data_5JMO
# 
_entry.id   5JMO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5JMO         
WWPDB D_1000220867 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5JMO 
_pdbx_database_status.recvd_initial_deposition_date   2016-04-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dahms, S.O.' 1 
'Than, M.E.'  2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Rep' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2045-2322 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                34303 
_citation.page_last                 34303 
_citation.title                     
'The structure of a furin-antibody complex explains non-competitive inhibition by steric exclusion of substrate conformers.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/srep34303 
_citation.pdbx_database_id_PubMed   27670069 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Dahms, S.O.'      1 ? 
primary 'Creemers, J.W.'   2 ? 
primary 'Schaub, Y.'       3 ? 
primary 'Bourenkov, G.P.'  4 ? 
primary 'Zogg, T.'         5 ? 
primary 'Brandstetter, H.' 6 ? 
primary 'Than, M.E.'       7 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5JMO 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     169.775 
_cell.length_a_esd                 ? 
_cell.length_b                     50.039 
_cell.length_b_esd                 ? 
_cell.length_c                     144.244 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5JMO 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Furin                                    52388.602 2   3.4.21.75 ? ? ? 
2 polymer     man 'camelid VHH fragment'                   12615.001 2   ?         ? ? ? 
3 polymer     syn CMK-inhibitor                            749.452   2   ?         ? ? ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   4   ?         ? ? ? 
5 non-polymer syn 'CALCIUM ION'                            40.078    6   ?         ? ? ? 
6 non-polymer syn 'SODIUM ION'                             22.990    2   ?         ? ? ? 
7 water       nat water                                    18.015    769 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Dibasic-processing enzyme,Paired basic amino acid residue-cleaving enzyme,PACE' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTASGSLVPRGSHHHH
HH
;
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTASGSLVPRGSHHHH
HH
;
A,B ? 
2 'polypeptide(L)' no no  
;QVQLQESGGGLVQPGGSLTLSCAASGFTFSSYSMYWVRQAPGKGLEWVSSINRVGSNTDYADSVKGRFTISRDNAKNTLY
LQMNSLKSEDTALYYCAVGMYAAPPWRGQGTQVTVSS
;
;QVQLQESGGGLVQPGGSLTLSCAASGFTFSSYSMYWVRQAPGKGLEWVSSINRVGSNTDYADSVKGRFTISRDNAKNTLY
LQMNSLKSEDTALYYCAVGMYAAPPWRGQGTQVTVSS
;
C,D ? 
3 'polypeptide(L)' no yes '(DKA)RVK(AR7)(0QE)' XRVKRX G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   VAL n 
1 3   TYR n 
1 4   GLN n 
1 5   GLU n 
1 6   PRO n 
1 7   THR n 
1 8   ASP n 
1 9   PRO n 
1 10  LYS n 
1 11  PHE n 
1 12  PRO n 
1 13  GLN n 
1 14  GLN n 
1 15  TRP n 
1 16  TYR n 
1 17  LEU n 
1 18  SER n 
1 19  GLY n 
1 20  VAL n 
1 21  THR n 
1 22  GLN n 
1 23  ARG n 
1 24  ASP n 
1 25  LEU n 
1 26  ASN n 
1 27  VAL n 
1 28  LYS n 
1 29  ALA n 
1 30  ALA n 
1 31  TRP n 
1 32  ALA n 
1 33  GLN n 
1 34  GLY n 
1 35  TYR n 
1 36  THR n 
1 37  GLY n 
1 38  HIS n 
1 39  GLY n 
1 40  ILE n 
1 41  VAL n 
1 42  VAL n 
1 43  SER n 
1 44  ILE n 
1 45  LEU n 
1 46  ASP n 
1 47  ASP n 
1 48  GLY n 
1 49  ILE n 
1 50  GLU n 
1 51  LYS n 
1 52  ASN n 
1 53  HIS n 
1 54  PRO n 
1 55  ASP n 
1 56  LEU n 
1 57  ALA n 
1 58  GLY n 
1 59  ASN n 
1 60  TYR n 
1 61  ASP n 
1 62  PRO n 
1 63  GLY n 
1 64  ALA n 
1 65  SER n 
1 66  PHE n 
1 67  ASP n 
1 68  VAL n 
1 69  ASN n 
1 70  ASP n 
1 71  GLN n 
1 72  ASP n 
1 73  PRO n 
1 74  ASP n 
1 75  PRO n 
1 76  GLN n 
1 77  PRO n 
1 78  ARG n 
1 79  TYR n 
1 80  THR n 
1 81  GLN n 
1 82  MET n 
1 83  ASN n 
1 84  ASP n 
1 85  ASN n 
1 86  ARG n 
1 87  HIS n 
1 88  GLY n 
1 89  THR n 
1 90  ARG n 
1 91  CYS n 
1 92  ALA n 
1 93  GLY n 
1 94  GLU n 
1 95  VAL n 
1 96  ALA n 
1 97  ALA n 
1 98  VAL n 
1 99  ALA n 
1 100 ASN n 
1 101 ASN n 
1 102 GLY n 
1 103 VAL n 
1 104 CYS n 
1 105 GLY n 
1 106 VAL n 
1 107 GLY n 
1 108 VAL n 
1 109 ALA n 
1 110 TYR n 
1 111 ASN n 
1 112 ALA n 
1 113 ARG n 
1 114 ILE n 
1 115 GLY n 
1 116 GLY n 
1 117 VAL n 
1 118 ARG n 
1 119 MET n 
1 120 LEU n 
1 121 ASP n 
1 122 GLY n 
1 123 GLU n 
1 124 VAL n 
1 125 THR n 
1 126 ASP n 
1 127 ALA n 
1 128 VAL n 
1 129 GLU n 
1 130 ALA n 
1 131 ARG n 
1 132 SER n 
1 133 LEU n 
1 134 GLY n 
1 135 LEU n 
1 136 ASN n 
1 137 PRO n 
1 138 ASN n 
1 139 HIS n 
1 140 ILE n 
1 141 HIS n 
1 142 ILE n 
1 143 TYR n 
1 144 SER n 
1 145 ALA n 
1 146 SER n 
1 147 TRP n 
1 148 GLY n 
1 149 PRO n 
1 150 GLU n 
1 151 ASP n 
1 152 ASP n 
1 153 GLY n 
1 154 LYS n 
1 155 THR n 
1 156 VAL n 
1 157 ASP n 
1 158 GLY n 
1 159 PRO n 
1 160 ALA n 
1 161 ARG n 
1 162 LEU n 
1 163 ALA n 
1 164 GLU n 
1 165 GLU n 
1 166 ALA n 
1 167 PHE n 
1 168 PHE n 
1 169 ARG n 
1 170 GLY n 
1 171 VAL n 
1 172 SER n 
1 173 GLN n 
1 174 GLY n 
1 175 ARG n 
1 176 GLY n 
1 177 GLY n 
1 178 LEU n 
1 179 GLY n 
1 180 SER n 
1 181 ILE n 
1 182 PHE n 
1 183 VAL n 
1 184 TRP n 
1 185 ALA n 
1 186 SER n 
1 187 GLY n 
1 188 ASN n 
1 189 GLY n 
1 190 GLY n 
1 191 ARG n 
1 192 GLU n 
1 193 HIS n 
1 194 ASP n 
1 195 SER n 
1 196 CYS n 
1 197 ASN n 
1 198 CYS n 
1 199 ASP n 
1 200 GLY n 
1 201 TYR n 
1 202 THR n 
1 203 ASN n 
1 204 SER n 
1 205 ILE n 
1 206 TYR n 
1 207 THR n 
1 208 LEU n 
1 209 SER n 
1 210 ILE n 
1 211 SER n 
1 212 SER n 
1 213 ALA n 
1 214 THR n 
1 215 GLN n 
1 216 PHE n 
1 217 GLY n 
1 218 ASN n 
1 219 VAL n 
1 220 PRO n 
1 221 TRP n 
1 222 TYR n 
1 223 SER n 
1 224 GLU n 
1 225 ALA n 
1 226 CYS n 
1 227 SER n 
1 228 SER n 
1 229 THR n 
1 230 LEU n 
1 231 ALA n 
1 232 THR n 
1 233 THR n 
1 234 TYR n 
1 235 SER n 
1 236 SER n 
1 237 GLY n 
1 238 ASN n 
1 239 GLN n 
1 240 ASN n 
1 241 GLU n 
1 242 LYS n 
1 243 GLN n 
1 244 ILE n 
1 245 VAL n 
1 246 THR n 
1 247 THR n 
1 248 ASP n 
1 249 LEU n 
1 250 ARG n 
1 251 GLN n 
1 252 LYS n 
1 253 CYS n 
1 254 THR n 
1 255 GLU n 
1 256 SER n 
1 257 HIS n 
1 258 THR n 
1 259 GLY n 
1 260 THR n 
1 261 SER n 
1 262 ALA n 
1 263 SER n 
1 264 ALA n 
1 265 PRO n 
1 266 LEU n 
1 267 ALA n 
1 268 ALA n 
1 269 GLY n 
1 270 ILE n 
1 271 ILE n 
1 272 ALA n 
1 273 LEU n 
1 274 THR n 
1 275 LEU n 
1 276 GLU n 
1 277 ALA n 
1 278 ASN n 
1 279 LYS n 
1 280 ASN n 
1 281 LEU n 
1 282 THR n 
1 283 TRP n 
1 284 ARG n 
1 285 ASP n 
1 286 MET n 
1 287 GLN n 
1 288 HIS n 
1 289 LEU n 
1 290 VAL n 
1 291 VAL n 
1 292 GLN n 
1 293 THR n 
1 294 SER n 
1 295 LYS n 
1 296 PRO n 
1 297 ALA n 
1 298 HIS n 
1 299 LEU n 
1 300 ASN n 
1 301 ALA n 
1 302 ASN n 
1 303 ASP n 
1 304 TRP n 
1 305 ALA n 
1 306 THR n 
1 307 ASN n 
1 308 GLY n 
1 309 VAL n 
1 310 GLY n 
1 311 ARG n 
1 312 LYS n 
1 313 VAL n 
1 314 SER n 
1 315 HIS n 
1 316 SER n 
1 317 TYR n 
1 318 GLY n 
1 319 TYR n 
1 320 GLY n 
1 321 LEU n 
1 322 LEU n 
1 323 ASP n 
1 324 ALA n 
1 325 GLY n 
1 326 ALA n 
1 327 MET n 
1 328 VAL n 
1 329 ALA n 
1 330 LEU n 
1 331 ALA n 
1 332 GLN n 
1 333 ASN n 
1 334 TRP n 
1 335 THR n 
1 336 THR n 
1 337 VAL n 
1 338 ALA n 
1 339 PRO n 
1 340 GLN n 
1 341 ARG n 
1 342 LYS n 
1 343 CYS n 
1 344 ILE n 
1 345 ILE n 
1 346 ASP n 
1 347 ILE n 
1 348 LEU n 
1 349 THR n 
1 350 GLU n 
1 351 PRO n 
1 352 LYS n 
1 353 ASP n 
1 354 ILE n 
1 355 GLY n 
1 356 LYS n 
1 357 ARG n 
1 358 LEU n 
1 359 GLU n 
1 360 VAL n 
1 361 ARG n 
1 362 LYS n 
1 363 THR n 
1 364 VAL n 
1 365 THR n 
1 366 ALA n 
1 367 CYS n 
1 368 LEU n 
1 369 GLY n 
1 370 GLU n 
1 371 PRO n 
1 372 ASN n 
1 373 HIS n 
1 374 ILE n 
1 375 THR n 
1 376 ARG n 
1 377 LEU n 
1 378 GLU n 
1 379 HIS n 
1 380 ALA n 
1 381 GLN n 
1 382 ALA n 
1 383 ARG n 
1 384 LEU n 
1 385 THR n 
1 386 LEU n 
1 387 SER n 
1 388 TYR n 
1 389 ASN n 
1 390 ARG n 
1 391 ARG n 
1 392 GLY n 
1 393 ASP n 
1 394 LEU n 
1 395 ALA n 
1 396 ILE n 
1 397 HIS n 
1 398 LEU n 
1 399 VAL n 
1 400 SER n 
1 401 PRO n 
1 402 MET n 
1 403 GLY n 
1 404 THR n 
1 405 ARG n 
1 406 SER n 
1 407 THR n 
1 408 LEU n 
1 409 LEU n 
1 410 ALA n 
1 411 ALA n 
1 412 ARG n 
1 413 PRO n 
1 414 HIS n 
1 415 ASP n 
1 416 TYR n 
1 417 SER n 
1 418 ALA n 
1 419 ASP n 
1 420 GLY n 
1 421 PHE n 
1 422 ASN n 
1 423 ASP n 
1 424 TRP n 
1 425 ALA n 
1 426 PHE n 
1 427 MET n 
1 428 THR n 
1 429 THR n 
1 430 HIS n 
1 431 SER n 
1 432 TRP n 
1 433 ASP n 
1 434 GLU n 
1 435 ASP n 
1 436 PRO n 
1 437 SER n 
1 438 GLY n 
1 439 GLU n 
1 440 TRP n 
1 441 VAL n 
1 442 LEU n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 ASN n 
1 447 THR n 
1 448 SER n 
1 449 GLU n 
1 450 ALA n 
1 451 ASN n 
1 452 ASN n 
1 453 TYR n 
1 454 GLY n 
1 455 THR n 
1 456 LEU n 
1 457 THR n 
1 458 LYS n 
1 459 PHE n 
1 460 THR n 
1 461 LEU n 
1 462 VAL n 
1 463 LEU n 
1 464 TYR n 
1 465 GLY n 
1 466 THR n 
1 467 ALA n 
1 468 SER n 
1 469 GLY n 
1 470 SER n 
1 471 LEU n 
1 472 VAL n 
1 473 PRO n 
1 474 ARG n 
1 475 GLY n 
1 476 SER n 
1 477 HIS n 
1 478 HIS n 
1 479 HIS n 
1 480 HIS n 
1 481 HIS n 
1 482 HIS n 
2 1   GLN n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   GLN n 
2 6   GLU n 
2 7   SER n 
2 8   GLY n 
2 9   GLY n 
2 10  GLY n 
2 11  LEU n 
2 12  VAL n 
2 13  GLN n 
2 14  PRO n 
2 15  GLY n 
2 16  GLY n 
2 17  SER n 
2 18  LEU n 
2 19  THR n 
2 20  LEU n 
2 21  SER n 
2 22  CYS n 
2 23  ALA n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  PHE n 
2 28  THR n 
2 29  PHE n 
2 30  SER n 
2 31  SER n 
2 32  TYR n 
2 33  SER n 
2 34  MET n 
2 35  TYR n 
2 36  TRP n 
2 37  VAL n 
2 38  ARG n 
2 39  GLN n 
2 40  ALA n 
2 41  PRO n 
2 42  GLY n 
2 43  LYS n 
2 44  GLY n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  VAL n 
2 49  SER n 
2 50  SER n 
2 51  ILE n 
2 52  ASN n 
2 53  ARG n 
2 54  VAL n 
2 55  GLY n 
2 56  SER n 
2 57  ASN n 
2 58  THR n 
2 59  ASP n 
2 60  TYR n 
2 61  ALA n 
2 62  ASP n 
2 63  SER n 
2 64  VAL n 
2 65  LYS n 
2 66  GLY n 
2 67  ARG n 
2 68  PHE n 
2 69  THR n 
2 70  ILE n 
2 71  SER n 
2 72  ARG n 
2 73  ASP n 
2 74  ASN n 
2 75  ALA n 
2 76  LYS n 
2 77  ASN n 
2 78  THR n 
2 79  LEU n 
2 80  TYR n 
2 81  LEU n 
2 82  GLN n 
2 83  MET n 
2 84  ASN n 
2 85  SER n 
2 86  LEU n 
2 87  LYS n 
2 88  SER n 
2 89  GLU n 
2 90  ASP n 
2 91  THR n 
2 92  ALA n 
2 93  LEU n 
2 94  TYR n 
2 95  TYR n 
2 96  CYS n 
2 97  ALA n 
2 98  VAL n 
2 99  GLY n 
2 100 MET n 
2 101 TYR n 
2 102 ALA n 
2 103 ALA n 
2 104 PRO n 
2 105 PRO n 
2 106 TRP n 
2 107 ARG n 
2 108 GLY n 
2 109 GLN n 
2 110 GLY n 
2 111 THR n 
2 112 GLN n 
2 113 VAL n 
2 114 THR n 
2 115 VAL n 
2 116 SER n 
2 117 SER n 
3 1   DKA n 
3 2   ARG n 
3 3   VAL n 
3 4   LYS n 
3 5   AR7 n 
3 6   0QE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 482 Human           ? 'FURIN, FUR, PACE, PCSK3' ? ? ? ? ? ? 'Homo sapiens'        9606 ? ? ? ? 
? ? ? Human 'Homo sapiens'     9606 ? ? ? ? ? ? ? ? HEK293S ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 117 'Arabian camel' ? ?                         ? ? ? ? ? ? 'Camelus dromedarius' 9838 ? ? ? ? 
? ? ? ?     'Escherichia coli' 562  ? ? ? ? ? ? ? ? ?       ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       6 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP FURIN_HUMAN P09958 ? 1 
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTA
;
108 
2 PDB 5JMO        5JMO   ? 2 ? 1   
3 PDB 5JMO        5JMO   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5JMO A 1 ? 467 ? P09958 108 ? 574 ? 108 574 
2 1 5JMO B 1 ? 467 ? P09958 108 ? 574 ? 108 574 
3 2 5JMO C 1 ? 117 ? 5JMO   1   ? 117 ? 1   117 
4 2 5JMO D 1 ? 117 ? 5JMO   1   ? 117 ? 1   117 
5 3 5JMO G 1 ? 6   ? 5JMO   1   ? 6   ? 1   6   
6 3 5JMO H 1 ? 6   ? 5JMO   2   ? 7   ? 2   7   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5JMO SER A 468 ? UNP P09958 ? ? 'expression tag' 575 1  
1 5JMO GLY A 469 ? UNP P09958 ? ? 'expression tag' 576 2  
1 5JMO SER A 470 ? UNP P09958 ? ? 'expression tag' 577 3  
1 5JMO LEU A 471 ? UNP P09958 ? ? 'expression tag' 578 4  
1 5JMO VAL A 472 ? UNP P09958 ? ? 'expression tag' 579 5  
1 5JMO PRO A 473 ? UNP P09958 ? ? 'expression tag' 580 6  
1 5JMO ARG A 474 ? UNP P09958 ? ? 'expression tag' 581 7  
1 5JMO GLY A 475 ? UNP P09958 ? ? 'expression tag' 582 8  
1 5JMO SER A 476 ? UNP P09958 ? ? 'expression tag' 583 9  
1 5JMO HIS A 477 ? UNP P09958 ? ? 'expression tag' 584 10 
1 5JMO HIS A 478 ? UNP P09958 ? ? 'expression tag' 585 11 
1 5JMO HIS A 479 ? UNP P09958 ? ? 'expression tag' 586 12 
1 5JMO HIS A 480 ? UNP P09958 ? ? 'expression tag' 587 13 
1 5JMO HIS A 481 ? UNP P09958 ? ? 'expression tag' 588 14 
1 5JMO HIS A 482 ? UNP P09958 ? ? 'expression tag' 589 15 
2 5JMO SER B 468 ? UNP P09958 ? ? 'expression tag' 575 16 
2 5JMO GLY B 469 ? UNP P09958 ? ? 'expression tag' 576 17 
2 5JMO SER B 470 ? UNP P09958 ? ? 'expression tag' 577 18 
2 5JMO LEU B 471 ? UNP P09958 ? ? 'expression tag' 578 19 
2 5JMO VAL B 472 ? UNP P09958 ? ? 'expression tag' 579 20 
2 5JMO PRO B 473 ? UNP P09958 ? ? 'expression tag' 580 21 
2 5JMO ARG B 474 ? UNP P09958 ? ? 'expression tag' 581 22 
2 5JMO GLY B 475 ? UNP P09958 ? ? 'expression tag' 582 23 
2 5JMO SER B 476 ? UNP P09958 ? ? 'expression tag' 583 24 
2 5JMO HIS B 477 ? UNP P09958 ? ? 'expression tag' 584 25 
2 5JMO HIS B 478 ? UNP P09958 ? ? 'expression tag' 585 26 
2 5JMO HIS B 479 ? UNP P09958 ? ? 'expression tag' 586 27 
2 5JMO HIS B 480 ? UNP P09958 ? ? 'expression tag' 587 28 
2 5JMO HIS B 481 ? UNP P09958 ? ? 'expression tag' 588 29 
2 5JMO HIS B 482 ? UNP P09958 ? ? 'expression tag' 589 30 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0QE non-polymer                  . chloromethane                                                 'Chloro Methyl group' 'C H3 Cl' 
50.488  
ALA 'L-peptide linking'          y ALANINE                                                       ?                     
'C3 H7 N O2'     89.093  
AR7 peptide-like                 n 'amino{[(4S)-4-amino-5,5-dihydroxypentyl]amino}methaniminium' ?                     
'C6 H17 N4 O2 1' 177.225 
ARG 'L-peptide linking'          y ARGININE                                                      ?                     
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                    ?                     
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                               ?                     
'C4 H7 N O4'     133.103 
CA  non-polymer                  . 'CALCIUM ION'                                                 ?                     'Ca 2' 
40.078  
CYS 'L-peptide linking'          y CYSTEINE                                                      ?                     
'C3 H7 N O2 S'   121.158 
DKA non-polymer                  . 'DECANOIC ACID'                                               ?                     
'C10 H20 O2'     172.265 
GLN 'L-peptide linking'          y GLUTAMINE                                                     ?                     
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                               ?                     
'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                                       ?                     
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                     ?                     
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                         ?                     'H2 O' 
18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                    ?                     
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                                       ?                     
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                                        ?                     
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                                    ?                     
'C5 H11 N O2 S'  149.211 
NA  non-polymer                  . 'SODIUM ION'                                                  ?                     'Na 1' 
22.990  
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                      ?                     
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                                 ?                     
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                                       ?                     
'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                                        ?                     
'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                                     ?                     
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                    ?                     
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                                      ?                     
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                                        ?                     
'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5JMO 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.33 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47.20 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '.1 M sodium acetate, pH 5.6, 16-18% PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-06-18 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.976300 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PETRA III, EMBL c/o DESY BEAMLINE P13 (MX1)' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.976300 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   'P13 (MX1)' 
_diffrn_source.pdbx_synchrotron_site       'PETRA III, EMBL c/o DESY' 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5JMO 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.998 
_reflns.d_resolution_low                 66.381 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       83341 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.73 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.132 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.02 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.998 
_reflns_shell.d_res_low                   2.12 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             0.608 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5JMO 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.998 
_refine.ls_d_res_low                             66.381 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     83298 
_refine.ls_number_reflns_R_free                  4181 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.74 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1647 
_refine.ls_R_factor_R_free                       0.1971 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1630 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.21 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '4RYD (furin, chain A or chain B) and 5JMR (antibody, chain C or chain D)' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 17.91 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.17 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9025 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             769 
_refine_hist.number_atoms_total               9858 
_refine_hist.d_res_high                       1.998 
_refine_hist.d_res_low                        66.381 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 9353  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.054  ? 12736 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 13.589 ? 3390  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.043  ? 1389  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 1673  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.9979 2.0207  . . 0   2517 91.00  . . . .      . 0.2070 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0207 2.0444  . . 279 2455 100.00 . . . 0.2458 . 0.1964 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0444 2.0694  . . 0   2739 98.00  . . . .      . 0.1922 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0694 2.0956  . . 279 2440 97.00  . . . 0.2476 . 0.1891 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0956 2.1231  . . 0   2746 100.00 . . . .      . 0.1776 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1231 2.1522  . . 279 2484 99.00  . . . 0.2164 . 0.1852 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1522 2.1830  . . 0   2716 96.00  . . . .      . 0.1805 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1830 2.2156  . . 279 2446 100.00 . . . 0.2224 . 0.1720 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2156 2.2502  . . 0   2760 99.00  . . . .      . 0.1721 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2502 2.2871  . . 279 2431 97.00  . . . 0.2134 . 0.1773 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2871 2.3265  . . 0   2754 100.00 . . . .      . 0.1737 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3265 2.3688  . . 278 2503 99.00  . . . 0.2218 . 0.1772 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3688 2.4144  . . 0   2724 98.00  . . . .      . 0.1740 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4144 2.4637  . . 279 2522 100.00 . . . 0.2444 . 0.1715 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4637 2.5172  . . 0   2735 98.00  . . . .      . 0.1718 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5172 2.5758  . . 278 2484 100.00 . . . 0.1917 . 0.1622 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5758 2.6402  . . 0   2774 98.00  . . . .      . 0.1720 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6402 2.7116  . . 279 2501 100.00 . . . 0.2109 . 0.1688 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7116 2.7914  . . 0   2752 97.00  . . . .      . 0.1692 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7914 2.8815  . . 279 2512 100.00 . . . 0.2004 . 0.1732 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8815 2.9845  . . 0   2783 99.00  . . . .      . 0.1613 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9845 3.1040  . . 279 2538 100.00 . . . 0.2046 . 0.1695 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1040 3.2452  . . 0   2754 98.00  . . . .      . 0.1679 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2452 3.4163  . . 279 2522 99.00  . . . 0.1932 . 0.1646 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4163 3.6303  . . 0   2829 99.00  . . . .      . 0.1614 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6303 3.9106  . . 278 2568 100.00 . . . 0.1743 . 0.1495 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9106 4.3041  . . 0   2838 100.00 . . . .      . 0.1260 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3041 4.9267  . . 278 2616 100.00 . . . 0.1421 . 0.1276 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9267 6.2065  . . 0   2915 100.00 . . . .      . 0.1480 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.2065 66.4173 . . 279 2759 99.00  . . . 0.2058 . 0.1734 . . . . . . . . . . 
# 
_struct.entry_id                     5JMO 
_struct.title                        'X-ray structure of furin in complex with the inhibitory antibody Nb14' 
_struct.pdbx_descriptor              'Furin (E.C.3.4.21.75), camelid VHH fragment, CMK-inhibitor' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5JMO 
_struct_keywords.text            'protease, camelid, antibody, complex, Hydrolase-Antibody complex, furin' 
_struct_keywords.pdbx_keywords   Hydrolase/Antibody 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 6 ? 
M N N 4 ? 
N N N 4 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 6 ? 
S N N 7 ? 
T N N 7 ? 
U N N 7 ? 
V N N 7 ? 
W N N 7 ? 
X N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 10  ? GLN A 13  ? LYS A 117 GLN A 120 5 ? 4  
HELX_P HELX_P2  AA2 GLN A 14  ? GLY A 19  ? GLN A 121 GLY A 126 1 ? 6  
HELX_P HELX_P3  AA3 ASN A 26  ? GLN A 33  ? ASN A 133 GLN A 140 1 ? 8  
HELX_P HELX_P4  AA4 LEU A 56  ? TYR A 60  ? LEU A 163 TYR A 167 5 ? 5  
HELX_P HELX_P5  AA5 ASP A 61  ? SER A 65  ? ASP A 168 SER A 172 5 ? 5  
HELX_P HELX_P6  AA6 ARG A 86  ? ALA A 97  ? ARG A 193 ALA A 204 1 ? 12 
HELX_P HELX_P7  AA7 THR A 125 ? GLY A 134 ? THR A 232 GLY A 241 1 ? 10 
HELX_P HELX_P8  AA8 ALA A 160 ? GLY A 174 ? ALA A 267 GLY A 281 1 ? 15 
HELX_P HELX_P9  AA9 ARG A 175 ? LEU A 178 ? ARG A 282 LEU A 285 5 ? 4  
HELX_P HELX_P10 AB1 GLY A 189 ? HIS A 193 ? GLY A 296 HIS A 300 5 ? 5  
HELX_P HELX_P11 AB2 SER A 195 ? ASP A 199 ? SER A 302 ASP A 306 5 ? 5  
HELX_P HELX_P12 AB3 GLY A 259 ? ASN A 278 ? GLY A 366 ASN A 385 1 ? 20 
HELX_P HELX_P13 AB4 THR A 282 ? SER A 294 ? THR A 389 SER A 401 1 ? 13 
HELX_P HELX_P14 AB5 ASP A 323 ? GLN A 332 ? ASP A 430 GLN A 439 1 ? 10 
HELX_P HELX_P15 AB6 ARG A 390 ? GLY A 392 ? ARG A 497 GLY A 499 5 ? 3  
HELX_P HELX_P16 AB7 LYS B 10  ? GLN B 14  ? LYS B 117 GLN B 121 5 ? 5  
HELX_P HELX_P17 AB8 ASN B 26  ? GLN B 33  ? ASN B 133 GLN B 140 1 ? 8  
HELX_P HELX_P18 AB9 LEU B 56  ? TYR B 60  ? LEU B 163 TYR B 167 5 ? 5  
HELX_P HELX_P19 AC1 ASP B 61  ? SER B 65  ? ASP B 168 SER B 172 5 ? 5  
HELX_P HELX_P20 AC2 ASN B 83  ? ASN B 85  ? ASN B 190 ASN B 192 5 ? 3  
HELX_P HELX_P21 AC3 ARG B 86  ? ALA B 97  ? ARG B 193 ALA B 204 1 ? 12 
HELX_P HELX_P22 AC4 THR B 125 ? GLY B 134 ? THR B 232 GLY B 241 1 ? 10 
HELX_P HELX_P23 AC5 ALA B 160 ? GLY B 174 ? ALA B 267 GLY B 281 1 ? 15 
HELX_P HELX_P24 AC6 ARG B 175 ? LEU B 178 ? ARG B 282 LEU B 285 5 ? 4  
HELX_P HELX_P25 AC7 GLY B 189 ? HIS B 193 ? GLY B 296 HIS B 300 5 ? 5  
HELX_P HELX_P26 AC8 SER B 195 ? ASP B 199 ? SER B 302 ASP B 306 5 ? 5  
HELX_P HELX_P27 AC9 GLY B 259 ? ASN B 278 ? GLY B 366 ASN B 385 1 ? 20 
HELX_P HELX_P28 AD1 THR B 282 ? SER B 294 ? THR B 389 SER B 401 1 ? 13 
HELX_P HELX_P29 AD2 ASP B 323 ? GLN B 332 ? ASP B 430 GLN B 439 1 ? 10 
HELX_P HELX_P30 AD3 ARG B 390 ? GLY B 392 ? ARG B 497 GLY B 499 5 ? 3  
HELX_P HELX_P31 AD4 THR C 28  ? TYR C 32  ? THR C 28  TYR C 32  5 ? 5  
HELX_P HELX_P32 AD5 ASP C 62  ? LYS C 65  ? ASP C 62  LYS C 65  5 ? 4  
HELX_P HELX_P33 AD6 LYS C 87  ? THR C 91  ? LYS C 87  THR C 91  5 ? 5  
HELX_P HELX_P34 AD7 THR D 28  ? TYR D 32  ? THR D 28  TYR D 32  5 ? 5  
HELX_P HELX_P35 AD8 LYS D 87  ? THR D 91  ? LYS D 87  THR D 91  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 104 SG  ? ? ? 1_555 A CYS 253 SG ? ? A CYS 211 A CYS 360  1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf2  disulf ?    ? A CYS 196 SG  ? ? ? 1_555 A CYS 226 SG ? ? A CYS 303 A CYS 333  1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf3  disulf ?    ? A CYS 343 SG  ? ? ? 1_555 A CYS 367 SG ? ? A CYS 450 A CYS 474  1_555 ? ? ? ? ? ? ? 2.058 ? ?               
disulf4  disulf ?    ? B CYS 104 SG  ? ? ? 1_555 B CYS 253 SG ? ? B CYS 211 B CYS 360  1_555 ? ? ? ? ? ? ? 2.070 ? ?               
disulf5  disulf ?    ? B CYS 196 SG  ? ? ? 1_555 B CYS 226 SG ? ? B CYS 303 B CYS 333  1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf6  disulf ?    ? B CYS 343 SG  ? ? ? 1_555 B CYS 367 SG ? ? B CYS 450 B CYS 474  1_555 ? ? ? ? ? ? ? 2.055 ? ?               
disulf7  disulf ?    ? C CYS 22  SG  ? ? ? 1_555 C CYS 96  SG ? ? C CYS 22  C CYS 96   1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf8  disulf ?    ? D CYS 22  SG  ? ? ? 1_555 D CYS 96  SG ? ? D CYS 22  D CYS 96   1_555 ? ? ? ? ? ? ? 2.040 ? ?               
covale1  covale one  ? A HIS 87  NE2 ? ? ? 1_555 E 0QE 6   C1 ? ? A HIS 194 G 0QE 6    1_555 ? ? ? ? ? ? ? 1.519 ? ?               
covale2  covale one  ? A SER 261 OG  ? ? ? 1_555 E AR7 5   C  ? ? A SER 368 G AR7 5    1_555 ? ? ? ? ? ? ? 1.424 ? ?               
covale3  covale one  ? A ASN 280 ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 387 A NAG 601  1_555 ? ? ? ? ? ? ? 1.421 ? N-Glycosylation 
covale4  covale one  ? A ASN 333 ND2 ? ? ? 1_555 H NAG .   C1 ? ? A ASN 440 A NAG 602  1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation 
covale5  covale one  ? B HIS 87  NE2 ? ? ? 1_555 F 0QE 6   C1 ? ? B HIS 194 H 0QE 7    1_555 ? ? ? ? ? ? ? 1.499 ? ?               
covale6  covale one  ? B SER 261 OG  ? ? ? 1_555 F AR7 5   C  ? ? B SER 368 H AR7 6    1_555 ? ? ? ? ? ? ? 1.416 ? ?               
covale7  covale one  ? B ASN 280 ND2 ? ? ? 1_555 M NAG .   C1 ? ? B ASN 387 B NAG 601  1_555 ? ? ? ? ? ? ? 1.428 ? N-Glycosylation 
covale8  covale one  ? B ASN 333 ND2 ? ? ? 1_555 N NAG .   C1 ? ? B ASN 440 B NAG 602  1_555 ? ? ? ? ? ? ? 1.426 ? N-Glycosylation 
covale9  covale both ? E DKA 1   C1  ? ? ? 1_555 E ARG 2   N  ? ? G DKA 1   G ARG 2    1_555 ? ? ? ? ? ? ? 1.339 ? ?               
covale10 covale both ? E LYS 4   C   ? ? ? 1_555 E AR7 5   N  ? ? G LYS 4   G AR7 5    1_555 ? ? ? ? ? ? ? 1.333 ? ?               
covale11 covale both ? E AR7 5   C   ? ? ? 1_555 E 0QE 6   C1 ? ? G AR7 5   G 0QE 6    1_555 ? ? ? ? ? ? ? 1.557 ? ?               
covale12 covale both ? F DKA 1   C1  ? ? ? 1_555 F ARG 2   N  ? ? H DKA 2   H ARG 3    1_555 ? ? ? ? ? ? ? 1.346 ? ?               
covale13 covale both ? F LYS 4   C   ? ? ? 1_555 F AR7 5   N  ? ? H LYS 5   H AR7 6    1_555 ? ? ? ? ? ? ? 1.340 ? ?               
covale14 covale both ? F AR7 5   C   ? ? ? 1_555 F 0QE 6   C1 ? ? H AR7 6   H 0QE 7    1_555 ? ? ? ? ? ? ? 1.556 ? ?               
metalc1  metalc ?    ? A ASP 8   OD2 ? ? ? 1_555 J CA  .   CA ? ? A ASP 115 A CA  604  1_555 ? ? ? ? ? ? ? 2.378 ? ?               
metalc2  metalc ?    ? A ASP 55  OD1 ? ? ? 1_555 J CA  .   CA ? ? A ASP 162 A CA  604  1_555 ? ? ? ? ? ? ? 2.496 ? ?               
metalc3  metalc ?    ? A ASP 55  OD2 ? ? ? 1_555 J CA  .   CA ? ? A ASP 162 A CA  604  1_555 ? ? ? ? ? ? ? 2.568 ? ?               
metalc4  metalc ?    ? A ASP 67  OD2 ? ? ? 1_555 I CA  .   CA ? ? A ASP 174 A CA  603  1_555 ? ? ? ? ? ? ? 2.290 ? ?               
metalc5  metalc ?    ? A ASP 72  OD1 ? ? ? 1_555 I CA  .   CA ? ? A ASP 179 A CA  603  1_555 ? ? ? ? ? ? ? 2.491 ? ?               
metalc6  metalc ?    ? A ASP 72  OD2 ? ? ? 1_555 I CA  .   CA ? ? A ASP 179 A CA  603  1_555 ? ? ? ? ? ? ? 2.594 ? ?               
metalc7  metalc ?    ? A ASP 74  O   ? ? ? 1_555 I CA  .   CA ? ? A ASP 181 A CA  603  1_555 ? ? ? ? ? ? ? 2.407 ? ?               
metalc8  metalc ?    ? A VAL 98  O   ? ? ? 1_555 J CA  .   CA ? ? A VAL 205 A CA  604  1_555 ? ? ? ? ? ? ? 2.327 ? ?               
metalc9  metalc ?    ? A ASN 101 OD1 ? ? ? 1_555 J CA  .   CA ? ? A ASN 208 A CA  604  1_555 ? ? ? ? ? ? ? 2.628 ? ?               
metalc10 metalc ?    ? A VAL 103 O   ? ? ? 1_555 J CA  .   CA ? ? A VAL 210 A CA  604  1_555 ? ? ? ? ? ? ? 2.285 ? ?               
metalc11 metalc ?    ? A GLY 105 O   ? ? ? 1_555 J CA  .   CA ? ? A GLY 212 A CA  604  1_555 ? ? ? ? ? ? ? 2.356 ? ?               
metalc12 metalc ?    ? A ASP 151 OD1 ? ? ? 1_555 K CA  .   CA ? ? A ASP 258 A CA  605  1_555 ? ? ? ? ? ? ? 2.385 ? ?               
metalc13 metalc ?    ? A ASP 194 OD2 ? ? ? 1_555 K CA  .   CA ? ? A ASP 301 A CA  605  1_555 ? ? ? ? ? ? ? 2.342 ? ?               
metalc14 metalc ?    ? A THR 202 O   ? ? ? 1_555 L NA  .   NA ? ? A THR 309 A NA  606  1_555 ? ? ? ? ? ? ? 2.388 ? ?               
metalc15 metalc ?    ? A SER 204 O   ? ? ? 1_555 L NA  .   NA ? ? A SER 311 A NA  606  1_555 ? ? ? ? ? ? ? 2.314 ? ?               
metalc16 metalc ?    ? A THR 207 O   ? ? ? 1_555 L NA  .   NA ? ? A THR 314 A NA  606  1_555 ? ? ? ? ? ? ? 2.404 ? ?               
metalc17 metalc ?    ? A THR 207 OG1 ? ? ? 1_555 L NA  .   NA ? ? A THR 314 A NA  606  1_555 ? ? ? ? ? ? ? 2.416 ? ?               
metalc18 metalc ?    ? A GLU 224 OE1 ? ? ? 1_555 K CA  .   CA ? ? A GLU 331 A CA  605  1_555 ? ? ? ? ? ? ? 2.401 ? ?               
metalc19 metalc ?    ? A GLU 224 OE2 ? ? ? 1_555 K CA  .   CA ? ? A GLU 331 A CA  605  1_555 ? ? ? ? ? ? ? 2.564 ? ?               
metalc20 metalc ?    ? I CA  .   CA  ? ? ? 1_555 S HOH .   O  ? ? A CA  603 A HOH 769  1_555 ? ? ? ? ? ? ? 2.470 ? ?               
metalc21 metalc ?    ? I CA  .   CA  ? ? ? 1_555 S HOH .   O  ? ? A CA  603 A HOH 859  1_555 ? ? ? ? ? ? ? 2.472 ? ?               
metalc22 metalc ?    ? I CA  .   CA  ? ? ? 1_555 S HOH .   O  ? ? A CA  603 A HOH 1008 1_555 ? ? ? ? ? ? ? 2.480 ? ?               
metalc23 metalc ?    ? K CA  .   CA  ? ? ? 1_555 S HOH .   O  ? ? A CA  605 A HOH 808  1_555 ? ? ? ? ? ? ? 2.332 ? ?               
metalc24 metalc ?    ? K CA  .   CA  ? ? ? 1_555 S HOH .   O  ? ? A CA  605 A HOH 948  1_555 ? ? ? ? ? ? ? 2.560 ? ?               
metalc25 metalc ?    ? K CA  .   CA  ? ? ? 1_555 S HOH .   O  ? ? A CA  605 A HOH 955  1_555 ? ? ? ? ? ? ? 2.440 ? ?               
metalc26 metalc ?    ? L NA  .   NA  ? ? ? 1_555 S HOH .   O  ? ? A NA  606 A HOH 765  1_555 ? ? ? ? ? ? ? 2.368 ? ?               
metalc27 metalc ?    ? B ASP 8   OD2 ? ? ? 1_555 P CA  .   CA ? ? B ASP 115 B CA  604  1_555 ? ? ? ? ? ? ? 2.378 ? ?               
metalc28 metalc ?    ? B ASP 55  OD1 ? ? ? 1_555 P CA  .   CA ? ? B ASP 162 B CA  604  1_555 ? ? ? ? ? ? ? 2.508 ? ?               
metalc29 metalc ?    ? B ASP 55  OD2 ? ? ? 1_555 P CA  .   CA ? ? B ASP 162 B CA  604  1_555 ? ? ? ? ? ? ? 2.613 ? ?               
metalc30 metalc ?    ? B ASP 67  OD2 ? ? ? 1_555 O CA  .   CA ? ? B ASP 174 B CA  603  1_555 ? ? ? ? ? ? ? 2.290 ? ?               
metalc31 metalc ?    ? B ASP 72  OD1 ? ? ? 1_555 O CA  .   CA ? ? B ASP 179 B CA  603  1_555 ? ? ? ? ? ? ? 2.509 ? ?               
metalc32 metalc ?    ? B ASP 72  OD2 ? ? ? 1_555 O CA  .   CA ? ? B ASP 179 B CA  603  1_555 ? ? ? ? ? ? ? 2.597 ? ?               
metalc33 metalc ?    ? B ASP 74  O   ? ? ? 1_555 O CA  .   CA ? ? B ASP 181 B CA  603  1_555 ? ? ? ? ? ? ? 2.378 ? ?               
metalc34 metalc ?    ? B VAL 98  O   ? ? ? 1_555 P CA  .   CA ? ? B VAL 205 B CA  604  1_555 ? ? ? ? ? ? ? 2.346 ? ?               
metalc35 metalc ?    ? B ASN 101 OD1 ? ? ? 1_555 P CA  .   CA ? ? B ASN 208 B CA  604  1_555 ? ? ? ? ? ? ? 2.641 ? ?               
metalc36 metalc ?    ? B VAL 103 O   ? ? ? 1_555 P CA  .   CA ? ? B VAL 210 B CA  604  1_555 ? ? ? ? ? ? ? 2.387 ? ?               
metalc37 metalc ?    ? B GLY 105 O   ? ? ? 1_555 P CA  .   CA ? ? B GLY 212 B CA  604  1_555 ? ? ? ? ? ? ? 2.392 ? ?               
metalc38 metalc ?    ? B ASP 151 OD1 ? ? ? 1_555 Q CA  .   CA ? ? B ASP 258 B CA  605  1_555 ? ? ? ? ? ? ? 2.367 ? ?               
metalc39 metalc ?    ? B ASP 194 OD2 ? ? ? 1_555 Q CA  .   CA ? ? B ASP 301 B CA  605  1_555 ? ? ? ? ? ? ? 2.314 ? ?               
metalc40 metalc ?    ? B THR 202 O   ? ? ? 1_555 R NA  .   NA ? ? B THR 309 B NA  606  1_555 ? ? ? ? ? ? ? 2.424 ? ?               
metalc41 metalc ?    ? B SER 204 O   ? ? ? 1_555 R NA  .   NA ? ? B SER 311 B NA  606  1_555 ? ? ? ? ? ? ? 2.315 ? ?               
metalc42 metalc ?    ? B THR 207 O   ? ? ? 1_555 R NA  .   NA ? ? B THR 314 B NA  606  1_555 ? ? ? ? ? ? ? 2.408 ? ?               
metalc43 metalc ?    ? B THR 207 OG1 ? ? ? 1_555 R NA  .   NA ? ? B THR 314 B NA  606  1_555 ? ? ? ? ? ? ? 2.430 ? ?               
metalc44 metalc ?    ? B GLU 224 OE1 ? ? ? 1_555 Q CA  .   CA ? ? B GLU 331 B CA  605  1_555 ? ? ? ? ? ? ? 2.406 ? ?               
metalc45 metalc ?    ? B GLU 224 OE2 ? ? ? 1_555 Q CA  .   CA ? ? B GLU 331 B CA  605  1_555 ? ? ? ? ? ? ? 2.492 ? ?               
metalc46 metalc ?    ? O CA  .   CA  ? ? ? 1_555 T HOH .   O  ? ? B CA  603 B HOH 757  1_555 ? ? ? ? ? ? ? 2.450 ? ?               
metalc47 metalc ?    ? O CA  .   CA  ? ? ? 1_555 T HOH .   O  ? ? B CA  603 B HOH 934  1_555 ? ? ? ? ? ? ? 2.416 ? ?               
metalc48 metalc ?    ? O CA  .   CA  ? ? ? 1_555 T HOH .   O  ? ? B CA  603 B HOH 1029 1_555 ? ? ? ? ? ? ? 2.315 ? ?               
metalc49 metalc ?    ? Q CA  .   CA  ? ? ? 1_555 T HOH .   O  ? ? B CA  605 B HOH 750  1_555 ? ? ? ? ? ? ? 2.413 ? ?               
metalc50 metalc ?    ? Q CA  .   CA  ? ? ? 1_555 T HOH .   O  ? ? B CA  605 B HOH 795  1_555 ? ? ? ? ? ? ? 2.457 ? ?               
metalc51 metalc ?    ? Q CA  .   CA  ? ? ? 1_555 T HOH .   O  ? ? B CA  605 B HOH 923  1_555 ? ? ? ? ? ? ? 2.514 ? ?               
metalc52 metalc ?    ? R NA  .   NA  ? ? ? 1_555 T HOH .   O  ? ? B NA  606 B HOH 811  1_555 ? ? ? ? ? ? ? 2.440 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 104 C . ? PRO 104 C PRO 105 C ? PRO 105 C 1 4.92 
2 PRO 104 D . ? PRO 104 D PRO 105 D ? PRO 105 D 1 9.15 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 3 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 7 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 3 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 5 ? 
AB8 ? 4 ? 
AB9 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? parallel      
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA8 5 6 ? parallel      
AA8 6 7 ? parallel      
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB7 4 5 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB9 1 2 ? parallel      
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 66  ? ASP A 67  ? PHE A 173 ASP A 174 
AA1 2 ARG A 113 ? ARG A 118 ? ARG A 220 ARG A 225 
AA1 3 VAL A 41  ? ASP A 46  ? VAL A 148 ASP A 153 
AA1 4 ILE A 142 ? ALA A 145 ? ILE A 249 ALA A 252 
AA1 5 ILE A 181 ? ALA A 185 ? ILE A 288 ALA A 292 
AA1 6 THR A 207 ? ALA A 213 ? THR A 314 ALA A 320 
AA1 7 ALA A 231 ? TYR A 234 ? ALA A 338 TYR A 341 
AA2 1 TRP A 147 ? GLY A 148 ? TRP A 254 GLY A 255 
AA2 2 VAL E 3   ? LYS E 4   ? VAL G 3   LYS G 4   
AA3 1 ILE A 244 ? ASP A 248 ? ILE A 351 ASP A 355 
AA3 2 LYS A 252 ? HIS A 257 ? LYS A 359 HIS A 364 
AA4 1 ALA A 305 ? THR A 306 ? ALA A 412 THR A 413 
AA4 2 LYS A 312 ? VAL A 313 ? LYS A 419 VAL A 420 
AA5 1 ARG A 341 ? ASP A 346 ? ARG A 448 ASP A 453 
AA5 2 GLY A 454 ? THR A 466 ? GLY A 561 THR A 573 
AA5 3 LYS A 352 ? ASP A 353 ? LYS A 459 ASP A 460 
AA6 1 ARG A 341 ? ASP A 346 ? ARG A 448 ASP A 453 
AA6 2 GLY A 454 ? THR A 466 ? GLY A 561 THR A 573 
AA6 3 ARG A 376 ? TYR A 388 ? ARG A 483 TYR A 495 
AA6 4 PHE A 421 ? THR A 428 ? PHE A 528 THR A 535 
AA7 1 ARG A 357 ? VAL A 364 ? ARG A 464 VAL A 471 
AA7 2 GLY A 438 ? ASN A 446 ? GLY A 545 ASN A 553 
AA7 3 LEU A 394 ? VAL A 399 ? LEU A 501 VAL A 506 
AA7 4 ARG A 405 ? LEU A 409 ? ARG A 512 LEU A 516 
AA8 1 PHE B 66  ? ASP B 67  ? PHE B 173 ASP B 174 
AA8 2 ARG B 113 ? ARG B 118 ? ARG B 220 ARG B 225 
AA8 3 VAL B 41  ? ASP B 46  ? VAL B 148 ASP B 153 
AA8 4 ILE B 142 ? ALA B 145 ? ILE B 249 ALA B 252 
AA8 5 ILE B 181 ? ALA B 185 ? ILE B 288 ALA B 292 
AA8 6 THR B 207 ? ALA B 213 ? THR B 314 ALA B 320 
AA8 7 ALA B 231 ? TYR B 234 ? ALA B 338 TYR B 341 
AA9 1 TRP B 147 ? GLY B 148 ? TRP B 254 GLY B 255 
AA9 2 VAL F 3   ? LYS F 4   ? VAL H 4   LYS H 5   
AB1 1 ILE B 244 ? ASP B 248 ? ILE B 351 ASP B 355 
AB1 2 LYS B 252 ? HIS B 257 ? LYS B 359 HIS B 364 
AB2 1 ALA B 305 ? THR B 306 ? ALA B 412 THR B 413 
AB2 2 LYS B 312 ? VAL B 313 ? LYS B 419 VAL B 420 
AB3 1 ARG B 341 ? ASP B 346 ? ARG B 448 ASP B 453 
AB3 2 GLY B 454 ? THR B 466 ? GLY B 561 THR B 573 
AB3 3 LYS B 352 ? ASP B 353 ? LYS B 459 ASP B 460 
AB4 1 ARG B 341 ? ASP B 346 ? ARG B 448 ASP B 453 
AB4 2 GLY B 454 ? THR B 466 ? GLY B 561 THR B 573 
AB4 3 ARG B 376 ? TYR B 388 ? ARG B 483 TYR B 495 
AB4 4 PHE B 421 ? THR B 428 ? PHE B 528 THR B 535 
AB5 1 ARG B 357 ? VAL B 364 ? ARG B 464 VAL B 471 
AB5 2 GLY B 438 ? ASN B 446 ? GLY B 545 ASN B 553 
AB5 3 LEU B 394 ? VAL B 399 ? LEU B 501 VAL B 506 
AB5 4 ARG B 405 ? LEU B 409 ? ARG B 512 LEU B 516 
AB6 1 GLN C 3   ? SER C 7   ? GLN C 3   SER C 7   
AB6 2 LEU C 18  ? SER C 25  ? LEU C 18  SER C 25  
AB6 3 THR C 78  ? MET C 83  ? THR C 78  MET C 83  
AB6 4 PHE C 68  ? ASP C 73  ? PHE C 68  ASP C 73  
AB7 1 THR C 58  ? TYR C 60  ? THR C 58  TYR C 60  
AB7 2 LEU C 45  ? ILE C 51  ? LEU C 45  ILE C 51  
AB7 3 MET C 34  ? GLN C 39  ? MET C 34  GLN C 39  
AB7 4 ALA C 92  ? ALA C 97  ? ALA C 92  ALA C 97  
AB7 5 THR C 111 ? VAL C 113 ? THR C 111 VAL C 113 
AB8 1 GLN D 3   ? SER D 7   ? GLN D 3   SER D 7   
AB8 2 LEU D 18  ? SER D 25  ? LEU D 18  SER D 25  
AB8 3 THR D 78  ? MET D 83  ? THR D 78  MET D 83  
AB8 4 PHE D 68  ? ASP D 73  ? PHE D 68  ASP D 73  
AB9 1 GLY D 10  ? VAL D 12  ? GLY D 10  VAL D 12  
AB9 2 THR D 111 ? VAL D 115 ? THR D 111 VAL D 115 
AB9 3 ALA D 92  ? ALA D 97  ? ALA D 92  ALA D 97  
AB9 4 MET D 34  ? GLN D 39  ? MET D 34  GLN D 39  
AB9 5 GLU D 46  ? ILE D 51  ? GLU D 46  ILE D 51  
AB9 6 THR D 58  ? TYR D 60  ? THR D 58  TYR D 60  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A 66  ? N PHE A 173 O ARG A 118 ? O ARG A 225 
AA1 2 3 O VAL A 117 ? O VAL A 224 N ILE A 44  ? N ILE A 151 
AA1 3 4 N SER A 43  ? N SER A 150 O SER A 144 ? O SER A 251 
AA1 4 5 N TYR A 143 ? N TYR A 250 O VAL A 183 ? O VAL A 290 
AA1 5 6 N PHE A 182 ? N PHE A 289 O LEU A 208 ? O LEU A 315 
AA1 6 7 N SER A 211 ? N SER A 318 O ALA A 231 ? O ALA A 338 
AA2 1 2 N GLY A 148 ? N GLY A 255 O VAL E 3   ? O VAL G 3   
AA3 1 2 N ASP A 248 ? N ASP A 355 O LYS A 252 ? O LYS A 359 
AA4 1 2 N ALA A 305 ? N ALA A 412 O VAL A 313 ? O VAL A 420 
AA5 1 2 N CYS A 343 ? N CYS A 450 O LEU A 463 ? O LEU A 570 
AA5 2 3 O LEU A 456 ? O LEU A 563 N LYS A 352 ? N LYS A 459 
AA6 1 2 N CYS A 343 ? N CYS A 450 O LEU A 463 ? O LEU A 570 
AA6 2 3 O TYR A 464 ? O TYR A 571 N GLU A 378 ? N GLU A 485 
AA6 3 4 N ALA A 380 ? N ALA A 487 O THR A 428 ? O THR A 535 
AA7 1 2 N LEU A 358 ? N LEU A 465 O ILE A 444 ? O ILE A 551 
AA7 2 3 O GLU A 443 ? O GLU A 550 N HIS A 397 ? N HIS A 504 
AA7 3 4 N LEU A 398 ? N LEU A 505 O SER A 406 ? O SER A 513 
AA8 1 2 N PHE B 66  ? N PHE B 173 O ARG B 118 ? O ARG B 225 
AA8 2 3 O VAL B 117 ? O VAL B 224 N ILE B 44  ? N ILE B 151 
AA8 3 4 N SER B 43  ? N SER B 150 O SER B 144 ? O SER B 251 
AA8 4 5 N TYR B 143 ? N TYR B 250 O VAL B 183 ? O VAL B 290 
AA8 5 6 N TRP B 184 ? N TRP B 291 O ILE B 210 ? O ILE B 317 
AA8 6 7 N SER B 211 ? N SER B 318 O ALA B 231 ? O ALA B 338 
AA9 1 2 N GLY B 148 ? N GLY B 255 O VAL F 3   ? O VAL H 4   
AB1 1 2 N ASP B 248 ? N ASP B 355 O LYS B 252 ? O LYS B 359 
AB2 1 2 N ALA B 305 ? N ALA B 412 O VAL B 313 ? O VAL B 420 
AB3 1 2 N ILE B 345 ? N ILE B 452 O LEU B 461 ? O LEU B 568 
AB3 2 3 O LEU B 456 ? O LEU B 563 N LYS B 352 ? N LYS B 459 
AB4 1 2 N ILE B 345 ? N ILE B 452 O LEU B 461 ? O LEU B 568 
AB4 2 3 O TYR B 464 ? O TYR B 571 N GLU B 378 ? N GLU B 485 
AB4 3 4 N ALA B 380 ? N ALA B 487 O THR B 428 ? O THR B 535 
AB5 1 2 N LEU B 358 ? N LEU B 465 O ILE B 444 ? O ILE B 551 
AB5 2 3 O VAL B 441 ? O VAL B 548 N VAL B 399 ? N VAL B 506 
AB5 3 4 N LEU B 398 ? N LEU B 505 O SER B 406 ? O SER B 513 
AB6 1 2 N GLN C 3   ? N GLN C 3   O SER C 25  ? O SER C 25  
AB6 2 3 N LEU C 18  ? N LEU C 18  O MET C 83  ? O MET C 83  
AB6 3 4 O TYR C 80  ? O TYR C 80  N SER C 71  ? N SER C 71  
AB7 1 2 O ASP C 59  ? O ASP C 59  N SER C 50  ? N SER C 50  
AB7 2 3 O GLU C 46  ? O GLU C 46  N ARG C 38  ? N ARG C 38  
AB7 3 4 N VAL C 37  ? N VAL C 37  O TYR C 95  ? O TYR C 95  
AB7 4 5 N TYR C 94  ? N TYR C 94  O THR C 111 ? O THR C 111 
AB8 1 2 N GLN D 3   ? N GLN D 3   O SER D 25  ? O SER D 25  
AB8 2 3 N LEU D 20  ? N LEU D 20  O LEU D 81  ? O LEU D 81  
AB8 3 4 O TYR D 80  ? O TYR D 80  N SER D 71  ? N SER D 71  
AB9 1 2 N GLY D 10  ? N GLY D 10  O THR D 114 ? O THR D 114 
AB9 2 3 O VAL D 113 ? O VAL D 113 N ALA D 92  ? N ALA D 92  
AB9 3 4 O TYR D 95  ? O TYR D 95  N VAL D 37  ? N VAL D 37  
AB9 4 5 N ARG D 38  ? N ARG D 38  O GLU D 46  ? O GLU D 46  
AB9 5 6 N SER D 50  ? N SER D 50  O ASP D 59  ? O ASP D 59  
# 
_atom_sites.entry_id                    5JMO 
_atom_sites.fract_transf_matrix[1][1]   0.005890 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019984 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006933 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . TYR A 1 3   ? -3.095 31.950  46.915  1.00 42.90 ? 110  TYR A N   1 
ATOM   2    C  CA  . TYR A 1 3   ? -2.205 31.085  47.685  1.00 45.60 ? 110  TYR A CA  1 
ATOM   3    C  C   . TYR A 1 3   ? -2.913 30.397  48.839  1.00 42.64 ? 110  TYR A C   1 
ATOM   4    O  O   . TYR A 1 3   ? -3.626 31.023  49.622  1.00 41.29 ? 110  TYR A O   1 
ATOM   5    C  CB  . TYR A 1 3   ? -1.001 31.860  48.241  1.00 37.94 ? 110  TYR A CB  1 
ATOM   6    C  CG  . TYR A 1 3   ? -0.231 31.072  49.289  1.00 39.08 ? 110  TYR A CG  1 
ATOM   7    C  CD1 . TYR A 1 3   ? 0.399  29.873  48.958  1.00 44.18 ? 110  TYR A CD1 1 
ATOM   8    C  CD2 . TYR A 1 3   ? -0.139 31.517  50.605  1.00 35.74 ? 110  TYR A CD2 1 
ATOM   9    C  CE1 . TYR A 1 3   ? 1.098  29.135  49.909  1.00 37.08 ? 110  TYR A CE1 1 
ATOM   10   C  CE2 . TYR A 1 3   ? 0.561  30.783  51.566  1.00 40.25 ? 110  TYR A CE2 1 
ATOM   11   C  CZ  . TYR A 1 3   ? 1.176  29.594  51.206  1.00 36.30 ? 110  TYR A CZ  1 
ATOM   12   O  OH  . TYR A 1 3   ? 1.870  28.850  52.138  1.00 40.21 ? 110  TYR A OH  1 
ATOM   13   N  N   . GLN A 1 4   ? -2.690 29.094  48.927  1.00 39.39 ? 111  GLN A N   1 
ATOM   14   C  CA  . GLN A 1 4   ? -3.127 28.286  50.048  1.00 38.47 ? 111  GLN A CA  1 
ATOM   15   C  C   . GLN A 1 4   ? -1.929 27.476  50.509  1.00 34.12 ? 111  GLN A C   1 
ATOM   16   O  O   . GLN A 1 4   ? -1.227 26.908  49.685  1.00 37.04 ? 111  GLN A O   1 
ATOM   17   C  CB  . GLN A 1 4   ? -4.274 27.365  49.641  1.00 39.17 ? 111  GLN A CB  1 
ATOM   18   C  CG  . GLN A 1 4   ? -5.549 28.087  49.258  1.00 40.84 ? 111  GLN A CG  1 
ATOM   19   C  CD  . GLN A 1 4   ? -6.259 28.643  50.461  1.00 35.92 ? 111  GLN A CD  1 
ATOM   20   O  OE1 . GLN A 1 4   ? -7.087 27.966  51.067  1.00 39.06 ? 111  GLN A OE1 1 
ATOM   21   N  NE2 . GLN A 1 4   ? -5.940 29.887  50.822  1.00 34.95 ? 111  GLN A NE2 1 
ATOM   22   N  N   . GLU A 1 5   ? -1.675 27.417  51.810  1.00 34.95 ? 112  GLU A N   1 
ATOM   23   C  CA  . GLU A 1 5   ? -0.558 26.604  52.260  1.00 33.83 ? 112  GLU A CA  1 
ATOM   24   C  C   . GLU A 1 5   ? -0.858 25.130  51.959  1.00 29.52 ? 112  GLU A C   1 
ATOM   25   O  O   . GLU A 1 5   ? -2.015 24.707  51.977  1.00 28.06 ? 112  GLU A O   1 
ATOM   26   C  CB  . GLU A 1 5   ? -0.270 26.827  53.743  1.00 40.20 ? 112  GLU A CB  1 
ATOM   27   C  CG  . GLU A 1 5   ? -1.246 26.200  54.687  1.00 36.19 ? 112  GLU A CG  1 
ATOM   28   C  CD  . GLU A 1 5   ? -0.596 25.883  56.016  1.00 48.90 ? 112  GLU A CD  1 
ATOM   29   O  OE1 . GLU A 1 5   ? -1.296 25.395  56.933  1.00 48.33 ? 112  GLU A OE1 1 
ATOM   30   O  OE2 . GLU A 1 5   ? 0.627  26.125  56.136  1.00 43.09 ? 112  GLU A OE2 1 
ATOM   31   N  N   . PRO A 1 6   ? 0.189  24.360  51.629  1.00 27.14 ? 113  PRO A N   1 
ATOM   32   C  CA  . PRO A 1 6   ? 0.049  22.961  51.216  1.00 24.53 ? 113  PRO A CA  1 
ATOM   33   C  C   . PRO A 1 6   ? -0.641 22.101  52.249  1.00 24.40 ? 113  PRO A C   1 
ATOM   34   O  O   . PRO A 1 6   ? -0.395 22.266  53.438  1.00 28.60 ? 113  PRO A O   1 
ATOM   35   C  CB  . PRO A 1 6   ? 1.494  22.499  51.038  1.00 20.60 ? 113  PRO A CB  1 
ATOM   36   C  CG  . PRO A 1 6   ? 2.246  23.740  50.721  1.00 28.22 ? 113  PRO A CG  1 
ATOM   37   C  CD  . PRO A 1 6   ? 1.581  24.830  51.517  1.00 25.28 ? 113  PRO A CD  1 
ATOM   38   N  N   . THR A 1 7   ? -1.471 21.175  51.780  1.00 24.06 ? 114  THR A N   1 
ATOM   39   C  CA  . THR A 1 7   ? -2.224 20.281  52.652  1.00 22.16 ? 114  THR A CA  1 
ATOM   40   C  C   . THR A 1 7   ? -1.546 18.922  52.837  1.00 26.85 ? 114  THR A C   1 
ATOM   41   O  O   . THR A 1 7   ? -2.054 18.076  53.561  1.00 24.42 ? 114  THR A O   1 
ATOM   42   C  CB  . THR A 1 7   ? -3.642 20.045  52.105  1.00 24.55 ? 114  THR A CB  1 
ATOM   43   O  OG1 . THR A 1 7   ? -3.552 19.588  50.750  1.00 24.28 ? 114  THR A OG1 1 
ATOM   44   C  CG2 . THR A 1 7   ? -4.473 21.349  52.148  1.00 21.46 ? 114  THR A CG2 1 
ATOM   45   N  N   . ASP A 1 8   ? -0.395 18.719  52.197  1.00 22.88 ? 115  ASP A N   1 
ATOM   46   C  CA  . ASP A 1 8   ? 0.317  17.439  52.270  1.00 20.01 ? 115  ASP A CA  1 
ATOM   47   C  C   . ASP A 1 8   ? 0.613  16.995  53.700  1.00 21.48 ? 115  ASP A C   1 
ATOM   48   O  O   . ASP A 1 8   ? 0.997  17.816  54.539  1.00 22.39 ? 115  ASP A O   1 
ATOM   49   C  CB  . ASP A 1 8   ? 1.620  17.528  51.477  1.00 16.63 ? 115  ASP A CB  1 
ATOM   50   C  CG  . ASP A 1 8   ? 1.400  18.039  50.096  1.00 18.61 ? 115  ASP A CG  1 
ATOM   51   O  OD1 . ASP A 1 8   ? 0.969  19.209  49.954  1.00 20.64 ? 115  ASP A OD1 1 
ATOM   52   O  OD2 . ASP A 1 8   ? 1.639  17.272  49.154  1.00 21.07 ? 115  ASP A OD2 1 
ATOM   53   N  N   . PRO A 1 9   ? 0.447  15.688  53.975  1.00 18.11 ? 116  PRO A N   1 
ATOM   54   C  CA  . PRO A 1 9   ? 0.545  15.113  55.324  1.00 22.30 ? 116  PRO A CA  1 
ATOM   55   C  C   . PRO A 1 9   ? 1.831  15.461  56.085  1.00 26.78 ? 116  PRO A C   1 
ATOM   56   O  O   . PRO A 1 9   ? 1.772  15.650  57.301  1.00 22.91 ? 116  PRO A O   1 
ATOM   57   C  CB  . PRO A 1 9   ? 0.461  13.591  55.076  1.00 24.15 ? 116  PRO A CB  1 
ATOM   58   C  CG  . PRO A 1 9   ? 0.668  13.402  53.587  1.00 24.29 ? 116  PRO A CG  1 
ATOM   59   C  CD  . PRO A 1 9   ? 0.143  14.662  52.959  1.00 21.18 ? 116  PRO A CD  1 
ATOM   60   N  N   . LYS A 1 10  ? 2.962  15.557  55.394  1.00 23.53 ? 117  LYS A N   1 
ATOM   61   C  CA  . LYS A 1 10  ? 4.230  15.802  56.076  1.00 19.98 ? 117  LYS A CA  1 
ATOM   62   C  C   . LYS A 1 10  ? 4.717  17.238  55.948  1.00 19.66 ? 117  LYS A C   1 
ATOM   63   O  O   . LYS A 1 10  ? 5.790  17.575  56.437  1.00 22.43 ? 117  LYS A O   1 
ATOM   64   C  CB  . LYS A 1 10  ? 5.310  14.855  55.556  1.00 19.82 ? 117  LYS A CB  1 
ATOM   65   C  CG  . LYS A 1 10  ? 5.063  13.393  55.895  1.00 24.26 ? 117  LYS A CG  1 
ATOM   66   C  CD  . LYS A 1 10  ? 4.823  13.226  57.391  1.00 32.08 ? 117  LYS A CD  1 
ATOM   67   C  CE  . LYS A 1 10  ? 4.807  11.768  57.804  1.00 41.62 ? 117  LYS A CE  1 
ATOM   68   N  NZ  . LYS A 1 10  ? 3.845  10.969  57.005  1.00 48.97 ? 117  LYS A NZ  1 
ATOM   69   N  N   . PHE A 1 11  ? 3.936  18.090  55.302  1.00 21.11 ? 118  PHE A N   1 
ATOM   70   C  CA  . PHE A 1 11  ? 4.313  19.498  55.246  1.00 22.84 ? 118  PHE A CA  1 
ATOM   71   C  C   . PHE A 1 11  ? 4.590  20.101  56.639  1.00 23.75 ? 118  PHE A C   1 
ATOM   72   O  O   . PHE A 1 11  ? 5.582  20.829  56.791  1.00 21.86 ? 118  PHE A O   1 
ATOM   73   C  CB  . PHE A 1 11  ? 3.253  20.324  54.517  1.00 20.77 ? 118  PHE A CB  1 
ATOM   74   C  CG  . PHE A 1 11  ? 3.597  21.772  54.434  1.00 19.26 ? 118  PHE A CG  1 
ATOM   75   C  CD1 . PHE A 1 11  ? 4.672  22.190  53.678  1.00 20.86 ? 118  PHE A CD1 1 
ATOM   76   C  CD2 . PHE A 1 11  ? 2.868  22.713  55.137  1.00 24.90 ? 118  PHE A CD2 1 
ATOM   77   C  CE1 . PHE A 1 11  ? 5.004  23.535  53.610  1.00 30.23 ? 118  PHE A CE1 1 
ATOM   78   C  CE2 . PHE A 1 11  ? 3.189  24.054  55.077  1.00 25.35 ? 118  PHE A CE2 1 
ATOM   79   C  CZ  . PHE A 1 11  ? 4.256  24.470  54.313  1.00 24.65 ? 118  PHE A CZ  1 
ATOM   80   N  N   . PRO A 1 12  ? 3.752  19.779  57.664  1.00 25.38 ? 119  PRO A N   1 
ATOM   81   C  CA  . PRO A 1 12  ? 4.075  20.274  59.012  1.00 21.56 ? 119  PRO A CA  1 
ATOM   82   C  C   . PRO A 1 12  ? 5.446  19.838  59.525  1.00 23.48 ? 119  PRO A C   1 
ATOM   83   O  O   . PRO A 1 12  ? 6.074  20.570  60.292  1.00 27.82 ? 119  PRO A O   1 
ATOM   84   C  CB  . PRO A 1 12  ? 2.959  19.670  59.879  1.00 27.48 ? 119  PRO A CB  1 
ATOM   85   C  CG  . PRO A 1 12  ? 1.785  19.587  58.949  1.00 24.93 ? 119  PRO A CG  1 
ATOM   86   C  CD  . PRO A 1 12  ? 2.421  19.128  57.646  1.00 25.40 ? 119  PRO A CD  1 
ATOM   87   N  N   . GLN A 1 13  ? 5.912  18.667  59.107  1.00 22.55 ? 120  GLN A N   1 
ATOM   88   C  CA  . GLN A 1 13  ? 7.229  18.208  59.514  1.00 20.37 ? 120  GLN A CA  1 
ATOM   89   C  C   . GLN A 1 13  ? 8.332  18.831  58.656  1.00 20.50 ? 120  GLN A C   1 
ATOM   90   O  O   . GLN A 1 13  ? 9.518  18.578  58.867  1.00 21.02 ? 120  GLN A O   1 
ATOM   91   C  CB  . GLN A 1 13  ? 7.310  16.680  59.456  1.00 28.13 ? 120  GLN A CB  1 
ATOM   92   C  CG  . GLN A 1 13  ? 6.541  15.966  60.575  1.00 30.60 ? 120  GLN A CG  1 
ATOM   93   C  CD  . GLN A 1 13  ? 5.098  15.656  60.206  1.00 32.26 ? 120  GLN A CD  1 
ATOM   94   O  OE1 . GLN A 1 13  ? 4.451  16.405  59.480  1.00 32.75 ? 120  GLN A OE1 1 
ATOM   95   N  NE2 . GLN A 1 13  ? 4.593  14.537  60.703  1.00 47.90 ? 120  GLN A NE2 1 
ATOM   96   N  N   . GLN A 1 14  ? 7.954  19.656  57.691  1.00 18.90 ? 121  GLN A N   1 
ATOM   97   C  CA  . GLN A 1 14  ? 8.974  20.373  56.922  1.00 21.14 ? 121  GLN A CA  1 
ATOM   98   C  C   . GLN A 1 14  ? 9.240  21.734  57.572  1.00 20.39 ? 121  GLN A C   1 
ATOM   99   O  O   . GLN A 1 14  ? 8.893  22.784  57.039  1.00 23.18 ? 121  GLN A O   1 
ATOM   100  C  CB  . GLN A 1 14  ? 8.556  20.499  55.459  1.00 18.80 ? 121  GLN A CB  1 
ATOM   101  C  CG  . GLN A 1 14  ? 8.346  19.137  54.784  1.00 18.56 ? 121  GLN A CG  1 
ATOM   102  C  CD  . GLN A 1 14  ? 8.065  19.258  53.297  1.00 22.82 ? 121  GLN A CD  1 
ATOM   103  O  OE1 . GLN A 1 14  ? 6.938  19.540  52.890  1.00 23.88 ? 121  GLN A OE1 1 
ATOM   104  N  NE2 . GLN A 1 14  ? 9.094  19.057  52.479  1.00 20.92 ? 121  GLN A NE2 1 
ATOM   105  N  N   . TRP A 1 15  ? 9.872  21.671  58.743  1.00 22.57 ? 122  TRP A N   1 
ATOM   106  C  CA  . TRP A 1 15  ? 10.154 22.823  59.598  1.00 20.33 ? 122  TRP A CA  1 
ATOM   107  C  C   . TRP A 1 15  ? 10.907 23.944  58.878  1.00 24.38 ? 122  TRP A C   1 
ATOM   108  O  O   . TRP A 1 15  ? 10.726 25.120  59.184  1.00 24.45 ? 122  TRP A O   1 
ATOM   109  C  CB  . TRP A 1 15  ? 10.959 22.361  60.827  1.00 17.65 ? 122  TRP A CB  1 
ATOM   110  C  CG  . TRP A 1 15  ? 12.238 21.618  60.477  1.00 17.79 ? 122  TRP A CG  1 
ATOM   111  C  CD1 . TRP A 1 15  ? 12.374 20.276  60.217  1.00 17.22 ? 122  TRP A CD1 1 
ATOM   112  C  CD2 . TRP A 1 15  ? 13.545 22.182  60.337  1.00 17.62 ? 122  TRP A CD2 1 
ATOM   113  N  NE1 . TRP A 1 15  ? 13.688 19.977  59.933  1.00 17.48 ? 122  TRP A NE1 1 
ATOM   114  C  CE2 . TRP A 1 15  ? 14.424 21.130  59.999  1.00 19.09 ? 122  TRP A CE2 1 
ATOM   115  C  CE3 . TRP A 1 15  ? 14.058 23.472  60.463  1.00 17.79 ? 122  TRP A CE3 1 
ATOM   116  C  CZ2 . TRP A 1 15  ? 15.783 21.337  59.789  1.00 23.23 ? 122  TRP A CZ2 1 
ATOM   117  C  CZ3 . TRP A 1 15  ? 15.401 23.669  60.257  1.00 21.55 ? 122  TRP A CZ3 1 
ATOM   118  C  CH2 . TRP A 1 15  ? 16.252 22.608  59.927  1.00 19.43 ? 122  TRP A CH2 1 
ATOM   119  N  N   . TYR A 1 16  ? 11.754 23.564  57.927  1.00 21.78 ? 123  TYR A N   1 
ATOM   120  C  CA  . TYR A 1 16  ? 12.608 24.494  57.183  1.00 23.81 ? 123  TYR A CA  1 
ATOM   121  C  C   . TYR A 1 16  ? 11.808 25.279  56.133  1.00 23.13 ? 123  TYR A C   1 
ATOM   122  O  O   . TYR A 1 16  ? 12.275 26.308  55.627  1.00 20.37 ? 123  TYR A O   1 
ATOM   123  C  CB  . TYR A 1 16  ? 13.775 23.720  56.524  1.00 18.73 ? 123  TYR A CB  1 
ATOM   124  C  CG  . TYR A 1 16  ? 13.317 22.424  55.881  1.00 18.30 ? 123  TYR A CG  1 
ATOM   125  C  CD1 . TYR A 1 16  ? 13.160 21.263  56.638  1.00 16.41 ? 123  TYR A CD1 1 
ATOM   126  C  CD2 . TYR A 1 16  ? 12.993 22.374  54.533  1.00 15.81 ? 123  TYR A CD2 1 
ATOM   127  C  CE1 . TYR A 1 16  ? 12.723 20.092  56.066  1.00 16.19 ? 123  TYR A CE1 1 
ATOM   128  C  CE2 . TYR A 1 16  ? 12.546 21.203  53.952  1.00 17.62 ? 123  TYR A CE2 1 
ATOM   129  C  CZ  . TYR A 1 16  ? 12.415 20.062  54.727  1.00 16.74 ? 123  TYR A CZ  1 
ATOM   130  O  OH  . TYR A 1 16  ? 11.975 18.895  54.155  1.00 19.41 ? 123  TYR A OH  1 
ATOM   131  N  N   . LEU A 1 17  ? 10.609 24.786  55.820  1.00 23.38 ? 124  LEU A N   1 
ATOM   132  C  CA  . LEU A 1 17  ? 9.639  25.501  54.987  1.00 26.36 ? 124  LEU A CA  1 
ATOM   133  C  C   . LEU A 1 17  ? 8.460  26.072  55.788  1.00 32.80 ? 124  LEU A C   1 
ATOM   134  O  O   . LEU A 1 17  ? 8.020  27.191  55.554  1.00 34.79 ? 124  LEU A O   1 
ATOM   135  C  CB  . LEU A 1 17  ? 9.065  24.582  53.900  1.00 21.22 ? 124  LEU A CB  1 
ATOM   136  C  CG  . LEU A 1 17  ? 9.963  23.688  53.044  1.00 19.62 ? 124  LEU A CG  1 
ATOM   137  C  CD1 . LEU A 1 17  ? 9.088  22.851  52.128  1.00 27.00 ? 124  LEU A CD1 1 
ATOM   138  C  CD2 . LEU A 1 17  ? 10.908 24.526  52.231  1.00 19.79 ? 124  LEU A CD2 1 
ATOM   139  N  N   . SER A 1 18  ? 7.909  25.275  56.695  1.00 39.44 ? 125  SER A N   1 
ATOM   140  C  CA  . SER A 1 18  ? 6.629  25.634  57.312  1.00 41.21 ? 125  SER A CA  1 
ATOM   141  C  C   . SER A 1 18  ? 6.787  26.312  58.669  1.00 42.94 ? 125  SER A C   1 
ATOM   142  O  O   . SER A 1 18  ? 5.808  26.484  59.392  1.00 47.24 ? 125  SER A O   1 
ATOM   143  C  CB  . SER A 1 18  ? 5.736  24.393  57.462  1.00 35.05 ? 125  SER A CB  1 
ATOM   144  O  OG  . SER A 1 18  ? 6.239  23.499  58.441  1.00 37.05 ? 125  SER A OG  1 
ATOM   145  N  N   . GLY A 1 19  ? 8.008  26.710  59.009  1.00 38.17 ? 126  GLY A N   1 
ATOM   146  C  CA  . GLY A 1 19  ? 8.262  27.311  60.304  1.00 37.67 ? 126  GLY A CA  1 
ATOM   147  C  C   . GLY A 1 19  ? 7.487  28.601  60.518  1.00 45.66 ? 126  GLY A C   1 
ATOM   148  O  O   . GLY A 1 19  ? 7.256  29.359  59.575  1.00 45.62 ? 126  GLY A O   1 
ATOM   149  N  N   . VAL A 1 20  ? 7.060  28.823  61.758  1.00 40.17 ? 127  VAL A N   1 
ATOM   150  C  CA  . VAL A 1 20  ? 6.465  30.091  62.179  1.00 51.86 ? 127  VAL A CA  1 
ATOM   151  C  C   . VAL A 1 20  ? 7.371  30.638  63.289  1.00 53.59 ? 127  VAL A C   1 
ATOM   152  O  O   . VAL A 1 20  ? 7.062  31.630  63.953  1.00 50.82 ? 127  VAL A O   1 
ATOM   153  C  CB  . VAL A 1 20  ? 4.992  29.920  62.669  1.00 43.08 ? 127  VAL A CB  1 
ATOM   154  C  CG1 . VAL A 1 20  ? 4.305  31.269  62.837  0.00 41.18 ? 127  VAL A CG1 1 
ATOM   155  C  CG2 . VAL A 1 20  ? 4.208  29.060  61.690  0.00 41.31 ? 127  VAL A CG2 1 
ATOM   156  N  N   . THR A 1 21  ? 8.507  29.961  63.463  1.00 50.19 ? 128  THR A N   1 
ATOM   157  C  CA  . THR A 1 21  ? 9.510  30.301  64.468  1.00 43.81 ? 128  THR A CA  1 
ATOM   158  C  C   . THR A 1 21  ? 10.377 31.461  63.978  1.00 47.72 ? 128  THR A C   1 
ATOM   159  O  O   . THR A 1 21  ? 11.166 32.022  64.733  1.00 51.64 ? 128  THR A O   1 
ATOM   160  C  CB  . THR A 1 21  ? 10.401 29.068  64.814  1.00 39.54 ? 128  THR A CB  1 
ATOM   161  O  OG1 . THR A 1 21  ? 9.574  27.906  64.961  0.00 40.60 ? 128  THR A OG1 1 
ATOM   162  C  CG2 . THR A 1 21  ? 11.164 29.292  66.110  0.00 40.54 ? 128  THR A CG2 1 
ATOM   163  N  N   . GLN A 1 22  ? 10.199 31.825  62.710  1.00 47.68 ? 129  GLN A N   1 
ATOM   164  C  CA  . GLN A 1 22  ? 11.129 32.693  61.991  1.00 44.23 ? 129  GLN A CA  1 
ATOM   165  C  C   . GLN A 1 22  ? 12.531 32.079  61.977  1.00 42.99 ? 129  GLN A C   1 
ATOM   166  O  O   . GLN A 1 22  ? 13.534 32.778  62.095  1.00 49.07 ? 129  GLN A O   1 
ATOM   167  C  CB  . GLN A 1 22  ? 11.158 34.098  62.590  1.00 40.48 ? 129  GLN A CB  1 
ATOM   168  C  CG  . GLN A 1 22  ? 9.847  34.845  62.429  0.00 37.73 ? 129  GLN A CG  1 
ATOM   169  C  CD  . GLN A 1 22  ? 10.043 36.258  61.924  0.00 33.27 ? 129  GLN A CD  1 
ATOM   170  O  OE1 . GLN A 1 22  ? 10.579 37.112  62.628  0.00 31.47 ? 129  GLN A OE1 1 
ATOM   171  N  NE2 . GLN A 1 22  ? 9.616  36.510  60.691  0.00 31.26 ? 129  GLN A NE2 1 
ATOM   172  N  N   . ARG A 1 23  ? 12.576 30.759  61.829  1.00 38.82 ? 130  ARG A N   1 
ATOM   173  C  CA  . ARG A 1 23  ? 13.821 30.023  61.662  1.00 38.18 ? 130  ARG A CA  1 
ATOM   174  C  C   . ARG A 1 23  ? 13.702 29.106  60.448  1.00 33.29 ? 130  ARG A C   1 
ATOM   175  O  O   . ARG A 1 23  ? 13.816 27.879  60.564  1.00 27.87 ? 130  ARG A O   1 
ATOM   176  C  CB  . ARG A 1 23  ? 14.148 29.210  62.915  1.00 39.52 ? 130  ARG A CB  1 
ATOM   177  C  CG  . ARG A 1 23  ? 14.298 30.036  64.178  1.00 43.82 ? 130  ARG A CG  1 
ATOM   178  C  CD  . ARG A 1 23  ? 15.507 30.937  64.123  1.00 41.40 ? 130  ARG A CD  1 
ATOM   179  N  NE  . ARG A 1 23  ? 15.934 31.323  65.464  1.00 51.49 ? 130  ARG A NE  1 
ATOM   180  C  CZ  . ARG A 1 23  ? 15.645 32.485  66.036  1.00 54.90 ? 130  ARG A CZ  1 
ATOM   181  N  NH1 . ARG A 1 23  ? 14.933 33.391  65.378  1.00 52.30 ? 130  ARG A NH1 1 
ATOM   182  N  NH2 . ARG A 1 23  ? 16.073 32.743  67.265  1.00 55.86 ? 130  ARG A NH2 1 
ATOM   183  N  N   . ASP A 1 24  ? 13.462 29.707  59.286  1.00 27.54 ? 131  ASP A N   1 
ATOM   184  C  CA  . ASP A 1 24  ? 13.270 28.940  58.062  1.00 24.54 ? 131  ASP A CA  1 
ATOM   185  C  C   . ASP A 1 24  ? 13.794 29.658  56.822  1.00 22.96 ? 131  ASP A C   1 
ATOM   186  O  O   . ASP A 1 24  ? 14.425 30.708  56.905  1.00 24.16 ? 131  ASP A O   1 
ATOM   187  C  CB  . ASP A 1 24  ? 11.792 28.604  57.889  1.00 27.04 ? 131  ASP A CB  1 
ATOM   188  C  CG  . ASP A 1 24  ? 10.908 29.838  57.906  1.00 31.72 ? 131  ASP A CG  1 
ATOM   189  O  OD1 . ASP A 1 24  ? 11.161 30.767  57.112  1.00 25.88 ? 131  ASP A OD1 1 
ATOM   190  O  OD2 . ASP A 1 24  ? 9.964  29.885  58.723  1.00 34.93 ? 131  ASP A OD2 1 
ATOM   191  N  N   . LEU A 1 25  ? 13.502 29.089  55.663  1.00 23.38 ? 132  LEU A N   1 
ATOM   192  C  CA  . LEU A 1 25  ? 14.017 29.607  54.402  1.00 18.31 ? 132  LEU A CA  1 
ATOM   193  C  C   . LEU A 1 25  ? 13.130 30.684  53.790  1.00 19.75 ? 132  LEU A C   1 
ATOM   194  O  O   . LEU A 1 25  ? 13.414 31.166  52.703  1.00 20.77 ? 132  LEU A O   1 
ATOM   195  C  CB  . LEU A 1 25  ? 14.190 28.456  53.422  1.00 16.01 ? 132  LEU A CB  1 
ATOM   196  C  CG  . LEU A 1 25  ? 15.236 27.454  53.891  1.00 17.62 ? 132  LEU A CG  1 
ATOM   197  C  CD1 . LEU A 1 25  ? 15.219 26.247  52.990  1.00 18.61 ? 132  LEU A CD1 1 
ATOM   198  C  CD2 . LEU A 1 25  ? 16.602 28.112  53.867  1.00 17.68 ? 132  LEU A CD2 1 
ATOM   199  N  N   . ASN A 1 26  ? 12.061 31.045  54.497  1.00 21.79 ? 133  ASN A N   1 
ATOM   200  C  CA  . ASN A 1 26  ? 11.141 32.108  54.074  1.00 19.91 ? 133  ASN A CA  1 
ATOM   201  C  C   . ASN A 1 26  ? 10.573 31.827  52.688  1.00 21.24 ? 133  ASN A C   1 
ATOM   202  O  O   . ASN A 1 26  ? 10.459 32.724  51.855  1.00 17.14 ? 133  ASN A O   1 
ATOM   203  C  CB  . ASN A 1 26  ? 11.834 33.474  54.096  1.00 20.35 ? 133  ASN A CB  1 
ATOM   204  C  CG  . ASN A 1 26  ? 10.837 34.637  54.171  1.00 26.35 ? 133  ASN A CG  1 
ATOM   205  O  OD1 . ASN A 1 26  ? 9.765  34.507  54.769  1.00 22.24 ? 133  ASN A OD1 1 
ATOM   206  N  ND2 . ASN A 1 26  ? 11.185 35.768  53.551  1.00 21.99 ? 133  ASN A ND2 1 
ATOM   207  N  N   . VAL A 1 27  ? 10.237 30.562  52.451  1.00 19.76 ? 134  VAL A N   1 
ATOM   208  C  CA  . VAL A 1 27  ? 9.672  30.133  51.180  1.00 15.86 ? 134  VAL A CA  1 
ATOM   209  C  C   . VAL A 1 27  ? 8.192  30.538  51.012  1.00 21.14 ? 134  VAL A C   1 
ATOM   210  O  O   . VAL A 1 27  ? 7.758  30.870  49.908  1.00 17.10 ? 134  VAL A O   1 
ATOM   211  C  CB  . VAL A 1 27  ? 9.841  28.602  51.025  1.00 17.57 ? 134  VAL A CB  1 
ATOM   212  C  CG1 . VAL A 1 27  ? 9.181  28.123  49.803  1.00 23.29 ? 134  VAL A CG1 1 
ATOM   213  C  CG2 . VAL A 1 27  ? 11.324 28.264  50.938  1.00 19.45 ? 134  VAL A CG2 1 
ATOM   214  N  N   . LYS A 1 28  ? 7.426  30.534  52.104  1.00 17.89 ? 135  LYS A N   1 
ATOM   215  C  CA  . LYS A 1 28  ? 6.003  30.870  52.025  1.00 18.72 ? 135  LYS A CA  1 
ATOM   216  C  C   . LYS A 1 28  ? 5.784  32.279  51.492  1.00 18.91 ? 135  LYS A C   1 
ATOM   217  O  O   . LYS A 1 28  ? 4.831  32.528  50.756  1.00 20.23 ? 135  LYS A O   1 
ATOM   218  C  CB  . LYS A 1 28  ? 5.324  30.736  53.391  1.00 23.28 ? 135  LYS A CB  1 
ATOM   219  C  CG  . LYS A 1 28  ? 5.016  29.304  53.820  1.00 26.41 ? 135  LYS A CG  1 
ATOM   220  C  CD  . LYS A 1 28  ? 4.398  29.275  55.231  1.00 35.89 ? 135  LYS A CD  1 
ATOM   221  C  CE  . LYS A 1 28  ? 3.877  27.883  55.589  1.00 44.31 ? 135  LYS A CE  1 
ATOM   222  N  NZ  . LYS A 1 28  ? 3.311  27.822  56.963  0.00 37.88 ? 135  LYS A NZ  1 
ATOM   223  N  N   . ALA A 1 29  ? 6.675  33.191  51.863  1.00 19.79 ? 136  ALA A N   1 
ATOM   224  C  CA  . ALA A 1 29  ? 6.595  34.566  51.376  1.00 23.66 ? 136  ALA A CA  1 
ATOM   225  C  C   . ALA A 1 29  ? 6.731  34.607  49.850  1.00 25.11 ? 136  ALA A C   1 
ATOM   226  O  O   . ALA A 1 29  ? 6.086  35.422  49.191  1.00 22.67 ? 136  ALA A O   1 
ATOM   227  C  CB  . ALA A 1 29  ? 7.670  35.441  52.039  1.00 20.09 ? 136  ALA A CB  1 
ATOM   228  N  N   . ALA A 1 30  ? 7.570  33.730  49.298  1.00 19.78 ? 137  ALA A N   1 
ATOM   229  C  CA  . ALA A 1 30  ? 7.721  33.620  47.846  1.00 20.02 ? 137  ALA A CA  1 
ATOM   230  C  C   . ALA A 1 30  ? 6.468  33.019  47.214  1.00 20.07 ? 137  ALA A C   1 
ATOM   231  O  O   . ALA A 1 30  ? 5.938  33.553  46.238  1.00 23.24 ? 137  ALA A O   1 
ATOM   232  C  CB  . ALA A 1 30  ? 8.959  32.782  47.488  1.00 17.72 ? 137  ALA A CB  1 
ATOM   233  N  N   . TRP A 1 31  ? 6.004  31.906  47.776  1.00 18.41 ? 138  TRP A N   1 
ATOM   234  C  CA  . TRP A 1 31  ? 4.779  31.262  47.325  1.00 20.00 ? 138  TRP A CA  1 
ATOM   235  C  C   . TRP A 1 31  ? 3.572  32.231  47.295  1.00 27.01 ? 138  TRP A C   1 
ATOM   236  O  O   . TRP A 1 31  ? 2.770  32.212  46.366  1.00 23.03 ? 138  TRP A O   1 
ATOM   237  C  CB  . TRP A 1 31  ? 4.449  30.081  48.231  1.00 19.92 ? 138  TRP A CB  1 
ATOM   238  C  CG  . TRP A 1 31  ? 5.380  28.907  48.136  1.00 19.62 ? 138  TRP A CG  1 
ATOM   239  C  CD1 . TRP A 1 31  ? 6.341  28.676  47.182  1.00 16.22 ? 138  TRP A CD1 1 
ATOM   240  C  CD2 . TRP A 1 31  ? 5.428  27.796  49.035  1.00 21.25 ? 138  TRP A CD2 1 
ATOM   241  N  NE1 . TRP A 1 31  ? 6.970  27.474  47.436  1.00 17.68 ? 138  TRP A NE1 1 
ATOM   242  C  CE2 . TRP A 1 31  ? 6.430  26.918  48.566  1.00 17.00 ? 138  TRP A CE2 1 
ATOM   243  C  CE3 . TRP A 1 31  ? 4.715  27.454  50.189  1.00 19.88 ? 138  TRP A CE3 1 
ATOM   244  C  CZ2 . TRP A 1 31  ? 6.744  25.726  49.224  1.00 19.81 ? 138  TRP A CZ2 1 
ATOM   245  C  CZ3 . TRP A 1 31  ? 5.028  26.265  50.837  1.00 21.26 ? 138  TRP A CZ3 1 
ATOM   246  C  CH2 . TRP A 1 31  ? 6.035  25.419  50.352  1.00 19.64 ? 138  TRP A CH2 1 
ATOM   247  N  N   . ALA A 1 32  ? 3.454  33.067  48.318  1.00 23.44 ? 139  ALA A N   1 
ATOM   248  C  CA  . ALA A 1 32  ? 2.346  34.027  48.397  1.00 27.50 ? 139  ALA A CA  1 
ATOM   249  C  C   . ALA A 1 32  ? 2.509  35.186  47.406  1.00 29.28 ? 139  ALA A C   1 
ATOM   250  O  O   . ALA A 1 32  ? 1.537  35.847  47.049  1.00 37.97 ? 139  ALA A O   1 
ATOM   251  C  CB  . ALA A 1 32  ? 2.213  34.560  49.817  1.00 23.94 ? 139  ALA A CB  1 
ATOM   252  N  N   . GLN A 1 33  ? 3.737  35.441  46.971  1.00 28.94 ? 140  GLN A N   1 
ATOM   253  C  CA  . GLN A 1 33  ? 3.977  36.422  45.911  1.00 29.14 ? 140  GLN A CA  1 
ATOM   254  C  C   . GLN A 1 33  ? 3.600  35.814  44.558  1.00 30.55 ? 140  GLN A C   1 
ATOM   255  O  O   . GLN A 1 33  ? 3.703  36.471  43.524  1.00 33.13 ? 140  GLN A O   1 
ATOM   256  C  CB  . GLN A 1 33  ? 5.446  36.879  45.894  1.00 25.91 ? 140  GLN A CB  1 
ATOM   257  C  CG  . GLN A 1 33  ? 5.878  37.854  47.019  1.00 28.29 ? 140  GLN A CG  1 
ATOM   258  C  CD  . GLN A 1 33  ? 7.356  38.296  46.898  1.00 38.36 ? 140  GLN A CD  1 
ATOM   259  O  OE1 . GLN A 1 33  ? 8.242  37.803  47.617  1.00 33.06 ? 140  GLN A OE1 1 
ATOM   260  N  NE2 . GLN A 1 33  ? 7.617  39.235  45.991  1.00 36.12 ? 140  GLN A NE2 1 
ATOM   261  N  N   . GLY A 1 34  ? 3.189  34.548  44.571  1.00 25.08 ? 141  GLY A N   1 
ATOM   262  C  CA  . GLY A 1 34  ? 2.778  33.853  43.364  1.00 25.05 ? 141  GLY A CA  1 
ATOM   263  C  C   . GLY A 1 34  ? 3.872  33.070  42.638  1.00 30.94 ? 141  GLY A C   1 
ATOM   264  O  O   . GLY A 1 34  ? 3.723  32.776  41.453  1.00 26.76 ? 141  GLY A O   1 
ATOM   265  N  N   . TYR A 1 35  ? 4.965  32.736  43.324  1.00 20.54 ? 142  TYR A N   1 
ATOM   266  C  CA  . TYR A 1 35  ? 6.081  32.025  42.680  1.00 21.37 ? 142  TYR A CA  1 
ATOM   267  C  C   . TYR A 1 35  ? 6.276  30.634  43.257  1.00 20.85 ? 142  TYR A C   1 
ATOM   268  O  O   . TYR A 1 35  ? 6.690  30.474  44.406  1.00 21.29 ? 142  TYR A O   1 
ATOM   269  C  CB  . TYR A 1 35  ? 7.387  32.816  42.801  1.00 20.07 ? 142  TYR A CB  1 
ATOM   270  C  CG  . TYR A 1 35  ? 7.297  34.169  42.148  1.00 21.91 ? 142  TYR A CG  1 
ATOM   271  C  CD1 . TYR A 1 35  ? 7.293  34.297  40.765  1.00 19.03 ? 142  TYR A CD1 1 
ATOM   272  C  CD2 . TYR A 1 35  ? 7.157  35.313  42.908  1.00 28.07 ? 142  TYR A CD2 1 
ATOM   273  C  CE1 . TYR A 1 35  ? 7.177  35.532  40.165  1.00 24.09 ? 142  TYR A CE1 1 
ATOM   274  C  CE2 . TYR A 1 35  ? 7.052  36.562  42.313  1.00 26.43 ? 142  TYR A CE2 1 
ATOM   275  C  CZ  . TYR A 1 35  ? 7.064  36.659  40.944  1.00 22.94 ? 142  TYR A CZ  1 
ATOM   276  O  OH  . TYR A 1 35  ? 6.956  37.891  40.354  1.00 28.73 ? 142  TYR A OH  1 
ATOM   277  N  N   . THR A 1 36  ? 5.977  29.632  42.440  1.00 18.36 ? 143  THR A N   1 
ATOM   278  C  CA  . THR A 1 36  ? 6.040  28.245  42.871  1.00 17.65 ? 143  THR A CA  1 
ATOM   279  C  C   . THR A 1 36  ? 6.917  27.401  41.947  1.00 16.02 ? 143  THR A C   1 
ATOM   280  O  O   . THR A 1 36  ? 7.027  26.199  42.128  1.00 17.26 ? 143  THR A O   1 
ATOM   281  C  CB  . THR A 1 36  ? 4.634  27.625  42.929  1.00 22.60 ? 143  THR A CB  1 
ATOM   282  O  OG1 . THR A 1 36  ? 4.037  27.696  41.631  1.00 29.57 ? 143  THR A OG1 1 
ATOM   283  C  CG2 . THR A 1 36  ? 3.772  28.378  43.900  1.00 29.23 ? 143  THR A CG2 1 
ATOM   284  N  N   . GLY A 1 37  ? 7.530  28.043  40.960  1.00 17.27 ? 144  GLY A N   1 
ATOM   285  C  CA  . GLY A 1 37  ? 8.483  27.394  40.081  1.00 16.51 ? 144  GLY A CA  1 
ATOM   286  C  C   . GLY A 1 37  ? 7.928  27.061  38.707  1.00 19.07 ? 144  GLY A C   1 
ATOM   287  O  O   . GLY A 1 37  ? 8.601  26.411  37.917  1.00 15.04 ? 144  GLY A O   1 
ATOM   288  N  N   . HIS A 1 38  ? 6.712  27.521  38.412  1.00 17.04 ? 145  HIS A N   1 
ATOM   289  C  CA  . HIS A 1 38  ? 6.127  27.281  37.102  1.00 17.75 ? 145  HIS A CA  1 
ATOM   290  C  C   . HIS A 1 38  ? 7.054  27.706  35.967  1.00 19.25 ? 145  HIS A C   1 
ATOM   291  O  O   . HIS A 1 38  ? 7.597  28.802  35.982  1.00 18.15 ? 145  HIS A O   1 
ATOM   292  C  CB  . HIS A 1 38  ? 4.795  28.019  36.953  1.00 25.53 ? 145  HIS A CB  1 
ATOM   293  C  CG  . HIS A 1 38  ? 4.198  27.886  35.589  1.00 27.48 ? 145  HIS A CG  1 
ATOM   294  N  ND1 . HIS A 1 38  ? 3.582  26.731  35.157  1.00 35.06 ? 145  HIS A ND1 1 
ATOM   295  C  CD2 . HIS A 1 38  ? 4.147  28.752  34.548  1.00 33.14 ? 145  HIS A CD2 1 
ATOM   296  C  CE1 . HIS A 1 38  ? 3.154  26.898  33.917  1.00 29.46 ? 145  HIS A CE1 1 
ATOM   297  N  NE2 . HIS A 1 38  ? 3.488  28.116  33.523  1.00 37.03 ? 145  HIS A NE2 1 
ATOM   298  N  N   . GLY A 1 39  ? 7.229  26.830  34.987  1.00 15.19 ? 146  GLY A N   1 
ATOM   299  C  CA  . GLY A 1 39  ? 8.023  27.145  33.818  1.00 18.62 ? 146  GLY A CA  1 
ATOM   300  C  C   . GLY A 1 39  ? 9.505  26.883  33.979  1.00 16.27 ? 146  GLY A C   1 
ATOM   301  O  O   . GLY A 1 39  ? 10.263 26.964  33.004  1.00 17.63 ? 146  GLY A O   1 
ATOM   302  N  N   . ILE A 1 40  ? 9.936  26.562  35.194  1.00 14.45 ? 147  ILE A N   1 
ATOM   303  C  CA  . ILE A 1 40  ? 11.365 26.336  35.424  1.00 11.68 ? 147  ILE A CA  1 
ATOM   304  C  C   . ILE A 1 40  ? 11.664 24.826  35.435  1.00 12.83 ? 147  ILE A C   1 
ATOM   305  O  O   . ILE A 1 40  ? 10.832 24.009  35.848  1.00 14.44 ? 147  ILE A O   1 
ATOM   306  C  CB  . ILE A 1 40  ? 11.847 26.991  36.731  1.00 11.96 ? 147  ILE A CB  1 
ATOM   307  C  CG1 . ILE A 1 40  ? 11.428 28.468  36.791  1.00 14.28 ? 147  ILE A CG1 1 
ATOM   308  C  CG2 . ILE A 1 40  ? 13.367 26.813  36.927  1.00 9.45  ? 147  ILE A CG2 1 
ATOM   309  C  CD1 . ILE A 1 40  ? 11.911 29.316  35.617  1.00 13.08 ? 147  ILE A CD1 1 
ATOM   310  N  N   . VAL A 1 41  ? 12.840 24.472  34.933  1.00 12.36 ? 148  VAL A N   1 
