ? 22.760  8.952   41.808   1.00 106.04 ? 142 TYR B N     1 
ATOM   4024  C  CA    . TYR B 1 142 ? 23.936  9.804   41.600   1.00 112.75 ? 142 TYR B CA    1 
ATOM   4025  C  C     . TYR B 1 142 ? 25.026  9.364   42.526   1.00 136.72 ? 142 TYR B C     1 
ATOM   4026  O  O     . TYR B 1 142 ? 26.188  9.278   42.144   1.00 158.98 ? 142 TYR B O     1 
ATOM   4027  C  CB    . TYR B 1 142 ? 23.686  11.268  42.008   1.00 104.06 ? 142 TYR B CB    1 
ATOM   4028  C  CG    . TYR B 1 142 ? 23.177  12.088  40.887   1.00 100.56 ? 142 TYR B CG    1 
ATOM   4029  C  CD1   . TYR B 1 142 ? 24.039  12.659  39.969   1.00 104.42 ? 142 TYR B CD1   1 
ATOM   4030  C  CD2   . TYR B 1 142 ? 21.832  12.349  40.776   1.00 106.31 ? 142 TYR B CD2   1 
ATOM   4031  C  CE1   . TYR B 1 142 ? 23.555  13.449  38.945   1.00 126.73 ? 142 TYR B CE1   1 
ATOM   4032  C  CE2   . TYR B 1 142 ? 21.336  13.132  39.755   1.00 115.39 ? 142 TYR B CE2   1 
ATOM   4033  C  CZ    . TYR B 1 142 ? 22.199  13.682  38.838   1.00 125.32 ? 142 TYR B CZ    1 
ATOM   4034  O  OH    . TYR B 1 142 ? 21.709  14.491  37.804   1.00 112.82 ? 142 TYR B OH    1 
ATOM   4035  N  N     . ALA B 1 143 ? 24.684  9.209   43.791   1.00 151.97 ? 143 ALA B N     1 
ATOM   4036  C  CA    . ALA B 1 143 ? 25.660  8.823   44.819   1.00 168.00 ? 143 ALA B CA    1 
ATOM   4037  C  C     . ALA B 1 143 ? 26.359  7.557   44.430   1.00 166.19 ? 143 ALA B C     1 
ATOM   4038  O  O     . ALA B 1 143 ? 27.509  7.387   44.778   1.00 167.11 ? 143 ALA B O     1 
ATOM   4039  C  CB    . ALA B 1 143 ? 25.055  8.609   46.208   1.00 187.72 ? 143 ALA B CB    1 
ATOM   4040  N  N     . SER B 1 144 ? 25.644  6.620   43.776   1.00 164.08 ? 144 SER B N     1 
ATOM   4041  C  CA    . SER B 1 144 ? 26.253  5.372   43.339   1.00 163.54 ? 144 SER B CA    1 
ATOM   4042  C  C     . SER B 1 144 ? 27.104  5.588   42.112   1.00 171.21 ? 144 SER B C     1 
ATOM   4043  O  O     . SER B 1 144 ? 27.844  4.686   41.736   1.00 171.01 ? 144 SER B O     1 
ATOM   4044  C  CB    . SER B 1 144 ? 25.214  4.256   43.067   1.00 162.45 ? 144 SER B CB    1 
ATOM   4045  O  OG    . SER B 1 144 ? 24.701  3.770   44.296   1.00 151.41 ? 144 SER B OG    1 
ATOM   4046  N  N     . GLY B 1 145 ? 26.993  6.749   41.459   1.00 176.94 ? 145 GLY B N     1 
ATOM   4047  C  CA    . GLY B 1 145 ? 27.855  7.035   40.331   1.00 186.36 ? 145 GLY B CA    1 
ATOM   4048  C  C     . GLY B 1 145 ? 27.518  6.307   39.059   1.00 183.17 ? 145 GLY B C     1 
ATOM   4049  O  O     . GLY B 1 145 ? 28.363  6.171   38.196   1.00 179.17 ? 145 GLY B O     1 
ATOM   4050  N  N     . ARG B 1 146 ? 26.279  5.840   38.966   1.00 176.57 ? 146 ARG B N     1 
ATOM   4051  C  CA    . ARG B 1 146 ? 25.763  5.148   37.797   1.00 167.60 ? 146 ARG B CA    1 
ATOM   4052  C  C     . ARG B 1 146 ? 24.699  6.025   37.197   1.00 170.44 ? 146 ARG B C     1 
ATOM   4053  O  O     . ARG B 1 146 ? 23.992  6.755   37.912   1.00 174.05 ? 146 ARG B O     1 
ATOM   4054  C  CB    . ARG B 1 146 ? 25.128  3.812   38.160   1.00 160.30 ? 146 ARG B CB    1 
ATOM   4055  C  CG    . ARG B 1 146 ? 25.816  3.098   39.352   1.00 158.98 ? 146 ARG B CG    1 
ATOM   4056  C  CD    . ARG B 1 146 ? 24.972  1.981   39.893   1.00 154.07 ? 146 ARG B CD    1 
ATOM   4057  N  NE    . ARG B 1 146 ? 24.699  1.080   38.793   1.00 165.21 ? 146 ARG B NE    1 
ATOM   4058  C  CZ    . ARG B 1 146 ? 25.563  0.183   38.326   1.00 189.67 ? 146 ARG B CZ    1 
ATOM   4059  N  NH1   . ARG B 1 146 ? 26.761  0.004   38.886   1.00 197.99 ? 146 ARG B NH1   1 
ATOM   4060  N  NH2   . ARG B 1 146 ? 25.217  -0.559  37.293   1.00 192.60 ? 146 ARG B NH2   1 
ATOM   4061  N  N     . THR B 1 147 ? 24.592  5.926   35.865   1.00 171.01 ? 147 THR B N     1 
ATOM   4062  C  CA    . THR B 1 147 ? 23.659  6.714   35.035   1.00 163.98 ? 147 THR B CA    1 
ATOM   4063  C  C     . THR B 1 147 ? 22.344  5.972   34.845   1.00 135.18 ? 147 THR B C     1 
ATOM   4064  O  O     . THR B 1 147 ? 21.367  6.554   34.453   1.00 122.91 ? 147 THR B O     1 
ATOM   4065  C  CB    . THR B 1 147 ? 24.229  6.950   33.646   1.00 190.93 ? 147 THR B CB    1 
ATOM   4066  O  OG1   . THR B 1 147 ? 24.459  5.703   32.976   1.00 206.39 ? 147 THR B OG1   1 
ATOM   4067  C  CG2   . THR B 1 147 ? 25.553  7.678   33.773   1.00 212.62 ? 147 THR B CG2   1 
ATOM   4068  N  N     . THR B 1 148 ? 22.329  4.686   35.158   1.00 131.49 ? 148 THR B N     1 
ATOM   4069  C  CA    . THR B 1 148 ? 21.180  3.859   34.841   1.00 129.20 ? 148 THR B CA    1 
ATOM   4070  C  C     . THR B 1 148 ? 20.993  2.819   35.910   1.00 137.87 ? 148 THR B C     1 
ATOM   4071  O  O     . THR B 1 148 ? 21.966  2.244   36.398   1.00 158.20 ? 148 THR B O     1 
ATOM   4072  C  CB    . THR B 1 148 ? 21.421  3.082   33.558   1.00 139.02 ? 148 THR B CB    1 
ATOM   4073  O  OG1   . THR B 1 148 ? 21.575  3.998   32.467   1.00 157.81 ? 148 THR B OG1   1 
ATOM   4074  C  CG2   . THR B 1 148 ? 20.240  2.129   33.313   1.00 145.69 ? 148 THR B CG2   1 
ATOM   4075  N  N     . GLY B 1 149 ? 19.735  2.555   36.271   1.00 132.09 ? 149 GLY B N     1 
ATOM   4076  C  CA    . GLY B 1 149 ? 19.469  1.570   37.299   1.00 137.22 ? 149 GLY B CA    1 
ATOM   4077  C  C     . GLY B 1 149 ? 18.069  1.700   37.793   1.00 140.23 ? 149 GLY B C     1 
ATOM   4078  O  O     . GLY B 1 149 ? 17.364  2.622   37.388   1.00 153.08 ? 149 GLY B O     1 
ATOM   4079  N  N     . ILE B 1 150 ? 17.602  0.741   38.600   1.00 143.89 ? 150 ILE B N     1 
ATOM   4080  C  CA    . ILE B 1 150 ? 16.280  0.850   39.159   1.00 151.89 ? 150 ILE B CA    1 
ATOM   4081  C  C     . ILE B 1 150 ? 16.511  0.973   40.639   1.00 155.60 ? 150 ILE B C     1 
ATOM   4082  O  O     . ILE B 1 150 ? 17.077  0.073   41.253   1.00 166.94 ? 150 ILE B O     1 
ATOM   4083  C  CB    . ILE B 1 150 ? 15.369  -0.328  38.814   1.00 163.42 ? 150 ILE B CB    1 
ATOM   4084  C  CG1   . ILE B 1 150 ? 14.008  -0.124  39.515   1.00 186.67 ? 150 ILE B CG1   1 
ATOM   4085  C  CG2   . ILE B 1 150 ? 16.029  -1.684  39.143   1.00 168.25 ? 150 ILE B CG2   1 
ATOM   4086  C  CD1   . ILE B 1 150 ? 12.896  -0.999  38.979   1.00 202.89 ? 150 ILE B CD1   1 
ATOM   4087  N  N     . VAL B 1 151 ? 16.179  2.128   41.200   1.00 152.50 ? 151 VAL B N     1 
ATOM   4088  C  CA    . VAL B 1 151 ? 16.579  2.406   42.555   1.00 154.05 ? 151 VAL B CA    1 
ATOM   4089  C  C     . VAL B 1 151 ? 15.451  2.014   43.430   1.00 157.75 ? 151 VAL B C     1 
ATOM   4090  O  O     . VAL B 1 151 ? 14.354  2.544   43.262   1.00 154.65 ? 151 VAL B O     1 
ATOM   4091  C  CB    . VAL B 1 151 ? 16.952  3.850   42.737   1.00 164.68 ? 151 VAL B CB    1 
ATOM   4092  C  CG1   . VAL B 1 151 ? 17.129  4.184   44.225   1.00 178.82 ? 151 VAL B CG1   1 
ATOM   4093  C  CG2   . VAL B 1 151 ? 18.192  4.121   41.882   1.00 173.53 ? 151 VAL B CG2   1 
ATOM   4094  N  N     . MET B 1 152 ? 15.749  1.057   44.291   1.00 169.49 ? 152 MET B N     1 
ATOM   4095  C  CA    . MET B 1 152 ? 14.860  0.571   45.350   1.00 164.01 ? 152 MET B CA    1 
ATOM   4096  C  C     . MET B 1 152 ? 15.155  1.369   46.610   1.00 147.97 ? 152 MET B C     1 
ATOM   4097  O  O     . MET B 1 152 ? 16.200  1.278   47.223   1.00 155.82 ? 152 MET B O     1 
ATOM   4098  C  CB    . MET B 1 152 ? 15.128  -0.890  45.617   1.00 184.95 ? 152 MET B CB    1 
ATOM   4099  C  CG    . MET B 1 152 ? 14.360  -1.518  46.767   1.00 205.34 ? 152 MET B CG    1 
ATOM   4100  S  SD    . MET B 1 152 ? 12.629  -1.513  46.332   1.00 239.12 ? 152 MET B SD    1 
ATOM   4101  C  CE    . MET B 1 152 ? 11.981  -2.064  47.894   1.00 245.63 ? 152 MET B CE    1 
ATOM   4102  N  N     . ASP B 1 153 ? 14.225  2.237   46.927   1.00 142.87 ? 153 ASP B N     1 
ATOM   4103  C  CA    . ASP B 1 153 ? 14.398  3.211   47.998   1.00 160.10 ? 153 ASP B CA    1 
ATOM   4104  C  C     . ASP B 1 153 ? 13.409  2.864   49.090   1.00 171.74 ? 153 ASP B C     1 
ATOM   4105  O  O     . ASP B 1 153 ? 12.183  2.952   48.870   1.00 194.02 ? 153 ASP B O     1 
ATOM   4106  C  CB    . ASP B 1 153 ? 14.121  4.639   47.467   1.00 178.34 ? 153 ASP B CB    1 
ATOM   4107  C  CG    . ASP B 1 153 ? 13.659  5.644   48.532   1.00 178.04 ? 153 ASP B CG    1 
ATOM   4108  O  OD1   . ASP B 1 153 ? 13.963  5.484   49.752   1.00 168.03 ? 153 ASP B OD1   1 
ATOM   4109  O  OD2   . ASP B 1 153 ? 12.956  6.596   48.119   1.00 164.84 ? 153 ASP B OD2   1 
ATOM   4110  N  N     . SER B 1 154 ? 13.910  2.435   50.219   1.00 186.13 ? 154 SER B N     1 
ATOM   4111  C  CA    . SER B 1 154 ? 13.034  2.176   51.343   1.00 199.96 ? 154 SER B CA    1 
ATOM   4112  C  C     . SER B 1 154 ? 13.709  2.791   52.495   1.00 206.48 ? 154 SER B C     1 
ATOM   4113  O  O     . SER B 1 154 ? 14.841  2.390   52.879   1.00 210.60 ? 154 SER B O     1 
ATOM   4114  C  CB    . SER B 1 154 ? 12.793  0.697   51.557   1.00 196.64 ? 154 SER B CB    1 
ATOM   4115  O  OG    . SER B 1 154 ? 13.996  -0.028  51.718   1.00 197.08 ? 154 SER B OG    1 
ATOM   4116  N  N     . GLY B 1 155 ? 13.088  3.825   53.025   1.00 214.87 ? 155 GLY B N     1 
ATOM   4117  C  CA    . GLY B 1 155 ? 13.508  4.391   54.299   1.00 220.34 ? 155 GLY B CA    1 
ATOM   4118  C  C     . GLY B 1 155 ? 12.658  3.887   55.437   1.00 229.26 ? 155 GLY B C     1 
ATOM   4119  O  O     . GLY B 1 155 ? 12.035  2.832   55.402   1.00 221.44 ? 155 GLY B O     1 
ATOM   4120  N  N     . ASP B 1 156 ? 12.570  4.704   56.487   1.00 242.61 ? 156 ASP B N     1 
ATOM   4121  C  CA    . ASP B 1 156 ? 11.626  4.488   57.564   1.00 255.19 ? 156 ASP B CA    1 
ATOM   4122  C  C     . ASP B 1 156 ? 10.244  4.969   57.125   1.00 253.33 ? 156 ASP B C     1 
ATOM   4123  O  O     . ASP B 1 156 ? 9.239   4.445   57.565   1.00 250.40 ? 156 ASP B O     1 
ATOM   4124  C  CB    . ASP B 1 156 ? 12.068  5.281   58.808   1.00 264.69 ? 156 ASP B CB    1 
ATOM   4125  C  CG    . ASP B 1 156 ? 11.262  4.950   60.003   1.00 274.97 ? 156 ASP B CG    1 
ATOM   4126  O  OD1   . ASP B 1 156 ? 11.457  3.867   60.582   1.00 276.64 ? 156 ASP B OD1   1 
ATOM   4127  O  OD2   . ASP B 1 156 ? 10.412  5.769   60.413   1.00 279.95 ? 156 ASP B OD2   1 
ATOM   4128  N  N     . GLY B 1 157 ? 10.216  5.996   56.272   1.00 240.79 ? 157 GLY B N     1 
ATOM   4129  C  CA    . GLY B 1 157 ? 8.956   6.566   55.787   1.00 216.72 ? 157 GLY B CA    1 
ATOM   4130  C  C     . GLY B 1 157 ? 8.111   5.618   54.983   1.00 194.00 ? 157 GLY B C     1 
ATOM   4131  O  O     . GLY B 1 157 ? 7.171   5.020   55.501   1.00 187.56 ? 157 GLY B O     1 
ATOM   4132  N  N     . VAL B 1 158 ? 8.467   5.508   53.711   1.00 187.79 ? 158 VAL B N     1 
ATOM   4133  C  CA    . VAL B 1 158 ? 7.844   4.545   52.817   1.00 188.32 ? 158 VAL B CA    1 
ATOM   4134  C  C     . VAL B 1 158 ? 8.874   4.050   51.828   1.00 169.17 ? 158 VAL B C     1 
ATOM   4135  O  O     . VAL B 1 158 ? 9.914   4.651   51.648   1.00 162.06 ? 158 VAL B O     1 
ATOM   4136  C  CB    . VAL B 1 158 ? 6.556   5.130   52.128   1.00 203.57 ? 158 VAL B CB    1 
ATOM   4137  C  CG1   . VAL B 1 158 ? 6.358   4.721   50.667   1.00 207.66 ? 158 VAL B CG1   1 
ATOM   4138  C  CG2   . VAL B 1 158 ? 5.316   4.714   52.913   1.00 210.54 ? 158 VAL B CG2   1 
ATOM   4139  N  N     . THR B 1 159 ? 8.556   2.937   51.164   1.00 156.64 ? 159 THR B N     1 
ATOM   4140  C  CA    . THR B 1 159 ? 9.325   2.384   50.105   1.00 156.95 ? 159 THR B CA    1 
ATOM   4141  C  C     . THR B 1 159 ? 8.902   2.849   48.709   1.00 159.14 ? 159 THR B C     1 
ATOM   4142  O  O     . THR B 1 159 ? 7.731   2.938   48.354   1.00 173.35 ? 159 THR B O     1 
ATOM   4143  C  CB    . THR B 1 159 ? 9.138   0.860   50.116   1.00 159.49 ? 159 THR B CB    1 
ATOM   4144  O  OG1   . THR B 1 159 ? 9.771   0.340   51.276   1.00 165.65 ? 159 THR B OG1   1 
ATOM   4145  C  CG2   . THR B 1 159 ? 9.699   0.174   48.854   1.00 161.32 ? 159 THR B CG2   1 
ATOM   4146  N  N     . HIS B 1 160 ? 9.895   3.041   47.885   1.00 152.27 ? 160 HIS B N     1 
ATOM   4147  C  CA    . HIS B 1 160 ? 9.719   3.668   46.575   1.00 139.69 ? 160 HIS B CA    1 
ATOM   4148  C  C     . HIS B 1 160 ? 10.645  2.998   45.603   1.00 135.86 ? 160 HIS B C     1 
ATOM   4149  O  O     . HIS B 1 160 ? 11.645  2.351   45.972   1.00 158.16 ? 160 HIS B O     1 
ATOM   4150  C  CB    . HIS B 1 160 ? 10.004  5.205   46.626   1.00 145.99 ? 160 HIS B CB    1 
ATOM   4151  C  CG    . HIS B 1 160 ? 9.241   5.939   47.702   1.00 194.03 ? 160 HIS B CG    1 
ATOM   4152  N  ND1   . HIS B 1 160 ? 9.680   6.039   49.008   1.00 218.24 ? 160 HIS B ND1   1 
ATOM   4153  C  CD2   . HIS B 1 160 ? 8.060   6.595   47.649   1.00 218.53 ? 160 HIS B CD2   1 
ATOM   4154  C  CE1   . HIS B 1 160 ? 8.806   6.738   49.712   1.00 225.76 ? 160 HIS B CE1   1 
ATOM   4155  N  NE2   . HIS B 1 160 ? 7.809   7.084   48.915   1.00 227.79 ? 160 HIS B NE2   1 
ATOM   4156  N  N     . THR B 1 161 ? 10.290  3.127   44.343   1.00 132.94 ? 161 THR B N     1 
ATOM   4157  C  CA    . THR B 1 161 ? 11.000  2.411   43.282   1.00 137.60 ? 161 THR B CA    1 
ATOM   4158  C  C     . THR B 1 161 ? 10.957  3.228   42.026   1.00 124.38 ? 161 THR B C     1 
ATOM   4159  O  O     . THR B 1 161 ? 9.907   3.520   41.500   1.00 133.16 ? 161 THR B O     1 
ATOM   4160  C  CB    . THR B 1 161 ? 10.430  1.015   43.003   1.00 151.27 ? 161 THR B CB    1 
ATOM   4161  O  OG1   . THR B 1 161 ? 10.334  0.245   44.215   1.00 149.49 ? 161 THR B OG1   1 
ATOM   4162  C  CG2   . THR B 1 161 ? 11.311  0.271   42.020   1.00 155.62 ? 161 THR B CG2   1 
ATOM   4163  N  N     . VAL B 1 162 ? 12.110  3.629   41.547   1.00 119.71 ? 162 VAL B N     1 
ATOM   4164  C  CA    . VAL B 1 162 ? 12.167  4.499   40.356   1.00 122.59 ? 162 VAL B CA    1 
ATOM   4165  C  C     . VAL B 1 162 ? 13.211  3.971   39.407   1.00 131.31 ? 162 VAL B C     1 
ATOM   4166  O  O     . VAL B 1 162 ? 14.414  3.971   39.667   1.00 148.64 ? 162 VAL B O     1 
ATOM   4167  C  CB    . VAL B 1 162 ? 12.469  5.981   40.744   1.00 121.90 ? 162 VAL B CB    1 
ATOM   4168  C  CG1   . VAL B 1 162 ? 12.549  6.872   39.499   1.00 119.37 ? 162 VAL B CG1   1 
ATOM   4169  C  CG2   . VAL B 1 162 ? 11.415  6.473   41.728   1.00 127.58 ? 162 VAL B CG2   1 
ATOM   4170  N  N     . PRO B 1 163 ? 12.740  3.484   38.273   1.00 123.64 ? 163 PRO B N     1 
ATOM   4171  C  CA    . PRO B 1 163 ? 13.646  3.046   37.235   1.00 123.72 ? 163 PRO B CA    1 
ATOM   4172  C  C     . PRO B 1 163 ? 14.169  4.239   36.500   1.00 115.94 ? 163 PRO B C     1 
ATOM   4173  O  O     . PRO B 1 163 ? 13.403  5.138   36.229   1.00 117.77 ? 163 PRO B O     1 
ATOM   4174  C  CB    . PRO B 1 163 ? 12.764  2.165   36.339   1.00 132.58 ? 163 PRO B CB    1 
ATOM   4175  C  CG    . PRO B 1 163 ? 11.382  2.674   36.566   1.00 134.12 ? 163 PRO B CG    1 
ATOM   4176  C  CD    . PRO B 1 163 ? 11.331  3.207   37.963   1.00 121.84 ? 163 PRO B CD    1 
ATOM   4177  N  N     . ILE B 1 164 ? 15.448  4.223   36.127   1.00 116.00 ? 164 ILE B N     1 
ATOM   4178  C  CA    . ILE B 1 164 ? 16.030  5.328   35.402   1.00 118.59 ? 164 ILE B CA    1 
ATOM   4179  C  C     . ILE B 1 164 ? 16.888  4.770   34.287   1.00 114.04 ? 164 ILE B C     1 
ATOM   4180  O  O     . ILE B 1 164 ? 17.629  3.808   34.486   1.00 126.31 ? 164 ILE B O     1 
ATOM   4181  C  CB    . ILE B 1 164 ? 16.889  6.190   36.342   1.00 123.27 ? 164 ILE B CB    1 
ATOM   4182  C  CG1   . ILE B 1 164 ? 16.672  7.691   36.119   1.00 125.02 ? 164 ILE B CG1   1 
ATOM   4183  C  CG2   . ILE B 1 164 ? 18.337  5.753   36.374   1.00 134.74 ? 164 ILE B CG2   1 
ATOM   4184  C  CD1   . ILE B 1 164 ? 15.517  8.278   36.927   1.00 141.47 ? 164 ILE B CD1   1 
ATOM   4185  N  N     . TYR B 1 165 ? 16.852  5.353   33.112   1.00 97.20  ? 165 TYR B N     1 
ATOM   4186  C  CA    . TYR B 1 165 ? 17.712  4.855   32.080   1.00 92.73  ? 165 TYR B CA    1 
ATOM   4187  C  C     . TYR B 1 165 ? 18.422  6.013   31.491   1.00 103.43 ? 165 TYR B C     1 
ATOM   4188  O  O     . TYR B 1 165 ? 17.798  6.862   30.926   1.00 112.89 ? 165 TYR B O     1 
ATOM   4189  C  CB    . TYR B 1 165 ? 16.904  4.125   30.997   1.00 94.80  ? 165 TYR B CB    1 
ATOM   4190  C  CG    . TYR B 1 165 ? 17.795  3.757   29.869   1.00 91.75  ? 165 TYR B CG    1 
ATOM   4191  C  CD1   . TYR B 1 165 ? 18.529  2.617   29.939   1.00 105.95 ? 165 TYR B CD1   1 
ATOM   4192  C  CD2   . TYR B 1 165 ? 17.905  4.547   28.736   1.00 94.25  ? 165 TYR B CD2   1 
ATOM   4193  C  CE1   . TYR B 1 165 ? 19.396  2.246   28.922   1.00 126.82 ? 165 TYR B CE1   1 
ATOM   4194  C  CE2   . TYR B 1 165 ? 18.762  4.203   27.722   1.00 103.02 ? 165 TYR B CE2   1 
ATOM   4195  C  CZ    . TYR B 1 165 ? 19.509  3.048   27.810   1.00 120.77 ? 165 TYR B CZ    1 
ATOM   4196  O  OH    . TYR B 1 165 ? 20.375  2.665   26.774   1.00 130.36 ? 165 TYR B OH    1 
ATOM   4197  N  N     . GLU B 1 166 ? 19.752  6.003   31.548   1.00 115.32 ? 166 GLU B N     1 
ATOM   4198  C  CA    . GLU B 1 166 ? 20.599  6.983   30.865   1.00 118.77 ? 166 GLU B CA    1 
ATOM   4199  C  C     . GLU B 1 166 ? 20.147  8.396   31.258   1.00 104.61 ? 166 GLU B C     1 
ATOM   4200  O  O     . GLU B 1 166 ? 19.922  9.281   30.442   1.00 87.90  ? 166 GLU B O     1 
ATOM   4201  C  CB    . GLU B 1 166 ? 20.600  6.795   29.348   1.00 145.39 ? 166 GLU B CB    1 
ATOM   4202  C  CG    . GLU B 1 166 ? 21.698  7.526   28.626   1.00 158.28 ? 166 GLU B CG    1 
ATOM   4203  C  CD    . GLU B 1 166 ? 23.049  7.033   29.052   1.00 157.56 ? 166 GLU B CD    1 
ATOM   4204  O  OE1   . GLU B 1 166 ? 23.130  5.845   29.406   1.00 170.56 ? 166 GLU B OE1   1 
ATOM   4205  O  OE2   . GLU B 1 166 ? 24.001  7.828   29.047   1.00 159.37 ? 166 GLU B OE2   1 
ATOM   4206  N  N     . GLY B 1 167 ? 20.031  8.609   32.550   1.00 111.21 ? 167 GLY B N     1 
ATOM   4207  C  CA    . GLY B 1 167 ? 19.252  9.719   33.057   1.00 109.09 ? 167 GLY B CA    1 
ATOM   4208  C  C     . GLY B 1 167 ? 17.838  9.389   32.719   1.00 122.88 ? 167 GLY B C     1 
ATOM   4209  O  O     . GLY B 1 167 ? 17.359  8.308   33.030   1.00 142.21 ? 167 GLY B O     1 
ATOM   4210  N  N     . TYR B 1 168 ? 17.139  10.281  32.058   1.00 133.26 ? 168 TYR B N     1 
ATOM   4211  C  CA    . TYR B 1 168 ? 15.690  10.078  31.897   1.00 136.81 ? 168 TYR B CA    1 
ATOM   4212  C  C     . TYR B 1 168 ? 14.949  9.555   33.151   1.00 133.45 ? 168 TYR B C     1 
ATOM   4213  O  O     . TYR B 1 168 ? 15.363  9.917   34.260   1.00 154.73 ? 168 TYR B O     1 
ATOM   4214  C  CB    . TYR B 1 168 ? 15.381  9.402   30.551   1.00 127.78 ? 168 TYR B CB    1 
ATOM   4215  C  CG    . TYR B 1 168 ? 15.912  10.243  29.438   1.00 130.38 ? 168 TYR B CG    1 
ATOM   4216  C  CD1   . TYR B 1 168 ? 15.335  11.467  29.151   1.00 128.93 ? 168 TYR B CD1   1 
ATOM   4217  C  CD2   . TYR B 1 168 ? 17.025  9.855   28.738   1.00 126.88 ? 168 TYR B CD2   1 
ATOM   4218  C  CE1   . TYR B 1 168 ? 15.848  12.268  28.172   1.00 123.98 ? 168 TYR B CE1   1 
ATOM   4219  C  CE2   . TYR B 1 168 ? 17.536  10.637  27.731   1.00 128.97 ? 168 TYR B CE2   1 
ATOM   4220  C  CZ    . TYR B 1 168 ? 16.949  11.855  27.447   1.00 126.16 ? 168 TYR B CZ    1 
ATOM   4221  O  OH    . TYR B 1 168 ? 17.477  12.659  26.424   1.00 119.97 ? 168 TYR B OH    1 
ATOM   4222  N  N     . ALA B 1 169 ? 13.869  8.793   33.022   1.00 114.90 ? 169 ALA B N     1 
ATOM   4223  C  CA    . ALA B 1 169 ? 13.006  8.508   34.168   1.00 116.42 ? 169 ALA B CA    1 
ATOM   4224  C  C     . ALA B 1 169 ? 11.675  8.132   33.600   1.00 110.48 ? 169 ALA B C     1 
ATOM   4225  O  O     . ALA B 1 169 ? 11.247  8.693   32.596   1.00 130.28 ? 169 ALA B O     1 
ATOM   4226  C  CB    . ALA B 1 169 ? 12.796  9.725   35.086   1.00 130.98 ? 169 ALA B CB    1 
ATOM   4227  N  N     . LEU B 1 170 ? 10.973  7.231   34.253   1.00 105.54 ? 170 LEU B N     1 
ATOM   4228  C  CA    . LEU B 1 170 ? 9.717   6.720   33.689   1.00 109.93 ? 170 LEU B CA    1 
ATOM   4229  C  C     . LEU B 1 170 ? 8.633   6.906   34.716   1.00 122.09 ? 170 LEU B C     1 
ATOM   4230  O  O     . LEU B 1 170 ? 8.556   6.165   35.656   1.00 118.15 ? 170 LEU B O     1 
ATOM   4231  C  CB    . LEU B 1 170 ? 9.906   5.258   33.345   1.00 113.06 ? 170 LEU B CB    1 
ATOM   4232  C  CG    . LEU B 1 170 ? 10.939  4.975   32.247   1.00 119.75 ? 170 LEU B CG    1 
ATOM   4233  C  CD1   . LEU B 1 170 ? 11.324  3.479   32.212   1.00 120.84 ? 170 LEU B CD1   1 
ATOM   4234  C  CD2   . LEU B 1 170 ? 10.473  5.486   30.876   1.00 130.16 ? 170 LEU B CD2   1 
ATOM   4235  N  N     . PRO B 1 171 ? 7.798   7.932   34.578   1.00 135.74 ? 171 PRO B N     1 
ATOM   4236  C  CA    . PRO B 1 171 ? 6.745   8.218   35.526   1.00 141.63 ? 171 PRO B CA    1 
ATOM   4237  C  C     . PRO B 1 171 ? 5.749   7.113   35.758   1.00 145.16 ? 171 PRO B C     1 
ATOM   4238  O  O     . PRO B 1 171 ? 5.336   6.862   36.888   1.00 153.24 ? 171 PRO B O     1 
ATOM   4239  C  CB    . PRO B 1 171 ? 6.049   9.429   34.901   1.00 151.19 ? 171 PRO B CB    1 
ATOM   4240  C  CG    . PRO B 1 171 ? 7.132   10.123  34.163   1.00 154.89 ? 171 PRO B CG    1 
ATOM   4241  C  CD    . PRO B 1 171 ? 8.035   9.048   33.654   1.00 146.65 ? 171 PRO B CD    1 
ATOM   4242  N  N     . HIS B 1 172 ? 5.308   6.454   34.687   1.00 136.95 ? 172 HIS B N     1 
ATOM   4243  C  CA    . HIS B 1 172 ? 4.310   5.410   34.790   1.00 128.84 ? 172 HIS B CA    1 
ATOM   4244  C  C     . HIS B 1 172 ? 4.869   4.254   35.561   1.00 123.45 ? 172 HIS B C     1 
ATOM   4245  O  O     . HIS B 1 172 ? 4.137   3.566   36.291   1.00 120.89 ? 172 HIS B O     1 
ATOM   4246  C  CB    . HIS B 1 172 ? 3.835   4.923   33.420   1.00 138.62 ? 172 HIS B CB    1 
ATOM   4247  C  CG    . HIS B 1 172 ? 4.958   4.544   32.502   1.00 158.18 ? 172 HIS B CG    1 
ATOM   4248  N  ND1   . HIS B 1 172 ? 5.726   5.472   31.836   1.00 168.56 ? 172 HIS B ND1   1 
ATOM   4249  C  CD2   . HIS B 1 172 ? 5.444   3.332   32.136   1.00 168.57 ? 172 HIS B CD2   1 
ATOM   4250  C  CE1   . HIS B 1 172 ? 6.614   4.852   31.073   1.00 170.92 ? 172 HIS B CE1   1 
ATOM   4251  N  NE2   . HIS B 1 172 ? 6.477   3.551   31.249   1.00 169.04 ? 172 HIS B NE2   1 
ATOM   4252  N  N     . ALA B 1 173 ? 6.177   3.996   35.365   1.00 141.49 ? 173 ALA B N     1 
ATOM   4253  C  CA    . ALA B 1 173 ? 6.930   2.892   35.934   1.00 157.89 ? 173 ALA B CA    1 
ATOM   4254  C  C     . ALA B 1 173 ? 7.264   3.077   37.399   1.00 155.02 ? 173 ALA B C     1 
ATOM   4255  O  O     . ALA B 1 173 ? 7.532   2.093   38.088   1.00 148.75 ? 173 ALA B O     1 
ATOM   4256  C  CB    . ALA B 1 173 ? 8.247   2.657   35.189   1.00 173.85 ? 173 ALA B CB    1 
ATOM   4257  N  N     . ILE B 1 174 ? 7.339   4.316   37.891   1.00 157.66 ? 174 ILE B N     1 
ATOM   4258  C  CA    . ILE B 1 174 ? 7.629   4.556   39.287   1.00 152.04 ? 174 ILE B CA    1 
ATOM   4259  C  C     . ILE B 1 174 ? 6.624   3.914   40.237   1.00 132.42 ? 174 ILE B C     1 
ATOM   4260  O  O     . ILE B 1 174 ? 5.422   4.039   39.986   1.00 124.27 ? 174 ILE B O     1 
ATOM   4261  C  CB    . ILE B 1 174 ? 7.606   6.035   39.631   1.00 157.68 ? 174 ILE B CB    1 
ATOM   4262  C  CG1   . ILE B 1 174 ? 8.831   6.750   39.005   1.00 189.39 ? 174 ILE B CG1   1 
ATOM   4263  C  CG2   . ILE B 1 174 ? 7.546   6.206   41.156   1.00 144.93 ? 174 ILE B CG2   1 
ATOM   4264  C  CD1   . ILE B 1 174 ? 8.696   8.267   39.016   1.00 199.25 ? 174 ILE B CD1   1 
ATOM   4265  N  N     . LEU B 1 175 ? 7.119   3.225   41.257   1.00 136.26 ? 175 LEU B N     1 
ATOM   4266  C  CA    . LEU B 1 175 ? 6.174   2.467   42.087   1.00 141.79 ? 175 LEU B CA    1 
ATOM   4267  C  C     . LEU B 1 175 ? 6.381   2.872   43.503   1.00 158.87 ? 175 LEU B C     1 
ATOM   4268  O  O     . LEU B 1 175 ? 7.520   3.112   43.901   1.00 189.00 ? 175 LEU B O     1 
ATOM   4269  C  CB    . LEU B 1 175 ? 6.269   0.967   41.869   1.00 146.54 ? 175 LEU B CB    1 
ATOM   4270  C  CG    . LEU B 1 175 ? 5.175   0.175   42.552   1.00 168.84 ? 175 LEU B CG    1 
ATOM   4271  C  CD1   . LEU B 1 175 ? 3.771   0.684   42.174   1.00 185.53 ? 175 LEU B CD1   1 
ATOM   4272  C  CD2   . LEU B 1 175 ? 5.318   -1.342  42.258   1.00 181.89 ? 175 LEU B CD2   1 
ATOM   4273  N  N     . ARG B 1 176 ? 5.304   2.952   44.302   1.00 156.89 ? 176 ARG B N     1 
ATOM   4274  C  CA    . ARG B 1 176 ? 5.457   3.341   45.700   1.00 156.31 ? 176 ARG B CA    1 
ATOM   4275  C  C     . ARG B 1 176 ? 4.649   2.384   46.550   1.00 142.65 ? 176 ARG B C     1 
ATOM   4276  O  O     . ARG B 1 176 ? 3.443   2.273   46.348   1.00 129.69 ? 176 ARG B O     1 
ATOM   4277  C  CB    . ARG B 1 176 ? 4.943   4.755   45.965   1.00 169.39 ? 176 ARG B CB    1 
ATOM   4278  C  CG    . ARG B 1 176 ? 4.610   5.076   47.435   1.00 173.04 ? 176 ARG B CG    1 
ATOM   4279  C  CD    . ARG B 1 176 ? 4.116   6.513   47.602   1.00 174.69 ? 176 ARG B CD    1 
ATOM   4280  N  NE    . ARG B 1 176 ? 3.769   6.773   48.980   1.00 162.75 ? 176 ARG B NE    1 
ATOM   4281  C  CZ    . ARG B 1 176 ? 3.343   7.951   49.413   1.00 147.16 ? 176 ARG B CZ    1 
ATOM   4282  N  NH1   . ARG B 1 176 ? 3.207   8.954   48.556   1.00 135.80 ? 176 ARG B NH1   1 
ATOM   4283  N  NH2   . ARG B 1 176 ? 3.054   8.126   50.705   1.00 153.30 ? 176 ARG B NH2   1 
ATOM   4284  N  N     . LEU B 1 177 ? 5.329   1.729   47.467   1.00 162.44 ? 177 LEU B N     1 
ATOM   4285  C  CA    . LEU B 1 177 ? 4.800   0.590   48.226   1.00 184.39 ? 177 LEU B CA    1 
ATOM   4286  C  C     . LEU B 1 177 ? 4.764   1.002   49.674   1.00 198.59 ? 177 LEU B C     1 
ATOM   4287  O  O     . LEU B 1 177 ? 5.748   1.455   50.251   1.00 220.33 ? 177 LEU B O     1 
ATOM   4288  C  CB    . LEU B 1 177 ? 5.758   -0.607  48.070   1.00 189.85 ? 177 LEU B CB    1 
ATOM   4289  C  CG    . LEU B 1 177 ? 5.413   -1.846  48.918   1.00 197.61 ? 177 LEU B CG    1 
ATOM   4290  C  CD1   . LEU B 1 177 ? 4.048   -2.440  48.526   1.00 212.67 ? 177 LEU B CD1   1 
ATOM   4291  C  CD2   . LEU B 1 177 ? 6.544   -2.890  48.821   1.00 198.03 ? 177 LEU B CD2   1 
ATOM   4292  N  N     . ASP B 1 178 ? 3.609   0.846   50.301   1.00 195.50 ? 178 ASP B N     1 
ATOM   4293  C  CA    . ASP B 1 178 ? 3.509   1.219   51.721   1.00 190.57 ? 178 ASP B CA    1 
ATOM   4294  C  C     . ASP B 1 178 ? 4.024   0.130   52.688   1.00 188.48 ? 178 ASP B C     1 
ATOM   4295  O  O     . ASP B 1 178 ? 3.288   -0.625  53.311   1.00 176.98 ? 178 ASP B O     1 
ATOM   4296  C  CB    . ASP B 1 178 ? 2.083   1.662   52.102   1.00 191.32 ? 178 ASP B CB    1 
ATOM   4297  C  CG    . ASP B 1 178 ? 1.669   2.863   51.348   1.00 203.70 ? 178 ASP B CG    1 
ATOM   4298  O  OD1   . ASP B 1 178 ? 2.456   3.292   50.481   1.00 200.12 ? 178 ASP B OD1   1 
ATOM   4299  O  OD2   . ASP B 1 178 ? 0.578   3.360   51.606   1.00 227.59 ? 178 ASP B OD2   1 
ATOM   4300  N  N     . LEU B 1 179 ? 5.352   0.103   52.810   1.00 192.27 ? 179 LEU B N     1 
ATOM   4301  C  CA    . LEU B 1 179 ? 6.019   -0.665  53.811   1.00 196.26 ? 179 LEU B CA    1 
ATOM   4302  C  C     . LEU B 1 179 ? 7.171   0.217   54.201   1.00 208.28 ? 179 LEU B C     1 
ATOM   4303  O  O     . LEU B 1 179 ? 7.609   1.077   53.440   1.00 214.78 ? 179 LEU B O     1 
ATOM   4304  C  CB    . LEU B 1 179 ? 6.611   -1.933  53.224   1.00 200.93 ? 179 LEU B CB    1 
ATOM   4305  C  CG    . LEU B 1 179 ? 5.726   -3.133  52.854   1.00 210.90 ? 179 LEU B CG    1 
ATOM   4306  C  CD1   . LEU B 1 179 ? 6.597   -4.284  52.296   1.00 220.22 ? 179 LEU B CD1   1 
ATOM   4307  C  CD2   . LEU B 1 179 ? 4.844   -3.628  54.011   1.00 207.63 ? 179 LEU B CD2   1 
ATOM   4308  N  N     . ALA B 1 180 ? 7.712   0.014   55.372   1.00 212.74 ? 180 ALA B N     1 
ATOM   4309  C  CA    . ALA B 1 180 ? 8.796   0.847   55.876   1.00 201.25 ? 180 ALA B CA    1 
ATOM   4310  C  C     . ALA B 1 180 ? 9.463   0.164   57.046   1.00 204.02 ? 180 ALA B C     1 
ATOM   4311  O  O     . ALA B 1 180 ? 8.941   -0.789  57.593   1.00 210.92 ? 180 ALA B O     1 
ATOM   4312  C  CB    . ALA B 1 180 ? 8.277   2.174   56.386   1.00 200.21 ? 180 ALA B CB    1 
ATOM   4313  N  N     . GLY B 1 181 ? 10.574  0.728   57.479   1.00 221.87 ? 181 GLY B N     1 
ATOM   4314  C  CA    . GLY B 1 181 ? 11.203  0.370   58.751   1.00 249.12 ? 181 GLY B CA    1 
ATOM   4315  C  C     . GLY B 1 181 ? 10.181  0.486   59.886   1.00 251.35 ? 181 GLY B C     1 
ATOM   4316  O  O     . GLY B 1 181 ? 10.163  -0.359  60.776   1.00 275.68 ? 181 GLY B O     1 
ATOM   4317  N  N     . ARG B 1 182 ? 9.366   1.521   59.841   1.00 223.78 ? 182 ARG B N     1 
ATOM   4318  C  CA    . ARG B 1 182 ? 8.428   1.736   60.925   1.00 216.66 ? 182 ARG B CA    1 
ATOM   4319  C  C     . ARG B 1 182 ? 7.392   0.632   60.979   1.00 211.86 ? 182 ARG B C     1 
ATOM   4320  O  O     . ARG B 1 182 ? 7.068   0.145   62.070   1.00 218.47 ? 182 ARG B O     1 
ATOM   4321  C  CB    . ARG B 1 182 ? 7.796   3.148   60.864   1.00 225.36 ? 182 ARG B CB    1 
ATOM   4322  C  CG    . ARG B 1 182 ? 7.272   3.677   62.196   1.00 243.45 ? 182 ARG B CG    1 
ATOM   4323  C  CD    . ARG B 1 182 ? 7.055   5.176   62.133   1.00 259.08 ? 182 ARG B CD    1 
ATOM   4324  N  NE    . ARG B 1 182 ? 6.125   5.653   63.174   1.00 285.22 ? 182 ARG B NE    1 
ATOM   4325  C  CZ    . ARG B 1 182 ? 4.798   5.506   63.131   1.00 315.75 ? 182 ARG B CZ    1 
ATOM   4326  N  NH1   . ARG B 1 182 ? 4.252   4.874   62.099   1.00 323.45 ? 182 ARG B NH1   1 
ATOM   4327  N  NH2   . ARG B 1 182 ? 4.009   5.969   64.126   1.00 335.01 ? 182 ARG B NH2   1 
ATOM   4328  N  N     . ASP B 1 183 ? 6.949   0.163   59.814   1.00 209.78 ? 183 ASP B N     1 
ATOM   4329  C  CA    . ASP B 1 183 ? 5.971   -0.912  59.794   1.00 218.50 ? 183 ASP B CA    1 
ATOM   4330  C  C     . ASP B 1 183 ? 6.621   -2.196  60.281   1.00 193.38 ? 183 ASP B C     1 
ATOM   4331  O  O     . ASP B 1 183 ? 5.963   -2.973  60.991   1.00 188.39 ? 183 ASP B O     1 
ATOM   4332  C  CB    . ASP B 1 183 ? 5.226   -1.023  58.435   1.00 249.49 ? 183 ASP B CB    1 
ATOM   4333  C  CG    . ASP B 1 183 ? 4.534   0.310   58.028   1.00 264.49 ? 183 ASP B CG    1 
ATOM   4334  O  OD1   . ASP B 1 183 ? 4.113   1.103   58.908   1.00 266.03 ? 183 ASP B OD1   1 
ATOM   4335  O  OD2   . ASP B 1 183 ? 4.421   0.576   56.814   1.00 264.93 ? 183 ASP B OD2   1 
ATOM   4336  N  N     . LEU B 1 184 ? 7.886   -2.418  59.947   1.00 192.12 ? 184 LEU B N     1 
ATOM   4337  C  CA    . LEU B 1 184 ? 8.597   -3.581  60.469   1.00 207.14 ? 184 LEU B CA    1 
ATOM   4338  C  C     . LEU B 1 184 ? 8.683   -3.536  61.992   1.00 213.90 ? 184 LEU B C     1 
ATOM   4339  O  O     . LEU B 1 184 ? 8.481   -4.522  62.665   1.00 221.48 ? 184 LEU B O     1 
ATOM   4340  C  CB    . LEU B 1 184 ? 10.004  -3.770  59.866   1.00 210.19 ? 184 LEU B CB    1 
ATOM   4341  C  CG    . LEU B 1 184 ? 9.980   -4.089  58.376   1.00 218.99 ? 184 LEU B CG    1 
ATOM   4342  C  CD1   . LEU B 1 184 ? 11.377  -4.140  57.757   1.00 220.42 ? 184 LEU B CD1   1 
ATOM   4343  C  CD2   . LEU B 1 184 ? 9.202   -5.390  58.245   1.00 225.94 ? 184 LEU B CD2   1 
ATOM   4344  N  N     . THR B 1 185 ? 8.948   -2.364  62.523   1.00 205.19 ? 185 THR B N     1 
ATOM   4345  C  CA    . THR B 1 185 ? 9.029   -2.161  63.947   1.00 196.74 ? 185 THR B CA    1 
ATOM   4346  C  C     . THR B 1 185 ? 7.703   -2.520  64.581   1.00 177.37 ? 185 THR B C     1 
ATOM   4347  O  O     . THR B 1 185 ? 7.657   -3.232  65.573   1.00 177.89 ? 185 THR B O     1 
ATOM   4348  C  CB    . THR B 1 185 ? 9.374   -0.707  64.288   1.00 209.33 ? 185 THR B CB    1 
ATOM   4349  O  OG1   . THR B 1 185 ? 10.729  -0.501  63.913   1.00 205.06 ? 185 THR B OG1   1 
ATOM   4350  C  CG2   . THR B 1 185 ? 9.276   -0.421  65.754   1.00 230.19 ? 185 THR B CG2   1 
ATOM   4351  N  N     . ASP B 1 186 ? 6.617   -2.009  63.988   1.00 162.14 ? 186 ASP B N     1 
ATOM   4352  C  CA    . ASP B 1 186 ? 5.286   -2.296  64.546   1.00 164.68 ? 186 ASP B CA    1 
ATOM   4353  C  C     . ASP B 1 186 ? 5.006   -3.775  64.512   1.00 161.03 ? 186 ASP B C     1 
ATOM   4354  O  O     . ASP B 1 186 ? 4.463   -4.324  65.476   1.00 156.07 ? 186 ASP B O     1 
ATOM   4355  C  CB    . ASP B 1 186 ? 4.160   -1.571  63.821   1.00 180.89 ? 186 ASP B CB    1 
ATOM   4356  C  CG    . ASP B 1 186 ? 3.914   -0.210  64.375   1.00 186.37 ? 186 ASP B CG    1 
ATOM   4357  O  OD1   . ASP B 1 186 ? 4.203   -0.062  65.570   1.00 189.13 ? 186 ASP B OD1   1 
ATOM   4358  O  OD2   . ASP B 1 186 ? 3.445   0.690   63.640   1.00 191.02 ? 186 ASP B OD2   1 
ATOM   4359  N  N     . TYR B 1 187 ? 5.392   -4.446  63.432   1.00 168.19 ? 187 TYR B N     1 
ATOM   4360  C  CA    . TYR B 1 187 ? 5.269   -5.899  63.324   1.00 180.81 ? 187 TYR B CA    1 
ATOM   4361  C  C     . TYR B 1 187 ? 6.112   -6.551  64.409   1.00 189.28 ? 187 TYR B C     1 
ATOM   4362  O  O     . TYR B 1 187 ? 5.678   -7.524  65.046   1.00 196.99 ? 187 TYR B O     1 
ATOM   4363  C  CB    . TYR B 1 187 ? 5.741   -6.409  61.955   1.00 188.40 ? 187 TYR B CB    1 
ATOM   4364  C  CG    . TYR B 1 187 ? 5.626   -7.889  61.846   1.00 193.34 ? 187 TYR B CG    1 
ATOM   4365  C  CD1   . TYR B 1 187 ? 4.393   -8.478  61.754   1.00 196.36 ? 187 TYR B CD1   1 
ATOM   4366  C  CD2   . TYR B 1 187 ? 6.754   -8.705  61.845   1.00 190.95 ? 187 TYR B CD2   1 
ATOM   4367  C  CE1   . TYR B 1 187 ? 4.268   -9.855  61.650   1.00 191.26 ? 187 TYR B CE1   1 
ATOM   4368  C  CE2   . TYR B 1 187 ? 6.629   -10.064 61.773   1.00 189.58 ? 187 TYR B CE2   1 
ATOM   4369  C  CZ    . TYR B 1 187 ? 5.385   -10.647 61.659   1.00 186.15 ? 187 TYR B CZ    1 
ATOM   4370  O  OH    . TYR B 1 187 ? 5.254   -12.040 61.564   1.00 175.48 ? 187 TYR B OH    1 
ATOM   4371  N  N     . LEU B 1 188 ? 7.320   -6.029  64.634   1.00 192.81 ? 188 LEU B N     1 
ATOM   4372  C  CA    . LEU B 1 188 ? 8.284   -6.723  65.460   1.00 195.50 ? 188 LEU B CA    1 
ATOM   4373  C  C     . LEU B 1 188 ? 7.774   -6.706  66.902   1.00 203.12 ? 188 LEU B C     1 
ATOM   4374  O  O     . LEU B 1 188 ? 7.833   -7.713  67.607   1.00 206.39 ? 188 LEU B O     1 
ATOM   4375  C  CB    . LEU B 1 188 ? 9.654   -6.034  65.405   1.00 192.11 ? 188 LEU B CB    1 
ATOM   4376  C  CG    . LEU B 1 188 ? 10.771  -6.760  66.161   1.00 203.16 ? 188 LEU B CG    1 
ATOM   4377  C  CD1   . LEU B 1 188 ? 10.997  -8.175  65.610   1.00 198.55 ? 188 LEU B CD1   1 
ATOM   4378  C  CD2   . LEU B 1 188 ? 12.067  -5.929  66.159   1.00 213.81 ? 188 LEU B CD2   1 
ATOM   4379  N  N     . MET B 1 189 ? 7.364   -5.525  67.362   1.00 215.05 ? 189 MET B N     1 
ATOM   4380  C  CA    . MET B 1 189 ? 6.862   -5.461  68.747   1.00 229.84 ? 189 MET B CA    1 
ATOM   4381  C  C     . MET B 1 189 ? 5.684   -6.378  68.895   1.00 223.21 ? 189 MET B C     1 
ATOM   4382  O  O     . MET B 1 189 ? 5.504   -6.968  69.947   1.00 223.18 ? 189 MET B O     1 
ATOM   4383  C  CB    . MET B 1 189 ? 6.630   -4.023  69.227   1.00 242.50 ? 189 MET B CB    1 
ATOM   4384  C  CG    . MET B 1 189 ? 5.624   -3.208  68.441   1.00 252.47 ? 189 MET B CG    1 
ATOM   4385  S  SD    . MET B 1 189 ? 5.379   -1.520  69.047   1.00 261.85 ? 189 MET B SD    1 
ATOM   4386  C  CE    . MET B 1 189 ? 4.101   -1.901  70.223   1.00 262.95 ? 189 MET B CE    1 
ATOM   4387  N  N     . LYS B 1 190 ? 4.869   -6.545  67.852   1.00 216.36 ? 190 LYS B N     1 
ATOM   4388  C  CA    . LYS B 1 190 ? 3.778   -7.520  67.884   1.00 221.75 ? 190 LYS B CA    1 
ATOM   4389  C  C     . LYS B 1 190 ? 4.293   -8.936  68.088   1.00 216.02 ? 190 LYS B C     1 
ATOM   4390  O  O     . LYS B 1 190 ? 3.776   -9.691  68.892   1.00 215.37 ? 190 LYS B O     1 
ATOM   4391  C  CB    . LYS B 1 190 ? 2.925   -7.450  66.606   1.00 236.51 ? 190 LYS B CB    1 
ATOM   4392  C  CG    . LYS B 1 190 ? 1.584   -8.170  66.725   1.00 257.11 ? 190 LYS B CG    1 
ATOM   4393  C  CD    . LYS B 1 190 ? 0.614   -7.851  65.576   1.00 268.93 ? 190 LYS B CD    1 
ATOM   4394  C  CE    . LYS B 1 190 ? 1.051   -8.416  64.224   1.00 281.01 ? 190 LYS B CE    1 
ATOM   4395  N  NZ    . LYS B 1 190 ? 1.008   -9.905  64.166   1.00 285.46 ? 190 LYS B NZ    1 
ATOM   4396  N  N     . ILE B 1 191 ? 5.315   -9.296  67.338   1.00 212.35 ? 191 ILE B N     1 
ATOM   4397  C  CA    . ILE B 1 191 ? 5.811   -10.665 67.329   1.00 220.50 ? 191 ILE B CA    1 
ATOM   4398  C  C     . ILE B 1 191 ? 6.571   -11.047 68.609   1.00 220.09 ? 191 ILE B C     1 
ATOM   4399  O  O     . ILE B 1 191 ? 6.666   -12.211 68.954   1.00 220.73 ? 191 ILE B O     1 
ATOM   4400  C  CB    . ILE B 1 191 ? 6.615   -11.006 66.050   1.00 233.40 ? 191 ILE B CB    1 
ATOM   4401  C  CG1   . ILE B 1 191 ? 6.555   -12.505 65.767   1.00 240.08 ? 191 ILE B CG1   1 
ATOM   4402  C  CG2   . ILE B 1 191 ? 8.028   -10.417 66.083   1.00 236.30 ? 191 ILE B CG2   1 
ATOM   4403  C  CD1   . ILE B 1 191 ? 5.283   -12.945 65.073   1.00 241.34 ? 191 ILE B CD1   1 
ATOM   4404  N  N     . LEU B 1 192 ? 7.121   -10.049 69.314   1.00 221.17 ? 192 LEU B N     1 
ATOM   4405  C  CA    . LEU B 1 192 ? 7.803   -10.267 70.556   1.00 223.18 ? 192 LEU B CA    1 
ATOM   4406  C  C     . LEU B 1 192 ? 6.778   -10.772 71.585   1.00 239.86 ? 192 LEU B C     1 
ATOM   4407  O  O     . LEU B 1 192 ? 7.133   -11.558 72.446   1.00 248.58 ? 192 LEU B O     1 
ATOM   4408  C  CB    . LEU B 1 192 ? 8.466   -9.013  71.133   1.00 222.00 ? 192 LEU B CB    1 
ATOM   4409  C  CG    . LEU B 1 192 ? 9.937   -8.835  70.778   1.00 228.65 ? 192 LEU B CG    1 
ATOM   4410  C  CD1   . LEU B 1 192 ? 10.164  -8.500  69.311   1.00 232.17 ? 192 LEU B CD1   1 
ATOM   4411  C  CD2   . LEU B 1 192 ? 10.601  -7.750  71.636   1.00 239.68 ? 192 LEU B CD2   1 
ATOM   4412  N  N     . THR B 1 193 ? 5.567   -10.285 71.494   1.00 253.32 ? 193 THR B N     1 
ATOM   4413  C  CA    . THR B 1 193 ? 4.603   -10.440 72.529   1.00 258.81 ? 193 THR B CA    1 
ATOM   4414  C  C     . THR B 1 193 ? 4.278   -11.880 72.733   1.00 262.35 ? 193 THR B C     1 
ATOM   4415  O  O     . THR B 1 193 ? 3.981   -12.306 73.854   1.00 246.62 ? 193 THR B O     1 
ATOM   4416  C  CB    . THR B 1 193 ? 3.279   -9.707  72.227   1.00 257.62 ? 193 THR B CB    1 
ATOM   4417  O  OG1   . THR B 1 193 ? 2.790   -10.097 70.937   1.00 255.46 ? 193 THR B OG1   1 
ATOM   4418  C  CG2   . THR B 1 193 ? 3.455   -8.197  72.290   1.00 260.38 ? 193 THR B CG2   1 
ATOM   4419  N  N     . GLU B 1 194 ? 4.429   -12.691 71.675   1.00 280.76 ? 194 GLU B N     1 
ATOM   4420  C  CA    . GLU B 1 194 ? 4.233   -14.140 71.783   1.00 295.67 ? 194 GLU B CA    1 
ATOM   4421  C  C     . GLU B 1 194 ? 5.277   -14.828 72.683   1.00 290.39 ? 194 GLU B C     1 
ATOM   4422  O  O     . GLU B 1 194 ? 5.058   -15.944 73.160   1.00 267.96 ? 194 GLU B O     1 
ATOM   4423  C  CB    . GLU B 1 194 ? 4.201   -14.827 70.422   1.00 322.52 ? 194 GLU B CB    1 
ATOM   4424  C  CG    . GLU B 1 194 ? 5.526   -14.816 69.673   1.00 349.97 ? 194 GLU B CG    1 
ATOM   4425  C  CD    . GLU B 1 194 ? 5.377   -15.438 68.324   1.00 373.57 ? 194 GLU B CD    1 
ATOM   4426  O  OE1   . GLU B 1 194 ? 4.233   -15.796 67.990   1.00 386.59 ? 194 GLU B OE1   1 
ATOM   4427  O  OE2   . GLU B 1 194 ? 6.394   -15.551 67.610   1.00 388.93 ? 194 GLU B OE2   1 
ATOM   4428  N  N     . ARG B 1 195 ? 6.415   -14.158 72.865   1.00 297.55 ? 195 ARG B N     1 
ATOM   4429  C  CA    . ARG B 1 195 ? 7.486   -14.583 73.726   1.00 287.28 ? 195 ARG B CA    1 
ATOM   4430  C  C     . ARG B 1 195 ? 7.310   -14.080 75.145   1.00 278.92 ? 195 ARG B C     1 
ATOM   4431  O  O     . ARG B 1 195 ? 7.956   -14.609 76.029   1.00 273.57 ? 195 ARG B O     1 
ATOM   4432  C  CB    . ARG B 1 195 ? 8.822   -14.055 73.191   1.00 274.48 ? 195 ARG B CB    1 
ATOM   4433  C  CG    . ARG B 1 195 ? 10.049  -14.820 73.685   1.00 265.34 ? 195 ARG B CG    1 
ATOM   4434  C  CD    . ARG B 1 195 ? 11.337  -14.500 72.913   1.00 269.27 ? 195 ARG B CD    1 
ATOM   4435  N  NE    . ARG B 1 195 ? 11.284  -15.168 71.613   1.00 268.59 ? 195 ARG B NE    1 
ATOM   4436  C  CZ    . ARG B 1 195 ? 11.751  -16.397 71.353   1.00 261.28 ? 195 ARG B CZ    1 
ATOM   4437  N  NH1   . ARG B 1 195 ? 12.339  -17.080 72.326   1.00 260.15 ? 195 ARG B NH1   1 
ATOM   4438  N  NH2   . ARG B 1 195 ? 11.649  -16.942 70.115   1.00 254.31 ? 195 ARG B NH2   1 
ATOM   4439  N  N     . GLY B 1 196 ? 6.438   -13.109 75.365   1.00 272.59 ? 196 GLY B N     1 
ATOM   4440  C  CA    . GLY B 1 196 ? 6.207   -12.668 76.721   1.00 265.21 ? 196 GLY B CA    1 
ATOM   4441  C  C     . GLY B 1 196 ? 6.606   -11.242 76.884   1.00 266.80 ? 196 GLY B C     1 
ATOM   4442  O  O     . GLY B 1 196 ? 6.161   -10.609 77.838   1.00 272.09 ? 196 GLY B O     1 
ATOM   4443  N  N     . TYR B 1 197 ? 7.484   -10.760 76.012   1.00 262.72 ? 197 TYR B N     1 
ATOM   4444  C  CA    . TYR B 1 197 ? 8.026   -9.413  76.171   1.00 257.74 ? 197 TYR B CA    1 
ATOM   4445  C  C     . TYR B 1 197 ? 7.015   -8.473  75.590   1.00 249.71 ? 197 TYR B C     1 
ATOM   4446  O  O     . TYR B 1 197 ? 6.607   -8.638  74.436   1.00 251.79 ? 197 TYR B O     1 
ATOM   4447  C  CB    . TYR B 1 197 ? 9.404   -9.244  75.492   1.00 263.12 ? 197 TYR B CB    1 
ATOM   4448  C  CG    . TYR B 1 197 ? 10.355  -10.346 75.825   1.00 269.84 ? 197 TYR B CG    1 
ATOM   4449  C  CD1   . TYR B 1 197 ? 10.633  -10.677 77.140   1.00 277.43 ? 197 TYR B CD1   1 
ATOM   4450  C  CD2   . TYR B 1 197 ? 10.957  -11.059 74.826   1.00 273.19 ? 197 TYR B CD2   1 
ATOM   4451  C  CE1   . TYR B 1 197 ? 11.508  -11.688 77.438   1.00 277.46 ? 197 TYR B CE1   1 
ATOM   4452  C  CE2   . TYR B 1 197 ? 11.845  -12.080 75.119   1.00 269.62 ? 197 TYR B CE2   1 
ATOM   4453  C  CZ    . TYR B 1 197 ? 12.124  -12.394 76.427   1.00 270.84 ? 197 TYR B CZ    1 
ATOM   4454  O  OH    . TYR B 1 197 ? 13.027  -13.433 76.710   1.00 264.71 ? 197 TYR B OH    1 
ATOM   4455  N  N     . SER B 1 198 ? 6.640   -7.476  76.380   1.00 245.77 ? 198 SER B N     1 
ATOM   4456  C  CA    . SER B 1 198 ? 5.574   -6.572  75.962   1.00 248.79 ? 198 SER B CA    1 
ATOM   4457  C  C     . SER B 1 198 ? 6.088   -5.154  75.958   1.00 250.57 ? 198 SER B C     1 
ATOM   4458  O  O     . SER B 1 198 ? 6.490   -4.614  76.972   1.00 248.17 ? 198 SER B O     1 
ATOM   4459  C  CB    . SER B 1 198 ? 4.336   -6.673  76.862   1.00 249.00 ? 198 SER B CB    1 
ATOM   4460  O  OG    . SER B 1 198 ? 3.648   -7.890  76.637   1.00 251.30 ? 198 SER B OG    1 
ATOM   4461  N  N     . PHE B 1 199 ? 6.098   -4.542  74.789   1.00 253.88 ? 199 PHE B N     1 
ATOM   4462  C  CA    . PHE B 1 199 ? 6.594   -3.193  74.612   1.00 254.96 ? 199 PHE B CA    1 
ATOM   4463  C  C     . PHE B 1 199 ? 5.441   -2.315  74.114   1.00 258.24 ? 199 PHE B C     1 
ATOM   4464  O  O     . PHE B 1 199 ? 5.051   -2.336  72.952   1.00 241.73 ? 199 PHE B O     1 
ATOM   4465  C  CB    . PHE B 1 199 ? 7.818   -3.203  73.657   1.00 253.27 ? 199 PHE B CB    1 
ATOM   4466  C  CG    . PHE B 1 199 ? 8.998   -3.925  74.223   1.00 250.09 ? 199 PHE B CG    1 
ATOM   4467  C  CD1   . PHE B 1 199 ? 9.172   -4.017  75.589   1.00 249.29 ? 199 PHE B CD1   1 
ATOM   4468  C  CD2   . PHE B 1 199 ? 9.913   -4.536  73.402   1.00 252.68 ? 199 PHE B CD2   1 
ATOM   4469  C  CE1   . PHE B 1 199 ? 10.262  -4.671  76.116   1.00 254.05 ? 199 PHE B CE1   1 
ATOM   4470  C  CE2   . PHE B 1 199 ? 10.997  -5.205  73.918   1.00 253.86 ? 199 PHE B CE2   1 
ATOM   4471  C  CZ    . PHE B 1 199 ? 11.176  -5.275  75.281   1.00 254.93 ? 199 PHE B CZ    1 
ATOM   4472  N  N     . THR B 1 200 ? 4.869   -1.519  75.015   1.00 273.70 ? 200 THR B N     1 
ATOM   4473  C  CA    . THR B 1 200 ? 3.559   -0.902  74.774   1.00 284.46 ? 200 THR B CA    1 
ATOM   4474  C  C     . THR B 1 200 ? 3.627   0.583   74.428   1.00 282.67 ? 200 THR B C     1 
ATOM   4475  O  O     . THR B 1 200 ? 2.626   1.178   74.039   1.00 282.34 ? 200 THR B O     1 
ATOM   4476  C  CB    . THR B 1 200 ? 2.677   -1.058  76.016   1.00 287.61 ? 200 THR B CB    1 
ATOM   4477  O  OG1   . THR B 1 200 ? 3.373   -0.554  77.165   1.00 282.55 ? 200 THR B OG1   1 
ATOM   4478  C  CG2   . THR B 1 200 ? 2.293   -2.521  76.273   1.00 286.59 ? 200 THR B CG2   1 
ATOM   4479  N  N     . THR B 1 201 ? 4.816   1.164   74.527   1.00 280.33 ? 201 THR B N     1 
ATOM   4480  C  CA    . THR B 1 201 ? 4.973   2.627   74.599   1.00 269.88 ? 201 THR B CA    1 
ATOM   4481  C  C     . THR B 1 201 ? 6.089   3.112   73.647   1.00 273.45 ? 201 THR B C     1 
ATOM   4482  O  O     . THR B 1 201 ? 6.917   2.305   73.210   1.00 287.04 ? 201 THR B O     1 
ATOM   4483  C  CB    . THR B 1 201 ? 5.205   3.057   76.070   1.00 256.88 ? 201 THR B CB    1 
ATOM   4484  O  OG1   . THR B 1 201 ? 4.123   2.583   76.880   1.00 249.94 ? 201 THR B OG1   1 
ATOM   4485  C  CG2   . THR B 1 201 ? 5.303   4.552   76.233   1.00 240.69 ? 201 THR B CG2   1 
ATOM   4486  N  N     . THR B 1 202 ? 6.002   4.400   73.300   1.00 264.53 ? 202 THR B N     1 
ATOM   4487  C  CA    . THR B 1 202 ? 6.795   4.949   72.250   1.00 267.09 ? 202 THR B CA    1 
ATOM   4488  C  C     . THR B 1 202 ? 8.225   4.849   72.620   1.00 260.80 ? 202 THR B C     1 
ATOM   4489  O  O     . THR B 1 202 ? 9.043   4.462   71.821   1.00 257.90 ? 202 THR B O     1 
ATOM   4490  C  CB    . THR B 1 202 ? 6.537   6.440   72.000   1.00 272.68 ? 202 THR B CB    1 
ATOM   4491  O  OG1   . THR B 1 202 ? 5.133   6.763   71.954   1.00 273.35 ? 202 THR B OG1   1 
ATOM   4492  C  CG2   . THR B 1 202 ? 7.147   6.826   70.651   1.00 276.07 ? 202 THR B CG2   1 
ATOM   4493  N  N     . ALA B 1 203 ? 8.528   5.171   73.872   1.00 262.55 ? 203 ALA B N     1 
ATOM   4494  C  CA    . ALA B 1 203 ? 9.887   4.989   74.406   1.00 277.48 ? 203 ALA B CA    1 
ATOM   4495  C  C     . ALA B 1 203 ? 10.551  3.687   73.986   1.00 290.30 ? 203 ALA B C     1 
ATOM   4496  O  O     . ALA B 1 203 ? 11.552  3.670   73.254   1.00 291.56 ? 203 ALA B O     1 
ATOM   4497  C  CB    . ALA B 1 203 ? 9.925   5.154   75.941   1.00 278.50 ? 203 ALA B CB    1 
ATOM   4498  N  N     . GLU B 1 204 ? 9.958   2.597   74.450   1.00 312.24 ? 204 GLU B N     1 
ATOM   4499  C  CA    . GLU B 1 204 ? 10.523  1.264   74.175   1.00 323.17 ? 204 GLU B CA    1 
ATOM   4500  C  C     . GLU B 1 204 ? 10.292  0.778   72.746   1.00 308.81 ? 204 GLU B C     1 
ATOM   4501  O  O     . GLU B 1 204 ? 10.949  -0.122  72.252   1.00 299.01 ? 204 GLU B O     1 
ATOM   4502  C  CB    . GLU B 1 204 ? 10.109  0.189   75.189   1.00 351.11 ? 204 GLU B CB    1 
ATOM   4503  C  CG    . GLU B 1 204 ? 8.659   -0.189  75.096   1.00 372.01 ? 204 GLU B CG    1 
ATOM   4504  C  CD    . GLU B 1 204 ? 7.749   0.572   76.042   1.00 386.15 ? 204 GLU B CD    1 
ATOM   4505  O  OE1   . GLU B 1 204 ? 7.979   1.786   76.253   1.00 402.21 ? 204 GLU B OE1   1 
ATOM   4506  O  OE2   . GLU B 1 204 ? 6.785   -0.027  76.561   1.00 395.72 ? 204 GLU B OE2   1 
ATOM   4507  N  N     . ARG B 1 205 ? 9.344   1.415   72.067   1.00 300.01 ? 205 ARG B N     1 
ATOM   4508  C  CA    . ARG B 1 205 ? 9.211   1.201   70.625   1.00 289.95 ? 205 ARG B CA    1 
ATOM   4509  C  C     . ARG B 1 205 ? 10.543  1.512   69.938   1.00 276.25 ? 205 ARG B C     1 
ATOM   4510  O  O     . ARG B 1 205 ? 11.027  0.802   69.064   1.00 277.24 ? 205 ARG B O     1 
ATOM   4511  C  CB    . ARG B 1 205 ? 8.102   2.111   70.027   1.00 289.03 ? 205 ARG B CB    1 
ATOM   4512  C  CG    . ARG B 1 205 ? 7.470   1.647   68.754   1.00 278.57 ? 205 ARG B CG    1 
ATOM   4513  C  CD    . ARG B 1 205 ? 6.191   2.455   68.583   1.00 269.51 ? 205 ARG B CD    1 
ATOM   4514  N  NE    . ARG B 1 205 ? 5.676   2.390   67.240   1.00 264.74 ? 205 ARG B NE    1 
ATOM   4515  C  CZ    . ARG B 1 205 ? 6.083   3.159   66.239   1.00 268.41 ? 205 ARG B CZ    1 
ATOM   4516  N  NH1   . ARG B 1 205 ? 7.040   4.070   66.418   1.00 264.28 ? 205 ARG B NH1   1 
ATOM   4517  N  NH2   . ARG B 1 205 ? 5.530   2.981   65.052   1.00 276.59 ? 205 ARG B NH2   1 
ATOM   4518  N  N     . GLU B 1 206 ? 11.178  2.563   70.394   1.00 265.28 ? 206 GLU B N     1 
ATOM   4519  C  CA    . GLU B 1 206 ? 12.500  2.875   69.872   1.00 266.82 ? 206 GLU B CA    1 
ATOM   4520  C  C     . GLU B 1 206 ? 13.495  1.851   70.337   1.00 262.59 ? 206 GLU B C     1 
ATOM   4521  O  O     . GLU B 1 206 ? 14.438  1.617   69.611   1.00 267.55 ? 206 GLU B O     1 
ATOM   4522  C  CB    . GLU B 1 206 ? 12.894  4.335   70.158   1.00 279.43 ? 206 GLU B CB    1 
ATOM   4523  C  CG    . GLU B 1 206 ? 12.113  5.321   69.269   1.00 293.70 ? 206 GLU B CG    1 
ATOM   4524  C  CD    . GLU B 1 206 ? 12.849  6.597   69.048   1.00 318.34 ? 206 GLU B CD    1 
ATOM   4525  O  OE1   . GLU B 1 206 ? 13.404  7.104   70.039   1.00 334.97 ? 206 GLU B OE1   1 
ATOM   4526  O  OE2   . GLU B 1 206 ? 12.881  7.086   67.901   1.00 331.40 ? 206 GLU B OE2   1 
ATOM   4527  N  N     . ILE B 1 207 ? 13.354  1.233   71.508   1.00 257.88 ? 207 ILE B N     1 
ATOM   4528  C  CA    . ILE B 1 207 ? 14.240  0.168   71.904   1.00 261.35 ? 207 ILE B CA    1 
ATOM   4529  C  C     . ILE B 1 207 ? 14.131  -0.958  70.880   1.00 251.56 ? 207 ILE B C     1 
ATOM   4530  O  O     . ILE B 1 207 ? 15.153  -1.464  70.436   1.00 253.24 ? 207 ILE B O     1 
ATOM   4531  C  CB    . ILE B 1 207 ? 13.943  -0.292  73.327   1.00 275.75 ? 207 ILE B CB    1 
ATOM   4532  C  CG1   . ILE B 1 207 ? 14.301  0.843   74.310   1.00 285.93 ? 207 ILE B CG1   1 
ATOM   4533  C  CG2   . ILE B 1 207 ? 14.668  -1.600  73.608   1.00 284.74 ? 207 ILE B CG2   1 
ATOM   4534  C  CD1   . ILE B 1 207 ? 15.772  1.211   74.313   1.00 290.84 ? 207 ILE B CD1   1 
ATOM   4535  N  N     . VAL B 1 208 ? 12.924  -1.309  70.471   1.00 235.37 ? 208 VAL B N     1 
ATOM   4536  C  CA    . VAL B 1 208 ? 12.834  -2.385  69.488   1.00 223.26 ? 208 VAL B CA    1 
ATOM   4537  C  C     . VAL B 1 208 ? 13.354  -1.962  68.159   1.00 204.82 ? 208 VAL B C     1 
ATOM   4538  O  O     . VAL B 1 208 ? 13.927  -2.778  67.463   1.00 186.28 ? 208 VAL B O     1 
ATOM   4539  C  CB    . VAL B 1 208 ? 11.469  -3.016  69.272   1.00 235.33 ? 208 VAL B CB    1 
ATOM   4540  C  CG1   . VAL B 1 208 ? 11.133  -3.916  70.450   1.00 250.86 ? 208 VAL B CG1   1 
ATOM   4541  C  CG2   . VAL B 1 208 ? 10.374  -1.999  68.923   1.00 239.39 ? 208 VAL B CG2   1 
ATOM   4542  N  N     . ARG B 1 209 ? 13.207  -0.691  67.809   1.00 218.09 ? 209 ARG B N     1 
ATOM   4543  C  CA    . ARG B 1 209 ? 13.847  -0.178  66.603   1.00 228.91 ? 209 ARG B CA    1 
ATOM   4544  C  C     . ARG B 1 209 ? 15.349  -0.464  66.660   1.00 229.62 ? 209 ARG B C     1 
ATOM   4545  O  O     . ARG B 1 209 ? 15.950  -0.871  65.672   1.00 236.71 ? 209 ARG B O     1 
ATOM   4546  C  CB    . ARG B 1 209 ? 13.612  1.352   66.462   1.00 246.82 ? 209 ARG B CB    1 
ATOM   4547  C  CG    . ARG B 1 209 ? 14.200  1.928   65.173   1.00 251.25 ? 209 ARG B CG    1 
ATOM   4548  C  CD    . ARG B 1 209 ? 13.811  3.377   64.919   1.00 257.39 ? 209 ARG B CD    1 
ATOM   4549  N  NE    . ARG B 1 209 ? 14.386  4.193   65.992   1.00 263.03 ? 209 ARG B NE    1 
ATOM   4550  C  CZ    . ARG B 1 209 ? 15.639  4.663   65.991   1.00 265.84 ? 209 ARG B CZ    1 
ATOM   4551  N  NH1   . ARG B 1 209 ? 16.429  4.364   64.971   1.00 272.00 ? 209 ARG B NH1   1 
ATOM   4552  N  NH2   . ARG B 1 209 ? 16.121  5.414   67.007   1.00 260.32 ? 209 ARG B NH2   1 
ATOM   4553  N  N     . ASP B 1 210 ? 15.941  -0.222  67.825   1.00 225.18 ? 210 ASP B N     1 
ATOM   4554  C  CA    . ASP B 1 210 ? 17.372  -0.436  67.997   1.00 219.55 ? 210 ASP B CA    1 
ATOM   4555  C  C     . ASP B 1 210 ? 17.712  -1.904  67.814   1.00 210.48 ? 210 ASP B C     1 
ATOM   4556  O  O     . ASP B 1 210 ? 18.698  -2.229  67.125   1.00 201.91 ? 210 ASP B O     1 
ATOM   4557  C  CB    . ASP B 1 210 ? 17.863  -0.032  69.403   1.00 227.25 ? 210 ASP B CB    1 
ATOM   4558  C  CG    . ASP B 1 210 ? 19.329  0.070   69.468   1.00 239.72 ? 210 ASP B CG    1 
ATOM   4559  O  OD1   . ASP B 1 210 ? 19.921  0.283   68.397   1.00 239.37 ? 210 ASP B OD1   1 
ATOM   4560  O  OD2   . ASP B 1 210 ? 19.901  -0.086  70.569   1.00 251.11 ? 210 ASP B OD2   1 
ATOM   4561  N  N     . ILE B 1 211 ? 16.932  -2.803  68.408   1.00 209.19 ? 211 ILE B N     1 
ATOM   4562  C  CA    . ILE B 1 211 ? 17.117  -4.213  68.273   1.00 212.28 ? 211 ILE B CA    1 
ATOM   4563  C  C     . ILE B 1 211 ? 17.105  -4.605  66.806   1.00 208.47 ? 211 ILE B C     1 
ATOM   4564  O  O     . ILE B 1 211 ? 17.941  -5.336  66.327   1.00 183.11 ? 211 ILE B O     1 
ATOM   4565  C  CB    . ILE B 1 211 ? 15.967  -4.996  68.904   1.00 220.20 ? 211 ILE B CB    1 
ATOM   4566  C  CG1   . ILE B 1 211 ? 16.123  -4.974  70.425   1.00 230.31 ? 211 ILE B CG1   1 
ATOM   4567  C  CG2   . ILE B 1 211 ? 15.919  -6.430  68.312   1.00 224.14 ? 211 ILE B CG2   1 
ATOM   4568  C  CD1   . ILE B 1 211 ? 14.935  -5.473  71.203   1.00 232.81 ? 211 ILE B CD1   1 
ATOM   4569  N  N     . LYS B 1 212 ? 16.112  -4.139  66.110   1.00 226.61 ? 212 LYS B N     1 
ATOM   4570  C  CA    . LYS B 1 212 ? 15.961  -4.496  64.718   1.00 232.60 ? 212 LYS B CA    1 
ATOM   4571  C  C     . LYS B 1 212 ? 17.189  -4.019  63.931   1.00 233.29 ? 212 LYS B C     1 
ATOM   4572  O  O     . LYS B 1 212 ? 17.727  -4.744  63.110   1.00 225.48 ? 212 LYS B O     1 
ATOM   4573  C  CB    . LYS B 1 212 ? 14.644  -3.937  64.274   1.00 245.75 ? 212 LYS B CB    1 
ATOM   4574  C  CG    . LYS B 1 212 ? 14.180  -4.163  62.845   1.00 248.54 ? 212 LYS B CG    1 
ATOM   4575  C  CD    . LYS B 1 212 ? 12.956  -3.250  62.527   1.00 254.65 ? 212 LYS B CD    1 
ATOM   4576  C  CE    . LYS B 1 212 ? 13.303  -1.760  62.631   1.00 257.48 ? 212 LYS B CE    1 
ATOM   4577  N  NZ    . LYS B 1 212 ? 12.262  -0.928  61.999   1.00 267.49 ? 212 LYS B NZ    1 
ATOM   4578  N  N     . GLU B 1 213 ? 17.623  -2.790  64.218   1.00 255.91 ? 213 GLU B N     1 
ATOM   4579  C  CA    . GLU B 1 213 ? 18.800  -2.233  63.570   1.00 269.09 ? 213 GLU B CA    1 
ATOM   4580  C  C     . GLU B 1 213 ? 20.026  -3.065  63.745   1.00 255.36 ? 213 GLU B C     1 
ATOM   4581  O  O     . GLU B 1 213 ? 20.970  -2.815  62.981   1.00 244.75 ? 213 GLU B O     1 
ATOM   4582  C  CB    . GLU B 1 213 ? 19.088  -0.797  64.051   1.00 292.01 ? 213 GLU B CB    1 
ATOM   4583  C  CG    . GLU B 1 213 ? 18.061  0.245   63.613   1.00 297.89 ? 213 GLU B CG    1 
ATOM   4584  C  CD    . GLU B 1 213 ? 18.291  1.623   64.196   1.00 308.59 ? 213 GLU B CD    1 
ATOM   4585  O  OE1   . GLU B 1 213 ? 19.132  1.792   65.109   1.00 309.50 ? 213 GLU B OE1   1 
ATOM   4586  O  OE2   . GLU B 1 213 ? 17.608  2.543   63.722   1.00 315.41 ? 213 GLU B OE2   1 
ATOM   4587  N  N     . LYS B 1 214 ? 20.115  -3.967  64.721   1.00 249.02 ? 214 LYS B N     1 
ATOM   4588  C  CA    . LYS B 1 214 ? 21.211  -4.930  64.685   1.00 246.18 ? 214 LYS B CA    1 
ATOM   4589  C  C     . LYS B 1 214 ? 20.864  -6.399  64.586   1.00 235.13 ? 214 LYS B C     1 
ATOM   4590  O  O     . LYS B 1 214 ? 21.275  -7.077  63.633   1.00 236.30 ? 214 LYS B O     1 
ATOM   4591  C  CB    . LYS B 1 214 ? 22.219  -4.725  65.756   1.00 261.94 ? 214 LYS B CB    1 
ATOM   4592  C  CG    . LYS B 1 214 ? 21.717  -4.641  67.198   1.00 281.42 ? 214 LYS B CG    1 
ATOM   4593  C  CD    . LYS B 1 214 ? 22.869  -4.423  68.198   1.00 294.44 ? 214 LYS B CD    1 
ATOM   4594  C  CE    . LYS B 1 214 ? 22.401  -4.117  69.617   1.00 298.65 ? 214 LYS B CE    1 
ATOM   4595  N  NZ    . LYS B 1 214 ? 21.704  -2.798  69.704   1.00 301.54 ? 214 LYS B NZ    1 
ATOM   4596  N  N     . LEU B 1 215 ? 20.132  -6.902  65.567   1.00 224.31 ? 215 LEU B N     1 
ATOM   4597  C  CA    . LEU B 1 215 ? 19.793  -8.355  65.609   1.00 225.59 ? 215 LEU B CA    1 
ATOM   4598  C  C     . LEU B 1 215 ? 19.110  -8.961  64.417   1.00 235.57 ? 215 LEU B C     1 
ATOM   4599  O  O     . LEU B 1 215 ? 19.440  -10.085 64.035   1.00 229.91 ? 215 LEU B O     1 
ATOM   4600  C  CB    . LEU B 1 215 ? 19.012  -8.672  66.877   1.00 226.64 ? 215 LEU B CB    1 
ATOM   4601  C  CG    . LEU B 1 215 ? 19.747  -8.282  68.162   1.00 241.04 ? 215 LEU B CG    1 
ATOM   4602  C  CD1   . LEU B 1 215 ? 19.044  -8.891  69.407   1.00 256.03 ? 215 LEU B CD1   1 
ATOM   4603  C  CD2   . LEU B 1 215 ? 21.236  -8.668  68.114   1.00 243.37 ? 215 LEU B CD2   1 
ATOM   4604  N  N     . CYS B 1 216 ? 18.157  -8.267  63.796   1.00 239.63 ? 216 CYS B N     1 
ATOM   4605  C  CA    . CYS B 1 216 ? 17.386  -8.853  62.699   1.00 230.09 ? 216 CYS B CA    1 
ATOM   4606  C  C     . CYS B 1 216 ? 18.186  -9.061  61.453   1.00 216.98 ? 216 CYS B C     1 
ATOM   4607  O  O     . CYS B 1 216 ? 19.102  -8.302  61.212   1.00 213.25 ? 216 CYS B O     1 
ATOM   4608  C  CB    . CYS B 1 216 ? 16.248  -7.945  62.247   1.00 233.53 ? 216 CYS B CB    1 
ATOM   4609  S  SG    . CYS B 1 216 ? 15.002  -7.593  63.494   1.00 230.53 ? 216 CYS B SG    1 
ATOM   4610  N  N     . TYR B 1 217 ? 17.879  -10.120 60.690   1.00 209.47 ? 217 TYR B N     1 
ATOM   4611  C  CA    . TYR B 1 217 ? 18.544  -10.354 59.423   1.00 210.77 ? 217 TYR B CA    1 
ATOM   4612  C  C     . TYR B 1 217 ? 17.561  -11.072 58.513   1.00 205.30 ? 217 TYR B C     1 
ATOM   4613  O  O     . TYR B 1 217 ? 16.560  -11.613 58.990   1.00 209.35 ? 217 TYR B O     1 
ATOM   4614  C  CB    . TYR B 1 217 ? 19.831  -11.178 59.526   1.00 212.25 ? 217 TYR B CB    1 
ATOM   4615  C  CG    . TYR B 1 217 ? 19.561  -12.577 59.916   1.00 216.04 ? 217 TYR B CG    1 
ATOM   4616  C  CD1   . TYR B 1 217 ? 19.316  -13.538 58.956   1.00 217.97 ? 217 TYR B CD1   1 
ATOM   4617  C  CD2   . TYR B 1 217 ? 19.580  -12.957 61.226   1.00 221.81 ? 217 TYR B CD2   1 
ATOM   4618  C  CE1   . TYR B 1 217 ? 19.073  -14.853 59.310   1.00 223.26 ? 217 TYR B CE1   1 
ATOM   4619  C  CE2   . TYR B 1 217 ? 19.353  -14.277 61.596   1.00 228.86 ? 217 TYR B CE2   1 
ATOM   4620  C  CZ    . TYR B 1 217 ? 19.084  -15.218 60.632   1.00 226.91 ? 217 TYR B CZ    1 
ATOM   4621  O  OH    . TYR B 1 217 ? 18.848  -16.552 61.000   1.00 224.98 ? 217 TYR B OH    1 
ATOM   4622  N  N     . VAL B 1 218 ? 17.857  -11.101 57.211   1.00 185.73 ? 218 VAL B N     1 
ATOM   4623  C  CA    . VAL B 1 218 ? 16.952  -11.689 56.267   1.00 174.12 ? 218 VAL B CA    1 
ATOM   4624  C  C     . VAL B 1 218 ? 17.462  -13.049 55.865   1.00 162.69 ? 218 VAL B C     1 
ATOM   4625  O  O     . VAL B 1 218 ? 18.630  -13.257 55.563   1.00 154.95 ? 218 VAL B O     1 
ATOM   4626  C  CB    . VAL B 1 218 ? 16.752  -10.884 55.008   1.00 182.61 ? 218 VAL B CB    1 
ATOM   4627  C  CG1   . VAL B 1 218 ? 15.712  -11.600 54.134   1.00 173.44 ? 218 VAL B CG1   1 
ATOM   4628  C  CG2   . VAL B 1 218 ? 16.348  -9.451  55.353   1.00 194.88 ? 218 VAL B CG2   1 
ATOM   4629  N  N     . ALA B 1 219 ? 16.531  -13.983 55.910   1.00 173.90 ? 219 ALA B N     1 
ATOM   4630  C  CA    . ALA B 1 219 ? 16.777  -15.363 55.450   1.00 200.26 ? 219 ALA B CA    1 
ATOM   4631  C  C     . ALA B 1 219 ? 17.026  -15.526 53.966   1.00 206.52 ? 219 ALA B C     1 
ATOM   4632  O  O     . ALA B 1 219 ? 16.323  -15.035 53.102   1.00 196.46 ? 219 ALA B O     1 
ATOM   4633  C  CB    . ALA B 1 219 ? 15.603  -16.282 55.852   1.00 215.55 ? 219 ALA B CB    1 
ATOM   4634  N  N     . LEU B 1 220 ? 18.049  -16.321 53.659   1.00 226.15 ? 220 LEU B N     1 
ATOM   4635  C  CA    . LEU B 1 220 ? 18.327  -16.704 52.280   1.00 227.65 ? 220 LEU B CA    1 
ATOM   4636  C  C     . LEU B 1 220 ? 17.379  -17.816 51.798   1.00 215.41 ? 220 LEU B C     1 
ATOM   4637  O  O     . LEU B 1 220 ? 17.357  -18.124 50.616   1.00 197.47 ? 220 LEU B O     1 
ATOM   4638  C  CB    . LEU B 1 220 ? 19.789  -17.185 52.081   1.00 247.21 ? 220 LEU B CB    1 
ATOM   4639  C  CG    . LEU B 1 220 ? 20.815  -16.059 52.026   1.00 266.07 ? 220 LEU B CG    1 
ATOM   4640  C  CD1   . LEU B 1 220 ? 20.875  -15.291 53.360   1.00 272.35 ? 220 LEU B CD1   1 
ATOM   4641  C  CD2   . LEU B 1 220 ? 22.208  -16.591 51.591   1.00 270.28 ? 220 LEU B CD2   1 
ATOM   4642  N  N     . ASP B 1 221 ? 16.715  -18.491 52.723   1.00 219.58 ? 221 ASP B N     1 
ATOM   4643  C  CA    . ASP B 1 221 ? 15.439  -19.095 52.487   1.00 223.99 ? 221 ASP B CA    1 
ATOM   4644  C  C     . ASP B 1 221 ? 14.708  -19.104 53.803   1.00 221.82 ? 221 ASP B C     1 
ATOM   4645  O  O     . ASP B 1 221 ? 15.207  -19.611 54.790   1.00 230.75 ? 221 ASP B O     1 
ATOM   4646  C  CB    . ASP B 1 221 ? 15.528  -20.527 51.981   1.00 242.28 ? 221 ASP B CB    1 
ATOM   4647  C  CG    . ASP B 1 221 ? 14.171  -21.043 51.597   1.00 253.92 ? 221 ASP B CG    1 
ATOM   4648  O  OD1   . ASP B 1 221 ? 13.186  -20.270 51.519   1.00 249.67 ? 221 ASP B OD1   1 
ATOM   4649  O  OD2   . ASP B 1 221 ? 14.062  -22.249 51.302   1.00 267.21 ? 221 ASP B OD2   1 
ATOM   4650  N  N     . PHE B 1 222 ? 13.503  -18.515 53.821   1.00 222.97 ? 222 PHE B N     1 
ATOM   4651  C  CA    . PHE B 1 222 ? 12.735  -18.338 55.022   1.00 236.39 ? 222 PHE B CA    1 
ATOM   4652  C  C     . PHE B 1 222 ? 12.384  -19.676 55.671   1.00 254.22 ? 222 PHE B C     1 
ATOM   4653  O  O     . PHE B 1 222 ? 12.619  -19.869 56.857   1.00 258.87 ? 222 PHE B O     1 
ATOM   4654  C  CB    . PHE B 1 222 ? 11.442  -17.564 54.717   1.00 235.06 ? 222 PHE B CB    1 
ATOM   4655  C  CG    . PHE B 1 222 ? 10.504  -17.508 55.863   1.00 235.35 ? 222 PHE B CG    1 
ATOM   4656  C  CD1   . PHE B 1 222 ? 10.745  -16.683 56.946   1.00 243.78 ? 222 PHE B CD1   1 
ATOM   4657  C  CD2   . PHE B 1 222 ? 9.368   -18.290 55.872   1.00 236.75 ? 222 PHE B CD2   1 
ATOM   4658  C  CE1   . PHE B 1 222 ? 9.864   -16.619 57.997   1.00 250.04 ? 222 PHE B CE1   1 
ATOM   4659  C  CE2   . PHE B 1 222 ? 8.472   -18.225 56.915   1.00 243.88 ? 222 PHE B CE2   1 
ATOM   4660  C  CZ    . PHE B 1 222 ? 8.734   -17.407 57.992   1.00 248.50 ? 222 PHE B CZ    1 
ATOM   4661  N  N     . GLU B 1 223 ? 11.819  -20.590 54.891   1.00 265.75 ? 223 GLU B N     1 
ATOM   4662  C  CA    . GLU B 1 223 ? 11.313  -21.832 55.469   1.00 268.43 ? 223 GLU B CA    1 
ATOM   4663  C  C     . GLU B 1 223 ? 12.454  -22.651 56.016   1.00 283.60 ? 223 GLU B C     1 
ATOM   4664  O  O     . GLU B 1 223 ? 12.276  -23.345 56.981   1.00 290.21 ? 223 GLU B O     1 
ATOM   4665  C  CB    . GLU B 1 223 ? 10.548  -22.697 54.455   1.00 266.18 ? 223 GLU B CB    1 
ATOM   4666  C  CG    . GLU B 1 223 ? 9.215   -22.131 54.024   1.00 274.08 ? 223 GLU B CG    1 
ATOM   4667  C  CD    . GLU B 1 223 ? 9.358   -21.122 52.919   1.00 290.88 ? 223 GLU B CD    1 
ATOM   4668  O  OE1   . GLU B 1 223 ? 10.507  -20.747 52.604   1.00 296.92 ? 223 GLU B OE1   1 
ATOM   4669  O  OE2   . GLU B 1 223 ? 8.327   -20.726 52.353   1.00 311.65 ? 223 GLU B OE2   1 
ATOM   4670  N  N     . GLN B 1 224 ? 13.620  -22.647 55.362   1.00 287.70 ? 224 GLN B N     1 
ATOM   4671  C  CA    . GLN B 1 224 ? 14.746  -23.424 55.818   1.00 288.39 ? 224 GLN B CA    1 
ATOM   4672  C  C     . GLN B 1 224 ? 15.201  -22.935 57.175   1.00 294.73 ? 224 GLN B C     1 
ATOM   4673  O  O     . GLN B 1 224 ? 15.448  -23.716 58.113   1.00 302.40 ? 224 GLN B O     1 
ATOM   4674  C  CB    . GLN B 1 224 ? 15.910  -23.328 54.802   1.00 283.60 ? 224 GLN B CB    1 
ATOM   4675  C  CG    . GLN B 1 224 ? 15.628  -24.057 53.503   1.00 290.79 ? 224 GLN B CG    1 
ATOM   4676  C  CD    . GLN B 1 224 ? 16.740  -23.893 52.529   1.00 305.43 ? 224 GLN B CD    1 
ATOM   4677  O  OE1   . GLN B 1 224 ? 17.742  -23.224 52.800   1.00 308.92 ? 224 GLN B OE1   1 
ATOM   4678  N  NE2   . GLN B 1 224 ? 16.584  -24.504 51.356   1.00 314.90 ? 224 GLN B NE2   1 
ATOM   4679  N  N     . GLU B 1 225 ? 15.352  -21.613 57.270   1.00 290.81 ? 225 GLU B N     1 
ATOM   4680  C  CA    . GLU B 1 225 ? 15.795  -21.025 58.536   1.00 288.02 ? 225 GLU B CA    1 
ATOM   4681  C  C     . GLU B 1 225 ? 14.776  -21.261 59.623   1.00 281.06 ? 225 GLU B C     1 
ATOM   4682  O  O     . GLU B 1 225 ? 15.137  -21.574 60.751   1.00 290.05 ? 225 GLU B O     1 
ATOM   4683  C  CB    . GLU B 1 225 ? 16.322  -19.584 58.402   1.00 294.20 ? 225 GLU B CB    1 
ATOM   4684  C  CG    . GLU B 1 225 ? 17.687  -19.496 57.729   1.00 309.21 ? 225 GLU B CG    1 
ATOM   4685  C  CD    . GLU B 1 225 ? 18.272  -18.120 57.838   1.00 324.91 ? 225 GLU B CD    1 
ATOM   4686  O  OE1   . GLU B 1 225 ? 17.524  -17.202 58.222   1.00 333.91 ? 225 GLU B OE1   1 
ATOM   4687  O  OE2   . GLU B 1 225 ? 19.467  -17.968 57.539   1.00 326.18 ? 225 GLU B OE2   1 
ATOM   4688  N  N     . MET B 1 226 ? 13.497  -21.184 59.290   1.00 268.90 ? 226 MET B N     1 
ATOM   4689  C  CA    . MET B 1 226 ? 12.455  -21.430 60.265   1.00 262.43 ? 226 MET B CA    1 
ATOM   4690  C  C     . MET B 1 226 ? 12.471  -22.873 60.667   1.00 253.94 ? 226 MET B C     1 
ATOM   4691  O  O     . MET B 1 226 ? 12.159  -23.181 61.819   1.00 260.46 ? 226 MET B O     1 
ATOM   4692  C  CB    . MET B 1 226 ? 11.053  -20.977 59.773   1.00 260.87 ? 226 MET B CB    1 
ATOM   4693  C  CG    . MET B 1 226 ? 10.042  -20.736 60.901   1.00 265.96 ? 226 MET B CG    1 
ATOM   4694  S  SD    . MET B 1 226 ? 8.595   -19.754 60.458   1.00 277.75 ? 226 MET B SD    1 
ATOM   4695  C  CE    . MET B 1 226 ? 7.969   -20.816 59.160   1.00 293.55 ? 226 MET B CE    1 
ATOM   4696  N  N     . ALA B 1 227 ? 12.814  -23.787 59.752   1.00 246.48 ? 227 ALA B N     1 
ATOM   4697  C  CA    . ALA B 1 227 ? 12.897  -25.204 60.082   1.00 243.25 ? 227 ALA B CA    1 
ATOM   4698  C  C     . ALA B 1 227 ? 14.010  -25.407 61.097   1.00 253.38 ? 227 ALA B C     1 
ATOM   4699  O  O     . ALA B 1 227 ? 13.813  -26.131 62.107   1.00 258.05 ? 227 ALA B O     1 
ATOM   4700  C  CB    . ALA B 1 227 ? 13.124  -26.081 58.841   1.00 239.84 ? 227 ALA B CB    1 
ATOM   4701  N  N     . THR B 1 228 ? 15.171  -24.791 60.815   1.00 263.99 ? 228 THR B N     1 
ATOM   4702  C  CA    . THR B 1 228 ? 16.334  -24.923 61.685   1.00 269.79 ? 228 THR B CA    1 
ATOM   4703  C  C     . THR B 1 228 ? 16.164  -24.213 63.024   1.00 277.78 ? 228 THR B C     1 
ATOM   4704  O  O     . THR B 1 228 ? 16.898  -24.509 63.929   1.00 282.69 ? 228 THR B O     1 
ATOM   4705  C  CB    . THR B 1 228 ? 17.662  -24.586 61.002   1.00 268.37 ? 228 THR B CB    1 
ATOM   4706  O  OG1   . THR B 1 228 ? 18.747  -24.944 61.872   1.00 266.18 ? 228 THR B OG1   1 
ATOM   4707  C  CG2   . THR B 1 228 ? 17.813  -23.127 60.659   1.00 272.20 ? 228 THR B CG2   1 
ATOM   4708  N  N     . ALA B 1 229 ? 15.215  -23.280 63.134   1.00 279.73 ? 229 ALA B N     1 
ATOM   4709  C  CA    . ALA B 1 229 ? 14.780  -22.835 64.453   1.00 275.82 ? 229 ALA B CA    1 
ATOM   4710  C  C     . ALA B 1 229 ? 14.360  -23.897 65.400   1.00 278.73 ? 229 ALA B C     1 
ATOM   4711  O  O     . ALA B 1 229 ? 14.288  -23.646 66.605   1.00 278.17 ? 229 ALA B O     1 
ATOM   4712  C  CB    . ALA B 1 229 ? 13.654  -21.791 64.377   1.00 267.31 ? 229 ALA B CB    1 
ATOM   4713  N  N     . ALA B 1 230 ? 14.023  -25.111 64.972   1.00 276.45 ? 230 ALA B N     1 
ATOM   4714  C  CA    . ALA B 1 230 ? 13.719  -26.157 65.916   1.00 270.09 ? 230 ALA B CA    1 
ATOM   4715  C  C     . ALA B 1 230 ? 14.866  -26.355 66.909   1.00 274.85 ? 230 ALA B C     1 
ATOM   4716  O  O     . ALA B 1 230 ? 14.635  -26.401 68.125   1.00 272.41 ? 230 ALA B O     1 
ATOM   4717  C  CB    . ALA B 1 230 ? 13.388  -27.481 65.196   1.00 263.32 ? 230 ALA B CB    1 
ATOM   4718  N  N     . SER B 1 231 ? 16.067  -26.532 66.368   1.00 276.58 ? 231 SER B N     1 
ATOM   4719  C  CA    . SER B 1 231 ? 17.257  -26.729 67.202   1.00 272.69 ? 231 SER B CA    1 
ATOM   4720  C  C     . SER B 1 231 ? 17.905  -25.392 67.388   1.00 280.70 ? 231 SER B C     1 
ATOM   4721  O  O     . SER B 1 231 ? 18.752  -24.987 66.591   1.00 277.86 ? 231 SER B O     1 
ATOM   4722  C  CB    . SER B 1 231 ? 18.246  -27.713 66.561   1.00 264.87 ? 231 SER B CB    1 
ATOM   4723  O  OG    . SER B 1 231 ? 18.660  -27.267 65.283   1.00 261.25 ? 231 SER B OG    1 
ATOM   4724  N  N     . SER B 1 232 ? 17.522  -24.667 68.448   1.00 280.69 ? 232 SER B N     1 
ATOM   4725  C  CA    . SER B 1 232 ? 17.951  -23.262 68.617   1.00 280.53 ? 232 SER B CA    1 
ATOM   4726  C  C     . SER B 1 232 ? 19.345  -23.185 69.199   1.00 278.72 ? 232 SER B C     1 
ATOM   4727  O  O     . SER B 1 232 ? 19.556  -23.700 70.294   1.00 275.99 ? 232 SER B O     1 
ATOM   4728  C  CB    . SER B 1 232 ? 16.992  -22.474 69.543   1.00 277.26 ? 232 SER B CB    1 
ATOM   4729  O  OG    . SER B 1 232 ? 15.682  -22.429 69.005   1.00 283.94 ? 232 SER B OG    1 
ATOM   4730  N  N     . SER B 1 233 ? 20.268  -22.586 68.453   1.00 285.10 ? 233 SER B N     1 
ATOM   4731  C  CA    . SER B 1 233 ? 21.643  -22.485 68.869   1.00 289.36 ? 233 SER B CA    1 
ATOM   4732  C  C     . SER B 1 233 ? 22.112  -21.101 68.528   1.00 297.69 ? 233 SER B C     1 
ATOM   4733  O  O     . SER B 1 233 ? 22.149  -20.252 69.404   1.00 293.46 ? 233 SER B O     1 
ATOM   4734  C  CB    . SER B 1 233 ? 22.498  -23.580 68.212   1.00 288.44 ? 233 SER B CB    1 
ATOM   4735  O  OG    . SER B 1 233 ? 23.870  -23.414 68.528   1.00 293.68 ? 233 SER B OG    1 
ATOM   4736  N  N     . SER B 1 234 ? 22.355  -20.857 67.234   1.00 310.35 ? 234 SER B N     1 
ATOM   4737  C  CA    . SER B 1 234 ? 22.795  -19.564 66.710   1.00 321.14 ? 234 SER B CA    1 
ATOM   4738  C  C     . SER B 1 234 ? 21.687  -18.552 66.482   1.00 331.24 ? 234 SER B C     1 
ATOM   4739  O  O     . SER B 1 234 ? 21.947  -17.377 66.478   1.00 331.99 ? 234 SER B O     1 
ATOM   4740  C  CB    . SER B 1 234 ? 23.553  -19.728 65.368   1.00 315.91 ? 234 SER B CB    1 
ATOM   4741  O  OG    . SER B 1 234 ? 24.736  -20.496 65.518   1.00 308.39 ? 234 SER B OG    1 
ATOM   4742  N  N     . LEU B 1 235 ? 20.459  -18.995 66.250   1.00 337.27 ? 235 LEU B N     1 
ATOM   4743  C  CA    . LEU B 1 235 ? 19.383  -18.110 65.919   1.00 329.77 ? 235 LEU B CA    1 
ATOM   4744  C  C     . LEU B 1 235 ? 18.878  -17.320 67.110   1.00 300.91 ? 235 LEU B C     1 
ATOM   4745  O  O     . LEU B 1 235 ? 18.210  -16.312 66.955   1.00 290.27 ? 235 LEU B O     1 
ATOM   4746  C  CB    . LEU B 1 235 ? 18.235  -18.916 65.293   1.00 345.24 ? 235 LEU B CB    1 
ATOM   4747  C  CG    . LEU B 1 235 ? 18.684  -19.807 64.116   1.00 354.25 ? 235 LEU B CG    1 
ATOM   4748  C  CD1   . LEU B 1 235 ? 17.685  -20.940 63.855   1.00 353.24 ? 235 LEU B CD1   1 
ATOM   4749  C  CD2   . LEU B 1 235 ? 18.994  -18.970 62.870   1.00 354.69 ? 235 LEU B CD2   1 
ATOM   4750  N  N     . GLU B 1 236 ? 19.185  -17.774 68.315   1.00 281.83 ? 236 GLU B N     1 
ATOM   4751  C  CA    . GLU B 1 236 ? 18.865  -16.974 69.482   1.00 271.91 ? 236 GLU B CA    1 
ATOM   4752  C  C     . GLU B 1 236 ? 19.989  -16.020 69.801   1.00 258.30 ? 236 GLU B C     1 
ATOM   4753  O  O     . GLU B 1 236 ? 21.155  -16.389 69.729   1.00 257.02 ? 236 GLU B O     1 
ATOM   4754  C  CB    . GLU B 1 236 ? 18.598  -17.849 70.739   1.00 279.19 ? 236 GLU B CB    1 
ATOM   4755  C  CG    . GLU B 1 236 ? 17.363  -18.718 70.633   1.00 285.25 ? 236 GLU B CG    1 
ATOM   4756  C  CD    . GLU B 1 236 ? 17.249  -19.635 71.814   1.00 288.24 ? 236 GLU B CD    1 
ATOM   4757  O  OE1   . GLU B 1 236 ? 18.119  -19.529 72.697   1.00 291.21 ? 236 GLU B OE1   1 
ATOM   4758  O  OE2   . GLU B 1 236 ? 16.305  -20.441 71.858   1.00 291.23 ? 236 GLU B OE2   1 
ATOM   4759  N  N     . LYS B 1 237 ? 19.628  -14.827 70.200   1.00 252.93 ? 237 LYS B N     1 
ATOM   4760  C  CA    . LYS B 1 237 ? 20.629  -13.894 70.655   1.00 259.07 ? 237 LYS B CA    1 
ATOM   4761  C  C     . LYS B 1 237 ? 20.123  -13.192 71.900   1.00 257.54 ? 237 LYS B C     1 
ATOM   4762  O  O     . LYS B 1 237 ? 18.978  -12.761 71.979   1.00 251.05 ? 237 LYS B O     1 
ATOM   4763  C  CB    . LYS B 1 237 ? 21.028  -12.860 69.567   1.00 271.16 ? 237 LYS B CB    1 
ATOM   4764  C  CG    . LYS B 1 237 ? 22.385  -13.091 68.922   1.00 283.34 ? 237 LYS B CG    1 