ATOM   311  C  CA  . VAL A 1 41  ? 13.267 23.082  34.781  1.00 13.73 ? 148  VAL A CA  1 
ATOM   312  C  C   . VAL A 1 41  ? 14.567 22.866  35.559  1.00 13.54 ? 148  VAL A C   1 
ATOM   313  O  O   . VAL A 1 41  ? 15.551 23.574  35.337  1.00 13.31 ? 148  VAL A O   1 
ATOM   314  C  CB  . VAL A 1 41  ? 13.478 22.722  33.294  1.00 13.13 ? 148  VAL A CB  1 
ATOM   315  C  CG1 . VAL A 1 41  ? 14.023 21.290  33.144  1.00 12.20 ? 148  VAL A CG1 1 
ATOM   316  C  CG2 . VAL A 1 41  ? 12.169 22.906  32.505  1.00 15.35 ? 148  VAL A CG2 1 
ATOM   317  N  N   . VAL A 1 42  ? 14.548 21.900  36.467  1.00 11.47 ? 149  VAL A N   1 
ATOM   318  C  CA  . VAL A 1 42  ? 15.701 21.565  37.300  1.00 12.08 ? 149  VAL A CA  1 
ATOM   319  C  C   . VAL A 1 42  ? 16.100 20.100  37.091  1.00 12.05 ? 149  VAL A C   1 
ATOM   320  O  O   . VAL A 1 42  ? 15.234 19.234  36.999  1.00 13.84 ? 149  VAL A O   1 
ATOM   321  C  CB  . VAL A 1 42  ? 15.394 21.784  38.804  1.00 12.44 ? 149  VAL A CB  1 
ATOM   322  C  CG1 . VAL A 1 42  ? 16.608 21.460  39.652  1.00 12.89 ? 149  VAL A CG1 1 
ATOM   323  C  CG2 . VAL A 1 42  ? 14.902 23.227  39.074  1.00 10.35 ? 149  VAL A CG2 1 
ATOM   324  N  N   . SER A 1 43  ? 17.396 19.817  37.045  1.00 10.77 ? 150  SER A N   1 
ATOM   325  C  CA  . SER A 1 43  ? 17.858 18.436  36.916  1.00 10.37 ? 150  SER A CA  1 
ATOM   326  C  C   . SER A 1 43  ? 18.829 18.057  38.045  1.00 13.13 ? 150  SER A C   1 
ATOM   327  O  O   . SER A 1 43  ? 19.751 18.811  38.382  1.00 11.52 ? 150  SER A O   1 
ATOM   328  C  CB  . SER A 1 43  ? 18.503 18.218  35.538  1.00 14.27 ? 150  SER A CB  1 
ATOM   329  O  OG  . SER A 1 43  ? 18.877 16.852  35.336  1.00 17.20 ? 150  SER A OG  1 
ATOM   330  N  N   . ILE A 1 44  ? 18.593 16.879  38.617  1.00 13.80 ? 151  ILE A N   1 
ATOM   331  C  CA  . ILE A 1 44  ? 19.416 16.281  39.666  1.00 13.91 ? 151  ILE A CA  1 
ATOM   332  C  C   . ILE A 1 44  ? 20.486 15.357  39.087  1.00 14.91 ? 151  ILE A C   1 
ATOM   333  O  O   . ILE A 1 44  ? 20.160 14.303  38.529  1.00 14.69 ? 151  ILE A O   1 
ATOM   334  C  CB  . ILE A 1 44  ? 18.559 15.444  40.635  1.00 11.55 ? 151  ILE A CB  1 
ATOM   335  C  CG1 . ILE A 1 44  ? 17.422 16.285  41.223  1.00 12.12 ? 151  ILE A CG1 1 
ATOM   336  C  CG2 . ILE A 1 44  ? 19.440 14.817  41.740  1.00 11.25 ? 151  ILE A CG2 1 
ATOM   337  C  CD1 . ILE A 1 44  ? 17.905 17.524  41.897  1.00 11.72 ? 151  ILE A CD1 1 
ATOM   338  N  N   . LEU A 1 45  ? 21.755 15.730  39.207  1.00 12.63 ? 152  LEU A N   1 
ATOM   339  C  CA  . LEU A 1 45  ? 22.804 14.851  38.693  1.00 16.98 ? 152  LEU A CA  1 
ATOM   340  C  C   . LEU A 1 45  ? 23.281 13.946  39.837  1.00 14.33 ? 152  LEU A C   1 
ATOM   341  O  O   . LEU A 1 45  ? 23.926 14.404  40.776  1.00 15.25 ? 152  LEU A O   1 
ATOM   342  C  CB  . LEU A 1 45  ? 23.972 15.651  38.093  1.00 18.76 ? 152  LEU A CB  1 
ATOM   343  C  CG  . LEU A 1 45  ? 23.718 16.952  37.314  1.00 19.85 ? 152  LEU A CG  1 
ATOM   344  C  CD1 . LEU A 1 45  ? 25.006 17.483  36.678  1.00 16.00 ? 152  LEU A CD1 1 
ATOM   345  C  CD2 . LEU A 1 45  ? 22.611 16.841  36.274  1.00 17.73 ? 152  LEU A CD2 1 
ATOM   346  N  N   . ASP A 1 46  ? 22.937 12.666  39.774  1.00 11.80 ? 153  ASP A N   1 
ATOM   347  C  CA  . ASP A 1 46  ? 23.137 11.801  40.930  1.00 14.81 ? 153  ASP A CA  1 
ATOM   348  C  C   . ASP A 1 46  ? 23.093 10.335  40.490  1.00 13.67 ? 153  ASP A C   1 
ATOM   349  O  O   . ASP A 1 46  ? 23.584 10.010  39.411  1.00 13.46 ? 153  ASP A O   1 
ATOM   350  C  CB  . ASP A 1 46  ? 22.074 12.101  41.999  1.00 12.28 ? 153  ASP A CB  1 
ATOM   351  C  CG  . ASP A 1 46  ? 22.568 11.838  43.432  1.00 17.76 ? 153  ASP A CG  1 
ATOM   352  O  OD1 . ASP A 1 46  ? 22.884 10.682  43.767  1.00 18.05 ? 153  ASP A OD1 1 
ATOM   353  O  OD2 . ASP A 1 46  ? 22.631 12.794  44.246  1.00 22.32 ? 153  ASP A OD2 1 
ATOM   354  N  N   . ASP A 1 47  ? 22.484 9.476   41.304  1.00 12.42 ? 154  ASP A N   1 
ATOM   355  C  CA  . ASP A 1 47  ? 22.426 8.034   41.023  1.00 14.08 ? 154  ASP A CA  1 
ATOM   356  C  C   . ASP A 1 47  ? 21.099 7.614   40.380  1.00 14.90 ? 154  ASP A C   1 
ATOM   357  O  O   . ASP A 1 47  ? 20.770 6.424   40.322  1.00 15.72 ? 154  ASP A O   1 
ATOM   358  C  CB  . ASP A 1 47  ? 22.665 7.230   42.316  1.00 14.04 ? 154  ASP A CB  1 
ATOM   359  C  CG  . ASP A 1 47  ? 21.708 7.619   43.449  1.00 13.18 ? 154  ASP A CG  1 
ATOM   360  O  OD1 . ASP A 1 47  ? 20.680 8.270   43.194  1.00 15.48 ? 154  ASP A OD1 1 
ATOM   361  O  OD2 . ASP A 1 47  ? 21.981 7.263   44.608  1.00 18.70 ? 154  ASP A OD2 1 
ATOM   362  N  N   . GLY A 1 48  ? 20.340 8.597   39.895  1.00 16.66 ? 155  GLY A N   1 
ATOM   363  C  CA  . GLY A 1 48  ? 19.061 8.330   39.248  1.00 11.26 ? 155  GLY A CA  1 
ATOM   364  C  C   . GLY A 1 48  ? 17.890 8.989   39.954  1.00 15.09 ? 155  GLY A C   1 
ATOM   365  O  O   . GLY A 1 48  ? 18.034 9.539   41.049  1.00 13.91 ? 155  GLY A O   1 
ATOM   366  N  N   . ILE A 1 49  ? 16.723 8.927   39.327  1.00 14.03 ? 156  ILE A N   1 
ATOM   367  C  CA  . ILE A 1 49  ? 15.516 9.469   39.927  1.00 14.89 ? 156  ILE A CA  1 
ATOM   368  C  C   . ILE A 1 49  ? 14.376 8.496   39.722  1.00 12.35 ? 156  ILE A C   1 
ATOM   369  O  O   . ILE A 1 49  ? 14.175 8.006   38.620  1.00 14.34 ? 156  ILE A O   1 
ATOM   370  C  CB  . ILE A 1 49  ? 15.164 10.861  39.321  1.00 14.75 ? 156  ILE A CB  1 
ATOM   371  C  CG1 . ILE A 1 49  ? 13.892 11.432  39.926  1.00 16.65 ? 156  ILE A CG1 1 
ATOM   372  C  CG2 . ILE A 1 49  ? 15.041 10.795  37.807  1.00 13.32 ? 156  ILE A CG2 1 
ATOM   373  C  CD1 . ILE A 1 49  ? 13.612 12.868  39.458  1.00 16.66 ? 156  ILE A CD1 1 
ATOM   374  N  N   . GLU A 1 50  ? 13.639 8.207   40.789  1.00 16.03 ? 157  GLU A N   1 
ATOM   375  C  CA  . GLU A 1 50  ? 12.484 7.324   40.702  1.00 13.84 ? 157  GLU A CA  1 
ATOM   376  C  C   . GLU A 1 50  ? 11.343 8.087   40.043  1.00 15.00 ? 157  GLU A C   1 
ATOM   377  O  O   . GLU A 1 50  ? 10.499 8.668   40.723  1.00 16.42 ? 157  GLU A O   1 
ATOM   378  C  CB  . GLU A 1 50  ? 12.081 6.811   42.090  1.00 16.85 ? 157  GLU A CB  1 
ATOM   379  C  CG  . GLU A 1 50  ? 11.153 5.628   42.043  1.00 15.17 ? 157  GLU A CG  1 
ATOM   380  C  CD  . GLU A 1 50  ? 11.019 4.933   43.379  1.00 18.59 ? 157  GLU A CD  1 
ATOM   381  O  OE1 . GLU A 1 50  ? 10.295 5.451   44.253  1.00 20.40 ? 157  GLU A OE1 1 
ATOM   382  O  OE2 . GLU A 1 50  ? 11.632 3.859   43.549  1.00 20.16 ? 157  GLU A OE2 1 
ATOM   383  N  N   . LYS A 1 51  ? 11.335 8.089   38.712  1.00 15.84 ? 158  LYS A N   1 
ATOM   384  C  CA  . LYS A 1 51  ? 10.454 8.964   37.946  1.00 14.21 ? 158  LYS A CA  1 
ATOM   385  C  C   . LYS A 1 51  ? 8.975  8.632   38.145  1.00 18.68 ? 158  LYS A C   1 
ATOM   386  O  O   . LYS A 1 51  ? 8.106  9.445   37.837  1.00 18.44 ? 158  LYS A O   1 
ATOM   387  C  CB  . LYS A 1 51  ? 10.821 8.912   36.457  1.00 15.01 ? 158  LYS A CB  1 
ATOM   388  C  CG  . LYS A 1 51  ? 10.522 7.583   35.758  1.00 17.67 ? 158  LYS A CG  1 
ATOM   389  C  CD  . LYS A 1 51  ? 10.993 7.618   34.308  1.00 18.75 ? 158  LYS A CD  1 
ATOM   390  C  CE  . LYS A 1 51  ? 10.610 6.345   33.563  1.00 23.31 ? 158  LYS A CE  1 
ATOM   391  N  NZ  . LYS A 1 51  ? 11.302 5.182   34.181  1.00 24.50 ? 158  LYS A NZ  1 
ATOM   392  N  N   . ASN A 1 52  ? 8.704  7.454   38.687  1.00 16.34 ? 159  ASN A N   1 
ATOM   393  C  CA  . ASN A 1 52  ? 7.345  6.998   38.934  1.00 18.20 ? 159  ASN A CA  1 
ATOM   394  C  C   . ASN A 1 52  ? 6.945  7.154   40.402  1.00 20.08 ? 159  ASN A C   1 
ATOM   395  O  O   . ASN A 1 52  ? 5.927  6.630   40.831  1.00 20.48 ? 159  ASN A O   1 
ATOM   396  C  CB  . ASN A 1 52  ? 7.195  5.525   38.503  1.00 22.12 ? 159  ASN A CB  1 
ATOM   397  C  CG  . ASN A 1 52  ? 8.171  4.608   39.226  1.00 27.07 ? 159  ASN A CG  1 
ATOM   398  O  OD1 . ASN A 1 52  ? 9.310  4.985   39.483  1.00 25.72 ? 159  ASN A OD1 1 
ATOM   399  N  ND2 . ASN A 1 52  ? 7.720  3.407   39.572  1.00 29.85 ? 159  ASN A ND2 1 
ATOM   400  N  N   . HIS A 1 53  ? 7.752  7.862   41.184  1.00 17.22 ? 160  HIS A N   1 
ATOM   401  C  CA  . HIS A 1 53  ? 7.387  8.105   42.566  1.00 14.95 ? 160  HIS A CA  1 
ATOM   402  C  C   . HIS A 1 53  ? 6.091  8.923   42.639  1.00 12.73 ? 160  HIS A C   1 
ATOM   403  O  O   . HIS A 1 53  ? 5.936  9.883   41.898  1.00 18.22 ? 160  HIS A O   1 
ATOM   404  C  CB  . HIS A 1 53  ? 8.511  8.831   43.291  1.00 11.92 ? 160  HIS A CB  1 
ATOM   405  C  CG  . HIS A 1 53  ? 8.356  8.823   44.769  1.00 15.54 ? 160  HIS A CG  1 
ATOM   406  N  ND1 . HIS A 1 53  ? 7.350  9.513   45.410  1.00 16.39 ? 160  HIS A ND1 1 
ATOM   407  C  CD2 . HIS A 1 53  ? 9.066  8.201   45.737  1.00 14.48 ? 160  HIS A CD2 1 
ATOM   408  C  CE1 . HIS A 1 53  ? 7.446  9.314   46.711  1.00 17.48 ? 160  HIS A CE1 1 
ATOM   409  N  NE2 . HIS A 1 53  ? 8.486  8.531   46.936  1.00 17.61 ? 160  HIS A NE2 1 
ATOM   410  N  N   . PRO A 1 54  ? 5.155  8.528   43.519  1.00 19.19 ? 161  PRO A N   1 
ATOM   411  C  CA  . PRO A 1 54  ? 3.858  9.213   43.623  1.00 21.84 ? 161  PRO A CA  1 
ATOM   412  C  C   . PRO A 1 54  ? 3.989  10.713  43.858  1.00 21.06 ? 161  PRO A C   1 
ATOM   413  O  O   . PRO A 1 54  ? 3.115  11.463  43.421  1.00 22.26 ? 161  PRO A O   1 
ATOM   414  C  CB  . PRO A 1 54  ? 3.197  8.533   44.822  1.00 27.44 ? 161  PRO A CB  1 
ATOM   415  C  CG  . PRO A 1 54  ? 3.779  7.135   44.804  1.00 29.88 ? 161  PRO A CG  1 
ATOM   416  C  CD  . PRO A 1 54  ? 5.215  7.325   44.371  1.00 20.32 ? 161  PRO A CD  1 
ATOM   417  N  N   . ASP A 1 55  ? 5.069  11.149  44.499  1.00 17.96 ? 162  ASP A N   1 
ATOM   418  C  CA  . ASP A 1 55  ? 5.261  12.577  44.706  1.00 18.01 ? 162  ASP A CA  1 
ATOM   419  C  C   . ASP A 1 55  ? 6.210  13.225  43.691  1.00 19.12 ? 162  ASP A C   1 
ATOM   420  O  O   . ASP A 1 55  ? 6.495  14.416  43.802  1.00 19.38 ? 162  ASP A O   1 
ATOM   421  C  CB  . ASP A 1 55  ? 5.756  12.839  46.124  1.00 14.42 ? 162  ASP A CB  1 
ATOM   422  C  CG  . ASP A 1 55  ? 4.915  13.886  46.841  1.00 17.22 ? 162  ASP A CG  1 
ATOM   423  O  OD1 . ASP A 1 55  ? 3.771  14.132  46.407  1.00 18.22 ? 162  ASP A OD1 1 
ATOM   424  O  OD2 . ASP A 1 55  ? 5.383  14.447  47.847  1.00 19.93 ? 162  ASP A OD2 1 
ATOM   425  N  N   . LEU A 1 56  ? 6.683  12.461  42.704  1.00 15.53 ? 163  LEU A N   1 
ATOM   426  C  CA  . LEU A 1 56  ? 7.503  13.028  41.624  1.00 13.53 ? 163  LEU A CA  1 
ATOM   427  C  C   . LEU A 1 56  ? 6.886  12.945  40.219  1.00 15.59 ? 163  LEU A C   1 
ATOM   428  O  O   . LEU A 1 56  ? 7.124  13.823  39.376  1.00 14.30 ? 163  LEU A O   1 
ATOM   429  C  CB  . LEU A 1 56  ? 8.872  12.345  41.587  1.00 13.58 ? 163  LEU A CB  1 
ATOM   430  C  CG  . LEU A 1 56  ? 9.721  12.430  42.854  1.00 16.36 ? 163  LEU A CG  1 
ATOM   431  C  CD1 . LEU A 1 56  ? 11.044 11.674  42.670  1.00 10.87 ? 163  LEU A CD1 1 
ATOM   432  C  CD2 . LEU A 1 56  ? 9.949  13.883  43.251  1.00 13.10 ? 163  LEU A CD2 1 
ATOM   433  N  N   . ALA A 1 57  ? 6.114  11.890  39.968  1.00 16.24 ? 164  ALA A N   1 
ATOM   434  C  CA  . ALA A 1 57  ? 5.556  11.622  38.637  1.00 15.09 ? 164  ALA A CA  1 
ATOM   435  C  C   . ALA A 1 57  ? 4.920  12.842  37.991  1.00 16.88 ? 164  ALA A C   1 
ATOM   436  O  O   . ALA A 1 57  ? 5.201  13.152  36.833  1.00 16.69 ? 164  ALA A O   1 
ATOM   437  C  CB  . ALA A 1 57  ? 4.522  10.469  38.713  1.00 19.39 ? 164  ALA A CB  1 
ATOM   438  N  N   . GLY A 1 58  ? 4.076  13.536  38.752  1.00 15.85 ? 165  GLY A N   1 
ATOM   439  C  CA  . GLY A 1 58  ? 3.399  14.731  38.273  1.00 14.88 ? 165  GLY A CA  1 
ATOM   440  C  C   . GLY A 1 58  ? 4.292  15.858  37.762  1.00 18.15 ? 165  GLY A C   1 
ATOM   441  O  O   . GLY A 1 58  ? 3.873  16.633  36.905  1.00 16.40 ? 165  GLY A O   1 
ATOM   442  N  N   . ASN A 1 59  ? 5.509  15.968  38.288  1.00 13.79 ? 166  ASN A N   1 
ATOM   443  C  CA  . ASN A 1 59  ? 6.434  17.022  37.863  1.00 15.32 ? 166  ASN A CA  1 
ATOM   444  C  C   . ASN A 1 59  ? 7.594  16.499  37.009  1.00 15.00 ? 166  ASN A C   1 
ATOM   445  O  O   . ASN A 1 59  ? 8.419  17.274  36.527  1.00 17.07 ? 166  ASN A O   1 
ATOM   446  C  CB  . ASN A 1 59  ? 7.001  17.761  39.076  1.00 13.51 ? 166  ASN A CB  1 
ATOM   447  C  CG  . ASN A 1 59  ? 5.986  18.658  39.737  1.00 17.15 ? 166  ASN A CG  1 
ATOM   448  O  OD1 . ASN A 1 59  ? 4.999  19.065  39.120  1.00 17.65 ? 166  ASN A OD1 1 
ATOM   449  N  ND2 . ASN A 1 59  ? 6.222  18.979  40.998  1.00 14.58 ? 166  ASN A ND2 1 
ATOM   450  N  N   . TYR A 1 60  ? 7.641  15.187  36.808  1.00 13.82 ? 167  TYR A N   1 
ATOM   451  C  CA  . TYR A 1 60  ? 8.756  14.582  36.089  1.00 13.65 ? 167  TYR A CA  1 
ATOM   452  C  C   . TYR A 1 60  ? 8.868  15.078  34.649  1.00 17.80 ? 167  TYR A C   1 
ATOM   453  O  O   . TYR A 1 60  ? 7.872  15.160  33.934  1.00 15.55 ? 167  TYR A O   1 
ATOM   454  C  CB  . TYR A 1 60  ? 8.639  13.057  36.087  1.00 16.33 ? 167  TYR A CB  1 
ATOM   455  C  CG  . TYR A 1 60  ? 9.765  12.409  35.340  1.00 13.97 ? 167  TYR A CG  1 
ATOM   456  C  CD1 . TYR A 1 60  ? 11.076 12.563  35.781  1.00 14.72 ? 167  TYR A CD1 1 
ATOM   457  C  CD2 . TYR A 1 60  ? 9.539  11.680  34.178  1.00 16.57 ? 167  TYR A CD2 1 
ATOM   458  C  CE1 . TYR A 1 60  ? 12.128 11.989  35.106  1.00 16.89 ? 167  TYR A CE1 1 
ATOM   459  C  CE2 . TYR A 1 60  ? 10.598 11.087  33.488  1.00 16.51 ? 167  TYR A CE2 1 
ATOM   460  C  CZ  . TYR A 1 60  ? 11.893 11.259  33.968  1.00 15.37 ? 167  TYR A CZ  1 
ATOM   461  O  OH  . TYR A 1 60  ? 12.965 10.713  33.325  1.00 18.50 ? 167  TYR A OH  1 
ATOM   462  N  N   . ASP A 1 61  ? 10.093 15.388  34.227  1.00 14.49 ? 168  ASP A N   1 
ATOM   463  C  CA  . ASP A 1 61  ? 10.353 15.850  32.865  1.00 16.02 ? 168  ASP A CA  1 
ATOM   464  C  C   . ASP A 1 61  ? 11.394 14.963  32.155  1.00 17.03 ? 168  ASP A C   1 
ATOM   465  O  O   . ASP A 1 61  ? 12.595 15.066  32.427  1.00 13.36 ? 168  ASP A O   1 
ATOM   466  C  CB  . ASP A 1 61  ? 10.821 17.307  32.912  1.00 15.93 ? 168  ASP A CB  1 
ATOM   467  C  CG  . ASP A 1 61  ? 11.110 17.892  31.542  1.00 18.43 ? 168  ASP A CG  1 
ATOM   468  O  OD1 . ASP A 1 61  ? 10.910 17.217  30.513  1.00 20.21 ? 168  ASP A OD1 1 
ATOM   469  O  OD2 . ASP A 1 61  ? 11.523 19.069  31.493  1.00 20.94 ? 168  ASP A OD2 1 
ATOM   470  N  N   . PRO A 1 62  ? 10.941 14.096  31.233  1.00 18.03 ? 169  PRO A N   1 
ATOM   471  C  CA  . PRO A 1 62  ? 11.917 13.260  30.510  1.00 14.85 ? 169  PRO A CA  1 
ATOM   472  C  C   . PRO A 1 62  ? 12.956 14.077  29.730  1.00 16.87 ? 169  PRO A C   1 
ATOM   473  O  O   . PRO A 1 62  ? 14.087 13.621  29.573  1.00 15.89 ? 169  PRO A O   1 
ATOM   474  C  CB  . PRO A 1 62  ? 11.042 12.418  29.556  1.00 22.10 ? 169  PRO A CB  1 
ATOM   475  C  CG  . PRO A 1 62  ? 9.638  12.965  29.669  1.00 22.67 ? 169  PRO A CG  1 
ATOM   476  C  CD  . PRO A 1 62  ? 9.544  13.703  30.963  1.00 21.31 ? 169  PRO A CD  1 
ATOM   477  N  N   . GLY A 1 63  ? 12.595 15.278  29.275  1.00 17.79 ? 170  GLY A N   1 
ATOM   478  C  CA  . GLY A 1 63  ? 13.550 16.133  28.584  1.00 15.55 ? 170  GLY A CA  1 
ATOM   479  C  C   . GLY A 1 63  ? 14.686 16.655  29.459  1.00 15.24 ? 170  GLY A C   1 
ATOM   480  O  O   . GLY A 1 63  ? 15.749 17.000  28.961  1.00 17.52 ? 170  GLY A O   1 
ATOM   481  N  N   . ALA A 1 64  ? 14.460 16.728  30.764  1.00 13.19 ? 171  ALA A N   1 
ATOM   482  C  CA  . ALA A 1 64  ? 15.500 17.151  31.693  1.00 14.64 ? 171  ALA A CA  1 
ATOM   483  C  C   . ALA A 1 64  ? 16.295 15.976  32.238  1.00 13.70 ? 171  ALA A C   1 
ATOM   484  O  O   . ALA A 1 64  ? 16.987 16.124  33.229  1.00 14.86 ? 171  ALA A O   1 
ATOM   485  C  CB  . ALA A 1 64  ? 14.887 17.925  32.853  1.00 14.00 ? 171  ALA A CB  1 
ATOM   486  N  N   . SER A 1 65  ? 16.163 14.811  31.608  1.00 13.02 ? 172  SER A N   1 
ATOM   487  C  CA  . SER A 1 65  ? 16.691 13.561  32.152  1.00 13.58 ? 172  SER A CA  1 
ATOM   488  C  C   . SER A 1 65  ? 17.490 12.744  31.142  1.00 12.97 ? 172  SER A C   1 
ATOM   489  O  O   . SER A 1 65  ? 17.227 12.781  29.946  1.00 12.71 ? 172  SER A O   1 
ATOM   490  C  CB  . SER A 1 65  ? 15.548 12.682  32.684  1.00 12.89 ? 172  SER A CB  1 
ATOM   491  O  OG  . SER A 1 65  ? 14.776 13.372  33.646  1.00 18.56 ? 172  SER A OG  1 
ATOM   492  N  N   . PHE A 1 66  ? 18.461 11.995  31.647  1.00 13.70 ? 173  PHE A N   1 
ATOM   493  C  CA  . PHE A 1 66  ? 19.186 11.040  30.830  1.00 10.30 ? 173  PHE A CA  1 
ATOM   494  C  C   . PHE A 1 66  ? 19.935 10.054  31.720  1.00 13.70 ? 173  PHE A C   1 
ATOM   495  O  O   . PHE A 1 66  ? 20.278 10.369  32.855  1.00 14.45 ? 173  PHE A O   1 
ATOM   496  C  CB  . PHE A 1 66  ? 20.165 11.754  29.881  1.00 13.70 ? 173  PHE A CB  1 
ATOM   497  C  CG  . PHE A 1 66  ? 20.484 10.951  28.645  1.00 14.64 ? 173  PHE A CG  1 
ATOM   498  C  CD1 . PHE A 1 66  ? 19.570 10.882  27.603  1.00 14.04 ? 173  PHE A CD1 1 
ATOM   499  C  CD2 . PHE A 1 66  ? 21.678 10.245  28.541  1.00 19.14 ? 173  PHE A CD2 1 
ATOM   500  C  CE1 . PHE A 1 66  ? 19.846 10.133  26.465  1.00 19.58 ? 173  PHE A CE1 1 
ATOM   501  C  CE2 . PHE A 1 66  ? 21.966 9.479   27.401  1.00 15.55 ? 173  PHE A CE2 1 
ATOM   502  C  CZ  . PHE A 1 66  ? 21.053 9.424   26.366  1.00 17.90 ? 173  PHE A CZ  1 
ATOM   503  N  N   . ASP A 1 67  ? 20.192 8.860   31.196  1.00 15.96 ? 174  ASP A N   1 
ATOM   504  C  CA  . ASP A 1 67  ? 20.985 7.865   31.907  1.00 11.58 ? 174  ASP A CA  1 
ATOM   505  C  C   . ASP A 1 67  ? 22.349 7.821   31.234  1.00 15.57 ? 174  ASP A C   1 
ATOM   506  O  O   . ASP A 1 67  ? 22.520 7.185   30.206  1.00 17.52 ? 174  ASP A O   1 
ATOM   507  C  CB  . ASP A 1 67  ? 20.291 6.493   31.893  1.00 15.19 ? 174  ASP A CB  1 
ATOM   508  C  CG  . ASP A 1 67  ? 21.066 5.418   32.668  1.00 16.32 ? 174  ASP A CG  1 
ATOM   509  O  OD1 . ASP A 1 67  ? 22.247 5.640   32.983  1.00 15.66 ? 174  ASP A OD1 1 
ATOM   510  O  OD2 . ASP A 1 67  ? 20.475 4.348   32.956  1.00 14.70 ? 174  ASP A OD2 1 
ATOM   511  N  N   . VAL A 1 68  ? 23.317 8.521   31.815  1.00 14.52 ? 175  VAL A N   1 
ATOM   512  C  CA  . VAL A 1 68  ? 24.649 8.598   31.245  1.00 12.33 ? 175  VAL A CA  1 
ATOM   513  C  C   . VAL A 1 68  ? 25.443 7.309   31.518  1.00 13.71 ? 175  VAL A C   1 
ATOM   514  O  O   . VAL A 1 68  ? 26.254 6.909   30.696  1.00 17.41 ? 175  VAL A O   1 
ATOM   515  C  CB  . VAL A 1 68  ? 25.399 9.847   31.782  1.00 14.39 ? 175  VAL A CB  1 
ATOM   516  C  CG1 . VAL A 1 68  ? 26.832 9.907   31.257  1.00 15.58 ? 175  VAL A CG1 1 
ATOM   517  C  CG2 . VAL A 1 68  ? 24.645 11.104  31.364  1.00 16.59 ? 175  VAL A CG2 1 
ATOM   518  N  N   . ASN A 1 69  ? 25.180 6.642   32.643  1.00 15.33 ? 176  ASN A N   1 
ATOM   519  C  CA  . ASN A 1 69  ? 25.882 5.398   32.970  1.00 14.27 ? 176  ASN A CA  1 
ATOM   520  C  C   . ASN A 1 69  ? 25.586 4.263   31.986  1.00 18.67 ? 176  ASN A C   1 
ATOM   521  O  O   . ASN A 1 69  ? 26.504 3.561   31.564  1.00 18.10 ? 176  ASN A O   1 
ATOM   522  C  CB  . ASN A 1 69  ? 25.545 4.936   34.399  1.00 14.31 ? 176  ASN A CB  1 
ATOM   523  C  CG  . ASN A 1 69  ? 26.076 5.890   35.468  1.00 13.45 ? 176  ASN A CG  1 
ATOM   524  O  OD1 . ASN A 1 69  ? 25.356 6.261   36.394  1.00 17.28 ? 176  ASN A OD1 1 
ATOM   525  N  ND2 . ASN A 1 69  ? 27.339 6.281   35.343  1.00 12.95 ? 176  ASN A ND2 1 
ATOM   526  N  N   . ASP A 1 70  ? 24.316 4.087   31.623  1.00 14.88 ? 177  ASP A N   1 
ATOM   527  C  CA  . ASP A 1 70  ? 23.917 3.018   30.691  1.00 16.63 ? 177  ASP A CA  1 
ATOM   528  C  C   . ASP A 1 70  ? 23.546 3.548   29.301  1.00 25.16 ? 177  ASP A C   1 
ATOM   529  O  O   . ASP A 1 70  ? 23.111 2.777   28.428  1.00 23.15 ? 177  ASP A O   1 
ATOM   530  C  CB  . ASP A 1 70  ? 22.730 2.220   31.241  1.00 17.58 ? 177  ASP A CB  1 
ATOM   531  C  CG  . ASP A 1 70  ? 23.116 1.300   32.389  1.00 26.89 ? 177  ASP A CG  1 
ATOM   532  O  OD1 . ASP A 1 70  ? 24.325 1.046   32.582  1.00 33.55 ? 177  ASP A OD1 1 
ATOM   533  O  OD2 . ASP A 1 70  ? 22.207 0.826   33.096  1.00 25.55 ? 177  ASP A OD2 1 
ATOM   534  N  N   . GLN A 1 71  ? 23.688 4.862   29.120  1.00 18.22 ? 178  GLN A N   1 
ATOM   535  C  CA  . GLN A 1 71  ? 23.500 5.517   27.835  1.00 17.19 ? 178  GLN A CA  1 
ATOM   536  C  C   . GLN A 1 71  ? 22.085 5.362   27.257  1.00 16.98 ? 178  GLN A C   1 
ATOM   537  O  O   . GLN A 1 71  ? 21.921 5.139   26.063  1.00 18.04 ? 178  GLN A O   1 
ATOM   538  C  CB  . GLN A 1 71  ? 24.560 5.007   26.843  1.00 20.85 ? 178  GLN A CB  1 
ATOM   539  C  CG  . GLN A 1 71  ? 25.988 5.359   27.288  1.00 20.59 ? 178  GLN A CG  1 
ATOM   540  C  CD  . GLN A 1 71  ? 27.073 4.861   26.328  1.00 35.78 ? 178  GLN A CD  1 
ATOM   541  O  OE1 . GLN A 1 71  ? 27.102 5.244   25.159  1.00 37.45 ? 178  GLN A OE1 1 
ATOM   542  N  NE2 . GLN A 1 71  ? 27.976 4.010   26.826  1.00 34.49 ? 178  GLN A NE2 1 
ATOM   543  N  N   . ASP A 1 72  ? 21.063 5.522   28.098  1.00 18.94 ? 179  ASP A N   1 
ATOM   544  C  CA  . ASP A 1 72  ? 19.675 5.486   27.633  1.00 15.27 ? 179  ASP A CA  1 
ATOM   545  C  C   . ASP A 1 72  ? 18.869 6.677   28.187  1.00 16.93 ? 179  ASP A C   1 
ATOM   546  O  O   . ASP A 1 72  ? 19.340 7.374   29.085  1.00 14.71 ? 179  ASP A O   1 
ATOM   547  C  CB  . ASP A 1 72  ? 19.026 4.142   28.000  1.00 15.68 ? 179  ASP A CB  1 
ATOM   548  C  CG  . ASP A 1 72  ? 18.896 3.919   29.493  1.00 18.84 ? 179  ASP A CG  1 
ATOM   549  O  OD1 . ASP A 1 72  ? 18.157 4.667   30.158  1.00 18.99 ? 179  ASP A OD1 1 
ATOM   550  O  OD2 . ASP A 1 72  ? 19.502 2.949   30.004  1.00 22.34 ? 179  ASP A OD2 1 
ATOM   551  N  N   . PRO A 1 73  ? 17.650 6.913   27.659  1.00 20.65 ? 180  PRO A N   1 
ATOM   552  C  CA  . PRO A 1 73  ? 16.898 8.092   28.122  1.00 18.30 ? 180  PRO A CA  1 
ATOM   553  C  C   . PRO A 1 73  ? 16.213 7.924   29.486  1.00 18.63 ? 180  PRO A C   1 
ATOM   554  O  O   . PRO A 1 73  ? 15.548 8.854   29.918  1.00 18.68 ? 180  PRO A O   1 
ATOM   555  C  CB  . PRO A 1 73  ? 15.828 8.281   27.027  1.00 18.62 ? 180  PRO A CB  1 
ATOM   556  C  CG  . PRO A 1 73  ? 16.173 7.337   25.932  1.00 20.19 ? 180  PRO A CG  1 
ATOM   557  C  CD  . PRO A 1 73  ? 16.965 6.243   26.533  1.00 20.65 ? 180  PRO A CD  1 
ATOM   558  N  N   . ASP A 1 74  ? 16.388 6.785   30.155  1.00 20.67 ? 181  ASP A N   1 
ATOM   559  C  CA  . ASP A 1 74  ? 15.605 6.458   31.355  1.00 16.74 ? 181  ASP A CA  1 
ATOM   560  C  C   . ASP A 1 74  ? 16.476 6.413   32.624  1.00 16.30 ? 181  ASP A C   1 
ATOM   561  O  O   . ASP A 1 74  ? 17.187 5.450   32.821  1.00 14.37 ? 181  ASP A O   1 
ATOM   562  C  CB  . ASP A 1 74  ? 14.904 5.107   31.139  1.00 16.73 ? 181  ASP A CB  1 
ATOM   563  C  CG  . ASP A 1 74  ? 13.981 4.707   32.301  1.00 20.25 ? 181  ASP A CG  1 
ATOM   564  O  OD1 . ASP A 1 74  ? 13.949 5.375   33.350  1.00 20.93 ? 181  ASP A OD1 1 
ATOM   565  O  OD2 . ASP A 1 74  ? 13.279 3.686   32.172  1.00 29.47 ? 181  ASP A OD2 1 
ATOM   566  N  N   . PRO A 1 75  ? 16.377 7.436   33.497  1.00 14.25 ? 182  PRO A N   1 
ATOM   567  C  CA  . PRO A 1 75  ? 17.240 7.575   34.680  1.00 13.87 ? 182  PRO A CA  1 
ATOM   568  C  C   . PRO A 1 75  ? 16.760 6.801   35.913  1.00 16.93 ? 182  PRO A C   1 
ATOM   569  O  O   . PRO A 1 75  ? 17.201 7.120   37.010  1.00 13.31 ? 182  PRO A O   1 
ATOM   570  C  CB  . PRO A 1 75  ? 17.192 9.078   34.959  1.00 15.97 ? 182  PRO A CB  1 
ATOM   571  C  CG  . PRO A 1 75  ? 15.761 9.444   34.580  1.00 16.02 ? 182  PRO A CG  1 
ATOM   572  C  CD  . PRO A 1 75  ? 15.365 8.511   33.434  1.00 15.26 ? 182  PRO A CD  1 
ATOM   573  N  N   . GLN A 1 76  ? 15.876 5.818   35.744  1.00 13.66 ? 183  GLN A N   1 
ATOM   574  C  CA  . GLN A 1 76  ? 15.392 5.024   36.874  1.00 16.15 ? 183  GLN A CA  1 
ATOM   575  C  C   . GLN A 1 76  ? 16.578 4.470   37.667  1.00 15.78 ? 183  GLN A C   1 
ATOM   576  O  O   . GLN A 1 76  ? 17.525 3.980   37.065  1.00 13.52 ? 183  GLN A O   1 
ATOM   577  C  CB  . GLN A 1 76  ? 14.496 3.875   36.387  1.00 18.22 ? 183  GLN A CB  1 
ATOM   578  C  CG  . GLN A 1 76  ? 13.703 3.182   37.491  1.00 19.20 ? 183  GLN A CG  1 
ATOM   579  C  CD  . GLN A 1 76  ? 12.444 3.959   37.862  1.00 23.21 ? 183  GLN A CD  1 
ATOM   580  O  OE1 . GLN A 1 76  ? 12.008 4.828   37.113  1.00 26.99 ? 183  GLN A OE1 1 
ATOM   581  N  NE2 . GLN A 1 76  ? 11.864 3.650   39.011  1.00 17.21 ? 183  GLN A NE2 1 
ATOM   582  N  N   . PRO A 1 77  ? 16.546 4.592   39.008  1.00 14.69 ? 184  PRO A N   1 
ATOM   583  C  CA  . PRO A 1 77  ? 17.626 4.072   39.856  1.00 13.51 ? 184  PRO A CA  1 
ATOM   584  C  C   . PRO A 1 77  ? 17.678 2.548   39.777  1.00 15.87 ? 184  PRO A C   1 
ATOM   585  O  O   . PRO A 1 77  ? 16.642 1.917   39.597  1.00 17.96 ? 184  PRO A O   1 
ATOM   586  C  CB  . PRO A 1 77  ? 17.231 4.518   41.268  1.00 15.96 ? 184  PRO A CB  1 
ATOM   587  C  CG  . PRO A 1 77  ? 16.104 5.548   41.059  1.00 16.14 ? 184  PRO A CG  1 
ATOM   588  C  CD  . PRO A 1 77  ? 15.437 5.134   39.811  1.00 14.12 ? 184  PRO A CD  1 
ATOM   589  N  N   . ARG A 1 78  ? 18.869 1.980   39.906  1.00 13.00 ? 185  ARG A N   1 
ATOM   590  C  CA  . ARG A 1 78  ? 19.045 0.541   39.930  1.00 14.27 ? 185  ARG A CA  1 
ATOM   591  C  C   . ARG A 1 78  ? 18.673 0.030   41.334  1.00 18.40 ? 185  ARG A C   1 
ATOM   592  O  O   . ARG A 1 78  ? 19.211 0.510   42.341  1.00 16.85 ? 185  ARG A O   1 
ATOM   593  C  CB  . ARG A 1 78  ? 20.489 0.205   39.549  1.00 15.33 ? 185  ARG A CB  1 
ATOM   594  C  CG  . ARG A 1 78  ? 20.803 -1.239  39.291  1.00 22.82 ? 185  ARG A CG  1 
ATOM   595  C  CD  . ARG A 1 78  ? 22.241 -1.394  38.793  1.00 19.42 ? 185  ARG A CD  1 
ATOM   596  N  NE  . ARG A 1 78  ? 23.156 -0.713  39.695  1.00 23.97 ? 185  ARG A NE  1 
ATOM   597  C  CZ  . ARG A 1 78  ? 23.678 -1.259  40.790  1.00 30.30 ? 185  ARG A CZ  1 
ATOM   598  N  NH1 . ARG A 1 78  ? 24.489 -0.545  41.564  1.00 25.36 ? 185  ARG A NH1 1 
ATOM   599  N  NH2 . ARG A 1 78  ? 23.403 -2.520  41.104  1.00 26.40 ? 185  ARG A NH2 1 
ATOM   600  N  N   . TYR A 1 79  ? 17.741 -0.919  41.417  1.00 15.06 ? 186  TYR A N   1 
ATOM   601  C  CA  . TYR A 1 79  ? 17.300 -1.389  42.734  1.00 14.15 ? 186  TYR A CA  1 
ATOM   602  C  C   . TYR A 1 79  ? 18.222 -2.478  43.284  1.00 20.01 ? 186  TYR A C   1 
ATOM   603  O  O   . TYR A 1 79  ? 18.637 -3.391  42.562  1.00 19.99 ? 186  TYR A O   1 
ATOM   604  C  CB  . TYR A 1 79  ? 15.843 -1.869  42.684  1.00 14.36 ? 186  TYR A CB  1 
ATOM   605  C  CG  . TYR A 1 79  ? 14.894 -0.728  42.406  1.00 15.81 ? 186  TYR A CG  1 
ATOM   606  C  CD1 . TYR A 1 79  ? 14.500 0.134   43.418  1.00 19.53 ? 186  TYR A CD1 1 
ATOM   607  C  CD2 . TYR A 1 79  ? 14.439 -0.480  41.121  1.00 20.39 ? 186  TYR A CD2 1 
ATOM   608  C  CE1 . TYR A 1 79  ? 13.656 1.210   43.163  1.00 16.26 ? 186  TYR A CE1 1 
ATOM   609  C  CE2 . TYR A 1 79  ? 13.589 0.589   40.849  1.00 24.86 ? 186  TYR A CE2 1 
ATOM   610  C  CZ  . TYR A 1 79  ? 13.204 1.429   41.874  1.00 22.32 ? 186  TYR A CZ  1 
ATOM   611  O  OH  . TYR A 1 79  ? 12.370 2.485   41.609  1.00 24.92 ? 186  TYR A OH  1 
ATOM   612  N  N   . THR A 1 80  ? 18.561 -2.338  44.565  1.00 19.08 ? 187  THR A N   1 
ATOM   613  C  CA  . THR A 1 80  ? 19.430 -3.267  45.288  1.00 16.68 ? 187  THR A CA  1 
ATOM   614  C  C   . THR A 1 80  ? 18.860 -3.543  46.689  1.00 23.67 ? 187  THR A C   1 
ATOM   615  O  O   . THR A 1 80  ? 17.910 -2.882  47.131  1.00 18.52 ? 187  THR A O   1 
ATOM   616  C  CB  . THR A 1 80  ? 20.859 -2.717  45.435  1.00 20.63 ? 187  THR A CB  1 
ATOM   617  O  OG1 . THR A 1 80  ? 20.815 -1.486  46.159  1.00 17.55 ? 187  THR A OG1 1 
ATOM   618  C  CG2 . THR A 1 80  ? 21.518 -2.472  44.071  1.00 20.99 ? 187  THR A CG2 1 
ATOM   619  N  N   . GLN A 1 81  ? 19.441 -4.506  47.399  1.00 18.26 ? 188  GLN A N   1 
ATOM   620  C  CA  . GLN A 1 81  ? 18.894 -4.894  48.701  1.00 19.04 ? 188  GLN A CA  1 
ATOM   621  C  C   . GLN A 1 81  ? 18.959 -3.747  49.713  1.00 20.71 ? 188  GLN A C   1 
ATOM   622  O  O   . GLN A 1 81  ? 18.005 -3.513  50.445  1.00 20.98 ? 188  GLN A O   1 
ATOM   623  C  CB  . GLN A 1 81  ? 19.635 -6.115  49.265  1.00 16.06 ? 188  GLN A CB  1 
ATOM   624  C  CG  . GLN A 1 81  ? 19.040 -6.651  50.570  1.00 15.61 ? 188  GLN A CG  1 
ATOM   625  C  CD  . GLN A 1 81  ? 17.641 -7.204  50.394  1.00 19.71 ? 188  GLN A CD  1 
ATOM   626  O  OE1 . GLN A 1 81  ? 17.257 -7.623  49.304  1.00 48.67 ? 188  GLN A OE1 1 
ATOM   627  N  NE2 . GLN A 1 81  ? 16.867 -7.195  51.468  1.00 27.24 ? 188  GLN A NE2 1 
ATOM   628  N  N   . MET A 1 82  ? 20.090 -3.046  49.748  1.00 19.63 ? 189  MET A N   1 
ATOM   629  C  CA  . MET A 1 82  ? 20.313 -1.984  50.729  1.00 22.59 ? 189  MET A CA  1 
ATOM   630  C  C   . MET A 1 82  ? 19.949 -0.585  50.231  1.00 22.91 ? 189  MET A C   1 
ATOM   631  O  O   . MET A 1 82  ? 20.302 0.405   50.880  1.00 22.46 ? 189  MET A O   1 
ATOM   632  C  CB  . MET A 1 82  ? 21.776 -1.974  51.180  1.00 22.89 ? 189  MET A CB  1 
ATOM   633  C  CG  . MET A 1 82  ? 22.247 -3.281  51.813  1.00 31.80 ? 189  MET A CG  1 
ATOM   634  S  SD  . MET A 1 82  ? 21.215 -3.792  53.207  1.00 55.64 ? 189  MET A SD  1 
ATOM   635  C  CE  . MET A 1 82  ? 21.749 -5.494  53.418  1.00 34.48 ? 189  MET A CE  1 
ATOM   636  N  N   . ASN A 1 83  ? 19.262 -0.499  49.091  1.00 18.98 ? 190  ASN A N   1 
ATOM   637  C  CA  . ASN A 1 83  ? 18.809 0.792   48.568  1.00 18.10 ? 190  ASN A CA  1 
ATOM   638  C  C   . ASN A 1 83  ? 19.941 1.804   48.416  1.00 20.05 ? 190  ASN A C   1 
ATOM   639  O  O   . ASN A 1 83  ? 19.802 2.967   48.779  1.00 18.51 ? 190  ASN A O   1 
ATOM   640  C  CB  . ASN A 1 83  ? 17.716 1.367   49.476  1.00 17.99 ? 190  ASN A CB  1 
ATOM   641  C  CG  . ASN A 1 83  ? 16.487 0.481   49.524  1.00 27.83 ? 190  ASN A CG  1 
ATOM   642  O  OD1 . ASN A 1 83  ? 16.010 0.005   48.492  1.00 26.72 ? 190  ASN A OD1 1 
ATOM   643  N  ND2 . ASN A 1 83  ? 15.985 0.225   50.727  1.00 29.65 ? 190  ASN A ND2 1 
ATOM   644  N  N   . ASP A 1 84  ? 21.057 1.349   47.864  1.00 18.77 ? 191  ASP A N   1 
ATOM   645  C  CA  . ASP A 1 84  ? 22.208 2.202   47.625  1.00 21.23 ? 191  ASP A CA  1 
ATOM   646  C  C   . ASP A 1 84  ? 21.898 3.407   46.740  1.00 19.92 ? 191  ASP A C   1 
ATOM   647  O  O   . ASP A 1 84  ? 22.518 4.454   46.893  1.00 23.92 ? 191  ASP A O   1 
ATOM   648  C  CB  . ASP A 1 84  ? 23.338 1.394   46.981  1.00 27.05 ? 191  ASP A CB  1 
ATOM   649  C  CG  . ASP A 1 84  ? 23.707 0.168   47.791  1.00 30.18 ? 191  ASP A CG  1 
ATOM   650  O  OD1 . ASP A 1 84  ? 24.461 0.316   48.770  1.00 34.59 ? 191  ASP A OD1 1 
ATOM   651  O  OD2 . ASP A 1 84  ? 23.234 -0.940  47.462  1.00 29.45 ? 191  ASP A OD2 1 
ATOM   652  N  N   . ASN A 1 85  ? 20.958 3.272   45.809  1.00 14.82 ? 192  ASN A N   1 
ATOM   653  C  CA  . ASN A 1 85  ? 20.791 4.332   44.812  1.00 13.29 ? 192  ASN A CA  1 
ATOM   654  C  C   . ASN A 1 85  ? 19.586 5.225   45.080  1.00 14.80 ? 192  ASN A C   1 
ATOM   655  O  O   . ASN A 1 85  ? 18.836 5.560   44.178  1.00 15.10 ? 192  ASN A O   1 
ATOM   656  C  CB  . ASN A 1 85  ? 20.716 3.715   43.415  1.00 15.37 ? 192  ASN A CB  1 
ATOM   657  C  CG  . ASN A 1 85  ? 21.998 3.000   43.042  1.00 18.29 ? 192  ASN A CG  1 
ATOM   658  O  OD1 . ASN A 1 85  ? 23.078 3.586   43.088  1.00 18.07 ? 192  ASN A OD1 1 
ATOM   659  N  ND2 . ASN A 1 85  ? 21.892 1.716   42.712  1.00 19.68 ? 192  ASN A ND2 1 
ATOM   660  N  N   . ARG A 1 86  ? 19.440 5.630   46.338  1.00 17.74 ? 193  ARG A N   1 
ATOM   661  C  CA  . ARG A 1 86  ? 18.316 6.433   46.800  1.00 17.59 ? 193  ARG A CA  1 
ATOM   662  C  C   . ARG A 1 86  ? 18.645 7.927   46.828  1.00 14.12 ? 193  ARG A C   1 
ATOM   663  O  O   . ARG A 1 86  ? 17.786 8.761   47.107  1.00 13.01 ? 193  ARG A O   1 
ATOM   664  C  CB  . ARG A 1 86  ? 17.915 5.980   48.210  1.00 17.13 ? 193  ARG A CB  1 
ATOM   665  C  CG  . ARG A 1 86  ? 18.986 6.329   49.241  1.00 17.57 ? 193  ARG A CG  1 
ATOM   666  C  CD  . ARG A 1 86  ? 18.644 5.805   50.636  1.00 20.31 ? 193  ARG A CD  1 
ATOM   667  N  NE  . ARG A 1 86  ? 19.651 6.226   51.605  1.00 22.66 ? 193  ARG A NE  1 
ATOM   668  C  CZ  . ARG A 1 86  ? 19.661 5.852   52.880  1.00 29.65 ? 193  ARG A CZ  1 
ATOM   669  N  NH1 . ARG A 1 86  ? 18.718 5.039   53.336  1.00 26.84 ? 193  ARG A NH1 1 
ATOM   670  N  NH2 . ARG A 1 86  ? 20.618 6.284   53.696  1.00 27.74 ? 193  ARG A NH2 1 
ATOM   671  N  N   . HIS A 1 87  ? 19.903 8.256   46.571  1.00 13.67 ? 194  HIS A N   1 
ATOM   672  C  CA  . HIS A 1 87  ? 20.413 9.590   46.883  1.00 14.33 ? 194  HIS A CA  1 
ATOM   673  C  C   . HIS A 1 87  ? 19.773 10.642  45.964  1.00 13.84 ? 194  HIS A C   1 
ATOM   674  O  O   . HIS A 1 87  ? 19.364 11.713  46.426  1.00 13.25 ? 194  HIS A O   1 
ATOM   675  C  CB  . HIS A 1 87  ? 21.947 9.583   46.787  1.00 14.53 ? 194  HIS A CB  1 
ATOM   676  C  CG  . HIS A 1 87  ? 22.633 10.724  47.480  1.00 15.59 ? 194  HIS A CG  1 
ATOM   677  N  ND1 . HIS A 1 87  ? 23.015 11.869  46.814  1.00 14.84 ? 194  HIS A ND1 1 
ATOM   678  C  CD2 . HIS A 1 87  ? 23.084 10.868  48.754  1.00 19.08 ? 194  HIS A CD2 1 
ATOM   679  C  CE1 . HIS A 1 87  ? 23.637 12.683  47.649  1.00 17.56 ? 194  HIS A CE1 1 
ATOM   680  N  NE2 . HIS A 1 87  ? 23.690 12.105  48.837  1.00 18.83 ? 194  HIS A NE2 1 
ATOM   681  N  N   . GLY A 1 88  ? 19.640 10.323  44.677  1.00 14.82 ? 195  GLY A N   1 
ATOM   682  C  CA  . GLY A 1 88  ? 19.065 11.255  43.715  1.00 13.46 ? 195  GLY A CA  1 
ATOM   683  C  C   . GLY A 1 88  ? 17.585 11.513  43.929  1.00 17.34 ? 195  GLY A C   1 
ATOM   684  O  O   . GLY A 1 88  ? 17.093 12.633  43.748  1.00 13.51 ? 195  GLY A O   1 
ATOM   685  N  N   . THR A 1 89  ? 16.871 10.459  44.306  1.00 13.07 ? 196  THR A N   1 
ATOM   686  C  CA  . THR A 1 89  ? 15.431 10.531  44.501  1.00 12.32 ? 196  THR A CA  1 
ATOM   687  C  C   . THR A 1 89  ? 15.092 11.437  45.689  1.00 14.03 ? 196  THR A C   1 
ATOM   688  O  O   . THR A 1 89  ? 14.146 12.225  45.632  1.00 11.65 ? 196  THR A O   1 
ATOM   689  C  CB  . THR A 1 89  ? 14.845 9.111   44.686  1.00 16.40 ? 196  THR A CB  1 
ATOM   690  O  OG1 . THR A 1 89  ? 14.994 8.390   43.450  1.00 15.15 ? 196  THR A OG1 1 
ATOM   691  C  CG2 . THR A 1 89  ? 13.368 9.168   45.069  1.00 13.07 ? 196  THR A CG2 1 
ATOM   692  N  N   . ARG A 1 90  ? 15.897 11.344  46.741  1.00 12.77 ? 197  ARG A N   1 
ATOM   693  C  CA  . ARG A 1 90  ? 15.740 12.195  47.905  1.00 14.02 ? 197  ARG A CA  1 
ATOM   694  C  C   . ARG A 1 90  ? 15.993 13.676  47.560  1.00 14.92 ? 197  ARG A C   1 
ATOM   695  O  O   . ARG A 1 90  ? 15.267 14.571  48.006  1.00 15.47 ? 197  ARG A O   1 
ATOM   696  C  CB  . ARG A 1 90  ? 16.689 11.723  49.011  1.00 14.92 ? 197  ARG A CB  1 
ATOM   697  C  CG  . ARG A 1 90  ? 16.268 10.387  49.638  1.00 15.07 ? 197  ARG A CG  1 
ATOM   698  C  CD  . ARG A 1 90  ? 17.201 9.962   50.759  1.00 17.77 ? 197  ARG A CD  1 
ATOM   699  N  NE  . ARG A 1 90  ? 16.681 8.795   51.468  1.00 17.30 ? 197  ARG A NE  1 
ATOM   700  C  CZ  . ARG A 1 90  ? 17.077 8.421   52.681  1.00 18.21 ? 197  ARG A CZ  1 
ATOM   701  N  NH1 . ARG A 1 90  ? 16.539 7.357   53.256  1.00 16.60 ? 197  ARG A NH1 1 
ATOM   702  N  NH2 . ARG A 1 90  ? 18.008 9.113   53.314  1.00 17.88 ? 197  ARG A NH2 1 
ATOM   703  N  N   . CYS A 1 91  ? 17.027 13.926  46.760  1.00 13.30 ? 198  CYS A N   1 
ATOM   704  C  CA  . CYS A 1 91  ? 17.340 15.292  46.341  1.00 15.80 ? 198  CYS A CA  1 
ATOM   705  C  C   . CYS A 1 91  ? 16.227 15.899  45.464  1.00 14.76 ? 198  CYS A C   1 
ATOM   706  O  O   . CYS A 1 91  ? 15.879 17.066  45.605  1.00 12.69 ? 198  CYS A O   1 
ATOM   707  C  CB  . CYS A 1 91  ? 18.681 15.316  45.604  1.00 15.26 ? 198  CYS A CB  1 
ATOM   708  S  SG  . CYS A 1 91  ? 20.131 14.936  46.650  1.00 18.85 ? 198  CYS A SG  1 
ATOM   709  N  N   . ALA A 1 92  ? 15.673 15.090  44.568  1.00 10.82 ? 199  ALA A N   1 
ATOM   710  C  CA  . ALA A 1 92  ? 14.641 15.540  43.647  1.00 12.36 ? 199  ALA A CA  1 
ATOM   711  C  C   . ALA A 1 92  ? 13.376 16.012  44.355  1.00 14.29 ? 199  ALA A C   1 
ATOM   712  O  O   . ALA A 1 92  ? 12.775 17.009  43.956  1.00 16.33 ? 199  ALA A O   1 
ATOM   713  C  CB  . ALA A 1 92  ? 14.288 14.428  42.683  1.00 16.24 ? 199  ALA A CB  1 
ATOM   714  N  N   . GLY A 1 93  ? 12.959 15.277  45.381  1.00 11.87 ? 200  GLY A N   1 
ATOM   715  C  CA  . GLY A 1 93  ? 11.763 15.638  46.128  1.00 13.98 ? 200  GLY A CA  1 
ATOM   716  C  C   . GLY A 1 93  ? 11.878 16.959  46.866  1.00 15.75 ? 200  GLY A C   1 
ATOM   717  O  O   . GLY A 1 93  ? 10.879 17.662  47.071  1.00 16.69 ? 200  GLY A O   1 
ATOM   718  N  N   . GLU A 1 94  ? 13.092 17.303  47.282  1.00 15.00 ? 201  GLU A N   1 
ATOM   719  C  CA  . GLU A 1 94  ? 13.304 18.573  47.959  1.00 16.89 ? 201  GLU A CA  1 
ATOM   720  C  C   . GLU A 1 94  ? 13.047 19.740  47.039  1.00 19.45 ? 201  GLU A C   1 
ATOM   721  O  O   . GLU A 1 94  ? 12.572 20.786  47.475  1.00 16.76 ? 201  GLU A O   1 
ATOM   722  C  CB  . GLU A 1 94  ? 14.718 18.686  48.473  1.00 19.03 ? 201  GLU A CB  1 
ATOM   723  C  CG  . GLU A 1 94  ? 15.124 17.624  49.435  1.00 19.04 ? 201  GLU A CG  1 
ATOM   724  C  CD  . GLU A 1 94  ? 16.492 17.928  49.930  1.00 21.19 ? 201  GLU A CD  1 
ATOM   725  O  OE1 . GLU A 1 94  ? 17.445 17.270  49.478  1.00 23.47 ? 201  GLU A OE1 1 
ATOM   726  O  OE2 . GLU A 1 94  ? 16.613 18.877  50.739  1.00 23.42 ? 201  GLU A OE2 1 
ATOM   727  N  N   . VAL A 1 95  ? 13.437 19.573  45.777  1.00 14.53 ? 202  VAL A N   1 
ATOM   728  C  CA  . VAL A 1 95  ? 13.244 20.611  44.798  1.00 15.35 ? 202  VAL A CA  1 
ATOM   729  C  C   . VAL A 1 95  ? 11.786 20.710  44.392  1.00 16.48 ? 202  VAL A C   1 
ATOM   730  O  O   . VAL A 1 95  ? 11.215 21.812  44.364  1.00 15.53 ? 202  VAL A O   1 
ATOM   731  C  CB  . VAL A 1 95  ? 14.078 20.387  43.517  1.00 14.62 ? 202  VAL A CB  1 
ATOM   732  C  CG1 . VAL A 1 95  ? 13.853 21.545  42.548  1.00 12.64 ? 202  VAL A CG1 1 
ATOM   733  C  CG2 . VAL A 1 95  ? 15.558 20.237  43.849  1.00 11.85 ? 202  VAL A CG2 1 
ATOM   734  N  N   . ALA A 1 96  ? 11.183 19.564  44.078  1.00 14.50 ? 203  ALA A N   1 
ATOM   735  C  CA  . ALA A 1 96  ? 9.931  19.592  43.325  1.00 14.18 ? 203  ALA A CA  1 
ATOM   736  C  C   . ALA A 1 96  ? 8.920  18.484  43.622  1.00 13.58 ? 203  ALA A C   1 
ATOM   737  O  O   . ALA A 1 96  ? 8.133  18.129  42.741  1.00 17.51 ? 203  ALA A O   1 
ATOM   738  C  CB  . ALA A 1 96  ? 10.248 19.582  41.852  1.00 11.22 ? 203  ALA A CB  1 
ATOM   739  N  N   . ALA A 1 97  ? 8.915  17.949  44.835  1.00 12.89 ? 204  ALA A N   1 
ATOM   740  C  CA  . ALA A 1 97  ? 7.828  17.046  45.217  1.00 16.03 ? 204  ALA A CA  1 
ATOM   741  C  C   . ALA A 1 97  ? 6.485  17.743  45.003  1.00 15.65 ? 204  ALA A C   1 
ATOM   742  O  O   . ALA A 1 97  ? 6.342  18.930  45.278  1.00 18.20 ? 204  ALA A O   1 
ATOM   743  C  CB  . ALA A 1 97  ? 7.964  16.582  46.661  1.00 12.36 ? 204  ALA A CB  1 
ATOM   744  N  N   . VAL A 1 98  ? 5.510  16.997  44.495  1.00 15.95 ? 205  VAL A N   1 
ATOM   745  C  CA  . VAL A 1 98  ? 4.201  17.545  44.150  1.00 16.00 ? 205  VAL A CA  1 
ATOM   746  C  C   . VAL A 1 98  ? 3.459  18.021  45.399  1.00 18.04 ? 205  VAL A C   1 
ATOM   747  O  O   . VAL A 1 98  ? 3.593  17.431  46.465  1.00 17.98 ? 205  VAL A O   1 
ATOM   748  C  CB  . VAL A 1 98  ? 3.377  16.493  43.376  1.00 19.42 ? 205  VAL A CB  1 
ATOM   749  C  CG1 . VAL A 1 98  ? 1.909  16.928  43.201  1.00 17.74 ? 205  VAL A CG1 1 
ATOM   750  C  CG2 . VAL A 1 98  ? 4.044  16.243  42.022  1.00 16.37 ? 205  VAL A CG2 1 
ATOM   751  N  N   . ALA A 1 99  ? 2.724  19.125  45.270  1.00 21.14 ? 206  ALA A N   1 
ATOM   752  C  CA  . ALA A 1 99  ? 1.952  19.685  46.378  1.00 19.29 ? 206  ALA A CA  1 
ATOM   753  C  C   . ALA A 1 99  ? 0.470  19.341  46.312  1.00 17.89 ? 206  ALA A C   1 
ATOM   754  O  O   . ALA A 1 99  ? -0.083 19.127  45.238  1.00 22.86 ? 206  ALA A O   1 
ATOM   755  C  CB  . ALA A 1 99  ? 2.109  21.206  46.423  1.00 19.72 ? 206  ALA A CB  1 
ATOM   756  N  N   . ASN A 1 100 ? -0.157 19.325  47.482  1.00 21.41 ? 207  ASN A N   1 
ATOM   757  C  CA  . ASN A 1 100 ? -1.599 19.158  47.617  1.00 18.48 ? 207  ASN A CA  1 
ATOM   758  C  C   . ASN A 1 100 ? -2.130 17.873  47.008  1.00 22.14 ? 207  ASN A C   1 
ATOM   759  O  O   . ASN A 1 100 ? -3.254 17.828  46.514  1.00 21.81 ? 207  ASN A O   1 
ATOM   760  C  CB  . ASN A 1 100 ? -2.304 20.371  47.007  1.00 19.28 ? 207  ASN A CB  1 
ATOM   761  C  CG  . ASN A 1 100 ? -1.937 21.641  47.712  1.00 20.52 ? 207  ASN A CG  1 
ATOM   762  O  OD1 . ASN A 1 100 ? -2.051 21.732  48.933  1.00 28.49 ? 207  ASN A OD1 1 
ATOM   763  N  ND2 . ASN A 1 100 ? -1.447 22.618  46.964  1.00 25.72 ? 207  ASN A ND2 1 
ATOM   764  N  N   . ASN A 1 101 ? -1.322 16.817  47.057  1.00 20.33 ? 208  ASN A N   1 
ATOM   765  C  CA  . ASN A 1 101 ? -1.739 15.533  46.507  1.00 20.50 ? 208  ASN A CA  1 
ATOM   766  C  C   . ASN A 1 101 ? -1.869 14.447  47.570  1.00 21.83 ? 208  ASN A C   1 
ATOM   767  O  O   . ASN A 1 101 ? -1.986 13.269  47.243  1.00 26.94 ? 208  ASN A O   1 
ATOM   768  C  CB  . ASN A 1 101 ? -0.759 15.079  45.424  1.00 20.37 ? 208  ASN A CB  1 
ATOM   769  C  CG  . ASN A 1 101 ? 0.606  14.720  45.990  1.00 16.55 ? 208  ASN A CG  1 
ATOM   770  O  OD1 . ASN A 1 101 ? 0.955  15.118  47.100  1.00 21.52 ? 208  ASN A OD1 1 
ATOM   771  N  ND2 . ASN A 1 101 ? 1.381  13.966  45.226  1.00 18.71 ? 208  ASN A ND2 1 
ATOM   772  N  N   . GLY A 1 102 ? -1.823 14.839  48.838  1.00 22.29 ? 209  GLY A N   1 
ATOM   773  C  CA  . GLY A 1 102 ? -1.989 13.889  49.930  1.00 24.41 ? 209  GLY A CA  1 
ATOM   774  C  C   . GLY A 1 102 ? -0.843 12.914  50.139  1.00 25.46 ? 209  GLY A C   1 
ATOM   775  O  O   . GLY A 1 102 ? -0.973 11.936  50.872  1.00 21.62 ? 209  GLY A O   1 
ATOM   776  N  N   . VAL A 1 103 ? 0.292  13.180  49.503  1.00 20.57 ? 210  VAL A N   1 
ATOM   777  C  CA  . VAL A 1 103 ? 1.448  12.298  49.605  1.00 18.13 ? 210  VAL A CA  1 
ATOM   778  C  C   . VAL A 1 103 ? 2.655  13.073  50.138  1.00 21.07 ? 210  VAL A C   1 
ATOM   779  O  O   . VAL A 1 103 ? 2.955  14.178  49.666  1.00 20.03 ? 210  VAL A O   1 
ATOM   780  C  CB  . VAL A 1 103 ? 1.783  11.654  48.227  1.00 20.79 ? 210  VAL A CB  1 
ATOM   781  C  CG1 . VAL A 1 103 ? 3.009  10.735  48.319  1.00 24.54 ? 210  VAL A CG1 1 
ATOM   782  C  CG2 . VAL A 1 103 ? 0.584  10.883  47.692  1.00 23.15 ? 210  VAL A CG2 1 
ATOM   783  N  N   . CYS A 1 104 ? 3.309  12.497  51.143  1.00 21.38 ? 211  CYS A N   1 
ATOM   784  C  CA  . CYS A 1 104 ? 4.549  13.027  51.718  1.00 20.71 ? 211  CYS A CA  1 
ATOM   785  C  C   . CYS A 1 104 ? 4.480  14.536  52.014  1.00 24.71 ? 211  CYS A C   1 
ATOM   786  O  O   . CYS A 1 104 ? 3.554  14.995  52.685  1.00 24.60 ? 211  CYS A O   1 
ATOM   787  C  CB  . CYS A 1 104 ? 5.731  12.723  50.792  1.00 21.60 ? 211  CYS A CB  1 
ATOM   788  S  SG  . CYS A 1 104 ? 7.356  12.606  51.621  1.00 34.04 ? 211  CYS A SG  1 
ATOM   789  N  N   . GLY A 1 105 ? 5.462  15.288  51.517  1.00 19.23 ? 212  GLY A N   1 
ATOM   790  C  CA  . GLY A 1 105 ? 5.515  16.734  51.694  1.00 13.96 ? 212  GLY A CA  1 
ATOM   791  C  C   . GLY A 1 105 ? 5.466  17.496  50.381  1.00 16.08 ? 212  GLY A C   1 
ATOM   792  O  O   . GLY A 1 105 ? 4.781  17.079  49.449  1.00 18.66 ? 212  GLY A O   1 
ATOM   793  N  N   . VAL A 1 106 ? 6.172  18.626  50.309  1.00 14.42 ? 213  VAL A N   1 
ATOM   794  C  CA  . VAL A 1 106 ? 6.216  19.428  49.093  1.00 15.24 ? 213  VAL A CA  1 
ATOM   795  C  C   . VAL A 1 106 ? 7.637  19.867  48.776  1.00 14.58 ? 213  VAL A C   1 
ATOM   796  O  O   . VAL A 1 106 ? 8.481  19.961  49.657  1.00 19.81 ? 213  VAL A O   1 
ATOM   797  C  CB  . VAL A 1 106 ? 5.344  20.706  49.184  1.00 19.60 ? 213  VAL A CB  1 
ATOM   798  C  CG1 . VAL A 1 106 ? 3.925  20.363  49.600  1.00 20.24 ? 213  VAL A CG1 1 
ATOM   799  C  CG2 . VAL A 1 106 ? 5.980  21.737  50.154  1.00 18.47 ? 213  VAL A CG2 1 
ATOM   800  N  N   . GLY A 1 107 ? 7.895  20.134  47.506  1.00 16.07 ? 214  GLY A N   1 
ATOM   801  C  CA  . GLY A 1 107 ? 9.179  20.668  47.104  1.00 15.19 ? 214  GLY A CA  1 
ATOM   802  C  C   . GLY A 1 107 ? 9.158  22.178  47.274  1.00 15.21 ? 214  GLY A C   1 
ATOM   803  O  O   . GLY A 1 107 ? 8.089  22.783  47.337  1.00 13.94 ? 214  GLY A O   1 
ATOM   804  N  N   . VAL A 1 108 ? 10.338 22.782  47.355  1.00 15.92 ? 215  VAL A N   1 
ATOM   805  C  CA  . VAL A 1 108 ? 10.446 24.233  47.423  1.00 15.82 ? 215  VAL A CA  1 
ATOM   806  C  C   . VAL A 1 108 ? 9.792  24.873  46.202  1.00 17.16 ? 215  VAL A C   1 
ATOM   807  O  O   . VAL A 1 108 ? 9.059  25.856  46.322  1.00 14.52 ? 215  VAL A O   1 
ATOM   808  C  CB  . VAL A 1 108 ? 11.908 24.671  47.518  1.00 13.31 ? 215  VAL A CB  1 
ATOM   809  C  CG1 . VAL A 1 108 ? 12.037 26.174  47.332  1.00 12.91 ? 215  VAL A CG1 1 
ATOM   810  C  CG2 . VAL A 1 108 ? 12.482 24.236  48.838  1.00 15.56 ? 215  VAL A CG2 1 
ATOM   811  N  N   . ALA A 1 109 ? 10.039 24.284  45.033  1.00 15.81 ? 216  ALA A N   1 
ATOM   812  C  CA  . ALA A 1 109 ? 9.430  24.737  43.784  1.00 13.55 ? 216  ALA A CA  1 
ATOM   813  C  C   . ALA A 1 109 ? 8.473  23.662  43.274  1.00 16.21 ? 216  ALA A C   1 
ATOM   814  O  O   . ALA A 1 109 ? 8.738  22.979  42.282  1.00 15.56 ? 216  ALA A O   1 
ATOM   815  C  CB  . ALA A 1 109 ? 10.500 25.058  42.748  1.00 10.70 ? 216  ALA A CB  1 
ATOM   816  N  N   . TYR A 1 110 ? 7.352  23.508  43.969  1.00 15.80 ? 217  TYR A N   1 
ATOM   817  C  CA  . TYR A 1 110 ? 6.483  22.379  43.710  1.00 13.45 ? 217  TYR A CA  1 
ATOM   818  C  C   . TYR A 1 110 ? 5.706  22.441  42.386  1.00 16.02 ? 217  TYR A C   1 
ATOM   819  O  O   . TYR A 1 110 ? 5.003  21.488  42.045  1.00 16.85 ? 217  TYR A O   1 
ATOM   820  C  CB  . TYR A 1 110 ? 5.534  22.182  44.891  1.00 17.08 ? 217  TYR A CB  1 
ATOM   821  C  CG  . TYR A 1 110 ? 4.657  23.351  45.261  1.00 16.83 ? 217  TYR A CG  1 
ATOM   822  C  CD1 . TYR A 1 110 ? 3.585  23.731  44.459  1.00 14.84 ? 217  TYR A CD1 1 
ATOM   823  C  CD2 . TYR A 1 110 ? 4.858  24.029  46.454  1.00 18.33 ? 217  TYR A CD2 1 
ATOM   824  C  CE1 . TYR A 1 110 ? 2.756  24.790  44.825  1.00 20.92 ? 217  TYR A CE1 1 
ATOM   825  C  CE2 . TYR A 1 110 ? 4.043  25.073  46.831  1.00 21.68 ? 217  TYR A CE2 1 
ATOM   826  C  CZ  . TYR A 1 110 ? 2.997  25.455  46.020  1.00 23.91 ? 217  TYR A CZ  1 
ATOM   827  O  OH  . TYR A 1 110 ? 2.201  26.501  46.418  1.00 25.72 ? 217  TYR A OH  1 
ATOM   828  N  N   . ASN A 1 111 ? 5.834  23.534  41.634  1.00 16.73 ? 218  ASN A N   1 
ATOM   829  C  CA  . ASN A 1 111 ? 5.298  23.565  40.264  1.00 17.17 ? 218  ASN A CA  1 
ATOM   830  C  C   . ASN A 1 111 ? 6.380  23.556  39.179  1.00 16.70 ? 218  ASN A C   1 
ATOM   831  O  O   . ASN A 1 111 ? 6.084  23.711  37.985  1.00 22.21 ? 218  ASN A O   1 
ATOM   832  C  CB  . ASN A 1 111 ? 4.400  24.782  40.055  1.00 18.37 ? 218  ASN A CB  1 
ATOM   833  C  CG  . ASN A 1 111 ? 3.024  24.593  40.644  1.00 20.03 ? 218  ASN A CG  1 
ATOM   834  O  OD1 . ASN A 1 111 ? 2.417  23.534  40.507  1.00 22.67 ? 218  ASN A OD1 1 
ATOM   835  N  ND2 . ASN A 1 111 ? 2.521  25.628  41.309  1.00 27.32 ? 218  ASN A ND2 1 
ATOM   836  N  N   . ALA A 1 112 ? 7.626  23.386  39.594  1.00 13.88 ? 219  ALA A N   1 
ATOM   837  C  CA  . ALA A 1 112 ? 8.732  23.266  38.660  1.00 14.90 ? 219  ALA A CA  1 
ATOM   838  C  C   . ALA A 1 112 ? 8.683  21.880  38.019  1.00 16.26 ? 219  ALA A C   1 
ATOM   839  O  O   . ALA A 1 112 ? 8.005  20.984  38.522  1.00 18.74 ? 219  ALA A O   1 
ATOM   840  C  CB  . ALA A 1 112 ? 10.063 23.474  39.376  1.00 13.84 ? 219  ALA A CB  1 
ATOM   841  N  N   . ARG A 1 113 ? 9.410  21.691  36.929  1.00 13.35 ? 220  ARG A N   1 
ATOM   842  C  CA  . ARG A 1 113 ? 9.565  20.356  36.375  1.00 12.93 ? 220  ARG A CA  1 
ATOM   843  C  C   . ARG A 1 113 ? 10.941 19.827  36.784  1.00 18.34 ? 220  ARG A C   1 
ATOM   844  O  O   . ARG A 1 113 ? 11.899 20.591  36.869  1.00 13.29 ? 220  ARG A O   1 
ATOM   845  C  CB  . ARG A 1 113 ? 9.387  20.374  34.868  1.00 17.16 ? 220  ARG A CB  1 
ATOM   846  C  CG  . ARG A 1 113 ? 7.923  20.511  34.446  1.00 29.09 ? 220  ARG A CG  1 
ATOM   847  C  CD  . ARG A 1 113 ? 7.808  20.571  32.940  1.00 38.44 ? 220  ARG A CD  1 
ATOM   848  N  NE  . ARG A 1 113 ? 8.242  21.874  32.434  1.00 45.41 ? 220  ARG A NE  1 
ATOM   849  C  CZ  . ARG A 1 113 ? 8.713  22.089  31.208  1.00 41.20 ? 220  ARG A CZ  1 
ATOM   850  N  NH1 . ARG A 1 113 ? 8.837  21.075  30.346  1.00 36.48 ? 220  ARG A NH1 1 
ATOM   851  N  NH2 . ARG A 1 113 ? 9.067  23.320  30.850  1.00 27.01 ? 220  ARG A NH2 1 
ATOM   852  N  N   . ILE A 1 114 ? 11.023 18.526  37.052  1.00 13.10 ? 221  ILE A N   1 
ATOM   853  C  CA  . ILE A 1 114 ? 12.214 17.963  37.655  1.00 14.11 ? 221  ILE A CA  1 
ATOM   854  C  C   . ILE A 1 114 ? 12.707 16.807  36.817  1.00 14.20 ? 221  ILE A C   1 
ATOM   855  O  O   . ILE A 1 114 ? 11.923 15.978  36.352  1.00 16.57 ? 221  ILE A O   1 
ATOM   856  C  CB  . ILE A 1 114 ? 11.957 17.504  39.128  1.00 14.18 ? 221  ILE A CB  1 
ATOM   857  C  CG1 . ILE A 1 114 ? 13.259 17.098  39.831  1.00 15.57 ? 221  ILE A CG1 1 
ATOM   858  C  CG2 . ILE A 1 114 ? 10.912 16.384  39.211  1.00 13.34 ? 221  ILE A CG2 1 
ATOM   859  C  CD1 . ILE A 1 114 ? 14.175 18.263  40.166  1.00 12.23 ? 221  ILE A CD1 1 
ATOM   860  N  N   . GLY A 1 115 ? 14.015 16.778  36.605  1.00 14.89 ? 222  GLY A N   1 
ATOM   861  C  CA  . GLY A 1 115 ? 14.645 15.697  35.886  1.00 13.74 ? 222  GLY A CA  1 
ATOM   862  C  C   . GLY A 1 115 ? 15.754 15.087  36.718  1.00 18.25 ? 222  GLY A C   1 
ATOM   863  O  O   . GLY A 1 115 ? 16.114 15.605  37.784  1.00 12.90 ? 222  GLY A O   1 
ATOM   864  N  N   . GLY A 1 116 ? 16.295 13.971  36.242  1.00 14.52 ? 223  GLY A N   1 
ATOM   865  C  CA  . GLY A 1 116 ? 17.447 13.385  36.892  1.00 13.60 ? 223  GLY A CA  1 
ATOM   866  C  C   . GLY A 1 116 ? 18.413 12.880  35.842  1.00 16.97 ? 223  GLY A C   1 
ATOM   867  O  O   . GLY A 1 116 ? 17.991 12.357  34.814  1.00 11.53 ? 223  GLY A O   1 
ATOM   868  N  N   . VAL A 1 117 ? 19.709 13.064  36.089  1.00 12.86 ? 224  VAL A N   1 
ATOM   869  C  CA  . VAL A 1 117 ? 20.728 12.428  35.263  1.00 15.97 ? 224  VAL A CA  1 
ATOM   870  C  C   . VAL A 1 117 ? 21.387 11.310  36.061  1.00 15.55 ? 224  VAL A C   1 
ATOM   871  O  O   . VAL A 1 117 ? 22.039 11.572  37.066  1.00 11.84 ? 224  VAL A O   1 
ATOM   872  C  CB  . VAL A 1 117 ? 21.791 13.429  34.800  1.00 13.66 ? 224  VAL A CB  1 
ATOM   873  C  CG1 . VAL A 1 117 ? 22.842 12.749  33.948  1.00 12.85 ? 224  VAL A CG1 1 
ATOM   874  C  CG2 . VAL A 1 117 ? 21.121 14.569  34.056  1.00 16.51 ? 224  VAL A CG2 1 
ATOM   875  N  N   . ARG A 1 118 ? 21.196 10.066  35.629  1.00 11.60 ? 225  ARG A N   1 
ATOM   876  C  CA  . ARG A 1 118 ? 21.850 8.945   36.296  1.00 12.35 ? 225  ARG A CA  1 
ATOM   877  C  C   . ARG A 1 118 ? 23.301 8.901   35.832  1.00 13.76 ? 225  ARG A C   1 
ATOM   878  O  O   . ARG A 1 118 ? 23.579 8.507   34.700  1.00 13.41 ? 225  ARG A O   1 
ATOM   879  C  CB  . ARG A 1 118 ? 21.116 7.623   35.994  1.00 12.33 ? 225  ARG A CB  1 
ATOM   880  C  CG  . ARG A 1 118 ? 21.701 6.371   36.658  1.00 11.70 ? 225  ARG A CG  1 
ATOM   881  C  CD  . ARG A 1 118 ? 20.805 5.124   36.470  1.00 16.39 ? 225  ARG A CD  1 
ATOM   882  N  NE  . ARG A 1 118 ? 21.443 3.927   37.023  1.00 15.66 ? 225  ARG A NE  1 
ATOM   883  C  CZ  . ARG A 1 118 ? 22.042 2.973   36.301  1.00 18.11 ? 225  ARG A CZ  1 
ATOM   884  N  NH1 . ARG A 1 118 ? 22.629 1.952   36.918  1.00 14.72 ? 225  ARG A NH1 1 
ATOM   885  N  NH2 . ARG A 1 118 ? 22.058 3.030   34.970  1.00 14.19 ? 225  ARG A NH2 1 
ATOM   886  N  N   . MET A 1 119 ? 24.230 9.296   36.704  1.00 12.94 ? 226  MET A N   1 
ATOM   887  C  CA  . MET A 1 119 ? 25.640 9.346   36.320  1.00 12.57 ? 226  MET A CA  1 
ATOM   888  C  C   . MET A 1 119 ? 26.635 8.894   37.410  1.00 14.90 ? 226  MET A C   1 
ATOM   889  O  O   . MET A 1 119 ? 27.826 8.763   37.128  1.00 14.58 ? 226  MET A O   1 
ATOM   890  C  CB  . MET A 1 119 ? 26.015 10.769  35.832  1.00 13.76 ? 226  MET A CB  1 
ATOM   891  C  CG  . MET A 1 119 ? 25.515 11.929  36.674  1.00 16.34 ? 226  MET A CG  1 
ATOM   892  S  SD  . MET A 1 119 ? 26.503 12.316  38.142  1.00 19.45 ? 226  MET A SD  1 
ATOM   893  C  CE  . MET A 1 119 ? 28.181 12.516  37.484  1.00 14.39 ? 226  MET A CE  1 
ATOM   894  N  N   . LEU A 1 120 ? 26.173 8.648   38.633  1.00 12.83 ? 227  LEU A N   1 
ATOM   895  C  CA  . LEU A 1 120 ? 27.097 8.171   39.679  1.00 14.28 ? 227  LEU A CA  1 
ATOM   896  C  C   . LEU A 1 120 ? 27.168 6.639   39.758  1.00 15.83 ? 227  LEU A C   1 
ATOM   897  O  O   . LEU A 1 120 ? 28.110 6.084   40.321  1.00 18.39 ? 227  LEU A O   1 
ATOM   898  C  CB  . LEU A 1 120 ? 26.712 8.741   41.044  1.00 10.45 ? 227  LEU A CB  1 
ATOM   899  C  CG  . LEU A 1 120 ? 26.865 10.264  41.160  1.00 14.40 ? 227  LEU A CG  1 
ATOM   900  C  CD1 . LEU A 1 120 ? 26.538 10.716  42.574  1.00 13.50 ? 227  LEU A CD1 1 
ATOM   901  C  CD2 . LEU A 1 120 ? 28.284 10.665  40.787  1.00 14.51 ? 227  LEU A CD2 1 
ATOM   902  N  N   . ASP A 1 121 ? 26.183 5.963   39.179  1.00 16.10 ? 228  ASP A N   1 
ATOM   903  C  CA  . ASP A 1 121 ? 26.093 4.510   39.262  1.00 14.16 ? 228  ASP A CA  1 
ATOM   904  C  C   . ASP A 1 121 ? 26.808 3.839   38.091  1.00 18.47 ? 228  ASP A C   1 
ATOM   905  O  O   . ASP A 1 121 ? 26.201 3.083   37.335  1.00 20.12 ? 228  ASP A O   1 
ATOM   906  C  CB  . ASP A 1 121 ? 24.623 4.081   39.303  1.00 14.66 ? 228  ASP A CB  1 
ATOM   907  C  CG  . ASP A 1 121 ? 24.434 2.640   39.767  1.00 20.68 ? 228  ASP A CG  1 
ATOM   908  O  OD1 . ASP A 1 121 ? 25.421 2.019   40.218  1.00 22.47 ? 228  ASP A OD1 1 
ATOM   909  O  OD2 . ASP A 1 121 ? 23.290 2.138   39.694  1.00 15.49 ? 228  ASP A OD2 1 
ATOM   910  N  N   . GLY A 1 122 ? 28.096 4.129   37.954  1.00 17.18 ? 229  GLY A N   1 
ATOM   911  C  CA  . GLY A 1 122 ? 28.946 3.572   36.908  1.00 14.13 ? 229  GLY A CA  1 
ATOM   912  C  C   . GLY A 1 122 ? 30.293 4.232   37.092  1.00 17.08 ? 229  GLY A C   1 
ATOM   913  O  O   . GLY A 1 122 ? 30.434 5.046   37.993  1.00 16.80 ? 229  GLY A O   1 
ATOM   914  N  N   . GLU A 1 123 ? 31.283 3.911   36.264  1.00 16.40 ? 230  GLU A N   1 
ATOM   915  C  CA  . GLU A 1 123 ? 32.528 4.672   36.307  1.00 19.87 ? 230  GLU A CA  1 
ATOM   916  C  C   . GLU A 1 123 ? 32.276 6.155   36.055  1.00 20.91 ? 230  GLU A C   1 
ATOM   917  O  O   . GLU A 1 123 ? 31.730 6.520   35.009  1.00 17.09 ? 230  GLU A O   1 
ATOM   918  C  CB  . GLU A 1 123 ? 33.517 4.165   35.275  1.00 21.34 ? 230  GLU A CB  1 
ATOM   919  C  CG  . GLU A 1 123 ? 34.089 2.815   35.564  1.00 25.98 ? 230  GLU A CG  1 
ATOM   920  C  CD  . GLU A 1 123 ? 35.310 2.554   34.728  1.00 29.77 ? 230  GLU A CD  1 
ATOM   921  O  OE1 . GLU A 1 123 ? 35.144 2.063   33.598  1.00 34.83 ? 230  GLU A OE1 1 
ATOM   922  O  OE2 . GLU A 1 123 ? 36.430 2.858   35.195  1.00 40.03 ? 230  GLU A OE2 1 
ATOM   923  N  N   . VAL A 1 124 ? 32.667 7.005   37.001  1.00 17.06 ? 231  VAL A N   1 
ATOM   924  C  CA  . VAL A 1 124 ? 32.454 8.436   36.842  1.00 15.26 ? 231  VAL A CA  1 
ATOM   925  C  C   . VAL A 1 124 ? 33.695 9.063   36.200  1.00 21.25 ? 231  VAL A C   1 
ATOM   926  O  O   . VAL A 1 124 ? 34.547 9.660   36.865  1.00 18.96 ? 231  VAL A O   1 
ATOM   927  C  CB  . VAL A 1 124 ? 32.116 9.104   38.187  1.00 16.43 ? 231  VAL A CB  1 
ATOM   928  C  CG1 . VAL A 1 124 ? 31.650 10.537  37.971  1.00 13.26 ? 231  VAL A CG1 1 
ATOM   929  C  CG2 . VAL A 1 124 ? 31.019 8.307   38.902  1.00 15.92 ? 231  VAL A CG2 1 
ATOM   930  N  N   . THR A 1 125 ? 33.793 8.891   34.888  1.00 17.71 ? 232  THR A N   1 
ATOM   931  C  CA  . THR A 1 125 ? 34.916 9.404   34.125  1.00 14.83 ? 232  THR A CA  1 
ATOM   932  C  C   . THR A 1 125 ? 34.720 10.884  33.852  1.00 16.07 ? 232  THR A C   1 
ATOM   933  O  O   . THR A 1 125 ? 33.661 11.432  34.122  1.00 15.30 ? 232  THR A O   1 
ATOM   934  C  CB  . THR A 1 125 ? 35.083 8.651   32.790  1.00 20.08 ? 232  THR A CB  1 
ATOM   935  O  OG1 . THR A 1 125 ? 33.952 8.912   31.951  1.00 17.61 ? 232  THR A OG1 1 
ATOM   936  C  CG2 . THR A 1 125 ? 35.178 7.131   33.049  1.00 18.90 ? 232  THR A CG2 1 
ATOM   937  N  N   . ASP A 1 126 ? 35.748 11.520  33.309  1.00 17.16 ? 233  ASP A N   1 
ATOM   938  C  CA  . ASP A 1 126 ? 35.667 12.918  32.905  1.00 15.21 ? 233  ASP A CA  1 
ATOM   939  C  C   . ASP A 1 126 ? 34.551 13.127  31.866  1.00 19.01 ? 233  ASP A C   1 
ATOM   940  O  O   . ASP A 1 126 ? 33.821 14.119  31.927  1.00 16.09 ? 233  ASP A O   1 
ATOM   941  C  CB  . ASP A 1 126 ? 37.022 13.374  32.366  1.00 18.89 ? 233  ASP A CB  1 
ATOM   942  C  CG  . ASP A 1 126 ? 37.068 14.853  32.050  1.00 20.15 ? 233  ASP A CG  1 
ATOM   943  O  OD1 . ASP A 1 126 ? 36.352 15.646  32.704  1.00 18.45 ? 233  ASP A OD1 1 
ATOM   944  O  OD2 . ASP A 1 126 ? 37.837 15.218  31.137  1.00 23.52 ? 233  ASP A OD2 1 
ATOM   945  N  N   . ALA A 1 127 ? 34.403 12.184  30.931  1.00 17.14 ? 234  ALA A N   1 
ATOM   946  C  CA  . ALA A 1 127 ? 33.370 12.283  29.890  1.00 15.17 ? 234  ALA A CA  1 
ATOM   947  C  C   . ALA A 1 127 ? 31.958 12.138  30.454  1.00 12.92 ? 234  ALA A C   1 
ATOM   948  O  O   . ALA A 1 127 ? 31.030 12.787  29.978  1.00 16.20 ? 234  ALA A O   1 
ATOM   949  C  CB  . ALA A 1 127 ? 33.603 11.233  28.806  1.00 16.53 ? 234  ALA A CB  1 
ATOM   950  N  N   . VAL A 1 128 ? 31.800 11.261  31.438  1.00 10.11 ? 235  VAL A N   1 
ATOM   951  C  CA  . VAL A 1 128 ? 30.525 11.049  32.116  1.00 14.67 ? 235  VAL A CA  1 
ATOM   952  C  C   . VAL A 1 128 ? 30.092 12.346  32.810  1.00 15.73 ? 235  VAL A C   1 
ATOM   953  O  O   . VAL A 1 128 ? 28.937 12.775  32.692  1.00 13.71 ? 235  VAL A O   1 
ATOM   954  C  CB  . VAL A 1 128 ? 30.621 9.871   33.126  1.00 15.61 ? 235  VAL A CB  1 
ATOM   955  C  CG1 . VAL A 1 128 ? 29.450 9.869   34.099  1.00 14.16 ? 235  VAL A CG1 1 
ATOM   956  C  CG2 . VAL A 1 128 ? 30.717 8.513   32.373  1.00 17.85 ? 235  VAL A CG2 1 
ATOM   957  N  N   . GLU A 1 129 ? 31.026 12.990  33.507  1.00 13.06 ? 236  GLU A N   1 
ATOM   958  C  CA  . GLU A 1 129 ? 30.720 14.263  34.163  1.00 12.44 ? 236  GLU A CA  1 
ATOM   959  C  C   . GLU A 1 129 ? 30.331 15.333  33.149  1.00 14.58 ? 236  GLU A C   1 
ATOM   960  O  O   . GLU A 1 129 ? 29.380 16.080  33.359  1.00 14.64 ? 236  GLU A O   1 
ATOM   961  C  CB  . GLU A 1 129 ? 31.919 14.734  35.000  1.00 12.30 ? 236  GLU A CB  1 
ATOM   962  C  CG  . GLU A 1 129 ? 32.185 13.844  36.234  1.00 14.24 ? 236  GLU A CG  1 
ATOM   963  C  CD  . GLU A 1 129 ? 33.291 14.402  37.120  1.00 16.15 ? 236  GLU A CD  1 
ATOM   964  O  OE1 . GLU A 1 129 ? 33.785 15.514  36.822  1.00 14.94 ? 236  GLU A OE1 1 
ATOM   965  O  OE2 . GLU A 1 129 ? 33.661 13.734  38.109  1.00 15.54 ? 236  GLU A OE2 1 
ATOM   966  N  N   . ALA A 1 130 ? 31.077 15.413  32.054  1.00 14.31 ? 237  ALA A N   1 
ATOM   967  C  CA  . ALA A 1 130 ? 30.832 16.428  31.040  1.00 15.11 ? 237  ALA A CA  1 
ATOM   968  C  C   . ALA A 1 130 ? 29.472 16.247  30.361  1.00 13.54 ? 237  ALA A C   1 
ATOM   969  O  O   . ALA A 1 130 ? 28.772 17.222  30.098  1.00 14.35 ? 237  ALA A O   1 
ATOM   970  C  CB  . ALA A 1 130 ? 31.963 16.421  29.995  1.00 15.86 ? 237  ALA A CB  1 
ATOM   971  N  N   . ARG A 1 131 ? 29.095 15.000  30.096  1.00 13.40 ? 238  ARG A N   1 
ATOM   972  C  CA  . ARG A 1 131 ? 27.809 14.707  29.473  1.00 16.61 ? 238  ARG A CA  1 
ATOM   973  C  C   . ARG A 1 131 ? 26.650 15.038  30.413  1.00 15.27 ? 238  ARG A C   1 
ATOM   974  O  O   . ARG A 1 131 ? 25.561 15.372  29.966  1.00 13.88 ? 238  ARG A O   1 
ATOM   975  C  CB  . ARG A 1 131 ? 27.729 13.237  29.047  1.00 19.78 ? 238  ARG A CB  1 
ATOM   976  C  CG  . ARG A 1 131 ? 28.646 12.897  27.866  1.00 32.32 ? 238  ARG A CG  1 
ATOM   977  C  CD  . ARG A 1 131 ? 28.187 13.579  26.587  0.00 29.23 ? 238  ARG A CD  1 
ATOM   978  N  NE  . ARG A 1 131 ? 29.294 13.813  25.664  0.00 41.27 ? 238  ARG A NE  1 
ATOM   979  C  CZ  . ARG A 1 131 ? 29.149 14.269  24.424  0.00 32.23 ? 238  ARG A CZ  1 
ATOM   980  N  NH1 . ARG A 1 131 ? 30.213 14.457  23.656  0.00 27.17 ? 238  ARG A NH1 1 
ATOM   981  N  NH2 . ARG A 1 131 ? 27.939 14.533  23.949  0.00 28.14 ? 238  ARG A NH2 1 
ATOM   982  N  N   . SER A 1 132 ? 26.891 14.972  31.716  1.00 11.80 ? 239  SER A N   1 
ATOM   983  C  CA  . SER A 1 132 ? 25.843 15.288  32.673  1.00 13.59 ? 239  SER A CA  1 
ATOM   984  C  C   . SER A 1 132 ? 25.661 16.801  32.838  1.00 12.45 ? 239  SER A C   1 
ATOM   985  O  O   . SER A 1 132 ? 24.549 17.313  32.748  1.00 14.30 ? 239  SER A O   1 
ATOM   986  C  CB  . SER A 1 132 ? 26.153 14.619  34.016  1.00 12.86 ? 239  SER A CB  1 
ATOM   987  O  OG  . SER A 1 132 ? 26.480 13.256  33.778  1.00 17.45 ? 239  SER A OG  1 
ATOM   988  N  N   . LEU A 1 133 ? 26.770 17.497  33.056  1.00 13.24 ? 240  LEU A N   1 
ATOM   989  C  CA  . LEU A 1 133 ? 26.789 18.952  33.231  1.00 12.98 ? 240  LEU A CA  1 
ATOM   990  C  C   . LEU A 1 133 ? 26.296 19.689  32.003  1.00 14.93 ? 240  LEU A C   1 
ATOM   991  O  O   . LEU A 1 133 ? 25.771 20.805  32.104  1.00 13.63 ? 240  LEU A O   1 
ATOM   992  C  CB  . LEU A 1 133 ? 28.206 19.419  33.567  1.00 10.10 ? 240  LEU A CB  1 
ATOM   993  C  CG  . LEU A 1 133 ? 28.730 18.971  34.930  1.00 16.48 ? 240  LEU A CG  1 
ATOM   994  C  CD1 . LEU A 1 133 ? 30.230 19.296  35.084  1.00 14.00 ? 240  LEU A CD1 1 
ATOM   995  C  CD2 . LEU A 1 133 ? 27.892 19.627  36.022  1.00 13.43 ? 240  LEU A CD2 1 
ATOM   996  N  N   . GLY A 1 134 ? 26.488 19.060  30.845  1.00 13.67 ? 241  GLY A N   1 
ATOM   997  C  CA  . GLY A 1 134 ? 26.177 19.670  29.569  1.00 14.16 ? 241  GLY A CA  1 
ATOM   998  C  C   . GLY A 1 134 ? 24.843 19.250  28.961  1.00 15.22 ? 241  GLY A C   1 
ATOM   999  O  O   . GLY A 1 134 ? 24.546 19.637  27.837  1.00 18.17 ? 241  GLY A O   1 
ATOM   1000 N  N   . LEU A 1 135 ? 24.030 18.494  29.697  1.00 12.36 ? 242  LEU A N   1 
ATOM   1001 C  CA  . LEU A 1 135 ? 22.776 17.958  29.148  1.00 14.33 ? 242  LEU A CA  1 
ATOM   1002 C  C   . LEU A 1 135 ? 21.721 19.026  28.817  1.00 13.05 ? 242  LEU A C   1 
ATOM   1003 O  O   . LEU A 1 135 ? 21.314 19.774  29.695  1.00 15.06 ? 242  LEU A O   1 
ATOM   1004 C  CB  . LEU A 1 135 ? 22.154 16.938  30.122  1.00 12.11 ? 242  LEU A CB  1 
ATOM   1005 C  CG  . LEU A 1 135 ? 20.804 16.382  29.644  1.00 13.91 ? 242  LEU A CG  1 
ATOM   1006 C  CD1 . LEU A 1 135 ? 21.023 15.602  28.356  1.00 13.35 ? 242  LEU A CD1 1 
ATOM   1007 C  CD2 . LEU A 1 135 ? 20.115 15.483  30.680  1.00 11.97 ? 242  LEU A CD2 1 
ATOM   1008 N  N   . ASN A 1 136 ? 21.277 19.069  27.558  1.00 12.27 ? 243  ASN A N   1 
ATOM   1009 C  CA  . ASN A 1 136 ? 20.102 19.860  27.134  1.00 13.76 ? 243  ASN A CA  1 
ATOM   1010 C  C   . ASN A 1 136 ? 20.017 21.268  27.745  1.00 12.52 ? 243  ASN A C   1 
ATOM   1011 O  O   . ASN A 1 136 ? 19.011 21.603  28.362  1.00 12.32 ? 243  ASN A O   1 
ATOM   1012 C  CB  . ASN A 1 136 ? 18.814 19.091  27.482  1.00 12.99 ? 243  ASN A CB  1 
ATOM   1013 C  CG  . ASN A 1 136 ? 17.661 19.411  26.549  1.00 28.14 ? 243  ASN A CG  1 
ATOM   1014 O  OD1 . ASN A 1 136 ? 17.827 20.097  25.551  1.00 23.57 ? 243  ASN A OD1 1 
ATOM   1015 N  ND2 . ASN A 1 136 ? 16.486 18.890  26.866  1.00 16.20 ? 243  ASN A ND2 1 
ATOM   1016 N  N   . PRO A 1 137 ? 21.074 22.078  27.575  1.00 14.20 ? 244  PRO A N   1 
ATOM   1017 C  CA  . PRO A 1 137 ? 21.231 23.319  28.344  1.00 14.45 ? 244  PRO A CA  1 
ATOM   1018 C  C   . PRO A 1 137 ? 20.320 24.470  27.920  1.00 15.77 ? 244  PRO A C   1 
ATOM   1019 O  O   . PRO A 1 137 ? 20.326 25.484  28.615  1.00 15.30 ? 244  PRO A O   1 
ATOM   1020 C  CB  . PRO A 1 137 ? 22.700 23.693  28.102  1.00 13.41 ? 244  PRO A CB  1 
ATOM   1021 C  CG  . PRO A 1 137 ? 22.974 23.187  26.744  1.00 15.42 ? 244  PRO A CG  1 
ATOM   1022 C  CD  . PRO A 1 137 ? 22.196 21.879  26.635  1.00 16.55 ? 244  PRO A CD  1 
ATOM   1023 N  N   . ASN A 1 138 ? 19.573 24.335  26.825  1.00 14.16 ? 245  ASN A N   1 
ATOM   1024 C  CA  . ASN A 1 138 ? 18.532 25.320  26.514  1.00 16.09 ? 245  ASN A CA  1 
ATOM   1025 C  C   . ASN A 1 138 ? 17.160 24.862  27.000  1.00 20.03 ? 245  ASN A C   1 
ATOM   1026 O  O   . ASN A 1 138 ? 16.149 25.528  26.747  1.00 18.87 ? 245  ASN A O   1 
ATOM   1027 C  CB  . ASN A 1 138 ? 18.477 25.622  25.011  1.00 14.68 ? 245  ASN A CB  1 
ATOM   1028 C  CG  . ASN A 1 138 ? 19.592 26.544  24.564  1.00 18.35 ? 245  ASN A CG  1 
ATOM   1029 O  OD1 . ASN A 1 138 ? 20.150 27.296  25.361  1.00 19.02 ? 245  ASN A OD1 1 
ATOM   1030 N  ND2 . ASN A 1 138 ? 19.926 26.487  23.286  1.00 29.17 ? 245  ASN A ND2 1 
ATOM   1031 N  N   . HIS A 1 139 ? 17.127 23.724  27.687  1.00 14.95 ? 246  HIS A N   1 
ATOM   1032 C  CA  . HIS A 1 139 ? 15.903 23.234  28.316  1.00 13.79 ? 246  HIS A CA  1 
ATOM   1033 C  C   . HIS A 1 139 ? 16.003 23.212  29.844  1.00 13.93 ? 246  HIS A C   1 
ATOM   1034 O  O   . HIS A 1 139 ? 15.141 23.740  30.552  1.00 14.08 ? 246  HIS A O   1 
ATOM   1035 C  CB  . HIS A 1 139 ? 15.563 21.831  27.807  1.00 16.04 ? 246  HIS A CB  1 
ATOM   1036 C  CG  . HIS A 1 139 ? 14.286 21.288  28.368  1.00 18.54 ? 246  HIS A CG  1 
ATOM   1037 N  ND1 . HIS A 1 139 ? 13.048 21.773  28.001  1.00 21.17 ? 246  HIS A ND1 1 
ATOM   1038 C  CD2 . HIS A 1 139 ? 14.054 20.319  29.284  1.00 16.88 ? 246  HIS A CD2 1 
ATOM   1039 C  CE1 . HIS A 1 139 ? 12.108 21.111  28.650  1.00 19.32 ? 246  HIS A CE1 1 
ATOM   1040 N  NE2 . HIS A 1 139 ? 12.691 20.224  29.438  1.00 19.35 ? 246  HIS A NE2 1 
ATOM   1041 N  N   . ILE A 1 140 ? 17.067 22.592  30.350  1.00 13.98 ? 247  ILE A N   1 
ATOM   1042 C  CA  . ILE A 1 140 ? 17.351 22.589  31.778  1.00 12.04 ? 247  ILE A CA  1 
ATOM   1043 C  C   . ILE A 1 140 ? 17.912 23.942  32.179  1.00 12.72 ? 247  ILE A C   1 
ATOM   1044 O  O   . ILE A 1 140 ? 18.889 24.396  31.591  1.00 13.64 ? 247  ILE A O   1 
ATOM   1045 C  CB  . ILE A 1 140 ? 18.360 21.459  32.145  1.00 12.78 ? 247  ILE A CB  1 
ATOM   1046 C  CG1 . ILE A 1 140 ? 17.797 20.094  31.724  1.00 13.00 ? 247  ILE A CG1 1 
ATOM   1047 C  CG2 . ILE A 1 140 ? 18.697 21.476  33.627  1.00 12.41 ? 247  ILE A CG2 1 
ATOM   1048 C  CD1 . ILE A 1 140 ? 18.822 18.951  31.767  1.00 8.79  ? 247  ILE A CD1 1 
ATOM   1049 N  N   . HIS A 1 141 ? 17.295 24.587  33.167  1.00 11.08 ? 248  HIS A N   1 
ATOM   1050 C  CA  . HIS A 1 141 ? 17.775 25.885  33.662  1.00 11.96 ? 248  HIS A CA  1 
ATOM   1051 C  C   . HIS A 1 141 ? 18.824 25.740  34.741  1.00 11.79 ? 248  HIS A C   1 
ATOM   1052 O  O   . HIS A 1 141 ? 19.823 26.455  34.741  1.00 11.69 ? 248  HIS A O   1 
ATOM   1053 C  CB  . HIS A 1 141 ? 16.614 26.720  34.226  1.00 11.42 ? 248  HIS A CB  1 
ATOM   1054 C  CG  . HIS A 1 141 ? 15.506 26.931  33.250  1.00 15.76 ? 248  HIS A CG  1 
ATOM   1055 N  ND1 . HIS A 1 141 ? 14.265 26.355  33.399  1.00 14.25 ? 248  HIS A ND1 1 
ATOM   1056 C  CD2 . HIS A 1 141 ? 15.462 27.624  32.088  1.00 21.45 ? 248  HIS A CD2 1 
ATOM   1057 C  CE1 . HIS A 1 141 ? 13.495 26.700  32.383  1.00 16.35 ? 248  HIS A CE1 1 
ATOM   1058 N  NE2 . HIS A 1 141 ? 14.197 27.472  31.574  1.00 17.25 ? 248  HIS A NE2 1 
ATOM   1059 N  N   . ILE A 1 142 ? 18.571 24.803  35.652  1.00 11.61 ? 249  ILE A N   1 
ATOM   1060 C  CA  . ILE A 1 142 ? 19.316 24.660  36.895  1.00 14.01 ? 249  ILE A CA  1 
ATOM   1061 C  C   . ILE A 1 142 ? 19.771 23.217  37.115  1.00 13.22 ? 249  ILE A C   1 
ATOM   1062 O  O   . ILE A 1 142 ? 18.974 22.290  37.006  1.00 11.92 ? 249  ILE A O   1 
ATOM   1063 C  CB  . ILE A 1 142 ? 18.454 25.097  38.108  1.00 12.81 ? 249  ILE A CB  1 
ATOM   1064 C  CG1 . ILE A 1 142 ? 18.033 26.577  37.988  1.00 13.37 ? 249  ILE A CG1 1 
ATOM   1065 C  CG2 . ILE A 1 142 ? 19.202 24.851  39.400  1.00 13.21 ? 249  ILE A CG2 1 
ATOM   1066 C  CD1 . ILE A 1 142 ? 16.814 26.936  38.837  1.00 10.09 ? 249  ILE A CD1 1 
ATOM   1067 N  N   . TYR A 1 143 ? 21.052 23.036  37.435  1.00 14.09 ? 250  TYR A N   1 
ATOM   1068 C  CA  . TYR A 1 143 ? 21.599 21.719  37.707  1.00 13.58 ? 250  TYR A CA  1 
ATOM   1069 C  C   . TYR A 1 143 ? 21.979 21.609  39.182  1.00 15.59 ? 250  TYR A C   1 
ATOM   1070 O  O   . TYR A 1 143 ? 22.680 22.471  39.716  1.00 12.62 ? 250  TYR A O   1 
ATOM   1071 C  CB  . TYR A 1 143 ? 22.838 21.428  36.829  1.00 12.52 ? 250  TYR A CB  1 
ATOM   1072 C  CG  . TYR A 1 143 ? 22.620 21.525  35.323  1.00 13.22 ? 250  TYR A CG  1 
ATOM   1073 C  CD1 . TYR A 1 143 ? 22.550 22.756  34.695  1.00 12.69 ? 250  TYR A CD1 1 
ATOM   1074 C  CD2 . TYR A 1 143 ? 22.511 20.387  34.537  1.00 13.19 ? 250  TYR A CD2 1 
ATOM   1075 C  CE1 . TYR A 1 143 ? 22.361 22.857  33.319  1.00 14.28 ? 250  TYR A CE1 1 
ATOM   1076 C  CE2 . TYR A 1 143 ? 22.333 20.473  33.169  1.00 11.93 ? 250  TYR A CE2 1 
ATOM   1077 C  CZ  . TYR A 1 143 ? 22.249 21.714  32.564  1.00 13.83 ? 250  TYR A CZ  1 
ATOM   1078 O  OH  . TYR A 1 143 ? 22.076 21.819  31.200  1.00 15.01 ? 250  TYR A OH  1 
ATOM   1079 N  N   . SER A 1 144 ? 21.532 20.541  39.832  1.00 11.49 ? 251  SER A N   1 
ATOM   1080 C  CA  . SER A 1 144 ? 21.825 20.346  41.250  1.00 13.63 ? 251  SER A CA  1 
ATOM   1081 C  C   . SER A 1 144 ? 22.738 19.136  41.427  1.00 13.30 ? 251  SER A C   1 
ATOM   1082 O  O   . SER A 1 144 ? 22.391 18.026  41.019  1.00 12.31 ? 251  SER A O   1 
ATOM   1083 C  CB  . SER A 1 144 ? 20.521 20.174  42.048  1.00 14.02 ? 251  SER A CB  1 
ATOM   1084 O  OG  . SER A 1 144 ? 20.768 20.147  43.441  1.00 15.96 ? 251  SER A OG  1 
ATOM   1085 N  N   . ALA A 1 145 ? 23.916 19.341  42.008  1.00 11.81 ? 252  ALA A N   1 
ATOM   1086 C  CA  . ALA A 1 145 ? 24.855 18.234  42.185  1.00 14.78 ? 252  ALA A CA  1 
ATOM   1087 C  C   . ALA A 1 145 ? 25.310 18.096  43.628  1.00 17.42 ? 252  ALA A C   1 
ATOM   1088 O  O   . ALA A 1 145 ? 26.001 18.965  44.157  1.00 13.83 ? 252  ALA A O   1 
ATOM   1089 C  CB  . ALA A 1 145 ? 26.073 18.410  41.269  1.00 12.16 ? 252  ALA A CB  1 
ATOM   1090 N  N   . SER A 1 146 ? 24.930 16.985  44.247  1.00 13.25 ? 253  SER A N   1 
ATOM   1091 C  CA  . SER A 1 146 ? 25.301 16.694  45.624  1.00 13.25 ? 253  SER A CA  1 
ATOM   1092 C  C   . SER A 1 146 ? 26.308 15.555  45.668  1.00 15.38 ? 253  SER A C   1 
ATOM   1093 O  O   . SER A 1 146 ? 26.015 14.474  46.183  1.00 17.80 ? 253  SER A O   1 
ATOM   1094 C  CB  . SER A 1 146 ? 24.070 16.332  46.447  1.00 16.68 ? 253  SER A CB  1 
ATOM   1095 O  OG  . SER A 1 146 ? 23.165 17.423  46.497  1.00 19.93 ? 253  SER A OG  1 
ATOM   1096 N  N   . TRP A 1 147 ? 27.479 15.799  45.100  1.00 15.42 ? 254  TRP A N   1 
ATOM   1097 C  CA  . TRP A 1 147 ? 28.552 14.813  45.065  1.00 15.72 ? 254  TRP A CA  1 
ATOM   1098 C  C   . TRP A 1 147 ? 29.847 15.545  44.809  1.00 16.45 ? 254  TRP A C   1 
ATOM   1099 O  O   . TRP A 1 147 ? 29.834 16.723  44.459  1.00 17.39 ? 254  TRP A O   1 
ATOM   1100 C  CB  . TRP A 1 147 ? 28.311 13.741  43.988  1.00 12.43 ? 254  TRP A CB  1 
ATOM   1101 C  CG  . TRP A 1 147 ? 27.996 14.276  42.619  1.00 14.79 ? 254  TRP A CG  1 
ATOM   1102 C  CD1 . TRP A 1 147 ? 26.749 14.478  42.089  1.00 14.77 ? 254  TRP A CD1 1 
ATOM   1103 C  CD2 . TRP A 1 147 ? 28.932 14.660  41.599  1.00 14.14 ? 254  TRP A CD2 1 
ATOM   1104 N  NE1 . TRP A 1 147 ? 26.854 14.958  40.810  1.00 15.34 ? 254  TRP A NE1 1 
ATOM   1105 C  CE2 . TRP A 1 147 ? 28.179 15.093  40.491  1.00 14.53 ? 254  TRP A CE2 1 