ATOM   4765  C  CD    . LYS B 1 237 ? 22.545  -12.247 67.656   1.00 292.38 ? 237 LYS B CD    1 
ATOM   4766  C  CE    . LYS B 1 237 ? 23.609  -12.802 66.693   1.00 296.09 ? 237 LYS B CE    1 
ATOM   4767  N  NZ    . LYS B 1 237 ? 23.827  -11.937 65.504   1.00 299.08 ? 237 LYS B NZ    1 
ATOM   4768  N  N     . SER B 1 238 ? 20.998  -13.072 72.878   1.00 263.44 ? 238 SER B N     1 
ATOM   4769  C  CA    . SER B 1 238 ? 20.720  -12.240 74.005   1.00 268.43 ? 238 SER B CA    1 
ATOM   4770  C  C     . SER B 1 238 ? 20.875  -10.780 73.630   1.00 260.87 ? 238 SER B C     1 
ATOM   4771  O  O     . SER B 1 238 ? 21.818  -10.358 72.972   1.00 249.99 ? 238 SER B O     1 
ATOM   4772  C  CB    . SER B 1 238 ? 21.696  -12.606 75.101   1.00 267.78 ? 238 SER B CB    1 
ATOM   4773  O  OG    . SER B 1 238 ? 21.493  -11.833 76.272   1.00 263.41 ? 238 SER B OG    1 
ATOM   4774  N  N     . TYR B 1 239 ? 19.892  -10.003 74.054   1.00 258.41 ? 239 TYR B N     1 
ATOM   4775  C  CA    . TYR B 1 239 ? 19.950  -8.553  73.951   1.00 257.38 ? 239 TYR B CA    1 
ATOM   4776  C  C     . TYR B 1 239 ? 19.734  -7.960  75.336   1.00 268.66 ? 239 TYR B C     1 
ATOM   4777  O  O     . TYR B 1 239 ? 19.020  -8.507  76.171   1.00 274.26 ? 239 TYR B O     1 
ATOM   4778  C  CB    . TYR B 1 239 ? 18.871  -8.064  72.981   1.00 253.61 ? 239 TYR B CB    1 
ATOM   4779  C  CG    . TYR B 1 239 ? 18.886  -6.587  72.792   1.00 268.75 ? 239 TYR B CG    1 
ATOM   4780  C  CD1   . TYR B 1 239 ? 19.874  -5.971  72.054   1.00 273.03 ? 239 TYR B CD1   1 
ATOM   4781  C  CD2   . TYR B 1 239 ? 17.991  -5.798  73.479   1.00 277.01 ? 239 TYR B CD2   1 
ATOM   4782  C  CE1   . TYR B 1 239 ? 19.912  -4.596  71.930   1.00 271.24 ? 239 TYR B CE1   1 
ATOM   4783  C  CE2   . TYR B 1 239 ? 18.009  -4.421  73.341   1.00 276.55 ? 239 TYR B CE2   1 
ATOM   4784  C  CZ    . TYR B 1 239 ? 18.975  -3.822  72.570   1.00 266.75 ? 239 TYR B CZ    1 
ATOM   4785  O  OH    . TYR B 1 239 ? 18.996  -2.429  72.448   1.00 238.15 ? 239 TYR B OH    1 
ATOM   4786  N  N     . GLU B 1 240 ? 20.428  -6.856  75.578   1.00 286.55 ? 240 GLU B N     1 
ATOM   4787  C  CA    . GLU B 1 240 ? 20.388  -6.181  76.881   1.00 306.94 ? 240 GLU B CA    1 
ATOM   4788  C  C     . GLU B 1 240 ? 19.551  -4.961  76.717   1.00 304.52 ? 240 GLU B C     1 
ATOM   4789  O  O     . GLU B 1 240 ? 19.916  -4.131  75.893   1.00 306.35 ? 240 GLU B O     1 
ATOM   4790  C  CB    . GLU B 1 240 ? 21.797  -5.740  77.266   1.00 315.52 ? 240 GLU B CB    1 
ATOM   4791  C  CG    . GLU B 1 240 ? 21.896  -5.007  78.592   1.00 327.64 ? 240 GLU B CG    1 
ATOM   4792  C  CD    . GLU B 1 240 ? 21.692  -5.915  79.789   1.00 338.15 ? 240 GLU B CD    1 
ATOM   4793  O  OE1   . GLU B 1 240 ? 21.835  -7.149  79.655   1.00 345.04 ? 240 GLU B OE1   1 
ATOM   4794  O  OE2   . GLU B 1 240 ? 21.400  -5.389  80.875   1.00 340.11 ? 240 GLU B OE2   1 
ATOM   4795  N  N     . LEU B 1 241 ? 18.520  -4.787  77.570   1.00 296.67 ? 241 LEU B N     1 
ATOM   4796  C  CA    . LEU B 1 241 ? 17.725  -3.569  77.540   1.00 293.09 ? 241 LEU B CA    1 
ATOM   4797  C  C     . LEU B 1 241 ? 18.402  -2.560  78.408   1.00 295.37 ? 241 LEU B C     1 
ATOM   4798  O  O     . LEU B 1 241 ? 19.231  -2.915  79.253   1.00 309.99 ? 241 LEU B O     1 
ATOM   4799  C  CB    . LEU B 1 241 ? 16.310  -3.749  78.090   1.00 304.24 ? 241 LEU B CB    1 
ATOM   4800  C  CG    . LEU B 1 241 ? 15.228  -3.919  77.009   1.00 313.72 ? 241 LEU B CG    1 
ATOM   4801  C  CD1   . LEU B 1 241 ? 15.523  -5.114  76.097   1.00 309.69 ? 241 LEU B CD1   1 
ATOM   4802  C  CD2   . LEU B 1 241 ? 13.817  -3.985  77.629   1.00 324.28 ? 241 LEU B CD2   1 
ATOM   4803  N  N     . PRO B 1 242 ? 18.013  -1.306  78.249   1.00 291.51 ? 242 PRO B N     1 
ATOM   4804  C  CA    . PRO B 1 242 ? 18.567  -0.289  79.138   1.00 297.24 ? 242 PRO B CA    1 
ATOM   4805  C  C     . PRO B 1 242 ? 18.141  -0.491  80.570   1.00 308.48 ? 242 PRO B C     1 
ATOM   4806  O  O     . PRO B 1 242 ? 18.821  -0.022  81.450   1.00 305.99 ? 242 PRO B O     1 
ATOM   4807  C  CB    . PRO B 1 242 ? 18.067  1.033   78.532   1.00 283.09 ? 242 PRO B CB    1 
ATOM   4808  C  CG    . PRO B 1 242 ? 16.868  0.628   77.764   1.00 279.99 ? 242 PRO B CG    1 
ATOM   4809  C  CD    . PRO B 1 242 ? 17.207  -0.695  77.180   1.00 282.56 ? 242 PRO B CD    1 
ATOM   4810  N  N     . ASP B 1 243 ? 17.001  -1.153  80.802   1.00 315.91 ? 243 ASP B N     1 
ATOM   4811  C  CA    . ASP B 1 243 ? 16.465  -1.461  82.102   1.00 314.08 ? 243 ASP B CA    1 
ATOM   4812  C  C     . ASP B 1 243 ? 17.395  -2.458  82.788   1.00 311.74 ? 243 ASP B C     1 
ATOM   4813  O  O     . ASP B 1 243 ? 17.444  -2.521  84.019   1.00 305.17 ? 243 ASP B O     1 
ATOM   4814  C  CB    . ASP B 1 243 ? 14.975  -1.964  81.930   1.00 303.04 ? 243 ASP B CB    1 
ATOM   4815  C  CG    . ASP B 1 243 ? 14.404  -2.483  83.184   1.00 288.40 ? 243 ASP B CG    1 
ATOM   4816  O  OD1   . ASP B 1 243 ? 14.868  -2.010  84.228   1.00 276.57 ? 243 ASP B OD1   1 
ATOM   4817  O  OD2   . ASP B 1 243 ? 13.479  -3.350  83.150   1.00 277.62 ? 243 ASP B OD2   1 
ATOM   4818  N  N     . GLY B 1 244 ? 18.118  -3.275  82.008   1.00 298.43 ? 244 GLY B N     1 
ATOM   4819  C  CA    . GLY B 1 244 ? 18.973  -4.253  82.614   1.00 277.02 ? 244 GLY B CA    1 
ATOM   4820  C  C     . GLY B 1 244 ? 18.386  -5.620  82.391   1.00 271.10 ? 244 GLY B C     1 
ATOM   4821  O  O     . GLY B 1 244 ? 19.018  -6.632  82.692   1.00 264.82 ? 244 GLY B O     1 
ATOM   4822  N  N     . GLN B 1 245 ? 17.167  -5.656  81.846   1.00 272.82 ? 245 GLN B N     1 
ATOM   4823  C  CA    . GLN B 1 245 ? 16.494  -6.890  81.535   1.00 271.57 ? 245 GLN B CA    1 
ATOM   4824  C  C     . GLN B 1 245 ? 17.195  -7.435  80.306   1.00 284.48 ? 245 GLN B C     1 
ATOM   4825  O  O     . GLN B 1 245 ? 17.784  -6.680  79.543   1.00 293.97 ? 245 GLN B O     1 
ATOM   4826  C  CB    . GLN B 1 245 ? 14.985  -6.677  81.283   1.00 262.32 ? 245 GLN B CB    1 
ATOM   4827  C  CG    . GLN B 1 245 ? 14.144  -7.936  81.321   1.00 259.98 ? 245 GLN B CG    1 
ATOM   4828  C  CD    . GLN B 1 245 ? 12.654  -7.644  81.260   1.00 264.59 ? 245 GLN B CD    1 
ATOM   4829  O  OE1   . GLN B 1 245 ? 12.215  -6.510  81.470   1.00 260.91 ? 245 GLN B OE1   1 
ATOM   4830  N  NE2   . GLN B 1 245 ? 11.864  -8.672  80.971   1.00 272.15 ? 245 GLN B NE2   1 
ATOM   4831  N  N     . VAL B 1 246 ? 17.088  -8.748  80.125   1.00 293.25 ? 246 VAL B N     1 
ATOM   4832  C  CA    . VAL B 1 246 ? 17.694  -9.434  79.017   1.00 295.48 ? 246 VAL B CA    1 
ATOM   4833  C  C     . VAL B 1 246 ? 16.606  -10.078 78.193   1.00 288.94 ? 246 VAL B C     1 
ATOM   4834  O  O     . VAL B 1 246 ? 15.650  -10.638 78.695   1.00 278.39 ? 246 VAL B O     1 
ATOM   4835  C  CB    . VAL B 1 246 ? 18.711  -10.471 79.519   1.00 290.40 ? 246 VAL B CB    1 
ATOM   4836  C  CG1   . VAL B 1 246 ? 19.227  -11.303 78.338   1.00 284.83 ? 246 VAL B CG1   1 
ATOM   4837  C  CG2   . VAL B 1 246 ? 19.819  -9.748  80.291   1.00 284.57 ? 246 VAL B CG2   1 
ATOM   4838  N  N     . ILE B 1 247 ? 16.752  -9.986  76.890   1.00 278.47 ? 247 ILE B N     1 
ATOM   4839  C  CA    . ILE B 1 247 ? 15.746  -10.525 75.965   1.00 263.89 ? 247 ILE B CA    1 
ATOM   4840  C  C     . ILE B 1 247 ? 16.430  -11.585 75.140   1.00 247.26 ? 247 ILE B C     1 
ATOM   4841  O  O     . ILE B 1 247 ? 17.625  -11.438 74.874   1.00 243.12 ? 247 ILE B O     1 
ATOM   4842  C  CB    . ILE B 1 247 ? 15.219  -9.402  75.033   1.00 265.80 ? 247 ILE B CB    1 
ATOM   4843  C  CG1   . ILE B 1 247 ? 14.559  -8.264  75.838   1.00 260.15 ? 247 ILE B CG1   1 
ATOM   4844  C  CG2   . ILE B 1 247 ? 14.329  -9.960  73.919   1.00 268.77 ? 247 ILE B CG2   1 
ATOM   4845  C  CD1   . ILE B 1 247 ? 13.395  -8.691  76.689   1.00 255.87 ? 247 ILE B CD1   1 
ATOM   4846  N  N     . THR B 1 248 ? 15.712  -12.614 74.723   1.00 233.65 ? 248 THR B N     1 
ATOM   4847  C  CA    . THR B 1 248 ? 16.322  -13.669 73.959   1.00 230.92 ? 248 THR B CA    1 
ATOM   4848  C  C     . THR B 1 248 ? 15.419  -14.012 72.798   1.00 238.30 ? 248 THR B C     1 
ATOM   4849  O  O     . THR B 1 248 ? 14.339  -14.561 72.981   1.00 235.69 ? 248 THR B O     1 
ATOM   4850  C  CB    . THR B 1 248 ? 16.501  -14.914 74.861   1.00 232.08 ? 248 THR B CB    1 
ATOM   4851  O  OG1   . THR B 1 248 ? 17.347  -14.582 75.967   1.00 241.55 ? 248 THR B OG1   1 
ATOM   4852  C  CG2   . THR B 1 248 ? 17.117  -16.091 74.102   1.00 231.24 ? 248 THR B CG2   1 
ATOM   4853  N  N     . ILE B 1 249 ? 15.872  -13.726 71.572   1.00 251.47 ? 249 ILE B N     1 
ATOM   4854  C  CA    . ILE B 1 249 ? 14.998  -13.751 70.433   1.00 257.29 ? 249 ILE B CA    1 
ATOM   4855  C  C     . ILE B 1 249 ? 15.520  -14.707 69.392   1.00 257.43 ? 249 ILE B C     1 
ATOM   4856  O  O     . ILE B 1 249 ? 16.639  -14.535 68.937   1.00 260.28 ? 249 ILE B O     1 
ATOM   4857  C  CB    . ILE B 1 249 ? 14.826  -12.353 69.830   1.00 260.13 ? 249 ILE B CB    1 
ATOM   4858  C  CG1   . ILE B 1 249 ? 16.181  -11.684 69.519   1.00 273.41 ? 249 ILE B CG1   1 
ATOM   4859  C  CG2   . ILE B 1 249 ? 14.102  -11.488 70.822   1.00 253.84 ? 249 ILE B CG2   1 
ATOM   4860  C  CD1   . ILE B 1 249 ? 16.088  -10.563 68.519   1.00 277.95 ? 249 ILE B CD1   1 
ATOM   4861  N  N     . GLY B 1 250 ? 14.716  -15.713 69.099   1.00 250.81 ? 250 GLY B N     1 
ATOM   4862  C  CA    . GLY B 1 250 ? 15.087  -16.787 68.177   1.00 243.96 ? 250 GLY B CA    1 
ATOM   4863  C  C     . GLY B 1 250 ? 14.751  -16.589 66.725   1.00 232.98 ? 250 GLY B C     1 
ATOM   4864  O  O     . GLY B 1 250 ? 15.331  -15.737 66.062   1.00 230.41 ? 250 GLY B O     1 
ATOM   4865  N  N     . ASN B 1 251 ? 13.702  -17.322 66.279   1.00 223.04 ? 251 ASN B N     1 
ATOM   4866  C  CA    . ASN B 1 251 ? 13.197  -17.298 64.895   1.00 220.15 ? 251 ASN B CA    1 
ATOM   4867  C  C     . ASN B 1 251 ? 12.482  -15.972 64.611   1.00 225.13 ? 251 ASN B C     1 
ATOM   4868  O  O     . ASN B 1 251 ? 12.403  -15.467 63.481   1.00 223.60 ? 251 ASN B O     1 
ATOM   4869  C  CB    . ASN B 1 251 ? 12.239  -18.466 64.604   1.00 212.66 ? 251 ASN B CB    1 
ATOM   4870  C  CG    . ASN B 1 251 ? 10.969  -18.358 65.412   1.00 206.82 ? 251 ASN B CG    1 
ATOM   4871  O  OD1   . ASN B 1 251 ? 10.957  -17.863 66.534   1.00 197.26 ? 251 ASN B OD1   1 
ATOM   4872  N  ND2   . ASN B 1 251 ? 9.892   -18.917 64.875   1.00 208.04 ? 251 ASN B ND2   1 
ATOM   4873  N  N     . GLU B 1 252 ? 11.966  -15.403 65.686   1.00 231.97 ? 252 GLU B N     1 
ATOM   4874  C  CA    . GLU B 1 252 ? 11.287  -14.163 65.680   1.00 246.46 ? 252 GLU B CA    1 
ATOM   4875  C  C     . GLU B 1 252 ? 12.204  -13.103 65.090   1.00 231.77 ? 252 GLU B C     1 
ATOM   4876  O  O     . GLU B 1 252 ? 11.767  -12.129 64.494   1.00 225.48 ? 252 GLU B O     1 
ATOM   4877  C  CB    . GLU B 1 252 ? 10.856  -13.850 67.121   1.00 266.64 ? 252 GLU B CB    1 
ATOM   4878  C  CG    . GLU B 1 252 ? 10.679  -12.379 67.447   1.00 283.92 ? 252 GLU B CG    1 
ATOM   4879  C  CD    . GLU B 1 252 ? 10.716  -12.137 68.942   1.00 300.85 ? 252 GLU B CD    1 
ATOM   4880  O  OE1   . GLU B 1 252 ? 10.200  -13.039 69.616   1.00 319.07 ? 252 GLU B OE1   1 
ATOM   4881  O  OE2   . GLU B 1 252 ? 11.304  -11.142 69.393   1.00 298.93 ? 252 GLU B OE2   1 
ATOM   4882  N  N     . ARG B 1 253 ? 13.496  -13.286 65.292   1.00 225.77 ? 253 ARG B N     1 
ATOM   4883  C  CA    . ARG B 1 253 ? 14.467  -12.379 64.706   1.00 229.56 ? 253 ARG B CA    1 
ATOM   4884  C  C     . ARG B 1 253 ? 14.252  -12.194 63.214   1.00 224.50 ? 253 ARG B C     1 
ATOM   4885  O  O     . ARG B 1 253 ? 14.048  -11.050 62.753   1.00 223.32 ? 253 ARG B O     1 
ATOM   4886  C  CB    . ARG B 1 253 ? 15.919  -12.858 64.987   1.00 240.95 ? 253 ARG B CB    1 
ATOM   4887  C  CG    . ARG B 1 253 ? 16.972  -11.887 64.463   1.00 247.86 ? 253 ARG B CG    1 
ATOM   4888  C  CD    . ARG B 1 253 ? 18.320  -12.538 64.238   1.00 252.86 ? 253 ARG B CD    1 
ATOM   4889  N  NE    . ARG B 1 253 ? 18.780  -13.177 65.444   1.00 258.88 ? 253 ARG B NE    1 
ATOM   4890  C  CZ    . ARG B 1 253 ? 20.020  -13.645 65.592   1.00 265.16 ? 253 ARG B CZ    1 
ATOM   4891  N  NH1   . ARG B 1 253 ? 20.354  -14.234 66.728   1.00 266.92 ? 253 ARG B NH1   1 
ATOM   4892  N  NH2   . ARG B 1 253 ? 20.930  -13.540 64.616   1.00 267.44 ? 253 ARG B NH2   1 
ATOM   4893  N  N     . PHE B 1 254 ? 14.363  -13.283 62.419   1.00 221.11 ? 254 PHE B N     1 
ATOM   4894  C  CA    . PHE B 1 254 ? 14.539  -13.112 60.973   1.00 215.57 ? 254 PHE B CA    1 
ATOM   4895  C  C     . PHE B 1 254 ? 13.205  -12.961 60.218   1.00 217.62 ? 254 PHE B C     1 
ATOM   4896  O  O     . PHE B 1 254 ? 13.213  -12.382 59.151   1.00 219.80 ? 254 PHE B O     1 
ATOM   4897  C  CB    . PHE B 1 254 ? 15.393  -14.229 60.345   1.00 206.81 ? 254 PHE B CB    1 
ATOM   4898  C  CG    . PHE B 1 254 ? 14.805  -15.567 60.554   1.00 215.20 ? 254 PHE B CG    1 
ATOM   4899  C  CD1   . PHE B 1 254 ? 13.822  -16.067 59.708   1.00 222.28 ? 254 PHE B CD1   1 
ATOM   4900  C  CD2   . PHE B 1 254 ? 15.207  -16.326 61.604   1.00 229.84 ? 254 PHE B CD2   1 
ATOM   4901  C  CE1   . PHE B 1 254 ? 13.249  -17.280 59.942   1.00 231.02 ? 254 PHE B CE1   1 
ATOM   4902  C  CE2   . PHE B 1 254 ? 14.669  -17.591 61.829   1.00 240.11 ? 254 PHE B CE2   1 
ATOM   4903  C  CZ    . PHE B 1 254 ? 13.685  -18.059 60.987   1.00 237.71 ? 254 PHE B CZ    1 
ATOM   4904  N  N     . ARG B 1 255 ? 12.110  -13.546 60.744   1.00 215.19 ? 255 ARG B N     1 
ATOM   4905  C  CA    . ARG B 1 255 ? 10.820  -13.324 60.175   1.00 213.39 ? 255 ARG B CA    1 
ATOM   4906  C  C     . ARG B 1 255 ? 10.413  -11.892 60.235   1.00 192.83 ? 255 ARG B C     1 
ATOM   4907  O  O     . ARG B 1 255 ? 9.553   -11.528 59.443   1.00 197.25 ? 255 ARG B O     1 
ATOM   4908  C  CB    . ARG B 1 255 ? 9.743   -14.262 60.716   1.00 229.09 ? 255 ARG B CB    1 
ATOM   4909  C  CG    . ARG B 1 255 ? 9.284   -14.072 62.140   1.00 239.22 ? 255 ARG B CG    1 
ATOM   4910  C  CD    . ARG B 1 255 ? 8.226   -15.129 62.377   1.00 249.67 ? 255 ARG B CD    1 
ATOM   4911  N  NE    . ARG B 1 255 ? 7.965   -15.401 63.777   1.00 258.60 ? 255 ARG B NE    1 
ATOM   4912  C  CZ    . ARG B 1 255 ? 7.098   -16.318 64.187   1.00 264.83 ? 255 ARG B CZ    1 
ATOM   4913  N  NH1   . ARG B 1 255 ? 6.403   -17.035 63.305   1.00 266.81 ? 255 ARG B NH1   1 
ATOM   4914  N  NH2   . ARG B 1 255 ? 6.913   -16.525 65.488   1.00 268.22 ? 255 ARG B NH2   1 
ATOM   4915  N  N     . CYS B 1 256 ? 11.026  -11.019 61.055   1.00 183.81 ? 256 CYS B N     1 
ATOM   4916  C  CA    . CYS B 1 256 ? 10.683  -9.632  61.003   1.00 189.92 ? 256 CYS B CA    1 
ATOM   4917  C  C     . CYS B 1 256 ? 10.919  -9.005  59.648   1.00 196.51 ? 256 CYS B C     1 
ATOM   4918  O  O     . CYS B 1 256 ? 10.023  -8.436  59.077   1.00 210.59 ? 256 CYS B O     1 
ATOM   4919  C  CB    . CYS B 1 256 ? 11.282  -8.794  62.142   1.00 195.29 ? 256 CYS B CB    1 
ATOM   4920  S  SG    . CYS B 1 256 ? 10.887  -7.019  62.018   1.00 193.21 ? 256 CYS B SG    1 
ATOM   4921  N  N     . PRO B 1 257 ? 12.129  -9.097  59.093   1.00 196.15 ? 257 PRO B N     1 
ATOM   4922  C  CA    . PRO B 1 257 ? 12.376  -8.550  57.759   1.00 189.91 ? 257 PRO B CA    1 
ATOM   4923  C  C     . PRO B 1 257 ? 11.722  -9.330  56.653   1.00 173.72 ? 257 PRO B C     1 
ATOM   4924  O  O     . PRO B 1 257 ? 11.598  -8.846  55.533   1.00 171.36 ? 257 PRO B O     1 
ATOM   4925  C  CB    . PRO B 1 257 ? 13.879  -8.720  57.585   1.00 197.31 ? 257 PRO B CB    1 
ATOM   4926  C  CG    . PRO B 1 257 ? 14.470  -8.739  58.944   1.00 204.82 ? 257 PRO B CG    1 
ATOM   4927  C  CD    . PRO B 1 257 ? 13.370  -9.291  59.834   1.00 203.35 ? 257 PRO B CD    1 
ATOM   4928  N  N     . GLU B 1 258 ? 11.333  -10.566 56.932   1.00 165.41 ? 258 GLU B N     1 
ATOM   4929  C  CA    . GLU B 1 258 ? 10.693  -11.417 55.955   1.00 169.94 ? 258 GLU B CA    1 
ATOM   4930  C  C     . GLU B 1 258 ? 9.484   -10.715 55.429   1.00 158.72 ? 258 GLU B C     1 
ATOM   4931  O  O     . GLU B 1 258 ? 9.078   -10.935 54.299   1.00 164.75 ? 258 GLU B O     1 
ATOM   4932  C  CB    . GLU B 1 258 ? 10.282  -12.787 56.543   1.00 191.76 ? 258 GLU B CB    1 
ATOM   4933  C  CG    . GLU B 1 258 ? 9.593   -13.709 55.562   1.00 209.44 ? 258 GLU B CG    1 
ATOM   4934  C  CD    . GLU B 1 258 ? 10.503  -14.100 54.402   1.00 214.30 ? 258 GLU B CD    1 
ATOM   4935  O  OE1   . GLU B 1 258 ? 11.750  -13.870 54.450   1.00 203.56 ? 258 GLU B OE1   1 
ATOM   4936  O  OE2   . GLU B 1 258 ? 9.948   -14.555 53.371   1.00 217.71 ? 258 GLU B OE2   1 
ATOM   4937  N  N     . ALA B 1 259 ? 8.912   -9.845  56.257   1.00 157.78 ? 259 ALA B N     1 
ATOM   4938  C  CA    . ALA B 1 259 ? 7.678   -9.150  55.928   1.00 164.99 ? 259 ALA B CA    1 
ATOM   4939  C  C     . ALA B 1 259 ? 7.813   -8.424  54.606   1.00 165.21 ? 259 ALA B C     1 
ATOM   4940  O  O     . ALA B 1 259 ? 6.839   -8.362  53.832   1.00 173.96 ? 259 ALA B O     1 
ATOM   4941  C  CB    . ALA B 1 259 ? 7.236   -8.172  57.003   1.00 171.63 ? 259 ALA B CB    1 
ATOM   4942  N  N     . LEU B 1 260 ? 8.985   -7.872  54.322   1.00 165.18 ? 260 LEU B N     1 
ATOM   4943  C  CA    . LEU B 1 260 ? 9.168   -7.150  53.069   1.00 169.78 ? 260 LEU B CA    1 
ATOM   4944  C  C     . LEU B 1 260 ? 8.834   -8.021  51.900   1.00 154.08 ? 260 LEU B C     1 
ATOM   4945  O  O     . LEU B 1 260 ? 8.337   -7.537  50.950   1.00 156.00 ? 260 LEU B O     1 
ATOM   4946  C  CB    . LEU B 1 260 ? 10.619  -6.635  52.911   1.00 196.09 ? 260 LEU B CB    1 
ATOM   4947  C  CG    . LEU B 1 260 ? 11.049  -5.623  53.991   1.00 223.31 ? 260 LEU B CG    1 
ATOM   4948  C  CD1   . LEU B 1 260 ? 12.495  -5.132  53.741   1.00 239.99 ? 260 LEU B CD1   1 
ATOM   4949  C  CD2   . LEU B 1 260 ? 10.059  -4.444  54.085   1.00 214.23 ? 260 LEU B CD2   1 
ATOM   4950  N  N     . PHE B 1 261 ? 9.078   -9.298  51.986   1.00 154.87 ? 261 PHE B N     1 
ATOM   4951  C  CA    . PHE B 1 261 ? 8.849   -10.251 50.954   1.00 166.91 ? 261 PHE B CA    1 
ATOM   4952  C  C     . PHE B 1 261 ? 7.478   -10.939 51.117   1.00 175.49 ? 261 PHE B C     1 
ATOM   4953  O  O     . PHE B 1 261 ? 7.032   -11.625 50.200   1.00 177.07 ? 261 PHE B O     1 
ATOM   4954  C  CB    . PHE B 1 261 ? 10.042  -11.241 50.982   1.00 176.27 ? 261 PHE B CB    1 
ATOM   4955  C  CG    . PHE B 1 261 ? 11.382  -10.567 50.895   1.00 181.74 ? 261 PHE B CG    1 
ATOM   4956  C  CD1   . PHE B 1 261 ? 11.917  -10.273 49.678   1.00 181.49 ? 261 PHE B CD1   1 
ATOM   4957  C  CD2   . PHE B 1 261 ? 12.067  -10.180 52.037   1.00 197.77 ? 261 PHE B CD2   1 
ATOM   4958  C  CE1   . PHE B 1 261 ? 13.144  -9.651  49.574   1.00 187.03 ? 261 PHE B CE1   1 
ATOM   4959  C  CE2   . PHE B 1 261 ? 13.260  -9.517  51.951   1.00 199.22 ? 261 PHE B CE2   1 
ATOM   4960  C  CZ    . PHE B 1 261 ? 13.825  -9.272  50.713   1.00 194.85 ? 261 PHE B CZ    1 
ATOM   4961  N  N     . GLN B 1 262 ? 6.816   -10.793 52.251   1.00 177.89 ? 262 GLN B N     1 
ATOM   4962  C  CA    . GLN B 1 262 ? 5.544   -11.485 52.479   1.00 176.54 ? 262 GLN B CA    1 
ATOM   4963  C  C     . GLN B 1 262 ? 4.688   -10.550 53.246   1.00 165.55 ? 262 GLN B C     1 
ATOM   4964  O  O     . GLN B 1 262 ? 4.512   -10.717 54.478   1.00 177.74 ? 262 GLN B O     1 
ATOM   4965  C  CB    . GLN B 1 262 ? 5.723   -12.751 53.312   1.00 190.06 ? 262 GLN B CB    1 
ATOM   4966  C  CG    . GLN B 1 262 ? 6.611   -13.805 52.695   1.00 200.92 ? 262 GLN B CG    1 
ATOM   4967  C  CD    . GLN B 1 262 ? 5.979   -14.606 51.554   1.00 202.98 ? 262 GLN B CD    1 
ATOM   4968  O  OE1   . GLN B 1 262 ? 4.807   -14.994 51.604   1.00 202.48 ? 262 GLN B OE1   1 
ATOM   4969  N  NE2   . GLN B 1 262 ? 6.782   -14.896 50.532   1.00 203.91 ? 262 GLN B NE2   1 
ATOM   4970  N  N     . PRO B 1 263 ? 4.109   -9.562  52.539   1.00 161.95 ? 263 PRO B N     1 
ATOM   4971  C  CA    . PRO B 1 263 ? 3.334   -8.571  53.281   1.00 172.30 ? 263 PRO B CA    1 
ATOM   4972  C  C     . PRO B 1 263 ? 2.064   -9.144  53.797   1.00 195.98 ? 263 PRO B C     1 
ATOM   4973  O  O     . PRO B 1 263 ? 1.382   -8.477  54.546   1.00 203.95 ? 263 PRO B O     1 
ATOM   4974  C  CB    . PRO B 1 263 ? 3.099   -7.453  52.281   1.00 162.12 ? 263 PRO B CB    1 
ATOM   4975  C  CG    . PRO B 1 263 ? 4.173   -7.597  51.317   1.00 162.18 ? 263 PRO B CG    1 
ATOM   4976  C  CD    . PRO B 1 263 ? 4.334   -9.096  51.165   1.00 160.02 ? 263 PRO B CD    1 
ATOM   4977  N  N     . SER B 1 264 ? 1.721   -10.387 53.443   1.00 201.12 ? 264 SER B N     1 
ATOM   4978  C  CA    . SER B 1 264 ? 0.577   -11.067 54.006   1.00 203.49 ? 264 SER B CA    1 
ATOM   4979  C  C     . SER B 1 264 ? 0.756   -11.193 55.496   1.00 216.46 ? 264 SER B C     1 
ATOM   4980  O  O     . SER B 1 264 ? -0.220  -11.312 56.225   1.00 226.12 ? 264 SER B O     1 
ATOM   4981  C  CB    . SER B 1 264 ? 0.423   -12.478 53.427   1.00 196.41 ? 264 SER B CB    1 
ATOM   4982  O  OG    . SER B 1 264 ? 0.372   -12.436 52.013   1.00 192.95 ? 264 SER B OG    1 
ATOM   4983  N  N     . PHE B 1 265 ? 2.011   -11.194 55.958   1.00 219.00 ? 265 PHE B N     1 
ATOM   4984  C  CA    . PHE B 1 265 ? 2.272   -11.292 57.378   1.00 211.92 ? 265 PHE B CA    1 
ATOM   4985  C  C     . PHE B 1 265 ? 1.676   -10.105 58.089   1.00 203.57 ? 265 PHE B C     1 
ATOM   4986  O  O     . PHE B 1 265 ? 1.111   -10.244 59.163   1.00 211.49 ? 265 PHE B O     1 
ATOM   4987  C  CB    . PHE B 1 265 ? 3.773   -11.400 57.712   1.00 212.44 ? 265 PHE B CB    1 
ATOM   4988  C  CG    . PHE B 1 265 ? 4.380   -12.698 57.304   1.00 218.67 ? 265 PHE B CG    1 
ATOM   4989  C  CD1   . PHE B 1 265 ? 3.608   -13.760 56.881   1.00 221.46 ? 265 PHE B CD1   1 
ATOM   4990  C  CD2   . PHE B 1 265 ? 5.747   -12.885 57.407   1.00 216.74 ? 265 PHE B CD2   1 
ATOM   4991  C  CE1   . PHE B 1 265 ? 4.183   -14.952 56.524   1.00 223.01 ? 265 PHE B CE1   1 
ATOM   4992  C  CE2   . PHE B 1 265 ? 6.329   -14.084 57.057   1.00 217.97 ? 265 PHE B CE2   1 
ATOM   4993  C  CZ    . PHE B 1 265 ? 5.544   -15.122 56.611   1.00 220.12 ? 265 PHE B CZ    1 
ATOM   4994  N  N     . LEU B 1 266 ? 1.877   -8.931  57.490   1.00 195.12 ? 266 LEU B N     1 
ATOM   4995  C  CA    . LEU B 1 266 ? 1.335   -7.657  57.932   1.00 202.88 ? 266 LEU B CA    1 
ATOM   4996  C  C     . LEU B 1 266 ? -0.137  -7.575  57.614   1.00 202.74 ? 266 LEU B C     1 
ATOM   4997  O  O     . LEU B 1 266 ? -0.837  -6.850  58.319   1.00 198.75 ? 266 LEU B O     1 
ATOM   4998  C  CB    . LEU B 1 266 ? 2.087   -6.468  57.270   1.00 207.96 ? 266 LEU B CB    1 
ATOM   4999  C  CG    . LEU B 1 266 ? 3.502   -6.230  57.871   1.00 201.46 ? 266 LEU B CG    1 
ATOM   5000  C  CD1   . LEU B 1 266 ? 4.292   -5.193  57.073   1.00 203.74 ? 266 LEU B CD1   1 
ATOM   5001  C  CD2   . LEU B 1 266 ? 3.372   -5.891  59.369   1.00 199.85 ? 266 LEU B CD2   1 
ATOM   5002  N  N     . GLY B 1 267 ? -0.598  -8.263  56.577   1.00 200.77 ? 267 GLY B N     1 
ATOM   5003  C  CA    . GLY B 1 267 ? -2.039  -8.300  56.348   1.00 204.93 ? 267 GLY B CA    1 
ATOM   5004  C  C     . GLY B 1 267 ? -2.371  -7.490  55.136   1.00 201.12 ? 267 GLY B C     1 
ATOM   5005  O  O     . GLY B 1 267 ? -3.527  -7.328  54.841   1.00 223.32 ? 267 GLY B O     1 
ATOM   5006  N  N     . MET B 1 268 ? -1.366  -6.933  54.451   1.00 179.38 ? 268 MET B N     1 
ATOM   5007  C  CA    . MET B 1 268 ? -1.571  -6.166  53.252   1.00 174.29 ? 268 MET B CA    1 
ATOM   5008  C  C     . MET B 1 268 ? -1.424  -7.091  52.059   1.00 166.04 ? 268 MET B C     1 
ATOM   5009  O  O     . MET B 1 268 ? -0.638  -8.063  52.075   1.00 157.12 ? 268 MET B O     1 
ATOM   5010  C  CB    . MET B 1 268 ? -0.603  -4.947  53.196   1.00 190.95 ? 268 MET B CB    1 
ATOM   5011  C  CG    . MET B 1 268 ? -0.961  -3.857  54.206   1.00 200.64 ? 268 MET B CG    1 
ATOM   5012  S  SD    . MET B 1 268 ? 0.134   -2.429  54.225   1.00 230.45 ? 268 MET B SD    1 
ATOM   5013  C  CE    . MET B 1 268 ? 1.616   -3.260  54.759   1.00 229.62 ? 268 MET B CE    1 
ATOM   5014  N  N     . GLU B 1 269 ? -2.185  -6.769  51.026   1.00 175.41 ? 269 GLU B N     1 
ATOM   5015  C  CA    . GLU B 1 269 ? -2.187  -7.515  49.747   1.00 192.84 ? 269 GLU B CA    1 
ATOM   5016  C  C     . GLU B 1 269 ? -0.985  -7.107  48.919   1.00 189.96 ? 269 GLU B C     1 
ATOM   5017  O  O     . GLU B 1 269 ? -0.364  -7.926  48.210   1.00 192.30 ? 269 GLU B O     1 
ATOM   5018  C  CB    . GLU B 1 269 ? -3.403  -7.209  48.871   1.00 227.08 ? 269 GLU B CB    1 
ATOM   5019  C  CG    . GLU B 1 269 ? -4.700  -7.574  49.519   1.00 262.98 ? 269 GLU B CG    1 
ATOM   5020  C  CD    . GLU B 1 269 ? -5.880  -7.573  48.557   1.00 291.05 ? 269 GLU B CD    1 
ATOM   5021  O  OE1   . GLU B 1 269 ? -5.683  -7.273  47.359   1.00 297.61 ? 269 GLU B OE1   1 
ATOM   5022  O  OE2   . GLU B 1 269 ? -7.011  -7.864  49.005   1.00 304.69 ? 269 GLU B OE2   1 
ATOM   5023  N  N     . SER B 1 270 ? -0.637  -5.829  49.058   1.00 186.02 ? 270 SER B N     1 
ATOM   5024  C  CA    . SER B 1 270 ? 0.426   -5.206  48.267   1.00 180.09 ? 270 SER B CA    1 
ATOM   5025  C  C     . SER B 1 270 ? 1.589   -6.147  48.190   1.00 196.78 ? 270 SER B C     1 
ATOM   5026  O  O     . SER B 1 270 ? 1.996   -6.741  49.189   1.00 215.30 ? 270 SER B O     1 
ATOM   5027  C  CB    . SER B 1 270 ? 0.871   -3.842  48.824   1.00 167.59 ? 270 SER B CB    1 
ATOM   5028  O  OG    . SER B 1 270 ? -0.256  -3.006  48.961   1.00 171.50 ? 270 SER B OG    1 
ATOM   5029  N  N     . CYS B 1 271 ? 2.083   -6.359  46.964   1.00 196.68 ? 271 CYS B N     1 
ATOM   5030  C  CA    . CYS B 1 271 ? 3.073   -7.411  46.716   1.00 188.84 ? 271 CYS B CA    1 
ATOM   5031  C  C     . CYS B 1 271 ? 4.341   -7.091  47.447   1.00 155.03 ? 271 CYS B C     1 
ATOM   5032  O  O     . CYS B 1 271 ? 4.575   -5.950  47.843   1.00 132.20 ? 271 CYS B O     1 
ATOM   5033  C  CB    . CYS B 1 271 ? 3.368   -7.625  45.209   1.00 209.13 ? 271 CYS B CB    1 
ATOM   5034  S  SG    . CYS B 1 271 ? 1.975   -8.300  44.293   1.00 263.35 ? 271 CYS B SG    1 
ATOM   5035  N  N     . GLY B 1 272 ? 5.136   -8.128  47.653   1.00 153.08 ? 272 GLY B N     1 
ATOM   5036  C  CA    . GLY B 1 272 ? 6.443   -7.978  48.227   1.00 154.48 ? 272 GLY B CA    1 
ATOM   5037  C  C     . GLY B 1 272 ? 7.342   -7.123  47.394   1.00 148.83 ? 272 GLY B C     1 
ATOM   5038  O  O     . GLY B 1 272 ? 7.113   -6.965  46.189   1.00 159.65 ? 272 GLY B O     1 
ATOM   5039  N  N     . ILE B 1 273 ? 8.455   -6.671  47.976   1.00 139.13 ? 273 ILE B N     1 
ATOM   5040  C  CA    . ILE B 1 273 ? 9.344   -5.741  47.335   1.00 139.05 ? 273 ILE B CA    1 
ATOM   5041  C  C     . ILE B 1 273 ? 9.922   -6.241  46.018   1.00 143.08 ? 273 ILE B C     1 
ATOM   5042  O  O     . ILE B 1 273 ? 10.013  -5.488  45.034   1.00 164.81 ? 273 ILE B O     1 
ATOM   5043  C  CB    . ILE B 1 273 ? 10.454  -5.277  48.262   1.00 158.15 ? 273 ILE B CB    1 
ATOM   5044  C  CG1   . ILE B 1 273 ? 11.348  -6.455  48.693   1.00 178.07 ? 273 ILE B CG1   1 
ATOM   5045  C  CG2   . ILE B 1 273 ? 9.816   -4.525  49.427   1.00 165.71 ? 273 ILE B CG2   1 
ATOM   5046  C  CD1   . ILE B 1 273 ? 12.606  -6.023  49.432   1.00 190.68 ? 273 ILE B CD1   1 
ATOM   5047  N  N     . HIS B 1 274 ? 10.299  -7.498  45.958   1.00 139.75 ? 274 HIS B N     1 
ATOM   5048  C  CA    . HIS B 1 274 ? 10.847  -8.056  44.742   1.00 146.49 ? 274 HIS B CA    1 
ATOM   5049  C  C     . HIS B 1 274 ? 9.806   -8.036  43.628   1.00 163.80 ? 274 HIS B C     1 
ATOM   5050  O  O     . HIS B 1 274 ? 10.142  -7.648  42.482   1.00 171.60 ? 274 HIS B O     1 
ATOM   5051  C  CB    . HIS B 1 274 ? 11.438  -9.442  44.929   1.00 143.32 ? 274 HIS B CB    1 
ATOM   5052  C  CG    . HIS B 1 274 ? 10.477  -10.427 45.522   1.00 146.33 ? 274 HIS B CG    1 
ATOM   5053  N  ND1   . HIS B 1 274 ? 9.973   -10.321 46.801   1.00 154.25 ? 274 HIS B ND1   1 
ATOM   5054  C  CD2   . HIS B 1 274 ? 9.981   -11.580 45.021   1.00 154.62 ? 274 HIS B CD2   1 
ATOM   5055  C  CE1   . HIS B 1 274 ? 9.228   -11.385 47.071   1.00 158.51 ? 274 HIS B CE1   1 
ATOM   5056  N  NE2   . HIS B 1 274 ? 9.200   -12.155 46.000   1.00 158.71 ? 274 HIS B NE2   1 
ATOM   5057  N  N     . GLU B 1 275 ? 8.573   -8.387  43.966   1.00 174.86 ? 275 GLU B N     1 
ATOM   5058  C  CA    . GLU B 1 275 ? 7.501   -8.367  42.981   1.00 193.18 ? 275 GLU B CA    1 
ATOM   5059  C  C     . GLU B 1 275 ? 7.221   -6.967  42.538   1.00 198.18 ? 275 GLU B C     1 
ATOM   5060  O  O     . GLU B 1 275 ? 6.772   -6.810  41.436   1.00 202.56 ? 275 GLU B O     1 
ATOM   5061  C  CB    . GLU B 1 275 ? 6.193   -9.031  43.408   1.00 204.35 ? 275 GLU B CB    1 
ATOM   5062  C  CG    . GLU B 1 275 ? 6.291   -10.527 43.630   1.00 208.94 ? 275 GLU B CG    1 
ATOM   5063  C  CD    . GLU B 1 275 ? 6.741   -10.849 45.017   1.00 214.47 ? 275 GLU B CD    1 
ATOM   5064  O  OE1   . GLU B 1 275 ? 7.281   -9.963  45.716   1.00 211.08 ? 275 GLU B OE1   1 
ATOM   5065  O  OE2   . GLU B 1 275 ? 6.555   -12.014 45.433   1.00 221.63 ? 275 GLU B OE2   1 
ATOM   5066  N  N     . THR B 1 276 ? 7.333   -5.961  43.397   1.00 199.50 ? 276 THR B N     1 
ATOM   5067  C  CA    . THR B 1 276 ? 7.155   -4.582  43.033   1.00 198.93 ? 276 THR B CA    1 
ATOM   5068  C  C     . THR B 1 276 ? 8.237   -4.130  42.085   1.00 204.27 ? 276 THR B C     1 
ATOM   5069  O  O     . THR B 1 276 ? 8.024   -3.298  41.245   1.00 230.19 ? 276 THR B O     1 
ATOM   5070  C  CB    . THR B 1 276 ? 7.181   -3.652  44.250   1.00 198.05 ? 276 THR B CB    1 
ATOM   5071  O  OG1   . THR B 1 276 ? 8.458   -3.744  44.908   1.00 188.60 ? 276 THR B OG1   1 
ATOM   5072  C  CG2   . THR B 1 276 ? 6.069   -4.025  45.195   1.00 204.29 ? 276 THR B CG2   1 
ATOM   5073  N  N     . THR B 1 277 ? 9.450   -4.632  42.306   1.00 179.89 ? 277 THR B N     1 
ATOM   5074  C  CA    . THR B 1 277 ? 10.530  -4.342  41.381   1.00 160.58 ? 277 THR B CA    1 
ATOM   5075  C  C     . THR B 1 277 ? 10.208  -4.869  40.000   1.00 162.30 ? 277 THR B C     1 
ATOM   5076  O  O     . THR B 1 277 ? 10.336  -4.154  39.046   1.00 154.82 ? 277 THR B O     1 
ATOM   5077  C  CB    . THR B 1 277 ? 11.851  -4.914  41.819   1.00 152.84 ? 277 THR B CB    1 
ATOM   5078  O  OG1   . THR B 1 277 ? 12.182  -4.387  43.101   1.00 144.43 ? 277 THR B OG1   1 
ATOM   5079  C  CG2   . THR B 1 277 ? 12.916  -4.540  40.823   1.00 159.15 ? 277 THR B CG2   1 
ATOM   5080  N  N     . PHE B 1 278 ? 9.716   -6.081  39.941   1.00 151.37 ? 278 PHE B N     1 
ATOM   5081  C  CA    . PHE B 1 278 ? 9.171   -6.646  38.667   1.00 143.04 ? 278 PHE B CA    1 
ATOM   5082  C  C     . PHE B 1 278 ? 8.079   -5.800  38.109   1.00 136.94 ? 278 PHE B C     1 
ATOM   5083  O  O     . PHE B 1 278 ? 8.022   -5.556  36.956   1.00 140.52 ? 278 PHE B O     1 
ATOM   5084  C  CB    . PHE B 1 278 ? 8.599   -8.059  38.859   1.00 149.13 ? 278 PHE B CB    1 
ATOM   5085  C  CG    . PHE B 1 278 ? 9.369   -9.119  38.165   1.00 161.31 ? 278 PHE B CG    1 
ATOM   5086  C  CD1   . PHE B 1 278 ? 8.981   -9.598  36.923   1.00 165.44 ? 278 PHE B CD1   1 
ATOM   5087  C  CD2   . PHE B 1 278 ? 10.483  -9.646  38.757   1.00 179.49 ? 278 PHE B CD2   1 
ATOM   5088  C  CE1   . PHE B 1 278 ? 9.704   -10.589 36.299   1.00 183.32 ? 278 PHE B CE1   1 
ATOM   5089  C  CE2   . PHE B 1 278 ? 11.219  -10.632 38.135   1.00 209.91 ? 278 PHE B CE2   1 
ATOM   5090  C  CZ    . PHE B 1 278 ? 10.823  -11.101 36.907   1.00 205.35 ? 278 PHE B CZ    1 
ATOM   5091  N  N     . ASN B 1 279 ? 7.183   -5.347  38.961   1.00 131.20 ? 279 ASN B N     1 
ATOM   5092  C  CA    . ASN B 1 279 ? 6.090   -4.501  38.528   1.00 135.70 ? 279 ASN B CA    1 
ATOM   5093  C  C     . ASN B 1 279 ? 6.643   -3.246  37.859   1.00 117.95 ? 279 ASN B C     1 
ATOM   5094  O  O     . ASN B 1 279 ? 6.122   -2.782  36.848   1.00 110.38 ? 279 ASN B O     1 
ATOM   5095  C  CB    . ASN B 1 279 ? 5.128   -4.178  39.760   1.00 171.71 ? 279 ASN B CB    1 
ATOM   5096  C  CG    . ASN B 1 279 ? 3.778   -3.639  39.354   1.00 213.80 ? 279 ASN B CG    1 
ATOM   5097  O  OD1   . ASN B 1 279 ? 3.403   -3.687  38.184   1.00 240.50 ? 279 ASN B OD1   1 
ATOM   5098  N  ND2   . ASN B 1 279 ? 3.003   -3.173  40.333   1.00 223.71 ? 279 ASN B ND2   1 
ATOM   5099  N  N     . SER B 1 280 ? 7.727   -2.687  38.415   1.00 122.56 ? 280 SER B N     1 
ATOM   5100  C  CA    . SER B 1 280 ? 8.319   -1.494  37.826   1.00 132.04 ? 280 SER B CA    1 
ATOM   5101  C  C     . SER B 1 280 ? 8.968   -1.816  36.488   1.00 135.24 ? 280 SER B C     1 
ATOM   5102  O  O     . SER B 1 280 ? 8.715   -1.159  35.499   1.00 140.78 ? 280 SER B O     1 
ATOM   5103  C  CB    . SER B 1 280 ? 9.354   -0.838  38.739   1.00 128.86 ? 280 SER B CB    1 
ATOM   5104  O  OG    . SER B 1 280 ? 8.752   -0.392  39.939   1.00 131.51 ? 280 SER B OG    1 
ATOM   5105  N  N     . ILE B 1 281 ? 9.870   -2.808  36.470   1.00 134.20 ? 281 ILE B N     1 
ATOM   5106  C  CA    . ILE B 1 281 ? 10.593  -3.159  35.288   1.00 133.46 ? 281 ILE B CA    1 
ATOM   5107  C  C     . ILE B 1 281 ? 9.657   -3.548  34.175   1.00 140.17 ? 281 ILE B C     1 
ATOM   5108  O  O     . ILE B 1 281 ? 9.886   -3.186  33.016   1.00 135.50 ? 281 ILE B O     1 
ATOM   5109  C  CB    . ILE B 1 281 ? 11.615  -4.282  35.621   1.00 128.92 ? 281 ILE B CB    1 
ATOM   5110  C  CG1   . ILE B 1 281 ? 12.731  -3.624  36.423   1.00 128.03 ? 281 ILE B CG1   1 
ATOM   5111  C  CG2   . ILE B 1 281 ? 12.090  -5.018  34.368   1.00 121.83 ? 281 ILE B CG2   1 
ATOM   5112  C  CD1   . ILE B 1 281 ? 13.694  -4.575  37.097   1.00 133.47 ? 281 ILE B CD1   1 
ATOM   5113  N  N     . MET B 1 282 ? 8.574   -4.263  34.521   1.00 146.47 ? 282 MET B N     1 
ATOM   5114  C  CA    . MET B 1 282 ? 7.663   -4.763  33.501   1.00 148.51 ? 282 MET B CA    1 
ATOM   5115  C  C     . MET B 1 282 ? 6.906   -3.644  32.861   1.00 144.65 ? 282 MET B C     1 
ATOM   5116  O  O     . MET B 1 282 ? 6.523   -3.782  31.701   1.00 158.05 ? 282 MET B O     1 
ATOM   5117  C  CB    . MET B 1 282 ? 6.635   -5.747  34.036   1.00 172.04 ? 282 MET B CB    1 
ATOM   5118  C  CG    . MET B 1 282 ? 7.161   -7.168  34.191   1.00 189.81 ? 282 MET B CG    1 
ATOM   5119  S  SD    . MET B 1 282 ? 7.625   -7.955  32.643   1.00 199.15 ? 282 MET B SD    1 
ATOM   5120  C  CE    . MET B 1 282 ? 9.381   -7.754  32.788   1.00 180.47 ? 282 MET B CE    1 
ATOM   5121  N  N     . LYS B 1 283 ? 6.721   -2.538  33.583   1.00 139.74 ? 283 LYS B N     1 
ATOM   5122  C  CA    . LYS B 1 283 ? 6.068   -1.344  33.056   1.00 139.49 ? 283 LYS B CA    1 
ATOM   5123  C  C     . LYS B 1 283 ? 6.942   -0.627  32.069   1.00 139.07 ? 283 LYS B C     1 
ATOM   5124  O  O     . LYS B 1 283 ? 6.490   0.215   31.322   1.00 128.76 ? 283 LYS B O     1 
ATOM   5125  C  CB    . LYS B 1 283 ? 5.694   -0.362  34.205   1.00 139.36 ? 283 LYS B CB    1 
ATOM   5126  C  CG    . LYS B 1 283 ? 4.387   -0.781  34.887   1.00 151.88 ? 283 LYS B CG    1 
ATOM   5127  C  CD    . LYS B 1 283 ? 3.967   0.132   36.029   1.00 166.69 ? 283 LYS B CD    1 
ATOM   5128  C  CE    . LYS B 1 283 ? 2.838   -0.464  36.894   1.00 180.47 ? 283 LYS B CE    1 
ATOM   5129  N  NZ    . LYS B 1 283 ? 1.581   -0.596  36.096   1.00 187.74 ? 283 LYS B NZ    1 
ATOM   5130  N  N     . CYS B 1 284 ? 8.248   -0.891  32.080   1.00 134.20 ? 284 CYS B N     1 
ATOM   5131  C  CA    . CYS B 1 284 ? 9.212   -0.185  31.252   1.00 126.23 ? 284 CYS B CA    1 
ATOM   5132  C  C     . CYS B 1 284 ? 9.319   -0.804  29.876   1.00 127.40 ? 284 CYS B C     1 
ATOM   5133  O  O     . CYS B 1 284 ? 8.871   -1.942  29.656   1.00 118.85 ? 284 CYS B O     1 
ATOM   5134  C  CB    . CYS B 1 284 ? 10.608  -0.290  31.848   1.00 143.16 ? 284 CYS B CB    1 
ATOM   5135  S  SG    . CYS B 1 284 ? 10.839  0.104   33.633   1.00 137.48 ? 284 CYS B SG    1 
ATOM   5136  N  N     . ASP B 1 285 ? 9.948   -0.052  28.970   1.00 152.23 ? 285 ASP B N     1 
ATOM   5137  C  CA    . ASP B 1 285 ? 10.065  -0.471  27.581   1.00 175.85 ? 285 ASP B CA    1 
ATOM   5138  C  C     . ASP B 1 285 ? 10.907  -1.730  27.524   1.00 182.02 ? 285 ASP B C     1 
ATOM   5139  O  O     . ASP B 1 285 ? 11.791  -1.927  28.378   1.00 188.37 ? 285 ASP B O     1 
ATOM   5140  C  CB    . ASP B 1 285 ? 10.624  0.690   26.685   1.00 173.15 ? 285 ASP B CB    1 
ATOM   5141  C  CG    . ASP B 1 285 ? 9.572   1.746   26.379   1.00 181.40 ? 285 ASP B CG    1 
ATOM   5142  O  OD1   . ASP B 1 285 ? 8.607   1.862   27.168   1.00 199.13 ? 285 ASP B OD1   1 
ATOM   5143  O  OD2   . ASP B 1 285 ? 9.695   2.472   25.351   1.00 164.70 ? 285 ASP B OD2   1 
ATOM   5144  N  N     . VAL B 1 286 ? 10.624  -2.578  26.543   1.00 172.50 ? 286 VAL B N     1 
ATOM   5145  C  CA    . VAL B 1 286 ? 11.228  -3.875  26.462   1.00 159.53 ? 286 VAL B CA    1 
ATOM   5146  C  C     . VAL B 1 286 ? 12.718  -3.742  26.308   1.00 159.61 ? 286 VAL B C     1 
ATOM   5147  O  O     . VAL B 1 286 ? 13.460  -4.540  26.823   1.00 164.60 ? 286 VAL B O     1 
ATOM   5148  C  CB    . VAL B 1 286 ? 10.644  -4.716  25.332   1.00 158.57 ? 286 VAL B CB    1 
ATOM   5149  C  CG1   . VAL B 1 286 ? 9.125   -4.919  25.534   1.00 165.12 ? 286 VAL B CG1   1 
ATOM   5150  C  CG2   . VAL B 1 286 ? 11.012  -4.168  23.941   1.00 159.88 ? 286 VAL B CG2   1 
ATOM   5151  N  N     . ASP B 1 287 ? 13.158  -2.722  25.574   1.00 161.22 ? 287 ASP B N     1 
ATOM   5152  C  CA    . ASP B 1 287 ? 14.536  -2.552  25.223   1.00 162.16 ? 287 ASP B CA    1 
ATOM   5153  C  C     . ASP B 1 287 ? 15.493  -2.416  26.402   1.00 151.49 ? 287 ASP B C     1 
ATOM   5154  O  O     . ASP B 1 287 ? 16.527  -3.091  26.389   1.00 137.00 ? 287 ASP B O     1 
ATOM   5155  C  CB    . ASP B 1 287 ? 14.683  -1.313  24.263   1.00 162.66 ? 287 ASP B CB    1 
ATOM   5156  C  CG    . ASP B 1 287 ? 16.119  -1.074  23.803   1.00 177.81 ? 287 ASP B CG    1 
ATOM   5157  O  OD1   . ASP B 1 287 ? 16.659  -1.953  23.096   1.00 192.85 ? 287 ASP B OD1   1 
ATOM   5158  O  OD2   . ASP B 1 287 ? 16.697  0.007   24.108   1.00 186.34 ? 287 ASP B OD2   1 
ATOM   5159  N  N     . ILE B 1 288 ? 15.175  -1.514  27.344   1.00 147.94 ? 288 ILE B N     1 
ATOM   5160  C  CA    . ILE B 1 288 ? 16.061  -1.156  28.443   1.00 139.65 ? 288 ILE B CA    1 
ATOM   5161  C  C     . ILE B 1 288 ? 16.135  -2.174  29.548   1.00 137.70 ? 288 ILE B C     1 
ATOM   5162  O  O     . ILE B 1 288 ? 17.124  -2.183  30.287   1.00 160.87 ? 288 ILE B O     1 
ATOM   5163  C  CB    . ILE B 1 288 ? 15.748  0.194   29.074   1.00 113.50 ? 288 ILE B CB    1 
ATOM   5164  C  CG1   . ILE B 1 288 ? 14.374  0.215   29.744   1.00 110.27 ? 288 ILE B CG1   1 
ATOM   5165  C  CG2   . ILE B 1 288 ? 15.944  1.256   28.003   1.00 113.55 ? 288 ILE B CG2   1 
ATOM   5166  C  CD1   . ILE B 1 288 ? 14.147  1.431   30.612   1.00 112.04 ? 288 ILE B CD1   1 
ATOM   5167  N  N     . ARG B 1 289 ? 15.116  -3.035  29.693   1.00 112.14 ? 289 ARG B N     1 
ATOM   5168  C  CA    . ARG B 1 289 ? 15.055  -3.932  30.832   1.00 97.89  ? 289 ARG B CA    1 
ATOM   5169  C  C     . ARG B 1 289 ? 16.356  -4.626  31.128   1.00 97.93  ? 289 ARG B C     1 
ATOM   5170  O  O     . ARG B 1 289 ? 16.646  -4.851  32.282   1.00 101.44 ? 289 ARG B O     1 
ATOM   5171  C  CB    . ARG B 1 289 ? 13.973  -5.000  30.643   1.00 97.60  ? 289 ARG B CB    1 
ATOM   5172  C  CG    . ARG B 1 289 ? 12.546  -4.414  30.711   1.00 97.41  ? 289 ARG B CG    1 
ATOM   5173  C  CD    . ARG B 1 289 ? 11.448  -5.478  30.846   1.00 123.73 ? 289 ARG B CD    1 
ATOM   5174  N  NE    . ARG B 1 289 ? 10.130  -4.877  30.673   1.00 134.29 ? 289 ARG B NE    1 
ATOM   5175  C  CZ    . ARG B 1 289 ? 9.213   -5.244  29.772   1.00 132.53 ? 289 ARG B CZ    1 
ATOM   5176  N  NH1   . ARG B 1 289 ? 9.527   -6.186  28.910   1.00 136.35 ? 289 ARG B NH1   1 
ATOM   5177  N  NH2   . ARG B 1 289 ? 8.034   -4.625  29.630   1.00 131.54 ? 289 ARG B NH2   1 
ATOM   5178  N  N     . LYS B 1 290 ? 17.142  -4.954  30.108   1.00 101.75 ? 290 LYS B N     1 
ATOM   5179  C  CA    . LYS B 1 290 ? 18.311  -5.791  30.288   1.00 131.33 ? 290 LYS B CA    1 
ATOM   5180  C  C     . LYS B 1 290 ? 19.195  -5.184  31.341   1.00 146.76 ? 290 LYS B C     1 
ATOM   5181  O  O     . LYS B 1 290 ? 19.669  -5.897  32.231   1.00 162.74 ? 290 LYS B O     1 
ATOM   5182  C  CB    . LYS B 1 290 ? 19.113  -6.000  29.000   1.00 154.51 ? 290 LYS B CB    1 
ATOM   5183  C  CG    . LYS B 1 290 ? 19.757  -4.748  28.373   1.00 184.39 ? 290 LYS B CG    1 
ATOM   5184  C  CD    . LYS B 1 290 ? 20.387  -4.970  26.981   1.00 225.18 ? 290 LYS B CD    1 
ATOM   5185  C  CE    . LYS B 1 290 ? 21.048  -3.708  26.411   1.00 246.55 ? 290 LYS B CE    1 
ATOM   5186  N  NZ    . LYS B 1 290 ? 20.081  -2.614  26.094   1.00 248.65 ? 290 LYS B NZ    1 
ATOM   5187  N  N     . ASP B 1 291 ? 19.421  -3.891  31.266   1.00 165.15 ? 291 ASP B N     1 
ATOM   5188  C  CA    . ASP B 1 291 ? 20.330  -3.238  32.186   1.00 179.30 ? 291 ASP B CA    1 
ATOM   5189  C  C     . ASP B 1 291 ? 19.677  -2.943  33.508   1.00 172.82 ? 291 ASP B C     1 
ATOM   5190  O  O     . ASP B 1 291 ? 20.354  -2.960  34.500   1.00 163.30 ? 291 ASP B O     1 
ATOM   5191  C  CB    . ASP B 1 291 ? 21.039  -2.048  31.565   1.00 189.97 ? 291 ASP B CB    1 
ATOM   5192  C  CG    . ASP B 1 291 ? 20.147  -0.897  31.358   1.00 202.24 ? 291 ASP B CG    1 
ATOM   5193  O  OD1   . ASP B 1 291 ? 18.925  -1.058  31.556   1.00 225.76 ? 291 ASP B OD1   1 
ATOM   5194  O  OD2   . ASP B 1 291 ? 20.682  0.114   30.950   1.00 211.86 ? 291 ASP B OD2   1 
ATOM   5195  N  N     . LEU B 1 292 ? 18.352  -2.737  33.538   1.00 167.95 ? 292 LEU B N     1 
ATOM   5196  C  CA    . LEU B 1 292 ? 17.684  -2.562  34.807   1.00 151.55 ? 292 LEU B CA    1 
ATOM   5197  C  C     . LEU B 1 292 ? 17.741  -3.779  35.668   1.00 152.23 ? 292 LEU B C     1 
ATOM   5198  O  O     . LEU B 1 292 ? 18.010  -3.697  36.847   1.00 172.75 ? 292 LEU B O     1 
ATOM   5199  C  CB    . LEU B 1 292 ? 16.192  -2.185  34.612   1.00 138.69 ? 292 LEU B CB    1 
ATOM   5200  C  CG    . LEU B 1 292 ? 16.046  -0.751  34.040   1.00 143.80 ? 292 LEU B CG    1 
ATOM   5201  C  CD1   . LEU B 1 292 ? 14.575  -0.382  33.818   1.00 146.97 ? 292 LEU B CD1   1 
ATOM   5202  C  CD2   . LEU B 1 292 ? 16.774  0.265   34.950   1.00 148.75 ? 292 LEU B CD2   1 
ATOM   5203  N  N     . TYR B 1 293 ? 17.622  -4.965  35.065   1.00 141.45 ? 293 TYR B N     1 
ATOM   5204  C  CA    . TYR B 1 293 ? 17.776  -6.225  35.773   1.00 144.37 ? 293 TYR B CA    1 
ATOM   5205  C  C     . TYR B 1 293 ? 19.173  -6.272  36.371   1.00 153.30 ? 293 TYR B C     1 
ATOM   5206  O  O     . TYR B 1 293 ? 19.363  -6.768  37.481   1.00 161.74 ? 293 TYR B O     1 
ATOM   5207  C  CB    . TYR B 1 293 ? 17.605  -7.459  34.900   1.00 135.82 ? 293 TYR B CB    1 
ATOM   5208  C  CG    . TYR B 1 293 ? 16.174  -7.793  34.635   1.00 141.76 ? 293 TYR B CG    1 
ATOM   5209  C  CD1   . TYR B 1 293 ? 15.373  -8.306  35.637   1.00 139.76 ? 293 TYR B CD1   1 
ATOM   5210  C  CD2   . TYR B 1 293 ? 15.612  -7.573  33.395   1.00 158.50 ? 293 TYR B CD2   1 
ATOM   5211  C  CE1   . TYR B 1 293 ? 14.064  -8.636  35.398   1.00 127.95 ? 293 TYR B CE1   1 
ATOM   5212  C  CE2   . TYR B 1 293 ? 14.306  -7.945  33.141   1.00 154.48 ? 293 TYR B CE2   1 
ATOM   5213  C  CZ    . TYR B 1 293 ? 13.527  -8.475  34.151   1.00 133.31 ? 293 TYR B CZ    1 
ATOM   5214  O  OH    . TYR B 1 293 ? 12.176  -8.773  33.900   1.00 136.84 ? 293 TYR B OH    1 
ATOM   5215  N  N     . ALA B 1 294 ? 20.151  -5.812  35.602   1.00 153.35 ? 294 ALA B N     1 
ATOM   5216  C  CA    . ALA B 1 294 ? 21.516  -5.824  36.023   1.00 156.33 ? 294 ALA B CA    1 
ATOM   5217  C  C     . ALA B 1 294 ? 21.895  -4.658  36.867   1.00 149.57 ? 294 ALA B C     1 
ATOM   5218  O  O     . ALA B 1 294 ? 22.964  -4.730  37.443   1.00 146.83 ? 294 ALA B O     1 
ATOM   5219  C  CB    . ALA B 1 294 ? 22.456  -5.958  34.833   1.00 160.11 ? 294 ALA B CB    1 
ATOM   5220  N  N     . ASN B 1 295 ? 21.114  -3.584  36.921   1.00 145.33 ? 295 ASN B N     1 
ATOM   5221  C  CA    . ASN B 1 295 ? 21.615  -2.442  37.690   1.00 148.44 ? 295 ASN B CA    1 
ATOM   5222  C  C     . ASN B 1 295 ? 20.792  -2.002  38.866   1.00 146.81 ? 295 ASN B C     1 
ATOM   5223  O  O     . ASN B 1 295 ? 20.755  -0.819  39.160   1.00 152.35 ? 295 ASN B O     1 
ATOM   5224  C  CB    . ASN B 1 295 ? 21.881  -1.209  36.807   1.00 153.10 ? 295 ASN B CB    1 
ATOM   5225  C  CG    . ASN B 1 295 ? 22.693  -1.516  35.559   1.00 165.62 ? 295 ASN B CG    1 
ATOM   5226  O  OD1   . ASN B 1 295 ? 22.388  -0.980  34.509   1.00 174.92 ? 295 ASN B OD1   1 
ATOM   5227  N  ND2   . ASN B 1 295 ? 23.723  -2.372  35.651   1.00 168.37 ? 295 ASN B ND2   1 
ATOM   5228  N  N     . THR B 1 296 ? 20.247  -2.909  39.639   1.00 148.18 ? 296 THR B N     1 
ATOM   5229  C  CA    . THR B 1 296 ? 19.310  -2.533  40.683   1.00 157.80 ? 296 THR B CA    1 
ATOM   5230  C  C     . THR B 1 296 ? 20.095  -1.949  41.830   1.00 152.60 ? 296 THR B C     1 
ATOM   5231  O  O     . THR B 1 296 ? 20.992  -2.590  42.367   1.00 156.86 ? 296 THR B O     1 
ATOM   5232  C  CB    . THR B 1 296 ? 18.587  -3.801  41.150   1.00 168.92 ? 296 THR B CB    1 
ATOM   5233  O  OG1   . THR B 1 296 ? 17.764  -4.324  40.097   1.00 166.01 ? 296 THR B OG1   1 
ATOM   5234  C  CG2   . THR B 1 296 ? 17.716  -3.578  42.394   1.00 170.26 ? 296 THR B CG2   1 
ATOM   5235  N  N     . VAL B 1 297 ? 19.763  -0.732  42.246   1.00 150.79 ? 297 VAL B N     1 
ATOM   5236  C  CA    . VAL B 1 297 ? 20.448  -0.107  43.343   1.00 162.19 ? 297 VAL B CA    1 
ATOM   5237  C  C     . VAL B 1 297 ? 19.594  -0.032  44.537   1.00 146.98 ? 297 VAL B C     1 
ATOM   5238  O  O     . VAL B 1 297 ? 18.490  0.470   44.440   1.00 159.21 ? 297 VAL B O     1 
ATOM   5239  C  CB    . VAL B 1 297 ? 20.839  1.313   42.991   1.00 191.51 ? 297 VAL B CB    1 
ATOM   5240  C  CG1   . VAL B 1 297 ? 21.327  2.074   44.226   1.00 206.67 ? 297 VAL B CG1   1 
ATOM   5241  C  CG2   . VAL B 1 297 ? 21.833  1.230   41.849   1.00 210.31 ? 297 VAL B CG2   1 
ATOM   5242  N  N     . LEU B 1 298 ? 20.102  -0.444  45.694   1.00 134.08 ? 298 LEU B N     1 
ATOM   5243  C  CA    . LEU B 1 298 ? 19.302  -0.383  46.933   1.00 132.19 ? 298 LEU B CA    1 
ATOM   5244  C  C     . LEU B 1 298 ? 19.760  0.848   47.679   1.00 127.13 ? 298 LEU B C     1 
ATOM   5245  O  O     . LEU B 1 298 ? 20.955  1.137   47.764   1.00 135.98 ? 298 LEU B O     1 
ATOM   5246  C  CB    . LEU B 1 298 ? 19.554  -1.558  47.873   1.00 145.68 ? 298 LEU B CB    1 
ATOM   5247  C  CG    . LEU B 1 298 ? 19.124  -2.937  47.385   1.00 163.75 ? 298 LEU B CG    1 
ATOM   5248  C  CD1   . LEU B 1 298 ? 19.415  -4.035  48.435   1.00 178.02 ? 298 LEU B CD1   1 
ATOM   5249  C  CD2   . LEU B 1 298 ? 17.669  -2.957  46.927   1.00 158.39 ? 298 LEU B CD2   1 
ATOM   5250  N  N     . SER B 1 299 ? 18.798  1.561   48.262   1.00 133.91 ? 299 SER B N     1 
ATOM   5251  C  CA    . SER B 1 299 ? 19.108  2.679   49.105   1.00 148.42 ? 299 SER B CA    1 
ATOM   5252  C  C     . SER B 1 299 ? 18.202  2.720   50.321   1.00 164.31 ? 299 SER B C     1 
ATOM   5253  O  O     . SER B 1 299 ? 17.258  1.975   50.417   1.00 164.26 ? 299 SER B O     1 
ATOM   5254  C  CB    . SER B 1 299 ? 18.949  3.983   48.355   1.00 146.13 ? 299 SER B CB    1 
ATOM   5255  O  OG    . SER B 1 299 ? 17.600  4.433   48.357   1.00 149.11 ? 299 SER B OG    1 
ATOM   5256  N  N     . GLY B 1 300 ? 18.534  3.590   51.257   1.00 193.79 ? 300 GLY B N     1 
ATOM   5257  C  CA    . GLY B 1 300 ? 17.676  3.868   52.390   1.00 210.53 ? 300 GLY B CA    1 
ATOM   5258  C  C     . GLY B 1 300 ? 17.995  2.963   53.564   1.00 214.77 ? 300 GLY B C     1 
ATOM   5259  O  O     . GLY B 1 300 ? 18.685  1.958   53.429   1.00 194.88 ? 300 GLY B O     1 
ATOM   5260  N  N     . GLY B 1 301 ? 17.529  3.358   54.734   1.00 222.06 ? 301 GLY B N     1 
ATOM   5261  C  CA    . GLY B 1 301 ? 17.969  2.746   55.982   1.00 227.84 ? 301 GLY B CA    1 
ATOM   5262  C  C     . GLY B 1 301 ? 17.523  1.293   56.053   1.00 223.37 ? 301 GLY B C     1 
ATOM   5263  O  O     . GLY B 1 301 ? 18.233  0.466   56.596   1.00 228.97 ? 301 GLY B O     1 
ATOM   5264  N  N     . THR B 1 302 ? 16.306  1.030   55.555   1.00 210.82 ? 302 THR B N     1 
ATOM   5265  C  CA    . THR B 1 302 ? 15.673  -0.256  55.771   1.00 196.87 ? 302 THR B CA    1 
ATOM   5266  C  C     . THR B 1 302 ? 16.096  -1.251  54.701   1.00 185.48 ? 302 THR B C     1 
ATOM   5267  O  O     . THR B 1 302 ? 15.480  -2.285  54.588   1.00 166.30 ? 302 THR B O     1 
ATOM   5268  C  CB    . THR B 1 302 ? 14.134  -0.235  55.957   1.00 198.06 ? 302 THR B CB    1 
ATOM   5269  O  OG1   . THR B 1 302 ? 13.730  -1.507  56.488   1.00 176.16 ? 302 THR B OG1   1 
ATOM   5270  C  CG2   . THR B 1 302 ? 13.379  0.012   54.664   1.00 202.50 ? 302 THR B CG2   1 
ATOM   5271  N  N     . THR B 1 303 ? 17.124  -0.939  53.905   1.00 188.14 ? 303 THR B N     1 
ATOM   5272  C  CA    . THR B 1 303 ? 17.823  -1.957  53.155   1.00 201.32 ? 303 THR B CA    1 
ATOM   5273  C  C     . THR B 1 303 ? 19.077  -2.454  53.841   1.00 207.60 ? 303 THR B C     1 
ATOM   5274  O  O     . THR B 1 303 ? 19.739  -3.332  53.306   1.00 205.20 ? 303 THR B O     1 
ATOM   5275  C  CB    . THR B 1 303 ? 18.185  -1.462  51.764   1.00 204.42 ? 303 THR B CB    1 
ATOM   5276  O  OG1   . THR B 1 303 ? 18.639  -0.104  51.838   1.00 202.54 ? 303 THR B OG1   1 
ATOM   5277  C  CG2   . THR B 1 303 ? 16.951  -1.534  50.876   1.00 196.95 ? 303 THR B CG2   1 
ATOM   5278  N  N     . MET B 1 304 ? 19.409  -1.908  55.021   1.00 216.19 ? 304 MET B N     1 
ATOM   5279  C  CA    . MET B 1 304 ? 20.641  -2.235  55.722   1.00 226.72 ? 304 MET B CA    1 
ATOM   5280  C  C     . MET B 1 304 ? 20.733  -3.686  56.185   1.00 215.24 ? 304 MET B C     1 
ATOM   5281  O  O     . MET B 1 304 ? 21.839  -4.189  56.363   1.00 209.42 ? 304 MET B O     1 
ATOM   5282  C  CB    . MET B 1 304 ? 20.924  -1.276  56.900   1.00 252.79 ? 304 MET B CB    1 
ATOM   5283  C  CG    . MET B 1 304 ? 21.347  0.114   56.428   1.00 262.72 ? 304 MET B CG    1 
ATOM   5284  S  SD    . MET B 1 304 ? 22.898  0.124   55.493   1.00 269.07 ? 304 MET B SD    1 
ATOM   5285  C  CE    . MET B 1 304 ? 24.102  -0.213  56.778   1.00 265.99 ? 304 MET B CE    1 
ATOM   5286  N  N     . TYR B 1 305 ? 19.617  -4.364  56.423   1.00 205.45 ? 305 TYR B N     1 
ATOM   5287  C  CA    . TYR B 1 305 ? 19.646  -5.698  57.004   1.00 201.04 ? 305 TYR B CA    1 
ATOM   5288  C  C     . TYR B 1 305 ? 20.568  -6.629  56.274   1.00 208.53 ? 305 TYR B C     1 
ATOM   5289  O  O     . TYR B 1 305 ? 20.547  -6.717  55.041   1.00 219.33 ? 305 TYR B O     1 
ATOM   5290  C  CB    . TYR B 1 305 ? 18.273  -6.405  57.020   1.00 191.94 ? 305 TYR B CB    1 
ATOM   5291  C  CG    . TYR B 1 305 ? 17.162  -5.679  57.693   1.00 203.86 ? 305 TYR B CG    1 
ATOM   5292  C  CD1   . TYR B 1 305 ? 17.354  -5.105  58.919   1.00 207.31 ? 305 TYR B CD1   1 
ATOM   5293  C  CD2   . TYR B 1 305 ? 15.902  -5.606  57.116   1.00 224.71 ? 305 TYR B CD2   1 
ATOM   5294  C  CE1   . TYR B 1 305 ? 16.335  -4.421  59.553   1.00 218.31 ? 305 TYR B CE1   1 
ATOM   5295  C  CE2   . TYR B 1 305 ? 14.884  -4.932  57.741   1.00 230.28 ? 305 TYR B CE2   1 
ATOM   5296  C  CZ    . TYR B 1 305 ? 15.107  -4.331  58.968   1.00 225.78 ? 305 TYR B CZ    1 
ATOM   5297  O  OH    . TYR B 1 305 ? 14.062  -3.643  59.603   1.00 223.21 ? 305 TYR B OH    1 
ATOM   5298  N  N     . PRO B 1 306 ? 21.380  -7.343  57.044   1.00 213.62 ? 306 PRO B N     1 
ATOM   5299  C  CA    . PRO B 1 306 ? 22.233  -8.326  56.382   1.00 211.05 ? 306 PRO B CA    1 
ATOM   5300  C  C     . PRO B 1 306 ? 21.440  -9.359  55.601   1.00 220.63 ? 306 PRO B C     1 
ATOM   5301  O  O     . PRO B 1 306 ? 20.432  -9.904  56.073   1.00 221.87 ? 306 PRO B O     1 
ATOM   5302  C  CB    . PRO B 1 306 ? 23.001  -8.978  57.526   1.00 199.65 ? 306 PRO B CB    1 
ATOM   5303  C  CG    . PRO B 1 306 ? 23.058  -7.898  58.532   1.00 206.98 ? 306 PRO B CG    1 
ATOM   5304  C  CD    . PRO B 1 306 ? 21.764  -7.182  58.461   1.00 213.76 ? 306 PRO B CD    1 
ATOM   5305  N  N     . GLY B 1 307 ? 21.900  -9.608  54.385   1.00 228.58 ? 307 GLY B N     1 
ATOM   5306  C  CA    . GLY B 1 307 ? 21.319  -10.641 53.541   1.00 233.24 ? 307 GLY B CA    1 
ATOM   5307  C  C     . GLY B 1 307 ? 20.158  -10.267 52.636   1.00 230.88 ? 307 GLY B C     1 
ATOM   5308  O  O     . GLY B 1 307 ? 19.671  -11.091 51.863   1.00 229.50 ? 307 GLY B O     1 
ATOM   5309  N  N     . ILE B 1 308 ? 19.727  -9.006  52.671   1.00 222.40 ? 308 ILE B N     1 
ATOM   5310  C  CA    . ILE B 1 308 ? 18.654  -8.561  51.826   1.00 203.52 ? 308 ILE B CA    1 
ATOM   5311  C  C     . ILE B 1 308 ? 18.991  -8.669  50.369   1.00 191.13 ? 308 ILE B C     1 
ATOM   5312  O  O     . ILE B 1 308 ? 18.172  -9.116  49.568   1.00 196.59 ? 308 ILE B O     1 
ATOM   5313  C  CB    . ILE B 1 308 ? 18.348  -7.064  52.029   1.00 206.25 ? 308 ILE B CB    1 
ATOM   5314  C  CG1   . ILE B 1 308 ? 17.613  -6.843  53.342   1.00 225.42 ? 308 ILE B CG1   1 
ATOM   5315  C  CG2   . ILE B 1 308 ? 17.434  -6.568  50.941   1.00 196.75 ? 308 ILE B CG2   1 
ATOM   5316  C  CD1   . ILE B 1 308 ? 17.565  -5.431  53.823   1.00 238.31 ? 308 ILE B CD1   1 
ATOM   5317  N  N     . ALA B 1 309 ? 20.203  -8.210  50.002   1.00 183.62 ? 309 ALA B N     1 
ATOM   5318  C  CA    . ALA B 1 309 ? 20.682  -8.201  48.632   1.00 188.03 ? 309 ALA B CA    1 
ATOM   5319  C  C     . ALA B 1 309 ? 20.577  -9.605  48.068   1.00 188.56 ? 309 ALA B C     1 
ATOM   5320  O  O     . ALA B 1 309 ? 20.094  -9.808  46.964   1.00 190.01 ? 309 ALA B O     1 
ATOM   5321  C  CB    . ALA B 1 309 ? 22.106  -7.671  48.550   1.00 189.01 ? 309 ALA B CB    1 
ATOM   5322  N  N     . ASP B 1 310 ? 21.086  -10.576 48.821   1.00 198.39 ? 310 ASP B N     1 
ATOM   5323  C  CA    . ASP B 1 310 ? 21.149  -11.939 48.363   1.00 208.24 ? 310 ASP B CA    1 
ATOM   5324  C  C     . ASP B 1 310 ? 19.740  -12.448 48.117   1.00 189.00 ? 310 ASP B C     1 
ATOM   5325  O  O     . ASP B 1 310 ? 19.477  -13.103 47.102   1.00 182.79 ? 310 ASP B O     1 
ATOM   5326  C  CB    . ASP B 1 310 ? 21.800  -12.859 49.392   1.00 232.40 ? 310 ASP B CB    1 
ATOM   5327  C  CG    . ASP B 1 310 ? 23.246  -12.508 49.606   1.00 250.33 ? 310 ASP B CG    1 
ATOM   5328  O  OD1   . ASP B 1 310 ? 23.884  -12.082 48.620   1.00 257.32 ? 310 ASP B OD1   1 
ATOM   5329  O  OD2   . ASP B 1 310 ? 23.745  -12.640 50.742   1.00 261.43 ? 310 ASP B OD2   1 
ATOM   5330  N  N     . ARG B 1 311 ? 18.830  -12.160 49.041   1.00 173.88 ? 311 ARG B N     1 
ATOM   5331  C  CA    . ARG B 1 311 ? 17.463  -12.671 48.880   1.00 169.45 ? 311 ARG B CA    1 
ATOM   5332  C  C     . ARG B 1 311 ? 16.815  -12.056 47.665   1.00 155.05 ? 311 ARG B C     1 
ATOM   5333  O  O     . ARG B 1 311 ? 16.145  -12.759 46.896   1.00 169.03 ? 311 ARG B O     1 
ATOM   5334  C  CB    . ARG B 1 311 ? 16.601  -12.471 50.125   1.00 180.34 ? 311 ARG B CB    1 
ATOM   5335  C  CG    . ARG B 1 311 ? 15.245  -13.161 50.031   1.00 175.58 ? 311 ARG B CG    1 
ATOM   5336  C  CD    . ARG B 1 311 ? 14.400  -13.088 51.297   1.00 170.84 ? 311 ARG B CD    1 
ATOM   5337  N  NE    . ARG B 1 311 ? 13.021  -13.503 51.033   1.00 167.86 ? 311 ARG B NE    1 
ATOM   5338  C  CZ    . ARG B 1 311 ? 12.629  -14.771 50.896   1.00 181.22 ? 311 ARG B CZ    1 
ATOM   5339  N  NH1   . ARG B 1 311 ? 13.513  -15.745 51.047   1.00 189.98 ? 311 ARG B NH1   1 
ATOM   5340  N  NH2   . ARG B 1 311 ? 11.327  -15.072 50.655   1.00 184.56 ? 311 ARG B NH2   1 
ATOM   5341  N  N     . MET B 1 312 ? 17.017  -10.752 47.493   1.00 151.66 ? 312 MET B N     1 
ATOM   5342  C  CA    . MET B 1 312 ? 16.453  -10.079 46.309   1.00 161.81 ? 312 MET B CA    1 
ATOM   5343  C  C     . MET B 1 312 ? 17.010  -10.686 45.051   1.00 159.61 ? 312 MET B C     1 
ATOM   5344  O  O     . MET B 1 312 ? 16.252  -10.871 44.086   1.00 157.75 ? 312 MET B O     1 
ATOM   5345  C  CB    . MET B 1 312 ? 16.749  -8.566  46.298   1.00 184.11 ? 312 MET B CB    1 
ATOM   5346  C  CG    . MET B 1 312 ? 15.990  -7.771  47.340   1.00 200.97 ? 312 MET B CG    1 
ATOM   5347  S  SD    . MET B 1 312 ? 14.278  -7.596  46.858   1.00 205.52 ? 312 MET B SD    1 
ATOM   5348  C  CE    . MET B 1 312 ? 14.456  -6.464  45.481   1.00 205.80 ? 312 MET B CE    1 
ATOM   5349  N  N     . GLN B 1 313 ? 18.296  -11.022 45.055   1.00 167.54 ? 313 GLN B N     1 
ATOM   5350  C  CA    . GLN B 1 313 ? 18.920  -11.618 43.895   1.00 172.64 ? 313 GLN B CA    1 
ATOM   5351  C  C     . GLN B 1 313 ? 18.290  -12.953 43.579   1.00 162.31 ? 313 GLN B C     1 
ATOM   5352  O  O     . GLN B 1 313 ? 18.001  -13.241 42.409   1.00 168.48 ? 313 GLN B O     1 
ATOM   5353  C  CB    . GLN B 1 313 ? 20.430  -11.835 44.084   1.00 187.61 ? 313 GLN B CB    1 
ATOM   5354  C  CG    . GLN B 1 313 ? 21.175  -12.225 42.818   1.00 193.50 ? 313 GLN B CG    1 
ATOM   5355  C  CD    . GLN B 1 313 ? 22.620  -11.793 42.880   1.00 208.02 ? 313 GLN B CD    1 
ATOM   5356  O  OE1   . GLN B 1 313 ? 22.995  -11.070 43.795   1.00 214.04 ? 313 GLN B OE1   1 
ATOM   5357  N  NE2   . GLN B 1 313 ? 23.434  -12.217 41.906   1.00 212.36 ? 313 GLN B NE2   1 
ATOM   5358  N  N     . LYS B 1 314 ? 18.104  -13.762 44.620   1.00 152.75 ? 314 LYS B N     1 
ATOM   5359  C  CA    . LYS B 1 314 ? 17.581  -15.109 44.403   1.00 152.42 ? 314 LYS B CA    1 
ATOM   5360  C  C     . LYS B 1 314 ? 16.146  -15.012 43.889   1.00 140.51 ? 314 LYS B C     1 
ATOM   5361  O  O     . LYS B 1 314 ? 15.792  -15.755 42.919   1.00 133.24 ? 314 LYS B O     1 
ATOM   5362  C  CB    . LYS B 1 314 ? 17.711  -16.059 45.596   1.00 179.26 ? 314 LYS B CB    1 
ATOM   5363  C  CG    . LYS B 1 314 ? 16.652  -15.908 46.663   1.00 201.15 ? 314 LYS B CG    1 
ATOM   5364  C  CD    . LYS B 1 314 ? 16.629  -17.045 47.699   1.00 222.09 ? 314 LYS B CD    1 
ATOM   5365  C  CE    . LYS B 1 314 ? 15.441  -16.903 48.667   1.00 237.11 ? 314 LYS B CE    1 
ATOM   5366  N  NZ    . LYS B 1 314 ? 14.108  -17.080 48.022   1.00 242.93 ? 314 LYS B NZ    1 
ATOM   5367  N  N     . GLU B 1 315 ? 15.360  -14.055 44.406   1.00 156.59 ? 315 GLU B N     1 
ATOM   5368  C  CA    . GLU B 1 315 ? 13.967  -14.002 44.031   1.00 162.28 ? 315 GLU B CA    1 
ATOM   5369  C  C     . GLU B 1 315 ? 13.791  -13.442 42.637   1.00 156.07 ? 315 GLU B C     1 
ATOM   5370  O  O     . GLU B 1 315 ? 13.049  -14.020 41.837   1.00 159.54 ? 315 GLU B O     1 
ATOM   5371  C  CB    . GLU B 1 315 ? 13.187  -13.169 45.012   1.00 176.37 ? 315 GLU B CB    1 
ATOM   5372  C  CG    . GLU B 1 315 ? 13.072  -13.788 46.407   1.00 213.03 ? 315 GLU B CG    1 
ATOM   5373  C  CD    . GLU B 1 315 ? 12.550  -12.788 47.397   1.00 247.32 ? 315 GLU B CD    1 
ATOM   5374  O  OE1   . GLU B 1 315 ? 12.682  -11.596 47.073   1.00 268.75 ? 315 GLU B OE1   1 
ATOM   5375  O  OE2   . GLU B 1 315 ? 12.027  -13.177 48.467   1.00 253.69 ? 315 GLU B OE2   1 
ATOM   5376  N  N     . ILE B 1 316 ? 14.516  -12.375 42.328   1.00 146.56 ? 316 ILE B N     1 
ATOM   5377  C  CA    . ILE B 1 316 ? 14.402  -11.756 41.038   1.00 140.71 ? 316 ILE B CA    1 
ATOM   5378  C  C     . ILE B 1 316 ? 14.889  -12.759 39.964   1.00 150.83 ? 316 ILE B C     1 
ATOM   5379  O  O     . ILE B 1 316 ? 14.199  -12.982 38.964   1.00 157.26 ? 316 ILE B O     1 
ATOM   5380  C  CB    . ILE B 1 316 ? 15.019  -10.331 41.011   1.00 136.05 ? 316 ILE B CB    1 
ATOM   5381  C  CG1   . ILE B 1 316 ? 14.076  -9.369  41.771   1.00 141.69 ? 316 ILE B CG1   1 
ATOM   5382  C  CG2   . ILE B 1 316 ? 15.273  -9.914  39.569   1.00 133.03 ? 316 ILE B CG2   1 
ATOM   5383  C  CD1   . ILE B 1 316 ? 14.566  -7.948  41.856   1.00 149.80 ? 316 ILE B CD1   1 
ATOM   5384  N  N     . THR B 1 317 ? 16.042  -13.348 40.168   1.00 166.25 ? 317 THR B N     1 
ATOM   5385  C  CA    . THR B 1 317 ? 16.569  -14.323 39.255   1.00 179.40 ? 317 THR B CA    1 
ATOM   5386  C  C     . THR B 1 317 ? 15.555  -15.439 39.051   1.00 182.36 ? 317 THR B C     1 
ATOM   5387  O  O     . THR B 1 317 ? 15.382  -15.949 37.940   1.00 187.81 ? 317 THR B O     1 
ATOM   5388  C  CB    . THR B 1 317 ? 17.864  -14.954 39.799   1.00 186.97 ? 317 THR B CB    1 
ATOM   5389  O  OG1   . THR B 1 317 ? 18.831  -13.927 40.071   1.00 192.90 ? 317 THR B OG1   1 
ATOM   5390  C  CG2   . THR B 1 317 ? 18.434  -15.924 38.801   1.00 186.66 ? 317 THR B CG2   1 
ATOM   5391  N  N     . ALA B 1 318 ? 14.918  -15.885 40.127   1.00 185.81 ? 318 ALA B N     1 
ATOM   5392  C  CA    . ALA B 1 318 ? 13.954  -16.964 40.046   1.00 186.22 ? 318 ALA B CA    1 
ATOM   5393  C  C     . ALA B 1 318 ? 12.789  -16.583 39.160   1.00 174.07 ? 318 ALA B C     1 
ATOM   5394  O  O     . ALA B 1 318 ? 12.370  -17.365 38.302   1.00 173.27 ? 318 ALA B O     1 
ATOM   5395  C  CB    . ALA B 1 318 ? 13.424  -17.370 41.428   1.00 197.78 ? 318 ALA B CB    1 
ATOM   5396  N  N     . LEU B 1 319 ? 12.295  -15.349 39.356   1.00 174.28 ? 319 LEU B N     1 
ATOM   5397  C  CA    . LEU B 1 319 ? 11.144  -14.866 38.598   1.00 185.19 ? 319 LEU B CA    1 
ATOM   5398  C  C     . LEU B 1 319 ? 11.439  -14.543 37.150   1.00 183.30 ? 319 LEU B C     1 
ATOM   5399  O  O     . LEU B 1 319 ? 10.667  -14.834 36.270   1.00 182.70 ? 319 LEU B O     1 
ATOM   5400  C  CB    . LEU B 1 319 ? 10.509  -13.625 39.252   1.00 185.58 ? 319 LEU B CB    1 
ATOM   5401  C  CG    . LEU B 1 319 ? 9.891   -13.893 40.631   1.00 194.68 ? 319 LEU B CG    1 
ATOM   5402  C  CD1   . LEU B 1 319 ? 9.243   -12.611 41.204   1.00 196.70 ? 319 LEU B CD1   1 
ATOM   5403  C  CD2   . LEU B 1 319 ? 8.886   -15.058 40.587   1.00 209.27 ? 319 LEU B CD2   1 
ATOM   5404  N  N     . ALA B 1 320 ? 12.579  -13.895 36.893   1.00 174.88 ? 320 ALA B N     1 
ATOM   5405  C  CA    . ALA B 1 320 ? 12.952  -13.364 35.592   1.00 163.67 ? 320 ALA B CA    1 
ATOM   5406  C  C     . ALA B 1 320 ? 13.448  -14.404 34.645   1.00 176.33 ? 320 ALA B C     1 
ATOM   5407  O  O     . ALA B 1 320 ? 13.707  -15.557 35.011   1.00 190.66 ? 320 ALA B O     1 
ATOM   5408  C  CB    . ALA B 1 320 ? 14.038  -12.275 35.747   1.00 148.56 ? 320 ALA B CB    1 
ATOM   5409  N  N     . PRO B 1 321 ? 13.602  -13.994 33.398   1.00 175.55 ? 321 PRO B N     1 
ATOM   5410  C  CA    . PRO B 1 321 ? 14.404  -14.809 32.460   1.00 164.02 ? 321 PRO B CA    1 
ATOM   5411  C  C     . PRO B 1 321 ? 15.813  -15.012 32.959   1.00 167.40 ? 321 PRO B C     1 
ATOM   5412  O  O     . PRO B 1 321 ? 16.509  -14.037 33.254   1.00 181.27 ? 321 PRO B O     1 
ATOM   5413  C  CB    . PRO B 1 321 ? 14.399  -13.980 31.171   1.00 159.75 ? 321 PRO B CB    1 
ATOM   5414  C  CG    . PRO B 1 321 ? 13.186  -13.127 31.290   1.00 171.15 ? 321 PRO B CG    1 
ATOM   5415  C  CD    . PRO B 1 321 ? 13.066  -12.791 32.735   1.00 175.50 ? 321 PRO B CD    1 
ATOM   5416  N  N     . SER B 1 322 ? 16.201  -16.278 33.134   1.00 166.61 ? 322 SER B N     1 
ATOM   5417  C  CA    . SER B 1 322 ? 17.613  -16.624 33.359   1.00 176.21 ? 322 SER B CA    1 
ATOM   5418  C  C     . SER B 1 322 ? 18.526  -16.475 32.149   1.00 186.08 ? 322 SER B C     1 
ATOM   5419  O  O     . SER B 1 322 ? 19.729  -16.738 32.218   1.00 187.41 ? 322 SER B O     1 
ATOM   5420  C  CB    . SER B 1 322 ? 17.769  -18.058 33.925   1.00 182.55 ? 322 SER B CB    1 
ATOM   5421  O  OG    . SER B 1 322 ? 17.342  -19.003 32.965   1.00 194.82 ? 322 SER B OG    1 
ATOM   5422  N  N     . THR B 1 323 ? 17.990  -15.956 31.053   1.00 206.51 ? 323 THR B N     1 
ATOM   5423  C  CA    . THR B 1 323 ? 18.729  -15.564 29.891   1.00 234.47 ? 323 THR B CA    1 
ATOM   5424  C  C     . THR B 1 323 ? 19.706  -14.430 30.150   1.00 222.32 ? 323 THR B C     1 
ATOM   5425  O  O     . THR B 1 323 ? 20.736  -14.355 29.507   1.00 208.84 ? 323 THR B O     1 
ATOM   5426  C  CB    . THR B 1 323 ? 17.749  -15.130 28.780   1.00 262.19 ? 323 THR B CB    1 
ATOM   5427  O  OG1   . THR B 1 323 ? 17.028  -13.952 29.173   1.00 270.90 ? 323 THR B OG1   1 
ATOM   5428  C  CG2   . THR B 1 323 ? 16.740  -16.246 28.509   1.00 272.59 ? 323 THR B CG2   1 
ATOM   5429  N  N     . MET B 1 324 ? 19.372  -13.570 31.105   1.00 208.56 ? 324 MET B N     1 
ATOM   5430  C  CA    . MET B 1 324 ? 20.196  -12.414 31.421   1.00 193.62 ? 324 MET B CA    1 
ATOM   5431  C  C     . MET B 1 324 ? 20.489  -12.433 32.907   1.00 186.43 ? 324 MET B C     1 
ATOM   5432  O  O     . MET B 1 324 ? 19.706  -12.945 33.700   1.00 173.05 ? 324 MET B O     1 
ATOM   5433  C  CB    . MET B 1 324 ? 19.536  -11.083 31.014   1.00 186.67 ? 324 MET B CB    1 
ATOM   5434  C  CG    . MET B 1 324 ? 18.199  -10.826 31.667   1.00 179.43 ? 324 MET B CG    1 
ATOM   5435  S  SD    . MET B 1 324 ? 17.583  -9.268  31.081   1.00 217.71 ? 324 MET B SD    1 
ATOM   5436  C  CE    . MET B 1 324 ? 17.567  -9.479  29.308   1.00 222.85 ? 324 MET B CE    1 
ATOM   5437  N  N     . LYS B 1 325 ? 21.695  -11.975 33.232   1.00 200.85 ? 325 LYS B N     1 
ATOM   5438  C  CA    . LYS B 1 325 ? 22.217  -12.033 34.568   1.00 208.90 ? 325 LYS B CA    1 
ATOM   5439  C  C     . LYS B 1 325 ? 21.706  -10.798 35.256   1.00 191.30 ? 325 LYS B C     1 
ATOM   5440  O  O     . LYS B 1 325 ? 21.824  -9.672  34.703   1.00 179.19 ? 325 LYS B O     1 
ATOM   5441  C  CB    . LYS B 1 325 ? 23.786  -12.162 34.597   1.00 231.75 ? 325 LYS B CB    1 
ATOM   5442  C  CG    . LYS B 1 325 ? 24.256  -13.519 34.066   1.00 254.10 ? 325 LYS B CG    1 
ATOM   5443  C  CD    . LYS B 1 325 ? 25.763  -13.714 34.171   1.00 266.44 ? 325 LYS B CD    1 
ATOM   5444  C  CE    . LYS B 1 325 ? 26.228  -15.089 33.680   1.00 271.08 ? 325 LYS B CE    1 
ATOM   5445  N  NZ    . LYS B 1 325 ? 27.709  -15.241 33.671   1.00 274.34 ? 325 LYS B NZ    1 
ATOM   5446  N  N     . ILE B 1 326 ? 21.281  -11.029 36.500   1.00 187.29 ? 326 ILE B N     1 
ATOM   5447  C  CA    . ILE B 1 326 ? 20.714  -10.051 37.415   1.00 192.97 ? 326 ILE B CA    1 
ATOM   5448  C  C     . ILE B 1 326 ? 21.664  -9.662  38.527   1.00 196.80 ? 326 ILE B C     1 
ATOM   5449  O  O     . ILE B 1 326 ? 21.684  -10.255 39.599   1.00 194.06 ? 326 ILE B O     1 
ATOM   5450  C  CB    . ILE B 1 326 ? 19.471  -10.625 38.097   1.00 202.36 ? 326 ILE B CB    1 
ATOM   5451  C  CG1   . ILE B 1 326 ? 18.590  -11.344 37.060   1.00 226.02 ? 326 ILE B CG1   1 
ATOM   5452  C  CG2   . ILE B 1 326 ? 18.742  -9.506  38.841   1.00 203.65 ? 326 ILE B CG2   1 
ATOM   5453  C  CD1   . ILE B 1 326 ? 18.125  -10.459 35.914   1.00 249.24 ? 326 ILE B CD1   1 
ATOM   5454  N  N     . LYS B 1 327 ? 22.458  -8.648  38.267   1.00 213.55 ? 327 LYS B N     1 
ATOM   5455  C  CA    . LYS B 1 327 ? 23.351  -8.128  39.298   1.00 225.13 ? 327 LYS B CA    1 
ATOM   5456  C  C     . LYS B 1 327 ? 22.546  -7.158  40.123   1.00 215.72 ? 327 LYS B C     1 
ATOM   5457  O  O     . LYS B 1 327 ? 21.846  -6.313  39.599   1.00 217.92 ? 327 LYS B O     1 
ATOM   5458  C  CB    . LYS B 1 327 ? 24.534  -7.439  38.666   1.00 239.75 ? 327 LYS B CB    1 
ATOM   5459  C  CG    . LYS B 1 327 ? 25.527  -6.783  39.620   1.00 251.22 ? 327 LYS B CG    1 
ATOM   5460  C  CD    . LYS B 1 327 ? 26.820  -6.325  38.928   1.00 257.57 ? 327 LYS B CD    1 
ATOM   5461  C  CE    . LYS B 1 327 ? 26.626  -5.094  38.030   1.00 274.00 ? 327 LYS B CE    1 
ATOM   5462  N  NZ    . LYS B 1 327 ? 27.876  -4.683  37.336   1.00 282.14 ? 327 LYS B NZ    1 
ATOM   5463  N  N     . ILE B 1 328 ? 22.744  -7.199  41.426   1.00 197.12 ? 328 ILE B N     1 
ATOM   5464  C  CA    . ILE B 1 328 ? 22.180  -6.174  42.278   1.00 192.18 ? 328 ILE B CA    1 
ATOM   5465  C  C     . ILE B 1 328 ? 23.296  -5.454  42.925   1.00 197.12 ? 328 ILE B C     1 
ATOM   5466  O  O     . ILE B 1 328 ? 24.145  -6.096  43.503   1.00 198.15 ? 328 ILE B O     1 
ATOM   5467  C  CB    . ILE B 1 328 ? 21.327  -6.783  43.352   1.00 194.34 ? 328 ILE B CB    1 
ATOM   5468  C  CG1   . ILE B 1 328 ? 20.115  -7.377  42.661   1.00 210.39 ? 328 ILE B CG1   1 
ATOM   5469  C  CG2   . ILE B 1 328 ? 21.017  -5.731  44.422   1.00 188.77 ? 328 ILE B CG2   1 
ATOM   5470  C  CD1   . ILE B 1 328 ? 19.253  -8.251  43.522   1.00 215.80 ? 328 ILE B CD1   1 
ATOM   5471  N  N     . ILE B 1 329 ? 23.278  -4.124  42.879   1.00 213.26 ? 329 ILE B N     1 
ATOM   5472  C  CA    . ILE B 1 329 ? 24.430  -3.378  43.377   1.00 233.74 ? 329 ILE B CA    1 
ATOM   5473  C  C     . ILE B 1 329 ? 23.923  -2.713  44.607   1.00 232.74 ? 329 ILE B C     1 
ATOM   5474  O  O     . ILE B 1 329 ? 23.094  -1.856  44.534   1.00 208.98 ? 329 ILE B O     1 
ATOM   5475  C  CB    . ILE B 1 329 ? 25.101  -2.436  42.346   1.00 251.68 ? 329 ILE B CB    1 
ATOM   5476  C  CG1   . ILE B 1 329 ? 26.090  -1.502  43.067   1.00 278.68 ? 329 ILE B CG1   1 
ATOM   5477  C  CG2   . ILE B 1 329 ? 24.082  -1.683  41.488   1.00 245.88 ? 329 ILE B CG2   1 
ATOM   5478  C  CD1   . ILE B 1 329 ? 27.110  -0.848  42.163   1.00 286.59 ? 329 ILE B CD1   1 
ATOM   5479  N  N     . ALA B 1 330 ? 24.365  -3.183  45.780   1.00 243.91 ? 330 ALA B N     1 
ATOM   5480  C  CA    . ALA B 1 330 ? 23.927  -2.594  47.023   1.00 248.94 ? 330 ALA B CA    1 
ATOM   5481  C  C     . ALA B 1 330 ? 25.163  -2.256  47.801   1.00 235.18 ? 330 ALA B C     1 
ATOM   5482  O  O     . ALA B 1 330 ? 25.745  -3.109  48.457   1.00 228.92 ? 330 ALA B O     1 
ATOM   5483  C  CB    . ALA B 1 330 ? 23.091  -3.550  47.857   1.00 245.30 ? 330 ALA B CB    1 
ATOM   5484  N  N     . PRO B 1 331 ? 25.538  -0.981  47.794   1.00 222.87 ? 331 PRO B N     1 
ATOM   5485  C  CA    . PRO B 1 331 ? 26.760  -0.621  48.484   1.00 212.49 ? 331 PRO B CA    1 
ATOM   5486  C  C     . PRO B 1 331 ? 26.521  -0.625  49.989   1.00 208.58 ? 331 PRO B C     1 
ATOM   5487  O  O     . PRO B 1 331 ? 25.404  -0.397  50.436   1.00 211.10 ? 331 PRO B O     1 
ATOM   5488  C  CB    . PRO B 1 331 ? 27.039  0.799   47.986   1.00 227.78 ? 331 PRO B CB    1 
ATOM   5489  C  CG    . PRO B 1 331 ? 25.685  1.354   47.688   1.00 228.24 ? 331 PRO B CG    1 
ATOM   5490  C  CD    . PRO B 1 331 ? 24.829  0.201   47.257   1.00 226.36 ? 331 PRO B CD    1 
ATOM   5491  N  N     . PRO B 1 332 ? 27.547  -0.896  50.772   1.00 199.59 ? 332 PRO B N     1 
ATOM   5492  C  CA    . PRO B 1 332 ? 27.546  -0.401  52.159   1.00 192.25 ? 332 PRO B CA    1 
ATOM   5493  C  C     . PRO B 1 332 ? 27.727  1.117   52.140   1.00 195.81 ? 332 PRO B C     1 
ATOM   5494  O  O     . PRO B 1 332 ? 28.267  1.660   51.182   1.00 195.05 ? 332 PRO B O     1 
ATOM   5495  C  CB    . PRO B 1 332 ? 28.772  -1.081  52.771   1.00 186.71 ? 332 PRO B CB    1 
ATOM   5496  C  CG    . PRO B 1 332 ? 29.678  -1.202  51.598   1.00 194.60 ? 332 PRO B CG    1 
ATOM   5497  C  CD    . PRO B 1 332 ? 28.824  -1.515  50.415   1.00 200.84 ? 332 PRO B CD    1 
ATOM   5498  N  N     . GLU B 1 333 ? 27.237  1.812   53.163   1.00 206.45 ? 333 GLU B N     1 
ATOM   5499  C  CA    . GLU B 1 333 ? 27.048  3.268   53.098   1.00 214.34 ? 333 GLU B CA    1 
ATOM   5500  C  C     . GLU B 1 333 ? 25.798  3.620   52.307   1.00 198.74 ? 333 GLU B C     1 
ATOM   5501  O  O     . GLU B 1 333 ? 25.466  4.784   52.163   1.00 196.21 ? 333 GLU B O     1 
ATOM   5502  C  CB    . GLU B 1 333 ? 28.246  3.976   52.490   1.00 242.05 ? 333 GLU B CB    1 
ATOM   5503  C  CG    . GLU B 1 333 ? 28.382  5.427   52.901   1.00 278.94 ? 333 GLU B CG    1 
ATOM   5504  C  CD    . GLU B 1 333 ? 29.692  6.031   52.455   1.00 291.47 ? 333 GLU B CD    1 
ATOM   5505  O  OE1   . GLU B 1 333 ? 30.561  5.315   51.910   1.00 267.05 ? 333 GLU B OE1   1 
ATOM   5506  O  OE2   . GLU B 1 333 ? 29.863  7.255   52.648   1.00 312.83 ? 333 GLU B OE2   1 