ATOM   1106 C  CE3 . TRP A 1 147 ? 30.329 14.683  41.519  1.00 14.74 ? 254  TRP A CE3 1 
ATOM   1107 C  CZ2 . TRP A 1 147 ? 28.777 15.547  39.318  1.00 11.00 ? 254  TRP A CZ2 1 
ATOM   1108 C  CZ3 . TRP A 1 147 ? 30.921 15.138  40.350  1.00 12.71 ? 254  TRP A CZ3 1 
ATOM   1109 C  CH2 . TRP A 1 147 ? 30.141 15.560  39.264  1.00 16.94 ? 254  TRP A CH2 1 
ATOM   1110 N  N   . GLY A 1 148 ? 30.968 14.859  44.983  1.00 12.08 ? 255  GLY A N   1 
ATOM   1111 C  CA  . GLY A 1 148 ? 32.261 15.478  44.748  1.00 13.55 ? 255  GLY A CA  1 
ATOM   1112 C  C   . GLY A 1 148 ? 33.398 14.541  45.094  1.00 12.10 ? 255  GLY A C   1 
ATOM   1113 O  O   . GLY A 1 148 ? 33.165 13.374  45.346  1.00 14.11 ? 255  GLY A O   1 
ATOM   1114 N  N   . PRO A 1 149 ? 34.637 15.055  45.098  1.00 14.52 ? 256  PRO A N   1 
ATOM   1115 C  CA  . PRO A 1 149 ? 35.799 14.260  45.521  1.00 13.71 ? 256  PRO A CA  1 
ATOM   1116 C  C   . PRO A 1 149 ? 35.611 13.723  46.936  1.00 15.38 ? 256  PRO A C   1 
ATOM   1117 O  O   . PRO A 1 149 ? 34.855 14.296  47.719  1.00 17.00 ? 256  PRO A O   1 
ATOM   1118 C  CB  . PRO A 1 149 ? 36.969 15.264  45.488  1.00 14.11 ? 256  PRO A CB  1 
ATOM   1119 C  CG  . PRO A 1 149 ? 36.507 16.394  44.648  1.00 14.32 ? 256  PRO A CG  1 
ATOM   1120 C  CD  . PRO A 1 149 ? 34.999 16.445  44.762  1.00 12.22 ? 256  PRO A CD  1 
ATOM   1121 N  N   . GLU A 1 150 ? 36.302 12.639  47.256  1.00 16.61 ? 257  GLU A N   1 
ATOM   1122 C  CA  . GLU A 1 150 ? 36.232 12.045  48.579  1.00 16.38 ? 257  GLU A CA  1 
ATOM   1123 C  C   . GLU A 1 150 ? 36.408 13.081  49.699  1.00 16.16 ? 257  GLU A C   1 
ATOM   1124 O  O   . GLU A 1 150 ? 37.300 13.923  49.653  1.00 16.56 ? 257  GLU A O   1 
ATOM   1125 C  CB  . GLU A 1 150 ? 37.283 10.951  48.713  1.00 18.10 ? 257  GLU A CB  1 
ATOM   1126 C  CG  . GLU A 1 150 ? 36.950 9.977   49.814  1.00 24.05 ? 257  GLU A CG  1 
ATOM   1127 C  CD  . GLU A 1 150 ? 37.926 8.822   49.895  1.00 25.93 ? 257  GLU A CD  1 
ATOM   1128 O  OE1 . GLU A 1 150 ? 38.709 8.624   48.939  1.00 29.44 ? 257  GLU A OE1 1 
ATOM   1129 O  OE2 . GLU A 1 150 ? 37.901 8.107   50.916  1.00 29.93 ? 257  GLU A OE2 1 
ATOM   1130 N  N   . ASP A 1 151 ? 35.522 13.026  50.680  1.00 16.09 ? 258  ASP A N   1 
ATOM   1131 C  CA  . ASP A 1 151 ? 35.560 13.949  51.807  1.00 18.36 ? 258  ASP A CA  1 
ATOM   1132 C  C   . ASP A 1 151 ? 36.399 13.406  52.987  1.00 17.34 ? 258  ASP A C   1 
ATOM   1133 O  O   . ASP A 1 151 ? 36.004 13.528  54.144  1.00 20.37 ? 258  ASP A O   1 
ATOM   1134 C  CB  . ASP A 1 151 ? 34.143 14.253  52.285  1.00 12.65 ? 258  ASP A CB  1 
ATOM   1135 C  CG  . ASP A 1 151 ? 33.348 15.114  51.307  1.00 15.17 ? 258  ASP A CG  1 
ATOM   1136 O  OD1 . ASP A 1 151 ? 33.917 16.005  50.642  1.00 13.80 ? 258  ASP A OD1 1 
ATOM   1137 O  OD2 . ASP A 1 151 ? 32.124 14.917  51.238  1.00 16.94 ? 258  ASP A OD2 1 
ATOM   1138 N  N   . ASP A 1 152 ? 37.554 12.822  52.695  1.00 18.39 ? 259  ASP A N   1 
ATOM   1139 C  CA  . ASP A 1 152 ? 38.364 12.210  53.762  1.00 20.52 ? 259  ASP A CA  1 
ATOM   1140 C  C   . ASP A 1 152 ? 39.320 13.201  54.438  1.00 18.05 ? 259  ASP A C   1 
ATOM   1141 O  O   . ASP A 1 152 ? 40.063 12.845  55.342  1.00 20.07 ? 259  ASP A O   1 
ATOM   1142 C  CB  . ASP A 1 152 ? 39.150 11.009  53.226  1.00 14.71 ? 259  ASP A CB  1 
ATOM   1143 C  CG  . ASP A 1 152 ? 39.958 11.333  51.962  1.00 25.31 ? 259  ASP A CG  1 
ATOM   1144 O  OD1 . ASP A 1 152 ? 40.065 12.523  51.577  1.00 19.09 ? 259  ASP A OD1 1 
ATOM   1145 O  OD2 . ASP A 1 152 ? 40.504 10.382  51.357  1.00 24.49 ? 259  ASP A OD2 1 
ATOM   1146 N  N   . GLY A 1 153 ? 39.295 14.446  53.997  1.00 16.94 ? 260  GLY A N   1 
ATOM   1147 C  CA  . GLY A 1 153 ? 40.180 15.445  54.554  1.00 20.58 ? 260  GLY A CA  1 
ATOM   1148 C  C   . GLY A 1 153 ? 41.608 15.360  54.049  1.00 15.62 ? 260  GLY A C   1 
ATOM   1149 O  O   . GLY A 1 153 ? 42.489 16.015  54.587  1.00 18.59 ? 260  GLY A O   1 
ATOM   1150 N  N   . LYS A 1 154 ? 41.860 14.561  53.020  1.00 15.17 ? 261  LYS A N   1 
ATOM   1151 C  CA  . LYS A 1 154 ? 43.209 14.547  52.473  1.00 15.08 ? 261  LYS A CA  1 
ATOM   1152 C  C   . LYS A 1 154 ? 43.268 14.582  50.952  1.00 15.88 ? 261  LYS A C   1 
ATOM   1153 O  O   . LYS A 1 154 ? 44.348 14.530  50.376  1.00 18.40 ? 261  LYS A O   1 
ATOM   1154 C  CB  . LYS A 1 154 ? 43.996 13.343  52.998  1.00 27.60 ? 261  LYS A CB  1 
ATOM   1155 C  CG  . LYS A 1 154 ? 43.259 12.038  53.103  1.00 20.29 ? 261  LYS A CG  1 
ATOM   1156 C  CD  . LYS A 1 154 ? 44.266 10.931  53.420  1.00 25.43 ? 261  LYS A CD  1 
ATOM   1157 C  CE  . LYS A 1 154 ? 43.608 9.584   53.586  1.00 35.90 ? 261  LYS A CE  1 
ATOM   1158 N  NZ  . LYS A 1 154 ? 43.013 9.417   54.932  1.00 35.53 ? 261  LYS A NZ  1 
ATOM   1159 N  N   . THR A 1 155 ? 42.119 14.740  50.305  1.00 17.69 ? 262  THR A N   1 
ATOM   1160 C  CA  . THR A 1 155 ? 42.066 14.744  48.848  1.00 16.26 ? 262  THR A CA  1 
ATOM   1161 C  C   . THR A 1 155 ? 42.136 16.170  48.292  1.00 17.01 ? 262  THR A C   1 
ATOM   1162 O  O   . THR A 1 155 ? 41.587 17.105  48.887  1.00 14.62 ? 262  THR A O   1 
ATOM   1163 C  CB  . THR A 1 155 ? 40.772 14.030  48.349  1.00 20.29 ? 262  THR A CB  1 
ATOM   1164 O  OG1 . THR A 1 155 ? 40.742 12.682  48.849  1.00 21.57 ? 262  THR A OG1 1 
ATOM   1165 C  CG2 . THR A 1 155 ? 40.700 13.993  46.828  1.00 17.78 ? 262  THR A CG2 1 
ATOM   1166 N  N   . VAL A 1 156 ? 42.850 16.340  47.179  1.00 15.41 ? 263  VAL A N   1 
ATOM   1167 C  CA  . VAL A 1 156 ? 42.739 17.551  46.361  1.00 14.55 ? 263  VAL A CA  1 
ATOM   1168 C  C   . VAL A 1 156 ? 42.406 17.139  44.937  1.00 20.60 ? 263  VAL A C   1 
ATOM   1169 O  O   . VAL A 1 156 ? 43.225 16.527  44.255  1.00 17.63 ? 263  VAL A O   1 
ATOM   1170 C  CB  . VAL A 1 156 ? 44.019 18.406  46.334  1.00 14.84 ? 263  VAL A CB  1 
ATOM   1171 C  CG1 . VAL A 1 156 ? 43.787 19.672  45.488  1.00 15.67 ? 263  VAL A CG1 1 
ATOM   1172 C  CG2 . VAL A 1 156 ? 44.452 18.778  47.743  1.00 15.88 ? 263  VAL A CG2 1 
ATOM   1173 N  N   . ASP A 1 157 ? 41.197 17.465  44.494  1.00 15.40 ? 264  ASP A N   1 
ATOM   1174 C  CA  . ASP A 1 157 ? 40.731 17.002  43.198  1.00 13.40 ? 264  ASP A CA  1 
ATOM   1175 C  C   . ASP A 1 157 ? 39.622 17.912  42.686  1.00 15.93 ? 264  ASP A C   1 
ATOM   1176 O  O   . ASP A 1 157 ? 38.914 18.538  43.468  1.00 14.45 ? 264  ASP A O   1 
ATOM   1177 C  CB  . ASP A 1 157 ? 40.246 15.558  43.297  1.00 17.09 ? 264  ASP A CB  1 
ATOM   1178 C  CG  . ASP A 1 157 ? 40.105 14.885  41.935  1.00 22.18 ? 264  ASP A CG  1 
ATOM   1179 O  OD1 . ASP A 1 157 ? 40.555 15.456  40.927  1.00 27.62 ? 264  ASP A OD1 1 
ATOM   1180 O  OD2 . ASP A 1 157 ? 39.565 13.761  41.879  1.00 26.93 ? 264  ASP A OD2 1 
ATOM   1181 N  N   . GLY A 1 158 ? 39.494 17.988  41.368  1.00 17.51 ? 265  GLY A N   1 
ATOM   1182 C  CA  . GLY A 1 158 ? 38.529 18.858  40.727  1.00 14.17 ? 265  GLY A CA  1 
ATOM   1183 C  C   . GLY A 1 158 ? 38.201 18.334  39.349  1.00 17.00 ? 265  GLY A C   1 
ATOM   1184 O  O   . GLY A 1 158 ? 38.690 17.272  38.969  1.00 17.55 ? 265  GLY A O   1 
ATOM   1185 N  N   . PRO A 1 159 ? 37.364 19.074  38.599  1.00 16.68 ? 266  PRO A N   1 
ATOM   1186 C  CA  . PRO A 1 159 ? 37.008 18.664  37.236  1.00 14.62 ? 266  PRO A CA  1 
ATOM   1187 C  C   . PRO A 1 159 ? 38.228 18.578  36.329  1.00 19.02 ? 266  PRO A C   1 
ATOM   1188 O  O   . PRO A 1 159 ? 39.076 19.477  36.325  1.00 16.38 ? 266  PRO A O   1 
ATOM   1189 C  CB  . PRO A 1 159 ? 36.048 19.771  36.759  1.00 14.35 ? 266  PRO A CB  1 
ATOM   1190 C  CG  . PRO A 1 159 ? 36.354 20.973  37.653  1.00 20.07 ? 266  PRO A CG  1 
ATOM   1191 C  CD  . PRO A 1 159 ? 36.736 20.351  38.988  1.00 13.63 ? 266  PRO A CD  1 
ATOM   1192 N  N   . ALA A 1 160 ? 38.316 17.488  35.578  1.00 16.12 ? 267  ALA A N   1 
ATOM   1193 C  CA  . ALA A 1 160 ? 39.289 17.393  34.507  1.00 15.46 ? 267  ALA A CA  1 
ATOM   1194 C  C   . ALA A 1 160 ? 38.813 18.197  33.278  1.00 22.84 ? 267  ALA A C   1 
ATOM   1195 O  O   . ALA A 1 160 ? 37.818 18.938  33.351  1.00 17.06 ? 267  ALA A O   1 
ATOM   1196 C  CB  . ALA A 1 160 ? 39.539 15.942  34.160  1.00 19.22 ? 267  ALA A CB  1 
ATOM   1197 N  N   . ARG A 1 161 ? 39.509 18.032  32.155  1.00 20.93 ? 268  ARG A N   1 
ATOM   1198 C  CA  . ARG A 1 161 ? 39.361 18.923  31.001  1.00 22.54 ? 268  ARG A CA  1 
ATOM   1199 C  C   . ARG A 1 161 ? 37.962 18.970  30.371  1.00 15.33 ? 268  ARG A C   1 
ATOM   1200 O  O   . ARG A 1 161 ? 37.458 20.051  30.077  1.00 16.78 ? 268  ARG A O   1 
ATOM   1201 C  CB  . ARG A 1 161 ? 40.381 18.544  29.920  1.00 25.92 ? 268  ARG A CB  1 
ATOM   1202 C  CG  . ARG A 1 161 ? 40.406 19.521  28.735  1.00 33.59 ? 268  ARG A CG  1 
ATOM   1203 C  CD  . ARG A 1 161 ? 41.467 19.119  27.695  1.00 32.77 ? 268  ARG A CD  1 
ATOM   1204 N  NE  . ARG A 1 161 ? 41.257 17.765  27.186  1.00 38.07 ? 268  ARG A NE  1 
ATOM   1205 C  CZ  . ARG A 1 161 ? 40.445 17.460  26.174  1.00 46.88 ? 268  ARG A CZ  1 
ATOM   1206 N  NH1 . ARG A 1 161 ? 39.767 18.417  25.554  1.00 48.92 ? 268  ARG A NH1 1 
ATOM   1207 N  NH2 . ARG A 1 161 ? 40.307 16.200  25.777  1.00 38.25 ? 268  ARG A NH2 1 
ATOM   1208 N  N   . LEU A 1 162 ? 37.340 17.812  30.156  1.00 17.93 ? 269  LEU A N   1 
ATOM   1209 C  CA  . LEU A 1 162 ? 36.011 17.789  29.537  1.00 14.44 ? 269  LEU A CA  1 
ATOM   1210 C  C   . LEU A 1 162 ? 34.941 18.413  30.447  1.00 17.97 ? 269  LEU A C   1 
ATOM   1211 O  O   . LEU A 1 162 ? 34.081 19.152  29.975  1.00 16.80 ? 269  LEU A O   1 
ATOM   1212 C  CB  . LEU A 1 162 ? 35.617 16.363  29.151  1.00 13.18 ? 269  LEU A CB  1 
ATOM   1213 C  CG  . LEU A 1 162 ? 36.500 15.712  28.078  1.00 21.43 ? 269  LEU A CG  1 
ATOM   1214 C  CD1 . LEU A 1 162 ? 36.115 14.246  27.835  1.00 21.01 ? 269  LEU A CD1 1 
ATOM   1215 C  CD2 . LEU A 1 162 ? 36.418 16.500  26.779  1.00 20.65 ? 269  LEU A CD2 1 
ATOM   1216 N  N   . ALA A 1 163 ? 34.998 18.116  31.743  1.00 14.69 ? 270  ALA A N   1 
ATOM   1217 C  CA  . ALA A 1 163 ? 34.020 18.650  32.693  1.00 16.88 ? 270  ALA A CA  1 
ATOM   1218 C  C   . ALA A 1 163 ? 34.190 20.161  32.850  1.00 16.39 ? 270  ALA A C   1 
ATOM   1219 O  O   . ALA A 1 163 ? 33.211 20.892  32.963  1.00 16.01 ? 270  ALA A O   1 
ATOM   1220 C  CB  . ALA A 1 163 ? 34.135 17.950  34.052  1.00 14.60 ? 270  ALA A CB  1 
ATOM   1221 N  N   . GLU A 1 164 ? 35.440 20.613  32.850  1.00 14.99 ? 271  GLU A N   1 
ATOM   1222 C  CA  . GLU A 1 164 ? 35.758 22.033  32.913  1.00 15.30 ? 271  GLU A CA  1 
ATOM   1223 C  C   . GLU A 1 164 ? 35.204 22.753  31.687  1.00 17.69 ? 271  GLU A C   1 
ATOM   1224 O  O   . GLU A 1 164 ? 34.581 23.804  31.796  1.00 17.11 ? 271  GLU A O   1 
ATOM   1225 C  CB  . GLU A 1 164 ? 37.270 22.225  33.020  1.00 17.83 ? 271  GLU A CB  1 
ATOM   1226 C  CG  . GLU A 1 164 ? 37.714 23.667  33.011  1.00 25.37 ? 271  GLU A CG  1 
ATOM   1227 C  CD  . GLU A 1 164 ? 37.264 24.422  34.248  1.00 37.74 ? 271  GLU A CD  1 
ATOM   1228 O  OE1 . GLU A 1 164 ? 37.552 23.959  35.374  1.00 43.63 ? 271  GLU A OE1 1 
ATOM   1229 O  OE2 . GLU A 1 164 ? 36.611 25.473  34.095  1.00 41.88 ? 271  GLU A OE2 1 
ATOM   1230 N  N   . GLU A 1 165 ? 35.432 22.156  30.526  1.00 16.32 ? 272  GLU A N   1 
ATOM   1231 C  CA  . GLU A 1 165 ? 34.857 22.605  29.271  1.00 16.58 ? 272  GLU A CA  1 
ATOM   1232 C  C   . GLU A 1 165 ? 33.315 22.663  29.326  1.00 18.57 ? 272  GLU A C   1 
ATOM   1233 O  O   . GLU A 1 165 ? 32.701 23.602  28.818  1.00 15.56 ? 272  GLU A O   1 
ATOM   1234 C  CB  . GLU A 1 165 ? 35.317 21.672  28.150  1.00 17.54 ? 272  GLU A CB  1 
ATOM   1235 C  CG  . GLU A 1 165 ? 34.776 21.992  26.766  1.00 26.81 ? 272  GLU A CG  1 
ATOM   1236 C  CD  . GLU A 1 165 ? 35.221 20.982  25.725  0.00 30.98 ? 272  GLU A CD  1 
ATOM   1237 O  OE1 . GLU A 1 165 ? 36.246 21.224  25.052  0.00 34.91 ? 272  GLU A OE1 1 
ATOM   1238 O  OE2 . GLU A 1 165 ? 34.544 19.943  25.582  0.00 34.06 ? 272  GLU A OE2 1 
ATOM   1239 N  N   . ALA A 1 166 ? 32.691 21.666  29.950  1.00 13.99 ? 273  ALA A N   1 
ATOM   1240 C  CA  . ALA A 1 166 ? 31.231 21.648  30.057  1.00 16.54 ? 273  ALA A CA  1 
ATOM   1241 C  C   . ALA A 1 166 ? 30.717 22.762  30.973  1.00 14.52 ? 273  ALA A C   1 
ATOM   1242 O  O   . ALA A 1 166 ? 29.683 23.370  30.692  1.00 14.51 ? 273  ALA A O   1 
ATOM   1243 C  CB  . ALA A 1 166 ? 30.737 20.281  30.546  1.00 14.47 ? 273  ALA A CB  1 
ATOM   1244 N  N   . PHE A 1 167 ? 31.430 23.027  32.067  1.00 14.16 ? 274  PHE A N   1 
ATOM   1245 C  CA  . PHE A 1 167 ? 31.077 24.151  32.941  1.00 12.81 ? 274  PHE A CA  1 
ATOM   1246 C  C   . PHE A 1 167 ? 31.089 25.463  32.153  1.00 14.50 ? 274  PHE A C   1 
ATOM   1247 O  O   . PHE A 1 167 ? 30.173 26.267  32.249  1.00 14.77 ? 274  PHE A O   1 
ATOM   1248 C  CB  . PHE A 1 167 ? 32.050 24.269  34.125  1.00 13.91 ? 274  PHE A CB  1 
ATOM   1249 C  CG  . PHE A 1 167 ? 31.711 23.389  35.306  1.00 14.57 ? 274  PHE A CG  1 
ATOM   1250 C  CD1 . PHE A 1 167 ? 30.435 23.394  35.859  1.00 11.20 ? 274  PHE A CD1 1 
ATOM   1251 C  CD2 . PHE A 1 167 ? 32.681 22.577  35.872  1.00 13.64 ? 274  PHE A CD2 1 
ATOM   1252 C  CE1 . PHE A 1 167 ? 30.132 22.613  36.957  1.00 14.88 ? 274  PHE A CE1 1 
ATOM   1253 C  CE2 . PHE A 1 167 ? 32.380 21.781  36.966  1.00 15.79 ? 274  PHE A CE2 1 
ATOM   1254 C  CZ  . PHE A 1 167 ? 31.099 21.807  37.513  1.00 15.95 ? 274  PHE A CZ  1 
ATOM   1255 N  N   . PHE A 1 168 ? 32.142 25.666  31.370  1.00 15.72 ? 275  PHE A N   1 
ATOM   1256 C  CA  . PHE A 1 168 ? 32.315 26.931  30.670  1.00 16.21 ? 275  PHE A CA  1 
ATOM   1257 C  C   . PHE A 1 168 ? 31.285 27.099  29.561  1.00 18.07 ? 275  PHE A C   1 
ATOM   1258 O  O   . PHE A 1 168 ? 30.686 28.172  29.420  1.00 17.54 ? 275  PHE A O   1 
ATOM   1259 C  CB  . PHE A 1 168 ? 33.723 27.050  30.094  1.00 16.62 ? 275  PHE A CB  1 
ATOM   1260 C  CG  . PHE A 1 168 ? 33.980 28.363  29.414  1.00 19.71 ? 275  PHE A CG  1 
ATOM   1261 C  CD1 . PHE A 1 168 ? 34.228 29.499  30.159  1.00 22.27 ? 275  PHE A CD1 1 
ATOM   1262 C  CD2 . PHE A 1 168 ? 33.953 28.462  28.036  1.00 23.16 ? 275  PHE A CD2 1 
ATOM   1263 C  CE1 . PHE A 1 168 ? 34.465 30.721  29.534  1.00 35.90 ? 275  PHE A CE1 1 
ATOM   1264 C  CE2 . PHE A 1 168 ? 34.186 29.680  27.401  1.00 26.48 ? 275  PHE A CE2 1 
ATOM   1265 C  CZ  . PHE A 1 168 ? 34.441 30.806  28.146  1.00 25.80 ? 275  PHE A CZ  1 
ATOM   1266 N  N   . ARG A 1 169 ? 31.085 26.043  28.776  1.00 15.89 ? 276  ARG A N   1 
ATOM   1267 C  CA  . ARG A 1 169 ? 30.020 26.021  27.770  1.00 14.79 ? 276  ARG A CA  1 
ATOM   1268 C  C   . ARG A 1 169 ? 28.673 26.286  28.421  1.00 15.35 ? 276  ARG A C   1 
ATOM   1269 O  O   . ARG A 1 169 ? 27.857 27.019  27.885  1.00 15.13 ? 276  ARG A O   1 
ATOM   1270 C  CB  . ARG A 1 169 ? 29.990 24.673  27.040  1.00 16.28 ? 276  ARG A CB  1 
ATOM   1271 C  CG  . ARG A 1 169 ? 28.764 24.431  26.150  1.00 18.64 ? 276  ARG A CG  1 
ATOM   1272 C  CD  . ARG A 1 169 ? 28.781 22.979  25.616  1.00 24.02 ? 276  ARG A CD  1 
ATOM   1273 N  NE  . ARG A 1 169 ? 27.605 22.658  24.804  1.00 36.86 ? 276  ARG A NE  1 
ATOM   1274 C  CZ  . ARG A 1 169 ? 26.525 21.995  25.233  1.00 35.44 ? 276  ARG A CZ  1 
ATOM   1275 N  NH1 . ARG A 1 169 ? 25.528 21.766  24.390  1.00 27.79 ? 276  ARG A NH1 1 
ATOM   1276 N  NH2 . ARG A 1 169 ? 26.430 21.554  26.488  1.00 25.53 ? 276  ARG A NH2 1 
ATOM   1277 N  N   . GLY A 1 170 ? 28.447 25.674  29.581  1.00 15.50 ? 277  GLY A N   1 
ATOM   1278 C  CA  . GLY A 1 170 ? 27.234 25.902  30.354  1.00 13.24 ? 277  GLY A CA  1 
ATOM   1279 C  C   . GLY A 1 170 ? 26.961 27.375  30.630  1.00 14.99 ? 277  GLY A C   1 
ATOM   1280 O  O   . GLY A 1 170 ? 25.887 27.898  30.292  1.00 12.55 ? 277  GLY A O   1 
ATOM   1281 N  N   . VAL A 1 171 ? 27.932 28.063  31.228  1.00 14.46 ? 278  VAL A N   1 
ATOM   1282 C  CA  . VAL A 1 171 ? 27.690 29.450  31.610  1.00 14.47 ? 278  VAL A CA  1 
ATOM   1283 C  C   . VAL A 1 171 ? 27.756 30.391  30.401  1.00 15.32 ? 278  VAL A C   1 
ATOM   1284 O  O   . VAL A 1 171 ? 27.156 31.459  30.435  1.00 16.20 ? 278  VAL A O   1 
ATOM   1285 C  CB  . VAL A 1 171 ? 28.668 29.948  32.720  1.00 13.54 ? 278  VAL A CB  1 
ATOM   1286 C  CG1 . VAL A 1 171 ? 28.446 29.191  34.034  1.00 10.92 ? 278  VAL A CG1 1 
ATOM   1287 C  CG2 . VAL A 1 171 ? 30.113 29.861  32.284  1.00 14.31 ? 278  VAL A CG2 1 
ATOM   1288 N  N   . SER A 1 172 ? 28.471 29.996  29.346  1.00 13.65 ? 279  SER A N   1 
ATOM   1289 C  CA  . SER A 1 172 ? 28.613 30.815  28.128  1.00 16.19 ? 279  SER A CA  1 
ATOM   1290 C  C   . SER A 1 172 ? 27.433 30.663  27.163  1.00 15.58 ? 279  SER A C   1 
ATOM   1291 O  O   . SER A 1 172 ? 26.995 31.630  26.562  1.00 19.46 ? 279  SER A O   1 
ATOM   1292 C  CB  . SER A 1 172 ? 29.896 30.455  27.370  1.00 20.42 ? 279  SER A CB  1 
ATOM   1293 O  OG  . SER A 1 172 ? 31.030 30.612  28.195  1.00 34.56 ? 279  SER A OG  1 
ATOM   1294 N  N   . GLN A 1 173 ? 26.927 29.442  27.034  1.00 16.79 ? 280  GLN A N   1 
ATOM   1295 C  CA  . GLN A 1 173 ? 25.946 29.084  26.009  1.00 17.60 ? 280  GLN A CA  1 
ATOM   1296 C  C   . GLN A 1 173 ? 24.585 28.702  26.551  1.00 18.28 ? 280  GLN A C   1 
ATOM   1297 O  O   . GLN A 1 173 ? 23.569 28.870  25.881  1.00 19.31 ? 280  GLN A O   1 
ATOM   1298 C  CB  . GLN A 1 173 ? 26.464 27.906  25.202  1.00 20.08 ? 280  GLN A CB  1 
ATOM   1299 C  CG  . GLN A 1 173 ? 26.953 28.238  23.852  1.00 30.31 ? 280  GLN A CG  1 
ATOM   1300 C  CD  . GLN A 1 173 ? 27.743 27.090  23.266  1.00 33.20 ? 280  GLN A CD  1 
ATOM   1301 O  OE1 . GLN A 1 173 ? 28.878 26.831  23.683  1.00 34.30 ? 280  GLN A OE1 1 
ATOM   1302 N  NE2 . GLN A 1 173 ? 27.149 26.384  22.317  1.00 29.27 ? 280  GLN A NE2 1 
ATOM   1303 N  N   . GLY A 1 174 ? 24.575 28.148  27.756  1.00 16.04 ? 281  GLY A N   1 
ATOM   1304 C  CA  . GLY A 1 174 ? 23.346 27.712  28.386  1.00 14.10 ? 281  GLY A CA  1 
ATOM   1305 C  C   . GLY A 1 174 ? 22.261 28.771  28.474  1.00 17.39 ? 281  GLY A C   1 
ATOM   1306 O  O   . GLY A 1 174 ? 22.546 29.969  28.525  1.00 17.31 ? 281  GLY A O   1 
ATOM   1307 N  N   . ARG A 1 175 ? 21.015 28.316  28.503  1.00 14.29 ? 282  ARG A N   1 
ATOM   1308 C  CA  . ARG A 1 175 ? 19.859 29.200  28.610  1.00 15.78 ? 282  ARG A CA  1 
ATOM   1309 C  C   . ARG A 1 175 ? 19.890 30.352  27.610  1.00 21.30 ? 282  ARG A C   1 
ATOM   1310 O  O   . ARG A 1 175 ? 19.703 31.506  27.990  1.00 21.21 ? 282  ARG A O   1 
ATOM   1311 C  CB  . ARG A 1 175 ? 19.738 29.773  30.025  1.00 16.56 ? 282  ARG A CB  1 
ATOM   1312 C  CG  . ARG A 1 175 ? 19.234 28.800  31.080  1.00 20.38 ? 282  ARG A CG  1 
ATOM   1313 C  CD  . ARG A 1 175 ? 18.736 29.540  32.323  1.00 15.61 ? 282  ARG A CD  1 
ATOM   1314 N  NE  . ARG A 1 175 ? 19.813 30.300  32.943  1.00 21.55 ? 282  ARG A NE  1 
ATOM   1315 C  CZ  . ARG A 1 175 ? 19.729 31.578  33.310  1.00 11.41 ? 282  ARG A CZ  1 
ATOM   1316 N  NH1 . ARG A 1 175 ? 18.610 32.270  33.131  1.00 14.27 ? 282  ARG A NH1 1 
ATOM   1317 N  NH2 . ARG A 1 175 ? 20.780 32.162  33.860  1.00 14.17 ? 282  ARG A NH2 1 
ATOM   1318 N  N   . GLY A 1 176 ? 20.140 30.039  26.342  1.00 21.06 ? 283  GLY A N   1 
ATOM   1319 C  CA  . GLY A 1 176 ? 20.181 31.052  25.300  1.00 22.46 ? 283  GLY A CA  1 
ATOM   1320 C  C   . GLY A 1 176 ? 21.262 32.102  25.519  1.00 24.57 ? 283  GLY A C   1 
ATOM   1321 O  O   . GLY A 1 176 ? 21.168 33.212  25.008  1.00 19.21 ? 283  GLY A O   1 
ATOM   1322 N  N   . GLY A 1 177 ? 22.286 31.756  26.291  1.00 19.53 ? 284  GLY A N   1 
ATOM   1323 C  CA  . GLY A 1 177 ? 23.373 32.681  26.556  1.00 17.92 ? 284  GLY A CA  1 
ATOM   1324 C  C   . GLY A 1 177 ? 23.331 33.322  27.934  1.00 16.57 ? 284  GLY A C   1 
ATOM   1325 O  O   . GLY A 1 177 ? 24.252 34.025  28.321  1.00 17.50 ? 284  GLY A O   1 
ATOM   1326 N  N   . LEU A 1 178 ? 22.272 33.073  28.688  1.00 13.95 ? 285  LEU A N   1 
ATOM   1327 C  CA  . LEU A 1 178 ? 22.184 33.644  30.024  1.00 13.50 ? 285  LEU A CA  1 
ATOM   1328 C  C   . LEU A 1 178 ? 23.057 32.853  31.007  1.00 16.01 ? 285  LEU A C   1 
ATOM   1329 O  O   . LEU A 1 178 ? 23.534 33.392  32.013  1.00 14.17 ? 285  LEU A O   1 
ATOM   1330 C  CB  . LEU A 1 178 ? 20.729 33.696  30.496  1.00 11.69 ? 285  LEU A CB  1 
ATOM   1331 C  CG  . LEU A 1 178 ? 19.769 34.617  29.720  1.00 16.75 ? 285  LEU A CG  1 
ATOM   1332 C  CD1 . LEU A 1 178 ? 18.348 34.480  30.251  1.00 16.12 ? 285  LEU A CD1 1 
ATOM   1333 C  CD2 . LEU A 1 178 ? 20.189 36.089  29.753  1.00 15.48 ? 285  LEU A CD2 1 
ATOM   1334 N  N   . GLY A 1 179 ? 23.283 31.582  30.689  1.00 14.14 ? 286  GLY A N   1 
ATOM   1335 C  CA  . GLY A 1 179 ? 24.153 30.733  31.476  1.00 12.20 ? 286  GLY A CA  1 
ATOM   1336 C  C   . GLY A 1 179 ? 23.439 29.734  32.380  1.00 13.36 ? 286  GLY A C   1 
ATOM   1337 O  O   . GLY A 1 179 ? 22.602 30.102  33.202  1.00 11.98 ? 286  GLY A O   1 
ATOM   1338 N  N   . SER A 1 180 ? 23.783 28.462  32.208  1.00 14.95 ? 287  SER A N   1 
ATOM   1339 C  CA  . SER A 1 180 ? 23.376 27.389  33.113  1.00 12.68 ? 287  SER A CA  1 
ATOM   1340 C  C   . SER A 1 180 ? 23.677 27.749  34.577  1.00 14.87 ? 287  SER A C   1 
ATOM   1341 O  O   . SER A 1 180 ? 24.725 28.327  34.868  1.00 12.76 ? 287  SER A O   1 
ATOM   1342 C  CB  . SER A 1 180 ? 24.107 26.088  32.757  1.00 11.30 ? 287  SER A CB  1 
ATOM   1343 O  OG  . SER A 1 180 ? 23.722 25.568  31.485  1.00 16.08 ? 287  SER A OG  1 
ATOM   1344 N  N   . ILE A 1 181 ? 22.771 27.396  35.489  1.00 14.65 ? 288  ILE A N   1 
ATOM   1345 C  CA  . ILE A 1 181 ? 23.010 27.601  36.915  1.00 10.99 ? 288  ILE A CA  1 
ATOM   1346 C  C   . ILE A 1 181 ? 23.420 26.276  37.556  1.00 17.33 ? 288  ILE A C   1 
ATOM   1347 O  O   . ILE A 1 181 ? 22.620 25.326  37.611  1.00 13.06 ? 288  ILE A O   1 
ATOM   1348 C  CB  . ILE A 1 181 ? 21.778 28.128  37.674  1.00 14.46 ? 288  ILE A CB  1 
ATOM   1349 C  CG1 . ILE A 1 181 ? 21.122 29.315  36.963  1.00 18.77 ? 288  ILE A CG1 1 
ATOM   1350 C  CG2 . ILE A 1 181 ? 22.166 28.482  39.112  1.00 15.63 ? 288  ILE A CG2 1 
ATOM   1351 C  CD1 . ILE A 1 181 ? 22.068 30.463  36.746  1.00 18.79 ? 288  ILE A CD1 1 
ATOM   1352 N  N   . PHE A 1 182 ? 24.650 26.217  38.053  1.00 12.34 ? 289  PHE A N   1 
ATOM   1353 C  CA  . PHE A 1 182 ? 25.175 24.993  38.669  1.00 13.57 ? 289  PHE A CA  1 
ATOM   1354 C  C   . PHE A 1 182 ? 25.191 25.146  40.186  1.00 14.70 ? 289  PHE A C   1 
ATOM   1355 O  O   . PHE A 1 182 ? 25.900 26.016  40.715  1.00 14.95 ? 289  PHE A O   1 
ATOM   1356 C  CB  . PHE A 1 182 ? 26.596 24.685  38.149  1.00 12.79 ? 289  PHE A CB  1 
ATOM   1357 C  CG  . PHE A 1 182 ? 26.668 24.381  36.660  1.00 12.53 ? 289  PHE A CG  1 
ATOM   1358 C  CD1 . PHE A 1 182 ? 26.184 23.186  36.153  1.00 13.91 ? 289  PHE A CD1 1 
ATOM   1359 C  CD2 . PHE A 1 182 ? 27.224 25.290  35.776  1.00 11.63 ? 289  PHE A CD2 1 
ATOM   1360 C  CE1 . PHE A 1 182 ? 26.252 22.904  34.779  1.00 10.08 ? 289  PHE A CE1 1 
ATOM   1361 C  CE2 . PHE A 1 182 ? 27.291 25.018  34.420  1.00 13.11 ? 289  PHE A CE2 1 
ATOM   1362 C  CZ  . PHE A 1 182 ? 26.815 23.828  33.917  1.00 10.34 ? 289  PHE A CZ  1 
ATOM   1363 N  N   . VAL A 1 183 ? 24.409 24.321  40.883  1.00 11.28 ? 290  VAL A N   1 
ATOM   1364 C  CA  . VAL A 1 183 ? 24.291 24.399  42.341  1.00 11.34 ? 290  VAL A CA  1 
ATOM   1365 C  C   . VAL A 1 183 ? 24.974 23.188  43.006  1.00 16.65 ? 290  VAL A C   1 
ATOM   1366 O  O   . VAL A 1 183 ? 24.668 22.040  42.670  1.00 14.45 ? 290  VAL A O   1 
ATOM   1367 C  CB  . VAL A 1 183 ? 22.807 24.452  42.777  1.00 13.43 ? 290  VAL A CB  1 
ATOM   1368 C  CG1 . VAL A 1 183 ? 22.689 24.680  44.283  1.00 13.32 ? 290  VAL A CG1 1 
ATOM   1369 C  CG2 . VAL A 1 183 ? 22.065 25.541  42.028  1.00 15.12 ? 290  VAL A CG2 1 
ATOM   1370 N  N   . TRP A 1 184 ? 25.891 23.436  43.936  1.00 12.94 ? 291  TRP A N   1 
ATOM   1371 C  CA  . TRP A 1 184 ? 26.757 22.366  44.464  1.00 12.43 ? 291  TRP A CA  1 
ATOM   1372 C  C   . TRP A 1 184 ? 26.716 22.227  45.994  1.00 13.43 ? 291  TRP A C   1 
ATOM   1373 O  O   . TRP A 1 184 ? 26.666 23.213  46.723  1.00 17.00 ? 291  TRP A O   1 
ATOM   1374 C  CB  . TRP A 1 184 ? 28.221 22.577  44.015  1.00 10.00 ? 291  TRP A CB  1 
ATOM   1375 C  CG  . TRP A 1 184 ? 28.829 21.293  43.525  1.00 12.62 ? 291  TRP A CG  1 
ATOM   1376 C  CD1 . TRP A 1 184 ? 29.429 20.331  44.276  1.00 11.26 ? 291  TRP A CD1 1 
ATOM   1377 C  CD2 . TRP A 1 184 ? 28.831 20.810  42.176  1.00 12.44 ? 291  TRP A CD2 1 
ATOM   1378 N  NE1 . TRP A 1 184 ? 29.837 19.284  43.474  1.00 13.07 ? 291  TRP A NE1 1 
ATOM   1379 C  CE2 . TRP A 1 184 ? 29.474 19.553  42.182  1.00 11.61 ? 291  TRP A CE2 1 
ATOM   1380 C  CE3 . TRP A 1 184 ? 28.366 21.327  40.964  1.00 11.68 ? 291  TRP A CE3 1 
ATOM   1381 C  CZ2 . TRP A 1 184 ? 29.654 18.800  41.022  1.00 12.02 ? 291  TRP A CZ2 1 
ATOM   1382 C  CZ3 . TRP A 1 184 ? 28.549 20.573  39.806  1.00 13.25 ? 291  TRP A CZ3 1 
ATOM   1383 C  CH2 . TRP A 1 184 ? 29.182 19.328  39.849  1.00 13.19 ? 291  TRP A CH2 1 
ATOM   1384 N  N   . ALA A 1 185 ? 26.748 20.988  46.476  1.00 13.90 ? 292  ALA A N   1 
ATOM   1385 C  CA  . ALA A 1 185 ? 26.845 20.725  47.913  1.00 11.99 ? 292  ALA A CA  1 
ATOM   1386 C  C   . ALA A 1 185 ? 28.291 20.884  48.340  1.00 11.95 ? 292  ALA A C   1 
ATOM   1387 O  O   . ALA A 1 185 ? 29.174 20.310  47.718  1.00 12.21 ? 292  ALA A O   1 
ATOM   1388 C  CB  . ALA A 1 185 ? 26.332 19.314  48.250  1.00 12.15 ? 292  ALA A CB  1 
ATOM   1389 N  N   . SER A 1 186 ? 28.539 21.643  49.406  1.00 12.25 ? 293  SER A N   1 
ATOM   1390 C  CA  . SER A 1 186 ? 29.909 22.062  49.721  1.00 14.81 ? 293  SER A CA  1 
ATOM   1391 C  C   . SER A 1 186 ? 30.783 20.952  50.327  1.00 14.43 ? 293  SER A C   1 
ATOM   1392 O  O   . SER A 1 186 ? 32.001 21.060  50.302  1.00 14.14 ? 293  SER A O   1 
ATOM   1393 C  CB  . SER A 1 186 ? 29.906 23.282  50.659  1.00 15.42 ? 293  SER A CB  1 
ATOM   1394 O  OG  . SER A 1 186 ? 29.404 22.968  51.937  1.00 16.23 ? 293  SER A OG  1 
ATOM   1395 N  N   . GLY A 1 187 ? 30.175 19.889  50.849  1.00 15.02 ? 294  GLY A N   1 
ATOM   1396 C  CA  . GLY A 1 187 ? 30.947 18.747  51.332  1.00 11.83 ? 294  GLY A CA  1 
ATOM   1397 C  C   . GLY A 1 187 ? 30.550 18.242  52.712  1.00 13.54 ? 294  GLY A C   1 
ATOM   1398 O  O   . GLY A 1 187 ? 30.007 18.986  53.526  1.00 16.53 ? 294  GLY A O   1 
ATOM   1399 N  N   . ASN A 1 188 ? 30.818 16.971  52.977  1.00 14.91 ? 295  ASN A N   1 
ATOM   1400 C  CA  . ASN A 1 188 ? 30.457 16.371  54.251  1.00 14.92 ? 295  ASN A CA  1 
ATOM   1401 C  C   . ASN A 1 188 ? 31.664 15.966  55.111  1.00 14.44 ? 295  ASN A C   1 
ATOM   1402 O  O   . ASN A 1 188 ? 31.529 15.155  56.026  1.00 15.94 ? 295  ASN A O   1 
ATOM   1403 C  CB  . ASN A 1 188 ? 29.564 15.150  54.029  1.00 14.67 ? 295  ASN A CB  1 
ATOM   1404 C  CG  . ASN A 1 188 ? 28.161 15.514  53.533  1.00 18.04 ? 295  ASN A CG  1 
ATOM   1405 O  OD1 . ASN A 1 188 ? 27.711 16.657  53.632  1.00 15.24 ? 295  ASN A OD1 1 
ATOM   1406 N  ND2 . ASN A 1 188 ? 27.464 14.520  52.998  1.00 15.87 ? 295  ASN A ND2 1 
ATOM   1407 N  N   . GLY A 1 189 ? 32.832 16.537  54.823  1.00 15.42 ? 296  GLY A N   1 
ATOM   1408 C  CA  . GLY A 1 189 ? 34.070 16.139  55.486  1.00 17.28 ? 296  GLY A CA  1 
ATOM   1409 C  C   . GLY A 1 189 ? 34.408 16.814  56.810  1.00 15.31 ? 296  GLY A C   1 
ATOM   1410 O  O   . GLY A 1 189 ? 35.572 16.834  57.219  1.00 17.96 ? 296  GLY A O   1 
ATOM   1411 N  N   . GLY A 1 190 ? 33.397 17.365  57.476  1.00 15.54 ? 297  GLY A N   1 
ATOM   1412 C  CA  . GLY A 1 190 ? 33.591 18.154  58.689  1.00 16.38 ? 297  GLY A CA  1 
ATOM   1413 C  C   . GLY A 1 190 ? 34.365 17.439  59.784  1.00 20.55 ? 297  GLY A C   1 
ATOM   1414 O  O   . GLY A 1 190 ? 35.244 18.023  60.425  1.00 19.24 ? 297  GLY A O   1 
ATOM   1415 N  N   . ARG A 1 191 ? 34.054 16.167  59.993  1.00 18.00 ? 298  ARG A N   1 
ATOM   1416 C  CA  . ARG A 1 191 ? 34.689 15.439  61.082  1.00 24.81 ? 298  ARG A CA  1 
ATOM   1417 C  C   . ARG A 1 191 ? 36.126 15.083  60.753  1.00 25.30 ? 298  ARG A C   1 
ATOM   1418 O  O   . ARG A 1 191 ? 36.916 14.845  61.658  1.00 24.55 ? 298  ARG A O   1 
ATOM   1419 C  CB  . ARG A 1 191 ? 33.890 14.193  61.443  1.00 25.64 ? 298  ARG A CB  1 
ATOM   1420 C  CG  . ARG A 1 191 ? 32.740 14.531  62.368  1.00 29.95 ? 298  ARG A CG  1 
ATOM   1421 C  CD  . ARG A 1 191 ? 32.180 13.306  63.058  0.00 33.09 ? 298  ARG A CD  1 
ATOM   1422 N  NE  . ARG A 1 191 ? 31.048 13.654  63.911  0.00 38.09 ? 298  ARG A NE  1 
ATOM   1423 C  CZ  . ARG A 1 191 ? 29.934 12.937  63.997  0.00 44.08 ? 298  ARG A CZ  1 
ATOM   1424 N  NH1 . ARG A 1 191 ? 28.951 13.327  64.796  0.00 42.96 ? 298  ARG A NH1 1 
ATOM   1425 N  NH2 . ARG A 1 191 ? 29.802 11.830  63.279  0.00 38.37 ? 298  ARG A NH2 1 
ATOM   1426 N  N   . GLU A 1 192 ? 36.466 15.080  59.464  1.00 18.63 ? 299  GLU A N   1 
ATOM   1427 C  CA  . GLU A 1 192 ? 37.852 14.922  59.041  1.00 18.80 ? 299  GLU A CA  1 
ATOM   1428 C  C   . GLU A 1 192 ? 38.521 16.277  58.860  1.00 20.19 ? 299  GLU A C   1 
ATOM   1429 O  O   . GLU A 1 192 ? 39.624 16.344  58.321  1.00 20.44 ? 299  GLU A O   1 
ATOM   1430 C  CB  . GLU A 1 192 ? 37.955 14.133  57.728  1.00 19.44 ? 299  GLU A CB  1 
ATOM   1431 C  CG  . GLU A 1 192 ? 36.915 13.055  57.565  1.00 22.91 ? 299  GLU A CG  1 
ATOM   1432 C  CD  . GLU A 1 192 ? 37.005 12.030  58.662  1.00 36.38 ? 299  GLU A CD  1 
ATOM   1433 O  OE1 . GLU A 1 192 ? 38.136 11.760  59.111  1.00 37.37 ? 299  GLU A OE1 1 
ATOM   1434 O  OE2 . GLU A 1 192 ? 35.948 11.503  59.078  1.00 40.66 ? 299  GLU A OE2 1 
ATOM   1435 N  N   . HIS A 1 193 ? 37.855 17.347  59.305  1.00 18.67 ? 300  HIS A N   1 
ATOM   1436 C  CA  . HIS A 1 193 ? 38.349 18.716  59.112  1.00 18.77 ? 300  HIS A CA  1 
ATOM   1437 C  C   . HIS A 1 193 ? 38.720 19.006  57.653  1.00 17.40 ? 300  HIS A C   1 
ATOM   1438 O  O   . HIS A 1 193 ? 39.706 19.668  57.388  1.00 18.00 ? 300  HIS A O   1 
ATOM   1439 C  CB  . HIS A 1 193 ? 39.574 18.991  60.005  1.00 21.40 ? 300  HIS A CB  1 
ATOM   1440 C  CG  . HIS A 1 193 ? 39.292 18.856  61.467  1.00 27.44 ? 300  HIS A CG  1 
ATOM   1441 N  ND1 . HIS A 1 193 ? 39.276 17.638  62.113  1.00 31.29 ? 300  HIS A ND1 1 
ATOM   1442 C  CD2 . HIS A 1 193 ? 38.981 19.781  62.402  1.00 28.53 ? 300  HIS A CD2 1 
ATOM   1443 C  CE1 . HIS A 1 193 ? 38.977 17.820  63.386  1.00 32.65 ? 300  HIS A CE1 1 
ATOM   1444 N  NE2 . HIS A 1 193 ? 38.791 19.112  63.586  1.00 34.38 ? 300  HIS A NE2 1 
ATOM   1445 N  N   . ASP A 1 194 ? 37.935 18.493  56.713  1.00 19.40 ? 301  ASP A N   1 
ATOM   1446 C  CA  . ASP A 1 194 ? 38.168 18.751  55.294  1.00 16.86 ? 301  ASP A CA  1 
ATOM   1447 C  C   . ASP A 1 194 ? 37.940 20.239  55.004  1.00 16.45 ? 301  ASP A C   1 
ATOM   1448 O  O   . ASP A 1 194 ? 37.218 20.901  55.732  1.00 17.49 ? 301  ASP A O   1 
ATOM   1449 C  CB  . ASP A 1 194 ? 37.236 17.876  54.445  1.00 13.93 ? 301  ASP A CB  1 
ATOM   1450 C  CG  . ASP A 1 194 ? 37.708 17.718  53.006  1.00 17.62 ? 301  ASP A CG  1 
ATOM   1451 O  OD1 . ASP A 1 194 ? 38.832 18.161  52.663  1.00 16.77 ? 301  ASP A OD1 1 
ATOM   1452 O  OD2 . ASP A 1 194 ? 36.954 17.119  52.218  1.00 16.06 ? 301  ASP A OD2 1 
ATOM   1453 N  N   . SER A 1 195 ? 38.562 20.752  53.948  1.00 17.60 ? 302  SER A N   1 
ATOM   1454 C  CA  . SER A 1 195 ? 38.347 22.132  53.497  1.00 18.66 ? 302  SER A CA  1 
ATOM   1455 C  C   . SER A 1 195 ? 37.730 22.115  52.106  1.00 16.85 ? 302  SER A C   1 
ATOM   1456 O  O   . SER A 1 195 ? 38.311 21.531  51.192  1.00 18.11 ? 302  SER A O   1 
ATOM   1457 C  CB  . SER A 1 195 ? 39.668 22.904  53.468  1.00 25.88 ? 302  SER A CB  1 
ATOM   1458 O  OG  . SER A 1 195 ? 39.606 24.017  52.583  1.00 25.76 ? 302  SER A OG  1 
ATOM   1459 N  N   . CYS A 1 196 ? 36.573 22.750  51.928  1.00 17.36 ? 303  CYS A N   1 
ATOM   1460 C  CA  . CYS A 1 196 ? 35.928 22.728  50.619  1.00 16.05 ? 303  CYS A CA  1 
ATOM   1461 C  C   . CYS A 1 196 ? 36.656 23.562  49.544  1.00 18.04 ? 303  CYS A C   1 
ATOM   1462 O  O   . CYS A 1 196 ? 36.208 23.595  48.407  1.00 20.54 ? 303  CYS A O   1 
ATOM   1463 C  CB  . CYS A 1 196 ? 34.448 23.157  50.709  1.00 17.84 ? 303  CYS A CB  1 
ATOM   1464 S  SG  . CYS A 1 196 ? 33.965 24.413  51.896  1.00 22.59 ? 303  CYS A SG  1 
ATOM   1465 N  N   . ASN A 1 197 ? 37.790 24.189  49.860  1.00 12.51 ? 304  ASN A N   1 
ATOM   1466 C  CA  . ASN A 1 197 ? 38.605 24.767  48.786  1.00 14.64 ? 304  ASN A CA  1 
ATOM   1467 C  C   . ASN A 1 197 ? 39.518 23.724  48.121  1.00 13.78 ? 304  ASN A C   1 
ATOM   1468 O  O   . ASN A 1 197 ? 40.132 23.996  47.112  1.00 16.85 ? 304  ASN A O   1 
ATOM   1469 C  CB  . ASN A 1 197 ? 39.453 25.938  49.278  1.00 17.18 ? 304  ASN A CB  1 
ATOM   1470 C  CG  . ASN A 1 197 ? 38.664 27.243  49.349  1.00 23.52 ? 304  ASN A CG  1 
ATOM   1471 O  OD1 . ASN A 1 197 ? 37.445 27.262  49.148  1.00 24.19 ? 304  ASN A OD1 1 
ATOM   1472 N  ND2 . ASN A 1 197 ? 39.353 28.332  49.660  1.00 19.47 ? 304  ASN A ND2 1 
ATOM   1473 N  N   . CYS A 1 198 ? 39.583 22.531  48.687  1.00 13.36 ? 305  CYS A N   1 
ATOM   1474 C  CA  . CYS A 1 198 ? 40.345 21.428  48.088  1.00 13.88 ? 305  CYS A CA  1 
ATOM   1475 C  C   . CYS A 1 198 ? 39.501 20.587  47.126  1.00 14.14 ? 305  CYS A C   1 
ATOM   1476 O  O   . CYS A 1 198 ? 39.926 19.535  46.631  1.00 13.55 ? 305  CYS A O   1 
ATOM   1477 C  CB  . CYS A 1 198 ? 40.917 20.540  49.192  1.00 15.76 ? 305  CYS A CB  1 
ATOM   1478 S  SG  . CYS A 1 198 ? 42.249 21.343  50.098  1.00 16.72 ? 305  CYS A SG  1 
ATOM   1479 N  N   . ASP A 1 199 ? 38.296 21.072  46.882  1.00 15.52 ? 306  ASP A N   1 
ATOM   1480 C  CA  . ASP A 1 199 ? 37.306 20.427  46.022  1.00 15.22 ? 306  ASP A CA  1 
ATOM   1481 C  C   . ASP A 1 199 ? 37.070 21.366  44.830  1.00 16.51 ? 306  ASP A C   1 
ATOM   1482 O  O   . ASP A 1 199 ? 36.477 22.425  44.979  1.00 16.47 ? 306  ASP A O   1 
ATOM   1483 C  CB  . ASP A 1 199 ? 36.036 20.141  46.854  1.00 15.34 ? 306  ASP A CB  1 
ATOM   1484 C  CG  . ASP A 1 199 ? 34.837 19.697  46.028  1.00 16.26 ? 306  ASP A CG  1 
ATOM   1485 O  OD1 . ASP A 1 199 ? 34.801 19.898  44.802  1.00 17.10 ? 306  ASP A OD1 1 
ATOM   1486 O  OD2 . ASP A 1 199 ? 33.895 19.148  46.642  1.00 18.05 ? 306  ASP A OD2 1 
ATOM   1487 N  N   . GLY A 1 200 ? 37.541 20.980  43.648  1.00 13.61 ? 307  GLY A N   1 
ATOM   1488 C  CA  . GLY A 1 200 ? 37.477 21.874  42.497  1.00 16.76 ? 307  GLY A CA  1 
ATOM   1489 C  C   . GLY A 1 200 ? 36.076 22.131  41.933  1.00 13.89 ? 307  GLY A C   1 
ATOM   1490 O  O   . GLY A 1 200 ? 35.889 23.005  41.090  1.00 15.08 ? 307  GLY A O   1 
ATOM   1491 N  N   . TYR A 1 201 ? 35.095 21.350  42.362  1.00 13.99 ? 308  TYR A N   1 
ATOM   1492 C  CA  . TYR A 1 201 ? 33.725 21.590  41.918  1.00 13.80 ? 308  TYR A CA  1 
ATOM   1493 C  C   . TYR A 1 201 ? 33.118 22.705  42.757  1.00 15.08 ? 308  TYR A C   1 
ATOM   1494 O  O   . TYR A 1 201 ? 32.584 23.659  42.216  1.00 16.13 ? 308  TYR A O   1 
ATOM   1495 C  CB  . TYR A 1 201 ? 32.883 20.315  41.981  1.00 12.57 ? 308  TYR A CB  1 
ATOM   1496 C  CG  . TYR A 1 201 ? 33.472 19.208  41.133  1.00 13.22 ? 308  TYR A CG  1 
ATOM   1497 C  CD1 . TYR A 1 201 ? 34.519 18.429  41.613  1.00 14.66 ? 308  TYR A CD1 1 
ATOM   1498 C  CD2 . TYR A 1 201 ? 33.020 18.975  39.841  1.00 11.93 ? 308  TYR A CD2 1 
ATOM   1499 C  CE1 . TYR A 1 201 ? 35.089 17.434  40.839  1.00 13.31 ? 308  TYR A CE1 1 
ATOM   1500 C  CE2 . TYR A 1 201 ? 33.580 17.986  39.057  1.00 10.43 ? 308  TYR A CE2 1 
ATOM   1501 C  CZ  . TYR A 1 201 ? 34.615 17.218  39.561  1.00 12.90 ? 308  TYR A CZ  1 
ATOM   1502 O  OH  . TYR A 1 201 ? 35.189 16.229  38.802  1.00 15.46 ? 308  TYR A OH  1 
ATOM   1503 N  N   . THR A 1 202 ? 33.229 22.604  44.075  1.00 16.57 ? 309  THR A N   1 
ATOM   1504 C  CA  . THR A 1 202 ? 32.679 23.635  44.948  1.00 18.13 ? 309  THR A CA  1 
ATOM   1505 C  C   . THR A 1 202 ? 33.465 24.940  44.799  1.00 15.97 ? 309  THR A C   1 
ATOM   1506 O  O   . THR A 1 202 ? 32.907 26.028  44.840  1.00 16.88 ? 309  THR A O   1 
ATOM   1507 C  CB  . THR A 1 202 ? 32.678 23.171  46.419  1.00 20.41 ? 309  THR A CB  1 
ATOM   1508 O  OG1 . THR A 1 202 ? 33.972 22.651  46.762  1.00 18.78 ? 309  THR A OG1 1 
ATOM   1509 C  CG2 . THR A 1 202 ? 31.650 22.061  46.614  1.00 16.80 ? 309  THR A CG2 1 
ATOM   1510 N  N   . ASN A 1 203 ? 34.764 24.802  44.593  1.00 16.18 ? 310  ASN A N   1 
ATOM   1511 C  CA  . ASN A 1 203 ? 35.712 25.914  44.496  1.00 17.23 ? 310  ASN A CA  1 
ATOM   1512 C  C   . ASN A 1 203 ? 35.596 26.704  43.181  1.00 18.78 ? 310  ASN A C   1 
ATOM   1513 O  O   . ASN A 1 203 ? 36.146 27.795  43.047  1.00 16.46 ? 310  ASN A O   1 
ATOM   1514 C  CB  . ASN A 1 203 ? 37.122 25.325  44.642  1.00 20.57 ? 310  ASN A CB  1 
ATOM   1515 C  CG  . ASN A 1 203 ? 38.172 26.330  44.972  1.00 23.57 ? 310  ASN A CG  1 
ATOM   1516 O  OD1 . ASN A 1 203 ? 38.023 27.167  45.871  1.00 26.40 ? 310  ASN A OD1 1 
ATOM   1517 N  ND2 . ASN A 1 203 ? 39.288 26.222  44.278  1.00 24.25 ? 310  ASN A ND2 1 
ATOM   1518 N  N   . SER A 1 204 ? 34.902 26.127  42.201  1.00 14.50 ? 311  SER A N   1 
ATOM   1519 C  CA  . SER A 1 204 ? 34.656 26.788  40.909  1.00 14.52 ? 311  SER A CA  1 
ATOM   1520 C  C   . SER A 1 204 ? 33.841 28.082  41.022  1.00 15.17 ? 311  SER A C   1 
ATOM   1521 O  O   . SER A 1 204 ? 32.874 28.149  41.792  1.00 12.79 ? 311  SER A O   1 
ATOM   1522 C  CB  . SER A 1 204 ? 33.919 25.831  39.967  1.00 14.22 ? 311  SER A CB  1 
ATOM   1523 O  OG  . SER A 1 204 ? 33.743 26.396  38.679  1.00 14.19 ? 311  SER A OG  1 
ATOM   1524 N  N   . ILE A 1 205 ? 34.199 29.093  40.231  1.00 13.67 ? 312  ILE A N   1 
ATOM   1525 C  CA  . ILE A 1 205 ? 33.369 30.294  40.162  1.00 14.72 ? 312  ILE A CA  1 
ATOM   1526 C  C   . ILE A 1 205 ? 32.040 29.999  39.453  1.00 13.35 ? 312  ILE A C   1 
ATOM   1527 O  O   . ILE A 1 205 ? 31.079 30.727  39.639  1.00 13.69 ? 312  ILE A O   1 
ATOM   1528 C  CB  . ILE A 1 205 ? 34.066 31.474  39.425  1.00 15.72 ? 312  ILE A CB  1 
ATOM   1529 C  CG1 . ILE A 1 205 ? 34.133 31.219  37.912  1.00 15.18 ? 312  ILE A CG1 1 
ATOM   1530 C  CG2 . ILE A 1 205 ? 35.454 31.780  40.023  1.00 17.18 ? 312  ILE A CG2 1 
ATOM   1531 C  CD1 . ILE A 1 205 ? 34.716 32.397  37.131  1.00 20.68 ? 312  ILE A CD1 1 
ATOM   1532 N  N   . TYR A 1 206 ? 32.001 28.943  38.636  1.00 12.92 ? 313  TYR A N   1 
ATOM   1533 C  CA  . TYR A 1 206 ? 30.802 28.582  37.864  1.00 13.58 ? 313  TYR A CA  1 
ATOM   1534 C  C   . TYR A 1 206 ? 29.718 27.891  38.664  1.00 13.17 ? 313  TYR A C   1 
ATOM   1535 O  O   . TYR A 1 206 ? 28.603 27.724  38.160  1.00 13.24 ? 313  TYR A O   1 
ATOM   1536 C  CB  . TYR A 1 206 ? 31.158 27.655  36.702  1.00 14.67 ? 313  TYR A CB  1 
ATOM   1537 C  CG  . TYR A 1 206 ? 32.251 28.196  35.818  1.00 14.91 ? 313  TYR A CG  1 
ATOM   1538 C  CD1 . TYR A 1 206 ? 32.181 29.481  35.325  1.00 14.29 ? 313  TYR A CD1 1 
ATOM   1539 C  CD2 . TYR A 1 206 ? 33.359 27.423  35.503  1.00 16.25 ? 313  TYR A CD2 1 
ATOM   1540 C  CE1 . TYR A 1 206 ? 33.176 29.991  34.523  1.00 21.73 ? 313  TYR A CE1 1 
ATOM   1541 C  CE2 . TYR A 1 206 ? 34.372 27.929  34.695  1.00 22.27 ? 313  TYR A CE2 1 
ATOM   1542 C  CZ  . TYR A 1 206 ? 34.261 29.211  34.210  1.00 22.63 ? 313  TYR A CZ  1 
ATOM   1543 O  OH  . TYR A 1 206 ? 35.244 29.738  33.412  1.00 29.38 ? 313  TYR A OH  1 
ATOM   1544 N  N   . THR A 1 207 ? 30.058 27.438  39.871  1.00 11.67 ? 314  THR A N   1 
ATOM   1545 C  CA  . THR A 1 207 ? 29.095 26.786  40.739  1.00 10.08 ? 314  THR A CA  1 
ATOM   1546 C  C   . THR A 1 207 ? 28.740 27.667  41.933  1.00 12.84 ? 314  THR A C   1 
ATOM   1547 O  O   . THR A 1 207 ? 29.577 28.398  42.452  1.00 11.60 ? 314  THR A O   1 
ATOM   1548 C  CB  . THR A 1 207 ? 29.610 25.413  41.270  1.00 12.18 ? 314  THR A CB  1 
ATOM   1549 O  OG1 . THR A 1 207 ? 30.714 25.608  42.164  1.00 10.87 ? 314  THR A OG1 1 
ATOM   1550 C  CG2 . THR A 1 207 ? 30.042 24.509  40.124  1.00 13.80 ? 314  THR A CG2 1 
ATOM   1551 N  N   . LEU A 1 208 ? 27.485 27.599  42.357  1.00 13.70 ? 315  LEU A N   1 
ATOM   1552 C  CA  . LEU A 1 208 ? 27.083 28.210  43.616  1.00 15.86 ? 315  LEU A CA  1 
ATOM   1553 C  C   . LEU A 1 208 ? 27.202 27.164  44.680  1.00 15.82 ? 315  LEU A C   1 
ATOM   1554 O  O   . LEU A 1 208 ? 26.386 26.253  44.738  1.00 14.74 ? 315  LEU A O   1 
ATOM   1555 C  CB  . LEU A 1 208 ? 25.653 28.718  43.592  1.00 17.11 ? 315  LEU A CB  1 
ATOM   1556 C  CG  . LEU A 1 208 ? 25.317 29.898  42.712  1.00 18.37 ? 315  LEU A CG  1 
ATOM   1557 C  CD1 . LEU A 1 208 ? 24.932 29.331  41.379  1.00 30.76 ? 315  LEU A CD1 1 
ATOM   1558 C  CD2 . LEU A 1 208 ? 24.176 30.707  43.316  1.00 18.86 ? 315  LEU A CD2 1 
ATOM   1559 N  N   . SER A 1 209 ? 28.214 27.282  45.525  1.00 13.52 ? 316  SER A N   1 
ATOM   1560 C  CA  . SER A 1 209 ? 28.446 26.253  46.524  1.00 13.41 ? 316  SER A CA  1 
ATOM   1561 C  C   . SER A 1 209 ? 27.689 26.561  47.815  1.00 16.42 ? 316  SER A C   1 
ATOM   1562 O  O   . SER A 1 209 ? 27.812 27.653  48.376  1.00 14.81 ? 316  SER A O   1 
ATOM   1563 C  CB  . SER A 1 209 ? 29.942 26.109  46.797  1.00 17.12 ? 316  SER A CB  1 
ATOM   1564 O  OG  . SER A 1 209 ? 30.146 25.122  47.792  1.00 22.09 ? 316  SER A OG  1 
ATOM   1565 N  N   . ILE A 1 210 ? 26.911 25.582  48.272  1.00 13.45 ? 317  ILE A N   1 
ATOM   1566 C  CA  . ILE A 1 210 ? 25.967 25.752  49.373  1.00 13.41 ? 317  ILE A CA  1 
ATOM   1567 C  C   . ILE A 1 210 ? 26.317 24.878  50.583  1.00 15.81 ? 317  ILE A C   1 
ATOM   1568 O  O   . ILE A 1 210 ? 26.547 23.684  50.446  1.00 14.15 ? 317  ILE A O   1 
ATOM   1569 C  CB  . ILE A 1 210 ? 24.523 25.404  48.928  1.00 14.30 ? 317  ILE A CB  1 
ATOM   1570 C  CG1 . ILE A 1 210 ? 24.121 26.221  47.691  1.00 15.98 ? 317  ILE A CG1 1 
ATOM   1571 C  CG2 . ILE A 1 210 ? 23.536 25.566  50.100  1.00 11.72 ? 317  ILE A CG2 1 
ATOM   1572 C  CD1 . ILE A 1 210 ? 24.160 27.738  47.881  1.00 18.05 ? 317  ILE A CD1 1 
ATOM   1573 N  N   . SER A 1 211 ? 26.345 25.486  51.763  1.00 17.10 ? 318  SER A N   1 
ATOM   1574 C  CA  . SER A 1 211 ? 26.631 24.774  52.996  1.00 13.74 ? 318  SER A CA  1 
ATOM   1575 C  C   . SER A 1 211 ? 25.352 24.600  53.808  1.00 14.99 ? 318  SER A C   1 
ATOM   1576 O  O   . SER A 1 211 ? 24.268 24.975  53.353  1.00 15.18 ? 318  SER A O   1 
ATOM   1577 C  CB  . SER A 1 211 ? 27.701 25.516  53.799  1.00 15.02 ? 318  SER A CB  1 
ATOM   1578 O  OG  . SER A 1 211 ? 28.982 25.249  53.254  1.00 16.02 ? 318  SER A OG  1 
ATOM   1579 N  N   . SER A 1 212 ? 25.482 24.007  54.991  1.00 14.98 ? 319  SER A N   1 
ATOM   1580 C  CA  . SER A 1 212 ? 24.334 23.630  55.815  1.00 13.38 ? 319  SER A CA  1 
ATOM   1581 C  C   . SER A 1 212 ? 24.347 24.318  57.195  1.00 14.34 ? 319  SER A C   1 
ATOM   1582 O  O   . SER A 1 212 ? 25.394 24.684  57.709  1.00 15.76 ? 319  SER A O   1 
ATOM   1583 C  CB  . SER A 1 212 ? 24.296 22.115  56.027  1.00 12.54 ? 319  SER A CB  1 
ATOM   1584 O  OG  . SER A 1 212 ? 24.237 21.401  54.811  1.00 17.31 ? 319  SER A OG  1 
ATOM   1585 N  N   . ALA A 1 213 ? 23.164 24.470  57.777  1.00 14.73 ? 320  ALA A N   1 
ATOM   1586 C  CA  . ALA A 1 213 ? 22.989 24.905  59.154  1.00 13.21 ? 320  ALA A CA  1 
ATOM   1587 C  C   . ALA A 1 213 ? 21.992 23.960  59.822  1.00 11.26 ? 320  ALA A C   1 
ATOM   1588 O  O   . ALA A 1 213 ? 21.061 23.491  59.173  1.00 18.19 ? 320  ALA A O   1 
ATOM   1589 C  CB  . ALA A 1 213 ? 22.500 26.356  59.213  1.00 12.90 ? 320  ALA A CB  1 
ATOM   1590 N  N   . THR A 1 214 ? 22.188 23.657  61.097  1.00 13.81 ? 321  THR A N   1 
ATOM   1591 C  CA  . THR A 1 214 ? 21.263 22.778  61.821  1.00 16.29 ? 321  THR A CA  1 
ATOM   1592 C  C   . THR A 1 214 ? 20.000 23.528  62.210  1.00 20.92 ? 321  THR A C   1 
ATOM   1593 O  O   . THR A 1 214 ? 19.948 24.761  62.119  1.00 18.70 ? 321  THR A O   1 
ATOM   1594 C  CB  . THR A 1 214 ? 21.890 22.198  63.102  1.00 16.15 ? 321  THR A CB  1 
ATOM   1595 O  OG1 . THR A 1 214 ? 21.990 23.235  64.082  1.00 18.19 ? 321  THR A OG1 1 
ATOM   1596 C  CG2 . THR A 1 214 ? 23.266 21.640  62.825  1.00 15.18 ? 321  THR A CG2 1 
ATOM   1597 N  N   . GLN A 1 215 ? 18.990 22.788  62.660  1.00 15.02 ? 322  GLN A N   1 
ATOM   1598 C  CA  . GLN A 1 215 ? 17.719 23.399  63.032  1.00 18.31 ? 322  GLN A CA  1 
ATOM   1599 C  C   . GLN A 1 215 ? 17.890 24.530  64.049  1.00 25.82 ? 322  GLN A C   1 
ATOM   1600 O  O   . GLN A 1 215 ? 17.192 25.536  63.980  1.00 21.74 ? 322  GLN A O   1 
ATOM   1601 C  CB  . GLN A 1 215 ? 16.755 22.353  63.597  1.00 19.12 ? 322  GLN A CB  1 
ATOM   1602 C  CG  . GLN A 1 215 ? 15.370 22.918  63.952  1.00 19.37 ? 322  GLN A CG  1 
ATOM   1603 C  CD  . GLN A 1 215 ? 14.438 21.869  64.539  1.00 20.35 ? 322  GLN A CD  1 
ATOM   1604 O  OE1 . GLN A 1 215 ? 14.888 20.844  65.044  1.00 21.37 ? 322  GLN A OE1 1 
ATOM   1605 N  NE2 . GLN A 1 215 ? 13.133 22.119  64.466  1.00 21.94 ? 322  GLN A NE2 1 
ATOM   1606 N  N   . PHE A 1 216 ? 18.820 24.366  64.985  1.00 20.44 ? 323  PHE A N   1 
ATOM   1607 C  CA  . PHE A 1 216 ? 19.021 25.378  66.019  1.00 24.32 ? 323  PHE A CA  1 
ATOM   1608 C  C   . PHE A 1 216 ? 20.062 26.426  65.618  1.00 24.04 ? 323  PHE A C   1 
ATOM   1609 O  O   . PHE A 1 216 ? 20.527 27.192  66.452  1.00 25.25 ? 323  PHE A O   1 
ATOM   1610 C  CB  . PHE A 1 216 ? 19.422 24.714  67.335  1.00 24.35 ? 323  PHE A CB  1 
ATOM   1611 C  CG  . PHE A 1 216 ? 18.417 23.708  67.836  1.00 25.75 ? 323  PHE A CG  1 
ATOM   1612 C  CD1 . PHE A 1 216 ? 17.084 23.812  67.495  1.00 31.95 ? 323  PHE A CD1 1 
ATOM   1613 C  CD2 . PHE A 1 216 ? 18.812 22.662  68.651  1.00 33.41 ? 323  PHE A CD2 1 
ATOM   1614 C  CE1 . PHE A 1 216 ? 16.159 22.893  67.951  1.00 27.01 ? 323  PHE A CE1 1 
ATOM   1615 C  CE2 . PHE A 1 216 ? 17.893 21.740  69.113  1.00 31.09 ? 323  PHE A CE2 1 
ATOM   1616 C  CZ  . PHE A 1 216 ? 16.565 21.858  68.761  1.00 32.44 ? 323  PHE A CZ  1 
ATOM   1617 N  N   . GLY A 1 217 ? 20.427 26.451  64.338  1.00 23.88 ? 324  GLY A N   1 
ATOM   1618 C  CA  . GLY A 1 217 ? 21.325 27.470  63.818  1.00 21.29 ? 324  GLY A CA  1 
ATOM   1619 C  C   . GLY A 1 217 ? 22.803 27.235  64.072  1.00 22.36 ? 324  GLY A C   1 
ATOM   1620 O  O   . GLY A 1 217 ? 23.576 28.189  64.112  1.00 21.28 ? 324  GLY A O   1 
ATOM   1621 N  N   . ASN A 1 218 ? 23.205 25.977  64.235  1.00 16.24 ? 325  ASN A N   1 
ATOM   1622 C  CA  . ASN A 1 218 ? 24.610 25.664  64.484  1.00 18.69 ? 325  ASN A CA  1 
ATOM   1623 C  C   . ASN A 1 218 ? 25.324 25.092  63.262  1.00 17.30 ? 325  ASN A C   1 
ATOM   1624 O  O   . ASN A 1 218 ? 24.694 24.678  62.291  1.00 19.33 ? 325  ASN A O   1 
ATOM   1625 C  CB  . ASN A 1 218 ? 24.743 24.681  65.662  1.00 20.05 ? 325  ASN A CB  1 
ATOM   1626 C  CG  . ASN A 1 218 ? 24.165 25.244  66.943  1.00 27.53 ? 325  ASN A CG  1 
ATOM   1627 O  OD1 . ASN A 1 218 ? 24.412 26.397  67.280  1.00 27.07 ? 325  ASN A OD1 1 
ATOM   1628 N  ND2 . ASN A 1 218 ? 23.367 24.451  67.639  1.00 26.39 ? 325  ASN A ND2 1 
ATOM   1629 N  N   . VAL A 1 219 ? 26.647 25.096  63.318  1.00 17.38 ? 326  VAL A N   1 
ATOM   1630 C  CA  . VAL A 1 219 ? 27.464 24.482  62.292  1.00 18.52 ? 326  VAL A CA  1 
ATOM   1631 C  C   . VAL A 1 219 ? 27.362 22.980  62.470  1.00 20.13 ? 326  VAL A C   1 
ATOM   1632 O  O   . VAL A 1 219 ? 27.737 22.461  63.516  1.00 18.34 ? 326  VAL A O   1 
ATOM   1633 C  CB  . VAL A 1 219 ? 28.946 24.934  62.384  1.00 24.43 ? 326  VAL A CB  1 
ATOM   1634 C  CG1 . VAL A 1 219 ? 29.789 24.212  61.340  1.00 18.14 ? 326  VAL A CG1 1 
ATOM   1635 C  CG2 . VAL A 1 219 ? 29.072 26.459  62.214  1.00 19.65 ? 326  VAL A CG2 1 
ATOM   1636 N  N   . PRO A 1 220 ? 26.820 22.273  61.458  1.00 20.84 ? 327  PRO A N   1 
ATOM   1637 C  CA  . PRO A 1 220 ? 26.659 20.817  61.562  1.00 17.11 ? 327  PRO A CA  1 
ATOM   1638 C  C   . PRO A 1 220 ? 27.986 20.092  61.675  1.00 17.86 ? 327  PRO A C   1 
ATOM   1639 O  O   . PRO A 1 220 ? 28.996 20.608  61.207  1.00 15.94 ? 327  PRO A O   1 
ATOM   1640 C  CB  . PRO A 1 220 ? 25.955 20.441  60.248  1.00 17.49 ? 327  PRO A CB  1 
ATOM   1641 C  CG  . PRO A 1 220 ? 25.288 21.699  59.795  1.00 13.94 ? 327  PRO A CG  1 
ATOM   1642 C  CD  . PRO A 1 220 ? 26.235 22.801  60.214  1.00 16.69 ? 327  PRO A CD  1 
ATOM   1643 N  N   . TRP A 1 221 ? 27.971 18.897  62.257  1.00 22.08 ? 328  TRP A N   1 
ATOM   1644 C  CA  . TRP A 1 221 ? 29.196 18.130  62.461  1.00 20.98 ? 328  TRP A CA  1 
ATOM   1645 C  C   . TRP A 1 221 ? 29.923 17.816  61.151  1.00 17.59 ? 328  TRP A C   1 
ATOM   1646 O  O   . TRP A 1 221 ? 31.139 17.693  61.138  1.00 14.97 ? 328  TRP A O   1 
ATOM   1647 C  CB  . TRP A 1 221 ? 28.891 16.824  63.208  1.00 18.50 ? 328  TRP A CB  1 
ATOM   1648 C  CG  . TRP A 1 221 ? 27.951 15.881  62.492  1.00 23.07 ? 328  TRP A CG  1 
ATOM   1649 C  CD1 . TRP A 1 221 ? 26.589 15.831  62.610  1.00 27.68 ? 328  TRP A CD1 1 
ATOM   1650 C  CD2 . TRP A 1 221 ? 28.308 14.848  61.564  1.00 20.91 ? 328  TRP A CD2 1 
ATOM   1651 N  NE1 . TRP A 1 221 ? 26.080 14.832  61.813  1.00 24.74 ? 328  TRP A NE1 1 
ATOM   1652 C  CE2 . TRP A 1 221 ? 27.114 14.214  61.162  1.00 26.10 ? 328  TRP A CE2 1 
ATOM   1653 C  CE3 . TRP A 1 221 ? 29.519 14.397  61.037  1.00 26.54 ? 328  TRP A CE3 1 
ATOM   1654 C  CZ2 . TRP A 1 221 ? 27.098 13.154  60.252  1.00 25.20 ? 328  TRP A CZ2 1 
ATOM   1655 C  CZ3 . TRP A 1 221 ? 29.501 13.334  60.134  1.00 28.50 ? 328  TRP A CZ3 1 
ATOM   1656 C  CH2 . TRP A 1 221 ? 28.302 12.731  59.756  1.00 27.97 ? 328  TRP A CH2 1 
ATOM   1657 N  N   . TYR A 1 222 ? 29.169 17.693  60.060  1.00 16.09 ? 329  TYR A N   1 
ATOM   1658 C  CA  . TYR A 1 222 ? 29.716 17.281  58.771  1.00 15.96 ? 329  TYR A CA  1 
ATOM   1659 C  C   . TYR A 1 222 ? 30.213 18.460  57.934  1.00 18.13 ? 329  TYR A C   1 
ATOM   1660 O  O   . TYR A 1 222 ? 30.768 18.272  56.853  1.00 16.28 ? 329  TYR A O   1 
ATOM   1661 C  CB  . TYR A 1 222 ? 28.655 16.493  57.975  1.00 15.60 ? 329  TYR A CB  1 
ATOM   1662 C  CG  . TYR A 1 222 ? 27.322 17.212  57.866  1.00 17.20 ? 329  TYR A CG  1 
ATOM   1663 C  CD1 . TYR A 1 222 ? 27.126 18.243  56.940  1.00 13.61 ? 329  TYR A CD1 1 
ATOM   1664 C  CD2 . TYR A 1 222 ? 26.262 16.866  58.693  1.00 16.03 ? 329  TYR A CD2 1 
ATOM   1665 C  CE1 . TYR A 1 222 ? 25.899 18.915  56.853  1.00 12.00 ? 329  TYR A CE1 1 
ATOM   1666 C  CE2 . TYR A 1 222 ? 25.034 17.517  58.605  1.00 15.26 ? 329  TYR A CE2 1 
ATOM   1667 C  CZ  . TYR A 1 222 ? 24.863 18.541  57.692  1.00 13.39 ? 329  TYR A CZ  1 
ATOM   1668 O  OH  . TYR A 1 222 ? 23.656 19.180  57.623  1.00 13.64 ? 329  TYR A OH  1 
ATOM   1669 N  N   . SER A 1 223 ? 29.998 19.674  58.432  1.00 18.28 ? 330  SER A N   1 
ATOM   1670 C  CA  . SER A 1 223 ? 30.238 20.881  57.646  1.00 19.14 ? 330  SER A CA  1 
ATOM   1671 C  C   . SER A 1 223 ? 31.718 21.201  57.391  1.00 15.63 ? 330  SER A C   1 
ATOM   1672 O  O   . SER A 1 223 ? 32.553 21.129  58.284  1.00 16.56 ? 330  SER A O   1 
ATOM   1673 C  CB  . SER A 1 223 ? 29.576 22.081  58.332  1.00 18.08 ? 330  SER A CB  1 
ATOM   1674 O  OG  . SER A 1 223 ? 30.174 23.286  57.897  1.00 22.26 ? 330  SER A OG  1 
ATOM   1675 N  N   . GLU A 1 224 ? 32.030 21.553  56.151  1.00 13.98 ? 331  GLU A N   1 
ATOM   1676 C  CA  . GLU A 1 224 ? 33.373 21.976  55.797  1.00 16.26 ? 331  GLU A CA  1 
ATOM   1677 C  C   . GLU A 1 224 ? 33.423 23.486  55.666  1.00 16.36 ? 331  GLU A C   1 
ATOM   1678 O  O   . GLU A 1 224 ? 32.551 24.085  55.043  1.00 18.37 ? 331  GLU A O   1 
ATOM   1679 C  CB  . GLU A 1 224 ? 33.830 21.345  54.489  1.00 15.24 ? 331  GLU A CB  1 
ATOM   1680 C  CG  . GLU A 1 224 ? 33.857 19.820  54.493  1.00 14.87 ? 331  GLU A CG  1 
ATOM   1681 C  CD  . GLU A 1 224 ? 34.358 19.258  53.174  1.00 15.96 ? 331  GLU A CD  1 
ATOM   1682 O  OE1 . GLU A 1 224 ? 33.890 18.161  52.805  1.00 15.06 ? 331  GLU A OE1 1 
ATOM   1683 O  OE2 . GLU A 1 224 ? 35.221 19.904  52.521  1.00 11.32 ? 331  GLU A OE2 1 
ATOM   1684 N  N   . ALA A 1 225 ? 34.455 24.091  56.232  1.00 16.24 ? 332  ALA A N   1 
ATOM   1685 C  CA  . ALA A 1 225 ? 34.632 25.530  56.134  1.00 15.53 ? 332  ALA A CA  1 
ATOM   1686 C  C   . ALA A 1 225 ? 35.563 25.843  54.973  1.00 15.14 ? 332  ALA A C   1 
ATOM   1687 O  O   . ALA A 1 225 ? 36.508 25.107  54.730  1.00 19.45 ? 332  ALA A O   1 
ATOM   1688 C  CB  . ALA A 1 225 ? 35.189 26.093  57.439  1.00 15.58 ? 332  ALA A CB  1 
ATOM   1689 N  N   . CYS A 1 226 ? 35.271 26.912  54.237  1.00 15.58 ? 333  CYS A N   1 
ATOM   1690 C  CA  . CYS A 1 226 ? 36.180 27.415  53.208  1.00 15.24 ? 333  CYS A CA  1 
ATOM   1691 C  C   . CYS A 1 226 ? 35.685 28.750  52.685  1.00 13.42 ? 333  CYS A C   1 
ATOM   1692 O  O   . CYS A 1 226 ? 34.541 29.131  52.927  1.00 16.64 ? 333  CYS A O   1 
ATOM   1693 C  CB  . CYS A 1 226 ? 36.323 26.438  52.049  1.00 16.87 ? 333  CYS A CB  1 
ATOM   1694 S  SG  . CYS A 1 226 ? 34.797 26.134  51.178  1.00 25.45 ? 333  CYS A SG  1 
ATOM   1695 N  N   . SER A 1 227 ? 36.540 29.437  51.937  1.00 14.14 ? 334  SER A N   1 
ATOM   1696 C  CA  . SER A 1 227 ? 36.211 30.769  51.436  1.00 13.76 ? 334  SER A CA  1 
ATOM   1697 C  C   . SER A 1 227 ? 35.350 30.750  50.159  1.00 14.81 ? 334  SER A C   1 
ATOM   1698 O  O   . SER A 1 227 ? 34.845 31.796  49.738  1.00 14.27 ? 334  SER A O   1 
ATOM   1699 C  CB  . SER A 1 227 ? 37.508 31.570  51.192  1.00 12.29 ? 334  SER A CB  1 
ATOM   1700 O  OG  . SER A 1 227 ? 38.395 30.898  50.305  1.00 14.77 ? 334  SER A OG  1 
ATOM   1701 N  N   . SER A 1 228 ? 35.188 29.583  49.531  1.00 14.43 ? 335  SER A N   1 
ATOM   1702 C  CA  . SER A 1 228 ? 34.493 29.520  48.233  1.00 12.79 ? 335  SER A CA  1 
ATOM   1703 C  C   . SER A 1 228 ? 32.969 29.357  48.371  1.00 18.00 ? 335  SER A C   1 
ATOM   1704 O  O   . SER A 1 228 ? 32.225 29.555  47.419  1.00 16.55 ? 335  SER A O   1 
ATOM   1705 C  CB  . SER A 1 228 ? 35.057 28.379  47.365  1.00 19.30 ? 335  SER A CB  1 
ATOM   1706 O  OG  . SER A 1 228 ? 34.816 27.112  47.967  1.00 16.22 ? 335  SER A OG  1 
ATOM   1707 N  N   . THR A 1 229 ? 32.511 29.000  49.560  1.00 16.89 ? 336  THR A N   1 
ATOM   1708 C  CA  . THR A 1 229 ? 31.084 28.841  49.814  1.00 17.19 ? 336  THR A CA  1 
ATOM   1709 C  C   . THR A 1 229 ? 30.372 30.185  49.695  1.00 16.45 ? 336  THR A C   1 
ATOM   1710 O  O   . THR A 1 229 ? 30.904 31.203  50.130  1.00 14.01 ? 336  THR A O   1 
ATOM   1711 C  CB  . THR A 1 229 ? 30.862 28.224  51.204  1.00 17.75 ? 336  THR A CB  1 
ATOM   1712 O  OG1 . THR A 1 229 ? 31.418 26.900  51.209  1.00 17.24 ? 336  THR A OG1 1 
ATOM   1713 C  CG2 . THR A 1 229 ? 29.389 28.181  51.571  1.00 16.57 ? 336  THR A CG2 1 
ATOM   1714 N  N   . LEU A 1 230 ? 29.184 30.183  49.088  1.00 13.94 ? 337  LEU A N   1 
ATOM   1715 C  CA  . LEU A 1 230 ? 28.441 31.415  48.850  1.00 15.19 ? 337  LEU A CA  1 
ATOM   1716 C  C   . LEU A 1 230 ? 27.319 31.652  49.866  1.00 16.66 ? 337  LEU A C   1 
ATOM   1717 O  O   . LEU A 1 230 ? 27.143 32.773  50.352  1.00 14.31 ? 337  LEU A O   1 
ATOM   1718 C  CB  . LEU A 1 230 ? 27.860 31.407  47.436  1.00 14.89 ? 337  LEU A CB  1 
ATOM   1719 C  CG  . LEU A 1 230 ? 27.508 32.774  46.856  1.00 21.12 ? 337  LEU A CG  1 
ATOM   1720 C  CD1 . LEU A 1 230 ? 28.729 33.685  46.837  1.00 16.94 ? 337  LEU A CD1 1 
ATOM   1721 C  CD2 . LEU A 1 230 ? 26.941 32.585  45.454  1.00 20.25 ? 337  LEU A CD2 1 
ATOM   1722 N  N   . ALA A 1 231 ? 26.553 30.602  50.169  1.00 13.35 ? 338  ALA A N   1 
ATOM   1723 C  CA  . ALA A 1 231 ? 25.457 30.722  51.115  1.00 11.37 ? 338  ALA A CA  1 
ATOM   1724 C  C   . ALA A 1 231 ? 25.058 29.369  51.688  1.00 11.11 ? 338  ALA A C   1 
ATOM   1725 O  O   . ALA A 1 231 ? 25.685 28.356  51.382  1.00 15.22 ? 338  ALA A O   1 
ATOM   1726 C  CB  . ALA A 1 231 ? 24.262 31.401  50.460  1.00 11.33 ? 338  ALA A CB  1 
ATOM   1727 N  N   . THR A 1 232 ? 24.014 29.375  52.516  1.00 13.79 ? 339  THR A N   1 
ATOM   1728 C  CA  . THR A 1 232 ? 23.618 28.252  53.365  1.00 12.60 ? 339  THR A CA  1 
ATOM   1729 C  C   . THR A 1 232 ? 22.126 27.957  53.297  1.00 14.80 ? 339  THR A C   1 
ATOM   1730 O  O   . THR A 1 232 ? 21.327 28.874  53.171  1.00 14.28 ? 339  THR A O   1 
ATOM   1731 C  CB  . THR A 1 232 ? 23.965 28.549  54.843  1.00 16.13 ? 339  THR A CB  1 
ATOM   1732 O  OG1 . THR A 1 232 ? 25.360 28.824  54.948  1.00 17.81 ? 339  THR A OG1 1 
ATOM   1733 C  CG2 . THR A 1 232 ? 23.609 27.371  55.763  1.00 15.17 ? 339  THR A CG2 1 
ATOM   1734 N  N   . THR A 1 233 ? 21.748 26.682  53.377  1.00 14.01 ? 340  THR A N   1 
ATOM   1735 C  CA  . THR A 1 233 ? 20.375 26.348  53.731  1.00 11.96 ? 340  THR A CA  1 
ATOM   1736 C  C   . THR A 1 233 ? 20.368 25.396  54.931  1.00 17.31 ? 340  THR A C   1 
ATOM   1737 O  O   . THR A 1 233 ? 21.373 24.771  55.240  1.00 16.20 ? 340  THR A O   1 
ATOM   1738 C  CB  . THR A 1 233 ? 19.590 25.694  52.567  1.00 18.29 ? 340  THR A CB  1 
ATOM   1739 O  OG1 . THR A 1 233 ? 20.051 24.362  52.372  1.00 20.18 ? 340  THR A OG1 1 
ATOM   1740 C  CG2 . THR A 1 233 ? 19.739 26.474  51.259  1.00 18.11 ? 340  THR A CG2 1 
ATOM   1741 N  N   . TYR A 1 234 ? 19.227 25.302  55.605  1.00 15.19 ? 341  TYR A N   1 
ATOM   1742 C  CA  . TYR A 1 234 ? 19.060 24.372  56.697  1.00 18.71 ? 341  TYR A CA  1 
ATOM   1743 C  C   . TYR A 1 234 ? 19.241 22.935  56.224  1.00 16.62 ? 341  TYR A C   1 
ATOM   1744 O  O   . TYR A 1 234 ? 18.899 22.608  55.097  1.00 17.82 ? 341  TYR A O   1 
ATOM   1745 C  CB  . TYR A 1 234 ? 17.677 24.541  57.329  1.00 17.55 ? 341  TYR A CB  1 
ATOM   1746 C  CG  . TYR A 1 234 ? 17.567 25.748  58.225  1.00 17.92 ? 341  TYR A CG  1 
ATOM   1747 C  CD1 . TYR A 1 234 ? 18.271 25.805  59.410  1.00 18.04 ? 341  TYR A CD1 1 
ATOM   1748 C  CD2 . TYR A 1 234 ? 16.754 26.827  57.888  1.00 20.19 ? 341  TYR A CD2 1 
ATOM   1749 C  CE1 . TYR A 1 234 ? 18.185 26.907  60.243  1.00 23.63 ? 341  TYR A CE1 1 
ATOM   1750 C  CE2 . TYR A 1 234 ? 16.655 27.935  58.717  1.00 19.85 ? 341  TYR A CE2 1 
ATOM   1751 C  CZ  . TYR A 1 234 ? 17.370 27.964  59.897  1.00 24.40 ? 341  TYR A CZ  1 
ATOM   1752 O  OH  . TYR A 1 234 ? 17.294 29.042  60.744  1.00 22.83 ? 341  TYR A OH  1 
ATOM   1753 N  N   . SER A 1 235 ? 19.789 22.094  57.095  1.00 18.86 ? 342  SER A N   1 
ATOM   1754 C  CA  . SER A 1 235 ? 19.825 20.656  56.878  1.00 17.52 ? 342  SER A CA  1 
ATOM   1755 C  C   . SER A 1 235 ? 19.781 19.924  58.233  1.00 17.34 ? 342  SER A C   1 
ATOM   1756 O  O   . SER A 1 235 ? 19.279 20.460  59.215  1.00 19.07 ? 342  SER A O   1 
ATOM   1757 C  CB  . SER A 1 235 ? 21.066 20.258  56.073  1.00 19.46 ? 342  SER A CB  1 
ATOM   1758 O  OG  . SER A 1 235 ? 21.004 18.896  55.680  1.00 18.09 ? 342  SER A OG  1 
ATOM   1759 N  N   . SER A 1 236 ? 20.298 18.701  58.273  1.00 18.22 ? 343  SER A N   1 
ATOM   1760 C  CA  . SER A 1 236 ? 20.260 17.877  59.478  1.00 19.33 ? 343  SER A CA  1 
ATOM   1761 C  C   . SER A 1 236 ? 21.345 18.304  60.473  1.00 15.74 ? 343  SER A C   1 
ATOM   1762 O  O   . SER A 1 236 ? 22.300 18.996  60.100  1.00 14.02 ? 343  SER A O   1 
ATOM   1763 C  CB  . SER A 1 236 ? 20.427 16.400  59.109  1.00 17.32 ? 343  SER A CB  1 
ATOM   1764 O  OG  . SER A 1 236 ? 21.710 16.188  58.551  1.00 18.13 ? 343  SER A OG  1 
ATOM   1765 N  N   . GLY A 1 237 ? 21.191 17.890  61.731  1.00 16.66 ? 344  GLY A N   1 
ATOM   1766 C  CA  . GLY A 1 237 ? 22.138 18.245  62.780  1.00 18.16 ? 344  GLY A CA  1 
ATOM   1767 C  C   . GLY A 1 237 ? 22.386 17.131  63.793  1.00 21.46 ? 344  GLY A C   1 
ATOM   1768 O  O   . GLY A 1 237 ? 22.674 16.012  63.400  1.00 20.57 ? 344  GLY A O   1 
ATOM   1769 N  N   . ASN A 1 238 ? 22.286 17.436  65.087  1.00 20.66 ? 345  ASN A N   1 
ATOM   1770 C  CA  . ASN A 1 238 ? 22.523 16.423  66.116  1.00 26.34 ? 345  ASN A CA  1 
ATOM   1771 C  C   . ASN A 1 238 ? 21.257 15.601  66.333  1.00 21.85 ? 345  ASN A C   1 
ATOM   1772 O  O   . ASN A 1 238 ? 20.274 15.806  65.637  1.00 21.09 ? 345  ASN A O   1 
ATOM   1773 C  CB  . ASN A 1 238 ? 23.037 17.052  67.430  1.00 28.06 ? 345  ASN A CB  1 
ATOM   1774 C  CG  . ASN A 1 238 ? 21.994 17.921  68.164  1.00 31.04 ? 345  ASN A CG  1 
ATOM   1775 O  OD1 . ASN A 1 238 ? 20.785 17.686  68.106  1.00 38.11 ? 345  ASN A OD1 1 
ATOM   1776 N  ND2 . ASN A 1 238 ? 22.488 18.916  68.902  1.00 36.95 ? 345  ASN A ND2 1 
ATOM   1777 N  N   . GLN A 1 239 ? 21.272 14.681  67.294  1.00 24.16 ? 346  GLN A N   1 
ATOM   1778 C  CA  . GLN A 1 239 ? 20.153 13.752  67.447  1.00 29.39 ? 346  GLN A CA  1 
ATOM   1779 C  C   . GLN A 1 239 ? 18.902 14.462  67.952  1.00 27.68 ? 346  GLN A C   1 
ATOM   1780 O  O   . GLN A 1 239 ? 17.791 13.986  67.743  1.00 29.32 ? 346  GLN A O   1 
ATOM   1781 C  CB  . GLN A 1 239 ? 20.526 12.581  68.376  1.00 25.69 ? 346  GLN A CB  1 
ATOM   1782 C  CG  . GLN A 1 239 ? 21.042 12.977  69.742  1.00 32.10 ? 346  GLN A CG  1 
ATOM   1783 C  CD  . GLN A 1 239 ? 21.281 11.779  70.654  1.00 36.91 ? 346  GLN A CD  1 
ATOM   1784 O  OE1 . GLN A 1 239 ? 22.066 11.857  71.599  0.00 34.06 ? 346  GLN A OE1 1 
ATOM   1785 N  NE2 . GLN A 1 239 ? 20.598 10.674  70.379  0.00 34.22 ? 346  GLN A NE2 1 
ATOM   1786 N  N   . ASN A 1 240 ? 19.081 15.617  68.580  1.00 27.52 ? 347  ASN A N   1 
ATOM   1787 C  CA  . ASN A 1 240 ? 17.956 16.400  69.092  1.00 28.23 ? 347  ASN A CA  1 
ATOM   1788 C  C   . ASN A 1 240 ? 17.342 17.338  68.041  1.00 28.94 ? 347  ASN A C   1 
ATOM   1789 O  O   . ASN A 1 240 ? 16.370 18.041  68.315  1.00 32.02 ? 347  ASN A O   1 
ATOM   1790 C  CB  . ASN A 1 240 ? 18.402 17.214  70.312  1.00 29.65 ? 347  ASN A CB  1 
ATOM   1791 C  CG  . ASN A 1 240 ? 19.085 16.359  71.367  0.00 31.85 ? 347  ASN A CG  1 
ATOM   1792 O  OD1 . ASN A 1 240 ? 18.565 15.320  71.774  0.00 32.34 ? 347  ASN A OD1 1 
ATOM   1793 N  ND2 . ASN A 1 240 ? 20.262 16.791  71.808  0.00 33.27 ? 347  ASN A ND2 1 
ATOM   1794 N  N   . GLU A 1 241 ? 17.903 17.345  66.837  1.00 22.76 ? 348  GLU A N   1 
ATOM   1795 C  CA  . GLU A 1 241 ? 17.437 18.249  65.790  1.00 19.90 ? 348  GLU A CA  1 
ATOM   1796 C  C   . GLU A 1 241 ? 16.740 17.523  64.632  1.00 17.93 ? 348  GLU A C   1 
ATOM   1797 O  O   . GLU A 1 241 ? 17.149 16.442  64.234  1.00 18.36 ? 348  GLU A O   1 
ATOM   1798 C  CB  . GLU A 1 241 ? 18.615 19.079  65.277  1.00 24.70 ? 348  GLU A CB  1 
ATOM   1799 C  CG  . GLU A 1 241 ? 19.170 20.017  66.361  1.00 25.77 ? 348  GLU A CG  1 
ATOM   1800 C  CD  . GLU A 1 241 ? 20.391 20.798  65.936  1.00 23.52 ? 348  GLU A CD  1 
ATOM   1801 O  OE1 . GLU A 1 241 ? 20.275 22.035  65.785  1.00 25.16 ? 348  GLU A OE1 1 
ATOM   1802 O  OE2 . GLU A 1 241 ? 21.468 20.190  65.771  1.00 27.77 ? 348  GLU A OE2 1 
ATOM   1803 N  N   . LYS A 1 242 ? 15.695 18.142  64.085  1.00 21.42 ? 349  LYS A N   1 
ATOM   1804 C  CA  . LYS A 1 242 ? 14.916 17.525  63.016  1.00 25.44 ? 349  LYS A CA  1 
ATOM   1805 C  C   . LYS A 1 242 ? 15.721 17.505  61.719  1.00 19.86 ? 349  LYS A C   1 
ATOM   1806 O  O   . LYS A 1 242 ? 16.728 18.179  61.609  1.00 20.99 ? 349  LYS A O   1 
ATOM   1807 C  CB  . LYS A 1 242 ? 13.588 18.259  62.816  1.00 20.44 ? 349  LYS A CB  1 
ATOM   1808 C  CG  . LYS A 1 242 ? 12.648 18.190  64.018  1.00 26.38 ? 349  LYS A CG  1 
ATOM   1809 C  CD  . LYS A 1 242 ? 12.423 16.755  64.425  1.00 29.00 ? 349  LYS A CD  1 
ATOM   1810 C  CE  . LYS A 1 242 ? 11.399 16.650  65.541  0.00 28.29 ? 349  LYS A CE  1 
ATOM   1811 N  NZ  . LYS A 1 242 ? 11.231 15.243  65.994  0.00 30.89 ? 349  LYS A NZ  1 
ATOM   1812 N  N   . GLN A 1 243 ? 15.271 16.724  60.746  1.00 20.73 ? 350  GLN A N   1 
ATOM   1813 C  CA  . GLN A 1 243 ? 16.021 16.545  59.509  1.00 22.53 ? 350  GLN A CA  1 
ATOM   1814 C  C   . GLN A 1 243 ? 15.130 16.826  58.300  1.00 22.50 ? 350  GLN A C   1 
ATOM   1815 O  O   . GLN A 1 243 ? 14.061 17.424  58.436  1.00 21.73 ? 350  GLN A O   1 
ATOM   1816 C  CB  . GLN A 1 243 ? 16.627 15.131  59.459  1.00 20.39 ? 350  GLN A CB  1 
ATOM   1817 C  CG  . GLN A 1 243 ? 17.529 14.849  60.671  1.00 17.98 ? 350  GLN A CG  1 
ATOM   1818 C  CD  . GLN A 1 243 ? 18.219 13.496  60.640  1.00 25.06 ? 350  GLN A CD  1 
ATOM   1819 O  OE1 . GLN A 1 243 ? 17.797 12.573  59.944  1.00 23.44 ? 350  GLN A OE1 1 
ATOM   1820 N  NE2 . GLN A 1 243 ? 19.297 13.379  61.401  1.00 29.98 ? 350  GLN A NE2 1 
ATOM   1821 N  N   . ILE A 1 244 ? 15.570 16.415  57.115  1.00 21.73 ? 351  ILE A N   1 
ATOM   1822 C  CA  . ILE A 1 244 ? 14.864 16.792  55.902  1.00 17.83 ? 351  ILE A CA  1 
ATOM   1823 C  C   . ILE A 1 244 ? 13.867 15.717  55.474  1.00 17.11 ? 351  ILE A C   1 
ATOM   1824 O  O   . ILE A 1 244 ? 14.159 14.521  55.509  1.00 19.57 ? 351  ILE A O   1 
ATOM   1825 C  CB  . ILE A 1 244 ? 15.869 17.096  54.765  1.00 21.29 ? 351  ILE A CB  1 
ATOM   1826 C  CG1 . ILE A 1 244 ? 16.861 18.171  55.223  1.00 21.02 ? 351  ILE A CG1 1 
ATOM   1827 C  CG2 . ILE A 1 244 ? 15.159 17.525  53.502  1.00 21.03 ? 351  ILE A CG2 1 
ATOM   1828 C  CD1 . ILE A 1 244 ? 16.234 19.506  55.531  1.00 23.84 ? 351  ILE A CD1 1 
ATOM   1829 N  N   . VAL A 1 245 ? 12.682 16.177  55.081  1.00 18.95 ? 352  VAL A N   1 
ATOM   1830 C  CA  . VAL A 1 245 ? 11.555 15.325  54.719  1.00 19.76 ? 352  VAL A CA  1 
ATOM   1831 C  C   . VAL A 1 245 ? 11.410 15.328  53.216  1.00 20.04 ? 352  VAL A C   1 
ATOM   1832 O  O   . VAL A 1 245 ? 11.215 16.385  52.625  1.00 20.57 ? 352  VAL A O   1 
ATOM   1833 C  CB  . VAL A 1 245 ? 10.232 15.827  55.347  1.00 24.76 ? 352  VAL A CB  1 
ATOM   1834 C  CG1 . VAL A 1 245 ? 9.031  15.016  54.840  1.00 24.40 ? 352  VAL A CG1 1 
ATOM   1835 C  CG2 . VAL A 1 245 ? 10.321 15.808  56.866  1.00 20.76 ? 352  VAL A CG2 1 
ATOM   1836 N  N   . THR A 1 246 ? 11.500 14.161  52.588  1.00 18.01 ? 353  THR A N   1 
ATOM   1837 C  CA  . THR A 1 246 ? 11.509 14.116  51.133  1.00 15.99 ? 353  THR A CA  1 
ATOM   1838 C  C   . THR A 1 246 ? 11.097 12.739  50.617  1.00 17.70 ? 353  THR A C   1 
ATOM   1839 O  O   . THR A 1 246 ? 10.803 11.836  51.395  1.00 20.39 ? 353  THR A O   1 
ATOM   1840 C  CB  . THR A 1 246 ? 12.919 14.486  50.576  1.00 19.63 ? 353  THR A CB  1 
ATOM   1841 O  OG1 . THR A 1 246 ? 12.852 14.712  49.162  1.00 16.08 ? 353  THR A OG1 1 
ATOM   1842 C  CG2 . THR A 1 246 ? 13.919 13.369  50.869  1.00 13.86 ? 353  THR A CG2 1 
ATOM   1843 N  N   . THR A 1 247 ? 11.072 12.602  49.297  1.00 17.91 ? 354  THR A N   1 
ATOM   1844 C  CA  . THR A 1 247 ? 10.756 11.355  48.618  1.00 17.02 ? 354  THR A CA  1 
ATOM   1845 C  C   . THR A 1 247 ? 11.899 10.351  48.726  1.00 16.73 ? 354  THR A C   1 
ATOM   1846 O  O   . THR A 1 247 ? 13.056 10.723  48.582  1.00 19.60 ? 354  THR A O   1 
ATOM   1847 C  CB  . THR A 1 247 ? 10.469 11.619  47.140  1.00 17.29 ? 354  THR A CB  1 
ATOM   1848 O  OG1 . THR A 1 247 ? 11.514 12.445  46.604  1.00 14.56 ? 354  THR A OG1 1 
ATOM   1849 C  CG2 . THR A 1 247 ? 9.148  12.351  46.997  1.00 16.81 ? 354  THR A CG2 1 
ATOM   1850 N  N   . ASP A 1 248 ? 11.574 9.082   48.962  1.00 16.60 ? 355  ASP A N   1 
ATOM   1851 C  CA  . ASP A 1 248 ? 12.586 8.017   49.026  1.00 17.24 ? 355  ASP A CA  1 
ATOM   1852 C  C   . ASP A 1 248 ? 12.318 6.931   47.987  1.00 19.54 ? 355  ASP A C   1 
ATOM   1853 O  O   . ASP A 1 248 ? 11.200 6.809   47.471  1.00 17.14 ? 355  ASP A O   1 
ATOM   1854 C  CB  . ASP A 1 248 ? 12.617 7.387   50.422  1.00 20.07 ? 355  ASP A CB  1 
ATOM   1855 C  CG  . ASP A 1 248 ? 13.997 6.854   50.813  1.00 19.25 ? 355  ASP A CG  1 
ATOM   1856 O  OD1 . ASP A 1 248 ? 14.946 6.883   49.999  1.00 17.42 ? 355  ASP A OD1 1 
ATOM   1857 O  OD2 . ASP A 1 248 ? 14.136 6.414   51.967  1.00 22.92 ? 355  ASP A OD2 1 
ATOM   1858 N  N   . LEU A 1 249 ? 13.354 6.147   47.691  1.00 20.07 ? 356  LEU A N   1 
ATOM   1859 C  CA  . LEU A 1 249 ? 13.250 4.980   46.819  1.00 19.44 ? 356  LEU A CA  1 
ATOM   1860 C  C   . LEU A 1 249 ? 12.121 4.035   47.233  1.00 20.07 ? 356  LEU A C   1 
ATOM   1861 O  O   . LEU A 1 249 ? 11.779 3.957   48.410  1.00 21.05 ? 356  LEU A O   1 
ATOM   1862 C  CB  . LEU A 1 249 ? 14.561 4.196   46.821  1.00 20.83 ? 356  LEU A CB  1 
ATOM   1863 C  CG  . LEU A 1 249 ? 15.616 4.289   45.729  1.00 31.06 ? 356  LEU A CG  1 
ATOM   1864 C  CD1 . LEU A 1 249 ? 16.509 3.043   45.862  1.00 19.45 ? 356  LEU A CD1 1 
ATOM   1865 C  CD2 . LEU A 1 249 ? 15.030 4.411   44.320  1.00 21.26 ? 356  LEU A CD2 1 
ATOM   1866 N  N   . ARG A 1 250 ? 11.575 3.317   46.252  1.00 19.00 ? 357  ARG A N   1 
ATOM   1867 C  CA  . ARG A 1 250 ? 10.463 2.375   46.439  1.00 19.95 ? 357  ARG A CA  1 
ATOM   1868 C  C   . ARG A 1 250 ? 9.202  3.092   46.916  1.00 23.79 ? 357  ARG A C   1 
ATOM   1869 O  O   . ARG A 1 250 ? 8.415  2.559   47.711  1.00 18.45 ? 357  ARG A O   1 
ATOM   1870 C  CB  . ARG A 1 250 ? 10.850 1.253   47.411  1.00 20.91 ? 357  ARG A CB  1 
ATOM   1871 C  CG  . ARG A 1 250 ? 12.167 0.582   47.054  1.00 18.56 ? 357  ARG A CG  1 
ATOM   1872 C  CD  . ARG A 1 250 ? 12.437 -0.631  47.936  1.00 27.03 ? 357  ARG A CD  1 
ATOM   1873 N  NE  . ARG A 1 250 ? 13.704 -1.262  47.585  1.00 30.68 ? 357  ARG A NE  1 
ATOM   1874 C  CZ  . ARG A 1 250 ? 13.828 -2.257  46.712  1.00 27.02 ? 357  ARG A CZ  1 
ATOM   1875 N  NH1 . ARG A 1 250 ? 15.027 -2.757  46.457  1.00 23.34 ? 357  ARG A NH1 1 
ATOM   1876 N  NH2 . ARG A 1 250 ? 12.757 -2.750  46.096  1.00 20.77 ? 357  ARG A NH2 1 
ATOM   1877 N  N   . GLN A 1 251 ? 9.024  4.309   46.407  1.00 20.10 ? 358  GLN A N   1 
ATOM   1878 C  CA  . GLN A 1 251 ? 7.783  5.053   46.564  1.00 21.86 ? 358  GLN A CA  1 
ATOM   1879 C  C   . GLN A 1 251 ? 7.469  5.362   48.020  1.00 17.46 ? 358  GLN A C   1 
ATOM   1880 O  O   . GLN A 1 251 ? 6.313  5.471   48.406  1.00 22.04 ? 358  GLN A O   1 
ATOM   1881 C  CB  . GLN A 1 251 ? 6.631  4.276   45.917  1.00 22.34 ? 358  GLN A CB  1 
ATOM   1882 C  CG  . GLN A 1 251 ? 6.891  3.996   44.445  1.00 22.77 ? 358  GLN A CG  1 
ATOM   1883 C  CD  . GLN A 1 251 ? 5.650  3.536   43.712  1.00 30.41 ? 358  GLN A CD  1 
ATOM   1884 O  OE1 . GLN A 1 251 ? 4.657  3.158   44.327  1.00 44.39 ? 358  GLN A OE1 1 
ATOM   1885 N  NE2 . GLN A 1 251 ? 5.696  3.577   42.389  1.00 37.60 ? 358  GLN A NE2 1 
ATOM   1886 N  N   . LYS A 1 252 ? 8.505  5.524   48.824  1.00 17.99 ? 359  LYS A N   1 
ATOM   1887 C  CA  . LYS A 1 252 ? 8.325  5.868   50.228  1.00 19.19 ? 359  LYS A CA  1 
ATOM   1888 C  C   . LYS A 1 252 ? 8.620  7.329   50.527  1.00 19.39 ? 359  LYS A C   1 
ATOM   1889 O  O   . LYS A 1 252 ? 9.004  8.103   49.643  1.00 19.18 ? 359  LYS A O   1 
ATOM   1890 C  CB  . LYS A 1 252 ? 9.214  4.980   51.097  1.00 24.63 ? 359  LYS A CB  1 
ATOM   1891 C  CG  . LYS A 1 252 ? 8.906  3.491   50.942  1.00 20.58 ? 359  LYS A CG  1 
ATOM   1892 C  CD  . LYS A 1 252 ? 9.699  2.684   51.936  1.00 28.03 ? 359  LYS A CD  1 
ATOM   1893 C  CE  . LYS A 1 252 ? 9.426  1.196   51.792  1.00 31.48 ? 359  LYS A CE  1 
ATOM   1894 N  NZ  . LYS A 1 252 ? 9.670  0.481   53.084  1.00 43.13 ? 359  LYS A NZ  1 
ATOM   1895 N  N   . CYS A 1 253 ? 8.428  7.676   51.791  1.00 19.16 ? 360  CYS A N   1 
ATOM   1896 C  CA  . CYS A 1 253 ? 8.668  9.004   52.330  1.00 24.58 ? 360  CYS A CA  1 
ATOM   1897 C  C   . CYS A 1 253 ? 9.709  8.880   53.442  1.00 27.61 ? 360  CYS A C   1 
ATOM   1898 O  O   . CYS A 1 253 ? 9.573  8.021   54.305  1.00 28.71 ? 360  CYS A O   1 
ATOM   1899 C  CB  . CYS A 1 253 ? 7.357  9.594   52.867  1.00 28.58 ? 360  CYS A CB  1 
ATOM   1900 S  SG  . CYS A 1 253 ? 7.382  11.366  53.250  1.00 45.68 ? 360  CYS A SG  1 
ATOM   1901 N  N   . THR A 1 254 ? 10.765 9.687   53.414  1.00 19.72 ? 361  THR A N   1 
ATOM   1902 C  CA  . THR A 1 254 ? 11.706 9.689   54.530  1.00 17.81 ? 361  THR A CA  1 
ATOM   1903 C  C   . THR A 1 254 ? 11.657 11.010  55.287  1.00 19.87 ? 361  THR A C   1 
ATOM   1904 O  O   . THR A 1 254 ? 11.373 12.052  54.707  1.00 20.35 ? 361  THR A O   1 
ATOM   1905 C  CB  . THR A 1 254 ? 13.168 9.429   54.086  1.00 20.32 ? 361  THR A CB  1 
ATOM   1906 O  OG1 . THR A 1 254 ? 14.024 9.496   55.230  1.00 23.47 ? 361  THR A OG1 1 
ATOM   1907 C  CG2 . THR A 1 254 ? 13.644 10.468  53.085  1.00 19.36 ? 361  THR A CG2 1 
ATOM   1908 N  N   . GLU A 1 255 ? 11.940 10.957  56.584  1.00 20.55 ? 362  GLU A N   1 
ATOM   1909 C  CA  . GLU A 1 255 ? 12.128 12.165  57.372  1.00 20.36 ? 362  GLU A CA  1 
ATOM   1910 C  C   . GLU A 1 255 ? 13.576 12.249  57.841  1.00 20.58 ? 362  GLU A C   1 
ATOM   1911 O  O   . GLU A 1 255 ? 13.912 13.001  58.757  1.00 21.04 ? 362  GLU A O   1 
ATOM   1912 C  CB  . GLU A 1 255 ? 11.169 12.190  58.564  1.00 23.51 ? 362  GLU A CB  1 
ATOM   1913 C  CG  . GLU A 1 255 ? 9.703  12.048  58.153  1.00 33.79 ? 362  GLU A CG  1 
ATOM   1914 C  CD  . GLU A 1 255 ? 8.739  12.027  59.335  1.00 40.12 ? 362  GLU A CD  1 
ATOM   1915 O  OE1 . GLU A 1 255 ? 7.707  11.330  59.244  1.00 44.32 ? 362  GLU A OE1 1 
ATOM   1916 O  OE2 . GLU A 1 255 ? 9.007  12.709  60.346  1.00 39.62 ? 362  GLU A OE2 1 
ATOM   1917 N  N   . SER A 1 256 ? 14.446 11.480  57.207  1.00 17.56 ? 363  SER A N   1 
ATOM   1918 C  CA  . SER A 1 256 ? 15.818 11.391  57.692  1.00 24.94 ? 363  SER A CA  1 
ATOM   1919 C  C   . SER A 1 256 ? 16.871 11.683  56.616  1.00 20.83 ? 363  SER A C   1 
ATOM   1920 O  O   . SER A 1 256 ? 17.935 11.068  56.600  1.00 21.35 ? 363  SER A O   1 
ATOM   1921 C  CB  . SER A 1 256 ? 16.061 10.002  58.301  1.00 25.44 ? 363  SER A CB  1 
ATOM   1922 O  OG  . SER A 1 256 ? 15.840 8.997   57.333  1.00 33.05 ? 363  SER A OG  1 
ATOM   1923 N  N   . HIS A 1 257 ? 16.588 12.642  55.739  1.00 20.73 ? 364  HIS A N   1 
ATOM   1924 C  CA  . HIS A 1 257 ? 17.547 13.036  54.710  1.00 18.19 ? 364  HIS A CA  1 
ATOM   1925 C  C   . HIS A 1 257 ? 18.525 14.030  55.336  1.00 18.49 ? 364  HIS A C   1 
ATOM   1926 O  O   . HIS A 1 257 ? 18.102 14.946  56.043  1.00 19.46 ? 364  HIS A O   1 
ATOM   1927 C  CB  . HIS A 1 257 ? 16.818 13.625  53.497  1.00 19.51 ? 364  HIS A CB  1 
ATOM   1928 C  CG  . HIS A 1 257 ? 17.701 13.918  52.321  1.00 17.73 ? 364  HIS A CG  1 
ATOM   1929 N  ND1 . HIS A 1 257 ? 18.792 13.145  51.987  1.00 19.59 ? 364  HIS A ND1 1 
ATOM   1930 C  CD2 . HIS A 1 257 ? 17.626 14.889  51.377  1.00 16.76 ? 364  HIS A CD2 1 
ATOM   1931 C  CE1 . HIS A 1 257 ? 19.359 13.636  50.899  1.00 19.08 ? 364  HIS A CE1 1 
ATOM   1932 N  NE2 . HIS A 1 257 ? 18.667 14.691  50.506  1.00 17.44 ? 364  HIS A NE2 1 
ATOM   1933 N  N   . THR A 1 258 ? 19.822 13.832  55.089  1.00 18.56 ? 365  THR A N   1 
ATOM   1934 C  CA  . THR A 1 258 ? 20.903 14.477  55.853  1.00 17.72 ? 365  THR A CA  1 
ATOM   1935 C  C   . THR A 1 258 ? 22.023 15.074  54.994  1.00 20.78 ? 365  THR A C   1 
ATOM   1936 O  O   . THR A 1 258 ? 22.117 14.807  53.802  1.00 21.24 ? 365  THR A O   1 
ATOM   1937 C  CB  . THR A 1 258 ? 21.592 13.477  56.807  1.00 22.82 ? 365  THR A CB  1 
ATOM   1938 O  OG1 . THR A 1 258 ? 22.177 12.438  56.019  1.00 24.19 ? 365  THR A OG1 1 
ATOM   1939 C  CG2 . THR A 1 258 ? 20.604 12.861  57.795  1.00 23.27 ? 365  THR A CG2 1 
ATOM   1940 N  N   . GLY A 1 259 ? 22.888 15.864  55.626  1.00 17.86 ? 366  GLY A N   1 
ATOM   1941 C  CA  . GLY A 1 259 ? 24.125 16.304  55.004  1.00 13.86 ? 366  GLY A CA  1 
ATOM   1942 C  C   . GLY A 1 259 ? 23.980 17.495  54.074  1.00 15.94 ? 366  GLY A C   1 
ATOM   1943 O  O   . GLY A 1 259 ? 22.898 18.042  53.929  1.00 16.55 ? 366  GLY A O   1 
ATOM   1944 N  N   . THR A 1 260 ? 25.068 17.902  53.435  1.00 14.59 ? 367  THR A N   1 
ATOM   1945 C  CA  . THR A 1 260 ? 24.967 19.005  52.482  1.00 14.59 ? 367  THR A CA  1 
ATOM   1946 C  C   . THR A 1 260 ? 24.230 18.549  51.225  1.00 17.05 ? 367  THR A C   1 
ATOM   1947 O  O   . THR A 1 260 ? 23.798 19.377  50.429  1.00 15.40 ? 367  THR A O   1 
ATOM   1948 C  CB  . THR A 1 260 ? 26.336 19.577  52.078  1.00 14.14 ? 367  THR A CB  1 
ATOM   1949 O  OG1 . THR A 1 260 ? 27.172 18.520  51.587  1.00 16.32 ? 367  THR A OG1 1 
ATOM   1950 C  CG2 . THR A 1 260 ? 27.018 20.264  53.264  1.00 17.33 ? 367  THR A CG2 1 
ATOM   1951 N  N   . SER A 1 261 ? 24.066 17.240  51.052  1.00 14.60 ? 368  SER A N   1 
ATOM   1952 C  CA  . SER A 1 261 ? 23.240 16.767  49.948  1.00 15.10 ? 368  SER A CA  1 
ATOM   1953 C  C   . SER A 1 261 ? 21.805 17.218  50.082  1.00 16.54 ? 368  SER A C   1 
ATOM   1954 O  O   . SER A 1 261 ? 21.077 17.235  49.105  1.00 19.69 ? 368  SER A O   1 
ATOM   1955 C  CB  . SER A 1 261 ? 23.269 15.243  49.836  1.00 15.19 ? 368  SER A CB  1 
ATOM   1956 O  OG  . SER A 1 261 ? 24.501 14.851  49.279  1.00 20.60 ? 368  SER A OG  1 
ATOM   1957 N  N   . ALA A 1 262 ? 21.369 17.536  51.293  1.00 17.74 ? 369  ALA A N   1 
ATOM   1958 C  CA  . ALA A 1 262 ? 20.015 18.052  51.446  1.00 17.78 ? 369  ALA A CA  1 
ATOM   1959 C  C   . ALA A 1 262 ? 19.982 19.572  51.214  1.00 16.81 ? 369  ALA A C   1 
ATOM   1960 O  O   . ALA A 1 262 ? 18.965 20.133  50.784  1.00 21.07 ? 369  ALA A O   1 
ATOM   1961 C  CB  . ALA A 1 262 ? 19.465 17.699  52.812  1.00 19.09 ? 369  ALA A CB  1 
ATOM   1962 N  N   . SER A 1 263 ? 21.092 20.240  51.489  1.00 13.10 ? 370  SER A N   1 
ATOM   1963 C  CA  . SER A 1 263 ? 21.146 21.701  51.335  1.00 14.39 ? 370  SER A CA  1 
ATOM   1964 C  C   . SER A 1 263 ? 21.162 22.184  49.881  1.00 14.22 ? 370  SER A C   1 
ATOM   1965 O  O   . SER A 1 263 ? 20.434 23.104  49.535  1.00 15.44 ? 370  SER A O   1 
ATOM   1966 C  CB  . SER A 1 263 ? 22.367 22.269  52.064  1.00 17.24 ? 370  SER A CB  1 
ATOM   1967 O  OG  . SER A 1 263 ? 22.128 22.293  53.453  1.00 16.36 ? 370  SER A OG  1 
ATOM   1968 N  N   . ALA A 1 264 ? 21.987 21.576  49.033  1.00 14.01 ? 371  ALA A N   1 
ATOM   1969 C  CA  . ALA A 1 264 ? 22.060 21.992  47.628  1.00 14.27 ? 371  ALA A CA  1 
ATOM   1970 C  C   . ALA A 1 264 ? 20.709 21.976  46.884  1.00 13.19 ? 371  ALA A C   1 
ATOM   1971 O  O   . ALA A 1 264 ? 20.401 22.940  46.195  1.00 16.34 ? 371  ALA A O   1 
ATOM   1972 C  CB  . ALA A 1 264 ? 23.085 21.141  46.871  1.00 14.70 ? 371  ALA A CB  1 
ATOM   1973 N  N   . PRO A 1 265 ? 19.894 20.900  47.023  1.00 14.56 ? 372  PRO A N   1 
ATOM   1974 C  CA  . PRO A 1 265 ? 18.595 20.903  46.331  1.00 12.37 ? 372  PRO A CA  1 
ATOM   1975 C  C   . PRO A 1 265 ? 17.614 21.969  46.852  1.00 15.08 ? 372  PRO A C   1 
ATOM   1976 O  O   . PRO A 1 265 ? 16.826 22.482  46.064  1.00 11.57 ? 372  PRO A O   1 
ATOM   1977 C  CB  . PRO A 1 265 ? 18.035 19.486  46.606  1.00 12.97 ? 372  PRO A CB  1 
ATOM   1978 C  CG  . PRO A 1 265 ? 19.227 18.661  46.942  1.00 16.01 ? 372  PRO A CG  1 
ATOM   1979 C  CD  . PRO A 1 265 ? 20.148 19.604  47.673  1.00 13.96 ? 372  PRO A CD  1 
ATOM   1980 N  N   . LEU A 1 266 ? 17.644 22.277  48.149  1.00 14.37 ? 373  LEU A N   1 
ATOM   1981 C  CA  . LEU A 1 266 ? 16.754 23.313  48.680  1.00 15.96 ? 373  LEU A CA  1 
ATOM   1982 C  C   . LEU A 1 266 ? 17.154 24.650  48.068  1.00 17.38 ? 373  LEU A C   1 
ATOM   1983 O  O   . LEU A 1 266 ? 16.309 25.472  47.711  1.00 16.15 ? 373  LEU A O   1 
ATOM   1984 C  CB  . LEU A 1 266 ? 16.811 23.378  50.210  1.00 13.33 ? 373  LEU A CB  1 
ATOM   1985 C  CG  . LEU A 1 266 ? 16.240 22.173  50.969  1.00 14.53 ? 373  LEU A CG  1 
ATOM   1986 C  CD1 . LEU A 1 266 ? 16.584 22.271  52.455  1.00 15.07 ? 373  LEU A CD1 1 
ATOM   1987 C  CD2 . LEU A 1 266 ? 14.734 22.055  50.763  1.00 13.28 ? 373  LEU A CD2 1 
ATOM   1988 N  N   . ALA A 1 267 ? 18.459 24.845  47.922  1.00 13.40 ? 374  ALA A N   1 
ATOM   1989 C  CA  . ALA A 1 267 ? 18.970 26.038  47.257  1.00 13.34 ? 374  ALA A CA  1 
ATOM   1990 C  C   . ALA A 1 267 ? 18.560 26.080  45.775  1.00 14.65 ? 374  ALA A C   1 
ATOM   1991 O  O   . ALA A 1 267 ? 18.166 27.129  45.269  1.00 14.14 ? 374  ALA A O   1 
ATOM   1992 C  CB  . ALA A 1 267 ? 20.486 26.120  47.400  1.00 12.99 ? 374  ALA A CB  1 
ATOM   1993 N  N   . ALA A 1 268 ? 18.648 24.944  45.083  1.00 11.32 ? 375  ALA A N   1 
ATOM   1994 C  CA  . ALA A 1 268 ? 18.216 24.871  43.694  1.00 10.77 ? 375  ALA A CA  1 
ATOM   1995 C  C   . ALA A 1 268 ? 16.733 25.231  43.545  1.00 11.08 ? 375  ALA A C   1 
ATOM   1996 O  O   . ALA A 1 268 ? 16.349 25.914  42.605  1.00 11.64 ? 375  ALA A O   1 
ATOM   1997 C  CB  . ALA A 1 268 ? 18.478 23.472  43.113  1.00 12.89 ? 375  ALA A CB  1 
ATOM   1998 N  N   . GLY A 1 269 ? 15.907 24.755  44.466  1.00 11.04 ? 376  GLY A N   1 
ATOM   1999 C  CA  . GLY A 1 269 ? 14.493 25.105  44.478  1.00 13.18 ? 376  GLY A CA  1 
ATOM   2000 C  C   . GLY A 1 269 ? 14.225 26.595  44.692  1.00 13.42 ? 376  GLY A C   1 
ATOM   2001 O  O   . GLY A 1 269 ? 13.352 27.183  44.048  1.00 15.53 ? 376  GLY A O   1 
ATOM   2002 N  N   . ILE A 1 270 ? 14.969 27.205  45.608  1.00 12.49 ? 377  ILE A N   1 
ATOM   2003 C  CA  . ILE A 1 270 ? 14.845 28.643  45.860  1.00 13.44 ? 377  ILE A CA  1 
ATOM   2004 C  C   . ILE A 1 270 ? 15.300 29.419  44.625  1.00 12.23 ? 377  ILE A C   1 
ATOM   2005 O  O   . ILE A 1 270 ? 14.672 30.379  44.219  1.00 14.41 ? 377  ILE A O   1 
ATOM   2006 C  CB  . ILE A 1 270 ? 15.664 29.064  47.099  1.00 12.48 ? 377  ILE A CB  1 
ATOM   2007 C  CG1 . ILE A 1 270 ? 15.031 28.502  48.380  1.00 16.78 ? 377  ILE A CG1 1 
ATOM   2008 C  CG2 . ILE A 1 270 ? 15.824 30.595  47.174  1.00 14.43 ? 377  ILE A CG2 1 
ATOM   2009 C  CD1 . ILE A 1 270 ? 15.870 28.736  49.637  1.00 14.06 ? 377  ILE A CD1 1 
ATOM   2010 N  N   . ILE A 1 271 ? 16.385 28.969  44.006  1.00 14.50 ? 378  ILE A N   1 
ATOM   2011 C  CA  . ILE A 1 271 ? 16.856 29.573  42.765  1.00 13.86 ? 378  ILE A CA  1 
ATOM   2012 C  C   . ILE A 1 271 ? 15.809 29.439  41.641  1.00 13.64 ? 378  ILE A C   1 
ATOM   2013 O  O   . ILE A 1 271 ? 15.612 30.365  40.842  1.00 13.76 ? 378  ILE A O   1 
ATOM   2014 C  CB  . ILE A 1 271 ? 18.206 28.964  42.344  1.00 13.98 ? 378  ILE A CB  1 
ATOM   2015 C  CG1 . ILE A 1 271 ? 19.304 29.441  43.297  1.00 17.20 ? 378  ILE A CG1 1 
ATOM   2016 C  CG2 . ILE A 1 271 ? 18.562 29.358  40.914  1.00 16.23 ? 378  ILE A CG2 1 
ATOM   2017 C  CD1 . ILE A 1 271 ? 20.660 28.754  43.084  1.00 21.48 ? 378  ILE A CD1 1 
ATOM   2018 N  N   . ALA A 1 272 ? 15.098 28.313  41.611  1.00 13.55 ? 379  ALA A N   1 
ATOM   2019 C  CA  . ALA A 1 272 ? 14.026 28.123  40.627  1.00 9.80  ? 379  ALA A CA  1 
ATOM   2020 C  C   . ALA A 1 272 ? 12.911 29.146  40.814  1.00 14.48 ? 379  ALA A C   1 
ATOM   2021 O  O   . ALA A 1 272 ? 12.377 29.671  39.830  1.00 13.25 ? 379  ALA A O   1 
ATOM   2022 C  CB  . ALA A 1 272 ? 13.458 26.692  40.704  1.00 8.99  ? 379  ALA A CB  1 
ATOM   2023 N  N   . LEU A 1 273 ? 12.560 29.422  42.067  1.00 12.34 ? 380  LEU A N   1 
ATOM   2024 C  CA  . LEU A 1 273 ? 11.541 30.443  42.361  1.00 14.03 ? 380  LEU A CA  1 
ATOM   2025 C  C   . LEU A 1 273 ? 12.004 31.791  41.842  1.00 17.22 ? 380  LEU A C   1 
ATOM   2026 O  O   . LEU A 1 273 ? 11.240 32.551  41.239  1.00 15.93 ? 380  LEU A O   1 
ATOM   2027 C  CB  . LEU A 1 273 ? 11.276 30.542  43.860  1.00 13.76 ? 380  LEU A CB  1 
ATOM   2028 C  CG  . LEU A 1 273 ? 10.725 29.294  44.546  1.00 16.07 ? 380  LEU A CG  1 
ATOM   2029 C  CD1 . LEU A 1 273 ? 10.333 29.576  45.988  1.00 15.03 ? 380  LEU A CD1 1 
ATOM   2030 C  CD2 . LEU A 1 273 ? 9.558  28.739  43.754  1.00 15.36 ? 380  LEU A CD2 1 
ATOM   2031 N  N   . THR A 1 274 ? 13.280 32.062  42.090  1.00 14.62 ? 381  THR A N   1 
ATOM   2032 C  CA  . THR A 1 274 ? 13.914 33.311  41.717  1.00 13.88 ? 381  THR A CA  1 
ATOM   2033 C  C   . THR A 1 274 ? 13.943 33.509  40.210  1.00 17.56 ? 381  THR A C   1 
ATOM   2034 O  O   . THR A 1 274 ? 13.673 34.604  39.731  1.00 18.38 ? 381  THR A O   1 
ATOM   2035 C  CB  . THR A 1 274 ? 15.348 33.380  42.278  1.00 16.26 ? 381  THR A CB  1 
ATOM   2036 O  OG1 . THR A 1 274 ? 15.301 33.170  43.694  1.00 14.43 ? 381  THR A OG1 1 
ATOM   2037 C  CG2 . THR A 1 274 ? 15.972 34.758  41.987  1.00 17.14 ? 381  THR A CG2 1 
ATOM   2038 N  N   . LEU A 1 275 ? 14.250 32.446  39.465  1.00 14.91 ? 382  LEU A N   1 
ATOM   2039 C  CA  . LEU A 1 275 ? 14.210 32.483  38.005  1.00 13.59 ? 382  LEU A CA  1 
ATOM   2040 C  C   . LEU A 1 275 ? 12.820 32.721  37.450  1.00 15.87 ? 382  LEU A C   1 
ATOM   2041 O  O   . LEU A 1 275 ? 12.667 33.326  36.398  1.00 17.46 ? 382  LEU A O   1 
ATOM   2042 C  CB  . LEU A 1 275 ? 14.732 31.172  37.412  1.00 14.29 ? 382  LEU A CB  1 
ATOM   2043 C  CG  . LEU A 1 275 ? 16.137 31.141  36.835  1.00 22.26 ? 382  LEU A CG  1 
ATOM   2044 C  CD1 . LEU A 1 275 ? 16.337 29.834  36.045  1.00 19.15 ? 382  LEU A CD1 1 
ATOM   2045 C  CD2 . LEU A 1 275 ? 16.391 32.369  35.969  1.00 15.60 ? 382  LEU A CD2 1 
ATOM   2046 N  N   . GLU A 1 276 ? 11.803 32.205  38.128  1.00 18.35 ? 383  GLU A N   1 
ATOM   2047 C  CA  . GLU A 1 276 ? 10.447 32.426  37.660  1.00 17.44 ? 383  GLU A CA  1 
ATOM   2048 C  C   . GLU A 1 276 ? 10.091 33.903  37.799  1.00 14.98 ? 383  GLU A C   1 
ATOM   2049 O  O   . GLU A 1 276 ? 9.378  34.453  36.980  1.00 17.85 ? 383  GLU A O   1 
ATOM   2050 C  CB  . GLU A 1 276 ? 9.428  31.566  38.422  1.00 20.53 ? 383  GLU A CB  1 
ATOM   2051 C  CG  . GLU A 1 276 ? 8.017  31.726  37.862  1.00 17.92 ? 383  GLU A CG  1 
ATOM   2052 C  CD  . GLU A 1 276 ? 6.943  31.053  38.700  1.00 25.22 ? 383  GLU A CD  1 
ATOM   2053 O  OE1 . GLU A 1 276 ? 7.268  30.426  39.734  1.00 21.28 ? 383  GLU A OE1 1 
ATOM   2054 O  OE2 . GLU A 1 276 ? 5.761  31.165  38.313  1.00 25.55 ? 383  GLU A OE2 1 
ATOM   2055 N  N   . ALA A 1 277 ? 10.614 34.543  38.836  1.00 17.01 ? 384  ALA A N   1 
ATOM   2056 C  CA  . ALA A 1 277 ? 10.351 35.960  39.064  1.00 17.59 ? 384  ALA A CA  1 
ATOM   2057 C  C   . ALA A 1 277 ? 11.108 36.864  38.078  1.00 20.08 ? 384  ALA A C   1 
ATOM   2058 O  O   . ALA A 1 277 ? 10.682 37.984  37.799  1.00 20.98 ? 384  ALA A O   1 
ATOM   2059 C  CB  . ALA A 1 277 ? 10.698 36.324  40.503  1.00 19.91 ? 384  ALA A CB  1 
ATOM   2060 N  N   . ASN A 1 278 ? 12.223 36.376  37.541  1.00 17.09 ? 385  ASN A N   1 
ATOM   2061 C  CA  . ASN A 1 278 ? 12.978 37.116  36.530  1.00 14.13 ? 385  ASN A CA  1 
ATOM   2062 C  C   . ASN A 1 278 ? 13.723 36.141  35.644  1.00 17.05 ? 385  ASN A C   1 
ATOM   2063 O  O   . ASN A 1 278 ? 14.841 35.733  35.961  1.00 16.95 ? 385  ASN A O   1 
ATOM   2064 C  CB  . ASN A 1 278 ? 13.976 38.108  37.172  1.00 15.21 ? 385  ASN A CB  1 
ATOM   2065 C  CG  . ASN A 1 278 ? 14.698 38.994  36.134  1.00 17.40 ? 385  ASN A CG  1 
ATOM   2066 O  OD1 . ASN A 1 278 ? 14.693 38.704  34.941  1.00 17.71 ? 385  ASN A OD1 1 
ATOM   2067 N  ND2 . ASN A 1 278 ? 15.264 40.114  36.589  1.00 18.02 ? 385  ASN A ND2 1 
ATOM   2068 N  N   . LYS A 1 279 ? 13.129 35.804  34.510  1.00 14.21 ? 386  LYS A N   1 
ATOM   2069 C  CA  . LYS A 1 279 ? 13.721 34.808  33.632  1.00 16.42 ? 386  LYS A CA  1 
ATOM   2070 C  C   . LYS A 1 279 ? 14.934 35.341  32.878  1.00 16.95 ? 386  LYS A C   1 
ATOM   2071 O  O   . LYS A 1 279 ? 15.625 34.574  32.223  1.00 19.52 ? 386  LYS A O   1 
ATOM   2072 C  CB  . LYS A 1 279 ? 12.667 34.288  32.646  1.00 22.34 ? 386  LYS A CB  1 
ATOM   2073 C  CG  . LYS A 1 279 ? 11.449 33.681  33.336  1.00 25.22 ? 386  LYS A CG  1 
ATOM   2074 C  CD  . LYS A 1 279 ? 10.304 33.423  32.364  1.00 35.41 ? 386  LYS A CD  1 
ATOM   2075 C  CE  . LYS A 1 279 ? 8.975  33.402  33.098  0.00 27.58 ? 386  LYS A CE  1 
ATOM   2076 N  NZ  . LYS A 1 279 ? 7.913  34.124  32.346  0.00 29.19 ? 386  LYS A NZ  1 
ATOM   2077 N  N   . ASN A 1 280 ? 15.206 36.641  32.980  1.00 13.98 ? 387  ASN A N   1 
ATOM   2078 C  CA  . ASN A 1 280 ? 16.360 37.225  32.298  1.00 16.98 ? 387  ASN A CA  1 
ATOM   2079 C  C   . ASN A 1 280 ? 17.657 37.186  33.078  1.00 15.59 ? 387  ASN A C   1 
ATOM   2080 O  O   . ASN A 1 280 ? 18.663 37.671  32.589  1.00 17.30 ? 387  ASN A O   1 
ATOM   2081 C  CB  . ASN A 1 280 ? 16.121 38.690  31.952  1.00 17.37 ? 387  ASN A CB  1 
ATOM   2082 C  CG  . ASN A 1 280 ? 14.842 38.921  31.205  1.00 26.37 ? 387  ASN A CG  1 
ATOM   2083 O  OD1 . ASN A 1 280 ? 14.461 38.162  30.320  1.00 26.20 ? 387  ASN A OD1 1 
ATOM   2084 N  ND2 . ASN A 1 280 ? 14.169 39.997  31.560  1.00 33.12 ? 387  ASN A ND2 1 
ATOM   2085 N  N   . LEU A 1 281 ? 17.624 36.680  34.305  1.00 18.61 ? 388  LEU A N   1 
ATOM   2086 C  CA  . LEU A 1 281 ? 18.809 36.685  35.166  1.00 13.51 ? 388  LEU A CA  1 
ATOM   2087 C  C   . LEU A 1 281 ? 19.915 35.843  34.546  1.00 14.44 ? 388  LEU A C   1 
ATOM   2088 O  O   . LEU A 1 281 ? 19.645 34.762  34.025  1.00 18.38 ? 388  LEU A O   1 
ATOM   2089 C  CB  . LEU A 1 281 ? 18.461 36.159  36.557  1.00 16.97 ? 388  LEU A CB  1 
ATOM   2090 C  CG  . LEU A 1 281 ? 17.448 36.961  37.371  1.00 17.13 ? 388  LEU A CG  1 
ATOM   2091 C  CD1 . LEU A 1 281 ? 16.902 36.118  38.519  1.00 14.54 ? 388  LEU A CD1 1 
ATOM   2092 C  CD2 . LEU A 1 281 ? 18.074 38.271  37.892  1.00 16.77 ? 388  LEU A CD2 1 
ATOM   2093 N  N   . THR A 1 282 ? 21.147 36.345  34.575  1.00 15.71 ? 389  THR A N   1 
ATOM   2094 C  CA  . THR A 1 282 ? 22.288 35.579  34.082  1.00 13.30 ? 389  THR A CA  1 
ATOM   2095 C  C   . THR A 1 282 ? 22.829 34.704  35.211  1.00 16.51 ? 389  THR A C   1 
ATOM   2096 O  O   . THR A 1 282 ? 22.413 34.856  36.362  1.00 13.58 ? 389  THR A O   1 
ATOM   2097 C  CB  . THR A 1 282 ? 23.423 36.472  33.565  1.00 16.43 ? 389  THR A CB  1 
ATOM   2098 O  OG1 . THR A 1 282 ? 23.973 37.218  34.661  1.00 19.03 ? 389  THR A OG1 1 
ATOM   2099 C  CG2 . THR A 1 282 ? 22.912 37.438  32.488  1.00 16.07 ? 389  THR A CG2 1 
ATOM   2100 N  N   . TRP A 1 283 ? 23.764 33.809  34.893  1.00 13.73 ? 390  TRP A N   1 
ATOM   2101 C  CA  . TRP A 1 283 ? 24.359 32.987  35.939  1.00 13.79 ? 390  TRP A CA  1 
ATOM   2102 C  C   . TRP A 1 283 ? 25.047 33.843  36.998  1.00 13.67 ? 390  TRP A C   1 
ATOM   2103 O  O   . TRP A 1 283 ? 24.987 33.521  38.182  1.00 14.25 ? 390  TRP A O   1 
ATOM   2104 C  CB  . TRP A 1 283 ? 25.343 31.960  35.356  1.00 12.80 ? 390  TRP A CB  1 
ATOM   2105 C  CG  . TRP A 1 283 ? 26.579 32.541  34.738  1.00 13.49 ? 390  TRP A CG  1 
ATOM   2106 C  CD1 . TRP A 1 283 ? 26.689 33.112  33.508  1.00 12.08 ? 390  TRP A CD1 1 
ATOM   2107 C  CD2 . TRP A 1 283 ? 27.887 32.577  35.320  1.00 11.58 ? 390  TRP A CD2 1 
ATOM   2108 N  NE1 . TRP A 1 283 ? 27.986 33.517  33.292  1.00 16.58 ? 390  TRP A NE1 1 
ATOM   2109 C  CE2 . TRP A 1 283 ? 28.739 33.199  34.392  1.00 15.02 ? 390  TRP A CE2 1 
ATOM   2110 C  CE3 . TRP A 1 283 ? 28.419 32.150  36.545  1.00 13.03 ? 390  TRP A CE3 1 
ATOM   2111 C  CZ2 . TRP A 1 283 ? 30.098 33.399  34.644  1.00 14.06 ? 390  TRP A CZ2 1 
ATOM   2112 C  CZ3 . TRP A 1 283 ? 29.771 32.350  36.793  1.00 12.77 ? 390  TRP A CZ3 1 
ATOM   2113 C  CH2 . TRP A 1 283 ? 30.591 32.970  35.847  1.00 13.31 ? 390  TRP A CH2 1 
ATOM   2114 N  N   . ARG A 1 284 ? 25.669 34.949  36.586  1.00 13.56 ? 391  ARG A N   1 
ATOM   2115 C  CA  . ARG A 1 284 ? 26.272 35.856  37.557  1.00 15.17 ? 391  ARG A CA  1 
ATOM   2116 C  C   . ARG A 1 284 ? 25.236 36.708  38.306  1.00 12.61 ? 391  ARG A C   1 
ATOM   2117 O  O   . ARG A 1 284 ? 25.440 37.009  39.474  1.00 15.77 ? 391  ARG A O   1 
ATOM   2118 C  CB  . ARG A 1 284 ? 27.319 36.755  36.886  1.00 12.43 ? 391  ARG A CB  1 
ATOM   2119 C  CG  . ARG A 1 284 ? 28.658 36.052  36.685  1.00 11.00 ? 391  ARG A CG  1 
ATOM   2120 C  CD  . ARG A 1 284 ? 29.593 36.761  35.706  1.00 14.68 ? 391  ARG A CD  1 
ATOM   2121 N  NE  . ARG A 1 284 ? 29.873 38.148  36.073  1.00 14.66 ? 391  ARG A NE  1 
ATOM   2122 C  CZ  . ARG A 1 284 ? 29.462 39.200  35.368  1.00 18.85 ? 391  ARG A CZ  1 
ATOM   2123 N  NH1 . ARG A 1 284 ? 29.744 40.439  35.774  1.00 13.70 ? 391  ARG A NH1 1 
ATOM   2124 N  NH2 . ARG A 1 284 ? 28.761 39.012  34.256  1.00 16.03 ? 391  ARG A NH2 1 
ATOM   2125 N  N   . ASP A 1 285 ? 24.150 37.102  37.648  1.00 13.74 ? 392  ASP A N   1 
ATOM   2126 C  CA  . ASP A 1 285 ? 23.048 37.773  38.335  1.00 13.98 ? 392  ASP A CA  1 
ATOM   2127 C  C   . ASP A 1 285 ? 22.608 36.940  39.542  1.00 12.67 ? 392  ASP A C   1 
ATOM   2128 O  O   . ASP A 1 285 ? 22.360 37.469  40.614  1.00 15.84 ? 392  ASP A O   1 
ATOM   2129 C  CB  . ASP A 1 285 ? 21.830 37.990  37.411  1.00 12.54 ? 392  ASP A CB  1 
ATOM   2130 C  CG  . ASP A 1 285 ? 22.023 39.120  36.385  1.00 21.02 ? 392  ASP A CG  1 
ATOM   2131 O  OD1 . ASP A 1 285 ? 22.799 40.070  36.627  1.00 17.35 ? 392  ASP A OD1 1 
ATOM   2132 O  OD2 . ASP A 1 285 ? 21.367 39.056  35.319  1.00 19.60 ? 392  ASP A OD2 1 
ATOM   2133 N  N   . MET A 1 286 ? 22.486 35.631  39.352  1.00 14.27 ? 393  MET A N   1 
ATOM   2134 C  CA  . MET A 1 286 ? 21.967 34.792  40.421  1.00 13.76 ? 393  MET A CA  1 
ATOM   2135 C  C   . MET A 1 286 ? 22.885 34.826  41.646  1.00 12.94 ? 393  MET A C   1 
ATOM   2136 O  O   . MET A 1 286 ? 22.418 34.891  42.788  1.00 12.39 ? 393  MET A O   1 
ATOM   2137 C  CB  . MET A 1 286 ? 21.778 33.355  39.932  1.00 12.63 ? 393  MET A CB  1 
ATOM   2138 C  CG  . MET A 1 286 ? 20.959 32.519  40.888  1.00 13.56 ? 393  MET A CG  1 
ATOM   2139 S  SD  . MET A 1 286 ? 19.292 33.193  41.198  1.00 19.67 ? 393  MET A SD  1 
ATOM   2140 C  CE  . MET A 1 286 ? 18.571 33.082  39.569  1.00 15.53 ? 393  MET A CE  1 
ATOM   2141 N  N   . GLN A 1 287 ? 24.188 34.768  41.412  1.00 9.37  ? 394  GLN A N   1 
ATOM   2142 C  CA  . GLN A 1 287 ? 25.131 34.847  42.516  1.00 10.79 ? 394  GLN A CA  1 
ATOM   2143 C  C   . GLN A 1 287 ? 25.078 36.232  43.188  1.00 16.53 ? 394  GLN A C   1 
ATOM   2144 O  O   . GLN A 1 287 ? 25.129 36.314  44.414  1.00 13.00 ? 394  GLN A O   1 
ATOM   2145 C  CB  . GLN A 1 287 ? 26.555 34.519  42.039  1.00 12.36 ? 394  GLN A CB  1 
ATOM   2146 C  CG  . GLN A 1 287 ? 26.658 33.114  41.391  1.00 10.00 ? 394  GLN A CG  1 
ATOM   2147 C  CD  . GLN A 1 287 ? 28.084 32.587  41.267  1.00 16.04 ? 394  GLN A CD  1 
ATOM   2148 O  OE1 . GLN A 1 287 ? 28.982 32.988  42.012  1.00 17.62 ? 394  GLN A OE1 1 
ATOM   2149 N  NE2 . GLN A 1 287 ? 28.294 31.674  40.322  1.00 13.44 ? 394  GLN A NE2 1 
ATOM   2150 N  N   . HIS A 1 288 ? 24.964 37.313  42.408  1.00 13.92 ? 395  HIS A N   1 
ATOM   2151 C  CA  . HIS A 1 288 ? 24.749 38.632  43.022  1.00 14.00 ? 395  HIS A CA  1 
ATOM   2152 C  C   . HIS A 1 288 ? 23.531 38.681  43.951  1.00 14.14 ? 395  HIS A C   1 
ATOM   2153 O  O   . HIS A 1 288 ? 23.599 39.251  45.039  1.00 15.20 ? 395  HIS A O   1 
ATOM   2154 C  CB  . HIS A 1 288 ? 24.592 39.724  41.956  1.00 12.52 ? 395  HIS A CB  1 
ATOM   2155 C  CG  . HIS A 1 288 ? 25.889 40.190  41.380  1.00 15.24 ? 395  HIS A CG  1 
ATOM   2156 N  ND1 . HIS A 1 288 ? 26.684 41.125  42.008  1.00 14.49 ? 395  HIS A ND1 1 
ATOM   2157 C  CD2 . HIS A 1 288 ? 26.537 39.849  40.240  1.00 11.67 ? 395  HIS A CD2 1 
ATOM   2158 C  CE1 . HIS A 1 288 ? 27.770 41.332  41.284  1.00 14.56 ? 395  HIS A CE1 1 
ATOM   2159 N  NE2 . HIS A 1 288 ? 27.708 40.569  40.208  1.00 12.67 ? 395  HIS A NE2 1 
ATOM   2160 N  N   . LEU A 1 289 ? 22.418 38.099  43.520  1.00 13.68 ? 396  LEU A N   1 
ATOM   2161 C  CA  . LEU A 1 289 ? 21.192 38.132  44.306  1.00 12.14 ? 396  LEU A CA  1 
ATOM   2162 C  C   . LEU A 1 289 ? 21.391 37.370  45.626  1.00 14.77 ? 396  LEU A C   1 
ATOM   2163 O  O   . LEU A 1 289 ? 20.894 37.783  46.675  1.00 15.54 ? 396  LEU A O   1 
ATOM   2164 C  CB  . LEU A 1 289 ? 20.014 37.548  43.516  1.00 14.63 ? 396  LEU A CB  1 
ATOM   2165 C  CG  . LEU A 1 289 ? 19.551 38.309  42.265  1.00 14.57 ? 396  LEU A CG  1 
ATOM   2166 C  CD1 . LEU A 1 289 ? 18.434 37.597  41.532  1.00 12.65 ? 396  LEU A CD1 1 
ATOM   2167 C  CD2 . LEU A 1 289 ? 19.119 39.723  42.630  1.00 13.55 ? 396  LEU A CD2 1 
ATOM   2168 N  N   . VAL A 1 290 ? 22.130 36.267  45.564  1.00 12.54 ? 397  VAL A N   1 
ATOM   2169 C  CA  . VAL A 1 290 ? 22.447 35.474  46.754  1.00 10.39 ? 397  VAL A CA  1 
ATOM   2170 C  C   . VAL A 1 290 ? 23.290 36.285  47.753  1.00 12.57 ? 397  VAL A C   1 
ATOM   2171 O  O   . VAL A 1 290 ? 23.006 36.308  48.948  1.00 12.54 ? 397  VAL A O   1 
ATOM   2172 C  CB  . VAL A 1 290 ? 23.186 34.182  46.371  1.00 12.93 ? 397  VAL A CB  1 
ATOM   2173 C  CG1 . VAL A 1 290 ? 23.723 33.481  47.608  1.00 14.34 ? 397  VAL A CG1 1 
ATOM   2174 C  CG2 . VAL A 1 290 ? 22.243 33.256  45.606  1.00 12.66 ? 397  VAL A CG2 1 
ATOM   2175 N  N   . VAL A 1 291 ? 24.301 36.977  47.251  1.00 10.57 ? 398  VAL A N   1 
ATOM   2176 C  CA  . VAL A 1 291 ? 25.148 37.807  48.106  1.00 13.65 ? 398  VAL A CA  1 
ATOM   2177 C  C   . VAL A 1 291 ? 24.362 38.962  48.728  1.00 15.88 ? 398  VAL A C   1 
ATOM   2178 O  O   . VAL A 1 291 ? 24.547 39.305  49.894  1.00 17.54 ? 398  VAL A O   1 
ATOM   2179 C  CB  . VAL A 1 291 ? 26.348 38.360  47.317  1.00 13.71 ? 398  VAL A CB  1 
ATOM   2180 C  CG1 . VAL A 1 291 ? 27.078 39.426  48.117  1.00 12.45 ? 398  VAL A CG1 1 
ATOM   2181 C  CG2 . VAL A 1 291 ? 27.302 37.216  46.943  1.00 11.89 ? 398  VAL A CG2 1 
ATOM   2182 N  N   . GLN A 1 292 ? 23.471 39.555  47.946  1.00 16.15 ? 399  GLN A N   1 
ATOM   2183 C  CA  . GLN A 1 292 ? 22.719 40.712  48.411  1.00 16.26 ? 399  GLN A CA  1 
ATOM   2184 C  C   . GLN A 1 292 ? 21.636 40.380  49.440  1.00 16.75 ? 399  GLN A C   1 
ATOM   2185 O  O   . GLN A 1 292 ? 21.333 41.207  50.296  1.00 13.67 ? 399  GLN A O   1 
ATOM   2186 C  CB  . GLN A 1 292 ? 22.078 41.423  47.226  1.00 16.46 ? 399  GLN A CB  1 
ATOM   2187 C  CG  . GLN A 1 292 ? 23.065 42.013  46.265  1.00 19.32 ? 399  GLN A CG  1 
ATOM   2188 C  CD  . GLN A 1 292 ? 22.838 43.485  46.054  1.00 19.34 ? 399  GLN A CD  1 
ATOM   2189 O  OE1 . GLN A 1 292 ? 21.835 44.037  46.502  1.00 18.98 ? 399  GLN A OE1 1 
ATOM   2190 N  NE2 . GLN A 1 292 ? 23.765 44.129  45.374  1.00 16.35 ? 399  GLN A NE2 1 
ATOM   2191 N  N   . THR A 1 293 ? 21.046 39.186  49.355  1.00 12.31 ? 400  THR A N   1 
ATOM   2192 C  CA  . THR A 1 293 ? 19.859 38.889  50.155  1.00 12.84 ? 400  THR A CA  1 
ATOM   2193 C  C   . THR A 1 293 ? 20.021 37.874  51.291  1.00 14.19 ? 400  THR A C   1 
ATOM   2194 O  O   . THR A 1 293 ? 19.123 37.734  52.119  1.00 18.71 ? 400  THR A O   1 
ATOM   2195 C  CB  . THR A 1 293 ? 18.709 38.368  49.255  1.00 17.68 ? 400  THR A CB  1 
ATOM   2196 O  OG1 . THR A 1 293 ? 19.083 37.106  48.662  1.00 14.39 ? 400  THR A OG1 1 
ATOM   2197 C  CG2 . THR A 1 293 ? 18.370 39.389  48.164  1.00 16.78 ? 400  THR A CG2 1 
ATOM   2198 N  N   . SER A 1 294 ? 21.127 37.142  51.319  1.00 12.96 ? 401  SER A N   1 
ATOM   2199 C  CA  . SER A 1 294 ? 21.300 36.106  52.323  1.00 14.64 ? 401  SER A CA  1 
ATOM   2200 C  C   . SER A 1 294 ? 21.565 36.718  53.703  1.00 24.45 ? 401  SER A C   1 
ATOM   2201 O  O   . SER A 1 294 ? 22.276 37.708  53.820  1.00 21.37 ? 401  SER A O   1 
ATOM   2202 C  CB  . SER A 1 294 ? 22.427 35.149  51.911  1.00 15.60 ? 401  SER A CB  1 
ATOM   2203 O  OG  . SER A 1 294 ? 22.043 34.465  50.725  1.00 15.98 ? 401  SER A OG  1 
ATOM   2204 N  N   . LYS A 1 295 ? 20.978 36.091  54.722  1.00 24.63 ? 402  LYS A N   1 
ATOM   2205 C  CA  . LYS A 1 295 ? 20.926 36.592  56.095  1.00 26.75 ? 402  LYS A CA  1 
ATOM   2206 C  C   . LYS A 1 295 ? 21.845 35.819  57.049  1.00 22.98 ? 402  LYS A C   1 
ATOM   2207 O  O   . LYS A 1 295 ? 21.686 34.622  57.216  1.00 22.17 ? 402  LYS A O   1 
ATOM   2208 C  CB  . LYS A 1 295 ? 19.499 36.496  56.644  1.00 28.93 ? 402  LYS A CB  1 
ATOM   2209 C  CG  . LYS A 1 295 ? 18.380 36.884  55.679  1.00 28.59 ? 402  LYS A CG  1 
ATOM   2210 C  CD  . LYS A 1 295 ? 18.459 38.343  55.286  0.00 24.53 ? 402  LYS A CD  1 
ATOM   2211 C  CE  . LYS A 1 295 ? 17.226 38.746  54.503  0.00 24.12 ? 402  LYS A CE  1 
ATOM   2212 N  NZ  . LYS A 1 295 ? 17.400 40.033  53.786  0.00 23.62 ? 402  LYS A NZ  1 
ATOM   2213 N  N   . PRO A 1 296 ? 22.782 36.518  57.700  1.00 24.08 ? 403  PRO A N   1 
ATOM   2214 C  CA  . PRO A 1 296 ? 23.572 35.933  58.788  1.00 28.18 ? 403  PRO A CA  1 
ATOM   2215 C  C   . PRO A 1 296 ? 22.742 35.641  60.034  1.00 30.35 ? 403  PRO A C   1 
ATOM   2216 O  O   . PRO A 1 296 ? 23.134 34.780  60.818  1.00 34.86 ? 403  PRO A O   1 
ATOM   2217 C  CB  . PRO A 1 296 ? 24.613 37.022  59.104  1.00 29.66 ? 403  PRO A CB  1 
ATOM   2218 C  CG  . PRO A 1 296 ? 24.607 37.917  57.923  1.00 31.63 ? 403  PRO A CG  1 
ATOM   2219 C  CD  . PRO A 1 296 ? 23.213 37.886  57.382  1.00 26.81 ? 403  PRO A CD  1 
ATOM   2220 N  N   . ALA A 1 297 ? 21.623 36.338  60.203  1.00 27.85 ? 404  ALA A N   1 
ATOM   2221 C  CA  . ALA A 1 297 ? 20.922 36.369  61.489  1.00 39.30 ? 404  ALA A CA  1 
ATOM   2222 C  C   . ALA A 1 297 ? 20.514 34.992  61.970  1.00 27.63 ? 404  ALA A C   1 
ATOM   2223 O  O   . ALA A 1 297 ? 19.975 34.197  61.210  1.00 36.65 ? 404  ALA A O   1 
ATOM   2224 C  CB  . ALA A 1 297 ? 19.705 37.266  61.406  1.00 42.25 ? 404  ALA A CB  1 
ATOM   2225 N  N   . HIS A 1 298 ? 20.813 34.729  63.235  1.00 33.43 ? 405  HIS A N   1 
ATOM   2226 C  CA  . HIS A 1 298 ? 20.423 33.502  63.936  1.00 36.82 ? 405  HIS A CA  1 
ATOM   2227 C  C   . HIS A 1 298 ? 21.241 32.278  63.532  1.00 29.80 ? 405  HIS A C   1 
ATOM   2228 O  O   . HIS A 1 298 ? 20.970 31.175  64.001  1.00 31.09 ? 405  HIS A O   1 
ATOM   2229 C  CB  . HIS A 1 298 ? 18.926 33.220  63.742  1.00 39.70 ? 405  HIS A CB  1 
ATOM   2230 C  CG  . HIS A 1 298 ? 18.046 34.349  64.174  1.00 47.94 ? 405  HIS A CG  1 
ATOM   2231 N  ND1 . HIS A 1 298 ? 16.959 34.773  63.438  1.00 51.85 ? 405  HIS A ND1 1 
ATOM   2232 C  CD2 . HIS A 1 298 ? 18.100 35.155  65.261  1.00 47.61 ? 405  HIS A CD2 1 
ATOM   2233 C  CE1 . HIS A 1 298 ? 16.382 35.789  64.053  1.00 49.76 ? 405  HIS A CE1 1 
ATOM   2234 N  NE2 . HIS A 1 298 ? 17.054 36.040  65.163  1.00 51.11 ? 405  HIS A NE2 1 
ATOM   2235 N  N   . LEU A 1 299 ? 22.238 32.469  62.676  1.00 26.03 ? 406  LEU A N   1 
ATOM   2236 C  CA  . LEU A 1 299 ? 23.225 31.418  62.420  1.00 23.43 ? 406  LEU A CA  1 
ATOM   2237 C  C   . LEU A 1 299 ? 24.453 31.635  63.286  1.00 26.72 ? 406  LEU A C   1 
ATOM   2238 O  O   . LEU A 1 299 ? 25.099 32.681  63.216  1.00 29.55 ? 406  LEU A O   1 
ATOM   2239 C  CB  . LEU A 1 299 ? 23.635 31.374  60.952  1.00 20.96 ? 406  LEU A CB  1 
ATOM   2240 C  CG  . LEU A 1 299 ? 22.563 30.996  59.933  1.00 22.28 ? 406  LEU A CG  1 
ATOM   2241 C  CD1 . LEU A 1 299 ? 23.187 30.842  58.558  1.00 26.49 ? 406  LEU A CD1 1 
ATOM   2242 C  CD2 . LEU A 1 299 ? 21.854 29.734  60.335  1.00 18.67 ? 406  LEU A CD2 1 
ATOM   2243 N  N   . ASN A 1 300 ? 24.780 30.636  64.091  1.00 21.93 ? 407  ASN A N   1 
ATOM   2244 C  CA  . ASN A 1 300 ? 25.886 30.746  65.026  1.00 26.84 ? 407  ASN A CA  1 
ATOM   2245 C  C   . ASN A 1 300 ? 27.202 30.242  64.437  1.00 25.21 ? 407  ASN A C   1 
ATOM   2246 O  O   . ASN A 1 300 ? 27.287 29.113  63.942  1.00 23.85 ? 407  ASN A O   1 
ATOM   2247 C  CB  . ASN A 1 300 ? 25.543 29.989  66.313  1.00 25.57 ? 407  ASN A CB  1 
ATOM   2248 C  CG  . ASN A 1 300 ? 24.194 30.405  66.888  1.00 33.24 ? 407  ASN A CG  1 
ATOM   2249 O  OD1 . ASN A 1 300 ? 23.940 31.588  67.126  1.00 36.34 ? 407  ASN A OD1 1 
ATOM   2250 N  ND2 . ASN A 1 300 ? 23.316 29.429  67.102  1.00 36.45 ? 407  ASN A ND2 1 
ATOM   2251 N  N   . ALA A 1 301 ? 28.225 31.091  64.468  1.00 21.93 ? 408  ALA A N   1 
ATOM   2252 C  CA  . ALA A 1 301 ? 29.561 30.678  64.052  1.00 20.18 ? 408  ALA A CA  1 
ATOM   2253 C  C   . ALA A 1 301 ? 30.618 31.463  64.817  1.00 25.64 ? 408  ALA A C   1 
ATOM   2254 O  O   . ALA A 1 301 ? 30.335 32.534  65.350  1.00 29.99 ? 408  ALA A O   1 
ATOM   2255 C  CB  . ALA A 1 301 ? 29.738 30.863  62.547  1.00 21.62 ? 408  ALA A CB  1 
ATOM   2256 N  N   . ASN A 1 302 ? 31.839 30.943  64.862  1.00 23.96 ? 409  ASN A N   1 
ATOM   2257 C  CA  . ASN A 1 302 ? 32.899 31.617  65.604  1.00 29.92 ? 409  ASN A CA  1 
ATOM   2258 C  C   . ASN A 1 302 ? 33.680 32.611  64.751  1.00 35.19 ? 409  ASN A C   1 
ATOM   2259 O  O   . ASN A 1 302 ? 34.546 33.319  65.259  1.00 33.71 ? 409  ASN A O   1 
ATOM   2260 C  CB  . ASN A 1 302 ? 33.861 30.591  66.206  1.00 33.81 ? 409  ASN A CB  1 
ATOM   2261 C  CG  . ASN A 1 302 ? 34.715 29.893  65.156  1.00 40.17 ? 409  ASN A CG  1 
ATOM   2262 O  OD1 . ASN A 1 302 ? 34.424 29.943  63.960  0.00 42.99 ? 409  ASN A OD1 1 
ATOM   2263 N  ND2 . ASN A 1 302 ? 35.769 29.222  65.606  0.00 39.28 ? 409  ASN A ND2 1 
ATOM   2264 N  N   . ASP A 1 303 ? 33.378 32.662  63.455  1.00 26.83 ? 410  ASP A N   1 
ATOM   2265 C  CA  . ASP A 1 303 ? 34.216 33.422  62.536  1.00 28.19 ? 410  ASP A CA  1 
ATOM   2266 C  C   . ASP A 1 303 ? 33.474 34.458  61.693  1.00 25.33 ? 410  ASP A C   1 
ATOM   2267 O  O   . ASP A 1 303 ? 33.975 34.858  60.648  1.00 25.54 ? 410  ASP A O   1 
ATOM   2268 C  CB  . ASP A 1 303 ? 34.955 32.468  61.594  1.00 28.53 ? 410  ASP A CB  1 
ATOM   2269 C  CG  . ASP A 1 303 ? 34.044 31.890  60.516  1.00 24.34 ? 410  ASP A CG  1 
ATOM   2270 O  OD1 . ASP A 1 303 ? 32.817 31.758  60.755  1.00 20.41 ? 410  ASP A OD1 1 
ATOM   2271 O  OD2 . ASP A 1 303 ? 34.560 31.589  59.423  1.00 22.70 ? 410  ASP A OD2 1 
ATOM   2272 N  N   . TRP A 1 304 ? 32.288 34.882  62.117  1.00 20.42 ? 411  TRP A N   1 
ATOM   2273 C  CA  . TRP A 1 304 ? 31.626 35.963  61.405  1.00 21.88 ? 411  TRP A CA  1 
ATOM   2274 C  C   . TRP A 1 304 ? 32.545 37.180  61.369  1.00 28.23 ? 411  TRP A C   1 
ATOM   2275 O  O   . TRP A 1 304 ? 33.044 37.612  62.404  1.00 23.14 ? 411  TRP A O   1 
ATOM   2276 C  CB  . TRP A 1 304 ? 30.300 36.336  62.057  1.00 22.59 ? 411  TRP A CB  1 
ATOM   2277 C  CG  . TRP A 1 304 ? 29.165 35.423  61.741  1.00 22.73 ? 411  TRP A CG  1 
ATOM   2278 C  CD1 . TRP A 1 304 ? 28.480 34.628  62.620  1.00 23.75 ? 411  TRP A CD1 1 
ATOM   2279 C  CD2 . TRP A 1 304 ? 28.555 35.225  60.462  1.00 21.45 ? 411  TRP A CD2 1 
ATOM   2280 N  NE1 . TRP A 1 304 ? 27.480 33.953  61.965  1.00 23.64 ? 411  TRP A NE1 1 
ATOM   2281 C  CE2 . TRP A 1 304 ? 27.509 34.294  60.639  1.00 23.56 ? 411  TRP A CE2 1 
ATOM   2282 C  CE3 . TRP A 1 304 ? 28.799 35.730  59.181  1.00 15.71 ? 411  TRP A CE3 1 
ATOM   2283 C  CZ2 . TRP A 1 304 ? 26.704 33.869  59.584  1.00 19.09 ? 411  TRP A CZ2 1 
ATOM   2284 C  CZ3 . TRP A 1 304 ? 27.996 35.304  58.138  1.00 16.17 ? 411  TRP A CZ3 1 
ATOM   2285 C  CH2 . TRP A 1 304 ? 26.961 34.389  58.347  1.00 17.40 ? 411  TRP A CH2 1 
ATOM   2286 N  N   . ALA A 1 305 ? 32.799 37.690  60.167  1.00 22.63 ? 412  ALA A N   1 
ATOM   2287 C  CA  . ALA A 1 305 ? 33.579 38.900  59.990  1.00 21.05 ? 412  ALA A CA  1 
ATOM   2288 C  C   . ALA A 1 305 ? 32.860 39.840  59.030  1.00 24.98 ? 412  ALA A C   1 
ATOM   2289 O  O   . ALA A 1 305 ? 32.106 39.397  58.168  1.00 29.01 ? 412  ALA A O   1 
ATOM   2290 C  CB  . ALA A 1 305 ? 34.982 38.571  59.478  1.00 24.48 ? 412  ALA A CB  1 
ATOM   2291 N  N   . THR A 1 306 ? 33.070 41.139  59.204  1.00 21.08 ? 413  THR A N   1 
ATOM   2292 C  CA  . THR A 1 306 ? 32.532 42.153  58.294  1.00 21.15 ? 413  THR A CA  1 
ATOM   2293 C  C   . THR A 1 306 ? 33.538 42.400  57.177  1.00 21.50 ? 413  THR A C   1 
ATOM   2294 O  O   . THR A 1 306 ? 34.716 42.615  57.449  1.00 20.85 ? 413  THR A O   1 
ATOM   2295 C  CB  . THR A 1 306 ? 32.235 43.475  59.046  1.00 24.88 ? 413  THR A CB  1 
ATOM   2296 O  OG1 . THR A 1 306 ? 31.365 43.203  60.150  1.00 29.48 ? 413  THR A OG1 1 
ATOM   2297 C  CG2 . THR A 1 306 ? 31.576 44.504  58.129  1.00 21.37 ? 413  THR A CG2 1 
ATOM   2298 N  N   . ASN A 1 307 ? 33.113 42.340  55.918  1.00 21.74 ? 414  ASN A N   1 
ATOM   2299 C  CA  . ASN A 1 307 ? 34.084 42.574  54.850  1.00 20.01 ? 414  ASN A CA  1 
ATOM   2300 C  C   . ASN A 1 307 ? 34.168 44.064  54.478  1.00 24.84 ? 414  ASN A C   1 
ATOM   2301 O  O   . ASN A 1 307 ? 33.682 44.921  55.228  1.00 20.19 ? 414  ASN A O   1 
ATOM   2302 C  CB  . ASN A 1 307 ? 33.780 41.696  53.618  1.00 18.34 ? 414  ASN A CB  1 
ATOM   2303 C  CG  . ASN A 1 307 ? 32.511 42.096  52.875  1.00 23.44 ? 414  ASN A CG  1 
ATOM   2304 O  OD1 . ASN A 1 307 ? 31.843 43.071  53.211  1.00 20.32 ? 414  ASN A OD1 1 
ATOM   2305 N  ND2 . ASN A 1 307 ? 32.190 41.341  51.833  1.00 18.56 ? 414  ASN A ND2 1 
ATOM   2306 N  N   . GLY A 1 308 ? 34.778 44.362  53.329  1.00 22.67 ? 415  GLY A N   1 
ATOM   2307 C  CA  . GLY A 1 308 ? 35.028 45.740  52.913  1.00 26.22 ? 415  GLY A CA  1 
ATOM   2308 C  C   . GLY A 1 308 ? 33.816 46.579  52.531  1.00 29.03 ? 415  GLY A C   1 
ATOM   2309 O  O   . GLY A 1 308 ? 33.859 47.814  52.574  1.00 27.68 ? 415  GLY A O   1 
ATOM   2310 N  N   . VAL A 1 309 ? 32.725 45.925  52.147  1.00 22.22 ? 416  VAL A N   1 
ATOM   2311 C  CA  . VAL A 1 309 ? 31.514 46.655  51.822  1.00 19.42 ? 416  VAL A CA  1 
ATOM   2312 C  C   . VAL A 1 309 ? 30.470 46.496  52.907  1.00 21.31 ? 416  VAL A C   1 
ATOM   2313 O  O   . VAL A 1 309 ? 29.304 46.796  52.688  1.00 21.82 ? 416  VAL A O   1 
ATOM   2314 C  CB  . VAL A 1 309 ? 30.902 46.215  50.473  1.00 24.48 ? 416  VAL A CB  1 
ATOM   2315 C  CG1 . VAL A 1 309 ? 31.773 46.693  49.318  1.00 17.48 ? 416  VAL A CG1 1 
ATOM   2316 C  CG2 . VAL A 1 309 ? 30.712 44.699  50.427  1.00 20.56 ? 416  VAL A CG2 1 
ATOM   2317 N  N   . GLY A 1 310 ? 30.889 46.010  54.071  1.00 21.64 ? 417  GLY A N   1 
ATOM   2318 C  CA  . GLY A 1 310 ? 30.008 45.962  55.224  1.00 25.37 ? 417  GLY A CA  1 
ATOM   2319 C  C   . GLY A 1 310 ? 29.121 44.739  55.358  1.00 27.84 ? 417  GLY A C   1 
ATOM   2320 O  O   . GLY A 1 310 ? 28.199 44.727  56.176  1.00 23.73 ? 417  GLY A O   1 
ATOM   2321 N  N   . ARG A 1 311 ? 29.374 43.705  54.563  1.00 22.80 ? 418  ARG A N   1 
ATOM   2322 C  CA  . ARG A 1 311 ? 28.599 42.470  54.701  1.00 21.07 ? 418  ARG A CA  1 
ATOM   2323 C  C   . ARG A 1 311 ? 29.264 41.476  55.652  1.00 19.95 ? 418  ARG A C   1 
ATOM   2324 O  O   . ARG A 1 311 ? 30.485 41.311  55.636  1.00 21.38 ? 418  ARG A O   1 
ATOM   2325 C  CB  . ARG A 1 311 ? 28.392 41.795  53.340  1.00 17.57 ? 418  ARG A CB  1 
ATOM   2326 C  CG  . ARG A 1 311 ? 27.490 42.558  52.416  1.00 20.55 ? 418  ARG A CG  1 
ATOM   2327 C  CD  . ARG A 1 311 ? 27.020 41.701  51.255  1.00 15.61 ? 418  ARG A CD  1 
ATOM   2328 N  NE  . ARG A 1 311 ? 26.147 42.480  50.389  1.00 20.02 ? 418  ARG A NE  1 
ATOM   2329 C  CZ  . ARG A 1 311 ? 26.553 43.070  49.271  1.00 17.62 ? 418  ARG A CZ  1 
ATOM   2330 N  NH1 . ARG A 1 311 ? 25.697 43.771  48.541  1.00 23.65 ? 418  ARG A NH1 1 
ATOM   2331 N  NH2 . ARG A 1 311 ? 27.813 42.950  48.882  1.00 17.13 ? 418  ARG A NH2 1 
ATOM   2332 N  N   . LYS A 1 312 ? 28.449 40.796  56.454  1.00 19.10 ? 419  LYS A N   1 
ATOM   2333 C  CA  . LYS A 1 312 ? 28.946 39.751  57.336  1.00 19.91 ? 419  LYS A CA  1 
ATOM   2334 C  C   . LYS A 1 312 ? 29.216 38.497  56.514  1.00 16.65 ? 419  LYS A C   1 
ATOM   2335 O  O   . LYS A 1 312 ? 28.380 38.067  55.715  1.00 17.32 ? 419  LYS A O   1 
ATOM   2336 C  CB  . LYS A 1 312 ? 27.949 39.457  58.461  1.00 21.64 ? 419  LYS A CB  1 
ATOM   2337 C  CG  . LYS A 1 312 ? 27.869 40.550  59.525  1.00 29.11 ? 419  LYS A CG  1 
ATOM   2338 C  CD  . LYS A 1 312 ? 28.785 40.235  60.700  1.00 36.20 ? 419  LYS A CD  1 
ATOM   2339 C  CE  . LYS A 1 312 ? 29.111 41.484  61.509  1.00 49.08 ? 419  LYS A CE  1 
ATOM   2340 N  NZ  . LYS A 1 312 ? 27.909 42.341  61.752  1.00 48.80 ? 419  LYS A NZ  1 
ATOM   2341 N  N   . VAL A 1 313 ? 30.399 37.932  56.699  1.00 14.33 ? 420  VAL A N   1 
ATOM   2342 C  CA  . VAL A 1 313 ? 30.771 36.713  56.012  1.00 15.23 ? 420  VAL A CA  1 
ATOM   2343 C  C   . VAL A 1 313 ? 31.362 35.700  56.964  1.00 18.42 ? 420  VAL A C   1 
ATOM   2344 O  O   . VAL A 1 313 ? 32.086 36.064  57.888  1.00 19.32 ? 420  VAL A O   1 
ATOM   2345 C  CB  . VAL A 1 313 ? 31.798 36.975  54.886  1.00 21.07 ? 420  VAL A CB  1 
ATOM   2346 C  CG1 . VAL A 1 313 ? 31.204 37.813  53.832  1.00 24.13 ? 420  VAL A CG1 1 
ATOM   2347 C  CG2 . VAL A 1 313 ? 33.026 37.664  55.417  1.00 22.00 ? 420  VAL A CG2 1 
ATOM   2348 N  N   . SER A 1 314 ? 31.066 34.428  56.707  1.00 17.28 ? 421  SER A N   1 
ATOM   2349 C  CA  . SER A 1 314 ? 31.614 33.318  57.472  1.00 14.34 ? 421  SER A CA  1 
ATOM   2350 C  C   . SER A 1 314 ? 32.160 32.219  56.559  1.00 14.48 ? 421  SER A C   1 
ATOM   2351 O  O   . SER A 1 314 ? 31.605 31.956  55.494  1.00 15.94 ? 421  SER A O   1 
ATOM   2352 C  CB  . SER A 1 314 ? 30.543 32.739  58.398  1.00 17.01 ? 421  SER A CB  1 
ATOM   2353 O  OG  . SER A 1 314 ? 30.971 31.508  58.942  1.00 16.17 ? 421  SER A OG  1 
ATOM   2354 N  N   . HIS A 1 315 ? 33.242 31.569  56.975  1.00 15.74 ? 422  HIS A N   1 
ATOM   2355 C  CA  . HIS A 1 315 ? 33.772 30.434  56.223  1.00 16.06 ? 422  HIS A CA  1 
ATOM   2356 C  C   . HIS A 1 315 ? 32.872 29.202  56.346  1.00 16.10 ? 422  HIS A C   1 
ATOM   2357 O  O   . HIS A 1 315 ? 32.934 28.296  55.512  1.00 15.25 ? 422  HIS A O   1 
ATOM   2358 C  CB  . HIS A 1 315 ? 35.207 30.120  56.666  1.00 15.93 ? 422  HIS A CB  1 
ATOM   2359 C  CG  . HIS A 1 315 ? 36.190 31.160  56.226  1.00 16.94 ? 422  HIS A CG  1 
ATOM   2360 N  ND1 . HIS A 1 315 ? 36.432 32.305  56.952  1.00 16.78 ? 422  HIS A ND1 1 
ATOM   2361 C  CD2 . HIS A 1 315 ? 36.938 31.263  55.102  1.00 15.41 ? 422  HIS A CD2 1 
ATOM   2362 C  CE1 . HIS A 1 315 ? 37.310 33.055  56.310  1.00 16.89 ? 422  HIS A CE1 1 
ATOM   2363 N  NE2 . HIS A 1 315 ? 37.632 32.445  55.184  1.00 18.77 ? 422  HIS A NE2 1 
ATOM   2364 N  N   . SER A 1 316 ? 32.006 29.193  57.355  1.00 13.85 ? 423  SER A N   1 
ATOM   2365 C  CA  . SER A 1 316 ? 31.042 28.098  57.528  1.00 18.72 ? 423  SER A CA  1 
ATOM   2366 C  C   . SER A 1 316 ? 29.773 28.293  56.719  1.00 16.65 ? 423  SER A C   1 
ATOM   2367 O  O   . SER A 1 316 ? 29.132 27.325  56.324  1.00 15.62 ? 423  SER A O   1 
ATOM   2368 C  CB  . SER A 1 316 ? 30.654 27.935  59.003  1.00 17.86 ? 423  SER A CB  1 
ATOM   2369 O  OG  . SER A 1 316 ? 31.701 27.342  59.738  1.00 20.13 ? 423  SER A OG  1 
ATOM   2370 N  N   . TYR A 1 317 ? 29.396 29.546  56.485  1.00 16.00 ? 424  TYR A N   1 
ATOM   2371 C  CA  . TYR A 1 317 ? 28.077 29.829  55.933  1.00 14.09 ? 424  TYR A CA  1 
ATOM   2372 C  C   . TYR A 1 317 ? 28.045 30.706  54.682  1.00 13.96 ? 424  TYR A C   1 
ATOM   2373 O  O   . TYR A 1 317 ? 26.974 30.959  54.136  1.00 13.55 ? 424  TYR A O   1 
ATOM   2374 C  CB  . TYR A 1 317 ? 27.213 30.520  56.980  1.00 14.06 ? 424  TYR A CB  1 
ATOM   2375 C  CG  . TYR A 1 317 ? 26.923 29.737  58.231  1.00 20.11 ? 424  TYR A CG  1 
ATOM   2376 C  CD1 . TYR A 1 317 ? 26.410 28.437  58.179  1.00 16.75 ? 424  TYR A CD1 1 
ATOM   2377 C  CD2 . TYR A 1 317 ? 27.134 30.308  59.478  1.00 17.26 ? 424  TYR A CD2 1 
ATOM   2378 C  CE1 . TYR A 1 317 ? 26.125 27.731  59.349  1.00 15.27 ? 424  TYR A CE1 1 
ATOM   2379 C  CE2 . TYR A 1 317 ? 26.848 29.621  60.641  1.00 23.50 ? 424  TYR A CE2 1 
ATOM   2380 C  CZ  . TYR A 1 317 ? 26.339 28.330  60.575  1.00 20.87 ? 424  TYR A CZ  1 
ATOM   2381 O  OH  . TYR A 1 317 ? 26.056 27.652  61.743  1.00 21.79 ? 424  TYR A OH  1 
ATOM   2382 N  N   . GLY A 1 318 ? 29.200 31.182  54.238  1.00 14.68 ? 425  GLY A N   1 
ATOM   2383 C  CA  . GLY A 1 318 ? 29.238 32.197  53.204  1.00 13.13 ? 425  GLY A CA  1 
ATOM   2384 C  C   . GLY A 1 318 ? 28.566 33.466  53.714  1.00 17.72 ? 425  GLY A C   1 
ATOM   2385 O  O   . GLY A 1 318 ? 28.890 33.955  54.799  1.00 14.03 ? 425  GLY A O   1 
ATOM   2386 N  N   . TYR A 1 319 ? 27.630 33.998  52.935  1.00 14.90 ? 426  TYR A N   1 
ATOM   2387 C  CA  . TYR A 1 319 ? 26.909 35.222  53.313  1.00 14.40 ? 426  TYR A CA  1 
ATOM   2388 C  C   . TYR A 1 319 ? 25.684 34.922  54.156  1.00 15.66 ? 426  TYR A C   1 
ATOM   2389 O  O   . TYR A 1 319 ? 24.936 35.826  54.545  1.00 16.95 ? 426  TYR A O   1 
ATOM   2390 C  CB  . TYR A 1 319 ? 26.523 36.018  52.054  1.00 15.42 ? 426  TYR A CB  1 
ATOM   2391 C  CG  . TYR A 1 319 ? 27.730 36.703  51.461  1.00 14.25 ? 426  TYR A CG  1 
ATOM   2392 C  CD1 . TYR A 1 319 ? 28.121 37.954  51.920  1.00 14.15 ? 426  TYR A CD1 1 
ATOM   2393 C  CD2 . TYR A 1 319 ? 28.515 36.080  50.484  1.00 15.40 ? 426  TYR A CD2 1 
ATOM   2394 C  CE1 . TYR A 1 319 ? 29.245 38.589  51.406  1.00 15.43 ? 426  TYR A CE1 1 
ATOM   2395 C  CE2 . TYR A 1 319 ? 29.644 36.707  49.967  1.00 13.53 ? 426  TYR A CE2 1 
ATOM   2396 C  CZ  . TYR A 1 319 ? 30.007 37.960  50.447  1.00 19.83 ? 426  TYR A CZ  1 
ATOM   2397 O  OH  . TYR A 1 319 ? 31.116 38.603  49.962  1.00 15.44 ? 426  TYR A OH  1 
ATOM   2398 N  N   . GLY A 1 320 ? 25.485 33.646  54.462  1.00 18.68 ? 427  GLY A N   1 
ATOM   2399 C  CA  . GLY A 1 320 ? 24.432 33.268  55.382  1.00 17.13 ? 427  GLY A CA  1 
ATOM   2400 C  C   . GLY A 1 320 ? 23.289 32.494  54.760  1.00 15.05 ? 427  GLY A C   1 
ATOM   2401 O  O   . GLY A 1 320 ? 23.422 31.884  53.703  1.00 13.69 ? 427  GLY A O   1 
ATOM   2402 N  N   . LEU A 1 321 ? 22.150 32.532  55.434  1.00 14.44 ? 428  LEU A N   1 
ATOM   2403 C  CA  . LEU A 1 321 ? 21.000 31.730  55.056  1.00 16.18 ? 428  LEU A CA  1 
ATOM   2404 C  C   . LEU A 1 321 ? 20.280 32.330  53.853  1.00 18.97 ? 428  LEU A C   1 
ATOM   2405 O  O   . LEU A 1 321 ? 19.984 33.534  53.844  1.00 18.95 ? 428  LEU A O   1 
ATOM   2406 C  CB  . LEU A 1 321 ? 20.038 31.625  56.240  1.00 17.05 ? 428  LEU A CB  1 
ATOM   2407 C  CG  . LEU A 1 321 ? 18.900 30.623  56.146  1.00 23.45 ? 428  LEU A CG  1 
ATOM   2408 C  CD1 . LEU A 1 321 ? 19.463 29.212  56.275  1.00 19.02 ? 428  LEU A CD1 1 
ATOM   2409 C  CD2 . LEU A 1 321 ? 17.882 30.914  57.236  1.00 27.90 ? 428  LEU A CD2 1 
ATOM   2410 N  N   . LEU A 1 322 ? 20.000 31.506  52.844  1.00 16.15 ? 429  LEU A N   1 
ATOM   2411 C  CA  . LEU A 1 322 ? 19.132 31.936  51.751  1.00 15.04 ? 429  LEU A CA  1 
ATOM   2412 C  C   . LEU A 1 322 ? 17.770 32.358  52.280  1.00 19.06 ? 429  LEU A C   1 
ATOM   2413 O  O   . LEU A 1 322 ? 17.235 31.766  53.222  1.00 18.01 ? 429  LEU A O   1 
ATOM   2414 C  CB  . LEU A 1 322 ? 18.937 30.832  50.708  1.00 18.45 ? 429  LEU A CB  1 
ATOM   2415 C  CG  . LEU A 1 322 ? 20.153 30.377  49.908  1.00 16.89 ? 429  LEU A CG  1 
ATOM   2416 C  CD1 . LEU A 1 322 ? 19.675 29.381  48.855  1.00 14.86 ? 429  LEU A CD1 1 
ATOM   2417 C  CD2 . LEU A 1 322 ? 20.846 31.577  49.259  1.00 14.24 ? 429  LEU A CD2 1 
ATOM   2418 N  N   . ASP A 1 323 ? 17.210 33.376  51.636  1.00 19.96 ? 430  ASP A N   1 
ATOM   2419 C  CA  . ASP A 1 323 ? 15.917 33.943  51.998  1.00 17.96 ? 430  ASP A CA  1 
ATOM   2420 C  C   . ASP A 1 323 ? 15.085 34.002  50.725  1.00 15.81 ? 430  ASP A C   1 
ATOM   2421 O  O   . ASP A 1 323 ? 15.270 34.897  49.905  1.00 16.55 ? 430  ASP A O   1 
ATOM   2422 C  CB  . ASP A 1 323 ? 16.109 35.332  52.622  1.00 17.06 ? 430  ASP A CB  1 
ATOM   2423 C  CG  . ASP A 1 323 ? 14.789 36.038  52.959  1.00 20.67 ? 430  ASP A CG  1 
ATOM   2424 O  OD1 . ASP A 1 323 ? 13.721 35.715  52.402  1.00 20.46 ? 430  ASP A OD1 1 
ATOM   2425 O  OD2 . ASP A 1 323 ? 14.834 36.959  53.787  1.00 25.47 ? 430  ASP A OD2 1 
ATOM   2426 N  N   . ALA A 1 324 ? 14.183 33.043  50.552  1.00 16.45 ? 431  ALA A N   1 
ATOM   2427 C  CA  . ALA A 1 324 ? 13.442 32.919  49.301  1.00 16.56 ? 431  ALA A CA  1 
ATOM   2428 C  C   . ALA A 1 324 ? 12.635 34.188  48.993  1.00 19.20 ? 431  ALA A C   1 
ATOM   2429 O  O   . ALA A 1 324 ? 12.668 34.709  47.869  1.00 18.17 ? 431  ALA A O   1 
ATOM   2430 C  CB  . ALA A 1 324 ? 12.523 31.700  49.350  1.00 14.68 ? 431  ALA A CB  1 
ATOM   2431 N  N   . GLY A 1 325 ? 11.932 34.688  50.002  1.00 20.23 ? 432  GLY A N   1 
ATOM   2432 C  CA  . GLY A 1 325 ? 11.149 35.905  49.846  1.00 15.86 ? 432  GLY A CA  1 
ATOM   2433 C  C   . GLY A 1 325 ? 11.985 37.080  49.356  1.00 15.66 ? 432  GLY A C   1 
ATOM   2434 O  O   . GLY A 1 325 ? 11.589 37.795  48.444  1.00 17.17 ? 432  GLY A O   1 
ATOM   2435 N  N   . ALA A 1 326 ? 13.157 37.267  49.948  1.00 16.19 ? 433  ALA A N   1 
ATOM   2436 C  CA  . ALA A 1 326 ? 14.017 38.377  49.579  1.00 16.34 ? 433  ALA A CA  1 
ATOM   2437 C  C   . ALA A 1 326 ? 14.644 38.188  48.201  1.00 16.87 ? 433  ALA A C   1 
ATOM   2438 O  O   . ALA A 1 326 ? 14.831 39.163  47.468  1.00 17.48 ? 433  ALA A O   1 
ATOM   2439 C  CB  . ALA A 1 326 ? 15.095 38.581  50.630  1.00 16.16 ? 433  ALA A CB  1 
ATOM   2440 N  N   . MET A 1 327 ? 14.962 36.939  47.851  1.00 17.08 ? 434  MET A N   1 
ATOM   2441 C  CA  . MET A 1 327 ? 15.520 36.614  46.532  1.00 14.84 ? 434  MET A CA  1 
ATOM   2442 C  C   . MET A 1 327 ? 14.549 36.993  45.423  1.00 13.70 ? 434  MET A C   1 
ATOM   2443 O  O   . MET A 1 327 ? 14.878 37.724  44.493  1.00 14.97 ? 434  MET A O   1 
ATOM   2444 C  CB  . MET A 1 327 ? 15.857 35.114  46.431  1.00 14.31 ? 434  MET A CB  1 
ATOM   2445 C  CG  . MET A 1 327 ? 17.127 34.685  47.162  1.00 12.96 ? 434  MET A CG  1 
ATOM   2446 S  SD  . MET A 1 327 ? 18.638 35.019  46.234  1.00 20.11 ? 434  MET A SD  1 
ATOM   2447 C  CE  . MET A 1 327 ? 18.455 33.875  44.859  1.00 15.63 ? 434  MET A CE  1 
ATOM   2448 N  N   . VAL A 1 328 ? 13.340 36.483  45.538  1.00 13.19 ? 435  VAL A N   1 
ATOM   2449 C  CA  . VAL A 1 328 ? 12.303 36.757  44.570  1.00 14.33 ? 435  VAL A CA  1 
ATOM   2450 C  C   . VAL A 1 328 ? 11.945 38.261  44.506  1.00 18.41 ? 435  VAL A C   1 
ATOM   2451 O  O   . VAL A 1 328 ? 11.749 38.823  43.424  1.00 17.38 ? 435  VAL A O   1 
ATOM   2452 C  CB  . VAL A 1 328 ? 11.059 35.935  44.904  1.00 19.69 ? 435  VAL A CB  1 
ATOM   2453 C  CG1 . VAL A 1 328 ? 9.876  36.504  44.211  1.00 28.07 ? 435  VAL A CG1 1 
ATOM   2454 C  CG2 . VAL A 1 328 ? 11.289 34.468  44.534  1.00 20.48 ? 435  VAL A CG2 1 
ATOM   2455 N  N   . ALA A 1 329 ? 11.852 38.900  45.663  1.00 16.28 ? 436  ALA A N   1 
ATOM   2456 C  CA  . ALA A 1 329 ? 11.496 40.326  45.713  1.00 17.35 ? 436  ALA A CA  1 
ATOM   2457 C  C   . ALA A 1 329 ? 12.525 41.163  44.953  1.00 18.41 ? 436  ALA A C   1 
ATOM   2458 O  O   . ALA A 1 329 ? 12.170 42.052  44.175  1.00 19.12 ? 436  ALA A O   1 
ATOM   2459 C  CB  . ALA A 1 329 ? 11.384 40.793  47.148  1.00 19.28 ? 436  ALA A CB  1 
ATOM   2460 N  N   . LEU A 1 330 ? 13.802 40.856  45.148  1.00 15.62 ? 437  LEU A N   1 
ATOM   2461 C  CA  . LEU A 1 330 ? 14.853 41.618  44.474  1.00 16.36 ? 437  LEU A CA  1 
ATOM   2462 C  C   . LEU A 1 330 ? 14.987 41.260  42.989  1.00 14.06 ? 437  LEU A C   1 
ATOM   2463 O  O   . LEU A 1 330 ? 15.239 42.123  42.157  1.00 17.61 ? 437  LEU A O   1 
ATOM   2464 C  CB  . LEU A 1 330 ? 16.192 41.423  45.189  1.00 18.31 ? 437  LEU A CB  1 
ATOM   2465 C  CG  . LEU A 1 330 ? 17.316 42.350  44.711  1.00 23.24 ? 437  LEU A CG  1 
ATOM   2466 C  CD1 . LEU A 1 330 ? 16.881 43.826  44.798  1.00 21.85 ? 437  LEU A CD1 1 
ATOM   2467 C  CD2 . LEU A 1 330 ? 18.597 42.110  45.511  1.00 17.43 ? 437  LEU A CD2 1 
ATOM   2468 N  N   . ALA A 1 331 ? 14.810 39.985  42.659  1.00 15.95 ? 438  ALA A N   1 
ATOM   2469 C  CA  . ALA A 1 331 ? 14.881 39.520  41.267  1.00 14.07 ? 438  ALA A CA  1 
ATOM   2470 C  C   . ALA A 1 331 ? 13.973 40.346  40.356  1.00 14.40 ? 438  ALA A C   1 
ATOM   2471 O  O   . ALA A 1 331 ? 14.355 40.727  39.263  1.00 14.51 ? 438  ALA A O   1 
ATOM   2472 C  CB  . ALA A 1 331 ? 14.497 38.041  41.184  1.00 11.83 ? 438  ALA A CB  1 
ATOM   2473 N  N   . GLN A 1 332 ? 12.774 40.626  40.847  1.00 15.66 ? 439  GLN A N   1 
ATOM   2474 C  CA  . GLN A 1 332 ? 11.758 41.347  40.091  1.00 20.50 ? 439  GLN A CA  1 
ATOM   2475 C  C   . GLN A 1 332 ? 12.216 42.707  39.577  1.00 16.83 ? 439  GLN A C   1 
ATOM   2476 O  O   . GLN A 1 332 ? 11.790 43.138  38.516  1.00 21.12 ? 439  GLN A O   1 
ATOM   2477 C  CB  . GLN A 1 332 ? 10.508 41.533  40.947  1.00 19.71 ? 439  GLN A CB  1 
ATOM   2478 C  CG  . GLN A 1 332 ? 9.775  40.243  41.191  1.00 26.13 ? 439  GLN A CG  1 
ATOM   2479 C  CD  . GLN A 1 332 ? 8.545  40.440  42.030  1.00 25.86 ? 439  GLN A CD  1 
ATOM   2480 O  OE1 . GLN A 1 332 ? 8.594  40.399  43.253  1.00 36.87 ? 439  GLN A OE1 1 
ATOM   2481 N  NE2 . GLN A 1 332 ? 7.426  40.665  41.371  1.00 40.43 ? 439  GLN A NE2 1 
ATOM   2482 N  N   . ASN A 1 333 ? 13.091 43.369  40.324  1.00 17.99 ? 440  ASN A N   1 
ATOM   2483 C  CA  . ASN A 1 333 ? 13.549 44.704  39.931  1.00 18.59 ? 440  ASN A CA  1 
ATOM   2484 C  C   . ASN A 1 333 ? 15.059 44.781  39.621  1.00 20.70 ? 440  ASN A C   1 
ATOM   2485 O  O   . ASN A 1 333 ? 15.620 45.866  39.541  1.00 22.44 ? 440  ASN A O   1 
ATOM   2486 C  CB  . ASN A 1 333 ? 13.172 45.706  41.029  1.00 21.15 ? 440  ASN A CB  1 
ATOM   2487 C  CG  . ASN A 1 333 ? 11.753 45.491  41.535  1.00 26.41 ? 440  ASN A CG  1 
ATOM   2488 O  OD1 . ASN A 1 333 ? 11.524 45.209  42.714  1.00 29.73 ? 440  ASN A OD1 1 
ATOM   2489 N  ND2 . ASN A 1 333 ? 10.795 45.600  40.634  1.00 30.49 ? 440  ASN A ND2 1 
ATOM   2490 N  N   . TRP A 1 334 ? 15.700 43.633  39.420  1.00 13.85 ? 441  TRP A N   1 
ATOM   2491 C  CA  . TRP A 1 334 ? 17.151 43.566  39.246  1.00 14.71 ? 441  TRP A CA  1 
ATOM   2492 C  C   . TRP A 1 334 ? 17.590 43.946  37.837  1.00 19.61 ? 441  TRP A C   1 
ATOM   2493 O  O   . TRP A 1 334 ? 17.093 43.398  36.859  1.00 18.40 ? 441  TRP A O   1 
ATOM   2494 C  CB  . TRP A 1 334 ? 17.656 42.148  39.572  1.00 14.94 ? 441  TRP A CB  1 
ATOM   2495 C  CG  . TRP A 1 334 ? 19.143 41.992  39.516  1.00 14.05 ? 441  TRP A CG  1 
ATOM   2496 C  CD1 . TRP A 1 334 ? 19.880 41.401  38.518  1.00 15.63 ? 441  TRP A CD1 1 
ATOM   2497 C  CD2 . TRP A 1 334 ? 20.082 42.432  40.503  1.00 13.73 ? 441  TRP A CD2 1 
ATOM   2498 N  NE1 . TRP A 1 334 ? 21.227 41.456  38.835  1.00 15.49 ? 441  TRP A NE1 1 
ATOM   2499 C  CE2 . TRP A 1 334 ? 21.369 42.076  40.049  1.00 14.15 ? 441  TRP A CE2 1 
ATOM   2500 C  CE3 . TRP A 1 334 ? 19.957 43.083  41.730  1.00 17.56 ? 441  TRP A CE3 1 
ATOM   2501 C  CZ2 . TRP A 1 334 ? 22.515 42.361  40.778  1.00 16.61 ? 441  TRP A CZ2 1 
ATOM   2502 C  CZ3 . TRP A 1 334 ? 21.093 43.363  42.451  1.00 17.59 ? 441  TRP A CZ3 1 
ATOM   2503 C  CH2 . TRP A 1 334 ? 22.358 43.001  41.975  1.00 17.27 ? 441  TRP A CH2 1 
ATOM   2504 N  N   . THR A 1 335 ? 18.520 44.892  37.743  1.00 17.32 ? 442  THR A N   1 
ATOM   2505 C  CA  . THR A 1 335 ? 19.175 45.214  36.483  1.00 17.06 ? 442  THR A CA  1 
ATOM   2506 C  C   . THR A 1 335 ? 20.361 44.266  36.254  1.00 19.49 ? 442  THR A C   1 
ATOM   2507 O  O   . THR A 1 335 ? 21.221 44.113  37.125  1.00 15.44 ? 442  THR A O   1 
ATOM   2508 C  CB  . THR A 1 335 ? 19.667 46.672  36.469  1.00 17.09 ? 442  THR A CB  1 
ATOM   2509 O  OG1 . THR A 1 335 ? 18.549 47.554  36.585  1.00 19.79 ? 442  THR A OG1 1 
ATOM   2510 C  CG2 . THR A 1 335 ? 20.453 46.992  35.192  1.00 15.85 ? 442  THR A CG2 1 
ATOM   2511 N  N   . THR A 1 336 ? 20.405 43.640  35.082  1.00 17.02 ? 443  THR A N   1 
ATOM   2512 C  CA  . THR A 1 336 ? 21.472 42.691  34.762  1.00 17.86 ? 443  THR A CA  1 
ATOM   2513 C  C   . THR A 1 336 ? 22.858 43.340  34.859  1.00 20.74 ? 443  THR A C   1 
ATOM   2514 O  O   . THR A 1 336 ? 23.053 44.479  34.453  1.00 15.47 ? 443  THR A O   1 
ATOM   2515 C  CB  . THR A 1 336 ? 21.277 42.095  33.344  1.00 23.60 ? 443  THR A CB  1 
ATOM   2516 O  OG1 . THR A 1 336 ? 19.972 41.513  33.252  1.00 33.07 ? 443  THR A OG1 1 
ATOM   2517 C  CG2 . THR A 1 336 ? 22.297 41.010  33.058  1.00 18.98 ? 443  THR A CG2 1 
ATOM   2518 N  N   . VAL A 1 337 ? 23.825 42.608  35.399  1.00 19.93 ? 444  VAL A N   1 
ATOM   2519 C  CA  . VAL A 1 337 ? 25.160 43.155  35.561  1.00 20.14 ? 444  VAL A CA  1 
ATOM   2520 C  C   . VAL A 1 337 ? 25.924 43.135  34.246  1.00 22.02 ? 444  VAL A C   1 
ATOM   2521 O  O   . VAL A 1 337 ? 25.590 42.375  33.334  1.00 20.02 ? 444  VAL A O   1 
ATOM   2522 C  CB  . VAL A 1 337 ? 25.958 42.391  36.638  1.00 19.70 ? 444  VAL A CB  1 
ATOM   2523 C  CG1 . VAL A 1 337 ? 25.291 42.572  37.982  1.00 16.97 ? 444  VAL A CG1 1 
ATOM   2524 C  CG2 . VAL A 1 337 ? 26.055 40.927  36.286  1.00 16.80 ? 444  VAL A CG2 1 
ATOM   2525 N  N   . ALA A 1 338 ? 26.945 43.982  34.155  1.00 19.48 ? 445  ALA A N   1 
ATOM   2526 C  CA  . ALA A 1 338 ? 27.772 44.072  32.955  1.00 17.90 ? 445  ALA A CA  1 
ATOM   2527 C  C   . ALA A 1 338 ? 28.542 42.764  32.743  1.00 21.17 ? 445  ALA A C   1 
ATOM   2528 O  O   . ALA A 1 338 ? 28.650 41.957  33.666  1.00 17.24 ? 445  ALA A O   1 
ATOM   2529 C  CB  . ALA A 1 338 ? 28.736 45.285  33.059  1.00 18.19 ? 445  ALA A CB  1 
ATOM   2530 N  N   . PRO A 1 339 ? 29.052 42.532  31.517  1.00 24.87 ? 446  PRO A N   1 
ATOM   2531 C  CA  . PRO A 1 339 ? 29.766 41.281  31.253  1.00 20.37 ? 446  PRO A CA  1 
ATOM   2532 C  C   . PRO A 1 339 ? 30.955 41.077  32.180  1.00 20.67 ? 446  PRO A C   1 
ATOM   2533 O  O   . PRO A 1 339 ? 31.582 42.030  32.621  1.00 20.46 ? 446  PRO A O   1 
ATOM   2534 C  CB  . PRO A 1 339 ? 30.238 41.443  29.802  1.00 22.99 ? 446  PRO A CB  1 
ATOM   2535 C  CG  . PRO A 1 339 ? 29.265 42.393  29.199  1.00 22.84 ? 446  PRO A CG  1 
ATOM   2536 C  CD  . PRO A 1 339 ? 28.982 43.371  30.305  1.00 20.63 ? 446  PRO A CD  1 
ATOM   2537 N  N   . GLN A 1 340 ? 31.256 39.821  32.463  1.00 20.25 ? 447  GLN A N   1 
ATOM   2538 C  CA  . GLN A 1 340 ? 32.396 39.492  33.305  1.00 20.45 ? 447  GLN A CA  1 
ATOM   2539 C  C   . GLN A 1 340 ? 33.719 39.942  32.685  1.00 21.45 ? 447  GLN A C   1 
ATOM   2540 O  O   . GLN A 1 340 ? 33.958 39.749  31.501  1.00 22.05 ? 447  GLN A O   1 
ATOM   2541 C  CB  . GLN A 1 340 ? 32.433 37.995  33.566  1.00 18.21 ? 447  GLN A CB  1 
ATOM   2542 C  CG  . GLN A 1 340 ? 33.428 37.588  34.621  1.00 20.40 ? 447  GLN A CG  1 
ATOM   2543 C  CD  . GLN A 1 340 ? 33.738 36.118  34.553  1.00 24.91 ? 447  GLN A CD  1 
ATOM   2544 O  OE1 . GLN A 1 340 ? 34.234 35.626  33.533  1.00 28.02 ? 447  GLN A OE1 1 
ATOM   2545 N  NE2 . GLN A 1 340 ? 33.435 35.397  35.624  1.00 15.90 ? 447  GLN A NE2 1 
ATOM   2546 N  N   . ARG A 1 341 ? 34.546 40.583  33.500  1.00 16.75 ? 448  ARG A N   1 
ATOM   2547 C  CA  . ARG A 1 341 ? 35.934 40.861  33.167  1.00 16.97 ? 448  ARG A CA  1 
ATOM   2548 C  C   . ARG A 1 341 ? 36.854 39.984  34.022  1.00 18.24 ? 448  ARG A C   1 
ATOM   2549 O  O   . ARG A 1 341 ? 36.520 39.628  35.152  1.00 16.09 ? 448  ARG A O   1 
ATOM   2550 C  CB  . ARG A 1 341 ? 36.265 42.338  33.391  1.00 12.77 ? 448  ARG A CB  1 
ATOM   2551 C  CG  . ARG A 1 341 ? 35.483 43.282  32.490  1.00 18.53 ? 448  ARG A CG  1 
ATOM   2552 C  CD  . ARG A 1 341 ? 35.735 44.744  32.852  1.00 18.57 ? 448  ARG A CD  1 
ATOM   2553 N  NE  . ARG A 1 341 ? 35.120 45.633  31.872  1.00 22.73 ? 448  ARG A NE  1 
ATOM   2554 C  CZ  . ARG A 1 341 ? 35.435 46.915  31.715  1.00 20.77 ? 448  ARG A CZ  1 
ATOM   2555 N  NH1 . ARG A 1 341 ? 34.816 47.631  30.791  1.00 19.99 ? 448  ARG A NH1 1 
ATOM   2556 N  NH2 . ARG A 1 341 ? 36.358 47.480  32.480  1.00 21.53 ? 448  ARG A NH2 1 
ATOM   2557 N  N   . LYS A 1 342 ? 38.014 39.654  33.475  1.00 17.93 ? 449  LYS A N   1 
ATOM   2558 C  CA  . LYS A 1 342 ? 38.982 38.809  34.156  1.00 16.15 ? 449  LYS A CA  1 
ATOM   2559 C  C   . LYS A 1 342 ? 40.367 39.436  34.076  1.00 18.73 ? 449  LYS A C   1 
ATOM   2560 O  O   . LYS A 1 342 ? 40.890 39.653  32.982  1.00 19.09 ? 449  LYS A O   1 
ATOM   2561 C  CB  . LYS A 1 342 ? 39.003 37.416  33.534  1.00 14.46 ? 449  LYS A CB  1 
ATOM   2562 C  CG  . LYS A 1 342 ? 39.981 36.456  34.175  1.00 15.71 ? 449  LYS A CG  1 
ATOM   2563 C  CD  . LYS A 1 342 ? 40.101 35.179  33.352  1.00 17.13 ? 449  LYS A CD  1 
ATOM   2564 C  CE  . LYS A 1 342 ? 40.821 34.099  34.120  1.00 25.40 ? 449  LYS A CE  1 
ATOM   2565 N  NZ  . LYS A 1 342 ? 41.282 32.989  33.226  1.00 32.00 ? 449  LYS A NZ  1 
ATOM   2566 N  N   . CYS A 1 343 ? 40.956 39.725  35.234  1.00 19.14 ? 450  CYS A N   1 
ATOM   2567 C  CA  . CYS A 1 343 ? 42.269 40.358  35.288  1.00 18.11 ? 450  CYS A CA  1 
ATOM   2568 C  C   . CYS A 1 343 ? 43.275 39.430  35.967  1.00 22.47 ? 450  CYS A C   1 
ATOM   2569 O  O   . CYS A 1 343 ? 43.070 39.004  37.104  1.00 22.86 ? 450  CYS A O   1 
ATOM   2570 C  CB  . CYS A 1 343 ? 42.175 41.709  36.013  1.00 26.77 ? 450  CYS A CB  1 
ATOM   2571 S  SG  . CYS A 1 343 ? 43.747 42.546  36.263  1.00 31.90 ? 450  CYS A SG  1 
ATOM   2572 N  N   . ILE A 1 344 ? 44.348 39.109  35.251  1.00 19.73 ? 451  ILE A N   1 
ATOM   2573 C  CA  . ILE A 1 344 ? 45.336 38.142  35.704  1.00 24.01 ? 451  ILE A CA  1 
ATOM   2574 C  C   . ILE A 1 344 ? 46.639 38.840  36.082  1.00 28.82 ? 451  ILE A C   1 
ATOM   2575 O  O   . ILE A 1 344 ? 47.182 39.622  35.298  1.00 24.90 ? 451  ILE A O   1 
ATOM   2576 C  CB  . ILE A 1 344 ? 45.636 37.094  34.620  1.00 23.44 ? 451  ILE A CB  1 
ATOM   2577 C  CG1 . ILE A 1 344 ? 44.369 36.325  34.232  1.00 19.22 ? 451  ILE A CG1 1 
ATOM   2578 C  CG2 . ILE A 1 344 ? 46.716 36.143  35.073  1.00 23.74 ? 451  ILE A CG2 1 
ATOM   2579 C  CD1 . ILE A 1 344 ? 44.614 35.346  33.095  1.00 23.29 ? 451  ILE A CD1 1 
ATOM   2580 N  N   . ILE A 1 345 ? 47.135 38.559  37.283  1.00 19.81 ? 452  ILE A N   1 
ATOM   2581 C  CA  . ILE A 1 345 ? 48.367 39.180  37.753  1.00 24.98 ? 452  ILE A CA  1 
ATOM   2582 C  C   . ILE A 1 345 ? 49.370 38.146  38.284  1.00 25.80 ? 452  ILE A C   1 
ATOM   2583 O  O   . ILE A 1 345 ? 49.138 37.499  39.311  1.00 21.69 ? 452  ILE A O   1 
ATOM   2584 C  CB  . ILE A 1 345 ? 48.076 40.228  38.848  1.00 23.80 ? 452  ILE A CB  1 
ATOM   2585 C  CG1 . ILE A 1 345 ? 47.037 41.241  38.344  1.00 26.33 ? 452  ILE A CG1 1 
ATOM   2586 C  CG2 . ILE A 1 345 ? 49.354 40.954  39.225  1.00 27.17 ? 452  ILE A CG2 1 
ATOM   2587 C  CD1 . ILE A 1 345 ? 45.977 41.630  39.343  1.00 21.05 ? 452  ILE A CD1 1 
ATOM   2588 N  N   . ASP A 1 346 ? 50.475 37.994  37.564  1.00 19.25 ? 453  ASP A N   1 
ATOM   2589 C  CA  . ASP A 1 346 ? 51.568 37.132  37.991  1.00 23.52 ? 453  ASP A CA  1 
ATOM   2590 C  C   . ASP A 1 346 ? 52.369 37.841  39.067  1.00 26.82 ? 453  ASP A C   1 
ATOM   2591 O  O   . ASP A 1 346 ? 52.845 38.953  38.850  1.00 27.24 ? 453  ASP A O   1 
ATOM   2592 C  CB  . ASP A 1 346 ? 52.473 36.783  36.814  1.00 30.75 ? 453  ASP A CB  1 
ATOM   2593 C  CG  . ASP A 1 346 ? 51.743 36.044  35.723  1.00 43.46 ? 453  ASP A CG  1 
ATOM   2594 O  OD1 . ASP A 1 346 ? 50.902 35.175  36.050  1.00 50.17 ? 453  ASP A OD1 1 
ATOM   2595 O  OD2 . ASP A 1 346 ? 52.001 36.336  34.536  1.00 55.29 ? 453  ASP A OD2 1 
ATOM   2596 N  N   . ILE A 1 347 ? 52.515 37.213  40.227  1.00 22.19 ? 454  ILE A N   1 
ATOM   2597 C  CA  . ILE A 1 347 ? 53.100 37.913  41.362  1.00 25.70 ? 454  ILE A CA  1 
ATOM   2598 C  C   . ILE A 1 347 ? 54.604 37.653  41.554  1.00 23.97 ? 454  ILE A C   1 
ATOM   2599 O  O   . ILE A 1 347 ? 55.361 38.592  41.743  1.00 28.24 ? 454  ILE A O   1 
ATOM   2600 C  CB  . ILE A 1 347 ? 52.375 37.558  42.664  1.00 28.21 ? 454  ILE A CB  1 
ATOM   2601 C  CG1 . ILE A 1 347 ? 50.853 37.623  42.476  1.00 22.75 ? 454  ILE A CG1 1 
ATOM   2602 C  CG2 . ILE A 1 347 ? 52.806 38.506  43.782  1.00 26.59 ? 454  ILE A CG2 1 
ATOM   2603 C  CD1 . ILE A 1 347 ? 50.294 39.004  42.532  1.00 27.94 ? 454  ILE A CD1 1 
ATOM   2604 N  N   . LEU A 1 348 ? 55.038 36.393  41.508  1.00 23.26 ? 455  LEU A N   1 
ATOM   2605 C  CA  . LEU A 1 348 ? 56.429 36.055  41.841  1.00 24.93 ? 455  LEU A CA  1 
ATOM   2606 C  C   . LEU A 1 348 ? 57.462 36.321  40.740  1.00 29.38 ? 455  LEU A C   1 
ATOM   2607 O  O   . LEU A 1 348 ? 57.244 35.989  39.580  1.00 27.64 ? 455  LEU A O   1 
ATOM   2608 C  CB  . LEU A 1 348 ? 56.534 34.576  42.232  1.00 26.04 ? 455  LEU A CB  1 
ATOM   2609 C  CG  . LEU A 1 348 ? 55.727 34.116  43.439  1.00 25.14 ? 455  LEU A CG  1 
ATOM   2610 C  CD1 . LEU A 1 348 ? 56.090 32.687  43.777  1.00 26.47 ? 455  LEU A CD1 1 
ATOM   2611 C  CD2 . LEU A 1 348 ? 55.949 35.034  44.636  1.00 24.15 ? 455  LEU A CD2 1 
ATOM   2612 N  N   . THR A 1 349 ? 58.606 36.889  41.121  1.00 31.03 ? 456  THR A N   1 
ATOM   2613 C  CA  . THR A 1 349 ? 59.741 36.998  40.206  1.00 28.63 ? 456  THR A CA  1 
ATOM   2614 C  C   . THR A 1 349 ? 60.795 35.929  40.501  1.00 31.93 ? 456  THR A C   1 
ATOM   2615 O  O   . THR A 1 349 ? 61.695 35.690  39.696  1.00 30.04 ? 456  THR A O   1 
ATOM   2616 C  CB  . THR A 1 349 ? 60.407 38.386  40.278  1.00 33.77 ? 456  THR A CB  1 
ATOM   2617 O  OG1 . THR A 1 349 ? 60.772 38.679  41.632  1.00 36.63 ? 456  THR A OG1 1 
ATOM   2618 C  CG2 . THR A 1 349 ? 59.455 39.459  39.783  1.00 40.11 ? 456  THR A CG2 1 
ATOM   2619 N  N   . GLU A 1 350 ? 60.668 35.299  41.665  1.00 27.77 ? 457  GLU A N   1 
ATOM   2620 C  CA  . GLU A 1 350 ? 61.586 34.267  42.136  1.00 30.27 ? 457  GLU A CA  1 
ATOM   2621 C  C   . GLU A 1 350 ? 60.820 33.349  43.083  1.00 22.32 ? 457  GLU A C   1 
ATOM   2622 O  O   . GLU A 1 350 ? 59.924 33.798  43.773  1.00 22.02 ? 457  GLU A O   1 
ATOM   2623 C  CB  . GLU A 1 350 ? 62.796 34.888  42.862  1.00 32.42 ? 457  GLU A CB  1 
ATOM   2624 C  CG  . GLU A 1 350 ? 62.408 35.992  43.860  1.00 32.86 ? 457  GLU A CG  1 
ATOM   2625 C  CD  . GLU A 1 350 ? 63.504 36.322  44.863  1.00 41.16 ? 457  GLU A CD  1 
ATOM   2626 O  OE1 . GLU A 1 350 ? 63.953 37.488  44.891  0.00 41.65 ? 457  GLU A OE1 1 
ATOM   2627 O  OE2 . GLU A 1 350 ? 63.904 35.424  45.632  0.00 38.14 ? 457  GLU A OE2 1 
ATOM   2628 N  N   . PRO A 1 351 ? 61.172 32.060  43.121  1.00 26.89 ? 458  PRO A N   1 
ATOM   2629 C  CA  . PRO A 1 351 ? 60.525 31.179  44.105  1.00 26.42 ? 458  PRO A CA  1 
ATOM   2630 C  C   . PRO A 1 351 ? 60.813 31.630  45.535  1.00 25.62 ? 458  PRO A C   1 
ATOM   2631 O  O   . PRO A 1 351 ? 61.851 32.249  45.764  1.00 26.55 ? 458  PRO A O   1 
ATOM   2632 C  CB  . PRO A 1 351 ? 61.152 29.814  43.825  1.00 28.22 ? 458  PRO A CB  1 
ATOM   2633 C  CG  . PRO A 1 351 ? 62.428 30.120  43.081  1.00 35.92 ? 458  PRO A CG  1 
ATOM   2634 C  CD  . PRO A 1 351 ? 62.146 31.347  42.284  1.00 27.50 ? 458  PRO A CD  1 
ATOM   2635 N  N   . LYS A 1 352 ? 59.908 31.339  46.465  1.00 21.07 ? 459  LYS A N   1 
ATOM   2636 C  CA  . LYS A 1 352 ? 60.064 31.763  47.850  1.00 22.12 ? 459  LYS A CA  1 
ATOM   2637 C  C   . LYS A 1 352 ? 60.087 30.580  48.806  1.00 28.05 ? 459  LYS A C   1 
ATOM   2638 O  O   . LYS A 1 352 ? 59.221 29.697  48.746  1.00 22.85 ? 459  LYS A O   1 
ATOM   2639 C  CB  . LYS A 1 352 ? 58.936 32.707  48.261  1.00 28.43 ? 459  LYS A CB  1 
ATOM   2640 C  CG  . LYS A 1 352 ? 58.754 33.907  47.357  1.00 29.59 ? 459  LYS A CG  1 
ATOM   2641 C  CD  . LYS A 1 352 ? 59.877 34.903  47.511  1.00 29.49 ? 459  LYS A CD  1 
ATOM   2642 C  CE  . LYS A 1 352 ? 59.586 36.155  46.705  1.00 27.88 ? 459  LYS A CE  1 
ATOM   2643 N  NZ  . LYS A 1 352 ? 60.780 37.044  46.609  1.00 45.03 ? 459  LYS A NZ  1 
ATOM   2644 N  N   . ASP A 1 353 ? 61.076 30.565  49.691  1.00 23.23 ? 460  ASP A N   1 
ATOM   2645 C  CA  . ASP A 1 353 ? 61.111 29.566  50.741  1.00 24.66 ? 460  ASP A CA  1 
ATOM   2646 C  C   . ASP A 1 353 ? 59.955 29.818  51.667  1.00 22.00 ? 460  ASP A C   1 
ATOM   2647 O  O   . ASP A 1 353 ? 59.636 30.962  51.963  1.00 25.69 ? 460  ASP A O   1 
ATOM   2648 C  CB  . ASP A 1 353 ? 62.417 29.602  51.530  1.00 26.18 ? 460  ASP A CB  1 
ATOM   2649 C  CG  . ASP A 1 353 ? 62.479 28.504  52.584  1.00 27.56 ? 460  ASP A CG  1 
ATOM   2650 O  OD1 . ASP A 1 353 ? 62.322 27.321  52.217  1.00 34.64 ? 460  ASP A OD1 1 
ATOM   2651 O  OD2 . ASP A 1 353 ? 62.664 28.825  53.778  1.00 31.08 ? 460  ASP A OD2 1 
ATOM   2652 N  N   . ILE A 1 354 ? 59.320 28.761  52.147  1.00 18.63 ? 461  ILE A N   1 
ATOM   2653 C  CA  . ILE A 1 354 ? 58.128 28.976  52.944  1.00 21.80 ? 461  ILE A CA  1 
ATOM   2654 C  C   . ILE A 1 354 ? 58.473 29.140  54.430  1.00 21.47 ? 461  ILE A C   1 
ATOM   2655 O  O   . ILE A 1 354 ? 58.107 30.144  55.038  1.00 28.17 ? 461  ILE A O   1 
ATOM   2656 C  CB  . ILE A 1 354 ? 57.099 27.847  52.707  1.00 23.02 ? 461  ILE A CB  1 
ATOM   2657 C  CG1 . ILE A 1 354 ? 56.400 28.106  51.369  1.00 18.51 ? 461  ILE A CG1 1 
ATOM   2658 C  CG2 . ILE A 1 354 ? 56.080 27.791  53.837  1.00 17.41 ? 461  ILE A CG2 1 
ATOM   2659 C  CD1 . ILE A 1 354 ? 55.621 26.931  50.814  1.00 19.90 ? 461  ILE A CD1 1 
ATOM   2660 N  N   . GLY A 1 355 ? 59.204 28.204  55.012  1.00 31.58 ? 462  GLY A N   1 
ATOM   2661 C  CA  . GLY A 1 355 ? 59.595 28.353  56.415  1.00 27.76 ? 462  GLY A CA  1 
ATOM   2662 C  C   . GLY A 1 355 ? 58.409 28.358  57.370  1.00 28.69 ? 462  GLY A C   1 
ATOM   2663 O  O   . GLY A 1 355 ? 57.358 27.803  57.060  1.00 35.40 ? 462  GLY A O   1 
ATOM   2664 N  N   . LYS A 1 356 ? 58.561 28.982  58.533  1.00 28.50 ? 463  LYS A N   1 
ATOM   2665 C  CA  . LYS A 1 356 ? 57.482 28.985  59.512  1.00 28.32 ? 463  LYS A CA  1 
ATOM   2666 C  C   . LYS A 1 356 ? 56.311 29.851  59.053  1.00 30.52 ? 463  LYS A C   1 
ATOM   2667 O  O   . LYS A 1 356 ? 55.144 29.519  59.290  1.00 21.66 ? 463  LYS A O   1 
ATOM   2668 C  CB  . LYS A 1 356 ? 57.986 29.466  60.868  1.00 29.02 ? 463  LYS A CB  1 
ATOM   2669 C  CG  . LYS A 1 356 ? 56.929 29.425  61.963  1.00 30.85 ? 463  LYS A CG  1 
ATOM   2670 C  CD  . LYS A 1 356 ? 56.679 28.003  62.452  1.00 24.67 ? 463  LYS A CD  1 
ATOM   2671 C  CE  . LYS A 1 356 ? 55.529 27.983  63.446  1.00 30.71 ? 463  LYS A CE  1 
ATOM   2672 N  NZ  . LYS A 1 356 ? 55.125 26.591  63.790  1.00 32.94 ? 463  LYS A NZ  1 
ATOM   2673 N  N   . ARG A 1 357 ? 56.630 30.965  58.401  1.00 31.37 ? 464  ARG A N   1 
ATOM   2674 C  CA  . ARG A 1 357 ? 55.609 31.866  57.897  1.00 29.28 ? 464  ARG A CA  1 
ATOM   2675 C  C   . ARG A 1 357 ? 56.129 32.625  56.683  1.00 28.85 ? 464  ARG A C   1 
ATOM   2676 O  O   . ARG A 1 357 ? 57.213 33.207  56.723  1.00 29.55 ? 464  ARG A O   1 
ATOM   2677 C  CB  . ARG A 1 357 ? 55.164 32.845  58.986  1.00 33.79 ? 464  ARG A CB  1 
ATOM   2678 C  CG  . ARG A 1 357 ? 53.873 33.577  58.662  1.00 36.04 ? 464  ARG A CG  1 
ATOM   2679 C  CD  . ARG A 1 357 ? 53.491 34.534  59.774  1.00 43.21 ? 464  ARG A CD  1 
ATOM   2680 N  NE  . ARG A 1 357 ? 52.137 35.038  59.590  1.00 44.05 ? 464  ARG A NE  1 
ATOM   2681 C  CZ  . ARG A 1 357 ? 51.839 36.166  58.956  1.00 48.79 ? 464  ARG A CZ  1 
ATOM   2682 N  NH1 . ARG A 1 357 ? 52.809 36.925  58.455  1.00 41.43 ? 464  ARG A NH1 1 
ATOM   2683 N  NH2 . ARG A 1 357 ? 50.570 36.539  58.829  1.00 47.87 ? 464  ARG A NH2 1 
ATOM   2684 N  N   . LEU A 1 358 ? 55.364 32.592  55.598  1.00 18.01 ? 465  LEU A N   1 
ATOM   2685 C  CA  . LEU A 1 358 ? 55.724 33.315  54.392  1.00 19.37 ? 465  LEU A CA  1 
ATOM   2686 C  C   . LEU A 1 358 ? 54.639 34.312  54.067  1.00 23.23 ? 465  LEU A C   1 
ATOM   2687 O  O   . LEU A 1 358 ? 53.453 33.990  54.092  1.00 20.88 ? 465  LEU A O   1 
ATOM   2688 C  CB  . LEU A 1 358 ? 55.936 32.375  53.206  1.00 18.82 ? 465  LEU A CB  1 
ATOM   2689 C  CG  . LEU A 1 358 ? 56.095 33.056  51.845  1.00 25.84 ? 465  LEU A CG  1 
ATOM   2690 C  CD1 . LEU A 1 358 ? 57.336 33.966  51.812  1.00 23.05 ? 465  LEU A CD1 1 
ATOM   2691 C  CD2 . LEU A 1 358 ? 56.178 32.006  50.747  1.00 21.57 ? 465  LEU A CD2 1 
ATOM   2692 N  N   . GLU A 1 359 ? 55.054 35.531  53.769  1.00 20.05 ? 466  GLU A N   1 
ATOM   2693 C  CA  . GLU A 1 359 ? 54.117 36.546  53.348  1.00 23.29 ? 466  GLU A CA  1 
ATOM   2694 C  C   . GLU A 1 359 ? 54.608 37.161  52.033  1.00 25.70 ? 466  GLU A C   1 
ATOM   2695 O  O   . GLU A 1 359 ? 55.794 37.440  51.860  1.00 20.33 ? 466  GLU A O   1 