ATOM   5507  N  N     . ARG B 1 334 ? 25.012  2.632   51.874   1.00 186.81 ? 334 ARG B N     1 
ATOM   5508  C  CA    . ARG B 1 334 ? 23.697  2.877   51.306   1.00 172.07 ? 334 ARG B CA    1 
ATOM   5509  C  C     . ARG B 1 334 ? 22.759  3.739   52.153   1.00 155.84 ? 334 ARG B C     1 
ATOM   5510  O  O     . ARG B 1 334 ? 21.926  4.429   51.603   1.00 131.51 ? 334 ARG B O     1 
ATOM   5511  C  CB    . ARG B 1 334 ? 22.930  1.587   50.924   1.00 159.50 ? 334 ARG B CB    1 
ATOM   5512  C  CG    . ARG B 1 334 ? 22.681  0.654   52.110   1.00 156.42 ? 334 ARG B CG    1 
ATOM   5513  C  CD    . ARG B 1 334 ? 21.815  -0.558  51.795   1.00 171.93 ? 334 ARG B CD    1 
ATOM   5514  N  NE    . ARG B 1 334 ? 22.576  -1.676  51.199   1.00 173.52 ? 334 ARG B NE    1 
ATOM   5515  C  CZ    . ARG B 1 334 ? 23.097  -2.692  51.882   1.00 172.92 ? 334 ARG B CZ    1 
ATOM   5516  N  NH1   . ARG B 1 334 ? 22.964  -2.701  53.192   1.00 161.96 ? 334 ARG B NH1   1 
ATOM   5517  N  NH2   . ARG B 1 334 ? 23.833  -3.629  51.254   1.00 173.39 ? 334 ARG B NH2   1 
ATOM   5518  N  N     . LYS B 1 335 ? 22.870  3.665   53.485   1.00 164.78 ? 335 LYS B N     1 
ATOM   5519  C  CA    . LYS B 1 335 ? 21.937  4.360   54.325   1.00 184.43 ? 335 LYS B CA    1 
ATOM   5520  C  C     . LYS B 1 335 ? 21.918  5.827   53.964   1.00 179.60 ? 335 LYS B C     1 
ATOM   5521  O  O     . LYS B 1 335 ? 20.846  6.484   54.020   1.00 184.92 ? 335 LYS B O     1 
ATOM   5522  C  CB    . LYS B 1 335 ? 22.307  4.215   55.821   1.00 209.61 ? 335 LYS B CB    1 
ATOM   5523  C  CG    . LYS B 1 335 ? 21.400  5.029   56.739   1.00 237.06 ? 335 LYS B CG    1 
ATOM   5524  C  CD    . LYS B 1 335 ? 21.691  4.818   58.220   1.00 244.68 ? 335 LYS B CD    1 
ATOM   5525  C  CE    . LYS B 1 335 ? 21.322  3.431   58.731   1.00 246.11 ? 335 LYS B CE    1 
ATOM   5526  N  NZ    . LYS B 1 335 ? 21.475  3.382   60.207   1.00 247.47 ? 335 LYS B NZ    1 
ATOM   5527  N  N     . TYR B 1 336 ? 23.132  6.367   53.711   1.00 183.04 ? 336 TYR B N     1 
ATOM   5528  C  CA    . TYR B 1 336 ? 23.375  7.805   53.504   1.00 192.30 ? 336 TYR B CA    1 
ATOM   5529  C  C     . TYR B 1 336 ? 23.356  8.212   52.029   1.00 200.32 ? 336 TYR B C     1 
ATOM   5530  O  O     . TYR B 1 336 ? 23.365  9.393   51.717   1.00 211.97 ? 336 TYR B O     1 
ATOM   5531  C  CB    . TYR B 1 336 ? 24.692  8.254   54.159   1.00 196.65 ? 336 TYR B CB    1 
ATOM   5532  C  CG    . TYR B 1 336 ? 24.688  7.778   55.562   1.00 193.91 ? 336 TYR B CG    1 
ATOM   5533  C  CD1   . TYR B 1 336 ? 23.738  8.238   56.434   1.00 198.01 ? 336 TYR B CD1   1 
ATOM   5534  C  CD2   . TYR B 1 336 ? 25.594  6.842   56.001   1.00 194.11 ? 336 TYR B CD2   1 
ATOM   5535  C  CE1   . TYR B 1 336 ? 23.702  7.799   57.749   1.00 199.71 ? 336 TYR B CE1   1 
ATOM   5536  C  CE2   . TYR B 1 336 ? 25.576  6.392   57.299   1.00 193.77 ? 336 TYR B CE2   1 
ATOM   5537  C  CZ    . TYR B 1 336 ? 24.628  6.874   58.177   1.00 196.38 ? 336 TYR B CZ    1 
ATOM   5538  O  OH    . TYR B 1 336 ? 24.593  6.420   59.504   1.00 202.24 ? 336 TYR B OH    1 
ATOM   5539  N  N     . SER B 1 337 ? 22.950  7.277   51.166   1.00 185.59 ? 337 SER B N     1 
ATOM   5540  C  CA    . SER B 1 337 ? 23.081  7.472   49.725   1.00 176.84 ? 337 SER B CA    1 
ATOM   5541  C  C     . SER B 1 337 ? 22.304  8.710   49.282   1.00 164.45 ? 337 SER B C     1 
ATOM   5542  O  O     . SER B 1 337 ? 22.816  9.503   48.499   1.00 146.39 ? 337 SER B O     1 
ATOM   5543  C  CB    . SER B 1 337 ? 22.640  6.211   48.934   1.00 170.75 ? 337 SER B CB    1 
ATOM   5544  O  OG    . SER B 1 337 ? 23.514  5.167   49.244   1.00 182.64 ? 337 SER B OG    1 
ATOM   5545  N  N     . VAL B 1 338 ? 21.130  8.919   49.849   1.00 169.99 ? 338 VAL B N     1 
ATOM   5546  C  CA    . VAL B 1 338 ? 20.327  10.035  49.431   1.00 184.91 ? 338 VAL B CA    1 
ATOM   5547  C  C     . VAL B 1 338 ? 21.108  11.328  49.715   1.00 180.49 ? 338 VAL B C     1 
ATOM   5548  O  O     . VAL B 1 338 ? 21.213  12.233  48.882   1.00 169.83 ? 338 VAL B O     1 
ATOM   5549  C  CB    . VAL B 1 338 ? 18.940  9.999   50.129   1.00 204.63 ? 338 VAL B CB    1 
ATOM   5550  C  CG1   . VAL B 1 338 ? 18.175  11.321  49.915   1.00 208.86 ? 338 VAL B CG1   1 
ATOM   5551  C  CG2   . VAL B 1 338 ? 18.165  8.746   49.704   1.00 210.70 ? 338 VAL B CG2   1 
ATOM   5552  N  N     . TRP B 1 339 ? 21.620  11.421  50.950   1.00 193.93 ? 339 TRP B N     1 
ATOM   5553  C  CA    . TRP B 1 339 ? 22.283  12.641  51.341   1.00 206.49 ? 339 TRP B CA    1 
ATOM   5554  C  C     . TRP B 1 339 ? 23.513  12.873  50.490   1.00 183.64 ? 339 TRP B C     1 
ATOM   5555  O  O     . TRP B 1 339 ? 23.760  14.027  50.064   1.00 189.06 ? 339 TRP B O     1 
ATOM   5556  C  CB    . TRP B 1 339 ? 22.700  12.683  52.812   1.00 223.18 ? 339 TRP B CB    1 
ATOM   5557  C  CG    . TRP B 1 339 ? 23.198  14.074  53.190   1.00 220.58 ? 339 TRP B CG    1 
ATOM   5558  C  CD1   . TRP B 1 339 ? 22.467  15.129  53.643   1.00 212.72 ? 339 TRP B CD1   1 
ATOM   5559  C  CD2   . TRP B 1 339 ? 24.535  14.509  53.107   1.00 213.67 ? 339 TRP B CD2   1 
ATOM   5560  N  NE1   . TRP B 1 339 ? 23.281  16.200  53.868   1.00 215.27 ? 339 TRP B NE1   1 
ATOM   5561  C  CE2   . TRP B 1 339 ? 24.560  15.852  53.498   1.00 218.87 ? 339 TRP B CE2   1 
ATOM   5562  C  CE3   . TRP B 1 339 ? 25.696  13.900  52.679   1.00 203.79 ? 339 TRP B CE3   1 
ATOM   5563  C  CZ2   . TRP B 1 339 ? 25.734  16.579  53.559   1.00 221.55 ? 339 TRP B CZ2   1 
ATOM   5564  C  CZ3   . TRP B 1 339 ? 26.859  14.614  52.714   1.00 212.78 ? 339 TRP B CZ3   1 
ATOM   5565  C  CH2   . TRP B 1 339 ? 26.876  15.942  53.145   1.00 219.77 ? 339 TRP B CH2   1 
ATOM   5566  N  N     . ILE B 1 340 ? 24.267  11.812  50.215   1.00 160.17 ? 340 ILE B N     1 
ATOM   5567  C  CA    . ILE B 1 340 ? 25.452  11.963  49.393   1.00 161.19 ? 340 ILE B CA    1 
ATOM   5568  C  C     . ILE B 1 340 ? 25.068  12.502  47.997   1.00 155.81 ? 340 ILE B C     1 
ATOM   5569  O  O     . ILE B 1 340 ? 25.672  13.375  47.425   1.00 150.04 ? 340 ILE B O     1 
ATOM   5570  C  CB    . ILE B 1 340 ? 26.237  10.657  49.244   1.00 178.68 ? 340 ILE B CB    1 
ATOM   5571  C  CG1   . ILE B 1 340 ? 26.693  10.139  50.624   1.00 184.05 ? 340 ILE B CG1   1 
ATOM   5572  C  CG2   . ILE B 1 340 ? 27.355  10.884  48.253   1.00 189.35 ? 340 ILE B CG2   1 
ATOM   5573  C  CD1   . ILE B 1 340 ? 27.255  8.762   50.634   1.00 176.95 ? 340 ILE B CD1   1 
ATOM   5574  N  N     . GLY B 1 341 ? 24.034  11.907  47.449   1.00 152.34 ? 341 GLY B N     1 
ATOM   5575  C  CA    . GLY B 1 341 ? 23.514  12.334  46.168   1.00 157.52 ? 341 GLY B CA    1 
ATOM   5576  C  C     . GLY B 1 341 ? 23.201  13.800  46.192   1.00 157.43 ? 341 GLY B C     1 
ATOM   5577  O  O     . GLY B 1 341 ? 23.457  14.533  45.226   1.00 159.99 ? 341 GLY B O     1 
ATOM   5578  N  N     . GLY B 1 342 ? 22.581  14.249  47.284   1.00 156.96 ? 342 GLY B N     1 
ATOM   5579  C  CA    . GLY B 1 342 ? 22.260  15.671  47.423   1.00 157.88 ? 342 GLY B CA    1 
ATOM   5580  C  C     . GLY B 1 342 ? 23.526  16.492  47.398   1.00 157.66 ? 342 GLY B C     1 
ATOM   5581  O  O     . GLY B 1 342 ? 23.555  17.554  46.767   1.00 149.70 ? 342 GLY B O     1 
ATOM   5582  N  N     . SER B 1 343 ? 24.562  16.011  48.093   1.00 168.36 ? 343 SER B N     1 
ATOM   5583  C  CA    . SER B 1 343 ? 25.822  16.731  48.160   1.00 179.13 ? 343 SER B CA    1 
ATOM   5584  C  C     . SER B 1 343 ? 26.400  16.913  46.747   1.00 166.74 ? 343 SER B C     1 
ATOM   5585  O  O     . SER B 1 343 ? 26.859  18.002  46.356   1.00 180.58 ? 343 SER B O     1 
ATOM   5586  C  CB    . SER B 1 343 ? 26.857  15.985  49.043   1.00 197.72 ? 343 SER B CB    1 
ATOM   5587  O  OG    . SER B 1 343 ? 27.456  14.895  48.349   1.00 200.24 ? 343 SER B OG    1 
ATOM   5588  N  N     . ILE B 1 344 ? 26.376  15.813  46.006   1.00 144.72 ? 344 ILE B N     1 
ATOM   5589  C  CA    . ILE B 1 344 ? 26.960  15.845  44.678   1.00 139.36 ? 344 ILE B CA    1 
ATOM   5590  C  C     . ILE B 1 344 ? 26.129  16.764  43.773   1.00 119.36 ? 344 ILE B C     1 
ATOM   5591  O  O     . ILE B 1 344 ? 26.725  17.534  42.999   1.00 118.79 ? 344 ILE B O     1 
ATOM   5592  C  CB    . ILE B 1 344 ? 27.181  14.442  44.092   1.00 162.18 ? 344 ILE B CB    1 
ATOM   5593  C  CG1   . ILE B 1 344 ? 28.017  14.506  42.823   1.00 184.92 ? 344 ILE B CG1   1 
ATOM   5594  C  CG2   . ILE B 1 344 ? 25.875  13.720  43.818   1.00 171.83 ? 344 ILE B CG2   1 
ATOM   5595  C  CD1   . ILE B 1 344 ? 28.552  13.152  42.340   1.00 189.39 ? 344 ILE B CD1   1 
ATOM   5596  N  N     . LEU B 1 345 ? 24.814  16.771  43.928   1.00 124.17 ? 345 LEU B N     1 
ATOM   5597  C  CA    . LEU B 1 345 ? 23.999  17.601  43.066   1.00 139.08 ? 345 LEU B CA    1 
ATOM   5598  C  C     . LEU B 1 345 ? 24.205  19.028  43.377   1.00 137.18 ? 345 LEU B C     1 
ATOM   5599  O  O     . LEU B 1 345 ? 24.274  19.808  42.432   1.00 148.68 ? 345 LEU B O     1 
ATOM   5600  C  CB    . LEU B 1 345 ? 22.498  17.333  43.276   1.00 161.54 ? 345 LEU B CB    1 
ATOM   5601  C  CG    . LEU B 1 345 ? 21.810  17.067  41.931   1.00 171.78 ? 345 LEU B CG    1 
ATOM   5602  C  CD1   . LEU B 1 345 ? 22.330  15.752  41.333   1.00 164.58 ? 345 LEU B CD1   1 
ATOM   5603  C  CD2   . LEU B 1 345 ? 20.282  17.076  42.041   1.00 175.21 ? 345 LEU B CD2   1 
ATOM   5604  N  N     . ALA B 1 346 ? 24.255  19.424  44.652   1.00 142.09 ? 346 ALA B N     1 
ATOM   5605  C  CA    . ALA B 1 346 ? 24.454  20.829  44.865   1.00 152.30 ? 346 ALA B CA    1 
ATOM   5606  C  C     . ALA B 1 346 ? 25.848  21.285  44.471   1.00 152.59 ? 346 ALA B C     1 
ATOM   5607  O  O     . ALA B 1 346 ? 26.086  22.508  44.260   1.00 142.49 ? 346 ALA B O     1 
ATOM   5608  C  CB    . ALA B 1 346 ? 24.077  21.240  46.275   1.00 161.81 ? 346 ALA B CB    1 
ATOM   5609  N  N     . SER B 1 347 ? 26.816  20.357  44.453   1.00 158.49 ? 347 SER B N     1 
ATOM   5610  C  CA    . SER B 1 347 ? 28.167  20.634  44.040   1.00 162.31 ? 347 SER B CA    1 
ATOM   5611  C  C     . SER B 1 347 ? 28.282  20.877  42.540   1.00 152.69 ? 347 SER B C     1 
ATOM   5612  O  O     . SER B 1 347 ? 29.218  21.499  42.078   1.00 150.14 ? 347 SER B O     1 
ATOM   5613  C  CB    . SER B 1 347 ? 29.153  19.530  44.475   1.00 171.82 ? 347 SER B CB    1 
ATOM   5614  O  OG    . SER B 1 347 ? 29.075  19.296  45.864   1.00 170.84 ? 347 SER B OG    1 
ATOM   5615  N  N     . LEU B 1 348 ? 27.294  20.383  41.789   1.00 157.04 ? 348 LEU B N     1 
ATOM   5616  C  CA    . LEU B 1 348 ? 27.370  20.492  40.334   1.00 166.06 ? 348 LEU B CA    1 
ATOM   5617  C  C     . LEU B 1 348 ? 27.156  21.924  39.906   1.00 164.66 ? 348 LEU B C     1 
ATOM   5618  O  O     . LEU B 1 348 ? 26.303  22.616  40.465   1.00 155.57 ? 348 LEU B O     1 
ATOM   5619  C  CB    . LEU B 1 348 ? 26.315  19.606  39.667   1.00 183.09 ? 348 LEU B CB    1 
ATOM   5620  C  CG    . LEU B 1 348 ? 26.857  18.301  39.078   1.00 204.02 ? 348 LEU B CG    1 
ATOM   5621  C  CD1   . LEU B 1 348 ? 27.485  17.402  40.141   1.00 218.39 ? 348 LEU B CD1   1 
ATOM   5622  C  CD2   . LEU B 1 348 ? 25.769  17.540  38.292   1.00 220.05 ? 348 LEU B CD2   1 
ATOM   5623  N  N     . SER B 1 349 ? 27.991  22.369  38.968   1.00 176.80 ? 349 SER B N     1 
ATOM   5624  C  CA    . SER B 1 349 ? 27.985  23.768  38.547   1.00 192.61 ? 349 SER B CA    1 
ATOM   5625  C  C     . SER B 1 349 ? 26.663  24.153  37.840   1.00 205.18 ? 349 SER B C     1 
ATOM   5626  O  O     . SER B 1 349 ? 26.028  25.186  38.159   1.00 224.49 ? 349 SER B O     1 
ATOM   5627  C  CB    . SER B 1 349 ? 29.186  24.078  37.616   1.00 183.16 ? 349 SER B CB    1 
ATOM   5628  O  OG    . SER B 1 349 ? 30.409  23.837  38.284   1.00 181.42 ? 349 SER B OG    1 
ATOM   5629  N  N     . THR B 1 350 ? 26.277  23.333  36.875   1.00 190.05 ? 350 THR B N     1 
ATOM   5630  C  CA    . THR B 1 350 ? 25.108  23.607  36.078   1.00 173.30 ? 350 THR B CA    1 
ATOM   5631  C  C     . THR B 1 350 ? 23.910  23.674  36.957   1.00 148.39 ? 350 THR B C     1 
ATOM   5632  O  O     . THR B 1 350 ? 23.018  24.481  36.710   1.00 141.93 ? 350 THR B O     1 
ATOM   5633  C  CB    . THR B 1 350 ? 24.822  22.485  35.072   1.00 166.35 ? 350 THR B CB    1 
ATOM   5634  O  OG1   . THR B 1 350 ? 25.954  22.281  34.211   1.00 165.67 ? 350 THR B OG1   1 
ATOM   5635  C  CG2   . THR B 1 350 ? 23.600  22.843  34.208   1.00 170.26 ? 350 THR B CG2   1 
ATOM   5636  N  N     . PHE B 1 351 ? 23.880  22.819  37.987   1.00 139.09 ? 351 PHE B N     1 
ATOM   5637  C  CA    . PHE B 1 351 ? 22.715  22.762  38.900   1.00 145.41 ? 351 PHE B CA    1 
ATOM   5638  C  C     . PHE B 1 351 ? 22.451  24.142  39.506   1.00 162.30 ? 351 PHE B C     1 
ATOM   5639  O  O     . PHE B 1 351 ? 21.278  24.569  39.686   1.00 174.90 ? 351 PHE B O     1 
ATOM   5640  C  CB    . PHE B 1 351 ? 22.859  21.702  40.013   1.00 145.40 ? 351 PHE B CB    1 
ATOM   5641  C  CG    . PHE B 1 351 ? 21.689  21.605  40.932   1.00 146.35 ? 351 PHE B CG    1 
ATOM   5642  C  CD1   . PHE B 1 351 ? 20.462  21.154  40.480   1.00 150.37 ? 351 PHE B CD1   1 
ATOM   5643  C  CD2   . PHE B 1 351 ? 21.839  21.921  42.266   1.00 169.94 ? 351 PHE B CD2   1 
ATOM   5644  C  CE1   . PHE B 1 351 ? 19.406  21.061  41.342   1.00 175.64 ? 351 PHE B CE1   1 
ATOM   5645  C  CE2   . PHE B 1 351 ? 20.786  21.823  43.133   1.00 181.24 ? 351 PHE B CE2   1 
ATOM   5646  C  CZ    . PHE B 1 351 ? 19.564  21.391  42.674   1.00 183.14 ? 351 PHE B CZ    1 
ATOM   5647  N  N     . GLN B 1 352 ? 23.550  24.898  39.672   1.00 178.61 ? 352 GLN B N     1 
ATOM   5648  C  CA    . GLN B 1 352 ? 23.486  26.214  40.302   1.00 210.05 ? 352 GLN B CA    1 
ATOM   5649  C  C     . GLN B 1 352 ? 22.567  27.231  39.612   1.00 208.99 ? 352 GLN B C     1 
ATOM   5650  O  O     . GLN B 1 352 ? 22.273  28.279  40.182   1.00 212.62 ? 352 GLN B O     1 
ATOM   5651  C  CB    . GLN B 1 352 ? 24.876  26.780  40.594   1.00 229.35 ? 352 GLN B CB    1 
ATOM   5652  C  CG    . GLN B 1 352 ? 25.606  26.018  41.699   1.00 241.16 ? 352 GLN B CG    1 
ATOM   5653  C  CD    . GLN B 1 352 ? 26.763  26.794  42.261   1.00 261.01 ? 352 GLN B CD    1 
ATOM   5654  O  OE1   . GLN B 1 352 ? 27.360  27.629  41.577   1.00 264.54 ? 352 GLN B OE1   1 
ATOM   5655  N  NE2   . GLN B 1 352 ? 27.112  26.515  43.518   1.00 265.48 ? 352 GLN B NE2   1 
ATOM   5656  N  N     . GLN B 1 353 ? 22.082  26.909  38.416   1.00 200.45 ? 353 GLN B N     1 
ATOM   5657  C  CA    . GLN B 1 353 ? 21.102  27.709  37.756   1.00 191.14 ? 353 GLN B CA    1 
ATOM   5658  C  C     . GLN B 1 353 ? 19.687  27.201  37.887   1.00 187.69 ? 353 GLN B C     1 
ATOM   5659  O  O     . GLN B 1 353 ? 18.747  27.948  37.671   1.00 180.95 ? 353 GLN B O     1 
ATOM   5660  C  CB    . GLN B 1 353 ? 21.443  27.803  36.262   1.00 198.76 ? 353 GLN B CB    1 
ATOM   5661  C  CG    . GLN B 1 353 ? 20.769  28.931  35.495   1.00 208.02 ? 353 GLN B CG    1 
ATOM   5662  C  CD    . GLN B 1 353 ? 21.478  29.240  34.198   1.00 216.71 ? 353 GLN B CD    1 
ATOM   5663  O  OE1   . GLN B 1 353 ? 22.413  28.547  33.790   1.00 215.14 ? 353 GLN B OE1   1 
ATOM   5664  N  NE2   . GLN B 1 353 ? 21.029  30.296  33.527   1.00 227.80 ? 353 GLN B NE2   1 
ATOM   5665  N  N     . MET B 1 354 ? 19.553  25.915  38.224   1.00 204.05 ? 354 MET B N     1 
ATOM   5666  C  CA    . MET B 1 354 ? 18.226  25.292  38.377   1.00 209.85 ? 354 MET B CA    1 
ATOM   5667  C  C     . MET B 1 354 ? 17.556  25.519  39.725   1.00 213.08 ? 354 MET B C     1 
ATOM   5668  O  O     . MET B 1 354 ? 16.444  25.064  39.937   1.00 202.54 ? 354 MET B O     1 
ATOM   5669  C  CB    . MET B 1 354 ? 18.302  23.772  38.130   1.00 211.70 ? 354 MET B CB    1 
ATOM   5670  C  CG    . MET B 1 354 ? 18.784  23.390  36.736   1.00 219.43 ? 354 MET B CG    1 
ATOM   5671  S  SD    . MET B 1 354 ? 19.124  21.627  36.532   1.00 226.11 ? 354 MET B SD    1 
ATOM   5672  C  CE    . MET B 1 354 ? 17.500  20.911  36.731   1.00 235.99 ? 354 MET B CE    1 
ATOM   5673  N  N     . TRP B 1 355 ? 18.227  26.220  40.640   1.00 212.70 ? 355 TRP B N     1 
ATOM   5674  C  CA    . TRP B 1 355 ? 17.658  26.411  41.939   1.00 201.46 ? 355 TRP B CA    1 
ATOM   5675  C  C     . TRP B 1 355 ? 16.330  27.125  41.774   1.00 191.91 ? 355 TRP B C     1 
ATOM   5676  O  O     . TRP B 1 355 ? 16.157  27.901  40.829   1.00 192.97 ? 355 TRP B O     1 
ATOM   5677  C  CB    . TRP B 1 355 ? 18.551  27.261  42.882   1.00 197.80 ? 355 TRP B CB    1 
ATOM   5678  C  CG    . TRP B 1 355 ? 19.830  26.592  43.321   1.00 195.05 ? 355 TRP B CG    1 
ATOM   5679  C  CD1   . TRP B 1 355 ? 21.095  26.782  42.845   1.00 197.62 ? 355 TRP B CD1   1 
ATOM   5680  C  CD2   . TRP B 1 355 ? 19.934  25.643  44.372   1.00 193.54 ? 355 TRP B CD2   1 
ATOM   5681  N  NE1   . TRP B 1 355 ? 21.981  25.990  43.542   1.00 195.84 ? 355 TRP B NE1   1 
ATOM   5682  C  CE2   . TRP B 1 355 ? 21.273  25.264  44.472   1.00 196.44 ? 355 TRP B CE2   1 
ATOM   5683  C  CE3   . TRP B 1 355 ? 18.987  25.062  45.185   1.00 204.27 ? 355 TRP B CE3   1 
ATOM   5684  C  CZ2   . TRP B 1 355 ? 21.698  24.341  45.390   1.00 205.33 ? 355 TRP B CZ2   1 
ATOM   5685  C  CZ3   . TRP B 1 355 ? 19.387  24.135  46.095   1.00 217.24 ? 355 TRP B CZ3   1 
ATOM   5686  C  CH2   . TRP B 1 355 ? 20.736  23.771  46.196   1.00 211.67 ? 355 TRP B CH2   1 
ATOM   5687  N  N     . ILE B 1 356 ? 15.430  26.933  42.722   1.00 183.17 ? 356 ILE B N     1 
ATOM   5688  C  CA    . ILE B 1 356 ? 14.268  27.788  42.838   1.00 185.31 ? 356 ILE B CA    1 
ATOM   5689  C  C     . ILE B 1 356 ? 14.764  28.972  43.625   1.00 198.04 ? 356 ILE B C     1 
ATOM   5690  O  O     . ILE B 1 356 ? 15.226  28.854  44.753   1.00 190.59 ? 356 ILE B O     1 
ATOM   5691  C  CB    . ILE B 1 356 ? 13.123  27.133  43.540   1.00 193.24 ? 356 ILE B CB    1 
ATOM   5692  C  CG1   . ILE B 1 356 ? 12.683  25.844  42.808   1.00 214.86 ? 356 ILE B CG1   1 
ATOM   5693  C  CG2   . ILE B 1 356 ? 12.003  28.165  43.670   1.00 183.84 ? 356 ILE B CG2   1 
ATOM   5694  C  CD1   . ILE B 1 356 ? 11.752  24.970  43.642   1.00 222.56 ? 356 ILE B CD1   1 
ATOM   5695  N  N     . SER B 1 357 ? 14.699  30.145  42.999   1.00 231.91 ? 357 SER B N     1 
ATOM   5696  C  CA    . SER B 1 357 ? 15.246  31.350  43.605   1.00 244.08 ? 357 SER B CA    1 
ATOM   5697  C  C     . SER B 1 357 ? 14.152  31.929  44.448   1.00 249.37 ? 357 SER B C     1 
ATOM   5698  O  O     . SER B 1 357 ? 12.968  31.754  44.173   1.00 247.54 ? 357 SER B O     1 
ATOM   5699  C  CB    . SER B 1 357 ? 15.731  32.384  42.557   1.00 244.85 ? 357 SER B CB    1 
ATOM   5700  O  OG    . SER B 1 357 ? 16.806  31.838  41.816   1.00 234.23 ? 357 SER B OG    1 
ATOM   5701  N  N     . LYS B 1 358 ? 14.579  32.590  45.544   1.00 250.43 ? 358 LYS B N     1 
ATOM   5702  C  CA    . LYS B 1 358 ? 13.692  33.336  46.410   1.00 253.04 ? 358 LYS B CA    1 
ATOM   5703  C  C     . LYS B 1 358 ? 12.846  34.300  45.597   1.00 240.81 ? 358 LYS B C     1 
ATOM   5704  O  O     . LYS B 1 358 ? 11.645  34.453  45.816   1.00 235.26 ? 358 LYS B O     1 
ATOM   5705  C  CB    . LYS B 1 358 ? 14.533  34.083  47.476   1.00 264.45 ? 358 LYS B CB    1 
ATOM   5706  C  CG    . LYS B 1 358 ? 13.692  34.890  48.453   1.00 263.51 ? 358 LYS B CG    1 
ATOM   5707  C  CD    . LYS B 1 358 ? 12.583  34.126  49.171   1.00 263.83 ? 358 LYS B CD    1 
ATOM   5708  C  CE    . LYS B 1 358 ? 12.098  34.842  50.448   1.00 263.27 ? 358 LYS B CE    1 
ATOM   5709  N  NZ    . LYS B 1 358 ? 11.394  36.131  50.201   1.00 264.75 ? 358 LYS B NZ    1 
ATOM   5710  N  N     . GLN B 1 359 ? 13.504  35.000  44.680   1.00 242.94 ? 359 GLN B N     1 
ATOM   5711  C  CA    . GLN B 1 359 ? 12.884  36.007  43.849   1.00 245.13 ? 359 GLN B CA    1 
ATOM   5712  C  C     . GLN B 1 359 ? 11.739  35.378  43.070   1.00 226.65 ? 359 GLN B C     1 
ATOM   5713  O  O     . GLN B 1 359 ? 10.612  35.904  43.074   1.00 230.89 ? 359 GLN B O     1 
ATOM   5714  C  CB    . GLN B 1 359 ? 13.926  36.597  42.859   1.00 250.52 ? 359 GLN B CB    1 
ATOM   5715  C  CG    . GLN B 1 359 ? 13.412  37.691  41.937   1.00 253.71 ? 359 GLN B CG    1 
ATOM   5716  C  CD    . GLN B 1 359 ? 14.534  38.297  41.141   1.00 265.88 ? 359 GLN B CD    1 
ATOM   5717  O  OE1   . GLN B 1 359 ? 15.690  37.968  41.389   1.00 260.27 ? 359 GLN B OE1   1 
ATOM   5718  N  NE2   . GLN B 1 359 ? 14.212  39.170  40.175   1.00 285.00 ? 359 GLN B NE2   1 
ATOM   5719  N  N     . GLU B 1 360 ? 12.051  34.234  42.449   1.00 207.40 ? 360 GLU B N     1 
ATOM   5720  C  CA    . GLU B 1 360 ? 11.093  33.545  41.579   1.00 207.27 ? 360 GLU B CA    1 
ATOM   5721  C  C     . GLU B 1 360 ? 9.870   33.167  42.379   1.00 196.16 ? 360 GLU B C     1 
ATOM   5722  O  O     . GLU B 1 360 ? 8.706   33.350  41.945   1.00 195.87 ? 360 GLU B O     1 
ATOM   5723  C  CB    . GLU B 1 360 ? 11.767  32.351  40.911   1.00 222.28 ? 360 GLU B CB    1 
ATOM   5724  C  CG    . GLU B 1 360 ? 12.826  32.802  39.893   1.00 247.41 ? 360 GLU B CG    1 
ATOM   5725  C  CD    . GLU B 1 360 ? 13.508  31.662  39.232   1.00 266.46 ? 360 GLU B CD    1 
ATOM   5726  O  OE1   . GLU B 1 360 ? 13.584  30.569  39.817   1.00 283.44 ? 360 GLU B OE1   1 
ATOM   5727  O  OE2   . GLU B 1 360 ? 14.001  31.849  38.096   1.00 272.12 ? 360 GLU B OE2   1 
ATOM   5728  N  N     . TYR B 1 361 ? 10.109  32.600  43.553   1.00 199.46 ? 361 TYR B N     1 
ATOM   5729  C  CA    . TYR B 1 361 ? 9.017   32.278  44.477   1.00 214.54 ? 361 TYR B CA    1 
ATOM   5730  C  C     . TYR B 1 361 ? 8.185   33.522  44.805   1.00 233.24 ? 361 TYR B C     1 
ATOM   5731  O  O     . TYR B 1 361 ? 6.978   33.475  44.795   1.00 235.91 ? 361 TYR B O     1 
ATOM   5732  C  CB    . TYR B 1 361 ? 9.546   31.716  45.760   1.00 221.82 ? 361 TYR B CB    1 
ATOM   5733  C  CG    . TYR B 1 361 ? 8.530   31.637  46.838   1.00 230.72 ? 361 TYR B CG    1 
ATOM   5734  C  CD1   . TYR B 1 361 ? 7.493   30.739  46.770   1.00 228.13 ? 361 TYR B CD1   1 
ATOM   5735  C  CD2   . TYR B 1 361 ? 8.604   32.481  47.920   1.00 246.05 ? 361 TYR B CD2   1 
ATOM   5736  C  CE1   . TYR B 1 361 ? 6.560   30.659  47.788   1.00 239.81 ? 361 TYR B CE1   1 
ATOM   5737  C  CE2   . TYR B 1 361 ? 7.674   32.415  48.948   1.00 249.79 ? 361 TYR B CE2   1 
ATOM   5738  C  CZ    . TYR B 1 361 ? 6.651   31.502  48.871   1.00 249.52 ? 361 TYR B CZ    1 
ATOM   5739  O  OH    . TYR B 1 361 ? 5.702   31.425  49.899   1.00 257.56 ? 361 TYR B OH    1 
ATOM   5740  N  N     . ASP B 1 362 ? 8.821   34.641  45.120   1.00 245.70 ? 362 ASP B N     1 
ATOM   5741  C  CA    . ASP B 1 362 ? 8.083   35.801  45.547   1.00 244.25 ? 362 ASP B CA    1 
ATOM   5742  C  C     . ASP B 1 362 ? 7.171   36.310  44.471   1.00 227.55 ? 362 ASP B C     1 
ATOM   5743  O  O     . ASP B 1 362 ? 6.032   36.684  44.749   1.00 205.48 ? 362 ASP B O     1 
ATOM   5744  C  CB    . ASP B 1 362 ? 8.983   36.965  45.944   1.00 252.79 ? 362 ASP B CB    1 
ATOM   5745  C  CG    . ASP B 1 362 ? 9.842   36.668  47.145   1.00 255.51 ? 362 ASP B CG    1 
ATOM   5746  O  OD1   . ASP B 1 362 ? 9.407   36.020  48.128   1.00 265.81 ? 362 ASP B OD1   1 
ATOM   5747  O  OD2   . ASP B 1 362 ? 10.982  37.119  47.104   1.00 247.63 ? 362 ASP B OD2   1 
ATOM   5748  N  N     . GLU B 1 363 ? 7.618   36.296  43.222   1.00 229.07 ? 363 GLU B N     1 
ATOM   5749  C  CA    . GLU B 1 363 ? 6.762   36.672  42.103   1.00 230.12 ? 363 GLU B CA    1 
ATOM   5750  C  C     . GLU B 1 363 ? 5.651   35.645  41.880   1.00 222.34 ? 363 GLU B C     1 
ATOM   5751  O  O     . GLU B 1 363 ? 4.473   35.985  41.863   1.00 210.57 ? 363 GLU B O     1 
ATOM   5752  C  CB    . GLU B 1 363 ? 7.549   36.794  40.796   1.00 240.65 ? 363 GLU B CB    1 
ATOM   5753  C  CG    . GLU B 1 363 ? 8.423   38.032  40.686   1.00 249.73 ? 363 GLU B CG    1 
ATOM   5754  C  CD    . GLU B 1 363 ? 9.910   37.775  40.368   1.00 245.47 ? 363 GLU B CD    1 
ATOM   5755  O  OE1   . GLU B 1 363 ? 10.459  36.644  40.565   1.00 232.69 ? 363 GLU B OE1   1 
ATOM   5756  O  OE2   . GLU B 1 363 ? 10.571  38.749  39.953   1.00 247.66 ? 363 GLU B OE2   1 
ATOM   5757  N  N     . SER B 1 364 ? 6.064   34.398  41.677   1.00 219.76 ? 364 SER B N     1 
ATOM   5758  C  CA    . SER B 1 364 ? 5.199   33.315  41.183   1.00 212.71 ? 364 SER B CA    1 
ATOM   5759  C  C     . SER B 1 364 ? 4.461   32.420  42.189   1.00 223.06 ? 364 SER B C     1 
ATOM   5760  O  O     . SER B 1 364 ? 3.572   31.661  41.798   1.00 206.01 ? 364 SER B O     1 
ATOM   5761  C  CB    . SER B 1 364 ? 5.998   32.496  40.178   1.00 209.56 ? 364 SER B CB    1 
ATOM   5762  O  OG    . SER B 1 364 ? 6.647   33.345  39.246   1.00 205.66 ? 364 SER B OG    1 
ATOM   5763  N  N     . GLY B 1 365 ? 4.794   32.535  43.466   1.00 249.05 ? 365 GLY B N     1 
ATOM   5764  C  CA    . GLY B 1 365 ? 4.134   31.792  44.490   1.00 260.43 ? 365 GLY B CA    1 
ATOM   5765  C  C     . GLY B 1 365 ? 4.719   30.429  44.752   1.00 266.43 ? 365 GLY B C     1 
ATOM   5766  O  O     . GLY B 1 365 ? 5.644   29.992  44.105   1.00 276.28 ? 365 GLY B O     1 
ATOM   5767  N  N     . PRO B 1 366 ? 4.172   29.750  45.752   1.00 261.32 ? 366 PRO B N     1 
ATOM   5768  C  CA    . PRO B 1 366 ? 4.568   28.415  46.144   1.00 254.08 ? 366 PRO B CA    1 
ATOM   5769  C  C     . PRO B 1 366 ? 4.278   27.314  45.149   1.00 238.02 ? 366 PRO B C     1 
ATOM   5770  O  O     . PRO B 1 366 ? 4.917   26.279  45.223   1.00 236.51 ? 366 PRO B O     1 
ATOM   5771  C  CB    . PRO B 1 366 ? 3.761   28.153  47.426   1.00 253.38 ? 366 PRO B CB    1 
ATOM   5772  C  CG    . PRO B 1 366 ? 3.187   29.441  47.874   1.00 253.99 ? 366 PRO B CG    1 
ATOM   5773  C  CD    . PRO B 1 366 ? 3.262   30.392  46.708   1.00 256.95 ? 366 PRO B CD    1 
ATOM   5774  N  N     . SER B 1 367 ? 3.296   27.497  44.261   1.00 218.82 ? 367 SER B N     1 
ATOM   5775  C  CA    . SER B 1 367 ? 2.817   26.454  43.393   1.00 214.65 ? 367 SER B CA    1 
ATOM   5776  C  C     . SER B 1 367 ? 3.896   26.122  42.371   1.00 215.65 ? 367 SER B C     1 
ATOM   5777  O  O     . SER B 1 367 ? 3.849   25.024  41.769   1.00 212.07 ? 367 SER B O     1 
ATOM   5778  C  CB    . SER B 1 367 ? 1.550   26.909  42.621   1.00 211.97 ? 367 SER B CB    1 
ATOM   5779  O  OG    . SER B 1 367 ? 1.857   27.964  41.720   1.00 208.54 ? 367 SER B OG    1 
ATOM   5780  N  N     . ILE B 1 368 ? 4.858   27.030  42.211   1.00 208.45 ? 368 ILE B N     1 
ATOM   5781  C  CA    . ILE B 1 368 ? 5.864   26.862  41.186   1.00 207.06 ? 368 ILE B CA    1 
ATOM   5782  C  C     . ILE B 1 368 ? 6.769   25.657  41.409   1.00 209.46 ? 368 ILE B C     1 
ATOM   5783  O  O     . ILE B 1 368 ? 7.658   25.455  40.565   1.00 214.28 ? 368 ILE B O     1 
ATOM   5784  C  CB    . ILE B 1 368 ? 6.746   28.094  41.003   1.00 206.23 ? 368 ILE B CB    1 
ATOM   5785  C  CG1   . ILE B 1 368 ? 7.645   28.341  42.239   1.00 206.82 ? 368 ILE B CG1   1 
ATOM   5786  C  CG2   . ILE B 1 368 ? 5.932   29.309  40.574   1.00 217.62 ? 368 ILE B CG2   1 
ATOM   5787  C  CD1   . ILE B 1 368 ? 9.109   27.994  42.045   1.00 203.50 ? 368 ILE B CD1   1 
ATOM   5788  N  N     . VAL B 1 369 ? 6.599   24.894  42.496   1.00 212.62 ? 369 VAL B N     1 
ATOM   5789  C  CA    . VAL B 1 369 ? 7.507   23.819  42.781   1.00 208.85 ? 369 VAL B CA    1 
ATOM   5790  C  C     . VAL B 1 369 ? 7.419   22.814  41.662   1.00 214.46 ? 369 VAL B C     1 
ATOM   5791  O  O     . VAL B 1 369 ? 8.418   22.391  41.099   1.00 224.53 ? 369 VAL B O     1 
ATOM   5792  C  CB    . VAL B 1 369 ? 7.212   23.130  44.112   1.00 203.71 ? 369 VAL B CB    1 
ATOM   5793  C  CG1   . VAL B 1 369 ? 8.234   22.032  44.380   1.00 193.22 ? 369 VAL B CG1   1 
ATOM   5794  C  CG2   . VAL B 1 369 ? 7.258   24.133  45.242   1.00 209.75 ? 369 VAL B CG2   1 
ATOM   5795  N  N     . HIS B 1 370 ? 6.197   22.467  41.280   1.00 206.69 ? 370 HIS B N     1 
ATOM   5796  C  CA    . HIS B 1 370 ? 5.973   21.424  40.270   1.00 205.33 ? 370 HIS B CA    1 
ATOM   5797  C  C     . HIS B 1 370 ? 6.330   21.835  38.846   1.00 214.81 ? 370 HIS B C     1 
ATOM   5798  O  O     . HIS B 1 370 ? 6.885   21.072  38.066   1.00 190.08 ? 370 HIS B O     1 
ATOM   5799  C  CB    . HIS B 1 370 ? 4.484   21.017  40.298   1.00 203.86 ? 370 HIS B CB    1 
ATOM   5800  C  CG    . HIS B 1 370 ? 4.039   20.561  41.655   1.00 218.86 ? 370 HIS B CG    1 
ATOM   5801  N  ND1   . HIS B 1 370 ? 4.475   19.382  42.225   1.00 220.40 ? 370 HIS B ND1   1 
ATOM   5802  C  CD2   . HIS B 1 370 ? 3.194   21.120  42.555   1.00 224.22 ? 370 HIS B CD2   1 
ATOM   5803  C  CE1   . HIS B 1 370 ? 3.932   19.238  43.425   1.00 228.34 ? 370 HIS B CE1   1 
ATOM   5804  N  NE2   . HIS B 1 370 ? 3.138   20.275  43.644   1.00 236.55 ? 370 HIS B NE2   1 
ATOM   5805  N  N     . ARG B 1 371 ? 5.979   23.063  38.540   1.00 245.03 ? 371 ARG B N     1 
ATOM   5806  C  CA    . ARG B 1 371 ? 6.353   23.726  37.301   1.00 262.71 ? 371 ARG B CA    1 
ATOM   5807  C  C     . ARG B 1 371 ? 7.807   23.568  36.945   1.00 244.63 ? 371 ARG B C     1 
ATOM   5808  O  O     . ARG B 1 371 ? 8.152   23.157  35.843   1.00 220.69 ? 371 ARG B O     1 
ATOM   5809  C  CB    . ARG B 1 371 ? 6.006   25.179  37.513   1.00 287.58 ? 371 ARG B CB    1 
ATOM   5810  C  CG    . ARG B 1 371 ? 6.286   26.110  36.375   1.00 295.62 ? 371 ARG B CG    1 
ATOM   5811  C  CD    . ARG B 1 371 ? 5.797   27.489  36.795   1.00 297.49 ? 371 ARG B CD    1 
ATOM   5812  N  NE    . ARG B 1 371 ? 6.067   28.541  35.798   1.00 304.23 ? 371 ARG B NE    1 
ATOM   5813  C  CZ    . ARG B 1 371 ? 5.666   29.815  35.902   1.00 313.70 ? 371 ARG B CZ    1 
ATOM   5814  N  NH1   . ARG B 1 371 ? 4.968   30.198  36.971   1.00 312.64 ? 371 ARG B NH1   1 
ATOM   5815  N  NH2   . ARG B 1 371 ? 5.954   30.719  34.942   1.00 324.24 ? 371 ARG B NH2   1 
ATOM   5816  N  N     . LYS B 1 372 ? 8.677   23.873  37.891   1.00 246.01 ? 372 LYS B N     1 
ATOM   5817  C  CA    . LYS B 1 372 ? 10.096  23.881  37.587   1.00 248.39 ? 372 LYS B CA    1 
ATOM   5818  C  C     . LYS B 1 372 ? 10.754  22.521  37.745   1.00 256.41 ? 372 LYS B C     1 
ATOM   5819  O  O     . LYS B 1 372 ? 11.426  22.032  36.830   1.00 268.05 ? 372 LYS B O     1 
ATOM   5820  C  CB    . LYS B 1 372 ? 10.851  24.902  38.451   1.00 263.42 ? 372 LYS B CB    1 
ATOM   5821  C  CG    . LYS B 1 372 ? 12.276  25.179  37.946   1.00 273.23 ? 372 LYS B CG    1 
ATOM   5822  C  CD    . LYS B 1 372 ? 13.014  26.212  38.800   1.00 284.65 ? 372 LYS B CD    1 
ATOM   5823  C  CE    . LYS B 1 372 ? 12.552  27.647  38.557   1.00 291.07 ? 372 LYS B CE    1 
ATOM   5824  N  NZ    . LYS B 1 372 ? 13.097  28.203  37.283   1.00 290.19 ? 372 LYS B NZ    1 
ATOM   5825  N  N     . CYS B 1 373 ? 10.609  21.930  38.925   1.00 264.94 ? 373 CYS B N     1 
ATOM   5826  C  CA    . CYS B 1 373 ? 11.336  20.738  39.236   1.00 266.58 ? 373 CYS B CA    1 
ATOM   5827  C  C     . CYS B 1 373 ? 10.395  19.577  39.090   1.00 252.06 ? 373 CYS B C     1 
ATOM   5828  O  O     . CYS B 1 373 ? 9.177   19.746  39.048   1.00 239.39 ? 373 CYS B O     1 
ATOM   5829  C  CB    . CYS B 1 373 ? 11.944  20.855  40.641   1.00 271.83 ? 373 CYS B CB    1 
ATOM   5830  S  SG    . CYS B 1 373 ? 10.767  20.742  41.984   1.00 282.11 ? 373 CYS B SG    1 
ATOM   5831  N  N     . PHE B 1 374 ? 10.992  18.396  38.961   1.00 250.69 ? 374 PHE B N     1 
ATOM   5832  C  CA    . PHE B 1 374 ? 10.311  17.128  38.982   1.00 267.94 ? 374 PHE B CA    1 
ATOM   5833  C  C     . PHE B 1 374 ? 9.823   16.723  40.393   1.00 289.95 ? 374 PHE B C     1 
ATOM   5834  O  O     . PHE B 1 374 ? 8.854   15.978  40.549   1.00 320.48 ? 374 PHE B O     1 
ATOM   5835  C  CB    . PHE B 1 374 ? 11.288  16.077  38.440   1.00 265.80 ? 374 PHE B CB    1 
ATOM   5836  C  CG    . PHE B 1 374 ? 10.739  14.695  38.365   1.00 266.70 ? 374 PHE B CG    1 
ATOM   5837  C  CD1   . PHE B 1 374 ? 9.964   14.302  37.292   1.00 272.58 ? 374 PHE B CD1   1 
ATOM   5838  C  CD2   . PHE B 1 374 ? 11.059  13.752  39.325   1.00 262.79 ? 374 PHE B CD2   1 
ATOM   5839  C  CE1   . PHE B 1 374 ? 9.487   13.015  37.194   1.00 270.67 ? 374 PHE B CE1   1 
ATOM   5840  C  CE2   . PHE B 1 374 ? 10.581  12.463  39.233   1.00 258.08 ? 374 PHE B CE2   1 
ATOM   5841  C  CZ    . PHE B 1 374 ? 9.794   12.094  38.169   1.00 261.31 ? 374 PHE B CZ    1 
ATOM   5842  O  OXT   . PHE B 1 374 ? 10.366  17.164  41.408   1.00 286.71 ? 374 PHE B OXT   1 
ATOM   5843  N  N     . GLU C 1 1   ? 47.559  -5.197  -59.814  1.00 354.45 ? 1   GLU C N     1 
ATOM   5844  C  CA    . GLU C 1 1   ? 46.704  -6.341  -60.274  1.00 349.12 ? 1   GLU C CA    1 
ATOM   5845  C  C     . GLU C 1 1   ? 46.119  -6.069  -61.644  1.00 352.37 ? 1   GLU C C     1 
ATOM   5846  O  O     . GLU C 1 1   ? 46.026  -4.912  -62.073  1.00 351.25 ? 1   GLU C O     1 
ATOM   5847  C  CB    . GLU C 1 1   ? 45.616  -6.680  -59.246  1.00 347.52 ? 1   GLU C CB    1 
ATOM   5848  C  CG    . GLU C 1 1   ? 44.605  -5.581  -58.997  1.00 354.45 ? 1   GLU C CG    1 
ATOM   5849  C  CD    . GLU C 1 1   ? 44.998  -4.600  -57.905  1.00 356.01 ? 1   GLU C CD    1 
ATOM   5850  O  OE1   . GLU C 1 1   ? 46.200  -4.466  -57.589  1.00 359.96 ? 1   GLU C OE1   1 
ATOM   5851  O  OE2   . GLU C 1 1   ? 44.087  -3.950  -57.362  1.00 356.51 ? 1   GLU C OE2   1 
ATOM   5852  N  N     . GLU C 1 2   ? 45.755  -7.139  -62.322  1.00 363.65 ? 2   GLU C N     1 
ATOM   5853  C  CA    . GLU C 1 2   ? 45.145  -7.028  -63.627  1.00 373.47 ? 2   GLU C CA    1 
ATOM   5854  C  C     . GLU C 1 2   ? 43.633  -6.917  -63.450  1.00 391.16 ? 2   GLU C C     1 
ATOM   5855  O  O     . GLU C 1 2   ? 43.088  -7.504  -62.515  1.00 410.28 ? 2   GLU C O     1 
ATOM   5856  C  CB    . GLU C 1 2   ? 45.496  -8.232  -64.490  1.00 361.38 ? 2   GLU C CB    1 
ATOM   5857  C  CG    . GLU C 1 2   ? 46.910  -8.244  -65.043  1.00 345.27 ? 2   GLU C CG    1 
ATOM   5858  C  CD    . GLU C 1 2   ? 47.124  -9.374  -66.011  1.00 331.39 ? 2   GLU C CD    1 
ATOM   5859  O  OE1   . GLU C 1 2   ? 46.378  -10.377 -65.968  1.00 323.31 ? 2   GLU C OE1   1 
ATOM   5860  O  OE2   . GLU C 1 2   ? 48.053  -9.257  -66.825  1.00 321.41 ? 2   GLU C OE2   1 
ATOM   5861  N  N     . GLU C 1 3   ? 42.980  -6.126  -64.306  1.00 381.72 ? 3   GLU C N     1 
ATOM   5862  C  CA    . GLU C 1 3   ? 41.524  -5.865  -64.265  1.00 364.00 ? 3   GLU C CA    1 
ATOM   5863  C  C     . GLU C 1 3   ? 40.954  -5.165  -63.003  1.00 353.10 ? 3   GLU C C     1 
ATOM   5864  O  O     . GLU C 1 3   ? 39.814  -4.700  -63.038  1.00 341.80 ? 3   GLU C O     1 
ATOM   5865  C  CB    . GLU C 1 3   ? 40.737  -7.137  -64.586  1.00 359.50 ? 3   GLU C CB    1 
ATOM   5866  C  CG    . GLU C 1 3   ? 41.016  -7.711  -65.971  1.00 348.17 ? 3   GLU C CG    1 
ATOM   5867  C  CD    . GLU C 1 3   ? 40.280  -8.986  -66.166  1.00 331.83 ? 3   GLU C CD    1 
ATOM   5868  O  OE1   . GLU C 1 3   ? 39.782  -9.539  -65.164  1.00 318.48 ? 3   GLU C OE1   1 
ATOM   5869  O  OE2   . GLU C 1 3   ? 40.188  -9.459  -67.319  1.00 325.03 ? 3   GLU C OE2   1 
ATOM   5870  N  N     . ILE C 1 4   ? 41.728  -5.099  -61.904  1.00 353.99 ? 4   ILE C N     1 
ATOM   5871  C  CA    . ILE C 1 4   ? 41.367  -4.427  -60.655  1.00 340.92 ? 4   ILE C CA    1 
ATOM   5872  C  C     . ILE C 1 4   ? 40.177  -5.044  -59.904  1.00 332.01 ? 4   ILE C C     1 
ATOM   5873  O  O     . ILE C 1 4   ? 39.693  -4.523  -58.912  1.00 336.00 ? 4   ILE C O     1 
ATOM   5874  C  CB    . ILE C 1 4   ? 41.163  -2.920  -60.892  1.00 338.81 ? 4   ILE C CB    1 
ATOM   5875  C  CG1   . ILE C 1 4   ? 42.240  -2.363  -61.820  1.00 340.30 ? 4   ILE C CG1   1 
ATOM   5876  C  CG2   . ILE C 1 4   ? 41.193  -2.179  -59.580  1.00 339.93 ? 4   ILE C CG2   1 
ATOM   5877  C  CD1   . ILE C 1 4   ? 43.663  -2.552  -61.339  1.00 346.94 ? 4   ILE C CD1   1 
ATOM   5878  N  N     . ALA C 1 5   ? 39.720  -6.195  -60.355  1.00 307.43 ? 5   ALA C N     1 
ATOM   5879  C  CA    . ALA C 1 5   ? 38.392  -6.615  -60.003  1.00 277.05 ? 5   ALA C CA    1 
ATOM   5880  C  C     . ALA C 1 5   ? 37.303  -5.558  -60.335  1.00 259.26 ? 5   ALA C C     1 
ATOM   5881  O  O     . ALA C 1 5   ? 37.490  -4.698  -61.182  1.00 266.57 ? 5   ALA C O     1 
ATOM   5882  C  CB    . ALA C 1 5   ? 38.332  -7.076  -58.538  1.00 262.68 ? 5   ALA C CB    1 
ATOM   5883  N  N     . ALA C 1 6   ? 36.140  -5.675  -59.718  1.00 230.27 ? 6   ALA C N     1 
ATOM   5884  C  CA    . ALA C 1 6   ? 35.107  -4.630  -59.771  1.00 203.70 ? 6   ALA C CA    1 
ATOM   5885  C  C     . ALA C 1 6   ? 34.111  -4.953  -58.696  1.00 199.75 ? 6   ALA C C     1 
ATOM   5886  O  O     . ALA C 1 6   ? 34.132  -6.085  -58.147  1.00 198.91 ? 6   ALA C O     1 
ATOM   5887  C  CB    . ALA C 1 6   ? 34.413  -4.587  -61.125  1.00 198.34 ? 6   ALA C CB    1 
ATOM   5888  N  N     . LEU C 1 7   ? 33.311  -3.974  -58.313  1.00 188.98 ? 7   LEU C N     1 
ATOM   5889  C  CA    . LEU C 1 7   ? 32.406  -4.114  -57.191  1.00 172.01 ? 7   LEU C CA    1 
ATOM   5890  C  C     . LEU C 1 7   ? 31.016  -4.095  -57.730  1.00 173.31 ? 7   LEU C C     1 
ATOM   5891  O  O     . LEU C 1 7   ? 30.753  -3.442  -58.727  1.00 169.96 ? 7   LEU C O     1 
ATOM   5892  C  CB    . LEU C 1 7   ? 32.580  -2.988  -56.160  1.00 165.27 ? 7   LEU C CB    1 
ATOM   5893  C  CG    . LEU C 1 7   ? 33.855  -3.107  -55.304  1.00 168.49 ? 7   LEU C CG    1 
ATOM   5894  C  CD1   . LEU C 1 7   ? 34.019  -1.941  -54.346  1.00 171.92 ? 7   LEU C CD1   1 
ATOM   5895  C  CD2   . LEU C 1 7   ? 33.952  -4.481  -54.631  1.00 163.36 ? 7   LEU C CD2   1 
ATOM   5896  N  N     . VAL C 1 8   ? 30.111  -4.815  -57.091  1.00 176.94 ? 8   VAL C N     1 
ATOM   5897  C  CA    . VAL C 1 8   ? 28.740  -4.877  -57.564  1.00 182.03 ? 8   VAL C CA    1 
ATOM   5898  C  C     . VAL C 1 8   ? 27.803  -4.696  -56.393  1.00 175.61 ? 8   VAL C C     1 
ATOM   5899  O  O     . VAL C 1 8   ? 27.980  -5.343  -55.360  1.00 192.31 ? 8   VAL C O     1 
ATOM   5900  C  CB    . VAL C 1 8   ? 28.455  -6.185  -58.322  1.00 190.21 ? 8   VAL C CB    1 
ATOM   5901  C  CG1   . VAL C 1 8   ? 27.020  -6.126  -58.840  1.00 197.05 ? 8   VAL C CG1   1 
ATOM   5902  C  CG2   . VAL C 1 8   ? 29.501  -6.397  -59.449  1.00 190.43 ? 8   VAL C CG2   1 
ATOM   5903  N  N     . ILE C 1 9   ? 26.830  -3.805  -56.529  1.00 161.23 ? 9   ILE C N     1 
ATOM   5904  C  CA    . ILE C 1 9   ? 25.822  -3.671  -55.489  1.00 167.19 ? 9   ILE C CA    1 
ATOM   5905  C  C     . ILE C 1 9   ? 24.387  -3.633  -56.013  1.00 176.57 ? 9   ILE C C     1 
ATOM   5906  O  O     . ILE C 1 9   ? 24.086  -2.877  -56.920  1.00 173.90 ? 9   ILE C O     1 
ATOM   5907  C  CB    . ILE C 1 9   ? 26.130  -2.432  -54.636  1.00 177.84 ? 9   ILE C CB    1 
ATOM   5908  C  CG1   . ILE C 1 9   ? 27.591  -2.503  -54.172  1.00 188.04 ? 9   ILE C CG1   1 
ATOM   5909  C  CG2   . ILE C 1 9   ? 25.115  -2.353  -53.501  1.00 187.03 ? 9   ILE C CG2   1 
ATOM   5910  C  CD1   . ILE C 1 9   ? 27.981  -1.513  -53.120  1.00 206.60 ? 9   ILE C CD1   1 
ATOM   5911  N  N     . ASP C 1 10  ? 23.549  -4.507  -55.448  1.00 196.45 ? 10  ASP C N     1 
ATOM   5912  C  CA    . ASP C 1 10  ? 22.139  -4.546  -55.779  1.00 216.51 ? 10  ASP C CA    1 
ATOM   5913  C  C     . ASP C 1 10  ? 21.440  -3.902  -54.547  1.00 215.76 ? 10  ASP C C     1 
ATOM   5914  O  O     . ASP C 1 10  ? 21.482  -4.390  -53.383  1.00 226.23 ? 10  ASP C O     1 
ATOM   5915  C  CB    . ASP C 1 10  ? 21.638  -5.954  -56.068  1.00 229.18 ? 10  ASP C CB    1 
ATOM   5916  C  CG    . ASP C 1 10  ? 20.137  -6.042  -56.109  1.00 244.57 ? 10  ASP C CG    1 
ATOM   5917  O  OD1   . ASP C 1 10  ? 19.424  -5.059  -55.808  1.00 255.31 ? 10  ASP C OD1   1 
ATOM   5918  O  OD2   . ASP C 1 10  ? 19.645  -7.103  -56.446  1.00 244.13 ? 10  ASP C OD2   1 
ATOM   5919  N  N     . ASN C 1 11  ? 20.875  -2.728  -54.795  1.00 194.66 ? 11  ASN C N     1 
ATOM   5920  C  CA    . ASN C 1 11  ? 19.908  -2.144  -53.901  1.00 182.00 ? 11  ASN C CA    1 
ATOM   5921  C  C     . ASN C 1 11  ? 18.495  -1.905  -54.470  1.00 211.00 ? 11  ASN C C     1 
ATOM   5922  O  O     . ASN C 1 11  ? 18.070  -0.778  -54.737  1.00 230.54 ? 11  ASN C O     1 
ATOM   5923  C  CB    . ASN C 1 11  ? 20.416  -0.836  -53.365  1.00 166.51 ? 11  ASN C CB    1 
ATOM   5924  C  CG    . ASN C 1 11  ? 21.147  -1.021  -52.085  1.00 160.34 ? 11  ASN C CG    1 
ATOM   5925  O  OD1   . ASN C 1 11  ? 20.971  -2.033  -51.424  1.00 134.63 ? 11  ASN C OD1   1 
ATOM   5926  N  ND2   . ASN C 1 11  ? 21.981  -0.064  -51.727  1.00 179.12 ? 11  ASN C ND2   1 
ATOM   5927  N  N     . GLY C 1 12  ? 17.726  -2.974  -54.592  1.00 223.42 ? 12  GLY C N     1 
ATOM   5928  C  CA    . GLY C 1 12  ? 16.243  -2.840  -54.497  1.00 223.21 ? 12  GLY C CA    1 
ATOM   5929  C  C     . GLY C 1 12  ? 16.079  -2.678  -53.017  1.00 201.75 ? 12  GLY C C     1 
ATOM   5930  O  O     . GLY C 1 12  ? 16.985  -3.072  -52.242  1.00 198.01 ? 12  GLY C O     1 
ATOM   5931  N  N     . SER C 1 13  ? 14.925  -2.142  -52.614  1.00 174.77 ? 13  SER C N     1 
ATOM   5932  C  CA    . SER C 1 13  ? 14.612  -2.009  -51.203  1.00 164.96 ? 13  SER C CA    1 
ATOM   5933  C  C     . SER C 1 13  ? 14.795  -3.340  -50.510  1.00 145.64 ? 13  SER C C     1 
ATOM   5934  O  O     . SER C 1 13  ? 14.595  -4.387  -51.118  1.00 130.28 ? 13  SER C O     1 
ATOM   5935  C  CB    . SER C 1 13  ? 13.157  -1.587  -50.924  1.00 192.42 ? 13  SER C CB    1 
ATOM   5936  O  OG    . SER C 1 13  ? 12.807  -0.380  -51.574  1.00 212.14 ? 13  SER C OG    1 
ATOM   5937  N  N     . GLY C 1 14  ? 15.149  -3.281  -49.237  1.00 151.62 ? 14  GLY C N     1 
ATOM   5938  C  CA    . GLY C 1 14  ? 15.084  -4.451  -48.329  1.00 167.23 ? 14  GLY C CA    1 
ATOM   5939  C  C     . GLY C 1 14  ? 16.431  -5.062  -48.021  1.00 175.23 ? 14  GLY C C     1 
ATOM   5940  O  O     . GLY C 1 14  ? 16.841  -5.291  -46.875  1.00 184.88 ? 14  GLY C O     1 
ATOM   5941  N  N     . MET C 1 15  ? 17.169  -5.309  -49.096  1.00 181.27 ? 15  MET C N     1 
ATOM   5942  C  CA    . MET C 1 15  ? 18.460  -5.970  -48.930  1.00 186.16 ? 15  MET C CA    1 
ATOM   5943  C  C     . MET C 1 15  ? 19.508  -5.323  -49.763  1.00 171.44 ? 15  MET C C     1 
ATOM   5944  O  O     . MET C 1 15  ? 19.266  -5.014  -50.922  1.00 160.96 ? 15  MET C O     1 
ATOM   5945  C  CB    . MET C 1 15  ? 18.415  -7.447  -49.357  1.00 203.06 ? 15  MET C CB    1 
ATOM   5946  C  CG    . MET C 1 15  ? 17.515  -8.321  -48.480  1.00 215.83 ? 15  MET C CG    1 
ATOM   5947  S  SD    . MET C 1 15  ? 17.487  -10.064 -48.879  1.00 237.45 ? 15  MET C SD    1 
ATOM   5948  C  CE    . MET C 1 15  ? 18.977  -10.532 -48.019  1.00 222.20 ? 15  MET C CE    1 
ATOM   5949  N  N     . CYS C 1 16  ? 20.705  -5.205  -49.185  1.00 158.00 ? 16  CYS C N     1 
ATOM   5950  C  CA    . CYS C 1 16  ? 21.874  -4.858  -50.011  1.00 147.04 ? 16  CYS C CA    1 
ATOM   5951  C  C     . CYS C 1 16  ? 22.633  -6.106  -50.314  1.00 154.68 ? 16  CYS C C     1 
ATOM   5952  O  O     . CYS C 1 16  ? 23.106  -6.802  -49.394  1.00 160.09 ? 16  CYS C O     1 
ATOM   5953  C  CB    . CYS C 1 16  ? 22.926  -3.980  -49.281  1.00 135.99 ? 16  CYS C CB    1 
ATOM   5954  S  SG    . CYS C 1 16  ? 22.636  -2.237  -49.423  1.00 126.05 ? 16  CYS C SG    1 
ATOM   5955  N  N     . LYS C 1 17  ? 22.880  -6.362  -51.591  1.00 148.86 ? 17  LYS C N     1 
ATOM   5956  C  CA    . LYS C 1 17  ? 23.562  -7.602  -51.974  1.00 144.65 ? 17  LYS C CA    1 
ATOM   5957  C  C     . LYS C 1 17  ? 24.818  -7.119  -52.644  1.00 130.35 ? 17  LYS C C     1 
ATOM   5958  O  O     . LYS C 1 17  ? 24.735  -6.424  -53.605  1.00 126.02 ? 17  LYS C O     1 
ATOM   5959  C  CB    . LYS C 1 17  ? 22.706  -8.519  -52.884  1.00 148.02 ? 17  LYS C CB    1 
ATOM   5960  C  CG    . LYS C 1 17  ? 21.496  -9.171  -52.196  1.00 141.73 ? 17  LYS C CG    1 
ATOM   5961  C  CD    . LYS C 1 17  ? 20.582  -9.921  -53.151  1.00 145.48 ? 17  LYS C CD    1 
ATOM   5962  C  CE    . LYS C 1 17  ? 19.616  -9.038  -53.934  1.00 159.39 ? 17  LYS C CE    1 
ATOM   5963  N  NZ    . LYS C 1 17  ? 18.527  -9.858  -54.512  1.00 176.80 ? 17  LYS C NZ    1 
ATOM   5964  N  N     . ALA C 1 18  ? 25.960  -7.328  -52.025  1.00 131.55 ? 18  ALA C N     1 
ATOM   5965  C  CA    . ALA C 1 18  ? 27.186  -6.720  -52.521  1.00 148.79 ? 18  ALA C CA    1 
ATOM   5966  C  C     . ALA C 1 18  ? 28.305  -7.724  -52.480  1.00 165.20 ? 18  ALA C C     1 
ATOM   5967  O  O     . ALA C 1 18  ? 28.311  -8.676  -51.699  1.00 157.30 ? 18  ALA C O     1 
ATOM   5968  C  CB    . ALA C 1 18  ? 27.620  -5.508  -51.710  1.00 148.84 ? 18  ALA C CB    1 
ATOM   5969  N  N     . GLY C 1 19  ? 29.286  -7.515  -53.359  1.00 183.35 ? 19  GLY C N     1 
ATOM   5970  C  CA    . GLY C 1 19  ? 30.415  -8.408  -53.404  1.00 186.71 ? 19  GLY C CA    1 
ATOM   5971  C  C     . GLY C 1 19  ? 31.279  -8.047  -54.578  1.00 176.37 ? 19  GLY C C     1 
ATOM   5972  O  O     . GLY C 1 19  ? 31.007  -7.072  -55.302  1.00 160.20 ? 19  GLY C O     1 
ATOM   5973  N  N     . PHE C 1 20  ? 32.328  -8.831  -54.771  1.00 171.87 ? 20  PHE C N     1 
ATOM   5974  C  CA    . PHE C 1 20  ? 33.206  -8.632  -55.913  1.00 172.08 ? 20  PHE C CA    1 
ATOM   5975  C  C     . PHE C 1 20  ? 32.645  -9.194  -57.203  1.00 190.32 ? 20  PHE C C     1 
ATOM   5976  O  O     . PHE C 1 20  ? 32.261  -10.357 -57.317  1.00 194.18 ? 20  PHE C O     1 
ATOM   5977  C  CB    . PHE C 1 20  ? 34.540  -9.247  -55.641  1.00 165.34 ? 20  PHE C CB    1 
ATOM   5978  C  CG    . PHE C 1 20  ? 35.244  -8.632  -54.482  1.00 172.75 ? 20  PHE C CG    1 
ATOM   5979  C  CD1   . PHE C 1 20  ? 35.937  -7.447  -54.630  1.00 177.01 ? 20  PHE C CD1   1 
ATOM   5980  C  CD2   . PHE C 1 20  ? 35.232  -9.241  -53.249  1.00 183.54 ? 20  PHE C CD2   1 
ATOM   5981  C  CE1   . PHE C 1 20  ? 36.597  -6.877  -53.568  1.00 182.14 ? 20  PHE C CE1   1 
ATOM   5982  C  CE2   . PHE C 1 20  ? 35.895  -8.678  -52.178  1.00 187.85 ? 20  PHE C CE2   1 
ATOM   5983  C  CZ    . PHE C 1 20  ? 36.578  -7.494  -52.339  1.00 185.85 ? 20  PHE C CZ    1 
ATOM   5984  N  N     . ALA C 1 21  ? 32.725  -8.384  -58.248  1.00 191.67 ? 21  ALA C N     1 
ATOM   5985  C  CA    . ALA C 1 21  ? 32.459  -8.866  -59.583  1.00 191.37 ? 21  ALA C CA    1 
ATOM   5986  C  C     . ALA C 1 21  ? 33.441  -9.946  -59.884  1.00 197.62 ? 21  ALA C C     1 
ATOM   5987  O  O     . ALA C 1 21  ? 34.608  -9.799  -59.561  1.00 204.71 ? 21  ALA C O     1 
ATOM   5988  C  CB    . ALA C 1 21  ? 32.690  -7.769  -60.574  1.00 188.87 ? 21  ALA C CB    1 
ATOM   5989  N  N     . GLY C 1 22  ? 32.999  -11.017 -60.532  1.00 196.44 ? 22  GLY C N     1 
ATOM   5990  C  CA    . GLY C 1 22  ? 33.896  -12.091 -60.870  1.00 208.13 ? 22  GLY C CA    1 
ATOM   5991  C  C     . GLY C 1 22  ? 33.751  -13.232 -59.884  1.00 214.50 ? 22  GLY C C     1 
ATOM   5992  O  O     . GLY C 1 22  ? 34.618  -14.063 -59.822  1.00 215.98 ? 22  GLY C O     1 
ATOM   5993  N  N     . ASP C 1 23  ? 32.687  -13.241 -59.091  1.00 209.07 ? 23  ASP C N     1 
ATOM   5994  C  CA    . ASP C 1 23  ? 32.451  -14.320 -58.180  1.00 212.26 ? 23  ASP C CA    1 
ATOM   5995  C  C     . ASP C 1 23  ? 30.998  -14.720 -58.358  1.00 212.50 ? 23  ASP C C     1 
ATOM   5996  O  O     . ASP C 1 23  ? 30.186  -13.960 -58.859  1.00 208.39 ? 23  ASP C O     1 
ATOM   5997  C  CB    . ASP C 1 23  ? 32.746  -13.900 -56.742  1.00 217.09 ? 23  ASP C CB    1 
ATOM   5998  C  CG    . ASP C 1 23  ? 34.217  -13.998 -56.415  1.00 223.83 ? 23  ASP C CG    1 
ATOM   5999  O  OD1   . ASP C 1 23  ? 34.885  -14.778 -57.116  1.00 217.27 ? 23  ASP C OD1   1 
ATOM   6000  O  OD2   . ASP C 1 23  ? 34.720  -13.317 -55.481  1.00 232.41 ? 23  ASP C OD2   1 
ATOM   6001  N  N     . ASP C 1 24  ? 30.694  -15.955 -57.993  1.00 220.04 ? 24  ASP C N     1 
ATOM   6002  C  CA    . ASP C 1 24  ? 29.381  -16.537 -58.214  1.00 227.23 ? 24  ASP C CA    1 
ATOM   6003  C  C     . ASP C 1 24  ? 28.401  -16.178 -57.137  1.00 218.03 ? 24  ASP C C     1 
ATOM   6004  O  O     . ASP C 1 24  ? 27.235  -16.335 -57.388  1.00 219.59 ? 24  ASP C O     1 
ATOM   6005  C  CB    . ASP C 1 24  ? 29.433  -18.089 -58.427  1.00 239.73 ? 24  ASP C CB    1 
ATOM   6006  C  CG    . ASP C 1 24  ? 30.241  -18.838 -57.347  1.00 246.53 ? 24  ASP C CG    1 
ATOM   6007  O  OD1   . ASP C 1 24  ? 30.869  -18.183 -56.482  1.00 245.70 ? 24  ASP C OD1   1 
ATOM   6008  O  OD2   . ASP C 1 24  ? 30.265  -20.085 -57.389  1.00 248.84 ? 24  ASP C OD2   1 
ATOM   6009  N  N     . ALA C 1 25  ? 28.850  -15.745 -55.958  1.00 198.51 ? 25  ALA C N     1 
ATOM   6010  C  CA    . ALA C 1 25  ? 27.936  -15.248 -54.944  1.00 174.08 ? 25  ALA C CA    1 
ATOM   6011  C  C     . ALA C 1 25  ? 28.518  -14.031 -54.268  1.00 156.76 ? 25  ALA C C     1 
ATOM   6012  O  O     . ALA C 1 25  ? 29.721  -13.894 -54.115  1.00 164.17 ? 25  ALA C O     1 
ATOM   6013  C  CB    . ALA C 1 25  ? 27.647  -16.306 -53.881  1.00 169.68 ? 25  ALA C CB    1 
ATOM   6014  N  N     . PRO C 1 26  ? 27.654  -13.144 -53.821  1.00 138.59 ? 26  PRO C N     1 
ATOM   6015  C  CA    . PRO C 1 26  ? 28.061  -11.965 -53.118  1.00 143.49 ? 26  PRO C CA    1 
ATOM   6016  C  C     . PRO C 1 26  ? 28.591  -12.306 -51.754  1.00 166.30 ? 26  PRO C C     1 
ATOM   6017  O  O     . PRO C 1 26  ? 28.025  -13.168 -51.064  1.00 165.17 ? 26  PRO C O     1 
ATOM   6018  C  CB    . PRO C 1 26  ? 26.774  -11.157 -52.942  1.00 129.50 ? 26  PRO C CB    1 
ATOM   6019  C  CG    . PRO C 1 26  ? 25.684  -12.099 -53.232  1.00 131.24 ? 26  PRO C CG    1 
ATOM   6020  C  CD    . PRO C 1 26  ? 26.207  -13.235 -54.010  1.00 130.70 ? 26  PRO C CD    1 
ATOM   6021  N  N     . ARG C 1 27  ? 29.534  -11.505 -51.285  1.00 191.29 ? 27  ARG C N     1 
ATOM   6022  C  CA    . ARG C 1 27  ? 30.101  -11.695 -49.943  1.00 198.80 ? 27  ARG C CA    1 
ATOM   6023  C  C     . ARG C 1 27  ? 29.130  -11.274 -48.889  1.00 185.66 ? 27  ARG C C     1 
ATOM   6024  O  O     . ARG C 1 27  ? 28.940  -11.942 -47.877  1.00 181.81 ? 27  ARG C O     1 
ATOM   6025  C  CB    . ARG C 1 27  ? 31.390  -10.903 -49.724  1.00 213.99 ? 27  ARG C CB    1 
ATOM   6026  C  CG    . ARG C 1 27  ? 32.526  -11.387 -50.600  1.00 244.49 ? 27  ARG C CG    1 
ATOM   6027  C  CD    . ARG C 1 27  ? 33.331  -12.567 -50.022  1.00 254.66 ? 27  ARG C CD    1 
ATOM   6028  N  NE    . ARG C 1 27  ? 34.509  -12.823 -50.861  1.00 265.35 ? 27  ARG C NE    1 
ATOM   6029  C  CZ    . ARG C 1 27  ? 34.475  -13.408 -52.067  1.00 274.96 ? 27  ARG C CZ    1 
ATOM   6030  N  NH1   . ARG C 1 27  ? 33.308  -13.793 -52.575  1.00 284.22 ? 27  ARG C NH1   1 
ATOM   6031  N  NH2   . ARG C 1 27  ? 35.599  -13.606 -52.793  1.00 268.39 ? 27  ARG C NH2   1 
ATOM   6032  N  N     . ALA C 1 28  ? 28.564  -10.091 -49.076  1.00 181.87 ? 28  ALA C N     1 
ATOM   6033  C  CA    . ALA C 1 28  ? 27.746  -9.517  -47.984  1.00 181.42 ? 28  ALA C CA    1 
ATOM   6034  C  C     . ALA C 1 28  ? 26.346  -9.311  -48.471  1.00 176.63 ? 28  ALA C C     1 
ATOM   6035  O  O     . ALA C 1 28  ? 26.152  -8.713  -49.504  1.00 189.38 ? 28  ALA C O     1 
ATOM   6036  C  CB    . ALA C 1 28  ? 28.266  -8.170  -47.526  1.00 181.67 ? 28  ALA C CB    1 
ATOM   6037  N  N     . VAL C 1 29  ? 25.377  -9.775  -47.683  1.00 162.28 ? 29  VAL C N     1 
ATOM   6038  C  CA    . VAL C 1 29  ? 23.977  -9.524  -47.971  1.00 173.13 ? 29  VAL C CA    1 
ATOM   6039  C  C     . VAL C 1 29  ? 23.319  -9.223  -46.659  1.00 157.81 ? 29  VAL C C     1 
ATOM   6040  O  O     . VAL C 1 29  ? 23.339  -10.050 -45.740  1.00 164.47 ? 29  VAL C O     1 
ATOM   6041  C  CB    . VAL C 1 29  ? 23.264  -10.717 -48.627  1.00 199.34 ? 29  VAL C CB    1 
ATOM   6042  C  CG1   . VAL C 1 29  ? 23.829  -10.953 -50.024  1.00 217.82 ? 29  VAL C CG1   1 
ATOM   6043  C  CG2   . VAL C 1 29  ? 23.406  -12.022 -47.837  1.00 194.97 ? 29  VAL C CG2   1 
ATOM   6044  N  N     . PHE C 1 30  ? 22.755  -8.021  -46.500  1.00 126.95 ? 30  PHE C N     1 
ATOM   6045  C  CA    . PHE C 1 30  ? 22.185  -7.644  -45.216  1.00 115.17 ? 30  PHE C CA    1 
ATOM   6046  C  C     . PHE C 1 30  ? 21.034  -6.705  -45.467  1.00 122.61 ? 30  PHE C C     1 
ATOM   6047  O  O     . PHE C 1 30  ? 20.902  -6.111  -46.540  1.00 115.27 ? 30  PHE C O     1 
ATOM   6048  C  CB    . PHE C 1 30  ? 23.212  -6.950  -44.327  1.00 110.37 ? 30  PHE C CB    1 
ATOM   6049  C  CG    . PHE C 1 30  ? 23.782  -5.750  -44.976  1.00 105.32 ? 30  PHE C CG    1 
ATOM   6050  C  CD1   . PHE C 1 30  ? 23.138  -4.550  -44.906  1.00 111.88 ? 30  PHE C CD1   1 
ATOM   6051  C  CD2   . PHE C 1 30  ? 24.930  -5.841  -45.731  1.00 119.39 ? 30  PHE C CD2   1 
ATOM   6052  C  CE1   . PHE C 1 30  ? 23.629  -3.426  -45.542  1.00 118.54 ? 30  PHE C CE1   1 
ATOM   6053  C  CE2   . PHE C 1 30  ? 25.444  -4.730  -46.374  1.00 126.74 ? 30  PHE C CE2   1 
ATOM   6054  C  CZ    . PHE C 1 30  ? 24.785  -3.522  -46.270  1.00 129.53 ? 30  PHE C CZ    1 
ATOM   6055  N  N     . PRO C 1 31  ? 20.178  -6.569  -44.466  1.00 130.88 ? 31  PRO C N     1 
ATOM   6056  C  CA    . PRO C 1 31  ? 18.989  -5.740  -44.698  1.00 117.14 ? 31  PRO C CA    1 
ATOM   6057  C  C     . PRO C 1 31  ? 19.331  -4.257  -44.774  1.00 96.12  ? 31  PRO C C     1 
ATOM   6058  O  O     . PRO C 1 31  ? 20.130  -3.787  -44.031  1.00 87.46  ? 31  PRO C O     1 
ATOM   6059  C  CB    . PRO C 1 31  ? 18.077  -6.096  -43.514  1.00 118.08 ? 31  PRO C CB    1 
ATOM   6060  C  CG    . PRO C 1 31  ? 19.015  -6.719  -42.527  1.00 126.11 ? 31  PRO C CG    1 
ATOM   6061  C  CD    . PRO C 1 31  ? 19.979  -7.480  -43.328  1.00 133.43 ? 31  PRO C CD    1 
ATOM   6062  N  N     . SER C 1 32  ? 18.650  -3.526  -45.659  1.00 97.29  ? 32  SER C N     1 
ATOM   6063  C  CA    . SER C 1 32  ? 18.918  -2.099  -45.852  1.00 99.21  ? 32  SER C CA    1 
ATOM   6064  C  C     . SER C 1 32  ? 18.060  -1.370  -44.896  1.00 92.12  ? 32  SER C C     1 
ATOM   6065  O  O     . SER C 1 32  ? 16.958  -0.925  -45.299  1.00 78.93  ? 32  SER C O     1 
ATOM   6066  C  CB    . SER C 1 32  ? 18.535  -1.609  -47.273  1.00 114.22 ? 32  SER C CB    1 
ATOM   6067  O  OG    . SER C 1 32  ? 19.317  -2.234  -48.266  1.00 138.32 ? 32  SER C OG    1 
ATOM   6068  N  N     . ILE C 1 33  ? 18.523  -1.266  -43.656  1.00 90.27  ? 33  ILE C N     1 
ATOM   6069  C  CA    . ILE C 1 33  ? 17.711  -0.636  -42.634  1.00 84.21  ? 33  ILE C CA    1 
ATOM   6070  C  C     . ILE C 1 33  ? 18.598  0.229   -41.807  1.00 75.34  ? 33  ILE C C     1 
ATOM   6071  O  O     . ILE C 1 33  ? 19.756  -0.045  -41.624  1.00 70.89  ? 33  ILE C O     1 
ATOM   6072  C  CB    . ILE C 1 33  ? 16.950  -1.590  -41.730  1.00 101.47 ? 33  ILE C CB    1 
ATOM   6073  C  CG1   . ILE C 1 33  ? 17.897  -2.677  -41.201  1.00 122.10 ? 33  ILE C CG1   1 
ATOM   6074  C  CG2   . ILE C 1 33  ? 15.733  -2.117  -42.475  1.00 115.86 ? 33  ILE C CG2   1 
ATOM   6075  C  CD1   . ILE C 1 33  ? 17.262  -3.637  -40.234  1.00 131.86 ? 33  ILE C CD1   1 
ATOM   6076  N  N     . VAL C 1 34  ? 18.058  1.365   -41.407  1.00 76.70  ? 34  VAL C N     1 
ATOM   6077  C  CA    . VAL C 1 34  ? 18.762  2.321   -40.557  1.00 85.01  ? 34  VAL C CA    1 
ATOM   6078  C  C     . VAL C 1 34  ? 17.903  2.465   -39.328  1.00 91.92  ? 34  VAL C C     1 
ATOM   6079  O  O     . VAL C 1 34  ? 16.878  3.123   -39.328  1.00 89.95  ? 34  VAL C O     1 
ATOM   6080  C  CB    . VAL C 1 34  ? 18.925  3.691   -41.248  1.00 90.77  ? 34  VAL C CB    1 
ATOM   6081  C  CG1   . VAL C 1 34  ? 19.350  4.821   -40.288  1.00 89.76  ? 34  VAL C CG1   1 
ATOM   6082  C  CG2   . VAL C 1 34  ? 19.878  3.556   -42.426  1.00 84.97  ? 34  VAL C CG2   1 
ATOM   6083  N  N     . GLY C 1 35  ? 18.340  1.818   -38.265  1.00 112.63 ? 35  GLY C N     1 
ATOM   6084  C  CA    . GLY C 1 35  ? 17.574  1.896   -37.036  1.00 128.37 ? 35  GLY C CA    1 
ATOM   6085  C  C     . GLY C 1 35  ? 18.133  3.026   -36.229  1.00 127.35 ? 35  GLY C C     1 
ATOM   6086  O  O     . GLY C 1 35  ? 19.343  3.277   -36.210  1.00 140.04 ? 35  GLY C O     1 
ATOM   6087  N  N     . ARG C 1 36  ? 17.247  3.723   -35.524  1.00 113.12 ? 36  ARG C N     1 
ATOM   6088  C  CA    . ARG C 1 36  ? 17.650  4.818   -34.653  1.00 117.28 ? 36  ARG C CA    1 
ATOM   6089  C  C     . ARG C 1 36  ? 17.116  4.568   -33.267  1.00 109.44 ? 36  ARG C C     1 
ATOM   6090  O  O     . ARG C 1 36  ? 16.061  4.055   -33.090  1.00 110.37 ? 36  ARG C O     1 
ATOM   6091  C  CB    . ARG C 1 36  ? 17.113  6.191   -35.137  1.00 132.07 ? 36  ARG C CB    1 
ATOM   6092  C  CG    . ARG C 1 36  ? 17.642  6.654   -36.486  1.00 141.55 ? 36  ARG C CG    1 
ATOM   6093  C  CD    . ARG C 1 36  ? 17.255  8.042   -36.930  1.00 142.08 ? 36  ARG C CD    1 
ATOM   6094  N  NE    . ARG C 1 36  ? 17.741  8.230   -38.319  1.00 145.82 ? 36  ARG C NE    1 
ATOM   6095  C  CZ    . ARG C 1 36  ? 19.009  8.504   -38.637  1.00 142.81 ? 36  ARG C CZ    1 
ATOM   6096  N  NH1   . ARG C 1 36  ? 19.887  8.686   -37.651  1.00 132.64 ? 36  ARG C NH1   1 
ATOM   6097  N  NH2   . ARG C 1 36  ? 19.400  8.622   -39.916  1.00 143.29 ? 36  ARG C NH2   1 
ATOM   6098  N  N     . PRO C 1 37  ? 17.902  4.887   -32.278  1.00 108.44 ? 37  PRO C N     1 
ATOM   6099  C  CA    . PRO C 1 37  ? 17.472  4.796   -30.917  1.00 102.78 ? 37  PRO C CA    1 
ATOM   6100  C  C     . PRO C 1 37  ? 16.383  5.830   -30.636  1.00 79.92  ? 37  PRO C C     1 
ATOM   6101  O  O     . PRO C 1 37  ? 16.611  7.014   -30.542  1.00 62.88  ? 37  PRO C O     1 
ATOM   6102  C  CB    . PRO C 1 37  ? 18.760  5.009   -30.100  1.00 118.50 ? 37  PRO C CB    1 
ATOM   6103  C  CG    . PRO C 1 37  ? 19.730  5.556   -31.063  1.00 125.37 ? 37  PRO C CG    1 
ATOM   6104  C  CD    . PRO C 1 37  ? 19.343  4.996   -32.389  1.00 119.46 ? 37  PRO C CD    1 
ATOM   6105  N  N     . ARG C 1 38  ? 15.165  5.313   -30.592  1.00 95.72  ? 38  ARG C N     1 
ATOM   6106  C  CA    . ARG C 1 38  ? 13.960  6.064   -30.259  1.00 116.34 ? 38  ARG C CA    1 
ATOM   6107  C  C     . ARG C 1 38  ? 13.877  6.332   -28.793  1.00 113.55 ? 38  ARG C C     1 
ATOM   6108  O  O     . ARG C 1 38  ? 13.443  7.396   -28.381  1.00 100.94 ? 38  ARG C O     1 
ATOM   6109  C  CB    . ARG C 1 38  ? 12.699  5.304   -30.783  1.00 135.20 ? 38  ARG C CB    1 
ATOM   6110  C  CG    . ARG C 1 38  ? 11.358  5.541   -30.070  1.00 139.63 ? 38  ARG C CG    1 
ATOM   6111  C  CD    . ARG C 1 38  ? 10.449  4.307   -30.095  1.00 143.12 ? 38  ARG C CD    1 
ATOM   6112  N  NE    . ARG C 1 38  ? 11.178  3.099   -29.642  1.00 134.34 ? 38  ARG C NE    1 
ATOM   6113  C  CZ    . ARG C 1 38  ? 10.606  1.911   -29.453  1.00 152.97 ? 38  ARG C CZ    1 
ATOM   6114  N  NH1   . ARG C 1 38  ? 9.300   1.797   -29.626  1.00 156.45 ? 38  ARG C NH1   1 
ATOM   6115  N  NH2   . ARG C 1 38  ? 11.318  0.843   -29.046  1.00 162.00 ? 38  ARG C NH2   1 
ATOM   6116  N  N     . HIS C 1 39  ? 14.262  5.356   -27.977  1.00 119.21 ? 39  HIS C N     1 
ATOM   6117  C  CA    . HIS C 1 39  ? 14.281  5.588   -26.516  1.00 126.92 ? 39  HIS C CA    1 
ATOM   6118  C  C     . HIS C 1 39  ? 15.559  6.133   -25.946  1.00 141.06 ? 39  HIS C C     1 
ATOM   6119  O  O     . HIS C 1 39  ? 16.628  5.542   -26.176  1.00 136.04 ? 39  HIS C O     1 
ATOM   6120  C  CB    . HIS C 1 39  ? 14.049  4.271   -25.761  1.00 125.31 ? 39  HIS C CB    1 
ATOM   6121  C  CG    . HIS C 1 39  ? 12.676  3.682   -25.950  1.00 162.16 ? 39  HIS C CG    1 
ATOM   6122  N  ND1   . HIS C 1 39  ? 11.520  4.396   -25.712  1.00 195.49 ? 39  HIS C ND1   1 
ATOM   6123  C  CD2   . HIS C 1 39  ? 12.280  2.453   -26.354  1.00 176.07 ? 39  HIS C CD2   1 
ATOM   6124  C  CE1   . HIS C 1 39  ? 10.468  3.633   -25.960  1.00 206.86 ? 39  HIS C CE1   1 
ATOM   6125  N  NE2   . HIS C 1 39  ? 10.901  2.444   -26.344  1.00 199.54 ? 39  HIS C NE2   1 
ATOM   6126  N  N     . GLN C 1 40  ? 15.449  7.202   -25.133  1.00 161.81 ? 40  GLN C N     1 
ATOM   6127  C  CA    . GLN C 1 40  ? 16.632  7.844   -24.573  1.00 167.23 ? 40  GLN C CA    1 
ATOM   6128  C  C     . GLN C 1 40  ? 17.296  6.901   -23.561  1.00 127.80 ? 40  GLN C C     1 
ATOM   6129  O  O     . GLN C 1 40  ? 16.653  6.325   -22.694  1.00 94.43  ? 40  GLN C O     1 
ATOM   6130  C  CB    . GLN C 1 40  ? 16.400  9.233   -23.975  1.00 207.14 ? 40  GLN C CB    1 
ATOM   6131  C  CG    . GLN C 1 40  ? 15.508  9.259   -22.759  1.00 230.12 ? 40  GLN C CG    1 
ATOM   6132  C  CD    . GLN C 1 40  ? 15.469  10.633  -22.091  1.00 243.16 ? 40  GLN C CD    1 
ATOM   6133  O  OE1   . GLN C 1 40  ? 15.997  11.616  -22.619  1.00 265.52 ? 40  GLN C OE1   1 
ATOM   6134  N  NE2   . GLN C 1 40  ? 14.829  10.708  -20.932  1.00 232.47 ? 40  GLN C NE2   1 
ATOM   6135  N  N     . GLY C 1 41  ? 18.575  6.656   -23.783  1.00 118.00 ? 41  GLY C N     1 
ATOM   6136  C  CA    . GLY C 1 41  ? 19.283  5.702   -22.981  1.00 117.95 ? 41  GLY C CA    1 
ATOM   6137  C  C     . GLY C 1 41  ? 19.772  6.347   -21.707  1.00 119.32 ? 41  GLY C C     1 
ATOM   6138  O  O     . GLY C 1 41  ? 20.122  7.529   -21.702  1.00 122.52 ? 41  GLY C O     1 
ATOM   6139  N  N     . VAL C 1 42  ? 19.786  5.571   -20.626  1.00 109.94 ? 42  VAL C N     1 
ATOM   6140  C  CA    . VAL C 1 42  ? 20.323  6.034   -19.378  1.00 103.26 ? 42  VAL C CA    1 
ATOM   6141  C  C     . VAL C 1 42  ? 21.222  4.993   -18.798  1.00 92.83  ? 42  VAL C C     1 
ATOM   6142  O  O     . VAL C 1 42  ? 20.775  4.067   -18.126  1.00 71.14  ? 42  VAL C O     1 
ATOM   6143  C  CB    . VAL C 1 42  ? 19.229  6.388   -18.408  1.00 127.96 ? 42  VAL C CB    1 
ATOM   6144  C  CG1   . VAL C 1 42  ? 19.864  6.850   -17.088  1.00 141.65 ? 42  VAL C CG1   1 
ATOM   6145  C  CG2   . VAL C 1 42  ? 18.322  7.447   -19.074  1.00 146.53 ? 42  VAL C CG2   1 
ATOM   6146  N  N     . MET C 1 43  ? 22.496  5.179   -19.117  1.00 112.70 ? 43  MET C N     1 
ATOM   6147  C  CA    . MET C 1 43  ? 23.644  4.534   -18.477  1.00 125.07 ? 43  MET C CA    1 
ATOM   6148  C  C     . MET C 1 43  ? 24.784  5.548   -18.705  1.00 125.95 ? 43  MET C C     1 
ATOM   6149  O  O     . MET C 1 43  ? 24.553  6.724   -18.995  1.00 117.67 ? 43  MET C O     1 
ATOM   6150  C  CB    . MET C 1 43  ? 24.013  3.218   -19.137  1.00 128.17 ? 43  MET C CB    1 
ATOM   6151  C  CG    . MET C 1 43  ? 22.924  2.205   -19.290  1.00 134.80 ? 43  MET C CG    1 
ATOM   6152  S  SD    . MET C 1 43  ? 22.559  1.138   -17.910  1.00 115.61 ? 43  MET C SD    1 
ATOM   6153  C  CE    . MET C 1 43  ? 23.972  0.066   -18.092  1.00 117.09 ? 43  MET C CE    1 
ATOM   6154  N  N     . VAL C 1 44  ? 26.016  5.094   -18.564  1.00 130.30 ? 44  VAL C N     1 
ATOM   6155  C  CA    . VAL C 1 44  ? 27.151  5.817   -19.049  1.00 144.67 ? 44  VAL C CA    1 
ATOM   6156  C  C     . VAL C 1 44  ? 28.048  4.777   -19.719  1.00 152.21 ? 44  VAL C C     1 
ATOM   6157  O  O     . VAL C 1 44  ? 28.092  3.632   -19.277  1.00 149.61 ? 44  VAL C O     1 
ATOM   6158  C  CB    . VAL C 1 44  ? 27.885  6.490   -17.881  1.00 142.91 ? 44  VAL C CB    1 
ATOM   6159  C  CG1   . VAL C 1 44  ? 29.177  7.148   -18.382  1.00 149.20 ? 44  VAL C CG1   1 
ATOM   6160  C  CG2   . VAL C 1 44  ? 26.942  7.456   -17.145  1.00 135.73 ? 44  VAL C CG2   1 
ATOM   6161  N  N     . GLY C 1 45  ? 28.776  5.196   -20.746  1.00 139.32 ? 45  GLY C N     1 
ATOM   6162  C  CA    . GLY C 1 45  ? 29.605  4.279   -21.484  1.00 141.55 ? 45  GLY C CA    1 
ATOM   6163  C  C     . GLY C 1 45  ? 28.717  3.370   -22.309  1.00 161.57 ? 45  GLY C C     1 
ATOM   6164  O  O     . GLY C 1 45  ? 28.998  2.175   -22.428  1.00 187.65 ? 45  GLY C O     1 
ATOM   6165  N  N     . MET C 1 46  ? 27.613  3.924   -22.824  1.00 161.89 ? 46  MET C N     1 
ATOM   6166  C  CA    . MET C 1 46  ? 26.925  3.354   -23.995  1.00 170.74 ? 46  MET C CA    1 
ATOM   6167  C  C     . MET C 1 46  ? 27.402  4.024   -25.250  1.00 184.89 ? 46  MET C C     1 
ATOM   6168  O  O     . MET C 1 46  ? 27.681  5.224   -25.243  1.00 191.43 ? 46  MET C O     1 
ATOM   6169  C  CB    . MET C 1 46  ? 25.419  3.590   -23.965  1.00 182.76 ? 46  MET C CB    1 
ATOM   6170  C  CG    . MET C 1 46  ? 24.750  2.863   -22.851  1.00 203.54 ? 46  MET C CG    1 
ATOM   6171  S  SD    . MET C 1 46  ? 22.980  3.069   -23.047  1.00 222.57 ? 46  MET C SD    1 
ATOM   6172  C  CE    . MET C 1 46  ? 22.869  4.730   -22.445  1.00 229.26 ? 46  MET C CE    1 
ATOM   6173  N  N     . GLY C 1 47  ? 27.449  3.253   -26.334  1.00 196.97 ? 47  GLY C N     1 
ATOM   6174  C  CA    . GLY C 1 47  ? 27.538  3.779   -27.700  1.00 210.26 ? 47  GLY C CA    1 
ATOM   6175  C  C     . GLY C 1 47  ? 28.358  5.056   -27.929  1.00 217.06 ? 47  GLY C C     1 
ATOM   6176  O  O     . GLY C 1 47  ? 29.590  4.981   -27.898  1.00 238.28 ? 47  GLY C O     1 
ATOM   6177  N  N     . GLN C 1 48  ? 27.739  6.224   -28.150  1.00 189.86 ? 48  GLN C N     1 
ATOM   6178  C  CA    . GLN C 1 48  ? 26.266  6.412   -28.174  1.00 174.08 ? 48  GLN C CA    1 
ATOM   6179  C  C     . GLN C 1 48  ? 25.680  5.844   -29.454  1.00 167.37 ? 48  GLN C C     1 
ATOM   6180  O  O     . GLN C 1 48  ? 24.604  5.232   -29.427  1.00 177.49 ? 48  GLN C O     1 
ATOM   6181  C  CB    . GLN C 1 48  ? 25.862  7.887   -28.044  1.00 178.03 ? 48  GLN C CB    1 
ATOM   6182  C  CG    . GLN C 1 48  ? 26.071  8.466   -26.656  1.00 181.58 ? 48  GLN C CG    1 
ATOM   6183  C  CD    . GLN C 1 48  ? 25.487  9.851   -26.531  1.00 189.16 ? 48  GLN C CD    1 
ATOM   6184  O  OE1   . GLN C 1 48  ? 25.156  10.500  -27.527  1.00 188.07 ? 48  GLN C OE1   1 
ATOM   6185  N  NE2   . GLN C 1 48  ? 25.362  10.325  -25.297  1.00 193.50 ? 48  GLN C NE2   1 
ATOM   6186  N  N     . LYS C 1 49  ? 26.403  6.055   -30.563  1.00 152.64 ? 49  LYS C N     1 
ATOM   6187  C  CA    . LYS C 1 49  ? 26.034  5.594   -31.921  1.00 135.60 ? 49  LYS C CA    1 
ATOM   6188  C  C     . LYS C 1 49  ? 24.645  6.087   -32.297  1.00 127.70 ? 49  LYS C C     1 
ATOM   6189  O  O     . LYS C 1 49  ? 23.662  5.509   -31.881  1.00 127.29 ? 49  LYS C O     1 
ATOM   6190  C  CB    . LYS C 1 49  ? 26.091  4.071   -32.063  1.00 149.09 ? 49  LYS C CB    1 
ATOM   6191  C  CG    . LYS C 1 49  ? 27.481  3.458   -32.096  1.00 173.48 ? 49  LYS C CG    1 
ATOM   6192  C  CD    . LYS C 1 49  ? 27.454  1.920   -31.889  1.00 202.96 ? 49  LYS C CD    1 
ATOM   6193  C  CE    . LYS C 1 49  ? 28.847  1.327   -31.641  1.00 217.54 ? 49  LYS C CE    1 
ATOM   6194  N  NZ    . LYS C 1 49  ? 28.819  -0.132  -31.320  1.00 223.94 ? 49  LYS C NZ    1 
ATOM   6195  N  N     . ASP C 1 50  ? 24.597  7.162   -33.071  1.00 142.49 ? 50  ASP C N     1 
ATOM   6196  C  CA    . ASP C 1 50  ? 23.395  7.826   -33.449  1.00 163.14 ? 50  ASP C CA    1 
ATOM   6197  C  C     . ASP C 1 50  ? 22.450  6.893   -34.151  1.00 162.99 ? 50  ASP C C     1 
ATOM   6198  O  O     . ASP C 1 50  ? 21.270  7.089   -34.059  1.00 168.92 ? 50  ASP C O     1 
ATOM   6199  C  CB    . ASP C 1 50  ? 23.742  8.949   -34.427  1.00 179.72 ? 50  ASP C CB    1 
ATOM   6200  C  CG    . ASP C 1 50  ? 22.520  9.743   -34.916  1.00 184.40 ? 50  ASP C CG    1 
ATOM   6201  O  OD1   . ASP C 1 50  ? 21.638  10.131  -34.107  1.00 196.04 ? 50  ASP C OD1   1 
ATOM   6202  O  OD2   . ASP C 1 50  ? 22.449  9.958   -36.148  1.00 165.76 ? 50  ASP C OD2   1 
ATOM   6203  N  N     . SER C 1 51  ? 22.967  5.907   -34.842  1.00 143.14 ? 51  SER C N     1 
ATOM   6204  C  CA    . SER C 1 51  ? 22.074  4.961   -35.468  1.00 117.63 ? 51  SER C CA    1 
ATOM   6205  C  C     . SER C 1 51  ? 22.817  3.741   -35.847  1.00 100.09 ? 51  SER C C     1 
ATOM   6206  O  O     . SER C 1 51  ? 24.026  3.772   -35.976  1.00 96.71  ? 51  SER C O     1 
ATOM   6207  C  CB    . SER C 1 51  ? 21.500  5.560   -36.733  1.00 133.37 ? 51  SER C CB    1 
ATOM   6208  O  OG    . SER C 1 51  ? 20.587  4.673   -37.330  1.00 146.99 ? 51  SER C OG    1 
ATOM   6209  N  N     . TYR C 1 52  ? 22.071  2.667   -36.125  1.00 95.81  ? 52  TYR C N     1 
ATOM   6210  C  CA    . TYR C 1 52  ? 22.606  1.398   -36.535  1.00 105.30 ? 52  TYR C CA    1 
ATOM   6211  C  C     . TYR C 1 52  ? 22.135  1.031   -37.930  1.00 109.90 ? 52  TYR C C     1 
ATOM   6212  O  O     . TYR C 1 52  ? 21.120  1.438   -38.406  1.00 101.80 ? 52  TYR C O     1 
ATOM   6213  C  CB    . TYR C 1 52  ? 22.196  0.320   -35.555  1.00 107.26 ? 52  TYR C CB    1 
ATOM   6214  C  CG    . TYR C 1 52  ? 22.613  0.544   -34.139  1.00 120.12 ? 52  TYR C CG    1 
ATOM   6215  C  CD1   . TYR C 1 52  ? 23.776  1.224   -33.828  1.00 118.51 ? 52  TYR C CD1   1 
ATOM   6216  C  CD2   . TYR C 1 52  ? 21.880  -0.015  -33.108  1.00 127.79 ? 52  TYR C CD2   1 
ATOM   6217  C  CE1   . TYR C 1 52  ? 24.161  1.391   -32.521  1.00 102.27 ? 52  TYR C CE1   1 
ATOM   6218  C  CE2   . TYR C 1 52  ? 22.272  0.161   -31.798  1.00 113.41 ? 52  TYR C CE2   1 
ATOM   6219  C  CZ    . TYR C 1 52  ? 23.426  0.854   -31.510  1.00 100.04 ? 52  TYR C CZ    1 
ATOM   6220  O  OH    . TYR C 1 52  ? 23.806  1.011   -30.168  1.00 107.72 ? 52  TYR C OH    1 
ATOM   6221  N  N     . VAL C 1 53  ? 23.009  0.344   -38.641  1.00 126.55 ? 53  VAL C N     1 
ATOM   6222  C  CA    . VAL C 1 53  ? 22.763  0.007   -40.050  1.00 118.35 ? 53  VAL C CA    1 
ATOM   6223  C  C     . VAL C 1 53  ? 23.088  -1.430  -40.255  1.00 109.13 ? 53  VAL C C     1 
ATOM   6224  O  O     . VAL C 1 53  ? 24.016  -1.965  -39.636  1.00 109.90 ? 53  VAL C O     1 
ATOM   6225  C  CB    . VAL C 1 53  ? 23.695  0.783   -40.966  1.00 129.65 ? 53  VAL C CB    1 
ATOM   6226  C  CG1   . VAL C 1 53  ? 23.500  0.318   -42.400  1.00 135.34 ? 53  VAL C CG1   1 
ATOM   6227  C  CG2   . VAL C 1 53  ? 23.453  2.305   -40.772  1.00 145.18 ? 53  VAL C CG2   1 
ATOM   6228  N  N     . GLY C 1 54  ? 22.348  -2.089  -41.152  1.00 101.44 ? 54  GLY C N     1 
ATOM   6229  C  CA    . GLY C 1 54  ? 22.560  -3.520  -41.438  1.00 105.23 ? 54  GLY C CA    1 
ATOM   6230  C  C     . GLY C 1 54  ? 22.166  -4.412  -40.310  1.00 96.98  ? 54  GLY C C     1 
ATOM   6231  O  O     . GLY C 1 54  ? 21.610  -3.938  -39.349  1.00 99.50  ? 54  GLY C O     1 
ATOM   6232  N  N     . ASP C 1 55  ? 22.470  -5.695  -40.450  1.00 112.68 ? 55  ASP C N     1 
ATOM   6233  C  CA    . ASP C 1 55  ? 21.948  -6.722  -39.539  1.00 142.07 ? 55  ASP C CA    1 
ATOM   6234  C  C     . ASP C 1 55  ? 22.270  -6.467  -38.061  1.00 140.61 ? 55  ASP C C     1 
ATOM   6235  O  O     . ASP C 1 55  ? 21.672  -7.040  -37.152  1.00 141.75 ? 55  ASP C O     1 
ATOM   6236  C  CB    . ASP C 1 55  ? 22.335  -8.153  -39.964  1.00 178.69 ? 55  ASP C CB    1 
ATOM   6237  C  CG    . ASP C 1 55  ? 23.803  -8.304  -40.121  1.00 217.63 ? 55  ASP C CG    1 
ATOM   6238  O  OD1   . ASP C 1 55  ? 24.455  -7.242  -40.151  1.00 236.19 ? 55  ASP C OD1   1 
ATOM   6239  O  OD2   . ASP C 1 55  ? 24.290  -9.445  -40.214  1.00 244.51 ? 55  ASP C OD2   1 
ATOM   6240  N  N     . GLU C 1 56  ? 23.120  -5.467  -37.842  1.00 144.39 ? 56  GLU C N     1 
ATOM   6241  C  CA    . GLU C 1 56  ? 23.242  -4.875  -36.514  1.00 160.39 ? 56  GLU C CA    1 
ATOM   6242  C  C     . GLU C 1 56  ? 21.881  -4.455  -36.004  1.00 139.11 ? 56  GLU C C     1 
ATOM   6243  O  O     . GLU C 1 56  ? 21.516  -4.709  -34.847  1.00 143.22 ? 56  GLU C O     1 
ATOM   6244  C  CB    . GLU C 1 56  ? 24.144  -3.631  -36.529  1.00 168.96 ? 56  GLU C CB    1 
ATOM   6245  C  CG    . GLU C 1 56  ? 24.387  -2.992  -35.163  1.00 180.54 ? 56  GLU C CG    1 
ATOM   6246  C  CD    . GLU C 1 56  ? 25.334  -1.816  -35.230  1.00 198.65 ? 56  GLU C CD    1 
ATOM   6247  O  OE1   . GLU C 1 56  ? 25.712  -1.392  -36.348  1.00 206.89 ? 56  GLU C OE1   1 