ATOM   2696 C  CB  . GLU A 1 359 ? 53.934 37.568  54.466  1.00 22.82 ? 466  GLU A CB  1 
ATOM   2697 C  CG  . GLU A 1 359 ? 53.945 39.008  54.063  1.00 33.67 ? 466  GLU A CG  1 
ATOM   2698 C  CD  . GLU A 1 359 ? 53.979 39.918  55.275  0.00 29.01 ? 466  GLU A CD  1 
ATOM   2699 O  OE1 . GLU A 1 359 ? 54.610 40.993  55.203  0.00 28.41 ? 466  GLU A OE1 1 
ATOM   2700 O  OE2 . GLU A 1 359 ? 53.378 39.552  56.307  0.00 30.70 ? 466  GLU A OE2 1 
ATOM   2701 N  N   . VAL A 1 360 ? 53.684 37.296  51.086  1.00 23.02 ? 467  VAL A N   1 
ATOM   2702 C  CA  . VAL A 1 360 ? 53.970 37.853  49.780  1.00 18.97 ? 467  VAL A CA  1 
ATOM   2703 C  C   . VAL A 1 360 ? 53.003 39.002  49.566  1.00 24.63 ? 467  VAL A C   1 
ATOM   2704 O  O   . VAL A 1 360 ? 51.791 38.804  49.601  1.00 23.90 ? 467  VAL A O   1 
ATOM   2705 C  CB  . VAL A 1 360 ? 53.807 36.814  48.649  1.00 24.86 ? 467  VAL A CB  1 
ATOM   2706 C  CG1 . VAL A 1 360 ? 54.183 37.413  47.303  1.00 19.31 ? 467  VAL A CG1 1 
ATOM   2707 C  CG2 . VAL A 1 360 ? 54.646 35.576  48.924  1.00 26.06 ? 467  VAL A CG2 1 
ATOM   2708 N  N   . ARG A 1 361 ? 53.533 40.201  49.360  1.00 19.19 ? 468  ARG A N   1 
ATOM   2709 C  CA  . ARG A 1 361 ? 52.701 41.384  49.198  1.00 21.01 ? 468  ARG A CA  1 
ATOM   2710 C  C   . ARG A 1 361 ? 52.867 41.926  47.800  1.00 24.43 ? 468  ARG A C   1 
ATOM   2711 O  O   . ARG A 1 361 ? 53.974 41.966  47.281  1.00 24.40 ? 468  ARG A O   1 
ATOM   2712 C  CB  . ARG A 1 361 ? 53.066 42.472  50.212  1.00 22.68 ? 468  ARG A CB  1 
ATOM   2713 C  CG  . ARG A 1 361 ? 53.505 41.941  51.564  1.00 31.32 ? 468  ARG A CG  1 
ATOM   2714 C  CD  . ARG A 1 361 ? 53.903 43.065  52.506  1.00 27.95 ? 468  ARG A CD  1 
ATOM   2715 N  NE  . ARG A 1 361 ? 52.736 43.808  52.952  1.00 31.47 ? 468  ARG A NE  1 
ATOM   2716 C  CZ  . ARG A 1 361 ? 52.038 43.510  54.038  1.00 31.18 ? 468  ARG A CZ  1 
ATOM   2717 N  NH1 . ARG A 1 361 ? 50.984 44.240  54.364  1.00 33.65 ? 468  ARG A NH1 1 
ATOM   2718 N  NH2 . ARG A 1 361 ? 52.392 42.486  54.793  1.00 37.55 ? 468  ARG A NH2 1 
ATOM   2719 N  N   . LYS A 1 362 ? 51.766 42.356  47.199  1.00 22.05 ? 469  LYS A N   1 
ATOM   2720 C  CA  . LYS A 1 362 ? 51.826 42.932  45.866  1.00 25.96 ? 469  LYS A CA  1 
ATOM   2721 C  C   . LYS A 1 362 ? 50.755 43.994  45.715  1.00 24.95 ? 469  LYS A C   1 
ATOM   2722 O  O   . LYS A 1 362 ? 49.588 43.763  46.028  1.00 21.71 ? 469  LYS A O   1 
ATOM   2723 C  CB  . LYS A 1 362 ? 51.658 41.850  44.805  1.00 27.71 ? 469  LYS A CB  1 
ATOM   2724 C  CG  . LYS A 1 362 ? 51.682 42.362  43.386  1.00 26.28 ? 469  LYS A CG  1 
ATOM   2725 C  CD  . LYS A 1 362 ? 53.083 42.674  42.919  1.00 30.35 ? 469  LYS A CD  1 
ATOM   2726 C  CE  . LYS A 1 362 ? 53.054 43.169  41.478  1.00 33.86 ? 469  LYS A CE  1 
ATOM   2727 N  NZ  . LYS A 1 362 ? 54.395 43.611  41.010  1.00 37.54 ? 469  LYS A NZ  1 
ATOM   2728 N  N   . THR A 1 363 ? 51.159 45.167  45.246  1.00 23.37 ? 470  THR A N   1 
ATOM   2729 C  CA  . THR A 1 363 ? 50.215 46.242  44.989  1.00 23.05 ? 470  THR A CA  1 
ATOM   2730 C  C   . THR A 1 363 ? 49.770 46.139  43.542  1.00 23.52 ? 470  THR A C   1 
ATOM   2731 O  O   . THR A 1 363 ? 50.592 46.105  42.645  1.00 22.15 ? 470  THR A O   1 
ATOM   2732 C  CB  . THR A 1 363 ? 50.836 47.620  45.292  1.00 25.87 ? 470  THR A CB  1 
ATOM   2733 O  OG1 . THR A 1 363 ? 51.096 47.704  46.698  1.00 24.65 ? 470  THR A OG1 1 
ATOM   2734 C  CG2 . THR A 1 363 ? 49.886 48.757  44.883  1.00 23.80 ? 470  THR A CG2 1 
ATOM   2735 N  N   . VAL A 1 364 ? 48.462 46.035  43.326  1.00 27.31 ? 471  VAL A N   1 
ATOM   2736 C  CA  . VAL A 1 364 ? 47.952 45.848  41.976  1.00 21.24 ? 471  VAL A CA  1 
ATOM   2737 C  C   . VAL A 1 364 ? 47.041 46.991  41.574  1.00 20.82 ? 471  VAL A C   1 
ATOM   2738 O  O   . VAL A 1 364 ? 46.437 47.659  42.422  1.00 22.02 ? 471  VAL A O   1 
ATOM   2739 C  CB  . VAL A 1 364 ? 47.178 44.523  41.825  1.00 23.96 ? 471  VAL A CB  1 
ATOM   2740 C  CG1 . VAL A 1 364 ? 47.949 43.378  42.456  1.00 24.77 ? 471  VAL A CG1 1 
ATOM   2741 C  CG2 . VAL A 1 364 ? 45.789 44.646  42.434  1.00 20.13 ? 471  VAL A CG2 1 
ATOM   2742 N  N   . THR A 1 365 ? 46.948 47.209  40.268  1.00 21.36 ? 472  THR A N   1 
ATOM   2743 C  CA  . THR A 1 365 ? 46.074 48.243  39.729  1.00 24.34 ? 472  THR A CA  1 
ATOM   2744 C  C   . THR A 1 365 ? 44.779 47.649  39.178  1.00 23.30 ? 472  THR A C   1 
ATOM   2745 O  O   . THR A 1 365 ? 43.888 48.388  38.762  1.00 22.28 ? 472  THR A O   1 
ATOM   2746 C  CB  . THR A 1 365 ? 46.763 49.015  38.613  1.00 27.09 ? 472  THR A CB  1 
ATOM   2747 O  OG1 . THR A 1 365 ? 47.105 48.095  37.572  1.00 26.13 ? 472  THR A OG1 1 
ATOM   2748 C  CG2 . THR A 1 365 ? 48.034 49.677  39.143  1.00 26.28 ? 472  THR A CG2 1 
ATOM   2749 N  N   . ALA A 1 366 ? 44.702 46.317  39.172  1.00 21.83 ? 473  ALA A N   1 
ATOM   2750 C  CA  . ALA A 1 366 ? 43.529 45.587  38.684  1.00 23.12 ? 473  ALA A CA  1 
ATOM   2751 C  C   . ALA A 1 366 ? 43.242 45.966  37.242  1.00 23.63 ? 473  ALA A C   1 
ATOM   2752 O  O   . ALA A 1 366 ? 42.107 46.278  36.884  1.00 19.33 ? 473  ALA A O   1 
ATOM   2753 C  CB  . ALA A 1 366 ? 42.314 45.858  39.570  1.00 21.28 ? 473  ALA A CB  1 
ATOM   2754 N  N   . CYS A 1 367 ? 44.301 45.953  36.433  1.00 25.93 ? 474  CYS A N   1 
ATOM   2755 C  CA  . CYS A 1 367 ? 44.244 46.275  35.009  1.00 23.60 ? 474  CYS A CA  1 
ATOM   2756 C  C   . CYS A 1 367 ? 43.656 47.656  34.714  1.00 22.75 ? 474  CYS A C   1 
ATOM   2757 O  O   . CYS A 1 367 ? 42.900 47.826  33.763  1.00 21.72 ? 474  CYS A O   1 
ATOM   2758 C  CB  . CYS A 1 367 ? 43.455 45.194  34.272  1.00 24.26 ? 474  CYS A CB  1 
ATOM   2759 S  SG  . CYS A 1 367 ? 44.159 43.541  34.509  1.00 30.91 ? 474  CYS A SG  1 
ATOM   2760 N  N   . LEU A 1 368 ? 44.005 48.636  35.539  1.00 24.49 ? 475  LEU A N   1 
ATOM   2761 C  CA  . LEU A 1 368 ? 43.700 50.032  35.231  1.00 27.07 ? 475  LEU A CA  1 
ATOM   2762 C  C   . LEU A 1 368 ? 44.179 50.370  33.821  1.00 26.19 ? 475  LEU A C   1 
ATOM   2763 O  O   . LEU A 1 368 ? 45.291 50.013  33.436  1.00 21.33 ? 475  LEU A O   1 
ATOM   2764 C  CB  . LEU A 1 368 ? 44.355 50.974  36.248  1.00 20.36 ? 475  LEU A CB  1 
ATOM   2765 C  CG  . LEU A 1 368 ? 44.196 52.488  36.038  1.00 24.38 ? 475  LEU A CG  1 
ATOM   2766 C  CD1 . LEU A 1 368 ? 42.795 52.967  36.401  1.00 26.01 ? 475  LEU A CD1 1 
ATOM   2767 C  CD2 . LEU A 1 368 ? 45.238 53.266  36.830  1.00 25.21 ? 475  LEU A CD2 1 
ATOM   2768 N  N   . GLY A 1 369 ? 43.319 51.027  33.050  1.00 22.37 ? 476  GLY A N   1 
ATOM   2769 C  CA  . GLY A 1 369 ? 43.682 51.482  31.723  1.00 30.31 ? 476  GLY A CA  1 
ATOM   2770 C  C   . GLY A 1 369 ? 43.560 50.424  30.644  1.00 30.11 ? 476  GLY A C   1 
ATOM   2771 O  O   . GLY A 1 369 ? 43.980 50.644  29.515  1.00 32.36 ? 476  GLY A O   1 
ATOM   2772 N  N   . GLU A 1 370 ? 42.984 49.276  30.988  1.00 25.51 ? 477  GLU A N   1 
ATOM   2773 C  CA  . GLU A 1 370 ? 42.819 48.180  30.031  1.00 24.16 ? 477  GLU A CA  1 
ATOM   2774 C  C   . GLU A 1 370 ? 41.351 47.762  29.971  1.00 23.18 ? 477  GLU A C   1 
ATOM   2775 O  O   . GLU A 1 370 ? 40.576 48.116  30.850  1.00 26.65 ? 477  GLU A O   1 
ATOM   2776 C  CB  . GLU A 1 370 ? 43.711 46.985  30.410  1.00 26.37 ? 477  GLU A CB  1 
ATOM   2777 C  CG  . GLU A 1 370 ? 45.212 47.271  30.393  1.00 31.68 ? 477  GLU A CG  1 
ATOM   2778 C  CD  . GLU A 1 370 ? 45.759 47.530  28.993  1.00 36.48 ? 477  GLU A CD  1 
ATOM   2779 O  OE1 . GLU A 1 370 ? 46.809 48.195  28.878  0.00 39.03 ? 477  GLU A OE1 1 
ATOM   2780 O  OE2 . GLU A 1 370 ? 45.141 47.061  28.012  0.00 34.61 ? 477  GLU A OE2 1 
ATOM   2781 N  N   . PRO A 1 371 ? 40.960 47.018  28.925  1.00 27.28 ? 478  PRO A N   1 
ATOM   2782 C  CA  . PRO A 1 371 ? 39.566 46.571  28.827  1.00 29.07 ? 478  PRO A CA  1 
ATOM   2783 C  C   . PRO A 1 371 ? 39.121 45.649  29.960  1.00 28.35 ? 478  PRO A C   1 
ATOM   2784 O  O   . PRO A 1 371 ? 37.916 45.535  30.176  1.00 25.81 ? 478  PRO A O   1 
ATOM   2785 C  CB  . PRO A 1 371 ? 39.532 45.814  27.498  1.00 26.10 ? 478  PRO A CB  1 
ATOM   2786 C  CG  . PRO A 1 371 ? 40.657 46.400  26.700  1.00 30.14 ? 478  PRO A CG  1 
ATOM   2787 C  CD  . PRO A 1 371 ? 41.728 46.694  27.707  1.00 29.06 ? 478  PRO A CD  1 
ATOM   2788 N  N   . ASN A 1 372 ? 40.047 44.988  30.656  1.00 22.76 ? 479  ASN A N   1 
ATOM   2789 C  CA  . ASN A 1 372 ? 39.635 44.106  31.750  1.00 19.00 ? 479  ASN A CA  1 
ATOM   2790 C  C   . ASN A 1 372 ? 39.773 44.759  33.130  1.00 20.26 ? 479  ASN A C   1 
ATOM   2791 O  O   . ASN A 1 372 ? 39.780 44.074  34.147  1.00 21.17 ? 479  ASN A O   1 
ATOM   2792 C  CB  . ASN A 1 372 ? 40.416 42.787  31.700  1.00 22.63 ? 479  ASN A CB  1 
ATOM   2793 C  CG  . ASN A 1 372 ? 41.893 42.988  31.449  1.00 32.19 ? 479  ASN A CG  1 
ATOM   2794 O  OD1 . ASN A 1 372 ? 42.313 44.014  30.919  1.00 34.02 ? 479  ASN A OD1 1 
ATOM   2795 N  ND2 . ASN A 1 372 ? 42.694 41.988  31.807  1.00 36.04 ? 479  ASN A ND2 1 
ATOM   2796 N  N   . HIS A 1 373 ? 39.867 46.087  33.149  1.00 17.57 ? 480  HIS A N   1 
ATOM   2797 C  CA  . HIS A 1 373 ? 39.867 46.866  34.384  1.00 17.12 ? 480  HIS A CA  1 
ATOM   2798 C  C   . HIS A 1 373 ? 38.699 46.477  35.286  1.00 18.77 ? 480  HIS A C   1 
ATOM   2799 O  O   . HIS A 1 373 ? 37.553 46.448  34.846  1.00 16.59 ? 480  HIS A O   1 
ATOM   2800 C  CB  . HIS A 1 373 ? 39.793 48.367  34.064  1.00 18.62 ? 480  HIS A CB  1 
ATOM   2801 C  CG  . HIS A 1 373 ? 39.829 49.247  35.274  1.00 18.10 ? 480  HIS A CG  1 
ATOM   2802 N  ND1 . HIS A 1 373 ? 39.155 50.447  35.341  1.00 23.25 ? 480  HIS A ND1 1 
ATOM   2803 C  CD2 . HIS A 1 373 ? 40.479 49.115  36.454  1.00 18.79 ? 480  HIS A CD2 1 
ATOM   2804 C  CE1 . HIS A 1 373 ? 39.375 51.010  36.515  1.00 20.80 ? 480  HIS A CE1 1 
ATOM   2805 N  NE2 . HIS A 1 373 ? 40.178 50.222  37.208  1.00 21.27 ? 480  HIS A NE2 1 
ATOM   2806 N  N   . ILE A 1 374 ? 38.991 46.177  36.544  1.00 17.93 ? 481  ILE A N   1 
ATOM   2807 C  CA  . ILE A 1 374 ? 37.951 45.826  37.504  1.00 17.80 ? 481  ILE A CA  1 
ATOM   2808 C  C   . ILE A 1 374 ? 37.948 46.766  38.714  1.00 18.01 ? 481  ILE A C   1 
ATOM   2809 O  O   . ILE A 1 374 ? 38.963 46.926  39.381  1.00 17.50 ? 481  ILE A O   1 
ATOM   2810 C  CB  . ILE A 1 374 ? 38.130 44.376  37.984  1.00 17.80 ? 481  ILE A CB  1 
ATOM   2811 C  CG1 . ILE A 1 374 ? 37.847 43.407  36.829  1.00 20.54 ? 481  ILE A CG1 1 
ATOM   2812 C  CG2 . ILE A 1 374 ? 37.204 44.061  39.154  1.00 17.94 ? 481  ILE A CG2 1 
ATOM   2813 C  CD1 . ILE A 1 374 ? 38.278 41.967  37.128  1.00 20.08 ? 481  ILE A CD1 1 
ATOM   2814 N  N   . THR A 1 375 ? 36.805 47.389  38.993  1.00 17.58 ? 482  THR A N   1 
ATOM   2815 C  CA  . THR A 1 375 ? 36.665 48.217  40.193  1.00 17.81 ? 482  THR A CA  1 
ATOM   2816 C  C   . THR A 1 375 ? 35.683 47.604  41.165  1.00 16.26 ? 482  THR A C   1 
ATOM   2817 O  O   . THR A 1 375 ? 35.592 48.028  42.321  1.00 15.33 ? 482  THR A O   1 
ATOM   2818 C  CB  . THR A 1 375 ? 36.178 49.647  39.870  1.00 22.09 ? 482  THR A CB  1 
ATOM   2819 O  OG1 . THR A 1 375 ? 34.838 49.592  39.363  1.00 19.20 ? 482  THR A OG1 1 
ATOM   2820 C  CG2 . THR A 1 375 ? 37.090 50.299  38.856  1.00 18.82 ? 482  THR A CG2 1 
ATOM   2821 N  N   . ARG A 1 376 ? 34.922 46.623  40.683  1.00 17.05 ? 483  ARG A N   1 
ATOM   2822 C  CA  . ARG A 1 376 ? 33.992 45.923  41.546  1.00 17.74 ? 483  ARG A CA  1 
ATOM   2823 C  C   . ARG A 1 376 ? 34.155 44.404  41.465  1.00 16.91 ? 483  ARG A C   1 
ATOM   2824 O  O   . ARG A 1 376 ? 33.685 43.759  40.536  1.00 16.00 ? 483  ARG A O   1 
ATOM   2825 C  CB  . ARG A 1 376 ? 32.563 46.300  41.219  1.00 20.37 ? 483  ARG A CB  1 
ATOM   2826 C  CG  . ARG A 1 376 ? 31.663 45.917  42.357  1.00 26.03 ? 483  ARG A CG  1 
ATOM   2827 C  CD  . ARG A 1 376 ? 30.401 46.696  42.349  1.00 29.95 ? 483  ARG A CD  1 
ATOM   2828 N  NE  . ARG A 1 376 ? 30.603 48.125  42.548  1.00 25.38 ? 483  ARG A NE  1 
ATOM   2829 C  CZ  . ARG A 1 376 ? 29.606 48.993  42.426  1.00 35.66 ? 483  ARG A CZ  1 
ATOM   2830 N  NH1 . ARG A 1 376 ? 29.799 50.298  42.600  1.00 30.21 ? 483  ARG A NH1 1 
ATOM   2831 N  NH2 . ARG A 1 376 ? 28.397 48.528  42.124  1.00 34.33 ? 483  ARG A NH2 1 
ATOM   2832 N  N   . LEU A 1 377 ? 34.827 43.855  42.464  1.00 14.49 ? 484  LEU A N   1 
ATOM   2833 C  CA  . LEU A 1 377 ? 35.177 42.442  42.493  1.00 14.07 ? 484  LEU A CA  1 
ATOM   2834 C  C   . LEU A 1 377 ? 33.962 41.532  42.592  1.00 11.32 ? 484  LEU A C   1 
ATOM   2835 O  O   . LEU A 1 377 ? 32.992 41.852  43.275  1.00 16.30 ? 484  LEU A O   1 
ATOM   2836 C  CB  . LEU A 1 377 ? 36.100 42.172  43.676  1.00 13.83 ? 484  LEU A CB  1 
ATOM   2837 C  CG  . LEU A 1 377 ? 36.901 40.878  43.649  1.00 17.68 ? 484  LEU A CG  1 
ATOM   2838 C  CD1 . LEU A 1 377 ? 37.863 40.893  42.464  1.00 12.80 ? 484  LEU A CD1 1 
ATOM   2839 C  CD2 . LEU A 1 377 ? 37.650 40.711  44.965  1.00 20.88 ? 484  LEU A CD2 1 
ATOM   2840 N  N   . GLU A 1 378 ? 34.022 40.392  41.920  1.00 11.57 ? 485  GLU A N   1 
ATOM   2841 C  CA  . GLU A 1 378 ? 33.095 39.310  42.212  1.00 12.89 ? 485  GLU A CA  1 
ATOM   2842 C  C   . GLU A 1 378 ? 33.918 38.208  42.900  1.00 15.34 ? 485  GLU A C   1 
ATOM   2843 O  O   . GLU A 1 378 ? 34.214 38.318  44.094  1.00 18.47 ? 485  GLU A O   1 
ATOM   2844 C  CB  . GLU A 1 378 ? 32.382 38.845  40.927  1.00 13.54 ? 485  GLU A CB  1 
ATOM   2845 C  CG  . GLU A 1 378 ? 31.411 39.927  40.392  1.00 14.37 ? 485  GLU A CG  1 
ATOM   2846 C  CD  . GLU A 1 378 ? 30.911 39.691  38.967  1.00 16.97 ? 485  GLU A CD  1 
ATOM   2847 O  OE1 . GLU A 1 378 ? 30.147 40.542  38.471  1.00 18.25 ? 485  GLU A OE1 1 
ATOM   2848 O  OE2 . GLU A 1 378 ? 31.265 38.671  38.345  1.00 17.73 ? 485  GLU A OE2 1 
ATOM   2849 N  N   . HIS A 1 379 ? 34.338 37.187  42.154  1.00 12.71 ? 486  HIS A N   1 
ATOM   2850 C  CA  . HIS A 1 379 ? 35.255 36.182  42.699  1.00 15.32 ? 486  HIS A CA  1 
ATOM   2851 C  C   . HIS A 1 379 ? 36.707 36.619  42.624  1.00 14.58 ? 486  HIS A C   1 
ATOM   2852 O  O   . HIS A 1 379 ? 37.082 37.410  41.754  1.00 15.25 ? 486  HIS A O   1 
ATOM   2853 C  CB  . HIS A 1 379 ? 35.148 34.844  41.959  1.00 12.44 ? 486  HIS A CB  1 
ATOM   2854 C  CG  . HIS A 1 379 ? 33.746 34.393  41.690  1.00 14.85 ? 486  HIS A CG  1 
ATOM   2855 N  ND1 . HIS A 1 379 ? 33.004 34.883  40.639  1.00 12.41 ? 486  HIS A ND1 1 
ATOM   2856 C  CD2 . HIS A 1 379 ? 32.973 33.456  42.294  1.00 14.22 ? 486  HIS A CD2 1 
ATOM   2857 C  CE1 . HIS A 1 379 ? 31.820 34.298  40.629  1.00 14.85 ? 486  HIS A CE1 1 
ATOM   2858 N  NE2 . HIS A 1 379 ? 31.774 33.426  41.622  1.00 13.79 ? 486  HIS A NE2 1 
ATOM   2859 N  N   . ALA A 1 380 ? 37.520 36.079  43.527  1.00 12.16 ? 487  ALA A N   1 
ATOM   2860 C  CA  . ALA A 1 380 ? 38.969 36.186  43.424  1.00 13.85 ? 487  ALA A CA  1 
ATOM   2861 C  C   . ALA A 1 380 ? 39.617 34.813  43.563  1.00 14.03 ? 487  ALA A C   1 
ATOM   2862 O  O   . ALA A 1 380 ? 39.185 34.009  44.378  1.00 14.58 ? 487  ALA A O   1 
ATOM   2863 C  CB  . ALA A 1 380 ? 39.509 37.132  44.483  1.00 16.57 ? 487  ALA A CB  1 
ATOM   2864 N  N   . GLN A 1 381 ? 40.648 34.548  42.766  1.00 17.27 ? 488  GLN A N   1 
ATOM   2865 C  CA  . GLN A 1 381 ? 41.420 33.311  42.901  1.00 19.70 ? 488  GLN A CA  1 
ATOM   2866 C  C   . GLN A 1 381 ? 42.887 33.594  43.209  1.00 18.15 ? 488  GLN A C   1 
ATOM   2867 O  O   . GLN A 1 381 ? 43.460 34.551  42.705  1.00 14.72 ? 488  GLN A O   1 
ATOM   2868 C  CB  . GLN A 1 381 ? 41.343 32.464  41.627  1.00 18.85 ? 488  GLN A CB  1 
ATOM   2869 C  CG  . GLN A 1 381 ? 39.971 31.889  41.271  1.00 15.69 ? 488  GLN A CG  1 
ATOM   2870 C  CD  . GLN A 1 381 ? 39.944 31.385  39.826  1.00 21.66 ? 488  GLN A CD  1 
ATOM   2871 O  OE1 . GLN A 1 381 ? 40.585 31.965  38.957  1.00 20.90 ? 488  GLN A OE1 1 
ATOM   2872 N  NE2 . GLN A 1 381 ? 39.227 30.291  39.577  1.00 16.44 ? 488  GLN A NE2 1 
ATOM   2873 N  N   . ALA A 1 382 ? 43.477 32.757  44.050  1.00 17.09 ? 489  ALA A N   1 
ATOM   2874 C  CA  . ALA A 1 382 ? 44.923 32.661  44.147  1.00 19.50 ? 489  ALA A CA  1 
ATOM   2875 C  C   . ALA A 1 382 ? 45.351 31.314  43.571  1.00 19.88 ? 489  ALA A C   1 
ATOM   2876 O  O   . ALA A 1 382 ? 45.064 30.269  44.146  1.00 17.23 ? 489  ALA A O   1 
ATOM   2877 C  CB  . ALA A 1 382 ? 45.390 32.802  45.583  1.00 18.56 ? 489  ALA A CB  1 
ATOM   2878 N  N   . ARG A 1 383 ? 46.012 31.340  42.422  1.00 16.89 ? 490  ARG A N   1 
ATOM   2879 C  CA  . ARG A 1 383 ? 46.495 30.105  41.816  1.00 19.03 ? 490  ARG A CA  1 
ATOM   2880 C  C   . ARG A 1 383 ? 47.909 29.837  42.332  1.00 20.75 ? 490  ARG A C   1 
ATOM   2881 O  O   . ARG A 1 383 ? 48.830 30.570  42.008  1.00 18.70 ? 490  ARG A O   1 
ATOM   2882 C  CB  . ARG A 1 383 ? 46.490 30.199  40.292  1.00 21.05 ? 490  ARG A CB  1 
ATOM   2883 C  CG  . ARG A 1 383 ? 45.131 30.547  39.685  1.00 19.56 ? 490  ARG A CG  1 
ATOM   2884 C  CD  . ARG A 1 383 ? 45.102 30.221  38.180  1.00 22.77 ? 490  ARG A CD  1 
ATOM   2885 N  NE  . ARG A 1 383 ? 45.280 28.789  37.958  1.00 41.49 ? 490  ARG A NE  1 
ATOM   2886 C  CZ  . ARG A 1 383 ? 44.294 27.941  37.682  1.00 29.08 ? 490  ARG A CZ  1 
ATOM   2887 N  NH1 . ARG A 1 383 ? 44.561 26.652  37.516  1.00 27.37 ? 490  ARG A NH1 1 
ATOM   2888 N  NH2 . ARG A 1 383 ? 43.042 28.374  37.564  1.00 34.93 ? 490  ARG A NH2 1 
ATOM   2889 N  N   . LEU A 1 384 ? 48.072 28.798  43.142  1.00 19.94 ? 491  LEU A N   1 
ATOM   2890 C  CA  . LEU A 1 384 ? 49.349 28.560  43.800  1.00 19.96 ? 491  LEU A CA  1 
ATOM   2891 C  C   . LEU A 1 384 ? 50.013 27.287  43.319  1.00 19.85 ? 491  LEU A C   1 
ATOM   2892 O  O   . LEU A 1 384 ? 49.358 26.266  43.088  1.00 17.18 ? 491  LEU A O   1 
ATOM   2893 C  CB  . LEU A 1 384 ? 49.169 28.495  45.324  1.00 14.67 ? 491  LEU A CB  1 
ATOM   2894 C  CG  . LEU A 1 384 ? 48.492 29.701  45.982  1.00 14.81 ? 491  LEU A CG  1 
ATOM   2895 C  CD1 . LEU A 1 384 ? 48.400 29.507  47.498  1.00 15.36 ? 491  LEU A CD1 1 
ATOM   2896 C  CD2 . LEU A 1 384 ? 49.226 30.997  45.657  1.00 15.12 ? 491  LEU A CD2 1 
ATOM   2897 N  N   . THR A 1 385 ? 51.326 27.358  43.161  1.00 15.82 ? 492  THR A N   1 
ATOM   2898 C  CA  . THR A 1 385 ? 52.116 26.165  42.937  1.00 18.62 ? 492  THR A CA  1 
ATOM   2899 C  C   . THR A 1 385 ? 53.172 26.117  44.023  1.00 17.69 ? 492  THR A C   1 
ATOM   2900 O  O   . THR A 1 385 ? 53.943 27.060  44.187  1.00 19.66 ? 492  THR A O   1 
ATOM   2901 C  CB  . THR A 1 385 ? 52.764 26.153  41.550  1.00 22.20 ? 492  THR A CB  1 
ATOM   2902 O  OG1 . THR A 1 385 ? 51.739 26.170  40.551  1.00 22.36 ? 492  THR A OG1 1 
ATOM   2903 C  CG2 . THR A 1 385 ? 53.626 24.907  41.375  1.00 20.99 ? 492  THR A CG2 1 
ATOM   2904 N  N   . LEU A 1 386 ? 53.173 25.039  44.794  1.00 19.30 ? 493  LEU A N   1 
ATOM   2905 C  CA  . LEU A 1 386 ? 54.085 24.933  45.920  1.00 19.36 ? 493  LEU A CA  1 
ATOM   2906 C  C   . LEU A 1 386 ? 54.372 23.482  46.250  1.00 18.39 ? 493  LEU A C   1 
ATOM   2907 O  O   . LEU A 1 386 ? 53.573 22.594  45.955  1.00 21.37 ? 493  LEU A O   1 
ATOM   2908 C  CB  . LEU A 1 386 ? 53.522 25.654  47.151  1.00 18.27 ? 493  LEU A CB  1 
ATOM   2909 C  CG  . LEU A 1 386 ? 52.310 25.137  47.935  1.00 18.63 ? 493  LEU A CG  1 
ATOM   2910 C  CD1 . LEU A 1 386 ? 52.714 24.139  49.000  1.00 18.26 ? 493  LEU A CD1 1 
ATOM   2911 C  CD2 . LEU A 1 386 ? 51.551 26.298  48.573  1.00 16.21 ? 493  LEU A CD2 1 
ATOM   2912 N  N   . SER A 1 387 ? 55.519 23.256  46.873  1.00 19.83 ? 494  SER A N   1 
ATOM   2913 C  CA  . SER A 1 387 ? 55.845 21.954  47.412  1.00 16.97 ? 494  SER A CA  1 
ATOM   2914 C  C   . SER A 1 387 ? 56.072 22.100  48.901  1.00 19.87 ? 494  SER A C   1 
ATOM   2915 O  O   . SER A 1 387 ? 56.533 23.144  49.384  1.00 18.59 ? 494  SER A O   1 
ATOM   2916 C  CB  . SER A 1 387 ? 57.065 21.354  46.717  1.00 22.49 ? 494  SER A CB  1 
ATOM   2917 O  OG  . SER A 1 387 ? 58.100 22.311  46.599  1.00 30.91 ? 494  SER A OG  1 
ATOM   2918 N  N   . TYR A 1 388 ? 55.716 21.053  49.631  1.00 20.91 ? 495  TYR A N   1 
ATOM   2919 C  CA  . TYR A 1 388 ? 55.840 21.047  51.077  1.00 21.49 ? 495  TYR A CA  1 
ATOM   2920 C  C   . TYR A 1 388 ? 55.936 19.596  51.540  1.00 20.43 ? 495  TYR A C   1 
ATOM   2921 O  O   . TYR A 1 388 ? 55.467 18.702  50.838  1.00 21.01 ? 495  TYR A O   1 
ATOM   2922 C  CB  . TYR A 1 388 ? 54.653 21.756  51.708  1.00 18.57 ? 495  TYR A CB  1 
ATOM   2923 C  CG  . TYR A 1 388 ? 54.973 22.395  53.028  1.00 20.62 ? 495  TYR A CG  1 
ATOM   2924 C  CD1 . TYR A 1 388 ? 55.862 23.452  53.097  1.00 21.65 ? 495  TYR A CD1 1 
ATOM   2925 C  CD2 . TYR A 1 388 ? 54.378 21.954  54.203  1.00 19.11 ? 495  TYR A CD2 1 
ATOM   2926 C  CE1 . TYR A 1 388 ? 56.169 24.051  54.296  1.00 22.18 ? 495  TYR A CE1 1 
ATOM   2927 C  CE2 . TYR A 1 388 ? 54.680 22.549  55.413  1.00 21.61 ? 495  TYR A CE2 1 
ATOM   2928 C  CZ  . TYR A 1 388 ? 55.575 23.600  55.449  1.00 23.64 ? 495  TYR A CZ  1 
ATOM   2929 O  OH  . TYR A 1 388 ? 55.890 24.209  56.640  1.00 28.13 ? 495  TYR A OH  1 
ATOM   2930 N  N   . ASN A 1 389 ? 56.544 19.344  52.697  1.00 18.09 ? 496  ASN A N   1 
ATOM   2931 C  CA  . ASN A 1 389 ? 56.766 17.948  53.101  1.00 18.78 ? 496  ASN A CA  1 
ATOM   2932 C  C   . ASN A 1 389 ? 55.512 17.293  53.690  1.00 22.68 ? 496  ASN A C   1 
ATOM   2933 O  O   . ASN A 1 389 ? 55.341 16.070  53.594  1.00 20.83 ? 496  ASN A O   1 
ATOM   2934 C  CB  . ASN A 1 389 ? 57.929 17.834  54.094  1.00 18.15 ? 496  ASN A CB  1 
ATOM   2935 C  CG  . ASN A 1 389 ? 57.650 18.525  55.395  1.00 17.59 ? 496  ASN A CG  1 
ATOM   2936 O  OD1 . ASN A 1 389 ? 57.291 19.702  55.418  1.00 20.46 ? 496  ASN A OD1 1 
ATOM   2937 N  ND2 . ASN A 1 389 ? 57.801 17.796  56.498  1.00 18.71 ? 496  ASN A ND2 1 
ATOM   2938 N  N   . ARG A 1 390 ? 54.644 18.103  54.294  1.00 17.70 ? 497  ARG A N   1 
ATOM   2939 C  CA  . ARG A 1 390 ? 53.369 17.617  54.821  1.00 20.53 ? 497  ARG A CA  1 
ATOM   2940 C  C   . ARG A 1 390 ? 52.271 18.647  54.563  1.00 22.14 ? 497  ARG A C   1 
ATOM   2941 O  O   . ARG A 1 390 ? 52.115 19.615  55.317  1.00 18.35 ? 497  ARG A O   1 
ATOM   2942 C  CB  . ARG A 1 390 ? 53.452 17.301  56.323  1.00 22.42 ? 497  ARG A CB  1 
ATOM   2943 C  CG  . ARG A 1 390 ? 52.141 16.725  56.852  1.00 23.31 ? 497  ARG A CG  1 
ATOM   2944 C  CD  . ARG A 1 390 ? 52.154 16.322  58.324  1.00 23.70 ? 497  ARG A CD  1 
ATOM   2945 N  NE  . ARG A 1 390 ? 50.802 15.921  58.707  1.00 22.10 ? 497  ARG A NE  1 
ATOM   2946 C  CZ  . ARG A 1 390 ? 50.427 14.674  58.967  1.00 24.74 ? 497  ARG A CZ  1 
ATOM   2947 N  NH1 . ARG A 1 390 ? 49.159 14.416  59.272  1.00 26.23 ? 497  ARG A NH1 1 
ATOM   2948 N  NH2 . ARG A 1 390 ? 51.317 13.690  58.943  1.00 31.29 ? 497  ARG A NH2 1 
ATOM   2949 N  N   . ARG A 1 391 ? 51.505 18.416  53.500  1.00 18.17 ? 498  ARG A N   1 
ATOM   2950 C  CA  . ARG A 1 391 ? 50.570 19.414  52.971  1.00 17.13 ? 498  ARG A CA  1 
ATOM   2951 C  C   . ARG A 1 391 ? 49.592 19.942  54.003  1.00 17.65 ? 498  ARG A C   1 
ATOM   2952 O  O   . ARG A 1 391 ? 49.336 21.146  54.066  1.00 17.38 ? 498  ARG A O   1 
ATOM   2953 C  CB  . ARG A 1 391 ? 49.790 18.833  51.789  1.00 13.71 ? 498  ARG A CB  1 
ATOM   2954 C  CG  . ARG A 1 391 ? 49.067 19.871  50.963  1.00 18.24 ? 498  ARG A CG  1 
ATOM   2955 C  CD  . ARG A 1 391 ? 48.686 19.290  49.625  1.00 14.18 ? 498  ARG A CD  1 
ATOM   2956 N  NE  . ARG A 1 391 ? 47.780 18.162  49.783  1.00 15.47 ? 498  ARG A NE  1 
ATOM   2957 C  CZ  . ARG A 1 391 ? 47.489 17.296  48.819  1.00 14.64 ? 498  ARG A CZ  1 
ATOM   2958 N  NH1 . ARG A 1 391 ? 46.645 16.301  49.056  1.00 16.02 ? 498  ARG A NH1 1 
ATOM   2959 N  NH2 . ARG A 1 391 ? 48.045 17.420  47.625  1.00 14.54 ? 498  ARG A NH2 1 
ATOM   2960 N  N   . GLY A 1 392 ? 49.054 19.037  54.811  1.00 17.87 ? 499  GLY A N   1 
ATOM   2961 C  CA  . GLY A 1 392 ? 48.020 19.371  55.764  1.00 13.45 ? 499  GLY A CA  1 
ATOM   2962 C  C   . GLY A 1 392 ? 48.428 20.297  56.889  1.00 14.67 ? 499  GLY A C   1 
ATOM   2963 O  O   . GLY A 1 392 ? 47.557 20.823  57.575  1.00 19.73 ? 499  GLY A O   1 
ATOM   2964 N  N   . ASP A 1 393 ? 49.723 20.505  57.101  1.00 15.31 ? 500  ASP A N   1 
ATOM   2965 C  CA  . ASP A 1 393 ? 50.136 21.441  58.139  1.00 16.14 ? 500  ASP A CA  1 
ATOM   2966 C  C   . ASP A 1 393 ? 50.123 22.899  57.639  1.00 18.22 ? 500  ASP A C   1 
ATOM   2967 O  O   . ASP A 1 393 ? 50.249 23.826  58.432  1.00 21.55 ? 500  ASP A O   1 
ATOM   2968 C  CB  . ASP A 1 393 ? 51.518 21.083  58.690  1.00 14.61 ? 500  ASP A CB  1 
ATOM   2969 C  CG  . ASP A 1 393 ? 51.496 19.827  59.550  1.00 18.88 ? 500  ASP A CG  1 
ATOM   2970 O  OD1 . ASP A 1 393 ? 50.430 19.489  60.115  1.00 21.35 ? 500  ASP A OD1 1 
ATOM   2971 O  OD2 . ASP A 1 393 ? 52.551 19.174  59.652  1.00 21.81 ? 500  ASP A OD2 1 
ATOM   2972 N  N   . LEU A 1 394 ? 49.936 23.104  56.342  1.00 15.50 ? 501  LEU A N   1 
ATOM   2973 C  CA  . LEU A 1 394 ? 49.802 24.467  55.820  1.00 15.34 ? 501  LEU A CA  1 
ATOM   2974 C  C   . LEU A 1 394 ? 48.458 25.112  56.136  1.00 16.76 ? 501  LEU A C   1 
ATOM   2975 O  O   . LEU A 1 394 ? 47.415 24.466  56.085  1.00 15.76 ? 501  LEU A O   1 
ATOM   2976 C  CB  . LEU A 1 394 ? 50.005 24.499  54.308  1.00 16.50 ? 501  LEU A CB  1 
ATOM   2977 C  CG  . LEU A 1 394 ? 51.391 24.090  53.819  1.00 21.40 ? 501  LEU A CG  1 
ATOM   2978 C  CD1 . LEU A 1 394 ? 51.364 23.908  52.333  1.00 21.28 ? 501  LEU A CD1 1 
ATOM   2979 C  CD2 . LEU A 1 394 ? 52.418 25.140  54.213  1.00 19.27 ? 501  LEU A CD2 1 
ATOM   2980 N  N   . ALA A 1 395 ? 48.499 26.400  56.462  1.00 15.47 ? 502  ALA A N   1 
ATOM   2981 C  CA  . ALA A 1 395 ? 47.314 27.247  56.428  1.00 14.07 ? 502  ALA A CA  1 
ATOM   2982 C  C   . ALA A 1 395 ? 47.647 28.444  55.555  1.00 18.38 ? 502  ALA A C   1 
ATOM   2983 O  O   . ALA A 1 395 ? 48.774 28.952  55.591  1.00 18.41 ? 502  ALA A O   1 
ATOM   2984 C  CB  . ALA A 1 395 ? 46.889 27.678  57.823  1.00 15.48 ? 502  ALA A CB  1 
ATOM   2985 N  N   . ILE A 1 396 ? 46.675 28.867  54.747  1.00 19.93 ? 503  ILE A N   1 
ATOM   2986 C  CA  . ILE A 1 396 ? 46.904 29.855  53.696  1.00 17.64 ? 503  ILE A CA  1 
ATOM   2987 C  C   . ILE A 1 396 ? 45.800 30.911  53.768  1.00 17.05 ? 503  ILE A C   1 
ATOM   2988 O  O   . ILE A 1 396 ? 44.612 30.573  53.780  1.00 16.78 ? 503  ILE A O   1 
ATOM   2989 C  CB  . ILE A 1 396 ? 46.937 29.188  52.290  1.00 17.55 ? 503  ILE A CB  1 
ATOM   2990 C  CG1 . ILE A 1 396 ? 48.035 28.112  52.228  1.00 18.65 ? 503  ILE A CG1 1 
ATOM   2991 C  CG2 . ILE A 1 396 ? 47.126 30.224  51.178  1.00 14.61 ? 503  ILE A CG2 1 
ATOM   2992 C  CD1 . ILE A 1 396 ? 48.243 27.489  50.835  1.00 17.52 ? 503  ILE A CD1 1 
ATOM   2993 N  N   . HIS A 1 397 ? 46.195 32.178  53.871  1.00 15.94 ? 504  HIS A N   1 
ATOM   2994 C  CA  . HIS A 1 397 ? 45.233 33.278  53.912  1.00 16.38 ? 504  HIS A CA  1 
ATOM   2995 C  C   . HIS A 1 397 ? 45.527 34.289  52.819  1.00 16.92 ? 504  HIS A C   1 
ATOM   2996 O  O   . HIS A 1 397 ? 46.661 34.404  52.341  1.00 14.31 ? 504  HIS A O   1 
ATOM   2997 C  CB  . HIS A 1 397 ? 45.225 33.985  55.276  1.00 16.15 ? 504  HIS A CB  1 
ATOM   2998 C  CG  . HIS A 1 397 ? 44.788 33.107  56.405  1.00 19.48 ? 504  HIS A CG  1 
ATOM   2999 N  ND1 . HIS A 1 397 ? 45.644 32.232  57.034  1.00 22.34 ? 504  HIS A ND1 1 
ATOM   3000 C  CD2 . HIS A 1 397 ? 43.583 32.951  57.003  1.00 27.13 ? 504  HIS A CD2 1 
ATOM   3001 C  CE1 . HIS A 1 397 ? 44.989 31.576  57.974  1.00 23.80 ? 504  HIS A CE1 1 
ATOM   3002 N  NE2 . HIS A 1 397 ? 43.736 31.993  57.976  1.00 30.32 ? 504  HIS A NE2 1 
ATOM   3003 N  N   . LEU A 1 398 ? 44.483 35.012  52.434  1.00 16.59 ? 505  LEU A N   1 
ATOM   3004 C  CA  . LEU A 1 398 ? 44.586 36.053  51.427  1.00 16.74 ? 505  LEU A CA  1 
ATOM   3005 C  C   . LEU A 1 398 ? 43.859 37.272  51.944  1.00 16.00 ? 505  LEU A C   1 
ATOM   3006 O  O   . LEU A 1 398 ? 42.692 37.179  52.335  1.00 16.60 ? 505  LEU A O   1 
ATOM   3007 C  CB  . LEU A 1 398 ? 44.003 35.593  50.096  1.00 15.38 ? 505  LEU A CB  1 
ATOM   3008 C  CG  . LEU A 1 398 ? 44.105 36.589  48.930  1.00 20.80 ? 505  LEU A CG  1 
ATOM   3009 C  CD1 . LEU A 1 398 ? 45.530 36.705  48.423  1.00 14.91 ? 505  LEU A CD1 1 
ATOM   3010 C  CD2 . LEU A 1 398 ? 43.146 36.196  47.788  1.00 17.03 ? 505  LEU A CD2 1 
ATOM   3011 N  N   . VAL A 1 399 ? 44.556 38.408  51.972  1.00 14.86 ? 506  VAL A N   1 
ATOM   3012 C  CA  . VAL A 1 399 ? 43.987 39.647  52.504  1.00 16.05 ? 506  VAL A CA  1 
ATOM   3013 C  C   . VAL A 1 399 ? 43.799 40.652  51.371  1.00 15.74 ? 506  VAL A C   1 
ATOM   3014 O  O   . VAL A 1 399 ? 44.732 40.953  50.637  1.00 20.38 ? 506  VAL A O   1 
ATOM   3015 C  CB  . VAL A 1 399 ? 44.884 40.275  53.626  1.00 19.90 ? 506  VAL A CB  1 
ATOM   3016 C  CG1 . VAL A 1 399 ? 44.184 41.482  54.262  1.00 17.38 ? 506  VAL A CG1 1 
ATOM   3017 C  CG2 . VAL A 1 399 ? 45.222 39.236  54.705  1.00 23.26 ? 506  VAL A CG2 1 
ATOM   3018 N  N   . SER A 1 400 ? 42.579 41.154  51.223  1.00 16.51 ? 507  SER A N   1 
ATOM   3019 C  CA  . SER A 1 400 ? 42.264 42.122  50.178  1.00 20.25 ? 507  SER A CA  1 
ATOM   3020 C  C   . SER A 1 400 ? 42.765 43.518  50.584  1.00 20.94 ? 507  SER A C   1 
ATOM   3021 O  O   . SER A 1 400 ? 43.047 43.746  51.752  1.00 17.98 ? 507  SER A O   1 
ATOM   3022 C  CB  . SER A 1 400 ? 40.757 42.146  49.913  1.00 17.17 ? 507  SER A CB  1 
ATOM   3023 O  OG  . SER A 1 400 ? 40.061 42.752  50.994  1.00 18.49 ? 507  SER A OG  1 
ATOM   3024 N  N   . PRO A 1 401 ? 42.895 44.442  49.614  1.00 20.45 ? 508  PRO A N   1 
ATOM   3025 C  CA  . PRO A 1 401 ? 43.291 45.819  49.945  1.00 20.44 ? 508  PRO A CA  1 
ATOM   3026 C  C   . PRO A 1 401 ? 42.372 46.486  50.969  1.00 23.10 ? 508  PRO A C   1 
ATOM   3027 O  O   . PRO A 1 401 ? 42.843 47.274  51.775  1.00 22.73 ? 508  PRO A O   1 
ATOM   3028 C  CB  . PRO A 1 401 ? 43.208 46.541  48.599  1.00 18.67 ? 508  PRO A CB  1 
ATOM   3029 C  CG  . PRO A 1 401 ? 43.494 45.490  47.604  1.00 16.92 ? 508  PRO A CG  1 
ATOM   3030 C  CD  . PRO A 1 401 ? 42.906 44.213  48.161  1.00 17.04 ? 508  PRO A CD  1 
ATOM   3031 N  N   . MET A 1 402 ? 41.085 46.170  50.952  1.00 20.71 ? 509  MET A N   1 
ATOM   3032 C  CA  . MET A 1 402 ? 40.180 46.745  51.941  1.00 19.89 ? 509  MET A CA  1 
ATOM   3033 C  C   . MET A 1 402 ? 40.211 45.934  53.240  1.00 24.56 ? 509  MET A C   1 
ATOM   3034 O  O   . MET A 1 402 ? 39.384 46.145  54.118  1.00 30.12 ? 509  MET A O   1 
ATOM   3035 C  CB  . MET A 1 402 ? 38.756 46.832  51.386  1.00 21.25 ? 509  MET A CB  1 
ATOM   3036 C  CG  . MET A 1 402 ? 38.645 47.685  50.110  1.00 26.45 ? 509  MET A CG  1 
ATOM   3037 S  SD  . MET A 1 402 ? 36.954 47.873  49.484  1.00 35.43 ? 509  MET A SD  1 
ATOM   3038 C  CE  . MET A 1 402 ? 36.349 49.198  50.525  0.00 30.97 ? 509  MET A CE  1 
ATOM   3039 N  N   . GLY A 1 403 ? 41.155 45.000  53.347  1.00 19.99 ? 510  GLY A N   1 
ATOM   3040 C  CA  . GLY A 1 403 ? 41.450 44.339  54.613  1.00 25.51 ? 510  GLY A CA  1 
ATOM   3041 C  C   . GLY A 1 403 ? 40.684 43.065  54.946  1.00 26.07 ? 510  GLY A C   1 
ATOM   3042 O  O   . GLY A 1 403 ? 40.725 42.580  56.079  1.00 23.80 ? 510  GLY A O   1 
ATOM   3043 N  N   . THR A 1 404 ? 39.986 42.508  53.967  1.00 21.92 ? 511  THR A N   1 
ATOM   3044 C  CA  . THR A 1 404 ? 39.194 41.309  54.214  1.00 20.90 ? 511  THR A CA  1 
ATOM   3045 C  C   . THR A 1 404 ? 40.084 40.077  54.167  1.00 18.02 ? 511  THR A C   1 
ATOM   3046 O  O   . THR A 1 404 ? 40.730 39.799  53.162  1.00 15.99 ? 511  THR A O   1 
ATOM   3047 C  CB  . THR A 1 404 ? 38.054 41.184  53.201  1.00 20.57 ? 511  THR A CB  1 
ATOM   3048 O  OG1 . THR A 1 404 ? 37.207 42.325  53.342  1.00 18.76 ? 511  THR A OG1 1 
ATOM   3049 C  CG2 . THR A 1 404 ? 37.221 39.908  53.465  1.00 19.47 ? 511  THR A CG2 1 
ATOM   3050 N  N   . ARG A 1 405 ? 40.129 39.346  55.270  1.00 20.01 ? 512  ARG A N   1 
ATOM   3051 C  CA  . ARG A 1 405 ? 40.992 38.170  55.347  1.00 21.59 ? 512  ARG A CA  1 
ATOM   3052 C  C   . ARG A 1 405 ? 40.215 36.893  54.994  1.00 14.24 ? 512  ARG A C   1 
ATOM   3053 O  O   . ARG A 1 405 ? 39.313 36.492  55.714  1.00 19.27 ? 512  ARG A O   1 
ATOM   3054 C  CB  . ARG A 1 405 ? 41.616 38.072  56.742  1.00 19.11 ? 512  ARG A CB  1 
ATOM   3055 C  CG  . ARG A 1 405 ? 42.711 37.032  56.898  1.00 24.63 ? 512  ARG A CG  1 
ATOM   3056 C  CD  . ARG A 1 405 ? 43.641 37.416  58.061  1.00 33.45 ? 512  ARG A CD  1 
ATOM   3057 N  NE  . ARG A 1 405 ? 44.603 36.364  58.371  1.00 32.98 ? 512  ARG A NE  1 
ATOM   3058 C  CZ  . ARG A 1 405 ? 44.348 35.327  59.170  1.00 42.78 ? 512  ARG A CZ  1 
ATOM   3059 N  NH1 . ARG A 1 405 ? 43.151 35.184  59.738  1.00 35.43 ? 512  ARG A NH1 1 
ATOM   3060 N  NH2 . ARG A 1 405 ? 45.290 34.419  59.395  1.00 41.20 ? 512  ARG A NH2 1 
ATOM   3061 N  N   . SER A 1 406 ? 40.565 36.278  53.869  1.00 14.60 ? 513  SER A N   1 
ATOM   3062 C  CA  . SER A 1 406 ? 39.980 34.997  53.469  1.00 15.42 ? 513  SER A CA  1 
ATOM   3063 C  C   . SER A 1 406 ? 40.918 33.878  53.841  1.00 15.65 ? 513  SER A C   1 
ATOM   3064 O  O   . SER A 1 406 ? 42.118 33.948  53.570  1.00 15.17 ? 513  SER A O   1 
ATOM   3065 C  CB  . SER A 1 406 ? 39.708 34.935  51.956  1.00 13.62 ? 513  SER A CB  1 
ATOM   3066 O  OG  . SER A 1 406 ? 38.806 35.941  51.547  1.00 17.10 ? 513  SER A OG  1 
ATOM   3067 N  N   . THR A 1 407 ? 40.368 32.846  54.465  1.00 17.08 ? 514  THR A N   1 
ATOM   3068 C  CA  . THR A 1 407 ? 41.118 31.618  54.704  1.00 18.25 ? 514  THR A CA  1 
ATOM   3069 C  C   . THR A 1 407 ? 41.014 30.742  53.472  1.00 17.10 ? 514  THR A C   1 
ATOM   3070 O  O   . THR A 1 407 ? 39.994 30.095  53.250  1.00 17.34 ? 514  THR A O   1 
ATOM   3071 C  CB  . THR A 1 407 ? 40.590 30.871  55.932  1.00 20.79 ? 514  THR A CB  1 
ATOM   3072 O  OG1 . THR A 1 407 ? 40.677 31.733  57.071  1.00 18.21 ? 514  THR A OG1 1 
ATOM   3073 C  CG2 . THR A 1 407 ? 41.390 29.575  56.174  1.00 17.31 ? 514  THR A CG2 1 
ATOM   3074 N  N   . LEU A 1 408 ? 42.059 30.744  52.653  1.00 13.39 ? 515  LEU A N   1 
ATOM   3075 C  CA  . LEU A 1 408 ? 42.081 29.908  51.462  1.00 13.49 ? 515  LEU A CA  1 
ATOM   3076 C  C   . LEU A 1 408 ? 42.254 28.425  51.792  1.00 16.25 ? 515  LEU A C   1 
ATOM   3077 O  O   . LEU A 1 408 ? 41.745 27.570  51.072  1.00 18.94 ? 515  LEU A O   1 
ATOM   3078 C  CB  . LEU A 1 408 ? 43.195 30.353  50.519  1.00 13.68 ? 515  LEU A CB  1 
ATOM   3079 C  CG  . LEU A 1 408 ? 43.030 31.743  49.918  1.00 20.52 ? 515  LEU A CG  1 
ATOM   3080 C  CD1 . LEU A 1 408 ? 44.067 31.922  48.840  1.00 15.53 ? 515  LEU A CD1 1 
ATOM   3081 C  CD2 . LEU A 1 408 ? 41.616 31.942  49.369  1.00 18.71 ? 515  LEU A CD2 1 
ATOM   3082 N  N   . LEU A 1 409 ? 42.992 28.130  52.861  1.00 14.86 ? 516  LEU A N   1 
ATOM   3083 C  CA  . LEU A 1 409 ? 43.191 26.750  53.335  1.00 14.51 ? 516  LEU A CA  1 
ATOM   3084 C  C   . LEU A 1 409 ? 43.442 26.744  54.836  1.00 14.35 ? 516  LEU A C   1 
ATOM   3085 O  O   . LEU A 1 409 ? 44.363 27.412  55.308  1.00 15.30 ? 516  LEU A O   1 
ATOM   3086 C  CB  . LEU A 1 409 ? 44.365 26.080  52.609  1.00 13.10 ? 516  LEU A CB  1 
ATOM   3087 C  CG  . LEU A 1 409 ? 44.701 24.620  52.979  1.00 13.34 ? 516  LEU A CG  1 
ATOM   3088 C  CD1 . LEU A 1 409 ? 43.602 23.644  52.530  1.00 14.43 ? 516  LEU A CD1 1 
ATOM   3089 C  CD2 . LEU A 1 409 ? 46.037 24.220  52.390  1.00 14.73 ? 516  LEU A CD2 1 
ATOM   3090 N  N   . ALA A 1 410 ? 42.616 26.024  55.593  1.00 17.34 ? 517  ALA A N   1 
ATOM   3091 C  CA  . ALA A 1 410 ? 42.933 25.743  57.001  1.00 17.05 ? 517  ALA A CA  1 
ATOM   3092 C  C   . ALA A 1 410 ? 43.712 24.434  57.094  1.00 16.93 ? 517  ALA A C   1 
ATOM   3093 O  O   . ALA A 1 410 ? 43.698 23.635  56.165  1.00 17.45 ? 517  ALA A O   1 
ATOM   3094 C  CB  . ALA A 1 410 ? 41.664 25.674  57.859  1.00 19.96 ? 517  ALA A CB  1 
ATOM   3095 N  N   . ALA A 1 411 ? 44.393 24.211  58.212  1.00 17.92 ? 518  ALA A N   1 
ATOM   3096 C  CA  . ALA A 1 411 ? 45.138 22.971  58.398  1.00 18.21 ? 518  ALA A CA  1 
ATOM   3097 C  C   . ALA A 1 411 ? 44.211 21.772  58.253  1.00 15.87 ? 518  ALA A C   1 
ATOM   3098 O  O   . ALA A 1 411 ? 43.073 21.796  58.707  1.00 17.64 ? 518  ALA A O   1 
ATOM   3099 C  CB  . ALA A 1 411 ? 45.822 22.950  59.758  1.00 18.55 ? 518  ALA A CB  1 
ATOM   3100 N  N   . ARG A 1 412 ? 44.702 20.738  57.588  1.00 12.68 ? 519  ARG A N   1 
ATOM   3101 C  CA  . ARG A 1 412 ? 43.952 19.502  57.431  1.00 18.62 ? 519  ARG A CA  1 
ATOM   3102 C  C   . ARG A 1 412 ? 44.766 18.385  58.065  1.00 14.92 ? 519  ARG A C   1 
ATOM   3103 O  O   . ARG A 1 412 ? 45.726 17.899  57.477  1.00 15.35 ? 519  ARG A O   1 
ATOM   3104 C  CB  . ARG A 1 412 ? 43.655 19.211  55.955  1.00 17.15 ? 519  ARG A CB  1 
ATOM   3105 C  CG  . ARG A 1 412 ? 42.821 20.285  55.241  1.00 14.61 ? 519  ARG A CG  1 
ATOM   3106 C  CD  . ARG A 1 412 ? 42.126 19.706  53.991  1.00 13.19 ? 519  ARG A CD  1 
ATOM   3107 N  NE  . ARG A 1 412 ? 43.081 19.209  53.003  1.00 15.09 ? 519  ARG A NE  1 
ATOM   3108 C  CZ  . ARG A 1 412 ? 42.756 18.436  51.970  1.00 17.30 ? 519  ARG A CZ  1 
ATOM   3109 N  NH1 . ARG A 1 412 ? 43.699 18.034  51.127  1.00 16.38 ? 519  ARG A NH1 1 
ATOM   3110 N  NH2 . ARG A 1 412 ? 41.489 18.064  51.780  1.00 15.15 ? 519  ARG A NH2 1 
ATOM   3111 N  N   . PRO A 1 413 ? 44.392 17.993  59.283  1.00 18.49 ? 520  PRO A N   1 
ATOM   3112 C  CA  . PRO A 1 413 ? 45.197 17.057  60.072  1.00 17.14 ? 520  PRO A CA  1 
ATOM   3113 C  C   . PRO A 1 413 ? 45.404 15.696  59.415  1.00 19.14 ? 520  PRO A C   1 
ATOM   3114 O  O   . PRO A 1 413 ? 46.437 15.089  59.671  1.00 20.01 ? 520  PRO A O   1 
ATOM   3115 C  CB  . PRO A 1 413 ? 44.402 16.916  61.373  1.00 16.05 ? 520  PRO A CB  1 
ATOM   3116 C  CG  . PRO A 1 413 ? 43.043 17.405  61.071  1.00 18.77 ? 520  PRO A CG  1 
ATOM   3117 C  CD  . PRO A 1 413 ? 43.208 18.460  60.024  1.00 18.91 ? 520  PRO A CD  1 
ATOM   3118 N  N   . HIS A 1 414 ? 44.468 15.234  58.589  1.00 16.17 ? 521  HIS A N   1 
ATOM   3119 C  CA  . HIS A 1 414 ? 44.620 13.933  57.929  1.00 18.34 ? 521  HIS A CA  1 
ATOM   3120 C  C   . HIS A 1 414 ? 45.468 13.984  56.655  1.00 16.83 ? 521  HIS A C   1 
ATOM   3121 O  O   . HIS A 1 414 ? 45.834 12.943  56.110  1.00 17.40 ? 521  HIS A O   1 
ATOM   3122 C  CB  . HIS A 1 414 ? 43.248 13.348  57.590  1.00 17.11 ? 521  HIS A CB  1 
ATOM   3123 C  CG  . HIS A 1 414 ? 42.426 13.010  58.789  1.00 21.96 ? 521  HIS A CG  1 
ATOM   3124 N  ND1 . HIS A 1 414 ? 42.668 11.897  59.567  1.00 25.07 ? 521  HIS A ND1 1 
ATOM   3125 C  CD2 . HIS A 1 414 ? 41.364 13.635  59.349  1.00 22.12 ? 521  HIS A CD2 1 
ATOM   3126 C  CE1 . HIS A 1 414 ? 41.795 11.854  60.556  1.00 25.27 ? 521  HIS A CE1 1 
ATOM   3127 N  NE2 . HIS A 1 414 ? 40.988 12.895  60.443  1.00 30.42 ? 521  HIS A NE2 1 
ATOM   3128 N  N   . ASP A 1 415 ? 45.770 15.185  56.173  1.00 14.85 ? 522  ASP A N   1 
ATOM   3129 C  CA  . ASP A 1 415 ? 46.433 15.332  54.875  1.00 15.22 ? 522  ASP A CA  1 
ATOM   3130 C  C   . ASP A 1 415 ? 47.954 15.338  55.016  1.00 21.15 ? 522  ASP A C   1 
ATOM   3131 O  O   . ASP A 1 415 ? 48.558 16.374  55.259  1.00 16.94 ? 522  ASP A O   1 
ATOM   3132 C  CB  . ASP A 1 415 ? 45.960 16.606  54.175  1.00 16.71 ? 522  ASP A CB  1 
ATOM   3133 C  CG  . ASP A 1 415 ? 46.563 16.785  52.780  1.00 15.72 ? 522  ASP A CG  1 
ATOM   3134 O  OD1 . ASP A 1 415 ? 47.198 15.847  52.243  1.00 19.44 ? 522  ASP A OD1 1 
ATOM   3135 O  OD2 . ASP A 1 415 ? 46.383 17.881  52.210  1.00 18.75 ? 522  ASP A OD2 1 
ATOM   3136 N  N   . TYR A 1 416 ? 48.555 14.167  54.840  1.00 20.57 ? 523  TYR A N   1 
ATOM   3137 C  CA  . TYR A 1 416 ? 49.996 13.984  54.997  1.00 21.01 ? 523  TYR A CA  1 
ATOM   3138 C  C   . TYR A 1 416 ? 50.680 13.904  53.635  1.00 20.42 ? 523  TYR A C   1 
ATOM   3139 O  O   . TYR A 1 416 ? 51.802 13.422  53.534  1.00 19.27 ? 523  TYR A O   1 
ATOM   3140 C  CB  . TYR A 1 416 ? 50.283 12.704  55.802  1.00 26.76 ? 523  TYR A CB  1 
ATOM   3141 C  CG  . TYR A 1 416 ? 49.526 11.509  55.254  1.00 32.06 ? 523  TYR A CG  1 
ATOM   3142 C  CD1 . TYR A 1 416 ? 49.843 10.974  54.010  0.00 26.30 ? 523  TYR A CD1 1 
ATOM   3143 C  CD2 . TYR A 1 416 ? 48.481 10.931  55.963  0.00 26.43 ? 523  TYR A CD2 1 
ATOM   3144 C  CE1 . TYR A 1 416 ? 49.154 9.905   53.490  0.00 27.68 ? 523  TYR A CE1 1 
ATOM   3145 C  CE2 . TYR A 1 416 ? 47.785 9.850   55.449  0.00 28.37 ? 523  TYR A CE2 1 
ATOM   3146 C  CZ  . TYR A 1 416 ? 48.129 9.343   54.211  0.00 29.40 ? 523  TYR A CZ  1 
ATOM   3147 O  OH  . TYR A 1 416 ? 47.448 8.270   53.687  0.00 32.07 ? 523  TYR A OH  1 
ATOM   3148 N  N   . SER A 1 417 ? 49.989 14.346  52.586  1.00 18.19 ? 524  SER A N   1 
ATOM   3149 C  CA  . SER A 1 417 ? 50.501 14.229  51.224  1.00 19.96 ? 524  SER A CA  1 
ATOM   3150 C  C   . SER A 1 417 ? 51.791 15.006  51.021  1.00 20.05 ? 524  SER A C   1 
ATOM   3151 O  O   . SER A 1 417 ? 51.970 16.082  51.587  1.00 22.22 ? 524  SER A O   1 
ATOM   3152 C  CB  . SER A 1 417 ? 49.458 14.710  50.206  1.00 18.28 ? 524  SER A CB  1 
ATOM   3153 O  OG  . SER A 1 417 ? 50.047 14.824  48.921  1.00 22.62 ? 524  SER A OG  1 
ATOM   3154 N  N   . ALA A 1 418 ? 52.677 14.460  50.197  1.00 17.41 ? 525  ALA A N   1 
ATOM   3155 C  CA  . ALA A 1 418 ? 53.901 15.160  49.826  1.00 26.33 ? 525  ALA A CA  1 
ATOM   3156 C  C   . ALA A 1 418 ? 53.770 15.875  48.472  1.00 27.01 ? 525  ALA A C   1 
ATOM   3157 O  O   . ALA A 1 418 ? 54.735 16.451  47.981  1.00 22.11 ? 525  ALA A O   1 
ATOM   3158 C  CB  . ALA A 1 418 ? 55.076 14.184  49.796  1.00 28.40 ? 525  ALA A CB  1 
ATOM   3159 N  N   . ASP A 1 419 ? 52.569 15.861  47.892  1.00 21.85 ? 526  ASP A N   1 
ATOM   3160 C  CA  . ASP A 1 419 ? 52.353 16.382  46.536  1.00 19.58 ? 526  ASP A CA  1 
ATOM   3161 C  C   . ASP A 1 419 ? 52.232 17.894  46.415  1.00 20.40 ? 526  ASP A C   1 
ATOM   3162 O  O   . ASP A 1 419 ? 52.314 18.427  45.310  1.00 25.09 ? 526  ASP A O   1 
ATOM   3163 C  CB  . ASP A 1 419 ? 51.094 15.769  45.930  1.00 28.08 ? 526  ASP A CB  1 
ATOM   3164 C  CG  . ASP A 1 419 ? 51.247 14.291  45.632  1.00 32.92 ? 526  ASP A CG  1 
ATOM   3165 O  OD1 . ASP A 1 419 ? 52.391 13.849  45.404  1.00 30.07 ? 526  ASP A OD1 1 
ATOM   3166 O  OD2 . ASP A 1 419 ? 50.217 13.578  45.626  1.00 38.96 ? 526  ASP A OD2 1 
ATOM   3167 N  N   . GLY A 1 420 ? 52.016 18.579  47.531  1.00 18.59 ? 527  GLY A N   1 
ATOM   3168 C  CA  . GLY A 1 420 ? 51.848 20.021  47.514  1.00 14.24 ? 527  GLY A CA  1 
ATOM   3169 C  C   . GLY A 1 420 ? 50.670 20.436  46.643  1.00 18.13 ? 527  GLY A C   1 
ATOM   3170 O  O   . GLY A 1 420 ? 49.667 19.725  46.566  1.00 16.00 ? 527  GLY A O   1 
ATOM   3171 N  N   . PHE A 1 421 ? 50.803 21.578  45.977  1.00 16.58 ? 528  PHE A N   1 
ATOM   3172 C  CA  . PHE A 1 421 ? 49.760 22.078  45.078  1.00 19.93 ? 528  PHE A CA  1 
ATOM   3173 C  C   . PHE A 1 421 ? 50.334 22.417  43.717  1.00 20.65 ? 528  PHE A C   1 
ATOM   3174 O  O   . PHE A 1 421 ? 51.351 23.104  43.615  1.00 18.80 ? 528  PHE A O   1 
ATOM   3175 C  CB  . PHE A 1 421 ? 49.068 23.309  45.666  1.00 18.30 ? 528  PHE A CB  1 
ATOM   3176 C  CG  . PHE A 1 421 ? 48.240 23.005  46.866  1.00 15.42 ? 528  PHE A CG  1 
ATOM   3177 C  CD1 . PHE A 1 421 ? 46.947 22.507  46.722  1.00 13.78 ? 528  PHE A CD1 1 
ATOM   3178 C  CD2 . PHE A 1 421 ? 48.750 23.191  48.137  1.00 15.54 ? 528  PHE A CD2 1 
ATOM   3179 C  CE1 . PHE A 1 421 ? 46.185 22.208  47.829  1.00 14.14 ? 528  PHE A CE1 1 
ATOM   3180 C  CE2 . PHE A 1 421 ? 47.988 22.906  49.251  1.00 16.99 ? 528  PHE A CE2 1 
ATOM   3181 C  CZ  . PHE A 1 421 ? 46.710 22.405  49.103  1.00 13.55 ? 528  PHE A CZ  1 
ATOM   3182 N  N   . ASN A 1 422 ? 49.680 21.932  42.669  1.00 18.48 ? 529  ASN A N   1 
ATOM   3183 C  CA  . ASN A 1 422 ? 50.136 22.210  41.319  1.00 19.44 ? 529  ASN A CA  1 
ATOM   3184 C  C   . ASN A 1 422 ? 49.157 23.111  40.554  1.00 19.57 ? 529  ASN A C   1 
ATOM   3185 O  O   . ASN A 1 422 ? 48.185 22.633  39.971  1.00 21.13 ? 529  ASN A O   1 
ATOM   3186 C  CB  . ASN A 1 422 ? 50.361 20.900  40.571  1.00 20.72 ? 529  ASN A CB  1 
ATOM   3187 C  CG  . ASN A 1 422 ? 51.026 21.108  39.231  1.00 29.88 ? 529  ASN A CG  1 
ATOM   3188 O  OD1 . ASN A 1 422 ? 51.401 22.226  38.880  1.00 26.12 ? 529  ASN A OD1 1 
ATOM   3189 N  ND2 . ASN A 1 422 ? 51.190 20.029  38.481  1.00 26.73 ? 529  ASN A ND2 1 
ATOM   3190 N  N   . ASP A 1 423 ? 49.441 24.411  40.565  1.00 19.57 ? 530  ASP A N   1 
ATOM   3191 C  CA  . ASP A 1 423 ? 48.609 25.430  39.930  1.00 20.02 ? 530  ASP A CA  1 
ATOM   3192 C  C   . ASP A 1 423 ? 47.143 25.246  40.332  1.00 23.55 ? 530  ASP A C   1 
ATOM   3193 O  O   . ASP A 1 423 ? 46.258 25.169  39.486  1.00 22.11 ? 530  ASP A O   1 
ATOM   3194 C  CB  . ASP A 1 423 ? 48.770 25.395  38.408  1.00 25.17 ? 530  ASP A CB  1 
ATOM   3195 C  CG  . ASP A 1 423 ? 48.097 26.578  37.720  1.00 30.38 ? 530  ASP A CG  1 
ATOM   3196 O  OD1 . ASP A 1 423 ? 48.090 27.689  38.289  1.00 21.08 ? 530  ASP A OD1 1 
ATOM   3197 O  OD2 . ASP A 1 423 ? 47.551 26.381  36.617  1.00 34.68 ? 530  ASP A OD2 1 
ATOM   3198 N  N   . TRP A 1 424 ? 46.922 25.158  41.639  1.00 14.36 ? 531  TRP A N   1 
ATOM   3199 C  CA  . TRP A 1 424 ? 45.600 24.976  42.218  1.00 17.23 ? 531  TRP A CA  1 
ATOM   3200 C  C   . TRP A 1 424 ? 44.960 26.336  42.487  1.00 17.24 ? 531  TRP A C   1 
ATOM   3201 O  O   . TRP A 1 424 ? 45.566 27.191  43.117  1.00 17.56 ? 531  TRP A O   1 
ATOM   3202 C  CB  . TRP A 1 424 ? 45.671 24.173  43.526  1.00 15.45 ? 531  TRP A CB  1 
ATOM   3203 C  CG  . TRP A 1 424 ? 44.312 23.821  44.042  1.00 17.04 ? 531  TRP A CG  1 
ATOM   3204 C  CD1 . TRP A 1 424 ? 43.631 24.411  45.071  1.00 15.58 ? 531  TRP A CD1 1 
ATOM   3205 C  CD2 . TRP A 1 424 ? 43.450 22.818  43.512  1.00 14.72 ? 531  TRP A CD2 1 
ATOM   3206 N  NE1 . TRP A 1 424 ? 42.393 23.821  45.213  1.00 14.45 ? 531  TRP A NE1 1 
ATOM   3207 C  CE2 . TRP A 1 424 ? 42.265 22.838  44.270  1.00 16.65 ? 531  TRP A CE2 1 
ATOM   3208 C  CE3 . TRP A 1 424 ? 43.571 21.896  42.471  1.00 18.46 ? 531  TRP A CE3 1 
ATOM   3209 C  CZ2 . TRP A 1 424 ? 41.198 21.975  44.009  1.00 18.21 ? 531  TRP A CZ2 1 
ATOM   3210 C  CZ3 . TRP A 1 424 ? 42.513 21.047  42.216  1.00 22.45 ? 531  TRP A CZ3 1 
ATOM   3211 C  CH2 . TRP A 1 424 ? 41.346 21.091  42.988  1.00 17.01 ? 531  TRP A CH2 1 
ATOM   3212 N  N   . ALA A 1 425 ? 43.736 26.525  42.011  1.00 15.60 ? 532  ALA A N   1 
ATOM   3213 C  CA  . ALA A 1 425 ? 43.046 27.785  42.186  1.00 19.59 ? 532  ALA A CA  1 
ATOM   3214 C  C   . ALA A 1 425 ? 42.209 27.795  43.464  1.00 25.56 ? 532  ALA A C   1 
ATOM   3215 O  O   . ALA A 1 425 ? 41.141 27.188  43.510  1.00 28.33 ? 532  ALA A O   1 
ATOM   3216 C  CB  . ALA A 1 425 ? 42.166 28.075  40.967  1.00 20.24 ? 532  ALA A CB  1 
ATOM   3217 N  N   . PHE A 1 426 ? 42.701 28.461  44.507  1.00 17.53 ? 533  PHE A N   1 
ATOM   3218 C  CA  . PHE A 1 426 ? 41.907 28.676  45.713  1.00 14.75 ? 533  PHE A CA  1 
ATOM   3219 C  C   . PHE A 1 426 ? 40.994 29.864  45.473  1.00 14.53 ? 533  PHE A C   1 
ATOM   3220 O  O   . PHE A 1 426 ? 41.459 30.905  45.030  1.00 16.71 ? 533  PHE A O   1 
ATOM   3221 C  CB  . PHE A 1 426 ? 42.793 28.940  46.931  1.00 15.13 ? 533  PHE A CB  1 
ATOM   3222 C  CG  . PHE A 1 426 ? 43.737 27.812  47.268  1.00 17.61 ? 533  PHE A CG  1 
ATOM   3223 C  CD1 . PHE A 1 426 ? 44.997 27.758  46.719  1.00 14.42 ? 533  PHE A CD1 1 
ATOM   3224 C  CD2 . PHE A 1 426 ? 43.368 26.835  48.180  1.00 16.26 ? 533  PHE A CD2 1 
ATOM   3225 C  CE1 . PHE A 1 426 ? 45.878 26.725  47.057  1.00 14.61 ? 533  PHE A CE1 1 
ATOM   3226 C  CE2 . PHE A 1 426 ? 44.241 25.809  48.518  1.00 14.26 ? 533  PHE A CE2 1 
ATOM   3227 C  CZ  . PHE A 1 426 ? 45.488 25.753  47.962  1.00 12.41 ? 533  PHE A CZ  1 
ATOM   3228 N  N   . MET A 1 427 ? 39.708 29.724  45.765  1.00 12.84 ? 534  MET A N   1 
ATOM   3229 C  CA  . MET A 1 427 ? 38.756 30.788  45.443  1.00 13.57 ? 534  MET A CA  1 
ATOM   3230 C  C   . MET A 1 427 ? 38.090 31.392  46.683  1.00 16.32 ? 534  MET A C   1 
ATOM   3231 O  O   . MET A 1 427 ? 37.745 30.681  47.633  1.00 14.08 ? 534  MET A O   1 
ATOM   3232 C  CB  . MET A 1 427 ? 37.690 30.262  44.474  1.00 12.17 ? 534  MET A CB  1 
ATOM   3233 C  CG  . MET A 1 427 ? 36.808 31.350  43.860  1.00 12.31 ? 534  MET A CG  1 
ATOM   3234 S  SD  . MET A 1 427 ? 35.325 31.723  44.855  1.00 16.27 ? 534  MET A SD  1 
ATOM   3235 C  CE  . MET A 1 427 ? 34.218 30.387  44.365  1.00 11.79 ? 534  MET A CE  1 
ATOM   3236 N  N   . THR A 1 428 ? 37.906 32.712  46.680  1.00 13.53 ? 535  THR A N   1 
ATOM   3237 C  CA  . THR A 1 428 ? 37.155 33.332  47.765  1.00 13.59 ? 535  THR A CA  1 
ATOM   3238 C  C   . THR A 1 428 ? 36.022 34.193  47.239  1.00 14.64 ? 535  THR A C   1 
ATOM   3239 O  O   . THR A 1 428 ? 36.176 34.891  46.242  1.00 15.60 ? 535  THR A O   1 
ATOM   3240 C  CB  . THR A 1 428 ? 38.049 34.194  48.688  1.00 12.43 ? 535  THR A CB  1 
ATOM   3241 O  OG1 . THR A 1 428 ? 37.224 34.811  49.681  1.00 15.11 ? 535  THR A OG1 1 
ATOM   3242 C  CG2 . THR A 1 428 ? 38.788 35.286  47.904  1.00 11.66 ? 535  THR A CG2 1 
ATOM   3243 N  N   . THR A 1 429 ? 34.875 34.106  47.907  1.00 13.67 ? 536  THR A N   1 
ATOM   3244 C  CA  . THR A 1 429 ? 33.716 34.926  47.609  1.00 11.17 ? 536  THR A CA  1 
ATOM   3245 C  C   . THR A 1 429 ? 33.627 36.109  48.570  1.00 15.63 ? 536  THR A C   1 
ATOM   3246 O  O   . THR A 1 429 ? 32.719 36.931  48.456  1.00 13.63 ? 536  THR A O   1 
ATOM   3247 C  CB  . THR A 1 429 ? 32.387 34.134  47.732  1.00 13.92 ? 536  THR A CB  1 
ATOM   3248 O  OG1 . THR A 1 429 ? 32.198 33.736  49.091  1.00 15.97 ? 536  THR A OG1 1 
ATOM   3249 C  CG2 . THR A 1 429 ? 32.385 32.922  46.861  1.00 11.19 ? 536  THR A CG2 1 
ATOM   3250 N  N   . HIS A 1 430 ? 34.563 36.187  49.516  1.00 15.40 ? 537  HIS A N   1 
ATOM   3251 C  CA  . HIS A 1 430 ? 34.379 37.072  50.668  1.00 17.84 ? 537  HIS A CA  1 
ATOM   3252 C  C   . HIS A 1 430 ? 34.660 38.554  50.393  1.00 16.20 ? 537  HIS A C   1 
ATOM   3253 O  O   . HIS A 1 430 ? 34.293 39.403  51.211  1.00 16.32 ? 537  HIS A O   1 
ATOM   3254 C  CB  . HIS A 1 430 ? 35.242 36.595  51.844  1.00 14.45 ? 537  HIS A CB  1 
ATOM   3255 C  CG  . HIS A 1 430 ? 34.734 35.342  52.495  1.00 15.03 ? 537  HIS A CG  1 
ATOM   3256 N  ND1 . HIS A 1 430 ? 35.035 35.003  53.798  1.00 18.54 ? 537  HIS A ND1 1 
ATOM   3257 C  CD2 . HIS A 1 430 ? 33.943 34.346  52.021  1.00 14.39 ? 537  HIS A CD2 1 
ATOM   3258 C  CE1 . HIS A 1 430 ? 34.451 33.855  54.100  1.00 15.42 ? 537  HIS A CE1 1 
ATOM   3259 N  NE2 . HIS A 1 430 ? 33.782 33.436  53.039  1.00 16.94 ? 537  HIS A NE2 1 
ATOM   3260 N  N   . SER A 1 431 ? 35.308 38.866  49.271  1.00 13.36 ? 538  SER A N   1 
ATOM   3261 C  CA  . SER A 1 431 ? 35.550 40.262  48.900  1.00 14.16 ? 538  SER A CA  1 
ATOM   3262 C  C   . SER A 1 431 ? 34.645 40.739  47.756  1.00 17.22 ? 538  SER A C   1 
ATOM   3263 O  O   . SER A 1 431 ? 34.966 41.683  47.035  1.00 15.96 ? 538  SER A O   1 
ATOM   3264 C  CB  . SER A 1 431 ? 37.014 40.463  48.532  1.00 14.50 ? 538  SER A CB  1 
ATOM   3265 O  OG  . SER A 1 431 ? 37.825 40.359  49.696  1.00 20.19 ? 538  SER A OG  1 
ATOM   3266 N  N   . TRP A 1 432 ? 33.506 40.082  47.604  1.00 13.84 ? 539  TRP A N   1 
ATOM   3267 C  CA  . TRP A 1 432 ? 32.538 40.455  46.586  1.00 15.24 ? 539  TRP A CA  1 
ATOM   3268 C  C   . TRP A 1 432 ? 32.106 41.925  46.760  1.00 15.16 ? 539  TRP A C   1 
ATOM   3269 O  O   . TRP A 1 432 ? 31.761 42.348  47.867  1.00 13.54 ? 539  TRP A O   1 
ATOM   3270 C  CB  . TRP A 1 432 ? 31.343 39.520  46.687  1.00 15.31 ? 539  TRP A CB  1 
ATOM   3271 C  CG  . TRP A 1 432 ? 30.397 39.446  45.527  1.00 18.03 ? 539  TRP A CG  1 
ATOM   3272 C  CD1 . TRP A 1 432 ? 29.399 40.313  45.233  1.00 15.10 ? 539  TRP A CD1 1 
ATOM   3273 C  CD2 . TRP A 1 432 ? 30.299 38.376  44.568  1.00 15.04 ? 539  TRP A CD2 1 
ATOM   3274 N  NE1 . TRP A 1 432 ? 28.705 39.876  44.130  1.00 17.24 ? 539  TRP A NE1 1 
ATOM   3275 C  CE2 . TRP A 1 432 ? 29.241 38.691  43.702  1.00 15.00 ? 539  TRP A CE2 1 
ATOM   3276 C  CE3 . TRP A 1 432 ? 31.024 37.198  44.350  1.00 13.24 ? 539  TRP A CE3 1 
ATOM   3277 C  CZ2 . TRP A 1 432 ? 28.863 37.852  42.637  1.00 14.29 ? 539  TRP A CZ2 1 
ATOM   3278 C  CZ3 . TRP A 1 432 ? 30.664 36.379  43.294  1.00 18.66 ? 539  TRP A CZ3 1 
ATOM   3279 C  CH2 . TRP A 1 432 ? 29.584 36.707  42.450  1.00 12.67 ? 539  TRP A CH2 1 
ATOM   3280 N  N   . ASP A 1 433 ? 32.148 42.669  45.657  1.00 15.43 ? 540  ASP A N   1 
ATOM   3281 C  CA  . ASP A 1 433 ? 31.780 44.101  45.574  1.00 15.93 ? 540  ASP A CA  1 
ATOM   3282 C  C   . ASP A 1 433 ? 32.852 45.060  46.111  1.00 18.31 ? 540  ASP A C   1 
ATOM   3283 O  O   . ASP A 1 433 ? 32.680 46.272  46.041  1.00 18.63 ? 540  ASP A O   1 
ATOM   3284 C  CB  . ASP A 1 433 ? 30.448 44.391  46.284  1.00 15.22 ? 540  ASP A CB  1 
ATOM   3285 C  CG  . ASP A 1 433 ? 29.234 44.046  45.421  1.00 19.13 ? 540  ASP A CG  1 
ATOM   3286 O  OD1 . ASP A 1 433 ? 29.360 44.000  44.175  1.00 20.36 ? 540  ASP A OD1 1 
ATOM   3287 O  OD2 . ASP A 1 433 ? 28.155 43.815  45.992  1.00 17.89 ? 540  ASP A OD2 1 
ATOM   3288 N  N   . GLU A 1 434 ? 33.958 44.540  46.627  1.00 16.96 ? 541  GLU A N   1 
ATOM   3289 C  CA  . GLU A 1 434 ? 35.063 45.414  47.024  1.00 19.21 ? 541  GLU A CA  1 
ATOM   3290 C  C   . GLU A 1 434 ? 35.797 45.980  45.798  1.00 19.26 ? 541  GLU A C   1 
ATOM   3291 O  O   . GLU A 1 434 ? 35.732 45.404  44.720  1.00 16.82 ? 541  GLU A O   1 
ATOM   3292 C  CB  . GLU A 1 434 ? 36.057 44.665  47.919  1.00 20.97 ? 541  GLU A CB  1 
ATOM   3293 C  CG  . GLU A 1 434 ? 35.467 44.144  49.230  1.00 21.48 ? 541  GLU A CG  1 
ATOM   3294 C  CD  . GLU A 1 434 ? 36.512 43.472  50.109  1.00 18.33 ? 541  GLU A CD  1 
ATOM   3295 O  OE1 . GLU A 1 434 ? 37.668 43.317  49.673  1.00 21.18 ? 541  GLU A OE1 1 
ATOM   3296 O  OE2 . GLU A 1 434 ? 36.177 43.107  51.244  1.00 20.70 ? 541  GLU A OE2 1 
ATOM   3297 N  N   . ASP A 1 435 ? 36.482 47.110  45.964  1.00 16.47 ? 542  ASP A N   1 
ATOM   3298 C  CA  . ASP A 1 435 ? 37.459 47.549  44.971  1.00 16.30 ? 542  ASP A CA  1 
ATOM   3299 C  C   . ASP A 1 435 ? 38.751 46.751  45.184  1.00 18.31 ? 542  ASP A C   1 
ATOM   3300 O  O   . ASP A 1 435 ? 39.323 46.784  46.266  1.00 19.29 ? 542  ASP A O   1 
ATOM   3301 C  CB  . ASP A 1 435 ? 37.724 49.055  45.084  1.00 22.05 ? 542  ASP A CB  1 
ATOM   3302 C  CG  . ASP A 1 435 ? 38.514 49.616  43.899  1.00 22.49 ? 542  ASP A CG  1 
ATOM   3303 O  OD1 . ASP A 1 435 ? 39.429 48.934  43.373  1.00 22.41 ? 542  ASP A OD1 1 
ATOM   3304 O  OD2 . ASP A 1 435 ? 38.206 50.751  43.483  1.00 23.30 ? 542  ASP A OD2 1 
ATOM   3305 N  N   . PRO A 1 436 ? 39.212 46.037  44.149  1.00 17.47 ? 543  PRO A N   1 
ATOM   3306 C  CA  . PRO A 1 436 ? 40.406 45.194  44.286  1.00 16.31 ? 543  PRO A CA  1 
ATOM   3307 C  C   . PRO A 1 436 ? 41.739 45.892  44.008  1.00 21.98 ? 543  PRO A C   1 
ATOM   3308 O  O   . PRO A 1 436 ? 42.761 45.218  44.009  1.00 17.58 ? 543  PRO A O   1 
ATOM   3309 C  CB  . PRO A 1 436 ? 40.172 44.111  43.239  1.00 14.85 ? 543  PRO A CB  1 
ATOM   3310 C  CG  . PRO A 1 436 ? 39.469 44.881  42.114  1.00 17.20 ? 543  PRO A CG  1 
ATOM   3311 C  CD  . PRO A 1 436 ? 38.585 45.899  42.818  1.00 16.41 ? 543  PRO A CD  1 
ATOM   3312 N  N   . SER A 1 437 ? 41.743 47.197  43.751  1.00 18.61 ? 544  SER A N   1 
ATOM   3313 C  CA  . SER A 1 437 ? 43.011 47.896  43.543  1.00 19.98 ? 544  SER A CA  1 
ATOM   3314 C  C   . SER A 1 437 ? 43.705 48.175  44.884  1.00 17.62 ? 544  SER A C   1 
ATOM   3315 O  O   . SER A 1 437 ? 43.057 48.516  45.876  1.00 21.71 ? 544  SER A O   1 
ATOM   3316 C  CB  . SER A 1 437 ? 42.789 49.203  42.777  1.00 20.66 ? 544  SER A CB  1 
ATOM   3317 O  OG  . SER A 1 437 ? 41.980 50.087  43.532  1.00 29.82 ? 544  SER A OG  1 
ATOM   3318 N  N   . GLY A 1 438 ? 45.024 48.042  44.912  1.00 21.94 ? 545  GLY A N   1 
ATOM   3319 C  CA  . GLY A 1 438 ? 45.765 48.247  46.148  1.00 21.07 ? 545  GLY A CA  1 
ATOM   3320 C  C   . GLY A 1 438 ? 46.603 47.028  46.511  1.00 17.96 ? 545  GLY A C   1 
ATOM   3321 O  O   . GLY A 1 438 ? 46.917 46.217  45.657  1.00 19.47 ? 545  GLY A O   1 
ATOM   3322 N  N   . GLU A 1 439 ? 46.959 46.891  47.781  1.00 19.79 ? 546  GLU A N   1 
ATOM   3323 C  CA  . GLU A 1 439 ? 47.863 45.826  48.185  1.00 21.48 ? 546  GLU A CA  1 
ATOM   3324 C  C   . GLU A 1 439 ? 47.143 44.554  48.633  1.00 19.60 ? 546  GLU A C   1 
ATOM   3325 O  O   . GLU A 1 439 ? 46.363 44.562  49.579  1.00 20.00 ? 546  GLU A O   1 
ATOM   3326 C  CB  . GLU A 1 439 ? 48.786 46.304  49.306  1.00 23.68 ? 546  GLU A CB  1 
ATOM   3327 C  CG  . GLU A 1 439 ? 49.848 45.288  49.715  1.00 23.99 ? 546  GLU A CG  1 
ATOM   3328 C  CD  . GLU A 1 439 ? 50.739 45.820  50.833  1.00 37.97 ? 546  GLU A CD  1 
ATOM   3329 O  OE1 . GLU A 1 439 ? 51.970 45.908  50.640  1.00 31.22 ? 546  GLU A OE1 1 
ATOM   3330 O  OE2 . GLU A 1 439 ? 50.199 46.172  51.902  1.00 33.76 ? 546  GLU A OE2 1 
ATOM   3331 N  N   . TRP A 1 440 ? 47.427 43.459  47.941  1.00 17.49 ? 547  TRP A N   1 
ATOM   3332 C  CA  . TRP A 1 440 ? 46.976 42.153  48.383  1.00 19.28 ? 547  TRP A CA  1 
ATOM   3333 C  C   . TRP A 1 440 ? 48.101 41.491  49.173  1.00 17.86 ? 547  TRP A C   1 
ATOM   3334 O  O   . TRP A 1 440 ? 49.275 41.721  48.893  1.00 17.88 ? 547  TRP A O   1 
ATOM   3335 C  CB  . TRP A 1 440 ? 46.576 41.277  47.198  1.00 18.39 ? 547  TRP A CB  1 
ATOM   3336 C  CG  . TRP A 1 440 ? 45.310 41.704  46.545  1.00 18.41 ? 547  TRP A CG  1 
ATOM   3337 C  CD1 . TRP A 1 440 ? 45.136 42.765  45.700  1.00 17.51 ? 547  TRP A CD1 1 
ATOM   3338 C  CD2 . TRP A 1 440 ? 44.035 41.072  46.672  1.00 14.94 ? 547  TRP A CD2 1 
ATOM   3339 N  NE1 . TRP A 1 440 ? 43.825 42.831  45.294  1.00 16.52 ? 547  TRP A NE1 1 
ATOM   3340 C  CE2 . TRP A 1 440 ? 43.129 41.803  45.877  1.00 18.08 ? 547  TRP A CE2 1 
ATOM   3341 C  CE3 . TRP A 1 440 ? 43.570 39.963  47.387  1.00 14.10 ? 547  TRP A CE3 1 
ATOM   3342 C  CZ2 . TRP A 1 440 ? 41.777 41.456  45.778  1.00 18.10 ? 547  TRP A CZ2 1 
ATOM   3343 C  CZ3 . TRP A 1 440 ? 42.224 39.618  47.287  1.00 16.75 ? 547  TRP A CZ3 1 
ATOM   3344 C  CH2 . TRP A 1 440 ? 41.346 40.363  46.494  1.00 14.10 ? 547  TRP A CH2 1 
ATOM   3345 N  N   . VAL A 1 441 ? 47.742 40.684  50.164  1.00 15.21 ? 548  VAL A N   1 
ATOM   3346 C  CA  . VAL A 1 441 ? 48.743 39.917  50.894  1.00 16.94 ? 548  VAL A CA  1 
ATOM   3347 C  C   . VAL A 1 441 ? 48.386 38.436  50.954  1.00 14.81 ? 548  VAL A C   1 
ATOM   3348 O  O   . VAL A 1 441 ? 47.308 38.068  51.416  1.00 17.69 ? 548  VAL A O   1 
ATOM   3349 C  CB  . VAL A 1 441 ? 48.921 40.430  52.325  1.00 16.76 ? 548  VAL A CB  1 
ATOM   3350 C  CG1 . VAL A 1 441 ? 50.126 39.775  52.963  1.00 19.24 ? 548  VAL A CG1 1 
ATOM   3351 C  CG2 . VAL A 1 441 ? 49.093 41.957  52.331  1.00 23.58 ? 548  VAL A CG2 1 
ATOM   3352 N  N   . LEU A 1 442 ? 49.301 37.594  50.494  1.00 15.22 ? 549  LEU A N   1 
ATOM   3353 C  CA  . LEU A 1 442 ? 49.157 36.153  50.674  1.00 17.66 ? 549  LEU A CA  1 
ATOM   3354 C  C   . LEU A 1 442 ? 50.004 35.716  51.860  1.00 17.30 ? 549  LEU A C   1 
ATOM   3355 O  O   . LEU A 1 442 ? 51.175 36.077  51.950  1.00 22.94 ? 549  LEU A O   1 
ATOM   3356 C  CB  . LEU A 1 442 ? 49.562 35.402  49.410  1.00 14.21 ? 549  LEU A CB  1 
ATOM   3357 C  CG  . LEU A 1 442 ? 49.539 33.869  49.470  1.00 18.47 ? 549  LEU A CG  1 
ATOM   3358 C  CD1 . LEU A 1 442 ? 48.120 33.334  49.344  1.00 18.16 ? 549  LEU A CD1 1 
ATOM   3359 C  CD2 . LEU A 1 442 ? 50.435 33.303  48.405  1.00 18.02 ? 549  LEU A CD2 1 
ATOM   3360 N  N   . GLU A 1 443 ? 49.390 34.967  52.772  1.00 15.28 ? 550  GLU A N   1 
ATOM   3361 C  CA  . GLU A 1 443 ? 50.054 34.429  53.948  1.00 18.68 ? 550  GLU A CA  1 
ATOM   3362 C  C   . GLU A 1 443 ? 50.049 32.896  53.902  1.00 17.76 ? 550  GLU A C   1 
ATOM   3363 O  O   . GLU A 1 443 ? 48.992 32.283  53.763  1.00 16.94 ? 550  GLU A O   1 
ATOM   3364 C  CB  . GLU A 1 443 ? 49.360 34.907  55.229  1.00 18.46 ? 550  GLU A CB  1 
ATOM   3365 C  CG  . GLU A 1 443 ? 49.374 36.414  55.452  1.00 23.50 ? 550  GLU A CG  1 
ATOM   3366 C  CD  . GLU A 1 443 ? 48.339 36.872  56.486  1.00 40.99 ? 550  GLU A CD  1 
ATOM   3367 O  OE1 . GLU A 1 443 ? 48.425 38.026  56.955  1.00 42.91 ? 550  GLU A OE1 1 
ATOM   3368 O  OE2 . GLU A 1 443 ? 47.432 36.084  56.832  1.00 41.47 ? 550  GLU A OE2 1 
ATOM   3369 N  N   . ILE A 1 444 ? 51.228 32.295  54.015  1.00 14.52 ? 551  ILE A N   1 
ATOM   3370 C  CA  . ILE A 1 444 ? 51.374 30.846  54.094  1.00 18.30 ? 551  ILE A CA  1 
ATOM   3371 C  C   . ILE A 1 444 ? 52.126 30.474  55.370  1.00 21.02 ? 551  ILE A C   1 
ATOM   3372 O  O   . ILE A 1 444 ? 53.240 30.956  55.596  1.00 22.18 ? 551  ILE A O   1 
ATOM   3373 C  CB  . ILE A 1 444 ? 52.137 30.279  52.881  1.00 15.25 ? 551  ILE A CB  1 
ATOM   3374 C  CG1 . ILE A 1 444 ? 51.400 30.618  51.577  1.00 16.79 ? 551  ILE A CG1 1 
ATOM   3375 C  CG2 . ILE A 1 444 ? 52.353 28.782  53.058  1.00 17.86 ? 551  ILE A CG2 1 
ATOM   3376 C  CD1 . ILE A 1 444 ? 52.121 30.186  50.322  1.00 14.84 ? 551  ILE A CD1 1 
ATOM   3377 N  N   . GLU A 1 445 ? 51.532 29.631  56.208  1.00 17.48 ? 552  GLU A N   1 
ATOM   3378 C  CA  . GLU A 1 445 ? 52.177 29.306  57.470  1.00 20.66 ? 552  GLU A CA  1 
ATOM   3379 C  C   . GLU A 1 445 ? 52.177 27.830  57.819  1.00 22.91 ? 552  GLU A C   1 
ATOM   3380 O  O   . GLU A 1 445 ? 51.245 27.086  57.489  1.00 19.66 ? 552  GLU A O   1 
ATOM   3381 C  CB  . GLU A 1 445 ? 51.534 30.095  58.616  1.00 29.11 ? 552  GLU A CB  1 
ATOM   3382 C  CG  . GLU A 1 445 ? 50.045 29.989  58.695  1.00 34.21 ? 552  GLU A CG  1 
ATOM   3383 C  CD  . GLU A 1 445 ? 49.459 30.953  59.714  1.00 45.73 ? 552  GLU A CD  1 
ATOM   3384 O  OE1 . GLU A 1 445 ? 49.627 30.701  60.928  1.00 55.64 ? 552  GLU A OE1 1 
ATOM   3385 O  OE2 . GLU A 1 445 ? 48.839 31.961  59.304  1.00 44.57 ? 552  GLU A OE2 1 
ATOM   3386 N  N   . ASN A 1 446 ? 53.251 27.429  58.497  1.00 19.71 ? 553  ASN A N   1 
ATOM   3387 C  CA  . ASN A 1 446 ? 53.380 26.100  59.063  1.00 16.61 ? 553  ASN A CA  1 
ATOM   3388 C  C   . ASN A 1 446 ? 52.711 26.068  60.421  1.00 24.18 ? 553  ASN A C   1 
ATOM   3389 O  O   . ASN A 1 446 ? 53.213 26.661  61.375  1.00 24.09 ? 553  ASN A O   1 
ATOM   3390 C  CB  . ASN A 1 446 ? 54.857 25.716  59.173  1.00 18.03 ? 553  ASN A CB  1 
ATOM   3391 C  CG  . ASN A 1 446 ? 55.072 24.377  59.857  1.00 21.10 ? 553  ASN A CG  1 
ATOM   3392 O  OD1 . ASN A 1 446 ? 54.153 23.565  59.977  1.00 16.46 ? 553  ASN A OD1 1 
ATOM   3393 N  ND2 . ASN A 1 446 ? 56.305 24.140  60.311  1.00 19.82 ? 553  ASN A ND2 1 
ATOM   3394 N  N   . THR A 1 447 ? 51.582 25.375  60.521  1.00 18.06 ? 554  THR A N   1 
ATOM   3395 C  CA  . THR A 1 447 ? 50.822 25.384  61.765  1.00 15.65 ? 554  THR A CA  1 
ATOM   3396 C  C   . THR A 1 447 ? 51.321 24.323  62.745  1.00 20.33 ? 554  THR A C   1 
ATOM   3397 O  O   . THR A 1 447 ? 50.769 24.171  63.833  1.00 21.13 ? 554  THR A O   1 
ATOM   3398 C  CB  . THR A 1 447 ? 49.317 25.163  61.520  1.00 22.27 ? 554  THR A CB  1 
ATOM   3399 O  OG1 . THR A 1 447 ? 49.100 23.850  60.992  1.00 23.63 ? 554  THR A OG1 1 
ATOM   3400 C  CG2 . THR A 1 447 ? 48.773 26.194  60.529  1.00 22.72 ? 554  THR A CG2 1 
ATOM   3401 N  N   . SER A 1 448 ? 52.357 23.592  62.355  1.00 19.67 ? 555  SER A N   1 
ATOM   3402 C  CA  . SER A 1 448 ? 52.885 22.516  63.195  1.00 24.50 ? 555  SER A CA  1 
ATOM   3403 C  C   . SER A 1 448 ? 54.205 22.915  63.846  1.00 23.74 ? 555  SER A C   1 
ATOM   3404 O  O   . SER A 1 448 ? 54.932 23.737  63.305  1.00 21.62 ? 555  SER A O   1 
ATOM   3405 C  CB  . SER A 1 448 ? 53.089 21.246  62.370  1.00 20.77 ? 555  SER A CB  1 
ATOM   3406 O  OG  . SER A 1 448 ? 53.705 20.226  63.135  1.00 23.05 ? 555  SER A OG  1 
ATOM   3407 N  N   . GLU A 1 449 ? 54.508 22.317  64.998  1.00 22.08 ? 556  GLU A N   1 
ATOM   3408 C  CA  . GLU A 1 449 ? 55.815 22.463  65.631  1.00 23.29 ? 556  GLU A CA  1 
ATOM   3409 C  C   . GLU A 1 449 ? 56.916 21.826  64.813  1.00 28.68 ? 556  GLU A C   1 
ATOM   3410 O  O   . GLU A 1 449 ? 58.078 22.170  64.986  1.00 26.82 ? 556  GLU A O   1 
ATOM   3411 C  CB  . GLU A 1 449 ? 55.848 21.814  67.013  1.00 26.19 ? 556  GLU A CB  1 
ATOM   3412 C  CG  . GLU A 1 449 ? 55.072 22.504  68.073  1.00 28.98 ? 556  GLU A CG  1 
ATOM   3413 C  CD  . GLU A 1 449 ? 55.102 21.716  69.360  1.00 30.98 ? 556  GLU A CD  1 
ATOM   3414 O  OE1 . GLU A 1 449 ? 55.534 20.535  69.329  1.00 28.41 ? 556  GLU A OE1 1 
ATOM   3415 O  OE2 . GLU A 1 449 ? 54.695 22.271  70.400  1.00 36.45 ? 556  GLU A OE2 1 
ATOM   3416 N  N   . ALA A 1 450 ? 56.565 20.857  63.968  1.00 19.89 ? 557  ALA A N   1 
ATOM   3417 C  CA  . ALA A 1 450 ? 57.588 20.109  63.251  1.00 21.46 ? 557  ALA A CA  1 
ATOM   3418 C  C   . ALA A 1 450 ? 58.398 21.020  62.339  1.00 22.35 ? 557  ALA A C   1 
ATOM   3419 O  O   . ALA A 1 450 ? 57.926 22.075  61.915  1.00 24.36 ? 557  ALA A O   1 
ATOM   3420 C  CB  . ALA A 1 450 ? 56.970 18.967  62.440  1.00 21.26 ? 557  ALA A CB  1 
ATOM   3421 N  N   . ASN A 1 451 ? 59.615 20.586  62.035  1.00 19.35 ? 558  ASN A N   1 
ATOM   3422 C  CA  . ASN A 1 451 ? 60.510 21.306  61.148  1.00 18.68 ? 558  ASN A CA  1 
ATOM   3423 C  C   . ASN A 1 451 ? 60.127 21.092  59.687  1.00 20.05 ? 558  ASN A C   1 
ATOM   3424 O  O   . ASN A 1 451 ? 60.926 20.609  58.888  1.00 20.28 ? 558  ASN A O   1 
ATOM   3425 C  CB  . ASN A 1 451 ? 61.956 20.865  61.392  1.00 26.94 ? 558  ASN A CB  1 
ATOM   3426 C  CG  . ASN A 1 451 ? 62.968 21.912  60.969  1.00 26.65 ? 558  ASN A CG  1 
ATOM   3427 O  OD1 . ASN A 1 451 ? 62.655 23.100  60.900  1.00 32.05 ? 558  ASN A OD1 1 
ATOM   3428 N  ND2 . ASN A 1 451 ? 64.194 21.476  60.690  1.00 30.87 ? 558  ASN A ND2 1 
ATOM   3429 N  N   . ASN A 1 452 ? 58.888 21.442  59.351  1.00 20.04 ? 559  ASN A N   1 
ATOM   3430 C  CA  . ASN A 1 452 ? 58.389 21.301  57.986  1.00 24.62 ? 559  ASN A CA  1 
ATOM   3431 C  C   . ASN A 1 452 ? 59.093 22.282  57.056  1.00 19.44 ? 559  ASN A C   1 
ATOM   3432 O  O   . ASN A 1 452 ? 59.647 23.267  57.511  1.00 22.35 ? 559  ASN A O   1 
ATOM   3433 C  CB  . ASN A 1 452 ? 56.874 21.518  57.938  1.00 18.79 ? 559  ASN A CB  1 
ATOM   3434 C  CG  . ASN A 1 452 ? 56.104 20.424  58.647  1.00 22.07 ? 559  ASN A CG  1 
ATOM   3435 O  OD1 . ASN A 1 452 ? 56.562 19.283  58.740  1.00 20.32 ? 559  ASN A OD1 1 
ATOM   3436 N  ND2 . ASN A 1 452 ? 54.912 20.761  59.132  1.00 19.99 ? 559  ASN A ND2 1 
ATOM   3437 N  N   . TYR A 1 453 ? 59.076 22.006  55.756  1.00 19.35 ? 560  TYR A N   1 
ATOM   3438 C  CA  . TYR A 1 453 ? 59.824 22.819  54.798  1.00 21.26 ? 560  TYR A CA  1 
ATOM   3439 C  C   . TYR A 1 453 ? 59.245 22.694  53.400  1.00 21.01 ? 560  TYR A C   1 
ATOM   3440 O  O   . TYR A 1 453 ? 58.644 21.680  53.057  1.00 16.61 ? 560  TYR A O   1 
ATOM   3441 C  CB  . TYR A 1 453 ? 61.299 22.408  54.770  1.00 17.32 ? 560  TYR A CB  1 
ATOM   3442 C  CG  . TYR A 1 453 ? 61.511 20.972  54.321  1.00 19.94 ? 560  TYR A CG  1 
ATOM   3443 C  CD1 . TYR A 1 453 ? 61.321 19.916  55.202  1.00 16.53 ? 560  TYR A CD1 1 
ATOM   3444 C  CD2 . TYR A 1 453 ? 61.892 20.676  53.010  1.00 21.93 ? 560  TYR A CD2 1 
ATOM   3445 C  CE1 . TYR A 1 453 ? 61.504 18.606  54.804  1.00 18.67 ? 560  TYR A CE1 1 
ATOM   3446 C  CE2 . TYR A 1 453 ? 62.069 19.373  52.601  1.00 20.87 ? 560  TYR A CE2 1 
ATOM   3447 C  CZ  . TYR A 1 453 ? 61.882 18.339  53.500  1.00 22.20 ? 560  TYR A CZ  1 
ATOM   3448 O  OH  . TYR A 1 453 ? 62.072 17.037  53.093  1.00 20.65 ? 560  TYR A OH  1 
ATOM   3449 N  N   . GLY A 1 454 ? 59.445 23.730  52.594  1.00 21.65 ? 561  GLY A N   1 
ATOM   3450 C  CA  . GLY A 1 454 ? 59.090 23.675  51.190  1.00 21.95 ? 561  GLY A CA  1 
ATOM   3451 C  C   . GLY A 1 454 ? 59.196 25.017  50.492  1.00 20.12 ? 561  GLY A C   1 
ATOM   3452 O  O   . GLY A 1 454 ? 59.729 25.970  51.056  1.00 18.76 ? 561  GLY A O   1 
ATOM   3453 N  N   . THR A 1 455 ? 58.651 25.087  49.279  1.00 22.54 ? 562  THR A N   1 
ATOM   3454 C  CA  . THR A 1 455 ? 58.846 26.235  48.394  1.00 19.48 ? 562  THR A CA  1 
ATOM   3455 C  C   . THR A 1 455 ? 57.592 26.627  47.594  1.00 18.25 ? 562  THR A C   1 
ATOM   3456 O  O   . THR A 1 455 ? 56.962 25.776  46.972  1.00 18.85 ? 562  THR A O   1 
ATOM   3457 C  CB  . THR A 1 455 ? 59.971 25.955  47.377  1.00 26.63 ? 562  THR A CB  1 
ATOM   3458 O  OG1 . THR A 1 455 ? 61.113 25.391  48.042  1.00 26.73 ? 562  THR A OG1 1 
ATOM   3459 C  CG2 . THR A 1 455 ? 60.378 27.231  46.653  1.00 22.35 ? 562  THR A CG2 1 
ATOM   3460 N  N   . LEU A 1 456 ? 57.260 27.917  47.604  1.00 15.85 ? 563  LEU A N   1 
ATOM   3461 C  CA  . LEU A 1 456 ? 56.253 28.500  46.719  1.00 15.58 ? 563  LEU A CA  1 
ATOM   3462 C  C   . LEU A 1 456 ? 56.887 28.886  45.381  1.00 23.04 ? 563  LEU A C   1 
ATOM   3463 O  O   . LEU A 1 456 ? 57.745 29.769  45.330  1.00 21.59 ? 563  LEU A O   1 
ATOM   3464 C  CB  . LEU A 1 456 ? 55.618 29.729  47.384  1.00 18.42 ? 563  LEU A CB  1 
ATOM   3465 C  CG  . LEU A 1 456 ? 54.524 30.486  46.635  1.00 16.29 ? 563  LEU A CG  1 
ATOM   3466 C  CD1 . LEU A 1 456 ? 53.231 29.683  46.635  1.00 14.88 ? 563  LEU A CD1 1 
ATOM   3467 C  CD2 . LEU A 1 456 ? 54.297 31.876  47.247  1.00 16.29 ? 563  LEU A CD2 1 
ATOM   3468 N  N   . THR A 1 457 ? 56.499 28.220  44.297  1.00 19.25 ? 564  THR A N   1 
ATOM   3469 C  CA  . THR A 1 457 ? 57.125 28.528  43.012  1.00 23.08 ? 564  THR A CA  1 
ATOM   3470 C  C   . THR A 1 457 ? 56.230 29.322  42.056  1.00 21.57 ? 564  THR A C   1 
ATOM   3471 O  O   . THR A 1 457 ? 56.705 29.793  41.027  1.00 28.18 ? 564  THR A O   1 
ATOM   3472 C  CB  . THR A 1 457 ? 57.614 27.253  42.294  1.00 24.16 ? 564  THR A CB  1 
ATOM   3473 O  OG1 . THR A 1 457 ? 56.555 26.300  42.208  1.00 23.43 ? 564  THR A OG1 1 
ATOM   3474 C  CG2 . THR A 1 457 ? 58.783 26.622  43.062  1.00 25.21 ? 564  THR A CG2 1 
ATOM   3475 N  N   . LYS A 1 458 ? 54.954 29.489  42.392  1.00 23.03 ? 565  LYS A N   1 
ATOM   3476 C  CA  . LYS A 1 458 ? 54.081 30.353  41.590  1.00 17.63 ? 565  LYS A CA  1 
ATOM   3477 C  C   . LYS A 1 458 ? 52.871 30.857  42.372  1.00 19.45 ? 565  LYS A C   1 
ATOM   3478 O  O   . LYS A 1 458 ? 52.255 30.117  43.131  1.00 19.13 ? 565  LYS A O   1 
ATOM   3479 C  CB  . LYS A 1 458 ? 53.611 29.620  40.333  1.00 21.94 ? 565  LYS A CB  1 
ATOM   3480 C  CG  . LYS A 1 458 ? 52.581 30.402  39.528  1.00 27.18 ? 565  LYS A CG  1 
ATOM   3481 C  CD  . LYS A 1 458 ? 52.109 29.639  38.309  1.00 28.29 ? 565  LYS A CD  1 
ATOM   3482 C  CE  . LYS A 1 458 ? 53.017 29.921  37.135  1.00 37.89 ? 565  LYS A CE  1 
ATOM   3483 N  NZ  . LYS A 1 458 ? 52.227 30.112  35.888  1.00 43.48 ? 565  LYS A NZ  1 
ATOM   3484 N  N   . PHE A 1 459 ? 52.561 32.136  42.190  1.00 18.50 ? 566  PHE A N   1 
ATOM   3485 C  CA  . PHE A 1 459 ? 51.393 32.765  42.779  1.00 18.46 ? 566  PHE A CA  1 
ATOM   3486 C  C   . PHE A 1 459 ? 50.799 33.660  41.696  1.00 21.76 ? 566  PHE A C   1 
ATOM   3487 O  O   . PHE A 1 459 ? 51.388 34.675  41.308  1.00 20.17 ? 566  PHE A O   1 
ATOM   3488 C  CB  . PHE A 1 459 ? 51.774 33.549  44.049  1.00 16.95 ? 566  PHE A CB  1 
ATOM   3489 C  CG  . PHE A 1 459 ? 50.691 34.465  44.594  1.00 21.06 ? 566  PHE A CG  1 
ATOM   3490 C  CD1 . PHE A 1 459 ? 49.353 34.269  44.311  1.00 14.33 ? 566  PHE A CD1 1 
ATOM   3491 C  CD2 . PHE A 1 459 ? 51.044 35.532  45.416  1.00 17.09 ? 566  PHE A CD2 1 
ATOM   3492 C  CE1 . PHE A 1 459 ? 48.401 35.104  44.825  1.00 18.84 ? 566  PHE A CE1 1 
ATOM   3493 C  CE2 . PHE A 1 459 ? 50.092 36.372  45.940  1.00 22.29 ? 566  PHE A CE2 1 
ATOM   3494 C  CZ  . PHE A 1 459 ? 48.768 36.163  45.650  1.00 21.48 ? 566  PHE A CZ  1 
ATOM   3495 N  N   . THR A 1 460 ? 49.641 33.257  41.190  1.00 18.91 ? 567  THR A N   1 
ATOM   3496 C  CA  . THR A 1 460 ? 48.905 34.072  40.239  1.00 19.67 ? 567  THR A CA  1 
ATOM   3497 C  C   . THR A 1 460 ? 47.638 34.568  40.914  1.00 20.39 ? 567  THR A C   1 
ATOM   3498 O  O   . THR A 1 460 ? 46.873 33.782  41.447  1.00 18.55 ? 567  THR A O   1 
ATOM   3499 C  CB  . THR A 1 460 ? 48.549 33.282  38.969  1.00 22.00 ? 567  THR A CB  1 
ATOM   3500 O  OG1 . THR A 1 460 ? 49.753 32.837  38.335  1.00 28.44 ? 567  THR A OG1 1 
ATOM   3501 C  CG2 . THR A 1 460 ? 47.786 34.138  37.997  1.00 21.05 ? 567  THR A CG2 1 
ATOM   3502 N  N   . LEU A 1 461 ? 47.435 35.877  40.915  1.00 20.52 ? 568  LEU A N   1 
ATOM   3503 C  CA  . LEU A 1 461 ? 46.205 36.451  41.445  1.00 20.83 ? 568  LEU A CA  1 
ATOM   3504 C  C   . LEU A 1 461 ? 45.241 36.677  40.286  1.00 21.65 ? 568  LEU A C   1 
ATOM   3505 O  O   . LEU A 1 461 ? 45.569 37.375  39.329  1.00 21.83 ? 568  LEU A O   1 
ATOM   3506 C  CB  . LEU A 1 461 ? 46.482 37.768  42.189  1.00 16.82 ? 568  LEU A CB  1 
ATOM   3507 C  CG  . LEU A 1 461 ? 45.281 38.484  42.815  1.00 21.28 ? 568  LEU A CG  1 
ATOM   3508 C  CD1 . LEU A 1 461 ? 44.640 37.602  43.881  1.00 19.63 ? 568  LEU A CD1 1 
ATOM   3509 C  CD2 . LEU A 1 461 ? 45.666 39.846  43.397  1.00 18.13 ? 568  LEU A CD2 1 
ATOM   3510 N  N   . VAL A 1 462 ? 44.066 36.063  40.365  1.00 18.24 ? 569  VAL A N   1 
ATOM   3511 C  CA  . VAL A 1 462 ? 43.046 36.226  39.334  1.00 17.44 ? 569  VAL A CA  1 
ATOM   3512 C  C   . VAL A 1 462 ? 41.809 36.935  39.896  1.00 18.06 ? 569  VAL A C   1 
ATOM   3513 O  O   . VAL A 1 462 ? 41.149 36.432  40.819  1.00 16.39 ? 569  VAL A O   1 
ATOM   3514 C  CB  . VAL A 1 462 ? 42.627 34.866  38.734  1.00 20.53 ? 569  VAL A CB  1 
ATOM   3515 C  CG1 . VAL A 1 462 ? 41.654 35.072  37.595  1.00 16.86 ? 569  VAL A CG1 1 
ATOM   3516 C  CG2 . VAL A 1 462 ? 43.852 34.061  38.264  1.00 17.00 ? 569  VAL A CG2 1 
ATOM   3517 N  N   . LEU A 1 463 ? 41.505 38.102  39.332  1.00 15.32 ? 570  LEU A N   1 
ATOM   3518 C  CA  . LEU A 1 463 ? 40.352 38.895  39.731  1.00 15.27 ? 570  LEU A CA  1 
ATOM   3519 C  C   . LEU A 1 463 ? 39.241 38.832  38.693  1.00 16.18 ? 570  LEU A C   1 
ATOM   3520 O  O   . LEU A 1 463 ? 39.497 38.972  37.502  1.00 16.28 ? 570  LEU A O   1 
ATOM   3521 C  CB  . LEU A 1 463 ? 40.748 40.361  39.949  1.00 19.39 ? 570  LEU A CB  1 
ATOM   3522 C  CG  . LEU A 1 463 ? 41.935 40.616  40.874  1.00 16.74 ? 570  LEU A CG  1 
ATOM   3523 C  CD1 . LEU A 1 463 ? 42.306 42.104  40.896  1.00 17.83 ? 570  LEU A CD1 1 
ATOM   3524 C  CD2 . LEU A 1 463 ? 41.615 40.116  42.255  1.00 15.26 ? 570  LEU A CD2 1 
ATOM   3525 N  N   . TYR A 1 464 ? 38.011 38.637  39.161  1.00 13.55 ? 571  TYR A N   1 
ATOM   3526 C  CA  . TYR A 1 464 ? 36.827 38.675  38.304  1.00 15.55 ? 571  TYR A CA  1 
ATOM   3527 C  C   . TYR A 1 464 ? 35.932 39.815  38.742  1.00 16.45 ? 571  TYR A C   1 
ATOM   3528 O  O   . TYR A 1 464 ? 35.826 40.107  39.932  1.00 16.65 ? 571  TYR A O   1 
ATOM   3529 C  CB  . TYR A 1 464 ? 36.037 37.365  38.366  1.00 12.93 ? 571  TYR A CB  1 
ATOM   3530 C  CG  . TYR A 1 464 ? 36.803 36.163  37.883  1.00 14.89 ? 571  TYR A CG  1 
ATOM   3531 C  CD1 . TYR A 1 464 ? 37.636 35.470  38.744  1.00 15.43 ? 571  TYR A CD1 1 
ATOM   3532 C  CD2 . TYR A 1 464 ? 36.697 35.722  36.573  1.00 14.60 ? 571  TYR A CD2 1 
ATOM   3533 C  CE1 . TYR A 1 464 ? 38.338 34.369  38.323  1.00 17.76 ? 571  TYR A CE1 1 
ATOM   3534 C  CE2 . TYR A 1 464 ? 37.404 34.610  36.137  1.00 17.86 ? 571  TYR A CE2 1 
ATOM   3535 C  CZ  . TYR A 1 464 ? 38.225 33.944  37.026  1.00 18.39 ? 571  TYR A CZ  1 
ATOM   3536 O  OH  . TYR A 1 464 ? 38.951 32.851  36.631  1.00 27.77 ? 571  TYR A OH  1 
ATOM   3537 N  N   . GLY A 1 465 ? 35.285 40.464  37.784  1.00 16.54 ? 572  GLY A N   1 
ATOM   3538 C  CA  . GLY A 1 465 ? 34.327 41.488  38.137  1.00 15.68 ? 572  GLY A CA  1 
ATOM   3539 C  C   . GLY A 1 465 ? 33.970 42.438  37.012  1.00 13.53 ? 572  GLY A C   1 
ATOM   3540 O  O   . GLY A 1 465 ? 34.012 42.082  35.840  1.00 15.43 ? 572  GLY A O   1 
ATOM   3541 N  N   . THR A 1 466 ? 33.595 43.652  37.397  1.00 16.77 ? 573  THR A N   1 
ATOM   3542 C  CA  . THR A 1 466 ? 33.121 44.670  36.469  1.00 14.65 ? 573  THR A CA  1 
ATOM   3543 C  C   . THR A 1 466 ? 33.735 46.024  36.831  1.00 17.55 ? 573  THR A C   1 
ATOM   3544 O  O   . THR A 1 466 ? 34.390 46.155  37.862  1.00 16.21 ? 573  THR A O   1 
ATOM   3545 C  CB  . THR A 1 466 ? 31.576 44.786  36.487  1.00 15.45 ? 573  THR A CB  1 
ATOM   3546 O  OG1 . THR A 1 466 ? 31.148 45.207  37.788  1.00 16.53 ? 573  THR A OG1 1 
ATOM   3547 C  CG2 . THR A 1 466 ? 30.914 43.439  36.152  1.00 18.02 ? 573  THR A CG2 1 
ATOM   3548 N  N   . ALA A 1 467 ? 33.519 47.023  35.975  1.00 16.82 ? 574  ALA A N   1 
ATOM   3549 C  CA  . ALA A 1 467 ? 33.903 48.394  36.276  1.00 17.64 ? 574  ALA A CA  1 
ATOM   3550 C  C   . ALA A 1 467 ? 32.651 49.212  36.562  1.00 21.74 ? 574  ALA A C   1 
ATOM   3551 O  O   . ALA A 1 467 ? 31.701 49.206  35.783  1.00 27.22 ? 574  ALA A O   1 
ATOM   3552 C  CB  . ALA A 1 467 ? 34.695 49.004  35.126  1.00 21.09 ? 574  ALA A CB  1 
ATOM   3553 N  N   . SER A 1 468 ? 32.636 49.909  37.686  1.00 24.68 ? 575  SER A N   1 
ATOM   3554 C  CA  . SER A 1 468 ? 31.435 50.626  38.068  1.00 22.76 ? 575  SER A CA  1 
ATOM   3555 C  C   . SER A 1 468 ? 31.764 51.812  38.963  1.00 22.76 ? 575  SER A C   1 
ATOM   3556 O  O   . SER A 1 468 ? 32.915 52.251  39.040  1.00 23.32 ? 575  SER A O   1 
ATOM   3557 C  CB  . SER A 1 468 ? 30.461 49.672  38.760  1.00 24.84 ? 575  SER A CB  1 
ATOM   3558 O  OG  . SER A 1 468 ? 29.171 50.242  38.871  1.00 33.67 ? 575  SER A OG  1 
ATOM   3559 N  N   . GLY A 1 469 ? 30.746 52.335  39.631  1.00 24.33 ? 576  GLY A N   1 
ATOM   3560 C  CA  . GLY A 1 469 ? 30.926 53.492  40.488  1.00 27.44 ? 576  GLY A CA  1 
ATOM   3561 C  C   . GLY A 1 469 ? 31.480 53.174  41.859  1.00 27.42 ? 576  GLY A C   1 
ATOM   3562 O  O   . GLY A 1 469 ? 31.770 52.025  42.186  1.00 25.57 ? 576  GLY A O   1 
ATOM   3563 N  N   . SER A 1 470 ? 31.618 54.209  42.674  1.00 27.54 ? 577  SER A N   1 
ATOM   3564 C  CA  . SER A 1 470 ? 32.123 54.042  44.033  1.00 28.31 ? 577  SER A CA  1 
ATOM   3565 C  C   . SER A 1 470 ? 30.997 53.683  44.995  1.00 28.53 ? 577  SER A C   1 
ATOM   3566 O  O   . SER A 1 470 ? 29.909 54.248  44.916  1.00 30.42 ? 577  SER A O   1 
ATOM   3567 C  CB  . SER A 1 470 ? 32.826 55.326  44.491  1.00 23.47 ? 577  SER A CB  1 
ATOM   3568 O  OG  . SER A 1 470 ? 33.917 55.628  43.631  1.00 29.12 ? 577  SER A OG  1 
ATOM   3569 N  N   . LEU A 1 471 ? 31.260 52.749  45.907  1.00 31.84 ? 578  LEU A N   1 
ATOM   3570 C  CA  . LEU A 1 471 ? 30.301 52.401  46.964  1.00 41.46 ? 578  LEU A CA  1 
ATOM   3571 C  C   . LEU A 1 471 ? 30.593 53.124  48.281  1.00 40.28 ? 578  LEU A C   1 
ATOM   3572 O  O   . LEU A 1 471 ? 31.714 53.588  48.514  1.00 49.43 ? 578  LEU A O   1 
ATOM   3573 C  CB  . LEU A 1 471 ? 30.295 50.891  47.204  1.00 41.28 ? 578  LEU A CB  1 
ATOM   3574 C  CG  . LEU A 1 471 ? 29.685 50.002  46.121  1.00 39.97 ? 578  LEU A CG  1 
ATOM   3575 C  CD1 . LEU A 1 471 ? 29.811 48.532  46.530  1.00 30.38 ? 578  LEU A CD1 1 
ATOM   3576 C  CD2 . LEU A 1 471 ? 28.224 50.375  45.856  1.00 34.68 ? 578  LEU A CD2 1 
ATOM   3577 N  N   . ASP B 1 1   ? -2.586 -15.764 -0.436  1.00 23.67 ? 108  ASP B N   1 
ATOM   3578 C  CA  . ASP B 1 1   ? -2.557 -14.310 -0.400  1.00 23.48 ? 108  ASP B CA  1 
ATOM   3579 C  C   . ASP B 1 1   ? -1.651 -13.759 -1.481  1.00 26.13 ? 108  ASP B C   1 
ATOM   3580 O  O   . ASP B 1 1   ? -0.721 -14.424 -1.937  1.00 22.90 ? 108  ASP B O   1 
ATOM   3581 C  CB  . ASP B 1 1   ? -2.119 -13.788 0.961   1.00 24.23 ? 108  ASP B CB  1 
ATOM   3582 C  CG  . ASP B 1 1   ? -3.185 -13.934 2.026   1.00 28.31 ? 108  ASP B CG  1 
ATOM   3583 O  OD1 . ASP B 1 1   ? -4.067 -14.808 1.937   1.00 24.64 ? 108  ASP B OD1 1 
ATOM   3584 O  OD2 . ASP B 1 1   ? -3.115 -13.116 2.970   1.00 25.54 ? 108  ASP B OD2 1 
ATOM   3585 N  N   . VAL B 1 2   ? -1.949 -12.536 -1.897  1.00 19.12 ? 109  VAL B N   1 
ATOM   3586 C  CA  . VAL B 1 2   ? -1.206 -11.858 -2.939  1.00 17.97 ? 109  VAL B CA  1 
ATOM   3587 C  C   . VAL B 1 2   ? -0.688 -10.547 -2.360  1.00 19.08 ? 109  VAL B C   1 
ATOM   3588 O  O   . VAL B 1 2   ? -1.471 -9.741  -1.880  1.00 18.93 ? 109  VAL B O   1 
ATOM   3589 C  CB  . VAL B 1 2   ? -2.096 -11.579 -4.182  1.00 20.00 ? 109  VAL B CB  1 
ATOM   3590 C  CG1 . VAL B 1 2   ? -1.351 -10.697 -5.193  1.00 17.24 ? 109  VAL B CG1 1 
ATOM   3591 C  CG2 . VAL B 1 2   ? -2.567 -12.895 -4.817  1.00 21.17 ? 109  VAL B CG2 1 
ATOM   3592 N  N   . TYR B 1 3   ? 0.621  -10.344 -2.388  1.00 13.13 ? 110  TYR B N   1 
ATOM   3593 C  CA  . TYR B 1 3   ? 1.209  -9.106  -1.904  1.00 14.62 ? 110  TYR B CA  1 
ATOM   3594 C  C   . TYR B 1 3   ? 1.185  -8.025  -2.991  1.00 16.72 ? 110  TYR B C   1 
ATOM   3595 O  O   . TYR B 1 3   ? 1.519  -8.296  -4.141  1.00 16.18 ? 110  TYR B O   1 
ATOM   3596 C  CB  . TYR B 1 3   ? 2.644  -9.357  -1.436  1.00 15.38 ? 110  TYR B CB  1 
ATOM   3597 C  CG  . TYR B 1 3   ? 3.440  -8.106  -1.188  1.00 14.57 ? 110  TYR B CG  1 
ATOM   3598 C  CD1 . TYR B 1 3   ? 3.239  -7.352  -0.031  1.00 13.80 ? 110  TYR B CD1 1 
ATOM   3599 C  CD2 . TYR B 1 3   ? 4.400  -7.679  -2.099  1.00 12.63 ? 110  TYR B CD2 1 
ATOM   3600 C  CE1 . TYR B 1 3   ? 3.967  -6.205  0.212   1.00 15.57 ? 110  TYR B CE1 1 
ATOM   3601 C  CE2 . TYR B 1 3   ? 5.135  -6.516  -1.871  1.00 12.76 ? 110  TYR B CE2 1 
ATOM   3602 C  CZ  . TYR B 1 3   ? 4.911  -5.787  -0.718  1.00 13.81 ? 110  TYR B CZ  1 
ATOM   3603 O  OH  . TYR B 1 3   ? 5.621  -4.643  -0.482  1.00 13.46 ? 110  TYR B OH  1 
ATOM   3604 N  N   A GLN B 1 4   ? 0.775  -6.813  -2.622  0.50 14.20 ? 111  GLN B N   1 
ATOM   3605 N  N   B GLN B 1 4   ? 0.794  -6.809  -2.630  0.50 14.16 ? 111  GLN B N   1 
ATOM   3606 C  CA  A GLN B 1 4   ? 0.828  -5.668  -3.532  0.50 16.47 ? 111  GLN B CA  1 
ATOM   3607 C  CA  B GLN B 1 4   ? 0.838  -5.705  -3.581  0.50 16.47 ? 111  GLN B CA  1 
ATOM   3608 C  C   A GLN B 1 4   ? 2.077  -4.842  -3.247  0.50 16.47 ? 111  GLN B C   1 
ATOM   3609 C  C   B GLN B 1 4   ? 2.039  -4.815  -3.273  0.50 16.48 ? 111  GLN B C   1 
ATOM   3610 O  O   A GLN B 1 4   ? 2.285  -4.409  -2.120  0.50 16.38 ? 111  GLN B O   1 
ATOM   3611 O  O   B GLN B 1 4   ? 2.182  -4.329  -2.157  0.50 16.36 ? 111  GLN B O   1 
ATOM   3612 C  CB  A GLN B 1 4   ? -0.420 -4.778  -3.395  0.50 16.01 ? 111  GLN B CB  1 
ATOM   3613 C  CB  B GLN B 1 4   ? -0.464 -4.892  -3.542  0.50 16.18 ? 111  GLN B CB  1 
ATOM   3614 C  CG  A GLN B 1 4   ? -1.721 -5.372  -3.946  0.50 19.24 ? 111  GLN B CG  1 
ATOM   3615 C  CG  B GLN B 1 4   ? -1.737 -5.716  -3.815  0.50 18.86 ? 111  GLN B CG  1 
ATOM   3616 C  CD  A GLN B 1 4   ? -2.873 -4.360  -3.955  0.50 19.45 ? 111  GLN B CD  1 
ATOM   3617 C  CD  B GLN B 1 4   ? -1.905 -6.104  -5.279  0.50 20.47 ? 111  GLN B CD  1 
ATOM   3618 O  OE1 A GLN B 1 4   ? -3.122 -3.669  -2.966  0.50 30.03 ? 111  GLN B OE1 1 
ATOM   3619 O  OE1 B GLN B 1 4   ? -1.289 -5.509  -6.163  0.50 30.03 ? 111  GLN B OE1 1 
ATOM   3620 N  NE2 A GLN B 1 4   ? -3.567 -4.266  -5.088  0.50 17.68 ? 111  GLN B NE2 1 
ATOM   3621 N  NE2 B GLN B 1 4   ? -2.744 -7.115  -5.541  0.50 19.77 ? 111  GLN B NE2 1 
ATOM   3622 N  N   . GLU B 1 5   ? 2.903  -4.613  -4.262  1.00 17.81 ? 112  GLU B N   1 
ATOM   3623 C  CA  . GLU B 1 5   ? 4.100  -3.802  -4.075  1.00 14.99 ? 112  GLU B CA  1 
ATOM   3624 C  C   . GLU B 1 5   ? 3.730  -2.334  -3.818  1.00 18.47 ? 112  GLU B C   1 
ATOM   3625 O  O   . GLU B 1 5   ? 2.620  -1.921  -4.127  1.00 13.64 ? 112  GLU B O   1 
ATOM   3626 C  CB  . GLU B 1 5   ? 5.023  -3.922  -5.286  1.00 18.29 ? 112  GLU B CB  1 
ATOM   3627 C  CG  . GLU B 1 5   ? 4.433  -3.415  -6.577  1.00 26.39 ? 112  GLU B CG  1 
ATOM   3628 C  CD  . GLU B 1 5   ? 5.378  -3.623  -7.755  1.00 34.15 ? 112  GLU B CD  1 
ATOM   3629 O  OE1 . GLU B 1 5   ? 5.153  -3.001  -8.811  1.00 28.15 ? 112  GLU B OE1 1 
ATOM   3630 O  OE2 . GLU B 1 5   ? 6.348  -4.403  -7.617  1.00 25.74 ? 112  GLU B OE2 1 
ATOM   3631 N  N   . PRO B 1 6   ? 4.663  -1.553  -3.236  1.00 15.83 ? 113  PRO B N   1 
ATOM   3632 C  CA  . PRO B 1 6   ? 4.366  -0.156  -2.913  1.00 12.00 ? 113  PRO B CA  1 
ATOM   3633 C  C   . PRO B 1 6   ? 3.904  0.653   -4.114  1.00 15.69 ? 113  PRO B C   1 
ATOM   3634 O  O   . PRO B 1 6   ? 4.327  0.395   -5.244  1.00 11.87 ? 113  PRO B O   1 
ATOM   3635 C  CB  . PRO B 1 6   ? 5.708  0.379   -2.405  1.00 13.37 ? 113  PRO B CB  1 
ATOM   3636 C  CG  . PRO B 1 6   ? 6.364  -0.819  -1.805  1.00 14.02 ? 113  PRO B CG  1 
ATOM   3637 C  CD  . PRO B 1 6   ? 6.005  -1.942  -2.761  1.00 14.34 ? 113  PRO B CD  1 
ATOM   3638 N  N   . THR B 1 7   ? 3.050  1.634   -3.841  1.00 12.56 ? 114  THR B N   1 
ATOM   3639 C  CA  . THR B 1 7   ? 2.469  2.486   -4.864  1.00 15.98 ? 114  THR B CA  1 
ATOM   3640 C  C   . THR B 1 7   ? 3.206  3.825   -5.008  1.00 13.76 ? 114  THR B C   1 
ATOM   3641 O  O   . THR B 1 7   ? 2.787  4.670   -5.794  1.00 12.89 ? 114  THR B O   1 
ATOM   3642 C  CB  . THR B 1 7   ? 0.989  2.812   -4.546  1.00 11.83 ? 114  THR B CB  1 
ATOM   3643 O  OG1 . THR B 1 7   ? 0.932  3.541   -3.316  1.00 15.54 ? 114  THR B OG1 1 
ATOM   3644 C  CG2 . THR B 1 7   ? 0.140  1.546   -4.412  1.00 17.25 ? 114  THR B CG2 1 
ATOM   3645 N  N   . ASP B 1 8   ? 4.259  4.047   -4.219  1.00 12.62 ? 115  ASP B N   1 
ATOM   3646 C  CA  . ASP B 1 8   ? 4.865  5.384   -4.146  1.00 11.81 ? 115  ASP B CA  1 
ATOM   3647 C  C   . ASP B 1 8   ? 5.356  5.867   -5.507  1.00 12.27 ? 115  ASP B C   1 
ATOM   3648 O  O   . ASP B 1 8   ? 5.860  5.085   -6.298  1.00 14.84 ? 115  ASP B O   1 
ATOM   3649 C  CB  . ASP B 1 8   ? 6.004  5.396   -3.123  1.00 10.00 ? 115  ASP B CB  1 
ATOM   3650 C  CG  . ASP B 1 8   ? 5.554  4.875   -1.782  1.00 12.67 ? 115  ASP B CG  1 
ATOM   3651 O  OD1 . ASP B 1 8   ? 5.061  3.728   -1.733  1.00 11.62 ? 115  ASP B OD1 1 
ATOM   3652 O  OD2 . ASP B 1 8   ? 5.632  5.630   -0.795  1.00 13.86 ? 115  ASP B OD2 1 
ATOM   3653 N  N   . PRO B 1 9   ? 5.216  7.172   -5.770  1.00 14.70 ? 116  PRO B N   1 
ATOM   3654 C  CA  . PRO B 1 9   ? 5.478  7.714   -7.110  1.00 14.92 ? 116  PRO B CA  1 
ATOM   3655 C  C   . PRO B 1 9   ? 6.892  7.465   -7.622  1.00 15.45 ? 116  PRO B C   1 
ATOM   3656 O  O   . PRO B 1 9   ? 7.062  7.291   -8.829  1.00 13.70 ? 116  PRO B O   1 
ATOM   3657 C  CB  . PRO B 1 9   ? 5.209  9.218   -6.942  1.00 15.93 ? 116  PRO B CB  1 
ATOM   3658 C  CG  . PRO B 1 9   ? 5.219  9.468   -5.474  1.00 16.00 ? 116  PRO B CG  1 
ATOM   3659 C  CD  . PRO B 1 9   ? 4.721  8.205   -4.845  1.00 13.44 ? 116  PRO B CD  1 
ATOM   3660 N  N   . LYS B 1 10  ? 7.881  7.408   -6.733  1.00 14.74 ? 117  LYS B N   1 
ATOM   3661 C  CA  . LYS B 1 10  ? 9.247  7.151   -7.163  1.00 13.91 ? 117  LYS B CA  1 
ATOM   3662 C  C   . LYS B 1 10  ? 9.693  5.706   -7.025  1.00 16.09 ? 117  LYS B C   1 
ATOM   3663 O  O   . LYS B 1 10  ? 10.833 5.387   -7.383  1.00 16.77 ? 117  LYS B O   1 
ATOM   3664 C  CB  . LYS B 1 10  ? 10.216 8.036   -6.384  1.00 15.67 ? 117  LYS B CB  1 
ATOM   3665 C  CG  . LYS B 1 10  ? 10.022 9.511   -6.638  1.00 14.10 ? 117  LYS B CG  1 
ATOM   3666 C  CD  . LYS B 1 10  ? 10.229 9.809   -8.104  1.00 23.89 ? 117  LYS B CD  1 
ATOM   3667 C  CE  . LYS B 1 10  ? 9.994  11.281  -8.392  1.00 35.34 ? 117  LYS B CE  1 
ATOM   3668 N  NZ  . LYS B 1 10  ? 10.511 11.632  -9.740  1.00 42.76 ? 117  LYS B NZ  1 
ATOM   3669 N  N   . PHE B 1 11  ? 8.830  4.832   -6.508  1.00 12.71 ? 118  PHE B N   1 
ATOM   3670 C  CA  . PHE B 1 11  ? 9.200  3.421   -6.421  1.00 13.70 ? 118  PHE B CA  1 
ATOM   3671 C  C   . PHE B 1 11  ? 9.641  2.848   -7.771  1.00 16.92 ? 118  PHE B C   1 
ATOM   3672 O  O   . PHE B 1 11  ? 10.617 2.111   -7.808  1.00 12.82 ? 118  PHE B O   1 
ATOM   3673 C  CB  . PHE B 1 11  ? 8.069  2.568   -5.843  1.00 13.13 ? 118  PHE B CB  1 
ATOM   3674 C  CG  . PHE B 1 11  ? 8.403  1.099   -5.763  1.00 14.35 ? 118  PHE B CG  1 
ATOM   3675 C  CD1 . PHE B 1 11  ? 9.392  0.637   -4.888  1.00 14.89 ? 118  PHE B CD1 1 
ATOM   3676 C  CD2 . PHE B 1 11  ? 7.733  0.183   -6.554  1.00 19.19 ? 118  PHE B CD2 1 
ATOM   3677 C  CE1 . PHE B 1 11  ? 9.703  -0.718  -4.814  1.00 15.20 ? 118  PHE B CE1 1 
ATOM   3678 C  CE2 . PHE B 1 11  ? 8.036  -1.175  -6.498  1.00 18.84 ? 118  PHE B CE2 1 
ATOM   3679 C  CZ  . PHE B 1 11  ? 9.025  -1.628  -5.623  1.00 19.24 ? 118  PHE B CZ  1 
ATOM   3680 N  N   . PRO B 1 12  ? 8.945  3.192   -8.884  1.00 16.30 ? 119  PRO B N   1 
ATOM   3681 C  CA  . PRO B 1 12  ? 9.474  2.589   -10.111 1.00 14.77 ? 119  PRO B CA  1 
ATOM   3682 C  C   . PRO B 1 12  ? 10.896 3.054   -10.447 1.00 18.95 ? 119  PRO B C   1 
ATOM   3683 O  O   . PRO B 1 12  ? 11.584 2.353   -11.179 1.00 23.83 ? 119  PRO B O   1 
ATOM   3684 C  CB  . PRO B 1 12  ? 8.489  3.044   -11.194 1.00 16.46 ? 119  PRO B CB  1 
ATOM   3685 C  CG  . PRO B 1 12  ? 7.192  3.345   -10.448 1.00 20.05 ? 119  PRO B CG  1 
ATOM   3686 C  CD  . PRO B 1 12  ? 7.641  3.858   -9.102  1.00 18.83 ? 119  PRO B CD  1 
ATOM   3687 N  N   . GLN B 1 13  ? 11.332 4.190   -9.913  1.00 14.56 ? 120  GLN B N   1 
ATOM   3688 C  CA  . GLN B 1 13  ? 12.705 4.642   -10.126 1.00 14.07 ? 120  GLN B CA  1 
ATOM   3689 C  C   . GLN B 1 13  ? 13.705 3.951   -9.178  1.00 15.04 ? 120  GLN B C   1 
ATOM   3690 O  O   . GLN B 1 13  ? 14.910 4.148   -9.293  1.00 17.36 ? 120  GLN B O   1 
ATOM   3691 C  CB  . GLN B 1 13  ? 12.801 6.157   -9.954  1.00 18.16 ? 120  GLN B CB  1 
ATOM   3692 C  CG  . GLN B 1 13  ? 12.309 6.978   -11.137 1.00 28.16 ? 120  GLN B CG  1 
ATOM   3693 C  CD  . GLN B 1 13  ? 10.871 6.705   -11.479 1.00 32.14 ? 120  GLN B CD  1 
ATOM   3694 O  OE1 . GLN B 1 13  ? 9.959  6.963   -10.684 1.00 27.85 ? 120  GLN B OE1 1 
ATOM   3695 N  NE2 . GLN B 1 13  ? 10.652 6.161   -12.667 1.00 29.90 ? 120  GLN B NE2 1 
ATOM   3696 N  N   . GLN B 1 14  ? 13.209 3.133   -8.251  1.00 17.09 ? 121  GLN B N   1 
ATOM   3697 C  CA  . GLN B 1 14  ? 14.085 2.449   -7.305  1.00 12.88 ? 121  GLN B CA  1 
ATOM   3698 C  C   . GLN B 1 14  ? 14.485 1.085   -7.867  1.00 15.16 ? 121  GLN B C   1 
ATOM   3699 O  O   . GLN B 1 14  ? 14.116 0.034   -7.350  1.00 14.25 ? 121  GLN B O   1 
ATOM   3700 C  CB  . GLN B 1 14  ? 13.420 2.345   -5.929  1.00 15.05 ? 121  GLN B CB  1 
ATOM   3701 C  CG  . GLN B 1 14  ? 13.311 3.738   -5.255  1.00 12.17 ? 121  GLN B CG  1 
ATOM   3702 C  CD  . GLN B 1 14  ? 12.683 3.699   -3.875  1.00 14.26 ? 121  GLN B CD  1 
ATOM   3703 O  OE1 . GLN B 1 14  ? 11.515 3.373   -3.723  1.00 12.71 ? 121  GLN B OE1 1 
ATOM   3704 N  NE2 . GLN B 1 14  ? 13.459 4.053   -2.863  1.00 16.02 ? 121  GLN B NE2 1 
ATOM   3705 N  N   . TRP B 1 15  ? 15.275 1.152   -8.938  1.00 13.38 ? 122  TRP B N   1 
ATOM   3706 C  CA  . TRP B 1 15  ? 15.744 -0.002  -9.696  1.00 13.23 ? 122  TRP B CA  1 
ATOM   3707 C  C   . TRP B 1 15  ? 16.463 -1.059  -8.841  1.00 13.11 ? 122  TRP B C   1 
ATOM   3708 O  O   . TRP B 1 15  ? 16.432 -2.251  -9.142  1.00 16.52 ? 122  TRP B O   1 
ATOM   3709 C  CB  . TRP B 1 15  ? 16.667 0.484   -10.819 1.00 13.18 ? 122  TRP B CB  1 
ATOM   3710 C  CG  . TRP B 1 15  ? 17.818 1.302   -10.321 1.00 11.38 ? 122  TRP B CG  1 
ATOM   3711 C  CD1 . TRP B 1 15  ? 17.828 2.647   -10.070 1.00 13.03 ? 122  TRP B CD1 1 
ATOM   3712 C  CD2 . TRP B 1 15  ? 19.129 0.822   -9.996  1.00 11.31 ? 122  TRP B CD2 1 
ATOM   3713 N  NE1 . TRP B 1 15  ? 19.058 3.026   -9.604  1.00 14.24 ? 122  TRP B NE1 1 
ATOM   3714 C  CE2 . TRP B 1 15  ? 19.878 1.928   -9.559  1.00 11.70 ? 122  TRP B CE2 1 
ATOM   3715 C  CE3 . TRP B 1 15  ? 19.738 -0.443  -10.034 1.00 16.17 ? 122  TRP B CE3 1 
ATOM   3716 C  CZ2 . TRP B 1 15  ? 21.217 1.815   -9.158  1.00 13.28 ? 122  TRP B CZ2 1 
ATOM   3717 C  CZ3 . TRP B 1 15  ? 21.071 -0.556  -9.631  1.00 14.11 ? 122  TRP B CZ3 1 
ATOM   3718 C  CH2 . TRP B 1 15  ? 21.794 0.568   -9.207  1.00 13.94 ? 122  TRP B CH2 1 
ATOM   3719 N  N   . TYR B 1 16  ? 17.098 -0.614  -7.770  1.00 10.89 ? 123  TYR B N   1 
ATOM   3720 C  CA  . TYR B 1 16  ? 17.921 -1.486  -6.934  1.00 14.79 ? 123  TYR B CA  1 
ATOM   3721 C  C   . TYR B 1 16  ? 17.061 -2.316  -5.987  1.00 17.02 ? 123  TYR B C   1 
ATOM   3722 O  O   . TYR B 1 16  ? 17.517 -3.327  -5.466  1.00 17.48 ? 123  TYR B O   1 
ATOM   3723 C  CB  . TYR B 1 16  ? 18.946 -0.654  -6.140  1.00 12.18 ? 123  TYR B CB  1 
ATOM   3724 C  CG  . TYR B 1 16  ? 18.323 0.607   -5.596  1.00 14.18 ? 123  TYR B CG  1 
ATOM   3725 C  CD1 . TYR B 1 16  ? 18.233 1.755   -6.386  1.00 12.40 ? 123  TYR B CD1 1 
ATOM   3726 C  CD2 . TYR B 1 16  ? 17.780 0.642   -4.324  1.00 11.50 ? 123  TYR B CD2 1 
ATOM   3727 C  CE1 . TYR B 1 16  ? 17.625 2.900   -5.920  1.00 13.82 ? 123  TYR B CE1 1 
ATOM   3728 C  CE2 . TYR B 1 16  ? 17.173 1.802   -3.841  1.00 12.18 ? 123  TYR B CE2 1 
ATOM   3729 C  CZ  . TYR B 1 16  ? 17.096 2.920   -4.651  1.00 12.69 ? 123  TYR B CZ  1 
ATOM   3730 O  OH  . TYR B 1 16  ? 16.505 4.078   -4.197  1.00 13.39 ? 123  TYR B OH  1 
ATOM   3731 N  N   . LEU B 1 17  ? 15.826 -1.877  -5.751  1.00 16.64 ? 124  LEU B N   1 
ATOM   3732 C  CA  . LEU B 1 17  ? 14.917 -2.610  -4.866  1.00 17.09 ? 124  LEU B CA  1 
ATOM   3733 C  C   . LEU B 1 17  ? 14.234 -3.714  -5.630  1.00 26.20 ? 124  LEU B C   1 
ATOM   3734 O  O   . LEU B 1 17  ? 14.310 -4.895  -5.261  1.00 23.95 ? 124  LEU B O   1 
ATOM   3735 C  CB  . LEU B 1 17  ? 13.858 -1.688  -4.261  1.00 14.06 ? 124  LEU B CB  1 
ATOM   3736 C  CG  . LEU B 1 17  ? 14.401 -0.599  -3.335  1.00 16.77 ? 124  LEU B CG  1 
ATOM   3737 C  CD1 . LEU B 1 17  ? 13.277 0.186   -2.688  1.00 12.86 ? 124  LEU B CD1 1 
ATOM   3738 C  CD2 . LEU B 1 17  ? 15.267 -1.227  -2.289  1.00 13.98 ? 124  LEU B CD2 1 
ATOM   3739 N  N   . SER B 1 18  ? 13.548 -3.306  -6.691  1.00 22.72 ? 125  SER B N   1 
ATOM   3740 C  CA  . SER B 1 18  ? 12.844 -4.232  -7.548  1.00 30.02 ? 125  SER B CA  1 
ATOM   3741 C  C   . SER B 1 18  ? 13.024 -3.829  -9.008  1.00 28.09 ? 125  SER B C   1 
ATOM   3742 O  O   . SER B 1 18  ? 12.791 -2.692  -9.391  1.00 31.79 ? 125  SER B O   1 
ATOM   3743 C  CB  . SER B 1 18  ? 11.360 -4.277  -7.178  1.00 31.19 ? 125  SER B CB  1 
ATOM   3744 O  OG  . SER B 1 18  ? 10.725 -5.407  -7.755  1.00 37.43 ? 125  SER B OG  1 
ATOM   3745 N  N   . GLY B 1 19  ? 13.464 -4.783  -9.809  1.00 35.20 ? 126  GLY B N   1 
ATOM   3746 C  CA  . GLY B 1 19  ? 13.585 -4.601  -11.234 1.00 28.45 ? 126  GLY B CA  1 
ATOM   3747 C  C   . GLY B 1 19  ? 13.129 -5.917  -11.799 1.00 31.04 ? 126  GLY B C   1 
ATOM   3748 O  O   . GLY B 1 19  ? 12.741 -6.806  -11.052 1.00 36.54 ? 126  GLY B O   1 
ATOM   3749 N  N   . VAL B 1 20  ? 13.185 -6.059  -13.110 1.00 33.53 ? 127  VAL B N   1 
ATOM   3750 C  CA  . VAL B 1 20  ? 12.688 -7.268  -13.735 1.00 34.32 ? 127  VAL B CA  1 
ATOM   3751 C  C   . VAL B 1 20  ? 13.778 -7.947  -14.544 1.00 38.02 ? 127  VAL B C   1 
ATOM   3752 O  O   . VAL B 1 20  ? 13.493 -8.664  -15.507 1.00 38.07 ? 127  VAL B O   1 
ATOM   3753 C  CB  . VAL B 1 20  ? 11.465 -6.962  -14.632 1.00 39.18 ? 127  VAL B CB  1 
ATOM   3754 C  CG1 . VAL B 1 20  ? 10.220 -6.767  -13.772 1.00 36.06 ? 127  VAL B CG1 1 
ATOM   3755 C  CG2 . VAL B 1 20  ? 11.723 -5.729  -15.481 1.00 34.99 ? 127  VAL B CG2 1 
ATOM   3756 N  N   . THR B 1 21  ? 15.031 -7.724  -14.154 1.00 29.29 ? 128  THR B N   1 
ATOM   3757 C  CA  . THR B 1 21  ? 16.151 -8.340  -14.858 1.00 28.27 ? 128  THR B CA  1 
ATOM   3758 C  C   . THR B 1 21  ? 17.081 -9.091  -13.910 1.00 25.69 ? 128  THR B C   1 
ATOM   3759 O  O   . THR B 1 21  ? 18.251 -9.302  -14.230 1.00 28.13 ? 128  THR B O   1 
ATOM   3760 C  CB  . THR B 1 21  ? 16.982 -7.292  -15.647 1.00 26.20 ? 128  THR B CB  1 
ATOM   3761 O  OG1 . THR B 1 21  ? 17.270 -6.164  -14.813 1.00 35.48 ? 128  THR B OG1 1 
ATOM   3762 C  CG2 . THR B 1 21  ? 16.214 -6.817  -16.868 1.00 24.30 ? 128  THR B CG2 1 
ATOM   3763 N  N   . GLN B 1 22  ? 16.567 -9.475  -12.742 1.00 21.85 ? 129  GLN B N   1 
ATOM   3764 C  CA  . GLN B 1 22  ? 17.320 -10.303 -11.796 1.00 20.34 ? 129  GLN B CA  1 
ATOM   3765 C  C   . GLN B 1 22  ? 18.615 -9.632  -11.344 1.00 20.10 ? 129  GLN B C   1 
ATOM   3766 O  O   . GLN B 1 22  ? 19.571 -10.308 -10.965 1.00 23.18 ? 129  GLN B O   1 
ATOM   3767 C  CB  . GLN B 1 22  ? 17.626 -11.681 -12.415 1.00 24.27 ? 129  GLN B CB  1 
ATOM   3768 C  CG  . GLN B 1 22  ? 16.370 -12.435 -12.846 1.00 26.31 ? 129  GLN B CG  1 
ATOM   3769 C  CD  . GLN B 1 22  ? 16.647 -13.740 -13.592 1.00 28.80 ? 129  GLN B CD  1 
ATOM   3770 O  OE1 . GLN B 1 22  ? 17.785 -14.048 -13.969 1.00 26.03 ? 129  GLN B OE1 1 
ATOM   3771 N  NE2 . GLN B 1 22  ? 15.588 -14.518 -13.807 1.00 25.70 ? 129  GLN B NE2 1 
ATOM   3772 N  N   . ARG B 1 23  ? 18.632 -8.301  -11.389 1.00 20.11 ? 130  ARG B N   1 
ATOM   3773 C  CA  . ARG B 1 23  ? 19.807 -7.508  -11.030 1.00 17.03 ? 130  ARG B CA  1 
ATOM   3774 C  C   . ARG B 1 23  ? 19.415 -6.413  -10.045 1.00 17.46 ? 130  ARG B C   1 
ATOM   3775 O  O   . ARG B 1 23  ? 19.510 -5.216  -10.334 1.00 17.55 ? 130  ARG B O   1 
ATOM   3776 C  CB  . ARG B 1 23  ? 20.451 -6.923  -12.284 1.00 18.82 ? 130  ARG B CB  1 
ATOM   3777 C  CG  . ARG B 1 23  ? 21.246 -7.965  -13.074 1.00 19.83 ? 130  ARG B CG  1 
ATOM   3778 C  CD  . ARG B 1 23  ? 21.153 -7.763  -14.579 1.00 27.10 ? 130  ARG B CD  1 
ATOM   3779 N  NE  . ARG B 1 23  ? 22.066 -8.652  -15.293 1.00 22.86 ? 130  ARG B NE  1 
ATOM   3780 C  CZ  . ARG B 1 23  ? 21.774 -9.893  -15.679 1.00 22.99 ? 130  ARG B CZ  1 
ATOM   3781 N  NH1 . ARG B 1 23  ? 20.578 -10.428 -15.427 1.00 16.70 ? 130  ARG B NH1 1 
ATOM   3782 N  NH2 . ARG B 1 23  ? 22.688 -10.606 -16.323 1.00 19.12 ? 130  ARG B NH2 1 
ATOM   3783 N  N   . ASP B 1 24  ? 18.955 -6.863  -8.881  1.00 15.78 ? 131  ASP B N   1 
ATOM   3784 C  CA  . ASP B 1 24  ? 18.534 -5.996  -7.794  1.00 14.44 ? 131  ASP B CA  1 
ATOM   3785 C  C   . ASP B 1 24  ? 18.828 -6.666  -6.458  1.00 14.99 ? 131  ASP B C   1 
ATOM   3786 O  O   . ASP B 1 24  ? 19.434 -7.742  -6.409  1.00 13.70 ? 131  ASP B O   1 
ATOM   3787 C  CB  . ASP B 1 24  ? 17.041 -5.650  -7.922  1.00 17.43 ? 131  ASP B CB  1 
ATOM   3788 C  CG  . ASP B 1 24  ? 16.158 -6.881  -8.085  1.00 22.48 ? 131  ASP B CG  1 
ATOM   3789 O  OD1 . ASP B 1 24  ? 16.250 -7.818  -7.255  1.00 19.64 ? 131  ASP B OD1 1 
ATOM   3790 O  OD2 . ASP B 1 24  ? 15.361 -6.906  -9.053  1.00 23.56 ? 131  ASP B OD2 1 
ATOM   3791 N  N   . LEU B 1 25  ? 18.386 -6.035  -5.378  1.00 14.51 ? 132  LEU B N   1 
ATOM   3792 C  CA  . LEU B 1 25  ? 18.654 -6.532  -4.030  1.00 14.93 ? 132  LEU B CA  1 
ATOM   3793 C  C   . LEU B 1 25  ? 17.664 -7.613  -3.567  1.00 14.49 ? 132  LEU B C   1 
ATOM   3794 O  O   . LEU B 1 25  ? 17.759 -8.101  -2.441  1.00 13.30 ? 132  LEU B O   1 
ATOM   3795 C  CB  . LEU B 1 25  ? 18.647 -5.366  -3.047  1.00 11.62 ? 132  LEU B CB  1 
ATOM   3796 C  CG  . LEU B 1 25  ? 19.822 -4.386  -3.212  1.00 12.82 ? 132  LEU B CG  1 
ATOM   3797 C  CD1 . LEU B 1 25  ? 19.634 -3.169  -2.316  1.00 12.08 ? 132  LEU B CD1 1 
ATOM   3798 C  CD2 . LEU B 1 25  ? 21.144 -5.064  -2.893  1.00 11.72 ? 132  LEU B CD2 1 
ATOM   3799 N  N   . ASN B 1 26  ? 16.739 -7.983  -4.447  1.00 10.88 ? 133  ASN B N   1 
ATOM   3800 C  CA  . ASN B 1 26  ? 15.760 -9.040  -4.183  1.00 13.46 ? 133  ASN B CA  1 
ATOM   3801 C  C   . ASN B 1 26  ? 14.940 -8.757  -2.926  1.00 16.00 ? 133  ASN B C   1 
ATOM   3802 O  O   . ASN B 1 26  ? 14.665 -9.648  -2.128  1.00 14.49 ? 133  ASN B O   1 
ATOM   3803 C  CB  . ASN B 1 26  ? 16.442 -10.407 -4.062  1.00 15.48 ? 133  ASN B CB  1 
ATOM   3804 C  CG  . ASN B 1 26  ? 15.451 -11.555 -4.208  1.00 16.03 ? 133  ASN B CG  1 
ATOM   3805 O  OD1 . ASN B 1 26  ? 14.409 -11.387 -4.827  1.00 17.86 ? 133  ASN B OD1 1 
ATOM   3806 N  ND2 . ASN B 1 26  ? 15.758 -12.702 -3.621  1.00 15.93 ? 133  ASN B ND2 1 
ATOM   3807 N  N   . VAL B 1 27  ? 14.543 -7.502  -2.760  1.00 12.60 ? 134  VAL B N   1 
ATOM   3808 C  CA  . VAL B 1 27  ? 13.850 -7.084  -1.548  1.00 11.94 ? 134  VAL B CA  1 
ATOM   3809 C  C   . VAL B 1 27  ? 12.357 -7.427  -1.608  1.00 12.94 ? 134  VAL B C   1 
ATOM   3810 O  O   . VAL B 1 27  ? 11.740 -7.760  -0.596  1.00 12.28 ? 134  VAL B O   1 
ATOM   3811 C  CB  . VAL B 1 27  ? 14.061 -5.577  -1.325  1.00 14.80 ? 134  VAL B CB  1 
ATOM   3812 C  CG1 . VAL B 1 27  ? 13.251 -5.093  -0.165  1.00 17.82 ? 134  VAL B CG1 1 
ATOM   3813 C  CG2 . VAL B 1 27  ? 15.530 -5.320  -1.066  1.00 16.28 ? 134  VAL B CG2 1 
ATOM   3814 N  N   . LYS B 1 28  ? 11.787 -7.381  -2.806  1.00 13.09 ? 135  LYS B N   1 
ATOM   3815 C  CA  . LYS B 1 28  ? 10.357 -7.623  -2.957  1.00 16.07 ? 135  LYS B CA  1 
ATOM   3816 C  C   . LYS B 1 28  ? 10.006 -9.032  -2.484  1.00 16.53 ? 135  LYS B C   1 
ATOM   3817 O  O   . LYS B 1 28  ? 8.953  -9.241  -1.884  1.00 15.70 ? 135  LYS B O   1 
ATOM   3818 C  CB  . LYS B 1 28  ? 9.915  -7.390  -4.409  1.00 14.94 ? 135  LYS B CB  1 
ATOM   3819 C  CG  . LYS B 1 28  ? 8.395  -7.381  -4.589  1.00 28.93 ? 135  LYS B CG  1 
ATOM   3820 C  CD  . LYS B 1 28  ? 7.976  -7.171  -6.034  0.00 24.10 ? 135  LYS B CD  1 
ATOM   3821 C  CE  . LYS B 1 28  ? 6.465  -7.304  -6.180  0.00 24.38 ? 135  LYS B CE  1 
ATOM   3822 N  NZ  . LYS B 1 28  ? 6.022  -7.177  -7.596  0.00 26.54 ? 135  LYS B NZ  1 
ATOM   3823 N  N   . ALA B 1 29  ? 10.906 -9.989  -2.691  1.00 13.76 ? 136  ALA B N   1 
ATOM   3824 C  CA  . ALA B 1 29  ? 10.666 -11.343 -2.201  1.00 14.33 ? 136  ALA B CA  1 
ATOM   3825 C  C   . ALA B 1 29  ? 10.534 -11.411 -0.663  1.00 16.41 ? 136  ALA B C   1 
ATOM   3826 O  O   . ALA B 1 29  ? 9.743  -12.202 -0.133  1.00 13.85 ? 136  ALA B O   1 
ATOM   3827 C  CB  . ALA B 1 29  ? 11.772 -12.273 -2.677  1.00 14.67 ? 136  ALA B CB  1 
ATOM   3828 N  N   . ALA B 1 30  ? 11.313 -10.598 0.048   1.00 15.21 ? 137  ALA B N   1 
ATOM   3829 C  CA  . ALA B 1 30  ? 11.193 -10.508 1.506   1.00 11.06 ? 137  ALA B CA  1 
ATOM   3830 C  C   . ALA B 1 30  ? 9.879  -9.833  1.932   1.00 10.31 ? 137  ALA B C   1 
ATOM   3831 O  O   . ALA B 1 30  ? 9.143  -10.344 2.792   1.00 10.40 ? 137  ALA B O   1 
ATOM   3832 C  CB  . ALA B 1 30  ? 12.380 -9.766  2.085   1.00 13.11 ? 137  ALA B CB  1 
ATOM   3833 N  N   . TRP B 1 31  ? 9.596  -8.677  1.336   1.00 12.39 ? 138  TRP B N   1 
ATOM   3834 C  CA  . TRP B 1 31  ? 8.338  -7.975  1.581   1.00 11.37 ? 138  TRP B CA  1 
ATOM   3835 C  C   . TRP B 1 31  ? 7.119  -8.890  1.432   1.00 11.49 ? 138  TRP B C   1 
ATOM   3836 O  O   . TRP B 1 31  ? 6.222  -8.925  2.276   1.00 10.20 ? 138  TRP B O   1 
ATOM   3837 C  CB  . TRP B 1 31  ? 8.198  -6.820  0.602   1.00 10.71 ? 138  TRP B CB  1 
ATOM   3838 C  CG  . TRP B 1 31  ? 9.161  -5.691  0.797   1.00 10.21 ? 138  TRP B CG  1 
ATOM   3839 C  CD1 . TRP B 1 31  ? 9.938  -5.443  1.888   1.00 10.03 ? 138  TRP B CD1 1 
ATOM   3840 C  CD2 . TRP B 1 31  ? 9.419  -4.643  -0.138  1.00 8.29  ? 138  TRP B CD2 1 
ATOM   3841 N  NE1 . TRP B 1 31  ? 10.667 -4.285  1.693   1.00 12.13 ? 138  TRP B NE1 1 
ATOM   3842 C  CE2 . TRP B 1 31  ? 10.362 -3.775  0.460   1.00 11.57 ? 138  TRP B CE2 1 
ATOM   3843 C  CE3 . TRP B 1 31  ? 8.934  -4.348  -1.419  1.00 9.55  ? 138  TRP B CE3 1 
ATOM   3844 C  CZ2 . TRP B 1 31  ? 10.839 -2.630  -0.193  1.00 11.27 ? 138  TRP B CZ2 1 
ATOM   3845 C  CZ3 . TRP B 1 31  ? 9.403  -3.213  -2.065  1.00 9.93  ? 138  TRP B CZ3 1 
ATOM   3846 C  CH2 . TRP B 1 31  ? 10.353 -2.369  -1.454  1.00 10.89 ? 138  TRP B CH2 1 
ATOM   3847 N  N   . ALA B 1 32  ? 7.099  -9.625  0.327   1.00 11.24 ? 139  ALA B N   1 
ATOM   3848 C  CA  . ALA B 1 32  ? 5.945  -10.439 -0.027  1.00 14.51 ? 139  ALA B CA  1 
ATOM   3849 C  C   . ALA B 1 32  ? 5.723  -11.573 0.973   1.00 17.24 ? 139  ALA B C   1 
ATOM   3850 O  O   . ALA B 1 32  ? 4.612  -12.063 1.096   1.00 15.95 ? 139  ALA B O   1 
ATOM   3851 C  CB  . ALA B 1 32  ? 6.094  -10.988 -1.448  1.00 11.58 ? 139  ALA B CB  1 
ATOM   3852 N  N   . GLN B 1 33  ? 6.769  -11.979 1.693   1.00 15.22 ? 140  GLN B N   1 
ATOM   3853 C  CA  . GLN B 1 33  ? 6.617  -12.998 2.731   1.00 14.69 ? 140  GLN B CA  1 
ATOM   3854 C  C   . GLN B 1 33  ? 6.263  -12.387 4.082   1.00 16.18 ? 140  GLN B C   1 
ATOM   3855 O  O   . GLN B 1 33  ? 6.190  -13.083 5.084   1.00 15.75 ? 140  GLN B O   1 
ATOM   3856 C  CB  . GLN B 1 33  ? 7.887  -13.840 2.848   1.00 18.30 ? 140  GLN B CB  1 
ATOM   3857 C  CG  . GLN B 1 33  ? 8.155  -14.661 1.607   1.00 25.68 ? 140  GLN B CG  1 
ATOM   3858 C  CD  . GLN B 1 33  ? 6.964  -15.538 1.217   1.00 30.32 ? 140  GLN B CD  1 
ATOM   3859 O  OE1 . GLN B 1 33  ? 6.413  -15.412 0.120   1.00 38.02 ? 140  GLN B OE1 1 
ATOM   3860 N  NE2 . GLN B 1 33  ? 6.574  -16.434 2.110   1.00 33.64 ? 140  GLN B NE2 1 
ATOM   3861 N  N   . GLY B 1 34  ? 6.052  -11.075 4.097   1.00 17.43 ? 141  GLY B N   1 
ATOM   3862 C  CA  . GLY B 1 34  ? 5.630  -10.386 5.295   1.00 15.71 ? 141  GLY B CA  1 
ATOM   3863 C  C   . GLY B 1 34  ? 6.735  -9.656  6.050   1.00 16.83 ? 141  GLY B C   1 
ATOM   3864 O  O   . GLY B 1 34  ? 6.491  -9.124  7.127   1.00 15.97 ? 141  GLY B O   1 
ATOM   3865 N  N   . TYR B 1 35  ? 7.941  -9.613  5.498   1.00 11.48 ? 142  TYR B N   1 
ATOM   3866 C  CA  . TYR B 1 35  ? 9.048  -8.989  6.226   1.00 13.63 ? 142  TYR B CA  1 
ATOM   3867 C  C   . TYR B 1 35  ? 9.319  -7.602  5.682   1.00 13.59 ? 142  TYR B C   1 
ATOM   3868 O  O   . TYR B 1 35  ? 9.852  -7.447  4.588   1.00 14.07 ? 142  TYR B O   1 
ATOM   3869 C  CB  . TYR B 1 35  ? 10.300 -9.879  6.173   1.00 12.11 ? 142  TYR B CB  1 
ATOM   3870 C  CG  . TYR B 1 35  ? 10.046 -11.255 6.785   1.00 13.59 ? 142  TYR B CG  1 
ATOM   3871 C  CD1 . TYR B 1 35  ? 9.971  -11.423 8.164   1.00 15.80 ? 142  TYR B CD1 1 
ATOM   3872 C  CD2 . TYR B 1 35  ? 9.818  -12.359 5.982   1.00 18.47 ? 142  TYR B CD2 1 
ATOM   3873 C  CE1 . TYR B 1 35  ? 9.702  -12.667 8.723   1.00 16.69 ? 142  TYR B CE1 1 
ATOM   3874 C  CE2 . TYR B 1 35  ? 9.565  -13.620 6.532   1.00 17.84 ? 142  TYR B CE2 1 
ATOM   3875 C  CZ  . TYR B 1 35  ? 9.508  -13.760 7.897   1.00 19.76 ? 142  TYR B CZ  1 
ATOM   3876 O  OH  . TYR B 1 35  ? 9.248  -14.992 8.432   1.00 25.24 ? 142  TYR B OH  1 
ATOM   3877 N  N   . THR B 1 36  ? 8.916  -6.593  6.447   1.00 12.59 ? 143  THR B N   1 
ATOM   3878 C  CA  . THR B 1 36  ? 9.046  -5.198  6.027   1.00 12.19 ? 143  THR B CA  1 
ATOM   3879 C  C   . THR B 1 36  ? 9.691  -4.327  7.097   1.00 13.74 ? 143  THR B C   1 
ATOM   3880 O  O   . THR B 1 36  ? 9.799  -3.106  6.938   1.00 13.68 ? 143  THR B O   1 
ATOM   3881 C  CB  . THR B 1 36  ? 7.688  -4.587  5.665   1.00 15.60 ? 143  THR B CB  1 
ATOM   3882 O  OG1 . THR B 1 36  ? 6.827  -4.652  6.807   1.00 17.41 ? 143  THR B OG1 1 
ATOM   3883 C  CG2 . THR B 1 36  ? 7.050  -5.343  4.480   1.00 19.03 ? 143  THR B CG2 1 
ATOM   3884 N  N   . GLY B 1 37  ? 10.125 -4.955  8.185   1.00 14.96 ? 144  GLY B N   1 
ATOM   3885 C  CA  . GLY B 1 37  ? 10.816 -4.235  9.233   1.00 12.48 ? 144  GLY B CA  1 
ATOM   3886 C  C   . GLY B 1 37  ? 10.048 -3.982  10.521  1.00 13.03 ? 144  GLY B C   1 
ATOM   3887 O  O   . GLY B 1 37  ? 10.578 -3.298  11.398  1.00 11.08 ? 144  GLY B O   1 
ATOM   3888 N  N   A HIS B 1 38  ? 8.833  -4.536  10.643  0.50 11.76 ? 145  HIS B N   1 
ATOM   3889 N  N   B HIS B 1 38  ? 8.828  -4.507  10.643  0.50 12.81 ? 145  HIS B N   1 
ATOM   3890 C  CA  A HIS B 1 38  ? 8.015  -4.345  11.851  0.50 14.57 ? 145  HIS B CA  1 
ATOM   3891 C  CA  B HIS B 1 38  ? 8.020  -4.248  11.837  0.50 14.56 ? 145  HIS B CA  1 
ATOM   3892 C  C   A HIS B 1 38  ? 8.815  -4.667  13.107  0.50 12.20 ? 145  HIS B C   1 
ATOM   3893 C  C   B HIS B 1 38  ? 8.760  -4.664  13.105  0.50 13.19 ? 145  HIS B C   1 
ATOM   3894 O  O   A HIS B 1 38  ? 9.425  -5.730  13.195  0.50 11.87 ? 145  HIS B O   1 
ATOM   3895 O  O   B HIS B 1 38  ? 9.301  -5.764  13.185  0.50 11.86 ? 145  HIS B O   1 
ATOM   3896 C  CB  A HIS B 1 38  ? 6.755  -5.228  11.881  0.50 15.39 ? 145  HIS B CB  1 
ATOM   3897 C  CB  B HIS B 1 38  ? 6.669  -4.969  11.764  0.50 15.24 ? 145  HIS B CB  1 
ATOM   3898 C  CG  A HIS B 1 38  ? 6.036  -5.370  10.575  0.50 15.17 ? 145  HIS B CG  1 
ATOM   3899 C  CG  B HIS B 1 38  ? 5.795  -4.734  12.957  0.50 15.82 ? 145  HIS B CG  1 
ATOM   3900 N  ND1 A HIS B 1 38  ? 6.297  -6.401  9.693   0.50 15.44 ? 145  HIS B ND1 1 
ATOM   3901 N  ND1 B HIS B 1 38  ? 5.007  -3.609  13.092  0.50 18.10 ? 145  HIS B ND1 1 
ATOM   3902 C  CD2 A HIS B 1 38  ? 5.006  -4.673  10.040  0.50 17.67 ? 145  HIS B CD2 1 
ATOM   3903 C  CD2 B HIS B 1 38  ? 5.591  -5.470  14.076  0.50 18.26 ? 145  HIS B CD2 1 
ATOM   3904 C  CE1 A HIS B 1 38  ? 5.483  -6.312  8.659   0.50 18.35 ? 145  HIS B CE1 1 
ATOM   3905 C  CE1 B HIS B 1 38  ? 4.350  -3.669  14.238  0.50 22.84 ? 145  HIS B CE1 1 
ATOM   3906 N  NE2 A HIS B 1 38  ? 4.690  -5.268  8.841   0.50 20.14 ? 145  HIS B NE2 1 
ATOM   3907 N  NE2 B HIS B 1 38  ? 4.686  -4.789  14.855  0.50 17.54 ? 145  HIS B NE2 1 
ATOM   3908 N  N   . GLY B 1 39  ? 8.810  -3.751  14.072  1.00 13.59 ? 146  GLY B N   1 
ATOM   3909 C  CA  . GLY B 1 39  ? 9.436  -4.006  15.356  1.00 12.17 ? 146  GLY B CA  1 
ATOM   3910 C  C   . GLY B 1 39  ? 10.941 -3.779  15.432  1.00 14.52 ? 146  GLY B C   1 
ATOM   3911 O  O   . GLY B 1 39  ? 11.532 -3.890  16.503  1.00 12.45 ? 146  GLY B O   1 
ATOM   3912 N  N   . ILE B 1 40  ? 11.567 -3.468  14.303  1.00 12.88 ? 147  ILE B N   1 
ATOM   3913 C  CA  . ILE B 1 40  ? 13.011 -3.267  14.279  1.00 10.04 ? 147  ILE B CA  1 
ATOM   3914 C  C   . ILE B 1 40  ? 13.321 -1.767  14.338  1.00 11.96 ? 147  ILE B C   1 
ATOM   3915 O  O   . ILE B 1 40  ? 12.563 -0.946  13.811  1.00 10.89 ? 147  ILE B O   1 
ATOM   3916 C  CB  . ILE B 1 40  ? 13.644 -3.919  13.029  1.00 10.76 ? 147  ILE B CB  1 
ATOM   3917 C  CG1 . ILE B 1 40  ? 13.251 -5.402  12.950  1.00 11.54 ? 147  ILE B CG1 1 
ATOM   3918 C  CG2 . ILE B 1 40  ? 15.171 -3.807  13.052  1.00 10.53 ? 147  ILE B CG2 1 
ATOM   3919 C  CD1 . ILE B 1 40  ? 13.612 -6.208  14.200  1.00 12.18 ? 147  ILE B CD1 1 
ATOM   3920 N  N   . VAL B 1 41  ? 14.417 -1.415  15.010  1.00 11.87 ? 148  VAL B N   1 
ATOM   3921 C  CA  . VAL B 1 41  ? 14.795 -0.018  15.212  1.00 9.76  ? 148  VAL B CA  1 
ATOM   3922 C  C   . VAL B 1 41  ? 16.201 0.245   14.673  1.00 10.23 ? 148  VAL B C   1 
ATOM   3923 O  O   . VAL B 1 41  ? 17.160 -0.407  15.078  1.00 9.25  ? 148  VAL B O   1 
ATOM   3924 C  CB  . VAL B 1 41  ? 14.727 0.370   16.715  1.00 11.46 ? 148  VAL B CB  1 
ATOM   3925 C  CG1 . VAL B 1 41  ? 15.149 1.813   16.924  1.00 11.23 ? 148  VAL B CG1 1 
ATOM   3926 C  CG2 . VAL B 1 41  ? 13.333 0.153   17.265  1.00 11.62 ? 148  VAL B CG2 1 
ATOM   3927 N  N   . VAL B 1 42  ? 16.310 1.188   13.741  1.00 8.23  ? 149  VAL B N   1 
ATOM   3928 C  CA  . VAL B 1 42  ? 17.587 1.534   13.132  1.00 8.54  ? 149  VAL B CA  1 
ATOM   3929 C  C   . VAL B 1 42  ? 17.933 2.991   13.442  1.00 10.80 ? 149  VAL B C   1 
ATOM   3930 O  O   . VAL B 1 42  ? 17.048 3.836   13.486  1.00 10.27 ? 149  VAL B O   1 
ATOM   3931 C  CB  . VAL B 1 42  ? 17.549 1.321   11.607  1.00 9.32  ? 149  VAL B CB  1 
ATOM   3932 C  CG1 . VAL B 1 42  ? 18.931 1.515   10.997  1.00 8.96  ? 149  VAL B CG1 1 
ATOM   3933 C  CG2 . VAL B 1 42  ? 16.997 -0.095  11.263  1.00 7.59  ? 149  VAL B CG2 1 
ATOM   3934 N  N   . SER B 1 43  ? 19.210 3.291   13.649  1.00 8.01  ? 150  SER B N   1 
ATOM   3935 C  CA  . SER B 1 43  ? 19.621 4.686   13.801  1.00 10.10 ? 150  SER B CA  1 
ATOM   3936 C  C   . SER B 1 43  ? 20.773 5.046   12.859  1.00 10.62 ? 150  SER B C   1 
ATOM   3937 O  O   . SER B 1 43  ? 21.730 4.291   12.703  1.00 8.96  ? 150  SER B O   1 
ATOM   3938 C  CB  . SER B 1 43  ? 20.006 4.990   15.255  1.00 11.30 ? 150  SER B CB  1 
ATOM   3939 O  OG  . SER B 1 43  ? 20.303 6.372   15.408  1.00 17.77 ? 150  SER B OG  1 
ATOM   3940 N  N   . ILE B 1 44  ? 20.639 6.213   12.228  1.00 10.82 ? 151  ILE B N   1 
ATOM   3941 C  CA  . ILE B 1 44  ? 21.648 6.791   11.339  1.00 10.05 ? 151  ILE B CA  1 
ATOM   3942 C  C   . ILE B 1 44  ? 22.599 7.721   12.104  1.00 12.01 ? 151  ILE B C   1 
ATOM   3943 O  O   . ILE B 1 44  ? 22.163 8.749   12.614  1.00 10.80 ? 151  ILE B O   1 
ATOM   3944 C  CB  . ILE B 1 44  ? 20.992 7.635   10.224  1.00 9.40  ? 151  ILE B CB  1 
ATOM   3945 C  CG1 . ILE B 1 44  ? 19.859 6.864   9.524   1.00 13.08 ? 151  ILE B CG1 1 
ATOM   3946 C  CG2 . ILE B 1 44  ? 22.070 8.226   9.268   1.00 9.30  ? 151  ILE B CG2 1 
ATOM   3947 C  CD1 . ILE B 1 44  ? 20.297 5.531   8.881   1.00 11.62 ? 151  ILE B CD1 1 
ATOM   3948 N  N   . LEU B 1 45  ? 23.884 7.385   12.168  1.00 11.96 ? 152  LEU B N   1 
ATOM   3949 C  CA  . LEU B 1 45  ? 24.853 8.246   12.836  1.00 11.93 ? 152  LEU B CA  1 
ATOM   3950 C  C   . LEU B 1 45  ? 25.480 9.140   11.764  1.00 12.43 ? 152  LEU B C   1 
ATOM   3951 O  O   . LEU B 1 45  ? 26.222 8.674   10.906  1.00 11.82 ? 152  LEU B O   1 
ATOM   3952 C  CB  . LEU B 1 45  ? 25.936 7.437   13.577  1.00 15.72 ? 152  LEU B CB  1 
ATOM   3953 C  CG  . LEU B 1 45  ? 25.561 6.163   14.356  1.00 19.17 ? 152  LEU B CG  1 
ATOM   3954 C  CD1 . LEU B 1 45  ? 26.675 5.718   15.315  1.00 13.77 ? 152  LEU B CD1 1 
ATOM   3955 C  CD2 . LEU B 1 45  ? 24.236 6.280   15.103  1.00 16.61 ? 152  LEU B CD2 1 
ATOM   3956 N  N   . ASP B 1 46  ? 25.145 10.422  11.794  1.00 11.30 ? 153  ASP B N   1 
ATOM   3957 C  CA  . ASP B 1 46  ? 25.497 11.306  10.695  1.00 12.49 ? 153  ASP B CA  1 
ATOM   3958 C  C   . ASP B 1 46  ? 25.341 12.766  11.121  1.00 11.59 ? 153  ASP B C   1 
ATOM   3959 O  O   . ASP B 1 46  ? 25.652 13.108  12.264  1.00 13.19 ? 153  ASP B O   1 
ATOM   3960 C  CB  . ASP B 1 46  ? 24.622 10.978  9.485   1.00 12.41 ? 153  ASP B CB  1 
ATOM   3961 C  CG  . ASP B 1 46  ? 25.309 11.257  8.163   1.00 15.12 ? 153  ASP B CG  1 
ATOM   3962 O  OD1 . ASP B 1 46  ? 25.659 12.425  7.928   1.00 15.61 ? 153  ASP B OD1 1 
ATOM   3963 O  OD2 . ASP B 1 46  ? 25.447 10.317  7.334   1.00 16.17 ? 153  ASP B OD2 1 
ATOM   3964 N  N   . ASP B 1 47  ? 24.872 13.615  10.213  1.00 11.04 ? 154  ASP B N   1 
ATOM   3965 C  CA  . ASP B 1 47  ? 24.771 15.050  10.482  1.00 12.52 ? 154  ASP B CA  1 
ATOM   3966 C  C   . ASP B 1 47  ? 23.370 15.437  10.930  1.00 15.68 ? 154  ASP B C   1 
ATOM   3967 O  O   . ASP B 1 47  ? 23.033 16.620  10.964  1.00 14.16 ? 154  ASP B O   1 
ATOM   3968 C  CB  . ASP B 1 47  ? 25.182 15.881  9.246   1.00 15.29 ? 154  ASP B CB  1 
ATOM   3969 C  CG  . ASP B 1 47  ? 24.439 15.483  7.970   1.00 11.70 ? 154  ASP B CG  1 
ATOM   3970 O  OD1 . ASP B 1 47  ? 23.374 14.859  8.053   1.00 12.97 ? 154  ASP B OD1 1 
ATOM   3971 O  OD2 . ASP B 1 47  ? 24.930 15.804  6.868   1.00 15.10 ? 154  ASP B OD2 1 
ATOM   3972 N  N   . GLY B 1 48  ? 22.569 14.435  11.282  1.00 11.38 ? 155  GLY B N   1 
ATOM   3973 C  CA  . GLY B 1 48  ? 21.217 14.676  11.728  1.00 13.39 ? 155  GLY B CA  1 
ATOM   3974 C  C   . GLY B 1 48  ? 20.171 14.036  10.831  1.00 11.85 ? 155  GLY B C   1 
ATOM   3975 O  O   . GLY B 1 48  ? 20.492 13.497  9.775   1.00 12.55 ? 155  GLY B O   1 
ATOM   3976 N  N   . ILE B 1 49  ? 18.915 14.109  11.253  1.00 12.05 ? 156  ILE B N   1 
ATOM   3977 C  CA  . ILE B 1 49  ? 17.812 13.576  10.475  1.00 10.16 ? 156  ILE B CA  1 
ATOM   3978 C  C   . ILE B 1 49  ? 16.618 14.544  10.512  1.00 13.12 ? 156  ILE B C   1 
ATOM   3979 O  O   . ILE B 1 49  ? 16.232 15.025  11.573  1.00 12.85 ? 156  ILE B O   1 
ATOM   3980 C  CB  . ILE B 1 49  ? 17.415 12.164  11.008  1.00 13.59 ? 156  ILE B CB  1 
ATOM   3981 C  CG1 . ILE B 1 49  ? 16.263 11.542  10.231  1.00 14.08 ? 156  ILE B CG1 1 
ATOM   3982 C  CG2 . ILE B 1 49  ? 17.024 12.204  12.475  1.00 12.98 ? 156  ILE B CG2 1 
ATOM   3983 C  CD1 . ILE B 1 49  ? 15.797 10.226  10.877  1.00 15.56 ? 156  ILE B CD1 1 
ATOM   3984 N  N   . GLU B 1 50  ? 16.050 14.841  9.345   1.00 12.86 ? 157  GLU B N   1 
ATOM   3985 C  CA  . GLU B 1 50  ? 14.883 15.713  9.263   1.00 15.60 ? 157  GLU B CA  1 
ATOM   3986 C  C   . GLU B 1 50  ? 13.653 14.925  9.713   1.00 12.47 ? 157  GLU B C   1 
ATOM   3987 O  O   . GLU B 1 50  ? 12.953 14.326  8.909   1.00 10.88 ? 157  GLU B O   1 
ATOM   3988 C  CB  . GLU B 1 50  ? 14.705 16.255  7.837   1.00 15.74 ? 157  GLU B CB  1 
ATOM   3989 C  CG  . GLU B 1 50  ? 13.749 17.431  7.724   1.00 18.31 ? 157  GLU B CG  1 
ATOM   3990 C  CD  . GLU B 1 50  ? 13.837 18.119  6.372   1.00 18.90 ? 157  GLU B CD  1 
ATOM   3991 O  OE1 . GLU B 1 50  ? 13.295 17.562  5.398   1.00 16.88 ? 157  GLU B OE1 1 
ATOM   3992 O  OE2 . GLU B 1 50  ? 14.452 19.210  6.290   1.00 15.66 ? 157  GLU B OE2 1 
ATOM   3993 N  N   . LYS B 1 51  ? 13.419 14.923  11.014  1.00 13.73 ? 158  LYS B N   1 
ATOM   3994 C  CA  . LYS B 1 51  ? 12.417 14.055  11.617  1.00 15.12 ? 158  LYS B CA  1 
ATOM   3995 C  C   . LYS B 1 51  ? 10.994 14.392  11.191  1.00 16.09 ? 158  LYS B C   1 
ATOM   3996 O  O   . LYS B 1 51  ? 10.101 13.563  11.315  1.00 16.63 ? 158  LYS B O   1 
ATOM   3997 C  CB  . LYS B 1 51  ? 12.538 14.103  13.140  1.00 15.07 ? 158  LYS B CB  1 
ATOM   3998 C  CG  . LYS B 1 51  ? 12.276 15.464  13.763  1.00 17.91 ? 158  LYS B CG  1 
ATOM   3999 C  CD  . LYS B 1 51  ? 12.533 15.440  15.267  1.00 15.54 ? 158  LYS B CD  1 
ATOM   4000 C  CE  . LYS B 1 51  ? 12.072 16.736  15.932  1.00 22.79 ? 158  LYS B CE  1 
ATOM   4001 N  NZ  . LYS B 1 51  ? 12.796 17.912  15.355  1.00 22.66 ? 158  LYS B NZ  1 
ATOM   4002 N  N   . ASN B 1 52  ? 10.790 15.605  10.684  1.00 14.45 ? 159  ASN B N   1 
ATOM   4003 C  CA  . ASN B 1 52  ? 9.478  16.018  10.194  1.00 17.80 ? 159  ASN B CA  1 
ATOM   4004 C  C   . ASN B 1 52  ? 9.286  15.852  8.675   1.00 16.39 ? 159  ASN B C   1 
ATOM   4005 O  O   . ASN B 1 52  ? 8.280  16.291  8.122   1.00 20.52 ? 159  ASN B O   1 
ATOM   4006 C  CB  . ASN B 1 52  ? 9.211  17.479  10.583  1.00 15.11 ? 159  ASN B CB  1 
ATOM   4007 C  CG  . ASN B 1 52  ? 10.274 18.431  10.059  1.00 24.03 ? 159  ASN B CG  1 
ATOM   4008 O  OD1 . ASN B 1 52  ? 11.456 18.080  9.945   1.00 22.05 ? 159  ASN B OD1 1 
ATOM   4009 N  ND2 . ASN B 1 52  ? 9.861  19.657  9.754   1.00 26.36 ? 159  ASN B ND2 1 
ATOM   4010 N  N   . HIS B 1 53  ? 10.252 15.246  8.000   1.00 12.79 ? 160  HIS B N   1 
ATOM   4011 C  CA  . HIS B 1 53  ? 10.128 14.978  6.571   1.00 11.62 ? 160  HIS B CA  1 
ATOM   4012 C  C   . HIS B 1 53  ? 8.852  14.174  6.303   1.00 13.19 ? 160  HIS B C   1 
ATOM   4013 O  O   . HIS B 1 53  ? 8.549  13.238  7.042   1.00 12.94 ? 160  HIS B O   1 
ATOM   4014 C  CB  . HIS B 1 53  ? 11.342 14.201  6.056   1.00 13.10 ? 160  HIS B CB  1 
ATOM   4015 C  CG  . HIS B 1 53  ? 11.499 14.249  4.569   1.00 11.65 ? 160  HIS B CG  1 
ATOM   4016 N  ND1 . HIS B 1 53  ? 10.636 13.610  3.707   1.00 11.79 ? 160  HIS B ND1 1 
ATOM   4017 C  CD2 . HIS B 1 53  ? 12.412 14.880  3.791   1.00 11.96 ? 160  HIS B CD2 1 
ATOM   4018 C  CE1 . HIS B 1 53  ? 11.008 13.847  2.462   1.00 11.35 ? 160  HIS B CE1 1 
ATOM   4019 N  NE2 . HIS B 1 53  ? 12.090 14.606  2.485   1.00 11.11 ? 160  HIS B NE2 1 
ATOM   4020 N  N   . PRO B 1 54  ? 8.089  14.546  5.263   1.00 16.36 ? 161  PRO B N   1 
ATOM   4021 C  CA  . PRO B 1 54  ? 6.840  13.816  4.979   1.00 13.55 ? 161  PRO B CA  1 
ATOM   4022 C  C   . PRO B 1 54  ? 7.035  12.325  4.686   1.00 13.69 ? 161  PRO B C   1 
ATOM   4023 O  O   . PRO B 1 54  ? 6.077  11.572  4.799   1.00 12.13 ? 161  PRO B O   1 
ATOM   4024 C  CB  . PRO B 1 54  ? 6.286  14.533  3.743   1.00 17.28 ? 161  PRO B CB  1 
ATOM   4025 C  CG  . PRO B 1 54  ? 6.831  15.923  3.848   1.00 22.66 ? 161  PRO B CG  1 
ATOM   4026 C  CD  . PRO B 1 54  ? 8.231  15.748  4.418   1.00 18.11 ? 161  PRO B CD  1 
ATOM   4027 N  N   . ASP B 1 55  ? 8.243  11.895  4.318   1.00 12.93 ? 162  ASP B N   1 
ATOM   4028 C  CA  . ASP B 1 55  ? 8.453  10.465  4.103   1.00 13.73 ? 162  ASP B CA  1 
ATOM   4029 C  C   . ASP B 1 55  ? 9.234  9.821   5.255   1.00 11.33 ? 162  ASP B C   1 
ATOM   4030 O  O   . ASP B 1 55  ? 9.554  8.639   5.184   1.00 12.51 ? 162  ASP B O   1 
ATOM   4031 C  CB  . ASP B 1 55  ? 9.166  10.200  2.771   1.00 13.61 ? 162  ASP B CB  1 
ATOM   4032 C  CG  . ASP B 1 55  ? 8.477  9.128   1.955   1.00 11.79 ? 162  ASP B CG  1 
ATOM   4033 O  OD1 . ASP B 1 55  ? 7.287  8.885   2.214   1.00 12.96 ? 162  ASP B OD1 1 
ATOM   4034 O  OD2 . ASP B 1 55  ? 9.111  8.540   1.056   1.00 12.38 ? 162  ASP B OD2 1 
ATOM   4035 N  N   . LEU B 1 56  ? 9.532  10.586  6.310   1.00 11.04 ? 163  LEU B N   1 
ATOM   4036 C  CA  . LEU B 1 56  ? 10.199 10.016  7.499   1.00 12.51 ? 163  LEU B CA  1 
ATOM   4037 C  C   . LEU B 1 56  ? 9.337  10.069  8.765   1.00 12.73 ? 163  LEU B C   1 
ATOM   4038 O  O   . LEU B 1 56  ? 9.421  9.176   9.604   1.00 11.29 ? 163  LEU B O   1 
ATOM   4039 C  CB  . LEU B 1 56  ? 11.547 10.711  7.773   1.00 10.15 ? 163  LEU B CB  1 
ATOM   4040 C  CG  . LEU B 1 56  ? 12.643 10.557  6.706   1.00 9.68  ? 163  LEU B CG  1 
ATOM   4041 C  CD1 . LEU B 1 56  ? 13.938 11.297  7.060   1.00 9.24  ? 163  LEU B CD1 1 
ATOM   4042 C  CD2 . LEU B 1 56  ? 12.935 9.086   6.440   1.00 12.34 ? 163  LEU B CD2 1 
ATOM   4043 N  N   . ALA B 1 57  ? 8.509  11.103  8.897   1.00 12.21 ? 164  ALA B N   1 
ATOM   4044 C  CA  . ALA B 1 57  ? 7.818  11.373  10.153  1.00 11.46 ? 164  ALA B CA  1 
ATOM   4045 C  C   . ALA B 1 57  ? 7.051  10.156  10.679  1.00 10.08 ? 164  ALA B C   1 
ATOM   4046 O  O   . ALA B 1 57  ? 7.120  9.840   11.855  1.00 12.82 ? 164  ALA B O   1 
ATOM   4047 C  CB  . ALA B 1 57  ? 6.871  12.583  9.982   1.00 14.64 ? 164  ALA B CB  1 
ATOM   4048 N  N   . GLY B 1 58  ? 6.354  9.447   9.798   1.00 12.33 ? 165  GLY B N   1 
ATOM   4049 C  CA  . GLY B 1 58  ? 5.588  8.288   10.214  1.00 14.05 ? 165  GLY B CA  1 
ATOM   4050 C  C   . GLY B 1 58  ? 6.387  7.143   10.815  1.00 11.92 ? 165  GLY B C   1 
ATOM   4051 O  O   . GLY B 1 58  ? 5.835  6.318   11.555  1.00 10.70 ? 165  GLY B O   1 
ATOM   4052 N  N   . ASN B 1 59  ? 7.677  7.066   10.500  1.00 9.17  ? 166  ASN B N   1 
ATOM   4053 C  CA  . ASN B 1 59  ? 8.524  6.018   11.079  1.00 12.01 ? 166  ASN B CA  1 
ATOM   4054 C  C   . ASN B 1 59  ? 9.510  6.535   12.131  1.00 16.46 ? 166  ASN B C   1 
ATOM   4055 O  O   . ASN B 1 59  ? 10.280 5.746   12.710  1.00 11.26 ? 166  ASN B O   1 
ATOM   4056 C  CB  . ASN B 1 59  ? 9.297  5.288   9.976   1.00 10.48 ? 166  ASN B CB  1 
ATOM   4057 C  CG  . ASN B 1 59  ? 8.421  4.372   9.182   1.00 11.83 ? 166  ASN B CG  1 
ATOM   4058 O  OD1 . ASN B 1 59  ? 7.346  3.969   9.645   1.00 13.07 ? 166  ASN B OD1 1 
ATOM   4059 N  ND2 . ASN B 1 59  ? 8.858  4.036   7.977   1.00 11.73 ? 166  ASN B ND2 1 
ATOM   4060 N  N   . TYR B 1 60  ? 9.471  7.845   12.394  1.00 10.56 ? 167  TYR B N   1 
ATOM   4061 C  CA  . TYR B 1 60  ? 10.482 8.460   13.246  1.00 11.87 ? 167  TYR B CA  1 
ATOM   4062 C  C   . TYR B 1 60  ? 10.388 8.003   14.691  1.00 15.62 ? 167  TYR B C   1 
ATOM   4063 O  O   . TYR B 1 60  ? 9.308  7.946   15.257  1.00 15.11 ? 167  TYR B O   1 
ATOM   4064 C  CB  . TYR B 1 60  ? 10.391 9.985   13.199  1.00 12.24 ? 167  TYR B CB  1 
ATOM   4065 C  CG  . TYR B 1 60  ? 11.401 10.622  14.099  1.00 10.66 ? 167  TYR B CG  1 
ATOM   4066 C  CD1 . TYR B 1 60  ? 12.764 10.513  13.827  1.00 11.76 ? 167  TYR B CD1 1 
ATOM   4067 C  CD2 . TYR B 1 60  ? 11.003 11.313  15.243  1.00 12.68 ? 167  TYR B CD2 1 
ATOM   4068 C  CE1 . TYR B 1 60  ? 13.712 11.082  14.667  1.00 14.34 ? 167  TYR B CE1 1 
ATOM   4069 C  CE2 . TYR B 1 60  ? 11.934 11.896  16.077  1.00 14.09 ? 167  TYR B CE2 1 
ATOM   4070 C  CZ  . TYR B 1 60  ? 13.291 11.768  15.790  1.00 16.66 ? 167  TYR B CZ  1 
ATOM   4071 O  OH  . TYR B 1 60  ? 14.215 12.343  16.621  1.00 18.34 ? 167  TYR B OH  1 
ATOM   4072 N  N   . ASP B 1 61  ? 11.536 7.683   15.278  1.00 13.17 ? 168  ASP B N   1 
ATOM   4073 C  CA  . ASP B 1 61  ? 11.602 7.192   16.647  1.00 12.73 ? 168  ASP B CA  1 
ATOM   4074 C  C   . ASP B 1 61  ? 12.525 8.075   17.487  1.00 13.48 ? 168  ASP B C   1 
ATOM   4075 O  O   . ASP B 1 61  ? 13.743 7.985   17.371  1.00 12.36 ? 168  ASP B O   1 
ATOM   4076 C  CB  . ASP B 1 61  ? 12.100 5.753   16.664  1.00 14.98 ? 168  ASP B CB  1 
ATOM   4077 C  CG  . ASP B 1 61  ? 12.025 5.121   18.044  1.00 17.83 ? 168  ASP B CG  1 
ATOM   4078 O  OD1 . ASP B 1 61  ? 11.772 5.833   19.044  1.00 18.49 ? 168  ASP B OD1 1 
ATOM   4079 O  OD2 . ASP B 1 61  ? 12.229 3.899   18.121  1.00 17.43 ? 168  ASP B OD2 1 
ATOM   4080 N  N   . PRO B 1 62  ? 11.944 8.915   18.352  1.00 14.10 ? 169  PRO B N   1 
ATOM   4081 C  CA  . PRO B 1 62  ? 12.786 9.796   19.177  1.00 14.30 ? 169  PRO B CA  1 
ATOM   4082 C  C   . PRO B 1 62  ? 13.679 9.013   20.153  1.00 13.11 ? 169  PRO B C   1 
ATOM   4083 O  O   . PRO B 1 62  ? 14.759 9.475   20.476  1.00 12.18 ? 169  PRO B O   1 
ATOM   4084 C  CB  . PRO B 1 62  ? 11.773 10.674  19.937  1.00 16.19 ? 169  PRO B CB  1 
ATOM   4085 C  CG  . PRO B 1 62  ? 10.454 9.958   19.826  1.00 22.94 ? 169  PRO B CG  1 
ATOM   4086 C  CD  . PRO B 1 62  ? 10.499 9.120   18.571  1.00 14.75 ? 169  PRO B CD  1 
ATOM   4087 N  N   . GLY B 1 63  ? 13.248 7.833   20.583  1.00 11.74 ? 170  GLY B N   1 
ATOM   4088 C  CA  . GLY B 1 63  ? 14.054 7.012   21.477  1.00 15.43 ? 170  GLY B CA  1 
ATOM   4089 C  C   . GLY B 1 63  ? 15.297 6.451   20.815  1.00 14.09 ? 170  GLY B C   1 
ATOM   4090 O  O   . GLY B 1 63  ? 16.242 6.049   21.493  1.00 15.08 ? 170  GLY B O   1 
ATOM   4091 N  N   . ALA B 1 64  ? 15.287 6.420   19.483  1.00 13.51 ? 171  ALA B N   1 
ATOM   4092 C  CA  . ALA B 1 64  ? 16.433 5.979   18.692  1.00 13.04 ? 171  ALA B CA  1 
ATOM   4093 C  C   . ALA B 1 64  ? 17.280 7.166   18.240  1.00 12.23 ? 171  ALA B C   1 
ATOM   4094 O  O   . ALA B 1 64  ? 18.159 7.035   17.370  1.00 14.20 ? 171  ALA B O   1 
ATOM   4095 C  CB  . ALA B 1 64  ? 15.955 5.188   17.482  1.00 12.23 ? 171  ALA B CB  1 
ATOM   4096 N  N   . SER B 1 65  ? 17.024 8.329   18.833  1.00 12.71 ? 172  SER B N   1 
ATOM   4097 C  CA  . SER B 1 65  ? 17.667 9.568   18.371  1.00 12.17 ? 172  SER B CA  1 
ATOM   4098 C  C   . SER B 1 65  ? 18.330 10.360  19.480  1.00 11.85 ? 172  SER B C   1 
ATOM   4099 O  O   . SER B 1 65  ? 17.892 10.326  20.624  1.00 11.29 ? 172  SER B O   1 
ATOM   4100 C  CB  . SER B 1 65  ? 16.643 10.462  17.660  1.00 11.33 ? 172  SER B CB  1 
ATOM   4101 O  OG  . SER B 1 65  ? 16.126 9.806   16.524  1.00 14.21 ? 172  SER B OG  1 
ATOM   4102 N  N   . PHE B 1 66  ? 19.395 11.074  19.129  1.00 13.27 ? 173  PHE B N   1 
ATOM   4103 C  CA  . PHE B 1 66  ? 19.979 12.049  20.043  1.00 12.02 ? 173  PHE B CA  1 
ATOM   4104 C  C   . PHE B 1 66  ? 20.828 13.047  19.271  1.00 15.49 ? 173  PHE B C   1 
ATOM   4105 O  O   . PHE B 1 66  ? 21.301 12.752  18.177  1.00 13.82 ? 173  PHE B O   1 
ATOM   4106 C  CB  . PHE B 1 66  ? 20.827 11.371  21.131  1.00 12.75 ? 173  PHE B CB  1 
ATOM   4107 C  CG  . PHE B 1 66  ? 20.951 12.208  22.381  1.00 15.48 ? 173  PHE B CG  1 
ATOM   4108 C  CD1 . PHE B 1 66  ? 19.894 12.299  23.277  1.00 16.83 ? 173  PHE B CD1 1 
ATOM   4109 C  CD2 . PHE B 1 66  ? 22.089 12.946  22.621  1.00 16.51 ? 173  PHE B CD2 1 
ATOM   4110 C  CE1 . PHE B 1 66  ? 19.994 13.093  24.415  1.00 19.57 ? 173  PHE B CE1 1 
ATOM   4111 C  CE2 . PHE B 1 66  ? 22.198 13.740  23.754  1.00 19.12 ? 173  PHE B CE2 1 
ATOM   4112 C  CZ  . PHE B 1 66  ? 21.149 13.815  24.649  1.00 15.78 ? 173  PHE B CZ  1 
ATOM   4113 N  N   . ASP B 1 67  ? 21.003 14.238  19.835  1.00 12.59 ? 174  ASP B N   1 
ATOM   4114 C  CA  . ASP B 1 67  ? 21.912 15.212  19.248  1.00 12.42 ? 174  ASP B CA  1 
ATOM   4115 C  C   . ASP B 1 67  ? 23.154 15.265  20.123  1.00 13.43 ? 174  ASP B C   1 
ATOM   4116 O  O   . ASP B 1 67  ? 23.165 15.928  21.145  1.00 13.91 ? 174  ASP B O   1 
ATOM   4117 C  CB  . ASP B 1 67  ? 21.224 16.585  19.130  1.00 15.39 ? 174  ASP B CB  1 
ATOM   4118 C  CG  . ASP B 1 67  ? 22.128 17.672  18.551  1.00 15.77 ? 174  ASP B CG  1 
ATOM   4119 O  OD1 . ASP B 1 67  ? 23.369 17.502  18.472  1.00 13.28 ? 174  ASP B OD1 1 
ATOM   4120 O  OD2 . ASP B 1 67  ? 21.570 18.730  18.187  1.00 14.87 ? 174  ASP B OD2 1 
ATOM   4121 N  N   . VAL B 1 68  ? 24.197 14.554  19.712  1.00 14.75 ? 175  VAL B N   1 
ATOM   4122 C  CA  . VAL B 1 68  ? 25.445 14.483  20.474  1.00 13.12 ? 175  VAL B CA  1 
ATOM   4123 C  C   . VAL B 1 68  ? 26.257 15.777  20.342  1.00 14.36 ? 175  VAL B C   1 
ATOM   4124 O  O   . VAL B 1 68  ? 26.940 16.175  21.279  1.00 14.71 ? 175  VAL B O   1 
ATOM   4125 C  CB  . VAL B 1 68  ? 26.279 13.239  20.036  1.00 14.37 ? 175  VAL B CB  1 
ATOM   4126 C  CG1 . VAL B 1 68  ? 27.683 13.252  20.641  1.00 15.74 ? 175  VAL B CG1 1 
ATOM   4127 C  CG2 . VAL B 1 68  ? 25.547 11.963  20.450  1.00 10.89 ? 175  VAL B CG2 1 
ATOM   4128 N  N   . ASN B 1 69  ? 26.136 16.463  19.206  1.00 13.27 ? 176  ASN B N   1 
ATOM   4129 C  CA  . ASN B 1 69  ? 26.864 17.715  18.995  1.00 14.28 ? 176  ASN B CA  1 
ATOM   4130 C  C   . ASN B 1 69  ? 26.404 18.862  19.894  1.00 18.56 ? 176  ASN B C   1 
ATOM   4131 O  O   . ASN B 1 69  ? 27.227 19.630  20.381  1.00 19.29 ? 176  ASN B O   1 
ATOM   4132 C  CB  . ASN B 1 69  ? 26.752 18.172  17.536  1.00 14.35 ? 176  ASN B CB  1 
ATOM   4133 C  CG  . ASN B 1 69  ? 27.477 17.253  16.580  1.00 13.32 ? 176  ASN B CG  1 
ATOM   4134 O  OD1 . ASN B 1 69  ? 26.917 16.823  15.582  1.00 13.44 ? 176  ASN B OD1 1 
ATOM   4135 N  ND2 . ASN B 1 69  ? 28.725 16.952  16.883  1.00 14.18 ? 176  ASN B ND2 1 
ATOM   4136 N  N   . ASP B 1 70  ? 25.097 18.995  20.096  1.00 17.25 ? 177  ASP B N   1 
ATOM   4137 C  CA  . ASP B 1 70  ? 24.581 20.080  20.933  1.00 18.56 ? 177  ASP B CA  1 
ATOM   4138 C  C   . ASP B 1 70  ? 24.033 19.543  22.240  1.00 17.98 ? 177  ASP B C   1 
ATOM   4139 O  O   . ASP B 1 70  ? 23.524 20.303  23.063  1.00 21.88 ? 177  ASP B O   1 
ATOM   4140 C  CB  . ASP B 1 70  ? 23.514 20.882  20.192  1.00 17.90 ? 177  ASP B CB  1 
ATOM   4141 C  CG  . ASP B 1 70  ? 24.111 21.895  19.222  1.00 25.75 ? 177  ASP B CG  1 
ATOM   4142 O  OD1 . ASP B 1 70  ? 25.250 22.362  19.454  1.00 29.53 ? 177  ASP B OD1 1 
ATOM   4143 O  OD2 . ASP B 1 70  ? 23.438 22.235  18.225  1.00 28.12 ? 177  ASP B OD2 1 
ATOM   4144 N  N   . GLN B 1 71  ? 24.158 18.228  22.427  1.00 13.14 ? 178  GLN B N   1 
ATOM   4145 C  CA  . GLN B 1 71  ? 23.759 17.550  23.658  1.00 15.74 ? 178  GLN B CA  1 
ATOM   4146 C  C   . GLN B 1 71  ? 22.290 17.765  24.020  1.00 16.52 ? 178  GLN B C   1 
ATOM   4147 O  O   . GLN B 1 71  ? 21.960 18.100  25.153  1.00 18.77 ? 178  GLN B O   1 
ATOM   4148 C  CB  . GLN B 1 71  ? 24.652 17.991  24.826  1.00 22.16 ? 178  GLN B CB  1 
ATOM   4149 C  CG  . GLN B 1 71  ? 26.129 17.667  24.621  1.00 23.00 ? 178  GLN B CG  1 
ATOM   4150 C  CD  . GLN B 1 71  ? 26.989 18.064  25.818  1.00 33.91 ? 178  GLN B CD  1 
ATOM   4151 O  OE1 . GLN B 1 71  ? 26.738 17.639  26.947  1.00 38.00 ? 178  GLN B OE1 1 
ATOM   4152 N  NE2 . GLN B 1 71  ? 28.006 18.883  25.573  1.00 33.87 ? 178  GLN B NE2 1 
ATOM   4153 N  N   . ASP B 1 72  ? 21.410 17.555  23.053  1.00 17.13 ? 179  ASP B N   1 
ATOM   4154 C  CA  . ASP B 1 72  ? 19.975 17.632  23.290  1.00 18.57 ? 179  ASP B CA  1 
ATOM   4155 C  C   . ASP B 1 72  ? 19.274 16.440  22.596  1.00 16.86 ? 179  ASP B C   1 
ATOM   4156 O  O   . ASP B 1 72  ? 19.901 15.747  21.809  1.00 16.95 ? 179  ASP B O   1 
ATOM   4157 C  CB  . ASP B 1 72  ? 19.438 18.994  22.829  1.00 15.40 ? 179  ASP B CB  1 
ATOM   4158 C  CG  . ASP B 1 72  ? 19.497 19.197  21.323  1.00 17.82 ? 179  ASP B CG  1 
ATOM   4159 O  OD1 . ASP B 1 72  ? 18.897 18.408  20.578  1.00 15.98 ? 179  ASP B OD1 1 
ATOM   4160 O  OD2 . ASP B 1 72  ? 20.110 20.198  20.883  1.00 19.55 ? 179  ASP B OD2 1 
ATOM   4161 N  N   . PRO B 1 73  ? 17.992 16.187  22.911  1.00 17.69 ? 180  PRO B N   1 
ATOM   4162 C  CA  . PRO B 1 73  ? 17.266 15.029  22.346  1.00 19.53 ? 180  PRO B CA  1 
ATOM   4163 C  C   . PRO B 1 73  ? 16.882 15.131  20.861  1.00 17.81 ? 180  PRO B C   1 
ATOM   4164 O  O   . PRO B 1 73  ? 16.449 14.139  20.291  1.00 18.85 ? 180  PRO B O   1 
ATOM   4165 C  CB  . PRO B 1 73  ? 15.980 14.976  23.192  1.00 16.31 ? 180  PRO B CB  1 
ATOM   4166 C  CG  . PRO B 1 73  ? 16.272 15.809  24.404  1.00 20.71 ? 180  PRO B CG  1 
ATOM   4167 C  CD  . PRO B 1 73  ? 17.199 16.868  23.950  1.00 18.24 ? 180  PRO B CD  1 
ATOM   4168 N  N   . ASP B 1 74  ? 17.058 16.299  20.257  1.00 14.97 ? 181  ASP B N   1 
ATOM   4169 C  CA  . ASP B 1 74  ? 16.502 16.611  18.949  1.00 15.90 ? 181  ASP B CA  1 
ATOM   4170 C  C   . ASP B 1 74  ? 17.569 16.658  17.861  1.00 14.11 ? 181  ASP B C   1 
ATOM   4171 O  O   . ASP B 1 74  ? 18.293 17.636  17.772  1.00 14.39 ? 181  ASP B O   1 
ATOM   4172 C  CB  . ASP B 1 74  ? 15.774 17.960  19.031  1.00 18.82 ? 181  ASP B CB  1 
ATOM   4173 C  CG  . ASP B 1 74  ? 15.092 18.350  17.735  1.00 21.56 ? 181  ASP B CG  1 
ATOM   4174 O  OD1 . ASP B 1 74  ? 15.271 17.658  16.713  1.00 15.72 ? 181  ASP B OD1 1 
ATOM   4175 O  OD2 . ASP B 1 74  ? 14.363 19.367  17.746  1.00 25.25 ? 181  ASP B OD2 1 
ATOM   4176 N  N   . PRO B 1 75  ? 17.619 15.631  16.994  1.00 12.04 ? 182  PRO B N   1 
ATOM   4177 C  CA  . PRO B 1 75  ? 18.658 15.488  15.958  1.00 12.16 ? 182  PRO B CA  1 
ATOM   4178 C  C   . PRO B 1 75  ? 18.375 16.265  14.657  1.00 12.31 ? 182  PRO B C   1 
ATOM   4179 O  O   . PRO B 1 75  ? 18.973 15.953  13.636  1.00 11.72 ? 182  PRO B O   1 
ATOM   4180 C  CB  . PRO B 1 75  ? 18.637 13.989  15.683  1.00 11.76 ? 182  PRO B CB  1 
ATOM   4181 C  CG  . PRO B 1 75  ? 17.178 13.657  15.789  1.00 10.39 ? 182  PRO B CG  1 
ATOM   4182 C  CD  . PRO B 1 75  ? 16.638 14.529  16.921  1.00 11.41 ? 182  PRO B CD  1 
ATOM   4183 N  N   . GLN B 1 76  ? 17.470 17.241  14.688  1.00 10.96 ? 183  GLN B N   1 
ATOM   4184 C  CA  . GLN B 1 76  ? 17.159 18.026  13.488  1.00 13.12 ? 183  GLN B CA  1 
ATOM   4185 C  C   . GLN B 1 76  ? 18.448 18.598  12.888  1.00 12.98 ? 183  GLN B C   1 
ATOM   4186 O  O   . GLN B 1 76  ? 19.305 19.095  13.613  1.00 12.74 ? 183  GLN B O   1 
ATOM   4187 C  CB  . GLN B 1 76  ? 16.177 19.159  13.831  1.00 15.81 ? 183  GLN B CB  1 
ATOM   4188 C  CG  . GLN B 1 76  ? 15.595 19.890  12.623  1.00 18.28 ? 183  GLN B CG  1 
ATOM   4189 C  CD  . GLN B 1 76  ? 14.445 19.122  11.987  1.00 18.13 ? 183  GLN B CD  1 
ATOM   4190 O  OE1 . GLN B 1 76  ? 13.828 18.277  12.631  1.00 22.45 ? 183  GLN B OE1 1 
ATOM   4191 N  NE2 . GLN B 1 76  ? 14.149 19.417  10.730  1.00 17.20 ? 183  GLN B NE2 1 
ATOM   4192 N  N   . PRO B 1 77  ? 18.604 18.502  11.566  1.00 14.35 ? 184  PRO B N   1 
ATOM   4193 C  CA  . PRO B 1 77  ? 19.802 19.044  10.906  1.00 13.66 ? 184  PRO B CA  1 
ATOM   4194 C  C   . PRO B 1 77  ? 19.880 20.559  11.044  1.00 14.92 ? 184  PRO B C   1 
ATOM   4195 O  O   . PRO B 1 77  ? 18.848 21.209  11.154  1.00 12.52 ? 184  PRO B O   1 
ATOM   4196 C  CB  . PRO B 1 77  ? 19.606 18.657  9.438   1.00 13.54 ? 184  PRO B CB  1 
ATOM   4197 C  CG  . PRO B 1 77  ? 18.556 17.584  9.444   1.00 15.76 ? 184  PRO B CG  1 
ATOM   4198 C  CD  . PRO B 1 77  ? 17.679 17.880  10.607  1.00 16.10 ? 184  PRO B CD  1 
ATOM   4199 N  N   . ARG B 1 78  ? 21.093 21.102  11.033  1.00 15.25 ? 185  ARG B N   1 
ATOM   4200 C  CA  . ARG B 1 78  ? 21.308 22.535  11.050  1.00 13.03 ? 185  ARG B CA  1 
ATOM   4201 C  C   . ARG B 1 78  ? 21.122 23.055  9.623   1.00 13.66 ? 185  ARG B C   1 
ATOM   4202 O  O   . ARG B 1 78  ? 21.763 22.554  8.707   1.00 16.17 ? 185  ARG B O   1 
ATOM   4203 C  CB  . ARG B 1 78  ? 22.718 22.842  11.600  1.00 14.58 ? 185  ARG B CB  1 
ATOM   4204 C  CG  . ARG B 1 78  ? 23.037 24.300  11.873  1.00 17.71 ? 185  ARG B CG  1 
ATOM   4205 C  CD  . ARG B 1 78  ? 24.372 24.441  12.609  1.00 16.74 ? 185  ARG B CD  1 
ATOM   4206 N  NE  . ARG B 1 78  ? 25.435 23.761  11.870  1.00 17.27 ? 185  ARG B NE  1 
ATOM   4207 C  CZ  . ARG B 1 78  ? 26.096 24.317  10.856  1.00 27.32 ? 185  ARG B CZ  1 
ATOM   4208 N  NH1 . ARG B 1 78  ? 27.033 23.634  10.210  1.00 19.93 ? 185  ARG B NH1 1 
ATOM   4209 N  NH2 . ARG B 1 78  ? 25.821 25.570  10.494  1.00 29.97 ? 185  ARG B NH2 1 
ATOM   4210 N  N   . TYR B 1 79  ? 20.243 24.040  9.428   1.00 12.02 ? 186  TYR B N   1 
ATOM   4211 C  CA  . TYR B 1 79  ? 19.954 24.527  8.081   1.00 13.23 ? 186  TYR B CA  1 
ATOM   4212 C  C   . TYR B 1 79  ? 20.949 25.596  7.659   1.00 12.99 ? 186  TYR B C   1 
ATOM   4213 O  O   . TYR B 1 79  ? 21.282 26.486  8.424   1.00 13.74 ? 186  TYR B O   1 
ATOM   4214 C  CB  . TYR B 1 79  ? 18.503 25.031  7.969   1.00 14.11 ? 186  TYR B CB  1 
ATOM   4215 C  CG  . TYR B 1 79  ? 17.541 23.864  8.061   1.00 12.65 ? 186  TYR B CG  1 
ATOM   4216 C  CD1 . TYR B 1 79  ? 17.409 22.971  7.007   1.00 13.81 ? 186  TYR B CD1 1 
ATOM   4217 C  CD2 . TYR B 1 79  ? 16.829 23.608  9.229   1.00 13.56 ? 186  TYR B CD2 1 
ATOM   4218 C  CE1 . TYR B 1 79  ? 16.558 21.862  7.095   1.00 15.58 ? 186  TYR B CE1 1 
ATOM   4219 C  CE2 . TYR B 1 79  ? 15.976 22.508  9.329   1.00 13.92 ? 186  TYR B CE2 1 
ATOM   4220 C  CZ  . TYR B 1 79  ? 15.845 21.640  8.261   1.00 21.00 ? 186  TYR B CZ  1 
ATOM   4221 O  OH  . TYR B 1 79  ? 15.005 20.545  8.363   1.00 21.24 ? 186  TYR B OH  1 
ATOM   4222 N  N   . THR B 1 80  ? 21.457 25.443  6.440   1.00 11.88 ? 187  THR B N   1 
ATOM   4223 C  CA  . THR B 1 80  ? 22.459 26.328  5.864   1.00 14.42 ? 187  THR B CA  1 
ATOM   4224 C  C   . THR B 1 80  ? 22.111 26.580  4.405   1.00 15.56 ? 187  THR B C   1 
ATOM   4225 O  O   . THR B 1 80  ? 21.276 25.878  3.834   1.00 13.07 ? 187  THR B O   1 
ATOM   4226 C  CB  . THR B 1 80  ? 23.885 25.739  5.941   1.00 14.63 ? 187  THR B CB  1 
ATOM   4227 O  OG1 . THR B 1 80  ? 23.960 24.554  5.139   1.00 20.60 ? 187  THR B OG1 1 
ATOM   4228 C  CG2 . THR B 1 80  ? 24.256 25.409  7.351   1.00 18.24 ? 187  THR B CG2 1 
ATOM   4229 N  N   . GLN B 1 81  ? 22.758 27.569  3.793   1.00 13.47 ? 188  GLN B N   1 
ATOM   4230 C  CA  . GLN B 1 81  ? 22.420 27.942  2.421   1.00 14.46 ? 188  GLN B CA  1 
ATOM   4231 C  C   . GLN B 1 81  ? 22.676 26.822  1.423   1.00 16.80 ? 188  GLN B C   1 
ATOM   4232 O  O   . GLN B 1 81  ? 21.928 26.656  0.476   1.00 19.46 ? 188  GLN B O   1 
ATOM   4233 C  CB  . GLN B 1 81  ? 23.206 29.186  1.987   1.00 13.95 ? 188  GLN B CB  1 
ATOM   4234 C  CG  . GLN B 1 81  ? 22.849 29.705  0.583   1.00 15.57 ? 188  GLN B CG  1 
ATOM   4235 C  CD  . GLN B 1 81  ? 21.436 30.277  0.507   1.00 20.92 ? 188  GLN B CD  1 
ATOM   4236 O  OE1 . GLN B 1 81  ? 20.845 30.664  1.514   1.00 48.67 ? 188  GLN B OE1 1 
ATOM   4237 N  NE2 . GLN B 1 81  ? 20.889 30.317  -0.702  1.00 23.29 ? 188  GLN B NE2 1 
ATOM   4238 N  N   . MET B 1 82  ? 23.744 26.067  1.633   1.00 16.05 ? 189  MET B N   1 
ATOM   4239 C  CA  . MET B 1 82  ? 24.153 25.057  0.668   1.00 18.86 ? 189  MET B CA  1 
ATOM   4240 C  C   . MET B 1 82  ? 23.702 23.653  1.077   1.00 16.77 ? 189  MET B C   1 
ATOM   4241 O  O   . MET B 1 82  ? 24.127 22.669  0.480   1.00 15.96 ? 189  MET B O   1 
ATOM   4242 C  CB  . MET B 1 82  ? 25.670 25.098  0.478   1.00 18.68 ? 189  MET B CB  1 
ATOM   4243 C  CG  . MET B 1 82  ? 26.164 26.354  -0.257  1.00 24.86 ? 189  MET B CG  1 
ATOM   4244 S  SD  . MET B 1 82  ? 25.444 26.534  -1.906  1.00 38.14 ? 189  MET B SD  1 
ATOM   4245 C  CE  . MET B 1 82  ? 25.951 28.207  -2.329  1.00 31.69 ? 189  MET B CE  1 
ATOM   4246 N  N   . ASN B 1 83  ? 22.831 23.573  2.080   1.00 16.01 ? 190  ASN B N   1 
ATOM   4247 C  CA  . ASN B 1 83  ? 22.310 22.288  2.554   1.00 17.16 ? 190  ASN B CA  1 
ATOM   4248 C  C   . ASN B 1 83  ? 23.412 21.273  2.869   1.00 19.31 ? 190  ASN B C   1 
ATOM   4249 O  O   . ASN B 1 83  ? 23.313 20.092  2.523   1.00 18.57 ? 190  ASN B O   1 
ATOM   4250 C  CB  . ASN B 1 83  ? 21.341 21.707  1.528   1.00 14.71 ? 190  ASN B CB  1 
ATOM   4251 C  CG  . ASN B 1 83  ? 20.160 22.616  1.288   1.00 19.82 ? 190  ASN B CG  1 
ATOM   4252 O  OD1 . ASN B 1 83  ? 19.564 23.128  2.235   1.00 19.93 ? 190  ASN B OD1 1 
ATOM   4253 N  ND2 . ASN B 1 83  ? 19.832 22.850  0.021   1.00 22.55 ? 190  ASN B ND2 1 
ATOM   4254 N  N   . ASP B 1 84  ? 24.451 21.752  3.535   1.00 16.62 ? 191  ASP B N   1 
ATOM   4255 C  CA  . ASP B 1 84  ? 25.556 20.913  3.962   1.00 17.10 ? 191  ASP B CA  1 
ATOM   4256 C  C   . ASP B 1 84  ? 25.114 19.705  4.800   1.00 18.56 ? 191  ASP B C   1 
ATOM   4257 O  O   . ASP B 1 84  ? 25.704 18.634  4.703   1.00 19.17 ? 191  ASP B O   1 
ATOM   4258 C  CB  . ASP B 1 84  ? 26.559 21.753  4.753   1.00 21.53 ? 191  ASP B CB  1 
ATOM   4259 C  CG  . ASP B 1 84  ? 27.065 22.949  3.958   1.00 33.70 ? 191  ASP B CG  1 
ATOM   4260 O  OD1 . ASP B 1 84  ? 26.428 24.029  4.026   1.00 27.42 ? 191  ASP B OD1 1 
ATOM   4261 O  OD2 . ASP B 1 84  ? 28.091 22.801  3.256   1.00 34.73 ? 191  ASP B OD2 1 
ATOM   4262 N  N   . ASN B 1 85  ? 24.082 19.867  5.622   1.00 16.23 ? 192  ASN B N   1 
ATOM   4263 C  CA  . ASN B 1 85  ? 23.748 18.818  6.579   1.00 13.56 ? 192  ASN B CA  1 
ATOM   4264 C  C   . ASN B 1 85  ? 22.613 17.881  6.122   1.00 12.87 ? 192  ASN B C   1 
ATOM   4265 O  O   . ASN B 1 85  ? 21.723 17.539  6.888   1.00 13.61 ? 192  ASN B O   1 
ATOM   4266 C  CB  . ASN B 1 85  ? 23.428 19.458  7.933   1.00 12.71 ? 192  ASN B CB  1 
ATOM   4267 C  CG  . ASN B 1 85  ? 24.658 20.138  8.557   1.00 18.59 ? 192  ASN B CG  1 
ATOM   4268 O  OD1 . ASN B 1 85  ? 25.694 19.507  8.759   1.00 15.90 ? 192  ASN B OD1 1 
ATOM   4269 N  ND2 . ASN B 1 85  ? 24.549 21.424  8.837   1.00 16.83 ? 192  ASN B ND2 1 
ATOM   4270 N  N   . ARG B 1 86  ? 22.681 17.456  4.871   1.00 12.25 ? 193  ARG B N   1 
ATOM   4271 C  CA  . ARG B 1 86  ? 21.629 16.657  4.248   1.00 13.24 ? 193  ARG B CA  1 
ATOM   4272 C  C   . ARG B 1 86  ? 21.954 15.154  4.234   1.00 13.56 ? 193  ARG B C   1 
ATOM   4273 O  O   . ARG B 1 86  ? 21.118 14.333  3.869   1.00 11.67 ? 193  ARG B O   1 
ATOM   4274 C  CB  . ARG B 1 86  ? 21.412 17.125  2.807   1.00 9.98  ? 193  ARG B CB  1 
ATOM   4275 C  CG  . ARG B 1 86  ? 22.574 16.680  1.913   1.00 13.58 ? 193  ARG B CG  1 
ATOM   4276 C  CD  . ARG B 1 86  ? 22.498 17.234  0.505   1.00 17.60 ? 193  ARG B CD  1 
ATOM   4277 N  NE  . ARG B 1 86  ? 23.639 16.746  -0.258  1.00 25.97 ? 193  ARG B NE  1 
ATOM   4278 C  CZ  . ARG B 1 86  ? 23.980 17.167  -1.472  1.00 31.72 ? 193  ARG B CZ  1 
ATOM   4279 N  NH1 . ARG B 1 86  ? 23.270 18.113  -2.084  1.00 25.35 ? 193  ARG B NH1 1 
ATOM   4280 N  NH2 . ARG B 1 86  ? 25.043 16.636  -2.070  1.00 32.25 ? 193  ARG B NH2 1 
ATOM   4281 N  N   . HIS B 1 87  ? 23.182 14.801  4.597   1.00 11.50 ? 194  HIS B N   1 
ATOM   4282 C  CA  . HIS B 1 87  ? 23.708 13.448  4.361   1.00 12.28 ? 194  HIS B CA  1 
ATOM   4283 C  C   . HIS B 1 87  ? 22.940 12.402  5.185   1.00 11.22 ? 194  HIS B C   1 
ATOM   4284 O  O   . HIS B 1 87  ? 22.549 11.353  4.671   1.00 12.03 ? 194  HIS B O   1 
ATOM   4285 C  CB  . HIS B 1 87  ? 25.218 13.456  4.682   1.00 15.09 ? 194  HIS B CB  1 