ATOM   6248  O  OE2   . GLU C 1 56  ? 25.704  -1.313  -34.148  1.00 209.69 ? 56  GLU C OE2   1 
ATOM   6249  N  N     . ALA C 1 57  ? 21.133  -3.780  -36.868  1.00 116.59 ? 57  ALA C N     1 
ATOM   6250  C  CA    . ALA C 1 57  ? 19.809  -3.300  -36.510  1.00 110.10 ? 57  ALA C CA    1 
ATOM   6251  C  C     . ALA C 1 57  ? 18.890  -4.433  -36.194  1.00 102.61 ? 57  ALA C C     1 
ATOM   6252  O  O     . ALA C 1 57  ? 18.130  -4.320  -35.262  1.00 118.95 ? 57  ALA C O     1 
ATOM   6253  C  CB    . ALA C 1 57  ? 19.220  -2.476  -37.632  1.00 111.68 ? 57  ALA C CB    1 
ATOM   6254  N  N     . GLN C 1 58  ? 18.966  -5.512  -36.958  1.00 102.27 ? 58  GLN C N     1 
ATOM   6255  C  CA    . GLN C 1 58  ? 18.167  -6.699  -36.693  1.00 132.09 ? 58  GLN C CA    1 
ATOM   6256  C  C     . GLN C 1 58  ? 18.446  -7.248  -35.296  1.00 137.91 ? 58  GLN C C     1 
ATOM   6257  O  O     . GLN C 1 58  ? 17.543  -7.580  -34.529  1.00 113.41 ? 58  GLN C O     1 
ATOM   6258  C  CB    . GLN C 1 58  ? 18.509  -7.847  -37.675  1.00 153.91 ? 58  GLN C CB    1 
ATOM   6259  C  CG    . GLN C 1 58  ? 18.157  -7.557  -39.100  1.00 165.31 ? 58  GLN C CG    1 
ATOM   6260  C  CD    . GLN C 1 58  ? 16.659  -7.547  -39.328  1.00 193.73 ? 58  GLN C CD    1 
ATOM   6261  O  OE1   . GLN C 1 58  ? 15.918  -8.427  -38.869  1.00 192.49 ? 58  GLN C OE1   1 
ATOM   6262  N  NE2   . GLN C 1 58  ? 16.202  -6.537  -40.037  1.00 211.35 ? 58  GLN C NE2   1 
ATOM   6263  N  N     . SER C 1 59  ? 19.735  -7.315  -34.987  1.00 165.12 ? 59  SER C N     1 
ATOM   6264  C  CA    . SER C 1 59  ? 20.139  -7.772  -33.642  1.00 175.61 ? 59  SER C CA    1 
ATOM   6265  C  C     . SER C 1 59  ? 19.511  -6.909  -32.530  1.00 147.15 ? 59  SER C C     1 
ATOM   6266  O  O     . SER C 1 59  ? 18.848  -7.406  -31.614  1.00 114.32 ? 59  SER C O     1 
ATOM   6267  C  CB    . SER C 1 59  ? 21.665  -7.863  -33.465  1.00 188.57 ? 59  SER C CB    1 
ATOM   6268  O  OG    . SER C 1 59  ? 21.969  -8.476  -32.247  1.00 180.31 ? 59  SER C OG    1 
ATOM   6269  N  N     . LYS C 1 60  ? 19.662  -5.590  -32.639  1.00 133.41 ? 60  LYS C N     1 
ATOM   6270  C  CA    . LYS C 1 60  ? 19.162  -4.676  -31.613  1.00 116.11 ? 60  LYS C CA    1 
ATOM   6271  C  C     . LYS C 1 60  ? 17.894  -4.042  -32.140  1.00 98.42  ? 60  LYS C C     1 
ATOM   6272  O  O     . LYS C 1 60  ? 17.910  -2.861  -32.448  1.00 102.94 ? 60  LYS C O     1 
ATOM   6273  C  CB    . LYS C 1 60  ? 20.222  -3.604  -31.286  1.00 113.58 ? 60  LYS C CB    1 
ATOM   6274  C  CG    . LYS C 1 60  ? 21.491  -4.118  -30.587  1.00 127.69 ? 60  LYS C CG    1 
ATOM   6275  C  CD    . LYS C 1 60  ? 22.414  -2.992  -30.089  1.00 145.57 ? 60  LYS C CD    1 
ATOM   6276  C  CE    . LYS C 1 60  ? 23.728  -3.488  -29.485  1.00 167.98 ? 60  LYS C CE    1 
ATOM   6277  N  NZ    . LYS C 1 60  ? 24.593  -2.345  -29.080  1.00 181.03 ? 60  LYS C NZ    1 
ATOM   6278  N  N     . ARG C 1 61  ? 16.796  -4.788  -32.234  1.00 83.63  ? 61  ARG C N     1 
ATOM   6279  C  CA    . ARG C 1 61  ? 15.565  -4.339  -32.922  1.00 84.73  ? 61  ARG C CA    1 
ATOM   6280  C  C     . ARG C 1 61  ? 14.597  -3.507  -32.043  1.00 82.19  ? 61  ARG C C     1 
ATOM   6281  O  O     . ARG C 1 61  ? 13.962  -2.524  -32.499  1.00 60.54  ? 61  ARG C O     1 
ATOM   6282  C  CB    . ARG C 1 61  ? 14.852  -5.584  -33.434  1.00 84.48  ? 61  ARG C CB    1 
ATOM   6283  C  CG    . ARG C 1 61  ? 13.829  -5.399  -34.544  1.00 89.98  ? 61  ARG C CG    1 
ATOM   6284  C  CD    . ARG C 1 61  ? 13.362  -6.724  -35.027  1.00 104.13 ? 61  ARG C CD    1 
ATOM   6285  N  NE    . ARG C 1 61  ? 14.525  -7.557  -35.395  1.00 129.83 ? 61  ARG C NE    1 
ATOM   6286  C  CZ    . ARG C 1 61  ? 14.469  -8.866  -35.623  1.00 158.59 ? 61  ARG C CZ    1 
ATOM   6287  N  NH1   . ARG C 1 61  ? 13.302  -9.455  -35.538  1.00 161.85 ? 61  ARG C NH1   1 
ATOM   6288  N  NH2   . ARG C 1 61  ? 15.569  -9.582  -35.941  1.00 170.66 ? 61  ARG C NH2   1 
ATOM   6289  N  N     . GLY C 1 62  ? 14.476  -3.980  -30.809  1.00 89.53  ? 62  GLY C N     1 
ATOM   6290  C  CA    . GLY C 1 62  ? 13.437  -3.527  -29.907  1.00 90.58  ? 62  GLY C CA    1 
ATOM   6291  C  C     . GLY C 1 62  ? 13.543  -2.069  -29.589  1.00 96.25  ? 62  GLY C C     1 
ATOM   6292  O  O     . GLY C 1 62  ? 12.520  -1.374  -29.577  1.00 98.47  ? 62  GLY C O     1 
ATOM   6293  N  N     . ILE C 1 63  ? 14.785  -1.600  -29.400  1.00 108.10 ? 63  ILE C N     1 
ATOM   6294  C  CA    . ILE C 1 63  ? 15.108  -0.237  -29.051  1.00 129.32 ? 63  ILE C CA    1 
ATOM   6295  C  C     . ILE C 1 63  ? 14.858  0.687   -30.239  1.00 113.94 ? 63  ILE C C     1 
ATOM   6296  O  O     . ILE C 1 63  ? 14.307  1.764   -30.061  1.00 93.47  ? 63  ILE C O     1 
ATOM   6297  C  CB    . ILE C 1 63  ? 16.583  -0.158  -28.660  1.00 146.61 ? 63  ILE C CB    1 
ATOM   6298  C  CG1   . ILE C 1 63  ? 16.836  -1.096  -27.476  1.00 160.15 ? 63  ILE C CG1   1 
ATOM   6299  C  CG2   . ILE C 1 63  ? 16.971  1.293   -28.411  1.00 161.10 ? 63  ILE C CG2   1 
ATOM   6300  C  CD1   . ILE C 1 63  ? 15.874  -0.897  -26.319  1.00 175.81 ? 63  ILE C CD1   1 
ATOM   6301  N  N     . LEU C 1 64  ? 15.271  0.243   -31.412  1.00 105.64 ? 64  LEU C N     1 
ATOM   6302  C  CA    . LEU C 1 64  ? 15.317  1.093   -32.557  1.00 104.45 ? 64  LEU C CA    1 
ATOM   6303  C  C     . LEU C 1 64  ? 13.992  1.175   -33.195  1.00 133.52 ? 64  LEU C C     1 
ATOM   6304  O  O     . LEU C 1 64  ? 13.197  0.259   -33.047  1.00 153.18 ? 64  LEU C O     1 
ATOM   6305  C  CB    . LEU C 1 64  ? 16.221  0.460   -33.565  1.00 94.08  ? 64  LEU C CB    1 
ATOM   6306  C  CG    . LEU C 1 64  ? 17.727  0.500   -33.304  1.00 101.29 ? 64  LEU C CG    1 
ATOM   6307  C  CD1   . LEU C 1 64  ? 18.071  0.148   -31.866  1.00 104.11 ? 64  LEU C CD1   1 
ATOM   6308  C  CD2   . LEU C 1 64  ? 18.499  -0.359  -34.333  1.00 119.63 ? 64  LEU C CD2   1 
ATOM   6309  N  N     . THR C 1 65  ? 13.786  2.262   -33.937  1.00 133.00 ? 65  THR C N     1 
ATOM   6310  C  CA    . THR C 1 65  ? 12.746  2.361   -34.933  1.00 118.20 ? 65  THR C CA    1 
ATOM   6311  C  C     . THR C 1 65  ? 13.502  2.200   -36.203  1.00 113.83 ? 65  THR C C     1 
ATOM   6312  O  O     . THR C 1 65  ? 14.594  2.736   -36.382  1.00 115.92 ? 65  THR C O     1 
ATOM   6313  C  CB    . THR C 1 65  ? 12.006  3.710   -34.912  1.00 106.99 ? 65  THR C CB    1 
ATOM   6314  O  OG1   . THR C 1 65  ? 11.133  3.801   -36.036  1.00 120.96 ? 65  THR C OG1   1 
ATOM   6315  C  CG2   . THR C 1 65  ? 12.949  4.885   -34.963  1.00 121.14 ? 65  THR C CG2   1 
ATOM   6316  N  N     . LEU C 1 66  ? 12.951  1.421   -37.105  1.00 103.46 ? 66  LEU C N     1 
ATOM   6317  C  CA    . LEU C 1 66  ? 13.702  1.129   -38.297  1.00 98.76  ? 66  LEU C CA    1 
ATOM   6318  C  C     . LEU C 1 66  ? 13.076  1.894   -39.400  1.00 111.87 ? 66  LEU C C     1 
ATOM   6319  O  O     . LEU C 1 66  ? 11.869  2.030   -39.445  1.00 115.19 ? 66  LEU C O     1 
ATOM   6320  C  CB    . LEU C 1 66  ? 13.665  -0.342  -38.629  1.00 91.24  ? 66  LEU C CB    1 
ATOM   6321  C  CG    . LEU C 1 66  ? 14.157  -1.220  -37.468  1.00 100.82 ? 66  LEU C CG    1 
ATOM   6322  C  CD1   . LEU C 1 66  ? 13.738  -2.694  -37.644  1.00 110.32 ? 66  LEU C CD1   1 
ATOM   6323  C  CD2   . LEU C 1 66  ? 15.669  -1.085  -37.238  1.00 97.95  ? 66  LEU C CD2   1 
ATOM   6324  N  N     . LYS C 1 67  ? 13.900  2.417   -40.307  1.00 129.11 ? 67  LYS C N     1 
ATOM   6325  C  CA    . LYS C 1 67  ? 13.423  3.128   -41.424  1.00 136.87 ? 67  LYS C CA    1 
ATOM   6326  C  C     . LYS C 1 67  ? 14.092  2.525   -42.631  1.00 144.47 ? 67  LYS C C     1 
ATOM   6327  O  O     . LYS C 1 67  ? 15.323  2.531   -42.742  1.00 142.77 ? 67  LYS C O     1 
ATOM   6328  C  CB    . LYS C 1 67  ? 13.813  4.615   -41.304  1.00 151.99 ? 67  LYS C CB    1 
ATOM   6329  C  CG    . LYS C 1 67  ? 13.167  5.535   -42.311  1.00 198.77 ? 67  LYS C CG    1 
ATOM   6330  C  CD    . LYS C 1 67  ? 13.505  7.007   -42.047  1.00 241.64 ? 67  LYS C CD    1 
ATOM   6331  C  CE    . LYS C 1 67  ? 13.232  7.897   -43.264  1.00 276.28 ? 67  LYS C CE    1 
ATOM   6332  N  NZ    . LYS C 1 67  ? 11.822  7.783   -43.734  1.00 297.27 ? 67  LYS C NZ    1 
ATOM   6333  N  N     . TYR C 1 68  ? 13.294  1.949   -43.519  1.00 148.05 ? 68  TYR C N     1 
ATOM   6334  C  CA    . TYR C 1 68  ? 13.788  1.546   -44.831  1.00 134.90 ? 68  TYR C CA    1 
ATOM   6335  C  C     . TYR C 1 68  ? 14.025  2.809   -45.696  1.00 131.30 ? 68  TYR C C     1 
ATOM   6336  O  O     . TYR C 1 68  ? 13.068  3.507   -45.999  1.00 143.97 ? 68  TYR C O     1 
ATOM   6337  C  CB    . TYR C 1 68  ? 12.763  0.660   -45.548  1.00 132.44 ? 68  TYR C CB    1 
ATOM   6338  C  CG    . TYR C 1 68  ? 12.675  -0.741  -45.066  1.00 147.14 ? 68  TYR C CG    1 
ATOM   6339  C  CD1   . TYR C 1 68  ? 13.743  -1.582  -45.183  1.00 142.28 ? 68  TYR C CD1   1 
ATOM   6340  C  CD2   . TYR C 1 68  ? 11.502  -1.228  -44.532  1.00 164.00 ? 68  TYR C CD2   1 
ATOM   6341  C  CE1   . TYR C 1 68  ? 13.654  -2.908  -44.768  1.00 146.61 ? 68  TYR C CE1   1 
ATOM   6342  C  CE2   . TYR C 1 68  ? 11.402  -2.535  -44.108  1.00 158.21 ? 68  TYR C CE2   1 
ATOM   6343  C  CZ    . TYR C 1 68  ? 12.482  -3.378  -44.225  1.00 144.09 ? 68  TYR C CZ    1 
ATOM   6344  O  OH    . TYR C 1 68  ? 12.401  -4.709  -43.802  1.00 138.24 ? 68  TYR C OH    1 
ATOM   6345  N  N     . PRO C 1 69  ? 15.275  3.103   -46.107  1.00 110.11 ? 69  PRO C N     1 
ATOM   6346  C  CA    . PRO C 1 69  ? 15.534  4.302   -46.870  1.00 99.51  ? 69  PRO C CA    1 
ATOM   6347  C  C     . PRO C 1 69  ? 15.005  4.230   -48.291  1.00 99.89  ? 69  PRO C C     1 
ATOM   6348  O  O     . PRO C 1 69  ? 14.800  5.260   -48.940  1.00 104.46 ? 69  PRO C O     1 
ATOM   6349  C  CB    . PRO C 1 69  ? 17.064  4.396   -46.828  1.00 87.12  ? 69  PRO C CB    1 
ATOM   6350  C  CG    . PRO C 1 69  ? 17.461  2.995   -46.802  1.00 93.04  ? 69  PRO C CG    1 
ATOM   6351  C  CD    . PRO C 1 69  ? 16.479  2.287   -45.940  1.00 99.21  ? 69  PRO C CD    1 
ATOM   6352  N  N     . ILE C 1 70  ? 14.833  3.026   -48.842  1.00 103.50 ? 70  ILE C N     1 
ATOM   6353  C  CA    . ILE C 1 70  ? 14.258  2.875   -50.189  1.00 118.45 ? 70  ILE C CA    1 
ATOM   6354  C  C     . ILE C 1 70  ? 12.800  2.401   -50.138  1.00 130.09 ? 70  ILE C C     1 
ATOM   6355  O  O     . ILE C 1 70  ? 12.520  1.362   -49.520  1.00 125.61 ? 70  ILE C O     1 
ATOM   6356  C  CB    . ILE C 1 70  ? 15.065  1.874   -51.077  1.00 131.09 ? 70  ILE C CB    1 
ATOM   6357  C  CG1   . ILE C 1 70  ? 16.567  2.027   -50.852  1.00 140.13 ? 70  ILE C CG1   1 
ATOM   6358  C  CG2   . ILE C 1 70  ? 14.647  2.028   -52.554  1.00 145.26 ? 70  ILE C CG2   1 
ATOM   6359  C  CD1   . ILE C 1 70  ? 17.350  0.970   -51.596  1.00 156.61 ? 70  ILE C CD1   1 
ATOM   6360  N  N     . GLU C 1 71  ? 11.896  3.163   -50.773  1.00 139.10 ? 71  GLU C N     1 
ATOM   6361  C  CA    . GLU C 1 71  ? 10.531  2.709   -50.999  1.00 153.20 ? 71  GLU C CA    1 
ATOM   6362  C  C     . GLU C 1 71  ? 10.075  2.778   -52.428  1.00 152.06 ? 71  GLU C C     1 
ATOM   6363  O  O     . GLU C 1 71  ? 10.033  3.851   -53.016  1.00 150.73 ? 71  GLU C O     1 
ATOM   6364  C  CB    . GLU C 1 71  ? 9.536   3.510   -50.141  1.00 176.48 ? 71  GLU C CB    1 
ATOM   6365  C  CG    . GLU C 1 71  ? 9.367   2.987   -48.737  1.00 206.44 ? 71  GLU C CG    1 
ATOM   6366  C  CD    . GLU C 1 71  ? 9.291   1.477   -48.736  1.00 234.11 ? 71  GLU C CD    1 
ATOM   6367  O  OE1   . GLU C 1 71  ? 8.404   0.931   -49.426  1.00 240.90 ? 71  GLU C OE1   1 
ATOM   6368  O  OE2   . GLU C 1 71  ? 10.144  0.844   -48.086  1.00 248.61 ? 71  GLU C OE2   1 
ATOM   6369  N  N     . HIS C 1 72  ? 9.680   1.626   -52.960  1.00 167.84 ? 72  HIS C N     1 
ATOM   6370  C  CA    . HIS C 1 72  ? 9.182   1.505   -54.311  1.00 185.88 ? 72  HIS C CA    1 
ATOM   6371  C  C     . HIS C 1 72  ? 10.281  1.797   -55.316  1.00 180.85 ? 72  HIS C C     1 
ATOM   6372  O  O     . HIS C 1 72  ? 10.070  2.406   -56.365  1.00 183.71 ? 72  HIS C O     1 
ATOM   6373  C  CB    . HIS C 1 72  ? 7.974   2.379   -54.570  1.00 189.12 ? 72  HIS C CB    1 
ATOM   6374  C  CG    . HIS C 1 72  ? 6.851   2.117   -53.611  1.00 199.85 ? 72  HIS C CG    1 
ATOM   6375  N  ND1   . HIS C 1 72  ? 6.450   0.843   -53.256  1.00 201.40 ? 72  HIS C ND1   1 
ATOM   6376  C  CD2   . HIS C 1 72  ? 6.061   2.965   -52.911  1.00 211.81 ? 72  HIS C CD2   1 
ATOM   6377  C  CE1   . HIS C 1 72  ? 5.445   0.915   -52.398  1.00 212.58 ? 72  HIS C CE1   1 
ATOM   6378  N  NE2   . HIS C 1 72  ? 5.189   2.194   -52.169  1.00 221.71 ? 72  HIS C NE2   1 
ATOM   6379  N  N     . GLY C 1 73  ? 11.478  1.361   -54.964  1.00 177.40 ? 73  GLY C N     1 
ATOM   6380  C  CA    . GLY C 1 73  ? 12.667  1.612   -55.799  1.00 176.29 ? 73  GLY C CA    1 
ATOM   6381  C  C     . GLY C 1 73  ? 13.151  3.045   -55.744  1.00 166.79 ? 73  GLY C C     1 
ATOM   6382  O  O     . GLY C 1 73  ? 14.139  3.380   -56.368  1.00 167.48 ? 73  GLY C O     1 
ATOM   6383  N  N     . ILE C 1 74  ? 12.475  3.915   -54.988  1.00 152.33 ? 74  ILE C N     1 
ATOM   6384  C  CA    . ILE C 1 74  ? 12.877  5.289   -54.844  1.00 153.87 ? 74  ILE C CA    1 
ATOM   6385  C  C     . ILE C 1 74  ? 13.578  5.448   -53.522  1.00 150.74 ? 74  ILE C C     1 
ATOM   6386  O  O     . ILE C 1 74  ? 12.985  5.061   -52.488  1.00 154.64 ? 74  ILE C O     1 
ATOM   6387  C  CB    . ILE C 1 74  ? 11.688  6.213   -54.766  1.00 162.72 ? 74  ILE C CB    1 
ATOM   6388  C  CG1   . ILE C 1 74  ? 10.643  5.871   -55.838  1.00 159.73 ? 74  ILE C CG1   1 
ATOM   6389  C  CG2   . ILE C 1 74  ? 12.140  7.673   -54.782  1.00 174.86 ? 74  ILE C CG2   1 
ATOM   6390  C  CD1   . ILE C 1 74  ? 11.150  5.881   -57.252  1.00 163.94 ? 74  ILE C CD1   1 
ATOM   6391  N  N     . VAL C 1 75  ? 14.711  6.165   -53.483  1.00 148.38 ? 75  VAL C N     1 
ATOM   6392  C  CA    . VAL C 1 75  ? 15.322  6.434   -52.188  1.00 155.37 ? 75  VAL C CA    1 
ATOM   6393  C  C     . VAL C 1 75  ? 14.565  7.622   -51.571  1.00 151.34 ? 75  VAL C C     1 
ATOM   6394  O  O     . VAL C 1 75  ? 14.512  8.718   -52.109  1.00 150.02 ? 75  VAL C O     1 
ATOM   6395  C  CB    . VAL C 1 75  ? 16.837  6.628   -52.217  1.00 170.81 ? 75  VAL C CB    1 
ATOM   6396  C  CG1   . VAL C 1 75  ? 17.506  5.417   -52.854  1.00 192.01 ? 75  VAL C CG1   1 
ATOM   6397  C  CG2   . VAL C 1 75  ? 17.236  7.862   -52.949  1.00 166.04 ? 75  VAL C CG2   1 
ATOM   6398  N  N     . THR C 1 76  ? 13.946  7.340   -50.438  1.00 162.38 ? 76  THR C N     1 
ATOM   6399  C  CA    . THR C 1 76  ? 13.318  8.415   -49.651  1.00 172.40 ? 76  THR C CA    1 
ATOM   6400  C  C     . THR C 1 76  ? 14.429  9.330   -49.059  1.00 164.42 ? 76  THR C C     1 
ATOM   6401  O  O     . THR C 1 76  ? 14.434  10.537  -49.273  1.00 160.15 ? 76  THR C O     1 
ATOM   6402  C  CB    . THR C 1 76  ? 12.358  7.790   -48.625  1.00 183.42 ? 76  THR C CB    1 
ATOM   6403  O  OG1   . THR C 1 76  ? 13.069  6.991   -47.683  1.00 185.04 ? 76  THR C OG1   1 
ATOM   6404  C  CG2   . THR C 1 76  ? 11.411  6.833   -49.298  1.00 177.50 ? 76  THR C CG2   1 
ATOM   6405  N  N     . ASN C 1 77  ? 15.382  8.735   -48.353  1.00 158.37 ? 77  ASN C N     1 
ATOM   6406  C  CA    . ASN C 1 77  ? 16.319  9.504   -47.586  1.00 156.45 ? 77  ASN C CA    1 
ATOM   6407  C  C     . ASN C 1 77  ? 17.727  9.142   -47.983  1.00 164.03 ? 77  ASN C C     1 
ATOM   6408  O  O     . ASN C 1 77  ? 18.153  7.997   -47.848  1.00 171.54 ? 77  ASN C O     1 
ATOM   6409  C  CB    . ASN C 1 77  ? 16.151  9.232   -46.091  1.00 149.60 ? 77  ASN C CB    1 
ATOM   6410  C  CG    . ASN C 1 77  ? 16.800  10.266  -45.196  1.00 156.22 ? 77  ASN C CG    1 
ATOM   6411  O  OD1   . ASN C 1 77  ? 17.570  11.118  -45.630  1.00 156.34 ? 77  ASN C OD1   1 
ATOM   6412  N  ND2   . ASN C 1 77  ? 16.450  10.214  -43.924  1.00 170.38 ? 77  ASN C ND2   1 
ATOM   6413  N  N     . TRP C 1 78  ? 18.452  10.140  -48.483  1.00 165.21 ? 78  TRP C N     1 
ATOM   6414  C  CA    . TRP C 1 78  ? 19.737  9.927   -49.120  1.00 165.27 ? 78  TRP C CA    1 
ATOM   6415  C  C     . TRP C 1 78  ? 20.803  9.676   -48.121  1.00 168.97 ? 78  TRP C C     1 
ATOM   6416  O  O     . TRP C 1 78  ? 21.686  8.817   -48.316  1.00 181.79 ? 78  TRP C O     1 
ATOM   6417  C  CB    . TRP C 1 78  ? 20.185  11.143  -49.916  1.00 159.54 ? 78  TRP C CB    1 
ATOM   6418  C  CG    . TRP C 1 78  ? 19.438  11.110  -51.222  1.00 160.07 ? 78  TRP C CG    1 
ATOM   6419  C  CD1   . TRP C 1 78  ? 18.347  11.847  -51.603  1.00 166.35 ? 78  TRP C CD1   1 
ATOM   6420  C  CD2   . TRP C 1 78  ? 19.694  10.196  -52.271  1.00 159.18 ? 78  TRP C CD2   1 
ATOM   6421  N  NE1   . TRP C 1 78  ? 17.953  11.476  -52.867  1.00 178.68 ? 78  TRP C NE1   1 
ATOM   6422  C  CE2   . TRP C 1 78  ? 18.773  10.458  -53.297  1.00 174.41 ? 78  TRP C CE2   1 
ATOM   6423  C  CE3   . TRP C 1 78  ? 20.645  9.213   -52.436  1.00 139.95 ? 78  TRP C CE3   1 
ATOM   6424  C  CZ2   . TRP C 1 78  ? 18.770  9.739   -54.466  1.00 171.87 ? 78  TRP C CZ2   1 
ATOM   6425  C  CZ3   . TRP C 1 78  ? 20.642  8.492   -53.604  1.00 130.22 ? 78  TRP C CZ3   1 
ATOM   6426  C  CH2   . TRP C 1 78  ? 19.754  8.789   -54.619  1.00 150.54 ? 78  TRP C CH2   1 
ATOM   6427  N  N     . ASP C 1 79  ? 20.876  10.473  -47.065  1.00 169.24 ? 79  ASP C N     1 
ATOM   6428  C  CA    . ASP C 1 79  ? 21.947  10.264  -46.053  1.00 172.02 ? 79  ASP C CA    1 
ATOM   6429  C  C     . ASP C 1 79  ? 21.914  8.852   -45.537  1.00 178.61 ? 79  ASP C C     1 
ATOM   6430  O  O     . ASP C 1 79  ? 22.926  8.260   -45.297  1.00 185.18 ? 79  ASP C O     1 
ATOM   6431  C  CB    . ASP C 1 79  ? 21.825  11.216  -44.876  1.00 180.75 ? 79  ASP C CB    1 
ATOM   6432  C  CG    . ASP C 1 79  ? 20.412  11.317  -44.355  1.00 198.48 ? 79  ASP C CG    1 
ATOM   6433  O  OD1   . ASP C 1 79  ? 19.674  10.332  -44.528  1.00 178.73 ? 79  ASP C OD1   1 
ATOM   6434  O  OD2   . ASP C 1 79  ? 20.031  12.378  -43.804  1.00 226.51 ? 79  ASP C OD2   1 
ATOM   6435  N  N     . ASP C 1 80  ? 20.700  8.302   -45.401  1.00 189.47 ? 80  ASP C N     1 
ATOM   6436  C  CA    . ASP C 1 80  ? 20.531  6.945   -44.937  1.00 208.18 ? 80  ASP C CA    1 
ATOM   6437  C  C     . ASP C 1 80  ? 21.146  5.982   -45.919  1.00 176.57 ? 80  ASP C C     1 
ATOM   6438  O  O     . ASP C 1 80  ? 21.863  5.069   -45.528  1.00 151.26 ? 80  ASP C O     1 
ATOM   6439  C  CB    . ASP C 1 80  ? 19.043  6.597   -44.745  1.00 234.13 ? 80  ASP C CB    1 
ATOM   6440  C  CG    . ASP C 1 80  ? 18.416  7.452   -43.689  1.00 249.49 ? 80  ASP C CG    1 
ATOM   6441  O  OD1   . ASP C 1 80  ? 19.170  8.097   -42.945  1.00 234.55 ? 80  ASP C OD1   1 
ATOM   6442  O  OD2   . ASP C 1 80  ? 17.172  7.481   -43.595  1.00 271.24 ? 80  ASP C OD2   1 
ATOM   6443  N  N     . MET C 1 81  ? 20.859  6.188   -47.214  1.00 153.36 ? 81  MET C N     1 
ATOM   6444  C  CA    . MET C 1 81  ? 21.428  5.334   -48.245  1.00 162.06 ? 81  MET C CA    1 
ATOM   6445  C  C     . MET C 1 81  ? 22.941  5.386   -48.224  1.00 150.18 ? 81  MET C C     1 
ATOM   6446  O  O     . MET C 1 81  ? 23.648  4.388   -48.316  1.00 145.65 ? 81  MET C O     1 
ATOM   6447  C  CB    . MET C 1 81  ? 20.954  5.795   -49.645  1.00 183.34 ? 81  MET C CB    1 
ATOM   6448  C  CG    . MET C 1 81  ? 21.466  4.938   -50.754  1.00 210.42 ? 81  MET C CG    1 
ATOM   6449  S  SD    . MET C 1 81  ? 21.337  3.170   -50.557  1.00 237.14 ? 81  MET C SD    1 
ATOM   6450  C  CE    . MET C 1 81  ? 19.613  3.068   -50.151  1.00 248.46 ? 81  MET C CE    1 
ATOM   6451  N  N     . GLU C 1 82  ? 23.452  6.599   -48.114  1.00 154.62 ? 82  GLU C N     1 
ATOM   6452  C  CA    . GLU C 1 82  ? 24.902  6.788   -48.042  1.00 158.45 ? 82  GLU C CA    1 
ATOM   6453  C  C     . GLU C 1 82  ? 25.414  5.989   -46.875  1.00 148.91 ? 82  GLU C C     1 
ATOM   6454  O  O     . GLU C 1 82  ? 26.441  5.357   -47.000  1.00 151.61 ? 82  GLU C O     1 
ATOM   6455  C  CB    . GLU C 1 82  ? 25.309  8.269   -47.902  1.00 164.00 ? 82  GLU C CB    1 
ATOM   6456  C  CG    . GLU C 1 82  ? 26.795  8.522   -47.739  1.00 165.05 ? 82  GLU C CG    1 
ATOM   6457  C  CD    . GLU C 1 82  ? 27.257  8.599   -46.286  1.00 171.65 ? 82  GLU C CD    1 
ATOM   6458  O  OE1   . GLU C 1 82  ? 26.534  9.173   -45.439  1.00 172.08 ? 82  GLU C OE1   1 
ATOM   6459  O  OE2   . GLU C 1 82  ? 28.363  8.095   -45.991  1.00 174.50 ? 82  GLU C OE2   1 
ATOM   6460  N  N     . LYS C 1 83  ? 24.725  6.013   -45.730  1.00 135.79 ? 83  LYS C N     1 
ATOM   6461  C  CA    . LYS C 1 83  ? 25.199  5.290   -44.561  1.00 126.36 ? 83  LYS C CA    1 
ATOM   6462  C  C     . LYS C 1 83  ? 25.241  3.807   -44.865  1.00 116.50 ? 83  LYS C C     1 
ATOM   6463  O  O     . LYS C 1 83  ? 26.195  3.106   -44.472  1.00 121.41 ? 83  LYS C O     1 
ATOM   6464  C  CB    . LYS C 1 83  ? 24.256  5.451   -43.375  1.00 123.36 ? 83  LYS C CB    1 
ATOM   6465  C  CG    . LYS C 1 83  ? 24.349  6.782   -42.692  1.00 138.16 ? 83  LYS C CG    1 
ATOM   6466  C  CD    . LYS C 1 83  ? 23.341  6.909   -41.531  1.00 135.47 ? 83  LYS C CD    1 
ATOM   6467  C  CE    . LYS C 1 83  ? 23.627  8.093   -40.636  1.00 140.80 ? 83  LYS C CE    1 
ATOM   6468  N  NZ    . LYS C 1 83  ? 22.746  8.046   -39.439  1.00 145.27 ? 83  LYS C NZ    1 
ATOM   6469  N  N     . ILE C 1 84  ? 24.208  3.314   -45.583  1.00 104.81 ? 84  ILE C N     1 
ATOM   6470  C  CA    . ILE C 1 84  ? 24.165  1.902   -45.885  1.00 111.43 ? 84  ILE C CA    1 
ATOM   6471  C  C     . ILE C 1 84  ? 25.328  1.505   -46.755  1.00 107.25 ? 84  ILE C C     1 
ATOM   6472  O  O     . ILE C 1 84  ? 25.955  0.489   -46.507  1.00 96.14  ? 84  ILE C O     1 
ATOM   6473  C  CB    . ILE C 1 84  ? 22.863  1.553   -46.596  1.00 131.62 ? 84  ILE C CB    1 
ATOM   6474  C  CG1   . ILE C 1 84  ? 21.758  1.618   -45.557  1.00 147.26 ? 84  ILE C CG1   1 
ATOM   6475  C  CG2   . ILE C 1 84  ? 22.932  0.142   -47.151  1.00 143.64 ? 84  ILE C CG2   1 
ATOM   6476  C  CD1   . ILE C 1 84  ? 20.382  1.169   -46.020  1.00 160.35 ? 84  ILE C CD1   1 
ATOM   6477  N  N     . TRP C 1 85  ? 25.606  2.303   -47.790  1.00 112.52 ? 85  TRP C N     1 
ATOM   6478  C  CA    . TRP C 1 85  ? 26.738  2.033   -48.660  1.00 115.12 ? 85  TRP C CA    1 
ATOM   6479  C  C     . TRP C 1 85  ? 28.036  2.063   -47.892  1.00 109.20 ? 85  TRP C C     1 
ATOM   6480  O  O     . TRP C 1 85  ? 28.887  1.180   -48.071  1.00 116.30 ? 85  TRP C O     1 
ATOM   6481  C  CB    . TRP C 1 85  ? 26.796  2.985   -49.850  1.00 120.65 ? 85  TRP C CB    1 
ATOM   6482  C  CG    . TRP C 1 85  ? 25.809  2.650   -50.947  1.00 116.87 ? 85  TRP C CG    1 
ATOM   6483  C  CD1   . TRP C 1 85  ? 25.382  1.420   -51.359  1.00 108.75 ? 85  TRP C CD1   1 
ATOM   6484  C  CD2   . TRP C 1 85  ? 25.204  3.594   -51.814  1.00 133.74 ? 85  TRP C CD2   1 
ATOM   6485  N  NE1   . TRP C 1 85  ? 24.537  1.549   -52.432  1.00 118.79 ? 85  TRP C NE1   1 
ATOM   6486  C  CE2   . TRP C 1 85  ? 24.434  2.883   -52.748  1.00 133.73 ? 85  TRP C CE2   1 
ATOM   6487  C  CE3   . TRP C 1 85  ? 25.351  4.958   -51.947  1.00 155.58 ? 85  TRP C CE3   1 
ATOM   6488  C  CZ2   . TRP C 1 85  ? 23.715  3.517   -53.728  1.00 151.90 ? 85  TRP C CZ2   1 
ATOM   6489  C  CZ3   . TRP C 1 85  ? 24.615  5.598   -52.907  1.00 161.58 ? 85  TRP C CZ3   1 
ATOM   6490  C  CH2   . TRP C 1 85  ? 23.816  4.888   -53.788  1.00 162.28 ? 85  TRP C CH2   1 
ATOM   6491  N  N     . HIS C 1 86  ? 28.173  3.029   -47.005  1.00 98.95  ? 86  HIS C N     1 
ATOM   6492  C  CA    . HIS C 1 86  ? 29.335  3.199   -46.134  1.00 100.07 ? 86  HIS C CA    1 
ATOM   6493  C  C     . HIS C 1 86  ? 29.568  1.870   -45.431  1.00 98.91  ? 86  HIS C C     1 
ATOM   6494  O  O     . HIS C 1 86  ? 30.678  1.347   -45.389  1.00 146.56 ? 86  HIS C O     1 
ATOM   6495  C  CB    . HIS C 1 86  ? 29.091  4.342   -45.136  1.00 118.93 ? 86  HIS C CB    1 
ATOM   6496  C  CG    . HIS C 1 86  ? 30.309  4.719   -44.356  1.00 150.88 ? 86  HIS C CG    1 
ATOM   6497  N  ND1   . HIS C 1 86  ? 30.667  4.113   -43.169  1.00 175.94 ? 86  HIS C ND1   1 
ATOM   6498  C  CD2   . HIS C 1 86  ? 31.254  5.655   -44.595  1.00 168.67 ? 86  HIS C CD2   1 
ATOM   6499  C  CE1   . HIS C 1 86  ? 31.781  4.666   -42.706  1.00 192.72 ? 86  HIS C CE1   1 
ATOM   6500  N  NE2   . HIS C 1 86  ? 32.160  5.603   -43.556  1.00 184.11 ? 86  HIS C NE2   1 
ATOM   6501  N  N     . HIS C 1 87  ? 28.498  1.359   -44.826  1.00 90.72  ? 87  HIS C N     1 
ATOM   6502  C  CA    . HIS C 1 87  ? 28.544  0.135   -44.092  1.00 109.18 ? 87  HIS C CA    1 
ATOM   6503  C  C     . HIS C 1 87  ? 28.996  -1.041  -45.010  1.00 110.06 ? 87  HIS C C     1 
ATOM   6504  O  O     . HIS C 1 87  ? 29.851  -1.850  -44.617  1.00 106.73 ? 87  HIS C O     1 
ATOM   6505  C  CB    . HIS C 1 87  ? 27.202  -0.128  -43.383  1.00 121.31 ? 87  HIS C CB    1 
ATOM   6506  C  CG    . HIS C 1 87  ? 27.139  -1.450  -42.652  1.00 121.15 ? 87  HIS C CG    1 
ATOM   6507  N  ND1   . HIS C 1 87  ? 26.757  -2.626  -43.269  1.00 123.35 ? 87  HIS C ND1   1 
ATOM   6508  C  CD2   . HIS C 1 87  ? 27.315  -1.743  -41.349  1.00 121.14 ? 87  HIS C CD2   1 
ATOM   6509  C  CE1   . HIS C 1 87  ? 26.719  -3.597  -42.376  1.00 131.71 ? 87  HIS C CE1   1 
ATOM   6510  N  NE2   . HIS C 1 87  ? 27.063  -3.088  -41.202  1.00 138.62 ? 87  HIS C NE2   1 
ATOM   6511  N  N     . THR C 1 88  ? 28.466  -1.042  -46.221  1.00 109.83 ? 88  THR C N     1 
ATOM   6512  C  CA    . THR C 1 88  ? 28.851  -2.132  -47.114  1.00 125.26 ? 88  THR C CA    1 
ATOM   6513  C  C     . THR C 1 88  ? 30.335  -2.126  -47.388  1.00 134.03 ? 88  THR C C     1 
ATOM   6514  O  O     . THR C 1 88  ? 31.034  -3.157  -47.227  1.00 138.10 ? 88  THR C O     1 
ATOM   6515  C  CB    . THR C 1 88  ? 28.325  -2.077  -48.522  1.00 131.76 ? 88  THR C CB    1 
ATOM   6516  O  OG1   . THR C 1 88  ? 28.864  -0.958  -49.241  1.00 131.44 ? 88  THR C OG1   1 
ATOM   6517  C  CG2   . THR C 1 88  ? 26.842  -2.088  -48.621  1.00 134.58 ? 88  THR C CG2   1 
ATOM   6518  N  N     . PHE C 1 89  ? 30.850  -0.956  -47.789  1.00 131.62 ? 89  PHE C N     1 
ATOM   6519  C  CA    . PHE C 1 89  ? 32.251  -0.900  -48.162  1.00 118.96 ? 89  PHE C CA    1 
ATOM   6520  C  C     . PHE C 1 89  ? 33.152  -1.106  -46.960  1.00 101.63 ? 89  PHE C C     1 
ATOM   6521  O  O     . PHE C 1 89  ? 34.007  -1.997  -46.965  1.00 112.70 ? 89  PHE C O     1 
ATOM   6522  C  CB    . PHE C 1 89  ? 32.595  0.394   -48.832  1.00 123.17 ? 89  PHE C CB    1 
ATOM   6523  C  CG    . PHE C 1 89  ? 31.904  0.574   -50.138  1.00 146.44 ? 89  PHE C CG    1 
ATOM   6524  C  CD1   . PHE C 1 89  ? 32.219  -0.200  -51.224  1.00 155.89 ? 89  PHE C CD1   1 
ATOM   6525  C  CD2   . PHE C 1 89  ? 30.952  1.555   -50.280  1.00 160.35 ? 89  PHE C CD2   1 
ATOM   6526  C  CE1   . PHE C 1 89  ? 31.584  -0.012  -52.439  1.00 159.28 ? 89  PHE C CE1   1 
ATOM   6527  C  CE2   . PHE C 1 89  ? 30.311  1.757   -51.493  1.00 155.35 ? 89  PHE C CE2   1 
ATOM   6528  C  CZ    . PHE C 1 89  ? 30.628  0.969   -52.570  1.00 155.63 ? 89  PHE C CZ    1 
ATOM   6529  N  N     . TYR C 1 90  ? 32.991  -0.283  -45.931  1.00 103.48 ? 90  TYR C N     1 
ATOM   6530  C  CA    . TYR C 1 90  ? 33.914  -0.343  -44.814  1.00 121.17 ? 90  TYR C CA    1 
ATOM   6531  C  C     . TYR C 1 90  ? 33.686  -1.493  -43.855  1.00 123.82 ? 90  TYR C C     1 
ATOM   6532  O  O     . TYR C 1 90  ? 34.629  -2.147  -43.446  1.00 118.03 ? 90  TYR C O     1 
ATOM   6533  C  CB    . TYR C 1 90  ? 34.004  0.997   -44.069  1.00 138.81 ? 90  TYR C CB    1 
ATOM   6534  C  CG    . TYR C 1 90  ? 34.386  2.060   -45.040  1.00 165.75 ? 90  TYR C CG    1 
ATOM   6535  C  CD1   . TYR C 1 90  ? 35.550  1.968   -45.790  1.00 180.26 ? 90  TYR C CD1   1 
ATOM   6536  C  CD2   . TYR C 1 90  ? 33.609  3.188   -45.168  1.00 187.75 ? 90  TYR C CD2   1 
ATOM   6537  C  CE1   . TYR C 1 90  ? 35.921  2.983   -46.629  1.00 205.80 ? 90  TYR C CE1   1 
ATOM   6538  C  CE2   . TYR C 1 90  ? 33.963  4.200   -46.028  1.00 206.42 ? 90  TYR C CE2   1 
ATOM   6539  C  CZ    . TYR C 1 90  ? 35.118  4.095   -46.771  1.00 222.84 ? 90  TYR C CZ    1 
ATOM   6540  O  OH    . TYR C 1 90  ? 35.478  5.128   -47.653  1.00 230.32 ? 90  TYR C OH    1 
ATOM   6541  N  N     . ASN C 1 91  ? 32.439  -1.675  -43.424  1.00 145.96 ? 91  ASN C N     1 
ATOM   6542  C  CA    . ASN C 1 91  ? 32.140  -2.747  -42.494  1.00 163.80 ? 91  ASN C CA    1 
ATOM   6543  C  C     . ASN C 1 91  ? 32.218  -4.151  -42.997  1.00 173.98 ? 91  ASN C C     1 
ATOM   6544  O  O     . ASN C 1 91  ? 32.722  -4.991  -42.238  1.00 179.24 ? 91  ASN C O     1 
ATOM   6545  C  CB    . ASN C 1 91  ? 30.798  -2.478  -41.751  1.00 165.52 ? 91  ASN C CB    1 
ATOM   6546  C  CG    . ASN C 1 91  ? 30.821  -1.154  -41.036  1.00 177.35 ? 91  ASN C CG    1 
ATOM   6547  O  OD1   . ASN C 1 91  ? 29.827  -0.433  -41.010  1.00 168.34 ? 91  ASN C OD1   1 
ATOM   6548  N  ND2   . ASN C 1 91  ? 31.961  -0.809  -40.445  1.00 195.67 ? 91  ASN C ND2   1 
ATOM   6549  N  N     . GLU C 1 92  ? 31.815  -4.444  -44.231  1.00 175.63 ? 92  GLU C N     1 
ATOM   6550  C  CA    . GLU C 1 92  ? 31.868  -5.802  -44.725  1.00 179.00 ? 92  GLU C CA    1 
ATOM   6551  C  C     . GLU C 1 92  ? 33.010  -6.073  -45.644  1.00 169.74 ? 92  GLU C C     1 
ATOM   6552  O  O     . GLU C 1 92  ? 33.776  -6.993  -45.384  1.00 190.61 ? 92  GLU C O     1 
ATOM   6553  C  CB    . GLU C 1 92  ? 30.597  -6.224  -45.483  1.00 184.38 ? 92  GLU C CB    1 
ATOM   6554  C  CG    . GLU C 1 92  ? 29.563  -6.920  -44.595  1.00 188.00 ? 92  GLU C CG    1 
ATOM   6555  C  CD    . GLU C 1 92  ? 28.826  -5.931  -43.755  1.00 215.44 ? 92  GLU C CD    1 
ATOM   6556  O  OE1   . GLU C 1 92  ? 28.809  -4.745  -44.147  1.00 230.00 ? 92  GLU C OE1   1 
ATOM   6557  O  OE2   . GLU C 1 92  ? 28.255  -6.340  -42.722  1.00 230.23 ? 92  GLU C OE2   1 
ATOM   6558  N  N     . LEU C 1 93  ? 33.061  -5.348  -46.769  1.00 150.38 ? 93  LEU C N     1 
ATOM   6559  C  CA    . LEU C 1 93  ? 33.995  -5.660  -47.871  1.00 146.68 ? 93  LEU C CA    1 
ATOM   6560  C  C     . LEU C 1 93  ? 35.385  -5.202  -47.524  1.00 131.07 ? 93  LEU C C     1 
ATOM   6561  O  O     . LEU C 1 93  ? 36.318  -5.845  -47.944  1.00 134.31 ? 93  LEU C O     1 
ATOM   6562  C  CB    . LEU C 1 93  ? 33.504  -5.137  -49.247  1.00 168.64 ? 93  LEU C CB    1 
ATOM   6563  C  CG    . LEU C 1 93  ? 32.140  -5.751  -49.645  1.00 186.28 ? 93  LEU C CG    1 
ATOM   6564  C  CD1   . LEU C 1 93  ? 31.655  -5.214  -50.989  1.00 192.18 ? 93  LEU C CD1   1 
ATOM   6565  C  CD2   . LEU C 1 93  ? 32.189  -7.286  -49.581  1.00 192.83 ? 93  LEU C CD2   1 
ATOM   6566  N  N     . ARG C 1 94  ? 35.524  -4.109  -46.798  1.00 132.71 ? 94  ARG C N     1 
ATOM   6567  C  CA    . ARG C 1 94  ? 36.810  -3.605  -46.436  1.00 141.13 ? 94  ARG C CA    1 
ATOM   6568  C  C     . ARG C 1 94  ? 37.604  -3.243  -47.683  1.00 122.23 ? 94  ARG C C     1 
ATOM   6569  O  O     . ARG C 1 94  ? 38.726  -3.669  -47.914  1.00 113.61 ? 94  ARG C O     1 
ATOM   6570  C  CB    . ARG C 1 94  ? 37.567  -4.615  -45.561  1.00 169.86 ? 94  ARG C CB    1 
ATOM   6571  C  CG    . ARG C 1 94  ? 36.804  -5.012  -44.325  1.00 186.62 ? 94  ARG C CG    1 
ATOM   6572  C  CD    . ARG C 1 94  ? 37.643  -5.931  -43.439  1.00 195.82 ? 94  ARG C CD    1 
ATOM   6573  N  NE    . ARG C 1 94  ? 36.859  -6.393  -42.289  1.00 216.98 ? 94  ARG C NE    1 
ATOM   6574  C  CZ    . ARG C 1 94  ? 37.287  -7.294  -41.407  1.00 235.59 ? 94  ARG C CZ    1 
ATOM   6575  N  NH1   . ARG C 1 94  ? 38.500  -7.810  -41.561  1.00 234.27 ? 94  ARG C NH1   1 
ATOM   6576  N  NH2   . ARG C 1 94  ? 36.513  -7.685  -40.369  1.00 249.73 ? 94  ARG C NH2   1 
ATOM   6577  N  N     . VAL C 1 95  ? 36.985  -2.427  -48.514  1.00 128.76 ? 95  VAL C N     1 
ATOM   6578  C  CA    . VAL C 1 95  ? 37.592  -1.934  -49.734  1.00 136.51 ? 95  VAL C CA    1 
ATOM   6579  C  C     . VAL C 1 95  ? 37.613  -0.422  -49.731  1.00 118.56 ? 95  VAL C C     1 
ATOM   6580  O  O     . VAL C 1 95  ? 36.770  0.248   -49.136  1.00 91.09  ? 95  VAL C O     1 
ATOM   6581  C  CB    . VAL C 1 95  ? 36.789  -2.421  -50.954  1.00 169.41 ? 95  VAL C CB    1 
ATOM   6582  C  CG1   . VAL C 1 95  ? 36.929  -3.945  -51.077  1.00 174.15 ? 95  VAL C CG1   1 
ATOM   6583  C  CG2   . VAL C 1 95  ? 35.313  -1.949  -50.875  1.00 184.01 ? 95  VAL C CG2   1 
ATOM   6584  N  N     . ALA C 1 96  ? 38.574  0.150   -50.458  1.00 128.79 ? 96  ALA C N     1 
ATOM   6585  C  CA    . ALA C 1 96  ? 38.594  1.555   -50.750  1.00 155.69 ? 96  ALA C CA    1 
ATOM   6586  C  C     . ALA C 1 96  ? 38.003  1.659   -52.109  1.00 173.58 ? 96  ALA C C     1 
ATOM   6587  O  O     . ALA C 1 96  ? 38.561  1.143   -53.065  1.00 187.92 ? 96  ALA C O     1 
ATOM   6588  C  CB    . ALA C 1 96  ? 40.035  2.121   -50.788  1.00 174.95 ? 96  ALA C CB    1 
ATOM   6589  N  N     . PRO C 1 97  ? 36.861  2.321   -52.236  1.00 190.74 ? 97  PRO C N     1 
ATOM   6590  C  CA    . PRO C 1 97  ? 36.190  2.381   -53.505  1.00 214.66 ? 97  PRO C CA    1 
ATOM   6591  C  C     . PRO C 1 97  ? 36.979  3.092   -54.587  1.00 228.93 ? 97  PRO C C     1 
ATOM   6592  O  O     . PRO C 1 97  ? 36.753  2.839   -55.750  1.00 237.43 ? 97  PRO C O     1 
ATOM   6593  C  CB    . PRO C 1 97  ? 34.851  3.064   -53.162  1.00 213.84 ? 97  PRO C CB    1 
ATOM   6594  C  CG    . PRO C 1 97  ? 34.578  2.611   -51.762  1.00 204.81 ? 97  PRO C CG    1 
ATOM   6595  C  CD    . PRO C 1 97  ? 35.947  2.530   -51.126  1.00 186.36 ? 97  PRO C CD    1 
ATOM   6596  N  N     . GLU C 1 98  ? 37.898  3.981   -54.210  1.00 230.30 ? 98  GLU C N     1 
ATOM   6597  C  CA    . GLU C 1 98  ? 38.929  4.446   -55.125  1.00 230.53 ? 98  GLU C CA    1 
ATOM   6598  C  C     . GLU C 1 98  ? 39.639  3.359   -55.896  1.00 232.96 ? 98  GLU C C     1 
ATOM   6599  O  O     . GLU C 1 98  ? 40.132  3.631   -56.980  1.00 238.12 ? 98  GLU C O     1 
ATOM   6600  C  CB    . GLU C 1 98  ? 40.033  5.280   -54.432  1.00 227.61 ? 98  GLU C CB    1 
ATOM   6601  C  CG    . GLU C 1 98  ? 39.578  6.550   -53.765  1.00 229.98 ? 98  GLU C CG    1 
ATOM   6602  C  CD    . GLU C 1 98  ? 39.089  6.327   -52.361  1.00 230.46 ? 98  GLU C CD    1 
ATOM   6603  O  OE1   . GLU C 1 98  ? 38.864  5.141   -52.020  1.00 219.68 ? 98  GLU C OE1   1 
ATOM   6604  O  OE2   . GLU C 1 98  ? 38.904  7.311   -51.635  1.00 238.43 ? 98  GLU C OE2   1 
ATOM   6605  N  N     . GLU C 1 99  ? 39.771  2.164   -55.308  1.00 234.00 ? 99  GLU C N     1 
ATOM   6606  C  CA    . GLU C 1 99  ? 40.450  1.059   -55.926  1.00 234.94 ? 99  GLU C CA    1 
ATOM   6607  C  C     . GLU C 1 99  ? 39.544  0.125   -56.730  1.00 222.26 ? 99  GLU C C     1 
ATOM   6608  O  O     . GLU C 1 99  ? 40.028  -0.915  -57.094  1.00 225.24 ? 99  GLU C O     1 
ATOM   6609  C  CB    . GLU C 1 99  ? 41.210  0.269   -54.871  1.00 245.58 ? 99  GLU C CB    1 
ATOM   6610  C  CG    . GLU C 1 99  ? 42.183  1.106   -54.035  1.00 254.78 ? 99  GLU C CG    1 
ATOM   6611  C  CD    . GLU C 1 99  ? 42.678  0.403   -52.801  1.00 266.72 ? 99  GLU C CD    1 
ATOM   6612  O  OE1   . GLU C 1 99  ? 42.118  -0.627  -52.346  1.00 279.99 ? 99  GLU C OE1   1 
ATOM   6613  O  OE2   . GLU C 1 99  ? 43.669  0.903   -52.223  1.00 260.63 ? 99  GLU C OE2   1 
ATOM   6614  N  N     . HIS C 1 100 ? 38.294  0.448   -57.014  1.00 201.33 ? 100 HIS C N     1 
ATOM   6615  C  CA    . HIS C 1 100 ? 37.387  -0.431  -57.727  1.00 187.81 ? 100 HIS C CA    1 
ATOM   6616  C  C     . HIS C 1 100 ? 36.326  0.357   -58.421  1.00 179.76 ? 100 HIS C C     1 
ATOM   6617  O  O     . HIS C 1 100 ? 35.852  1.354   -57.924  1.00 179.26 ? 100 HIS C O     1 
ATOM   6618  C  CB    . HIS C 1 100 ? 36.688  -1.392  -56.778  1.00 190.14 ? 100 HIS C CB    1 
ATOM   6619  C  CG    . HIS C 1 100 ? 37.623  -2.306  -56.031  1.00 188.69 ? 100 HIS C CG    1 
ATOM   6620  N  ND1   . HIS C 1 100 ? 38.173  -3.443  -56.587  1.00 197.57 ? 100 HIS C ND1   1 
ATOM   6621  C  CD2   . HIS C 1 100 ? 38.152  -2.204  -54.793  1.00 178.48 ? 100 HIS C CD2   1 
ATOM   6622  C  CE1   . HIS C 1 100 ? 38.971  -4.025  -55.705  1.00 195.72 ? 100 HIS C CE1   1 
ATOM   6623  N  NE2   . HIS C 1 100 ? 38.972  -3.297  -54.602  1.00 186.45 ? 100 HIS C NE2   1 
ATOM   6624  N  N     . PRO C 1 101 ? 35.937  -0.104  -59.608  1.00 184.74 ? 101 PRO C N     1 
ATOM   6625  C  CA    . PRO C 1 101 ? 34.819  0.415   -60.325  1.00 187.78 ? 101 PRO C CA    1 
ATOM   6626  C  C     . PRO C 1 101 ? 33.611  -0.224  -59.695  1.00 190.52 ? 101 PRO C C     1 
ATOM   6627  O  O     . PRO C 1 101 ? 33.695  -1.386  -59.289  1.00 187.58 ? 101 PRO C O     1 
ATOM   6628  C  CB    . PRO C 1 101 ? 35.062  -0.069  -61.787  1.00 196.20 ? 101 PRO C CB    1 
ATOM   6629  C  CG    . PRO C 1 101 ? 36.477  -0.443  -61.862  1.00 205.64 ? 101 PRO C CG    1 
ATOM   6630  C  CD    . PRO C 1 101 ? 36.866  -0.851  -60.477  1.00 195.23 ? 101 PRO C CD    1 
ATOM   6631  N  N     . VAL C 1 102 ? 32.492  0.519   -59.570  1.00 191.91 ? 102 VAL C N     1 
ATOM   6632  C  CA    . VAL C 1 102 ? 31.370  -0.058  -58.900  1.00 188.41 ? 102 VAL C CA    1 
ATOM   6633  C  C     . VAL C 1 102 ? 30.147  -0.046  -59.767  1.00 191.76 ? 102 VAL C C     1 
ATOM   6634  O  O     . VAL C 1 102 ? 29.819  0.937   -60.392  1.00 194.15 ? 102 VAL C O     1 
ATOM   6635  C  CB    . VAL C 1 102 ? 31.063  0.683   -57.599  1.00 187.39 ? 102 VAL C CB    1 
ATOM   6636  C  CG1   . VAL C 1 102 ? 30.776  2.192   -57.836  1.00 189.31 ? 102 VAL C CG1   1 
ATOM   6637  C  CG2   . VAL C 1 102 ? 29.915  -0.021  -56.859  1.00 193.09 ? 102 VAL C CG2   1 
ATOM   6638  N  N     . LEU C 1 103 ? 29.453  -1.177  -59.757  1.00 182.15 ? 103 LEU C N     1 
ATOM   6639  C  CA    . LEU C 1 103 ? 28.210  -1.306  -60.517  1.00 174.21 ? 103 LEU C CA    1 
ATOM   6640  C  C     . LEU C 1 103 ? 27.067  -1.202  -59.581  1.00 176.40 ? 103 LEU C C     1 
ATOM   6641  O  O     . LEU C 1 103 ? 27.029  -1.931  -58.606  1.00 180.28 ? 103 LEU C O     1 
ATOM   6642  C  CB    . LEU C 1 103 ? 28.144  -2.691  -61.174  1.00 178.05 ? 103 LEU C CB    1 
ATOM   6643  C  CG    . LEU C 1 103 ? 26.783  -3.137  -61.783  1.00 194.24 ? 103 LEU C CG    1 
ATOM   6644  C  CD1   . LEU C 1 103 ? 26.318  -2.136  -62.835  1.00 198.64 ? 103 LEU C CD1   1 
ATOM   6645  C  CD2   . LEU C 1 103 ? 26.833  -4.562  -62.354  1.00 200.00 ? 103 LEU C CD2   1 
ATOM   6646  N  N     . LEU C 1 104 ? 26.066  -0.373  -59.875  1.00 181.95 ? 104 LEU C N     1 
ATOM   6647  C  CA    . LEU C 1 104 ? 24.829  -0.385  -59.118  1.00 197.65 ? 104 LEU C CA    1 
ATOM   6648  C  C     . LEU C 1 104 ? 23.669  -0.902  -59.971  1.00 213.42 ? 104 LEU C C     1 
ATOM   6649  O  O     . LEU C 1 104 ? 23.593  -0.627  -61.201  1.00 217.70 ? 104 LEU C O     1 
ATOM   6650  C  CB    . LEU C 1 104 ? 24.416  1.030   -58.597  1.00 193.74 ? 104 LEU C CB    1 
ATOM   6651  C  CG    . LEU C 1 104 ? 25.368  1.595   -57.529  1.00 187.14 ? 104 LEU C CG    1 
ATOM   6652  C  CD1   . LEU C 1 104 ? 25.242  3.109   -57.381  1.00 185.90 ? 104 LEU C CD1   1 
ATOM   6653  C  CD2   . LEU C 1 104 ? 25.194  0.853   -56.195  1.00 188.29 ? 104 LEU C CD2   1 
ATOM   6654  N  N     . THR C 1 105 ? 22.757  -1.591  -59.316  1.00 230.44 ? 105 THR C N     1 
ATOM   6655  C  CA    . THR C 1 105 ? 21.509  -1.962  -59.931  1.00 243.24 ? 105 THR C CA    1 
ATOM   6656  C  C     . THR C 1 105 ? 20.514  -0.841  -59.683  1.00 250.33 ? 105 THR C C     1 
ATOM   6657  O  O     . THR C 1 105 ? 20.711  0.025   -58.835  1.00 234.17 ? 105 THR C O     1 
ATOM   6658  C  CB    . THR C 1 105 ? 20.963  -3.314  -59.418  1.00 257.64 ? 105 THR C CB    1 
ATOM   6659  O  OG1   . THR C 1 105 ? 20.070  -3.835  -60.418  1.00 259.92 ? 105 THR C OG1   1 
ATOM   6660  C  CG2   . THR C 1 105 ? 20.175  -3.147  -58.175  1.00 275.27 ? 105 THR C CG2   1 
ATOM   6661  N  N     . GLU C 1 106 ? 19.432  -0.879  -60.429  1.00 255.72 ? 106 GLU C N     1 
ATOM   6662  C  CA    . GLU C 1 106 ? 18.351  0.101   -60.254  1.00 253.86 ? 106 GLU C CA    1 
ATOM   6663  C  C     . GLU C 1 106 ? 17.156  -0.363  -61.076  1.00 228.17 ? 106 GLU C C     1 
ATOM   6664  O  O     . GLU C 1 106 ? 17.316  -1.106  -62.063  1.00 230.53 ? 106 GLU C O     1 
ATOM   6665  C  CB    . GLU C 1 106 ? 18.817  1.509   -60.658  1.00 275.00 ? 106 GLU C CB    1 
ATOM   6666  C  CG    . GLU C 1 106 ? 17.893  2.639   -60.257  1.00 293.35 ? 106 GLU C CG    1 
ATOM   6667  C  CD    . GLU C 1 106 ? 17.200  3.217   -61.465  1.00 308.79 ? 106 GLU C CD    1 
ATOM   6668  O  OE1   . GLU C 1 106 ? 17.145  2.487   -62.467  1.00 317.80 ? 106 GLU C OE1   1 
ATOM   6669  O  OE2   . GLU C 1 106 ? 16.762  4.385   -61.453  1.00 315.34 ? 106 GLU C OE2   1 
ATOM   6670  N  N     . ALA C 1 107 ? 15.964  0.015   -60.647  1.00 206.78 ? 107 ALA C N     1 
ATOM   6671  C  CA    . ALA C 1 107 ? 14.744  -0.534  -61.198  1.00 200.42 ? 107 ALA C CA    1 
ATOM   6672  C  C     . ALA C 1 107 ? 14.345  0.241   -62.401  1.00 194.18 ? 107 ALA C C     1 
ATOM   6673  O  O     . ALA C 1 107 ? 14.662  1.370   -62.526  1.00 194.24 ? 107 ALA C O     1 
ATOM   6674  C  CB    . ALA C 1 107 ? 13.650  -0.460  -60.160  1.00 206.61 ? 107 ALA C CB    1 
ATOM   6675  N  N     . PRO C 1 108 ? 13.622  -0.382  -63.296  1.00 196.84 ? 108 PRO C N     1 
ATOM   6676  C  CA    . PRO C 1 108 ? 13.068  0.309   -64.442  1.00 199.99 ? 108 PRO C CA    1 
ATOM   6677  C  C     . PRO C 1 108 ? 12.025  1.381   -64.177  1.00 196.36 ? 108 PRO C C     1 
ATOM   6678  O  O     . PRO C 1 108 ? 11.438  1.414   -63.118  1.00 194.73 ? 108 PRO C O     1 
ATOM   6679  C  CB    . PRO C 1 108 ? 12.364  -0.813  -65.225  1.00 203.71 ? 108 PRO C CB    1 
ATOM   6680  C  CG    . PRO C 1 108 ? 12.964  -2.085  -64.758  1.00 199.99 ? 108 PRO C CG    1 
ATOM   6681  C  CD    . PRO C 1 108 ? 13.455  -1.829  -63.350  1.00 192.49 ? 108 PRO C CD    1 
ATOM   6682  N  N     . LEU C 1 109 ? 11.804  2.239   -65.173  1.00 188.32 ? 109 LEU C N     1 
ATOM   6683  C  CA    . LEU C 1 109 ? 10.789  3.261   -65.145  1.00 191.11 ? 109 LEU C CA    1 
ATOM   6684  C  C     . LEU C 1 109 ? 10.915  4.202   -63.940  1.00 174.11 ? 109 LEU C C     1 
ATOM   6685  O  O     . LEU C 1 109 ? 10.024  4.860   -63.566  1.00 168.79 ? 109 LEU C O     1 
ATOM   6686  C  CB    . LEU C 1 109 ? 9.386   2.662   -65.238  1.00 208.99 ? 109 LEU C CB    1 
ATOM   6687  C  CG    . LEU C 1 109 ? 8.810   2.656   -66.670  1.00 221.93 ? 109 LEU C CG    1 
ATOM   6688  C  CD1   . LEU C 1 109 ? 9.674   1.802   -67.610  1.00 222.41 ? 109 LEU C CD1   1 
ATOM   6689  C  CD2   . LEU C 1 109 ? 7.339   2.232   -66.679  1.00 226.46 ? 109 LEU C CD2   1 
ATOM   6690  N  N     . ASN C 1 110 ? 12.094  4.276   -63.372  1.00 168.39 ? 110 ASN C N     1 
ATOM   6691  C  CA    . ASN C 1 110 ? 12.296  4.829   -62.065  1.00 172.34 ? 110 ASN C CA    1 
ATOM   6692  C  C     . ASN C 1 110 ? 12.644  6.259   -62.335  1.00 177.36 ? 110 ASN C C     1 
ATOM   6693  O  O     . ASN C 1 110 ? 13.144  6.609   -63.393  1.00 185.24 ? 110 ASN C O     1 
ATOM   6694  C  CB    . ASN C 1 110 ? 13.426  4.026   -61.401  1.00 179.74 ? 110 ASN C CB    1 
ATOM   6695  C  CG    . ASN C 1 110 ? 13.704  4.426   -59.966  1.00 193.03 ? 110 ASN C CG    1 
ATOM   6696  O  OD1   . ASN C 1 110 ? 13.478  5.559   -59.559  1.00 209.51 ? 110 ASN C OD1   1 
ATOM   6697  N  ND2   . ASN C 1 110 ? 14.243  3.474   -59.184  1.00 201.02 ? 110 ASN C ND2   1 
ATOM   6698  N  N     . PRO C 1 111 ? 12.314  7.138   -61.421  1.00 192.13 ? 111 PRO C N     1 
ATOM   6699  C  CA    . PRO C 1 111 ? 12.687  8.531   -61.578  1.00 196.32 ? 111 PRO C CA    1 
ATOM   6700  C  C     . PRO C 1 111 ? 14.147  8.820   -61.881  1.00 202.90 ? 111 PRO C C     1 
ATOM   6701  O  O     . PRO C 1 111 ? 15.044  8.121   -61.444  1.00 190.88 ? 111 PRO C O     1 
ATOM   6702  C  CB    . PRO C 1 111 ? 12.300  9.141   -60.230  1.00 197.72 ? 111 PRO C CB    1 
ATOM   6703  C  CG    . PRO C 1 111 ? 11.077  8.360   -59.905  1.00 200.95 ? 111 PRO C CG    1 
ATOM   6704  C  CD    . PRO C 1 111 ? 11.112  7.034   -60.588  1.00 205.31 ? 111 PRO C CD    1 
ATOM   6705  N  N     . LYS C 1 112 ? 14.346  9.842   -62.701  1.00 209.14 ? 112 LYS C N     1 
ATOM   6706  C  CA    . LYS C 1 112 ? 15.660  10.208  -63.196  1.00 213.74 ? 112 LYS C CA    1 
ATOM   6707  C  C     . LYS C 1 112 ? 16.543  10.549  -62.025  1.00 205.02 ? 112 LYS C C     1 
ATOM   6708  O  O     . LYS C 1 112 ? 17.694  10.166  -61.975  1.00 218.52 ? 112 LYS C O     1 
ATOM   6709  C  CB    . LYS C 1 112 ? 15.572  11.421  -64.158  1.00 228.45 ? 112 LYS C CB    1 
ATOM   6710  C  CG    . LYS C 1 112 ? 14.877  11.090  -65.475  1.00 243.62 ? 112 LYS C CG    1 
ATOM   6711  C  CD    . LYS C 1 112 ? 14.778  12.286  -66.423  1.00 263.12 ? 112 LYS C CD    1 
ATOM   6712  C  CE    . LYS C 1 112 ? 16.108  12.702  -67.038  1.00 279.39 ? 112 LYS C CE    1 
ATOM   6713  N  NZ    . LYS C 1 112 ? 16.441  11.884  -68.236  1.00 287.26 ? 112 LYS C NZ    1 
ATOM   6714  N  N     . ALA C 1 113 ? 15.954  11.306  -61.091  1.00 186.76 ? 113 ALA C N     1 
ATOM   6715  C  CA    . ALA C 1 113 ? 16.640  11.865  -59.963  1.00 179.10 ? 113 ALA C CA    1 
ATOM   6716  C  C     . ALA C 1 113 ? 17.417  10.814  -59.232  1.00 174.26 ? 113 ALA C C     1 
ATOM   6717  O  O     . ALA C 1 113 ? 18.518  11.094  -58.789  1.00 175.65 ? 113 ALA C O     1 
ATOM   6718  C  CB    . ALA C 1 113 ? 15.657  12.522  -58.978  1.00 188.36 ? 113 ALA C CB    1 
ATOM   6719  N  N     . ASN C 1 114 ? 16.859  9.609   -59.091  1.00 172.15 ? 114 ASN C N     1 
ATOM   6720  C  CA    . ASN C 1 114 ? 17.526  8.549   -58.379  1.00 176.27 ? 114 ASN C CA    1 
ATOM   6721  C  C     . ASN C 1 114 ? 18.794  8.170   -59.081  1.00 167.72 ? 114 ASN C C     1 
ATOM   6722  O  O     . ASN C 1 114 ? 19.830  8.016   -58.413  1.00 153.83 ? 114 ASN C O     1 
ATOM   6723  C  CB    . ASN C 1 114 ? 16.664  7.291   -58.221  1.00 180.13 ? 114 ASN C CB    1 
ATOM   6724  C  CG    . ASN C 1 114 ? 15.626  7.441   -57.148  1.00 186.99 ? 114 ASN C CG    1 
ATOM   6725  O  OD1   . ASN C 1 114 ? 15.807  8.147   -56.153  1.00 174.54 ? 114 ASN C OD1   1 
ATOM   6726  N  ND2   . ASN C 1 114 ? 14.521  6.776   -57.349  1.00 210.17 ? 114 ASN C ND2   1 
ATOM   6727  N  N     . ARG C 1 115 ? 18.728  8.027   -60.401  1.00 156.76 ? 115 ARG C N     1 
ATOM   6728  C  CA    . ARG C 1 115 ? 19.937  7.592   -61.134  1.00 142.87 ? 115 ARG C CA    1 
ATOM   6729  C  C     . ARG C 1 115 ? 20.970  8.718   -60.992  1.00 138.93 ? 115 ARG C C     1 
ATOM   6730  O  O     . ARG C 1 115 ? 22.127  8.512   -60.602  1.00 144.03 ? 115 ARG C O     1 
ATOM   6731  C  CB    . ARG C 1 115 ? 19.668  7.355   -62.620  1.00 145.90 ? 115 ARG C CB    1 
ATOM   6732  C  CG    . ARG C 1 115 ? 19.352  5.935   -63.063  1.00 152.24 ? 115 ARG C CG    1 
ATOM   6733  C  CD    . ARG C 1 115 ? 19.374  5.819   -64.591  1.00 165.26 ? 115 ARG C CD    1 
ATOM   6734  N  NE    . ARG C 1 115 ? 18.732  4.579   -65.047  1.00 182.00 ? 115 ARG C NE    1 
ATOM   6735  C  CZ    . ARG C 1 115 ? 17.410  4.394   -65.040  1.00 212.71 ? 115 ARG C CZ    1 
ATOM   6736  N  NH1   . ARG C 1 115 ? 16.623  5.404   -64.690  1.00 225.28 ? 115 ARG C NH1   1 
ATOM   6737  N  NH2   . ARG C 1 115 ? 16.865  3.232   -65.466  1.00 226.75 ? 115 ARG C NH2   1 
ATOM   6738  N  N     . GLU C 1 116 ? 20.520  9.940   -61.290  1.00 152.79 ? 116 GLU C N     1 
ATOM   6739  C  CA    . GLU C 1 116 ? 21.427  11.075  -61.356  1.00 160.63 ? 116 GLU C CA    1 
ATOM   6740  C  C     . GLU C 1 116 ? 22.064  11.278  -59.975  1.00 159.32 ? 116 GLU C C     1 
ATOM   6741  O  O     . GLU C 1 116 ? 23.286  11.337  -59.823  1.00 151.20 ? 116 GLU C O     1 
ATOM   6742  C  CB    . GLU C 1 116 ? 20.658  12.334  -61.858  1.00 187.84 ? 116 GLU C CB    1 
ATOM   6743  C  CG    . GLU C 1 116 ? 20.551  12.410  -63.351  1.00 214.62 ? 116 GLU C CG    1 
ATOM   6744  C  CD    . GLU C 1 116 ? 19.312  13.184  -63.787  1.00 229.93 ? 116 GLU C CD    1 
ATOM   6745  O  OE1   . GLU C 1 116 ? 18.507  13.515  -62.882  1.00 233.93 ? 116 GLU C OE1   1 
ATOM   6746  O  OE2   . GLU C 1 116 ? 19.150  13.406  -64.999  1.00 225.79 ? 116 GLU C OE2   1 
ATOM   6747  N  N     . LYS C 1 117 ? 21.191  11.336  -58.974  1.00 169.39 ? 117 LYS C N     1 
ATOM   6748  C  CA    . LYS C 1 117 ? 21.669  11.567  -57.620  1.00 178.78 ? 117 LYS C CA    1 
ATOM   6749  C  C     . LYS C 1 117 ? 22.522  10.447  -57.126  1.00 169.71 ? 117 LYS C C     1 
ATOM   6750  O  O     . LYS C 1 117 ? 23.510  10.627  -56.466  1.00 167.70 ? 117 LYS C O     1 
ATOM   6751  C  CB    . LYS C 1 117 ? 20.538  11.773  -56.600  1.00 195.84 ? 117 LYS C CB    1 
ATOM   6752  C  CG    . LYS C 1 117 ? 21.041  12.132  -55.208  1.00 217.87 ? 117 LYS C CG    1 
ATOM   6753  C  CD    . LYS C 1 117 ? 21.755  13.488  -55.135  1.00 220.97 ? 117 LYS C CD    1 
ATOM   6754  C  CE    . LYS C 1 117 ? 22.161  13.879  -53.713  1.00 235.80 ? 117 LYS C CE    1 
ATOM   6755  N  NZ    . LYS C 1 117 ? 23.187  14.958  -53.724  1.00 234.12 ? 117 LYS C NZ    1 
ATOM   6756  N  N     . MET C 1 118 ? 22.176  9.210   -57.496  1.00 166.25 ? 118 MET C N     1 
ATOM   6757  C  CA    . MET C 1 118 ? 22.987  8.023   -57.190  1.00 175.81 ? 118 MET C CA    1 
ATOM   6758  C  C     . MET C 1 118 ? 24.420  8.218   -57.682  1.00 177.06 ? 118 MET C C     1 
ATOM   6759  O  O     . MET C 1 118 ? 25.368  8.078   -56.865  1.00 178.19 ? 118 MET C O     1 
ATOM   6760  C  CB    . MET C 1 118 ? 22.336  6.789   -57.849  1.00 180.78 ? 118 MET C CB    1 
ATOM   6761  C  CG    . MET C 1 118 ? 22.864  5.458   -57.413  1.00 194.74 ? 118 MET C CG    1 
ATOM   6762  S  SD    . MET C 1 118 ? 21.824  4.011   -57.854  1.00 192.02 ? 118 MET C SD    1 
ATOM   6763  C  CE    . MET C 1 118 ? 20.407  4.193   -56.770  1.00 200.01 ? 118 MET C CE    1 
ATOM   6764  N  N     . THR C 1 119 ? 24.584  8.574   -58.944  1.00 171.55 ? 119 THR C N     1 
ATOM   6765  C  CA    . THR C 1 119 ? 25.871  8.818   -59.502  1.00 162.29 ? 119 THR C CA    1 
ATOM   6766  C  C     . THR C 1 119 ? 26.584  9.942   -58.816  1.00 165.33 ? 119 THR C C     1 
ATOM   6767  O  O     . THR C 1 119 ? 27.746  9.848   -58.528  1.00 171.71 ? 119 THR C O     1 
ATOM   6768  C  CB    . THR C 1 119 ? 25.858  9.152   -60.973  1.00 161.63 ? 119 THR C CB    1 
ATOM   6769  O  OG1   . THR C 1 119 ? 24.987  10.275  -61.149  1.00 152.48 ? 119 THR C OG1   1 
ATOM   6770  C  CG2   . THR C 1 119 ? 25.405  7.983   -61.781  1.00 178.40 ? 119 THR C CG2   1 
ATOM   6771  N  N     . GLN C 1 120 ? 25.854  11.008  -58.528  1.00 167.82 ? 120 GLN C N     1 
ATOM   6772  C  CA    . GLN C 1 120 ? 26.420  12.156  -57.822  1.00 170.61 ? 120 GLN C CA    1 
ATOM   6773  C  C     . GLN C 1 120 ? 27.072  11.701  -56.508  1.00 164.64 ? 120 GLN C C     1 
ATOM   6774  O  O     . GLN C 1 120 ? 28.201  12.115  -56.200  1.00 156.91 ? 120 GLN C O     1 
ATOM   6775  C  CB    . GLN C 1 120 ? 25.343  13.205  -57.484  1.00 174.33 ? 120 GLN C CB    1 
ATOM   6776  C  CG    . GLN C 1 120 ? 25.863  14.421  -56.771  1.00 172.00 ? 120 GLN C CG    1 
ATOM   6777  C  CD    . GLN C 1 120 ? 24.875  15.562  -56.802  1.00 181.60 ? 120 GLN C CD    1 
ATOM   6778  O  OE1   . GLN C 1 120 ? 23.788  15.455  -57.379  1.00 187.09 ? 120 GLN C OE1   1 
ATOM   6779  N  NE2   . GLN C 1 120 ? 25.242  16.672  -56.170  1.00 193.01 ? 120 GLN C NE2   1 
ATOM   6780  N  N     . ILE C 1 121 ? 26.352  10.878  -55.752  1.00 165.15 ? 121 ILE C N     1 
ATOM   6781  C  CA    . ILE C 1 121 ? 26.942  10.299  -54.564  1.00 165.01 ? 121 ILE C CA    1 
ATOM   6782  C  C     . ILE C 1 121 ? 28.165  9.492   -54.839  1.00 165.47 ? 121 ILE C C     1 
ATOM   6783  O  O     . ILE C 1 121 ? 29.163  9.674   -54.149  1.00 170.11 ? 121 ILE C O     1 
ATOM   6784  C  CB    . ILE C 1 121 ? 25.923  9.507   -53.760  1.00 172.29 ? 121 ILE C CB    1 
ATOM   6785  C  CG1   . ILE C 1 121 ? 24.978  10.532  -53.114  1.00 181.21 ? 121 ILE C CG1   1 
ATOM   6786  C  CG2   . ILE C 1 121 ? 26.662  8.619   -52.756  1.00 166.70 ? 121 ILE C CG2   1 
ATOM   6787  C  CD1   . ILE C 1 121 ? 23.950  9.938   -52.166  1.00 183.76 ? 121 ILE C CD1   1 
ATOM   6788  N  N     . MET C 1 122 ? 28.099  8.524   -55.716  1.00 177.75 ? 122 MET C N     1 
ATOM   6789  C  CA    . MET C 1 122 ? 29.216  7.637   -55.913  1.00 189.51 ? 122 MET C CA    1 
ATOM   6790  C  C     . MET C 1 122 ? 30.465  8.372   -56.263  1.00 191.08 ? 122 MET C C     1 
ATOM   6791  O  O     . MET C 1 122 ? 31.490  7.932   -55.907  1.00 191.83 ? 122 MET C O     1 
ATOM   6792  C  CB    . MET C 1 122 ? 28.919  6.627   -57.032  1.00 189.85 ? 122 MET C CB    1 
ATOM   6793  C  CG    . MET C 1 122 ? 28.149  5.410   -56.545  1.00 200.05 ? 122 MET C CG    1 
ATOM   6794  S  SD    . MET C 1 122 ? 29.102  4.563   -55.277  1.00 209.72 ? 122 MET C SD    1 
ATOM   6795  C  CE    . MET C 1 122 ? 27.887  3.378   -54.691  1.00 210.59 ? 122 MET C CE    1 
ATOM   6796  N  N     . PHE C 1 123 ? 30.368  9.433   -57.055  1.00 183.07 ? 123 PHE C N     1 
ATOM   6797  C  CA    . PHE C 1 123 ? 31.557  10.211  -57.381  1.00 176.78 ? 123 PHE C CA    1 
ATOM   6798  C  C     . PHE C 1 123 ? 31.940  11.127  -56.275  1.00 169.14 ? 123 PHE C C     1 
ATOM   6799  O  O     . PHE C 1 123 ? 33.111  11.146  -55.915  1.00 155.99 ? 123 PHE C O     1 
ATOM   6800  C  CB    . PHE C 1 123 ? 31.450  10.953  -58.738  1.00 185.45 ? 123 PHE C CB    1 
ATOM   6801  C  CG    . PHE C 1 123 ? 31.306  10.033  -59.905  1.00 199.39 ? 123 PHE C CG    1 
ATOM   6802  C  CD1   . PHE C 1 123 ? 32.167  8.963   -60.052  1.00 207.77 ? 123 PHE C CD1   1 
ATOM   6803  C  CD2   . PHE C 1 123 ? 30.275  10.183  -60.802  1.00 212.00 ? 123 PHE C CD2   1 
ATOM   6804  C  CE1   . PHE C 1 123 ? 32.033  8.092   -61.099  1.00 212.09 ? 123 PHE C CE1   1 
ATOM   6805  C  CE2   . PHE C 1 123 ? 30.132  9.310   -61.854  1.00 230.42 ? 123 PHE C CE2   1 
ATOM   6806  C  CZ    . PHE C 1 123 ? 31.019  8.263   -62.010  1.00 223.65 ? 123 PHE C CZ    1 
ATOM   6807  N  N     . GLU C 1 124 ? 30.984  11.853  -55.702  1.00 178.69 ? 124 GLU C N     1 
ATOM   6808  C  CA    . GLU C 1 124 ? 31.363  12.862  -54.702  1.00 190.11 ? 124 GLU C CA    1 
ATOM   6809  C  C     . GLU C 1 124 ? 31.126  12.461  -53.240  1.00 186.87 ? 124 GLU C C     1 
ATOM   6810  O  O     . GLU C 1 124 ? 31.027  13.327  -52.369  1.00 176.21 ? 124 GLU C O     1 
ATOM   6811  C  CB    . GLU C 1 124 ? 30.608  14.155  -55.023  1.00 208.04 ? 124 GLU C CB    1 
ATOM   6812  C  CG    . GLU C 1 124 ? 30.846  14.646  -56.431  1.00 227.20 ? 124 GLU C CG    1 
ATOM   6813  C  CD    . GLU C 1 124 ? 30.287  16.031  -56.645  1.00 249.73 ? 124 GLU C CD    1 
ATOM   6814  O  OE1   . GLU C 1 124 ? 29.204  16.341  -56.100  1.00 254.66 ? 124 GLU C OE1   1 
ATOM   6815  O  OE2   . GLU C 1 124 ? 30.948  16.804  -57.354  1.00 267.40 ? 124 GLU C OE2   1 
ATOM   6816  N  N     . THR C 1 125 ? 31.030  11.161  -52.965  1.00 188.06 ? 125 THR C N     1 
ATOM   6817  C  CA    . THR C 1 125 ? 31.068  10.699  -51.611  1.00 184.83 ? 125 THR C CA    1 
ATOM   6818  C  C     . THR C 1 125 ? 32.221  9.721   -51.472  1.00 166.66 ? 125 THR C C     1 
ATOM   6819  O  O     . THR C 1 125 ? 33.247  10.038  -50.861  1.00 142.40 ? 125 THR C O     1 
ATOM   6820  C  CB    . THR C 1 125 ? 29.731  10.097  -51.157  1.00 207.27 ? 125 THR C CB    1 
ATOM   6821  O  OG1   . THR C 1 125 ? 28.729  11.105  -51.304  1.00 227.22 ? 125 THR C OG1   1 
ATOM   6822  C  CG2   . THR C 1 125 ? 29.807  9.687   -49.713  1.00 213.17 ? 125 THR C CG2   1 
ATOM   6823  N  N     . PHE C 1 126 ? 32.083  8.577   -52.119  1.00 175.54 ? 126 PHE C N     1 
ATOM   6824  C  CA    . PHE C 1 126 ? 33.132  7.538   -52.104  1.00 181.57 ? 126 PHE C CA    1 
ATOM   6825  C  C     . PHE C 1 126 ? 33.892  7.782   -53.374  1.00 180.77 ? 126 PHE C C     1 
ATOM   6826  O  O     . PHE C 1 126 ? 33.399  7.411   -54.443  1.00 167.41 ? 126 PHE C O     1 
ATOM   6827  C  CB    . PHE C 1 126 ? 32.560  6.121   -52.132  1.00 181.53 ? 126 PHE C CB    1 
ATOM   6828  C  CG    . PHE C 1 126 ? 31.395  5.942   -51.228  1.00 185.73 ? 126 PHE C CG    1 
ATOM   6829  C  CD1   . PHE C 1 126 ? 31.503  6.245   -49.899  1.00 193.78 ? 126 PHE C CD1   1 
ATOM   6830  C  CD2   . PHE C 1 126 ? 30.202  5.437   -51.705  1.00 180.17 ? 126 PHE C CD2   1 
ATOM   6831  C  CE1   . PHE C 1 126 ? 30.435  6.065   -49.041  1.00 196.76 ? 126 PHE C CE1   1 
ATOM   6832  C  CE2   . PHE C 1 126 ? 29.129  5.261   -50.865  1.00 182.16 ? 126 PHE C CE2   1 
ATOM   6833  C  CZ    . PHE C 1 126 ? 29.246  5.562   -49.525  1.00 191.89 ? 126 PHE C CZ    1 
ATOM   6834  N  N     . ASN C 1 127 ? 35.063  8.404   -53.324  1.00 183.65 ? 127 ASN C N     1 
ATOM   6835  C  CA    . ASN C 1 127 ? 35.811  8.681   -54.566  1.00 189.85 ? 127 ASN C CA    1 
ATOM   6836  C  C     . ASN C 1 127 ? 36.115  7.372   -55.302  1.00 178.35 ? 127 ASN C C     1 
ATOM   6837  O  O     . ASN C 1 127 ? 36.611  6.424   -54.697  1.00 190.83 ? 127 ASN C O     1 
ATOM   6838  C  CB    . ASN C 1 127 ? 37.088  9.488   -54.242  1.00 197.52 ? 127 ASN C CB    1 
ATOM   6839  C  CG    . ASN C 1 127 ? 37.611  10.294  -55.426  1.00 221.26 ? 127 ASN C CG    1 
ATOM   6840  O  OD1   . ASN C 1 127 ? 36.852  10.985  -56.108  1.00 225.68 ? 127 ASN C OD1   1 
ATOM   6841  N  ND2   . ASN C 1 127 ? 38.916  10.218  -55.659  1.00 237.24 ? 127 ASN C ND2   1 
ATOM   6842  N  N     . THR C 1 128 ? 35.704  7.288   -56.561  1.00 165.62 ? 128 THR C N     1 
ATOM   6843  C  CA    . THR C 1 128 ? 35.716  6.038   -57.249  1.00 167.79 ? 128 THR C CA    1 
ATOM   6844  C  C     . THR C 1 128 ? 36.064  6.313   -58.673  1.00 174.10 ? 128 THR C C     1 
ATOM   6845  O  O     . THR C 1 128 ? 35.659  7.333   -59.192  1.00 171.40 ? 128 THR C O     1 
ATOM   6846  C  CB    . THR C 1 128 ? 34.366  5.293   -57.193  1.00 173.57 ? 128 THR C CB    1 
ATOM   6847  O  OG1   . THR C 1 128 ? 34.467  4.121   -58.005  1.00 180.76 ? 128 THR C OG1   1 
ATOM   6848  C  CG2   . THR C 1 128 ? 33.192  6.135   -57.703  1.00 176.87 ? 128 THR C CG2   1 
ATOM   6849  N  N     . PRO C 1 129 ? 36.824  5.410   -59.308  1.00 198.72 ? 129 PRO C N     1 
ATOM   6850  C  CA    . PRO C 1 129 ? 37.305  5.651   -60.636  1.00 206.78 ? 129 PRO C CA    1 
ATOM   6851  C  C     . PRO C 1 129 ? 36.204  5.602   -61.675  1.00 208.55 ? 129 PRO C C     1 
ATOM   6852  O  O     . PRO C 1 129 ? 36.256  6.342   -62.667  1.00 213.22 ? 129 PRO C O     1 
ATOM   6853  C  CB    . PRO C 1 129 ? 38.249  4.483   -60.907  1.00 216.15 ? 129 PRO C CB    1 
ATOM   6854  C  CG    . PRO C 1 129 ? 38.668  3.983   -59.601  1.00 218.00 ? 129 PRO C CG    1 
ATOM   6855  C  CD    . PRO C 1 129 ? 37.527  4.277   -58.674  1.00 214.30 ? 129 PRO C CD    1 
ATOM   6856  N  N     . ALA C 1 130 ? 35.255  4.699   -61.476  1.00 209.73 ? 130 ALA C N     1 
ATOM   6857  C  CA    . ALA C 1 130 ? 34.223  4.502   -62.461  1.00 217.66 ? 130 ALA C CA    1 
ATOM   6858  C  C     . ALA C 1 130 ? 33.047  3.792   -61.848  1.00 207.52 ? 130 ALA C C     1 
ATOM   6859  O  O     . ALA C 1 130 ? 33.108  3.166   -60.814  1.00 205.58 ? 130 ALA C O     1 
ATOM   6860  C  CB    . ALA C 1 130 ? 34.719  3.746   -63.712  1.00 230.01 ? 130 ALA C CB    1 
ATOM   6861  N  N     . MET C 1 131 ? 31.909  3.938   -62.520  1.00 195.88 ? 131 MET C N     1 
ATOM   6862  C  CA    . MET C 1 131 ? 30.700  3.315   -62.057  1.00 188.20 ? 131 MET C CA    1 
ATOM   6863  C  C     . MET C 1 131 ? 29.746  3.116   -63.189  1.00 174.34 ? 131 MET C C     1 
ATOM   6864  O  O     . MET C 1 131 ? 29.950  3.666   -64.271  1.00 172.27 ? 131 MET C O     1 
ATOM   6865  C  CB    . MET C 1 131 ? 29.963  4.173   -61.021  1.00 187.40 ? 131 MET C CB    1 
ATOM   6866  C  CG    . MET C 1 131 ? 29.189  5.312   -61.672  1.00 189.44 ? 131 MET C CG    1 
ATOM   6867  S  SD    . MET C 1 131 ? 28.091  6.254   -60.627  1.00 207.00 ? 131 MET C SD    1 
ATOM   6868  C  CE    . MET C 1 131 ? 26.844  4.991   -60.386  1.00 217.59 ? 131 MET C CE    1 
ATOM   6869  N  N     . TYR C 1 132 ? 28.696  2.319   -62.931  1.00 164.31 ? 132 TYR C N     1 
ATOM   6870  C  CA    . TYR C 1 132 ? 27.659  2.128   -63.930  1.00 170.96 ? 132 TYR C CA    1 
ATOM   6871  C  C     . TYR C 1 132 ? 26.366  1.892   -63.196  1.00 166.34 ? 132 TYR C C     1 
ATOM   6872  O  O     . TYR C 1 132 ? 26.397  1.304   -62.103  1.00 169.82 ? 132 TYR C O     1 
ATOM   6873  C  CB    . TYR C 1 132 ? 27.986  0.915   -64.800  1.00 191.10 ? 132 TYR C CB    1 
ATOM   6874  C  CG    . TYR C 1 132 ? 27.041  0.781   -65.938  1.00 200.57 ? 132 TYR C CG    1 
ATOM   6875  C  CD1   . TYR C 1 132 ? 27.171  1.585   -67.043  1.00 204.04 ? 132 TYR C CD1   1 
ATOM   6876  C  CD2   . TYR C 1 132 ? 26.032  -0.155  -65.917  1.00 198.32 ? 132 TYR C CD2   1 
ATOM   6877  C  CE1   . TYR C 1 132 ? 26.320  1.463   -68.122  1.00 201.83 ? 132 TYR C CE1   1 
ATOM   6878  C  CE2   . TYR C 1 132 ? 25.166  -0.276  -66.976  1.00 199.57 ? 132 TYR C CE2   1 
ATOM   6879  C  CZ    . TYR C 1 132 ? 25.313  0.528   -68.088  1.00 201.01 ? 132 TYR C CZ    1 
ATOM   6880  O  OH    . TYR C 1 132 ? 24.432  0.397   -69.175  1.00 206.63 ? 132 TYR C OH    1 
ATOM   6881  N  N     . VAL C 1 133 ? 25.231  2.278   -63.785  1.00 159.95 ? 133 VAL C N     1 
ATOM   6882  C  CA    . VAL C 1 133 ? 23.959  1.992   -63.135  1.00 162.46 ? 133 VAL C CA    1 
ATOM   6883  C  C     . VAL C 1 133 ? 23.117  1.222   -64.126  1.00 142.92 ? 133 VAL C C     1 
ATOM   6884  O  O     . VAL C 1 133 ? 22.974  1.653   -65.280  1.00 138.67 ? 133 VAL C O     1 
ATOM   6885  C  CB    . VAL C 1 133 ? 23.170  3.198   -62.688  1.00 179.47 ? 133 VAL C CB    1 
ATOM   6886  C  CG1   . VAL C 1 133 ? 23.819  3.867   -61.495  1.00 189.16 ? 133 VAL C CG1   1 
ATOM   6887  C  CG2   . VAL C 1 133 ? 23.036  4.199   -63.824  1.00 189.82 ? 133 VAL C CG2   1 
ATOM   6888  N  N     . ALA C 1 134 ? 22.588  0.073   -63.719  1.00 144.65 ? 134 ALA C N     1 
ATOM   6889  C  CA    . ALA C 1 134 ? 22.104  -0.908  -64.682  1.00 165.96 ? 134 ALA C CA    1 
ATOM   6890  C  C     . ALA C 1 134 ? 20.714  -1.337  -64.254  1.00 161.63 ? 134 ALA C C     1 
ATOM   6891  O  O     . ALA C 1 134 ? 20.331  -1.250  -63.060  1.00 161.95 ? 134 ALA C O     1 
ATOM   6892  C  CB    . ALA C 1 134 ? 23.039  -2.132  -64.770  1.00 185.19 ? 134 ALA C CB    1 
ATOM   6893  N  N     . ILE C 1 135 ? 19.942  -1.806  -65.234  1.00 163.90 ? 135 ILE C N     1 
ATOM   6894  C  CA    . ILE C 1 135 ? 18.566  -2.186  -64.984  1.00 177.37 ? 135 ILE C CA    1 
ATOM   6895  C  C     . ILE C 1 135 ? 18.591  -3.552  -64.356  1.00 180.38 ? 135 ILE C C     1 
ATOM   6896  O  O     . ILE C 1 135 ? 19.295  -4.452  -64.781  1.00 164.72 ? 135 ILE C O     1 
ATOM   6897  C  CB    . ILE C 1 135 ? 17.713  -2.157  -66.263  1.00 194.08 ? 135 ILE C CB    1 
ATOM   6898  C  CG1   . ILE C 1 135 ? 16.267  -1.744  -65.956  1.00 208.22 ? 135 ILE C CG1   1 
ATOM   6899  C  CG2   . ILE C 1 135 ? 17.849  -3.404  -67.103  1.00 197.44 ? 135 ILE C CG2   1 
ATOM   6900  C  CD1   . ILE C 1 135 ? 16.064  -0.234  -65.883  1.00 208.19 ? 135 ILE C CD1   1 
ATOM   6901  N  N     . GLN C 1 136 ? 17.772  -3.728  -63.332  1.00 195.76 ? 136 GLN C N     1 
ATOM   6902  C  CA    . GLN C 1 136 ? 17.728  -4.959  -62.586  1.00 192.93 ? 136 GLN C CA    1 
ATOM   6903  C  C     . GLN C 1 136 ? 17.414  -6.177  -63.445  1.00 173.07 ? 136 GLN C C     1 
ATOM   6904  O  O     . GLN C 1 136 ? 18.029  -7.209  -63.278  1.00 173.82 ? 136 GLN C O     1 
ATOM   6905  C  CB    . GLN C 1 136 ? 16.678  -4.918  -61.458  1.00 201.05 ? 136 GLN C CB    1 
ATOM   6906  C  CG    . GLN C 1 136 ? 17.130  -4.062  -60.311  1.00 213.66 ? 136 GLN C CG    1 
ATOM   6907  C  CD    . GLN C 1 136 ? 16.048  -3.807  -59.292  1.00 219.27 ? 136 GLN C CD    1 
ATOM   6908  O  OE1   . GLN C 1 136 ? 14.913  -4.252  -59.442  1.00 225.67 ? 136 GLN C OE1   1 
ATOM   6909  N  NE2   . GLN C 1 136 ? 16.374  -3.023  -58.267  1.00 223.86 ? 136 GLN C NE2   1 
ATOM   6910  N  N     . ALA C 1 137 ? 16.439  -6.056  -64.337  1.00 162.01 ? 137 ALA C N     1 
ATOM   6911  C  CA    . ALA C 1 137 ? 15.866  -7.248  -64.966  1.00 160.40 ? 137 ALA C CA    1 
ATOM   6912  C  C     . ALA C 1 137 ? 16.899  -7.902  -65.876  1.00 159.45 ? 137 ALA C C     1 
ATOM   6913  O  O     . ALA C 1 137 ? 17.041  -9.124  -65.899  1.00 159.05 ? 137 ALA C O     1 
ATOM   6914  C  CB    . ALA C 1 137 ? 14.569  -6.920  -65.737  1.00 162.63 ? 137 ALA C CB    1 
ATOM   6915  N  N     . VAL C 1 138 ? 17.520  -7.060  -66.696  1.00 169.70 ? 138 VAL C N     1 
ATOM   6916  C  CA    . VAL C 1 138 ? 18.533  -7.482  -67.662  1.00 187.09 ? 138 VAL C CA    1 
ATOM   6917  C  C     . VAL C 1 138 ? 19.591  -8.344  -66.967  1.00 179.15 ? 138 VAL C C     1 
ATOM   6918  O  O     . VAL C 1 138 ? 20.003  -9.389  -67.441  1.00 188.60 ? 138 VAL C O     1 
ATOM   6919  C  CB    . VAL C 1 138 ? 19.103  -6.235  -68.400  1.00 216.78 ? 138 VAL C CB    1 
ATOM   6920  C  CG1   . VAL C 1 138 ? 20.447  -6.505  -69.082  1.00 229.59 ? 138 VAL C CG1   1 
ATOM   6921  C  CG2   . VAL C 1 138 ? 18.021  -5.717  -69.323  1.00 222.82 ? 138 VAL C CG2   1 
ATOM   6922  N  N     . LEU C 1 139 ? 20.026  -7.862  -65.800  1.00 173.09 ? 139 LEU C N     1 
ATOM   6923  C  CA    . LEU C 1 139 ? 21.066  -8.516  -65.047  1.00 174.57 ? 139 LEU C CA    1 
ATOM   6924  C  C     . LEU C 1 139 ? 20.639  -9.922  -64.736  1.00 168.84 ? 139 LEU C C     1 
ATOM   6925  O  O     . LEU C 1 139 ? 21.412  -10.875 -64.947  1.00 172.17 ? 139 LEU C O     1 
ATOM   6926  C  CB    . LEU C 1 139 ? 21.398  -7.739  -63.750  1.00 188.55 ? 139 LEU C CB    1 
ATOM   6927  C  CG    . LEU C 1 139 ? 22.544  -6.705  -63.921  1.00 197.41 ? 139 LEU C CG    1 
ATOM   6928  C  CD1   . LEU C 1 139 ? 22.230  -5.709  -65.038  1.00 203.84 ? 139 LEU C CD1   1 
ATOM   6929  C  CD2   . LEU C 1 139 ? 22.864  -6.017  -62.583  1.00 206.64 ? 139 LEU C CD2   1 
ATOM   6930  N  N     . SER C 1 140 ? 19.410  -10.077 -64.248  1.00 158.41 ? 140 SER C N     1 
ATOM   6931  C  CA    . SER C 1 140 ? 18.923  -11.424 -63.933  1.00 154.27 ? 140 SER C CA    1 
ATOM   6932  C  C     . SER C 1 140 ? 18.862  -12.279 -65.149  1.00 151.07 ? 140 SER C C     1 
ATOM   6933  O  O     . SER C 1 140 ? 19.142  -13.464 -65.065  1.00 164.98 ? 140 SER C O     1 
ATOM   6934  C  CB    . SER C 1 140 ? 17.544  -11.444 -63.304  1.00 162.83 ? 140 SER C CB    1 
ATOM   6935  O  OG    . SER C 1 140 ? 16.663  -11.100 -64.325  1.00 184.24 ? 140 SER C OG    1 
ATOM   6936  N  N     . LEU C 1 141 ? 18.497  -11.696 -66.303  1.00 156.38 ? 141 LEU C N     1 
ATOM   6937  C  CA    . LEU C 1 141 ? 18.444  -12.458 -67.539  1.00 169.70 ? 141 LEU C CA    1 
ATOM   6938  C  C     . LEU C 1 141 ? 19.810  -12.977 -67.856  1.00 171.17 ? 141 LEU C C     1 
ATOM   6939  O  O     . LEU C 1 141 ? 19.945  -14.123 -68.250  1.00 174.10 ? 141 LEU C O     1 
ATOM   6940  C  CB    . LEU C 1 141 ? 17.973  -11.563 -68.708  1.00 184.95 ? 141 LEU C CB    1 
ATOM   6941  C  CG    . LEU C 1 141 ? 18.046  -12.191 -70.094  1.00 196.95 ? 141 LEU C CG    1 
ATOM   6942  C  CD1   . LEU C 1 141 ? 16.856  -13.131 -70.306  1.00 193.14 ? 141 LEU C CD1   1 
ATOM   6943  C  CD2   . LEU C 1 141 ? 18.186  -11.132 -71.208  1.00 202.44 ? 141 LEU C CD2   1 
ATOM   6944  N  N     . TYR C 1 142 ? 20.857  -12.163 -67.681  1.00 162.51 ? 142 TYR C N     1 
ATOM   6945  C  CA    . TYR C 1 142 ? 22.238  -12.605 -67.903  1.00 155.15 ? 142 TYR C CA    1 
ATOM   6946  C  C     . TYR C 1 142 ? 22.540  -13.745 -66.978  1.00 154.90 ? 142 TYR C C     1 
ATOM   6947  O  O     . TYR C 1 142 ? 23.156  -14.730 -67.366  1.00 153.88 ? 142 TYR C O     1 
ATOM   6948  C  CB    . TYR C 1 142 ? 23.274  -11.514 -67.527  1.00 157.85 ? 142 TYR C CB    1 
ATOM   6949  C  CG    . TYR C 1 142 ? 23.608  -10.626 -68.666  1.00 168.24 ? 142 TYR C CG    1 
ATOM   6950  C  CD1   . TYR C 1 142 ? 24.559  -10.989 -69.604  1.00 174.10 ? 142 TYR C CD1   1 
ATOM   6951  C  CD2   . TYR C 1 142 ? 23.006  -9.398  -68.784  1.00 177.14 ? 142 TYR C CD2   1 
ATOM   6952  C  CE1   . TYR C 1 142 ? 24.871  -10.147 -70.652  1.00 178.75 ? 142 TYR C CE1   1 
ATOM   6953  C  CE2   . TYR C 1 142 ? 23.308  -8.550  -69.830  1.00 178.99 ? 142 TYR C CE2   1 
ATOM   6954  C  CZ    . TYR C 1 142 ? 24.242  -8.928  -70.769  1.00 171.75 ? 142 TYR C CZ    1 
ATOM   6955  O  OH    . TYR C 1 142 ? 24.563  -8.064  -71.825  1.00 138.52 ? 142 TYR C OH    1 
ATOM   6956  N  N     . ALA C 1 143 ? 22.220  -13.561 -65.711  1.00 165.71 ? 143 ALA C N     1 
ATOM   6957  C  CA    . ALA C 1 143 ? 22.496  -14.576 -64.686  1.00 179.05 ? 143 ALA C CA    1 
ATOM   6958  C  C     . ALA C 1 143 ? 21.889  -15.889 -65.070  1.00 196.24 ? 143 ALA C C     1 
ATOM   6959  O  O     . ALA C 1 143 ? 22.436  -16.919 -64.726  1.00 201.72 ? 143 ALA C O     1 
ATOM   6960  C  CB    . ALA C 1 143 ? 21.981  -14.216 -63.293  1.00 182.71 ? 143 ALA C CB    1 
ATOM   6961  N  N     . SER C 1 144 ? 20.707  -15.872 -65.713  1.00 203.24 ? 144 SER C N     1 
ATOM   6962  C  CA    . SER C 1 144 ? 20.058  -17.101 -66.150  1.00 197.00 ? 144 SER C CA    1 
ATOM   6963  C  C     . SER C 1 144 ? 20.729  -17.659 -67.381  1.00 206.00 ? 144 SER C C     1 
ATOM   6964  O  O     . SER C 1 144 ? 20.438  -18.787 -67.754  1.00 198.21 ? 144 SER C O     1 
ATOM   6965  C  CB    . SER C 1 144 ? 18.542  -16.916 -66.420  1.00 193.37 ? 144 SER C CB    1 
ATOM   6966  O  OG    . SER C 1 144 ? 17.846  -16.785 -65.199  1.00 198.36 ? 144 SER C OG    1 
ATOM   6967  N  N     . GLY C 1 145 ? 21.594  -16.879 -68.040  1.00 218.48 ? 145 GLY C N     1 
ATOM   6968  C  CA    . GLY C 1 145 ? 22.327  -17.403 -69.171  1.00 219.85 ? 145 GLY C CA    1 
ATOM   6969  C  C     . GLY C 1 145 ? 21.526  -17.576 -70.434  1.00 214.81 ? 145 GLY C C     1 
ATOM   6970  O  O     . GLY C 1 145 ? 21.905  -18.345 -71.296  1.00 200.46 ? 145 GLY C O     1 
ATOM   6971  N  N     . ARG C 1 146 ? 20.421  -16.845 -70.523  1.00 222.05 ? 146 ARG C N     1 
ATOM   6972  C  CA    . ARG C 1 146 ? 19.549  -16.843 -71.686  1.00 221.51 ? 146 ARG C CA    1 
ATOM   6973  C  C     . ARG C 1 146 ? 19.609  -15.466 -72.282  1.00 228.28 ? 146 ARG C C     1 
ATOM   6974  O  O     . ARG C 1 146 ? 19.755  -14.467 -71.567  1.00 243.47 ? 146 ARG C O     1 
ATOM   6975  C  CB    . ARG C 1 146 ? 18.100  -17.123 -71.311  1.00 215.81 ? 146 ARG C CB    1 
ATOM   6976  C  CG    . ARG C 1 146 ? 17.946  -18.104 -70.118  1.00 212.10 ? 146 ARG C CG    1 
ATOM   6977  C  CD    . ARG C 1 146 ? 16.550  -18.093 -69.568  1.00 205.76 ? 146 ARG C CD    1 
ATOM   6978  N  NE    . ARG C 1 146 ? 15.661  -18.407 -70.670  1.00 196.09 ? 146 ARG C NE    1 
ATOM   6979  C  CZ    . ARG C 1 146 ? 15.445  -19.634 -71.134  1.00 193.90 ? 146 ARG C CZ    1 
ATOM   6980  N  NH1   . ARG C 1 146 ? 16.007  -20.704 -70.574  1.00 195.37 ? 146 ARG C NH1   1 
ATOM   6981  N  NH2   . ARG C 1 146 ? 14.635  -19.791 -72.163  1.00 191.59 ? 146 ARG C NH2   1 
ATOM   6982  N  N     . THR C 1 147 ? 19.456  -15.431 -73.614  1.00 230.71 ? 147 THR C N     1 
ATOM   6983  C  CA    . THR C 1 147 ? 19.527  -14.216 -74.443  1.00 237.90 ? 147 THR C CA    1 
ATOM   6984  C  C     . THR C 1 147 ? 18.145  -13.597 -74.614  1.00 230.73 ? 147 THR C C     1 
ATOM   6985  O  O     . THR C 1 147 ? 18.029  -12.460 -75.007  1.00 220.99 ? 147 THR C O     1 
ATOM   6986  C  CB    . THR C 1 147 ? 20.046  -14.544 -75.838  1.00 254.59 ? 147 THR C CB    1 
ATOM   6987  O  OG1   . THR C 1 147 ? 19.174  -15.473 -76.500  1.00 260.51 ? 147 THR C OG1   1 
ATOM   6988  C  CG2   . THR C 1 147 ? 21.423  -15.170 -75.719  1.00 254.31 ? 147 THR C CG2   1 
ATOM   6989  N  N     . THR C 1 148 ? 17.103  -14.358 -74.308  1.00 234.95 ? 148 THR C N     1 