ATOM   4286 C  CG  . HIS B 1 87  ? 26.012 12.322  4.097   1.00 13.79 ? 194  HIS B CG  1 
ATOM   4287 N  ND1 . HIS B 1 87  ? 26.327 11.193  4.824   1.00 11.99 ? 194  HIS B ND1 1 
ATOM   4288 C  CD2 . HIS B 1 87  ? 26.653 12.189  2.906   1.00 13.47 ? 194  HIS B CD2 1 
ATOM   4289 C  CE1 . HIS B 1 87  ? 27.075 10.385  4.090   1.00 13.07 ? 194  HIS B CE1 1 
ATOM   4290 N  NE2 . HIS B 1 87  ? 27.284 10.960  2.918   1.00 18.59 ? 194  HIS B NE2 1 
ATOM   4291 N  N   . GLY B 1 88  ? 22.686 12.703  6.457   1.00 12.73 ? 195  GLY B N   1 
ATOM   4292 C  CA  . GLY B 1 88  ? 21.969 11.773  7.313   1.00 11.41 ? 195  GLY B CA  1 
ATOM   4293 C  C   . GLY B 1 88  ? 20.529 11.545  6.890   1.00 11.93 ? 195  GLY B C   1 
ATOM   4294 O  O   . GLY B 1 88  ? 20.003 10.429  6.976   1.00 11.69 ? 195  GLY B O   1 
ATOM   4295 N  N   . THR B 1 89  ? 19.878 12.612  6.446   1.00 10.15 ? 196  THR B N   1 
ATOM   4296 C  CA  . THR B 1 89  ? 18.488 12.515  6.013   1.00 9.56  ? 196  THR B CA  1 
ATOM   4297 C  C   . THR B 1 89  ? 18.369 11.614  4.776   1.00 11.28 ? 196  THR B C   1 
ATOM   4298 O  O   . THR B 1 89  ? 17.442 10.821  4.677   1.00 10.54 ? 196  THR B O   1 
ATOM   4299 C  CB  . THR B 1 89  ? 17.904 13.927  5.735   1.00 12.02 ? 196  THR B CB  1 
ATOM   4300 O  OG1 . THR B 1 89  ? 17.794 14.630  6.979   1.00 11.96 ? 196  THR B OG1 1 
ATOM   4301 C  CG2 . THR B 1 89  ? 16.529 13.865  5.074   1.00 9.93  ? 196  THR B CG2 1 
ATOM   4302 N  N   . ARG B 1 90  ? 19.326 11.716  3.857   1.00 8.68  ? 197  ARG B N   1 
ATOM   4303 C  CA  . ARG B 1 90  ? 19.321 10.864  2.668   1.00 14.45 ? 197  ARG B CA  1 
ATOM   4304 C  C   . ARG B 1 90  ? 19.524 9.381   3.040   1.00 12.44 ? 197  ARG B C   1 
ATOM   4305 O  O   . ARG B 1 90  ? 18.851 8.497   2.503   1.00 10.73 ? 197  ARG B O   1 
ATOM   4306 C  CB  . ARG B 1 90  ? 20.386 11.332  1.672   1.00 10.81 ? 197  ARG B CB  1 
ATOM   4307 C  CG  . ARG B 1 90  ? 20.034 12.632  0.951   1.00 12.01 ? 197  ARG B CG  1 
ATOM   4308 C  CD  . ARG B 1 90  ? 21.218 13.181  0.119   1.00 15.70 ? 197  ARG B CD  1 
ATOM   4309 N  NE  . ARG B 1 90  ? 20.815 14.336  -0.688  1.00 17.04 ? 197  ARG B NE  1 
ATOM   4310 C  CZ  . ARG B 1 90  ? 21.361 14.672  -1.858  1.00 20.19 ? 197  ARG B CZ  1 
ATOM   4311 N  NH1 . ARG B 1 90  ? 20.911 15.728  -2.524  1.00 15.99 ? 197  ARG B NH1 1 
ATOM   4312 N  NH2 . ARG B 1 90  ? 22.357 13.955  -2.364  1.00 17.62 ? 197  ARG B NH2 1 
ATOM   4313 N  N   . CYS B 1 91  ? 20.425 9.114   3.984   1.00 10.56 ? 198  CYS B N   1 
ATOM   4314 C  CA  . CYS B 1 91  ? 20.627 7.743   4.443   1.00 10.02 ? 198  CYS B CA  1 
ATOM   4315 C  C   . CYS B 1 91  ? 19.365 7.176   5.128   1.00 11.92 ? 198  CYS B C   1 
ATOM   4316 O  O   . CYS B 1 91  ? 18.994 6.015   4.899   1.00 11.98 ? 198  CYS B O   1 
ATOM   4317 C  CB  . CYS B 1 91  ? 21.835 7.668   5.380   1.00 12.27 ? 198  CYS B CB  1 
ATOM   4318 S  SG  . CYS B 1 91  ? 23.439 8.095   4.583   1.00 17.31 ? 198  CYS B SG  1 
ATOM   4319 N  N   . ALA B 1 92  ? 18.704 7.990   5.948   1.00 9.21  ? 199  ALA B N   1 
ATOM   4320 C  CA  . ALA B 1 92  ? 17.509 7.541   6.684   1.00 9.91  ? 199  ALA B CA  1 
ATOM   4321 C  C   . ALA B 1 92  ? 16.413 7.049   5.746   1.00 11.30 ? 199  ALA B C   1 
ATOM   4322 O  O   . ALA B 1 92  ? 15.777 6.028   5.999   1.00 13.35 ? 199  ALA B O   1 
ATOM   4323 C  CB  . ALA B 1 92  ? 16.967 8.660   7.559   1.00 8.99  ? 199  ALA B CB  1 
ATOM   4324 N  N   . GLY B 1 93  ? 16.188 7.793   4.671   1.00 8.94  ? 200  GLY B N   1 
ATOM   4325 C  CA  . GLY B 1 93  ? 15.178 7.446   3.695   1.00 9.76  ? 200  GLY B CA  1 
ATOM   4326 C  C   . GLY B 1 93  ? 15.426 6.104   3.045   1.00 11.73 ? 200  GLY B C   1 
ATOM   4327 O  O   . GLY B 1 93  ? 14.489 5.369   2.749   1.00 10.93 ? 200  GLY B O   1 
ATOM   4328 N  N   . GLU B 1 94  ? 16.690 5.774   2.828   1.00 8.65  ? 201  GLU B N   1 
ATOM   4329 C  CA  . GLU B 1 94  ? 17.011 4.506   2.205   1.00 10.06 ? 201  GLU B CA  1 
ATOM   4330 C  C   . GLU B 1 94  ? 16.608 3.330   3.078   1.00 13.29 ? 201  GLU B C   1 
ATOM   4331 O  O   . GLU B 1 94  ? 16.148 2.303   2.571   1.00 10.64 ? 201  GLU B O   1 
ATOM   4332 C  CB  . GLU B 1 94  ? 18.490 4.410   1.909   1.00 12.52 ? 201  GLU B CB  1 
ATOM   4333 C  CG  . GLU B 1 94  ? 19.028 5.439   0.965   1.00 11.30 ? 201  GLU B CG  1 
ATOM   4334 C  CD  . GLU B 1 94  ? 20.472 5.135   0.695   1.00 19.35 ? 201  GLU B CD  1 
ATOM   4335 O  OE1 . GLU B 1 94  ? 21.332 5.746   1.353   1.00 18.80 ? 201  GLU B OE1 1 
ATOM   4336 O  OE2 . GLU B 1 94  ? 20.740 4.228   -0.125  1.00 21.35 ? 201  GLU B OE2 1 
ATOM   4337 N  N   . VAL B 1 95  ? 16.809 3.482   4.385   1.00 9.22  ? 202  VAL B N   1 
ATOM   4338 C  CA  . VAL B 1 95  ? 16.440 2.450   5.347   1.00 9.04  ? 202  VAL B CA  1 
ATOM   4339 C  C   . VAL B 1 95  ? 14.917 2.326   5.508   1.00 11.27 ? 202  VAL B C   1 
ATOM   4340 O  O   . VAL B 1 95  ? 14.356 1.222   5.440   1.00 10.87 ? 202  VAL B O   1 
ATOM   4341 C  CB  . VAL B 1 95  ? 17.036 2.725   6.752   1.00 9.15  ? 202  VAL B CB  1 
ATOM   4342 C  CG1 . VAL B 1 95  ? 16.605 1.605   7.750   1.00 8.98  ? 202  VAL B CG1 1 
ATOM   4343 C  CG2 . VAL B 1 95  ? 18.558 2.849   6.691   1.00 8.92  ? 202  VAL B CG2 1 
ATOM   4344 N  N   . ALA B 1 96  ? 14.261 3.457   5.738   1.00 10.33 ? 203  ALA B N   1 
ATOM   4345 C  CA  . ALA B 1 96  ? 12.894 3.414   6.278   1.00 10.22 ? 203  ALA B CA  1 
ATOM   4346 C  C   . ALA B 1 96  ? 11.967 4.555   5.850   1.00 10.05 ? 203  ALA B C   1 
ATOM   4347 O  O   . ALA B 1 96  ? 11.075 4.959   6.616   1.00 13.51 ? 203  ALA B O   1 
ATOM   4348 C  CB  . ALA B 1 96  ? 12.976 3.369   7.795   1.00 9.85  ? 203  ALA B CB  1 
ATOM   4349 N  N   . ALA B 1 97  ? 12.138 5.069   4.639   1.00 10.65 ? 204  ALA B N   1 
ATOM   4350 C  CA  . ALA B 1 97  ? 11.125 5.982   4.110   1.00 9.84  ? 204  ALA B CA  1 
ATOM   4351 C  C   . ALA B 1 97  ? 9.798  5.249   4.106   1.00 9.53  ? 204  ALA B C   1 
ATOM   4352 O  O   . ALA B 1 97  ? 9.749  4.089   3.729   1.00 10.90 ? 204  ALA B O   1 
ATOM   4353 C  CB  . ALA B 1 97  ? 11.476 6.445   2.728   1.00 10.44 ? 204  ALA B CB  1 
ATOM   4354 N  N   . VAL B 1 98  ? 8.746  5.933   4.550   1.00 10.21 ? 205  VAL B N   1 
ATOM   4355 C  CA  . VAL B 1 98  ? 7.380  5.402   4.612   1.00 9.74  ? 205  VAL B CA  1 
ATOM   4356 C  C   . VAL B 1 98  ? 6.891  4.931   3.237   1.00 10.80 ? 205  VAL B C   1 
ATOM   4357 O  O   . VAL B 1 98  ? 7.138  5.604   2.230   1.00 9.13  ? 205  VAL B O   1 
ATOM   4358 C  CB  . VAL B 1 98  ? 6.411  6.479   5.166   1.00 12.07 ? 205  VAL B CB  1 
ATOM   4359 C  CG1 . VAL B 1 98  ? 4.945  6.001   5.131   1.00 12.71 ? 205  VAL B CG1 1 
ATOM   4360 C  CG2 . VAL B 1 98  ? 6.818  6.888   6.581   1.00 11.68 ? 205  VAL B CG2 1 
ATOM   4361 N  N   . ALA B 1 99  ? 6.229  3.772   3.188   1.00 10.18 ? 206  ALA B N   1 
ATOM   4362 C  CA  . ALA B 1 99  ? 5.661  3.275   1.930   1.00 10.19 ? 206  ALA B CA  1 
ATOM   4363 C  C   . ALA B 1 99  ? 4.166  3.580   1.808   1.00 13.80 ? 206  ALA B C   1 
ATOM   4364 O  O   . ALA B 1 99  ? 3.488  3.838   2.809   1.00 13.42 ? 206  ALA B O   1 
ATOM   4365 C  CB  . ALA B 1 99  ? 5.891  1.765   1.788   1.00 9.97  ? 206  ALA B CB  1 
ATOM   4366 N  N   . ASN B 1 100 ? 3.661  3.519   0.580   1.00 11.23 ? 207  ASN B N   1 
ATOM   4367 C  CA  . ASN B 1 100 ? 2.226  3.635   0.324   1.00 12.17 ? 207  ASN B CA  1 
ATOM   4368 C  C   . ASN B 1 100 ? 1.590  4.891   0.899   1.00 11.20 ? 207  ASN B C   1 
ATOM   4369 O  O   . ASN B 1 100 ? 0.515  4.830   1.469   1.00 14.73 ? 207  ASN B O   1 
ATOM   4370 C  CB  . ASN B 1 100 ? 1.523  2.379   0.870   1.00 13.80 ? 207  ASN B CB  1 
ATOM   4371 C  CG  . ASN B 1 100 ? 1.913  1.131   0.096   1.00 15.07 ? 207  ASN B CG  1 
ATOM   4372 O  OD1 . ASN B 1 100 ? 1.806  1.114   -1.130  1.00 15.04 ? 207  ASN B OD1 1 
ATOM   4373 N  ND2 . ASN B 1 100 ? 2.384  0.088   0.799   1.00 15.39 ? 207  ASN B ND2 1 
ATOM   4374 N  N   . ASN B 1 101 ? 2.275  6.028   0.774   1.00 10.38 ? 208  ASN B N   1 
ATOM   4375 C  CA  . ASN B 1 101 ? 1.771  7.277   1.343   1.00 12.38 ? 208  ASN B CA  1 
ATOM   4376 C  C   . ASN B 1 101 ? 1.776  8.423   0.346   1.00 9.68  ? 208  ASN B C   1 
ATOM   4377 O  O   . ASN B 1 101 ? 1.613  9.575   0.729   1.00 16.25 ? 208  ASN B O   1 
ATOM   4378 C  CB  . ASN B 1 101 ? 2.590  7.671   2.582   1.00 12.41 ? 208  ASN B CB  1 
ATOM   4379 C  CG  . ASN B 1 101 ? 4.007  8.089   2.232   1.00 9.87  ? 208  ASN B CG  1 
ATOM   4380 O  OD1 . ASN B 1 101 ? 4.532  7.696   1.200   1.00 9.78  ? 208  ASN B OD1 1 
ATOM   4381 N  ND2 . ASN B 1 101 ? 4.629  8.893   3.090   1.00 10.74 ? 208  ASN B ND2 1 
ATOM   4382 N  N   . GLY B 1 102 ? 1.986  8.115   -0.928  1.00 12.01 ? 209  GLY B N   1 
ATOM   4383 C  CA  . GLY B 1 102 ? 1.907  9.115   -1.983  1.00 11.89 ? 209  GLY B CA  1 
ATOM   4384 C  C   . GLY B 1 102 ? 3.108  10.033  -2.114  1.00 13.28 ? 209  GLY B C   1 
ATOM   4385 O  O   . GLY B 1 102 ? 3.078  11.018  -2.863  1.00 10.97 ? 209  GLY B O   1 
ATOM   4386 N  N   . VAL B 1 103 ? 4.178  9.712   -1.397  1.00 13.16 ? 210  VAL B N   1 
ATOM   4387 C  CA  . VAL B 1 103 ? 5.337  10.609  -1.316  1.00 11.30 ? 210  VAL B CA  1 
ATOM   4388 C  C   . VAL B 1 103 ? 6.621  9.892   -1.710  1.00 12.65 ? 210  VAL B C   1 
ATOM   4389 O  O   . VAL B 1 103 ? 6.844  8.765   -1.279  1.00 12.72 ? 210  VAL B O   1 
ATOM   4390 C  CB  . VAL B 1 103 ? 5.499  11.177  0.123   1.00 12.42 ? 210  VAL B CB  1 
ATOM   4391 C  CG1 . VAL B 1 103 ? 6.732  12.078  0.210   1.00 12.30 ? 210  VAL B CG1 1 
ATOM   4392 C  CG2 . VAL B 1 103 ? 4.231  11.923  0.554   1.00 13.29 ? 210  VAL B CG2 1 
ATOM   4393 N  N   . CYS B 1 104 ? 7.441  10.531  -2.546  1.00 10.68 ? 211  CYS B N   1 
ATOM   4394 C  CA  . CYS B 1 104 ? 8.783  10.024  -2.899  1.00 13.42 ? 211  CYS B CA  1 
ATOM   4395 C  C   . CYS B 1 104 ? 8.816  8.496   -3.160  1.00 12.62 ? 211  CYS B C   1 
ATOM   4396 O  O   . CYS B 1 104 ? 8.021  7.975   -3.944  1.00 12.41 ? 211  CYS B O   1 
ATOM   4397 C  CB  . CYS B 1 104 ? 9.794  10.394  -1.795  1.00 12.02 ? 211  CYS B CB  1 
ATOM   4398 S  SG  . CYS B 1 104 ? 11.526 10.504  -2.395  1.00 24.29 ? 211  CYS B SG  1 
ATOM   4399 N  N   . GLY B 1 105 ? 9.734  7.787   -2.512  1.00 9.66  ? 212  GLY B N   1 
ATOM   4400 C  CA  . GLY B 1 105 ? 9.859  6.348   -2.715  1.00 11.84 ? 212  GLY B CA  1 
ATOM   4401 C  C   . GLY B 1 105 ? 9.616  5.560   -1.437  1.00 11.35 ? 212  GLY B C   1 
ATOM   4402 O  O   . GLY B 1 105 ? 8.817  5.980   -0.600  1.00 11.80 ? 212  GLY B O   1 
ATOM   4403 N  N   . VAL B 1 106 ? 10.295 4.420   -1.281  1.00 11.16 ? 213  VAL B N   1 
ATOM   4404 C  CA  . VAL B 1 106 ? 10.145 3.612   -0.076  1.00 11.89 ? 213  VAL B CA  1 
ATOM   4405 C  C   . VAL B 1 106 ? 11.495 3.187   0.492   1.00 12.42 ? 213  VAL B C   1 
ATOM   4406 O  O   . VAL B 1 106 ? 12.470 3.028   -0.246  1.00 12.66 ? 213  VAL B O   1 
ATOM   4407 C  CB  . VAL B 1 106 ? 9.305  2.321   -0.321  1.00 13.45 ? 213  VAL B CB  1 
ATOM   4408 C  CG1 . VAL B 1 106 ? 8.029  2.647   -1.056  1.00 11.44 ? 213  VAL B CG1 1 
ATOM   4409 C  CG2 . VAL B 1 106 ? 10.113 1.300   -1.112  1.00 13.59 ? 213  VAL B CG2 1 
ATOM   4410 N  N   . GLY B 1 107 ? 11.537 2.992   1.805   1.00 11.36 ? 214  GLY B N   1 
ATOM   4411 C  CA  . GLY B 1 107 ? 12.677 2.353   2.449   1.00 10.55 ? 214  GLY B CA  1 
ATOM   4412 C  C   . GLY B 1 107 ? 12.704 0.850   2.194   1.00 10.39 ? 214  GLY B C   1 
ATOM   4413 O  O   . GLY B 1 107 ? 11.672 0.239   1.895   1.00 9.22  ? 214  GLY B O   1 
ATOM   4414 N  N   . VAL B 1 108 ? 13.889 0.257   2.294   1.00 9.37  ? 215  VAL B N   1 
ATOM   4415 C  CA  . VAL B 1 108 ? 14.021 -1.210  2.321   1.00 8.13  ? 215  VAL B CA  1 
ATOM   4416 C  C   . VAL B 1 108 ? 13.182 -1.827  3.444   1.00 11.62 ? 215  VAL B C   1 
ATOM   4417 O  O   . VAL B 1 108 ? 12.461 -2.814  3.238   1.00 11.86 ? 215  VAL B O   1 
ATOM   4418 C  CB  . VAL B 1 108 ? 15.479 -1.638  2.536   1.00 9.06  ? 215  VAL B CB  1 
ATOM   4419 C  CG1 . VAL B 1 108 ? 15.585 -3.170  2.719   1.00 8.24  ? 215  VAL B CG1 1 
ATOM   4420 C  CG2 . VAL B 1 108 ? 16.366 -1.143  1.402   1.00 12.56 ? 215  VAL B CG2 1 
ATOM   4421 N  N   . ALA B 1 109 ? 13.320 -1.266  4.644   1.00 9.64  ? 216  ALA B N   1 
ATOM   4422 C  CA  . ALA B 1 109 ? 12.527 -1.696  5.798   1.00 10.47 ? 216  ALA B CA  1 
ATOM   4423 C  C   . ALA B 1 109 ? 11.468 -0.621  6.104   1.00 12.28 ? 216  ALA B C   1 
ATOM   4424 O  O   . ALA B 1 109 ? 11.529 0.075   7.112   1.00 10.32 ? 216  ALA B O   1 
ATOM   4425 C  CB  . ALA B 1 109 ? 13.413 -1.959  7.015   1.00 9.59  ? 216  ALA B CB  1 
ATOM   4426 N  N   . TYR B 1 110 ? 10.478 -0.505  5.225   1.00 9.37  ? 217  TYR B N   1 
ATOM   4427 C  CA  . TYR B 1 110 ? 9.589  0.636   5.290   1.00 12.08 ? 217  TYR B CA  1 
ATOM   4428 C  C   . TYR B 1 110 ? 8.590  0.614   6.468   1.00 14.22 ? 217  TYR B C   1 
ATOM   4429 O  O   . TYR B 1 110 ? 7.865  1.589   6.682   1.00 11.03 ? 217  TYR B O   1 
ATOM   4430 C  CB  . TYR B 1 110 ? 8.853  0.785   3.957   1.00 10.18 ? 217  TYR B CB  1 
ATOM   4431 C  CG  . TYR B 1 110 ? 8.002  -0.371  3.492   1.00 10.74 ? 217  TYR B CG  1 
ATOM   4432 C  CD1 . TYR B 1 110 ? 6.772  -0.657  4.094   1.00 13.01 ? 217  TYR B CD1 1 
ATOM   4433 C  CD2 . TYR B 1 110 ? 8.371  -1.114  2.387   1.00 11.93 ? 217  TYR B CD2 1 
ATOM   4434 C  CE1 . TYR B 1 110 ? 5.955  -1.693  3.626   1.00 12.93 ? 217  TYR B CE1 1 
ATOM   4435 C  CE2 . TYR B 1 110 ? 7.554  -2.151  1.908   1.00 12.81 ? 217  TYR B CE2 1 
ATOM   4436 C  CZ  . TYR B 1 110 ? 6.353  -2.423  2.534   1.00 12.39 ? 217  TYR B CZ  1 
ATOM   4437 O  OH  . TYR B 1 110 ? 5.556  -3.437  2.056   1.00 17.05 ? 217  TYR B OH  1 
ATOM   4438 N  N   . ASN B 1 111 ? 8.584  -0.472  7.244   1.00 12.44 ? 218  ASN B N   1 
ATOM   4439 C  CA  . ASN B 1 111 ? 7.838  -0.506  8.496   1.00 11.32 ? 218  ASN B CA  1 
ATOM   4440 C  C   . ASN B 1 111 ? 8.717  -0.540  9.755   1.00 13.22 ? 218  ASN B C   1 
ATOM   4441 O  O   . ASN B 1 111 ? 8.203  -0.683  10.875  1.00 12.88 ? 218  ASN B O   1 
ATOM   4442 C  CB  . ASN B 1 111 ? 6.878  -1.707  8.521   1.00 10.97 ? 218  ASN B CB  1 
ATOM   4443 C  CG  . ASN B 1 111 ? 5.621  -1.468  7.723   1.00 14.88 ? 218  ASN B CG  1 
ATOM   4444 O  OD1 . ASN B 1 111 ? 5.051  -0.376  7.745   1.00 20.67 ? 218  ASN B OD1 1 
ATOM   4445 N  ND2 . ASN B 1 111 ? 5.183  -2.488  6.994   1.00 12.66 ? 218  ASN B ND2 1 
ATOM   4446 N  N   . ALA B 1 112 ? 10.029 -0.397  9.590   1.00 9.75  ? 219  ALA B N   1 
ATOM   4447 C  CA  . ALA B 1 112 ? 10.905 -0.249  10.749  1.00 12.83 ? 219  ALA B CA  1 
ATOM   4448 C  C   . ALA B 1 112 ? 10.732 1.139   11.360  1.00 12.98 ? 219  ALA B C   1 
ATOM   4449 O  O   . ALA B 1 112 ? 10.138 2.022   10.748  1.00 13.81 ? 219  ALA B O   1 
ATOM   4450 C  CB  . ALA B 1 112 ? 12.369 -0.485  10.360  1.00 9.31  ? 219  ALA B CB  1 
ATOM   4451 N  N   . ARG B 1 113 ? 11.261 1.337   12.555  1.00 12.41 ? 220  ARG B N   1 
ATOM   4452 C  CA  . ARG B 1 113 ? 11.362 2.689   13.105  1.00 12.55 ? 220  ARG B CA  1 
ATOM   4453 C  C   . ARG B 1 113 ? 12.786 3.204   12.918  1.00 15.57 ? 220  ARG B C   1 
ATOM   4454 O  O   . ARG B 1 113 ? 13.746 2.435   13.036  1.00 11.04 ? 220  ARG B O   1 
ATOM   4455 C  CB  . ARG B 1 113 ? 10.955 2.708   14.566  1.00 12.05 ? 220  ARG B CB  1 
ATOM   4456 C  CG  . ARG B 1 113 ? 9.442  2.621   14.725  1.00 23.77 ? 220  ARG B CG  1 
ATOM   4457 C  CD  . ARG B 1 113 ? 9.055  2.625   16.183  1.00 32.23 ? 220  ARG B CD  1 
ATOM   4458 N  NE  . ARG B 1 113 ? 9.421  1.355   16.799  1.00 37.93 ? 220  ARG B NE  1 
ATOM   4459 C  CZ  . ARG B 1 113 ? 9.640  1.187   18.098  1.00 35.94 ? 220  ARG B CZ  1 
ATOM   4460 N  NH1 . ARG B 1 113 ? 9.970  -0.015  18.558  1.00 26.66 ? 220  ARG B NH1 1 
ATOM   4461 N  NH2 . ARG B 1 113 ? 9.534  2.219   18.926  1.00 28.46 ? 220  ARG B NH2 1 
ATOM   4462 N  N   . ILE B 1 114 ? 12.909 4.499   12.632  1.00 11.47 ? 221  ILE B N   1 
ATOM   4463 C  CA  . ILE B 1 114 ? 14.181 5.077   12.226  1.00 13.14 ? 221  ILE B CA  1 
ATOM   4464 C  C   . ILE B 1 114 ? 14.513 6.264   13.127  1.00 13.98 ? 221  ILE B C   1 
ATOM   4465 O  O   . ILE B 1 114 ? 13.669 7.110   13.419  1.00 13.13 ? 221  ILE B O   1 
ATOM   4466 C  CB  . ILE B 1 114 ? 14.160 5.492   10.710  1.00 12.19 ? 221  ILE B CB  1 
ATOM   4467 C  CG1 . ILE B 1 114 ? 15.535 5.924   10.206  1.00 11.49 ? 221  ILE B CG1 1 
ATOM   4468 C  CG2 . ILE B 1 114 ? 13.108 6.577   10.407  1.00 11.20 ? 221  ILE B CG2 1 
ATOM   4469 C  CD1 . ILE B 1 114 ? 16.513 4.756   10.064  1.00 12.99 ? 221  ILE B CD1 1 
ATOM   4470 N  N   . GLY B 1 115 ? 15.746 6.291   13.607  1.00 11.78 ? 222  GLY B N   1 
ATOM   4471 C  CA  . GLY B 1 115 ? 16.226 7.428   14.365  1.00 11.78 ? 222  GLY B CA  1 
ATOM   4472 C  C   . GLY B 1 115 ? 17.480 8.016   13.738  1.00 12.68 ? 222  GLY B C   1 
ATOM   4473 O  O   . GLY B 1 115 ? 17.995 7.503   12.744  1.00 9.70  ? 222  GLY B O   1 
ATOM   4474 N  N   . GLY B 1 116 ? 17.966 9.113   14.309  1.00 12.44 ? 223  GLY B N   1 
ATOM   4475 C  CA  . GLY B 1 116 ? 19.210 9.691   13.852  1.00 10.98 ? 223  GLY B CA  1 
ATOM   4476 C  C   . GLY B 1 116 ? 20.044 10.213  14.999  1.00 11.75 ? 223  GLY B C   1 
ATOM   4477 O  O   . GLY B 1 116 ? 19.514 10.733  15.971  1.00 10.73 ? 223  GLY B O   1 
ATOM   4478 N  N   . VAL B 1 117 ? 21.359 10.045  14.895  1.00 12.52 ? 224  VAL B N   1 
ATOM   4479 C  CA  . VAL B 1 117 ? 22.247 10.666  15.854  1.00 12.02 ? 224  VAL B CA  1 
ATOM   4480 C  C   . VAL B 1 117 ? 23.018 11.762  15.146  1.00 12.45 ? 224  VAL B C   1 
ATOM   4481 O  O   . VAL B 1 117 ? 23.801 11.496  14.226  1.00 11.81 ? 224  VAL B O   1 
ATOM   4482 C  CB  . VAL B 1 117 ? 23.226 9.662   16.497  1.00 13.70 ? 224  VAL B CB  1 
ATOM   4483 C  CG1 . VAL B 1 117 ? 24.080 10.366  17.561  1.00 12.28 ? 224  VAL B CG1 1 
ATOM   4484 C  CG2 . VAL B 1 117 ? 22.457 8.510   17.093  1.00 10.16 ? 224  VAL B CG2 1 
ATOM   4485 N  N   . ARG B 1 118 ? 22.759 13.000  15.552  1.00 9.46  ? 225  ARG B N   1 
ATOM   4486 C  CA  . ARG B 1 118 ? 23.490 14.135  15.021  1.00 10.94 ? 225  ARG B CA  1 
ATOM   4487 C  C   . ARG B 1 118 ? 24.839 14.176  15.736  1.00 12.12 ? 225  ARG B C   1 
ATOM   4488 O  O   . ARG B 1 118 ? 24.912 14.518  16.916  1.00 12.13 ? 225  ARG B O   1 
ATOM   4489 C  CB  . ARG B 1 118 ? 22.691 15.432  15.218  1.00 12.35 ? 225  ARG B CB  1 
ATOM   4490 C  CG  . ARG B 1 118 ? 23.382 16.710  14.733  1.00 12.56 ? 225  ARG B CG  1 
ATOM   4491 C  CD  . ARG B 1 118 ? 22.418 17.912  14.772  1.00 16.44 ? 225  ARG B CD  1 
ATOM   4492 N  NE  . ARG B 1 118 ? 23.087 19.118  14.277  1.00 14.32 ? 225  ARG B NE  1 
ATOM   4493 C  CZ  . ARG B 1 118 ? 23.590 20.069  15.057  1.00 18.04 ? 225  ARG B CZ  1 
ATOM   4494 N  NH1 . ARG B 1 118 ? 24.216 21.109  14.513  1.00 13.33 ? 225  ARG B NH1 1 
ATOM   4495 N  NH2 . ARG B 1 118 ? 23.458 19.988  16.381  1.00 16.13 ? 225  ARG B NH2 1 
ATOM   4496 N  N   . MET B 1 119 ? 25.902 13.794  15.036  1.00 11.19 ? 226  MET B N   1 
ATOM   4497 C  CA  . MET B 1 119 ? 27.212 13.737  15.664  1.00 9.00  ? 226  MET B CA  1 
ATOM   4498 C  C   . MET B 1 119 ? 28.383 14.187  14.779  1.00 10.79 ? 226  MET B C   1 
ATOM   4499 O  O   . MET B 1 119 ? 29.491 14.324  15.282  1.00 14.75 ? 226  MET B O   1 
ATOM   4500 C  CB  . MET B 1 119 ? 27.471 12.321  16.200  1.00 10.49 ? 226  MET B CB  1 
ATOM   4501 C  CG  . MET B 1 119 ? 27.076 11.177  15.271  1.00 16.21 ? 226  MET B CG  1 
ATOM   4502 S  SD  . MET B 1 119 ? 28.300 10.816  13.998  1.00 18.97 ? 226  MET B SD  1 
ATOM   4503 C  CE  . MET B 1 119 ? 29.743 10.286  14.964  1.00 13.33 ? 226  MET B CE  1 
ATOM   4504 N  N   . LEU B 1 120 ? 28.147 14.428  13.485  1.00 11.12 ? 227  LEU B N   1 
ATOM   4505 C  CA  . LEU B 1 120 ? 29.188 14.911  12.568  1.00 11.14 ? 227  LEU B CA  1 
ATOM   4506 C  C   . LEU B 1 120 ? 29.254 16.442  12.481  1.00 14.89 ? 227  LEU B C   1 
ATOM   4507 O  O   . LEU B 1 120 ? 30.241 16.982  11.987  1.00 17.50 ? 227  LEU B O   1 
ATOM   4508 C  CB  . LEU B 1 120 ? 28.981 14.352  11.150  1.00 12.08 ? 227  LEU B CB  1 
ATOM   4509 C  CG  . LEU B 1 120 ? 29.119 12.833  10.960  1.00 18.01 ? 227  LEU B CG  1 
ATOM   4510 C  CD1 . LEU B 1 120 ? 28.853 12.410  9.500   1.00 13.37 ? 227  LEU B CD1 1 
ATOM   4511 C  CD2 . LEU B 1 120 ? 30.496 12.382  11.421  1.00 16.66 ? 227  LEU B CD2 1 
ATOM   4512 N  N   . ASP B 1 121 ? 28.211 17.129  12.945  1.00 14.42 ? 228  ASP B N   1 
ATOM   4513 C  CA  . ASP B 1 121 ? 28.109 18.590  12.778  1.00 11.83 ? 228  ASP B CA  1 
ATOM   4514 C  C   . ASP B 1 121 ? 28.642 19.318  14.014  1.00 15.25 ? 228  ASP B C   1 
ATOM   4515 O  O   . ASP B 1 121 ? 27.921 20.047  14.678  1.00 17.73 ? 228  ASP B O   1 
ATOM   4516 C  CB  . ASP B 1 121 ? 26.649 19.010  12.482  1.00 11.26 ? 228  ASP B CB  1 
ATOM   4517 C  CG  . ASP B 1 121 ? 26.536 20.448  11.950  1.00 17.53 ? 228  ASP B CG  1 
ATOM   4518 O  OD1 . ASP B 1 121 ? 27.575 21.040  11.557  1.00 16.29 ? 228  ASP B OD1 1 
ATOM   4519 O  OD2 . ASP B 1 121 ? 25.402 20.979  11.906  1.00 16.09 ? 228  ASP B OD2 1 
ATOM   4520 N  N   . GLY B 1 122 ? 29.919 19.096  14.302  1.00 16.44 ? 229  GLY B N   1 
ATOM   4521 C  CA  . GLY B 1 122 ? 30.594 19.639  15.465  1.00 22.43 ? 229  GLY B CA  1 
ATOM   4522 C  C   . GLY B 1 122 ? 31.925 18.927  15.572  1.00 18.87 ? 229  GLY B C   1 
ATOM   4523 O  O   . GLY B 1 122 ? 32.221 18.081  14.731  1.00 18.10 ? 229  GLY B O   1 
ATOM   4524 N  N   . GLU B 1 123 ? 32.734 19.261  16.574  1.00 18.63 ? 230  GLU B N   1 
ATOM   4525 C  CA  . GLU B 1 123 ? 33.986 18.534  16.797  1.00 21.23 ? 230  GLU B CA  1 
ATOM   4526 C  C   . GLU B 1 123 ? 33.726 17.044  16.985  1.00 19.71 ? 230  GLU B C   1 
ATOM   4527 O  O   . GLU B 1 123 ? 33.039 16.652  17.915  1.00 21.17 ? 230  GLU B O   1 
ATOM   4528 C  CB  . GLU B 1 123 ? 34.727 19.076  18.019  1.00 28.07 ? 230  GLU B CB  1 
ATOM   4529 C  CG  . GLU B 1 123 ? 35.746 20.136  17.691  1.00 34.53 ? 230  GLU B CG  1 
ATOM   4530 C  CD  . GLU B 1 123 ? 36.699 20.389  18.843  1.00 27.62 ? 230  GLU B CD  1 
ATOM   4531 O  OE1 . GLU B 1 123 ? 36.245 20.859  19.899  1.00 31.80 ? 230  GLU B OE1 1 
ATOM   4532 O  OE2 . GLU B 1 123 ? 37.901 20.105  18.694  1.00 35.66 ? 230  GLU B OE2 1 
ATOM   4533 N  N   . VAL B 1 124 ? 34.255 16.213  16.098  1.00 16.53 ? 231  VAL B N   1 
ATOM   4534 C  CA  . VAL B 1 124 ? 34.035 14.773  16.216  1.00 17.49 ? 231  VAL B CA  1 
ATOM   4535 C  C   . VAL B 1 124 ? 35.161 14.138  17.025  1.00 18.78 ? 231  VAL B C   1 
ATOM   4536 O  O   . VAL B 1 124 ? 36.113 13.582  16.477  1.00 18.32 ? 231  VAL B O   1 
ATOM   4537 C  CB  . VAL B 1 124 ? 33.930 14.089  14.842  1.00 16.43 ? 231  VAL B CB  1 
ATOM   4538 C  CG1 . VAL B 1 124 ? 33.441 12.656  15.001  1.00 14.18 ? 231  VAL B CG1 1 
ATOM   4539 C  CG2 . VAL B 1 124 ? 32.992 14.865  13.941  1.00 14.44 ? 231  VAL B CG2 1 
ATOM   4540 N  N   . THR B 1 125 ? 35.041 14.234  18.343  1.00 16.49 ? 232  THR B N   1 
ATOM   4541 C  CA  . THR B 1 125 ? 36.025 13.664  19.249  1.00 15.06 ? 232  THR B CA  1 
ATOM   4542 C  C   . THR B 1 125 ? 35.762 12.188  19.513  1.00 16.97 ? 232  THR B C   1 
ATOM   4543 O  O   . THR B 1 125 ? 34.701 11.655  19.172  1.00 16.47 ? 232  THR B O   1 
ATOM   4544 C  CB  . THR B 1 125 ? 36.020 14.377  20.603  1.00 15.94 ? 232  THR B CB  1 
ATOM   4545 O  OG1 . THR B 1 125 ? 34.758 14.136  21.230  1.00 16.63 ? 232  THR B OG1 1 
ATOM   4546 C  CG2 . THR B 1 125 ? 36.230 15.887  20.431  1.00 18.37 ? 232  THR B CG2 1 
ATOM   4547 N  N   . ASP B 1 126 ? 36.719 11.545  20.163  1.00 14.62 ? 233  ASP B N   1 
ATOM   4548 C  CA  . ASP B 1 126 ? 36.560 10.163  20.580  1.00 16.19 ? 233  ASP B CA  1 
ATOM   4549 C  C   . ASP B 1 126 ? 35.304 10.009  21.442  1.00 15.64 ? 233  ASP B C   1 
ATOM   4550 O  O   . ASP B 1 126 ? 34.515 9.095   21.226  1.00 18.55 ? 233  ASP B O   1 
ATOM   4551 C  CB  . ASP B 1 126 ? 37.800 9.697   21.337  1.00 14.73 ? 233  ASP B CB  1 
ATOM   4552 C  CG  . ASP B 1 126 ? 37.759 8.233   21.670  1.00 19.77 ? 233  ASP B CG  1 
ATOM   4553 O  OD1 . ASP B 1 126 ? 37.105 7.468   20.925  1.00 19.87 ? 233  ASP B OD1 1 
ATOM   4554 O  OD2 . ASP B 1 126 ? 38.397 7.843   22.678  1.00 21.82 ? 233  ASP B OD2 1 
ATOM   4555 N  N   . ALA B 1 127 ? 35.095 10.924  22.387  1.00 15.86 ? 234  ALA B N   1 
ATOM   4556 C  CA  . ALA B 1 127 ? 33.912 10.868  23.246  1.00 13.81 ? 234  ALA B CA  1 
ATOM   4557 C  C   . ALA B 1 127 ? 32.611 11.025  22.451  1.00 14.42 ? 234  ALA B C   1 
ATOM   4558 O  O   . ALA B 1 127 ? 31.604 10.373  22.748  1.00 16.18 ? 234  ALA B O   1 
ATOM   4559 C  CB  . ALA B 1 127 ? 34.001 11.930  24.339  1.00 15.81 ? 234  ALA B CB  1 
ATOM   4560 N  N   . VAL B 1 128 ? 32.627 11.880  21.438  1.00 14.93 ? 235  VAL B N   1 
ATOM   4561 C  CA  . VAL B 1 128 ? 31.437 12.097  20.612  1.00 15.01 ? 235  VAL B CA  1 
ATOM   4562 C  C   . VAL B 1 128 ? 31.085 10.808  19.854  1.00 13.39 ? 235  VAL B C   1 
ATOM   4563 O  O   . VAL B 1 128 ? 29.931 10.404  19.818  1.00 13.67 ? 235  VAL B O   1 
ATOM   4564 C  CB  . VAL B 1 128 ? 31.631 13.260  19.619  1.00 13.66 ? 235  VAL B CB  1 
ATOM   4565 C  CG1 . VAL B 1 128 ? 30.646 13.149  18.430  1.00 12.51 ? 235  VAL B CG1 1 
ATOM   4566 C  CG2 . VAL B 1 128 ? 31.475 14.620  20.323  1.00 14.93 ? 235  VAL B CG2 1 
ATOM   4567 N  N   . GLU B 1 129 ? 32.084 10.159  19.270  1.00 12.01 ? 236  GLU B N   1 
ATOM   4568 C  CA  . GLU B 1 129 ? 31.860 8.878   18.586  1.00 13.44 ? 236  GLU B CA  1 
ATOM   4569 C  C   . GLU B 1 129 ? 31.333 7.796   19.538  1.00 16.49 ? 236  GLU B C   1 
ATOM   4570 O  O   . GLU B 1 129 ? 30.399 7.062   19.224  1.00 12.30 ? 236  GLU B O   1 
ATOM   4571 C  CB  . GLU B 1 129 ? 33.156 8.395   17.925  1.00 13.83 ? 236  GLU B CB  1 
ATOM   4572 C  CG  . GLU B 1 129 ? 33.682 9.301   16.804  1.00 13.59 ? 236  GLU B CG  1 
ATOM   4573 C  CD  . GLU B 1 129 ? 34.879 8.693   16.078  1.00 16.15 ? 236  GLU B CD  1 
ATOM   4574 O  OE1 . GLU B 1 129 ? 35.327 7.589   16.475  1.00 13.70 ? 236  GLU B OE1 1 
ATOM   4575 O  OE2 . GLU B 1 129 ? 35.376 9.322   15.115  1.00 13.19 ? 236  GLU B OE2 1 
ATOM   4576 N  N   . ALA B 1 130 ? 31.959 7.679   20.699  1.00 16.02 ? 237  ALA B N   1 
ATOM   4577 C  CA  . ALA B 1 130 ? 31.529 6.681   21.680  1.00 16.24 ? 237  ALA B CA  1 
ATOM   4578 C  C   . ALA B 1 130 ? 30.067 6.880   22.132  1.00 16.35 ? 237  ALA B C   1 
ATOM   4579 O  O   . ALA B 1 130 ? 29.306 5.919   22.289  1.00 13.52 ? 237  ALA B O   1 
ATOM   4580 C  CB  . ALA B 1 130 ? 32.459 6.711   22.877  1.00 14.98 ? 237  ALA B CB  1 
ATOM   4581 N  N   . ARG B 1 131 ? 29.670 8.131   22.323  1.00 14.04 ? 238  ARG B N   1 
ATOM   4582 C  CA  . ARG B 1 131 ? 28.304 8.423   22.754  1.00 17.35 ? 238  ARG B CA  1 
ATOM   4583 C  C   . ARG B 1 131 ? 27.308 8.083   21.647  1.00 14.74 ? 238  ARG B C   1 
ATOM   4584 O  O   . ARG B 1 131 ? 26.162 7.790   21.915  1.00 14.38 ? 238  ARG B O   1 
ATOM   4585 C  CB  . ARG B 1 131 ? 28.162 9.890   23.171  1.00 16.92 ? 238  ARG B CB  1 
ATOM   4586 C  CG  . ARG B 1 131 ? 28.924 10.213  24.451  1.00 28.50 ? 238  ARG B CG  1 
ATOM   4587 C  CD  . ARG B 1 131 ? 28.343 9.455   25.644  0.00 27.94 ? 238  ARG B CD  1 
ATOM   4588 N  NE  . ARG B 1 131 ? 29.268 9.387   26.775  0.00 40.69 ? 238  ARG B NE  1 
ATOM   4589 C  CZ  . ARG B 1 131 ? 28.963 8.867   27.961  0.00 30.25 ? 238  ARG B CZ  1 
ATOM   4590 N  NH1 . ARG B 1 131 ? 29.867 8.843   28.931  0.00 26.31 ? 238  ARG B NH1 1 
ATOM   4591 N  NH2 . ARG B 1 131 ? 27.751 8.375   28.181  0.00 28.62 ? 238  ARG B NH2 1 
ATOM   4592 N  N   . SER B 1 132 ? 27.767 8.114   20.406  1.00 13.21 ? 239  SER B N   1 
ATOM   4593 C  CA  . SER B 1 132 ? 26.912 7.825   19.258  1.00 16.00 ? 239  SER B CA  1 
ATOM   4594 C  C   . SER B 1 132 ? 26.736 6.324   19.047  1.00 13.79 ? 239  SER B C   1 
ATOM   4595 O  O   . SER B 1 132 ? 25.614 5.820   18.913  1.00 11.34 ? 239  SER B O   1 
ATOM   4596 C  CB  . SER B 1 132 ? 27.507 8.477   18.010  1.00 12.14 ? 239  SER B CB  1 
ATOM   4597 O  OG  . SER B 1 132 ? 27.613 9.876   18.220  1.00 16.35 ? 239  SER B OG  1 
ATOM   4598 N  N   . LEU B 1 133 ? 27.856 5.619   19.039  1.00 11.01 ? 240  LEU B N   1 
ATOM   4599 C  CA  . LEU B 1 133 ? 27.867 4.161   18.898  1.00 13.50 ? 240  LEU B CA  1 
ATOM   4600 C  C   . LEU B 1 133 ? 27.164 3.452   20.052  1.00 14.20 ? 240  LEU B C   1 
ATOM   4601 O  O   . LEU B 1 133 ? 26.583 2.380   19.879  1.00 14.38 ? 240  LEU B O   1 
ATOM   4602 C  CB  . LEU B 1 133 ? 29.309 3.660   18.794  1.00 10.96 ? 240  LEU B CB  1 
ATOM   4603 C  CG  . LEU B 1 133 ? 30.038 4.119   17.536  1.00 15.89 ? 240  LEU B CG  1 
ATOM   4604 C  CD1 . LEU B 1 133 ? 31.544 3.816   17.633  1.00 16.29 ? 240  LEU B CD1 1 
ATOM   4605 C  CD2 . LEU B 1 133 ? 29.408 3.455   16.307  1.00 12.05 ? 240  LEU B CD2 1 
ATOM   4606 N  N   . GLY B 1 134 ? 27.210 4.045   21.236  1.00 13.35 ? 241  GLY B N   1 
ATOM   4607 C  CA  . GLY B 1 134 ? 26.662 3.380   22.402  1.00 12.65 ? 241  GLY B CA  1 
ATOM   4608 C  C   . GLY B 1 134 ? 25.272 3.829   22.818  1.00 16.62 ? 241  GLY B C   1 
ATOM   4609 O  O   . GLY B 1 134 ? 24.836 3.495   23.920  1.00 16.05 ? 241  GLY B O   1 
ATOM   4610 N  N   . LEU B 1 135 ? 24.571 4.565   21.952  1.00 10.49 ? 242  LEU B N   1 
ATOM   4611 C  CA  . LEU B 1 135 ? 23.286 5.140   22.344  1.00 12.18 ? 242  LEU B CA  1 
ATOM   4612 C  C   . LEU B 1 135 ? 22.183 4.090   22.471  1.00 15.49 ? 242  LEU B C   1 
ATOM   4613 O  O   . LEU B 1 135 ? 21.917 3.350   21.529  1.00 14.76 ? 242  LEU B O   1 
ATOM   4614 C  CB  . LEU B 1 135 ? 22.844 6.209   21.346  1.00 13.09 ? 242  LEU B CB  1 
ATOM   4615 C  CG  . LEU B 1 135 ? 21.435 6.744   21.573  1.00 12.39 ? 242  LEU B CG  1 
ATOM   4616 C  CD1 . LEU B 1 135 ? 21.372 7.533   22.873  1.00 13.16 ? 242  LEU B CD1 1 
ATOM   4617 C  CD2 . LEU B 1 135 ? 20.952 7.598   20.379  1.00 12.21 ? 242  LEU B CD2 1 
ATOM   4618 N  N   . ASN B 1 136 ? 21.556 4.044   23.642  1.00 14.55 ? 243  ASN B N   1 
ATOM   4619 C  CA  . ASN B 1 136 ? 20.345 3.247   23.867  1.00 12.47 ? 243  ASN B CA  1 
ATOM   4620 C  C   . ASN B 1 136 ? 20.373 1.847   23.227  1.00 12.73 ? 243  ASN B C   1 
ATOM   4621 O  O   . ASN B 1 136 ? 19.489 1.513   22.434  1.00 11.75 ? 243  ASN B O   1 
ATOM   4622 C  CB  . ASN B 1 136 ? 19.125 4.033   23.347  1.00 13.98 ? 243  ASN B CB  1 
ATOM   4623 C  CG  . ASN B 1 136 ? 17.844 3.689   24.095  1.00 22.59 ? 243  ASN B CG  1 
ATOM   4624 O  OD1 . ASN B 1 136 ? 17.867 2.954   25.069  1.00 21.68 ? 243  ASN B OD1 1 
ATOM   4625 N  ND2 . ASN B 1 136 ? 16.731 4.232   23.643  1.00 14.45 ? 243  ASN B ND2 1 
ATOM   4626 N  N   . PRO B 1 137 ? 21.390 1.032   23.573  1.00 11.59 ? 244  PRO B N   1 
ATOM   4627 C  CA  . PRO B 1 137 ? 21.649 -0.225  22.858  1.00 13.27 ? 244  PRO B CA  1 
ATOM   4628 C  C   . PRO B 1 137 ? 20.654 -1.345  23.142  1.00 15.19 ? 244  PRO B C   1 
ATOM   4629 O  O   . PRO B 1 137 ? 20.701 -2.358  22.458  1.00 13.77 ? 244  PRO B O   1 
ATOM   4630 C  CB  . PRO B 1 137 ? 23.051 -0.628  23.343  1.00 14.97 ? 244  PRO B CB  1 
ATOM   4631 C  CG  . PRO B 1 137 ? 23.147 -0.063  24.717  1.00 13.71 ? 244  PRO B CG  1 
ATOM   4632 C  CD  . PRO B 1 137 ? 22.359 1.252   24.668  1.00 11.28 ? 244  PRO B CD  1 
ATOM   4633 N  N   . ASN B 1 138 ? 19.765 -1.174  24.112  1.00 12.95 ? 245  ASN B N   1 
ATOM   4634 C  CA  . ASN B 1 138 ? 18.695 -2.143  24.271  1.00 12.20 ? 245  ASN B CA  1 
ATOM   4635 C  C   . ASN B 1 138 ? 17.404 -1.728  23.549  1.00 17.18 ? 245  ASN B C   1 
ATOM   4636 O  O   . ASN B 1 138 ? 16.391 -2.411  23.649  1.00 16.47 ? 245  ASN B O   1 
ATOM   4637 C  CB  . ASN B 1 138 ? 18.435 -2.401  25.757  1.00 14.51 ? 245  ASN B CB  1 
ATOM   4638 C  CG  . ASN B 1 138 ? 19.420 -3.401  26.343  1.00 20.69 ? 245  ASN B CG  1 
ATOM   4639 O  OD1 . ASN B 1 138 ? 19.984 -4.214  25.620  1.00 17.12 ? 245  ASN B OD1 1 
ATOM   4640 N  ND2 . ASN B 1 138 ? 19.631 -3.341  27.650  1.00 28.46 ? 245  ASN B ND2 1 
ATOM   4641 N  N   . HIS B 1 139 ? 17.455 -0.618  22.814  1.00 11.82 ? 246  HIS B N   1 
ATOM   4642 C  CA  . HIS B 1 139 ? 16.306 -0.129  22.052  1.00 12.60 ? 246  HIS B CA  1 
ATOM   4643 C  C   . HIS B 1 139 ? 16.624 -0.122  20.560  1.00 12.92 ? 246  HIS B C   1 
ATOM   4644 O  O   . HIS B 1 139 ? 15.853 -0.626  19.761  1.00 11.81 ? 246  HIS B O   1 
ATOM   4645 C  CB  . HIS B 1 139 ? 15.890 1.287   22.496  1.00 11.70 ? 246  HIS B CB  1 
ATOM   4646 C  CG  . HIS B 1 139 ? 14.721 1.835   21.735  1.00 12.06 ? 246  HIS B CG  1 
ATOM   4647 N  ND1 . HIS B 1 139 ? 13.454 1.299   21.830  1.00 15.64 ? 246  HIS B ND1 1 
ATOM   4648 C  CD2 . HIS B 1 139 ? 14.633 2.849   20.840  1.00 14.14 ? 246  HIS B CD2 1 
ATOM   4649 C  CE1 . HIS B 1 139 ? 12.634 1.970   21.037  1.00 20.22 ? 246  HIS B CE1 1 
ATOM   4650 N  NE2 . HIS B 1 139 ? 13.325 2.916   20.425  1.00 16.11 ? 246  HIS B NE2 1 
ATOM   4651 N  N   . ILE B 1 140 ? 17.773 0.455   20.206  1.00 13.47 ? 247  ILE B N   1 
ATOM   4652 C  CA  . ILE B 1 140 ? 18.277 0.468   18.835  1.00 11.88 ? 247  ILE B CA  1 
ATOM   4653 C  C   . ILE B 1 140 ? 18.916 -0.886  18.485  1.00 13.62 ? 247  ILE B C   1 
ATOM   4654 O  O   . ILE B 1 140 ? 19.813 -1.348  19.197  1.00 13.14 ? 247  ILE B O   1 
ATOM   4655 C  CB  . ILE B 1 140 ? 19.330 1.601   18.644  1.00 9.79  ? 247  ILE B CB  1 
ATOM   4656 C  CG1 . ILE B 1 140 ? 18.709 2.969   18.971  1.00 10.57 ? 247  ILE B CG1 1 
ATOM   4657 C  CG2 . ILE B 1 140 ? 19.914 1.584   17.244  1.00 10.06 ? 247  ILE B CG2 1 
ATOM   4658 C  CD1 . ILE B 1 140 ? 19.746 4.113   19.185  1.00 10.46 ? 247  ILE B CD1 1 
ATOM   4659 N  N   . HIS B 1 141 ? 18.469 -1.523  17.408  1.00 10.09 ? 248  HIS B N   1 
ATOM   4660 C  CA  . HIS B 1 141 ? 19.045 -2.817  17.026  1.00 11.09 ? 248  HIS B CA  1 
ATOM   4661 C  C   . HIS B 1 141 ? 20.267 -2.670  16.115  1.00 13.99 ? 248  HIS B C   1 
ATOM   4662 O  O   . HIS B 1 141 ? 21.247 -3.414  16.242  1.00 13.26 ? 248  HIS B O   1 
ATOM   4663 C  CB  . HIS B 1 141 ? 18.002 -3.699  16.317  1.00 9.64  ? 248  HIS B CB  1 
ATOM   4664 C  CG  . HIS B 1 141 ? 16.755 -3.919  17.110  1.00 13.43 ? 248  HIS B CG  1 
ATOM   4665 N  ND1 . HIS B 1 141 ? 15.580 -3.254  16.842  1.00 13.69 ? 248  HIS B ND1 1 
ATOM   4666 C  CD2 . HIS B 1 141 ? 16.493 -4.734  18.160  1.00 22.52 ? 248  HIS B CD2 1 
ATOM   4667 C  CE1 . HIS B 1 141 ? 14.650 -3.639  17.698  1.00 15.39 ? 248  HIS B CE1 1 
ATOM   4668 N  NE2 . HIS B 1 141 ? 15.180 -4.536  18.512  1.00 17.99 ? 248  HIS B NE2 1 
ATOM   4669 N  N   . ILE B 1 142 ? 20.182 -1.722  15.187  1.00 9.24  ? 249  ILE B N   1 
ATOM   4670 C  CA  . ILE B 1 142 ? 21.128 -1.605  14.077  1.00 9.00  ? 249  ILE B CA  1 
ATOM   4671 C  C   . ILE B 1 142 ? 21.580 -0.153  13.964  1.00 10.43 ? 249  ILE B C   1 
ATOM   4672 O  O   . ILE B 1 142 ? 20.758 0.765   13.999  1.00 8.87  ? 249  ILE B O   1 
ATOM   4673 C  CB  . ILE B 1 142 ? 20.490 -2.062  12.734  1.00 8.36  ? 249  ILE B CB  1 
ATOM   4674 C  CG1 . ILE B 1 142 ? 20.040 -3.528  12.816  1.00 10.44 ? 249  ILE B CG1 1 
ATOM   4675 C  CG2 . ILE B 1 142 ? 21.450 -1.821  11.545  1.00 6.89  ? 249  ILE B CG2 1 
ATOM   4676 C  CD1 . ILE B 1 142 ? 18.826 -3.872  11.915  1.00 11.93 ? 249  ILE B CD1 1 
ATOM   4677 N  N   . TYR B 1 143 ? 22.887 0.046   13.856  1.00 10.72 ? 250  TYR B N   1 
ATOM   4678 C  CA  . TYR B 1 143 ? 23.475 1.366   13.684  1.00 10.17 ? 250  TYR B CA  1 
ATOM   4679 C  C   . TYR B 1 143 ? 24.079 1.473   12.294  1.00 11.44 ? 250  TYR B C   1 
ATOM   4680 O  O   . TYR B 1 143 ? 24.822 0.576   11.855  1.00 14.85 ? 250  TYR B O   1 
ATOM   4681 C  CB  . TYR B 1 143 ? 24.564 1.628   14.733  1.00 8.53  ? 250  TYR B CB  1 
ATOM   4682 C  CG  . TYR B 1 143 ? 24.092 1.521   16.162  1.00 9.28  ? 250  TYR B CG  1 
ATOM   4683 C  CD1 . TYR B 1 143 ? 23.915 0.288   16.764  1.00 10.46 ? 250  TYR B CD1 1 
ATOM   4684 C  CD2 . TYR B 1 143 ? 23.838 2.663   16.921  1.00 12.58 ? 250  TYR B CD2 1 
ATOM   4685 C  CE1 . TYR B 1 143 ? 23.480 0.194   18.084  1.00 13.56 ? 250  TYR B CE1 1 
ATOM   4686 C  CE2 . TYR B 1 143 ? 23.437 2.581   18.238  1.00 9.51  ? 250  TYR B CE2 1 
ATOM   4687 C  CZ  . TYR B 1 143 ? 23.247 1.341   18.809  1.00 10.38 ? 250  TYR B CZ  1 
ATOM   4688 O  OH  . TYR B 1 143 ? 22.827 1.248   20.115  1.00 13.05 ? 250  TYR B OH  1 
ATOM   4689 N  N   . SER B 1 144 ? 23.767 2.547   11.587  1.00 7.53  ? 251  SER B N   1 
ATOM   4690 C  CA  . SER B 1 144 ? 24.312 2.722   10.244  1.00 12.91 ? 251  SER B CA  1 
ATOM   4691 C  C   . SER B 1 144 ? 25.216 3.952   10.192  1.00 13.49 ? 251  SER B C   1 
ATOM   4692 O  O   . SER B 1 144 ? 24.789 5.053   10.530  1.00 10.30 ? 251  SER B O   1 
ATOM   4693 C  CB  . SER B 1 144 ? 23.183 2.816   9.207   1.00 12.03 ? 251  SER B CB  1 
ATOM   4694 O  OG  . SER B 1 144 ? 23.684 3.007   7.891   1.00 14.79 ? 251  SER B OG  1 
ATOM   4695 N  N   . ALA B 1 145 ? 26.471 3.764   9.794   1.00 9.23  ? 252  ALA B N   1 
ATOM   4696 C  CA  . ALA B 1 145 ? 27.392 4.904   9.728   1.00 14.60 ? 252  ALA B CA  1 
ATOM   4697 C  C   . ALA B 1 145 ? 28.074 5.008   8.374   1.00 14.38 ? 252  ALA B C   1 
ATOM   4698 O  O   . ALA B 1 145 ? 28.802 4.113   7.977   1.00 13.87 ? 252  ALA B O   1 
ATOM   4699 C  CB  . ALA B 1 145 ? 28.445 4.819   10.860  1.00 11.81 ? 252  ALA B CB  1 
ATOM   4700 N  N   . SER B 1 146 ? 27.820 6.115   7.681   1.00 11.58 ? 253  SER B N   1 
ATOM   4701 C  CA  . SER B 1 146 ? 28.388 6.403   6.370   1.00 14.13 ? 253  SER B CA  1 
ATOM   4702 C  C   . SER B 1 146 ? 29.387 7.536   6.493   1.00 14.76 ? 253  SER B C   1 
ATOM   4703 O  O   . SER B 1 146 ? 29.203 8.614   5.928   1.00 15.11 ? 253  SER B O   1 
ATOM   4704 C  CB  . SER B 1 146 ? 27.283 6.776   5.371   1.00 16.71 ? 253  SER B CB  1 
ATOM   4705 O  OG  . SER B 1 146 ? 26.400 5.679   5.167   1.00 17.15 ? 253  SER B OG  1 
ATOM   4706 N  N   . TRP B 1 147 ? 30.436 7.288   7.263   1.00 14.25 ? 254  TRP B N   1 
ATOM   4707 C  CA  . TRP B 1 147 ? 31.485 8.269   7.469   1.00 12.40 ? 254  TRP B CA  1 
ATOM   4708 C  C   . TRP B 1 147 ? 32.730 7.553   7.954   1.00 12.42 ? 254  TRP B C   1 
ATOM   4709 O  O   . TRP B 1 147 ? 32.676 6.382   8.316   1.00 13.39 ? 254  TRP B O   1 
ATOM   4710 C  CB  . TRP B 1 147 ? 31.065 9.344   8.480   1.00 11.11 ? 254  TRP B CB  1 
ATOM   4711 C  CG  . TRP B 1 147 ? 30.529 8.812   9.791   1.00 13.41 ? 254  TRP B CG  1 
ATOM   4712 C  CD1 . TRP B 1 147 ? 29.212 8.634   10.117  1.00 14.84 ? 254  TRP B CD1 1 
ATOM   4713 C  CD2 . TRP B 1 147 ? 31.284 8.417   10.954  1.00 13.95 ? 254  TRP B CD2 1 
ATOM   4714 N  NE1 . TRP B 1 147 ? 29.102 8.160   11.403  1.00 13.67 ? 254  TRP B NE1 1 
ATOM   4715 C  CE2 . TRP B 1 147 ? 30.354 8.020   11.935  1.00 14.31 ? 254  TRP B CE2 1 
ATOM   4716 C  CE3 . TRP B 1 147 ? 32.649 8.366   11.258  1.00 12.67 ? 254  TRP B CE3 1 
ATOM   4717 C  CZ2 . TRP B 1 147 ? 30.749 7.566   13.195  1.00 11.17 ? 254  TRP B CZ2 1 
ATOM   4718 C  CZ3 . TRP B 1 147 ? 33.037 7.926   12.510  1.00 13.23 ? 254  TRP B CZ3 1 
ATOM   4719 C  CH2 . TRP B 1 147 ? 32.090 7.526   13.464  1.00 13.40 ? 254  TRP B CH2 1 
ATOM   4720 N  N   . GLY B 1 148 ? 33.852 8.256   7.956   1.00 12.27 ? 255  GLY B N   1 
ATOM   4721 C  CA  . GLY B 1 148 ? 35.088 7.695   8.465   1.00 12.18 ? 255  GLY B CA  1 
ATOM   4722 C  C   . GLY B 1 148 ? 36.248 8.640   8.237   1.00 15.51 ? 255  GLY B C   1 
ATOM   4723 O  O   . GLY B 1 148 ? 36.043 9.815   7.923   1.00 13.22 ? 255  GLY B O   1 
ATOM   4724 N  N   . PRO B 1 149 ? 37.473 8.132   8.401   1.00 13.00 ? 256  PRO B N   1 
ATOM   4725 C  CA  . PRO B 1 149 ? 38.701 8.899   8.150   1.00 14.58 ? 256  PRO B CA  1 
ATOM   4726 C  C   . PRO B 1 149 ? 38.758 9.383   6.712   1.00 17.26 ? 256  PRO B C   1 
ATOM   4727 O  O   . PRO B 1 149 ? 38.180 8.774   5.816   1.00 12.18 ? 256  PRO B O   1 
ATOM   4728 C  CB  . PRO B 1 149 ? 39.821 7.891   8.416   1.00 16.88 ? 256  PRO B CB  1 
ATOM   4729 C  CG  . PRO B 1 149 ? 39.170 6.819   9.285   1.00 15.72 ? 256  PRO B CG  1 
ATOM   4730 C  CD  . PRO B 1 149 ? 37.761 6.744   8.794   1.00 14.54 ? 256  PRO B CD  1 
ATOM   4731 N  N   . GLU B 1 150 ? 39.459 10.486  6.507   1.00 16.04 ? 257  GLU B N   1 
ATOM   4732 C  CA  . GLU B 1 150 ? 39.580 11.073  5.191   1.00 17.25 ? 257  GLU B CA  1 
ATOM   4733 C  C   . GLU B 1 150 ? 39.965 10.058  4.114   1.00 17.11 ? 257  GLU B C   1 
ATOM   4734 O  O   . GLU B 1 150 ? 40.877 9.262   4.293   1.00 16.28 ? 257  GLU B O   1 
ATOM   4735 C  CB  . GLU B 1 150 ? 40.608 12.199  5.222   1.00 16.67 ? 257  GLU B CB  1 
ATOM   4736 C  CG  . GLU B 1 150 ? 40.404 13.161  4.094   1.00 23.57 ? 257  GLU B CG  1 
ATOM   4737 C  CD  . GLU B 1 150 ? 41.419 14.279  4.095   1.00 39.24 ? 257  GLU B CD  1 
ATOM   4738 O  OE1 . GLU B 1 150 ? 42.007 14.557  5.168   1.00 41.58 ? 257  GLU B OE1 1 
ATOM   4739 O  OE2 . GLU B 1 150 ? 41.640 14.871  3.017   1.00 38.27 ? 257  GLU B OE2 1 
ATOM   4740 N  N   . ASP B 1 151 ? 39.255 10.107  2.994   1.00 14.31 ? 258  ASP B N   1 
ATOM   4741 C  CA  . ASP B 1 151 ? 39.445 9.153   1.910   1.00 15.42 ? 258  ASP B CA  1 
ATOM   4742 C  C   . ASP B 1 151 ? 40.449 9.668   0.872   1.00 15.35 ? 258  ASP B C   1 
ATOM   4743 O  O   . ASP B 1 151 ? 40.228 9.548   -0.324  1.00 18.54 ? 258  ASP B O   1 
ATOM   4744 C  CB  . ASP B 1 151 ? 38.105 8.842   1.238   1.00 15.56 ? 258  ASP B CB  1 
ATOM   4745 C  CG  . ASP B 1 151 ? 37.211 7.942   2.089   1.00 15.74 ? 258  ASP B CG  1 
ATOM   4746 O  OD1 . ASP B 1 151 ? 37.733 7.107   2.856   1.00 14.35 ? 258  ASP B OD1 1 
ATOM   4747 O  OD2 . ASP B 1 151 ? 35.977 8.070   1.993   1.00 15.85 ? 258  ASP B OD2 1 
ATOM   4748 N  N   . ASP B 1 152 ? 41.553 10.243  1.336   1.00 16.65 ? 259  ASP B N   1 
ATOM   4749 C  CA  . ASP B 1 152 ? 42.506 10.871  0.422   1.00 15.08 ? 259  ASP B CA  1 
ATOM   4750 C  C   . ASP B 1 152 ? 43.596 9.909   -0.059  1.00 17.21 ? 259  ASP B C   1 
ATOM   4751 O  O   . ASP B 1 152 ? 44.448 10.282  -0.869  1.00 18.91 ? 259  ASP B O   1 
ATOM   4752 C  CB  . ASP B 1 152 ? 43.143 12.094  1.089   1.00 20.21 ? 259  ASP B CB  1 
ATOM   4753 C  CG  . ASP B 1 152 ? 43.895 11.747  2.375   1.00 22.55 ? 259  ASP B CG  1 
ATOM   4754 O  OD1 . ASP B 1 152 ? 43.884 10.566  2.811   1.00 21.60 ? 259  ASP B OD1 1 
ATOM   4755 O  OD2 . ASP B 1 152 ? 44.493 12.675  2.960   1.00 24.46 ? 259  ASP B OD2 1 
ATOM   4756 N  N   . GLY B 1 153 ? 43.569 8.678   0.445   1.00 16.95 ? 260  GLY B N   1 
ATOM   4757 C  CA  . GLY B 1 153 ? 44.551 7.679   0.060   1.00 17.24 ? 260  GLY B CA  1 
ATOM   4758 C  C   . GLY B 1 153 ? 45.910 7.899   0.714   1.00 16.30 ? 260  GLY B C   1 
ATOM   4759 O  O   . GLY B 1 153 ? 46.912 7.371   0.244   1.00 19.28 ? 260  GLY B O   1 
ATOM   4760 N  N   . LYS B 1 154 ? 45.939 8.671   1.796   1.00 19.28 ? 261  LYS B N   1 
ATOM   4761 C  CA  . LYS B 1 154 ? 47.172 8.991   2.522   1.00 19.47 ? 261  LYS B CA  1 
ATOM   4762 C  C   . LYS B 1 154 ? 47.055 8.692   4.016   1.00 21.72 ? 261  LYS B C   1 
ATOM   4763 O  O   . LYS B 1 154 ? 48.038 8.761   4.755   1.00 23.00 ? 261  LYS B O   1 
ATOM   4764 C  CB  . LYS B 1 154 ? 47.542 10.479  2.344   1.00 18.75 ? 261  LYS B CB  1 
ATOM   4765 C  CG  . LYS B 1 154 ? 47.706 10.919  0.904   1.00 22.88 ? 261  LYS B CG  1 
ATOM   4766 C  CD  . LYS B 1 154 ? 48.317 12.311  0.774   1.00 31.85 ? 261  LYS B CD  1 
ATOM   4767 C  CE  . LYS B 1 154 ? 47.422 13.380  1.351   1.00 35.54 ? 261  LYS B CE  1 
ATOM   4768 N  NZ  . LYS B 1 154 ? 47.938 14.750  1.037   1.00 48.97 ? 261  LYS B NZ  1 
ATOM   4769 N  N   . THR B 1 155 ? 45.845 8.383   4.458   1.00 16.17 ? 262  THR B N   1 
ATOM   4770 C  CA  . THR B 1 155 ? 45.517 8.331   5.880   1.00 15.98 ? 262  THR B CA  1 
ATOM   4771 C  C   . THR B 1 155 ? 45.442 6.911   6.446   1.00 15.39 ? 262  THR B C   1 
ATOM   4772 O  O   . THR B 1 155 ? 45.004 5.990   5.763   1.00 15.48 ? 262  THR B O   1 
ATOM   4773 C  CB  . THR B 1 155 ? 44.173 9.046   6.117   1.00 22.74 ? 262  THR B CB  1 
ATOM   4774 O  OG1 . THR B 1 155 ? 44.268 10.379  5.608   1.00 22.45 ? 262  THR B OG1 1 
ATOM   4775 C  CG2 . THR B 1 155 ? 43.797 9.084   7.591   1.00 18.42 ? 262  THR B CG2 1 
ATOM   4776 N  N   . VAL B 1 156 ? 45.899 6.754   7.687   1.00 17.09 ? 263  VAL B N   1 
ATOM   4777 C  CA  . VAL B 1 156 ? 45.695 5.537   8.475   1.00 18.77 ? 263  VAL B CA  1 
ATOM   4778 C  C   . VAL B 1 156 ? 45.147 5.984   9.818   1.00 19.41 ? 263  VAL B C   1 
ATOM   4779 O  O   . VAL B 1 156 ? 45.815 6.689   10.569  1.00 16.97 ? 263  VAL B O   1 
ATOM   4780 C  CB  . VAL B 1 156 ? 46.989 4.704   8.698   1.00 20.47 ? 263  VAL B CB  1 
ATOM   4781 C  CG1 . VAL B 1 156 ? 46.668 3.410   9.463   1.00 14.81 ? 263  VAL B CG1 1 
ATOM   4782 C  CG2 . VAL B 1 156 ? 47.691 4.393   7.379   1.00 13.51 ? 263  VAL B CG2 1 
ATOM   4783 N  N   . ASP B 1 157 ? 43.914 5.592   10.115  1.00 15.67 ? 264  ASP B N   1 
ATOM   4784 C  CA  . ASP B 1 157 ? 43.279 6.046   11.338  1.00 18.47 ? 264  ASP B CA  1 
ATOM   4785 C  C   . ASP B 1 157 ? 42.068 5.172   11.602  1.00 15.27 ? 264  ASP B C   1 
ATOM   4786 O  O   . ASP B 1 157 ? 41.522 4.582   10.691  1.00 14.04 ? 264  ASP B O   1 
ATOM   4787 C  CB  . ASP B 1 157 ? 42.885 7.531   11.234  1.00 16.39 ? 264  ASP B CB  1 
ATOM   4788 C  CG  . ASP B 1 157 ? 42.607 8.171   12.594  1.00 20.85 ? 264  ASP B CG  1 
ATOM   4789 O  OD1 . ASP B 1 157 ? 43.047 7.634   13.627  1.00 33.04 ? 264  ASP B OD1 1 
ATOM   4790 O  OD2 . ASP B 1 157 ? 41.950 9.229   12.638  1.00 29.25 ? 264  ASP B OD2 1 
ATOM   4791 N  N   . GLY B 1 158 ? 41.678 5.085   12.863  1.00 16.59 ? 265  GLY B N   1 
ATOM   4792 C  CA  . GLY B 1 158 ? 40.552 4.272   13.276  1.00 17.47 ? 265  GLY B CA  1 
ATOM   4793 C  C   . GLY B 1 158 ? 40.056 4.770   14.615  1.00 17.04 ? 265  GLY B C   1 
ATOM   4794 O  O   . GLY B 1 158 ? 40.488 5.823   15.082  1.00 17.90 ? 265  GLY B O   1 
ATOM   4795 N  N   . PRO B 1 159 ? 39.154 4.013   15.247  1.00 18.00 ? 266  PRO B N   1 
ATOM   4796 C  CA  . PRO B 1 159 ? 38.601 4.426   16.537  1.00 14.28 ? 266  PRO B CA  1 
ATOM   4797 C  C   . PRO B 1 159 ? 39.674 4.539   17.615  1.00 17.60 ? 266  PRO B C   1 
ATOM   4798 O  O   . PRO B 1 159 ? 40.561 3.699   17.695  1.00 19.51 ? 266  PRO B O   1 
ATOM   4799 C  CB  . PRO B 1 159 ? 37.609 3.311   16.868  1.00 15.65 ? 266  PRO B CB  1 
ATOM   4800 C  CG  . PRO B 1 159 ? 38.065 2.128   16.059  1.00 14.77 ? 266  PRO B CG  1 
ATOM   4801 C  CD  . PRO B 1 159 ? 38.630 2.709   14.805  1.00 14.02 ? 266  PRO B CD  1 
ATOM   4802 N  N   . ALA B 1 160 ? 39.587 5.588   18.421  1.00 17.75 ? 267  ALA B N   1 
ATOM   4803 C  CA  . ALA B 1 160 ? 40.385 5.693   19.629  1.00 19.85 ? 267  ALA B CA  1 
ATOM   4804 C  C   . ALA B 1 160 ? 39.703 4.940   20.775  1.00 17.20 ? 267  ALA B C   1 
ATOM   4805 O  O   . ALA B 1 160 ? 38.691 4.248   20.571  1.00 17.43 ? 267  ALA B O   1 
ATOM   4806 C  CB  . ALA B 1 160 ? 40.613 7.157   19.986  1.00 17.06 ? 267  ALA B CB  1 
ATOM   4807 N  N   . ARG B 1 161 ? 40.245 5.089   21.981  1.00 17.37 ? 268  ARG B N   1 
ATOM   4808 C  CA  . ARG B 1 161 ? 39.889 4.209   23.092  1.00 19.48 ? 268  ARG B CA  1 
ATOM   4809 C  C   . ARG B 1 161 ? 38.401 4.200   23.478  1.00 16.12 ? 268  ARG B C   1 
ATOM   4810 O  O   . ARG B 1 161 ? 37.837 3.134   23.739  1.00 16.72 ? 268  ARG B O   1 
ATOM   4811 C  CB  . ARG B 1 161 ? 40.710 4.564   24.338  1.00 23.62 ? 268  ARG B CB  1 
ATOM   4812 C  CG  . ARG B 1 161 ? 40.544 3.541   25.467  1.00 33.38 ? 268  ARG B CG  1 
ATOM   4813 C  CD  . ARG B 1 161 ? 41.255 3.954   26.757  1.00 36.72 ? 268  ARG B CD  1 
ATOM   4814 N  NE  . ARG B 1 161 ? 40.702 5.181   27.324  1.00 45.87 ? 268  ARG B NE  1 
ATOM   4815 C  CZ  . ARG B 1 161 ? 39.694 5.215   28.192  1.00 45.04 ? 268  ARG B CZ  1 
ATOM   4816 N  NH1 . ARG B 1 161 ? 39.122 4.087   28.591  0.00 43.10 ? 268  ARG B NH1 1 
ATOM   4817 N  NH2 . ARG B 1 161 ? 39.257 6.377   28.658  0.00 42.87 ? 268  ARG B NH2 1 
ATOM   4818 N  N   . LEU B 1 162 ? 37.765 5.364   23.534  1.00 16.73 ? 269  LEU B N   1 
ATOM   4819 C  CA  . LEU B 1 162 ? 36.376 5.383   23.978  1.00 16.41 ? 269  LEU B CA  1 
ATOM   4820 C  C   . LEU B 1 162 ? 35.458 4.760   22.931  1.00 15.18 ? 269  LEU B C   1 
ATOM   4821 O  O   . LEU B 1 162 ? 34.546 4.026   23.283  1.00 16.51 ? 269  LEU B O   1 
ATOM   4822 C  CB  . LEU B 1 162 ? 35.915 6.801   24.312  1.00 17.99 ? 269  LEU B CB  1 
ATOM   4823 C  CG  . LEU B 1 162 ? 36.652 7.478   25.474  1.00 22.26 ? 269  LEU B CG  1 
ATOM   4824 C  CD1 . LEU B 1 162 ? 36.151 8.902   25.620  1.00 25.36 ? 269  LEU B CD1 1 
ATOM   4825 C  CD2 . LEU B 1 162 ? 36.461 6.704   26.772  1.00 20.04 ? 269  LEU B CD2 1 
ATOM   4826 N  N   . ALA B 1 163 ? 35.702 5.056   21.654  1.00 15.55 ? 270  ALA B N   1 
ATOM   4827 C  CA  . ALA B 1 163 ? 34.914 4.460   20.566  1.00 16.29 ? 270  ALA B CA  1 
ATOM   4828 C  C   . ALA B 1 163 ? 35.101 2.945   20.517  1.00 16.01 ? 270  ALA B C   1 
ATOM   4829 O  O   . ALA B 1 163 ? 34.145 2.197   20.321  1.00 13.90 ? 270  ALA B O   1 
ATOM   4830 C  CB  . ALA B 1 163 ? 35.286 5.074   19.227  1.00 16.07 ? 270  ALA B CB  1 
ATOM   4831 N  N   . GLU B 1 164 ? 36.338 2.497   20.698  1.00 16.82 ? 271  GLU B N   1 
ATOM   4832 C  CA  . GLU B 1 164 ? 36.627 1.069   20.696  1.00 16.27 ? 271  GLU B CA  1 
ATOM   4833 C  C   . GLU B 1 164 ? 35.873 0.387   21.838  1.00 16.99 ? 271  GLU B C   1 
ATOM   4834 O  O   . GLU B 1 164 ? 35.277 -0.688  21.663  1.00 17.80 ? 271  GLU B O   1 
ATOM   4835 C  CB  . GLU B 1 164 ? 38.129 0.817   20.818  1.00 19.68 ? 271  GLU B CB  1 
ATOM   4836 C  CG  . GLU B 1 164 ? 38.501 -0.645  20.696  1.00 33.23 ? 271  GLU B CG  1 
ATOM   4837 C  CD  . GLU B 1 164 ? 38.306 -1.175  19.281  1.00 39.14 ? 271  GLU B CD  1 
ATOM   4838 O  OE1 . GLU B 1 164 ? 38.921 -0.610  18.349  1.00 44.28 ? 271  GLU B OE1 1 
ATOM   4839 O  OE2 . GLU B 1 164 ? 37.534 -2.139  19.095  1.00 28.38 ? 271  GLU B OE2 1 
ATOM   4840 N  N   . GLU B 1 165 ? 35.881 1.043   22.995  1.00 17.36 ? 272  GLU B N   1 
ATOM   4841 C  CA  . GLU B 1 165 ? 35.127 0.579   24.149  1.00 18.15 ? 272  GLU B CA  1 
ATOM   4842 C  C   . GLU B 1 165 ? 33.628 0.496   23.830  1.00 16.60 ? 272  GLU B C   1 
ATOM   4843 O  O   . GLU B 1 165 ? 32.975 -0.460  24.214  1.00 17.12 ? 272  GLU B O   1 
ATOM   4844 C  CB  . GLU B 1 165 ? 35.367 1.499   25.343  1.00 21.49 ? 272  GLU B CB  1 
ATOM   4845 C  CG  . GLU B 1 165 ? 34.586 1.153   26.603  1.00 23.86 ? 272  GLU B CG  1 
ATOM   4846 C  CD  . GLU B 1 165 ? 34.894 2.113   27.751  1.00 38.54 ? 272  GLU B CD  1 
ATOM   4847 O  OE1 . GLU B 1 165 ? 35.561 1.692   28.720  1.00 37.83 ? 272  GLU B OE1 1 
ATOM   4848 O  OE2 . GLU B 1 165 ? 34.485 3.291   27.682  1.00 30.92 ? 272  GLU B OE2 1 
ATOM   4849 N  N   . ALA B 1 166 ? 33.100 1.487   23.111  1.00 14.75 ? 273  ALA B N   1 
ATOM   4850 C  CA  . ALA B 1 166 ? 31.680 1.500   22.770  1.00 16.15 ? 273  ALA B CA  1 
ATOM   4851 C  C   . ALA B 1 166 ? 31.328 0.362   21.799  1.00 16.02 ? 273  ALA B C   1 
ATOM   4852 O  O   . ALA B 1 166 ? 30.288 -0.288  21.951  1.00 13.96 ? 273  ALA B O   1 
ATOM   4853 C  CB  . ALA B 1 166 ? 31.269 2.858   22.185  1.00 11.91 ? 273  ALA B CB  1 
ATOM   4854 N  N   . PHE B 1 167 ? 32.188 0.116   20.812  1.00 13.34 ? 274  PHE B N   1 
ATOM   4855 C  CA  . PHE B 1 167 ? 31.976 -1.012  19.912  1.00 12.25 ? 274  PHE B CA  1 
ATOM   4856 C  C   . PHE B 1 167 ? 31.878 -2.309  20.709  1.00 16.59 ? 274  PHE B C   1 
ATOM   4857 O  O   . PHE B 1 167 ? 30.965 -3.110  20.497  1.00 15.85 ? 274  PHE B O   1 
ATOM   4858 C  CB  . PHE B 1 167 ? 33.115 -1.153  18.888  1.00 12.12 ? 274  PHE B CB  1 
ATOM   4859 C  CG  . PHE B 1 167 ? 32.962 -0.302  17.644  1.00 14.75 ? 274  PHE B CG  1 
ATOM   4860 C  CD1 . PHE B 1 167 ? 31.794 -0.334  16.888  1.00 14.14 ? 274  PHE B CD1 1 
ATOM   4861 C  CD2 . PHE B 1 167 ? 34.008 0.503   17.215  1.00 17.23 ? 274  PHE B CD2 1 
ATOM   4862 C  CE1 . PHE B 1 167 ? 31.669 0.421   15.733  1.00 11.73 ? 274  PHE B CE1 1 
ATOM   4863 C  CE2 . PHE B 1 167 ? 33.893 1.278   16.050  1.00 15.59 ? 274  PHE B CE2 1 
ATOM   4864 C  CZ  . PHE B 1 167 ? 32.717 1.232   15.307  1.00 11.92 ? 274  PHE B CZ  1 
ATOM   4865 N  N   . PHE B 1 168 ? 32.840 -2.526  21.606  1.00 13.80 ? 275  PHE B N   1 
ATOM   4866 C  CA  . PHE B 1 168 ? 32.903 -3.787  22.327  1.00 14.39 ? 275  PHE B CA  1 
ATOM   4867 C  C   . PHE B 1 168 ? 31.720 -3.959  23.282  1.00 16.43 ? 275  PHE B C   1 
ATOM   4868 O  O   . PHE B 1 168 ? 31.121 -5.030  23.352  1.00 15.74 ? 275  PHE B O   1 
ATOM   4869 C  CB  . PHE B 1 168 ? 34.220 -3.919  23.096  1.00 16.29 ? 275  PHE B CB  1 
ATOM   4870 C  CG  . PHE B 1 168 ? 34.331 -5.214  23.824  1.00 20.27 ? 275  PHE B CG  1 
ATOM   4871 C  CD1 . PHE B 1 168 ? 34.659 -6.375  23.142  1.00 24.53 ? 275  PHE B CD1 1 
ATOM   4872 C  CD2 . PHE B 1 168 ? 34.041 -5.290  25.172  1.00 21.29 ? 275  PHE B CD2 1 
ATOM   4873 C  CE1 . PHE B 1 168 ? 34.729 -7.595  23.806  1.00 25.12 ? 275  PHE B CE1 1 
ATOM   4874 C  CE2 . PHE B 1 168 ? 34.107 -6.502  25.843  1.00 24.61 ? 275  PHE B CE2 1 
ATOM   4875 C  CZ  . PHE B 1 168 ? 34.456 -7.656  25.162  1.00 23.34 ? 275  PHE B CZ  1 
ATOM   4876 N  N   . ARG B 1 169 ? 31.386 -2.901  24.010  1.00 14.32 ? 276  ARG B N   1 
ATOM   4877 C  CA  . ARG B 1 169 ? 30.185 -2.882  24.837  1.00 15.49 ? 276  ARG B CA  1 
ATOM   4878 C  C   . ARG B 1 169 ? 28.941 -3.204  23.995  1.00 15.49 ? 276  ARG B C   1 
ATOM   4879 O  O   . ARG B 1 169 ? 28.071 -3.957  24.428  1.00 15.50 ? 276  ARG B O   1 
ATOM   4880 C  CB  . ARG B 1 169 ? 30.034 -1.517  25.522  1.00 19.46 ? 276  ARG B CB  1 
ATOM   4881 C  CG  . ARG B 1 169 ? 28.703 -1.287  26.212  1.00 20.15 ? 276  ARG B CG  1 
ATOM   4882 C  CD  . ARG B 1 169 ? 28.733 -0.011  27.077  1.00 24.13 ? 276  ARG B CD  1 
ATOM   4883 N  NE  . ARG B 1 169 ? 27.804 -0.123  28.202  1.00 38.31 ? 276  ARG B NE  1 
ATOM   4884 C  CZ  . ARG B 1 169 ? 27.654 0.783   29.169  1.00 46.26 ? 276  ARG B CZ  1 
ATOM   4885 N  NH1 . ARG B 1 169 ? 26.771 0.560   30.134  1.00 40.11 ? 276  ARG B NH1 1 
ATOM   4886 N  NH2 . ARG B 1 169 ? 28.369 1.907   29.177  1.00 41.50 ? 276  ARG B NH2 1 
ATOM   4887 N  N   . GLY B 1 170 ? 28.874 -2.637  22.794  1.00 15.89 ? 277  GLY B N   1 
ATOM   4888 C  CA  . GLY B 1 170 ? 27.757 -2.876  21.886  1.00 13.97 ? 277  GLY B CA  1 
ATOM   4889 C  C   . GLY B 1 170 ? 27.570 -4.350  21.540  1.00 13.20 ? 277  GLY B C   1 
ATOM   4890 O  O   . GLY B 1 170 ? 26.466 -4.884  21.713  1.00 13.16 ? 277  GLY B O   1 
ATOM   4891 N  N   . VAL B 1 171 ? 28.622 -5.016  21.052  1.00 13.52 ? 278  VAL B N   1 
ATOM   4892 C  CA  . VAL B 1 171 ? 28.457 -6.408  20.630  1.00 10.45 ? 278  VAL B CA  1 
ATOM   4893 C  C   . VAL B 1 171 ? 28.356 -7.330  21.852  1.00 15.96 ? 278  VAL B C   1 
ATOM   4894 O  O   . VAL B 1 171 ? 27.764 -8.391  21.763  1.00 15.33 ? 278  VAL B O   1 
ATOM   4895 C  CB  . VAL B 1 171 ? 29.592 -6.915  19.679  1.00 12.59 ? 278  VAL B CB  1 
ATOM   4896 C  CG1 . VAL B 1 171 ? 29.650 -6.087  18.386  1.00 13.77 ? 278  VAL B CG1 1 
ATOM   4897 C  CG2 . VAL B 1 171 ? 30.963 -6.965  20.378  1.00 14.08 ? 278  VAL B CG2 1 
ATOM   4898 N  N   . SER B 1 172 ? 28.869 -6.903  23.005  1.00 16.84 ? 279  SER B N   1 
ATOM   4899 C  CA  . SER B 1 172 ? 28.797 -7.742  24.203  1.00 17.99 ? 279  SER B CA  1 
ATOM   4900 C  C   . SER B 1 172 ? 27.514 -7.528  25.035  1.00 18.95 ? 279  SER B C   1 
ATOM   4901 O  O   . SER B 1 172 ? 27.011 -8.488  25.618  1.00 20.90 ? 279  SER B O   1 
ATOM   4902 C  CB  . SER B 1 172 ? 30.047 -7.540  25.076  1.00 15.88 ? 279  SER B CB  1 
ATOM   4903 O  OG  . SER B 1 172 ? 30.098 -6.241  25.617  1.00 25.49 ? 279  SER B OG  1 
ATOM   4904 N  N   . GLN B 1 173 ? 26.964 -6.309  25.063  1.00 19.04 ? 280  GLN B N   1 
ATOM   4905 C  CA  . GLN B 1 173 ? 25.758 -6.009  25.866  1.00 17.12 ? 280  GLN B CA  1 
ATOM   4906 C  C   . GLN B 1 173 ? 24.521 -5.558  25.091  1.00 18.13 ? 280  GLN B C   1 
ATOM   4907 O  O   . GLN B 1 173 ? 23.408 -5.621  25.604  1.00 17.28 ? 280  GLN B O   1 
ATOM   4908 C  CB  . GLN B 1 173 ? 26.049 -4.904  26.884  1.00 19.57 ? 280  GLN B CB  1 
ATOM   4909 C  CG  . GLN B 1 173 ? 26.978 -5.273  27.976  1.00 24.72 ? 280  GLN B CG  1 
ATOM   4910 C  CD  . GLN B 1 173 ? 27.323 -4.091  28.872  1.00 29.46 ? 280  GLN B CD  1 
ATOM   4911 O  OE1 . GLN B 1 173 ? 28.466 -3.643  28.884  1.00 34.99 ? 280  GLN B OE1 1 
ATOM   4912 N  NE2 . GLN B 1 173 ? 26.347 -3.595  29.631  1.00 28.15 ? 280  GLN B NE2 1 
ATOM   4913 N  N   . GLY B 1 174 ? 24.709 -5.033  23.887  1.00 17.27 ? 281  GLY B N   1 
ATOM   4914 C  CA  . GLY B 1 174 ? 23.585 -4.508  23.128  1.00 11.88 ? 281  GLY B CA  1 
ATOM   4915 C  C   . GLY B 1 174 ? 22.547 -5.580  22.857  1.00 15.63 ? 281  GLY B C   1 
ATOM   4916 O  O   . GLY B 1 174 ? 22.865 -6.765  22.873  1.00 15.05 ? 281  GLY B O   1 
ATOM   4917 N  N   . ARG B 1 175 ? 21.314 -5.152  22.593  1.00 17.00 ? 282  ARG B N   1 
ATOM   4918 C  CA  . ARG B 1 175 ? 20.191 -6.051  22.320  1.00 17.86 ? 282  ARG B CA  1 
ATOM   4919 C  C   . ARG B 1 175 ? 20.075 -7.189  23.331  1.00 17.36 ? 282  ARG B C   1 
ATOM   4920 O  O   . ARG B 1 175 ? 19.940 -8.346  22.947  1.00 19.11 ? 282  ARG B O   1 
ATOM   4921 C  CB  . ARG B 1 175 ? 20.287 -6.642  20.899  1.00 15.45 ? 282  ARG B CB  1 
ATOM   4922 C  CG  . ARG B 1 175 ? 19.921 -5.676  19.785  1.00 24.46 ? 282  ARG B CG  1 
ATOM   4923 C  CD  . ARG B 1 175 ? 19.722 -6.373  18.430  1.00 13.68 ? 282  ARG B CD  1 
ATOM   4924 N  NE  . ARG B 1 175 ? 20.879 -7.157  18.031  1.00 19.78 ? 282  ARG B NE  1 
ATOM   4925 C  CZ  . ARG B 1 175 ? 20.831 -8.427  17.633  1.00 15.27 ? 282  ARG B CZ  1 
ATOM   4926 N  NH1 . ARG B 1 175 ? 19.676 -9.077  17.587  1.00 12.64 ? 282  ARG B NH1 1 
ATOM   4927 N  NH2 . ARG B 1 175 ? 21.947 -9.048  17.294  1.00 11.86 ? 282  ARG B NH2 1 
ATOM   4928 N  N   . GLY B 1 176 ? 20.133 -6.857  24.614  1.00 17.80 ? 283  GLY B N   1 
ATOM   4929 C  CA  . GLY B 1 176 ? 20.031 -7.846  25.672  1.00 19.19 ? 283  GLY B CA  1 
ATOM   4930 C  C   . GLY B 1 176 ? 21.128 -8.897  25.653  1.00 23.64 ? 283  GLY B C   1 
ATOM   4931 O  O   . GLY B 1 176 ? 20.936 -9.995  26.147  1.00 22.44 ? 283  GLY B O   1 
ATOM   4932 N  N   . GLY B 1 177 ? 22.281 -8.562  25.085  1.00 19.36 ? 284  GLY B N   1 
ATOM   4933 C  CA  . GLY B 1 177 ? 23.383 -9.503  25.006  1.00 15.06 ? 284  GLY B CA  1 
ATOM   4934 C  C   . GLY B 1 177 ? 23.567 -10.177 23.654  1.00 16.18 ? 284  GLY B C   1 
ATOM   4935 O  O   . GLY B 1 177 ? 24.561 -10.853 23.425  1.00 15.95 ? 284  GLY B O   1 
ATOM   4936 N  N   . LEU B 1 178 ? 22.618 -9.999  22.747  1.00 14.79 ? 285  LEU B N   1 
ATOM   4937 C  CA  . LEU B 1 178 ? 22.791 -10.510 21.385  1.00 12.72 ? 285  LEU B CA  1 
ATOM   4938 C  C   . LEU B 1 178 ? 23.799 -9.685  20.572  1.00 17.80 ? 285  LEU B C   1 
ATOM   4939 O  O   . LEU B 1 178 ? 24.392 -10.179 19.617  1.00 13.90 ? 285  LEU B O   1 
ATOM   4940 C  CB  . LEU B 1 178 ? 21.450 -10.550 20.665  1.00 11.95 ? 285  LEU B CB  1 
ATOM   4941 C  CG  . LEU B 1 178 ? 20.421 -11.432 21.362  1.00 12.33 ? 285  LEU B CG  1 
ATOM   4942 C  CD1 . LEU B 1 178 ? 19.053 -11.301 20.698  1.00 15.10 ? 285  LEU B CD1 1 
ATOM   4943 C  CD2 . LEU B 1 178 ? 20.899 -12.877 21.325  1.00 11.96 ? 285  LEU B CD2 1 
ATOM   4944 N  N   . GLY B 1 179 ? 23.977 -8.422  20.938  1.00 12.39 ? 286  GLY B N   1 
ATOM   4945 C  CA  . GLY B 1 179 ? 24.969 -7.597  20.277  1.00 10.73 ? 286  GLY B CA  1 
ATOM   4946 C  C   . GLY B 1 179 ? 24.426 -6.604  19.269  1.00 13.09 ? 286  GLY B C   1 
ATOM   4947 O  O   . GLY B 1 179 ? 23.690 -6.964  18.349  1.00 13.34 ? 286  GLY B O   1 
ATOM   4948 N  N   . SER B 1 180 ? 24.797 -5.341  19.445  1.00 13.78 ? 287  SER B N   1 
ATOM   4949 C  CA  . SER B 1 180 ? 24.466 -4.296  18.479  1.00 14.30 ? 287  SER B CA  1 
ATOM   4950 C  C   . SER B 1 180 ? 24.968 -4.682  17.105  1.00 11.43 ? 287  SER B C   1 
ATOM   4951 O  O   . SER B 1 180 ? 26.027 -5.291  16.983  1.00 12.59 ? 287  SER B O   1 
ATOM   4952 C  CB  . SER B 1 180 ? 25.091 -2.952  18.884  1.00 12.86 ? 287  SER B CB  1 
ATOM   4953 O  OG  . SER B 1 180 ? 24.598 -2.505  20.127  1.00 12.15 ? 287  SER B OG  1 
ATOM   4954 N  N   . ILE B 1 181 ? 24.216 -4.326  16.071  1.00 10.07 ? 288  ILE B N   1 
ATOM   4955 C  CA  . ILE B 1 181 ? 24.673 -4.509  14.697  1.00 12.59 ? 288  ILE B CA  1 
ATOM   4956 C  C   . ILE B 1 181 ? 25.193 -3.173  14.160  1.00 11.98 ? 288  ILE B C   1 
ATOM   4957 O  O   . ILE B 1 181 ? 24.422 -2.220  14.069  1.00 10.63 ? 288  ILE B O   1 
ATOM   4958 C  CB  . ILE B 1 181 ? 23.536 -5.026  13.781  1.00 10.16 ? 288  ILE B CB  1 
ATOM   4959 C  CG1 . ILE B 1 181 ? 22.897 -6.298  14.357  1.00 16.45 ? 288  ILE B CG1 1 
ATOM   4960 C  CG2 . ILE B 1 181 ? 24.044 -5.291  12.379  1.00 10.73 ? 288  ILE B CG2 1 
ATOM   4961 C  CD1 . ILE B 1 181 ? 23.814 -7.480  14.357  1.00 16.59 ? 288  ILE B CD1 1 
ATOM   4962 N  N   . PHE B 1 182 ? 26.490 -3.098  13.833  1.00 9.84  ? 289  PHE B N   1 
ATOM   4963 C  CA  . PHE B 1 182 ? 27.101 -1.868  13.312  1.00 10.20 ? 289  PHE B CA  1 
ATOM   4964 C  C   . PHE B 1 182 ? 27.378 -2.021  11.818  1.00 12.31 ? 289  PHE B C   1 
ATOM   4965 O  O   . PHE B 1 182 ? 28.129 -2.900  11.398  1.00 12.21 ? 289  PHE B O   1 
ATOM   4966 C  CB  . PHE B 1 182 ? 28.421 -1.520  14.036  1.00 10.75 ? 289  PHE B CB  1 
ATOM   4967 C  CG  . PHE B 1 182 ? 28.262 -1.253  15.505  1.00 10.97 ? 289  PHE B CG  1 
ATOM   4968 C  CD1 . PHE B 1 182 ? 27.678 -0.064  15.952  1.00 7.11  ? 289  PHE B CD1 1 
ATOM   4969 C  CD2 . PHE B 1 182 ? 28.703 -2.185  16.449  1.00 12.60 ? 289  PHE B CD2 1 
ATOM   4970 C  CE1 . PHE B 1 182 ? 27.516 0.180   17.307  1.00 11.22 ? 289  PHE B CE1 1 
ATOM   4971 C  CE2 . PHE B 1 182 ? 28.544 -1.944  17.810  1.00 11.64 ? 289  PHE B CE2 1 
ATOM   4972 C  CZ  . PHE B 1 182 ? 27.949 -0.763  18.238  1.00 12.41 ? 289  PHE B CZ  1 
ATOM   4973 N  N   . VAL B 1 183 ? 26.771 -1.172  11.005  1.00 9.60  ? 290  VAL B N   1 
ATOM   4974 C  CA  . VAL B 1 183 ? 26.921 -1.303  9.565   1.00 9.18  ? 290  VAL B CA  1 
ATOM   4975 C  C   . VAL B 1 183 ? 27.708 -0.110  9.041   1.00 10.96 ? 290  VAL B C   1 
ATOM   4976 O  O   . VAL B 1 183 ? 27.386 1.025   9.375   1.00 12.97 ? 290  VAL B O   1 
ATOM   4977 C  CB  . VAL B 1 183 ? 25.549 -1.386  8.856   1.00 11.96 ? 290  VAL B CB  1 
ATOM   4978 C  CG1 . VAL B 1 183 ? 25.727 -1.653  7.353   1.00 12.15 ? 290  VAL B CG1 1 
ATOM   4979 C  CG2 . VAL B 1 183 ? 24.678 -2.465  9.495   1.00 10.21 ? 290  VAL B CG2 1 
ATOM   4980 N  N   . TRP B 1 184 ? 28.722 -0.358  8.217   1.00 11.30 ? 291  TRP B N   1 
ATOM   4981 C  CA  . TRP B 1 184 ? 29.648 0.709   7.821   1.00 11.00 ? 291  TRP B CA  1 
ATOM   4982 C  C   . TRP B 1 184 ? 29.789 0.838   6.310   1.00 13.02 ? 291  TRP B C   1 
ATOM   4983 O  O   . TRP B 1 184 ? 29.763 -0.152  5.575   1.00 14.97 ? 291  TRP B O   1 
ATOM   4984 C  CB  . TRP B 1 184 ? 31.042 0.489   8.457   1.00 13.47 ? 291  TRP B CB  1 
ATOM   4985 C  CG  . TRP B 1 184 ? 31.561 1.759   9.040   1.00 13.46 ? 291  TRP B CG  1 
ATOM   4986 C  CD1 . TRP B 1 184 ? 32.267 2.743   8.387   1.00 9.92  ? 291  TRP B CD1 1 
ATOM   4987 C  CD2 . TRP B 1 184 ? 31.333 2.239   10.365  1.00 9.03  ? 291  TRP B CD2 1 
ATOM   4988 N  NE1 . TRP B 1 184 ? 32.503 3.794   9.242   1.00 8.84  ? 291  TRP B NE1 1 
ATOM   4989 C  CE2 . TRP B 1 184 ? 31.937 3.512   10.457  1.00 12.16 ? 291  TRP B CE2 1 
ATOM   4990 C  CE3 . TRP B 1 184 ? 30.671 1.716   11.486  1.00 10.47 ? 291  TRP B CE3 1 
ATOM   4991 C  CZ2 . TRP B 1 184 ? 31.908 4.264   11.634  1.00 9.46  ? 291  TRP B CZ2 1 
ATOM   4992 C  CZ3 . TRP B 1 184 ? 30.649 2.456   12.641  1.00 9.57  ? 291  TRP B CZ3 1 
ATOM   4993 C  CH2 . TRP B 1 184 ? 31.267 3.721   12.710  1.00 9.13  ? 291  TRP B CH2 1 
ATOM   4994 N  N   . ALA B 1 185 ? 29.948 2.072   5.850   1.00 10.79 ? 292  ALA B N   1 
ATOM   4995 C  CA  . ALA B 1 185 ? 30.238 2.364   4.442   1.00 11.06 ? 292  ALA B CA  1 
ATOM   4996 C  C   . ALA B 1 185 ? 31.730 2.213   4.191   1.00 11.58 ? 292  ALA B C   1 
ATOM   4997 O  O   . ALA B 1 185 ? 32.528 2.795   4.925   1.00 11.42 ? 292  ALA B O   1 
ATOM   4998 C  CB  . ALA B 1 185 ? 29.790 3.780   4.086   1.00 8.84  ? 292  ALA B CB  1 
ATOM   4999 N  N   . SER B 1 186 ? 32.126 1.459   3.167   1.00 10.28 ? 293  SER B N   1 
ATOM   5000 C  CA  . SER B 1 186 ? 33.533 1.080   3.082   1.00 13.55 ? 293  SER B CA  1 
ATOM   5001 C  C   . SER B 1 186 ? 34.482 2.202   2.638   1.00 12.63 ? 293  SER B C   1 
ATOM   5002 O  O   . SER B 1 186 ? 35.683 2.112   2.896   1.00 15.24 ? 293  SER B O   1 
ATOM   5003 C  CB  . SER B 1 186 ? 33.723 -0.133  2.161   1.00 12.06 ? 293  SER B CB  1 
ATOM   5004 O  OG  . SER B 1 186 ? 33.362 0.162   0.836   1.00 15.73 ? 293  SER B OG  1 
ATOM   5005 N  N   . GLY B 1 187 ? 33.962 3.265   2.023   1.00 11.73 ? 294  GLY B N   1 
ATOM   5006 C  CA  . GLY B 1 187 ? 34.811 4.391   1.659   1.00 12.67 ? 294  GLY B CA  1 
ATOM   5007 C  C   . GLY B 1 187 ? 34.663 4.857   0.219   1.00 12.88 ? 294  GLY B C   1 
ATOM   5008 O  O   . GLY B 1 187 ? 34.337 4.075   -0.673  1.00 13.51 ? 294  GLY B O   1 
ATOM   5009 N  N   . ASN B 1 188 ? 34.909 6.141   -0.007  1.00 13.22 ? 295  ASN B N   1 
ATOM   5010 C  CA  . ASN B 1 188 ? 34.749 6.720   -1.328  1.00 14.00 ? 295  ASN B CA  1 
ATOM   5011 C  C   . ASN B 1 188 ? 36.089 7.167   -1.934  1.00 14.04 ? 295  ASN B C   1 
ATOM   5012 O  O   . ASN B 1 188 ? 36.117 8.002   -2.818  1.00 15.29 ? 295  ASN B O   1 
ATOM   5013 C  CB  . ASN B 1 188 ? 33.790 7.920   -1.281  1.00 11.85 ? 295  ASN B CB  1 
ATOM   5014 C  CG  . ASN B 1 188 ? 32.357 7.535   -0.909  1.00 13.85 ? 295  ASN B CG  1 
ATOM   5015 O  OD1 . ASN B 1 188 ? 31.919 6.411   -1.121  1.00 13.65 ? 295  ASN B OD1 1 
ATOM   5016 N  ND2 . ASN B 1 188 ? 31.618 8.496   -0.375  1.00 17.48 ? 295  ASN B ND2 1 
ATOM   5017 N  N   . GLY B 1 189 ? 37.193 6.609   -1.459  1.00 13.81 ? 296  GLY B N   1 
ATOM   5018 C  CA  . GLY B 1 189 ? 38.503 7.042   -1.915  1.00 16.60 ? 296  GLY B CA  1 
ATOM   5019 C  C   . GLY B 1 189 ? 39.088 6.375   -3.155  1.00 16.18 ? 296  GLY B C   1 
ATOM   5020 O  O   . GLY B 1 189 ? 40.305 6.350   -3.329  1.00 17.88 ? 296  GLY B O   1 
ATOM   5021 N  N   . GLY B 1 190 ? 38.236 5.847   -4.025  1.00 15.69 ? 297  GLY B N   1 
ATOM   5022 C  CA  . GLY B 1 190 ? 38.697 5.087   -5.182  1.00 17.93 ? 297  GLY B CA  1 
ATOM   5023 C  C   . GLY B 1 190 ? 39.600 5.846   -6.145  1.00 22.31 ? 297  GLY B C   1 
ATOM   5024 O  O   . GLY B 1 190 ? 40.587 5.305   -6.647  1.00 23.72 ? 297  GLY B O   1 
ATOM   5025 N  N   . ARG B 1 191 ? 39.277 7.107   -6.398  1.00 20.03 ? 298  ARG B N   1 
ATOM   5026 C  CA  . ARG B 1 191 ? 40.065 7.900   -7.330  1.00 22.58 ? 298  ARG B CA  1 
ATOM   5027 C  C   . ARG B 1 191 ? 41.472 8.172   -6.793  1.00 23.34 ? 298  ARG B C   1 
ATOM   5028 O  O   . ARG B 1 191 ? 42.390 8.428   -7.565  1.00 23.34 ? 298  ARG B O   1 
ATOM   5029 C  CB  . ARG B 1 191 ? 39.350 9.213   -7.650  1.00 26.75 ? 298  ARG B CB  1 
ATOM   5030 C  CG  . ARG B 1 191 ? 39.913 9.935   -8.850  1.00 40.52 ? 298  ARG B CG  1 
ATOM   5031 C  CD  . ARG B 1 191 ? 38.819 10.451  -9.764  0.00 41.74 ? 298  ARG B CD  1 
ATOM   5032 N  NE  . ARG B 1 191 ? 38.564 11.873  -9.559  0.00 50.94 ? 298  ARG B NE  1 
ATOM   5033 C  CZ  . ARG B 1 191 ? 37.955 12.653  -10.445 0.00 53.33 ? 298  ARG B CZ  1 
ATOM   5034 N  NH1 . ARG B 1 191 ? 37.765 13.938  -10.181 0.00 54.99 ? 298  ARG B NH1 1 
ATOM   5035 N  NH2 . ARG B 1 191 ? 37.542 12.147  -11.599 0.00 51.23 ? 298  ARG B NH2 1 
ATOM   5036 N  N   . GLU B 1 192 ? 41.643 8.093   -5.475  1.00 21.13 ? 299  GLU B N   1 
ATOM   5037 C  CA  . GLU B 1 192 ? 42.951 8.281   -4.861  1.00 18.93 ? 299  GLU B CA  1 
ATOM   5038 C  C   . GLU B 1 192 ? 43.616 6.945   -4.552  1.00 20.21 ? 299  GLU B C   1 
ATOM   5039 O  O   . GLU B 1 192 ? 44.628 6.898   -3.849  1.00 21.24 ? 299  GLU B O   1 
ATOM   5040 C  CB  . GLU B 1 192 ? 42.842 9.111   -3.569  1.00 21.35 ? 299  GLU B CB  1 
ATOM   5041 C  CG  . GLU B 1 192 ? 41.855 10.261  -3.635  1.00 24.42 ? 299  GLU B CG  1 
ATOM   5042 C  CD  . GLU B 1 192 ? 42.139 11.216  -4.780  1.00 39.14 ? 299  GLU B CD  1 
ATOM   5043 O  OE1 . GLU B 1 192 ? 43.315 11.311  -5.208  1.00 41.66 ? 299  GLU B OE1 1 
ATOM   5044 O  OE2 . GLU B 1 192 ? 41.186 11.871  -5.257  1.00 40.03 ? 299  GLU B OE2 1 
ATOM   5045 N  N   . HIS B 1 193 ? 43.034 5.873   -5.079  1.00 17.40 ? 300  HIS B N   1 
ATOM   5046 C  CA  . HIS B 1 193 ? 43.480 4.505   -4.823  1.00 21.48 ? 300  HIS B CA  1 
ATOM   5047 C  C   . HIS B 1 193 ? 43.576 4.174   -3.336  1.00 20.85 ? 300  HIS B C   1 
ATOM   5048 O  O   . HIS B 1 193 ? 44.457 3.438   -2.918  1.00 21.25 ? 300  HIS B O   1 
ATOM   5049 C  CB  . HIS B 1 193 ? 44.828 4.248   -5.504  1.00 28.04 ? 300  HIS B CB  1 
ATOM   5050 C  CG  . HIS B 1 193 ? 44.734 4.151   -6.993  1.00 35.26 ? 300  HIS B CG  1 
ATOM   5051 N  ND1 . HIS B 1 193 ? 44.797 5.256   -7.816  1.00 39.33 ? 300  HIS B ND1 1 
ATOM   5052 C  CD2 . HIS B 1 193 ? 44.561 3.084   -7.808  1.00 37.43 ? 300  HIS B CD2 1 
ATOM   5053 C  CE1 . HIS B 1 193 ? 44.674 4.873   -9.073  1.00 37.02 ? 300  HIS B CE1 1 
ATOM   5054 N  NE2 . HIS B 1 193 ? 44.530 3.559   -9.095  1.00 43.76 ? 300  HIS B NE2 1 
ATOM   5055 N  N   . ASP B 1 194 ? 42.652 4.709   -2.545  1.00 17.97 ? 301  ASP B N   1 
ATOM   5056 C  CA  . ASP B 1 194 ? 42.622 4.457   -1.116  1.00 16.52 ? 301  ASP B CA  1 
ATOM   5057 C  C   . ASP B 1 194 ? 42.336 2.964   -0.851  1.00 14.41 ? 301  ASP B C   1 
ATOM   5058 O  O   . ASP B 1 194 ? 41.777 2.281   -1.692  1.00 19.83 ? 301  ASP B O   1 
ATOM   5059 C  CB  . ASP B 1 194 ? 41.568 5.358   -0.469  1.00 17.40 ? 301  ASP B CB  1 
ATOM   5060 C  CG  . ASP B 1 194 ? 41.756 5.518   1.014   1.00 17.92 ? 301  ASP B CG  1 
ATOM   5061 O  OD1 . ASP B 1 194 ? 42.818 5.126   1.550   1.00 18.25 ? 301  ASP B OD1 1 
ATOM   5062 O  OD2 . ASP B 1 194 ? 40.834 6.063   1.642   1.00 15.20 ? 301  ASP B OD2 1 
ATOM   5063 N  N   . SER B 1 195 ? 42.737 2.470   0.310   1.00 17.03 ? 302  SER B N   1 
ATOM   5064 C  CA  . SER B 1 195 ? 42.456 1.091   0.722   1.00 18.74 ? 302  SER B CA  1 
ATOM   5065 C  C   . SER B 1 195 ? 41.633 1.080   1.995   1.00 14.16 ? 302  SER B C   1 
ATOM   5066 O  O   . SER B 1 195 ? 42.005 1.719   2.968   1.00 18.20 ? 302  SER B O   1 
ATOM   5067 C  CB  . SER B 1 195 ? 43.749 0.318   0.957   1.00 21.88 ? 302  SER B CB  1 
ATOM   5068 O  OG  . SER B 1 195 ? 43.562 -0.631  2.000   1.00 26.42 ? 302  SER B OG  1 
ATOM   5069 N  N   . CYS B 1 196 ? 40.528 0.350   2.022   1.00 12.75 ? 303  CYS B N   1 
ATOM   5070 C  CA  . CYS B 1 196 ? 39.676 0.435   3.196   1.00 16.63 ? 303  CYS B CA  1 
ATOM   5071 C  C   . CYS B 1 196 ? 40.266 -0.333  4.396   1.00 18.18 ? 303  CYS B C   1 
ATOM   5072 O  O   . CYS B 1 196 ? 39.733 -0.224  5.498   1.00 16.74 ? 303  CYS B O   1 
ATOM   5073 C  CB  . CYS B 1 196 ? 38.231 -0.022  2.894   1.00 17.88 ? 303  CYS B CB  1 
ATOM   5074 S  SG  . CYS B 1 196 ? 37.982 -1.274  1.625   1.00 24.64 ? 303  CYS B SG  1 
ATOM   5075 N  N   . ASN B 1 197 ? 41.390 -1.041  4.223   1.00 14.54 ? 304  ASN B N   1 
ATOM   5076 C  CA  . ASN B 1 197 ? 42.078 -1.619  5.391   1.00 13.89 ? 304  ASN B CA  1 
ATOM   5077 C  C   . ASN B 1 197 ? 42.898 -0.570  6.160   1.00 19.71 ? 304  ASN B C   1 
ATOM   5078 O  O   . ASN B 1 197 ? 43.435 -0.860  7.221   1.00 18.39 ? 304  ASN B O   1 
ATOM   5079 C  CB  . ASN B 1 197 ? 42.998 -2.784  5.000   1.00 13.92 ? 304  ASN B CB  1 
ATOM   5080 C  CG  . ASN B 1 197 ? 42.240 -4.102  4.797   1.00 22.39 ? 304  ASN B CG  1 