ATOM   6990  C  CA    . THR C 1 148 ? 15.755  -13.923 -74.606  1.00 243.78 ? 148 THR C CA    1 
ATOM   6991  C  C     . THR C 1 148 ? 14.816  -14.390 -73.524  1.00 221.95 ? 148 THR C C     1 
ATOM   6992  O  O     . THR C 1 148 ? 14.939  -15.507 -73.031  1.00 214.11 ? 148 THR C O     1 
ATOM   6993  C  CB    . THR C 1 148 ? 15.253  -14.566 -75.895  1.00 261.91 ? 148 THR C CB    1 
ATOM   6994  O  OG1   . THR C 1 148 ? 16.068  -14.134 -76.988  1.00 267.74 ? 148 THR C OG1   1 
ATOM   6995  C  CG2   . THR C 1 148 ? 13.790  -14.182 -76.121  1.00 270.85 ? 148 THR C CG2   1 
ATOM   6996  N  N     . GLY C 1 149 ? 13.861  -13.530 -73.159  1.00 202.71 ? 149 GLY C N     1 
ATOM   6997  C  CA    . GLY C 1 149 ? 12.921  -13.892 -72.125  1.00 201.16 ? 149 GLY C CA    1 
ATOM   6998  C  C     . GLY C 1 149 ? 12.195  -12.695 -71.623  1.00 201.54 ? 149 GLY C C     1 
ATOM   6999  O  O     . GLY C 1 149 ? 12.516  -11.584 -72.029  1.00 198.33 ? 149 GLY C O     1 
ATOM   7000  N  N     . ILE C 1 150 ? 11.161  -12.888 -70.799  1.00 194.61 ? 150 ILE C N     1 
ATOM   7001  C  CA    . ILE C 1 150 ? 10.467  -11.759 -70.235  1.00 180.78 ? 150 ILE C CA    1 
ATOM   7002  C  C     . ILE C 1 150 ? 10.709  -11.866 -68.761  1.00 169.04 ? 150 ILE C C     1 
ATOM   7003  O  O     . ILE C 1 150 ? 10.328  -12.857 -68.144  1.00 152.98 ? 150 ILE C O     1 
ATOM   7004  C  CB    . ILE C 1 150 ? 8.973   -11.728 -70.561  1.00 199.60 ? 150 ILE C CB    1 
ATOM   7005  C  CG1   . ILE C 1 150 ? 8.334   -10.514 -69.853  1.00 220.59 ? 150 ILE C CG1   1 
ATOM   7006  C  CG2   . ILE C 1 150 ? 8.274   -13.067 -70.229  1.00 190.05 ? 150 ILE C CG2   1 
ATOM   7007  C  CD1   . ILE C 1 150 ? 6.966   -10.137 -70.379  1.00 240.11 ? 150 ILE C CD1   1 
ATOM   7008  N  N     . VAL C 1 151 ? 11.451  -10.910 -68.212  1.00 176.07 ? 151 VAL C N     1 
ATOM   7009  C  CA    . VAL C 1 151 ? 11.920  -11.070 -66.855  1.00 186.95 ? 151 VAL C CA    1 
ATOM   7010  C  C     . VAL C 1 151 ? 10.942  -10.404 -65.966  1.00 188.10 ? 151 VAL C C     1 
ATOM   7011  O  O     . VAL C 1 151 ? 10.713  -9.203  -66.133  1.00 174.13 ? 151 VAL C O     1 
ATOM   7012  C  CB    . VAL C 1 151 ? 13.306  -10.517 -66.683  1.00 194.19 ? 151 VAL C CB    1 
ATOM   7013  C  CG1   . VAL C 1 151 ? 13.687  -10.473 -65.197  1.00 207.30 ? 151 VAL C CG1   1 
ATOM   7014  C  CG2   . VAL C 1 151 ? 14.256  -11.343 -67.550  1.00 194.53 ? 151 VAL C CG2   1 
ATOM   7015  N  N     . MET C 1 152 ? 10.357  -11.217 -65.105  1.00 194.59 ? 152 MET C N     1 
ATOM   7016  C  CA    . MET C 1 152 ? 9.452   -10.798 -64.033  1.00 190.49 ? 152 MET C CA    1 
ATOM   7017  C  C     . MET C 1 152 ? 10.274  -10.564 -62.782  1.00 199.80 ? 152 MET C C     1 
ATOM   7018  O  O     . MET C 1 152 ? 10.831  -11.452 -62.173  1.00 188.67 ? 152 MET C O     1 
ATOM   7019  C  CB    . MET C 1 152 ? 8.445   -11.886 -63.757  1.00 196.53 ? 152 MET C CB    1 
ATOM   7020  C  CG    . MET C 1 152 ? 7.490   -11.643 -62.601  1.00 205.83 ? 152 MET C CG    1 
ATOM   7021  S  SD    . MET C 1 152 ? 6.462   -10.253 -63.049  1.00 237.75 ? 152 MET C SD    1 
ATOM   7022  C  CE    . MET C 1 152 ? 5.638   -10.048 -61.481  1.00 256.03 ? 152 MET C CE    1 
ATOM   7023  N  N     . ASP C 1 153 ? 10.425  -9.290  -62.472  1.00 226.74 ? 153 ASP C N     1 
ATOM   7024  C  CA    . ASP C 1 153 ? 11.329  -8.852  -61.410  1.00 231.49 ? 153 ASP C CA    1 
ATOM   7025  C  C     . ASP C 1 153 ? 10.465  -8.257  -60.312  1.00 236.22 ? 153 ASP C C     1 
ATOM   7026  O  O     . ASP C 1 153 ? 9.803   -7.217  -60.527  1.00 235.61 ? 153 ASP C O     1 
ATOM   7027  C  CB    . ASP C 1 153 ? 12.318  -7.787  -61.941  1.00 217.37 ? 153 ASP C CB    1 
ATOM   7028  C  CG    . ASP C 1 153 ? 12.848  -6.816  -60.888  1.00 199.93 ? 153 ASP C CG    1 
ATOM   7029  O  OD1   . ASP C 1 153 ? 12.912  -7.155  -59.666  1.00 195.34 ? 153 ASP C OD1   1 
ATOM   7030  O  OD2   . ASP C 1 153 ? 13.176  -5.683  -61.301  1.00 185.51 ? 153 ASP C OD2   1 
ATOM   7031  N  N     . SER C 1 154 ? 10.426  -8.917  -59.180  1.00 226.43 ? 154 SER C N     1 
ATOM   7032  C  CA    . SER C 1 154 ? 9.706   -8.371  -58.055  1.00 218.70 ? 154 SER C CA    1 
ATOM   7033  C  C     . SER C 1 154 ? 10.616  -8.544  -56.908  1.00 225.62 ? 154 SER C C     1 
ATOM   7034  O  O     . SER C 1 154 ? 10.977  -9.690  -56.528  1.00 217.46 ? 154 SER C O     1 
ATOM   7035  C  CB    . SER C 1 154 ? 8.379   -9.062  -57.824  1.00 203.06 ? 154 SER C CB    1 
ATOM   7036  O  OG    . SER C 1 154 ? 8.518   -10.461 -57.666  1.00 192.44 ? 154 SER C OG    1 
ATOM   7037  N  N     . GLY C 1 155 ? 11.077  -7.430  -56.381  1.00 233.61 ? 155 GLY C N     1 
ATOM   7038  C  CA    . GLY C 1 155 ? 11.789  -7.425  -55.106  1.00 230.77 ? 155 GLY C CA    1 
ATOM   7039  C  C     . GLY C 1 155 ? 10.880  -7.008  -53.958  1.00 226.25 ? 155 GLY C C     1 
ATOM   7040  O  O     . GLY C 1 155 ? 9.665   -7.185  -53.992  1.00 219.21 ? 155 GLY C O     1 
ATOM   7041  N  N     . ASP C 1 156 ? 11.486  -6.465  -52.912  1.00 221.67 ? 156 ASP C N     1 
ATOM   7042  C  CA    . ASP C 1 156 ? 10.764  -5.873  -51.831  1.00 217.52 ? 156 ASP C CA    1 
ATOM   7043  C  C     . ASP C 1 156 ? 10.349  -4.490  -52.277  1.00 191.24 ? 156 ASP C C     1 
ATOM   7044  O  O     . ASP C 1 156 ? 9.335   -4.012  -51.833  1.00 182.61 ? 156 ASP C O     1 
ATOM   7045  C  CB    . ASP C 1 156 ? 11.676  -5.755  -50.603  1.00 249.05 ? 156 ASP C CB    1 
ATOM   7046  C  CG    . ASP C 1 156 ? 10.945  -5.298  -49.385  1.00 262.26 ? 156 ASP C CG    1 
ATOM   7047  O  OD1   . ASP C 1 156 ? 10.191  -6.098  -48.801  1.00 267.20 ? 156 ASP C OD1   1 
ATOM   7048  O  OD2   . ASP C 1 156 ? 11.120  -4.131  -48.969  1.00 261.43 ? 156 ASP C OD2   1 
ATOM   7049  N  N     . GLY C 1 157 ? 11.150  -3.847  -53.130  1.00 189.50 ? 157 GLY C N     1 
ATOM   7050  C  CA    . GLY C 1 157 ? 10.850  -2.494  -53.611  1.00 192.17 ? 157 GLY C CA    1 
ATOM   7051  C  C     . GLY C 1 157 ? 9.574   -2.382  -54.399  1.00 189.43 ? 157 GLY C C     1 
ATOM   7052  O  O     . GLY C 1 157 ? 8.537   -1.979  -53.869  1.00 198.73 ? 157 GLY C O     1 
ATOM   7053  N  N     . VAL C 1 158 ? 9.686   -2.718  -55.675  1.00 180.48 ? 158 VAL C N     1 
ATOM   7054  C  CA    . VAL C 1 158 ? 8.531   -2.794  -56.554  1.00 179.27 ? 158 VAL C CA    1 
ATOM   7055  C  C     . VAL C 1 158 ? 8.736   -3.914  -57.538  1.00 165.68 ? 158 VAL C C     1 
ATOM   7056  O  O     . VAL C 1 158 ? 9.837   -4.393  -57.739  1.00 171.10 ? 158 VAL C O     1 
ATOM   7057  C  CB    . VAL C 1 158 ? 8.233   -1.412  -57.239  1.00 197.74 ? 158 VAL C CB    1 
ATOM   7058  C  CG1   . VAL C 1 158 ? 7.778   -1.502  -58.694  1.00 206.49 ? 158 VAL C CG1   1 
ATOM   7059  C  CG2   . VAL C 1 158 ? 7.173   -0.659  -56.445  1.00 210.24 ? 158 VAL C CG2   1 
ATOM   7060  N  N     . THR C 1 159 ? 7.645   -4.315  -58.202  1.00 162.36 ? 159 THR C N     1 
ATOM   7061  C  CA    . THR C 1 159 ? 7.653   -5.269  -59.260  1.00 173.40 ? 159 THR C CA    1 
ATOM   7062  C  C     . THR C 1 159 ? 7.769   -4.651  -60.654  1.00 174.94 ? 159 THR C C     1 
ATOM   7063  O  O     . THR C 1 159 ? 7.147   -3.654  -61.005  1.00 165.31 ? 159 THR C O     1 
ATOM   7064  C  CB    . THR C 1 159 ? 6.317   -6.020  -59.240  1.00 181.29 ? 159 THR C CB    1 
ATOM   7065  O  OG1   . THR C 1 159 ? 6.288   -6.840  -58.081  1.00 185.93 ? 159 THR C OG1   1 
ATOM   7066  C  CG2   . THR C 1 159 ? 6.092   -6.882  -60.496  1.00 186.30 ? 159 THR C CG2   1 
ATOM   7067  N  N     . HIS C 1 160 ? 8.506   -5.340  -61.486  1.00 171.94 ? 160 HIS C N     1 
ATOM   7068  C  CA    . HIS C 1 160 ? 8.896   -4.824  -62.800  1.00 167.18 ? 160 HIS C CA    1 
ATOM   7069  C  C     . HIS C 1 160 ? 8.893   -5.970  -63.773  1.00 161.62 ? 160 HIS C C     1 
ATOM   7070  O  O     . HIS C 1 160 ? 8.968   -7.158  -63.409  1.00 167.67 ? 160 HIS C O     1 
ATOM   7071  C  CB    . HIS C 1 160 ? 10.302  -4.140  -62.759  1.00 187.91 ? 160 HIS C CB    1 
ATOM   7072  C  CG    . HIS C 1 160 ? 10.446  -3.090  -61.682  1.00 256.53 ? 160 HIS C CG    1 
ATOM   7073  N  ND1   . HIS C 1 160 ? 10.803  -3.380  -60.381  1.00 290.13 ? 160 HIS C ND1   1 
ATOM   7074  C  CD2   . HIS C 1 160 ? 10.273  -1.750  -61.735  1.00 298.69 ? 160 HIS C CD2   1 
ATOM   7075  C  CE1   . HIS C 1 160 ? 10.848  -2.261  -59.679  1.00 307.33 ? 160 HIS C CE1   1 
ATOM   7076  N  NE2   . HIS C 1 160 ? 10.524  -1.255  -60.474  1.00 311.21 ? 160 HIS C NE2   1 
ATOM   7077  N  N     . THR C 1 161 ? 8.780   -5.604  -65.029  1.00 174.02 ? 161 THR C N     1 
ATOM   7078  C  CA    . THR C 1 161 ? 8.607   -6.590  -66.095  1.00 185.66 ? 161 THR C CA    1 
ATOM   7079  C  C     . THR C 1 161 ? 9.231   -6.079  -67.358  1.00 196.35 ? 161 THR C C     1 
ATOM   7080  O  O     . THR C 1 161 ? 8.829   -5.073  -67.887  1.00 200.22 ? 161 THR C O     1 
ATOM   7081  C  CB    . THR C 1 161 ? 7.146   -6.947  -66.374  1.00 178.42 ? 161 THR C CB    1 
ATOM   7082  O  OG1   . THR C 1 161 ? 6.485   -7.350  -65.165  1.00 176.84 ? 161 THR C OG1   1 
ATOM   7083  C  CG2   . THR C 1 161 ? 7.062   -8.093  -67.355  1.00 183.98 ? 161 THR C CG2   1 
ATOM   7084  N  N     . VAL C 1 162 ? 10.245  -6.765  -67.840  1.00 187.58 ? 162 VAL C N     1 
ATOM   7085  C  CA    . VAL C 1 162 ? 10.966  -6.294  -69.036  1.00 179.77 ? 162 VAL C CA    1 
ATOM   7086  C  C     . VAL C 1 162 ? 11.155  -7.450  -69.992  1.00 177.94 ? 162 VAL C C     1 
ATOM   7087  O  O     . VAL C 1 162 ? 11.868  -8.414  -69.740  1.00 174.45 ? 162 VAL C O     1 
ATOM   7088  C  CB    . VAL C 1 162 ? 12.335  -5.650  -68.659  1.00 183.35 ? 162 VAL C CB    1 
ATOM   7089  C  CG1   . VAL C 1 162 ? 13.081  -5.182  -69.913  1.00 190.83 ? 162 VAL C CG1   1 
ATOM   7090  C  CG2   . VAL C 1 162 ? 12.119  -4.502  -67.670  1.00 185.49 ? 162 VAL C CG2   1 
ATOM   7091  N  N     . PRO C 1 163 ? 10.467  -7.360  -71.119  1.00 176.14 ? 163 PRO C N     1 
ATOM   7092  C  CA    . PRO C 1 163 ? 10.643  -8.344  -72.160  1.00 165.24 ? 163 PRO C CA    1 
ATOM   7093  C  C     . PRO C 1 163 ? 11.902  -8.055  -72.911  1.00 161.04 ? 163 PRO C C     1 
ATOM   7094  O  O     . PRO C 1 163 ? 12.163  -6.906  -73.184  1.00 164.11 ? 163 PRO C O     1 
ATOM   7095  C  CB    . PRO C 1 163 ? 9.402   -8.153  -73.043  1.00 181.53 ? 163 PRO C CB    1 
ATOM   7096  C  CG    . PRO C 1 163 ? 9.005   -6.739  -72.819  1.00 190.76 ? 163 PRO C CG    1 
ATOM   7097  C  CD    . PRO C 1 163 ? 9.413   -6.381  -71.426  1.00 185.18 ? 163 PRO C CD    1 
ATOM   7098  N  N     . ILE C 1 164 ? 12.648  -9.090  -73.293  1.00 165.39 ? 164 ILE C N     1 
ATOM   7099  C  CA    . ILE C 1 164 ? 13.873  -8.902  -74.031  1.00 178.59 ? 164 ILE C CA    1 
ATOM   7100  C  C     . ILE C 1 164 ? 13.921  -9.922  -75.145  1.00 194.74 ? 164 ILE C C     1 
ATOM   7101  O  O     . ILE C 1 164 ? 13.590  -11.086 -74.947  1.00 201.71 ? 164 ILE C O     1 
ATOM   7102  C  CB    . ILE C 1 164 ? 15.088  -9.077  -73.098  1.00 183.09 ? 164 ILE C CB    1 
ATOM   7103  C  CG1   . ILE C 1 164 ? 16.160  -8.001  -73.321  1.00 185.30 ? 164 ILE C CG1   1 
ATOM   7104  C  CG2   . ILE C 1 164 ? 15.603  -10.494 -73.070  1.00 186.02 ? 164 ILE C CG2   1 
ATOM   7105  C  CD1   . ILE C 1 164 ? 15.952  -6.728  -72.507  1.00 183.96 ? 164 ILE C CD1   1 
ATOM   7106  N  N     . TYR C 1 165 ? 14.355  -9.539  -76.321  1.00 200.70 ? 165 TYR C N     1 
ATOM   7107  C  CA    . TYR C 1 165 ? 14.463  -10.518 -77.370  1.00 207.14 ? 165 TYR C CA    1 
ATOM   7108  C  C     . TYR C 1 165 ? 15.823  -10.398 -77.950  1.00 199.14 ? 165 TYR C C     1 
ATOM   7109  O  O     . TYR C 1 165 ? 16.139  -9.383  -78.505  1.00 205.06 ? 165 TYR C O     1 
ATOM   7110  C  CB    . TYR C 1 165 ? 13.387  -10.287 -78.438  1.00 215.56 ? 165 TYR C CB    1 
ATOM   7111  C  CG    . TYR C 1 165 ? 13.599  -11.219 -79.572  1.00 225.91 ? 165 TYR C CG    1 
ATOM   7112  C  CD1   . TYR C 1 165 ? 13.132  -12.505 -79.498  1.00 235.40 ? 165 TYR C CD1   1 
ATOM   7113  C  CD2   . TYR C 1 165 ? 14.268  -10.824 -80.724  1.00 233.63 ? 165 TYR C CD2   1 
ATOM   7114  C  CE1   . TYR C 1 165 ? 13.326  -13.403 -80.524  1.00 245.97 ? 165 TYR C CE1   1 
ATOM   7115  C  CE2   . TYR C 1 165 ? 14.488  -11.720 -81.744  1.00 243.31 ? 165 TYR C CE2   1 
ATOM   7116  C  CZ    . TYR C 1 165 ? 14.005  -13.007 -81.650  1.00 252.87 ? 165 TYR C CZ    1 
ATOM   7117  O  OH    . TYR C 1 165 ? 14.207  -13.917 -82.703  1.00 263.47 ? 165 TYR C OH    1 
ATOM   7118  N  N     . GLU C 1 166 ? 16.597  -11.477 -77.891  1.00 210.24 ? 166 GLU C N     1 
ATOM   7119  C  CA    . GLU C 1 166 ? 17.885  -11.572 -78.595  1.00 236.73 ? 166 GLU C CA    1 
ATOM   7120  C  C     . GLU C 1 166 ? 18.760  -10.378 -78.202  1.00 231.57 ? 166 GLU C C     1 
ATOM   7121  O  O     . GLU C 1 166 ? 19.313  -9.657  -79.028  1.00 233.37 ? 166 GLU C O     1 
ATOM   7122  C  CB    . GLU C 1 166 ? 17.721  -11.677 -80.112  1.00 259.18 ? 166 GLU C CB    1 
ATOM   7123  C  CG    . GLU C 1 166 ? 18.947  -12.121 -80.856  1.00 277.39 ? 166 GLU C CG    1 
ATOM   7124  C  CD    . GLU C 1 166 ? 19.358  -13.508 -80.460  1.00 289.45 ? 166 GLU C CD    1 
ATOM   7125  O  OE1   . GLU C 1 166 ? 18.453  -14.280 -80.101  1.00 294.12 ? 166 GLU C OE1   1 
ATOM   7126  O  OE2   . GLU C 1 166 ? 20.562  -13.802 -80.482  1.00 300.42 ? 166 GLU C OE2   1 
ATOM   7127  N  N     . GLY C 1 167 ? 18.875  -10.162 -76.910  1.00 225.20 ? 167 GLY C N     1 
ATOM   7128  C  CA    . GLY C 1 167 ? 19.325  -8.867  -76.408  1.00 227.84 ? 167 GLY C CA    1 
ATOM   7129  C  C     . GLY C 1 167 ? 18.215  -7.907  -76.735  1.00 237.15 ? 167 GLY C C     1 
ATOM   7130  O  O     . GLY C 1 167 ? 17.061  -8.160  -76.437  1.00 244.33 ? 167 GLY C O     1 
ATOM   7131  N  N     . TYR C 1 168 ? 18.528  -6.812  -77.392  1.00 232.67 ? 168 TYR C N     1 
ATOM   7132  C  CA    . TYR C 1 168 ? 17.530  -5.756  -77.542  1.00 234.86 ? 168 TYR C CA    1 
ATOM   7133  C  C     . TYR C 1 168 ? 16.678  -5.458  -76.282  1.00 233.68 ? 168 TYR C C     1 
ATOM   7134  O  O     . TYR C 1 168 ? 17.207  -5.584  -75.181  1.00 245.77 ? 168 TYR C O     1 
ATOM   7135  C  CB    . TYR C 1 168 ? 16.765  -5.929  -78.869  1.00 252.67 ? 168 TYR C CB    1 
ATOM   7136  C  CG    . TYR C 1 168 ? 17.728  -5.844  -80.001  1.00 270.50 ? 168 TYR C CG    1 
ATOM   7137  C  CD1   . TYR C 1 168 ? 18.362  -4.653  -80.297  1.00 269.13 ? 168 TYR C CD1   1 
ATOM   7138  C  CD2   . TYR C 1 168 ? 18.060  -6.966  -80.716  1.00 296.26 ? 168 TYR C CD2   1 
ATOM   7139  C  CE1   . TYR C 1 168 ? 19.287  -4.586  -81.299  1.00 290.22 ? 168 TYR C CE1   1 
ATOM   7140  C  CE2   . TYR C 1 168 ? 18.973  -6.908  -81.744  1.00 306.23 ? 168 TYR C CE2   1 
ATOM   7141  C  CZ    . TYR C 1 168 ? 19.595  -5.714  -82.036  1.00 304.01 ? 168 TYR C CZ    1 
ATOM   7142  O  OH    . TYR C 1 168 ? 20.532  -5.658  -83.079  1.00 303.03 ? 168 TYR C OH    1 
ATOM   7143  N  N     . ALA C 1 169 ? 15.416  -5.033  -76.401  1.00 229.59 ? 169 ALA C N     1 
ATOM   7144  C  CA    . ALA C 1 169 ? 14.674  -4.518  -75.253  1.00 222.90 ? 169 ALA C CA    1 
ATOM   7145  C  C     . ALA C 1 169 ? 13.563  -3.671  -75.821  1.00 203.75 ? 169 ALA C C     1 
ATOM   7146  O  O     . ALA C 1 169 ? 13.744  -3.007  -76.831  1.00 203.50 ? 169 ALA C O     1 
ATOM   7147  C  CB    . ALA C 1 169 ? 15.527  -3.641  -74.334  1.00 226.54 ? 169 ALA C CB    1 
ATOM   7148  N  N     . LEU C 1 170 ? 12.421  -3.669  -75.164  1.00 181.85 ? 170 LEU C N     1 
ATOM   7149  C  CA    . LEU C 1 170 ? 11.256  -2.973  -75.710  1.00 173.27 ? 170 LEU C CA    1 
ATOM   7150  C  C     . LEU C 1 170 ? 10.767  -1.989  -74.678  1.00 175.95 ? 170 LEU C C     1 
ATOM   7151  O  O     . LEU C 1 170 ? 10.127  -2.372  -73.742  1.00 171.10 ? 170 LEU C O     1 
ATOM   7152  C  CB    . LEU C 1 170 ? 10.175  -3.998  -76.037  1.00 173.97 ? 170 LEU C CB    1 
ATOM   7153  C  CG    . LEU C 1 170 ? 10.555  -4.995  -77.137  1.00 177.18 ? 170 LEU C CG    1 
ATOM   7154  C  CD1   . LEU C 1 170 ? 9.584   -6.193  -77.170  1.00 172.59 ? 170 LEU C CD1   1 
ATOM   7155  C  CD2   . LEU C 1 170 ? 10.688  -4.314  -78.509  1.00 184.37 ? 170 LEU C CD2   1 
ATOM   7156  N  N     . PRO C 1 171 ? 11.089  -0.707  -74.817  1.00 198.37 ? 171 PRO C N     1 
ATOM   7157  C  CA    . PRO C 1 171 ? 10.696  0.307   -73.866  1.00 210.35 ? 171 PRO C CA    1 
ATOM   7158  C  C     . PRO C 1 171 ? 9.213   0.445   -73.624  1.00 211.37 ? 171 PRO C C     1 
ATOM   7159  O  O     . PRO C 1 171 ? 8.775   0.617   -72.485  1.00 217.74 ? 171 PRO C O     1 
ATOM   7160  C  CB    . PRO C 1 171 ? 11.249  1.590   -74.493  1.00 210.94 ? 171 PRO C CB    1 
ATOM   7161  C  CG    . PRO C 1 171 ? 12.449  1.136   -75.242  1.00 211.09 ? 171 PRO C CG    1 
ATOM   7162  C  CD    . PRO C 1 171 ? 12.120  -0.228  -75.749  1.00 208.87 ? 171 PRO C CD    1 
ATOM   7163  N  N     . HIS C 1 172 ? 8.416   0.405   -74.690  1.00 213.17 ? 172 HIS C N     1 
ATOM   7164  C  CA    . HIS C 1 172 ? 6.986   0.587   -74.574  1.00 224.17 ? 172 HIS C CA    1 
ATOM   7165  C  C     . HIS C 1 172 ? 6.393   -0.555  -73.801  1.00 217.73 ? 172 HIS C C     1 
ATOM   7166  O  O     . HIS C 1 172 ? 5.413   -0.380  -73.057  1.00 225.59 ? 172 HIS C O     1 
ATOM   7167  C  CB    . HIS C 1 172 ? 6.302   0.684   -75.943  1.00 234.12 ? 172 HIS C CB    1 
ATOM   7168  C  CG    . HIS C 1 172 ? 6.654   -0.443  -76.866  1.00 231.05 ? 172 HIS C CG    1 
ATOM   7169  N  ND1   . HIS C 1 172 ? 7.850   -0.504  -77.541  1.00 229.40 ? 172 HIS C ND1   1 
ATOM   7170  C  CD2   . HIS C 1 172 ? 5.967   -1.554  -77.226  1.00 231.92 ? 172 HIS C CD2   1 
ATOM   7171  C  CE1   . HIS C 1 172 ? 7.875   -1.589  -78.306  1.00 233.83 ? 172 HIS C CE1   1 
ATOM   7172  N  NE2   . HIS C 1 172 ? 6.748   -2.252  -78.123  1.00 232.41 ? 172 HIS C NE2   1 
ATOM   7173  N  N     . ALA C 1 173 ? 6.966   -1.758  -74.008  1.00 207.20 ? 173 ALA C N     1 
ATOM   7174  C  CA    . ALA C 1 173 ? 6.531   -3.023  -73.436  1.00 209.98 ? 173 ALA C CA    1 
ATOM   7175  C  C     . ALA C 1 173 ? 6.894   -3.187  -71.979  1.00 205.33 ? 173 ALA C C     1 
ATOM   7176  O  O     . ALA C 1 173 ? 6.270   -3.997  -71.294  1.00 198.67 ? 173 ALA C O     1 
ATOM   7177  C  CB    . ALA C 1 173 ? 7.105   -4.223  -74.187  1.00 229.10 ? 173 ALA C CB    1 
ATOM   7178  N  N     . ILE C 1 174 ? 7.938   -2.513  -71.490  1.00 210.92 ? 174 ILE C N     1 
ATOM   7179  C  CA    . ILE C 1 174 ? 8.311   -2.618  -70.094  1.00 219.29 ? 174 ILE C CA    1 
ATOM   7180  C  C     . ILE C 1 174 ? 7.200   -2.197  -69.137  1.00 213.33 ? 174 ILE C C     1 
ATOM   7181  O  O     . ILE C 1 174 ? 6.581   -1.151  -69.383  1.00 220.06 ? 174 ILE C O     1 
ATOM   7182  C  CB    . ILE C 1 174 ? 9.488   -1.721  -69.754  1.00 232.12 ? 174 ILE C CB    1 
ATOM   7183  C  CG1   . ILE C 1 174 ? 10.784  -2.271  -70.397  1.00 248.11 ? 174 ILE C CG1   1 
ATOM   7184  C  CG2   . ILE C 1 174 ? 9.604   -1.574  -68.229  1.00 229.01 ? 174 ILE C CG2   1 
ATOM   7185  C  CD1   . ILE C 1 174 ? 11.928  -1.268  -70.385  1.00 263.10 ? 174 ILE C CD1   1 
ATOM   7186  N  N     . LEU C 1 175 ? 6.951   -3.000  -68.104  1.00 192.94 ? 175 LEU C N     1 
ATOM   7187  C  CA    . LEU C 1 175 ? 5.792   -2.683  -67.265  1.00 185.55 ? 175 LEU C CA    1 
ATOM   7188  C  C     . LEU C 1 175 ? 6.261   -2.602  -65.855  1.00 191.35 ? 175 LEU C C     1 
ATOM   7189  O  O     . LEU C 1 175 ? 7.132   -3.378  -65.463  1.00 196.02 ? 175 LEU C O     1 
ATOM   7190  C  CB    . LEU C 1 175 ? 4.635   -3.644  -67.472  1.00 191.89 ? 175 LEU C CB    1 
ATOM   7191  C  CG    . LEU C 1 175 ? 3.353   -3.225  -66.779  1.00 207.13 ? 175 LEU C CG    1 
ATOM   7192  C  CD1   . LEU C 1 175 ? 2.933   -1.794  -67.151  1.00 201.52 ? 175 LEU C CD1   1 
ATOM   7193  C  CD2   . LEU C 1 175 ? 2.212   -4.243  -67.059  1.00 221.47 ? 175 LEU C CD2   1 
ATOM   7194  N  N     . ARG C 1 176 ? 5.692   -1.686  -65.053  1.00 186.45 ? 176 ARG C N     1 
ATOM   7195  C  CA    . ARG C 1 176 ? 6.105   -1.586  -63.654  1.00 174.64 ? 176 ARG C CA    1 
ATOM   7196  C  C     . ARG C 1 176 ? 4.858   -1.508  -62.795  1.00 172.33 ? 176 ARG C C     1 
ATOM   7197  O  O     . ARG C 1 176 ? 4.049   -0.602  -62.994  1.00 178.14 ? 176 ARG C O     1 
ATOM   7198  C  CB    . ARG C 1 176 ? 6.934   -0.334  -63.392  1.00 169.96 ? 176 ARG C CB    1 
ATOM   7199  C  CG    . ARG C 1 176 ? 7.004   0.127   -61.925  1.00 181.21 ? 176 ARG C CG    1 
ATOM   7200  C  CD    . ARG C 1 176 ? 7.868   1.377   -61.759  1.00 199.29 ? 176 ARG C CD    1 
ATOM   7201  N  NE    . ARG C 1 176 ? 7.885   1.803   -60.377  1.00 208.43 ? 176 ARG C NE    1 
ATOM   7202  C  CZ    . ARG C 1 176 ? 8.589   2.836   -59.940  1.00 218.60 ? 176 ARG C CZ    1 
ATOM   7203  N  NH1   . ARG C 1 176 ? 9.307   3.547   -60.798  1.00 222.33 ? 176 ARG C NH1   1 
ATOM   7204  N  NH2   . ARG C 1 176 ? 8.571   3.167   -58.650  1.00 231.41 ? 176 ARG C NH2   1 
ATOM   7205  N  N     . LEU C 1 177 ? 4.738   -2.446  -61.879  1.00 173.24 ? 177 LEU C N     1 
ATOM   7206  C  CA    . LEU C 1 177 ? 3.515   -2.696  -61.111  1.00 193.33 ? 177 LEU C CA    1 
ATOM   7207  C  C     . LEU C 1 177 ? 3.828   -2.426  -59.667  1.00 214.01 ? 177 LEU C C     1 
ATOM   7208  O  O     . LEU C 1 177 ? 4.785   -2.945  -59.095  1.00 216.74 ? 177 LEU C O     1 
ATOM   7209  C  CB    . LEU C 1 177 ? 3.112   -4.174  -61.267  1.00 199.46 ? 177 LEU C CB    1 
ATOM   7210  C  CG    . LEU C 1 177 ? 1.914   -4.628  -60.408  1.00 221.69 ? 177 LEU C CG    1 
ATOM   7211  C  CD1   . LEU C 1 177 ? 0.627   -3.879  -60.786  1.00 225.69 ? 177 LEU C CD1   1 
ATOM   7212  C  CD2   . LEU C 1 177 ? 1.742   -6.159  -60.503  1.00 230.20 ? 177 LEU C CD2   1 
ATOM   7213  N  N     . ASP C 1 178 ? 3.025   -1.581  -59.034  1.00 228.22 ? 178 ASP C N     1 
ATOM   7214  C  CA    . ASP C 1 178 ? 3.277   -1.282  -57.614  1.00 229.12 ? 178 ASP C CA    1 
ATOM   7215  C  C     . ASP C 1 178 ? 2.711   -2.345  -56.647  1.00 215.38 ? 178 ASP C C     1 
ATOM   7216  O  O     . ASP C 1 178 ? 1.680   -2.196  -56.010  1.00 215.47 ? 178 ASP C O     1 
ATOM   7217  C  CB    . ASP C 1 178 ? 2.793   0.128   -57.226  1.00 245.17 ? 178 ASP C CB    1 
ATOM   7218  C  CG    . ASP C 1 178 ? 3.522   1.184   -57.970  1.00 264.63 ? 178 ASP C CG    1 
ATOM   7219  O  OD1   . ASP C 1 178 ? 4.337   0.800   -58.833  1.00 271.56 ? 178 ASP C OD1   1 
ATOM   7220  O  OD2   . ASP C 1 178 ? 3.266   2.346   -57.721  1.00 291.31 ? 178 ASP C OD2   1 
ATOM   7221  N  N     . LEU C 1 179 ? 3.483   -3.428  -56.525  1.00 204.85 ? 179 LEU C N     1 
ATOM   7222  C  CA    . LEU C 1 179 ? 3.268   -4.421  -55.518  1.00 185.10 ? 179 LEU C CA    1 
ATOM   7223  C  C     . LEU C 1 179 ? 4.658   -4.835  -55.140  1.00 173.32 ? 179 LEU C C     1 
ATOM   7224  O  O     . LEU C 1 179 ? 5.609   -4.669  -55.907  1.00 181.81 ? 179 LEU C O     1 
ATOM   7225  C  CB    . LEU C 1 179 ? 2.593   -5.649  -56.099  1.00 187.63 ? 179 LEU C CB    1 
ATOM   7226  C  CG    . LEU C 1 179 ? 1.099   -5.644  -56.457  1.00 194.69 ? 179 LEU C CG    1 
ATOM   7227  C  CD1   . LEU C 1 179 ? 0.684   -7.023  -57.022  1.00 209.48 ? 179 LEU C CD1   1 
ATOM   7228  C  CD2   . LEU C 1 179 ? 0.188   -5.236  -55.291  1.00 187.62 ? 179 LEU C CD2   1 
ATOM   7229  N  N     . ALA C 1 180 ? 4.820   -5.395  -53.973  1.00 163.25 ? 180 ALA C N     1 
ATOM   7230  C  CA    . ALA C 1 180 ? 6.143   -5.776  -53.480  1.00 171.70 ? 180 ALA C CA    1 
ATOM   7231  C  C     . ALA C 1 180 ? 5.997   -6.713  -52.308  1.00 166.78 ? 180 ALA C C     1 
ATOM   7232  O  O     . ALA C 1 180 ? 4.929   -6.852  -51.749  1.00 163.68 ? 180 ALA C O     1 
ATOM   7233  C  CB    . ALA C 1 180 ? 6.914   -4.562  -52.983  1.00 194.41 ? 180 ALA C CB    1 
ATOM   7234  N  N     . GLY C 1 181 ? 7.118   -7.267  -51.888  1.00 181.46 ? 181 GLY C N     1 
ATOM   7235  C  CA    . GLY C 1 181 ? 7.220   -7.982  -50.617  1.00 190.44 ? 181 GLY C CA    1 
ATOM   7236  C  C     . GLY C 1 181 ? 6.713   -7.092  -49.475  1.00 175.53 ? 181 GLY C C     1 
ATOM   7237  O  O     . GLY C 1 181 ? 6.023   -7.581  -48.585  1.00 192.17 ? 181 GLY C O     1 
ATOM   7238  N  N     . ARG C 1 182 ? 7.062   -5.821  -49.526  1.00 149.59 ? 182 ARG C N     1 
ATOM   7239  C  CA    . ARG C 1 182 ? 6.688   -4.941  -48.440  1.00 148.47 ? 182 ARG C CA    1 
ATOM   7240  C  C     . ARG C 1 182 ? 5.184   -4.761  -48.373  1.00 137.32 ? 182 ARG C C     1 
ATOM   7241  O  O     . ARG C 1 182 ? 4.611   -4.787  -47.276  1.00 155.55 ? 182 ARG C O     1 
ATOM   7242  C  CB    . ARG C 1 182 ? 7.454   -3.598  -48.494  1.00 173.94 ? 182 ARG C CB    1 
ATOM   7243  C  CG    . ARG C 1 182 ? 7.581   -2.870  -47.160  1.00 184.24 ? 182 ARG C CG    1 
ATOM   7244  C  CD    . ARG C 1 182 ? 8.654   -1.801  -47.229  1.00 188.66 ? 182 ARG C CD    1 
ATOM   7245  N  NE    . ARG C 1 182 ? 8.490   -0.772  -46.186  1.00 199.79 ? 182 ARG C NE    1 
ATOM   7246  C  CZ    . ARG C 1 182 ? 7.584   0.212   -46.224  1.00 220.05 ? 182 ARG C CZ    1 
ATOM   7247  N  NH1   . ARG C 1 182 ? 6.749   0.279   -47.252  1.00 225.97 ? 182 ARG C NH1   1 
ATOM   7248  N  NH2   . ARG C 1 182 ? 7.494   1.121   -45.228  1.00 232.32 ? 182 ARG C NH2   1 
ATOM   7249  N  N     . ASP C 1 183 ? 4.533   -4.683  -49.530  1.00 132.30 ? 183 ASP C N     1 
ATOM   7250  C  CA    . ASP C 1 183 ? 3.089   -4.530  -49.532  1.00 147.88 ? 183 ASP C CA    1 
ATOM   7251  C  C     . ASP C 1 183 ? 2.443   -5.812  -49.046  1.00 136.49 ? 183 ASP C C     1 
ATOM   7252  O  O     . ASP C 1 183 ? 1.434   -5.747  -48.328  1.00 144.71 ? 183 ASP C O     1 
ATOM   7253  C  CB    . ASP C 1 183 ? 2.545   -3.997  -50.888  1.00 188.58 ? 183 ASP C CB    1 
ATOM   7254  C  CG    . ASP C 1 183 ? 3.204   -2.651  -51.303  1.00 219.01 ? 183 ASP C CG    1 
ATOM   7255  O  OD1   . ASP C 1 183 ? 3.599   -1.839  -50.426  1.00 226.30 ? 183 ASP C OD1   1 
ATOM   7256  O  OD2   . ASP C 1 183 ? 3.346   -2.407  -52.518  1.00 238.21 ? 183 ASP C OD2   1 
ATOM   7257  N  N     . LEU C 1 184 ? 3.008   -6.964  -49.380  1.00 127.00 ? 184 LEU C N     1 
ATOM   7258  C  CA    . LEU C 1 184 ? 2.500   -8.228  -48.856  1.00 116.66 ? 184 LEU C CA    1 
ATOM   7259  C  C     . LEU C 1 184 ? 2.613   -8.271  -47.343  1.00 105.76 ? 184 LEU C C     1 
ATOM   7260  O  O     . LEU C 1 184 ? 1.711   -8.695  -46.664  1.00 98.14  ? 184 LEU C O     1 
ATOM   7261  C  CB    . LEU C 1 184 ? 3.176   -9.469  -49.468  1.00 131.92 ? 184 LEU C CB    1 
ATOM   7262  C  CG    . LEU C 1 184 ? 2.899   -9.636  -50.958  1.00 159.08 ? 184 LEU C CG    1 
ATOM   7263  C  CD1   . LEU C 1 184 ? 3.688   -10.786 -51.583  1.00 181.60 ? 184 LEU C CD1   1 
ATOM   7264  C  CD2   . LEU C 1 184 ? 1.391   -9.785  -51.075  1.00 154.06 ? 184 LEU C CD2   1 
ATOM   7265  N  N     . THR C 1 185 ? 3.710   -7.790  -46.817  1.00 107.79 ? 185 THR C N     1 
ATOM   7266  C  CA    . THR C 1 185 ? 3.934   -7.737  -45.391  1.00 110.57 ? 185 THR C CA    1 
ATOM   7267  C  C     . THR C 1 185 ? 2.871   -6.879  -44.757  1.00 116.71 ? 185 THR C C     1 
ATOM   7268  O  O     . THR C 1 185 ? 2.274   -7.276  -43.752  1.00 131.16 ? 185 THR C O     1 
ATOM   7269  C  CB    . THR C 1 185 ? 5.306   -7.155  -45.050  1.00 118.63 ? 185 THR C CB    1 
ATOM   7270  O  OG1   . THR C 1 185 ? 6.273   -8.117  -45.429  1.00 120.85 ? 185 THR C OG1   1 
ATOM   7271  C  CG2   . THR C 1 185 ? 5.492   -6.915  -43.593  1.00 124.88 ? 185 THR C CG2   1 
ATOM   7272  N  N     . ASP C 1 186 ? 2.625   -5.704  -45.341  1.00 129.32 ? 186 ASP C N     1 
ATOM   7273  C  CA    . ASP C 1 186 ? 1.603   -4.807  -44.769  1.00 139.24 ? 186 ASP C CA    1 
ATOM   7274  C  C     . ASP C 1 186 ? 0.249   -5.467  -44.792  1.00 127.05 ? 186 ASP C C     1 
ATOM   7275  O  O     . ASP C 1 186 ? -0.505  -5.359  -43.822  1.00 119.87 ? 186 ASP C O     1 
ATOM   7276  C  CB    . ASP C 1 186 ? 1.510   -3.470  -45.501  1.00 160.69 ? 186 ASP C CB    1 
ATOM   7277  C  CG    . ASP C 1 186 ? 2.470   -2.465  -44.960  1.00 181.09 ? 186 ASP C CG    1 
ATOM   7278  O  OD1   . ASP C 1 186 ? 2.784   -2.611  -43.766  1.00 194.11 ? 186 ASP C OD1   1 
ATOM   7279  O  OD2   . ASP C 1 186 ? 2.908   -1.558  -45.706  1.00 184.58 ? 186 ASP C OD2   1 
ATOM   7280  N  N     . TYR C 1 187 ? -0.071  -6.176  -45.867  1.00 132.56 ? 187 TYR C N     1 
ATOM   7281  C  CA    . TYR C 1 187 ? -1.307  -6.945  -45.965  1.00 123.37 ? 187 TYR C CA    1 
ATOM   7282  C  C     . TYR C 1 187 ? -1.314  -8.017  -44.871  1.00 122.32 ? 187 TYR C C     1 
ATOM   7283  O  O     . TYR C 1 187 ? -2.351  -8.244  -44.230  1.00 124.10 ? 187 TYR C O     1 
ATOM   7284  C  CB    . TYR C 1 187 ? -1.447  -7.633  -47.330  1.00 125.16 ? 187 TYR C CB    1 
ATOM   7285  C  CG    . TYR C 1 187 ? -2.706  -8.416  -47.430  1.00 118.49 ? 187 TYR C CG    1 
ATOM   7286  C  CD1   . TYR C 1 187 ? -3.914  -7.769  -47.512  1.00 122.22 ? 187 TYR C CD1   1 
ATOM   7287  C  CD2   . TYR C 1 187 ? -2.697  -9.806  -47.437  1.00 118.33 ? 187 TYR C CD2   1 
ATOM   7288  C  CE1   . TYR C 1 187 ? -5.099  -8.483  -47.606  1.00 123.47 ? 187 TYR C CE1   1 
ATOM   7289  C  CE2   . TYR C 1 187 ? -3.867  -10.509 -47.498  1.00 118.93 ? 187 TYR C CE2   1 
ATOM   7290  C  CZ    . TYR C 1 187 ? -5.074  -9.853  -47.598  1.00 118.37 ? 187 TYR C CZ    1 
ATOM   7291  O  OH    . TYR C 1 187 ? -6.280  -10.567 -47.678  1.00 105.20 ? 187 TYR C OH    1 
ATOM   7292  N  N     . LEU C 1 188 ? -0.174  -8.670  -44.660  1.00 114.38 ? 188 LEU C N     1 
ATOM   7293  C  CA    . LEU C 1 188 ? -0.155  -9.858  -43.840  1.00 106.53 ? 188 LEU C CA    1 
ATOM   7294  C  C     . LEU C 1 188 ? -0.426  -9.455  -42.395  1.00 101.91 ? 188 LEU C C     1 
ATOM   7295  O  O     . LEU C 1 188 ? -1.146  -10.119 -41.685  1.00 98.39  ? 188 LEU C O     1 
ATOM   7296  C  CB    . LEU C 1 188 ? 1.201   -10.547 -43.906  1.00 114.62 ? 188 LEU C CB    1 
ATOM   7297  C  CG    . LEU C 1 188 ? 1.296   -11.882 -43.151  1.00 138.84 ? 188 LEU C CG    1 
ATOM   7298  C  CD1   . LEU C 1 188 ? 0.286   -12.902 -43.701  1.00 146.00 ? 188 LEU C CD1   1 
ATOM   7299  C  CD2   . LEU C 1 188 ? 2.735   -12.429 -43.175  1.00 156.03 ? 188 LEU C CD2   1 
ATOM   7300  N  N     . MET C 1 189 ? 0.267   -8.433  -41.925  1.00 111.55 ? 189 MET C N     1 
ATOM   7301  C  CA    . MET C 1 189 ? 0.039   -7.976  -40.548  1.00 119.70 ? 189 MET C CA    1 
ATOM   7302  C  C     . MET C 1 189 ? -1.407  -7.571  -40.383  1.00 107.23 ? 189 MET C C     1 
ATOM   7303  O  O     . MET C 1 189 ? -1.987  -7.812  -39.336  1.00 95.55  ? 189 MET C O     1 
ATOM   7304  C  CB    . MET C 1 189 ? 1.076   -6.947  -40.080  1.00 137.67 ? 189 MET C CB    1 
ATOM   7305  C  CG    . MET C 1 189 ? 1.135   -5.654  -40.870  1.00 164.19 ? 189 MET C CG    1 
ATOM   7306  S  SD    . MET C 1 189 ? 2.356   -4.461  -40.267  1.00 210.08 ? 189 MET C SD    1 
ATOM   7307  C  CE    . MET C 1 189 ? 1.287   -3.644  -39.095  1.00 229.62 ? 189 MET C CE    1 
ATOM   7308  N  N     . LYS C 1 190 ? -2.031  -7.025  -41.424  1.00 104.00 ? 190 LYS C N     1 
ATOM   7309  C  CA    . LYS C 1 190 ? -3.460  -6.725  -41.388  1.00 97.96  ? 190 LYS C CA    1 
ATOM   7310  C  C     . LYS C 1 190 ? -4.296  -7.973  -41.190  1.00 85.73  ? 190 LYS C C     1 
ATOM   7311  O  O     . LYS C 1 190 ? -5.207  -8.010  -40.384  1.00 83.07  ? 190 LYS C O     1 
ATOM   7312  C  CB    . LYS C 1 190 ? -3.922  -5.990  -42.660  1.00 115.79 ? 190 LYS C CB    1 
ATOM   7313  C  CG    . LYS C 1 190 ? -5.294  -5.342  -42.534  1.00 138.87 ? 190 LYS C CG    1 
ATOM   7314  C  CD    . LYS C 1 190 ? -5.621  -4.364  -43.677  1.00 162.40 ? 190 LYS C CD    1 
ATOM   7315  C  CE    . LYS C 1 190 ? -5.826  -5.045  -45.029  1.00 173.17 ? 190 LYS C CE    1 
ATOM   7316  N  NZ    . LYS C 1 190 ? -7.054  -5.888  -45.083  1.00 181.04 ? 190 LYS C NZ    1 
ATOM   7317  N  N     . ILE C 1 191 ? -3.992  -9.009  -41.940  1.00 99.61  ? 191 ILE C N     1 
ATOM   7318  C  CA    . ILE C 1 191 ? -4.794  -10.225 -41.947  1.00 121.23 ? 191 ILE C CA    1 
ATOM   7319  C  C     . ILE C 1 191 ? -4.631  -11.068 -40.668  1.00 121.69 ? 191 ILE C C     1 
ATOM   7320  O  O     . ILE C 1 191 ? -5.501  -11.842 -40.318  1.00 114.83 ? 191 ILE C O     1 
ATOM   7321  C  CB    . ILE C 1 191 ? -4.596  -11.072 -43.227  1.00 129.85 ? 191 ILE C CB    1 
ATOM   7322  C  CG1   . ILE C 1 191 ? -5.838  -11.924 -43.492  1.00 130.41 ? 191 ILE C CG1   1 
ATOM   7323  C  CG2   . ILE C 1 191 ? -3.279  -11.851 -43.211  1.00 132.94 ? 191 ILE C CG2   1 
ATOM   7324  C  CD1   . ILE C 1 191 ? -6.957  -11.158 -44.177  1.00 141.36 ? 191 ILE C CD1   1 
ATOM   7325  N  N     . LEU C 1 192 ? -3.500  -10.913 -39.972  1.00 111.99 ? 192 LEU C N     1 
ATOM   7326  C  CA    . LEU C 1 192 ? -3.260  -11.597 -38.730  1.00 96.98  ? 192 LEU C CA    1 
ATOM   7327  C  C     . LEU C 1 192 ? -4.260  -11.070 -37.696  1.00 108.50 ? 192 LEU C C     1 
ATOM   7328  O  O     . LEU C 1 192 ? -4.672  -11.821 -36.830  1.00 110.65 ? 192 LEU C O     1 
ATOM   7329  C  CB    . LEU C 1 192 ? -1.865  -11.410 -38.153  1.00 89.42  ? 192 LEU C CB    1 
ATOM   7330  C  CG    . LEU C 1 192 ? -0.846  -12.474 -38.526  1.00 91.63  ? 192 LEU C CG    1 
ATOM   7331  C  CD1   . LEU C 1 192 ? -0.454  -12.429 -40.003  1.00 90.61  ? 192 LEU C CD1   1 
ATOM   7332  C  CD2   . LEU C 1 192 ? 0.427   -12.368 -37.671  1.00 104.97 ? 192 LEU C CD2   1 
ATOM   7333  N  N     . THR C 1 193 ? -4.590  -9.805  -37.785  1.00 122.95 ? 193 THR C N     1 
ATOM   7334  C  CA    . THR C 1 193 ? -5.275  -9.122  -36.740  1.00 134.59 ? 193 THR C CA    1 
ATOM   7335  C  C     . THR C 1 193 ? -6.623  -9.717  -36.527  1.00 132.56 ? 193 THR C C     1 
ATOM   7336  O  O     . THR C 1 193 ? -7.133  -9.730  -35.404  1.00 140.24 ? 193 THR C O     1 
ATOM   7337  C  CB    . THR C 1 193 ? -5.475  -7.622  -37.040  1.00 137.41 ? 193 THR C CB    1 
ATOM   7338  O  OG1   . THR C 1 193 ? -6.085  -7.459  -38.330  1.00 134.77 ? 193 THR C OG1   1 
ATOM   7339  C  CG2   . THR C 1 193 ? -4.149  -6.856  -36.975  1.00 141.21 ? 193 THR C CG2   1 
ATOM   7340  N  N     . GLU C 1 194 ? -7.197  -10.321 -37.581  1.00 136.37 ? 194 GLU C N     1 
ATOM   7341  C  CA    . GLU C 1 194 ? -8.471  -11.033 -37.462  1.00 143.48 ? 194 GLU C CA    1 
ATOM   7342  C  C     . GLU C 1 194 ? -8.381  -12.308 -36.607  1.00 134.69 ? 194 GLU C C     1 
ATOM   7343  O  O     . GLU C 1 194 ? -9.413  -12.851 -36.195  1.00 153.03 ? 194 GLU C O     1 
ATOM   7344  C  CB    . GLU C 1 194 ? -9.051  -11.405 -38.818  1.00 159.29 ? 194 GLU C CB    1 
ATOM   7345  C  CG    . GLU C 1 194 ? -8.268  -12.473 -39.571  1.00 173.75 ? 194 GLU C CG    1 
ATOM   7346  C  CD    . GLU C 1 194 ? -8.863  -12.714 -40.919  1.00 210.32 ? 194 GLU C CD    1 
ATOM   7347  O  OE1   . GLU C 1 194 ? -9.830  -11.998 -41.246  1.00 230.39 ? 194 GLU C OE1   1 
ATOM   7348  O  OE2   . GLU C 1 194 ? -8.326  -13.587 -41.639  1.00 228.40 ? 194 GLU C OE2   1 
ATOM   7349  N  N     . ARG C 1 195 ? -7.160  -12.789 -36.395  1.00 118.92 ? 195 ARG C N     1 
ATOM   7350  C  CA    . ARG C 1 195 ? -6.862  -13.901 -35.529  1.00 119.50 ? 195 ARG C CA    1 
ATOM   7351  C  C     . ARG C 1 195 ? -6.559  -13.459 -34.115  1.00 120.11 ? 195 ARG C C     1 
ATOM   7352  O  O     . ARG C 1 195 ? -6.610  -14.288 -33.228  1.00 110.38 ? 195 ARG C O     1 
ATOM   7353  C  CB    . ARG C 1 195 ? -5.652  -14.657 -36.071  1.00 130.91 ? 195 ARG C CB    1 
ATOM   7354  C  CG    . ARG C 1 195 ? -5.529  -16.099 -35.580  1.00 138.88 ? 195 ARG C CG    1 
ATOM   7355  C  CD    . ARG C 1 195 ? -4.522  -16.946 -36.370  1.00 154.75 ? 195 ARG C CD    1 
ATOM   7356  N  NE    . ARG C 1 195 ? -5.112  -17.296 -37.664  1.00 165.28 ? 195 ARG C NE    1 
ATOM   7357  C  CZ    . ARG C 1 195 ? -5.825  -18.403 -37.914  1.00 177.59 ? 195 ARG C CZ    1 
ATOM   7358  N  NH1   . ARG C 1 195 ? -6.010  -19.286 -36.936  1.00 180.78 ? 195 ARG C NH1   1 
ATOM   7359  N  NH2   . ARG C 1 195 ? -6.342  -18.645 -39.144  1.00 174.26 ? 195 ARG C NH2   1 
ATOM   7360  N  N     . GLY C 1 196 ? -6.296  -12.178 -33.900  1.00 139.11 ? 196 GLY C N     1 
ATOM   7361  C  CA    . GLY C 1 196 ? -6.061  -11.731 -32.546  1.00 160.28 ? 196 GLY C CA    1 
ATOM   7362  C  C     . GLY C 1 196 ? -4.669  -11.214 -32.394  1.00 145.16 ? 196 GLY C C     1 
ATOM   7363  O  O     . GLY C 1 196 ? -4.420  -10.483 -31.436  1.00 136.68 ? 196 GLY C O     1 
ATOM   7364  N  N     . TYR C 1 197 ? -3.777  -11.622 -33.278  1.00 136.91 ? 197 TYR C N     1 
ATOM   7365  C  CA    . TYR C 1 197 ? -2.375  -11.256 -33.137  1.00 140.85 ? 197 TYR C CA    1 
ATOM   7366  C  C     . TYR C 1 197 ? -2.224  -9.890  -33.707  1.00 148.04 ? 197 TYR C C     1 
ATOM   7367  O  O     . TYR C 1 197 ? -2.608  -9.661  -34.851  1.00 158.28 ? 197 TYR C O     1 
ATOM   7368  C  CB    . TYR C 1 197 ? -1.459  -12.269 -33.830  1.00 146.96 ? 197 TYR C CB    1 
ATOM   7369  C  CG    . TYR C 1 197 ? -1.788  -13.686 -33.492  1.00 164.19 ? 197 TYR C CG    1 
ATOM   7370  C  CD1   . TYR C 1 197 ? -1.878  -14.109 -32.172  1.00 172.80 ? 197 TYR C CD1   1 
ATOM   7371  C  CD2   . TYR C 1 197 ? -1.990  -14.602 -34.489  1.00 170.28 ? 197 TYR C CD2   1 
ATOM   7372  C  CE1   . TYR C 1 197 ? -2.168  -15.408 -31.872  1.00 187.51 ? 197 TYR C CE1   1 
ATOM   7373  C  CE2   . TYR C 1 197 ? -2.283  -15.919 -34.192  1.00 173.66 ? 197 TYR C CE2   1 
ATOM   7374  C  CZ    . TYR C 1 197 ? -2.363  -16.330 -32.885  1.00 189.41 ? 197 TYR C CZ    1 
ATOM   7375  O  OH    . TYR C 1 197 ? -2.659  -17.673 -32.597  1.00 199.90 ? 197 TYR C OH    1 
ATOM   7376  N  N     . SER C 1 198 ? -1.646  -8.992  -32.917  1.00 155.15 ? 198 SER C N     1 
ATOM   7377  C  CA    . SER C 1 198 ? -1.550  -7.598  -33.334  1.00 162.17 ? 198 SER C CA    1 
ATOM   7378  C  C     . SER C 1 198 ? -0.103  -7.174  -33.345  1.00 162.64 ? 198 SER C C     1 
ATOM   7379  O  O     . SER C 1 198 ? 0.578   -7.175  -32.334  1.00 157.46 ? 198 SER C O     1 
ATOM   7380  C  CB    . SER C 1 198 ? -2.366  -6.663  -32.435  1.00 170.28 ? 198 SER C CB    1 
ATOM   7381  O  OG    . SER C 1 198 ? -3.753  -6.825  -32.670  1.00 183.72 ? 198 SER C OG    1 
ATOM   7382  N  N     . PHE C 1 199 ? 0.389   -6.816  -34.516  1.00 152.94 ? 199 PHE C N     1 
ATOM   7383  C  CA    . PHE C 1 199 ? 1.769   -6.412  -34.701  1.00 129.28 ? 199 PHE C CA    1 
ATOM   7384  C  C     . PHE C 1 199 ? 1.781   -4.965  -35.204  1.00 140.40 ? 199 PHE C C     1 
ATOM   7385  O  O     . PHE C 1 199 ? 1.518   -4.659  -36.363  1.00 151.72 ? 199 PHE C O     1 
ATOM   7386  C  CB    . PHE C 1 199 ? 2.467   -7.398  -35.668  1.00 117.03 ? 199 PHE C CB    1 
ATOM   7387  C  CG    . PHE C 1 199 ? 2.606   -8.775  -35.103  1.00 122.64 ? 199 PHE C CG    1 
ATOM   7388  C  CD1   . PHE C 1 199 ? 2.647   -8.969  -33.736  1.00 131.77 ? 199 PHE C CD1   1 
ATOM   7389  C  CD2   . PHE C 1 199 ? 2.659   -9.871  -35.923  1.00 126.91 ? 199 PHE C CD2   1 
ATOM   7390  C  CE1   . PHE C 1 199 ? 2.780   -10.236 -33.209  1.00 130.87 ? 199 PHE C CE1   1 
ATOM   7391  C  CE2   . PHE C 1 199 ? 2.778   -11.143 -35.406  1.00 129.72 ? 199 PHE C CE2   1 
ATOM   7392  C  CZ    . PHE C 1 199 ? 2.840   -11.327 -34.046  1.00 127.19 ? 199 PHE C CZ    1 
ATOM   7393  N  N     . THR C 1 200 ? 2.083   -4.026  -34.305  1.00 145.77 ? 200 THR C N     1 
ATOM   7394  C  CA    . THR C 1 200 ? 1.787   -2.606  -34.559  1.00 154.54 ? 200 THR C CA    1 
ATOM   7395  C  C     . THR C 1 200 ? 3.015   -1.772  -34.923  1.00 153.63 ? 200 THR C C     1 
ATOM   7396  O  O     . THR C 1 200 ? 2.897   -0.611  -35.315  1.00 145.59 ? 200 THR C O     1 
ATOM   7397  C  CB    . THR C 1 200 ? 1.147   -1.973  -33.312  1.00 171.03 ? 200 THR C CB    1 
ATOM   7398  O  OG1   . THR C 1 200 ? 1.971   -2.226  -32.164  1.00 183.87 ? 200 THR C OG1   1 
ATOM   7399  C  CG2   . THR C 1 200 ? -0.246  -2.538  -33.042  1.00 175.06 ? 200 THR C CG2   1 
ATOM   7400  N  N     . THR C 1 201 ? 4.193   -2.375  -34.823  1.00 152.68 ? 201 THR C N     1 
ATOM   7401  C  CA    . THR C 1 201 ? 5.460   -1.629  -34.750  1.00 140.37 ? 201 THR C CA    1 
ATOM   7402  C  C     . THR C 1 201 ? 6.516   -2.238  -35.699  1.00 148.62 ? 201 THR C C     1 
ATOM   7403  O  O     . THR C 1 201 ? 6.354   -3.381  -36.154  1.00 177.50 ? 201 THR C O     1 
ATOM   7404  C  CB    . THR C 1 201 ? 5.960   -1.590  -33.291  1.00 137.69 ? 201 THR C CB    1 
ATOM   7405  O  OG1   . THR C 1 201 ? 4.948   -0.992  -32.478  1.00 151.56 ? 201 THR C OG1   1 
ATOM   7406  C  CG2   . THR C 1 201 ? 7.215   -0.794  -33.133  1.00 143.88 ? 201 THR C CG2   1 
ATOM   7407  N  N     . THR C 1 202 ? 7.502   -1.400  -36.042  1.00 128.44 ? 202 THR C N     1 
ATOM   7408  C  CA    . THR C 1 202 ? 8.411   -1.703  -37.096  1.00 116.32 ? 202 THR C CA    1 
ATOM   7409  C  C     . THR C 1 202 ? 9.179   -2.916  -36.739  1.00 119.51 ? 202 THR C C     1 
ATOM   7410  O  O     . THR C 1 202 ? 9.350   -3.803  -37.544  1.00 132.09 ? 202 THR C O     1 
ATOM   7411  C  CB    . THR C 1 202 ? 9.450   -0.610  -37.345  1.00 111.73 ? 202 THR C CB    1 
ATOM   7412  O  OG1   . THR C 1 202 ? 8.876   0.710   -37.382  1.00 99.85  ? 202 THR C OG1   1 
ATOM   7413  C  CG2   . THR C 1 202 ? 10.105  -0.884  -38.717  1.00 137.79 ? 202 THR C CG2   1 
ATOM   7414  N  N     . ALA C 1 203 ? 9.627   -2.971  -35.487  1.00 116.86 ? 203 ALA C N     1 
ATOM   7415  C  CA    . ALA C 1 203 ? 10.289  -4.184  -34.970  1.00 127.11 ? 203 ALA C CA    1 
ATOM   7416  C  C     . ALA C 1 203 ? 9.627   -5.484  -35.392  1.00 117.27 ? 203 ALA C C     1 
ATOM   7417  O  O     . ALA C 1 203 ? 10.197  -6.289  -36.146  1.00 144.21 ? 203 ALA C O     1 
ATOM   7418  C  CB    . ALA C 1 203 ? 10.462  -4.130  -33.442  1.00 154.70 ? 203 ALA C CB    1 
ATOM   7419  N  N     . GLU C 1 204 ? 8.397   -5.657  -34.928  1.00 111.93 ? 204 GLU C N     1 
ATOM   7420  C  CA    . GLU C 1 204 ? 7.664   -6.902  -35.199  1.00 124.33 ? 204 GLU C CA    1 
ATOM   7421  C  C     . GLU C 1 204 ? 7.127   -7.000  -36.630  1.00 112.71 ? 204 GLU C C     1 
ATOM   7422  O  O     . GLU C 1 204 ? 6.801   -8.074  -37.110  1.00 123.12 ? 204 GLU C O     1 
ATOM   7423  C  CB    . GLU C 1 204 ? 6.566   -7.226  -34.179  1.00 163.20 ? 204 GLU C CB    1 
ATOM   7424  C  CG    . GLU C 1 204 ? 5.397   -6.283  -34.247  1.00 193.47 ? 204 GLU C CG    1 
ATOM   7425  C  CD    . GLU C 1 204 ? 5.473   -5.109  -33.276  1.00 208.26 ? 204 GLU C CD    1 
ATOM   7426  O  OE1   . GLU C 1 204 ? 6.596   -4.590  -33.056  1.00 214.61 ? 204 GLU C OE1   1 
ATOM   7427  O  OE2   . GLU C 1 204 ? 4.421   -4.689  -32.748  1.00 197.25 ? 204 GLU C OE2   1 
ATOM   7428  N  N     . ARG C 1 205 ? 7.078   -5.860  -37.312  1.00 116.00 ? 205 ARG C N     1 
ATOM   7429  C  CA    . ARG C 1 205 ? 6.808   -5.902  -38.746  1.00 132.52 ? 205 ARG C CA    1 
ATOM   7430  C  C     . ARG C 1 205 ? 7.847   -6.786  -39.444  1.00 128.35 ? 205 ARG C C     1 
ATOM   7431  O  O     . ARG C 1 205 ? 7.562   -7.594  -40.311  1.00 124.07 ? 205 ARG C O     1 
ATOM   7432  C  CB    . ARG C 1 205 ? 6.878   -4.486  -39.334  1.00 158.90 ? 205 ARG C CB    1 
ATOM   7433  C  CG    . ARG C 1 205 ? 6.121   -4.235  -40.607  1.00 173.63 ? 205 ARG C CG    1 
ATOM   7434  C  CD    . ARG C 1 205 ? 6.013   -2.720  -40.768  1.00 178.38 ? 205 ARG C CD    1 
ATOM   7435  N  NE    . ARG C 1 205 ? 5.640   -2.340  -42.108  1.00 186.47 ? 205 ARG C NE    1 
ATOM   7436  C  CZ    . ARG C 1 205 ? 6.495   -2.208  -43.113  1.00 204.14 ? 205 ARG C CZ    1 
ATOM   7437  N  NH1   . ARG C 1 205 ? 7.799   -2.442  -42.947  1.00 202.19 ? 205 ARG C NH1   1 
ATOM   7438  N  NH2   . ARG C 1 205 ? 6.016   -1.866  -44.295  1.00 219.84 ? 205 ARG C NH2   1 
ATOM   7439  N  N     . GLU C 1 206 ? 9.070   -6.671  -38.999  1.00 140.49 ? 206 GLU C N     1 
ATOM   7440  C  CA    . GLU C 1 206 ? 10.109  -7.544  -39.523  1.00 148.70 ? 206 GLU C CA    1 
ATOM   7441  C  C     . GLU C 1 206 ? 9.882   -8.956  -39.057  1.00 143.60 ? 206 GLU C C     1 
ATOM   7442  O  O     . GLU C 1 206 ? 10.245  -9.855  -39.778  1.00 166.74 ? 206 GLU C O     1 
ATOM   7443  C  CB    . GLU C 1 206 ? 11.514  -6.982  -39.243  1.00 155.69 ? 206 GLU C CB    1 
ATOM   7444  C  CG    . GLU C 1 206 ? 11.835  -5.776  -40.142  1.00 160.77 ? 206 GLU C CG    1 
ATOM   7445  C  CD    . GLU C 1 206 ? 13.295  -5.619  -40.380  1.00 160.66 ? 206 GLU C CD    1 
ATOM   7446  O  OE1   . GLU C 1 206 ? 14.047  -5.757  -39.395  1.00 163.61 ? 206 GLU C OE1   1 
ATOM   7447  O  OE2   . GLU C 1 206 ? 13.686  -5.355  -41.532  1.00 157.19 ? 206 GLU C OE2   1 
ATOM   7448  N  N     . ILE C 1 207 ? 9.312   -9.213  -37.884  1.00 141.23 ? 207 ILE C N     1 
ATOM   7449  C  CA    . ILE C 1 207 ? 8.994   -10.560 -37.491  1.00 137.14 ? 207 ILE C CA    1 
ATOM   7450  C  C     . ILE C 1 207 ? 8.005   -11.132 -38.492  1.00 136.66 ? 207 ILE C C     1 
ATOM   7451  O  O     . ILE C 1 207 ? 8.197   -12.259 -38.937  1.00 140.46 ? 207 ILE C O     1 
ATOM   7452  C  CB    . ILE C 1 207 ? 8.452   -10.600 -36.060  1.00 144.15 ? 207 ILE C CB    1 
ATOM   7453  C  CG1   . ILE C 1 207 ? 9.585   -10.213 -35.086  1.00 150.36 ? 207 ILE C CG1   1 
ATOM   7454  C  CG2   . ILE C 1 207 ? 7.827   -11.954 -35.769  1.00 142.84 ? 207 ILE C CG2   1 
ATOM   7455  C  CD1   . ILE C 1 207 ? 10.756  -11.179 -35.098  1.00 144.80 ? 207 ILE C CD1   1 
ATOM   7456  N  N     . VAL C 1 208 ? 6.999   -10.370 -38.893  1.00 143.17 ? 208 VAL C N     1 
ATOM   7457  C  CA    . VAL C 1 208 ? 6.071   -10.948 -39.869  1.00 147.86 ? 208 VAL C CA    1 
ATOM   7458  C  C     . VAL C 1 208 ? 6.710   -11.111 -41.201  1.00 138.10 ? 208 VAL C C     1 
ATOM   7459  O  O     . VAL C 1 208 ? 6.388   -12.047 -41.895  1.00 152.93 ? 208 VAL C O     1 
ATOM   7460  C  CB    . VAL C 1 208 ? 4.752   -10.227 -40.085  1.00 171.63 ? 208 VAL C CB    1 
ATOM   7461  C  CG1   . VAL C 1 208 ? 3.833   -10.495 -38.903  1.00 186.76 ? 208 VAL C CG1   1 
ATOM   7462  C  CG2   . VAL C 1 208 ? 4.912   -8.734  -40.432  1.00 183.84 ? 208 VAL C CG2   1 
ATOM   7463  N  N     . ARG C 1 209 ? 7.642   -10.235 -41.560  1.00 127.79 ? 209 ARG C N     1 
ATOM   7464  C  CA    . ARG C 1 209 ? 8.423   -10.445 -42.773  1.00 125.36 ? 209 ARG C CA    1 
ATOM   7465  C  C     . ARG C 1 209 ? 9.088   -11.821 -42.722  1.00 117.73 ? 209 ARG C C     1 
ATOM   7466  O  O     . ARG C 1 209 ? 9.106   -12.544 -43.712  1.00 134.61 ? 209 ARG C O     1 
ATOM   7467  C  CB    . ARG C 1 209 ? 9.508   -9.354  -42.937  1.00 146.87 ? 209 ARG C CB    1 
ATOM   7468  C  CG    . ARG C 1 209 ? 10.311  -9.490  -44.233  1.00 149.24 ? 209 ARG C CG    1 
ATOM   7469  C  CD    . ARG C 1 209 ? 11.242  -8.308  -44.494  1.00 166.49 ? 209 ARG C CD    1 
ATOM   7470  N  NE    . ARG C 1 209 ? 12.247  -8.281  -43.427  1.00 181.99 ? 209 ARG C NE    1 
ATOM   7471  C  CZ    . ARG C 1 209 ? 13.369  -9.010  -43.437  1.00 188.95 ? 209 ARG C CZ    1 
ATOM   7472  N  NH1   . ARG C 1 209 ? 13.592  -9.824  -44.456  1.00 195.66 ? 209 ARG C NH1   1 
ATOM   7473  N  NH2   . ARG C 1 209 ? 14.267  -8.951  -42.425  1.00 187.80 ? 209 ARG C NH2   1 
ATOM   7474  N  N     . ASP C 1 210 ? 9.641   -12.157 -41.562  1.00 116.74 ? 210 ASP C N     1 
ATOM   7475  C  CA    . ASP C 1 210 ? 10.318  -13.438 -41.399  1.00 130.71 ? 210 ASP C CA    1 
ATOM   7476  C  C     . ASP C 1 210 ? 9.330   -14.579 -41.578  1.00 130.04 ? 210 ASP C C     1 
ATOM   7477  O  O     . ASP C 1 210 ? 9.634   -15.570 -42.272  1.00 137.37 ? 210 ASP C O     1 
ATOM   7478  C  CB    . ASP C 1 210 ? 10.941  -13.604 -40.000  1.00 142.91 ? 210 ASP C CB    1 
ATOM   7479  C  CG    . ASP C 1 210 ? 11.883  -14.733 -39.951  1.00 141.50 ? 210 ASP C CG    1 
ATOM   7480  O  OD1   . ASP C 1 210 ? 12.418  -15.061 -41.025  1.00 135.62 ? 210 ASP C OD1   1 
ATOM   7481  O  OD2   . ASP C 1 210 ? 12.111  -15.295 -38.856  1.00 146.99 ? 210 ASP C OD2   1 
ATOM   7482  N  N     . ILE C 1 211 ? 8.143   -14.436 -40.998  1.00 116.14 ? 211 ILE C N     1 
ATOM   7483  C  CA    . ILE C 1 211 ? 7.122   -15.459 -41.104  1.00 107.51 ? 211 ILE C CA    1 
ATOM   7484  C  C     . ILE C 1 211 ? 6.800   -15.676 -42.576  1.00 99.35  ? 211 ILE C C     1 
ATOM   7485  O  O     . ILE C 1 211 ? 6.715   -16.779 -43.048  1.00 116.01 ? 211 ILE C O     1 
ATOM   7486  C  CB    . ILE C 1 211 ? 5.813   -14.999 -40.464  1.00 119.26 ? 211 ILE C CB    1 
ATOM   7487  C  CG1   . ILE C 1 211 ? 5.936   -15.123 -38.947  1.00 137.66 ? 211 ILE C CG1   1 
ATOM   7488  C  CG2   . ILE C 1 211 ? 4.632   -15.814 -41.053  1.00 123.81 ? 211 ILE C CG2   1 
ATOM   7489  C  CD1   . ILE C 1 211 ? 4.828   -14.471 -38.158  1.00 142.63 ? 211 ILE C CD1   1 
ATOM   7490  N  N     . LYS C 1 212 ? 6.570   -14.600 -43.276  1.00 96.34  ? 212 LYS C N     1 
ATOM   7491  C  CA    . LYS C 1 212 ? 6.188   -14.696 -44.657  1.00 113.51 ? 212 LYS C CA    1 
ATOM   7492  C  C     . LYS C 1 212 ? 7.298   -15.400 -45.455  1.00 126.79 ? 212 LYS C C     1 
ATOM   7493  O  O     . LYS C 1 212 ? 7.030   -16.273 -46.271  1.00 147.15 ? 212 LYS C O     1 
ATOM   7494  C  CB    . LYS C 1 212 ? 5.855   -13.302 -45.087  1.00 131.11 ? 212 LYS C CB    1 
ATOM   7495  C  CG    . LYS C 1 212 ? 5.382   -13.058 -46.510  1.00 164.32 ? 212 LYS C CG    1 
ATOM   7496  C  CD    . LYS C 1 212 ? 5.396   -11.534 -46.833  1.00 177.01 ? 212 LYS C CD    1 
ATOM   7497  C  CE    . LYS C 1 212 ? 6.802   -10.931 -46.724  1.00 176.62 ? 212 LYS C CE    1 
ATOM   7498  N  NZ    . LYS C 1 212 ? 6.840   -9.603  -47.360  1.00 186.19 ? 212 LYS C NZ    1 
ATOM   7499  N  N     . GLU C 1 213 ? 8.547   -15.017 -45.176  1.00 140.21 ? 213 GLU C N     1 
ATOM   7500  C  CA    . GLU C 1 213 ? 9.688   -15.638 -45.830  1.00 158.24 ? 213 GLU C CA    1 
ATOM   7501  C  C     . GLU C 1 213 ? 9.749   -17.122 -45.656  1.00 132.32 ? 213 GLU C C     1 
ATOM   7502  O  O     . GLU C 1 213 ? 10.494  -17.732 -46.428  1.00 125.24 ? 213 GLU C O     1 
ATOM   7503  C  CB    . GLU C 1 213 ? 11.019  -15.023 -45.349  1.00 193.68 ? 213 GLU C CB    1 
ATOM   7504  C  CG    . GLU C 1 213 ? 11.245  -13.574 -45.793  1.00 217.83 ? 213 GLU C CG    1 
ATOM   7505  C  CD    . GLU C 1 213 ? 12.495  -12.937 -45.216  1.00 219.12 ? 213 GLU C CD    1 
ATOM   7506  O  OE1   . GLU C 1 213 ? 13.133  -13.501 -44.298  1.00 219.56 ? 213 GLU C OE1   1 
ATOM   7507  O  OE2   . GLU C 1 213 ? 12.830  -11.850 -45.706  1.00 212.88 ? 213 GLU C OE2   1 
ATOM   7508  N  N     . LYS C 1 214 ? 9.084   -17.722 -44.670  1.00 125.49 ? 214 LYS C N     1 
ATOM   7509  C  CA    . LYS C 1 214 ? 8.949   -19.173 -44.702  1.00 139.84 ? 214 LYS C CA    1 
ATOM   7510  C  C     . LYS C 1 214 ? 7.548   -19.759 -44.790  1.00 141.86 ? 214 LYS C C     1 
ATOM   7511  O  O     . LYS C 1 214 ? 7.218   -20.473 -45.750  1.00 159.00 ? 214 LYS C O     1 
ATOM   7512  C  CB    . LYS C 1 214 ? 9.722   -19.862 -43.642  1.00 148.43 ? 214 LYS C CB    1 
ATOM   7513  C  CG    . LYS C 1 214 ? 9.507   -19.418 -42.200  1.00 154.64 ? 214 LYS C CG    1 
ATOM   7514  C  CD    . LYS C 1 214 ? 10.374  -20.229 -41.211  1.00 174.00 ? 214 LYS C CD    1 
ATOM   7515  C  CE    . LYS C 1 214 ? 10.364  -19.675 -39.791  1.00 186.04 ? 214 LYS C CE    1 
ATOM   7516  N  NZ    . LYS C 1 214 ? 11.015  -18.328 -39.705  1.00 191.85 ? 214 LYS C NZ    1 
ATOM   7517  N  N     . LEU C 1 215 ? 6.730   -19.483 -43.797  1.00 133.66 ? 215 LEU C N     1 
ATOM   7518  C  CA    . LEU C 1 215 ? 5.361   -20.071 -43.751  1.00 139.87 ? 215 LEU C CA    1 
ATOM   7519  C  C     . LEU C 1 215 ? 4.465   -19.874 -44.930  1.00 130.14 ? 215 LEU C C     1 
ATOM   7520  O  O     . LEU C 1 215 ? 3.788   -20.800 -45.289  1.00 140.80 ? 215 LEU C O     1 
ATOM   7521  C  CB    . LEU C 1 215 ? 4.638   -19.642 -42.477  1.00 160.13 ? 215 LEU C CB    1 
ATOM   7522  C  CG    . LEU C 1 215 ? 5.400   -20.007 -41.199  1.00 189.19 ? 215 LEU C CG    1 
ATOM   7523  C  CD1   . LEU C 1 215 ? 4.508   -19.804 -39.946  1.00 181.68 ? 215 LEU C CD1   1 
ATOM   7524  C  CD2   . LEU C 1 215 ? 5.979   -21.431 -41.256  1.00 198.21 ? 215 LEU C CD2   1 
ATOM   7525  N  N     . CYS C 1 216 ? 4.452   -18.700 -45.555  1.00 135.83 ? 216 CYS C N     1 
ATOM   7526  C  CA    . CYS C 1 216 ? 3.514   -18.431 -46.646  1.00 152.38 ? 216 CYS C CA    1 
ATOM   7527  C  C     . CYS C 1 216 ? 3.806   -19.199 -47.888  1.00 159.14 ? 216 CYS C C     1 
ATOM   7528  O  O     . CYS C 1 216 ? 4.961   -19.483 -48.141  1.00 172.24 ? 216 CYS C O     1 
ATOM   7529  C  CB    . CYS C 1 216 ? 3.577   -16.977 -47.105  1.00 162.68 ? 216 CYS C CB    1 
ATOM   7530  S  SG    . CYS C 1 216 ? 3.120   -15.761 -45.857  1.00 186.46 ? 216 CYS C SG    1 
ATOM   7531  N  N     . TYR C 1 217 ? 2.765   -19.581 -48.647  1.00 150.59 ? 217 TYR C N     1 
ATOM   7532  C  CA    . TYR C 1 217 ? 2.963   -20.257 -49.917  1.00 150.07 ? 217 TYR C CA    1 
ATOM   7533  C  C     . TYR C 1 217 ? 1.803   -19.894 -50.820  1.00 152.63 ? 217 TYR C C     1 
ATOM   7534  O  O     . TYR C 1 217 ? 0.777   -19.411 -50.338  1.00 172.51 ? 217 TYR C O     1 
ATOM   7535  C  CB    . TYR C 1 217 ? 3.067   -21.777 -49.814  1.00 152.86 ? 217 TYR C CB    1 
ATOM   7536  C  CG    . TYR C 1 217 ? 1.786   -22.394 -49.415  1.00 155.02 ? 217 TYR C CG    1 
ATOM   7537  C  CD1   . TYR C 1 217 ? 0.865   -22.775 -50.366  1.00 157.36 ? 217 TYR C CD1   1 
ATOM   7538  C  CD2   . TYR C 1 217 ? 1.507   -22.640 -48.104  1.00 155.65 ? 217 TYR C CD2   1 
ATOM   7539  C  CE1   . TYR C 1 217 ? -0.328  -23.375 -50.004  1.00 153.55 ? 217 TYR C CE1   1 
ATOM   7540  C  CE2   . TYR C 1 217 ? 0.321   -23.260 -47.725  1.00 152.25 ? 217 TYR C CE2   1 
ATOM   7541  C  CZ    . TYR C 1 217 ? -0.608  -23.595 -48.680  1.00 152.28 ? 217 TYR C CZ    1 
ATOM   7542  O  OH    . TYR C 1 217 ? -1.804  -24.222 -48.301  1.00 155.97 ? 217 TYR C OH    1 
ATOM   7543  N  N     . VAL C 1 218 ? 1.945   -20.148 -52.125  1.00 152.92 ? 218 VAL C N     1 
ATOM   7544  C  CA    . VAL C 1 218 ? 0.927   -19.767 -53.061  1.00 161.48 ? 218 VAL C CA    1 
ATOM   7545  C  C     . VAL C 1 218 ? 0.134   -20.982 -53.463  1.00 154.45 ? 218 VAL C C     1 
ATOM   7546  O  O     . VAL C 1 218 ? 0.661   -22.042 -53.775  1.00 163.22 ? 218 VAL C O     1 
ATOM   7547  C  CB    . VAL C 1 218 ? 1.445   -19.126 -54.322  1.00 176.32 ? 218 VAL C CB    1 
ATOM   7548  C  CG1   . VAL C 1 218 ? 0.236   -18.720 -55.184  1.00 182.89 ? 218 VAL C CG1   1 
ATOM   7549  C  CG2   . VAL C 1 218 ? 2.360   -17.949 -53.981  1.00 188.75 ? 218 VAL C CG2   1 
ATOM   7550  N  N     . ALA C 1 219 ? -1.171  -20.791 -53.406  1.00 150.48 ? 219 ALA C N     1 
ATOM   7551  C  CA    . ALA C 1 219 ? -2.138  -21.814 -53.847  1.00 164.47 ? 219 ALA C CA    1 
ATOM   7552  C  C     . ALA C 1 219 ? -2.137  -22.114 -55.330  1.00 177.38 ? 219 ALA C C     1 
ATOM   7553  O  O     . ALA C 1 219 ? -2.163  -21.255 -56.193  1.00 170.84 ? 219 ALA C O     1 
ATOM   7554  C  CB    . ALA C 1 219 ? -3.569  -21.414 -53.437  1.00 175.25 ? 219 ALA C CB    1 
ATOM   7555  N  N     . LEU C 1 220 ? -2.176  -23.408 -55.637  1.00 195.39 ? 220 LEU C N     1 
ATOM   7556  C  CA    . LEU C 1 220 ? -2.332  -23.853 -57.018  1.00 205.15 ? 220 LEU C CA    1 
ATOM   7557  C  C     . LEU C 1 220 ? -3.790  -23.743 -57.491  1.00 199.01 ? 220 LEU C C     1 
ATOM   7558  O  O     . LEU C 1 220 ? -4.056  -23.889 -58.675  1.00 179.37 ? 220 LEU C O     1 
ATOM   7559  C  CB    . LEU C 1 220 ? -1.847  -25.310 -57.227  1.00 221.57 ? 220 LEU C CB    1 
ATOM   7560  C  CG    . LEU C 1 220 ? -0.332  -25.463 -57.297  1.00 236.40 ? 220 LEU C CG    1 
ATOM   7561  C  CD1   . LEU C 1 220 ? 0.331   -25.060 -55.968  1.00 237.89 ? 220 LEU C CD1   1 
ATOM   7562  C  CD2   . LEU C 1 220 ? 0.064   -26.898 -57.741  1.00 242.77 ? 220 LEU C CD2   1 
ATOM   7563  N  N     . ASP C 1 221 ? -4.720  -23.615 -56.558  1.00 215.12 ? 221 ASP C N     1 
ATOM   7564  C  CA    . ASP C 1 221 ? -5.969  -22.952 -56.788  1.00 232.85 ? 221 ASP C CA    1 
ATOM   7565  C  C     . ASP C 1 221 ? -6.403  -22.370 -55.467  1.00 229.90 ? 221 ASP C C     1 
ATOM   7566  O  O     . ASP C 1 221 ? -6.507  -23.073 -54.481  1.00 224.18 ? 221 ASP C O     1 
ATOM   7567  C  CB    . ASP C 1 221 ? -7.068  -23.873 -57.287  1.00 248.91 ? 221 ASP C CB    1 
ATOM   7568  C  CG    . ASP C 1 221 ? -8.294  -23.092 -57.661  1.00 265.26 ? 221 ASP C CG    1 
ATOM   7569  O  OD1   . ASP C 1 221 ? -8.261  -21.839 -57.734  1.00 271.75 ? 221 ASP C OD1   1 
ATOM   7570  O  OD2   . ASP C 1 221 ? -9.330  -23.721 -57.953  1.00 273.25 ? 221 ASP C OD2   1 
ATOM   7571  N  N     . PHE C 1 222 ? -6.645  -21.051 -55.447  1.00 224.36 ? 222 PHE C N     1 
ATOM   7572  C  CA    . PHE C 1 222 ? -6.951  -20.327 -54.245  1.00 224.47 ? 222 PHE C CA    1 
ATOM   7573  C  C     . PHE C 1 222 ? -8.229  -20.842 -53.587  1.00 228.02 ? 222 PHE C C     1 
ATOM   7574  O  O     . PHE C 1 222 ? -8.236  -21.145 -52.400  1.00 249.31 ? 222 PHE C O     1 
ATOM   7575  C  CB    . PHE C 1 222 ? -7.101  -18.826 -54.550  1.00 216.84 ? 222 PHE C CB    1 
ATOM   7576  C  CG    . PHE C 1 222 ? -7.599  -18.036 -53.400  1.00 231.09 ? 222 PHE C CG    1 
ATOM   7577  C  CD1   . PHE C 1 222 ? -6.786  -17.748 -52.320  1.00 239.96 ? 222 PHE C CD1   1 
ATOM   7578  C  CD2   . PHE C 1 222 ? -8.905  -17.593 -53.378  1.00 245.69 ? 222 PHE C CD2   1 
ATOM   7579  C  CE1   . PHE C 1 222 ? -7.249  -17.001 -51.265  1.00 242.88 ? 222 PHE C CE1   1 
ATOM   7580  C  CE2   . PHE C 1 222 ? -9.375  -16.830 -52.329  1.00 247.00 ? 222 PHE C CE2   1 
ATOM   7581  C  CZ    . PHE C 1 222 ? -8.553  -16.558 -51.258  1.00 243.04 ? 222 PHE C CZ    1 
ATOM   7582  N  N     . GLU C 1 223 ? -9.306  -20.931 -54.357  1.00 208.02 ? 223 GLU C N     1 
ATOM   7583  C  CA    . GLU C 1 223 ? -10.602 -21.261 -53.769  1.00 190.86 ? 223 GLU C CA    1 
ATOM   7584  C  C     . GLU C 1 223 ? -10.579 -22.666 -53.221  1.00 191.45 ? 223 GLU C C     1 
ATOM   7585  O  O     . GLU C 1 223 ? -11.235 -22.934 -52.253  1.00 186.83 ? 223 GLU C O     1 
ATOM   7586  C  CB    . GLU C 1 223 ? -11.759 -21.161 -54.776  1.00 184.03 ? 223 GLU C CB    1 
ATOM   7587  C  CG    . GLU C 1 223 ? -12.099 -19.752 -55.205  1.00 195.35 ? 223 GLU C CG    1 
ATOM   7588  C  CD    . GLU C 1 223 ? -11.210 -19.269 -56.315  1.00 203.05 ? 223 GLU C CD    1 
ATOM   7589  O  OE1   . GLU C 1 223 ? -10.231 -19.972 -56.639  1.00 191.73 ? 223 GLU C OE1   1 
ATOM   7590  O  OE2   . GLU C 1 223 ? -11.505 -18.204 -56.876  1.00 222.47 ? 223 GLU C OE2   1 
ATOM   7591  N  N     . GLN C 1 224 ? -9.886  -23.601 -53.879  1.00 207.17 ? 224 GLN C N     1 
ATOM   7592  C  CA    . GLN C 1 224 ? -9.838  -24.969 -53.425  1.00 219.58 ? 224 GLN C CA    1 
ATOM   7593  C  C     . GLN C 1 224 ? -9.163  -25.043 -52.077  1.00 214.62 ? 224 GLN C C     1 
ATOM   7594  O  O     . GLN C 1 224 ? -9.638  -25.706 -51.133  1.00 226.37 ? 224 GLN C O     1 
ATOM   7595  C  CB    . GLN C 1 224 ? -9.073  -25.843 -54.449  1.00 235.38 ? 224 GLN C CB    1 
ATOM   7596  C  CG    . GLN C 1 224 ? -9.838  -26.046 -55.743  1.00 254.18 ? 224 GLN C CG    1 
ATOM   7597  C  CD    . GLN C 1 224 ? -9.056  -26.839 -56.724  1.00 266.00 ? 224 GLN C CD    1 
ATOM   7598  O  OE1   . GLN C 1 224 ? -7.919  -27.246 -56.467  1.00 271.33 ? 224 GLN C OE1   1 
ATOM   7599  N  NE2   . GLN C 1 224 ? -9.651  -27.079 -57.892  1.00 272.09 ? 224 GLN C NE2   1 
ATOM   7600  N  N     . GLU C 1 225 ? -8.007  -24.380 -51.990  1.00 208.30 ? 225 GLU C N     1 
ATOM   7601  C  CA    . GLU C 1 225 ? -7.262  -24.389 -50.729  1.00 210.74 ? 225 GLU C CA    1 
ATOM   7602  C  C     . GLU C 1 225 ? -8.049  -23.710 -49.636  1.00 224.47 ? 225 GLU C C     1 
ATOM   7603  O  O     . GLU C 1 225 ? -8.076  -24.188 -48.506  1.00 229.40 ? 225 GLU C O     1 
ATOM   7604  C  CB    . GLU C 1 225 ? -5.790  -23.960 -50.872  1.00 210.35 ? 225 GLU C CB    1 
ATOM   7605  C  CG    . GLU C 1 225 ? -4.917  -25.006 -51.555  1.00 219.76 ? 225 GLU C CG    1 
ATOM   7606  C  CD    . GLU C 1 225 ? -3.461  -24.662 -51.465  1.00 233.03 ? 225 GLU C CD    1 
ATOM   7607  O  OE1   . GLU C 1 225 ? -3.157  -23.514 -51.092  1.00 242.09 ? 225 GLU C OE1   1 
ATOM   7608  O  OE2   . GLU C 1 225 ? -2.633  -25.532 -51.778  1.00 236.08 ? 225 GLU C OE2   1 
ATOM   7609  N  N     . MET C 1 226 ? -8.749  -22.634 -49.963  1.00 236.13 ? 226 MET C N     1 
ATOM   7610  C  CA    . MET C 1 226 ? -9.556  -21.942 -48.978  1.00 232.96 ? 226 MET C CA    1 
ATOM   7611  C  C     . MET C 1 226 ? -10.707 -22.813 -48.568  1.00 219.86 ? 226 MET C C     1 
ATOM   7612  O  O     . MET C 1 226 ? -11.129 -22.748 -47.413  1.00 197.23 ? 226 MET C O     1 
ATOM   7613  C  CB    . MET C 1 226 ? -10.029 -20.545 -49.466  1.00 228.75 ? 226 MET C CB    1 
ATOM   7614  C  CG    . MET C 1 226 ? -10.427 -19.589 -48.335  1.00 229.73 ? 226 MET C CG    1 
ATOM   7615  S  SD    . MET C 1 226 ? -10.505 -17.841 -48.776  1.00 233.29 ? 226 MET C SD    1 
ATOM   7616  C  CE    . MET C 1 226 ? -11.739 -17.970 -50.063  1.00 239.57 ? 226 MET C CE    1 
ATOM   7617  N  N     . ALA C 1 227 ? -11.244 -23.632 -49.478  1.00 214.50 ? 227 ALA C N     1 
ATOM   7618  C  CA    . ALA C 1 227 ? -12.332 -24.541 -49.143  1.00 210.16 ? 227 ALA C CA    1 
ATOM   7619  C  C     . ALA C 1 227 ? -11.827 -25.556 -48.131  1.00 212.67 ? 227 ALA C C     1 
ATOM   7620  O  O     . ALA C 1 227 ? -12.518 -25.831 -47.117  1.00 215.50 ? 227 ALA C O     1 
ATOM   7621  C  CB    . ALA C 1 227 ? -12.905 -25.242 -50.385  1.00 210.40 ? 227 ALA C CB    1 
ATOM   7622  N  N     . THR C 1 228 ? -10.643 -26.124 -48.423  1.00 220.15 ? 228 THR C N     1 
ATOM   7623  C  CA    . THR C 1 228 ? -10.051 -27.141 -47.558  1.00 220.29 ? 228 THR C CA    1 
ATOM   7624  C  C     . THR C 1 228 ? -9.570  -26.582 -46.226  1.00 220.83 ? 228 THR C C     1 
ATOM   7625  O  O     . THR C 1 228 ? -9.362  -27.350 -45.326  1.00 219.24 ? 228 THR C O     1 
ATOM   7626  C  CB    . THR C 1 228 ? -8.991  -28.009 -48.242  1.00 216.94 ? 228 THR C CB    1 
ATOM   7627  O  OG1   . THR C 1 228 ? -8.623  -29.089 -47.368  1.00 196.70 ? 228 THR C OG1   1 
ATOM   7628  C  CG2   . THR C 1 228 ? -7.724  -27.260 -48.598  1.00 220.05 ? 228 THR C CG2   1 
ATOM   7629  N  N     . ALA C 1 229 ? -9.382  -25.264 -46.114  1.00 216.24 ? 229 ALA C N     1 
ATOM   7630  C  CA    . ALA C 1 229 ? -9.272  -24.652 -44.795  1.00 209.44 ? 229 ALA C CA    1 
ATOM   7631  C  C     . ALA C 1 229 ? -10.370 -24.949 -43.840  1.00 208.61 ? 229 ALA C C     1 
ATOM   7632  O  O     . ALA C 1 229 ? -10.202 -24.745 -42.639  1.00 206.25 ? 229 ALA C O     1 
ATOM   7633  C  CB    . ALA C 1 229 ? -9.107  -23.126 -44.869  1.00 205.50 ? 229 ALA C CB    1 
ATOM   7634  N  N     . ALA C 1 230 ? -11.550 -25.401 -44.262  1.00 208.09 ? 230 ALA C N     1 
ATOM   7635  C  CA    . ALA C 1 230 ? -12.564 -25.780 -43.314  1.00 205.57 ? 230 ALA C CA    1 
ATOM   7636  C  C     . ALA C 1 230 ? -12.034 -26.821 -42.325  1.00 223.04 ? 230 ALA C C     1 
ATOM   7637  O  O     . ALA C 1 230 ? -12.201 -26.663 -41.106  1.00 225.84 ? 230 ALA C O     1 
ATOM   7638  C  CB    . ALA C 1 230 ? -13.829 -26.302 -44.025  1.00 185.33 ? 230 ALA C CB    1 
ATOM   7639  N  N     . SER C 1 231 ? -11.464 -27.891 -42.869  1.00 232.80 ? 231 SER C N     1 
ATOM   7640  C  CA    . SER C 1 231 ? -10.904 -28.963 -42.039  1.00 232.52 ? 231 SER C CA    1 
ATOM   7641  C  C     . SER C 1 231 ? -9.443  -28.692 -41.862  1.00 244.54 ? 231 SER C C     1 
ATOM   7642  O  O     . SER C 1 231 ? -8.623  -29.126 -42.672  1.00 245.76 ? 231 SER C O     1 
ATOM   7643  C  CB    . SER C 1 231 ? -11.106 -30.343 -42.680  1.00 219.13 ? 231 SER C CB    1 
ATOM   7644  O  OG    . SER C 1 231 ? -10.501 -30.406 -43.959  1.00 209.60 ? 231 SER C OG    1 
ATOM   7645  N  N     . SER C 1 232 ? -9.078  -27.957 -40.804  1.00 247.13 ? 232 SER C N     1 
ATOM   7646  C  CA    . SER C 1 232 ? -7.693  -27.463 -40.647  1.00 241.98 ? 232 SER C CA    1 
ATOM   7647  C  C     . SER C 1 232 ? -6.798  -28.536 -40.075  1.00 235.32 ? 232 SER C C     1 
ATOM   7648  O  O     . SER C 1 232 ? -7.071  -29.012 -38.975  1.00 225.47 ? 232 SER C O     1 
ATOM   7649  C  CB    . SER C 1 232 ? -7.622  -26.224 -39.720  1.00 239.96 ? 232 SER C CB    1 
ATOM   7650  O  OG    . SER C 1 232 ? -8.372  -25.145 -40.250  1.00 245.24 ? 232 SER C OG    1 
ATOM   7651  N  N     . SER C 1 233 ? -5.771  -28.920 -40.831  1.00 234.40 ? 233 SER C N     1 
ATOM   7652  C  CA    . SER C 1 233 ? -4.871  -29.969 -40.427  1.00 242.68 ? 233 SER C CA    1 
ATOM   7653  C  C     . SER C 1 233 ? -3.482  -29.524 -40.777  1.00 242.28 ? 233 SER C C     1 
ATOM   7654  O  O     . SER C 1 233 ? -2.771  -29.054 -39.905  1.00 242.98 ? 233 SER C O     1 
ATOM   7655  C  CB    . SER C 1 233 ? -5.249  -31.305 -41.082  1.00 250.70 ? 233 SER C CB    1 
ATOM   7656  O  OG    . SER C 1 233 ? -4.300  -32.311 -40.775  1.00 259.83 ? 233 SER C OG    1 
ATOM   7657  N  N     . SER C 1 234 ? -3.149  -29.573 -42.073  1.00 251.48 ? 234 SER C N     1 
ATOM   7658  C  CA    . SER C 1 234 ? -1.851  -29.157 -42.604  1.00 261.09 ? 234 SER C CA    1 
ATOM   7659  C  C     . SER C 1 234 ? -1.701  -27.664 -42.830  1.00 263.08 ? 234 SER C C     1 
ATOM   7660  O  O     . SER C 1 234 ? -0.600  -27.169 -42.834  1.00 263.29 ? 234 SER C O     1 
ATOM   7661  C  CB    . SER C 1 234 ? -1.540  -29.861 -43.948  1.00 267.00 ? 234 SER C CB    1 
ATOM   7662  O  OG    . SER C 1 234 ? -1.447  -31.268 -43.798  1.00 267.40 ? 234 SER C OG    1 
ATOM   7663  N  N     . LEU C 1 235 ? -2.791  -26.941 -43.056  1.00 253.78 ? 235 LEU C N     1 
ATOM   7664  C  CA    . LEU C 1 235 ? -2.722  -25.549 -43.384  1.00 241.09 ? 235 LEU C CA    1 
ATOM   7665  C  C     . LEU C 1 235 ? -2.382  -24.679 -42.194  1.00 222.59 ? 235 LEU C C     1 
ATOM   7666  O  O     . LEU C 1 235 ? -1.966  -23.543 -42.348  1.00 226.99 ? 235 LEU C O     1 
ATOM   7667  C  CB    . LEU C 1 235 ? -4.055  -25.106 -44.005  1.00 239.56 ? 235 LEU C CB    1 
ATOM   7668  C  CG    . LEU C 1 235 ? -4.512  -25.999 -45.179  1.00 240.99 ? 235 LEU C CG    1 
ATOM   7669  C  CD1   . LEU C 1 235 ? -6.019  -25.866 -45.429  1.00 249.07 ? 235 LEU C CD1   1 
ATOM   7670  C  CD2   . LEU C 1 235 ? -3.663  -25.751 -46.430  1.00 233.98 ? 235 LEU C CD2   1 
ATOM   7671  N  N     . GLU C 1 236 ? -2.545  -25.203 -40.987  1.00 198.63 ? 236 GLU C N     1 
ATOM   7672  C  CA    . GLU C 1 236 ? -2.085  -24.474 -39.823  1.00 181.55 ? 236 GLU C CA    1 
ATOM   7673  C  C     . GLU C 1 236 ? -0.647  -24.806 -39.502  1.00 164.06 ? 236 GLU C C     1 
ATOM   7674  O  O     . GLU C 1 236 ? -0.250  -25.955 -39.580  1.00 154.64 ? 236 GLU C O     1 
ATOM   7675  C  CB    . GLU C 1 236 ? -2.936  -24.780 -38.561  1.00 187.01 ? 236 GLU C CB    1 
ATOM   7676  C  CG    . GLU C 1 236 ? -4.370  -24.297 -38.655  1.00 210.53 ? 236 GLU C CG    1 
ATOM   7677  C  CD    . GLU C 1 236 ? -5.162  -24.750 -37.466  1.00 236.99 ? 236 GLU C CD    1 
ATOM   7678  O  OE1   . GLU C 1 236 ? -4.552  -25.390 -36.587  1.00 248.53 ? 236 GLU C OE1   1 
ATOM   7679  O  OE2   . GLU C 1 236 ? -6.373  -24.468 -37.411  1.00 256.89 ? 236 GLU C OE2   1 
ATOM   7680  N  N     . LYS C 1 237 ? 0.097   -23.798 -39.123  1.00 167.63 ? 237 LYS C N     1 
ATOM   7681  C  CA    . LYS C 1 237 ? 1.448   -24.039 -38.683  1.00 162.10 ? 237 LYS C CA    1 
ATOM   7682  C  C     . LYS C 1 237 ? 1.725   -23.212 -37.439  1.00 160.49 ? 237 LYS C C     1 
ATOM   7683  O  O     . LYS C 1 237 ? 1.411   -22.024 -37.357  1.00 149.48 ? 237 LYS C O     1 
ATOM   7684  C  CB    . LYS C 1 237 ? 2.503   -23.742 -39.783  1.00 167.18 ? 237 LYS C CB    1 
ATOM   7685  C  CG    . LYS C 1 237 ? 3.122   -24.970 -40.429  1.00 193.50 ? 237 LYS C CG    1 
ATOM   7686  C  CD    . LYS C 1 237 ? 3.886   -24.601 -41.701  1.00 208.13 ? 237 LYS C CD    1 
ATOM   7687  C  CE    . LYS C 1 237 ? 4.066   -25.789 -42.664  1.00 223.17 ? 237 LYS C CE    1 
ATOM   7688  N  NZ    . LYS C 1 237 ? 4.882   -25.455 -43.863  1.00 233.04 ? 237 LYS C NZ    1 
ATOM   7689  N  N     . SER C 1 238 ? 2.340   -23.850 -36.466  1.00 168.83 ? 238 SER C N     1 
ATOM   7690  C  CA    . SER C 1 238 ? 2.861   -23.139 -35.342  1.00 173.58 ? 238 SER C CA    1 
ATOM   7691  C  C     . SER C 1 238 ? 4.129   -22.397 -35.728  1.00 167.57 ? 238 SER C C     1 
ATOM   7692  O  O     . SER C 1 238 ? 5.030   -22.904 -36.392  1.00 152.83 ? 238 SER C O     1 
ATOM   7693  C  CB    . SER C 1 238 ? 3.150   -24.144 -34.252  1.00 188.46 ? 238 SER C CB    1 
ATOM   7694  O  OG    . SER C 1 238 ? 3.669   -23.524 -33.090  1.00 194.33 ? 238 SER C OG    1 
ATOM   7695  N  N     . TYR C 1 239 ? 4.166   -21.147 -35.302  1.00 156.80 ? 239 TYR C N     1 
ATOM   7696  C  CA    . TYR C 1 239 ? 5.363   -20.324 -35.413  1.00 142.24 ? 239 TYR C CA    1 
ATOM   7697  C  C     . TYR C 1 239 ? 5.726   -19.806 -34.027  1.00 127.88 ? 239 TYR C C     1 
ATOM   7698  O  O     . TYR C 1 239 ? 4.868   -19.566 -33.185  1.00 105.92 ? 239 TYR C O     1 
ATOM   7699  C  CB    . TYR C 1 239 ? 5.107   -19.169 -36.392  1.00 130.03 ? 239 TYR C CB    1 
ATOM   7700  C  CG    . TYR C 1 239 ? 6.300   -18.308 -36.590  1.00 131.68 ? 239 TYR C CG    1 
ATOM   7701  C  CD1   . TYR C 1 239 ? 7.375   -18.735 -37.338  1.00 135.68 ? 239 TYR C CD1   1 
ATOM   7702  C  CD2   . TYR C 1 239 ? 6.414   -17.129 -35.897  1.00 137.10 ? 239 TYR C CD2   1 
ATOM   7703  C  CE1   . TYR C 1 239 ? 8.507   -17.947 -37.468  1.00 129.80 ? 239 TYR C CE1   1 
ATOM   7704  C  CE2   . TYR C 1 239 ? 7.537   -16.322 -36.044  1.00 136.18 ? 239 TYR C CE2   1 
ATOM   7705  C  CZ    . TYR C 1 239 ? 8.583   -16.743 -36.825  1.00 122.10 ? 239 TYR C CZ    1 
ATOM   7706  O  OH    . TYR C 1 239 ? 9.715   -15.933 -36.952  1.00 106.93 ? 239 TYR C OH    1 
ATOM   7707  N  N     . GLU C 1 240 ? 7.027   -19.722 -33.800  1.00 128.23 ? 240 GLU C N     1 
ATOM   7708  C  CA    . GLU C 1 240 ? 7.560   -19.287 -32.506  1.00 129.54 ? 240 GLU C CA    1 
ATOM   7709  C  C     . GLU C 1 240 ? 8.039   -17.896 -32.669  1.00 113.15 ? 240 GLU C C     1 
ATOM   7710  O  O     . GLU C 1 240 ? 8.916   -17.692 -33.503  1.00 105.69 ? 240 GLU C O     1 
ATOM   7711  C  CB    . GLU C 1 240 ? 8.761   -20.141 -32.147  1.00 155.69 ? 240 GLU C CB    1 
ATOM   7712  C  CG    . GLU C 1 240 ? 9.426   -19.800 -30.823  1.00 187.27 ? 240 GLU C CG    1 
ATOM   7713  C  CD    . GLU C 1 240 ? 8.569   -20.151 -29.626  1.00 223.77 ? 240 GLU C CD    1 
ATOM   7714  O  OE1   . GLU C 1 240 ? 7.657   -20.997 -29.752  1.00 241.01 ? 240 GLU C OE1   1 
ATOM   7715  O  OE2   . GLU C 1 240 ? 8.820   -19.586 -28.545  1.00 250.37 ? 240 GLU C OE2   1 
ATOM   7716  N  N     . LEU C 1 241 ? 7.581   -16.969 -31.806  1.00 110.35 ? 241 LEU C N     1 
ATOM   7717  C  CA    . LEU C 1 241 ? 8.080   -15.597 -31.842  1.00 109.46 ? 241 LEU C CA    1 
ATOM   7718  C  C     . LEU C 1 241 ? 9.299   -15.542 -30.991  1.00 126.74 ? 241 LEU C C     1 
ATOM   7719  O  O     . LEU C 1 241 ? 9.520   -16.421 -30.144  1.00 136.57 ? 241 LEU C O     1 
ATOM   7720  C  CB    . LEU C 1 241 ? 7.099   -14.570 -31.278  1.00 101.58 ? 241 LEU C CB    1 
ATOM   7721  C  CG    . LEU C 1 241 ? 6.316   -13.786 -32.340  1.00 105.16 ? 241 LEU C CG    1 
ATOM   7722  C  CD1   . LEU C 1 241 ? 5.524   -14.714 -33.267  1.00 104.76 ? 241 LEU C CD1   1 
ATOM   7723  C  CD2   . LEU C 1 241 ? 5.428   -12.696 -31.703  1.00 110.76 ? 241 LEU C CD2   1 
ATOM   7724  N  N     . PRO C 1 242 ? 10.077  -14.481 -31.159  1.00 135.11 ? 242 PRO C N     1 
ATOM   7725  C  CA    . PRO C 1 242 ? 11.229  -14.319 -30.271  1.00 148.42 ? 242 PRO C CA    1 
ATOM   7726  C  C     . PRO C 1 242 ? 10.823  -14.098 -28.841  1.00 159.19 ? 242 PRO C C     1 
ATOM   7727  O  O     . PRO C 1 242 ? 11.607  -14.353 -27.969  1.00 169.03 ? 242 PRO C O     1 
ATOM   7728  C  CB    . PRO C 1 242 ? 11.993  -13.137 -30.882  1.00 149.10 ? 242 PRO C CB    1 
ATOM   7729  C  CG    . PRO C 1 242 ? 10.942  -12.409 -31.631  1.00 147.04 ? 242 PRO C CG    1 
ATOM   7730  C  CD    . PRO C 1 242 ? 10.074  -13.463 -32.216  1.00 134.70 ? 242 PRO C CD    1 
ATOM   7731  N  N     . ASP C 1 243 ? 9.616   -13.577 -28.603  1.00 167.89 ? 243 ASP C N     1 
ATOM   7732  C  CA    . ASP C 1 243 ? 9.071   -13.332 -27.301  1.00 178.12 ? 243 ASP C CA    1 
ATOM   7733  C  C     . ASP C 1 243 ? 8.813   -14.669 -26.609  1.00 168.86 ? 243 ASP C C     1 
ATOM   7734  O  O     . ASP C 1 243 ? 8.801   -14.739 -25.377  1.00 179.37 ? 243 ASP C O     1 
ATOM   7735  C  CB    . ASP C 1 243 ? 7.769   -12.436 -27.454  1.00 180.50 ? 243 ASP C CB    1 
ATOM   7736  C  CG    . ASP C 1 243 ? 6.999   -12.347 -26.202  1.00 175.38 ? 243 ASP C CG    1 
ATOM   7737  O  OD1   . ASP C 1 243 ? 7.649   -12.468 -25.155  1.00 170.89 ? 243 ASP C OD1   1 
ATOM   7738  O  OD2   . ASP C 1 243 ? 5.753   -12.129 -26.231  1.00 156.02 ? 243 ASP C OD2   1 
ATOM   7739  N  N     . GLY C 1 244 ? 8.588   -15.741 -27.384  1.00 142.17 ? 244 GLY C N     1 
ATOM   7740  C  CA    . GLY C 1 244 ? 8.320   -17.007 -26.775  1.00 131.23 ? 244 GLY C CA    1 
ATOM   7741  C  C     . GLY C 1 244 ? 6.872   -17.358 -26.983  1.00 137.34 ? 244 GLY C C     1 
ATOM   7742  O  O     . GLY C 1 244 ? 6.438   -18.467 -26.684  1.00 131.07 ? 244 GLY C O     1 
ATOM   7743  N  N     . GLN C 1 245 ? 6.107   -16.400 -27.516  1.00 151.51 ? 245 GLN C N     1 
ATOM   7744  C  CA    . GLN C 1 245 ? 4.712   -16.590 -27.808  1.00 150.63 ? 245 GLN C CA    1 
ATOM   7745  C  C     . GLN C 1 245 ? 4.684   -17.466 -29.044  1.00 145.85 ? 245 GLN C C     1 
ATOM   7746  O  O     . GLN C 1 245 ? 5.635   -17.491 -29.818  1.00 156.30 ? 245 GLN C O     1 
ATOM   7747  C  CB    . GLN C 1 245 ? 3.991   -15.243 -28.049  1.00 169.93 ? 245 GLN C CB    1 
ATOM   7748  C  CG    . GLN C 1 245 ? 2.482   -15.307 -28.000  1.00 186.13 ? 245 GLN C CG    1 
ATOM   7749  C  CD    . GLN C 1 245 ? 1.838   -13.928 -28.063  1.00 203.91 ? 245 GLN C CD    1 
ATOM   7750  O  OE1   . GLN C 1 245 ? 2.495   -12.901 -27.865  1.00 198.60 ? 245 GLN C OE1   1 
ATOM   7751  N  NE2   . GLN C 1 245 ? 0.538   -13.899 -28.345  1.00 213.38 ? 245 GLN C NE2   1 
ATOM   7752  N  N     . VAL C 1 246 ? 3.566   -18.157 -29.225  1.00 136.62 ? 246 VAL C N     1 
ATOM   7753  C  CA    . VAL C 1 246 ? 3.368   -19.048 -30.339  1.00 133.65 ? 246 VAL C CA    1 
ATOM   7754  C  C     . VAL C 1 246 ? 2.195   -18.558 -31.147  1.00 128.20 ? 246 VAL C C     1 
ATOM   7755  O  O     . VAL C 1 246 ? 1.183   -18.128 -30.633  1.00 136.58 ? 246 VAL C O     1 
ATOM   7756  C  CB    . VAL C 1 246 ? 3.131   -20.480 -29.832  1.00 154.82 ? 246 VAL C CB    1 
ATOM   7757  C  CG1   . VAL C 1 246 ? 2.751   -21.388 -31.007  1.00 160.57 ? 246 VAL C CG1   1 
ATOM   7758  C  CG2   . VAL C 1 246 ? 4.380   -20.947 -29.074  1.00 172.44 ? 246 VAL C CG2   1 
ATOM   7759  N  N     . ILE C 1 247 ? 2.341   -18.613 -32.450  1.00 140.44 ? 247 ILE C N     1 
ATOM   7760  C  CA    . ILE C 1 247 ? 1.295   -18.123 -33.364  1.00 155.71 ? 247 ILE C CA    1 
ATOM   7761  C  C     . ILE C 1 247 ? 0.847   -19.309 -34.186  1.00 170.84 ? 247 ILE C C     1 
ATOM   7762  O  O     . ILE C 1 247 ? 1.674   -20.177 -34.464  1.00 175.16 ? 247 ILE C O     1 
ATOM   7763  C  CB    . ILE C 1 247 ? 1.871   -17.027 -34.299  1.00 153.61 ? 247 ILE C CB    1 
ATOM   7764  C  CG1   . ILE C 1 247 ? 2.403   -15.823 -33.498  1.00 151.34 ? 247 ILE C CG1   1 
ATOM   7765  C  CG2   . ILE C 1 247 ? 0.882   -16.634 -35.403  1.00 140.27 ? 247 ILE C CG2   1 
ATOM   7766  C  CD1   . ILE C 1 247 ? 1.382   -15.145 -32.630  1.00 145.01 ? 247 ILE C CD1   1 
ATOM   7767  N  N     . THR C 1 248 ? -0.411  -19.347 -34.591  1.00 171.67 ? 248 THR C N     1 
ATOM   7768  C  CA    . THR C 1 248 ? -0.901  -20.461 -35.351  1.00 175.81 ? 248 THR C CA    1 
ATOM   7769  C  C     . THR C 1 248 ? -1.723  -19.941 -36.508  1.00 152.62 ? 248 THR C C     1 
ATOM   7770  O  O     . THR C 1 248 ? -2.811  -19.409 -36.318  1.00 148.79 ? 248 THR C O     1 
ATOM   7771  C  CB    . THR C 1 248 ? -1.784  -21.349 -34.437  1.00 202.33 ? 248 THR C CB    1 
ATOM   7772  O  OG1   . THR C 1 248 ? -0.995  -21.834 -33.342  1.00 201.54 ? 248 THR C OG1   1 
ATOM   7773  C  CG2   . THR C 1 248 ? -2.371  -22.539 -35.189  1.00 225.76 ? 248 THR C CG2   1 
ATOM   7774  N  N     . ILE C 1 249 ? -1.226  -20.132 -37.740  1.00 130.06 ? 249 ILE C N     1 
ATOM   7775  C  CA    . ILE C 1 249 ? -1.776  -19.447 -38.873  1.00 126.53 ? 249 ILE C CA    1 
ATOM   7776  C  C     . ILE C 1 249 ? -2.239  -20.415 -39.916  1.00 121.62 ? 249 ILE C C     1 
ATOM   7777  O  O     . ILE C 1 249 ? -1.439  -21.208 -40.380  1.00 131.70 ? 249 ILE C O     1 
ATOM   7778  C  CB    . ILE C 1 249 ? -0.763  -18.487 -39.492  1.00 153.74 ? 249 ILE C CB    1 
ATOM   7779  C  CG1   . ILE C 1 249 ? 0.578   -19.178 -39.812  1.00 176.36 ? 249 ILE C CG1   1 
ATOM   7780  C  CG2   . ILE C 1 249 ? -0.496  -17.379 -38.504  1.00 178.61 ? 249 ILE C CG2   1 
ATOM   7781  C  CD1   . ILE C 1 249 ? 1.422   -18.425 -40.810  1.00 192.69 ? 249 ILE C CD1   1 
ATOM   7782  N  N     . GLY C 1 250 ? -3.529  -20.367 -40.200  1.00 137.58 ? 250 GLY C N     1 
ATOM   7783  C  CA    . GLY C 1 250 ? -4.183  -21.309 -41.115  1.00 148.55 ? 250 GLY C CA    1 
ATOM   7784  C  C     . GLY C 1 250 ? -4.235  -20.916 -42.566  1.00 152.87 ? 250 GLY C C     1 
ATOM   7785  O  O     . GLY C 1 250 ? -3.213  -20.874 -43.241  1.00 143.71 ? 250 GLY C O     1 
ATOM   7786  N  N     . ASN C 1 251 ? -5.453  -20.502 -42.996  1.00 157.84 ? 251 ASN C N     1 
ATOM   7787  C  CA    . ASN C 1 251 ? -5.750  -20.081 -44.375  1.00 166.30 ? 251 ASN C CA    1 
ATOM   7788  C  C     . ASN C 1 251 ? -5.111  -18.719 -44.665  1.00 166.05 ? 251 ASN C C     1 
ATOM   7789  O  O     . ASN C 1 251 ? -4.762  -18.354 -45.800  1.00 172.94 ? 251 ASN C O     1 
ATOM   7790  C  CB    . ASN C 1 251 ? -7.261  -19.999 -44.648  1.00 176.63 ? 251 ASN C CB    1 
ATOM   7791  C  CG    . ASN C 1 251 ? -7.917  -18.910 -43.832  1.00 172.05 ? 251 ASN C CG    1 
ATOM   7792  O  OD1   . ASN C 1 251 ? -7.513  -18.612 -42.713  1.00 159.26 ? 251 ASN C OD1   1 
ATOM   7793  N  ND2   . ASN C 1 251 ? -9.008  -18.367 -44.357  1.00 176.99 ? 251 ASN C ND2   1 
ATOM   7794  N  N     . GLU C 1 252 ? -4.951  -17.969 -43.591  1.00 176.87 ? 252 GLU C N     1 
ATOM   7795  C  CA    . GLU C 1 252 ? -4.353  -16.685 -43.602  1.00 199.90 ? 252 GLU C CA    1 
ATOM   7796  C  C     . GLU C 1 252 ? -2.958  -16.802 -44.204  1.00 176.43 ? 252 GLU C C     1 
ATOM   7797  O  O     . GLU C 1 252 ? -2.435  -15.873 -44.807  1.00 180.92 ? 252 GLU C O     1 
ATOM   7798  C  CB    . GLU C 1 252 ? -4.345  -16.157 -42.159  1.00 218.60 ? 252 GLU C CB    1 
ATOM   7799  C  CG    . GLU C 1 252 ? -3.272  -15.133 -41.840  1.00 219.37 ? 252 GLU C CG    1 
ATOM   7800  C  CD    . GLU C 1 252 ? -3.052  -15.009 -40.348  1.00 209.64 ? 252 GLU C CD    1 
ATOM   7801  O  OE1   . GLU C 1 252 ? -4.084  -15.119 -39.674  1.00 214.81 ? 252 GLU C OE1   1 
ATOM   7802  O  OE2   . GLU C 1 252 ? -1.900  -14.894 -39.904  1.00 195.77 ? 252 GLU C OE2   1 
ATOM   7803  N  N     . ARG C 1 253 ? -2.340  -17.953 -44.006  1.00 142.10 ? 253 ARG C N     1 
ATOM   7804  C  CA    . ARG C 1 253 ? -1.049  -18.204 -44.611  1.00 131.78 ? 253 ARG C CA    1 
ATOM   7805  C  C     . ARG C 1 253 ? -1.037  -17.915 -46.101  1.00 129.55 ? 253 ARG C C     1 
ATOM   7806  O  O     . ARG C 1 253 ? -0.258  -17.064 -46.563  1.00 130.28 ? 253 ARG C O     1 
ATOM   7807  C  CB    . ARG C 1 253 ? -0.569  -19.654 -44.339  1.00 123.95 ? 253 ARG C CB    1 
ATOM   7808  C  CG    . ARG C 1 253 ? 0.837   -19.918 -44.883  1.00 124.58 ? 253 ARG C CG    1 
ATOM   7809  C  CD    . ARG C 1 253 ? 1.114   -21.382 -45.104  1.00 127.49 ? 253 ARG C CD    1 
ATOM   7810  N  NE    . ARG C 1 253 ? 0.888   -22.135 -43.895  1.00 129.39 ? 253 ARG C NE    1 
ATOM   7811  C  CZ    . ARG C 1 253 ? 1.249   -23.410 -43.752  1.00 130.16 ? 253 ARG C CZ    1 
ATOM   7812  N  NH1   . ARG C 1 253 ? 0.982   -24.024 -42.613  1.00 135.62 ? 253 ARG C NH1   1 
ATOM   7813  N  NH2   . ARG C 1 253 ? 1.865   -24.079 -44.730  1.00 124.86 ? 253 ARG C NH2   1 
ATOM   7814  N  N     . PHE C 1 254 ? -1.853  -18.642 -46.892  1.00 147.89 ? 254 PHE C N     1 
ATOM   7815  C  CA    . PHE C 1 254 ? -1.622  -18.683 -48.342  1.00 160.68 ? 254 PHE C CA    1 
ATOM   7816  C  C     . PHE C 1 254 ? -2.298  -17.519 -49.089  1.00 154.64 ? 254 PHE C C     1 
ATOM   7817  O  O     . PHE C 1 254 ? -1.842  -17.177 -50.161  1.00 155.40 ? 254 PHE C O     1 
ATOM   7818  C  CB    . PHE C 1 254 ? -2.023  -20.039 -48.962  1.00 165.74 ? 254 PHE C CB    1 
ATOM   7819  C  CG    . PHE C 1 254 ? -3.449  -20.350 -48.744  1.00 160.76 ? 254 PHE C CG    1 
ATOM   7820  C  CD1   . PHE C 1 254 ? -4.438  -19.861 -49.582  1.00 153.67 ? 254 PHE C CD1   1 
ATOM   7821  C  CD2   . PHE C 1 254 ? -3.813  -21.124 -47.687  1.00 176.42 ? 254 PHE C CD2   1 
ATOM   7822  C  CE1   . PHE C 1 254 ? -5.754  -20.117 -49.337  1.00 161.27 ? 254 PHE C CE1   1 
ATOM   7823  C  CE2   . PHE C 1 254 ? -5.150  -21.438 -47.449  1.00 169.29 ? 254 PHE C CE2   1 
ATOM   7824  C  CZ    . PHE C 1 254 ? -6.115  -20.929 -48.286  1.00 161.43 ? 254 PHE C CZ    1 
ATOM   7825  N  N     . ARG C 1 255 ? -3.418  -16.990 -48.554  1.00 143.02 ? 255 ARG C N     1 
ATOM   7826  C  CA    . ARG C 1 255 ? -4.012  -15.820 -49.112  1.00 146.29 ? 255 ARG C CA    1 
ATOM   7827  C  C     . ARG C 1 255 ? -3.096  -14.640 -49.061  1.00 151.83 ? 255 ARG C C     1 
ATOM   7828  O  O     . ARG C 1 255 ? -3.320  -13.725 -49.842  1.00 162.54 ? 255 ARG C O     1 
ATOM   7829  C  CB    . ARG C 1 255 ? -5.404  -15.523 -48.548  1.00 143.02 ? 255 ARG C CB    1 
ATOM   7830  C  CG    . ARG C 1 255 ? -5.506  -15.048 -47.127  1.00 145.97 ? 255 ARG C CG    1 
ATOM   7831  C  CD    . ARG C 1 255 ? -6.982  -14.819 -46.876  1.00 144.79 ? 255 ARG C CD    1 
ATOM   7832  N  NE    . ARG C 1 255 ? -7.344  -14.777 -45.477  1.00 153.24 ? 255 ARG C NE    1 
ATOM   7833  C  CZ    . ARG C 1 255 ? -8.590  -14.615 -45.055  1.00 173.69 ? 255 ARG C CZ    1 
ATOM   7834  N  NH1   . ARG C 1 255 ? -9.588  -14.467 -45.928  1.00 180.96 ? 255 ARG C NH1   1 
ATOM   7835  N  NH2   . ARG C 1 255 ? -8.848  -14.594 -43.755  1.00 195.94 ? 255 ARG C NH2   1 
ATOM   7836  N  N     . CYS C 1 256 ? -2.027  -14.618 -48.251  1.00 150.69 ? 256 CYS C N     1 
ATOM   7837  C  CA    . CYS C 1 256 ? -1.122  -13.514 -48.307  1.00 168.83 ? 256 CYS C CA    1 
ATOM   7838  C  C     . CYS C 1 256 ? -0.480  -13.330 -49.662  1.00 168.23 ? 256 CYS C C     1 
ATOM   7839  O  O     . CYS C 1 256 ? -0.554  -12.268 -50.227  1.00 177.03 ? 256 CYS C O     1 
ATOM   7840  C  CB    . CYS C 1 256 ? -0.083  -13.496 -47.167  1.00 191.51 ? 256 CYS C CB    1 
ATOM   7841  S  SG    . CYS C 1 256 ? 1.102   -12.122 -47.297  1.00 224.62 ? 256 CYS C SG    1 
ATOM   7842  N  N     . PRO C 1 257 ? 0.163   -14.356 -50.222  1.00 163.02 ? 257 PRO C N     1 
ATOM   7843  C  CA    . PRO C 1 257 ? 0.737   -14.228 -51.563  1.00 154.48 ? 257 PRO C CA    1 
ATOM   7844  C  C     . PRO C 1 257 ? -0.290  -14.171 -52.654  1.00 155.64 ? 257 PRO C C     1 
ATOM   7845  O  O     . PRO C 1 257 ? 0.014   -13.783 -53.774  1.00 152.59 ? 257 PRO C O     1 
ATOM   7846  C  CB    . PRO C 1 257 ? 1.491   -15.534 -51.748  1.00 147.73 ? 257 PRO C CB    1 
ATOM   7847  C  CG    . PRO C 1 257 ? 1.841   -16.021 -50.394  1.00 162.39 ? 257 PRO C CG    1 
ATOM   7848  C  CD    . PRO C 1 257 ? 0.752   -15.471 -49.486  1.00 169.51 ? 257 PRO C CD    1 
ATOM   7849  N  N     . GLU C 1 258 ? -1.513  -14.601 -52.365  1.00 150.83 ? 258 GLU C N     1 
ATOM   7850  C  CA    . GLU C 1 258 ? -2.588  -14.579 -53.329  1.00 151.11 ? 258 GLU C CA    1 
ATOM   7851  C  C     . GLU C 1 258 ? -2.746  -13.189 -53.851  1.00 157.89 ? 258 GLU C C     1 
ATOM   7852  O  O     . GLU C 1 258 ? -3.175  -12.995 -54.977  1.00 162.63 ? 258 GLU C O     1 
ATOM   7853  C  CB    . GLU C 1 258 ? -3.929  -15.061 -52.734  1.00 143.47 ? 258 GLU C CB    1 
ATOM   7854  C  CG    . GLU C 1 258 ? -5.089  -15.050 -53.705  1.00 156.90 ? 258 GLU C CG    1 
ATOM   7855  C  CD    . GLU C 1 258 ? -4.878  -16.007 -54.870  1.00 171.98 ? 258 GLU C CD    1 
ATOM   7856  O  OE1   . GLU C 1 258 ? -3.952  -16.874 -54.839  1.00 178.24 ? 258 GLU C OE1   1 
ATOM   7857  O  OE2   . GLU C 1 258 ? -5.582  -15.827 -55.894  1.00 181.19 ? 258 GLU C OE2   1 
ATOM   7858  N  N     . ALA C 1 259 ? -2.377  -12.211 -53.028  1.00 160.02 ? 259 ALA C N     1 
ATOM   7859  C  CA    . ALA C 1 259 ? -2.554  -10.807 -53.357  1.00 155.29 ? 259 ALA C CA    1 
ATOM   7860  C  C     . ALA C 1 259 ? -1.901  -10.485 -54.685  1.00 147.65 ? 259 ALA C C     1 
ATOM   7861  O  O     . ALA C 1 259 ? -2.436  -9.667  -55.454  1.00 149.60 ? 259 ALA C O     1 
ATOM   7862  C  CB    . ALA C 1 259 ? -2.023  -9.869  -52.285  1.00 157.42 ? 259 ALA C CB    1 
ATOM   7863  N  N     . LEU C 1 260 ? -0.763  -11.101 -54.977  1.00 143.13 ? 260 LEU C N     1 
ATOM   7864  C  CA    . LEU C 1 260 ? -0.085  -10.822 -56.237  1.00 151.91 ? 260 LEU C CA    1 
ATOM   7865  C  C     . LEU C 1 260 ? -0.994  -11.067 -57.399  1.00 156.82 ? 260 LEU C C     1 
ATOM   7866  O  O     . LEU C 1 260 ? -0.909  -10.377 -58.350  1.00 164.75 ? 260 LEU C O     1 
ATOM   7867  C  CB    . LEU C 1 260 ? 1.191   -11.682 -56.406  1.00 151.74 ? 260 LEU C CB    1 
ATOM   7868  C  CG    . LEU C 1 260 ? 2.271   -11.426 -55.339  1.00 153.53 ? 260 LEU C CG    1 
ATOM   7869  C  CD1   . LEU C 1 260 ? 3.525   -12.292 -55.603  1.00 156.08 ? 260 LEU C CD1   1 
ATOM   7870  C  CD2   . LEU C 1 260 ? 2.630   -9.926  -55.250  1.00 153.70 ? 260 LEU C CD2   1 
ATOM   7871  N  N     . PHE C 1 261 ? -1.879  -12.018 -57.301  1.00 156.74 ? 261 PHE C N     1 
ATOM   7872  C  CA    . PHE C 1 261 ? -2.794  -12.398 -58.325  1.00 163.45 ? 261 PHE C CA    1 
ATOM   7873  C  C     . PHE C 1 261 ? -4.160  -11.714 -58.149  1.00 162.46 ? 261 PHE C C     1 
ATOM   7874  O  O     . PHE C 1 261 ? -4.988  -11.795 -59.045  1.00 157.53 ? 261 PHE C O     1 
ATOM   7875  C  CB    . PHE C 1 261 ? -2.876  -13.945 -58.299  1.00 166.35 ? 261 PHE C CB    1 
ATOM   7876  C  CG    . PHE C 1 261 ? -1.536  -14.621 -58.400  1.00 175.64 ? 261 PHE C CG    1 
ATOM   7877  C  CD1   . PHE C 1 261 ? -0.991  -14.872 -59.625  1.00 192.19 ? 261 PHE C CD1   1 
ATOM   7878  C  CD2   . PHE C 1 261 ? -0.810  -14.945 -57.266  1.00 174.16 ? 261 PHE C CD2   1 
ATOM   7879  C  CE1   . PHE C 1 261 ? 0.239   -15.487 -59.739  1.00 200.21 ? 261 PHE C CE1   1 
ATOM   7880  C  CE2   . PHE C 1 261 ? 0.432   -15.511 -57.365  1.00 182.00 ? 261 PHE C CE2   1 
ATOM   7881  C  CZ    . PHE C 1 261 ? 0.956   -15.816 -58.606  1.00 188.98 ? 261 PHE C CZ    1 
ATOM   7882  N  N     . GLN C 1 262 ? -4.419  -11.086 -57.017  1.00 170.44 ? 262 GLN C N     1 
ATOM   7883  C  CA    . GLN C 1 262 ? -5.730  -10.475 -56.778  1.00 181.74 ? 262 GLN C CA    1 
ATOM   7884  C  C     . GLN C 1 262 ? -5.472  -9.230  -56.010  1.00 173.36 ? 262 GLN C C     1 
ATOM   7885  O  O     . GLN C 1 262 ? -5.702  -9.188  -54.776  1.00 189.20 ? 262 GLN C O     1 
ATOM   7886  C  CB    . GLN C 1 262 ? -6.632  -11.372 -55.940  1.00 194.83 ? 262 GLN C CB    1 
ATOM   7887  C  CG    . GLN C 1 262 ? -6.956  -12.715 -56.549  1.00 191.98 ? 262 GLN C CG    1 
ATOM   7888  C  CD    . GLN C 1 262 ? -7.993  -12.686 -57.665  1.00 199.01 ? 262 GLN C CD    1 
ATOM   7889  O  OE1   . GLN C 1 262 ? -9.009  -11.975 -57.600  1.00 197.24 ? 262 GLN C OE1   1 
ATOM   7890  N  NE2   . GLN C 1 262 ? -7.753  -13.497 -58.695  1.00 202.08 ? 262 GLN C NE2   1 
ATOM   7891  N  N     . PRO C 1 263 ? -5.023  -8.176  -56.716  1.00 161.78 ? 263 PRO C N     1 
ATOM   7892  C  CA    . PRO C 1 263 ? -4.689  -6.964  -55.981  1.00 167.06 ? 263 PRO C CA    1 
ATOM   7893  C  C     . PRO C 1 263 ? -5.907  -6.284  -55.456  1.00 179.04 ? 263 PRO C C     1 
ATOM   7894  O  O     . PRO C 1 263 ? -5.781  -5.341  -54.705  1.00 187.59 ? 263 PRO C O     1 
ATOM   7895  C  CB    . PRO C 1 263 ? -3.941  -6.107  -56.991  1.00 164.71 ? 263 PRO C CB    1 
ATOM   7896  C  CG    . PRO C 1 263 ? -3.420  -7.059  -57.955  1.00 159.09 ? 263 PRO C CG    1 
ATOM   7897  C  CD    . PRO C 1 263 ? -4.527  -8.077  -58.095  1.00 157.92 ? 263 PRO C CD    1 
ATOM   7898  N  N     . SER C 1 264 ? -7.109  -6.750  -55.803  1.00 187.44 ? 264 SER C N     1 
ATOM   7899  C  CA    . SER C 1 264 ? -8.330  -6.229  -55.230  1.00 193.13 ? 264 SER C CA    1 
ATOM   7900  C  C     . SER C 1 264 ? -8.328  -6.458  -53.743  1.00 187.14 ? 264 SER C C     1 
ATOM   7901  O  O     . SER C 1 264 ? -9.010  -5.758  -53.020  1.00 201.36 ? 264 SER C O     1 
ATOM   7902  C  CB    . SER C 1 264 ? -9.568  -6.939  -55.796  1.00 201.39 ? 264 SER C CB    1 
ATOM   7903  O  OG    . SER C 1 264 ? -9.577  -6.870  -57.207  1.00 220.91 ? 264 SER C OG    1 
ATOM   7904  N  N     . PHE C 1 265 ? -7.570  -7.458  -53.282  1.00 167.32 ? 265 PHE C N     1 
ATOM   7905  C  CA    . PHE C 1 265 ? -7.479  -7.722  -51.862  1.00 152.85 ? 265 PHE C CA    1 
ATOM   7906  C  C     . PHE C 1 265 ? -6.864  -6.546  -51.148  1.00 131.36 ? 265 PHE C C     1 
ATOM   7907  O  O     . PHE C 1 265 ? -7.311  -6.161  -50.084  1.00 133.44 ? 265 PHE C O     1 
ATOM   7908  C  CB    . PHE C 1 265 ? -6.674  -8.992  -51.537  1.00 163.52 ? 265 PHE C CB    1 
ATOM   7909  C  CG    . PHE C 1 265 ? -7.363  -10.253 -51.935  1.00 175.68 ? 265 PHE C CG    1 
ATOM   7910  C  CD1   . PHE C 1 265 ? -8.680  -10.260 -52.343  1.00 176.37 ? 265 PHE C CD1   1 
ATOM   7911  C  CD2   . PHE C 1 265 ? -6.698  -11.459 -51.846  1.00 189.49 ? 265 PHE C CD2   1 
ATOM   7912  C  CE1   . PHE C 1 265 ? -9.298  -11.432 -52.701  1.00 183.39 ? 265 PHE C CE1   1 
ATOM   7913  C  CE2   . PHE C 1 265 ? -7.319  -12.642 -52.195  1.00 194.79 ? 265 PHE C CE2   1 
ATOM   7914  C  CZ    . PHE C 1 265 ? -8.626  -12.628 -52.624  1.00 188.79 ? 265 PHE C CZ    1 
ATOM   7915  N  N     . LEU C 1 266 ? -5.808  -6.020  -51.761  1.00 118.79 ? 266 LEU C N     1 
ATOM   7916  C  CA    . LEU C 1 266 ? -5.098  -4.822  -51.332  1.00 123.60 ? 266 LEU C CA    1 
ATOM   7917  C  C     . LEU C 1 266 ? -5.897  -3.591  -51.651  1.00 118.87 ? 266 LEU C C     1 
ATOM   7918  O  O     . LEU C 1 266 ? -5.703  -2.599  -50.988  1.00 114.65 ? 266 LEU C O     1 
ATOM   7919  C  CB    . LEU C 1 266 ? -3.700  -4.724  -52.010  1.00 139.77 ? 266 LEU C CB    1 
ATOM   7920  C  CG    . LEU C 1 266 ? -2.655  -5.710  -51.419  1.00 149.87 ? 266 LEU C CG    1 
ATOM   7921  C  CD1   . LEU C 1 266 ? -1.357  -5.722  -52.225  1.00 156.43 ? 266 LEU C CD1   1 
ATOM   7922  C  CD2   . LEU C 1 266 ? -2.450  -5.400  -49.922  1.00 161.34 ? 266 LEU C CD2   1 
ATOM   7923  N  N     . GLY C 1 267 ? -6.741  -3.625  -52.673  1.00 122.65 ? 267 GLY C N     1 
ATOM   7924  C  CA    . GLY C 1 267 ? -7.633  -2.492  -52.900  1.00 121.51 ? 267 GLY C CA    1 
ATOM   7925  C  C     . GLY C 1 267 ? -7.178  -1.730  -54.094  1.00 117.13 ? 267 GLY C C     1 
ATOM   7926  O  O     . GLY C 1 267 ? -7.737  -0.704  -54.381  1.00 134.54 ? 267 GLY C O     1 
ATOM   7927  N  N     . MET C 1 268 ? -6.143  -2.205  -54.794  1.00 128.32 ? 268 MET C N     1 
ATOM   7928  C  CA    . MET C 1 268 ? -5.659  -1.585  -55.997  1.00 161.49 ? 268 MET C CA    1 
ATOM   7929  C  C     . MET C 1 268 ? -6.334  -2.253  -57.181  1.00 180.22 ? 268 MET C C     1 
ATOM   7930  O  O     . MET C 1 268 ? -6.654  -3.462  -57.164  1.00 171.55 ? 268 MET C O     1 
ATOM   7931  C  CB    . MET C 1 268 ? -4.104  -1.639  -56.069  1.00 175.98 ? 268 MET C CB    1 
ATOM   7932  C  CG    . MET C 1 268 ? -3.430  -0.701  -55.063  1.00 181.47 ? 268 MET C CG    1 
ATOM   7933  S  SD    . MET C 1 268 ? -1.635  -0.729  -55.056  1.00 204.16 ? 268 MET C SD    1 
ATOM   7934  C  CE    . MET C 1 268 ? -1.417  -2.419  -54.526  1.00 209.91 ? 268 MET C CE    1 
ATOM   7935  N  N     . GLU C 1 269 ? -6.536  -1.446  -58.213  1.00 205.64 ? 269 GLU C N     1 
ATOM   7936  C  CA    . GLU C 1 269 ? -7.152  -1.881  -59.486  1.00 221.23 ? 269 GLU C CA    1 
ATOM   7937  C  C     . GLU C 1 269 ? -6.114  -2.614  -60.324  1.00 218.92 ? 269 GLU C C     1 
ATOM   7938  O  O     . GLU C 1 269 ? -6.412  -3.602  -61.028  1.00 209.89 ? 269 GLU C O     1 
ATOM   7939  C  CB    . GLU C 1 269 ? -7.640  -0.715  -60.346  1.00 233.37 ? 269 GLU C CB    1 
ATOM   7940  C  CG    . GLU C 1 269 ? -8.704  0.103   -59.677  1.00 243.18 ? 269 GLU C CG    1 
ATOM   7941  C  CD    . GLU C 1 269 ? -9.410  1.054   -60.635  1.00 261.01 ? 269 GLU C CD    1 
ATOM   7942  O  OE1   . GLU C 1 269 ? -9.068  1.078   -61.839  1.00 269.48 ? 269 GLU C OE1   1 
ATOM   7943  O  OE2   . GLU C 1 269 ? -10.313 1.783   -60.179  1.00 267.34 ? 269 GLU C OE2   1 
ATOM   7944  N  N     . SER C 1 270 ? -4.878  -2.139  -60.193  1.00 216.79 ? 270 SER C N     1 
ATOM   7945  C  CA    . SER C 1 270 ? -3.753  -2.624  -60.991  1.00 212.63 ? 270 SER C CA    1 
ATOM   7946  C  C     . SER C 1 270 ? -3.827  -4.119  -61.072  1.00 202.78 ? 270 SER C C     1 
ATOM   7947  O  O     . SER C 1 270 ? -4.048  -4.798  -60.075  1.00 202.65 ? 270 SER C O     1 
ATOM   7948  C  CB    . SER C 1 270 ? -2.384  -2.170  -60.444  1.00 214.90 ? 270 SER C CB    1 
ATOM   7949  O  OG    . SER C 1 270 ? -2.380  -0.765  -60.297  1.00 225.49 ? 270 SER C OG    1 
ATOM   7950  N  N     . CYS C 1 271 ? -3.722  -4.641  -62.299  1.00 200.16 ? 271 CYS C N     1 
ATOM   7951  C  CA    . CYS C 1 271 ? -3.988  -6.059  -62.543  1.00 195.80 ? 271 CYS C CA    1 
ATOM   7952  C  C     . CYS C 1 271 ? -2.971  -6.882  -61.814  1.00 190.28 ? 271 CYS C C     1 
ATOM   7953  O  O     . CYS C 1 271 ? -1.911  -6.385  -61.417  1.00 184.73 ? 271 CYS C O     1 
ATOM   7954  C  CB    . CYS C 1 271 ? -3.987  -6.422  -64.052  1.00 203.11 ? 271 CYS C CB    1 
ATOM   7955  S  SG    . CYS C 1 271 ? -5.360  -5.708  -64.962  1.00 237.69 ? 271 CYS C SG    1 
ATOM   7956  N  N     . GLY C 1 272 ? -3.317  -8.144  -61.625  1.00 194.97 ? 272 GLY C N     1 
ATOM   7957  C  CA    . GLY C 1 272 ? -2.409  -9.104  -61.059  1.00 197.72 ? 272 GLY C CA    1 
ATOM   7958  C  C     . GLY C 1 272 ? -1.194  -9.318  -61.902  1.00 198.51 ? 272 GLY C C     1 
ATOM   7959  O  O     . GLY C 1 272 ? -1.213  -9.036  -63.107  1.00 207.94 ? 272 GLY C O     1 
ATOM   7960  N  N     . ILE C 1 273 ? -0.166  -9.945  -61.325  1.00 188.04 ? 273 ILE C N     1 
ATOM   7961  C  CA    . ILE C 1 273 ? 1.108   -10.103 -61.980  1.00 188.06 ? 273 ILE C CA    1 
ATOM   7962  C  C     . ILE C 1 273 ? 1.039   -10.861 -63.302  1.00 197.30 ? 273 ILE C C     1 
ATOM   7963  O  O     . ILE C 1 273 ? 1.692   -10.489 -64.296  1.00 207.46 ? 273 ILE C O     1 
ATOM   7964  C  CB    . ILE C 1 273 ? 2.148   -10.721 -61.060  1.00 172.01 ? 273 ILE C CB    1 
ATOM   7965  C  CG1   . ILE C 1 273 ? 1.738   -12.143 -60.631  1.00 169.49 ? 273 ILE C CG1   1 
ATOM   7966  C  CG2   . ILE C 1 273 ? 2.380   -9.767  -59.893  1.00 166.15 ? 273 ILE C CG2   1 
ATOM   7967  C  CD1   . ILE C 1 273 ? 2.837   -12.899 -59.904  1.00 173.56 ? 273 ILE C CD1   1 
ATOM   7968  N  N     . HIS C 1 274 ? 0.253   -11.913 -63.355  1.00 186.26 ? 274 HIS C N     1 
ATOM   7969  C  CA    . HIS C 1 274 ? 0.119   -12.684 -64.571  1.00 179.72 ? 274 HIS C CA    1 
ATOM   7970  C  C     . HIS C 1 274 ? -0.496  -11.836 -65.679  1.00 188.12 ? 274 HIS C C     1 
ATOM   7971  O  O     . HIS C 1 274 ? 0.000   -11.876 -66.828  1.00 199.95 ? 274 HIS C O     1 
ATOM   7972  C  CB    . HIS C 1 274 ? -0.639  -13.984 -64.380  1.00 166.26 ? 274 HIS C CB    1 
ATOM   7973  C  CG    . HIS C 1 274 ? -1.995  -13.804 -63.772  1.00 167.74 ? 274 HIS C CG    1 
ATOM   7974  N  ND1   . HIS C 1 274 ? -2.196  -13.342 -62.489  1.00 168.93 ? 274 HIS C ND1   1 
ATOM   7975  C  CD2   . HIS C 1 274 ? -3.225  -14.084 -64.265  1.00 179.17 ? 274 HIS C CD2   1 
ATOM   7976  C  CE1   . HIS C 1 274 ? -3.493  -13.374 -62.206  1.00 180.75 ? 274 HIS C CE1   1 
ATOM   7977  N  NE2   . HIS C 1 274 ? -4.140  -13.803 -63.275  1.00 186.57 ? 274 HIS C NE2   1 
ATOM   7978  N  N     . GLU C 1 275 ? -1.506  -11.054 -65.330  1.00 201.87 ? 275 GLU C N     1 
ATOM   7979  C  CA    . GLU C 1 275 ? -2.134  -10.176 -66.309  1.00 222.63 ? 275 GLU C CA    1 
ATOM   7980  C  C     . GLU C 1 275 ? -1.180  -9.119  -66.758  1.00 216.30 ? 275 GLU C C     1 
ATOM   7981  O  O     . GLU C 1 275 ? -1.328  -8.662  -67.857  1.00 225.64 ? 275 GLU C O     1 
ATOM   7982  C  CB    . GLU C 1 275 ? -3.442  -9.520  -65.871  1.00 240.17 ? 275 GLU C CB    1 
ATOM   7983  C  CG    . GLU C 1 275 ? -4.585  -10.489 -65.646  1.00 257.27 ? 275 GLU C CG    1 
ATOM   7984  C  CD    . GLU C 1 275 ? -4.571  -11.040 -64.260  1.00 282.77 ? 275 GLU C CD    1 
ATOM   7985  O  OE1   . GLU C 1 275 ? -3.538  -10.936 -63.564  1.00 303.31 ? 275 GLU C OE1   1 
ATOM   7986  O  OE2   . GLU C 1 275 ? -5.613  -11.589 -63.844  1.00 295.75 ? 275 GLU C OE2   1 
ATOM   7987  N  N     . THR C 1 276 ? -0.296  -8.615  -65.905  1.00 204.95 ? 276 THR C N     1 
ATOM   7988  C  CA    . THR C 1 276 ? 0.706   -7.652  -66.275  1.00 211.53 ? 276 THR C CA    1 
ATOM   7989  C  C     . THR C 1 276 ? 1.698   -8.253  -67.235  1.00 204.47 ? 276 THR C C     1 
ATOM   7990  O  O     . THR C 1 276 ? 2.235   -7.584  -68.078  1.00 220.87 ? 276 THR C O     1 
ATOM   7991  C  CB    . THR C 1 276 ? 1.481   -7.127  -65.065  1.00 223.08 ? 276 THR C CB    1 
ATOM   7992  O  OG1   . THR C 1 276 ? 2.168   -8.212  -64.417  1.00 216.68 ? 276 THR C OG1   1 
ATOM   7993  C  CG2   . THR C 1 276 ? 0.529   -6.450  -64.109  1.00 234.76 ? 276 THR C CG2   1 
ATOM   7994  N  N     . THR C 1 277 ? 2.018   -9.527  -67.025  1.00 196.57 ? 277 THR C N     1 
ATOM   7995  C  CA    . THR C 1 277 ? 2.880   -10.224 -67.960  1.00 202.85 ? 277 THR C CA    1 
ATOM   7996  C  C     . THR C 1 277 ? 2.253   -10.273 -69.331  1.00 198.73 ? 277 THR C C     1 
ATOM   7997  O  O     . THR C 1 277 ? 2.898   -9.948  -70.292  1.00 199.20 ? 277 THR C O     1 
ATOM   7998  C  CB    . THR C 1 277 ? 3.205   -11.628 -67.527  1.00 204.03 ? 277 THR C CB    1 
ATOM   7999  O  OG1   . THR C 1 277 ? 3.842   -11.583 -66.248  1.00 200.07 ? 277 THR C OG1   1 
ATOM   8000  C  CG2   . THR C 1 277 ? 4.129   -12.261 -68.538  1.00 210.49 ? 277 THR C CG2   1 
ATOM   8001  N  N     . PHE C 1 278 ? 0.986   -10.592 -69.384  1.00 194.09 ? 278 PHE C N     1 
ATOM   8002  C  CA    . PHE C 1 278 ? 0.198   -10.481 -70.654  1.00 184.56 ? 278 PHE C CA    1 
ATOM   8003  C  C     . PHE C 1 278 ? 0.226   -9.101  -71.203  1.00 178.95 ? 278 PHE C C     1 
ATOM   8004  O  O     . PHE C 1 278 ? 0.374   -8.907  -72.349  1.00 182.23 ? 278 PHE C O     1 
ATOM   8005  C  CB    . PHE C 1 278 ? -1.274  -10.865 -70.458  1.00 187.69 ? 278 PHE C CB    1 
ATOM   8006  C  CG    . PHE C 1 278 ? -1.665  -12.122 -71.144  1.00 191.09 ? 278 PHE C CG    1 
ATOM   8007  C  CD1   . PHE C 1 278 ? -2.295  -12.100 -72.378  1.00 191.78 ? 278 PHE C CD1   1 
ATOM   8008  C  CD2   . PHE C 1 278 ? -1.417  -13.333 -70.549  1.00 194.22 ? 278 PHE C CD2   1 
ATOM   8009  C  CE1   . PHE C 1 278 ? -2.667  -13.273 -72.993  1.00 196.15 ? 278 PHE C CE1   1 
ATOM   8010  C  CE2   . PHE C 1 278 ? -1.777  -14.510 -71.163  1.00 204.19 ? 278 PHE C CE2   1 
ATOM   8011  C  CZ    . PHE C 1 278 ? -2.405  -14.475 -72.385  1.00 207.37 ? 278 PHE C CZ    1 
ATOM   8012  N  N     . ASN C 1 279 ? 0.068   -8.115  -70.344  1.00 184.10 ? 279 ASN C N     1 
ATOM   8013  C  CA    . ASN C 1 279 ? 0.099   -6.728  -70.770  1.00 211.39 ? 279 ASN C CA    1 
ATOM   8014  C  C     . ASN C 1 279 ? 1.433   -6.431  -71.450  1.00 205.40 ? 279 ASN C C     1 
ATOM   8015  O  O     . ASN C 1 279 ? 1.487   -5.735  -72.467  1.00 224.07 ? 279 ASN C O     1 
ATOM   8016  C  CB    . ASN C 1 279 ? -0.198  -5.767  -69.541  1.00 241.70 ? 279 ASN C CB    1 
ATOM   8017  C  CG    . ASN C 1 279 ? -0.565  -4.368  -69.947  1.00 268.29 ? 279 ASN C CG    1 
ATOM   8018  O  OD1   . ASN C 1 279 ? -0.835  -4.096  -71.115  1.00 289.02 ? 279 ASN C OD1   1 
ATOM   8019  N  ND2   . ASN C 1 279 ? -0.645  -3.467  -68.970  1.00 278.64 ? 279 ASN C ND2   1 
ATOM   8020  N  N     . SER C 1 280 ? 2.531   -6.977  -70.909  1.00 180.02 ? 280 SER C N     1 
ATOM   8021  C  CA    . SER C 1 280 ? 3.833   -6.742  -71.510  1.00 169.88 ? 280 SER C CA    1 
ATOM   8022  C  C     . SER C 1 280 ? 3.939   -7.455  -72.854  1.00 172.00 ? 280 SER C C     1 
ATOM   8023  O  O     . SER C 1 280 ? 4.313   -6.866  -73.846  1.00 183.36 ? 280 SER C O     1 
ATOM   8024  C  CB    . SER C 1 280 ? 4.989   -7.180  -70.607  1.00 175.39 ? 280 SER C CB    1 
ATOM   8025  O  OG    . SER C 1 280 ? 5.011   -6.438  -69.403  1.00 189.05 ? 280 SER C OG    1 
ATOM   8026  N  N     . ILE C 1 281 ? 3.671   -8.771  -72.866  1.00 176.64 ? 281 ILE C N     1 
ATOM   8027  C  CA    . ILE C 1 281 ? 3.807   -9.563  -74.046  1.00 181.97 ? 281 ILE C CA    1 
ATOM   8028  C  C     . ILE C 1 281 ? 2.932   -9.043  -75.154  1.00 188.89 ? 281 ILE C C     1 
ATOM   8029  O  O     . ILE C 1 281 ? 3.351   -9.021  -76.316  1.00 191.72 ? 281 ILE C O     1 
ATOM   8030  C  CB    . ILE C 1 281 ? 3.530   -11.053 -73.710  1.00 178.45 ? 281 ILE C CB    1 
ATOM   8031  C  CG1   . ILE C 1 281 ? 4.733   -11.554 -72.919  1.00 168.83 ? 281 ILE C CG1   1 
ATOM   8032  C  CG2   . ILE C 1 281 ? 3.227   -11.874 -74.968  1.00 181.19 ? 281 ILE C CG2   1 
ATOM   8033  C  CD1   . ILE C 1 281 ? 4.543   -12.895 -72.240  1.00 169.96 ? 281 ILE C CD1   1 
ATOM   8034  N  N     . MET C 1 282 ? 1.718   -8.590  -74.801  1.00 196.29 ? 282 MET C N     1 
ATOM   8035  C  CA    . MET C 1 282 ? 0.770   -8.157  -75.823  1.00 202.79 ? 282 MET C CA    1 
ATOM   8036  C  C     . MET C 1 282 ? 1.224   -6.885  -76.467  1.00 195.96 ? 282 MET C C     1 
ATOM   8037  O  O     . MET C 1 282 ? 0.880   -6.656  -77.623  1.00 204.39 ? 282 MET C O     1 
ATOM   8038  C  CB    . MET C 1 282 ? -0.629  -7.909  -75.272  1.00 222.16 ? 282 MET C CB    1 
ATOM   8039  C  CG    . MET C 1 282 ? -1.456  -9.175  -75.103  1.00 236.64 ? 282 MET C CG    1 
ATOM   8040  S  SD    . MET C 1 282 ? -1.836  -10.023 -76.638  1.00 241.64 ? 282 MET C SD    1 
ATOM   8041  C  CE    . MET C 1 282 ? -0.622  -11.315 -76.511  1.00 232.95 ? 282 MET C CE    1 
ATOM   8042  N  N     . LYS C 1 283 ? 2.006   -6.080  -75.749  1.00 199.27 ? 283 LYS C N     1 
ATOM   8043  C  CA    . LYS C 1 283 ? 2.579   -4.847  -76.274  1.00 205.96 ? 283 LYS C CA    1 
ATOM   8044  C  C     . LYS C 1 283 ? 3.678   -5.133  -77.260  1.00 212.70 ? 283 LYS C C     1 
ATOM   8045  O  O     . LYS C 1 283 ? 4.090   -4.266  -78.004  1.00 204.67 ? 283 LYS C O     1 
ATOM   8046  C  CB    . LYS C 1 283 ? 3.152   -3.964  -75.132  1.00 212.38 ? 283 LYS C CB    1 
ATOM   8047  C  CG    . LYS C 1 283 ? 2.043   -3.157  -74.442  1.00 222.70 ? 283 LYS C CG    1 
ATOM   8048  C  CD    . LYS C 1 283 ? 2.545   -2.275  -73.306  1.00 245.15 ? 283 LYS C CD    1 
ATOM   8049  C  CE    . LYS C 1 283 ? 1.406   -1.718  -72.428  1.00 265.12 ? 283 LYS C CE    1 
ATOM   8050  N  NZ    . LYS C 1 283 ? 0.540   -0.785  -73.210  1.00 273.89 ? 283 LYS C NZ    1 
ATOM   8051  N  N     . CYS C 1 284 ? 4.236   -6.345  -77.257  1.00 218.85 ? 284 CYS C N     1 
ATOM   8052  C  CA    . CYS C 1 284 ? 5.363   -6.704  -78.096  1.00 219.12 ? 284 CYS C CA    1 
ATOM   8053  C  C     . CYS C 1 284 ? 4.913   -7.161  -79.472  1.00 222.37 ? 284 CYS C C     1 
ATOM   8054  O  O     . CYS C 1 284 ? 3.736   -7.475  -79.681  1.00 224.21 ? 284 CYS C O     1 
ATOM   8055  C  CB    . CYS C 1 284 ? 6.124   -7.883  -77.520  1.00 217.14 ? 284 CYS C CB    1 
ATOM   8056  S  SG    . CYS C 1 284 ? 6.575   -7.814  -75.776  1.00 210.58 ? 284 CYS C SG    1 
ATOM   8057  N  N     . ASP C 1 285 ? 5.879   -7.212  -80.391  1.00 226.55 ? 285 ASP C N     1 
ATOM   8058  C  CA    . ASP C 1 285 ? 5.608   -7.539  -81.775  1.00 232.39 ? 285 ASP C CA    1 
ATOM   8059  C  C     . ASP C 1 285 ? 5.097   -8.976  -81.823  1.00 229.56 ? 285 ASP C C     1 
ATOM   8060  O  O     . ASP C 1 285 ? 5.472   -9.813  -80.976  1.00 218.51 ? 285 ASP C O     1 
ATOM   8061  C  CB    . ASP C 1 285 ? 6.867   -7.297  -82.677  1.00 236.07 ? 285 ASP C CB    1 
ATOM   8062  C  CG    . ASP C 1 285 ? 7.107   -5.822  -82.962  1.00 236.46 ? 285 ASP C CG    1 
ATOM   8063  O  OD1   . ASP C 1 285 ? 6.617   -4.978  -82.179  1.00 241.33 ? 285 ASP C OD1   1 
ATOM   8064  O  OD2   . ASP C 1 285 ? 7.790   -5.490  -83.968  1.00 225.13 ? 285 ASP C OD2   1 
ATOM   8065  N  N     . VAL C 1 286 ? 4.240   -9.244  -82.796  1.00 231.58 ? 286 VAL C N     1 
ATOM   8066  C  CA    . VAL C 1 286 ? 3.553   -10.498 -82.880  1.00 229.09 ? 286 VAL C CA    1 
ATOM   8067  C  C     . VAL C 1 286 ? 4.543   -11.621 -83.050  1.00 231.47 ? 286 VAL C C     1 
ATOM   8068  O  O     . VAL C 1 286 ? 4.346   -12.694 -82.543  1.00 226.48 ? 286 VAL C O     1 
ATOM   8069  C  CB    . VAL C 1 286 ? 2.514   -10.522 -84.002  1.00 233.94 ? 286 VAL C CB    1 
ATOM   8070  C  CG1   . VAL C 1 286 ? 1.448   -9.427  -83.788  1.00 238.85 ? 286 VAL C CG1   1 
ATOM   8071  C  CG2   . VAL C 1 286 ? 3.163   -10.485 -85.403  1.00 236.48 ? 286 VAL C CG2   1 
ATOM   8072  N  N     . ASP C 1 287 ? 5.618   -11.367 -83.789  1.00 247.67 ? 287 ASP C N     1 
ATOM   8073  C  CA    . ASP C 1 287 ? 6.572   -12.371 -84.155  1.00 256.45 ? 287 ASP C CA    1 
ATOM   8074  C  C     . ASP C 1 287 ? 7.255   -13.059 -82.980  1.00 252.14 ? 287 ASP C C     1 
ATOM   8075  O  O     . ASP C 1 287 ? 7.335   -14.292 -82.988  1.00 240.36 ? 287 ASP C O     1 
ATOM   8076  C  CB    . ASP C 1 287 ? 7.647   -11.745 -85.126  1.00 261.79 ? 287 ASP C CB    1 
ATOM   8077  C  CG    . ASP C 1 287 ? 8.697   -12.748 -85.610  1.00 254.17 ? 287 ASP C CG    1 
ATOM   8078  O  OD1   . ASP C 1 287 ? 8.317   -13.710 -86.306  1.00 250.51 ? 287 ASP C OD1   1 
ATOM   8079  O  OD2   . ASP C 1 287 ? 9.903   -12.551 -85.322  1.00 241.13 ? 287 ASP C OD2   1 
ATOM   8080  N  N     . ILE C 1 288 ? 7.799   -12.260 -82.044  1.00 251.99 ? 288 ILE C N     1 
ATOM   8081  C  CA    . ILE C 1 288 ? 8.617   -12.757 -80.944  1.00 248.88 ? 288 ILE C CA    1 
ATOM   8082  C  C     . ILE C 1 288 ? 7.860   -13.428 -79.838  1.00 224.52 ? 288 ILE C C     1 
ATOM   8083  O  O     . ILE C 1 288 ? 8.434   -14.249 -79.127  1.00 199.99 ? 288 ILE C O     1 
ATOM   8084  C  CB    . ILE C 1 288 ? 9.521   -11.699 -80.329  1.00 263.21 ? 288 ILE C CB    1 
ATOM   8085  C  CG1   . ILE C 1 288 ? 8.715   -10.574 -79.657  1.00 269.50 ? 288 ILE C CG1   1 
ATOM   8086  C  CG2   . ILE C 1 288 ? 10.481  -11.230 -81.403  1.00 264.69 ? 288 ILE C CG2   1 
ATOM   8087  C  CD1   . ILE C 1 288 ? 9.568   -9.672  -78.790  1.00 276.66 ? 288 ILE C CD1   1 
ATOM   8088  N  N     . ARG C 1 289 ? 6.559   -13.114 -79.683  1.00 223.71 ? 289 ARG C N     1 
ATOM   8089  C  CA    . ARG C 1 289 ? 5.802   -13.624 -78.541  1.00 236.61 ? 289 ARG C CA    1 
ATOM   8090  C  C     . ARG C 1 289 ? 6.002   -15.085 -78.227  1.00 248.76 ? 289 ARG C C     1 
ATOM   8091  O  O     . ARG C 1 289 ? 6.040   -15.435 -77.078  1.00 268.13 ? 289 ARG C O     1 
ATOM   8092  C  CB    . ARG C 1 289 ? 4.286   -13.387 -78.707  1.00 235.59 ? 289 ARG C CB    1 
ATOM   8093  C  CG    . ARG C 1 289 ? 3.914   -11.895 -78.630  1.00 243.73 ? 289 ARG C CG    1 
ATOM   8094  C  CD    . ARG C 1 289 ? 2.394   -11.649 -78.486  1.00 253.16 ? 289 ARG C CD    1 
ATOM   8095  N  NE    . ARG C 1 289 ? 2.106   -10.223 -78.652  1.00 263.83 ? 289 ARG C NE    1 
ATOM   8096  C  CZ    . ARG C 1 289 ? 1.273   -9.697  -79.552  1.00 270.82 ? 289 ARG C CZ    1 
ATOM   8097  N  NH1   . ARG C 1 289 ? 0.692   -10.515 -80.417  1.00 265.38 ? 289 ARG C NH1   1 
ATOM   8098  N  NH2   . ARG C 1 289 ? 1.079   -8.374  -79.679  1.00 281.49 ? 289 ARG C NH2   1 
ATOM   8099  N  N     . LYS C 1 290 ? 6.197   -15.914 -79.250  1.00 248.63 ? 290 LYS C N     1 
ATOM   8100  C  CA    . LYS C 1 290 ? 6.239   -17.351 -79.078  1.00 252.10 ? 290 LYS C CA    1 
ATOM   8101  C  C     . LYS C 1 290 ? 7.269   -17.688 -78.030  1.00 234.53 ? 290 LYS C C     1 
ATOM   8102  O  O     . LYS C 1 290 ? 6.995   -18.494 -77.131  1.00 233.63 ? 290 LYS C O     1 
ATOM   8103  C  CB    . LYS C 1 290 ? 6.544   -18.102 -80.375  1.00 267.76 ? 290 LYS C CB    1 
ATOM   8104  C  CG    . LYS C 1 290 ? 7.924   -17.863 -81.017  1.00 294.30 ? 290 LYS C CG    1 
ATOM   8105  C  CD    . LYS C 1 290 ? 8.111   -18.499 -82.411  1.00 316.62 ? 290 LYS C CD    1 
ATOM   8106  C  CE    . LYS C 1 290 ? 9.514   -18.284 -82.990  1.00 337.65 ? 290 LYS C CE    1 
ATOM   8107  N  NZ    . LYS C 1 290 ? 9.812   -16.858 -83.309  1.00 349.44 ? 290 LYS C NZ    1 
ATOM   8108  N  N     . ASP C 1 291 ? 8.437   -17.087 -78.122  1.00 222.40 ? 291 ASP C N     1 
ATOM   8109  C  CA    . ASP C 1 291 ? 9.517   -17.425 -77.219  1.00 220.33 ? 291 ASP C CA    1 
ATOM   8110  C  C     . ASP C 1 291 ? 9.374   -16.737 -75.887  1.00 206.45 ? 291 ASP C C     1 
ATOM   8111  O  O     . ASP C 1 291 ? 9.771   -17.298 -74.900  1.00 186.66 ? 291 ASP C O     1 
ATOM   8112  C  CB    . ASP C 1 291 ? 10.892  -17.290 -77.856  1.00 227.34 ? 291 ASP C CB    1 
ATOM   8113  C  CG    . ASP C 1 291 ? 11.279  -15.889 -78.086  1.00 228.66 ? 291 ASP C CG    1 
ATOM   8114  O  OD1   . ASP C 1 291 ? 10.419  -15.006 -77.894  1.00 230.74 ? 291 ASP C OD1   1 
ATOM   8115  O  OD2   . ASP C 1 291 ? 12.410  -15.718 -78.491  1.00 220.08 ? 291 ASP C OD2   1 
ATOM   8116  N  N     . LEU C 1 292 ? 8.760   -15.547 -75.848  1.00 196.68 ? 292 LEU C N     1 
ATOM   8117  C  CA    . LEU C 1 292 ? 8.517   -14.911 -74.573  1.00 184.05 ? 292 LEU C CA    1 
ATOM   8118  C  C     . LEU C 1 292 ? 7.578   -15.681 -73.701  1.00 178.69 ? 292 LEU C C     1 
ATOM   8119  O  O     . LEU C 1 292 ? 7.813   -15.853 -72.530  1.00 186.76 ? 292 LEU C O     1 
ATOM   8120  C  CB    . LEU C 1 292 ? 7.930   -13.485 -74.760  1.00 177.22 ? 292 LEU C CB    1 
ATOM   8121  C  CG    . LEU C 1 292 ? 8.987   -12.513 -75.341  1.00 178.61 ? 292 LEU C CG    1 
ATOM   8122  C  CD1   . LEU C 1 292 ? 8.399   -11.108 -75.549  1.00 179.08 ? 292 LEU C CD1   1 
ATOM   8123  C  CD2   . LEU C 1 292 ? 10.250  -12.496 -74.455  1.00 184.17 ? 292 LEU C CD2   1 
ATOM   8124  N  N     . TYR C 1 293 ? 6.551   -16.287 -74.298  1.00 178.08 ? 293 TYR C N     1 
ATOM   8125  C  CA    . TYR C 1 293 ? 5.628   -17.159 -73.585  1.00 179.94 ? 293 TYR C CA    1 
ATOM   8126  C  C     . TYR C 1 293 ? 6.413   -18.309 -72.991  1.00 168.26 ? 293 TYR C C     1 
ATOM   8127  O  O     . TYR C 1 293 ? 6.110   -18.750 -71.884  1.00 161.40 ? 293 TYR C O     1 
ATOM   8128  C  CB    . TYR C 1 293 ? 4.530   -17.751 -74.448  1.00 195.39 ? 293 TYR C CB    1 
ATOM   8129  C  CG    . TYR C 1 293 ? 3.401   -16.808 -74.710  1.00 218.52 ? 293 TYR C CG    1 
ATOM   8130  C  CD1   . TYR C 1 293 ? 2.525   -16.463 -73.697  1.00 225.64 ? 293 TYR C CD1   1 
ATOM   8131  C  CD2   . TYR C 1 293 ? 3.245   -16.213 -75.940  1.00 239.08 ? 293 TYR C CD2   1 
ATOM   8132  C  CE1   . TYR C 1 293 ? 1.491   -15.595 -73.921  1.00 236.98 ? 293 TYR C CE1   1 
ATOM   8133  C  CE2   . TYR C 1 293 ? 2.180   -15.370 -76.187  1.00 243.58 ? 293 TYR C CE2   1 
ATOM   8134  C  CZ    . TYR C 1 293 ? 1.285   -15.073 -75.174  1.00 243.88 ? 293 TYR C CZ    1 
ATOM   8135  O  OH    . TYR C 1 293 ? 0.246   -14.157 -75.419  1.00 241.55 ? 293 TYR C OH    1 
ATOM   8136  N  N     . ALA C 1 294 ? 7.367   -18.830 -73.767  1.00 168.62 ? 294 ALA C N     1 
ATOM   8137  C  CA    . ALA C 1 294 ? 8.176   -19.936 -73.365  1.00 178.29 ? 294 ALA C CA    1 
ATOM   8138  C  C     . ALA C 1 294 ? 9.353   -19.553 -72.543  1.00 167.89 ? 294 ALA C C     1 
ATOM   8139  O  O     . ALA C 1 294 ? 9.935   -20.443 -71.964  1.00 163.44 ? 294 ALA C O     1 
ATOM   8140  C  CB    . ALA C 1 294 ? 8.609   -20.769 -74.565  1.00 195.15 ? 294 ALA C CB    1 
ATOM   8141  N  N     . ASN C 1 295 ? 9.755   -18.287 -72.492  1.00 165.37 ? 295 ASN C N     1 
ATOM   8142  C  CA    . ASN C 1 295 ? 10.968  -17.994 -71.734  1.00 172.46 ? 295 ASN C CA    1 
ATOM   8143  C  C     . ASN C 1 295 ? 10.857  -17.062 -70.544  1.00 188.29 ? 295 ASN C C     1 
ATOM   8144  O  O     . ASN C 1 295 ? 11.792  -16.338 -70.245  1.00 179.48 ? 295 ASN C O     1 
ATOM   8145  C  CB    . ASN C 1 295 ? 12.108  -17.476 -72.632  1.00 167.16 ? 295 ASN C CB    1 
ATOM   8146  C  CG    . ASN C 1 295 ? 12.338  -18.314 -73.882  1.00 166.13 ? 295 ASN C CG    1 
ATOM   8147  O  OD1   . ASN C 1 295 ? 12.577  -17.750 -74.935  1.00 167.45 ? 295 ASN C OD1   1 
ATOM   8148  N  ND2   . ASN C 1 295 ? 12.272  -19.652 -73.787  1.00 161.22 ? 295 ASN C ND2   1 
ATOM   8149  N  N     . THR C 1 296 ? 9.814   -17.176 -69.762  1.00 199.82 ? 296 THR C N     1 
ATOM   8150  C  CA    . THR C 1 296 ? 9.562   -16.207 -68.710  1.00 187.27 ? 296 THR C CA    1 
ATOM   8151  C  C     . THR C 1 296 ? 10.506  -16.489 -67.573  1.00 176.96 ? 296 THR C C     1 
ATOM   8152  O  O     . THR C 1 296 ? 10.532  -17.596 -67.039  1.00 169.63 ? 296 THR C O     1 
ATOM   8153  C  CB    . THR C 1 296 ? 8.115   -16.372 -68.238  1.00 183.48 ? 296 THR C CB    1 
ATOM   8154  O  OG1   . THR C 1 296 ? 7.216   -15.985 -69.283  1.00 188.97 ? 296 THR C OG1   1 
ATOM   8155  C  CG2   . THR C 1 296 ? 7.793   -15.545 -66.996  1.00 176.40 ? 296 THR C CG2   1 
ATOM   8156  N  N     . VAL C 1 297 ? 11.289  -15.499 -67.162  1.00 171.09 ? 297 VAL C N     1 
ATOM   8157  C  CA    . VAL C 1 297 ? 12.210  -15.681 -66.074  1.00 179.65 ? 297 VAL C CA    1 
ATOM   8158  C  C     . VAL C 1 297 ? 11.772  -14.954 -64.873  1.00 194.23 ? 297 VAL C C     1 
ATOM   8159  O  O     . VAL C 1 297 ? 11.514  -13.768 -64.965  1.00 213.47 ? 297 VAL C O     1 
ATOM   8160  C  CB    . VAL C 1 297 ? 13.581  -15.153 -66.435  1.00 180.27 ? 297 VAL C CB    1 
ATOM   8161  C  CG1   . VAL C 1 297 ? 14.494  -15.095 -65.209  1.00 176.03 ? 297 VAL C CG1   1 
ATOM   8162  C  CG2   . VAL C 1 297 ? 14.094  -15.996 -67.585  1.00 191.40 ? 297 VAL C CG2   1 
ATOM   8163  N  N     . LEU C 1 298 ? 11.753  -15.611 -63.718  1.00 186.04 ? 298 LEU C N     1 
ATOM   8164  C  CA    . LEU C 1 298 ? 11.339  -14.935 -62.471  1.00 178.92 ? 298 LEU C CA    1 
ATOM   8165  C  C     . LEU C 1 298 ? 12.606  -14.572 -61.737  1.00 181.92 ? 298 LEU C C     1 
ATOM   8166  O  O     . LEU C 1 298 ? 13.550  -15.358 -61.665  1.00 178.61 ? 298 LEU C O     1 
ATOM   8167  C  CB    . LEU C 1 298 ? 10.555  -15.842 -61.528  1.00 166.51 ? 298 LEU C CB    1 
ATOM   8168  C  CG    . LEU C 1 298 ? 9.185   -16.313 -62.005  1.00 167.65 ? 298 LEU C CG    1 
ATOM   8169  C  CD1   . LEU C 1 298 ? 8.483   -17.201 -60.955  1.00 172.29 ? 298 LEU C CD1   1 
ATOM   8170  C  CD2   . LEU C 1 298 ? 8.301   -15.149 -62.452  1.00 162.88 ? 298 LEU C CD2   1 
ATOM   8171  N  N     . SER C 1 299 ? 12.611  -13.376 -61.150  1.00 185.61 ? 299 SER C N     1 
ATOM   8172  C  CA    . SER C 1 299 ? 13.709  -12.958 -60.323  1.00 187.85 ? 299 SER C CA    1 
ATOM   8173  C  C     . SER C 1 299 ? 13.216  -12.203 -59.104  1.00 191.07 ? 299 SER C C     1 
ATOM   8174  O  O     . SER C 1 299 ? 12.056  -11.879 -58.998  1.00 192.49 ? 299 SER C O     1 
ATOM   8175  C  CB    . SER C 1 299 ? 14.654  -12.056 -61.083  1.00 185.23 ? 299 SER C CB    1 
ATOM   8176  O  OG    . SER C 1 299 ? 14.204  -10.706 -61.086  1.00 177.43 ? 299 SER C OG    1 
ATOM   8177  N  N     . GLY C 1 300 ? 14.125  -11.949 -58.177  1.00 195.96 ? 300 GLY C N     1 
ATOM   8178  C  CA    . GLY C 1 300 ? 13.847  -11.094 -57.042  1.00 202.24 ? 300 GLY C CA    1 
ATOM   8179  C  C     . GLY C 1 300 ? 13.318  -11.887 -55.865  1.00 212.10 ? 300 GLY C C     1 
ATOM   8180  O  O     . GLY C 1 300 ? 12.916  -13.040 -55.999  1.00 209.45 ? 300 GLY C O     1 
ATOM   8181  N  N     . GLY C 1 301 ? 13.363  -11.279 -54.695  1.00 219.08 ? 301 GLY C N     1 
ATOM   8182  C  CA    . GLY C 1 301 ? 13.138  -11.998 -53.444  1.00 220.33 ? 301 GLY C CA    1 
ATOM   8183  C  C     . GLY C 1 301 ? 11.706  -12.503 -53.367  1.00 205.16 ? 301 GLY C C     1 
ATOM   8184  O  O     . GLY C 1 301 ? 11.467  -13.565 -52.822  1.00 214.10 ? 301 GLY C O     1 
ATOM   8185  N  N     . THR C 1 302 ? 10.767  -11.680 -53.863  1.00 173.65 ? 302 THR C N     1 
ATOM   8186  C  CA    . THR C 1 302 ? 9.358   -11.936 -53.638  1.00 153.10 ? 302 THR C CA    1 
ATOM   8187  C  C     . THR C 1 302 ? 8.802   -12.850 -54.713  1.00 139.98 ? 302 THR C C     1 
ATOM   8188  O  O     . THR C 1 302 ? 7.601   -12.949 -54.837  1.00 139.85 ? 302 THR C O     1 
ATOM   8189  C  CB    . THR C 1 302 ? 8.455   -10.697 -53.443  1.00 158.45 ? 302 THR C CB    1 
ATOM   8190  O  OG1   . THR C 1 302 ? 7.193   -11.140 -52.916  1.00 150.03 ? 302 THR C OG1   1 
ATOM   8191  C  CG2   . THR C 1 302 ? 8.201   -9.946  -54.720  1.00 152.15 ? 302 THR C CG2   1 
ATOM   8192  N  N     . THR C 1 303 ? 9.655   -13.509 -55.496  1.00 143.14 ? 303 THR C N     1 
ATOM   8193  C  CA    . THR C 1 303 ? 9.238   -14.685 -56.240  1.00 157.69 ? 303 THR C CA    1 
ATOM   8194  C  C     . THR C 1 303 ? 9.596   -15.982 -55.556  1.00 138.51 ? 303 THR C C     1 
ATOM   8195  O  O     . THR C 1 303 ? 9.285   -17.036 -56.089  1.00 126.89 ? 303 THR C O     1 
ATOM   8196  C  CB    . THR C 1 303 ? 9.833   -14.699 -57.637  1.00 190.56 ? 303 THR C CB    1 
ATOM   8197  O  OG1   . THR C 1 303 ? 11.200  -14.281 -57.572  1.00 206.93 ? 303 THR C OG1   1 
ATOM   8198  C  CG2   . THR C 1 303 ? 9.052   -13.723 -58.521  1.00 210.98 ? 303 THR C CG2   1 
ATOM   8199  N  N     . MET C 1 304 ? 10.238  -15.922 -54.379  1.00 141.85 ? 304 MET C N     1 
ATOM   8200  C  CA    . MET C 1 304 ? 10.712  -17.105 -53.679  1.00 156.20 ? 304 MET C CA    1 
ATOM   8201  C  C     . MET C 1 304 ? 9.602   -18.042 -53.208  1.00 149.25 ? 304 MET C C     1 
ATOM   8202  O  O     . MET C 1 304 ? 9.860   -19.230 -53.031  1.00 163.27 ? 304 MET C O     1 
ATOM   8203  C  CB    . MET C 1 304 ? 11.666  -16.765 -52.512  1.00 165.94 ? 304 MET C CB    1 
ATOM   8204  C  CG    . MET C 1 304 ? 13.029  -16.283 -52.999  1.00 176.01 ? 304 MET C CG    1 
ATOM   8205  S  SD    . MET C 1 304 ? 13.946  -17.528 -53.947  1.00 186.41 ? 304 MET C SD    1 
ATOM   8206  C  CE    . MET C 1 304 ? 14.409  -18.698 -52.670  1.00 188.40 ? 304 MET C CE    1 
ATOM   8207  N  N     . TYR C 1 305 ? 8.394   -17.553 -52.968  1.00 131.01 ? 305 TYR C N     1 
ATOM   8208  C  CA    . TYR C 1 305 ? 7.346   -18.370 -52.384  1.00 128.16 ? 305 TYR C CA    1 
ATOM   8209  C  C     . TYR C 1 305 ? 7.144   -19.665 -53.111  1.00 137.83 ? 305 TYR C C     1 
ATOM   8210  O  O     . TYR C 1 305 ? 7.056   -19.703 -54.343  1.00 146.34 ? 305 TYR C O     1 
ATOM   8211  C  CB    . TYR C 1 305 ? 5.958   -17.687 -52.358  1.00 128.94 ? 305 TYR C CB    1 
ATOM   8212  C  CG    . TYR C 1 305 ? 5.881   -16.361 -51.680  1.00 139.49 ? 305 TYR C CG    1 
ATOM   8213  C  CD1   . TYR C 1 305 ? 6.461   -16.178 -50.452  1.00 150.27 ? 305 TYR C CD1   1 
ATOM   8214  C  CD2   . TYR C 1 305 ? 5.190   -15.304 -52.254  1.00 145.82 ? 305 TYR C CD2   1 
ATOM   8215  C  CE1   . TYR C 1 305 ? 6.410   -14.956 -49.819  1.00 154.61 ? 305 TYR C CE1   1 
ATOM   8216  C  CE2   . TYR C 1 305 ? 5.135   -14.087 -51.626  1.00 152.55 ? 305 TYR C CE2   1 
ATOM   8217  C  CZ    . TYR C 1 305 ? 5.754   -13.910 -50.404  1.00 152.09 ? 305 TYR C CZ    1 
ATOM   8218  O  OH    . TYR C 1 305 ? 5.687   -12.661 -49.764  1.00 166.65 ? 305 TYR C OH    1 
ATOM   8219  N  N     . PRO C 1 306 ? 7.057   -20.742 -52.340  1.00 153.67 ? 306 PRO C N     1 
ATOM   8220  C  CA    . PRO C 1 306 ? 6.769   -22.012 -52.999  1.00 159.06 ? 306 PRO C CA    1 
ATOM   8221  C  C     . PRO C 1 306 ? 5.457   -21.988 -53.769  1.00 159.88 ? 306 PRO C C     1 
ATOM   8222  O  O     . PRO C 1 306 ? 4.431   -21.499 -53.282  1.00 156.80 ? 306 PRO C O     1 
ATOM   8223  C  CB    . PRO C 1 306 ? 6.701   -23.013 -51.850  1.00 161.14 ? 306 PRO C CB    1 
ATOM   8224  C  CG    . PRO C 1 306 ? 7.613   -22.418 -50.848  1.00 161.14 ? 306 PRO C CG    1 
ATOM   8225  C  CD    . PRO C 1 306 ? 7.425   -20.953 -50.925  1.00 158.67 ? 306 PRO C CD    1 
ATOM   8226  N  N     . GLY C 1 307 ? 5.516   -22.505 -54.984  1.00 154.08 ? 307 GLY C N     1 
ATOM   8227  C  CA    . GLY C 1 307 ? 4.331   -22.652 -55.812  1.00 155.05 ? 307 GLY C CA    1 
ATOM   8228  C  C     . GLY C 1 307 ? 3.930   -21.500 -56.712  1.00 153.74 ? 307 GLY C C     1 
ATOM   8229  O  O     . GLY C 1 307 ? 2.974   -21.600 -57.477  1.00 162.95 ? 307 GLY C O     1 
ATOM   8230  N  N     . ILE C 1 308 ? 4.679   -20.399 -56.680  1.00 153.18 ? 308 ILE C N     1 
ATOM   8231  C  CA    . ILE C 1 308 ? 4.385   -19.271 -57.523  1.00 161.01 ? 308 ILE C CA    1 
ATOM   8232  C  C     . ILE C 1 308 ? 4.497   -19.606 -58.978  1.00 181.95 ? 308 ILE C C     1 
ATOM   8233  O  O     . ILE C 1 308 ? 3.640   -19.212 -59.773  1.00 181.68 ? 308 ILE C O     1 
ATOM   8234  C  CB    . ILE C 1 308 ? 5.398   -18.131 -57.332  1.00 187.03 ? 308 ILE C CB    1 
ATOM   8235  C  CG1   . ILE C 1 308 ? 5.161   -17.410 -56.017  1.00 202.36 ? 308 ILE C CG1   1 
ATOM   8236  C  CG2   . ILE C 1 308 ? 5.242   -17.101 -58.419  1.00 190.34 ? 308 ILE C CG2   1 
ATOM   8237  C  CD1   . ILE C 1 308 ? 6.304   -16.542 -55.560  1.00 211.38 ? 308 ILE C CD1   1 
ATOM   8238  N  N     . ALA C 1 309 ? 5.586   -20.305 -59.354  1.00 198.28 ? 309 ALA C N     1 
ATOM   8239  C  CA    . ALA C 1 309 ? 5.866   -20.677 -60.731  1.00 194.68 ? 309 ALA C CA    1 
ATOM   8240  C  C     . ALA C 1 309 ? 4.676   -21.428 -61.288  1.00 187.44 ? 309 ALA C C     1 
ATOM   8241  O  O     . ALA C 1 309 ? 4.221   -21.165 -62.384  1.00 187.48 ? 309 ALA C O     1 
ATOM   8242  C  CB    . ALA C 1 309 ? 7.142   -21.507 -60.827  1.00 186.80 ? 309 ALA C CB    1 
ATOM   8243  N  N     . ASP C 1 310 ? 4.206   -22.419 -60.532  1.00 182.93 ? 310 ASP C N     1 
ATOM   8244  C  CA    . ASP C 1 310 ? 3.145   -23.284 -60.983  1.00 196.21 ? 310 ASP C CA    1 
ATOM   8245  C  C     . ASP C 1 310 ? 1.896   -22.453 -61.219  1.00 177.60 ? 310 ASP C C     1 
ATOM   8246  O  O     . ASP C 1 310 ? 1.204   -22.629 -62.228  1.00 184.64 ? 310 ASP C O     1 
ATOM   8247  C  CB    . ASP C 1 310 ? 2.804   -24.351 -59.947  1.00 218.88 ? 310 ASP C CB    1 
ATOM   8248  C  CG    . ASP C 1 310 ? 3.950   -25.305 -59.744  1.00 237.57 ? 310 ASP C CG    1 
ATOM   8249  O  OD1   . ASP C 1 310 ? 4.667   -25.563 -60.735  1.00 245.68 ? 310 ASP C OD1   1 
ATOM   8250  O  OD2   . ASP C 1 310 ? 4.146   -25.786 -58.611  1.00 252.71 ? 310 ASP C OD2   1 
ATOM   8251  N  N     . ARG C 1 311 ? 1.591   -21.552 -60.292  1.00 155.87 ? 311 ARG C N     1 
ATOM   8252  C  CA    . ARG C 1 311 ? 0.369   -20.757 -60.443  1.00 153.21 ? 311 ARG C CA    1 
ATOM   8253  C  C     . ARG C 1 311 ? 0.469   -19.867 -61.657  1.00 164.18 ? 311 ARG C C     1 
ATOM   8254  O  O     . ARG C 1 311 ? -0.502  -19.746 -62.418  1.00 181.80 ? 311 ARG C O     1 
ATOM   8255  C  CB    . ARG C 1 311 ? 0.026   -19.945 -59.196  1.00 151.31 ? 311 ARG C CB    1 
ATOM   8256  C  CG    . ARG C 1 311 ? -1.337  -19.264 -59.279  1.00 142.05 ? 311 ARG C CG    1 
ATOM   8257  C  CD    . ARG C 1 311 ? -1.773  -18.546 -58.010  1.00 139.56 ? 311 ARG C CD    1 
ATOM   8258  N  NE    . ARG C 1 311 ? -2.925  -17.678 -58.266  1.00 145.33 ? 311 ARG C NE    1 
ATOM   8259  C  CZ    . ARG C 1 311 ? -4.182  -18.108 -58.386  1.00 163.14 ? 311 ARG C CZ    1 
ATOM   8260  N  NH1   . ARG C 1 311 ? -4.442  -19.398 -58.241  1.00 172.38 ? 311 ARG C NH1   1 
ATOM   8261  N  NH2   . ARG C 1 311 ? -5.197  -17.241 -58.624  1.00 168.90 ? 311 ARG C NH2   1 
ATOM   8262  N  N     . MET C 1 312 ? 1.634   -19.254 -61.839  1.00 173.37 ? 312 MET C N     1 
ATOM   8263  C  CA    . MET C 1 312 ? 1.832   -18.400 -63.023  1.00 185.14 ? 312 MET C CA    1 
ATOM   8264  C  C     . MET C 1 312 ? 1.662   -19.207 -64.284  1.00 185.35 ? 312 MET C C     1 
ATOM   8265  O  O     . MET C 1 312 ? 1.059   -18.710 -65.239  1.00 167.23 ? 312 MET C O     1 
ATOM   8266  C  CB    . MET C 1 312 ? 3.226   -17.739 -63.042  1.00 194.86 ? 312 MET C CB    1 
ATOM   8267  C  CG    . MET C 1 312 ? 3.425   -16.660 -62.000  1.00 197.21 ? 312 MET C CG    1 
ATOM   8268  S  SD    . MET C 1 312 ? 2.537   -15.181 -62.475  1.00 209.30 ? 312 MET C SD    1 
ATOM   8269  C  CE    . MET C 1 312 ? 3.545   -14.643 -63.862  1.00 202.68 ? 312 MET C CE    1 
ATOM   8270  N  N     . GLN C 1 313 ? 2.154   -20.441 -64.287  1.00 189.71 ? 313 GLN C N     1 
ATOM   8271  C  CA    . GLN C 1 313 ? 2.045   -21.296 -65.440  1.00 185.71 ? 313 GLN C CA    1 
ATOM   8272  C  C     . GLN C 1 313 ? 0.589   -21.587 -65.744  1.00 194.47 ? 313 GLN C C     1 
ATOM   8273  O  O     . GLN C 1 313 ? 0.173   -21.513 -66.917  1.00 218.36 ? 313 GLN C O     1 
ATOM   8274  C  CB    . GLN C 1 313 ? 2.767   -22.638 -65.259  1.00 175.51 ? 313 GLN C CB    1 
ATOM   8275  C  CG    . GLN C 1 313 ? 2.891   -23.466 -66.529  1.00 179.81 ? 313 GLN C CG    1 
ATOM   8276  C  CD    . GLN C 1 313 ? 4.097   -24.365 -66.484  1.00 187.62 ? 313 GLN C CD    1 
ATOM   8277  O  OE1   . GLN C 1 313 ? 4.913   -24.231 -65.581  1.00 191.58 ? 313 GLN C OE1   1 
ATOM   8278  N  NE2   . GLN C 1 313 ? 4.233   -25.273 -67.458  1.00 189.57 ? 313 GLN C NE2   1 
ATOM   8279  N  N     . LYS C 1 314 ? -0.165  -21.917 -64.698  1.00 191.20 ? 314 LYS C N     1 
ATOM   8280  C  CA    . LYS C 1 314 ? -1.553  -22.297 -64.899  1.00 193.96 ? 314 LYS C CA    1 
ATOM   8281  C  C     . LYS C 1 314 ? -2.337  -21.080 -65.405  1.00 186.32 ? 314 LYS C C     1 
ATOM   8282  O  O     . LYS C 1 314 ? -3.156  -21.240 -66.374  1.00 185.84 ? 314 LYS C O     1 
ATOM   8283  C  CB    . LYS C 1 314 ? -2.232  -22.976 -63.705  1.00 201.82 ? 314 LYS C CB    1 
ATOM   8284  C  CG    . LYS C 1 314 ? -2.733  -22.037 -62.631  1.00 224.75 ? 314 LYS C CG    1 
ATOM   8285  C  CD    . LYS C 1 314 ? -3.653  -22.693 -61.591  1.00 242.80 ? 314 LYS C CD    1 
ATOM   8286  C  CE    . LYS C 1 314 ? -4.239  -21.654 -60.623  1.00 263.46 ? 314 LYS C CE    1 
ATOM   8287  N  NZ    . LYS C 1 314 ? -5.175  -20.682 -61.260  1.00 274.03 ? 314 LYS C NZ    1 
ATOM   8288  N  N     . GLU C 1 315 ? -2.031  -19.883 -64.891  1.00 186.19 ? 315 GLU C N     1 
ATOM   8289  C  CA    . GLU C 1 315 ? -2.818  -18.736 -65.265  1.00 192.42 ? 315 GLU C CA    1 
ATOM   8290  C  C     . GLU C 1 315 ? -2.475  -18.274 -66.660  1.00 183.93 ? 315 GLU C C     1 
ATOM   8291  O  O     . GLU C 1 315 ? -3.392  -18.002 -67.452  1.00 181.23 ? 315 GLU C O     1 
ATOM   8292  C  CB    . GLU C 1 315 ? -2.600  -17.611 -64.286  1.00 218.17 ? 315 GLU C CB    1 
ATOM   8293  C  CG    . GLU C 1 315 ? -3.154  -17.879 -62.885  1.00 246.83 ? 315 GLU C CG    1 
ATOM   8294  C  CD    . GLU C 1 315 ? -2.654  -16.858 -61.904  1.00 266.38 ? 315 GLU C CD    1 
ATOM   8295  O  OE1   . GLU C 1 315 ? -1.624  -16.250 -62.241  1.00 277.05 ? 315 GLU C OE1   1 
ATOM   8296  O  OE2   . GLU C 1 315 ? -3.263  -16.672 -60.826  1.00 263.02 ? 315 GLU C OE2   1 
ATOM   8297  N  N     . ILE C 1 316 ? -1.178  -18.229 -66.973  1.00 187.79 ? 316 ILE C N     1 
ATOM   8298  C  CA    . ILE C 1 316 ? -0.771  -17.756 -68.270  1.00 203.43 ? 316 ILE C CA    1 
ATOM   8299  C  C     . ILE C 1 316 ? -1.306  -18.728 -69.349  1.00 199.32 ? 316 ILE C C     1 
ATOM   8300  O  O     . ILE C 1 316 ? -1.904  -18.303 -70.332  1.00 214.38 ? 316 ILE C O     1 
ATOM   8301  C  CB    . ILE C 1 316 ? 0.741   -17.399 -68.312  1.00 211.86 ? 316 ILE C CB    1 
ATOM   8302  C  CG1   . ILE C 1 316 ? 0.959   -16.072 -67.547  1.00 218.60 ? 316 ILE C CG1   1 
ATOM   8303  C  CG2   . ILE C 1 316 ? 1.207   -17.341 -69.762  1.00 225.10 ? 316 ILE C CG2   1 
ATOM   8304  C  CD1   . ILE C 1 316 ? 2.393   -15.619 -67.477  1.00 211.24 ? 316 ILE C CD1   1 
ATOM   8305  N  N     . THR C 1 317 ? -1.098  -20.005 -69.138  1.00 191.09 ? 317 THR C N     1 
ATOM   8306  C  CA    . THR C 1 317 ? -1.578  -21.012 -70.059  1.00 190.21 ? 317 THR C CA    1 
ATOM   8307  C  C     . THR C 1 317 ? -3.076  -20.857 -70.245  1.00 192.43 ? 317 THR C C     1 
ATOM   8308  O  O     . THR C 1 317 ? -3.599  -21.021 -71.350  1.00 200.50 ? 317 THR C O     1 
ATOM   8309  C  CB    . THR C 1 317 ? -1.308  -22.425 -69.516  1.00 196.37 ? 317 THR C CB    1 
ATOM   8310  O  OG1   . THR C 1 317 ? 0.096   -22.591 -69.253  1.00 200.98 ? 317 THR C OG1   1 
ATOM   8311  C  CG2   . THR C 1 317 ? -1.756  -23.458 -70.507  1.00 194.72 ? 317 THR C CG2   1 
ATOM   8312  N  N     . ALA C 1 318 ? -3.804  -20.609 -69.163  1.00 199.13 ? 318 ALA C N     1 
ATOM   8313  C  CA    . ALA C 1 318 ? -5.247  -20.474 -69.230  1.00 208.38 ? 318 ALA C CA    1 
ATOM   8314  C  C     . ALA C 1 318 ? -5.637  -19.308 -70.110  1.00 214.73 ? 318 ALA C C     1 
ATOM   8315  O  O     . ALA C 1 318 ? -6.522  -19.434 -70.963  1.00 211.12 ? 318 ALA C O     1 
ATOM   8316  C  CB    . ALA C 1 318 ? -5.871  -20.292 -67.839  1.00 213.19 ? 318 ALA C CB    1 
ATOM   8317  N  N     . LEU C 1 319 ? -4.937  -18.176 -69.915  1.00 220.55 ? 319 LEU C N     1 
ATOM   8318  C  CA    . LEU C 1 319 ? -5.238  -16.963 -70.674  1.00 223.23 ? 319 LEU C CA    1 
ATOM   8319  C  C     . LEU C 1 319 ? -4.812  -17.010 -72.125  1.00 231.63 ? 319 LEU C C     1 
ATOM   8320  O  O     . LEU C 1 319 ? -5.509  -16.560 -73.000  1.00 226.56 ? 319 LEU C O     1 
ATOM   8321  C  CB    . LEU C 1 319 ? -4.615  -15.714 -70.028  1.00 225.19 ? 319 LEU C CB    1 
ATOM   8322  C  CG    . LEU C 1 319 ? -5.185  -15.377 -68.641  1.00 231.66 ? 319 LEU C CG    1 
ATOM   8323  C  CD1   . LEU C 1 319 ? -4.530  -14.100 -68.068  1.00 236.23 ? 319 LEU C CD1   1 
ATOM   8324  C  CD2   . LEU C 1 319 ? -6.718  -15.259 -68.674  1.00 240.11 ? 319 LEU C CD2   1 
ATOM   8325  N  N     . ALA C 1 320 ? -3.614  -17.541 -72.390  1.00 252.68 ? 320 ALA C N     1 
ATOM   8326  C  CA    . ALA C 1 320 ? -2.976  -17.529 -73.693  1.00 268.64 ? 320 ALA C CA    1 
ATOM   8327  C  C     . ALA C 1 320 ? -3.523  -18.543 -74.640  1.00 278.97 ? 320 ALA C C     1 
ATOM   8328  O  O     . ALA C 1 320 ? -4.290  -19.437 -74.264  1.00 273.51 ? 320 ALA C O     1 
ATOM   8329  C  CB    . ALA C 1 320 ? -1.451  -17.752 -73.556  1.00 273.26 ? 320 ALA C CB    1 
ATOM   8330  N  N     . PRO C 1 321 ? -3.112  -18.421 -75.892  1.00 292.97 ? 321 PRO C N     1 
ATOM   8331  C  CA    . PRO C 1 321 ? -3.298  -19.548 -76.827  1.00 293.01 ? 321 PRO C CA    1 
ATOM   8332  C  C     . PRO C 1 321 ? -2.611  -20.805 -76.326  1.00 288.46 ? 321 PRO C C     1 
ATOM   8333  O  O     . PRO C 1 321 ? -1.407  -20.791 -76.046  1.00 287.40 ? 321 PRO C O     1 
ATOM   8334  C  CB    . PRO C 1 321 ? -2.660  -19.040 -78.128  1.00 296.08 ? 321 PRO C CB    1 
ATOM   8335  C  CG    . PRO C 1 321 ? -2.702  -17.558 -78.005  1.00 300.00 ? 321 PRO C CG    1 
ATOM   8336  C  CD    . PRO C 1 321 ? -2.485  -17.265 -76.564  1.00 299.43 ? 321 PRO C CD    1 
ATOM   8337  N  N     . SER C 1 322 ? -3.400  -21.868 -76.151  1.00 278.10 ? 322 SER C N     1 
ATOM   8338  C  CA    . SER C 1 322 ? -2.841  -23.211 -75.943  1.00 271.32 ? 322 SER C CA    1 
ATOM   8339  C  C     . SER C 1 322 ? -2.196  -23.851 -77.169  1.00 276.92 ? 322 SER C C     1 
ATOM   8340  O  O     . SER C 1 322 ? -1.698  -24.980 -77.111  1.00 262.47 ? 322 SER C O     1 
ATOM   8341  C  CB    . SER C 1 322 ? -3.903  -24.192 -75.376  1.00 256.54 ? 322 SER C CB    1 
ATOM   8342  O  OG    . SER C 1 322 ? -4.916  -24.427 -76.335  1.00 250.07 ? 322 SER C OG    1 
ATOM   8343  N  N     . THR C 1 323 ? -2.105  -23.102 -78.261  1.00 293.57 ? 323 THR C N     1 
ATOM   8344  C  CA    . THR C 1 323 ? -1.363  -23.459 -79.428  1.00 301.29 ? 323 THR C CA    1 
ATOM   8345  C  C     . THR C 1 323 ? 0.131   -23.573 -79.183  1.00 292.46 ? 323 THR C C     1 
ATOM   8346  O  O     . THR C 1 323 ? 0.800   -24.356 -79.833  1.00 293.03 ? 323 THR C O     1 
ATOM   8347  C  CB    . THR C 1 323 ? -1.606  -22.406 -80.537  1.00 303.02 ? 323 THR C CB    1 
ATOM   8348  O  OG1   . THR C 1 323 ? -1.083  -21.129 -80.143  1.00 289.07 ? 323 THR C OG1   1 
ATOM   8349  C  CG2   . THR C 1 323 ? -3.099  -22.258 -80.795  1.00 306.23 ? 323 THR C CG2   1 
ATOM   8350  N  N     . MET C 1 324 ? 0.636   -22.794 -78.234  1.00 275.49 ? 324 MET C N     1 
ATOM   8351  C  CA    . MET C 1 324 ? 2.056   -22.776 -77.924  1.00 261.64 ? 324 MET C CA    1 
ATOM   8352  C  C     . MET C 1 324 ? 2.219   -23.034 -76.436  1.00 234.98 ? 324 MET C C     1 
ATOM   8353  O  O     . MET C 1 324 ? 1.344   -22.712 -75.628  1.00 218.00 ? 324 MET C O     1 
ATOM   8354  C  CB    . MET C 1 324 ? 2.741   -21.460 -78.341  1.00 266.09 ? 324 MET C CB    1 
ATOM   8355  C  CG    . MET C 1 324 ? 2.148   -20.221 -77.703  1.00 264.93 ? 324 MET C CG    1 
ATOM   8356  S  SD    . MET C 1 324 ? 3.000   -18.761 -78.297  1.00 265.84 ? 324 MET C SD    1 
ATOM   8357  C  CE    . MET C 1 324 ? 2.811   -18.880 -80.067  1.00 239.05 ? 324 MET C CE    1 
ATOM   8358  N  N     . LYS C 1 325 ? 3.307   -23.730 -76.124  1.00 227.20 ? 325 LYS C N     1 
ATOM   8359  C  CA    . LYS C 1 325 ? 3.583   -24.185 -74.791  1.00 224.28 ? 325 LYS C CA    1 
ATOM   8360  C  C     . LYS C 1 325 ? 4.280   -23.037 -74.108  1.00 216.74 ? 325 LYS C C     1 
ATOM   8361  O  O     . LYS C 1 325 ? 5.249   -22.462 -74.671  1.00 201.40 ? 325 LYS C O     1 
ATOM   8362  C  CB    . LYS C 1 325 ? 4.408   -25.522 -74.766  1.00 233.95 ? 325 LYS C CB    1 
ATOM   8363  C  CG    . LYS C 1 325 ? 3.594   -26.708 -75.291  1.00 243.26 ? 325 LYS C CG    1 
ATOM   8364  C  CD    . LYS C 1 325 ? 4.337   -28.033 -75.198  1.00 258.42 ? 325 LYS C CD    1 
ATOM   8365  C  CE    . LYS C 1 325 ? 3.507   -29.226 -75.683  1.00 268.33 ? 325 LYS C CE    1 
ATOM   8366  N  NZ    . LYS C 1 325 ? 4.266   -30.505 -75.699  1.00 271.41 ? 325 LYS C NZ    1 
ATOM   8367  N  N     . ILE C 1 326 ? 3.854   -22.832 -72.862  1.00 224.66 ? 326 ILE C N     1 
ATOM   8368  C  CA    . ILE C 1 326 ? 4.313   -21.803 -71.948  1.00 219.81 ? 326 ILE C CA    1 
ATOM   8369  C  C     . ILE C 1 326 ? 5.205   -22.324 -70.846  1.00 222.05 ? 326 ILE C C     1 
ATOM   8370  O  O     . ILE C 1 326 ? 4.748   -22.694 -69.767  1.00 210.12 ? 326 ILE C O     1 
ATOM   8371  C  CB    . ILE C 1 326 ? 3.126   -21.137 -71.251  1.00 218.43 ? 326 ILE C CB    1 
ATOM   8372  C  CG1   . ILE C 1 326 ? 2.017   -20.848 -72.284  1.00 225.42 ? 326 ILE C CG1   1 
ATOM   8373  C  CG2   . ILE C 1 326 ? 3.603   -19.890 -70.509  1.00 216.36 ? 326 ILE C CG2   1 
ATOM   8374  C  CD1   . ILE C 1 326 ? 2.445   -19.949 -73.425  1.00 222.06 ? 326 ILE C CD1   1 
ATOM   8375  N  N     . LYS C 1 327 ? 6.490   -22.365 -71.122  1.00 233.70 ? 327 LYS C N     1 
ATOM   8376  C  CA    . LYS C 1 327 ? 7.448   -22.775 -70.097  1.00 243.34 ? 327 LYS C CA    1 
ATOM   8377  C  C     . LYS C 1 327 ? 7.758   -21.545 -69.279  1.00 240.12 ? 327 LYS C C     1 
ATOM   8378  O  O     . LYS C 1 327 ? 8.018   -20.488 -69.801  1.00 233.90 ? 327 LYS C O     1 
ATOM   8379  C  CB    . LYS C 1 327 ? 8.700   -23.316 -70.741  1.00 241.48 ? 327 LYS C CB    1 
ATOM   8380  C  CG    . LYS C 1 327 ? 9.822   -23.730 -69.795  1.00 241.66 ? 327 LYS C CG    1 
ATOM   8381  C  CD    . LYS C 1 327 ? 10.958  -24.492 -70.495  1.00 244.07 ? 327 LYS C CD    1 
ATOM   8382  C  CE    . LYS C 1 327 ? 11.825  -23.604 -71.397  1.00 254.13 ? 327 LYS C CE    1 
ATOM   8383  N  NZ    . LYS C 1 327 ? 12.891  -24.366 -72.103  1.00 257.17 ? 327 LYS C NZ    1 
ATOM   8384  N  N     . ILE C 1 328 ? 7.853   -21.734 -67.976  1.00 232.48 ? 328 ILE C N     1 
ATOM   8385  C  CA    . ILE C 1 328 ? 8.348   -20.673 -67.125  1.00 217.82 ? 328 ILE C CA    1 
ATOM   8386  C  C     . ILE C 1 328 ? 9.593   -21.151 -66.488  1.00 204.07 ? 328 ILE C C     1 
ATOM   8387  O  O     . ILE C 1 328 ? 9.581   -22.216 -65.910  1.00 190.60 ? 328 ILE C O     1 
ATOM   8388  C  CB    . ILE C 1 328 ? 7.359   -20.353 -66.043  1.00 230.39 ? 328 ILE C CB    1 
ATOM   8389  C  CG1   . ILE C 1 328 ? 6.156   -19.729 -66.723  1.00 249.21 ? 328 ILE C CG1   1 
ATOM   8390  C  CG2   . ILE C 1 328 ? 8.029   -19.482 -64.975  1.00 238.71 ? 328 ILE C CG2   1 
ATOM   8391  C  CD1   . ILE C 1 328 ? 4.946   -19.565 -65.850  1.00 270.62 ? 328 ILE C CD1   1 
ATOM   8392  N  N     . ILE C 1 329 ? 10.654  -20.348 -66.537  1.00 210.99 ? 329 ILE C N     1 
ATOM   8393  C  CA    . ILE C 1 329 ? 11.942  -20.835 -66.045  1.00 230.50 ? 329 ILE C CA    1 
ATOM   8394  C  C     . ILE C 1 329 ? 12.185  -20.030 -64.818  1.00 235.86 ? 329 ILE C C     1 
ATOM   8395  O  O     . ILE C 1 329 ? 12.380  -18.853 -64.894  1.00 234.34 ? 329 ILE C O     1 
ATOM   8396  C  CB    . ILE C 1 329 ? 13.091  -20.823 -67.087  1.00 249.57 ? 329 ILE C CB    1 
ATOM   8397  C  CG1   . ILE C 1 329 ? 14.432  -21.067 -66.377  1.00 255.48 ? 329 ILE C CG1   1 
ATOM   8398  C  CG2   . ILE C 1 329 ? 13.083  -19.556 -67.944  1.00 268.24 ? 329 ILE C CG2   1 
ATOM   8399  C  CD1   . ILE C 1 329 ? 15.561  -21.491 -67.294  1.00 251.30 ? 329 ILE C CD1   1 
ATOM   8400  N  N     . ALA C 1 330 ? 12.083  -20.660 -63.644  1.00 235.99 ? 330 ALA C N     1 
ATOM   8401  C  CA    . ALA C 1 330 ? 12.311  -19.957 -62.404  1.00 226.83 ? 330 ALA C CA    1 
ATOM   8402  C  C     . ALA C 1 330 ? 13.324  -20.748 -61.636  1.00 213.93 ? 330 ALA C C     1 
ATOM   8403  O  O     . ALA C 1 330 ? 12.990  -21.727 -60.977  1.00 194.79 ? 330 ALA C O     1 
ATOM   8404  C  CB    . ALA C 1 330 ? 11.053  -19.849 -61.555  1.00 228.53 ? 330 ALA C CB    1 
ATOM   8405  N  N     . PRO C 1 331 ? 14.571  -20.295 -61.654  1.00 210.05 ? 331 PRO C N     1 
ATOM   8406  C  CA    . PRO C 1 331 ? 15.595  -21.060 -60.968  1.00 211.06 ? 331 PRO C CA    1 
ATOM   8407  C  C     . PRO C 1 331 ? 15.460  -20.873 -59.465  1.00 217.97 ? 331 PRO C C     1 
ATOM   8408  O  O     . PRO C 1 331 ? 14.993  -19.841 -59.017  1.00 223.78 ? 331 PRO C O     1 
ATOM   8409  C  CB    . PRO C 1 331 ? 16.899  -20.444 -61.476  1.00 201.35 ? 331 PRO C CB    1 
ATOM   8410  C  CG    . PRO C 1 331 ? 16.535  -19.030 -61.766  1.00 207.02 ? 331 PRO C CG    1 
ATOM   8411  C  CD    . PRO C 1 331 ? 15.098  -19.026 -62.194  1.00 207.98 ? 331 PRO C CD    1 
ATOM   8412  N  N     . PRO C 1 332 ? 15.856  -21.859 -58.684  1.00 222.16 ? 332 PRO C N     1 
ATOM   8413  C  CA    . PRO C 1 332 ? 16.257  -21.570 -57.296  1.00 217.64 ? 332 PRO C CA    1 
ATOM   8414  C  C     . PRO C 1 332 ? 17.588  -20.827 -57.330  1.00 219.37 ? 332 PRO C C     1 
ATOM   8415  O  O     . PRO C 1 332 ? 18.314  -20.939 -58.315  1.00 208.83 ? 332 PRO C O     1 
ATOM   8416  C  CB    . PRO C 1 332 ? 16.438  -22.965 -56.693  1.00 217.68 ? 332 PRO C CB    1 
ATOM   8417  C  CG    . PRO C 1 332 ? 16.868  -23.765 -57.872  1.00 226.11 ? 332 PRO C CG    1 
ATOM   8418  C  CD    . PRO C 1 332 ? 16.104  -23.256 -59.048  1.00 225.89 ? 332 PRO C CD    1 
ATOM   8419  N  N     . GLU C 1 333 ? 17.870  -20.018 -56.311  1.00 223.06 ? 333 GLU C N     1 
ATOM   8420  C  CA    . GLU C 1 333 ? 18.930  -18.999 -56.382  1.00 213.83 ? 333 GLU C CA    1 
ATOM   8421  C  C     . GLU C 1 333 ? 18.467  -17.781 -57.167  1.00 188.97 ? 333 GLU C C     1 
ATOM   8422  O  O     . GLU C 1 333 ? 19.203  -16.824 -57.306  1.00 166.20 ? 333 GLU C O     1 
ATOM   8423  C  CB    . GLU C 1 333 ? 20.207  -19.545 -56.995  1.00 217.18 ? 333 GLU C CB    1 
ATOM   8424  C  CG    . GLU C 1 333 ? 21.459  -18.794 -56.601  1.00 213.60 ? 333 GLU C CG    1 
ATOM   8425  C  CD    . GLU C 1 333 ? 22.717  -19.498 -57.053  1.00 204.21 ? 333 GLU C CD    1 
ATOM   8426  O  OE1   . GLU C 1 333 ? 22.650  -20.633 -57.577  1.00 181.48 ? 333 GLU C OE1   1 
ATOM   8427  O  OE2   . GLU C 1 333 ? 23.803  -18.903 -56.889  1.00 208.63 ? 333 GLU C OE2   1 
ATOM   8428  N  N     . ARG C 1 334 ? 17.201  -17.737 -57.595  1.00 179.83 ? 334 ARG C N     1 
ATOM   8429  C  CA    . ARG C 1 334 ? 16.612  -16.537 -58.157  1.00 171.81 ? 334 ARG C CA    1 
ATOM   8430  C  C     . ARG C 1 334 ? 16.755  -15.271 -57.307  1.00 163.26 ? 334 ARG C C     1 
ATOM   8431  O  O     . ARG C 1 334 ? 16.809  -14.189 -57.855  1.00 160.74 ? 334 ARG C O     1 
ATOM   8432  C  CB    . ARG C 1 334 ? 15.118  -16.686 -58.524  1.00 193.11 ? 334 ARG C CB    1 
ATOM   8433  C  CG    . ARG C 1 334 ? 14.226  -17.045 -57.334  1.00 213.26 ? 334 ARG C CG    1 
ATOM   8434  C  CD    . ARG C 1 334 ? 12.734  -17.057 -57.638  1.00 220.59 ? 334 ARG C CD    1 
ATOM   8435  N  NE    . ARG C 1 334 ? 12.279  -18.332 -58.234  1.00 214.93 ? 334 ARG C NE    1 
ATOM   8436  C  CZ    . ARG C 1 334 ? 11.789  -19.358 -57.544  1.00 215.57 ? 334 ARG C CZ    1 
ATOM   8437  N  NH1   . ARG C 1 334 ? 11.726  -19.263 -56.235  1.00 218.67 ? 334 ARG C NH1   1 
ATOM   8438  N  NH2   . ARG C 1 334 ? 11.467  -20.506 -58.164  1.00 222.29 ? 334 ARG C NH2   1 
ATOM   8439  N  N     . LYS C 1 335 ? 16.771  -15.407 -55.974  1.00 167.88 ? 335 LYS C N     1 
ATOM   8440  C  CA    . LYS C 1 335 ? 16.780  -14.244 -55.134  1.00 181.37 ? 335 LYS C CA    1 
ATOM   8441  C  C     . LYS C 1 335 ? 17.946  -13.359 -55.499  1.00 168.88 ? 335 LYS C C     1 
ATOM   8442  O  O     . LYS C 1 335 ? 17.835  -12.106 -55.440  1.00 186.53 ? 335 LYS C O     1 
ATOM   8443  C  CB    . LYS C 1 335 ? 16.893  -14.622 -53.638  1.00 208.58 ? 335 LYS C CB    1 
ATOM   8444  C  CG    . LYS C 1 335 ? 17.011  -13.404 -52.722  1.00 225.71 ? 335 LYS C CG    1 
ATOM   8445  C  CD    . LYS C 1 335 ? 17.026  -13.761 -51.242  1.00 239.03 ? 335 LYS C CD    1 
ATOM   8446  C  CE    . LYS C 1 335 ? 15.697  -14.293 -50.720  1.00 240.23 ? 335 LYS C CE    1 
ATOM   8447  N  NZ    . LYS C 1 335 ? 15.762  -14.449 -49.244  1.00 236.94 ? 335 LYS C NZ    1 
ATOM   8448  N  N     . TYR C 1 336 ? 19.101  -14.014 -55.763  1.00 152.62 ? 336 TYR C N     1 
ATOM   8449  C  CA    . TYR C 1 336 ? 20.398  -13.349 -55.978  1.00 148.65 ? 336 TYR C CA    1 
ATOM   8450  C  C     . TYR C 1 336 ? 20.701  -13.087 -57.458  1.00 137.66 ? 336 TYR C C     1 
ATOM   8451  O  O     . TYR C 1 336 ? 21.651  -12.393 -57.779  1.00 126.13 ? 336 TYR C O     1 
ATOM   8452  C  CB    . TYR C 1 336 ? 21.549  -14.137 -55.335  1.00 156.67 ? 336 TYR C CB    1 
ATOM   8453  C  CG    . TYR C 1 336 ? 21.179  -14.418 -53.927  1.00 149.62 ? 336 TYR C CG    1 
ATOM   8454  C  CD1   . TYR C 1 336 ? 20.990  -13.382 -53.053  1.00 148.52 ? 336 TYR C CD1   1 
ATOM   8455  C  CD2   . TYR C 1 336 ? 20.976  -15.702 -53.489  1.00 158.02 ? 336 TYR C CD2   1 
ATOM   8456  C  CE1   . TYR C 1 336 ? 20.635  -13.616 -51.734  1.00 157.03 ? 336 TYR C CE1   1 
ATOM   8457  C  CE2   . TYR C 1 336 ? 20.620  -15.958 -52.185  1.00 161.99 ? 336 TYR C CE2   1 
ATOM   8458  C  CZ    . TYR C 1 336 ? 20.450  -14.910 -51.305  1.00 162.52 ? 336 TYR C CZ    1 
ATOM   8459  O  OH    . TYR C 1 336 ? 20.078  -15.158 -49.976  1.00 175.10 ? 336 TYR C OH    1 
ATOM   8460  N  N     . SER C 1 337 ? 19.698  -13.311 -58.309  1.00 134.48 ? 337 SER C N     1 
ATOM   8461  C  CA    . SER C 1 337 ? 19.912  -13.299 -59.750  1.00 138.16 ? 337 SER C CA    1 
ATOM   8462  C  C     . SER C 1 337 ? 20.444  -11.936 -60.198  1.00 131.87 ? 337 SER C C     1 
ATOM   8463  O  O     . SER C 1 337 ? 21.382  -11.876 -60.992  1.00 134.58 ? 337 SER C O     1 
ATOM   8464  C  CB    . SER C 1 337 ? 18.619  -13.694 -60.522  1.00 132.93 ? 337 SER C CB    1 
ATOM   8465  O  OG    . SER C 1 337 ? 18.282  -15.015 -60.197  1.00 122.08 ? 337 SER C OG    1 
ATOM   8466  N  N     . VAL C 1 338 ? 19.923  -10.871 -59.625  1.00 128.12 ? 338 VAL C N     1 
ATOM   8467  C  CA    . VAL C 1 338 ? 20.344  -9.561  -60.048  1.00 139.33 ? 338 VAL C CA    1 
ATOM   8468  C  C     . VAL C 1 338 ? 21.848  -9.422  -59.777  1.00 137.46 ? 338 VAL C C     1 
ATOM   8469  O  O     . VAL C 1 338 ? 22.628  -8.965  -60.611  1.00 146.45 ? 338 VAL C O     1 
ATOM   8470  C  CB    . VAL C 1 338 ? 19.498  -8.461  -59.346  1.00 158.27 ? 338 VAL C CB    1 
ATOM   8471  C  CG1   . VAL C 1 338 ? 20.104  -7.060  -59.571  1.00 154.24 ? 338 VAL C CG1   1 
ATOM   8472  C  CG2   . VAL C 1 338 ? 18.024  -8.585  -59.751  1.00 171.56 ? 338 VAL C CG2   1 
ATOM   8473  N  N     . TRP C 1 339 ? 22.238  -9.779  -58.547  1.00 140.88 ? 339 TRP C N     1 
ATOM   8474  C  CA    . TRP C 1 339 ? 23.620  -9.589  -58.167  1.00 131.13 ? 339 TRP C CA    1 
ATOM   8475  C  C     . TRP C 1 339 ? 24.526  -10.440 -59.026  1.00 126.22 ? 339 TRP C C     1 
ATOM   8476  O  O     . TRP C 1 339 ? 25.596  -9.954  -59.460  1.00 129.36 ? 339 TRP C O     1 
ATOM   8477  C  CB    . TRP C 1 339 ? 23.916  -9.898  -56.703  1.00 137.74 ? 339 TRP C CB    1 
ATOM   8478  C  CG    . TRP C 1 339 ? 25.332  -9.475  -56.342  1.00 138.40 ? 339 TRP C CG    1 
ATOM   8479  C  CD1   . TRP C 1 339 ? 25.754  -8.265  -55.876  1.00 146.10 ? 339 TRP C CD1   1 
ATOM   8480  C  CD2   . TRP C 1 339 ? 26.473  -10.298 -56.428  1.00 147.44 ? 339 TRP C CD2   1 
ATOM   8481  N  NE1   . TRP C 1 339 ? 27.104  -8.283  -55.679  1.00 152.56 ? 339 TRP C NE1   1 
ATOM   8482  C  CE2   . TRP C 1 339 ? 27.573  -9.524  -56.042  1.00 154.16 ? 339 TRP C CE2   1 
ATOM   8483  C  CE3   . TRP C 1 339 ? 26.664  -11.592 -56.860  1.00 149.85 ? 339 TRP C CE3   1 
ATOM   8484  C  CZ2   . TRP C 1 339 ? 28.854  -10.040 -55.990  1.00 166.16 ? 339 TRP C CZ2   1 
ATOM   8485  C  CZ3   . TRP C 1 339 ? 27.926  -12.111 -56.830  1.00 161.94 ? 339 TRP C CZ3   1 
ATOM   8486  C  CH2   . TRP C 1 339 ? 29.011  -11.339 -56.405  1.00 170.67 ? 339 TRP C CH2   1 
ATOM   8487  N  N     . ILE C 1 340 ? 24.118  -11.676 -59.303  1.00 125.84 ? 340 ILE C N     1 
ATOM   8488  C  CA    . ILE C 1 340 ? 24.935  -12.539 -60.135  1.00 134.49 ? 340 ILE C CA    1 
ATOM   8489  C  C     . ILE C 1 340 ? 25.128  -11.899 -61.535  1.00 124.36 ? 340 ILE C C     1 
ATOM   8490  O  O     . ILE C 1 340 ? 26.183  -11.867 -62.113  1.00 124.79 ? 340 ILE C O     1 
ATOM   8491  C  CB    . ILE C 1 340 ? 24.350  -13.946 -60.278  1.00 154.59 ? 340 ILE C CB    1 
ATOM   8492  C  CG1   . ILE C 1 340 ? 24.223  -14.621 -58.896  1.00 169.67 ? 340 ILE C CG1   1 
ATOM   8493  C  CG2   . ILE C 1 340 ? 25.182  -14.709 -61.280  1.00 164.36 ? 340 ILE C CG2   1 
ATOM   8494  C  CD1   . ILE C 1 340 ? 23.450  -15.895 -58.877  1.00 174.98 ? 340 ILE C CD1   1 
ATOM   8495  N  N     . GLY C 1 341 ? 24.026  -11.426 -62.062  1.00 124.91 ? 341 GLY C N     1 
ATOM   8496  C  CA    . GLY C 1 341 ? 24.051  -10.746 -63.343  1.00 141.82 ? 341 GLY C CA    1 
ATOM   8497  C  C     . GLY C 1 341 ? 25.050  -9.622  -63.324  1.00 137.12 ? 341 GLY C C     1 
ATOM   8498  O  O     . GLY C 1 341 ? 25.782  -9.411  -64.283  1.00 146.66 ? 341 GLY C O     1 
ATOM   8499  N  N     . GLY C 1 342 ? 25.053  -8.861  -62.229  1.00 135.74 ? 342 GLY C N     1 
ATOM   8500  C  CA    . GLY C 1 342 ? 26.008  -7.761  -62.096  1.00 135.18 ? 342 GLY C CA    1 
ATOM   8501  C  C     . GLY C 1 342 ? 27.422  -8.293  -62.134  1.00 151.17 ? 342 GLY C C     1 
ATOM   8502  O  O     . GLY C 1 342 ? 28.286  -7.687  -62.774  1.00 165.48 ? 342 GLY C O     1 
ATOM   8503  N  N     . SER C 1 343 ? 27.656  -9.415  -61.443  1.00 159.35 ? 343 SER C N     1 
ATOM   8504  C  CA    . SER C 1 343 ? 28.982  -10.002 -61.394  1.00 156.22 ? 343 SER C CA    1 
ATOM   8505  C  C     . SER C 1 343 ? 29.464  -10.356 -62.807  1.00 142.98 ? 343 SER C C     1 
ATOM   8506  O  O     . SER C 1 343 ? 30.607  -10.077 -63.207  1.00 131.30 ? 343 SER C O     1 
ATOM   8507  C  CB    . SER C 1 343 ? 29.001  -11.282 -60.511  1.00 170.04 ? 343 SER C CB    1 
ATOM   8508  O  OG    . SER C 1 343 ? 28.520  -12.423 -61.201  1.00 182.61 ? 343 SER C OG    1 
ATOM   8509  N  N     . ILE C 1 344 ? 28.559  -10.987 -63.541  1.00 143.30 ? 344 ILE C N     1 
ATOM   8510  C  CA    . ILE C 1 344 ? 28.920  -11.431 -64.879  1.00 144.04 ? 344 ILE C CA    1 
ATOM   8511  C  C     . ILE C 1 344 ? 29.157  -10.219 -65.779  1.00 147.13 ? 344 ILE C C     1 
ATOM   8512  O  O     . ILE C 1 344 ? 30.126  -10.241 -66.561  1.00 162.29 ? 344 ILE C O     1 
ATOM   8513  C  CB    . ILE C 1 344 ? 27.913  -12.436 -65.463  1.00 149.15 ? 344 ILE C CB    1 
ATOM   8514  C  CG1   . ILE C 1 344 ? 28.445  -13.075 -66.732  1.00 167.16 ? 344 ILE C CG1   1 
ATOM   8515  C  CG2   . ILE C 1 344 ? 26.559  -11.809 -65.739  1.00 146.19 ? 344 ILE C CG2   1 
ATOM   8516  C  CD1   . ILE C 1 344 ? 27.668  -14.314 -67.204  1.00 173.84 ? 344 ILE C CD1   1 
ATOM   8517  N  N     . LEU C 1 345 ? 28.380  -9.153  -65.612  1.00 156.21 ? 345 LEU C N     1 
ATOM   8518  C  CA    . LEU C 1 345 ? 28.549  -7.995  -66.461  1.00 165.94 ? 345 LEU C CA    1 
ATOM   8519  C  C     . LEU C 1 345 ? 29.832  -7.323  -66.171  1.00 162.99 ? 345 LEU C C     1 
ATOM   8520  O  O     . LEU C 1 345 ? 30.497  -6.917  -67.124  1.00 181.47 ? 345 LEU C O     1 
ATOM   8521  C  CB    . LEU C 1 345 ? 27.442  -6.959  -66.253  1.00 180.12 ? 345 LEU C CB    1 
ATOM   8522  C  CG    . LEU C 1 345 ? 26.817  -6.564  -67.599  1.00 201.42 ? 345 LEU C CG    1 
ATOM   8523  C  CD1   . LEU C 1 345 ? 26.063  -7.764  -68.193  1.00 212.48 ? 345 LEU C CD1   1 
ATOM   8524  C  CD2   . LEU C 1 345 ? 25.914  -5.331  -67.485  1.00 210.86 ? 345 LEU C CD2   1 
ATOM   8525  N  N     . ALA C 1 346 ? 30.194  -7.133  -64.901  1.00 159.47 ? 346 ALA C N     1 
ATOM   8526  C  CA    . ALA C 1 346 ? 31.444  -6.460  -64.706  1.00 163.48 ? 346 ALA C CA    1 
ATOM   8527  C  C     . ALA C 1 346 ? 32.634  -7.313  -65.102  1.00 169.49 ? 346 ALA C C     1 
ATOM   8528  O  O     . ALA C 1 346 ? 33.757  -6.782  -65.314  1.00 160.48 ? 346 ALA C O     1 
ATOM   8529  C  CB    . ALA C 1 346 ? 31.565  -5.911  -63.301  1.00 171.15 ? 346 ALA C CB    1 
ATOM   8530  N  N     . SER C 1 347 ? 32.463  -8.642  -65.122  1.00 175.10 ? 347 SER C N     1 
ATOM   8531  C  CA    . SER C 1 347 ? 33.481  -9.567  -65.548  1.00 179.40 ? 347 SER C CA    1 
ATOM   8532  C  C     . SER C 1 347 ? 33.736  -9.504  -67.051  1.00 178.96 ? 347 SER C C     1 
ATOM   8533  O  O     . SER C 1 347 ? 34.802  -9.858  -67.523  1.00 184.69 ? 347 SER C O     1 
ATOM   8534  C  CB    . SER C 1 347 ? 33.174  -11.016 -65.117  1.00 190.88 ? 347 SER C CB    1 
ATOM   8535  O  OG    . SER C 1 347 ? 32.958  -11.095 -63.726  1.00 197.07 ? 347 SER C OG    1 
ATOM   8536  N  N     . LEU C 1 348 ? 32.745  -9.003  -67.793  1.00 188.69 ? 348 LEU C N     1 
ATOM   8537  C  CA    . LEU C 1 348 ? 32.863  -9.001  -69.247  1.00 201.76 ? 348 LEU C CA    1 
ATOM   8538  C  C     . LEU C 1 348 ? 33.887  -7.978  -69.681  1.00 207.54 ? 348 LEU C C     1 
ATOM   8539  O  O     . LEU C 1 348 ? 33.943  -6.882  -69.123  1.00 206.05 ? 348 LEU C O     1 
ATOM   8540  C  CB    . LEU C 1 348 ? 31.513  -8.683  -69.902  1.00 225.84 ? 348 LEU C CB    1 
ATOM   8541  C  CG    . LEU C 1 348 ? 30.790  -9.894  -70.497  1.00 243.74 ? 348 LEU C CG    1 
ATOM   8542  C  CD1   . LEU C 1 348 ? 30.451  -10.943 -69.433  1.00 256.37 ? 348 LEU C CD1   1 
ATOM   8543  C  CD2   . LEU C 1 348 ? 29.524  -9.464  -71.278  1.00 254.48 ? 348 LEU C CD2   1 
ATOM   8544  N  N     . SER C 1 349 ? 34.733  -8.388  -70.626  1.00 220.27 ? 349 SER C N     1 
ATOM   8545  C  CA    . SER C 1 349 ? 35.850  -7.550  -71.063  1.00 227.21 ? 349 SER C CA    1 
ATOM   8546  C  C     . SER C 1 349 ? 35.371  -6.257  -71.764  1.00 236.51 ? 349 SER C C     1 
ATOM   8547  O  O     . SER C 1 349 ? 35.826  -5.136  -71.445  1.00 254.24 ? 349 SER C O     1 
ATOM   8548  C  CB    . SER C 1 349 ? 36.803  -8.328  -72.002  1.00 216.31 ? 349 SER C CB    1 
ATOM   8549  O  OG    . SER C 1 349 ? 37.341  -9.459  -71.344  1.00 217.76 ? 349 SER C OG    1 
ATOM   8550  N  N     . THR C 1 350 ? 34.489  -6.428  -72.732  1.00 234.31 ? 350 THR C N     1 
ATOM   8551  C  CA    . THR C 1 350 ? 34.005  -5.323  -73.519  1.00 235.52 ? 350 THR C CA    1 
ATOM   8552  C  C     . THR C 1 350 ? 33.347  -4.322  -72.631  1.00 226.86 ? 350 THR C C     1 
ATOM   8553  O  O     . THR C 1 350 ? 33.464  -3.126  -72.871  1.00 216.48 ? 350 THR C O     1 
ATOM   8554  C  CB    . THR C 1 350 ? 32.923  -5.757  -74.519  1.00 241.88 ? 350 THR C CB    1 
ATOM   8555  O  OG1   . THR C 1 350 ? 33.434  -6.774  -75.391  1.00 254.61 ? 350 THR C OG1   1 
ATOM   8556  C  CG2   . THR C 1 350 ? 32.453  -4.564  -75.371  1.00 245.06 ? 350 THR C CG2   1 
ATOM   8557  N  N     . PHE C 1 351 ? 32.643  -4.810  -71.599  1.00 224.73 ? 351 PHE C N     1 
ATOM   8558  C  CA    . PHE C 1 351 ? 31.912  -3.913  -70.683  1.00 232.58 ? 351 PHE C CA    1 
ATOM   8559  C  C     . PHE C 1 351 ? 32.870  -2.878  -70.081  1.00 222.80 ? 351 PHE C C     1 
ATOM   8560  O  O     . PHE C 1 351 ? 32.517  -1.681  -69.894  1.00 225.93 ? 351 PHE C O     1 
ATOM   8561  C  CB    . PHE C 1 351 ? 31.156  -4.669  -69.560  1.00 247.80 ? 351 PHE C CB    1 
ATOM   8562  C  CG    . PHE C 1 351 ? 30.395  -3.788  -68.625  1.00 256.70 ? 351 PHE C CG    1 
ATOM   8563  C  CD1   . PHE C 1 351 ? 29.300  -3.063  -69.065  1.00 262.98 ? 351 PHE C CD1   1 
ATOM   8564  C  CD2   . PHE C 1 351 ? 30.752  -3.724  -67.292  1.00 255.30 ? 351 PHE C CD2   1 
ATOM   8565  C  CE1   . PHE C 1 351 ? 28.611  -2.268  -68.198  1.00 267.64 ? 351 PHE C CE1   1 
ATOM   8566  C  CE2   . PHE C 1 351 ? 30.057  -2.940  -66.420  1.00 261.18 ? 351 PHE C CE2   1 
ATOM   8567  C  CZ    . PHE C 1 351 ? 28.980  -2.205  -66.869  1.00 272.04 ? 351 PHE C CZ    1 
ATOM   8568  N  N     . GLN C 1 352 ? 34.131  -3.311  -69.923  1.00 226.64 ? 352 GLN C N     1 
ATOM   8569  C  CA    . GLN C 1 352 ? 35.158  -2.481  -69.299  1.00 240.91 ? 352 GLN C CA    1 
ATOM   8570  C  C     . GLN C 1 352 ? 35.429  -1.136  -69.988  1.00 238.82 ? 352 GLN C C     1 
ATOM   8571  O  O     . GLN C 1 352 ? 36.099  -0.278  -69.419  1.00 231.61 ? 352 GLN C O     1 
ATOM   8572  C  CB    . GLN C 1 352 ? 36.440  -3.264  -69.021  1.00 255.21 ? 352 GLN C CB    1 
ATOM   8573  C  CG    . GLN C 1 352 ? 36.269  -4.309  -67.917  1.00 260.91 ? 352 GLN C CG    1 
ATOM   8574  C  CD    . GLN C 1 352 ? 37.585  -4.782  -67.368  1.00 262.22 ? 352 GLN C CD    1 
ATOM   8575  O  OE1   . GLN C 1 352 ? 38.606  -4.769  -68.060  1.00 262.62 ? 352 GLN C OE1   1 
ATOM   8576  N  NE2   . GLN C 1 352 ? 37.578  -5.229  -66.111  1.00 262.43 ? 352 GLN C NE2   1 
ATOM   8577  N  N     . GLN C 1 353 ? 34.868  -0.932  -71.177  1.00 241.56 ? 353 GLN C N     1 
ATOM   8578  C  CA    . GLN C 1 353 ? 34.922  0.336   -71.832  1.00 240.68 ? 353 GLN C CA    1 
ATOM   8579  C  C     . GLN C 1 353 ? 33.670  1.177   -71.684  1.00 227.63 ? 353 GLN C C     1 
ATOM   8580  O  O     . GLN C 1 353 ? 33.705  2.386   -71.896  1.00 202.37 ? 353 GLN C O     1 
ATOM   8581  C  CB    . GLN C 1 353 ? 35.188  0.119   -73.329  1.00 248.38 ? 353 GLN C CB    1 
ATOM   8582  C  CG    . GLN C 1 353 ? 35.686  1.334   -74.099  1.00 247.94 ? 353 GLN C CG    1 
ATOM   8583  C  CD    . GLN C 1 353 ? 36.344  0.949   -75.402  1.00 259.46 ? 353 GLN C CD    1 
ATOM   8584  O  OE1   . GLN C 1 353 ? 36.338  -0.216  -75.809  1.00 263.69 ? 353 GLN C OE1   1 
ATOM   8585  N  NE2   . GLN C 1 353 ? 36.920  1.937   -76.077  1.00 264.27 ? 353 GLN C NE2   1 
ATOM   8586  N  N     . MET C 1 354 ? 32.562  0.511   -71.345  1.00 222.19 ? 354 MET C N     1 
ATOM   8587  C  CA    . MET C 1 354 ? 31.273  1.206   -71.178  1.00 210.56 ? 354 MET C CA    1 
ATOM   8588  C  C     . MET C 1 354 ? 31.079  1.876   -69.822  1.00 192.33 ? 354 MET C C     1 
ATOM   8589  O  O     . MET C 1 354 ? 30.053  2.501   -69.599  1.00 179.31 ? 354 MET C O     1 
ATOM   8590  C  CB    . MET C 1 354 ? 30.094  0.240   -71.420  1.00 230.44 ? 354 MET C CB    1 
ATOM   8591  C  CG    . MET C 1 354 ? 30.067  -0.374  -72.812  1.00 252.31 ? 354 MET C CG    1 
ATOM   8592  S  SD    . MET C 1 354 ? 28.853  -1.699  -73.017  1.00 278.11 ? 354 MET C SD    1 
ATOM   8593  C  CE    . MET C 1 354 ? 27.308  -0.819  -72.804  1.00 278.68 ? 354 MET C CE    1 
ATOM   8594  N  N     . TRP C 1 355 ? 32.052  1.748   -68.916  1.00 190.16 ? 355 TRP C N     1 
ATOM   8595  C  CA    . TRP C 1 355 ? 31.879  2.322   -67.618  1.00 186.41 ? 355 TRP C CA    1 
ATOM   8596  C  C     . TRP C 1 355 ? 31.664  3.814   -67.780  1.00 188.47 ? 355 TRP C C     1 
ATOM   8597  O  O     . TRP C 1 355 ? 32.179  4.413   -68.729  1.00 191.38 ? 355 TRP C O     1 
ATOM   8598  C  CB    . TRP C 1 355 ? 33.104  2.119   -66.685  1.00 181.55 ? 355 TRP C CB    1 
ATOM   8599  C  CG    . TRP C 1 355 ? 33.334  0.694   -66.243  1.00 184.25 ? 355 TRP C CG    1 
ATOM   8600  C  CD1   . TRP C 1 355 ? 34.232  -0.214  -66.728  1.00 190.51 ? 355 TRP C CD1   1 
ATOM   8601  C  CD2   . TRP C 1 355 ? 32.644  0.051   -65.182  1.00 186.11 ? 355 TRP C CD2   1 
ATOM   8602  N  NE1   . TRP C 1 355 ? 34.120  -1.398  -66.035  1.00 186.38 ? 355 TRP C NE1   1 
ATOM   8603  C  CE2   . TRP C 1 355 ? 33.123  -1.259  -65.098  1.00 186.05 ? 355 TRP C CE2   1 
ATOM   8604  C  CE3   . TRP C 1 355 ? 31.631  0.473   -64.352  1.00 196.57 ? 355 TRP C CE3   1 
ATOM   8605  C  CZ2   . TRP C 1 355 ? 32.641  -2.148  -64.174  1.00 194.81 ? 355 TRP C CZ2   1 
ATOM   8606  C  CZ3   . TRP C 1 355 ? 31.125  -0.406  -63.441  1.00 208.12 ? 355 TRP C CZ3   1 
ATOM   8607  C  CH2   . TRP C 1 355 ? 31.617  -1.712  -63.361  1.00 204.80 ? 355 TRP C CH2   1 
ATOM   8608  N  N     . ILE C 1 356 ? 30.969  4.421   -66.835  1.00 191.37 ? 356 ILE C N     1 
ATOM   8609  C  CA    . ILE C 1 356 ? 30.967  5.865   -66.720  1.00 198.30 ? 356 ILE C CA    1 
ATOM   8610  C  C     . ILE C 1 356 ? 32.223  6.168   -65.945  1.00 198.65 ? 356 ILE C C     1 
ATOM   8611  O  O     . ILE C 1 356 ? 32.415  5.721   -64.816  1.00 197.15 ? 356 ILE C O     1 
ATOM   8612  C  CB    . ILE C 1 356 ? 29.765  6.395   -66.010  1.00 217.00 ? 356 ILE C CB    1 
ATOM   8613  C  CG1   . ILE C 1 356 ? 28.461  5.988   -66.732  1.00 238.91 ? 356 ILE C CG1   1 
ATOM   8614  C  CG2   . ILE C 1 356 ? 29.932  7.908   -65.870  1.00 212.41 ? 356 ILE C CG2   1 
ATOM   8615  C  CD1   . ILE C 1 356 ? 27.212  6.217   -65.886  1.00 248.69 ? 356 ILE C CD1   1 
ATOM   8616  N  N     . SER C 1 357 ? 33.120  6.922   -66.579  1.00 205.35 ? 357 SER C N     1 
ATOM   8617  C  CA    . SER C 1 357 ? 34.420  7.195   -65.981  1.00 210.40 ? 357 SER C CA    1 
ATOM   8618  C  C     . SER C 1 357 ? 34.247  8.416   -65.133  1.00 220.82 ? 357 SER C C     1 
ATOM   8619  O  O     . SER C 1 357 ? 33.400  9.266   -65.402  1.00 232.89 ? 357 SER C O     1 
ATOM   8620  C  CB    . SER C 1 357 ? 35.534  7.426   -67.030  1.00 208.70 ? 357 SER C CB    1 
ATOM   8621  O  OG    . SER C 1 357 ? 35.726  6.241   -67.778  1.00 214.01 ? 357 SER C OG    1 
ATOM   8622  N  N     . LYS C 1 358 ? 35.045  8.462   -64.044  1.00 224.96 ? 358 LYS C N     1 
ATOM   8623  C  CA    . LYS C 1 358 ? 35.126  9.615   -63.176  1.00 232.03 ? 358 LYS C CA    1 
ATOM   8624  C  C     . LYS C 1 358 ? 35.389  10.873  -63.989  1.00 239.26 ? 358 LYS C C     1 
ATOM   8625  O  O     . LYS C 1 358 ? 34.798  11.929  -63.763  1.00 251.33 ? 358 LYS C O     1 
ATOM   8626  C  CB    . LYS C 1 358 ? 36.235  9.386   -62.119  1.00 232.11 ? 358 LYS C CB    1 
ATOM   8627  C  CG    . LYS C 1 358 ? 36.391  10.540  -61.142  1.00 233.35 ? 358 LYS C CG    1 
ATOM   8628  C  CD    . LYS C 1 358 ? 35.121  10.975  -60.413  1.00 239.86 ? 358 LYS C CD    1 
ATOM   8629  C  CE    . LYS C 1 358 ? 35.415  11.792  -59.136  1.00 233.99 ? 358 LYS C CE    1 
ATOM   8630  N  NZ    . LYS C 1 358 ? 36.029  13.124  -59.383  1.00 231.24 ? 358 LYS C NZ    1 
ATOM   8631  N  N     . GLN C 1 359 ? 36.334  10.762  -64.915  1.00 242.15 ? 359 GLN C N     1 
ATOM   8632  C  CA    . GLN C 1 359 ? 36.770  11.862  -65.746  1.00 242.31 ? 359 GLN C CA    1 
ATOM   8633  C  C     . GLN C 1 359 ? 35.577  12.411  -66.513  1.00 239.85 ? 359 GLN C C     1 
ATOM   8634  O  O     . GLN C 1 359 ? 35.330  13.632  -66.503  1.00 240.91 ? 359 GLN C O     1 
ATOM   8635  C  CB    . GLN C 1 359 ? 37.855  11.375  -66.746  1.00 234.64 ? 359 GLN C CB    1 
ATOM   8636  C  CG    . GLN C 1 359 ? 38.421  12.440  -67.670  1.00 232.02 ? 359 GLN C CG    1 
ATOM   8637  C  CD    . GLN C 1 359 ? 39.569  11.900  -68.474  1.00 235.34 ? 359 GLN C CD    1 
ATOM   8638  O  OE1   . GLN C 1 359 ? 39.994  10.777  -68.231  1.00 233.71 ? 359 GLN C OE1   1 
ATOM   8639  N  NE2   . GLN C 1 359 ? 40.071  12.679  -69.445  1.00 245.57 ? 359 GLN C NE2   1 
ATOM   8640  N  N     . GLU C 1 360 ? 34.837  11.480  -67.131  1.00 235.17 ? 360 GLU C N     1 
ATOM   8641  C  CA    . GLU C 1 360 ? 33.708  11.845  -67.991  1.00 237.61 ? 360 GLU C CA    1 
ATOM   8642  C  C     . GLU C 1 360 ? 32.683  12.604  -67.181  1.00 231.30 ? 360 GLU C C     1 
ATOM   8643  O  O     . GLU C 1 360 ? 32.135  13.650  -67.606  1.00 229.50 ? 360 GLU C O     1 
ATOM   8644  C  CB    . GLU C 1 360 ? 33.143  10.593  -68.657  1.00 250.24 ? 360 GLU C CB    1 
ATOM   8645  C  CG    . GLU C 1 360 ? 34.126  10.007  -69.682  1.00 258.01 ? 360 GLU C CG    1 
ATOM   8646  C  CD    . GLU C 1 360 ? 33.610  8.784   -70.340  1.00 269.30 ? 360 GLU C CD    1 
ATOM   8647  O  OE1   . GLU C 1 360 ? 32.783  8.069   -69.747  1.00 276.56 ? 360 GLU C OE1   1 
ATOM   8648  O  OE2   . GLU C 1 360 ? 34.045  8.500   -71.477  1.00 272.61 ? 360 GLU C OE2   1 
ATOM   8649  N  N     . TYR C 1 361 ? 32.377  12.069  -66.004  1.00 227.36 ? 361 TYR C N     1 
ATOM   8650  C  CA    . TYR C 1 361 ? 31.475  12.752  -65.071  1.00 229.55 ? 361 TYR C CA    1 
ATOM   8651  C  C     . TYR C 1 361 ? 31.983  14.160  -64.742  1.00 245.66 ? 361 TYR C C     1 
ATOM   8652  O  O     . TYR C 1 361 ? 31.225  15.100  -64.742  1.00 248.44 ? 361 TYR C O     1 
ATOM   8653  C  CB    . TYR C 1 361 ? 31.348  11.991  -63.786  1.00 227.31 ? 361 TYR C CB    1 
ATOM   8654  C  CG    . TYR C 1 361 ? 30.696  12.765  -62.703  1.00 226.88 ? 361 TYR C CG    1 
ATOM   8655  C  CD1   . TYR C 1 361 ? 29.355  13.063  -62.758  1.00 229.98 ? 361 TYR C CD1   1 
ATOM   8656  C  CD2   . TYR C 1 361 ? 31.426  13.208  -61.629  1.00 226.56 ? 361 TYR C CD2   1 
ATOM   8657  C  CE1   . TYR C 1 361 ? 28.744  13.763  -61.732  1.00 229.01 ? 361 TYR C CE1   1 
ATOM   8658  C  CE2   . TYR C 1 361 ? 30.828  13.913  -60.595  1.00 225.77 ? 361 TYR C CE2   1 
ATOM   8659  C  CZ    . TYR C 1 361 ? 29.484  14.191  -60.657  1.00 226.16 ? 361 TYR C CZ    1 
ATOM   8660  O  OH    . TYR C 1 361 ? 28.868  14.910  -59.625  1.00 230.35 ? 361 TYR C OH    1 
ATOM   8661  N  N     . ASP C 1 362 ? 33.263  14.312  -64.435  1.00 263.05 ? 362 ASP C N     1 
ATOM   8662  C  CA    . ASP C 1 362 ? 33.760  15.597  -64.015  1.00 277.43 ? 362 ASP C CA    1 
ATOM   8663  C  C     . ASP C 1 362 ? 33.619  16.631  -65.098  1.00 274.94 ? 362 ASP C C     1 
ATOM   8664  O  O     . ASP C 1 362 ? 33.255  17.777  -64.815  1.00 270.39 ? 362 ASP C O     1 
ATOM   8665  C  CB    . ASP C 1 362 ? 35.233  15.568  -63.630  1.00 296.49 ? 362 ASP C CB    1 
ATOM   8666  C  CG    . ASP C 1 362 ? 35.513  14.702  -62.431  1.00 319.46 ? 362 ASP C CG    1 
ATOM   8667  O  OD1   . ASP C 1 362 ? 34.743  14.665  -61.440  1.00 335.60 ? 362 ASP C OD1   1 
ATOM   8668  O  OD2   . ASP C 1 362 ? 36.549  14.052  -62.493  1.00 331.98 ? 362 ASP C OD2   1 
ATOM   8669  N  N     . GLU C 1 363 ? 33.880  16.240  -66.344  1.00 288.25 ? 363 GLU C N     1 
ATOM   8670  C  CA    . GLU C 1 363 ? 33.653  17.170  -67.461  1.00 298.36 ? 363 GLU C CA    1 
ATOM   8671  C  C     . GLU C 1 363 ? 32.159  17.467  -67.672  1.00 275.67 ? 363 GLU C C     1 
ATOM   8672  O  O     . GLU C 1 363 ? 31.719  18.631  -67.674  1.00 254.54 ? 363 GLU C O     1 
ATOM   8673  C  CB    . GLU C 1 363 ? 34.206  16.626  -68.777  1.00 325.38 ? 363 GLU C CB    1 
ATOM   8674  C  CG    . GLU C 1 363 ? 35.723  16.662  -68.896  1.00 350.42 ? 363 GLU C CG    1 
ATOM   8675  C  CD    . GLU C 1 363 ? 36.399  15.315  -69.210  1.00 370.48 ? 363 GLU C CD    1 
ATOM   8676  O  OE1   . GLU C 1 363 ? 35.818  14.200  -69.010  1.00 376.00 ? 363 GLU C OE1   1 
ATOM   8677  O  OE2   . GLU C 1 363 ? 37.577  15.365  -69.624  1.00 376.00 ? 363 GLU C OE2   1 
ATOM   8678  N  N     . SER C 1 364 ? 31.408  16.387  -67.867  1.00 269.64 ? 364 SER C N     1 
ATOM   8679  C  CA    . SER C 1 364 ? 30.014  16.445  -68.349  1.00 265.76 ? 364 SER C CA    1 
ATOM   8680  C  C     . SER C 1 364 ? 28.865  16.510  -67.325  1.00 268.14 ? 364 SER C C     1 
ATOM   8681  O  O     . SER C 1 364 ? 27.724  16.788  -67.692  1.00 255.01 ? 364 SER C O     1 
ATOM   8682  C  CB    . SER C 1 364 ? 29.825  15.315  -69.358  1.00 260.93 ? 364 SER C CB    1 
ATOM   8683  O  OG    . SER C 1 364 ? 30.890  15.298  -70.298  1.00 245.80 ? 364 SER C OG    1 
ATOM   8684  N  N     . GLY C 1 365 ? 29.169  16.297  -66.055  1.00 274.98 ? 365 GLY C N     1 
ATOM   8685  C  CA    . GLY C 1 365 ? 28.181  16.387  -65.030  1.00 278.14 ? 365 GLY C CA    1 
ATOM   8686  C  C     . GLY C 1 365 ? 27.435  15.106  -64.760  1.00 280.68 ? 365 GLY C C     1 
ATOM   8687  O  O     . GLY C 1 365 ? 27.628  14.102  -65.407  1.00 288.88 ? 365 GLY C O     1 
ATOM   8688  N  N     . PRO C 1 366 ? 26.570  15.144  -63.754  1.00 262.78 ? 366 PRO C N     1 
ATOM   8689  C  CA    . PRO C 1 366 ? 25.735  14.033  -63.355  1.00 247.71 ? 366 PRO C CA    1 
ATOM   8690  C  C     . PRO C 1 366 ? 24.669  13.611  -64.344  1.00 236.50 ? 366 PRO C C     1 
ATOM   8691  O  O     . PRO C 1 366 ? 24.217  12.484  -64.264  1.00 237.98 ? 366 PRO C O     1 
ATOM   8692  C  CB    . PRO C 1 366 ? 25.055  14.524  -62.069  1.00 244.54 ? 366 PRO C CB    1 
ATOM   8693  C  CG    . PRO C 1 366 ? 25.753  15.752  -61.624  1.00 249.74 ? 366 PRO C CG    1 
ATOM   8694  C  CD    . PRO C 1 366 ? 26.553  16.257  -62.797  1.00 257.44 ? 366 PRO C CD    1 
ATOM   8695  N  N     . SER C 1 367 ? 24.227  14.512  -65.228  1.00 234.50 ? 367 SER C N     1 
ATOM   8696  C  CA    . SER C 1 367 ? 23.096  14.278  -66.087  1.00 233.13 ? 367 SER C CA    1 
ATOM   8697  C  C     . SER C 1 367 ? 23.456  13.208  -67.109  1.00 221.07 ? 367 SER C C     1 
ATOM   8698  O  O     . SER C 1 367 ? 22.535  12.592  -67.697  1.00 192.91 ? 367 SER C O     1 
ATOM   8699  C  CB    . SER C 1 367 ? 22.704  15.569  -66.855  1.00 238.05 ? 367 SER C CB    1 
ATOM   8700  O  OG    . SER C 1 367 ? 23.730  15.948  -67.765  1.00 234.00 ? 367 SER C OG    1 
ATOM   8701  N  N     . ILE C 1 368 ? 24.761  12.978  -67.282  1.00 221.34 ? 368 ILE C N     1 
ATOM   8702  C  CA    . ILE C 1 368 ? 25.220  12.067  -68.309  1.00 221.26 ? 368 ILE C CA    1 
ATOM   8703  C  C     . ILE C 1 368 ? 24.782  10.625  -68.089  1.00 211.68 ? 368 ILE C C     1 
ATOM   8704  O  O     . ILE C 1 368 ? 25.130  9.792   -68.939  1.00 201.17 ? 368 ILE C O     1 
ATOM   8705  C  CB    . ILE C 1 368 ? 26.732  12.095  -68.501  1.00 226.47 ? 368 ILE C CB    1 
ATOM   8706  C  CG1   . ILE C 1 368 ? 27.475  11.521  -67.271  1.00 222.08 ? 368 ILE C CG1   1 
ATOM   8707  C  CG2   . ILE C 1 368 ? 27.221  13.473  -68.935  1.00 234.00 ? 368 ILE C CG2   1 
ATOM   8708  C  CD1   . ILE C 1 368 ? 28.064  10.136  -67.471  1.00 221.07 ? 368 ILE C CD1   1 
ATOM   8709  N  N     . VAL C 1 369 ? 24.084  10.308  -66.991  1.00 215.08 ? 369 VAL C N     1 
ATOM   8710  C  CA    . VAL C 1 369 ? 23.758  8.940   -66.704  1.00 222.34 ? 369 VAL C CA    1 
ATOM   8711  C  C     . VAL C 1 369 ? 22.884  8.416   -67.812  1.00 235.39 ? 369 VAL C C     1 
ATOM   8712  O  O     . VAL C 1 369 ? 23.128  7.356   -68.373  1.00 248.03 ? 369 VAL C O     1 
ATOM   8713  C  CB    . VAL C 1 369 ? 23.037  8.770   -65.371  1.00 223.52 ? 369 VAL C CB    1 
ATOM   8714  C  CG1   . VAL C 1 369 ? 22.761  7.297   -65.107  1.00 221.16 ? 369 VAL C CG1   1 
ATOM   8715  C  CG2   . VAL C 1 369 ? 23.881  9.326   -64.251  1.00 229.00 ? 369 VAL C CG2   1 
ATOM   8716  N  N     . HIS C 1 370 ? 21.880  9.194   -68.187  1.00 240.00 ? 370 HIS C N     1 
ATOM   8717  C  CA    . HIS C 1 370 ? 20.900  8.757   -69.192  1.00 249.74 ? 370 HIS C CA    1 
ATOM   8718  C  C     . HIS C 1 370 ? 21.435  8.721   -70.618  1.00 256.71 ? 370 HIS C C     1 
ATOM   8719  O  O     . HIS C 1 370 ? 21.146  7.822   -71.398  1.00 244.51 ? 370 HIS C O     1 
ATOM   8720  C  CB    . HIS C 1 370 ? 19.689  9.717   -69.151  1.00 257.45 ? 370 HIS C CB    1 
ATOM   8721  C  CG    . HIS C 1 370 ? 19.071  9.804   -67.789  1.00 274.23 ? 370 HIS C CG    1 
ATOM   8722  N  ND1   . HIS C 1 370 ? 18.388  8.752   -67.211  1.00 286.78 ? 370 HIS C ND1   1 
ATOM   8723  C  CD2   . HIS C 1 370 ? 19.022  10.817  -66.891  1.00 280.53 ? 370 HIS C CD2   1 
ATOM   8724  C  CE1   . HIS C 1 370 ? 17.955  9.106   -66.010  1.00 294.28 ? 370 HIS C CE1   1 
ATOM   8725  N  NE2   . HIS C 1 370 ? 18.317  10.362  -65.799  1.00 296.89 ? 370 HIS C NE2   1 
ATOM   8726  N  N     . ARG C 1 371 ? 22.211  9.735   -70.927  1.00 271.22 ? 371 ARG C N     1 
ATOM   8727  C  CA    . ARG C 1 371 ? 22.958  9.830   -72.171  1.00 275.60 ? 371 ARG C CA    1 
ATOM   8728  C  C     . ARG C 1 371 ? 23.692  8.568   -72.537  1.00 274.61 ? 371 ARG C C     1 
ATOM   8729  O  O     . ARG C 1 371 ? 23.558  8.050   -73.641  1.00 276.90 ? 371 ARG C O     1 
ATOM   8730  C  CB    . ARG C 1 371 ? 23.924  10.968  -71.970  1.00 270.24 ? 371 ARG C CB    1 
ATOM   8731  C  CG    . ARG C 1 371 ? 24.829  11.292  -73.118  1.00 256.27 ? 371 ARG C CG    1 
ATOM   8732  C  CD    . ARG C 1 371 ? 25.649  12.499  -72.700  1.00 247.59 ? 371 ARG C CD    1 
ATOM   8733  N  NE    . ARG C 1 371 ? 26.646  12.909  -73.703  1.00 247.40 ? 371 ARG C NE    1 
ATOM   8734  C  CZ    . ARG C 1 371 ? 27.428  13.993  -73.604  1.00 251.56 ? 371 ARG C CZ    1 
ATOM   8735  N  NH1   . ARG C 1 371 ? 27.327  14.783  -72.537  1.00 242.23 ? 371 ARG C NH1   1 
ATOM   8736  N  NH2   . ARG C 1 371 ? 28.319  14.300  -74.574  1.00 265.55 ? 371 ARG C NH2   1 
ATOM   8737  N  N     . LYS C 1 372 ? 24.459  8.048   -71.597  1.00 266.73 ? 372 LYS C N     1 
ATOM   8738  C  CA    . LYS C 1 372 ? 25.300  6.907   -71.911  1.00 256.41 ? 372 LYS C CA    1 
ATOM   8739  C  C     . LYS C 1 372 ? 24.600  5.567   -71.750  1.00 253.84 ? 372 LYS C C     1 
ATOM   8740  O  O     . LYS C 1 372 ? 24.596  4.742   -72.669  1.00 252.69 ? 372 LYS C O     1 
ATOM   8741  C  CB    . LYS C 1 372 ? 26.577  6.904   -71.059  1.00 252.86 ? 372 LYS C CB    1 
ATOM   8742  C  CG    . LYS C 1 372 ? 27.642  5.923   -71.572  1.00 252.98 ? 372 LYS C CG    1 
ATOM   8743  C  CD    . LYS C 1 372 ? 28.919  5.942   -70.729  1.00 257.37 ? 372 LYS C CD    1 
ATOM   8744  C  CE    . LYS C 1 372 ? 29.797  7.166   -70.978  1.00 259.88 ? 372 LYS C CE    1 
ATOM   8745  N  NZ    . LYS C 1 372 ? 30.556  7.061   -72.262  1.00 262.92 ? 372 LYS C NZ    1 
ATOM   8746  N  N     . CYS C 1 373 ? 24.047  5.329   -70.567  1.00 263.90 ? 373 CYS C N     1 
ATOM   8747  C  CA    . CYS C 1 373 ? 23.523  4.035   -70.256  1.00 273.37 ? 373 CYS C CA    1 
ATOM   8748  C  C     . CYS C 1 373 ? 22.031  4.102   -70.384  1.00 288.17 ? 373 CYS C C     1 
ATOM   8749  O  O     . CYS C 1 373 ? 21.442  5.180   -70.394  1.00 278.72 ? 373 CYS C O     1 
ATOM   8750  C  CB    . CYS C 1 373 ? 23.990  3.614   -68.856  1.00 269.98 ? 373 CYS C CB    1 
ATOM   8751  S  SG    . CYS C 1 373 ? 23.202  4.488   -67.506  1.00 272.98 ? 373 CYS C SG    1 
ATOM   8752  N  N     . PHE C 1 374 ? 21.434  2.920   -70.517  1.00 311.14 ? 374 PHE C N     1 
ATOM   8753  C  CA    . PHE C 1 374 ? 20.009  2.717   -70.491  1.00 333.06 ? 374 PHE C CA    1 
ATOM   8754  C  C     . PHE C 1 374 ? 19.390  2.882   -69.080  1.00 346.77 ? 374 PHE C C     1 
ATOM   8755  O  O     . PHE C 1 374 ? 18.217  3.220   -68.923  1.00 355.21 ? 374 PHE C O     1 
ATOM   8756  C  CB    . PHE C 1 374 ? 19.745  1.305   -71.037  1.00 333.75 ? 374 PHE C CB    1 
ATOM   8757  C  CG    . PHE C 1 374 ? 18.309  0.922   -71.105  1.00 336.40 ? 374 PHE C CG    1 
ATOM   8758  C  CD1   . PHE C 1 374 ? 17.523  1.318   -72.168  1.00 336.02 ? 374 PHE C CD1   1 
ATOM   8759  C  CD2   . PHE C 1 374 ? 17.746  0.108   -70.137  1.00 336.25 ? 374 PHE C CD2   1 
ATOM   8760  C  CE1   . PHE C 1 374 ? 16.201  0.944   -72.251  1.00 332.01 ? 374 PHE C CE1   1 
ATOM   8761  C  CE2   . PHE C 1 374 ? 16.423  -0.267  -70.216  1.00 332.01 ? 374 PHE C CE2   1 
ATOM   8762  C  CZ    . PHE C 1 374 ? 15.649  0.151   -71.273  1.00 332.01 ? 374 PHE C CZ    1 
ATOM   8763  O  OXT   . PHE C 1 374 ? 20.072  2.714   -68.067  1.00 353.03 ? 374 PHE C OXT   1 
ATOM   8764  N  N     . GLU D 1 1   ? -40.438 -26.315 22.225   1.00 285.29 ? 1   GLU D N     1 
ATOM   8765  C  CA    . GLU D 1 1   ? -40.519 -24.884 21.778   1.00 278.59 ? 1   GLU D CA    1 
ATOM   8766  C  C     . GLU D 1 1   ? -39.906 -24.708 20.406   1.00 265.93 ? 1   GLU D C     1 
ATOM   8767  O  O     . GLU D 1 1   ? -39.096 -25.530 19.964   1.00 266.70 ? 1   GLU D O     1 
ATOM   8768  C  CB    . GLU D 1 1   ? -39.894 -23.935 22.810   1.00 281.48 ? 1   GLU D CB    1 
ATOM   8769  C  CG    . GLU D 1 1   ? -38.413 -24.132 23.049   1.00 284.33 ? 1   GLU D CG    1 
ATOM   8770  C  CD    . GLU D 1 1   ? -38.079 -25.154 24.125   1.00 274.70 ? 1   GLU D CD    1 
ATOM   8771  O  OE1   . GLU D 1 1   ? -38.911 -26.030 24.437   1.00 265.21 ? 1   GLU D OE1   1 
ATOM   8772  O  OE2   . GLU D 1 1   ? -36.959 -25.077 24.659   1.00 270.88 ? 1   GLU D OE2   1 
ATOM   8773  N  N     . GLU D 1 2   ? -40.317 -23.646 19.742   1.00 257.14 ? 2   GLU D N     1 
ATOM   8774  C  CA    . GLU D 1 2   ? -39.786 -23.328 18.434   1.00 258.30 ? 2   GLU D CA    1 
ATOM   8775  C  C     . GLU D 1 2   ? -38.559 -22.440 18.613   1.00 265.08 ? 2   GLU D C     1 
ATOM   8776  O  O     . GLU D 1 2   ? -38.515 -21.649 19.556   1.00 267.77 ? 2   GLU D O     1 
ATOM   8777  C  CB    . GLU D 1 2   ? -40.833 -22.623 17.585   1.00 258.54 ? 2   GLU D CB    1 
ATOM   8778  C  CG    . GLU D 1 2   ? -41.929 -23.521 17.031   1.00 257.81 ? 2   GLU D CG    1 
ATOM   8779  C  CD    . GLU D 1 2   ? -42.830 -22.791 16.081   1.00 254.08 ? 2   GLU D CD    1 
ATOM   8780  O  OE1   . GLU D 1 2   ? -42.911 -21.546 16.145   1.00 266.94 ? 2   GLU D OE1   1 
ATOM   8781  O  OE2   . GLU D 1 2   ? -43.469 -23.468 15.260   1.00 240.73 ? 2   GLU D OE2   1 
ATOM   8782  N  N     . GLU D 1 3   ? -37.556 -22.614 17.747   1.00 279.90 ? 3   GLU D N     1 
ATOM   8783  C  CA    . GLU D 1 3   ? -36.274 -21.875 17.790   1.00 291.17 ? 3   GLU D CA    1 
ATOM   8784  C  C     . GLU D 1 3   ? -35.379 -22.051 19.044   1.00 271.96 ? 3   GLU D C     1 
ATOM   8785  O  O     . GLU D 1 3   ? -34.207 -21.664 19.007   1.00 255.86 ? 3   GLU D O     1 
ATOM   8786  C  CB    . GLU D 1 3   ? -36.489 -20.399 17.473   1.00 315.31 ? 3   GLU D CB    1 
ATOM   8787  C  CG    . GLU D 1 3   ? -37.079 -20.134 16.089   1.00 331.48 ? 3   GLU D CG    1 
ATOM   8788  C  CD    . GLU D 1 3   ? -37.336 -18.682 15.911   1.00 335.13 ? 3   GLU D CD    1 
ATOM   8789  O  OE1   . GLU D 1 3   ? -37.298 -17.997 16.945   1.00 347.99 ? 3   GLU D OE1   1 
ATOM   8790  O  OE2   . GLU D 1 3   ? -37.569 -18.231 14.770   1.00 325.48 ? 3   GLU D OE2   1 
ATOM   8791  N  N     . ILE D 1 4   ? -35.921 -22.620 20.138   1.00 257.83 ? 4   ILE D N     1 
ATOM   8792  C  CA    . ILE D 1 4   ? -35.209 -22.924 21.378   1.00 240.32 ? 4   ILE D CA    1 
ATOM   8793  C  C     . ILE D 1 4   ? -34.697 -21.690 22.146   1.00 196.08 ? 4   ILE D C     1 
ATOM   8794  O  O     . ILE D 1 4   ? -33.997 -21.785 23.141   1.00 192.01 ? 4   ILE D O     1 
ATOM   8795  C  CB    . ILE D 1 4   ? -34.083 -23.943 21.123   1.00 257.84 ? 4   ILE D CB    1 
ATOM   8796  C  CG1   . ILE D 1 4   ? -34.557 -25.055 20.189   1.00 261.42 ? 4   ILE D CG1   1 
ATOM   8797  C  CG2   . ILE D 1 4   ? -33.620 -24.540 22.424   1.00 263.48 ? 4   ILE D CG2   1 
ATOM   8798  C  CD1   . ILE D 1 4   ? -35.766 -25.828 20.673   1.00 263.10 ? 4   ILE D CD1   1 
ATOM   8799  N  N     . ALA D 1 5   ? -35.080 -20.513 21.695   1.00 158.95 ? 5   ALA D N     1 
ATOM   8800  C  CA    . ALA D 1 5   ? -34.331 -19.345 22.054   1.00 144.90 ? 5   ALA D CA    1 
ATOM   8801  C  C     . ALA D 1 5   ? -32.825 -19.463 21.706   1.00 139.52 ? 5   ALA D C     1 
ATOM   8802  O  O     . ALA D 1 5   ? -32.426 -20.197 20.827   1.00 135.92 ? 5   ALA D O     1 
ATOM   8803  C  CB    . ALA D 1 5   ? -34.567 -18.969 23.526   1.00 136.93 ? 5   ALA D CB    1 
ATOM   8804  N  N     . ALA D 1 6   ? -32.002 -18.652 22.342   1.00 129.79 ? 6   ALA D N     1 
ATOM   8805  C  CA    . ALA D 1 6   ? -30.537 -18.753 22.276   1.00 111.12 ? 6   ALA D CA    1 
ATOM   8806  C  C     . ALA D 1 6   ? -29.956 -17.858 23.356   1.00 91.46  ? 6   ALA D C     1 
ATOM   8807  O  O     . ALA D 1 6   ? -30.603 -16.954 23.924   1.00 96.78  ? 6   ALA D O     1 
ATOM   8808  C  CB    . ALA D 1 6   ? -29.977 -18.322 20.915   1.00 119.85 ? 6   ALA D CB    1 
ATOM   8809  N  N     . LEU D 1 7   ? -28.727 -18.112 23.720   1.00 86.79  ? 7   LEU D N     1 
ATOM   8810  C  CA    . LEU D 1 7   ? -28.136 -17.420 24.856   1.00 91.89  ? 7   LEU D CA    1 
ATOM   8811  C  C     . LEU D 1 7   ? -27.041 -16.564 24.350   1.00 95.53  ? 7   LEU D C     1 
ATOM   8812  O  O     . LEU D 1 7   ? -26.397 -16.919 23.376   1.00 122.08 ? 7   LEU D O     1 
ATOM   8813  C  CB    . LEU D 1 7   ? -27.530 -18.407 25.874   1.00 103.81 ? 7   LEU D CB    1 
ATOM   8814  C  CG    . LEU D 1 7   ? -28.565 -19.134 26.739   1.00 122.77 ? 7   LEU D CG    1 
ATOM   8815  C  CD1   . LEU D 1 7   ? -27.927 -20.149 27.676   1.00 135.53 ? 7   LEU D CD1   1 
ATOM   8816  C  CD2   . LEU D 1 7   ? -29.515 -18.156 27.434   1.00 118.39 ? 7   LEU D CD2   1 
ATOM   8817  N  N     . VAL D 1 8   ? -26.823 -15.421 24.981   1.00 82.01  ? 8   VAL D N     1 
ATOM   8818  C  CA    . VAL D 1 8   ? -25.786 -14.500 24.491   1.00 74.63  ? 8   VAL D CA    1 
ATOM   8819  C  C     . VAL D 1 8   ? -24.937 -14.033 25.643   1.00 72.94  ? 8   VAL D C     1 
ATOM   8820  O  O     . VAL D 1 8   ? -25.488 -13.651 26.678   1.00 87.76  ? 8   VAL D O     1 
ATOM   8821  C  CB    . VAL D 1 8   ? -26.415 -13.307 23.766   1.00 69.24  ? 8   VAL D CB    1 
ATOM   8822  C  CG1   . VAL D 1 8   ? -25.293 -12.447 23.225   1.00 72.16  ? 8   VAL D CG1   1 
ATOM   8823  C  CG2   . VAL D 1 8   ? -27.352 -13.771 22.654   1.00 75.14  ? 8   VAL D CG2   1 
ATOM   8824  N  N     . ILE D 1 9   ? -23.619 -14.101 25.511   1.00 69.20  ? 9   ILE D N     1 
ATOM   8825  C  CA    . ILE D 1 9   ? -22.758 -13.567 26.549   1.00 79.26  ? 9   ILE D CA    1 
ATOM   8826  C  C     . ILE D 1 9   ? -21.624 -12.671 26.042   1.00 92.41  ? 9   ILE D C     1 
ATOM   8827  O  O     . ILE D 1 9   ? -20.915 -13.046 25.136   1.00 106.19 ? 9   ILE D O     1 
ATOM   8828  C  CB    . ILE D 1 9   ? -22.183 -14.727 27.368   1.00 83.40  ? 9   ILE D CB    1 
ATOM   8829  C  CG1   . ILE D 1 9   ? -23.336 -15.614 27.834   1.00 98.36  ? 9   ILE D CG1   1 
ATOM   8830  C  CG2   . ILE D 1 9   ? -21.338 -14.152 28.508   1.00 93.31  ? 9   ILE D CG2   1 
ATOM   8831  C  CD1   . ILE D 1 9   ? -22.983 -16.624 28.897   1.00 106.33 ? 9   ILE D CD1   1 
ATOM   8832  N  N     . ASP D 1 10  ? -21.556 -11.462 26.610   1.00 103.58 ? 10  ASP D N     1 
ATOM   8833  C  CA    . ASP D 1 10  ? -20.505 -10.522 26.283   1.00 121.61 ? 10  ASP D CA    1 
ATOM   8834  C  C     . ASP D 1 10  ? -19.544 -10.584 27.491   1.00 126.44 ? 10  ASP D C     1 
ATOM   8835  O  O     . ASP D 1 10  ? -19.873 -10.216 28.655   1.00 129.34 ? 10  ASP D O     1 
ATOM   8836  C  CB    . ASP D 1 10  ? -21.028 -9.121  26.011   1.00 139.60 ? 10  ASP D CB    1 
ATOM   8837  C  CG    . ASP D 1 10  ? -19.934 -8.082  25.981   1.00 152.21 ? 10  ASP D CG    1 
ATOM   8838  O  OD1   . ASP D 1 10  ? -18.759 -8.378  26.273   1.00 170.20 ? 10  ASP D OD1   1 
ATOM   8839  O  OD2   . ASP D 1 10  ? -20.204 -6.925  25.650   1.00 146.74 ? 10  ASP D OD2   1 
ATOM   8840  N  N     . ASN D 1 11  ? -18.358 -11.123 27.234   1.00 120.77 ? 11  ASN D N     1 
ATOM   8841  C  CA    . ASN D 1 11  ? -17.234 -10.957 28.126   1.00 116.16 ? 11  ASN D CA    1 
ATOM   8842  C  C     . ASN D 1 11  ? -15.996 -10.228 27.570   1.00 131.29 ? 11  ASN D C     1 
ATOM   8843  O  O     . ASN D 1 11  ? -14.945 -10.811 27.290   1.00 148.23 ? 11  ASN D O     1 
ATOM   8844  C  CB    . ASN D 1 11  ? -16.793 -12.294 28.639   1.00 112.69 ? 11  ASN D CB    1 
ATOM   8845  C  CG    . ASN D 1 11  ? -17.454 -12.619 29.918   1.00 109.80 ? 11  ASN D CG    1 
ATOM   8846  O  OD1   . ASN D 1 11  ? -17.911 -11.711 30.601   1.00 89.89  ? 11  ASN D OD1   1 
ATOM   8847  N  ND2   . ASN D 1 11  ? -17.506 -13.897 30.265   1.00 115.96 ? 11  ASN D ND2   1 
ATOM   8848  N  N     . GLY D 1 12  ? -16.098 -8.914  27.456   1.00 142.37 ? 12  GLY D N     1 
ATOM   8849  C  CA    . GLY D 1 12  ? -14.875 -8.058  27.543   1.00 139.53 ? 12  GLY D CA    1 
ATOM   8850  C  C     . GLY D 1 12  ? -14.632 -8.075  29.014   1.00 125.47 ? 12  GLY D C     1 
ATOM   8851  O  O     . GLY D 1 12  ? -15.571 -8.360  29.793   1.00 124.62 ? 12  GLY D O     1 
ATOM   8852  N  N     . SER D 1 13  ? -13.402 -7.747  29.413   1.00 118.77 ? 13  SER D N     1 
ATOM   8853  C  CA    . SER D 1 13  ? -13.065 -7.671  30.828   1.00 120.06 ? 13  SER D CA    1 
ATOM   8854  C  C     . SER D 1 13  ? -14.083 -6.793  31.548   1.00 120.48 ? 13  SER D C     1 
ATOM   8855  O  O     . SER D 1 13  ? -14.666 -5.892  30.944   1.00 101.08 ? 13  SER D O     1 
ATOM   8856  C  CB    . SER D 1 13  ? -11.684 -7.069  31.112   1.00 129.89 ? 13  SER D CB    1 
ATOM   8857  O  OG    . SER D 1 13  ? -10.657 -7.799  30.476   1.00 137.99 ? 13  SER D OG    1 
ATOM   8858  N  N     . GLY D 1 14  ? -14.287 -7.079  32.828   1.00 132.78 ? 14  GLY D N     1 
ATOM   8859  C  CA    . GLY D 1 14  ? -14.976 -6.154  33.739   1.00 141.12 ? 14  GLY D CA    1 
ATOM   8860  C  C     . GLY D 1 14  ? -16.385 -6.549  33.992   1.00 140.41 ? 14  GLY D C     1 
ATOM   8861  O  O     . GLY D 1 14  ? -16.819 -6.652  35.134   1.00 152.40 ? 14  GLY D O     1 
ATOM   8862  N  N     . MET D 1 15  ? -17.134 -6.816  32.928   1.00 134.88 ? 15  MET D N     1 
ATOM   8863  C  CA    . MET D 1 15  ? -18.543 -7.139  33.112   1.00 128.33 ? 15  MET D CA    1 
ATOM   8864  C  C     . MET D 1 15  ? -18.949 -8.293  32.269   1.00 124.80 ? 15  MET D C     1 
ATOM   8865  O  O     . MET D 1 15  ? -18.570 -8.383  31.113   1.00 117.78 ? 15  MET D O     1 
ATOM   8866  C  CB    . MET D 1 15  ? -19.456 -5.967  32.711   1.00 135.89 ? 15  MET D CB    1 
ATOM   8867  C  CG    . MET D 1 15  ? -19.320 -4.738  33.615   1.00 160.28 ? 15  MET D CG    1 
ATOM   8868  S  SD    . MET D 1 15  ? -20.416 -3.372  33.241   1.00 200.37 ? 15  MET D SD    1 
ATOM   8869  C  CE    . MET D 1 15  ? -21.858 -3.976  34.095   1.00 199.72 ? 15  MET D CE    1 
ATOM   8870  N  N     . CYS D 1 16  ? -19.788 -9.155  32.842   1.00 136.15 ? 16  CYS D N     1 
ATOM   8871  C  CA    . CYS D 1 16  ? -20.465 -10.176 32.027   1.00 128.27 ? 16  CYS D CA    1 
ATOM   8872  C  C     . CYS D 1 16  ? -21.849 -9.704  31.740   1.00 103.15 ? 16  CYS D C     1 
ATOM   8873  O  O     . CYS D 1 16  ? -22.656 -9.482  32.664   1.00 97.00  ? 16  CYS D O     1 
ATOM   8874  C  CB    . CYS D 1 16  ? -20.704 -11.515 32.752   1.00 144.03 ? 16  CYS D CB    1 
ATOM   8875  S  SG    . CYS D 1 16  ? -19.381 -12.699 32.584   1.00 157.61 ? 16  CYS D SG    1 
ATOM   8876  N  N     . LYS D 1 17  ? -22.211 -9.644  30.464   1.00 93.15  ? 17  LYS D N     1 
ATOM   8877  C  CA    . LYS D 1 17  ? -23.532 -9.134  30.092   1.00 96.39  ? 17  LYS D CA    1 
ATOM   8878  C  C     . LYS D 1 17  ? -24.185 -10.298 29.415   1.00 88.82  ? 17  LYS D C     1 
ATOM   8879  O  O     . LYS D 1 17  ? -23.687 -10.758 28.443   1.00 84.41  ? 17  LYS D O     1 
ATOM   8880  C  CB    . LYS D 1 17  ? -23.476 -7.869  29.197   1.00 102.39 ? 17  LYS D CB    1 
ATOM   8881  C  CG    . LYS D 1 17  ? -22.969 -6.600  29.893   1.00 112.48 ? 17  LYS D CG    1 
ATOM   8882  C  CD    . LYS D 1 17  ? -22.763 -5.423  28.953   1.00 116.65 ? 17  LYS D CD    1 
ATOM   8883  C  CE    . LYS D 1 17  ? -21.448 -5.461  28.171   1.00 134.48 ? 17  LYS D CE    1 
ATOM   8884  N  NZ    . LYS D 1 17  ? -21.134 -4.137  27.603   1.00 130.65 ? 17  LYS D NZ    1 
ATOM   8885  N  N     . ALA D 1 18  ? -25.187 -10.881 30.036   1.00 86.10  ? 18  ALA D N     1 
ATOM   8886  C  CA    . ALA D 1 18  ? -25.735 -12.140 29.525   1.00 81.51  ? 18  ALA D CA    1 
ATOM   8887  C  C     . ALA D 1 18  ? -27.238 -12.087 29.596   1.00 81.50  ? 18  ALA D C     1 
ATOM   8888  O  O     . ALA D 1 18  ? -27.850 -11.351 30.382   1.00 68.37  ? 18  ALA D O     1 
ATOM   8889  C  CB    . ALA D 1 18  ? -25.278 -13.349 30.324   1.00 81.15  ? 18  ALA D CB    1 
ATOM   8890  N  N     . GLY D 1 19  ? -27.863 -12.866 28.713   1.00 94.92  ? 19  GLY D N     1 
ATOM   8891  C  CA    . GLY D 1 19  ? -29.300 -12.902 28.682   1.00 109.69 ? 19  GLY D CA    1 
ATOM   8892  C  C     . GLY D 1 19  ? -29.752 -13.712 27.503   1.00 109.23 ? 19  GLY D C     1 
ATOM   8893  O  O     . GLY D 1 19  ? -28.922 -14.278 26.760   1.00 110.41 ? 19  GLY D O     1 
ATOM   8894  N  N     . PHE D 1 20  ? -31.064 -13.757 27.319   1.00 103.55 ? 20  PHE D N     1 
ATOM   8895  C  CA    . PHE D 1 20  ? -31.623 -14.457 26.175   1.00 108.66 ? 20  PHE D CA    1 
ATOM   8896  C  C     . PHE D 1 20  ? -31.555 -13.674 24.894   1.00 98.60  ? 20  PHE D C     1 
ATOM   8897  O  O     . PHE D 1 20  ? -32.005 -12.549 24.784   1.00 92.05  ? 20  PHE D O     1 
ATOM   8898  C  CB    . PHE D 1 20  ? -33.034 -14.853 26.447   1.00 111.59 ? 20  PHE D CB    1 
ATOM   8899  C  CG    . PHE D 1 20  ? -33.160 -15.792 27.597   1.00 122.59 ? 20  PHE D CG    1 
ATOM   8900  C  CD1   . PHE D 1 20  ? -32.915 -17.149 27.433   1.00 130.91 ? 20  PHE D CD1   1 
ATOM   8901  C  CD2   . PHE D 1 20  ? -33.529 -15.334 28.835   1.00 131.75 ? 20  PHE D CD2   1 
ATOM   8902  C  CE1   . PHE D 1 20  ? -33.033 -18.015 28.482   1.00 148.96 ? 20  PHE D CE1   1 
ATOM   8903  C  CE2   . PHE D 1 20  ? -33.668 -16.202 29.897   1.00 159.18 ? 20  PHE D CE2   1 
ATOM   8904  C  CZ    . PHE D 1 20  ? -33.419 -17.547 29.720   1.00 171.79 ? 20  PHE D CZ    1 
ATOM   8905  N  N     . ALA D 1 21  ? -31.106 -14.347 23.841   1.00 102.97 ? 21  ALA D N     1 
ATOM   8906  C  CA    . ALA D 1 21  ? -31.221 -13.810 22.503   1.00 102.71 ? 21  ALA D CA    1 
ATOM   8907  C  C     . ALA D 1 21  ? -32.675 -13.615 22.223   1.00 111.66 ? 21  ALA D C     1 
ATOM   8908  O  O     . ALA D 1 21  ? -33.474 -14.475 22.555   1.00 95.75  ? 21  ALA D O     1 
ATOM   8909  C  CB    . ALA D 1 21  ? -30.707 -14.796 21.504   1.00 92.13  ? 21  ALA D CB    1 
ATOM   8910  N  N     . GLY D 1 22  ? -33.029 -12.507 21.581   1.00 134.37 ? 22  GLY D N     1 
ATOM   8911  C  CA    . GLY D 1 22  ? -34.402 -12.249 21.261   1.00 159.66 ? 22  GLY D CA    1 
ATOM   8912  C  C     . GLY D 1 22  ? -35.009 -11.285 22.266   1.00 179.78 ? 22  GLY D C     1 
ATOM   8913  O  O     . GLY D 1 22  ? -36.209 -11.200 22.346   1.00 207.96 ? 22  GLY D O     1 
ATOM   8914  N  N     . ASP D 1 23  ? -34.181 -10.608 23.054   1.00 159.09 ? 23  ASP D N     1 
ATOM   8915  C  CA    . ASP D 1 23  ? -34.680 -9.632  23.978   1.00 143.21 ? 23  ASP D CA    1 
ATOM   8916  C  C     . ASP D 1 23  ? -33.829 -8.394  23.807   1.00 127.28 ? 23  ASP D C     1 
ATOM   8917  O  O     . ASP D 1 23  ? -32.727 -8.451  23.295   1.00 101.28 ? 23  ASP D O     1 
ATOM   8918  C  CB    . ASP D 1 23  ? -34.633 -10.144 25.413   1.00 150.02 ? 23  ASP D CB    1 
ATOM   8919  C  CG    . ASP D 1 23  ? -35.818 -11.023 25.741   1.00 168.14 ? 23  ASP D CG    1 
ATOM   8920  O  OD1   . ASP D 1 23  ? -36.834 -10.846 25.048   1.00 183.88 ? 23  ASP D OD1   1 
ATOM   8921  O  OD2   . ASP D 1 23  ? -35.761 -11.883 26.663   1.00 194.83 ? 23  ASP D OD2   1 
ATOM   8922  N  N     . ASP D 1 24  ? -34.406 -7.251  24.155   1.00 135.30 ? 24  ASP D N     1 
ATOM   8923  C  CA    . ASP D 1 24  ? -33.766 -5.957  23.933   1.00 131.60 ? 24  ASP D CA    1 
ATOM   8924  C  C     . ASP D 1 24  ? -32.789 -5.614  25.011   1.00 121.00 ? 24  ASP D C     1 
ATOM   8925  O  O     . ASP D 1 24  ? -32.008 -4.734  24.767   1.00 118.71 ? 24  ASP D O     1 
ATOM   8926  C  CB    . ASP D 1 24  ? -34.795 -4.795  23.760   1.00 151.96 ? 24  ASP D CB    1 
ATOM   8927  C  CG    . ASP D 1 24  ? -35.898 -4.780  24.846   1.00 181.65 ? 24  ASP D CG    1 
ATOM   8928  O  OD1   . ASP D 1 24  ? -35.956 -5.713  25.687   1.00 186.05 ? 24  ASP D OD1   1 
ATOM   8929  O  OD2   . ASP D 1 24  ? -36.722 -3.840  24.836   1.00 202.03 ? 24  ASP D OD2   1 
ATOM   8930  N  N     . ALA D 1 25  ? -32.839 -6.252  26.183   1.00 111.23 ? 25  ALA D N     1 
ATOM   8931  C  CA    . ALA D 1 25  ? -31.805 -6.060  27.185   1.00 110.49 ? 25  ALA D CA    1 
ATOM   8932  C  C     . ALA D 1 25  ? -31.467 -7.387  27.829   1.00 112.44 ? 25  ALA D C     1 
ATOM   8933  O  O     . ALA D 1 25  ? -32.309 -8.269  27.994   1.00 126.45 ? 25  ALA D O     1 
ATOM   8934  C  CB    . ALA D 1 25  ? -32.252 -5.087  28.272   1.00 117.90 ? 25  ALA D CB    1 
ATOM   8935  N  N     . PRO D 1 26  ? -30.225 -7.522  28.262   1.00 89.58  ? 26  PRO D N     1 
ATOM   8936  C  CA    . PRO D 1 26  ? -29.790 -8.683  28.973   1.00 89.38  ? 26  PRO D CA    1 
ATOM   8937  C  C     . PRO D 1 26  ? -30.409 -8.761  30.342   1.00 105.17 ? 26  PRO D C     1 
ATOM   8938  O  O     . PRO D 1 26  ? -30.514 -7.735  31.025   1.00 116.08 ? 26  PRO D O     1 
ATOM   8939  C  CB    . PRO D 1 26  ? -28.295 -8.464  29.176   1.00 82.73  ? 26  PRO D CB    1 
ATOM   8940  C  CG    . PRO D 1 26  ? -28.071 -7.028  28.906   1.00 79.96  ? 26  PRO D CG    1 
ATOM   8941  C  CD    . PRO D 1 26  ? -29.191 -6.490  28.112   1.00 75.34  ? 26  PRO D CD    1 
ATOM   8942  N  N     . ARG D 1 27  ? -30.613 -9.974  30.822   1.00 116.60 ? 27  ARG D N     1 
ATOM   8943  C  CA    . ARG D 1 27  ? -31.162 -10.187 32.161   1.00 123.99 ? 27  ARG D CA    1 
ATOM   8944  C  C     . ARG D 1 27  ? -30.142 -9.902  33.206   1.00 105.44 ? 27  ARG D C     1 
ATOM   8945  O  O     . ARG D 1 27  ? -30.426 -9.290  34.237   1.00 107.44 ? 27  ARG D O     1 
ATOM   8946  C  CB    . ARG D 1 27  ? -31.643 -11.622 32.393   1.00 149.93 ? 27  ARG D CB    1 
ATOM   8947  C  CG    . ARG D 1 27  ? -32.833 -11.981 31.524   1.00 161.78 ? 27  ARG D CG    1 
ATOM   8948  C  CD    . ARG D 1 27  ? -34.199 -11.620 32.120   1.00 165.22 ? 27  ARG D CD    1 
ATOM   8949  N  NE    . ARG D 1 27  ? -35.267 -12.175 31.280   1.00 185.13 ? 27  ARG D NE    1 
ATOM   8950  C  CZ    . ARG D 1 27  ? -35.616 -11.695 30.079   1.00 210.96 ? 27  ARG D CZ    1 
ATOM   8951  N  NH1   . ARG D 1 27  ? -34.969 -10.641 29.577   1.00 221.59 ? 27  ARG D NH1   1 
ATOM   8952  N  NH2   . ARG D 1 27  ? -36.608 -12.260 29.349   1.00 219.62 ? 27  ARG D NH2   1 
ATOM   8953  N  N     . ALA D 1 28  ? -28.948 -10.439 33.008   1.00 93.63  ? 28  ALA D N     1 
ATOM   8954  C  CA    . ALA D 1 28  ? -27.948 -10.355 34.094   1.00 109.73 ? 28  ALA D CA    1 
ATOM   8955  C  C     . ALA D 1 28  ? -26.751 -9.608  33.598   1.00 107.87 ? 28  ALA D C     1 
ATOM   8956  O  O     . ALA D 1 28  ? -26.223 -9.935  32.554   1.00 99.95  ? 28  ALA D O     1 
ATOM   8957  C  CB    . ALA D 1 28  ? -27.473 -11.734 34.536   1.00 135.37 ? 28  ALA D CB    1 
ATOM   8958  N  N     . VAL D 1 29  ? -26.294 -8.645  34.398   1.00 110.12 ? 29  VAL D N     1 
ATOM   8959  C  CA    . VAL D 1 29  ? -25.054 -7.942  34.105   1.00 115.98 ? 29  VAL D CA    1 
ATOM   8960  C  C     . VAL D 1 29  ? -24.352 -7.755  35.409   1.00 109.54 ? 29  VAL D C     1 
ATOM   8961  O  O     . VAL D 1 29  ? -24.892 -7.150  36.343   1.00 110.15 ? 29  VAL D O     1 
ATOM   8962  C  CB    . VAL D 1 29  ? -25.267 -6.564  33.465   1.00 121.02 ? 29  VAL D CB    1 
ATOM   8963  C  CG1   . VAL D 1 29  ? -25.876 -6.747  32.084   1.00 137.56 ? 29  VAL D CG1   1 
ATOM   8964  C  CG2   . VAL D 1 29  ? -26.198 -5.685  34.274   1.00 121.69 ? 29  VAL D CG2   1 
ATOM   8965  N  N     . PHE D 1 30  ? -23.147 -8.320  35.559   1.00 100.75 ? 30  PHE D N     1 
ATOM   8966  C  CA    . PHE D 1 30  ? -22.455 -8.255  36.837   1.00 98.76  ? 30  PHE D CA    1 
ATOM   8967  C  C     . PHE D 1 30  ? -20.970 -8.208  36.563   1.00 88.98  ? 30  PHE D C     1 
ATOM   8968  O  O     . PHE D 1 30  ? -20.493 -8.566  35.486   1.00 88.83  ? 30  PHE D O     1 
ATOM   8969  C  CB    . PHE D 1 30  ? -22.788 -9.454  37.722   1.00 103.28 ? 30  PHE D CB    1 
ATOM   8970  C  CG    . PHE D 1 30  ? -22.466 -10.733 37.051   1.00 107.07 ? 30  PHE D CG    1 
ATOM   8971  C  CD1   . PHE D 1 30  ? -21.205 -11.249 37.107   1.00 111.67 ? 30  PHE D CD1   1 
ATOM   8972  C  CD2   . PHE D 1 30  ? -23.417 -11.387 36.280   1.00 103.41 ? 30  PHE D CD2   1 
ATOM   8973  C  CE1   . PHE D 1 30  ? -20.876 -12.432 36.477   1.00 111.22 ? 30  PHE D CE1   1 
ATOM   8974  C  CE2   . PHE D 1 30  ? -23.117 -12.568 35.647   1.00 106.16 ? 30  PHE D CE2   1 
ATOM   8975  C  CZ    . PHE D 1 30  ? -21.839 -13.088 35.745   1.00 119.64 ? 30  PHE D CZ    1 
ATOM   8976  N  N     . PRO D 1 31  ? -20.222 -7.789  37.567   1.00 95.56  ? 31  PRO D N     1 
ATOM   8977  C  CA    . PRO D 1 31  ? -18.785 -7.659  37.339   1.00 98.24  ? 31  PRO D CA    1 
ATOM   8978  C  C     . PRO D 1 31  ? -18.104 -9.029  37.248   1.00 87.52  ? 31  PRO D C     1 
ATOM   8979  O  O     . PRO D 1 31  ? -18.428 -9.926  37.975   1.00 72.41  ? 31  PRO D O     1 
ATOM   8980  C  CB    . PRO D 1 31  ? -18.308 -6.827  38.539   1.00 111.36 ? 31  PRO D CB    1 
ATOM   8981  C  CG    . PRO D 1 31  ? -19.414 -6.966  39.521   1.00 115.74 ? 31  PRO D CG    1 
ATOM   8982  C  CD    . PRO D 1 31  ? -20.641 -6.980  38.715   1.00 107.11 ? 31  PRO D CD    1 
ATOM   8983  N  N     . SER D 1 32  ? -17.109 -9.153  36.368   1.00 81.44  ? 32  SER D N     1 
ATOM   8984  C  CA    . SER D 1 32  ? -16.408 -10.428 36.164   1.00 79.14  ? 32  SER D CA    1 
ATOM   8985  C  C     . SER D 1 32  ? -15.280 -10.415 37.123   1.00 83.96  ? 32  SER D C     1 
ATOM   8986  O  O     . SER D 1 32  ? -14.160 -9.991  36.739   1.00 90.75  ? 32  SER D O     1 
ATOM   8987  C  CB    . SER D 1 32  ? -15.800 -10.529 34.736   1.00 81.64  ? 32  SER D CB    1 
ATOM   8988  O  OG    . SER D 1 32  ? -16.781 -10.500 33.722   1.00 82.70  ? 32  SER D OG    1 
ATOM   8989  N  N     . ILE D 1 33  ? -15.556 -10.827 38.352   1.00 85.88  ? 33  ILE D N     1 
ATOM   8990  C  CA    . ILE D 1 33  ? -14.511 -10.805 39.360   1.00 91.95  ? 33  ILE D CA    1 
ATOM   8991  C  C     . ILE D 1 33  ? -14.618 -12.071 40.159   1.00 80.36  ? 33  ILE D C     1 
ATOM   8992  O  O     . ILE D 1 33  ? -15.673 -12.608 40.343   1.00 85.55  ? 33  ILE D O     1 
ATOM   8993  C  CB    . ILE D 1 33  ? -14.533 -9.571  40.273   1.00 114.25 ? 33  ILE D CB    1 
ATOM   8994  C  CG1   . ILE D 1 33  ? -15.960 -9.357  40.810   1.00 139.39 ? 33  ILE D CG1   1 
ATOM   8995  C  CG2   . ILE D 1 33  ? -13.943 -8.367  39.556   1.00 111.59 ? 33  ILE D CG2   1 
ATOM   8996  C  CD1   . ILE D 1 33  ? -16.087 -8.231  41.787   1.00 154.28 ? 33  ILE D CD1   1 
ATOM   8997  N  N     . VAL D 1 34  ? -13.475 -12.601 40.539   1.00 75.41  ? 34  VAL D N     1 
ATOM   8998  C  CA    . VAL D 1 34  ? -13.386 -13.768 41.400   1.00 86.26  ? 34  VAL D CA    1 
ATOM   8999  C  C     . VAL D 1 34  ? -12.634 -13.339 42.631   1.00 85.54  ? 34  VAL D C     1 
ATOM   9000  O  O     . VAL D 1 34  ? -11.416 -13.213 42.639   1.00 72.28  ? 34  VAL D O     1 
ATOM   9001  C  CB    . VAL D 1 34  ? -12.604 -14.899 40.695   1.00 113.18 ? 34  VAL D CB    1 
ATOM   9002  C  CG1   . VAL D 1 34  ? -12.201 -16.051 41.639   1.00 124.97 ? 34  VAL D CG1   1 
ATOM   9003  C  CG2   . VAL D 1 34  ? -13.437 -15.393 39.520   1.00 129.42 ? 34  VAL D CG2   1 
ATOM   9004  N  N     . GLY D 1 35  ? -13.377 -13.147 43.707   1.00 111.69 ? 35  GLY D N     1 
ATOM   9005  C  CA    . GLY D 1 35  ? -12.736 -12.724 44.932   1.00 129.79 ? 35  GLY D CA    1 
ATOM   9006  C  C     . GLY D 1 35  ? -12.440 -13.952 45.743   1.00 126.85 ? 35  GLY D C     1 
ATOM   9007  O  O     . GLY D 1 35  ? -13.211 -14.921 45.764   1.00 118.76 ? 35  GLY D O     1 
ATOM   9008  N  N     . ARG D 1 36  ? -11.309 -13.921 46.436   1.00 136.70 ? 36  ARG D N     1 
ATOM   9009  C  CA    . ARG D 1 36  ? -10.906 -15.027 47.293   1.00 148.63 ? 36  ARG D CA    1 
ATOM   9010  C  C     . ARG D 1 36  ? -10.631 -14.518 48.675   1.00 146.55 ? 36  ARG D C     1 
ATOM   9011  O  O     . ARG D 1 36  ? -10.161 -13.433 48.867   1.00 143.62 ? 36  ARG D O     1 
ATOM   9012  C  CB    . ARG D 1 36  ? -9.630  -15.746 46.813   1.00 162.59 ? 36  ARG D CB    1 
ATOM   9013  C  CG    . ARG D 1 36  ? -9.741  -16.417 45.444   1.00 172.04 ? 36  ARG D CG    1 
ATOM   9014  C  CD    . ARG D 1 36  ? -8.549  -17.218 44.985   1.00 166.18 ? 36  ARG D CD    1 
ATOM   9015  N  NE    . ARG D 1 36  ? -8.799  -17.654 43.592   1.00 171.61 ? 36  ARG D NE    1 
ATOM   9016  C  CZ    . ARG D 1 36  ? -9.585  -18.682 43.262   1.00 184.73 ? 36  ARG D CZ    1 
ATOM   9017  N  NH1   . ARG D 1 36  ? -10.141 -19.400 44.235   1.00 189.62 ? 36  ARG D NH1   1 
ATOM   9018  N  NH2   . ARG D 1 36  ? -9.818  -19.013 41.981   1.00 188.01 ? 36  ARG D NH2   1 
ATOM   9019  N  N     . PRO D 1 37  ? -10.989 -15.310 49.646   1.00 149.82 ? 37  PRO D N     1 
ATOM   9020  C  CA    . PRO D 1 37  ? -10.767 -14.925 51.028   1.00 141.54 ? 37  PRO D CA    1 
ATOM   9021  C  C     . PRO D 1 37  ? -9.290  -15.007 51.328   1.00 115.14 ? 37  PRO D C     1 
ATOM   9022  O  O     . PRO D 1 37  ? -8.710  -16.078 51.422   1.00 96.90  ? 37  PRO D O     1 
ATOM   9023  C  CB    . PRO D 1 37  ? -11.592 -15.932 51.841   1.00 169.48 ? 37  PRO D CB    1 
ATOM   9024  C  CG    . PRO D 1 37  ? -11.967 -16.985 50.869   1.00 182.20 ? 37  PRO D CG    1 
ATOM   9025  C  CD    . PRO D 1 37  ? -12.039 -16.312 49.541   1.00 168.90 ? 37  PRO D CD    1 
ATOM   9026  N  N     . ARG D 1 38  ? -8.681  -13.828 51.366   1.00 123.63 ? 38  ARG D N     1 
ATOM   9027  C  CA    . ARG D 1 38  ? -7.262  -13.651 51.677   1.00 143.83 ? 38  ARG D CA    1 
ATOM   9028  C  C     . ARG D 1 38  ? -7.009  -13.807 53.138   1.00 135.26 ? 38  ARG D C     1 
ATOM   9029  O  O     . ARG D 1 38  ? -5.987  -14.348 53.527   1.00 135.75 ? 38  ARG D O     1 
ATOM   9030  C  CB    . ARG D 1 38  ? -6.771  -12.263 51.148   1.00 159.95 ? 38  ARG D CB    1 
ATOM   9031  C  CG    . ARG D 1 38  ? -5.585  -11.583 51.847   1.00 165.98 ? 38  ARG D CG    1 
ATOM   9032  C  CD    . ARG D 1 38  ? -5.687  -10.052 51.834   1.00 166.70 ? 38  ARG D CD    1 
ATOM   9033  N  NE    . ARG D 1 38  ? -7.011  -9.591  52.307   1.00 175.48 ? 38  ARG D NE    1 
ATOM   9034  C  CZ    . ARG D 1 38  ? -7.331  -8.313  52.511   1.00 200.13 ? 38  ARG D CZ    1 
ATOM   9035  N  NH1   . ARG D 1 38  ? -6.403  -7.389  52.329   1.00 210.19 ? 38  ARG D NH1   1 
ATOM   9036  N  NH2   . ARG D 1 38  ? -8.560  -7.952  52.934   1.00 210.10 ? 38  ARG D NH2   1 
ATOM   9037  N  N     . HIS D 1 39  ? -7.907  -13.302 53.968   1.00 140.48 ? 39  HIS D N     1 
ATOM   9038  C  CA    . HIS D 1 39  ? -7.759  -13.519 55.428   1.00 161.54 ? 39  HIS D CA    1 
ATOM   9039  C  C     . HIS D 1 39  ? -8.407  -14.766 55.979   1.00 190.99 ? 39  HIS D C     1 
ATOM   9040  O  O     . HIS D 1 39  ? -9.614  -14.986 55.763   1.00 196.44 ? 39  HIS D O     1 
ATOM   9041  C  CB    . HIS D 1 39  ? -8.408  -12.367 56.205   1.00 164.09 ? 39  HIS D CB    1 
ATOM   9042  C  CG    . HIS D 1 39  ? -7.731  -11.034 56.024   1.00 174.94 ? 39  HIS D CG    1 
ATOM   9043  N  ND1   . HIS D 1 39  ? -6.386  -10.843 56.250   1.00 189.08 ? 39  HIS D ND1   1 
ATOM   9044  C  CD2   . HIS D 1 39  ? -8.222  -9.831  55.643   1.00 189.48 ? 39  HIS D CD2   1 
ATOM   9045  C  CE1   . HIS D 1 39  ? -6.074  -9.579  56.014   1.00 202.03 ? 39  HIS D CE1   1 
ATOM   9046  N  NE2   . HIS D 1 39  ? -7.172  -8.942  55.646   1.00 200.72 ? 39  HIS D NE2   1 
ATOM   9047  N  N     . GLN D 1 40  ? -7.634  -15.535 56.771   1.00 206.22 ? 40  GLN D N     1 
ATOM   9048  C  CA    . GLN D 1 40  ? -8.131  -16.786 57.325   1.00 206.36 ? 40  GLN D CA    1 
ATOM   9049  C  C     . GLN D 1 40  ? -9.237  -16.506 58.343   1.00 188.91 ? 40  GLN D C     1 
ATOM   9050  O  O     . GLN D 1 40  ? -9.105  -15.654 59.200   1.00 180.83 ? 40  GLN D O     1 
ATOM   9051  C  CB    . GLN D 1 40  ? -7.043  -17.706 57.902   1.00 222.24 ? 40  GLN D CB    1 
ATOM   9052  C  CG    . GLN D 1 40  ? -6.328  -17.159 59.106   1.00 242.52 ? 40  GLN D CG    1 
ATOM   9053  C  CD    . GLN D 1 40  ? -5.401  -18.184 59.749   1.00 267.50 ? 40  GLN D CD    1 
ATOM   9054  O  OE1   . GLN D 1 40  ? -5.169  -19.265 59.201   1.00 279.85 ? 40  GLN D OE1   1 
ATOM   9055  N  NE2   . GLN D 1 40  ? -4.867  -17.848 60.920   1.00 280.64 ? 40  GLN D NE2   1 
ATOM   9056  N  N     . GLY D 1 41  ? -10.383 -17.123 58.124   1.00 190.25 ? 41  GLY D N     1 
ATOM   9057  C  CA    . GLY D 1 41  ? -11.533 -16.835 58.941   1.00 195.25 ? 41  GLY D CA    1 
ATOM   9058  C  C     . GLY D 1 41  ? -11.467 -17.665 60.200   1.00 195.52 ? 41  GLY D C     1 
ATOM   9059  O  O     . GLY D 1 41  ? -10.976 -18.795 60.184   1.00 191.90 ? 41  GLY D O     1 
ATOM   9060  N  N     . VAL D 1 42  ? -11.946 -17.098 61.301   1.00 198.77 ? 42  VAL D N     1 
ATOM   9061  C  CA    . VAL D 1 42  ? -12.060 -17.819 62.539   1.00 202.36 ? 42  VAL D CA    1 
ATOM   9062  C  C     . VAL D 1 42  ? -13.425 -17.625 63.160   1.00 181.70 ? 42  VAL D C     1 
ATOM   9063  O  O     . VAL D 1 42  ? -13.691 -16.665 63.878   1.00 179.24 ? 42  VAL D O     1 
ATOM   9064  C  CB    . VAL D 1 42  ? -10.971 -17.400 63.510   1.00 232.66 ? 42  VAL D CB    1 
ATOM   9065  C  CG1   . VAL D 1 42  ? -11.157 -18.175 64.820   1.00 244.38 ? 42  VAL D CG1   1 
ATOM   9066  C  CG2   . VAL D 1 42  ? -9.605  -17.604 62.834   1.00 235.54 ? 42  VAL D CG2   1 
ATOM   9067  N  N     . MET D 1 43  ? -14.280 -18.575 62.831   1.00 181.53 ? 43  MET D N     1 
ATOM   9068  C  CA    . MET D 1 43  ? -15.567 -18.800 63.468   1.00 191.17 ? 43  MET D CA    1 
ATOM   9069  C  C     . MET D 1 43  ? -15.814 -20.307 63.266   1.00 198.09 ? 43  MET D C     1 
ATOM   9070  O  O     . MET D 1 43  ? -14.891 -21.077 62.984   1.00 200.75 ? 43  MET D O     1 
ATOM   9071  C  CB    . MET D 1 43  ? -16.701 -18.045 62.792   1.00 196.93 ? 43  MET D CB    1 
ATOM   9072  C  CG    . MET D 1 43  ? -16.524 -16.558 62.653   1.00 209.79 ? 43  MET D CG    1 
ATOM   9073  S  SD    . MET D 1 43  ? -16.918 -15.558 64.087   1.00 234.66 ? 43  MET D SD    1 
ATOM   9074  C  CE    . MET D 1 43  ? -18.683 -15.625 63.904   1.00 234.73 ? 43  MET D CE    1 
ATOM   9075  N  N     . VAL D 1 44  ? -17.057 -20.739 63.407   1.00 201.83 ? 44  VAL D N     1 
ATOM   9076  C  CA    . VAL D 1 44  ? -17.478 -22.007 62.897   1.00 210.94 ? 44  VAL D CA    1 
ATOM   9077  C  C     . VAL D 1 44  ? -18.829 -21.751 62.226   1.00 192.01 ? 44  VAL D C     1 
ATOM   9078  O  O     . VAL D 1 44  ? -19.590 -20.864 62.641   1.00 166.41 ? 44  VAL D O     1 
ATOM   9079  C  CB    . VAL D 1 44  ? -17.591 -23.024 64.044   1.00 242.43 ? 44  VAL D CB    1 
ATOM   9080  C  CG1   . VAL D 1 44  ? -18.150 -24.351 63.527   1.00 251.75 ? 44  VAL D CG1   1 
ATOM   9081  C  CG2   . VAL D 1 44  ? -16.234 -23.172 64.772   1.00 241.58 ? 44  VAL D CG2   1 
ATOM   9082  N  N     . GLY D 1 45  ? -19.120 -22.548 61.208   1.00 194.08 ? 45  GLY D N     1 
ATOM   9083  C  CA    . GLY D 1 45  ? -20.359 -22.380 60.473   1.00 198.09 ? 45  GLY D CA    1 
ATOM   9084  C  C     . GLY D 1 45  ? -20.266 -21.113 59.654   1.00 204.05 ? 45  GLY D C     1 
ATOM   9085  O  O     . GLY D 1 45  ? -21.235 -20.353 59.562   1.00 203.32 ? 45  GLY D O     1 
ATOM   9086  N  N     . MET D 1 46  ? -19.074 -20.858 59.106   1.00 204.92 ? 46  MET D N     1 
ATOM   9087  C  CA    . MET D 1 46  ? -18.910 -19.959 57.950   1.00 206.89 ? 46  MET D CA    1 
ATOM   9088  C  C     . MET D 1 46  ? -18.828 -20.760 56.684   1.00 197.54 ? 46  MET D C     1 
ATOM   9089  O  O     . MET D 1 46  ? -18.260 -21.853 56.676   1.00 195.63 ? 46  MET D O     1 
ATOM   9090  C  CB    . MET D 1 46  ? -17.598 -19.161 58.009   1.00 227.58 ? 46  MET D CB    1 
ATOM   9091  C  CG    . MET D 1 46  ? -17.500 -18.108 59.111   1.00 260.15 ? 46  MET D CG    1 
ATOM   9092  S  SD    . MET D 1 46  ? -16.005 -17.101 59.010   1.00 290.53 ? 46  MET D SD    1 
ATOM   9093  C  CE    . MET D 1 46  ? -14.864 -18.380 59.495   1.00 298.53 ? 46  MET D CE    1 
ATOM   9094  N  N     . GLY D 1 47  ? -19.361 -20.188 55.606   1.00 190.47 ? 47  GLY D N     1 
ATOM   9095  C  CA    . GLY D 1 47  ? -19.106 -20.638 54.238   1.00 188.83 ? 47  GLY D CA    1 
ATOM   9096  C  C     . GLY D 1 47  ? -18.918 -22.142 54.002   1.00 202.85 ? 47  GLY D C     1 
ATOM   9097  O  O     . GLY D 1 47  ? -19.908 -22.875 54.044   1.00 205.92 ? 47  GLY D O     1 
ATOM   9098  N  N     . GLN D 1 48  ? -17.694 -22.639 53.761   1.00 210.30 ? 48  GLN D N     1 
ATOM   9099  C  CA    . GLN D 1 48  ? -16.447 -21.833 53.733   1.00 210.73 ? 48  GLN D CA    1 
ATOM   9100  C  C     . GLN D 1 48  ? -16.373 -21.009 52.465   1.00 215.16 ? 48  GLN D C     1 
ATOM   9101  O  O     . GLN D 1 48  ? -15.948 -19.846 52.496   1.00 224.57 ? 48  GLN D O     1 
ATOM   9102  C  CB    . GLN D 1 48  ? -15.186 -22.705 53.849   1.00 213.26 ? 48  GLN D CB    1 
ATOM   9103  C  CG    . GLN D 1 48  ? -14.963 -23.286 55.233   1.00 229.22 ? 48  GLN D CG    1 
ATOM   9104  C  CD    . GLN D 1 48  ? -13.632 -23.981 55.344   1.00 248.70 ? 48  GLN D CD    1 
ATOM   9105  O  OE1   . GLN D 1 48  ? -12.975 -24.263 54.341   1.00 260.16 ? 48  GLN D OE1   1 
ATOM   9106  N  NE2   . GLN D 1 48  ? -13.222 -24.275 56.572   1.00 254.34 ? 48  GLN D NE2   1 
ATOM   9107  N  N     . LYS D 1 49  ? -16.796 -21.624 51.355   1.00 212.15 ? 49  LYS D N     1 
ATOM   9108  C  CA    . LYS D 1 49  ? -16.816 -21.010 50.009   1.00 195.22 ? 49  LYS D CA    1 
ATOM   9109  C  C     . LYS D 1 49  ? -15.437 -20.494 49.626   1.00 167.54 ? 49  LYS D C     1 
ATOM   9110  O  O     . LYS D 1 49  ? -15.046 -19.427 50.052   1.00 149.64 ? 49  LYS D O     1 
ATOM   9111  C  CB    . LYS D 1 49  ? -17.837 -19.872 49.894   1.00 216.00 ? 49  LYS D CB    1 
ATOM   9112  C  CG    . LYS D 1 49  ? -19.298 -20.294 49.863   1.00 237.64 ? 49  LYS D CG    1 
ATOM   9113  C  CD    . LYS D 1 49  ? -20.266 -19.108 50.087   1.00 251.92 ? 49  LYS D CD    1 
ATOM   9114  C  CE    . LYS D 1 49  ? -21.713 -19.554 50.339   1.00 261.02 ? 49  LYS D CE    1 
ATOM   9115  N  NZ    . LYS D 1 49  ? -22.625 -18.425 50.672   1.00 265.57 ? 49  LYS D NZ    1 
ATOM   9116  N  N     . ASP D 1 50  ? -14.718 -21.286 48.845   1.00 170.70 ? 50  ASP D N     1 
ATOM   9117  C  CA    . ASP D 1 50  ? -13.372 -21.023 48.458   1.00 182.26 ? 50  ASP D CA    1 
ATOM   9118  C  C     . ASP D 1 50  ? -13.253 -19.701 47.758   1.00 188.12 ? 50  ASP D C     1 
ATOM   9119  O  O     . ASP D 1 50  ? -12.224 -19.084 47.847   1.00 191.60 ? 50  ASP D O     1 
ATOM   9120  C  CB    . ASP D 1 50  ? -12.926 -22.113 47.475   1.00 197.15 ? 50  ASP D CB    1 
ATOM   9121  C  CG    . ASP D 1 50  ? -11.485 -21.950 46.983   1.00 200.48 ? 50  ASP D CG    1 
ATOM   9122  O  OD1   . ASP D 1 50  ? -10.557 -21.713 47.793   1.00 209.92 ? 50  ASP D OD1   1 
ATOM   9123  O  OD2   . ASP D 1 50  ? -11.284 -22.065 45.752   1.00 195.64 ? 50  ASP D OD2   1 
ATOM   9124  N  N     . SER D 1 51  ? -14.284 -19.283 47.063   1.00 172.53 ? 51  SER D N     1 
ATOM   9125  C  CA    . SER D 1 51  ? -14.219 -17.981 46.442   1.00 140.18 ? 51  SER D CA    1 
ATOM   9126  C  C     . SER D 1 51  ? -15.578 -17.516 46.089   1.00 114.00 ? 51  SER D C     1 
ATOM   9127  O  O     . SER D 1 51  ? -16.494 -18.310 45.999   1.00 105.52 ? 51  SER D O     1 
ATOM   9128  C  CB    . SER D 1 51  ? -13.414 -18.052 45.169   1.00 138.44 ? 51  SER D CB    1 
ATOM   9129  O  OG    . SER D 1 51  ? -13.273 -16.778 44.599   1.00 149.62 ? 51  SER D OG    1 
ATOM   9130  N  N     . TYR D 1 52  ? -15.695 -16.210 45.826   1.00 106.18 ? 52  TYR D N     1 
ATOM   9131  C  CA    . TYR D 1 52  ? -16.924 -15.580 45.429   1.00 113.65 ? 52  TYR D CA    1 
ATOM   9132  C  C     . TYR D 1 52  ? -16.795 -14.978 44.036   1.00 105.01 ? 52  TYR D C     1 
ATOM   9133  O  O     . TYR D 1 52  ? -15.752 -14.637 43.552   1.00 99.37  ? 52  TYR D O     1 
ATOM   9134  C  CB    . TYR D 1 52  ? -17.295 -14.497 46.426   1.00 130.29 ? 52  TYR D CB    1 
ATOM   9135  C  CG    . TYR D 1 52  ? -17.454 -14.944 47.840   1.00 152.49 ? 52  TYR D CG    1 
ATOM   9136  C  CD1   . TYR D 1 52  ? -17.903 -16.215 48.150   1.00 161.16 ? 52  TYR D CD1   1 
ATOM   9137  C  CD2   . TYR D 1 52  ? -17.242 -14.048 48.874   1.00 156.03 ? 52  TYR D CD2   1 
ATOM   9138  C  CE1   . TYR D 1 52  ? -18.084 -16.595 49.453   1.00 158.71 ? 52  TYR D CE1   1 
ATOM   9139  C  CE2   . TYR D 1 52  ? -17.424 -14.436 50.183   1.00 155.88 ? 52  TYR D CE2   1 
ATOM   9140  C  CZ    . TYR D 1 52  ? -17.852 -15.713 50.472   1.00 160.02 ? 52  TYR D CZ    1 
ATOM   9141  O  OH    . TYR D 1 52  ? -18.024 -16.092 51.812   1.00 174.61 ? 52  TYR D OH    1 
ATOM   9142  N  N     . VAL D 1 53  ? -17.912 -14.990 43.334   1.00 112.37 ? 53  VAL D N     1 
ATOM   9143  C  CA    . VAL D 1 53  ? -17.952 -14.552 41.937   1.00 118.81 ? 53  VAL D CA    1 
ATOM   9144  C  C     . VAL D 1 53  ? -19.114 -13.644 41.753   1.00 115.62 ? 53  VAL D C     1 
ATOM   9145  O  O     . VAL D 1 53  ? -20.161 -13.814 42.383   1.00 118.45 ? 53  VAL D O     1 
ATOM   9146  C  CB    . VAL D 1 53  ? -18.172 -15.741 40.998   1.00 135.94 ? 53  VAL D CB    1 
ATOM   9147  C  CG1   . VAL D 1 53  ? -18.300 -15.270 39.576   1.00 134.34 ? 53  VAL D CG1   1 
ATOM   9148  C  CG2   . VAL D 1 53  ? -17.020 -16.742 41.157   1.00 147.44 ? 53  VAL D CG2   1 
ATOM   9149  N  N     . GLY D 1 54  ? -18.976 -12.671 40.852   1.00 120.78 ? 54  GLY D N     1 
ATOM   9150  C  CA    . GLY D 1 54  ? -20.045 -11.694 40.573   1.00 133.13 ? 54  GLY D CA    1 
ATOM   9151  C  C     . GLY D 1 54  ? -20.286 -10.742 41.708   1.00 126.80 ? 54  GLY D C     1 
ATOM   9152  O  O     . GLY D 1 54  ? -19.528 -10.719 42.639   1.00 120.67 ? 54  GLY D O     1 
ATOM   9153  N  N     . ASP D 1 55  ? -21.368 -9.979  41.599   1.00 125.36 ? 55  ASP D N     1 
ATOM   9154  C  CA    . ASP D 1 55  ? -21.642 -8.877  42.512   1.00 138.28 ? 55  ASP D CA    1 
ATOM   9155  C  C     . ASP D 1 55  ? -21.689 -9.292  43.983   1.00 150.50 ? 55  ASP D C     1 
ATOM   9156  O  O     . ASP D 1 55  ? -21.592 -8.472  44.896   1.00 149.24 ? 55  ASP D O     1 
ATOM   9157  C  CB    . ASP D 1 55  ? -22.874 -8.044  42.108   1.00 156.14 ? 55  ASP D CB    1 
ATOM   9158  C  CG    . ASP D 1 55  ? -24.089 -8.882  41.948   1.00 163.94 ? 55  ASP D CG    1 
ATOM   9159  O  OD1   . ASP D 1 55  ? -23.887 -10.105 41.882   1.00 161.39 ? 55  ASP D OD1   1 
ATOM   9160  O  OD2   . ASP D 1 55  ? -25.202 -8.334  41.893   1.00 172.43 ? 55  ASP D OD2   1 
ATOM   9161  N  N     . GLU D 1 56  ? -21.713 -10.602 44.201   1.00 167.64 ? 56  GLU D N     1 
ATOM   9162  C  CA    . GLU D 1 56  ? -21.426 -11.144 45.525   1.00 170.69 ? 56  GLU D CA    1 
ATOM   9163  C  C     . GLU D 1 56  ? -20.113 -10.608 46.034   1.00 153.90 ? 56  GLU D C     1 
ATOM   9164  O  O     . GLU D 1 56  ? -19.985 -10.185 47.190   1.00 160.37 ? 56  GLU D O     1 
ATOM   9165  C  CB    . GLU D 1 56  ? -21.338 -12.676 45.506   1.00 185.56 ? 56  GLU D CB    1 
ATOM   9166  C  CG    . GLU D 1 56  ? -21.121 -13.339 46.859   1.00 211.09 ? 56  GLU D CG    1 
ATOM   9167  C  CD    . GLU D 1 56  ? -21.092 -14.856 46.777   1.00 251.36 ? 56  GLU D CD    1 
ATOM   9168  O  OE1   . GLU D 1 56  ? -21.110 -15.415 45.655   1.00 271.35 ? 56  GLU D OE1   1 
ATOM   9169  O  OE2   . GLU D 1 56  ? -21.047 -15.496 47.850   1.00 272.69 ? 56  GLU D OE2   1 
ATOM   9170  N  N     . ALA D 1 57  ? -19.105 -10.647 45.160   1.00 143.71 ? 57  ALA D N     1 
ATOM   9171  C  CA    . ALA D 1 57  ? -17.775 -10.166 45.519   1.00 148.47 ? 57  ALA D CA    1 
ATOM   9172  C  C     . ALA D 1 57  ? -17.790 -8.720  45.851   1.00 142.91 ? 57  ALA D C     1 
ATOM   9173  O  O     . ALA D 1 57  ? -17.129 -8.328  46.779   1.00 148.76 ? 57  ALA D O     1 
ATOM   9174  C  CB    . ALA D 1 57  ? -16.769 -10.404 44.387   1.00 140.35 ? 57  ALA D CB    1 
ATOM   9175  N  N     . GLN D 1 58  ? -18.535 -7.929  45.097   1.00 131.54 ? 58  GLN D N     1 
ATOM   9176  C  CA    . GLN D 1 58  ? -18.677 -6.497  45.381   1.00 148.53 ? 58  GLN D CA    1 
ATOM   9177  C  C     . GLN D 1 58  ? -19.242 -6.276  46.775   1.00 156.42 ? 58  GLN D C     1 
ATOM   9178  O  O     . GLN D 1 58  ? -18.759 -5.458  47.555   1.00 147.24 ? 58  GLN D O     1 
ATOM   9179  C  CB    . GLN D 1 58  ? -19.682 -5.829  44.419   1.00 180.48 ? 58  GLN D CB    1 
ATOM   9180  C  CG    . GLN D 1 58  ? -19.242 -5.815  42.986   1.00 199.74 ? 58  GLN D CG    1 
ATOM   9181  C  CD    . GLN D 1 58  ? -18.096 -4.856  42.750   1.00 211.74 ? 58  GLN D CD    1 
ATOM   9182  O  OE1   . GLN D 1 58  ? -18.081 -3.720  43.230   1.00 211.62 ? 58  GLN D OE1   1 
ATOM   9183  N  NE2   . GLN D 1 58  ? -17.117 -5.324  42.015   1.00 224.32 ? 58  GLN D NE2   1 
ATOM   9184  N  N     . SER D 1 59  ? -20.277 -7.047  47.078   1.00 169.56 ? 59  SER D N     1 
ATOM   9185  C  CA    . SER D 1 59  ? -20.888 -6.968  48.422   1.00 177.88 ? 59  SER D CA    1 
ATOM   9186  C  C     . SER D 1 59  ? -19.855 -7.274  49.519   1.00 146.80 ? 59  SER D C     1 
ATOM   9187  O  O     . SER D 1 59  ? -19.661 -6.504  50.464   1.00 149.40 ? 59  SER D O     1 
ATOM   9188  C  CB    . SER D 1 59  ? -22.119 -7.868  48.586   1.00 192.23 ? 59  SER D CB    1 
ATOM   9189  O  OG    . SER D 1 59  ? -22.742 -7.596  49.809   1.00 197.14 ? 59  SER D OG    1 
ATOM   9190  N  N     . LYS D 1 60  ? -19.133 -8.383  49.405   1.00 112.43 ? 60  LYS D N     1 
ATOM   9191  C  CA    . LYS D 1 60  ? -18.149 -8.753  50.412   1.00 105.49 ? 60  LYS D CA    1 
ATOM   9192  C  C     . LYS D 1 60  ? -16.770 -8.422  49.879   1.00 104.98 ? 60  LYS D C     1 
ATOM   9193  O  O     . LYS D 1 60  ? -16.033 -9.318  49.540   1.00 98.70  ? 60  LYS D O     1 
ATOM   9194  C  CB    . LYS D 1 60  ? -18.267 -10.245 50.746   1.00 113.72 ? 60  LYS D CB    1 
ATOM   9195  C  CG    . LYS D 1 60  ? -19.566 -10.675 51.448   1.00 134.21 ? 60  LYS D CG    1 
ATOM   9196  C  CD    . LYS D 1 60  ? -19.541 -12.139 51.932   1.00 164.69 ? 60  LYS D CD    1 
ATOM   9197  C  CE    . LYS D 1 60  ? -20.857 -12.607 52.551   1.00 193.09 ? 60  LYS D CE    1 
ATOM   9198  N  NZ    . LYS D 1 60  ? -20.787 -14.040 52.942   1.00 203.97 ? 60  LYS D NZ    1 
ATOM   9199  N  N     . ARG D 1 61  ? -16.402 -7.148  49.823   1.00 122.12 ? 61  ARG D N     1 
ATOM   9200  C  CA    . ARG D 1 61  ? -15.167 -6.693  49.140   1.00 140.92 ? 61  ARG D CA    1 
ATOM   9201  C  C     . ARG D 1 61  ? -13.892 -6.718  50.003   1.00 131.51 ? 61  ARG D C     1 
ATOM   9202  O  O     . ARG D 1 61  ? -12.792 -7.036  49.484   1.00 117.39 ? 61  ARG D O     1 
ATOM   9203  C  CB    . ARG D 1 61  ? -15.418 -5.264  48.662   1.00 165.99 ? 61  ARG D CB    1 
ATOM   9204  C  CG    . ARG D 1 61  ? -14.538 -4.749  47.527   1.00 181.05 ? 61  ARG D CG    1 
ATOM   9205  C  CD    . ARG D 1 61  ? -15.035 -3.430  47.037   1.00 197.10 ? 61  ARG D CD    1 
ATOM   9206  N  NE    . ARG D 1 61  ? -16.465 -3.536  46.680   1.00 196.92 ? 61  ARG D NE    1 
ATOM   9207  C  CZ    . ARG D 1 61  ? -17.263 -2.493  46.479   1.00 199.96 ? 61  ARG D CZ    1 
ATOM   9208  N  NH1   . ARG D 1 61  ? -16.748 -1.291  46.583   1.00 195.48 ? 61  ARG D NH1   1 
ATOM   9209  N  NH2   . ARG D 1 61  ? -18.566 -2.643  46.166   1.00 210.44 ? 61  ARG D NH2   1 
ATOM   9210  N  N     . GLY D 1 62  ? -14.092 -6.275  51.243   1.00 137.67 ? 62  GLY D N     1 
ATOM   9211  C  CA    . GLY D 1 62  ? -13.010 -5.963  52.154   1.00 150.57 ? 62  GLY D CA    1 
ATOM   9212  C  C     . GLY D 1 62  ? -12.143 -7.160  52.450   1.00 157.87 ? 62  GLY D C     1 
ATOM   9213  O  O     . GLY D 1 62  ? -10.908 -7.036  52.449   1.00 161.97 ? 62  GLY D O     1 
ATOM   9214  N  N     . ILE D 1 63  ? -12.795 -8.320  52.623   1.00 157.88 ? 63  ILE D N     1 
ATOM   9215  C  CA    . ILE D 1 63  ? -12.163 -9.570  52.956   1.00 160.99 ? 63  ILE D CA    1 
ATOM   9216  C  C     . ILE D 1 63  ? -11.391 -10.096 51.755   1.00 138.66 ? 63  ILE D C     1 
ATOM   9217  O  O     . ILE D 1 63  ? -10.285 -10.590 51.923   1.00 129.91 ? 63  ILE D O     1 
ATOM   9218  C  CB    . ILE D 1 63  ? -13.235 -10.585 53.362   1.00 189.05 ? 63  ILE D CB    1 
ATOM   9219  C  CG1   . ILE D 1 63  ? -14.037 -10.035 54.551   1.00 208.07 ? 63  ILE D CG1   1 
ATOM   9220  C  CG2   . ILE D 1 63  ? -12.598 -11.944 53.601   1.00 201.28 ? 63  ILE D CG2   1 
ATOM   9221  C  CD1   . ILE D 1 63  ? -13.181 -9.581  55.711   1.00 219.78 ? 63  ILE D CD1   1 
ATOM   9222  N  N     . LEU D 1 64  ? -12.001 -10.012 50.586   1.00 125.38 ? 64  LEU D N     1 
ATOM   9223  C  CA    . LEU D 1 64  ? -11.499 -10.689 49.431   1.00 118.77 ? 64  LEU D CA    1 
ATOM   9224  C  C     . LEU D 1 64  ? -10.425 -9.896  48.797   1.00 119.80 ? 64  LEU D C     1 
ATOM   9225  O  O     . LEU D 1 64  ? -10.391 -8.684  48.967   1.00 126.88 ? 64  LEU D O     1 
ATOM   9226  C  CB    . LEU D 1 64  ? -12.605 -10.777 48.430   1.00 128.76 ? 64  LEU D CB    1 
ATOM   9227  C  CG    . LEU D 1 64  ? -13.745 -11.764 48.688   1.00 145.08 ? 64  LEU D CG    1 
ATOM   9228  C  CD1   . LEU D 1 64  ? -14.234 -11.716 50.128   1.00 156.30 ? 64  LEU D CD1   1 
ATOM   9229  C  CD2   . LEU D 1 64  ? -14.887 -11.598 47.661   1.00 150.07 ? 64  LEU D CD2   1 
ATOM   9230  N  N     . THR D 1 65  ? -9.584  -10.592 48.038   1.00 123.90 ? 65  THR D N     1 
ATOM   9231  C  CA    . THR D 1 65  ? -8.739  -9.989  47.037   1.00 134.90 ? 65  THR D CA    1 
ATOM   9232  C  C     . THR D 1 65  ? -9.440  -10.335 45.779   1.00 125.05 ? 65  THR D C     1 
ATOM   9233  O  O     . THR D 1 65  ? -9.914  -11.453 45.587   1.00 124.58 ? 65  THR D O     1 
ATOM   9234  C  CB    . THR D 1 65  ? -7.306  -10.563 47.023   1.00 157.64 ? 65  THR D CB    1 
ATOM   9235  O  OG1   . THR D 1 65  ? -6.600  -10.069 45.875   1.00 167.46 ? 65  THR D OG1   1 
ATOM   9236  C  CG2   . THR D 1 65  ? -7.283  -12.083 46.973   1.00 159.70 ? 65  THR D CG2   1 
ATOM   9237  N  N     . LEU D 1 66  ? -9.521  -9.374  44.884   1.00 126.25 ? 66  LEU D N     1 
ATOM   9238  C  CA    . LEU D 1 66  ? -10.272 -9.621  43.682   1.00 128.70 ? 66  LEU D CA    1 
ATOM   9239  C  C     . LEU D 1 66  ? -9.279  -9.800  42.588   1.00 144.16 ? 66  LEU D C     1 
ATOM   9240  O  O     . LEU D 1 66  ? -8.247  -9.128  42.569   1.00 145.14 ? 66  LEU D O     1 
ATOM   9241  C  CB    . LEU D 1 66  ? -11.192 -8.465  43.363   1.00 117.54 ? 66  LEU D CB    1 
ATOM   9242  C  CG    . LEU D 1 66  ? -12.130 -8.120  44.522   1.00 123.97 ? 66  LEU D CG    1 
ATOM   9243  C  CD1   . LEU D 1 66  ? -12.734 -6.717  44.394   1.00 137.31 ? 66  LEU D CD1   1 
ATOM   9244  C  CD2   . LEU D 1 66  ? -13.215 -9.193  44.729   1.00 123.05 ? 66  LEU D CD2   1 
ATOM   9245  N  N     . LYS D 1 67  ? -9.591  -10.708 41.668   1.00 158.96 ? 67  LYS D N     1 
ATOM   9246  C  CA    . LYS D 1 67  ? -8.788  -10.928 40.530   1.00 152.37 ? 67  LYS D CA    1 
ATOM   9247  C  C     . LYS D 1 67  ? -9.720  -10.873 39.338   1.00 126.24 ? 67  LYS D C     1 
ATOM   9248  O  O     . LYS D 1 67  ? -10.650 -11.675 39.221   1.00 128.74 ? 67  LYS D O     1 
ATOM   9249  C  CB    . LYS D 1 67  ? -8.130  -12.321 40.644   1.00 170.43 ? 67  LYS D CB    1 
ATOM   9250  C  CG    . LYS D 1 67  ? -7.042  -12.602 39.624   1.00 184.37 ? 67  LYS D CG    1 
ATOM   9251  C  CD    . LYS D 1 67  ? -6.363  -13.952 39.868   1.00 212.00 ? 67  LYS D CD    1 
ATOM   9252  C  CE    . LYS D 1 67  ? -5.602  -14.456 38.639   1.00 238.46 ? 67  LYS D CE    1 
ATOM   9253  N  NZ    . LYS D 1 67  ? -4.600  -13.457 38.174   1.00 251.42 ? 67  LYS D NZ    1 
ATOM   9254  N  N     . TYR D 1 68  ? -9.495  -9.915  38.459   1.00 107.80 ? 68  TYR D N     1 
ATOM   9255  C  CA    . TYR D 1 68  ? -10.127 -9.924  37.150   1.00 109.25 ? 68  TYR D CA    1 
ATOM   9256  C  C     . TYR D 1 68  ? -9.479  -11.043 36.290   1.00 96.30  ? 68  TYR D C     1 
ATOM   9257  O  O     . TYR D 1 68  ? -8.290  -10.964 35.994   1.00 94.02  ? 68  TYR D O     1 
ATOM   9258  C  CB    . TYR D 1 68  ? -9.893  -8.578  36.457   1.00 131.39 ? 68  TYR D CB    1 
ATOM   9259  C  CG    . TYR D 1 68  ? -10.726 -7.447  36.944   1.00 148.88 ? 68  TYR D CG    1 
ATOM   9260  C  CD1   . TYR D 1 68  ? -12.092 -7.487  36.823   1.00 157.89 ? 68  TYR D CD1   1 
ATOM   9261  C  CD2   . TYR D 1 68  ? -10.143 -6.321  37.470   1.00 152.39 ? 68  TYR D CD2   1 
ATOM   9262  C  CE1   . TYR D 1 68  ? -12.874 -6.420  37.238   1.00 147.26 ? 68  TYR D CE1   1 
ATOM   9263  C  CE2   . TYR D 1 68  ? -10.904 -5.257  37.897   1.00 150.09 ? 68  TYR D CE2   1 
ATOM   9264  C  CZ    . TYR D 1 68  ? -12.277 -5.308  37.783   1.00 143.29 ? 68  TYR D CZ    1 
ATOM   9265  O  OH    . TYR D 1 68  ? -13.067 -4.234  38.214   1.00 142.78 ? 68  TYR D OH    1 
ATOM   9266  N  N     . PRO D 1 69  ? -10.244 -12.051 35.855   1.00 94.22  ? 69  PRO D N     1 
ATOM   9267  C  CA    . PRO D 1 69  ? -9.677  -13.124 35.080   1.00 99.95  ? 69  PRO D CA    1 
ATOM   9268  C  C     . PRO D 1 69  ? -9.301  -12.701 33.664   1.00 98.87  ? 69  PRO D C     1 
ATOM   9269  O  O     . PRO D 1 69  ? -8.509  -13.371 33.006   1.00 100.10 ? 69  PRO D O     1 
ATOM   9270  C  CB    . PRO D 1 69  ? -10.804 -14.175 35.088   1.00 107.92 ? 69  PRO D CB    1 
ATOM   9271  C  CG    . PRO D 1 69  ? -12.022 -13.340 35.132   1.00 97.90  ? 69  PRO D CG    1 
ATOM   9272  C  CD    . PRO D 1 69  ? -11.695 -12.194 36.019   1.00 95.56  ? 69  PRO D CD    1 
ATOM   9273  N  N     . ILE D 1 70  ? -9.942  -11.661 33.128   1.00 111.09 ? 70  ILE D N     1 
ATOM   9274  C  CA    . ILE D 1 70  ? -9.639  -11.200 31.768   1.00 133.73 ? 70  ILE D CA    1 
ATOM   9275  C  C     . ILE D 1 70  ? -8.840  -9.914  31.810   1.00 128.08 ? 70  ILE D C     1 
ATOM   9276  O  O     . ILE D 1 70  ? -9.303  -8.949  32.423   1.00 134.02 ? 70  ILE D O     1 
ATOM   9277  C  CB    . ILE D 1 70  ? -10.922 -10.943 30.907   1.00 166.44 ? 70  ILE D CB    1 
ATOM   9278  C  CG1   . ILE D 1 70  ? -11.964 -12.044 31.125   1.00 183.25 ? 70  ILE D CG1   1 
ATOM   9279  C  CG2   . ILE D 1 70  ? -10.512 -10.776 29.432   1.00 187.80 ? 70  ILE D CG2   1 
ATOM   9280  C  CD1   . ILE D 1 70  ? -13.251 -11.737 30.394   1.00 210.07 ? 70  ILE D CD1   1 
ATOM   9281  N  N     . GLU D 1 71  ? -7.661  -9.898  31.166   1.00 126.84 ? 71  GLU D N     1 
ATOM   9282  C  CA    . GLU D 1 71  ? -6.902  -8.670  30.965   1.00 134.49 ? 71  GLU D CA    1 
ATOM   9283  C  C     . GLU D 1 71  ? -6.517  -8.412  29.542   1.00 110.34 ? 71  GLU D C     1 
ATOM   9284  O  O     . GLU D 1 71  ? -5.803  -9.198  28.950   1.00 113.11 ? 71  GLU D O     1 
ATOM   9285  C  CB    . GLU D 1 71  ? -5.613  -8.652  31.812   1.00 157.45 ? 71  GLU D CB    1 
ATOM   9286  C  CG    . GLU D 1 71  ? -5.811  -8.166  33.225   1.00 200.63 ? 71  GLU D CG    1 
ATOM   9287  C  CD    . GLU D 1 71  ? -6.728  -6.962  33.258   1.00 233.65 ? 71  GLU D CD    1 
ATOM   9288  O  OE1   . GLU D 1 71  ? -6.408  -5.965  32.579   1.00 261.05 ? 71  GLU D OE1   1 
ATOM   9289  O  OE2   . GLU D 1 71  ? -7.780  -7.037  33.911   1.00 240.91 ? 71  GLU D OE2   1 
ATOM   9290  N  N     . HIS D 1 72  ? -6.964  -7.278  29.015   1.00 108.88 ? 72  HIS D N     1 
ATOM   9291  C  CA    . HIS D 1 72  ? -6.668  -6.860  27.667   1.00 119.01 ? 72  HIS D CA    1 
ATOM   9292  C  C     . HIS D 1 72  ? -7.326  -7.786  26.662   1.00 110.87 ? 72  HIS D C     1 
ATOM   9293  O  O     . HIS D 1 72  ? -6.781  -8.107  25.605   1.00 102.27 ? 72  HIS D O     1 
ATOM   9294  C  CB    . HIS D 1 72  ? -5.180  -6.762  27.414   1.00 134.61 ? 72  HIS D CB    1 
ATOM   9295  C  CG    . HIS D 1 72  ? -4.484  -5.834  28.365   1.00 151.41 ? 72  HIS D CG    1 
ATOM   9296  N  ND1   . HIS D 1 72  ? -4.993  -4.597  28.718   1.00 148.18 ? 72  HIS D ND1   1 
ATOM   9297  C  CD2   . HIS D 1 72  ? -3.330  -5.972  29.058   1.00 166.59 ? 72  HIS D CD2   1 
ATOM   9298  C  CE1   . HIS D 1 72  ? -4.169  -4.003  29.569   1.00 150.61 ? 72  HIS D CE1   1 
ATOM   9299  N  NE2   . HIS D 1 72  ? -3.153  -4.818  29.795   1.00 166.22 ? 72  HIS D NE2   1 
ATOM   9300  N  N     . GLY D 1 73  ? -8.518  -8.231  27.020   1.00 116.26 ? 73  GLY D N     1 
ATOM   9301  C  CA    . GLY D 1 73  ? -9.277  -9.173  26.177   1.00 125.77 ? 73  GLY D CA    1 
ATOM   9302  C  C     . GLY D 1 73  ? -8.731  -10.588 26.192   1.00 116.20 ? 73  GLY D C     1 
ATOM   9303  O  O     . GLY D 1 73  ? -9.286  -11.474 25.572   1.00 111.11 ? 73  GLY D O     1 
ATOM   9304  N  N     . ILE D 1 74  ? -7.653  -10.832 26.936   1.00 110.89 ? 74  ILE D N     1 
ATOM   9305  C  CA    . ILE D 1 74  ? -7.082  -12.147 27.072   1.00 112.94 ? 74  ILE D CA    1 
ATOM   9306  C  C     . ILE D 1 74  ? -7.513  -12.716 28.400   1.00 110.56 ? 74  ILE D C     1 
ATOM   9307  O  O     . ILE D 1 74  ? -7.300  -12.041 29.437   1.00 113.70 ? 74  ILE D O     1 
ATOM   9308  C  CB    . ILE D 1 74  ? -5.577  -12.088 27.145   1.00 138.57 ? 74  ILE D CB    1 
ATOM   9309  C  CG1   . ILE D 1 74  ? -5.005  -11.143 26.077   1.00 141.88 ? 74  ILE D CG1   1 
ATOM   9310  C  CG2   . ILE D 1 74  ? -4.976  -13.490 27.119   1.00 152.62 ? 74  ILE D CG2   1 
ATOM   9311  C  CD1   . ILE D 1 74  ? -5.395  -11.466 24.665   1.00 143.34 ? 74  ILE D CD1   1 
ATOM   9312  N  N     . VAL D 1 75  ? -7.919  -13.992 28.436   1.00 121.38 ? 75  VAL D N     1 
ATOM   9313  C  CA    . VAL D 1 75  ? -8.205  -14.594 29.734   1.00 135.95 ? 75  VAL D CA    1 
ATOM   9314  C  C     . VAL D 1 75  ? -6.848  -15.019 30.336   1.00 137.18 ? 75  VAL D C     1 
ATOM   9315  O  O     . VAL D 1 75  ? -6.108  -15.825 29.785   1.00 132.66 ? 75  VAL D O     1 
ATOM   9316  C  CB    . VAL D 1 75  ? -9.241  -15.716 29.709   1.00 150.07 ? 75  VAL D CB    1 
ATOM   9317  C  CG1   . VAL D 1 75  ? -10.538 -15.211 29.087   1.00 167.26 ? 75  VAL D CG1   1 
ATOM   9318  C  CG2   . VAL D 1 75  ? -8.763  -16.915 28.960   1.00 146.52 ? 75  VAL D CG2   1 
ATOM   9319  N  N     . THR D 1 76  ? -6.545  -14.415 31.466   1.00 133.75 ? 76  THR D N     1 
ATOM   9320  C  CA    . THR D 1 76  ? -5.364  -14.847 32.233   1.00 128.00 ? 76  THR D CA    1 
ATOM   9321  C  C     . THR D 1 76  ? -5.640  -16.261 32.820   1.00 121.21 ? 76  THR D C     1 
ATOM   9322  O  O     . THR D 1 76  ? -4.873  -17.187 32.594   1.00 115.76 ? 76  THR D O     1 
ATOM   9323  C  CB    . THR D 1 76  ? -5.016  -13.768 33.276   1.00 145.94 ? 76  THR D CB    1 
ATOM   9324  O  OG1   . THR D 1 76  ? -6.075  -13.616 34.225   1.00 147.28 ? 76  THR D OG1   1 
ATOM   9325  C  CG2   . THR D 1 76  ? -4.908  -12.423 32.618   1.00 148.63 ? 76  THR D CG2   1 
ATOM   9326  N  N     . ASN D 1 77  ? -6.750  -16.422 33.536   1.00 109.75 ? 77  ASN D N     1 
ATOM   9327  C  CA    . ASN D 1 77  ? -6.973  -17.606 34.295   1.00 111.57 ? 77  ASN D CA    1 
ATOM   9328  C  C     . ASN D 1 77  ? -8.283  -18.239 33.903   1.00 105.16 ? 77  ASN D C     1 
ATOM   9329  O  O     . ASN D 1 77  ? -9.337  -17.646 34.074   1.00 105.31 ? 77  ASN D O     1 
ATOM   9330  C  CB    . ASN D 1 77  ? -7.007  -17.306 35.792   1.00 117.46 ? 77  ASN D CB    1 
ATOM   9331  C  CG    . ASN D 1 77  ? -6.828  -18.533 36.676   1.00 150.21 ? 77  ASN D CG    1 
ATOM   9332  O  OD1   . ASN D 1 77  ? -6.869  -19.677 36.222   1.00 158.40 ? 77  ASN D OD1   1 
ATOM   9333  N  ND2   . ASN D 1 77  ? -6.574  -18.288 37.952   1.00 164.70 ? 77  ASN D ND2   1 
ATOM   9334  N  N     . TRP D 1 78  ? -8.200  -19.468 33.394   1.00 111.19 ? 78  TRP D N     1 
ATOM   9335  C  CA    . TRP D 1 78  ? -9.328  -20.123 32.763   1.00 109.96 ? 78  TRP D CA    1 
ATOM   9336  C  C     . TRP D 1 78  ? -10.289 -20.633 33.764   1.00 126.57 ? 78  TRP D C     1 
ATOM   9337  O  O     . TRP D 1 78  ? -11.518 -20.546 33.576   1.00 145.52 ? 78  TRP D O     1 
ATOM   9338  C  CB    . TRP D 1 78  ? -8.907  -21.337 31.956   1.00 107.35 ? 78  TRP D CB    1 
ATOM   9339  C  CG    . TRP D 1 78  ? -8.362  -20.822 30.651   1.00 113.56 ? 78  TRP D CG    1 
ATOM   9340  C  CD1   . TRP D 1 78  ? -7.056  -20.690 30.258   1.00 126.67 ? 78  TRP D CD1   1 
ATOM   9341  C  CD2   . TRP D 1 78  ? -9.151  -20.277 29.612   1.00 127.48 ? 78  TRP D CD2   1 
ATOM   9342  N  NE1   . TRP D 1 78  ? -7.001  -20.145 28.997   1.00 137.18 ? 78  TRP D NE1   1 
ATOM   9343  C  CE2   . TRP D 1 78  ? -8.286  -19.882 28.581   1.00 139.56 ? 78  TRP D CE2   1 
ATOM   9344  C  CE3   . TRP D 1 78  ? -10.513 -20.124 29.464   1.00 135.10 ? 78  TRP D CE3   1 
ATOM   9345  C  CZ2   . TRP D 1 78  ? -8.753  -19.308 27.426   1.00 150.88 ? 78  TRP D CZ2   1 
ATOM   9346  C  CZ3   . TRP D 1 78  ? -10.984 -19.558 28.303   1.00 135.51 ? 78  TRP D CZ3   1 
ATOM   9347  C  CH2   . TRP D 1 78  ? -10.117 -19.213 27.279   1.00 147.41 ? 78  TRP D CH2   1 
ATOM   9348  N  N     . ASP D 1 79  ? -9.827  -21.306 34.805   1.00 139.73 ? 79  ASP D N     1 
ATOM   9349  C  CA    . ASP D 1 79  ? -10.775 -21.847 35.818   1.00 147.14 ? 79  ASP D CA    1 
ATOM   9350  C  C     . ASP D 1 79  ? -11.657 -20.751 36.354   1.00 150.39 ? 79  ASP D C     1 
ATOM   9351  O  O     . ASP D 1 79  ? -12.809 -20.951 36.599   1.00 147.03 ? 79  ASP D O     1 
ATOM   9352  C  CB    . ASP D 1 79  ? -10.056 -22.511 36.985   1.00 153.81 ? 79  ASP D CB    1 
ATOM   9353  C  CG    . ASP D 1 79  ? -8.884  -21.707 37.489   1.00 147.18 ? 79  ASP D CG    1 
ATOM   9354  O  OD1   . ASP D 1 79  ? -8.936  -20.480 37.335   1.00 138.76 ? 79  ASP D OD1   1 
ATOM   9355  O  OD2   . ASP D 1 79  ? -7.914  -22.292 38.013   1.00 148.92 ? 79  ASP D OD2   1 
ATOM   9356  N  N     . ASP D 1 80  ? -11.084 -19.551 36.498   1.00 146.46 ? 80  ASP D N     1 
ATOM   9357  C  CA    . ASP D 1 80  ? -11.822 -18.408 36.979   1.00 153.11 ? 80  ASP D CA    1 
ATOM   9358  C  C     . ASP D 1 80  ? -12.916 -18.056 36.010   1.00 140.29 ? 80  ASP D C     1 
ATOM   9359  O  O     . ASP D 1 80  ? -14.048 -17.818 36.409   1.00 140.81 ? 80  ASP D O     1 
ATOM   9360  C  CB    . ASP D 1 80  ? -10.908 -17.187 37.186   1.00 172.36 ? 80  ASP D CB    1 
ATOM   9361  C  CG    . ASP D 1 80  ? -9.867  -17.444 38.218   1.00 205.05 ? 80  ASP D CG    1 
ATOM   9362  O  OD1   . ASP D 1 80  ? -10.021 -18.428 38.952   1.00 223.97 ? 80  ASP D OD1   1 
ATOM   9363  O  OD2   . ASP D 1 80  ? -8.896  -16.666 38.306   1.00 233.47 ? 80  ASP D OD2   1 
ATOM   9364  N  N     . MET D 1 81  ? -12.573 -18.012 34.715   1.00 131.01 ? 81  MET D N     1 
ATOM   9365  C  CA    . MET D 1 81  ? -13.567 -17.713 33.691   1.00 124.86 ? 81  MET D CA    1 
ATOM   9366  C  C     . MET D 1 81  ? -14.683 -18.730 33.706   1.00 111.42 ? 81  MET D C     1 
ATOM   9367  O  O     . MET D 1 81  ? -15.863 -18.421 33.619   1.00 115.30 ? 81  MET D O     1 
ATOM   9368  C  CB    . MET D 1 81  ? -12.928 -17.758 32.284   1.00 137.11 ? 81  MET D CB    1 
ATOM   9369  C  CG    . MET D 1 81  ? -13.872 -17.412 31.188   1.00 148.60 ? 81  MET D CG    1 
ATOM   9370  S  SD    . MET D 1 81  ? -14.894 -15.968 31.401   1.00 166.13 ? 81  MET D SD    1 
ATOM   9371  C  CE    . MET D 1 81  ? -13.632 -14.795 31.819   1.00 146.78 ? 81  MET D CE    1 
ATOM   9372  N  N     . GLU D 1 82  ? -14.297 -19.986 33.801   1.00 110.39 ? 82  GLU D N     1 
ATOM   9373  C  CA    . GLU D 1 82  ? -15.283 -21.065 33.874   1.00 120.20 ? 82  GLU D CA    1 
ATOM   9374  C  C     . GLU D 1 82  ? -16.185 -20.788 35.045   1.00 113.67 ? 82  GLU D C     1 
ATOM   9375  O  O     . GLU D 1 82  ? -17.376 -20.962 34.929   1.00 126.86 ? 82  GLU D O     1 
ATOM   9376  C  CB    . GLU D 1 82  ? -14.639 -22.465 33.994   1.00 134.34 ? 82  GLU D CB    1 
ATOM   9377  C  CG    . GLU D 1 82  ? -15.612 -23.616 34.144   1.00 156.40 ? 82  GLU D CG    1 
ATOM   9378  C  CD    . GLU D 1 82  ? -15.910 -24.006 35.589   1.00 182.63 ? 82  GLU D CD    1 
ATOM   9379  O  OE1   . GLU D 1 82  ? -14.976 -23.984 36.428   1.00 201.51 ? 82  GLU D OE1   1 
ATOM   9380  O  OE2   . GLU D 1 82  ? -17.083 -24.351 35.879   1.00 182.29 ? 82  GLU D OE2   1 
ATOM   9381  N  N     . LYS D 1 83  ? -15.632 -20.383 36.189   1.00 104.81 ? 83  LYS D N     1 
ATOM   9382  C  CA    . LYS D 1 83  ? -16.452 -20.127 37.367   1.00 111.50 ? 83  LYS D CA    1 
ATOM   9383  C  C     . LYS D 1 83  ? -17.439 -19.013 37.076   1.00 112.16 ? 83  LYS D C     1 
ATOM   9384  O  O     . LYS D 1 83  ? -18.617 -19.091 37.475   1.00 120.56 ? 83  LYS D O     1 
ATOM   9385  C  CB    . LYS D 1 83  ? -15.603 -19.659 38.548   1.00 110.90 ? 83  LYS D CB    1 
ATOM   9386  C  CG    . LYS D 1 83  ? -14.822 -20.743 39.211   1.00 127.50 ? 83  LYS D CG    1 
ATOM   9387  C  CD    . LYS D 1 83  ? -13.967 -20.205 40.377   1.00 144.24 ? 83  LYS D CD    1 
ATOM   9388  C  CE    . LYS D 1 83  ? -13.411 -21.315 41.250   1.00 168.47 ? 83  LYS D CE    1 
ATOM   9389  N  NZ    . LYS D 1 83  ? -12.749 -20.730 42.445   1.00 175.02 ? 83  LYS D NZ    1 
ATOM   9390  N  N     . ILE D 1 84  ? -16.973 -17.969 36.361   1.00 100.31 ? 84  ILE D N     1 
ATOM   9391  C  CA    . ILE D 1 84  ? -17.851 -16.859 36.064   1.00 96.00  ? 84  ILE D CA    1 
ATOM   9392  C  C     . ILE D 1 84  ? -19.001 -17.304 35.193   1.00 80.85  ? 84  ILE D C     1 
ATOM   9393  O  O     . ILE D 1 84  ? -20.133 -16.932 35.449   1.00 79.66  ? 84  ILE D O     1 
ATOM   9394  C  CB    . ILE D 1 84  ? -17.079 -15.753 35.356   1.00 99.70  ? 84  ILE D CB    1 
ATOM   9395  C  CG1   . ILE D 1 84  ? -16.179 -15.100 36.403   1.00 97.48  ? 84  ILE D CG1   1 
ATOM   9396  C  CG2   . ILE D 1 84  ? -18.038 -14.715 34.798   1.00 101.31 ? 84  ILE D CG2   1 
ATOM   9397  C  CD1   . ILE D 1 84  ? -15.415 -13.874 35.940   1.00 105.95 ? 84  ILE D CD1   1 
ATOM   9398  N  N     . TRP D 1 85  ? -18.702 -18.090 34.163   1.00 73.43  ? 85  TRP D N     1 
ATOM   9399  C  CA    . TRP D 1 85  ? -19.744 -18.616 33.297   1.00 81.34  ? 85  TRP D CA    1 
ATOM   9400  C  C     . TRP D 1 85  ? -20.714 -19.482 34.068   1.00 85.63  ? 85  TRP D C     1 
ATOM   9401  O  O     . TRP D 1 85  ? -21.920 -19.367 33.886   1.00 95.24  ? 85  TRP D O     1 
ATOM   9402  C  CB    . TRP D 1 85  ? -19.186 -19.353 32.101   1.00 85.61  ? 85  TRP D CB    1 
ATOM   9403  C  CG    . TRP D 1 85  ? -18.655 -18.450 31.006   1.00 85.38  ? 85  TRP D CG    1 
ATOM   9404  C  CD1   . TRP D 1 85  ? -19.127 -17.235 30.607   1.00 85.80  ? 85  TRP D CD1   1 
ATOM   9405  C  CD2   . TRP D 1 85  ? -17.599 -18.778 30.119   1.00 83.98  ? 85  TRP D CD2   1 
ATOM   9406  N  NE1   . TRP D 1 85  ? -18.414 -16.784 29.523   1.00 80.19  ? 85  TRP D NE1   1 
ATOM   9407  C  CE2   . TRP D 1 85  ? -17.487 -17.742 29.185   1.00 79.76  ? 85  TRP D CE2   1 
ATOM   9408  C  CE3   . TRP D 1 85  ? -16.829 -19.914 29.976   1.00 99.39  ? 85  TRP D CE3   1 
ATOM   9409  C  CZ2   . TRP D 1 85  ? -16.535 -17.752 28.200   1.00 93.13  ? 85  TRP D CZ2   1 
ATOM   9410  C  CZ3   . TRP D 1 85  ? -15.860 -19.922 29.009   1.00 103.06 ? 85  TRP D CZ3   1 
ATOM   9411  C  CH2   . TRP D 1 85  ? -15.728 -18.869 28.125   1.00 105.67 ? 85  TRP D CH2   1 
ATOM   9412  N  N     . HIS D 1 86  ? -20.196 -20.301 34.959   1.00 89.68  ? 86  HIS D N     1 
ATOM   9413  C  CA    . HIS D 1 86  ? -20.970 -21.180 35.831   1.00 104.55 ? 86  HIS D CA    1 
ATOM   9414  C  C     . HIS D 1 86  ? -22.006 -20.306 36.537   1.00 106.88 ? 86  HIS D C     1 
ATOM   9415  O  O     . HIS D 1 86  ? -23.191 -20.615 36.581   1.00 139.83 ? 86  HIS D O     1 
ATOM   9416  C  CB    . HIS D 1 86  ? -20.037 -21.897 36.829   1.00 116.54 ? 86  HIS D CB    1 
ATOM   9417  C  CG    . HIS D 1 86  ? -20.721 -22.976 37.603   1.00 143.49 ? 86  HIS D CG    1 
ATOM   9418  N  ND1   . HIS D 1 86  ? -21.388 -22.752 38.789   1.00 155.51 ? 86  HIS D ND1   1 
ATOM   9419  C  CD2   . HIS D 1 86  ? -20.848 -24.300 37.350   1.00 161.16 ? 86  HIS D CD2   1 
ATOM   9420  C  CE1   . HIS D 1 86  ? -21.897 -23.895 39.236   1.00 169.99 ? 86  HIS D CE1   1 
ATOM   9421  N  NE2   . HIS D 1 86  ? -21.584 -24.849 38.377   1.00 169.29 ? 86  HIS D NE2   1 
ATOM   9422  N  N     . HIS D 1 87  ? -21.507 -19.231 37.144   1.00 94.96  ? 87  HIS D N     1 
ATOM   9423  C  CA    . HIS D 1 87  ? -22.324 -18.321 37.887   1.00 108.29 ? 87  HIS D CA    1 
ATOM   9424  C  C     . HIS D 1 87  ? -23.428 -17.708 36.989   1.00 107.04 ? 87  HIS D C     1 
ATOM   9425  O  O     . HIS D 1 87  ? -24.599 -17.638 37.389   1.00 106.05 ? 87  HIS D O     1 
ATOM   9426  C  CB    . HIS D 1 87  ? -21.443 -17.260 38.593   1.00 111.50 ? 87  HIS D CB    1 
ATOM   9427  C  CG    . HIS D 1 87  ? -22.230 -16.216 39.346   1.00 120.62 ? 87  HIS D CG    1 
ATOM   9428  N  ND1   . HIS D 1 87  ? -22.690 -15.060 38.748   1.00 114.46 ? 87  HIS D ND1   1 
ATOM   9429  C  CD2   . HIS D 1 87  ? -22.537 -16.112 40.655   1.00 130.55 ? 87  HIS D CD2   1 
ATOM   9430  C  CE1   . HIS D 1 87  ? -23.290 -14.307 39.657   1.00 127.22 ? 87  HIS D CE1   1 
ATOM   9431  N  NE2   . HIS D 1 87  ? -23.213 -14.923 40.826   1.00 130.56 ? 87  HIS D NE2   1 
ATOM   9432  N  N     . THR D 1 88  ? -23.038 -17.353 35.780   1.00 102.98 ? 88  THR D N     1 
ATOM   9433  C  CA    . THR D 1 88  ? -24.060 -16.729 34.909   1.00 104.96 ? 88  THR D CA    1 
ATOM   9434  C  C     . THR D 1 88  ? -25.173 -17.712 34.626   1.00 96.61  ? 88  THR D C     1 
ATOM   9435  O  O     . THR D 1 88  ? -26.372 -17.369 34.800   1.00 104.99 ? 88  THR D O     1 
ATOM   9436  C  CB    . THR D 1 88  ? -23.674 -16.436 33.473   1.00 106.97 ? 88  THR D CB    1 
ATOM   9437  O  OG1   . THR D 1 88  ? -23.460 -17.651 32.723   1.00 98.35  ? 88  THR D OG1   1 
ATOM   9438  C  CG2   . THR D 1 88  ? -22.507 -15.500 33.370   1.00 115.15 ? 88  THR D CG2   1 
ATOM   9439  N  N     . PHE D 1 89  ? -24.818 -18.932 34.209   1.00 87.88  ? 89  PHE D N     1 
ATOM   9440  C  CA    . PHE D 1 89  ? -25.853 -19.849 33.833   1.00 97.84  ? 89  PHE D CA    1 
ATOM   9441  C  C     . PHE D 1 89  ? -26.671 -20.284 35.032   1.00 104.54 ? 89  PHE D C     1 
ATOM   9442  O  O     . PHE D 1 89  ? -27.898 -20.174 35.034   1.00 136.56 ? 89  PHE D O     1 
ATOM   9443  C  CB    . PHE D 1 89  ? -25.308 -21.060 33.132   1.00 119.49 ? 89  PHE D CB    1 
ATOM   9444  C  CG    . PHE D 1 89  ? -24.667 -20.737 31.823   1.00 120.71 ? 89  PHE D CG    1 
ATOM   9445  C  CD1   . PHE D 1 89  ? -25.407 -20.348 30.743   1.00 115.83 ? 89  PHE D CD1   1 
ATOM   9446  C  CD2   . PHE D 1 89  ? -23.301 -20.872 31.680   1.00 116.20 ? 89  PHE D CD2   1 
ATOM   9447  C  CE1   . PHE D 1 89  ? -24.805 -20.074 29.531   1.00 114.52 ? 89  PHE D CE1   1 
ATOM   9448  C  CE2   . PHE D 1 89  ? -22.680 -20.596 30.479   1.00 107.82 ? 89  PHE D CE2   1 
ATOM   9449  C  CZ    . PHE D 1 89  ? -23.430 -20.194 29.402   1.00 112.95 ? 89  PHE D CZ    1 
ATOM   9450  N  N     . TYR D 1 90  ? -26.013 -20.843 36.052   1.00 100.15 ? 90  TYR D N     1 
ATOM   9451  C  CA    . TYR D 1 90  ? -26.752 -21.402 37.166   1.00 111.11 ? 90  TYR D CA    1 
ATOM   9452  C  C     . TYR D 1 90  ? -27.301 -20.382 38.141   1.00 108.44 ? 90  TYR D C     1 
ATOM   9453  O  O     . TYR D 1 90  ? -28.448 -20.488 38.556   1.00 117.91 ? 90  TYR D O     1 
ATOM   9454  C  CB    . TYR D 1 90  ? -25.962 -22.492 37.899   1.00 124.89 ? 90  TYR D CB    1 
ATOM   9455  C  CG    . TYR D 1 90  ? -25.581 -23.549 36.926   1.00 143.43 ? 90  TYR D CG    1 
ATOM   9456  C  CD1   . TYR D 1 90  ? -26.542 -24.227 36.184   1.00 159.67 ? 90  TYR D CD1   1 
ATOM   9457  C  CD2   . TYR D 1 90  ? -24.262 -23.914 36.786   1.00 157.08 ? 90  TYR D CD2   1 
ATOM   9458  C  CE1   . TYR D 1 90  ? -26.182 -25.238 35.334   1.00 182.77 ? 90  TYR D CE1   1 
ATOM   9459  C  CE2   . TYR D 1 90  ? -23.893 -24.924 35.924   1.00 173.63 ? 90  TYR D CE2   1 
ATOM   9460  C  CZ    . TYR D 1 90  ? -24.854 -25.580 35.186   1.00 190.57 ? 90  TYR D CZ    1 
ATOM   9461  O  OH    . TYR D 1 90  ? -24.476 -26.598 34.296   1.00 190.87 ? 90  TYR D OH    1 
ATOM   9462  N  N     . ASN D 1 91  ? -26.464 -19.443 38.578   1.00 96.70  ? 91  ASN D N     1 
ATOM   9463  C  CA    . ASN D 1 91  ? -26.913 -18.440 39.513   1.00 103.57 ? 91  ASN D CA    1 
ATOM   9464  C  C     . ASN D 1 91  ? -27.875 -17.411 39.032   1.00 121.34 ? 91  ASN D C     1 
ATOM   9465  O  O     . ASN D 1 91  ? -28.794 -17.121 39.793   1.00 136.92 ? 91  ASN D O     1 
ATOM   9466  C  CB    . ASN D 1 91  ? -25.718 -17.785 40.256   1.00 107.49 ? 91  ASN D CB    1 
ATOM   9467  C  CG    . ASN D 1 91  ? -24.875 -18.811 40.961   1.00 116.74 ? 91  ASN D CG    1 
ATOM   9468  O  OD1   . ASN D 1 91  ? -23.659 -18.706 41.025   1.00 124.99 ? 91  ASN D OD1   1 
ATOM   9469  N  ND2   . ASN D 1 91  ? -25.528 -19.817 41.548   1.00 123.90 ? 91  ASN D ND2   1 
ATOM   9470  N  N     . GLU D 1 92  ? -27.770 -16.915 37.798   1.00 139.46 ? 92  GLU D N     1 
ATOM   9471  C  CA    . GLU D 1 92  ? -28.689 -15.907 37.321   1.00 152.52 ? 92  GLU D CA    1 
ATOM   9472  C  C     . GLU D 1 92  ? -29.752 -16.406 36.407   1.00 140.82 ? 92  GLU D C     1 
ATOM   9473  O  O     . GLU D 1 92  ? -30.923 -16.194 36.685   1.00 150.28 ? 92  GLU D O     1 
ATOM   9474  C  CB    . GLU D 1 92  ? -27.988 -14.753 36.574   1.00 144.28 ? 92  GLU D CB    1 
ATOM   9475  C  CG    . GLU D 1 92  ? -27.623 -13.582 37.474   1.00 160.81 ? 92  GLU D CG    1 
ATOM   9476  C  CD    . GLU D 1 92  ? -26.414 -13.893 38.304   1.00 170.17 ? 92  GLU D CD    1 
ATOM   9477  O  OE1   . GLU D 1 92  ? -25.652 -14.787 37.882   1.00 169.33 ? 92  GLU D OE1   1 
ATOM   9478  O  OE2   . GLU D 1 92  ? -26.228 -13.233 39.353   1.00 181.17 ? 92  GLU D OE2   1 
ATOM   9479  N  N     . LEU D 1 93  ? -29.346 -16.985 35.281   1.00 129.94 ? 93  LEU D N     1 
ATOM   9480  C  CA    . LEU D 1 93  ? -30.273 -17.337 34.179   1.00 131.04 ? 93  LEU D CA    1 
ATOM   9481  C  C     . LEU D 1 93  ? -31.042 -18.587 34.537   1.00 133.06 ? 93  LEU D C     1 
ATOM   9482  O  O     . LEU D 1 93  ? -32.174 -18.701 34.142   1.00 126.95 ? 93  LEU D O     1 
ATOM   9483  C  CB    . LEU D 1 93  ? -29.559 -17.408 32.801   1.00 133.78 ? 93  LEU D CB    1 
ATOM   9484  C  CG    . LEU D 1 93  ? -28.913 -16.057 32.414   1.00 130.87 ? 93  LEU D CG    1 
ATOM   9485  C  CD1   . LEU D 1 93  ? -28.212 -16.149 31.056   1.00 142.65 ? 93  LEU D CD1   1 
ATOM   9486  C  CD2   . LEU D 1 93  ? -29.929 -14.913 32.493   1.00 127.27 ? 93  LEU D CD2   1 
ATOM   9487  N  N     . ARG D 1 94  ? -30.422 -19.519 35.245   1.00 156.87 ? 94  ARG D N     1 
ATOM   9488  C  CA    . ARG D 1 94  ? -31.074 -20.739 35.610   1.00 168.88 ? 94  ARG D CA    1 
ATOM   9489  C  C     . ARG D 1 94  ? -31.458 -21.519 34.365   1.00 169.73 ? 94  ARG D C     1 
ATOM   9490  O  O     . ARG D 1 94  ? -32.595 -21.919 34.140   1.00 179.62 ? 94  ARG D O     1 
ATOM   9491  C  CB    . ARG D 1 94  ? -32.304 -20.461 36.495   1.00 172.64 ? 94  ARG D CB    1 
ATOM   9492  C  CG    . ARG D 1 94  ? -31.964 -19.664 37.725   1.00 170.15 ? 94  ARG D CG    1 
ATOM   9493  C  CD    . ARG D 1 94  ? -33.180 -19.511 38.603   1.00 184.76 ? 94  ARG D CD    1 
ATOM   9494  N  NE    . ARG D 1 94  ? -32.869 -18.664 39.749   1.00 196.69 ? 94  ARG D NE    1 
ATOM   9495  C  CZ    . ARG D 1 94  ? -33.771 -18.269 40.641   1.00 232.21 ? 94  ARG D CZ    1 
ATOM   9496  N  NH1   . ARG D 1 94  ? -35.037 -18.661 40.504   1.00 239.95 ? 94  ARG D NH1   1 
ATOM   9497  N  NH2   . ARG D 1 94  ? -33.422 -17.487 41.680   1.00 252.76 ? 94  ARG D NH2   1 
ATOM   9498  N  N     . VAL D 1 95  ? -30.467 -21.734 33.518   1.00 150.05 ? 95  VAL D N     1 
ATOM   9499  C  CA    . VAL D 1 95  ? -30.632 -22.485 32.286   1.00 136.29 ? 95  VAL D CA    1 
ATOM   9500  C  C     . VAL D 1 95  ? -29.681 -23.660 32.264   1.00 138.56 ? 95  VAL D C     1 
ATOM   9501  O  O     . VAL D 1 95  ? -28.597 -23.643 32.855   1.00 109.80 ? 95  VAL D O     1 
ATOM   9502  C  CB    . VAL D 1 95  ? -30.346 -21.585 31.074   1.00 122.79 ? 95  VAL D CB    1 
ATOM   9503  C  CG1   . VAL D 1 95  ? -31.433 -20.513 30.980   1.00 103.19 ? 95  VAL D CG1   1 
ATOM   9504  C  CG2   . VAL D 1 95  ? -28.908 -21.004 31.147   1.00 121.99 ? 95  VAL D CG2   1 
ATOM   9505  N  N     . ALA D 1 96  ? -30.062 -24.706 31.526   1.00 149.30 ? 96  ALA D N     1 
ATOM   9506  C  CA    . ALA D 1 96  ? -29.177 -25.796 31.220   1.00 163.81 ? 96  ALA D CA    1 
ATOM   9507  C  C     . ALA D 1 96  ? -28.672 -25.480 29.855   1.00 144.86 ? 96  ALA D C     1 
ATOM   9508  O  O     . ALA D 1 96  ? -29.439 -25.429 28.903   1.00 133.49 ? 96  ALA D O     1 
ATOM   9509  C  CB    . ALA D 1 96  ? -29.911 -27.162 31.186   1.00 187.15 ? 96  ALA D CB    1 
ATOM   9510  N  N     . PRO D 1 97  ? -27.372 -25.252 29.719   1.00 135.67 ? 97  PRO D N     1 
ATOM   9511  C  CA    . PRO D 1 97  ? -26.831 -24.854 28.454   1.00 138.18 ? 97  PRO D CA    1 
ATOM   9512  C  C     . PRO D 1 97  ? -26.978 -25.896 27.369   1.00 140.82 ? 97  PRO D C     1 
ATOM   9513  O  O     . PRO D 1 97  ? -26.971 -25.547 26.207   1.00 158.95 ? 97  PRO D O     1 
ATOM   9514  C  CB    . PRO D 1 97  ? -25.362 -24.531 28.787   1.00 151.52 ? 97  PRO D CB    1 
ATOM   9515  C  CG    . PRO D 1 97  ? -25.432 -24.014 30.186   1.00 139.92 ? 97  PRO D CG    1 
ATOM   9516  C  CD    . PRO D 1 97  ? -26.526 -24.835 30.823   1.00 130.92 ? 97  PRO D CD    1 
ATOM   9517  N  N     . GLU D 1 98  ? -27.120 -27.177 27.726   1.00 132.70 ? 98  GLU D N     1 
ATOM   9518  C  CA    . GLU D 1 98  ? -27.599 -28.185 26.807   1.00 132.58 ? 98  GLU D CA    1 
ATOM   9519  C  C     . GLU D 1 98  ? -28.840 -27.808 26.053   1.00 124.61 ? 98  GLU D C     1 
ATOM   9520  O  O     . GLU D 1 98  ? -29.037 -28.330 24.977   1.00 131.42 ? 98  GLU D O     1 
ATOM   9521  C  CB    . GLU D 1 98  ? -27.907 -29.540 27.491   1.00 170.33 ? 98  GLU D CB    1 
ATOM   9522  C  CG    . GLU D 1 98  ? -26.735 -30.226 28.142   1.00 209.60 ? 98  GLU D CG    1 
ATOM   9523  C  CD    . GLU D 1 98  ? -26.487 -29.750 29.549   1.00 215.14 ? 98  GLU D CD    1 
ATOM   9524  O  OE1   . GLU D 1 98  ? -27.084 -28.702 29.906   1.00 223.59 ? 98  GLU D OE1   1 
ATOM   9525  O  OE2   . GLU D 1 98  ? -25.709 -30.398 30.261   1.00 219.09 ? 98  GLU D OE2   1 
ATOM   9526  N  N     . GLU D 1 99  ? -29.711 -26.981 26.648   1.00 136.04 ? 99  GLU D N     1 
ATOM   9527  C  CA    . GLU D 1 99  ? -30.946 -26.567 26.038   1.00 150.99 ? 99  GLU D CA    1 
ATOM   9528  C  C     . GLU D 1 99  ? -30.855 -25.275 25.228   1.00 140.51 ? 99  GLU D C     1 
ATOM   9529  O  O     . GLU D 1 99  ? -31.888 -24.802 24.845   1.00 144.80 ? 99  GLU D O     1 
ATOM   9530  C  CB    . GLU D 1 99  ? -32.035 -26.467 27.105   1.00 178.57 ? 99  GLU D CB    1 
ATOM   9531  C  CG    . GLU D 1 99  ? -32.228 -27.741 27.930   1.00 197.76 ? 99  GLU D CG    1 
ATOM   9532  C  CD    . GLU D 1 99  ? -33.053 -27.538 29.185   1.00 215.92 ? 99  GLU D CD    1 
ATOM   9533  O  OE1   . GLU D 1 99  ? -33.281 -26.393 29.649   1.00 227.47 ? 99  GLU D OE1   1 
ATOM   9534  O  OE2   . GLU D 1 99  ? -33.496 -28.564 29.753   1.00 213.03 ? 99  GLU D OE2   1 
ATOM   9535  N  N     . HIS D 1 100 ? -29.693 -24.710 24.956   1.00 119.99 ? 100 HIS D N     1 
ATOM   9536  C  CA    . HIS D 1 100 ? -29.579 -23.438 24.263   1.00 99.16  ? 100 HIS D CA    1 
ATOM   9537  C  C     . HIS D 1 100 ? -28.263 -23.333 23.562   1.00 99.99  ? 100 HIS D C     1 
ATOM   9538  O  O     . HIS D 1 100 ? -27.247 -23.808 24.036   1.00 103.39 ? 100 HIS D O     1 
ATOM   9539  C  CB    . HIS D 1 100 ? -29.640 -22.276 25.234   1.00 93.87  ? 100 HIS D CB    1 
ATOM   9540  C  CG    . HIS D 1 100 ? -30.932 -22.173 25.990   1.00 102.35 ? 100 HIS D CG    1 
ATOM   9541  N  ND1   . HIS D 1 100 ? -32.085 -21.650 25.442   1.00 119.15 ? 100 HIS D ND1   1 
ATOM   9542  C  CD2   . HIS D 1 100 ? -31.269 -22.600 27.225   1.00 118.59 ? 100 HIS D CD2   1 
ATOM   9543  C  CE1   . HIS D 1 100 ? -33.071 -21.721 26.322   1.00 135.71 ? 100 HIS D CE1   1 
ATOM   9544  N  NE2   . HIS D 1 100 ? -32.601 -22.290 27.420   1.00 136.76 ? 100 HIS D NE2   1 
ATOM   9545  N  N     . PRO D 1 101 ? -28.278 -22.718 22.381   1.00 96.52  ? 101 PRO D N     1 
ATOM   9546  C  CA    . PRO D 1 101 ? -27.088 -22.402 21.657   1.00 92.83  ? 101 PRO D CA    1 
ATOM   9547  C  C     . PRO D 1 101 ? -26.567 -21.135 22.279   1.00 88.27  ? 101 PRO D C     1 
ATOM   9548  O  O     . PRO D 1 101 ? -27.366 -20.295 22.661   1.00 69.43  ? 101 PRO D O     1 
ATOM   9549  C  CB    . PRO D 1 101 ? -27.593 -22.181 20.193   1.00 93.94  ? 101 PRO D CB    1 
ATOM   9550  C  CG    . PRO D 1 101 ? -28.918 -22.805 20.122   1.00 100.70 ? 101 PRO D CG    1 
ATOM   9551  C  CD    . PRO D 1 101 ? -29.475 -22.745 21.523   1.00 98.90  ? 101 PRO D CD    1 
ATOM   9552  N  N     . VAL D 1 102 ? -25.233 -21.000 22.411   1.00 96.30  ? 102 VAL D N     1 
ATOM   9553  C  CA    . VAL D 1 102 ? -24.735 -19.845 23.097   1.00 89.80  ? 102 VAL D CA    1 
ATOM   9554  C  C     . VAL D 1 102 ? -23.777 -19.064 22.241   1.00 94.48  ? 102 VAL D C     1 
ATOM   9555  O  O     . VAL D 1 102 ? -22.907 -19.604 21.597   1.00 107.80 ? 102 VAL D O     1 
ATOM   9556  C  CB    . VAL D 1 102 ? -24.029 -20.237 24.389   1.00 90.87  ? 102 VAL D CB    1 
ATOM   9557  C  CG1   . VAL D 1 102 ? -22.831 -21.209 24.129   1.00 97.25  ? 102 VAL D CG1   1 
ATOM   9558  C  CG2   . VAL D 1 102 ? -23.591 -18.974 25.139   1.00 95.32  ? 102 VAL D CG2   1 
ATOM   9559  N  N     . LEU D 1 103 ? -23.971 -17.760 22.252   1.00 88.84  ? 103 LEU D N     1 
ATOM   9560  C  CA    . LEU D 1 103 ? -23.118 -16.853 21.488   1.00 87.55  ? 103 LEU D CA    1 
ATOM   9561  C  C     . LEU D 1 103 ? -22.161 -16.202 22.408   1.00 91.24  ? 103 LEU D C     1 
ATOM   9562  O  O     . LEU D 1 103 ? -22.583 -15.648 23.421   1.00 91.16  ? 103 LEU D O     1 
ATOM   9563  C  CB    . LEU D 1 103 ? -23.966 -15.741 20.863   1.00 89.04  ? 103 LEU D CB    1 
ATOM   9564  C  CG    . LEU D 1 103 ? -23.214 -14.507 20.274   1.00 90.07  ? 103 LEU D CG    1 
ATOM   9565  C  CD1   . LEU D 1 103 ? -22.213 -14.979 19.213   1.00 111.38 ? 103 LEU D CD1   1 
ATOM   9566  C  CD2   . LEU D 1 103 ? -24.163 -13.454 19.711   1.00 84.07  ? 103 LEU D CD2   1 
ATOM   9567  N  N     . LEU D 1 104 ? -20.864 -16.211 22.099   1.00 95.75  ? 104 LEU D N     1 
ATOM   9568  C  CA    . LEU D 1 104 ? -19.912 -15.423 22.853   1.00 101.84 ? 104 LEU D CA    1 
ATOM   9569  C  C     . LEU D 1 104 ? -19.375 -14.263 22.017   1.00 105.82 ? 104 LEU D C     1 
ATOM   9570  O  O     . LEU D 1 104 ? -19.151 -14.400 20.790   1.00 109.80 ? 104 LEU D O     1 
ATOM   9571  C  CB    . LEU D 1 104 ? -18.691 -16.244 23.370   1.00 92.37  ? 104 LEU D CB    1 
ATOM   9572  C  CG    . LEU D 1 104 ? -19.055 -17.296 24.428   1.00 94.96  ? 104 LEU D CG    1 
ATOM   9573  C  CD1   . LEU D 1 104 ? -17.995 -18.381 24.568   1.00 102.15 ? 104 LEU D CD1   1 
ATOM   9574  C  CD2   . LEU D 1 104 ? -19.390 -16.628 25.774   1.00 109.88 ? 104 LEU D CD2   1 
ATOM   9575  N  N     . THR D 1 105 ? -19.108 -13.159 22.693   1.00 111.25 ? 105 THR D N     1 
ATOM   9576  C  CA    . THR D 1 105 ? -18.387 -12.068 22.092   1.00 124.52 ? 105 THR D CA    1 
ATOM   9577  C  C     . THR D 1 105 ? -16.903 -12.303 22.325   1.00 112.42 ? 105 THR D C     1 
ATOM   9578  O  O     . THR D 1 105 ? -16.499 -13.100 23.162   1.00 98.62  ? 105 THR D O     1 
ATOM   9579  C  CB    . THR D 1 105 ? -18.842 -10.697 22.608   1.00 154.03 ? 105 THR D CB    1 
ATOM   9580  O  OG1   . THR D 1 105 ? -18.480 -9.710  21.613   1.00 159.45 ? 105 THR D OG1   1 
ATOM   9581  C  CG2   . THR D 1 105 ? -18.128 -10.339 23.850   1.00 183.51 ? 105 THR D CG2   1 
ATOM   9582  N  N     . GLU D 1 106 ? -16.101 -11.577 21.578   1.00 112.26 ? 106 GLU D N     1 
ATOM   9583  C  CA    . GLU D 1 106 ? -14.643 -11.629 21.755   1.00 113.64 ? 106 GLU D CA    1 
ATOM   9584  C  C     . GLU D 1 106 ? -14.036 -10.487 20.933   1.00 106.41 ? 106 GLU D C     1 
ATOM   9585  O  O     . GLU D 1 106 ? -14.635 -10.028 19.941   1.00 105.11 ? 106 GLU D O     1 
ATOM   9586  C  CB    . GLU D 1 106 ? -14.082 -12.993 21.338   1.00 128.65 ? 106 GLU D CB    1 
ATOM   9587  C  CG    . GLU D 1 106 ? -12.641 -13.262 21.744   1.00 129.46 ? 106 GLU D CG    1 
ATOM   9588  C  CD    . GLU D 1 106 ? -11.733 -13.271 20.529   1.00 120.14 ? 106 GLU D CD    1 
ATOM   9589  O  OE1   . GLU D 1 106 ? -12.161 -12.646 19.543   1.00 148.12 ? 106 GLU D OE1   1 
ATOM   9590  O  OE2   . GLU D 1 106 ? -10.675 -13.914 20.498   1.00 79.65  ? 106 GLU D OE2   1 
ATOM   9591  N  N     . ALA D 1 107 ? -12.890 -9.992  21.374   1.00 96.69  ? 107 ALA D N     1 
ATOM   9592  C  CA    . ALA D 1 107 ? -12.321 -8.794  20.828   1.00 91.65  ? 107 ALA D CA    1 
ATOM   9593  C  C     . ALA D 1 107 ? -11.519 -9.130  19.612   1.00 96.81  ? 107 ALA D C     1 
ATOM   9594  O  O     . ALA D 1 107 ? -11.047 -10.208 19.470   1.00 121.03 ? 107 ALA D O     1 
ATOM   9595  C  CB    . ALA D 1 107 ? -11.428 -8.184  21.858   1.00 104.26 ? 107 ALA D CB    1 
ATOM   9596  N  N     . PRO D 1 108 ? -11.345 -8.186  18.723   1.00 92.33  ? 108 PRO D N     1 
ATOM   9597  C  CA    . PRO D 1 108 ? -10.494 -8.369  17.553   1.00 89.82  ? 108 PRO D CA    1 
ATOM   9598  C  C     . PRO D 1 108 ? -9.019  -8.535  17.804   1.00 91.71  ? 108 PRO D C     1 
ATOM   9599  O  O     . PRO D 1 108 ? -8.547  -8.178  18.873   1.00 88.76  ? 108 PRO D O     1 
ATOM   9600  C  CB    . PRO D 1 108 ? -10.667 -7.052  16.787   1.00 101.04 ? 108 PRO D CB    1 
ATOM   9601  C  CG    . PRO D 1 108 ? -11.938 -6.452  17.264   1.00 109.94 ? 108 PRO D CG    1 
ATOM   9602  C  CD    . PRO D 1 108 ? -12.151 -6.969  18.676   1.00 99.92  ? 108 PRO D CD    1 
ATOM   9603  N  N     . LEU D 1 109 ? -8.308  -9.042  16.790   1.00 99.17  ? 109 LEU D N     1 
ATOM   9604  C  CA    . LEU D 1 109 ? -6.862  -9.163  16.792   1.00 114.80 ? 109 LEU D CA    1 
ATOM   9605  C  C     . LEU D 1 109 ? -6.331  -9.950  17.997   1.00 120.65 ? 109 LEU D C     1 
ATOM   9606  O  O     . LEU D 1 109 ? -5.223  -9.848  18.388   1.00 124.45 ? 109 LEU D O     1 
ATOM   9607  C  CB    . LEU D 1 109 ? -6.171  -7.789  16.719   1.00 120.25 ? 109 LEU D CB    1 
ATOM   9608  C  CG    . LEU D 1 109 ? -5.739  -7.403  15.290   1.00 127.99 ? 109 LEU D CG    1 
ATOM   9609  C  CD1   . LEU D 1 109 ? -6.955  -7.289  14.358   1.00 132.46 ? 109 LEU D CD1   1 
ATOM   9610  C  CD2   . LEU D 1 109 ? -4.876  -6.140  15.288   1.00 145.97 ? 109 LEU D CD2   1 
ATOM   9611  N  N     . ASN D 1 110 ? -7.169  -10.788 18.562   1.00 113.89 ? 110 ASN D N     1 
ATOM   9612  C  CA    . ASN D 1 110 ? -6.953  -11.331 19.871   1.00 101.82 ? 110 ASN D CA    1 
ATOM   9613  C  C     . ASN D 1 110 ? -6.280  -12.648 19.565   1.00 95.56  ? 110 ASN D C     1 
ATOM   9614  O  O     . ASN D 1 110 ? -6.395  -13.228 18.475   1.00 91.52  ? 110 ASN D O     1 
ATOM   9615  C  CB    . ASN D 1 110 ? -8.338  -11.438 20.545   1.00 106.77 ? 110 ASN D CB    1 
ATOM   9616  C  CG    . ASN D 1 110 ? -8.292  -11.932 21.972   1.00 114.63 ? 110 ASN D CG    1 
ATOM   9617  O  OD1   . ASN D 1 110 ? -7.392  -12.653 22.373   1.00 137.23 ? 110 ASN D OD1   1 
ATOM   9618  N  ND2   . ASN D 1 110 ? -9.319  -11.562 22.751   1.00 121.10 ? 110 ASN D ND2   1 
ATOM   9619  N  N     . PRO D 1 111 ? -5.492  -13.119 20.495   1.00 93.71  ? 111 PRO D N     1 
ATOM   9620  C  CA    . PRO D 1 111 ? -4.884  -14.428 20.338   1.00 96.33  ? 111 PRO D CA    1 
ATOM   9621  C  C     . PRO D 1 111 ? -5.808  -15.580 20.025   1.00 106.39 ? 111 PRO D C     1 
ATOM   9622  O  O     . PRO D 1 111 ? -6.944  -15.614 20.470   1.00 128.39 ? 111 PRO D O     1 
ATOM   9623  C  CB    . PRO D 1 111 ? -4.223  -14.664 21.693   1.00 95.71  ? 111 PRO D CB    1 
ATOM   9624  C  CG    . PRO D 1 111 ? -3.785  -13.284 22.033   1.00 98.20  ? 111 PRO D CG    1 
ATOM   9625  C  CD    . PRO D 1 111 ? -4.635  -12.276 21.331   1.00 94.63  ? 111 PRO D CD    1 
ATOM   9626  N  N     . LYS D 1 112 ? -5.317  -16.488 19.193   1.00 111.11 ? 112 LYS D N     1 
ATOM   9627  C  CA    . LYS D 1 112 ? -6.111  -17.598 18.692   1.00 119.86 ? 112 LYS D CA    1 
ATOM   9628  C  C     . LYS D 1 112 ? -6.558  -18.434 19.854   1.00 117.48 ? 112 LYS D C     1 
ATOM   9629  O  O     . LYS D 1 112 ? -7.676  -18.883 19.905   1.00 121.12 ? 112 LYS D O     1 
ATOM   9630  C  CB    . LYS D 1 112 ? -5.285  -18.472 17.720   1.00 136.53 ? 112 LYS D CB    1 
ATOM   9631  C  CG    . LYS D 1 112 ? -4.975  -17.772 16.401   1.00 156.55 ? 112 LYS D CG    1 
ATOM   9632  C  CD    . LYS D 1 112 ? -4.138  -18.622 15.445   1.00 189.86 ? 112 LYS D CD    1 
ATOM   9633  C  CE    . LYS D 1 112 ? -4.899  -19.792 14.829   1.00 197.67 ? 112 LYS D CE    1 
ATOM   9634  N  NZ    . LYS D 1 112 ? -5.673  -19.363 13.635   1.00 207.22 ? 112 LYS D NZ    1 
ATOM   9635  N  N     . ALA D 1 113 ? -5.627  -18.652 20.792   1.00 112.06 ? 113 ALA D N     1 
ATOM   9636  C  CA    . ALA D 1 113 ? -5.785  -19.556 21.888   1.00 107.33 ? 113 ALA D CA    1 
ATOM   9637  C  C     . ALA D 1 113 ? -7.062  -19.236 22.618   1.00 117.70 ? 113 ALA D C     1 
ATOM   9638  O  O     . ALA D 1 113 ? -7.743  -20.137 23.078   1.00 130.72 ? 113 ALA D O     1 
ATOM   9639  C  CB    . ALA D 1 113 ? -4.611  -19.453 22.875   1.00 101.45 ? 113 ALA D CB    1 
ATOM   9640  N  N     . ASN D 1 114 ? -7.379  -17.942 22.718   1.00 113.82 ? 114 ASN D N     1 
ATOM   9641  C  CA    . ASN D 1 114 ? -8.552  -17.530 23.468   1.00 113.72 ? 114 ASN D CA    1 
ATOM   9642  C  C     . ASN D 1 114 ? -9.790  -18.027 22.792   1.00 109.39 ? 114 ASN D C     1 
ATOM   9643  O  O     . ASN D 1 114 ? -10.685 -18.536 23.450   1.00 119.32 ? 114 ASN D O     1 
ATOM   9644  C  CB    . ASN D 1 114 ? -8.706  -16.041 23.660   1.00 111.08 ? 114 ASN D CB    1 
ATOM   9645  C  CG    . ASN D 1 114 ? -7.807  -15.524 24.735   1.00 134.98 ? 114 ASN D CG    1 
ATOM   9646  O  OD1   . ASN D 1 114 ? -7.487  -16.204 25.719   1.00 133.59 ? 114 ASN D OD1   1 
ATOM   9647  N  ND2   . ASN D 1 114 ? -7.395  -14.302 24.563   1.00 160.50 ? 114 ASN D ND2   1 
ATOM   9648  N  N     . ARG D 1 115 ? -9.854  -17.900 21.475   1.00 109.01 ? 115 ARG D N     1 
ATOM   9649  C  CA    . ARG D 1 115 ? -11.068 -18.354 20.779   1.00 107.65 ? 115 ARG D CA    1 
ATOM   9650  C  C     . ARG D 1 115 ? -11.108 -19.877 20.911   1.00 107.60 ? 115 ARG D C     1 
ATOM   9651  O  O     . ARG D 1 115 ? -12.135 -20.466 21.290   1.00 118.63 ? 115 ARG D O     1 
ATOM   9652  C  CB    . ARG D 1 115 ? -11.042 -18.013 19.283   1.00 111.20 ? 115 ARG D CB    1 
ATOM   9653  C  CG    . ARG D 1 115 ? -11.694 -16.713 18.847   1.00 107.91 ? 115 ARG D CG    1 
ATOM   9654  C  CD    . ARG D 1 115 ? -11.792 -16.626 17.325   1.00 107.44 ? 115 ARG D CD    1 
ATOM   9655  N  NE    . ARG D 1 115 ? -12.096 -15.258 16.887   1.00 128.82 ? 115 ARG D NE    1 
ATOM   9656  C  CZ    . ARG D 1 115 ? -11.204 -14.270 16.902   1.00 170.61 ? 115 ARG D CZ    1 
ATOM   9657  N  NH1   . ARG D 1 115 ? -9.951  -14.541 17.251   1.00 181.95 ? 115 ARG D NH1   1 
ATOM   9658  N  NH2   . ARG D 1 115 ? -11.535 -13.025 16.481   1.00 191.35 ? 115 ARG D NH2   1 
ATOM   9659  N  N     . GLU D 1 116 ? -9.989  -20.523 20.593   1.00 107.83 ? 116 GLU D N     1 
ATOM   9660  C  CA    . GLU D 1 116 ? -9.955  -21.971 20.519   1.00 122.33 ? 116 GLU D CA    1 
ATOM   9661  C  C     . GLU D 1 116 ? -10.299 -22.550 21.897   1.00 120.44 ? 116 GLU D C     1 
ATOM   9662  O  O     . GLU D 1 116 ? -11.190 -23.393 22.052   1.00 135.07 ? 116 GLU D O     1 
ATOM   9663  C  CB    . GLU D 1 116 ? -8.566  -22.449 20.000   1.00 143.20 ? 116 GLU D CB    1 
ATOM   9664  C  CG    . GLU D 1 116 ? -8.451  -22.427 18.503   1.00 160.38 ? 116 GLU D CG    1 
ATOM   9665  C  CD    . GLU D 1 116 ? -7.005  -22.225 18.058   1.00 172.02 ? 116 GLU D CD    1 
ATOM   9666  O  OE1   . GLU D 1 116 ? -6.162  -22.003 18.958   1.00 173.20 ? 116 GLU D OE1   1 
ATOM   9667  O  OE2   . GLU D 1 116 ? -6.745  -22.285 16.846   1.00 167.55 ? 116 GLU D OE2   1 
ATOM   9668  N  N     . LYS D 1 117 ? -9.591  -22.027 22.900   1.00 97.30  ? 117 LYS D N     1 
ATOM   9669  C  CA    . LYS D 1 117 ? -9.803  -22.518 24.252   1.00 93.89  ? 117 LYS D CA    1 
ATOM   9670  C  C     . LYS D 1 117 ? -11.172 -22.223 24.750   1.00 87.11  ? 117 LYS D C     1 
ATOM   9671  O  O     . LYS D 1 117 ? -11.797 -23.011 25.413   1.00 110.30 ? 117 LYS D O     1 
ATOM   9672  C  CB    . LYS D 1 117 ? -8.807  -21.968 25.276   1.00 99.02  ? 117 LYS D CB    1 
ATOM   9673  C  CG    . LYS D 1 117 ? -8.937  -22.591 26.656   1.00 126.62 ? 117 LYS D CG    1 
ATOM   9674  C  CD    . LYS D 1 117 ? -8.627  -24.086 26.711   1.00 159.01 ? 117 LYS D CD    1 
ATOM   9675  C  CE    . LYS D 1 117 ? -8.681  -24.666 28.127   1.00 173.17 ? 117 LYS D CE    1 
ATOM   9676  N  NZ    . LYS D 1 117 ? -8.778  -26.155 28.095   1.00 188.16 ? 117 LYS D NZ    1 
ATOM   9677  N  N     . MET D 1 118 ? -11.715 -21.061 24.390   1.00 82.01  ? 118 MET D N     1 
ATOM   9678  C  CA    . MET D 1 118 ? -13.097 -20.675 24.707   1.00 85.89  ? 118 MET D CA    1 
ATOM   9679  C  C     . MET D 1 118 ? -14.072 -21.736 24.204   1.00 81.58  ? 118 MET D C     1 
ATOM   9680  O  O     . MET D 1 118 ? -14.877 -22.253 25.028   1.00 83.53  ? 118 MET D O     1 
ATOM   9681  C  CB    . MET D 1 118 ? -13.399 -19.314 24.062   1.00 92.87  ? 118 MET D CB    1 
ATOM   9682  C  CG    . MET D 1 118 ? -14.649 -18.633 24.507   1.00 101.09 ? 118 MET D CG    1 
ATOM   9683  S  SD    . MET D 1 118 ? -14.773 -16.850 24.088   1.00 115.57 ? 118 MET D SD    1 
ATOM   9684  C  CE    . MET D 1 118 ? -13.561 -16.108 25.187   1.00 125.27 ? 118 MET D CE    1 
ATOM   9685  N  N     . THR D 1 119 ? -13.959 -22.119 22.945   1.00 79.14  ? 119 THR D N     1 
ATOM   9686  C  CA    . THR D 1 119 ? -14.784 -23.130 22.387   1.00 81.25  ? 119 THR D CA    1 
ATOM   9687  C  C     . THR D 1 119 ? -14.606 -24.451 23.067   1.00 97.65  ? 119 THR D C     1 
ATOM   9688  O  O     . THR D 1 119 ? -15.559 -25.126 23.354   1.00 129.93 ? 119 THR D O     1 
ATOM   9689  C  CB    . THR D 1 119 ? -14.562 -23.380 20.914   1.00 76.73  ? 119 THR D CB    1 
ATOM   9690  O  OG1   . THR D 1 119 ? -13.185 -23.686 20.736   1.00 70.07  ? 119 THR D OG1   1 
ATOM   9691  C  CG2   . THR D 1 119 ? -14.971 -22.190 20.124   1.00 86.38  ? 119 THR D CG2   1 
ATOM   9692  N  N     . GLN D 1 120 ? -13.363 -24.800 23.358   1.00 88.38  ? 120 GLN D N     1 
ATOM   9693  C  CA    . GLN D 1 120 ? -13.053 -26.043 24.052   1.00 91.59  ? 120 GLN D CA    1 
ATOM   9694  C  C     . GLN D 1 120 ? -13.834 -26.126 25.358   1.00 83.91  ? 120 GLN D C     1 
ATOM   9695  O  O     . GLN D 1 120 ? -14.456 -27.177 25.661   1.00 88.85  ? 120 GLN D O     1 
ATOM   9696  C  CB    . GLN D 1 120 ? -11.551 -26.147 24.364   1.00 106.51 ? 120 GLN D CB    1 
ATOM   9697  C  CG    . GLN D 1 120 ? -11.160 -27.429 25.074   1.00 146.23 ? 120 GLN D CG    1 
ATOM   9698  C  CD    . GLN D 1 120 ? -9.678  -27.689 25.018   1.00 176.25 ? 120 GLN D CD    1 
ATOM   9699  O  OE1   . GLN D 1 120 ? -8.915  -26.910 24.437   1.00 196.51 ? 120 GLN D OE1   1 
ATOM   9700  N  NE2   . GLN D 1 120 ? -9.251  -28.795 25.629   1.00 181.69 ? 120 GLN D NE2   1 
ATOM   9701  N  N     . ILE D 1 121 ? -13.807 -25.039 26.118   1.00 88.75  ? 121 ILE D N     1 
ATOM   9702  C  CA    . ILE D 1 121 ? -14.641 -24.986 27.297   1.00 107.41 ? 121 ILE D CA    1 
ATOM   9703  C  C     . ILE D 1 121 ? -16.121 -25.152 27.033   1.00 98.87  ? 121 ILE D C     1 
ATOM   9704  O  O     . ILE D 1 121 ? -16.773 -25.953 27.719   1.00 99.81  ? 121 ILE D O     1 
ATOM   9705  C  CB    . ILE D 1 121 ? -14.375 -23.736 28.124   1.00 124.61 ? 121 ILE D CB    1 
ATOM   9706  C  CG1   . ILE D 1 121 ? -12.985 -23.922 28.770   1.00 128.96 ? 121 ILE D CG1   1 
ATOM   9707  C  CG2   . ILE D 1 121 ? -15.507 -23.552 29.128   1.00 128.04 ? 121 ILE D CG2   1 
ATOM   9708  C  CD1   . ILE D 1 121 ? -12.575 -22.810 29.714   1.00 134.16 ? 121 ILE D CD1   1 
ATOM   9709  N  N     . MET D 1 122 ? -16.681 -24.352 26.168   1.00 93.75  ? 122 MET D N     1 
ATOM   9710  C  CA    . MET D 1 122 ? -18.106 -24.395 25.974   1.00 102.81 ? 122 MET D CA    1 
ATOM   9711  C  C     . MET D 1 122 ? -18.603 -25.770 25.602   1.00 100.00 ? 122 MET D C     1 
ATOM   9712  O  O     . MET D 1 122 ? -19.696 -26.103 25.958   1.00 112.28 ? 122 MET D O     1 
ATOM   9713  C  CB    . MET D 1 122 ? -18.527 -23.422 24.870   1.00 109.78 ? 122 MET D CB    1 
ATOM   9714  C  CG    . MET D 1 122 ? -18.719 -21.997 25.370   1.00 124.86 ? 122 MET D CG    1 
ATOM   9715  S  SD    . MET D 1 122 ? -20.013 -21.970 26.605   1.00 148.83 ? 122 MET D SD    1 
ATOM   9716  C  CE    . MET D 1 122 ? -19.819 -20.298 27.250   1.00 141.27 ? 122 MET D CE    1 
ATOM   9717  N  N     . PHE D 1 123 ? -17.843 -26.496 24.808   1.00 93.45  ? 123 PHE D N     1 
ATOM   9718  C  CA    . PHE D 1 123 ? -18.255 -27.853 24.478   1.00 103.76 ? 123 PHE D CA    1 
ATOM   9719  C  C     . PHE D 1 123 ? -17.971 -28.771 25.614   1.00 128.32 ? 123 PHE D C     1 
ATOM   9720  O  O     . PHE D 1 123 ? -18.883 -29.516 26.029   1.00 127.81 ? 123 PHE D O     1 
ATOM   9721  C  CB    . PHE D 1 123 ? -17.694 -28.343 23.134   1.00 109.46 ? 123 PHE D CB    1 
ATOM   9722  C  CG    . PHE D 1 123 ? -18.178 -27.545 21.967   1.00 111.55 ? 123 PHE D CG    1 
ATOM   9723  C  CD1   . PHE D 1 123 ? -19.531 -27.294 21.823   1.00 128.48 ? 123 PHE D CD1   1 
ATOM   9724  C  CD2   . PHE D 1 123 ? -17.303 -26.995 21.068   1.00 113.56 ? 123 PHE D CD2   1 
ATOM   9725  C  CE1   . PHE D 1 123 ? -20.000 -26.550 20.774   1.00 138.29 ? 123 PHE D CE1   1 
ATOM   9726  C  CE2   . PHE D 1 123 ? -17.760 -26.241 20.016   1.00 129.28 ? 123 PHE D CE2   1 
ATOM   9727  C  CZ    . PHE D 1 123 ? -19.118 -26.020 19.863   1.00 145.48 ? 123 PHE D CZ    1 
ATOM   9728  N  N     . GLU D 1 124 ? -16.741 -28.757 26.146   1.00 142.96 ? 124 GLU D N     1 
ATOM   9729  C  CA    . GLU D 1 124 ? -16.396 -29.792 27.132   1.00 151.17 ? 124 GLU D CA    1 
ATOM   9730  C  C     . GLU D 1 124 ? -16.455 -29.342 28.603   1.00 132.76 ? 124 GLU D C     1 
ATOM   9731  O  O     . GLU D 1 124 ? -15.807 -29.942 29.463   1.00 126.57 ? 124 GLU D O     1 
ATOM   9732  C  CB    . GLU D 1 124 ? -14.989 -30.303 26.795   1.00 154.14 ? 124 GLU D CB    1 
ATOM   9733  C  CG    . GLU D 1 124 ? -14.867 -30.813 25.380   1.00 150.78 ? 124 GLU D CG    1 
ATOM   9734  C  CD    . GLU D 1 124 ? -13.564 -31.540 25.155   1.00 169.70 ? 124 GLU D CD    1 
ATOM   9735  O  OE1   . GLU D 1 124 ? -12.525 -31.106 25.702   1.00 179.58 ? 124 GLU D OE1   1 
ATOM   9736  O  OE2   . GLU D 1 124 ? -13.591 -32.553 24.440   1.00 178.83 ? 124 GLU D OE2   1 
ATOM   9737  N  N     . THR D 1 125 ? -17.219 -28.293 28.891   1.00 125.20 ? 125 THR D N     1 
ATOM   9738  C  CA    . THR D 1 125 ? -17.534 -27.979 30.250   1.00 128.31 ? 125 THR D CA    1 
ATOM   9739  C  C     . THR D 1 125 ? -19.040 -27.967 30.387   1.00 133.72 ? 125 THR D C     1 
ATOM   9740  O  O     . THR D 1 125 ? -19.612 -28.869 30.994   1.00 147.85 ? 125 THR D O     1 
ATOM   9741  C  CB    . THR D 1 125 ? -16.897 -26.669 30.707   1.00 137.44 ? 125 THR D CB    1 
ATOM   9742  O  OG1   . THR D 1 125 ? -15.481 -26.796 30.560   1.00 147.20 ? 125 THR D OG1   1 
ATOM   9743  C  CG2   . THR D 1 125 ? -17.212 -26.410 32.160   1.00 145.75 ? 125 THR D CG2   1 
ATOM   9744  N  N     . PHE D 1 126 ? -19.682 -26.999 29.759   1.00 130.62 ? 126 PHE D N     1 
ATOM   9745  C  CA    . PHE D 1 126 ? -21.154 -26.883 29.797   1.00 121.02 ? 126 PHE D CA    1 
ATOM   9746  C  C     . PHE D 1 126 ? -21.597 -27.544 28.518   1.00 121.88 ? 126 PHE D C     1 
ATOM   9747  O  O     . PHE D 1 126 ? -21.442 -26.951 27.454   1.00 129.17 ? 126 PHE D O     1 
ATOM   9748  C  CB    . PHE D 1 126 ? -21.625 -25.432 29.784   1.00 121.62 ? 126 PHE D CB    1 
ATOM   9749  C  CG    . PHE D 1 126 ? -20.837 -24.547 30.682   1.00 121.73 ? 126 PHE D CG    1 
ATOM   9750  C  CD1   . PHE D 1 126 ? -20.716 -24.859 32.008   1.00 144.66 ? 126 PHE D CD1   1 
ATOM   9751  C  CD2   . PHE D 1 126 ? -20.244 -23.393 30.209   1.00 100.22 ? 126 PHE D CD2   1 
ATOM   9752  C  CE1   . PHE D 1 126 ? -20.004 -24.041 32.867   1.00 145.40 ? 126 PHE D CE1   1 
ATOM   9753  C  CE2   . PHE D 1 126 ? -19.535 -22.574 31.047   1.00 101.51 ? 126 PHE D CE2   1 
ATOM   9754  C  CZ    . PHE D 1 126 ? -19.428 -22.888 32.390   1.00 125.79 ? 126 PHE D CZ    1 
ATOM   9755  N  N     . ASN D 1 127 ? -22.104 -28.765 28.564   1.00 129.65 ? 127 ASN D N     1 
ATOM   9756  C  CA    . ASN D 1 127 ? -22.500 -29.448 27.320   1.00 138.45 ? 127 ASN D CA    1 
ATOM   9757  C  C     . ASN D 1 127 ? -23.573 -28.622 26.611   1.00 136.81 ? 127 ASN D C     1 
ATOM   9758  O  O     . ASN D 1 127 ? -24.559 -28.209 27.225   1.00 131.55 ? 127 ASN D O     1 
ATOM   9759  C  CB    . ASN D 1 127 ? -22.962 -30.887 27.627   1.00 148.29 ? 127 ASN D CB    1 
ATOM   9760  C  CG    . ASN D 1 127 ? -22.848 -31.827 26.430   1.00 160.83 ? 127 ASN D CG    1 
ATOM   9761  O  OD1   . ASN D 1 127 ? -21.825 -31.849 25.736   1.00 162.17 ? 127 ASN D OD1   1 
ATOM   9762  N  ND2   . ASN D 1 127 ? -23.891 -32.619 26.203   1.00 164.80 ? 127 ASN D ND2   1 
ATOM   9763  N  N     . THR D 1 128 ? -23.320 -28.286 25.349   1.00 136.71 ? 128 THR D N     1 
ATOM   9764  C  CA    . THR D 1 128 ? -24.134 -27.322 24.674   1.00 126.51 ? 128 THR D CA    1 
ATOM   9765  C  C     . THR D 1 128 ? -24.226 -27.741 23.246   1.00 114.54 ? 128 THR D C     1 
ATOM   9766  O  O     . THR D 1 128 ? -23.257 -28.256 22.717   1.00 105.13 ? 128 THR D O     1 
ATOM   9767  C  CB    . THR D 1 128 ? -23.577 -25.880 24.747   1.00 117.21 ? 128 THR D CB    1 
ATOM   9768  O  OG1   . THR D 1 128 ? -24.400 -25.045 23.938   1.00 105.08 ? 128 THR D OG1   1 
ATOM   9769  C  CG2   . THR D 1 128 ? -22.149 -25.769 24.237   1.00 123.54 ? 128 THR D CG2   1 
ATOM   9770  N  N     . PRO D 1 129 ? -25.391 -27.533 22.618   1.00 119.66 ? 129 PRO D N     1 
ATOM   9771  C  CA    . PRO D 1 129 ? -25.608 -28.017 21.286   1.00 121.68 ? 129 PRO D CA    1 
ATOM   9772  C  C     . PRO D 1 129 ? -24.805 -27.264 20.255   1.00 118.14 ? 129 PRO D C     1 
ATOM   9773  O  O     . PRO D 1 129 ? -24.366 -27.861 19.258   1.00 151.65 ? 129 PRO D O     1 
ATOM   9774  C  CB    . PRO D 1 129 ? -27.084 -27.733 21.022   1.00 136.50 ? 129 PRO D CB    1 
ATOM   9775  C  CG    . PRO D 1 129 ? -27.723 -27.630 22.343   1.00 151.30 ? 129 PRO D CG    1 
ATOM   9776  C  CD    . PRO D 1 129 ? -26.649 -27.122 23.267   1.00 138.87 ? 129 PRO D CD    1 
ATOM   9777  N  N     . ALA D 1 130 ? -24.658 -25.967 20.460   1.00 115.32 ? 130 ALA D N     1 
ATOM   9778  C  CA    . ALA D 1 130 ? -23.999 -25.144 19.477   1.00 120.77 ? 130 ALA D CA    1 
ATOM   9779  C  C     . ALA D 1 130 ? -23.573 -23.843 20.094   1.00 104.78 ? 130 ALA D C     1 
ATOM   9780  O  O     . ALA D 1 130 ? -24.017 -23.415 21.135   1.00 99.00  ? 130 ALA D O     1 
ATOM   9781  C  CB    . ALA D 1 130 ? -24.876 -24.882 18.230   1.00 137.72 ? 130 ALA D CB    1 
ATOM   9782  N  N     . MET D 1 131 ? -22.608 -23.218 19.425   1.00 97.31  ? 131 MET D N     1 
ATOM   9783  C  CA    . MET D 1 131 ? -22.087 -21.974 19.892   1.00 93.04  ? 131 MET D CA    1 
ATOM   9784  C  C     . MET D 1 131 ? -21.478 -21.201 18.770   1.00 93.61  ? 131 MET D C     1 
ATOM   9785  O  O     . MET D 1 131 ? -21.284 -21.744 17.672   1.00 85.60  ? 131 MET D O     1 
ATOM   9786  C  CB    . MET D 1 131 ? -20.957 -22.169 20.923   1.00 95.61  ? 131 MET D CB    1 
ATOM   9787  C  CG    . MET D 1 131 ? -19.638 -22.526 20.249   1.00 103.65 ? 131 MET D CG    1 
ATOM   9788  S  SD    . MET D 1 131 ? -18.185 -22.557 21.277   1.00 125.87 ? 131 MET D SD    1 
ATOM   9789  C  CE    . MET D 1 131 ? -18.034 -20.799 21.549   1.00 125.23 ? 131 MET D CE    1 
ATOM   9790  N  N     . TYR D 1 132 ? -21.181 -19.916 19.039   1.00 87.49  ? 132 TYR D N     1 
ATOM   9791  C  CA    . TYR D 1 132 ? -20.488 -19.106 18.050   1.00 80.47  ? 132 TYR D CA    1 
ATOM   9792  C  C     . TYR D 1 132 ? -19.663 -18.102 18.796   1.00 74.23  ? 132 TYR D C     1 
ATOM   9793  O  O     . TYR D 1 132 ? -20.061 -17.697 19.864   1.00 67.79  ? 132 TYR D O     1 
ATOM   9794  C  CB    . TYR D 1 132 ? -21.500 -18.364 17.206   1.00 91.04  ? 132 TYR D CB    1 
ATOM   9795  C  CG    . TYR D 1 132 ? -20.895 -17.651 16.052   1.00 96.17  ? 132 TYR D CG    1 
ATOM   9796  C  CD1   . TYR D 1 132 ? -20.485 -18.350 14.943   1.00 99.17  ? 132 TYR D CD1   1 
ATOM   9797  C  CD2   . TYR D 1 132 ? -20.720 -16.297 16.080   1.00 99.38  ? 132 TYR D CD2   1 
ATOM   9798  C  CE1   . TYR D 1 132 ? -19.930 -17.707 13.857   1.00 93.97  ? 132 TYR D CE1   1 
ATOM   9799  C  CE2   . TYR D 1 132 ? -20.134 -15.638 15.023   1.00 114.29 ? 132 TYR D CE2   1 
ATOM   9800  C  CZ    . TYR D 1 132 ? -19.740 -16.347 13.903   1.00 111.74 ? 132 TYR D CZ    1 
ATOM   9801  O  OH    . TYR D 1 132 ? -19.174 -15.671 12.806   1.00 131.47 ? 132 TYR D OH    1 
ATOM   9802  N  N     . VAL D 1 133 ? -18.554 -17.662 18.209   1.00 88.56  ? 133 VAL D N     1 
ATOM   9803  C  CA    . VAL D 1 133 ? -17.751 -16.624 18.863   1.00 93.74  ? 133 VAL D CA    1 
ATOM   9804  C  C     . VAL D 1 133 ? -17.597 -15.500 17.875   1.00 75.85  ? 133 VAL D C     1 
ATOM   9805  O  O     . VAL D 1 133 ? -17.213 -15.738 16.717   1.00 80.25  ? 133 VAL D O     1 
ATOM   9806  C  CB    . VAL D 1 133 ? -16.371 -17.049 19.288   1.00 114.11 ? 133 VAL D CB    1 
ATOM   9807  C  CG1   . VAL D 1 133 ? -16.439 -17.998 20.463   1.00 124.55 ? 133 VAL D CG1   1 
ATOM   9808  C  CG2   . VAL D 1 133 ? -15.636 -17.711 18.132   1.00 138.13 ? 133 VAL D CG2   1 
ATOM   9809  N  N     . ALA D 1 134 ? -17.929 -14.278 18.277   1.00 73.26  ? 134 ALA D N     1 
ATOM   9810  C  CA    . ALA D 1 134 ? -18.191 -13.216 17.309   1.00 84.78  ? 134 ALA D CA    1 
ATOM   9811  C  C     . ALA D 1 134 ? -17.394 -11.997 17.754   1.00 94.78  ? 134 ALA D C     1 
ATOM   9812  O  O     . ALA D 1 134 ? -17.025 -11.829 18.945   1.00 99.69  ? 134 ALA D O     1 
ATOM   9813  C  CB    . ALA D 1 134 ? -19.696 -12.878 17.215   1.00 87.31  ? 134 ALA D CB    1 
ATOM   9814  N  N     . ILE D 1 135 ? -17.114 -11.131 16.775   1.00 95.43  ? 135 ILE D N     1 
ATOM   9815  C  CA    . ILE D 1 135 ? -16.303 -9.959  17.031   1.00 101.49 ? 135 ILE D CA    1 
ATOM   9816  C  C     . ILE D 1 135 ? -17.189 -8.934  17.679   1.00 93.54  ? 135 ILE D C     1 
ATOM   9817  O  O     . ILE D 1 135 ? -18.304 -8.692  17.273   1.00 92.53  ? 135 ILE D O     1 
ATOM   9818  C  CB    . ILE D 1 135 ? -15.650 -9.420  15.753   1.00 121.42 ? 135 ILE D CB    1 
ATOM   9819  C  CG1   . ILE D 1 135 ? -14.275 -8.823  16.052   1.00 144.16 ? 135 ILE D CG1   1 
ATOM   9820  C  CG2   . ILE D 1 135 ? -16.572 -8.544  14.946   1.00 126.76 ? 135 ILE D CG2   1 
ATOM   9821  C  CD1   . ILE D 1 135 ? -13.152 -9.855  16.108   1.00 148.22 ? 135 ILE D CD1   1 
ATOM   9822  N  N     . GLN D 1 136 ? -16.667 -8.285  18.705   1.00 106.21 ? 136 GLN D N     1 
ATOM   9823  C  CA    . GLN D 1 136 ? -17.421 -7.326  19.473   1.00 115.77 ? 136 GLN D CA    1 
ATOM   9824  C  C     . GLN D 1 136 ? -17.946 -6.179  18.637   1.00 117.98 ? 136 GLN D C     1 
ATOM   9825  O  O     . GLN D 1 136 ? -19.092 -5.779  18.810   1.00 139.81 ? 136 GLN D O     1 
ATOM   9826  C  CB    . GLN D 1 136 ? -16.594 -6.692  20.600   1.00 123.63 ? 136 GLN D CB    1 
ATOM   9827  C  CG    . GLN D 1 136 ? -16.376 -7.656  21.730   1.00 133.53 ? 136 GLN D CG    1 
ATOM   9828  C  CD    . GLN D 1 136 ? -15.383 -7.154  22.760   1.00 148.29 ? 136 GLN D CD    1 
ATOM   9829  O  OE1   . GLN D 1 136 ? -14.824 -6.070  22.630   1.00 165.66 ? 136 GLN D OE1   1 
ATOM   9830  N  NE2   . GLN D 1 136 ? -15.111 -7.973  23.772   1.00 157.82 ? 136 GLN D NE2   1 
ATOM   9831  N  N     . ALA D 1 137 ? -17.131 -5.637  17.731   1.00 99.72  ? 137 ALA D N     1 
ATOM   9832  C  CA    . ALA D 1 137 ? -17.467 -4.358  17.117   1.00 107.06 ? 137 ALA D CA    1 
ATOM   9833  C  C     . ALA D 1 137 ? -18.685 -4.520  16.218   1.00 109.68 ? 137 ALA D C     1 
ATOM   9834  O  O     . ALA D 1 137 ? -19.589 -3.690  16.235   1.00 101.33 ? 137 ALA D O     1 
ATOM   9835  C  CB    . ALA D 1 137 ? -16.281 -3.767  16.341   1.00 114.17 ? 137 ALA D CB    1 
ATOM   9836  N  N     . VAL D 1 138 ? -18.638 -5.556  15.387   1.00 104.01 ? 138 VAL D N     1 
ATOM   9837  C  CA    . VAL D 1 138 ? -19.691 -5.872  14.430   1.00 97.18  ? 138 VAL D CA    1 
ATOM   9838  C  C     . VAL D 1 138 ? -21.053 -5.898  15.137   1.00 87.12  ? 138 VAL D C     1 
ATOM   9839  O  O     . VAL D 1 138 ? -22.049 -5.348  14.666   1.00 109.71 ? 138 VAL D O     1 
ATOM   9840  C  CB    . VAL D 1 138 ? -19.341 -7.186  13.678   1.00 92.64  ? 138 VAL D CB    1 
ATOM   9841  C  CG1   . VAL D 1 138 ? -20.561 -7.836  13.018   1.00 96.80  ? 138 VAL D CG1   1 
ATOM   9842  C  CG2   . VAL D 1 138 ? -18.198 -6.886  12.732   1.00 87.42  ? 138 VAL D CG2   1 
ATOM   9843  N  N     . LEU D 1 139 ? -21.070 -6.545  16.302   1.00 69.16  ? 139 LEU D N     1 
ATOM   9844  C  CA    . LEU D 1 139 ? -22.281 -6.707  17.054   1.00 68.59  ? 139 LEU D CA    1 
ATOM   9845  C  C     . LEU D 1 139 ? -22.845 -5.352  17.377   1.00 73.89  ? 139 LEU D C     1 
ATOM   9846  O  O     . LEU D 1 139 ? -24.055 -5.119  17.165   1.00 83.36  ? 139 LEU D O     1 
ATOM   9847  C  CB    . LEU D 1 139 ? -22.049 -7.537  18.332   1.00 80.15  ? 139 LEU D CB    1 
ATOM   9848  C  CG    . LEU D 1 139 ? -22.263 -9.059  18.151   1.00 93.61  ? 139 LEU D CG    1 
ATOM   9849  C  CD1   . LEU D 1 139 ? -21.397 -9.612  17.020   1.00 102.65 ? 139 LEU D CD1   1 
ATOM   9850  C  CD2   . LEU D 1 139 ? -22.058 -9.807  19.481   1.00 108.40 ? 139 LEU D CD2   1 
ATOM   9851  N  N     . SER D 1 140 ? -21.997 -4.447  17.861   1.00 74.45  ? 140 SER D N     1 
ATOM   9852  C  CA    . SER D 1 140 ? -22.500 -3.107  18.187   1.00 88.19  ? 140 SER D CA    1 
ATOM   9853  C  C     . SER D 1 140 ? -23.005 -2.408  16.969   1.00 81.41  ? 140 SER D C     1 
ATOM   9854  O  O     . SER D 1 140 ? -23.978 -1.675  17.069   1.00 86.28  ? 140 SER D O     1 
ATOM   9855  C  CB    . SER D 1 140 ? -21.456 -2.201  18.820   1.00 93.32  ? 140 SER D CB    1 
ATOM   9856  O  OG    . SER D 1 140 ? -20.591 -1.875  17.789   1.00 99.11  ? 140 SER D OG    1 
ATOM   9857  N  N     . LEU D 1 141 ? -22.337 -2.616  15.820   1.00 81.85  ? 141 LEU D N     1 
ATOM   9858  C  CA    . LEU D 1 141 ? -22.807 -1.984  14.591   1.00 93.77  ? 141 LEU D CA    1 
ATOM   9859  C  C     . LEU D 1 141 ? -24.197 -2.454  14.275   1.00 90.55  ? 141 LEU D C     1 
ATOM   9860  O  O     . LEU D 1 141 ? -25.049 -1.652  13.888   1.00 85.41  ? 141 LEU D O     1 
ATOM   9861  C  CB    . LEU D 1 141 ? -21.890 -2.340  13.404   1.00 100.09 ? 141 LEU D CB    1 
ATOM   9862  C  CG    . LEU D 1 141 ? -22.368 -1.922  12.033   1.00 110.13 ? 141 LEU D CG    1 
ATOM   9863  C  CD1   . LEU D 1 141 ? -22.053 -0.449  11.887   1.00 93.68  ? 141 LEU D CD1   1 
ATOM   9864  C  CD2   . LEU D 1 141 ? -21.795 -2.806  10.906   1.00 128.70 ? 141 LEU D CD2   1 
ATOM   9865  N  N     . TYR D 1 142 ? -24.471 -3.746  14.453   1.00 86.04  ? 142 TYR D N     1 
ATOM   9866  C  CA    . TYR D 1 142 ? -25.813 -4.292  14.232   1.00 80.42  ? 142 TYR D CA    1 
ATOM   9867  C  C     . TYR D 1 142 ? -26.774 -3.625  15.166   1.00 91.37  ? 142 TYR D C     1 
ATOM   9868  O  O     . TYR D 1 142 ? -27.883 -3.263  14.786   1.00 96.07  ? 142 TYR D O     1 
ATOM   9869  C  CB    . TYR D 1 142 ? -25.921 -5.787  14.626   1.00 67.44  ? 142 TYR D CB    1 
ATOM   9870  C  CG    . TYR D 1 142 ? -25.616 -6.680  13.494   1.00 64.51  ? 142 TYR D CG    1 
ATOM   9871  C  CD1   . TYR D 1 142 ? -26.585 -7.004  12.553   1.00 72.24  ? 142 TYR D CD1   1 
ATOM   9872  C  CD2   . TYR D 1 142 ? -24.378 -7.251  13.383   1.00 69.90  ? 142 TYR D CD2   1 
ATOM   9873  C  CE1   . TYR D 1 142 ? -26.296 -7.851  11.507   1.00 91.03  ? 142 TYR D CE1   1 
ATOM   9874  C  CE2   . TYR D 1 142 ? -24.066 -8.103  12.334   1.00 86.55  ? 142 TYR D CE2   1 
ATOM   9875  C  CZ    . TYR D 1 142 ? -25.029 -8.397  11.394   1.00 95.78  ? 142 TYR D CZ    1 
ATOM   9876  O  OH    . TYR D 1 142 ? -24.722 -9.275  10.345   1.00 74.91  ? 142 TYR D OH    1 
ATOM   9877  N  N     . ALA D 1 143 ? -26.407 -3.576  16.437   1.00 90.91  ? 143 ALA D N     1 
ATOM   9878  C  CA    . ALA D 1 143 ? -27.263 -2.981  17.466   1.00 98.53  ? 143 ALA D CA    1 
ATOM   9879  C  C     . ALA D 1 143 ? -27.653 -1.584  17.095   1.00 101.54 ? 143 ALA D C     1 
ATOM   9880  O  O     . ALA D 1 143 ? -28.736 -1.153  17.446   1.00 92.80  ? 143 ALA D O     1 
ATOM   9881  C  CB    . ALA D 1 143 ? -26.623 -2.940  18.856   1.00 100.61 ? 143 ALA D CB    1 
ATOM   9882  N  N     . SER D 1 144 ? -26.732 -0.834  16.452   1.00 106.23 ? 144 SER D N     1 
ATOM   9883  C  CA    . SER D 1 144 ? -27.031 0.531   16.036   1.00 104.77 ? 144 SER D CA    1 
ATOM   9884  C  C     . SER D 1 144 ? -27.911 0.540   14.809   1.00 116.30 ? 144 SER D C     1 
ATOM   9885  O  O     . SER D 1 144 ? -28.415 1.598   14.450   1.00 121.77 ? 144 SER D O     1 
ATOM   9886  C  CB    . SER D 1 144 ? -25.760 1.372   15.761   1.00 96.09  ? 144 SER D CB    1 
ATOM   9887  O  OG    . SER D 1 144 ? -25.180 1.734   16.989   1.00 101.20 ? 144 SER D OG    1 
ATOM   9888  N  N     . GLY D 1 145 ? -28.077 -0.609  14.137   1.00 113.70 ? 145 GLY D N     1 
ATOM   9889  C  CA    . GLY D 1 145 ? -28.970 -0.664  13.007   1.00 117.85 ? 145 GLY D CA    1 
ATOM   9890  C  C     . GLY D 1 145 ? -28.492 0.032   11.768   1.00 107.72 ? 145 GLY D C     1 
ATOM   9891  O  O     . GLY D 1 145 ? -29.311 0.439   10.941   1.00 103.68 ? 145 GLY D O     1 
ATOM   9892  N  N     . ARG D 1 146 ? -27.169 0.142   11.656   1.00 96.87  ? 146 ARG D N     1 
ATOM   9893  C  CA    . ARG D 1 146 ? -26.488 0.702   10.488   1.00 84.48  ? 146 ARG D CA    1 
ATOM   9894  C  C     . ARG D 1 146 ? -25.638 -0.348  9.864    1.00 88.52  ? 146 ARG D C     1 
ATOM   9895  O  O     . ARG D 1 146 ? -25.110 -1.203  10.584   1.00 112.47 ? 146 ARG D O     1 
ATOM   9896  C  CB    . ARG D 1 146 ? -25.562 1.845   10.867   1.00 80.59  ? 146 ARG D CB    1 
ATOM   9897  C  CG    . ARG D 1 146 ? -26.060 2.675   12.081   1.00 99.85  ? 146 ARG D CG    1 
ATOM   9898  C  CD    . ARG D 1 146 ? -24.985 3.565   12.632   1.00 110.83 ? 146 ARG D CD    1 
ATOM   9899  N  NE    . ARG D 1 146 ? -24.503 4.394   11.540   1.00 118.83 ? 146 ARG D NE    1 
ATOM   9900  C  CZ    . ARG D 1 146 ? -25.125 5.479   11.093   1.00 139.10 ? 146 ARG D CZ    1 
ATOM   9901  N  NH1   . ARG D 1 146 ? -26.256 5.923   11.657   1.00 152.38 ? 146 ARG D NH1   1 
ATOM   9902  N  NH2   . ARG D 1 146 ? -24.610 6.133   10.074   1.00 131.23 ? 146 ARG D NH2   1 
ATOM   9903  N  N     . THR D 1 147 ? -25.507 -0.282  8.529    1.00 91.75  ? 147 THR D N     1 
ATOM   9904  C  CA    . THR D 1 147 ? -24.807 -1.297  7.707    1.00 93.56  ? 147 THR D CA    1 
ATOM   9905  C  C     . THR D 1 147 ? -23.349 -0.911  7.524    1.00 83.25  ? 147 THR D C     1 
ATOM   9906  O  O     . THR D 1 147 ? -22.540 -1.699  7.119    1.00 70.90  ? 147 THR D O     1 
ATOM   9907  C  CB    . THR D 1 147 ? -25.407 -1.384  6.313    1.00 111.86 ? 147 THR D CB    1 
ATOM   9908  O  OG1   . THR D 1 147 ? -25.311 -0.117  5.641    1.00 115.38 ? 147 THR D OG1   1 
ATOM   9909  C  CG2   . THR D 1 147 ? -26.855 -1.757  6.437    1.00 142.63 ? 147 THR D CG2   1 
ATOM   9910  N  N     . THR D 1 148 ? -23.038 0.331   7.872    1.00 87.18  ? 148 THR D N     1 
ATOM   9911  C  CA    . THR D 1 148 ? -21.723 0.877   7.571    1.00 82.52  ? 148 THR D CA    1 
ATOM   9912  C  C     . THR D 1 148 ? -21.313 1.809   8.653    1.00 76.19  ? 148 THR D C     1 
ATOM   9913  O  O     . THR D 1 148 ? -22.119 2.616   9.113    1.00 103.16 ? 148 THR D O     1 
ATOM   9914  C  CB    . THR D 1 148 ? -21.796 1.758   6.318    1.00 92.56  ? 148 THR D CB    1 
ATOM   9915  O  OG1   . THR D 1 148 ? -22.170 0.960   5.198    1.00 118.51 ? 148 THR D OG1   1 
ATOM   9916  C  CG2   . THR D 1 148 ? -20.430 2.403   6.085    1.00 104.14 ? 148 THR D CG2   1 
ATOM   9917  N  N     . GLY D 1 149 ? -20.036 1.789   9.030    1.00 59.64  ? 149 GLY D N     1 
ATOM   9918  C  CA    . GLY D 1 149 ? -19.561 2.673   10.082   1.00 54.50  ? 149 GLY D CA    1 
ATOM   9919  C  C     . GLY D 1 149 ? -18.224 2.215   10.554   1.00 55.25  ? 149 GLY D C     1 
ATOM   9920  O  O     . GLY D 1 149 ? -17.745 1.159   10.129   1.00 67.44  ? 149 GLY D O     1 
ATOM   9921  N  N     . ILE D 1 150 ? -17.549 3.049   11.361   1.00 58.01  ? 150 ILE D N     1 
ATOM   9922  C  CA    . ILE D 1 150 ? -16.302 2.644   11.914   1.00 65.38  ? 150 ILE D CA    1 
ATOM   9923  C  C     . ILE D 1 150 ? -16.580 2.614   13.394   1.00 66.62  ? 150 ILE D C     1 
ATOM   9924  O  O     . ILE D 1 150 ? -16.890 3.590   14.007   1.00 64.05  ? 150 ILE D O     1 
ATOM   9925  C  CB    . ILE D 1 150 ? -15.123 3.543   11.583   1.00 81.45  ? 150 ILE D CB    1 
ATOM   9926  C  CG1   . ILE D 1 150 ? -13.853 2.998   12.280   1.00 99.09  ? 150 ILE D CG1   1 
ATOM   9927  C  CG2   . ILE D 1 150 ? -15.434 5.004   11.917   1.00 88.07  ? 150 ILE D CG2   1 
ATOM   9928  C  CD1   . ILE D 1 150 ? -12.560 3.603   11.732   1.00 123.69 ? 150 ILE D CD1   1 
ATOM   9929  N  N     . VAL D 1 151 ? -16.523 1.422   13.950   1.00 74.66  ? 151 VAL D N     1 
ATOM   9930  C  CA    . VAL D 1 151 ? -16.980 1.206   15.307   1.00 73.15  ? 151 VAL D CA    1 
ATOM   9931  C  C     . VAL D 1 151 ? -15.772 1.271   16.153   1.00 66.20  ? 151 VAL D C     1 
ATOM   9932  O  O     . VAL D 1 151 ? -14.824 0.504   15.922   1.00 62.13  ? 151 VAL D O     1 
ATOM   9933  C  CB    . VAL D 1 151 ? -17.640 -0.123  15.453   1.00 89.49  ? 151 VAL D CB    1 
ATOM   9934  C  CG1   . VAL D 1 151 ? -17.891 -0.433  16.939   1.00 95.63  ? 151 VAL D CG1   1 
ATOM   9935  C  CG2   . VAL D 1 151 ? -18.909 -0.117  14.594   1.00 100.11 ? 151 VAL D CG2   1 
ATOM   9936  N  N     . MET D 1 152 ? -15.802 2.242   17.042   1.00 72.48  ? 152 MET D N     1 
ATOM   9937  C  CA    . MET D 1 152 ? -14.818 2.475   18.100   1.00 79.55  ? 152 MET D CA    1 
ATOM   9938  C  C     . MET D 1 152 ? -15.310 1.755   19.345   1.00 85.51  ? 152 MET D C     1 
ATOM   9939  O  O     . MET D 1 152 ? -16.303 2.091   19.966   1.00 85.84  ? 152 MET D O     1 
ATOM   9940  C  CB    . MET D 1 152 ? -14.735 3.958   18.386   1.00 84.83  ? 152 MET D CB    1 
ATOM   9941  C  CG    . MET D 1 152 ? -13.881 4.378   19.546   1.00 98.31  ? 152 MET D CG    1 
ATOM   9942  S  SD    . MET D 1 152 ? -12.217 3.984   19.063   1.00 133.18 ? 152 MET D SD    1 
ATOM   9943  C  CE    . MET D 1 152 ? -11.427 4.323   20.635   1.00 159.60 ? 152 MET D CE    1 
ATOM   9944  N  N     . ASP D 1 153 ? -14.616 0.691   19.661   1.00 105.00 ? 153 ASP D N     1 
ATOM   9945  C  CA    . ASP D 1 153 ? -15.035 -0.235  20.709   1.00 124.44 ? 153 ASP D CA    1 
ATOM   9946  C  C     . ASP D 1 153 ? -13.995 -0.163  21.803   1.00 118.87 ? 153 ASP D C     1 
ATOM   9947  O  O     . ASP D 1 153 ? -12.828 -0.574  21.590   1.00 139.68 ? 153 ASP D O     1 
ATOM   9948  C  CB    . ASP D 1 153 ? -15.104 -1.678  20.158   1.00 153.44 ? 153 ASP D CB    1 
ATOM   9949  C  CG    . ASP D 1 153 ? -14.874 -2.780  21.206   1.00 166.80 ? 153 ASP D CG    1 
ATOM   9950  O  OD1   . ASP D 1 153 ? -15.171 -2.567  22.434   1.00 151.16 ? 153 ASP D OD1   1 
ATOM   9951  O  OD2   . ASP D 1 153 ? -14.358 -3.837  20.767   1.00 158.64 ? 153 ASP D OD2   1 
ATOM   9952  N  N     . SER D 1 154 ? -14.375 0.367   22.941   1.00 112.79 ? 154 SER D N     1 
ATOM   9953  C  CA    . SER D 1 154 ? -13.461 0.396   24.060   1.00 120.11 ? 154 SER D CA    1 
ATOM   9954  C  C     . SER D 1 154 ? -14.273 -0.065  25.203   1.00 120.41 ? 154 SER D C     1 
ATOM   9955  O  O     . SER D 1 154 ? -15.267 0.594   25.600   1.00 132.55 ? 154 SER D O     1 
ATOM   9956  C  CB    . SER D 1 154 ? -12.866 1.786   24.276   1.00 121.03 ? 154 SER D CB    1 
ATOM