ATOM   5081 O  OD1 . ASN B 1 197 ? 41.003 -4.140  4.778   1.00 26.83 ? 304  ASN B OD1 1 
ATOM   5082 N  ND2 . ASN B 1 197 ? 42.983 -5.180  4.626   1.00 21.05 ? 304  ASN B ND2 1 
ATOM   5083 N  N   . CYS B 1 198 ? 42.993 0.645   5.628   1.00 15.66 ? 305  CYS B N   1 
ATOM   5084 C  CA  . CYS B 1 198 ? 43.657 1.741   6.340   1.00 15.45 ? 305  CYS B CA  1 
ATOM   5085 C  C   . CYS B 1 198 ? 42.660 2.550   7.149   1.00 16.23 ? 305  CYS B C   1 
ATOM   5086 O  O   . CYS B 1 198 ? 42.970 3.627   7.649   1.00 16.09 ? 305  CYS B O   1 
ATOM   5087 C  CB  . CYS B 1 198 ? 44.394 2.665   5.361   1.00 16.62 ? 305  CYS B CB  1 
ATOM   5088 S  SG  . CYS B 1 198 ? 45.838 1.867   4.627   1.00 19.89 ? 305  CYS B SG  1 
ATOM   5089 N  N   . ASP B 1 199 ? 41.459 2.006   7.275   1.00 15.29 ? 306  ASP B N   1 
ATOM   5090 C  CA  . ASP B 1 199 ? 40.348 2.663   7.958   1.00 13.11 ? 306  ASP B CA  1 
ATOM   5091 C  C   . ASP B 1 199 ? 39.916 1.720   9.071   1.00 16.64 ? 306  ASP B C   1 
ATOM   5092 O  O   . ASP B 1 199 ? 39.370 0.649   8.811   1.00 17.46 ? 306  ASP B O   1 
ATOM   5093 C  CB  . ASP B 1 199 ? 39.242 2.975   6.934   1.00 15.48 ? 306  ASP B CB  1 
ATOM   5094 C  CG  . ASP B 1 199 ? 37.896 3.391   7.553   1.00 16.73 ? 306  ASP B CG  1 
ATOM   5095 O  OD1 . ASP B 1 199 ? 37.598 3.138   8.742   1.00 12.09 ? 306  ASP B OD1 1 
ATOM   5096 O  OD2 . ASP B 1 199 ? 37.106 3.992   6.792   1.00 19.68 ? 306  ASP B OD2 1 
ATOM   5097 N  N   . GLY B 1 200 ? 40.166 2.111   10.318  1.00 14.83 ? 307  GLY B N   1 
ATOM   5098 C  CA  . GLY B 1 200 ? 39.935 1.213   11.435  1.00 14.82 ? 307  GLY B CA  1 
ATOM   5099 C  C   . GLY B 1 200 ? 38.466 0.955   11.751  1.00 16.40 ? 307  GLY B C   1 
ATOM   5100 O  O   . GLY B 1 200 ? 38.136 0.046   12.493  1.00 12.93 ? 307  GLY B O   1 
ATOM   5101 N  N   . TYR B 1 201 ? 37.571 1.760   11.192  1.00 14.73 ? 308  TYR B N   1 
ATOM   5102 C  CA  . TYR B 1 201 ? 36.156 1.520   11.424  1.00 13.41 ? 308  TYR B CA  1 
ATOM   5103 C  C   . TYR B 1 201 ? 35.681 0.389   10.523  1.00 14.93 ? 308  TYR B C   1 
ATOM   5104 O  O   . TYR B 1 201 ? 35.052 -0.552  10.998  1.00 15.23 ? 308  TYR B O   1 
ATOM   5105 C  CB  . TYR B 1 201 ? 35.339 2.790   11.201  1.00 8.02  ? 308  TYR B CB  1 
ATOM   5106 C  CG  . TYR B 1 201 ? 35.777 3.879   12.139  1.00 11.77 ? 308  TYR B CG  1 
ATOM   5107 C  CD1 . TYR B 1 201 ? 36.862 4.692   11.820  1.00 13.43 ? 308  TYR B CD1 1 
ATOM   5108 C  CD2 . TYR B 1 201 ? 35.138 4.077   13.356  1.00 10.51 ? 308  TYR B CD2 1 
ATOM   5109 C  CE1 . TYR B 1 201 ? 37.293 5.678   12.670  1.00 15.51 ? 308  TYR B CE1 1 
ATOM   5110 C  CE2 . TYR B 1 201 ? 35.560 5.075   14.224  1.00 13.85 ? 308  TYR B CE2 1 
ATOM   5111 C  CZ  . TYR B 1 201 ? 36.647 5.872   13.869  1.00 14.74 ? 308  TYR B CZ  1 
ATOM   5112 O  OH  . TYR B 1 201 ? 37.104 6.861   14.701  1.00 13.99 ? 308  TYR B OH  1 
ATOM   5113 N  N   . THR B 1 202 ? 35.995 0.480   9.231   1.00 13.45 ? 309  THR B N   1 
ATOM   5114 C  CA  . THR B 1 202 ? 35.605 -0.558  8.285   1.00 13.82 ? 309  THR B CA  1 
ATOM   5115 C  C   . THR B 1 202 ? 36.359 -1.859  8.586   1.00 16.61 ? 309  THR B C   1 
ATOM   5116 O  O   . THR B 1 202 ? 35.798 -2.947  8.518   1.00 16.17 ? 309  THR B O   1 
ATOM   5117 C  CB  . THR B 1 202 ? 35.845 -0.101  6.823   1.00 19.24 ? 309  THR B CB  1 
ATOM   5118 O  OG1 . THR B 1 202 ? 37.209 0.303   6.644   1.00 18.32 ? 309  THR B OG1 1 
ATOM   5119 C  CG2 . THR B 1 202 ? 34.964 1.088   6.507   1.00 15.84 ? 309  THR B CG2 1 
ATOM   5120 N  N   . ASN B 1 203 ? 37.624 -1.715  8.957   1.00 16.27 ? 310  ASN B N   1 
ATOM   5121 C  CA  . ASN B 1 203 ? 38.537 -2.810  9.305   1.00 16.94 ? 310  ASN B CA  1 
ATOM   5122 C  C   . ASN B 1 203 ? 38.114 -3.633  10.538  1.00 18.71 ? 310  ASN B C   1 
ATOM   5123 O  O   . ASN B 1 203 ? 38.567 -4.754  10.737  1.00 19.76 ? 310  ASN B O   1 
ATOM   5124 C  CB  . ASN B 1 203 ? 39.923 -2.193  9.557   1.00 23.47 ? 310  ASN B CB  1 
ATOM   5125 C  CG  . ASN B 1 203 ? 41.052 -3.129  9.287   1.00 23.28 ? 310  ASN B CG  1 
ATOM   5126 O  OD1 . ASN B 1 203 ? 41.034 -3.910  8.338   1.00 28.04 ? 310  ASN B OD1 1 
ATOM   5127 N  ND2 . ASN B 1 203 ? 42.062 -3.061  10.134  1.00 31.83 ? 310  ASN B ND2 1 
ATOM   5128 N  N   . SER B 1 204 ? 37.272 -3.049  11.385  1.00 16.67 ? 311  SER B N   1 
ATOM   5129 C  CA  . SER B 1 204 ? 36.871 -3.670  12.645  1.00 13.61 ? 311  SER B CA  1 
ATOM   5130 C  C   . SER B 1 204 ? 36.088 -4.958  12.427  1.00 14.83 ? 311  SER B C   1 
ATOM   5131 O  O   . SER B 1 204 ? 35.282 -5.049  11.501  1.00 13.59 ? 311  SER B O   1 
ATOM   5132 C  CB  . SER B 1 204 ? 36.031 -2.695  13.476  1.00 12.23 ? 311  SER B CB  1 
ATOM   5133 O  OG  . SER B 1 204 ? 35.564 -3.291  14.668  1.00 13.30 ? 311  SER B OG  1 
ATOM   5134 N  N   . ILE B 1 205 ? 36.289 -5.947  13.291  1.00 12.73 ? 312  ILE B N   1 
ATOM   5135 C  CA  . ILE B 1 205 ? 35.460 -7.153  13.203  1.00 13.43 ? 312  ILE B CA  1 
ATOM   5136 C  C   . ILE B 1 205 ? 34.036 -6.874  13.674  1.00 13.47 ? 312  ILE B C   1 
ATOM   5137 O  O   . ILE B 1 205 ? 33.120 -7.627  13.347  1.00 14.01 ? 312  ILE B O   1 
ATOM   5138 C  CB  . ILE B 1 205 ? 36.043 -8.345  14.039  1.00 17.09 ? 312  ILE B CB  1 
ATOM   5139 C  CG1 . ILE B 1 205 ? 35.907 -8.082  15.535  1.00 15.10 ? 312  ILE B CG1 1 
ATOM   5140 C  CG2 . ILE B 1 205 ? 37.505 -8.629  13.637  1.00 13.88 ? 312  ILE B CG2 1 
ATOM   5141 C  CD1 . ILE B 1 205 ? 36.290 -9.270  16.422  1.00 14.45 ? 312  ILE B CD1 1 
ATOM   5142 N  N   . TYR B 1 206 ? 33.851 -5.803  14.444  1.00 12.84 ? 313  TYR B N   1 
ATOM   5143 C  CA  . TYR B 1 206 ? 32.538 -5.474  15.012  1.00 14.71 ? 313  TYR B CA  1 
ATOM   5144 C  C   . TYR B 1 206 ? 31.599 -4.776  14.024  1.00 14.28 ? 313  TYR B C   1 
ATOM   5145 O  O   . TYR B 1 206 ? 30.415 -4.605  14.322  1.00 13.25 ? 313  TYR B O   1 
ATOM   5146 C  CB  . TYR B 1 206 ? 32.688 -4.580  16.241  1.00 11.63 ? 313  TYR B CB  1 
ATOM   5147 C  CG  . TYR B 1 206 ? 33.611 -5.137  17.287  1.00 17.83 ? 313  TYR B CG  1 
ATOM   5148 C  CD1 . TYR B 1 206 ? 33.501 -6.459  17.709  1.00 17.03 ? 313  TYR B CD1 1 
ATOM   5149 C  CD2 . TYR B 1 206 ? 34.625 -4.356  17.823  1.00 18.97 ? 313  TYR B CD2 1 
ATOM   5150 C  CE1 . TYR B 1 206 ? 34.351 -6.971  18.649  1.00 18.84 ? 313  TYR B CE1 1 
ATOM   5151 C  CE2 . TYR B 1 206 ? 35.488 -4.871  18.776  1.00 19.39 ? 313  TYR B CE2 1 
ATOM   5152 C  CZ  . TYR B 1 206 ? 35.340 -6.175  19.177  1.00 19.76 ? 313  TYR B CZ  1 
ATOM   5153 O  OH  . TYR B 1 206 ? 36.198 -6.692  20.113  1.00 33.57 ? 313  TYR B OH  1 
ATOM   5154 N  N   . THR B 1 207 ? 32.124 -4.368  12.869  1.00 11.56 ? 314  THR B N   1 
ATOM   5155 C  CA  . THR B 1 207 ? 31.303 -3.695  11.858  1.00 11.22 ? 314  THR B CA  1 
ATOM   5156 C  C   . THR B 1 207 ? 31.134 -4.550  10.615  1.00 12.96 ? 314  THR B C   1 
ATOM   5157 O  O   . THR B 1 207 ? 32.037 -5.292  10.249  1.00 10.68 ? 314  THR B O   1 
ATOM   5158 C  CB  . THR B 1 207 ? 31.906 -2.326  11.430  1.00 14.79 ? 314  THR B CB  1 
ATOM   5159 O  OG1 . THR B 1 207 ? 33.182 -2.534  10.793  1.00 13.22 ? 314  THR B OG1 1 
ATOM   5160 C  CG2 . THR B 1 207 ? 32.054 -1.397  12.638  1.00 10.93 ? 314  THR B CG2 1 
ATOM   5161 N  N   . LEU B 1 208 ? 29.968 -4.466  9.977   1.00 11.11 ? 315  LEU B N   1 
ATOM   5162 C  CA  . LEU B 1 208 ? 29.816 -5.076  8.658   1.00 13.59 ? 315  LEU B CA  1 
ATOM   5163 C  C   . LEU B 1 208 ? 30.099 -4.013  7.622   1.00 16.73 ? 315  LEU B C   1 
ATOM   5164 O  O   . LEU B 1 208 ? 29.270 -3.137  7.393   1.00 14.69 ? 315  LEU B O   1 
ATOM   5165 C  CB  . LEU B 1 208 ? 28.419 -5.638  8.428   1.00 17.52 ? 315  LEU B CB  1 
ATOM   5166 C  CG  . LEU B 1 208 ? 27.841 -6.661  9.382   1.00 16.97 ? 315  LEU B CG  1 
ATOM   5167 C  CD1 . LEU B 1 208 ? 27.064 -5.941  10.465  1.00 19.65 ? 315  LEU B CD1 1 
ATOM   5168 C  CD2 . LEU B 1 208 ? 26.939 -7.587  8.601   1.00 18.71 ? 315  LEU B CD2 1 
ATOM   5169 N  N   . SER B 1 209 ? 31.270 -4.089  7.005   1.00 13.57 ? 316  SER B N   1 
ATOM   5170 C  CA  . SER B 1 209 ? 31.668 -3.112  6.016   1.00 16.85 ? 316  SER B CA  1 
ATOM   5171 C  C   . SER B 1 209 ? 31.068 -3.438  4.652   1.00 14.24 ? 316  SER B C   1 
ATOM   5172 O  O   . SER B 1 209 ? 31.240 -4.535  4.124   1.00 14.08 ? 316  SER B O   1 
ATOM   5173 C  CB  . SER B 1 209 ? 33.194 -3.035  5.935   1.00 16.24 ? 316  SER B CB  1 
ATOM   5174 O  OG  . SER B 1 209 ? 33.590 -1.925  5.141   1.00 19.29 ? 316  SER B OG  1 
ATOM   5175 N  N   . ILE B 1 210 ? 30.365 -2.462  4.096   1.00 10.46 ? 317  ILE B N   1 
ATOM   5176 C  CA  . ILE B 1 210 ? 29.600 -2.624  2.868   1.00 9.15  ? 317  ILE B CA  1 
ATOM   5177 C  C   . ILE B 1 210 ? 30.182 -1.765  1.746   1.00 12.36 ? 317  ILE B C   1 
ATOM   5178 O  O   . ILE B 1 210 ? 30.402 -0.556  1.916   1.00 12.36 ? 317  ILE B O   1 
ATOM   5179 C  CB  . ILE B 1 210 ? 28.110 -2.240  3.105   1.00 11.74 ? 317  ILE B CB  1 
ATOM   5180 C  CG1 . ILE B 1 210 ? 27.564 -2.999  4.315   1.00 13.05 ? 317  ILE B CG1 1 
ATOM   5181 C  CG2 . ILE B 1 210 ? 27.249 -2.513  1.862   1.00 11.66 ? 317  ILE B CG2 1 
ATOM   5182 C  CD1 . ILE B 1 210 ? 27.478 -4.505  4.097   1.00 11.07 ? 317  ILE B CD1 1 
ATOM   5183 N  N   . SER B 1 211 ? 30.414 -2.389  0.598   1.00 11.79 ? 318  SER B N   1 
ATOM   5184 C  CA  . SER B 1 211 ? 30.863 -1.682  -0.598  1.00 12.63 ? 318  SER B CA  1 
ATOM   5185 C  C   . SER B 1 211 ? 29.735 -1.521  -1.618  1.00 14.58 ? 318  SER B C   1 
ATOM   5186 O  O   . SER B 1 211 ? 28.604 -1.936  -1.371  1.00 13.53 ? 318  SER B O   1 
ATOM   5187 C  CB  . SER B 1 211 ? 32.044 -2.421  -1.236  1.00 13.24 ? 318  SER B CB  1 
ATOM   5188 O  OG  . SER B 1 211 ? 33.219 -2.250  -0.464  1.00 12.73 ? 318  SER B OG  1 
ATOM   5189 N  N   . SER B 1 212 ? 30.054 -0.932  -2.771  1.00 14.09 ? 319  SER B N   1 
ATOM   5190 C  CA  . SER B 1 212 ? 29.060 -0.571  -3.780  1.00 11.46 ? 319  SER B CA  1 
ATOM   5191 C  C   . SER B 1 212 ? 29.304 -1.234  -5.131  1.00 14.39 ? 319  SER B C   1 
ATOM   5192 O  O   . SER B 1 212 ? 30.416 -1.608  -5.472  1.00 11.40 ? 319  SER B O   1 
ATOM   5193 C  CB  . SER B 1 212 ? 29.030 0.953   -3.988  1.00 14.88 ? 319  SER B CB  1 
ATOM   5194 O  OG  . SER B 1 212 ? 28.726 1.632   -2.787  1.00 12.72 ? 319  SER B OG  1 
ATOM   5195 N  N   . ALA B 1 213 ? 28.227 -1.385  -5.887  1.00 12.14 ? 320  ALA B N   1 
ATOM   5196 C  CA  . ALA B 1 213 ? 28.299 -1.780  -7.282  1.00 12.39 ? 320  ALA B CA  1 
ATOM   5197 C  C   . ALA B 1 213 ? 27.367 -0.888  -8.096  1.00 12.90 ? 320  ALA B C   1 
ATOM   5198 O  O   . ALA B 1 213 ? 26.303 -0.476  -7.620  1.00 11.61 ? 320  ALA B O   1 
ATOM   5199 C  CB  . ALA B 1 213 ? 27.938 -3.270  -7.457  1.00 12.24 ? 320  ALA B CB  1 
ATOM   5200 N  N   . THR B 1 214 ? 27.782 -0.558  -9.310  1.00 12.02 ? 321  THR B N   1 
ATOM   5201 C  CA  . THR B 1 214 ? 26.947 0.268   -10.181 1.00 13.99 ? 321  THR B CA  1 
ATOM   5202 C  C   . THR B 1 214 ? 25.793 -0.515  -10.781 1.00 12.83 ? 321  THR B C   1 
ATOM   5203 O  O   . THR B 1 214 ? 25.782 -1.742  -10.744 1.00 11.37 ? 321  THR B O   1 
ATOM   5204 C  CB  . THR B 1 214 ? 27.749 0.881   -11.341 1.00 11.86 ? 321  THR B CB  1 
ATOM   5205 O  OG1 . THR B 1 214 ? 28.009 -0.121  -12.332 1.00 12.14 ? 321  THR B OG1 1 
ATOM   5206 C  CG2 . THR B 1 214 ? 29.061 1.472   -10.824 1.00 11.25 ? 321  THR B CG2 1 
ATOM   5207 N  N   . GLN B 1 215 ? 24.848 0.216   -11.374 1.00 13.20 ? 322  GLN B N   1 
ATOM   5208 C  CA  . GLN B 1 215 ? 23.657 -0.377  -11.958 1.00 13.74 ? 322  GLN B CA  1 
ATOM   5209 C  C   . GLN B 1 215 ? 23.970 -1.557  -12.878 1.00 14.33 ? 322  GLN B C   1 
ATOM   5210 O  O   . GLN B 1 215 ? 23.256 -2.549  -12.869 1.00 17.50 ? 322  GLN B O   1 
ATOM   5211 C  CB  . GLN B 1 215 ? 22.845 0.671   -12.733 1.00 15.51 ? 322  GLN B CB  1 
ATOM   5212 C  CG  . GLN B 1 215 ? 21.530 0.094   -13.251 1.00 18.06 ? 322  GLN B CG  1 
ATOM   5213 C  CD  . GLN B 1 215 ? 20.665 1.107   -13.995 1.00 23.44 ? 322  GLN B CD  1 
ATOM   5214 O  OE1 . GLN B 1 215 ? 21.120 2.190   -14.387 1.00 18.96 ? 322  GLN B OE1 1 
ATOM   5215 N  NE2 . GLN B 1 215 ? 19.398 0.758   -14.178 1.00 21.12 ? 322  GLN B NE2 1 
ATOM   5216 N  N   . PHE B 1 216 ? 25.040 -1.469  -13.651 1.00 14.68 ? 323  PHE B N   1 
ATOM   5217 C  CA  . PHE B 1 216 ? 25.352 -2.555  -14.590 1.00 16.22 ? 323  PHE B CA  1 
ATOM   5218 C  C   . PHE B 1 216 ? 26.397 -3.525  -14.060 1.00 19.99 ? 323  PHE B C   1 
ATOM   5219 O  O   . PHE B 1 216 ? 27.009 -4.272  -14.829 1.00 18.87 ? 323  PHE B O   1 
ATOM   5220 C  CB  . PHE B 1 216 ? 25.799 -1.979  -15.921 1.00 22.50 ? 323  PHE B CB  1 
ATOM   5221 C  CG  . PHE B 1 216 ? 24.745 -1.175  -16.577 1.00 24.78 ? 323  PHE B CG  1 
ATOM   5222 C  CD1 . PHE B 1 216 ? 23.471 -1.684  -16.716 1.00 26.84 ? 323  PHE B CD1 1 
ATOM   5223 C  CD2 . PHE B 1 216 ? 24.995 0.117   -16.982 1.00 27.00 ? 323  PHE B CD2 1 
ATOM   5224 C  CE1 . PHE B 1 216 ? 22.473 -0.924  -17.298 1.00 35.52 ? 323  PHE B CE1 1 
ATOM   5225 C  CE2 . PHE B 1 216 ? 24.011 0.871   -17.556 1.00 29.28 ? 323  PHE B CE2 1 
ATOM   5226 C  CZ  . PHE B 1 216 ? 22.750 0.356   -17.713 1.00 26.85 ? 323  PHE B CZ  1 
ATOM   5227 N  N   . GLY B 1 217 ? 26.579 -3.519  -12.741 1.00 15.48 ? 324  GLY B N   1 
ATOM   5228 C  CA  . GLY B 1 217 ? 27.398 -4.512  -12.080 1.00 12.50 ? 324  GLY B CA  1 
ATOM   5229 C  C   . GLY B 1 217 ? 28.890 -4.228  -12.097 1.00 16.51 ? 324  GLY B C   1 
ATOM   5230 O  O   . GLY B 1 217 ? 29.680 -5.131  -11.928 1.00 15.16 ? 324  GLY B O   1 
ATOM   5231 N  N   . ASN B 1 218 ? 29.282 -2.972  -12.281 1.00 15.27 ? 325  ASN B N   1 
ATOM   5232 C  CA  . ASN B 1 218 ? 30.700 -2.643  -12.297 1.00 16.15 ? 325  ASN B CA  1 
ATOM   5233 C  C   . ASN B 1 218 ? 31.206 -2.088  -10.971 1.00 14.65 ? 325  ASN B C   1 
ATOM   5234 O  O   . ASN B 1 218 ? 30.418 -1.659  -10.129 1.00 13.34 ? 325  ASN B O   1 
ATOM   5235 C  CB  . ASN B 1 218 ? 30.982 -1.647  -13.428 1.00 18.32 ? 325  ASN B CB  1 
ATOM   5236 C  CG  . ASN B 1 218 ? 30.596 -2.210  -14.783 1.00 22.27 ? 325  ASN B CG  1 
ATOM   5237 O  OD1 . ASN B 1 218 ? 30.878 -3.368  -15.075 1.00 21.95 ? 325  ASN B OD1 1 
ATOM   5238 N  ND2 . ASN B 1 218 ? 29.907 -1.419  -15.586 1.00 25.23 ? 325  ASN B ND2 1 
ATOM   5239 N  N   . VAL B 1 219 ? 32.527 -2.102  -10.798 1.00 14.44 ? 326  VAL B N   1 
ATOM   5240 C  CA  . VAL B 1 219 ? 33.166 -1.421  -9.680  1.00 10.93 ? 326  VAL B CA  1 
ATOM   5241 C  C   . VAL B 1 219 ? 33.059 0.091   -9.865  1.00 14.32 ? 326  VAL B C   1 
ATOM   5242 O  O   . VAL B 1 219 ? 33.512 0.633   -10.869 1.00 16.43 ? 326  VAL B O   1 
ATOM   5243 C  CB  . VAL B 1 219 ? 34.656 -1.817  -9.549  1.00 18.93 ? 326  VAL B CB  1 
ATOM   5244 C  CG1 . VAL B 1 219 ? 35.308 -1.063  -8.401  1.00 14.52 ? 326  VAL B CG1 1 
ATOM   5245 C  CG2 . VAL B 1 219 ? 34.800 -3.327  -9.345  1.00 16.66 ? 326  VAL B CG2 1 
ATOM   5246 N  N   . PRO B 1 220 ? 32.445 0.785   -8.900  1.00 10.45 ? 327  PRO B N   1 
ATOM   5247 C  CA  . PRO B 1 220 ? 32.282 2.233   -9.077  1.00 11.59 ? 327  PRO B CA  1 
ATOM   5248 C  C   . PRO B 1 220 ? 33.607 2.989   -9.015  1.00 12.34 ? 327  PRO B C   1 
ATOM   5249 O  O   . PRO B 1 220 ? 34.557 2.517   -8.397  1.00 10.81 ? 327  PRO B O   1 
ATOM   5250 C  CB  . PRO B 1 220 ? 31.388 2.631   -7.906  1.00 11.96 ? 327  PRO B CB  1 
ATOM   5251 C  CG  . PRO B 1 220 ? 30.702 1.355   -7.478  1.00 10.80 ? 327  PRO B CG  1 
ATOM   5252 C  CD  . PRO B 1 220 ? 31.701 0.273   -7.736  1.00 10.78 ? 327  PRO B CD  1 
ATOM   5253 N  N   . TRP B 1 221 ? 33.651 4.170   -9.623  1.00 15.15 ? 328  TRP B N   1 
ATOM   5254 C  CA  . TRP B 1 221 ? 34.871 4.973   -9.619  1.00 17.02 ? 328  TRP B CA  1 
ATOM   5255 C  C   . TRP B 1 221 ? 35.355 5.273   -8.199  1.00 16.74 ? 328  TRP B C   1 
ATOM   5256 O  O   . TRP B 1 221 ? 36.549 5.391   -7.973  1.00 16.80 ? 328  TRP B O   1 
ATOM   5257 C  CB  . TRP B 1 221 ? 34.659 6.279   -10.393 1.00 18.41 ? 328  TRP B CB  1 
ATOM   5258 C  CG  . TRP B 1 221 ? 33.626 7.217   -9.796  1.00 19.19 ? 328  TRP B CG  1 
ATOM   5259 C  CD1 . TRP B 1 221 ? 32.293 7.277   -10.095 1.00 20.93 ? 328  TRP B CD1 1 
ATOM   5260 C  CD2 . TRP B 1 221 ? 33.858 8.225   -8.812  1.00 17.41 ? 328  TRP B CD2 1 
ATOM   5261 N  NE1 . TRP B 1 221 ? 31.686 8.260   -9.357  1.00 17.56 ? 328  TRP B NE1 1 
ATOM   5262 C  CE2 . TRP B 1 221 ? 32.625 8.856   -8.560  1.00 15.99 ? 328  TRP B CE2 1 
ATOM   5263 C  CE3 . TRP B 1 221 ? 34.992 8.664   -8.127  1.00 17.76 ? 328  TRP B CE3 1 
ATOM   5264 C  CZ2 . TRP B 1 221 ? 32.496 9.903   -7.651  1.00 20.08 ? 328  TRP B CZ2 1 
ATOM   5265 C  CZ3 . TRP B 1 221 ? 34.859 9.699   -7.224  1.00 16.32 ? 328  TRP B CZ3 1 
ATOM   5266 C  CH2 . TRP B 1 221 ? 33.624 10.307  -6.993  1.00 16.81 ? 328  TRP B CH2 1 
ATOM   5267 N  N   . TYR B 1 222 ? 34.431 5.388   -7.244  1.00 15.74 ? 329  TYR B N   1 
ATOM   5268 C  CA  . TYR B 1 222 ? 34.796 5.768   -5.875  1.00 13.12 ? 329  TYR B CA  1 
ATOM   5269 C  C   . TYR B 1 222 ? 35.173 4.583   -4.992  1.00 15.77 ? 329  TYR B C   1 
ATOM   5270 O  O   . TYR B 1 222 ? 35.571 4.778   -3.843  1.00 13.12 ? 329  TYR B O   1 
ATOM   5271 C  CB  . TYR B 1 222 ? 33.651 6.536   -5.200  1.00 14.28 ? 329  TYR B CB  1 
ATOM   5272 C  CG  . TYR B 1 222 ? 32.323 5.829   -5.317  1.00 11.50 ? 329  TYR B CG  1 
ATOM   5273 C  CD1 . TYR B 1 222 ? 31.979 4.801   -4.445  1.00 12.12 ? 329  TYR B CD1 1 
ATOM   5274 C  CD2 . TYR B 1 222 ? 31.428 6.168   -6.327  1.00 13.27 ? 329  TYR B CD2 1 
ATOM   5275 C  CE1 . TYR B 1 222 ? 30.748 4.125   -4.569  1.00 11.57 ? 329  TYR B CE1 1 
ATOM   5276 C  CE2 . TYR B 1 222 ? 30.208 5.520   -6.456  1.00 13.24 ? 329  TYR B CE2 1 
ATOM   5277 C  CZ  . TYR B 1 222 ? 29.880 4.492   -5.579  1.00 14.04 ? 329  TYR B CZ  1 
ATOM   5278 O  OH  . TYR B 1 222 ? 28.680 3.846   -5.725  1.00 11.60 ? 329  TYR B OH  1 
ATOM   5279 N  N   . SER B 1 223 ? 35.026 3.367   -5.517  1.00 12.50 ? 330  SER B N   1 
ATOM   5280 C  CA  . SER B 1 223 ? 35.199 2.153   -4.717  1.00 16.35 ? 330  SER B CA  1 
ATOM   5281 C  C   . SER B 1 223 ? 36.627 1.964   -4.217  1.00 19.05 ? 330  SER B C   1 
ATOM   5282 O  O   . SER B 1 223 ? 37.579 2.148   -4.968  1.00 17.84 ? 330  SER B O   1 
ATOM   5283 C  CB  . SER B 1 223 ? 34.795 0.917   -5.524  1.00 17.21 ? 330  SER B CB  1 
ATOM   5284 O  OG  . SER B 1 223 ? 35.209 -0.269  -4.871  1.00 20.08 ? 330  SER B OG  1 
ATOM   5285 N  N   . GLU B 1 224 ? 36.753 1.590   -2.949  1.00 14.85 ? 331  GLU B N   1 
ATOM   5286 C  CA  . GLU B 1 224 ? 38.024 1.189   -2.348  1.00 16.42 ? 331  GLU B CA  1 
ATOM   5287 C  C   . GLU B 1 224 ? 38.066 -0.326  -2.187  1.00 17.94 ? 331  GLU B C   1 
ATOM   5288 O  O   . GLU B 1 224 ? 37.116 -0.934  -1.691  1.00 17.30 ? 331  GLU B O   1 
ATOM   5289 C  CB  . GLU B 1 224 ? 38.227 1.839   -0.974  1.00 15.36 ? 331  GLU B CB  1 
ATOM   5290 C  CG  . GLU B 1 224 ? 38.194 3.368   -0.956  1.00 14.29 ? 331  GLU B CG  1 
ATOM   5291 C  CD  . GLU B 1 224 ? 38.495 3.940   0.419   1.00 16.40 ? 331  GLU B CD  1 
ATOM   5292 O  OE1 . GLU B 1 224 ? 37.981 5.028   0.721   1.00 14.52 ? 331  GLU B OE1 1 
ATOM   5293 O  OE2 . GLU B 1 224 ? 39.248 3.307   1.200   1.00 18.03 ? 331  GLU B OE2 1 
ATOM   5294 N  N   . ALA B 1 225 ? 39.177 -0.936  -2.572  1.00 14.48 ? 332  ALA B N   1 
ATOM   5295 C  CA  . ALA B 1 225 ? 39.326 -2.376  -2.406  1.00 15.77 ? 332  ALA B CA  1 
ATOM   5296 C  C   . ALA B 1 225 ? 40.035 -2.701  -1.108  1.00 19.36 ? 332  ALA B C   1 
ATOM   5297 O  O   . ALA B 1 225 ? 40.995 -2.012  -0.729  1.00 21.29 ? 332  ALA B O   1 
ATOM   5298 C  CB  . ALA B 1 225 ? 40.085 -2.972  -3.577  1.00 16.92 ? 332  ALA B CB  1 
ATOM   5299 N  N   . CYS B 1 226 ? 39.570 -3.746  -0.424  1.00 15.89 ? 333  CYS B N   1 
ATOM   5300 C  CA  . CYS B 1 226 ? 40.308 -4.306  0.721   1.00 16.33 ? 333  CYS B CA  1 
ATOM   5301 C  C   . CYS B 1 226 ? 39.737 -5.634  1.188   1.00 14.51 ? 333  CYS B C   1 
ATOM   5302 O  O   . CYS B 1 226 ? 38.624 -6.001  0.819   1.00 17.67 ? 333  CYS B O   1 
ATOM   5303 C  CB  . CYS B 1 226 ? 40.322 -3.331  1.895   1.00 15.09 ? 333  CYS B CB  1 
ATOM   5304 S  SG  . CYS B 1 226 ? 38.689 -2.969  2.534   1.00 22.81 ? 333  CYS B SG  1 
ATOM   5305 N  N   . SER B 1 227 ? 40.479 -6.330  2.042   1.00 15.49 ? 334  SER B N   1 
ATOM   5306 C  CA  . SER B 1 227 ? 40.067 -7.656  2.491   1.00 14.02 ? 334  SER B CA  1 
ATOM   5307 C  C   . SER B 1 227 ? 39.059 -7.614  3.636   1.00 16.25 ? 334  SER B C   1 
ATOM   5308 O  O   . SER B 1 227 ? 38.489 -8.650  3.979   1.00 14.40 ? 334  SER B O   1 
ATOM   5309 C  CB  . SER B 1 227 ? 41.284 -8.492  2.917   1.00 10.61 ? 334  SER B CB  1 
ATOM   5310 O  OG  . SER B 1 227 ? 42.000 -7.856  3.960   1.00 17.83 ? 334  SER B OG  1 
ATOM   5311 N  N   . SER B 1 228 ? 38.822 -6.440  4.216   1.00 12.78 ? 335  SER B N   1 
ATOM   5312 C  CA  . SER B 1 228 ? 37.915 -6.365  5.360   1.00 13.80 ? 335  SER B CA  1 
ATOM   5313 C  C   . SER B 1 228 ? 36.428 -6.224  4.961   1.00 15.43 ? 335  SER B C   1 
ATOM   5314 O  O   . SER B 1 228 ? 35.554 -6.434  5.782   1.00 15.42 ? 335  SER B O   1 
ATOM   5315 C  CB  . SER B 1 228 ? 38.318 -5.208  6.294   1.00 14.32 ? 335  SER B CB  1 
ATOM   5316 O  OG  . SER B 1 228 ? 38.167 -3.948  5.663   1.00 16.45 ? 335  SER B OG  1 
ATOM   5317 N  N   . THR B 1 229 ? 36.155 -5.899  3.703   1.00 14.96 ? 336  THR B N   1 
ATOM   5318 C  CA  . THR B 1 229 ? 34.786 -5.698  3.233   1.00 13.64 ? 336  THR B CA  1 
ATOM   5319 C  C   . THR B 1 229 ? 34.028 -7.020  3.281   1.00 16.96 ? 336  THR B C   1 
ATOM   5320 O  O   . THR B 1 229 ? 34.579 -8.048  2.887   1.00 15.77 ? 336  THR B O   1 
ATOM   5321 C  CB  . THR B 1 229 ? 34.778 -5.143  1.807   1.00 11.71 ? 336  THR B CB  1 
ATOM   5322 O  OG1 . THR B 1 229 ? 35.245 -3.785  1.829   1.00 15.34 ? 336  THR B OG1 1 
ATOM   5323 C  CG2 . THR B 1 229 ? 33.368 -5.198  1.194   1.00 12.70 ? 336  THR B CG2 1 
ATOM   5324 N  N   . LEU B 1 230 ? 32.778 -7.013  3.744   1.00 10.50 ? 337  LEU B N   1 
ATOM   5325 C  CA  . LEU B 1 230 ? 32.024 -8.269  3.823   1.00 10.72 ? 337  LEU B CA  1 
ATOM   5326 C  C   . LEU B 1 230 ? 31.087 -8.525  2.628   1.00 11.86 ? 337  LEU B C   1 
ATOM   5327 O  O   . LEU B 1 230 ? 30.994 -9.644  2.128   1.00 12.28 ? 337  LEU B O   1 
ATOM   5328 C  CB  . LEU B 1 230 ? 31.224 -8.297  5.129   1.00 14.77 ? 337  LEU B CB  1 
ATOM   5329 C  CG  . LEU B 1 230 ? 30.712 -9.654  5.595   1.00 20.15 ? 337  LEU B CG  1 
ATOM   5330 C  CD1 . LEU B 1 230 ? 31.876 -10.629 5.886   1.00 14.52 ? 337  LEU B CD1 1 
ATOM   5331 C  CD2 . LEU B 1 230 ? 29.829 -9.450  6.830   1.00 14.00 ? 337  LEU B CD2 1 
ATOM   5332 N  N   . ALA B 1 231 ? 30.392 -7.490  2.169   1.00 9.68  ? 338  ALA B N   1 
ATOM   5333 C  CA  . ALA B 1 231 ? 29.423 -7.660  1.089   1.00 9.84  ? 338  ALA B CA  1 
ATOM   5334 C  C   . ALA B 1 231 ? 29.131 -6.320  0.425   1.00 10.80 ? 338  ALA B C   1 
ATOM   5335 O  O   . ALA B 1 231 ? 29.736 -5.309  0.780   1.00 11.53 ? 338  ALA B O   1 
ATOM   5336 C  CB  . ALA B 1 231 ? 28.133 -8.298  1.617   1.00 9.98  ? 338  ALA B CB  1 
ATOM   5337 N  N   . THR B 1 232 ? 28.202 -6.316  -0.526  1.00 12.70 ? 339  THR B N   1 
ATOM   5338 C  CA  . THR B 1 232 ? 27.992 -5.184  -1.434  1.00 10.15 ? 339  THR B CA  1 
ATOM   5339 C  C   . THR B 1 232 ? 26.513 -4.892  -1.634  1.00 12.27 ? 339  THR B C   1 
ATOM   5340 O  O   . THR B 1 232 ? 25.706 -5.809  -1.617  1.00 11.48 ? 339  THR B O   1 
ATOM   5341 C  CB  . THR B 1 232 ? 28.617 -5.489  -2.822  1.00 15.08 ? 339  THR B CB  1 
ATOM   5342 O  OG1 . THR B 1 232 ? 30.010 -5.748  -2.658  1.00 14.41 ? 339  THR B OG1 1 
ATOM   5343 C  CG2 . THR B 1 232 ? 28.419 -4.342  -3.816  1.00 12.59 ? 339  THR B CG2 1 
ATOM   5344 N  N   . THR B 1 233 ? 26.144 -3.630  -1.825  1.00 10.55 ? 340  THR B N   1 
ATOM   5345 C  CA  . THR B 1 233 ? 24.835 -3.335  -2.406  1.00 9.83  ? 340  THR B CA  1 
ATOM   5346 C  C   . THR B 1 233 ? 24.988 -2.440  -3.623  1.00 14.97 ? 340  THR B C   1 
ATOM   5347 O  O   . THR B 1 233 ? 26.022 -1.792  -3.805  1.00 15.04 ? 340  THR B O   1 
ATOM   5348 C  CB  . THR B 1 233 ? 23.888 -2.610  -1.435  1.00 14.60 ? 340  THR B CB  1 
ATOM   5349 O  OG1 . THR B 1 233 ? 24.267 -1.242  -1.387  1.00 19.24 ? 340  THR B OG1 1 
ATOM   5350 C  CG2 . THR B 1 233 ? 23.943 -3.199  -0.030  1.00 12.68 ? 340  THR B CG2 1 
ATOM   5351 N  N   . TYR B 1 234 ? 23.943 -2.372  -4.441  1.00 14.41 ? 341  TYR B N   1 
ATOM   5352 C  CA  . TYR B 1 234 ? 23.920 -1.423  -5.542  1.00 12.53 ? 341  TYR B CA  1 
ATOM   5353 C  C   . TYR B 1 234 ? 24.024 0.002   -5.023  1.00 15.57 ? 341  TYR B C   1 
ATOM   5354 O  O   . TYR B 1 234 ? 23.586 0.315   -3.912  1.00 15.65 ? 341  TYR B O   1 
ATOM   5355 C  CB  . TYR B 1 234 ? 22.653 -1.596  -6.385  1.00 9.45  ? 341  TYR B CB  1 
ATOM   5356 C  CG  . TYR B 1 234 ? 22.743 -2.797  -7.294  1.00 15.29 ? 341  TYR B CG  1 
ATOM   5357 C  CD1 . TYR B 1 234 ? 23.668 -2.833  -8.334  1.00 15.95 ? 341  TYR B CD1 1 
ATOM   5358 C  CD2 . TYR B 1 234 ? 21.908 -3.901  -7.116  1.00 14.29 ? 341  TYR B CD2 1 
ATOM   5359 C  CE1 . TYR B 1 234 ? 23.756 -3.933  -9.178  1.00 14.17 ? 341  TYR B CE1 1 
ATOM   5360 C  CE2 . TYR B 1 234 ? 21.993 -5.013  -7.948  1.00 13.75 ? 341  TYR B CE2 1 
ATOM   5361 C  CZ  . TYR B 1 234 ? 22.914 -5.023  -8.977  1.00 19.27 ? 341  TYR B CZ  1 
ATOM   5362 O  OH  . TYR B 1 234 ? 23.001 -6.126  -9.802  1.00 17.52 ? 341  TYR B OH  1 
ATOM   5363 N  N   . SER B 1 235 ? 24.636 0.858   -5.828  1.00 13.63 ? 342  SER B N   1 
ATOM   5364 C  CA  . SER B 1 235 ? 24.673 2.291   -5.557  1.00 13.19 ? 342  SER B CA  1 
ATOM   5365 C  C   . SER B 1 235 ? 24.902 3.032   -6.881  1.00 13.09 ? 342  SER B C   1 
ATOM   5366 O  O   . SER B 1 235 ? 24.580 2.514   -7.951  1.00 15.82 ? 342  SER B O   1 
ATOM   5367 C  CB  . SER B 1 235 ? 25.754 2.652   -4.527  1.00 12.42 ? 342  SER B CB  1 
ATOM   5368 O  OG  . SER B 1 235 ? 25.694 4.046   -4.213  1.00 12.82 ? 342  SER B OG  1 
ATOM   5369 N  N   . SER B 1 236 ? 25.411 4.254   -6.807  1.00 15.79 ? 343  SER B N   1 
ATOM   5370 C  CA  . SER B 1 236 ? 25.595 5.077   -8.001  1.00 16.00 ? 343  SER B CA  1 
ATOM   5371 C  C   . SER B 1 236 ? 26.855 4.687   -8.792  1.00 15.18 ? 343  SER B C   1 
ATOM   5372 O  O   . SER B 1 236 ? 27.722 3.972   -8.289  1.00 15.12 ? 343  SER B O   1 
ATOM   5373 C  CB  . SER B 1 236 ? 25.671 6.558   -7.618  1.00 16.29 ? 343  SER B CB  1 
ATOM   5374 O  OG  . SER B 1 236 ? 26.844 6.820   -6.862  1.00 13.91 ? 343  SER B OG  1 
ATOM   5375 N  N   . GLY B 1 237 ? 26.942 5.169   -10.031 1.00 16.58 ? 344  GLY B N   1 
ATOM   5376 C  CA  . GLY B 1 237 ? 28.076 4.885   -10.894 1.00 15.99 ? 344  GLY B CA  1 
ATOM   5377 C  C   . GLY B 1 237 ? 28.425 6.064   -11.787 1.00 16.63 ? 344  GLY B C   1 
ATOM   5378 O  O   . GLY B 1 237 ? 28.579 7.182   -11.297 1.00 19.22 ? 344  GLY B O   1 
ATOM   5379 N  N   . ASN B 1 238 ? 28.516 5.812   -13.094 1.00 16.06 ? 345  ASN B N   1 
ATOM   5380 C  CA  . ASN B 1 238 ? 28.790 6.853   -14.073 1.00 20.26 ? 345  ASN B CA  1 
ATOM   5381 C  C   . ASN B 1 238 ? 27.509 7.557   -14.513 1.00 24.42 ? 345  ASN B C   1 
ATOM   5382 O  O   . ASN B 1 238 ? 26.408 7.186   -14.095 1.00 20.45 ? 345  ASN B O   1 
ATOM   5383 C  CB  . ASN B 1 238 ? 29.533 6.265   -15.283 1.00 20.22 ? 345  ASN B CB  1 
ATOM   5384 C  CG  . ASN B 1 238 ? 30.891 5.693   -14.903 1.00 27.15 ? 345  ASN B CG  1 
ATOM   5385 O  OD1 . ASN B 1 238 ? 31.497 6.106   -13.903 1.00 23.72 ? 345  ASN B OD1 1 
ATOM   5386 N  ND2 . ASN B 1 238 ? 31.369 4.728   -15.683 1.00 20.75 ? 345  ASN B ND2 1 
ATOM   5387 N  N   . GLN B 1 239 ? 27.647 8.586   -15.344 1.00 24.04 ? 346  GLN B N   1 
ATOM   5388 C  CA  . GLN B 1 239 ? 26.500 9.425   -15.652 1.00 20.89 ? 346  GLN B CA  1 
ATOM   5389 C  C   . GLN B 1 239 ? 25.448 8.678   -16.434 1.00 20.07 ? 346  GLN B C   1 
ATOM   5390 O  O   . GLN B 1 239 ? 24.284 9.059   -16.411 1.00 21.22 ? 346  GLN B O   1 
ATOM   5391 C  CB  . GLN B 1 239 ? 26.923 10.682  -16.405 1.00 26.95 ? 346  GLN B CB  1 
ATOM   5392 C  CG  . GLN B 1 239 ? 27.427 11.762  -15.462 1.00 34.58 ? 346  GLN B CG  1 
ATOM   5393 C  CD  . GLN B 1 239 ? 27.468 13.154  -16.091 1.00 38.50 ? 346  GLN B CD  1 
ATOM   5394 O  OE1 . GLN B 1 239 ? 27.379 13.314  -17.315 1.00 26.62 ? 346  GLN B OE1 1 
ATOM   5395 N  NE2 . GLN B 1 239 ? 27.610 14.169  -15.243 1.00 34.37 ? 346  GLN B NE2 1 
ATOM   5396 N  N   . ASN B 1 240 ? 25.845 7.595   -17.093 1.00 20.04 ? 347  ASN B N   1 
ATOM   5397 C  CA  . ASN B 1 240 ? 24.892 6.790   -17.840 1.00 25.21 ? 347  ASN B CA  1 
ATOM   5398 C  C   . ASN B 1 240 ? 24.123 5.795   -16.968 1.00 23.21 ? 347  ASN B C   1 
ATOM   5399 O  O   . ASN B 1 240 ? 23.299 5.044   -17.471 1.00 26.78 ? 347  ASN B O   1 
ATOM   5400 C  CB  . ASN B 1 240 ? 25.613 6.033   -18.958 1.00 33.08 ? 347  ASN B CB  1 
ATOM   5401 C  CG  . ASN B 1 240 ? 26.559 4.977   -18.425 1.00 36.36 ? 347  ASN B CG  1 
ATOM   5402 O  OD1 . ASN B 1 240 ? 27.460 5.274   -17.639 1.00 35.28 ? 347  ASN B OD1 1 
ATOM   5403 N  ND2 . ASN B 1 240 ? 26.343 3.727   -18.834 1.00 33.07 ? 347  ASN B ND2 1 
ATOM   5404 N  N   . GLU B 1 241 ? 24.394 5.782   -15.665 1.00 22.69 ? 348  GLU B N   1 
ATOM   5405 C  CA  . GLU B 1 241 ? 23.775 4.801   -14.768 1.00 19.23 ? 348  GLU B CA  1 
ATOM   5406 C  C   . GLU B 1 241 ? 22.893 5.490   -13.727 1.00 18.62 ? 348  GLU B C   1 
ATOM   5407 O  O   . GLU B 1 241 ? 23.159 6.618   -13.347 1.00 16.67 ? 348  GLU B O   1 
ATOM   5408 C  CB  . GLU B 1 241 ? 24.851 3.951   -14.091 1.00 19.66 ? 348  GLU B CB  1 
ATOM   5409 C  CG  . GLU B 1 241 ? 25.712 3.169   -15.099 1.00 22.64 ? 348  GLU B CG  1 
ATOM   5410 C  CD  . GLU B 1 241 ? 26.872 2.419   -14.466 1.00 22.59 ? 348  GLU B CD  1 
ATOM   5411 O  OE1 . GLU B 1 241 ? 26.772 1.172   -14.333 1.00 21.03 ? 348  GLU B OE1 1 
ATOM   5412 O  OE2 . GLU B 1 241 ? 27.884 3.071   -14.115 1.00 19.94 ? 348  GLU B OE2 1 
ATOM   5413 N  N   . LYS B 1 242 ? 21.844 4.815   -13.271 1.00 21.07 ? 349  LYS B N   1 
ATOM   5414 C  CA  . LYS B 1 242 ? 20.917 5.429   -12.324 1.00 17.62 ? 349  LYS B CA  1 
ATOM   5415 C  C   . LYS B 1 242 ? 21.531 5.512   -10.936 1.00 18.25 ? 349  LYS B C   1 
ATOM   5416 O  O   . LYS B 1 242 ? 22.514 4.842   -10.641 1.00 16.88 ? 349  LYS B O   1 
ATOM   5417 C  CB  . LYS B 1 242 ? 19.600 4.658   -12.245 1.00 22.87 ? 349  LYS B CB  1 
ATOM   5418 C  CG  . LYS B 1 242 ? 18.902 4.396   -13.573 1.00 26.34 ? 349  LYS B CG  1 
ATOM   5419 C  CD  . LYS B 1 242 ? 19.064 5.524   -14.557 1.00 31.13 ? 349  LYS B CD  1 
ATOM   5420 C  CE  . LYS B 1 242 ? 18.026 6.611   -14.381 1.00 38.42 ? 349  LYS B CE  1 
ATOM   5421 N  NZ  . LYS B 1 242 ? 17.833 7.351   -15.657 0.00 32.18 ? 349  LYS B NZ  1 
ATOM   5422 N  N   . GLN B 1 243 ? 20.933 6.333   -10.087 1.00 14.74 ? 350  GLN B N   1 
ATOM   5423 C  CA  . GLN B 1 243 ? 21.415 6.526   -8.734  1.00 15.36 ? 350  GLN B CA  1 
ATOM   5424 C  C   . GLN B 1 243 ? 20.317 6.213   -7.713  1.00 14.94 ? 350  GLN B C   1 
ATOM   5425 O  O   . GLN B 1 243 ? 19.306 5.598   -8.049  1.00 16.71 ? 350  GLN B O   1 
ATOM   5426 C  CB  . GLN B 1 243 ? 21.945 7.952   -8.582  1.00 19.79 ? 350  GLN B CB  1 
ATOM   5427 C  CG  . GLN B 1 243 ? 22.949 8.297   -9.693  1.00 20.52 ? 350  GLN B CG  1 
ATOM   5428 C  CD  . GLN B 1 243 ? 23.602 9.647   -9.542  1.00 28.61 ? 350  GLN B CD  1 
ATOM   5429 O  OE1 . GLN B 1 243 ? 23.012 10.580  -8.996  1.00 23.80 ? 350  GLN B OE1 1 
ATOM   5430 N  NE2 . GLN B 1 243 ? 24.848 9.758   -10.021 1.00 27.21 ? 350  GLN B NE2 1 
ATOM   5431 N  N   . ILE B 1 244 ? 20.529 6.606   -6.467  1.00 16.63 ? 351  ILE B N   1 
ATOM   5432 C  CA  . ILE B 1 244 ? 19.650 6.175   -5.395  1.00 16.36 ? 351  ILE B CA  1 
ATOM   5433 C  C   . ILE B 1 244 ? 18.595 7.247   -5.102  1.00 15.20 ? 351  ILE B C   1 
ATOM   5434 O  O   . ILE B 1 244 ? 18.902 8.432   -5.040  1.00 17.57 ? 351  ILE B O   1 
ATOM   5435 C  CB  . ILE B 1 244 ? 20.465 5.843   -4.130  1.00 15.02 ? 351  ILE B CB  1 
ATOM   5436 C  CG1 . ILE B 1 244 ? 21.530 4.768   -4.447  1.00 15.05 ? 351  ILE B CG1 1 
ATOM   5437 C  CG2 . ILE B 1 244 ? 19.563 5.422   -2.969  1.00 17.89 ? 351  ILE B CG2 1 
ATOM   5438 C  CD1 . ILE B 1 244 ? 21.009 3.514   -5.081  1.00 14.50 ? 351  ILE B CD1 1 
ATOM   5439 N  N   . VAL B 1 245 ? 17.351 6.814   -4.930  1.00 16.75 ? 352  VAL B N   1 
ATOM   5440 C  CA  . VAL B 1 245 ? 16.227 7.717   -4.704  1.00 15.53 ? 352  VAL B CA  1 
ATOM   5441 C  C   . VAL B 1 245 ? 15.882 7.729   -3.225  1.00 17.55 ? 352  VAL B C   1 
ATOM   5442 O  O   . VAL B 1 245 ? 15.648 6.671   -2.635  1.00 18.44 ? 352  VAL B O   1 
ATOM   5443 C  CB  . VAL B 1 245 ? 14.981 7.284   -5.512  1.00 17.12 ? 352  VAL B CB  1 
ATOM   5444 C  CG1 . VAL B 1 245 ? 13.770 8.152   -5.166  1.00 19.98 ? 352  VAL B CG1 1 
ATOM   5445 C  CG2 . VAL B 1 245 ? 15.270 7.306   -6.988  1.00 18.15 ? 352  VAL B CG2 1 
ATOM   5446 N  N   . THR B 1 246 ? 15.839 8.913   -2.619  1.00 14.03 ? 353  THR B N   1 
ATOM   5447 C  CA  . THR B 1 246 ? 15.662 8.981   -1.178  1.00 12.70 ? 353  THR B CA  1 
ATOM   5448 C  C   . THR B 1 246 ? 15.183 10.362  -0.730  1.00 14.71 ? 353  THR B C   1 
ATOM   5449 O  O   . THR B 1 246 ? 15.010 11.271  -1.545  1.00 15.13 ? 353  THR B O   1 
ATOM   5450 C  CB  . THR B 1 246 ? 16.995 8.592   -0.437  1.00 14.83 ? 353  THR B CB  1 
ATOM   5451 O  OG1 . THR B 1 246 ? 16.745 8.372   0.956   1.00 13.51 ? 353  THR B OG1 1 
ATOM   5452 C  CG2 . THR B 1 246 ? 18.066 9.653   -0.609  1.00 14.62 ? 353  THR B CG2 1 
ATOM   5453 N  N   . THR B 1 247 ? 14.950 10.486  0.572   1.00 14.95 ? 354  THR B N   1 
ATOM   5454 C  CA  . THR B 1 247 ? 14.514 11.729  1.199   1.00 11.99 ? 354  THR B CA  1 
ATOM   5455 C  C   . THR B 1 247 ? 15.662 12.736  1.263   1.00 13.55 ? 354  THR B C   1 
ATOM   5456 O  O   . THR B 1 247 ? 16.775 12.366  1.633   1.00 13.14 ? 354  THR B O   1 
ATOM   5457 C  CB  . THR B 1 247 ? 14.006 11.463  2.620   1.00 12.75 ? 354  THR B CB  1 
ATOM   5458 O  OG1 . THR B 1 247 ? 14.939 10.597  3.286   1.00 11.99 ? 354  THR B OG1 1 
ATOM   5459 C  CG2 . THR B 1 247 ? 12.645 10.780  2.591   1.00 14.93 ? 354  THR B CG2 1 
ATOM   5460 N  N   . ASP B 1 248 ? 15.381 13.995  0.924   1.00 11.41 ? 355  ASP B N   1 
ATOM   5461 C  CA  . ASP B 1 248 ? 16.373 15.067  0.991   1.00 11.92 ? 355  ASP B CA  1 
ATOM   5462 C  C   . ASP B 1 248 ? 15.922 16.150  1.976   1.00 13.46 ? 355  ASP B C   1 
ATOM   5463 O  O   . ASP B 1 248 ? 14.756 16.227  2.346   1.00 11.73 ? 355  ASP B O   1 
ATOM   5464 C  CB  . ASP B 1 248 ? 16.602 15.681  -0.396  1.00 15.92 ? 355  ASP B CB  1 
ATOM   5465 C  CG  . ASP B 1 248 ? 18.014 16.223  -0.585  1.00 20.35 ? 355  ASP B CG  1 
ATOM   5466 O  OD1 . ASP B 1 248 ? 18.812 16.208  0.373   1.00 15.85 ? 355  ASP B OD1 1 
ATOM   5467 O  OD2 . ASP B 1 248 ? 18.326 16.665  -1.715  1.00 19.51 ? 355  ASP B OD2 1 
ATOM   5468 N  N   . LEU B 1 249 ? 16.864 16.989  2.384   1.00 13.96 ? 356  LEU B N   1 
ATOM   5469 C  CA  . LEU B 1 249 ? 16.603 18.124  3.260   1.00 16.69 ? 356  LEU B CA  1 
ATOM   5470 C  C   . LEU B 1 249 ? 15.520 19.050  2.703   1.00 17.66 ? 356  LEU B C   1 
ATOM   5471 O  O   . LEU B 1 249 ? 15.334 19.127  1.483   1.00 15.31 ? 356  LEU B O   1 
ATOM   5472 C  CB  . LEU B 1 249 ? 17.911 18.902  3.485   1.00 16.82 ? 356  LEU B CB  1 
ATOM   5473 C  CG  . LEU B 1 249 ? 18.201 19.447  4.882   1.00 20.75 ? 356  LEU B CG  1 
ATOM   5474 C  CD1 . LEU B 1 249 ? 18.212 18.326  5.892   1.00 16.25 ? 356  LEU B CD1 1 
ATOM   5475 C  CD2 . LEU B 1 249 ? 19.517 20.234  4.904   1.00 16.97 ? 356  LEU B CD2 1 
ATOM   5476 N  N   . ARG B 1 250 ? 14.816 19.729  3.614   1.00 12.48 ? 357  ARG B N   1 
ATOM   5477 C  CA  . ARG B 1 250 ? 13.755 20.680  3.298   1.00 16.21 ? 357  ARG B CA  1 
ATOM   5478 C  C   . ARG B 1 250 ? 12.578 19.968  2.614   1.00 16.30 ? 357  ARG B C   1 
ATOM   5479 O  O   . ARG B 1 250 ? 11.971 20.491  1.689   1.00 13.53 ? 357  ARG B O   1 
ATOM   5480 C  CB  . ARG B 1 250 ? 14.298 21.836  2.434   1.00 19.57 ? 357  ARG B CB  1 
ATOM   5481 C  CG  . ARG B 1 250 ? 15.458 22.614  3.117   1.00 16.50 ? 357  ARG B CG  1 
ATOM   5482 C  CD  . ARG B 1 250 ? 16.098 23.633  2.183   1.00 22.39 ? 357  ARG B CD  1 
ATOM   5483 N  NE  . ARG B 1 250 ? 17.228 24.338  2.794   1.00 23.25 ? 357  ARG B NE  1 
ATOM   5484 C  CZ  . ARG B 1 250 ? 17.122 25.377  3.621   1.00 25.80 ? 357  ARG B CZ  1 
ATOM   5485 N  NH1 . ARG B 1 250 ? 18.218 25.940  4.114   1.00 20.91 ? 357  ARG B NH1 1 
ATOM   5486 N  NH2 . ARG B 1 250 ? 15.930 25.857  3.965   1.00 20.37 ? 357  ARG B NH2 1 
ATOM   5487 N  N   . GLN B 1 251 ? 12.299 18.754  3.084   1.00 13.66 ? 358  GLN B N   1 
ATOM   5488 C  CA  . GLN B 1 251 ? 11.128 17.977  2.690   1.00 13.79 ? 358  GLN B CA  1 
ATOM   5489 C  C   . GLN B 1 251 ? 11.088 17.641  1.206   1.00 15.15 ? 358  GLN B C   1 
ATOM   5490 O  O   . GLN B 1 251 ? 10.017 17.483  0.636   1.00 18.12 ? 358  GLN B O   1 
ATOM   5491 C  CB  . GLN B 1 251 ? 9.851  18.726  3.102   1.00 16.13 ? 358  GLN B CB  1 
ATOM   5492 C  CG  . GLN B 1 251 ? 9.899  19.118  4.560   1.00 18.00 ? 358  GLN B CG  1 
ATOM   5493 C  CD  . GLN B 1 251 ? 8.567  19.540  5.138   1.00 30.50 ? 358  GLN B CD  1 
ATOM   5494 O  OE1 . GLN B 1 251 ? 7.533  19.485  4.479   1.00 35.27 ? 358  GLN B OE1 1 
ATOM   5495 N  NE2 . GLN B 1 251 ? 8.591  19.957  6.394   1.00 43.85 ? 358  GLN B NE2 1 
ATOM   5496 N  N   . LYS B 1 252 ? 12.256 17.487  0.593   1.00 13.71 ? 359  LYS B N   1 
ATOM   5497 C  CA  . LYS B 1 252 ? 12.325 17.192  -0.835  1.00 13.17 ? 359  LYS B CA  1 
ATOM   5498 C  C   . LYS B 1 252 ? 12.662 15.733  -1.107  1.00 15.37 ? 359  LYS B C   1 
ATOM   5499 O  O   . LYS B 1 252 ? 12.961 14.972  -0.197  1.00 13.22 ? 359  LYS B O   1 
ATOM   5500 C  CB  . LYS B 1 252 ? 13.341 18.110  -1.520  1.00 15.79 ? 359  LYS B CB  1 
ATOM   5501 C  CG  . LYS B 1 252 ? 12.867 19.576  -1.539  1.00 19.49 ? 359  LYS B CG  1 
ATOM   5502 C  CD  . LYS B 1 252 ? 13.917 20.494  -2.110  1.00 27.64 ? 359  LYS B CD  1 
ATOM   5503 C  CE  . LYS B 1 252 ? 13.317 21.856  -2.432  0.00 25.90 ? 359  LYS B CE  1 
ATOM   5504 N  NZ  . LYS B 1 252 ? 14.241 22.715  -3.223  0.00 28.26 ? 359  LYS B NZ  1 
ATOM   5505 N  N   . CYS B 1 253 ? 12.578 15.360  -2.375  1.00 15.20 ? 360  CYS B N   1 
ATOM   5506 C  CA  . CYS B 1 253 ? 12.893 14.012  -2.834  1.00 17.34 ? 360  CYS B CA  1 
ATOM   5507 C  C   . CYS B 1 253 ? 14.057 14.093  -3.821  1.00 23.39 ? 360  CYS B C   1 
ATOM   5508 O  O   . CYS B 1 253 ? 14.025 14.898  -4.759  1.00 27.21 ? 360  CYS B O   1 
ATOM   5509 C  CB  . CYS B 1 253 ? 11.664 13.377  -3.479  1.00 23.45 ? 360  CYS B CB  1 
ATOM   5510 S  SG  . CYS B 1 253 ? 11.885 11.692  -4.052  1.00 29.51 ? 360  CYS B SG  1 
ATOM   5511 N  N   . THR B 1 254 ? 15.100 13.298  -3.604  1.00 18.30 ? 361  THR B N   1 
ATOM   5512 C  CA  . THR B 1 254 ? 16.253 13.321  -4.498  1.00 16.48 ? 361  THR B CA  1 
ATOM   5513 C  C   . THR B 1 254 ? 16.414 11.984  -5.230  1.00 20.67 ? 361  THR B C   1 
ATOM   5514 O  O   . THR B 1 254 ? 16.069 10.925  -4.693  1.00 17.59 ? 361  THR B O   1 
ATOM   5515 C  CB  . THR B 1 254 ? 17.552 13.666  -3.734  1.00 17.91 ? 361  THR B CB  1 
ATOM   5516 O  OG1 . THR B 1 254 ? 18.637 13.774  -4.659  1.00 21.96 ? 361  THR B OG1 1 
ATOM   5517 C  CG2 . THR B 1 254 ? 17.891 12.598  -2.702  1.00 15.48 ? 361  THR B CG2 1 
ATOM   5518 N  N   . GLU B 1 255 ? 16.913 12.039  -6.462  1.00 17.48 ? 362  GLU B N   1 
ATOM   5519 C  CA  . GLU B 1 255 ? 17.220 10.823  -7.219  1.00 18.62 ? 362  GLU B CA  1 
ATOM   5520 C  C   . GLU B 1 255 ? 18.706 10.755  -7.496  1.00 18.54 ? 362  GLU B C   1 
ATOM   5521 O  O   . GLU B 1 255 ? 19.147 10.054  -8.406  1.00 23.88 ? 362  GLU B O   1 
ATOM   5522 C  CB  . GLU B 1 255 ? 16.446 10.772  -8.542  1.00 20.84 ? 362  GLU B CB  1 
ATOM   5523 C  CG  . GLU B 1 255 ? 14.937 10.685  -8.373  1.00 35.24 ? 362  GLU B CG  1 
ATOM   5524 C  CD  . GLU B 1 255 ? 14.191 10.842  -9.685  1.00 44.40 ? 362  GLU B CD  1 
ATOM   5525 O  OE1 . GLU B 1 255 ? 14.236 9.903   -10.507 1.00 41.27 ? 362  GLU B OE1 1 
ATOM   5526 O  OE2 . GLU B 1 255 ? 13.554 11.901  -9.889  1.00 45.87 ? 362  GLU B OE2 1 
ATOM   5527 N  N   . SER B 1 256 ? 19.484 11.480  -6.705  1.00 16.46 ? 363  SER B N   1 
ATOM   5528 C  CA  . SER B 1 256 ? 20.903 11.576  -6.959  1.00 20.49 ? 363  SER B CA  1 
ATOM   5529 C  C   . SER B 1 256 ? 21.732 11.347  -5.701  1.00 21.11 ? 363  SER B C   1 
ATOM   5530 O  O   . SER B 1 256 ? 22.757 11.984  -5.511  1.00 20.87 ? 363  SER B O   1 
ATOM   5531 C  CB  . SER B 1 256 ? 21.239 12.942  -7.569  1.00 25.51 ? 363  SER B CB  1 
ATOM   5532 O  OG  . SER B 1 256 ? 21.105 13.968  -6.593  1.00 35.45 ? 363  SER B OG  1 
ATOM   5533 N  N   . HIS B 1 257 ? 21.285 10.437  -4.842  1.00 18.90 ? 364  HIS B N   1 
ATOM   5534 C  CA  . HIS B 1 257 ? 22.099 10.027  -3.701  1.00 16.05 ? 364  HIS B CA  1 
ATOM   5535 C  C   . HIS B 1 257 ? 23.175 9.059   -4.226  1.00 17.52 ? 364  HIS B C   1 
ATOM   5536 O  O   . HIS B 1 257 ? 22.882 8.196   -5.055  1.00 16.90 ? 364  HIS B O   1 
ATOM   5537 C  CB  . HIS B 1 257 ? 21.226 9.388   -2.613  1.00 15.13 ? 364  HIS B CB  1 
ATOM   5538 C  CG  . HIS B 1 257 ? 21.940 9.134   -1.317  1.00 13.59 ? 364  HIS B CG  1 
ATOM   5539 N  ND1 . HIS B 1 257 ? 23.009 9.889   -0.888  1.00 13.61 ? 364  HIS B ND1 1 
ATOM   5540 C  CD2 . HIS B 1 257 ? 21.730 8.199   -0.355  1.00 16.33 ? 364  HIS B CD2 1 
ATOM   5541 C  CE1 . HIS B 1 257 ? 23.427 9.434   0.282   1.00 16.51 ? 364  HIS B CE1 1 
ATOM   5542 N  NE2 . HIS B 1 257 ? 22.672 8.405   0.626   1.00 16.00 ? 364  HIS B NE2 1 
ATOM   5543 N  N   . THR B 1 258 ? 24.411 9.219   -3.754  1.00 17.96 ? 365  THR B N   1 
ATOM   5544 C  CA  . THR B 1 258 ? 25.567 8.545   -4.340  1.00 20.37 ? 365  THR B CA  1 
ATOM   5545 C  C   . THR B 1 258 ? 26.525 7.931   -3.303  1.00 16.89 ? 365  THR B C   1 
ATOM   5546 O  O   . THR B 1 258 ? 26.390 8.181   -2.112  1.00 13.58 ? 365  THR B O   1 
ATOM   5547 C  CB  . THR B 1 258 ? 26.399 9.524   -5.196  1.00 15.78 ? 365  THR B CB  1 
ATOM   5548 O  OG1 . THR B 1 258 ? 26.835 10.602  -4.365  1.00 18.32 ? 365  THR B OG1 1 
ATOM   5549 C  CG2 . THR B 1 258 ? 25.593 10.088  -6.373  1.00 21.47 ? 365  THR B CG2 1 
ATOM   5550 N  N   . GLY B 1 259 ? 27.503 7.157   -3.785  1.00 15.17 ? 366  GLY B N   1 
ATOM   5551 C  CA  . GLY B 1 259 ? 28.642 6.707   -2.985  1.00 12.20 ? 366  GLY B CA  1 
ATOM   5552 C  C   . GLY B 1 259 ? 28.403 5.479   -2.114  1.00 14.02 ? 366  GLY B C   1 
ATOM   5553 O  O   . GLY B 1 259 ? 27.332 4.887   -2.153  1.00 11.59 ? 366  GLY B O   1 
ATOM   5554 N  N   . THR B 1 260 ? 29.392 5.093   -1.304  1.00 12.50 ? 367  THR B N   1 
ATOM   5555 C  CA  . THR B 1 260 ? 29.154 4.009   -0.351  1.00 12.29 ? 367  THR B CA  1 
ATOM   5556 C  C   . THR B 1 260 ? 28.211 4.466   0.768   1.00 12.96 ? 367  THR B C   1 
ATOM   5557 O  O   . THR B 1 260 ? 27.685 3.641   1.508   1.00 14.41 ? 367  THR B O   1 
ATOM   5558 C  CB  . THR B 1 260 ? 30.463 3.460   0.268   1.00 14.27 ? 367  THR B CB  1 
ATOM   5559 O  OG1 . THR B 1 260 ? 31.201 4.531   0.880   1.00 14.07 ? 367  THR B OG1 1 
ATOM   5560 C  CG2 . THR B 1 260 ? 31.313 2.797   -0.811  1.00 14.12 ? 367  THR B CG2 1 
ATOM   5561 N  N   . SER B 1 261 ? 27.988 5.775   0.882   1.00 11.32 ? 368  SER B N   1 
ATOM   5562 C  CA  . SER B 1 261 ? 27.018 6.278   1.844   1.00 12.19 ? 368  SER B CA  1 
ATOM   5563 C  C   . SER B 1 261 ? 25.613 5.800   1.546   1.00 15.04 ? 368  SER B C   1 
ATOM   5564 O  O   . SER B 1 261 ? 24.769 5.793   2.423   1.00 20.44 ? 368  SER B O   1 
ATOM   5565 C  CB  . SER B 1 261 ? 27.015 7.802   1.877   1.00 13.03 ? 368  SER B CB  1 
ATOM   5566 O  OG  . SER B 1 261 ? 28.090 8.253   2.658   1.00 15.93 ? 368  SER B OG  1 
ATOM   5567 N  N   . ALA B 1 262 ? 25.350 5.445   0.298   1.00 13.28 ? 369  ALA B N   1 
ATOM   5568 C  CA  . ALA B 1 262 ? 24.041 4.942   -0.057  1.00 15.19 ? 369  ALA B CA  1 
ATOM   5569 C  C   . ALA B 1 262 ? 23.984 3.432   0.126   1.00 14.51 ? 369  ALA B C   1 
ATOM   5570 O  O   . ALA B 1 262 ? 22.910 2.891   0.344   1.00 16.16 ? 369  ALA B O   1 
ATOM   5571 C  CB  . ALA B 1 262 ? 23.682 5.337   -1.492  1.00 14.69 ? 369  ALA B CB  1 
ATOM   5572 N  N   . SER B 1 263 ? 25.131 2.752   0.075   1.00 12.56 ? 370  SER B N   1 
ATOM   5573 C  CA  . SER B 1 263 ? 25.138 1.285   0.211   1.00 12.23 ? 370  SER B CA  1 
ATOM   5574 C  C   . SER B 1 263 ? 24.928 0.793   1.653   1.00 13.93 ? 370  SER B C   1 
ATOM   5575 O  O   . SER B 1 263 ? 24.180 -0.159  1.884   1.00 11.89 ? 370  SER B O   1 
ATOM   5576 C  CB  . SER B 1 263 ? 26.444 0.695   -0.356  1.00 13.17 ? 370  SER B CB  1 
ATOM   5577 O  OG  . SER B 1 263 ? 26.427 0.700   -1.784  1.00 13.36 ? 370  SER B OG  1 
ATOM   5578 N  N   . ALA B 1 264 ? 25.573 1.432   2.621   1.00 13.32 ? 371  ALA B N   1 
ATOM   5579 C  CA  . ALA B 1 264 ? 25.455 0.982   4.004   1.00 13.26 ? 371  ALA B CA  1 
ATOM   5580 C  C   . ALA B 1 264 ? 24.004 1.034   4.541   1.00 11.33 ? 371  ALA B C   1 
ATOM   5581 O  O   . ALA B 1 264 ? 23.555 0.069   5.154   1.00 12.88 ? 371  ALA B O   1 
ATOM   5582 C  CB  . ALA B 1 264 ? 26.409 1.786   4.912   1.00 10.67 ? 371  ALA B CB  1 
ATOM   5583 N  N   . PRO B 1 265 ? 23.265 2.138   4.290   1.00 11.89 ? 372  PRO B N   1 
ATOM   5584 C  CA  . PRO B 1 265 ? 21.868 2.200   4.747   1.00 11.79 ? 372  PRO B CA  1 
ATOM   5585 C  C   . PRO B 1 265 ? 20.991 1.147   4.099   1.00 11.91 ? 372  PRO B C   1 
ATOM   5586 O  O   . PRO B 1 265 ? 20.140 0.600   4.791   1.00 9.69  ? 372  PRO B O   1 
ATOM   5587 C  CB  . PRO B 1 265 ? 21.411 3.606   4.320   1.00 13.18 ? 372  PRO B CB  1 
ATOM   5588 C  CG  . PRO B 1 265 ? 22.644 4.400   4.296   1.00 14.37 ? 372  PRO B CG  1 
ATOM   5589 C  CD  . PRO B 1 265 ? 23.729 3.460   3.830   1.00 12.09 ? 372  PRO B CD  1 
ATOM   5590 N  N   . LEU B 1 266 ? 21.198 0.875   2.811   1.00 10.01 ? 373  LEU B N   1 
ATOM   5591 C  CA  . LEU B 1 266 ? 20.460 -0.188  2.136   1.00 13.12 ? 373  LEU B CA  1 
ATOM   5592 C  C   . LEU B 1 266 ? 20.764 -1.518  2.805   1.00 12.57 ? 373  LEU B C   1 
ATOM   5593 O  O   . LEU B 1 266 ? 19.863 -2.321  3.024   1.00 12.91 ? 373  LEU B O   1 
ATOM   5594 C  CB  . LEU B 1 266 ? 20.804 -0.265  0.641   1.00 11.02 ? 373  LEU B CB  1 
ATOM   5595 C  CG  . LEU B 1 266 ? 20.364 0.879   -0.267  1.00 13.36 ? 373  LEU B CG  1 
ATOM   5596 C  CD1 . LEU B 1 266 ? 20.897 0.673   -1.702  1.00 13.24 ? 373  LEU B CD1 1 
ATOM   5597 C  CD2 . LEU B 1 266 ? 18.827 1.025   -0.261  1.00 13.16 ? 373  LEU B CD2 1 
ATOM   5598 N  N   . ALA B 1 267 ? 22.031 -1.751  3.129   1.00 9.19  ? 374  ALA B N   1 
ATOM   5599 C  CA  . ALA B 1 267 ? 22.403 -2.977  3.829   1.00 14.30 ? 374  ALA B CA  1 
ATOM   5600 C  C   . ALA B 1 267 ? 21.732 -3.037  5.200   1.00 10.49 ? 374  ALA B C   1 
ATOM   5601 O  O   . ALA B 1 267 ? 21.227 -4.084  5.606   1.00 10.24 ? 374  ALA B O   1 
ATOM   5602 C  CB  . ALA B 1 267 ? 23.930 -3.076  3.976   1.00 11.59 ? 374  ALA B CB  1 
ATOM   5603 N  N   . ALA B 1 268 ? 21.733 -1.902  5.906   1.00 8.84  ? 375  ALA B N   1 
ATOM   5604 C  CA  . ALA B 1 268 ? 21.099 -1.791  7.214   1.00 9.97  ? 375  ALA B CA  1 
ATOM   5605 C  C   . ALA B 1 268 ? 19.627 -2.171  7.138   1.00 9.43  ? 375  ALA B C   1 
ATOM   5606 O  O   . ALA B 1 268 ? 19.103 -2.826  8.035   1.00 8.21  ? 375  ALA B O   1 
ATOM   5607 C  CB  . ALA B 1 268 ? 21.232 -0.367  7.770   1.00 8.12  ? 375  ALA B CB  1 
ATOM   5608 N  N   . GLY B 1 269 ? 18.968 -1.733  6.069   1.00 10.78 ? 376  GLY B N   1 
ATOM   5609 C  CA  . GLY B 1 269 ? 17.572 -2.073  5.843   1.00 9.84  ? 376  GLY B CA  1 
ATOM   5610 C  C   . GLY B 1 269 ? 17.372 -3.559  5.635   1.00 10.91 ? 376  GLY B C   1 
ATOM   5611 O  O   . GLY B 1 269 ? 16.444 -4.146  6.180   1.00 9.68  ? 376  GLY B O   1 
ATOM   5612 N  N   . ILE B 1 270 ? 18.236 -4.172  4.829   1.00 9.66  ? 377  ILE B N   1 
ATOM   5613 C  CA  . ILE B 1 270 ? 18.156 -5.617  4.597   1.00 12.77 ? 377  ILE B CA  1 
ATOM   5614 C  C   . ILE B 1 270 ? 18.363 -6.386  5.901   1.00 10.84 ? 377  ILE B C   1 
ATOM   5615 O  O   . ILE B 1 270 ? 17.664 -7.345  6.188   1.00 11.84 ? 377  ILE B O   1 
ATOM   5616 C  CB  . ILE B 1 270 ? 19.195 -6.066  3.543   1.00 12.71 ? 377  ILE B CB  1 
ATOM   5617 C  CG1 . ILE B 1 270 ? 18.801 -5.485  2.179   1.00 13.31 ? 377  ILE B CG1 1 
ATOM   5618 C  CG2 . ILE B 1 270 ? 19.303 -7.604  3.477   1.00 9.85  ? 377  ILE B CG2 1 
ATOM   5619 C  CD1 . ILE B 1 270 ? 19.858 -5.681  1.085   1.00 12.94 ? 377  ILE B CD1 1 
ATOM   5620 N  N   . ILE B 1 271 ? 19.309 -5.933  6.708   1.00 10.16 ? 378  ILE B N   1 
ATOM   5621 C  CA  . ILE B 1 271 ? 19.582 -6.568  7.986   1.00 8.34  ? 378  ILE B CA  1 
ATOM   5622 C  C   . ILE B 1 271 ? 18.365 -6.428  8.894   1.00 11.82 ? 378  ILE B C   1 
ATOM   5623 O  O   . ILE B 1 271 ? 18.025 -7.337  9.634   1.00 13.09 ? 378  ILE B O   1 
ATOM   5624 C  CB  . ILE B 1 271 ? 20.837 -5.958  8.621   1.00 10.57 ? 378  ILE B CB  1 
ATOM   5625 C  CG1 . ILE B 1 271 ? 22.068 -6.423  7.847   1.00 12.11 ? 378  ILE B CG1 1 
ATOM   5626 C  CG2 . ILE B 1 271 ? 20.959 -6.312  10.114  1.00 11.29 ? 378  ILE B CG2 1 
ATOM   5627 C  CD1 . ILE B 1 271 ? 23.303 -5.603  8.161   1.00 14.81 ? 378  ILE B CD1 1 
ATOM   5628 N  N   . ALA B 1 272 ? 17.675 -5.301  8.793   1.00 8.78  ? 379  ALA B N   1 
ATOM   5629 C  CA  . ALA B 1 272 ? 16.452 -5.123  9.560   1.00 10.70 ? 379  ALA B CA  1 
ATOM   5630 C  C   . ALA B 1 272 ? 15.388 -6.176  9.197   1.00 10.39 ? 379  ALA B C   1 
ATOM   5631 O  O   . ALA B 1 272 ? 14.763 -6.758  10.077  1.00 12.36 ? 379  ALA B O   1 
ATOM   5632 C  CB  . ALA B 1 272 ? 15.897 -3.703  9.353   1.00 10.92 ? 379  ALA B CB  1 
ATOM   5633 N  N   . LEU B 1 273 ? 15.188 -6.416  7.905   1.00 10.86 ? 380  LEU B N   1 
ATOM   5634 C  CA  . LEU B 1 273 ? 14.239 -7.435  7.458   1.00 10.38 ? 380  LEU B CA  1 
ATOM   5635 C  C   . LEU B 1 273 ? 14.645 -8.792  8.025   1.00 10.45 ? 380  LEU B C   1 
ATOM   5636 O  O   . LEU B 1 273 ? 13.805 -9.614  8.377   1.00 10.38 ? 380  LEU B O   1 
ATOM   5637 C  CB  . LEU B 1 273 ? 14.181 -7.505  5.926   1.00 9.26  ? 380  LEU B CB  1 
ATOM   5638 C  CG  . LEU B 1 273 ? 13.846 -6.214  5.163   1.00 9.67  ? 380  LEU B CG  1 
ATOM   5639 C  CD1 . LEU B 1 273 ? 13.673 -6.538  3.701   1.00 9.17  ? 380  LEU B CD1 1 
ATOM   5640 C  CD2 . LEU B 1 273 ? 12.573 -5.583  5.708   1.00 11.84 ? 380  LEU B CD2 1 
ATOM   5641 N  N   . THR B 1 274 ? 15.951 -9.005  8.110   1.00 11.18 ? 381  THR B N   1 
ATOM   5642 C  CA  . THR B 1 274 ? 16.510 -10.266 8.574   1.00 9.56  ? 381  THR B CA  1 
ATOM   5643 C  C   . THR B 1 274 ? 16.269 -10.464 10.077  1.00 14.58 ? 381  THR B C   1 
ATOM   5644 O  O   . THR B 1 274 ? 15.928 -11.560 10.525  1.00 10.04 ? 381  THR B O   1 
ATOM   5645 C  CB  . THR B 1 274 ? 18.018 -10.345 8.238   1.00 12.08 ? 381  THR B CB  1 
ATOM   5646 O  OG1 . THR B 1 274 ? 18.189 -10.151 6.822   1.00 11.66 ? 381  THR B OG1 1 
ATOM   5647 C  CG2 . THR B 1 274 ? 18.583 -11.708 8.621   1.00 10.35 ? 381  THR B CG2 1 
ATOM   5648 N  N   . LEU B 1 275 ? 16.423 -9.398  10.854  1.00 10.99 ? 382  LEU B N   1 
ATOM   5649 C  CA  . LEU B 1 275 ? 16.131 -9.453  12.277  1.00 10.51 ? 382  LEU B CA  1 
ATOM   5650 C  C   . LEU B 1 275 ? 14.635 -9.641  12.540  1.00 13.11 ? 382  LEU B C   1 
ATOM   5651 O  O   . LEU B 1 275 ? 14.253 -10.267 13.522  1.00 14.45 ? 382  LEU B O   1 
ATOM   5652 C  CB  . LEU B 1 275 ? 16.613 -8.178  12.982  1.00 12.00 ? 382  LEU B CB  1 
ATOM   5653 C  CG  . LEU B 1 275 ? 18.045 -8.105  13.502  1.00 17.77 ? 382  LEU B CG  1 
ATOM   5654 C  CD1 . LEU B 1 275 ? 18.236 -6.778  14.259  1.00 14.74 ? 382  LEU B CD1 1 
ATOM   5655 C  CD2 . LEU B 1 275 ? 18.401 -9.317  14.395  1.00 16.11 ? 382  LEU B CD2 1 
ATOM   5656 N  N   . GLU B 1 276 ? 13.784 -9.099  11.678  1.00 10.22 ? 383  GLU B N   1 
ATOM   5657 C  CA  . GLU B 1 276 ? 12.359 -9.359  11.837  1.00 14.54 ? 383  GLU B CA  1 
ATOM   5658 C  C   . GLU B 1 276 ? 12.069 -10.844 11.648  1.00 14.70 ? 383  GLU B C   1 
ATOM   5659 O  O   . GLU B 1 276 ? 11.246 -11.412 12.353  1.00 14.43 ? 383  GLU B O   1 
ATOM   5660 C  CB  . GLU B 1 276 ? 11.499 -8.544  10.863  1.00 13.33 ? 383  GLU B CB  1 
ATOM   5661 C  CG  . GLU B 1 276 ? 9.993  -8.704  11.157  1.00 17.04 ? 383  GLU B CG  1 
ATOM   5662 C  CD  . GLU B 1 276 ? 9.111  -8.030  10.129  1.00 17.36 ? 383  GLU B CD  1 
ATOM   5663 O  OE1 . GLU B 1 276 ? 9.645  -7.402  9.192   1.00 20.58 ? 383  GLU B OE1 1 
ATOM   5664 O  OE2 . GLU B 1 276 ? 7.880  -8.127  10.265  1.00 18.99 ? 383  GLU B OE2 1 
ATOM   5665 N  N   . ALA B 1 277 ? 12.773 -11.469 10.712  1.00 14.33 ? 384  ALA B N   1 
ATOM   5666 C  CA  . ALA B 1 277 ? 12.608 -12.891 10.461  1.00 14.37 ? 384  ALA B CA  1 
ATOM   5667 C  C   . ALA B 1 277 ? 13.121 -13.751 11.622  1.00 17.47 ? 384  ALA B C   1 
ATOM   5668 O  O   . ALA B 1 277 ? 12.629 -14.856 11.841  1.00 15.41 ? 384  ALA B O   1 
ATOM   5669 C  CB  . ALA B 1 277 ? 13.298 -13.273 9.172   1.00 14.30 ? 384  ALA B CB  1 
ATOM   5670 N  N   . ASN B 1 278 ? 14.108 -13.253 12.361  1.00 14.43 ? 385  ASN B N   1 
ATOM   5671 C  CA  . ASN B 1 278 ? 14.647 -14.003 13.500  1.00 15.18 ? 385  ASN B CA  1 
ATOM   5672 C  C   . ASN B 1 278 ? 15.290 -13.044 14.491  1.00 13.35 ? 385  ASN B C   1 
ATOM   5673 O  O   . ASN B 1 278 ? 16.453 -12.676 14.360  1.00 9.62  ? 385  ASN B O   1 
ATOM   5674 C  CB  . ASN B 1 278 ? 15.657 -15.073 13.034  1.00 13.63 ? 385  ASN B CB  1 
ATOM   5675 C  CG  . ASN B 1 278 ? 16.229 -15.910 14.185  1.00 17.21 ? 385  ASN B CG  1 
ATOM   5676 O  OD1 . ASN B 1 278 ? 16.065 -15.584 15.363  1.00 15.02 ? 385  ASN B OD1 1 
ATOM   5677 N  ND2 . ASN B 1 278 ? 16.909 -17.004 13.834  1.00 14.87 ? 385  ASN B ND2 1 
ATOM   5678 N  N   . LYS B 1 279 ? 14.514 -12.658 15.497  1.00 15.21 ? 386  LYS B N   1 
ATOM   5679 C  CA  . LYS B 1 279 ? 14.952 -11.677 16.477  1.00 14.61 ? 386  LYS B CA  1 
ATOM   5680 C  C   . LYS B 1 279 ? 16.040 -12.212 17.412  1.00 16.36 ? 386  LYS B C   1 
ATOM   5681 O  O   . LYS B 1 279 ? 16.620 -11.455 18.171  1.00 18.04 ? 386  LYS B O   1 
ATOM   5682 C  CB  . LYS B 1 279 ? 13.745 -11.190 17.295  1.00 19.47 ? 386  LYS B CB  1 
ATOM   5683 C  CG  . LYS B 1 279 ? 12.757 -10.330 16.496  1.00 20.37 ? 386  LYS B CG  1 
ATOM   5684 C  CD  . LYS B 1 279 ? 13.098 -8.859  16.611  0.00 19.65 ? 386  LYS B CD  1 
ATOM   5685 C  CE  . LYS B 1 279 ? 12.811 -8.352  18.012  0.00 21.28 ? 386  LYS B CE  1 
ATOM   5686 N  NZ  . LYS B 1 279 ? 13.844 -7.385  18.468  0.00 21.05 ? 386  LYS B NZ  1 
ATOM   5687 N  N   . ASN B 1 280 ? 16.315 -13.514 17.349  1.00 16.38 ? 387  ASN B N   1 
ATOM   5688 C  CA  . ASN B 1 280 ? 17.324 -14.124 18.211  1.00 13.13 ? 387  ASN B CA  1 
ATOM   5689 C  C   . ASN B 1 280 ? 18.736 -14.074 17.655  1.00 13.24 ? 387  ASN B C   1 
ATOM   5690 O  O   . ASN B 1 280 ? 19.663 -14.572 18.293  1.00 11.28 ? 387  ASN B O   1 
ATOM   5691 C  CB  . ASN B 1 280 ? 16.997 -15.591 18.481  1.00 16.83 ? 387  ASN B CB  1 
ATOM   5692 C  CG  . ASN B 1 280 ? 15.609 -15.801 19.037  1.00 27.56 ? 387  ASN B CG  1 
ATOM   5693 O  OD1 . ASN B 1 280 ? 15.122 -15.021 19.853  1.00 23.32 ? 387  ASN B OD1 1 
ATOM   5694 N  ND2 . ASN B 1 280 ? 14.963 -16.878 18.591  1.00 30.85 ? 387  ASN B ND2 1 
ATOM   5695 N  N   . LEU B 1 281 ? 18.905 -13.536 16.452  1.00 14.17 ? 388  LEU B N   1 
ATOM   5696 C  CA  . LEU B 1 281 ? 20.222 -13.557 15.799  1.00 13.16 ? 388  LEU B CA  1 
ATOM   5697 C  C   . LEU B 1 281 ? 21.252 -12.728 16.569  1.00 11.86 ? 388  LEU B C   1 
ATOM   5698 O  O   . LEU B 1 281 ? 20.968 -11.603 16.966  1.00 12.90 ? 388  LEU B O   1 
ATOM   5699 C  CB  . LEU B 1 281 ? 20.116 -13.055 14.348  1.00 13.04 ? 388  LEU B CB  1 
ATOM   5700 C  CG  . LEU B 1 281 ? 19.354 -13.921 13.338  1.00 14.83 ? 388  LEU B CG  1 
ATOM   5701 C  CD1 . LEU B 1 281 ? 19.136 -13.159 12.044  1.00 10.66 ? 388  LEU B CD1 1 
ATOM   5702 C  CD2 . LEU B 1 281 ? 20.085 -15.266 13.060  1.00 9.99  ? 388  LEU B CD2 1 
ATOM   5703 N  N   . THR B 1 282 ? 22.448 -13.279 16.772  1.00 10.17 ? 389  THR B N   1 
ATOM   5704 C  CA  . THR B 1 282 ? 23.532 -12.516 17.385  1.00 12.01 ? 389  THR B CA  1 
ATOM   5705 C  C   . THR B 1 282 ? 24.259 -11.669 16.336  1.00 13.25 ? 389  THR B C   1 
ATOM   5706 O  O   . THR B 1 282 ? 24.072 -11.857 15.130  1.00 9.95  ? 389  THR B O   1 
ATOM   5707 C  CB  . THR B 1 282 ? 24.560 -13.427 18.074  1.00 14.86 ? 389  THR B CB  1 
ATOM   5708 O  OG1 . THR B 1 282 ? 25.267 -14.153 17.068  1.00 16.63 ? 389  THR B OG1 1 
ATOM   5709 C  CG2 . THR B 1 282 ? 23.881 -14.411 19.058  1.00 11.07 ? 389  THR B CG2 1 
ATOM   5710 N  N   . TRP B 1 283 ? 25.103 -10.743 16.789  1.00 12.93 ? 390  TRP B N   1 
ATOM   5711 C  CA  . TRP B 1 283 ? 25.860 -9.916  15.850  1.00 10.39 ? 390  TRP B CA  1 
ATOM   5712 C  C   . TRP B 1 283 ? 26.719 -10.785 14.927  1.00 11.93 ? 390  TRP B C   1 
ATOM   5713 O  O   . TRP B 1 283 ? 26.884 -10.482 13.753  1.00 11.26 ? 390  TRP B O   1 
ATOM   5714 C  CB  . TRP B 1 283 ? 26.732 -8.891  16.591  1.00 10.48 ? 390  TRP B CB  1 
ATOM   5715 C  CG  . TRP B 1 283 ? 27.887 -9.478  17.412  1.00 10.50 ? 390  TRP B CG  1 
ATOM   5716 C  CD1 . TRP B 1 283 ? 27.819 -10.031 18.663  1.00 13.22 ? 390  TRP B CD1 1 
ATOM   5717 C  CD2 . TRP B 1 283 ? 29.262 -9.514  17.033  1.00 12.72 ? 390  TRP B CD2 1 
ATOM   5718 N  NE1 . TRP B 1 283 ? 29.077 -10.422 19.080  1.00 12.55 ? 390  TRP B NE1 1 
ATOM   5719 C  CE2 . TRP B 1 283 ? 29.976 -10.116 18.092  1.00 11.44 ? 390  TRP B CE2 1 
ATOM   5720 C  CE3 . TRP B 1 283 ? 29.962 -9.099  15.893  1.00 11.54 ? 390  TRP B CE3 1 
ATOM   5721 C  CZ2 . TRP B 1 283 ? 31.353 -10.309 18.042  1.00 13.30 ? 390  TRP B CZ2 1 
ATOM   5722 C  CZ3 . TRP B 1 283 ? 31.328 -9.301  15.842  1.00 12.97 ? 390  TRP B CZ3 1 
ATOM   5723 C  CH2 . TRP B 1 283 ? 32.011 -9.900  16.910  1.00 14.10 ? 390  TRP B CH2 1 
ATOM   5724 N  N   . ARG B 1 284 ? 27.226 -11.889 15.451  1.00 10.92 ? 391  ARG B N   1 
ATOM   5725 C  CA  . ARG B 1 284 ? 28.000 -12.824 14.628  1.00 13.02 ? 391  ARG B CA  1 
ATOM   5726 C  C   . ARG B 1 284 ? 27.131 -13.691 13.711  1.00 10.17 ? 391  ARG B C   1 
ATOM   5727 O  O   . ARG B 1 284 ? 27.509 -13.893 12.558  1.00 9.02  ? 391  ARG B O   1 
ATOM   5728 C  CB  . ARG B 1 284 ? 28.898 -13.703 15.516  1.00 11.37 ? 391  ARG B CB  1 
ATOM   5729 C  CG  . ARG B 1 284 ? 30.201 -12.980 15.880  1.00 14.07 ? 391  ARG B CG  1 
ATOM   5730 C  CD  . ARG B 1 284 ? 30.993 -13.660 17.003  1.00 14.68 ? 391  ARG B CD  1 
ATOM   5731 N  NE  . ARG B 1 284 ? 31.313 -15.050 16.696  1.00 12.56 ? 391  ARG B NE  1 
ATOM   5732 C  CZ  . ARG B 1 284 ? 30.777 -16.090 17.321  1.00 13.37 ? 391  ARG B CZ  1 
ATOM   5733 N  NH1 . ARG B 1 284 ? 31.126 -17.322 16.970  1.00 14.50 ? 391  ARG B NH1 1 
ATOM   5734 N  NH2 . ARG B 1 284 ? 29.892 -15.901 18.291  1.00 14.38 ? 391  ARG B NH2 1 
ATOM   5735 N  N   . ASP B 1 285 ? 25.976 -14.176 14.191  1.00 11.07 ? 392  ASP B N   1 
ATOM   5736 C  CA  . ASP B 1 285 ? 24.983 -14.802 13.301  1.00 11.12 ? 392  ASP B CA  1 
ATOM   5737 C  C   . ASP B 1 285 ? 24.739 -13.970 12.039  1.00 9.54  ? 392  ASP B C   1 
ATOM   5738 O  O   . ASP B 1 285 ? 24.689 -14.500 10.938  1.00 8.92  ? 392  ASP B O   1 
ATOM   5739 C  CB  . ASP B 1 285 ? 23.632 -14.990 13.994  1.00 10.47 ? 392  ASP B CB  1 
ATOM   5740 C  CG  . ASP B 1 285 ? 23.645 -16.076 15.052  1.00 15.38 ? 392  ASP B CG  1 
ATOM   5741 O  OD1 . ASP B 1 285 ? 24.411 -17.067 14.943  1.00 15.11 ? 392  ASP B OD1 1 
ATOM   5742 O  OD2 . ASP B 1 285 ? 22.844 -15.935 15.993  1.00 17.67 ? 392  ASP B OD2 1 
ATOM   5743 N  N   . MET B 1 286 ? 24.570 -12.661 12.211  1.00 10.68 ? 393  MET B N   1 
ATOM   5744 C  CA  . MET B 1 286 ? 24.249 -11.776 11.085  1.00 8.81  ? 393  MET B CA  1 
ATOM   5745 C  C   . MET B 1 286 ? 25.368 -11.749 10.039  1.00 12.12 ? 393  MET B C   1 
ATOM   5746 O  O   . MET B 1 286 ? 25.110 -11.774 8.842   1.00 11.33 ? 393  MET B O   1 
ATOM   5747 C  CB  . MET B 1 286 ? 23.982 -10.345 11.577  1.00 13.21 ? 393  MET B CB  1 
ATOM   5748 C  CG  . MET B 1 286 ? 23.366 -9.471  10.513  1.00 12.58 ? 393  MET B CG  1 
ATOM   5749 S  SD  . MET B 1 286 ? 21.758 -10.106 9.953   1.00 14.36 ? 393  MET B SD  1 
ATOM   5750 C  CE  . MET B 1 286 ? 20.770 -9.889  11.417  1.00 12.14 ? 393  MET B CE  1 
ATOM   5751 N  N   . GLN B 1 287 ? 26.615 -11.704 10.489  1.00 8.55  ? 394  GLN B N   1 
ATOM   5752 C  CA  . GLN B 1 287 ? 27.712 -11.752 9.542   1.00 10.08 ? 394  GLN B CA  1 
ATOM   5753 C  C   . GLN B 1 287 ? 27.787 -13.128 8.864   1.00 10.30 ? 394  GLN B C   1 
ATOM   5754 O  O   . GLN B 1 287 ? 28.083 -13.208 7.680   1.00 10.87 ? 394  GLN B O   1 
ATOM   5755 C  CB  . GLN B 1 287 ? 29.031 -11.396 10.231  1.00 8.09  ? 394  GLN B CB  1 
ATOM   5756 C  CG  . GLN B 1 287 ? 29.033 -9.963  10.757  1.00 11.02 ? 394  GLN B CG  1 
ATOM   5757 C  CD  . GLN B 1 287 ? 30.416 -9.456  11.159  1.00 16.35 ? 394  GLN B CD  1 
ATOM   5758 O  OE1 . GLN B 1 287 ? 31.445 -9.897  10.634  1.00 15.82 ? 394  GLN B OE1 1 
ATOM   5759 N  NE2 . GLN B 1 287 ? 30.440 -8.535  12.105  1.00 13.21 ? 394  GLN B NE2 1 
ATOM   5760 N  N   . HIS B 1 288 ? 27.516 -14.200 9.603   1.00 9.47  ? 395  HIS B N   1 
ATOM   5761 C  CA  . HIS B 1 288 ? 27.465 -15.528 8.983   1.00 12.83 ? 395  HIS B CA  1 
ATOM   5762 C  C   . HIS B 1 288 ? 26.403 -15.590 7.879   1.00 11.42 ? 395  HIS B C   1 
ATOM   5763 O  O   . HIS B 1 288 ? 26.640 -16.141 6.806   1.00 12.09 ? 395  HIS B O   1 
ATOM   5764 C  CB  . HIS B 1 288 ? 27.169 -16.619 10.020  1.00 9.99  ? 395  HIS B CB  1 
ATOM   5765 C  CG  . HIS B 1 288 ? 28.371 -17.098 10.774  1.00 12.45 ? 395  HIS B CG  1 
ATOM   5766 N  ND1 . HIS B 1 288 ? 29.198 -18.095 10.299  1.00 18.08 ? 395  HIS B ND1 1 
ATOM   5767 C  CD2 . HIS B 1 288 ? 28.868 -16.739 11.983  1.00 11.88 ? 395  HIS B CD2 1 
ATOM   5768 C  CE1 . HIS B 1 288 ? 30.158 -18.322 11.179  1.00 16.50 ? 395  HIS B CE1 1 
ATOM   5769 N  NE2 . HIS B 1 288 ? 29.977 -17.520 12.212  1.00 15.04 ? 395  HIS B NE2 1 
ATOM   5770 N  N   . LEU B 1 289 ? 25.220 -15.054 8.157   1.00 7.81  ? 396  LEU B N   1 
ATOM   5771 C  CA  . LEU B 1 289 ? 24.139 -15.049 7.174   1.00 10.72 ? 396  LEU B CA  1 
ATOM   5772 C  C   . LEU B 1 289 ? 24.547 -14.292 5.914   1.00 11.76 ? 396  LEU B C   1 
ATOM   5773 O  O   . LEU B 1 289 ? 24.265 -14.721 4.785   1.00 12.90 ? 396  LEU B O   1 
ATOM   5774 C  CB  . LEU B 1 289 ? 22.867 -14.426 7.763   1.00 8.33  ? 396  LEU B CB  1 
ATOM   5775 C  CG  . LEU B 1 289 ? 22.161 -15.238 8.840   1.00 10.90 ? 396  LEU B CG  1 
ATOM   5776 C  CD1 . LEU B 1 289 ? 20.910 -14.514 9.330   1.00 12.25 ? 396  LEU B CD1 1 
ATOM   5777 C  CD2 . LEU B 1 289 ? 21.816 -16.609 8.304   1.00 11.29 ? 396  LEU B CD2 1 
ATOM   5778 N  N   . VAL B 1 290 ? 25.214 -13.162 6.110   1.00 9.85  ? 397  VAL B N   1 
ATOM   5779 C  CA  . VAL B 1 290 ? 25.687 -12.358 4.982   1.00 8.49  ? 397  VAL B CA  1 
ATOM   5780 C  C   . VAL B 1 290 ? 26.670 -13.171 4.147   1.00 12.73 ? 397  VAL B C   1 
ATOM   5781 O  O   . VAL B 1 290 ? 26.578 -13.205 2.932   1.00 12.35 ? 397  VAL B O   1 
ATOM   5782 C  CB  . VAL B 1 290 ? 26.363 -11.063 5.458   1.00 12.22 ? 397  VAL B CB  1 
ATOM   5783 C  CG1 . VAL B 1 290 ? 27.172 -10.437 4.333   1.00 8.99  ? 397  VAL B CG1 1 
ATOM   5784 C  CG2 . VAL B 1 290 ? 25.299 -10.089 5.985   1.00 11.00 ? 397  VAL B CG2 1 
ATOM   5785 N  N   . VAL B 1 291 ? 27.602 -13.846 4.809   1.00 10.66 ? 398  VAL B N   1 
ATOM   5786 C  CA  . VAL B 1 291 ? 28.574 -14.648 4.075   1.00 12.17 ? 398  VAL B CA  1 
ATOM   5787 C  C   . VAL B 1 291 ? 27.890 -15.775 3.315   1.00 13.46 ? 398  VAL B C   1 
ATOM   5788 O  O   . VAL B 1 291 ? 28.196 -16.008 2.155   1.00 13.94 ? 398  VAL B O   1 
ATOM   5789 C  CB  . VAL B 1 291 ? 29.661 -15.232 5.011   1.00 12.38 ? 398  VAL B CB  1 
ATOM   5790 C  CG1 . VAL B 1 291 ? 30.532 -16.233 4.259   1.00 16.71 ? 398  VAL B CG1 1 
ATOM   5791 C  CG2 . VAL B 1 291 ? 30.516 -14.111 5.585   1.00 10.97 ? 398  VAL B CG2 1 
ATOM   5792 N  N   . GLN B 1 292 ? 26.936 -16.445 3.960   1.00 13.86 ? 399  GLN B N   1 
ATOM   5793 C  CA  . GLN B 1 292 ? 26.274 -17.597 3.355   1.00 12.72 ? 399  GLN B CA  1 
ATOM   5794 C  C   . GLN B 1 292 ? 25.396 -17.250 2.156   1.00 12.73 ? 399  GLN B C   1 
ATOM   5795 O  O   . GLN B 1 292 ? 25.315 -18.036 1.217   1.00 13.11 ? 399  GLN B O   1 
ATOM   5796 C  CB  . GLN B 1 292 ? 25.430 -18.338 4.398   1.00 12.16 ? 399  GLN B CB  1 
ATOM   5797 C  CG  . GLN B 1 292 ? 26.259 -18.954 5.518   1.00 18.59 ? 399  GLN B CG  1 
ATOM   5798 C  CD  . GLN B 1 292 ? 26.024 -20.445 5.672   1.00 17.61 ? 399  GLN B CD  1 
ATOM   5799 O  OE1 . GLN B 1 292 ? 25.141 -21.000 5.040   1.00 17.00 ? 399  GLN B OE1 1 
ATOM   5800 N  NE2 . GLN B 1 292 ? 26.811 -21.092 6.525   1.00 15.43 ? 399  GLN B NE2 1 
ATOM   5801 N  N   . THR B 1 293 ? 24.735 -16.094 2.186   1.00 12.18 ? 400  THR B N   1 
ATOM   5802 C  CA  . THR B 1 293 ? 23.721 -15.786 1.175   1.00 12.04 ? 400  THR B CA  1 
ATOM   5803 C  C   . THR B 1 293 ? 24.146 -14.775 0.106   1.00 13.37 ? 400  THR B C   1 
ATOM   5804 O  O   . THR B 1 293 ? 23.426 -14.577 -0.870  1.00 12.51 ? 400  THR B O   1 
ATOM   5805 C  CB  . THR B 1 293 ? 22.428 -15.246 1.820   1.00 10.59 ? 400  THR B CB  1 
ATOM   5806 O  OG1 . THR B 1 293 ? 22.724 -14.053 2.554   1.00 11.99 ? 400  THR B OG1 1 
ATOM   5807 C  CG2 . THR B 1 293 ? 21.812 -16.271 2.759   1.00 10.93 ? 400  THR B CG2 1 
ATOM   5808 N  N   . SER B 1 294 ? 25.289 -14.119 0.298   1.00 14.50 ? 401  SER B N   1 
ATOM   5809 C  CA  . SER B 1 294 ? 25.788 -13.150 -0.679  1.00 13.45 ? 401  SER B CA  1 
ATOM   5810 C  C   . SER B 1 294 ? 26.584 -13.866 -1.768  1.00 17.51 ? 401  SER B C   1 
ATOM   5811 O  O   . SER B 1 294 ? 27.428 -14.713 -1.471  1.00 19.30 ? 401  SER B O   1 
ATOM   5812 C  CB  . SER B 1 294 ? 26.667 -12.090 -0.015  1.00 11.93 ? 401  SER B CB  1 
ATOM   5813 O  OG  . SER B 1 294 ? 26.006 -11.460 1.071   1.00 14.22 ? 401  SER B OG  1 
ATOM   5814 N  N   . LYS B 1 295 ? 26.337 -13.479 -3.014  1.00 18.31 ? 402  LYS B N   1 
ATOM   5815 C  CA  . LYS B 1 295 ? 26.894 -14.154 -4.188  1.00 22.15 ? 402  LYS B CA  1 
ATOM   5816 C  C   . LYS B 1 295 ? 27.489 -13.184 -5.206  1.00 15.90 ? 402  LYS B C   1 
ATOM   5817 O  O   . LYS B 1 295 ? 27.041 -12.046 -5.304  1.00 17.67 ? 402  LYS B O   1 
ATOM   5818 C  CB  . LYS B 1 295 ? 25.816 -14.954 -4.908  1.00 19.21 ? 402  LYS B CB  1 
ATOM   5819 C  CG  . LYS B 1 295 ? 25.185 -16.093 -4.164  1.00 28.90 ? 402  LYS B CG  1 
ATOM   5820 C  CD  . LYS B 1 295 ? 23.995 -16.556 -5.002  0.00 23.70 ? 402  LYS B CD  1 
ATOM   5821 C  CE  . LYS B 1 295 ? 23.109 -17.565 -4.301  0.00 25.21 ? 402  LYS B CE  1 
ATOM   5822 N  NZ  . LYS B 1 295 ? 21.970 -17.948 -5.187  0.00 26.59 ? 402  LYS B NZ  1 
ATOM   5823 N  N   . PRO B 1 296 ? 28.459 -13.656 -6.011  1.00 18.14 ? 403  PRO B N   1 
ATOM   5824 C  CA  . PRO B 1 296 ? 28.989 -12.833 -7.105  1.00 16.38 ? 403  PRO B CA  1 
ATOM   5825 C  C   . PRO B 1 296 ? 27.888 -12.320 -8.012  1.00 18.22 ? 403  PRO B C   1 
ATOM   5826 O  O   . PRO B 1 296 ? 27.995 -11.202 -8.501  1.00 20.30 ? 403  PRO B O   1 
ATOM   5827 C  CB  . PRO B 1 296 ? 29.907 -13.798 -7.862  1.00 18.49 ? 403  PRO B CB  1 
ATOM   5828 C  CG  . PRO B 1 296 ? 30.324 -14.764 -6.848  1.00 21.29 ? 403  PRO B CG  1 
ATOM   5829 C  CD  . PRO B 1 296 ? 29.159 -14.947 -5.916  1.00 16.75 ? 403  PRO B CD  1 
ATOM   5830 N  N   . ALA B 1 297 ? 26.842 -13.124 -8.210  1.00 15.29 ? 404  ALA B N   1 
ATOM   5831 C  CA  . ALA B 1 297 ? 25.708 -12.732 -9.030  1.00 17.69 ? 404  ALA B CA  1 
ATOM   5832 C  C   . ALA B 1 297 ? 26.202 -12.150 -10.361 1.00 18.45 ? 404  ALA B C   1 
ATOM   5833 O  O   . ALA B 1 297 ? 26.989 -12.781 -11.069 1.00 19.99 ? 404  ALA B O   1 
ATOM   5834 C  CB  . ALA B 1 297 ? 24.819 -11.726 -8.275  1.00 18.06 ? 404  ALA B CB  1 
ATOM   5835 N  N   . HIS B 1 298 ? 25.789 -10.935 -10.687 1.00 16.02 ? 405  HIS B N   1 
ATOM   5836 C  CA  . HIS B 1 298 ? 26.254 -10.342 -11.943 1.00 19.00 ? 405  HIS B CA  1 
ATOM   5837 C  C   . HIS B 1 298 ? 27.159 -9.147  -11.682 1.00 18.02 ? 405  HIS B C   1 
ATOM   5838 O  O   . HIS B 1 298 ? 27.217 -8.204  -12.464 1.00 20.48 ? 405  HIS B O   1 
ATOM   5839 C  CB  . HIS B 1 298 ? 25.064 -9.956  -12.820 1.00 17.93 ? 405  HIS B CB  1 
ATOM   5840 C  CG  . HIS B 1 298 ? 24.226 -11.127 -13.223 1.00 18.54 ? 405  HIS B CG  1 
ATOM   5841 N  ND1 . HIS B 1 298 ? 24.656 -12.070 -14.133 1.00 20.04 ? 405  HIS B ND1 1 
ATOM   5842 C  CD2 . HIS B 1 298 ? 23.002 -11.531 -12.810 1.00 19.36 ? 405  HIS B CD2 1 
ATOM   5843 C  CE1 . HIS B 1 298 ? 23.725 -12.996 -14.274 1.00 21.75 ? 405  HIS B CE1 1 
ATOM   5844 N  NE2 . HIS B 1 298 ? 22.709 -12.692 -13.485 1.00 19.94 ? 405  HIS B NE2 1 
ATOM   5845 N  N   . LEU B 1 299 ? 27.877 -9.207  -10.573 1.00 16.03 ? 406  LEU B N   1 
ATOM   5846 C  CA  . LEU B 1 299 ? 28.879 -8.196  -10.267 1.00 14.35 ? 406  LEU B CA  1 
ATOM   5847 C  C   . LEU B 1 299 ? 30.216 -8.492  -10.961 1.00 16.70 ? 406  LEU B C   1 
ATOM   5848 O  O   . LEU B 1 299 ? 30.832 -9.543  -10.753 1.00 15.78 ? 406  LEU B O   1 
ATOM   5849 C  CB  . LEU B 1 299 ? 29.080 -8.091  -8.763  1.00 14.26 ? 406  LEU B CB  1 
ATOM   5850 C  CG  . LEU B 1 299 ? 27.826 -7.818  -7.926  1.00 14.36 ? 406  LEU B CG  1 
ATOM   5851 C  CD1 . LEU B 1 299 ? 28.213 -7.561  -6.465  1.00 14.88 ? 406  LEU B CD1 1 
ATOM   5852 C  CD2 . LEU B 1 299 ? 27.020 -6.660  -8.497  1.00 14.56 ? 406  LEU B CD2 1 
ATOM   5853 N  N   . ASN B 1 300 ? 30.659 -7.546  -11.780 1.00 17.24 ? 407  ASN B N   1 
ATOM   5854 C  CA  . ASN B 1 300 ? 31.923 -7.674  -12.512 1.00 20.24 ? 407  ASN B CA  1 
ATOM   5855 C  C   . ASN B 1 300 ? 33.116 -7.146  -11.720 1.00 16.24 ? 407  ASN B C   1 
ATOM   5856 O  O   . ASN B 1 300 ? 33.106 -6.007  -11.262 1.00 15.26 ? 407  ASN B O   1 
ATOM   5857 C  CB  . ASN B 1 300 ? 31.838 -6.927  -13.851 1.00 14.52 ? 407  ASN B CB  1 
ATOM   5858 C  CG  . ASN B 1 300 ? 30.610 -7.307  -14.656 1.00 21.31 ? 407  ASN B CG  1 
ATOM   5859 O  OD1 . ASN B 1 300 ? 29.914 -6.441  -15.195 1.00 25.53 ? 407  ASN B OD1 1 
ATOM   5860 N  ND2 . ASN B 1 300 ? 30.326 -8.602  -14.726 1.00 17.43 ? 407  ASN B ND2 1 
ATOM   5861 N  N   . ALA B 1 301 ? 34.148 -7.971  -11.573 1.00 16.30 ? 408  ALA B N   1 
ATOM   5862 C  CA  . ALA B 1 301 ? 35.408 -7.523  -10.982 1.00 19.88 ? 408  ALA B CA  1 
ATOM   5863 C  C   . ALA B 1 301 ? 36.552 -8.310  -11.593 1.00 19.64 ? 408  ALA B C   1 
ATOM   5864 O  O   . ALA B 1 301 ? 36.350 -9.405  -12.103 1.00 20.20 ? 408  ALA B O   1 
ATOM   5865 C  CB  . ALA B 1 301 ? 35.406 -7.686  -9.482  1.00 14.68 ? 408  ALA B CB  1 
ATOM   5866 N  N   . ASN B 1 302 ? 37.761 -7.767  -11.546 1.00 18.01 ? 409  ASN B N   1 
ATOM   5867 C  CA  . ASN B 1 302 ? 38.864 -8.517  -12.115 1.00 22.29 ? 409  ASN B CA  1 
ATOM   5868 C  C   . ASN B 1 302 ? 39.552 -9.400  -11.081 1.00 21.96 ? 409  ASN B C   1 
ATOM   5869 O  O   . ASN B 1 302 ? 40.505 -10.091 -11.401 1.00 27.75 ? 409  ASN B O   1 
ATOM   5870 C  CB  . ASN B 1 302 ? 39.861 -7.567  -12.781 1.00 30.29 ? 409  ASN B CB  1 
ATOM   5871 C  CG  . ASN B 1 302 ? 39.354 -7.049  -14.124 1.00 35.48 ? 409  ASN B CG  1 
ATOM   5872 O  OD1 . ASN B 1 302 ? 38.980 -7.830  -15.000 0.00 33.08 ? 409  ASN B OD1 1 
ATOM   5873 N  ND2 . ASN B 1 302 ? 39.323 -5.731  -14.280 0.00 35.36 ? 409  ASN B ND2 1 
ATOM   5874 N  N   . ASP B 1 303 ? 39.058 -9.405  -9.847  1.00 17.28 ? 410  ASP B N   1 
ATOM   5875 C  CA  . ASP B 1 303 ? 39.755 -10.148 -8.803  1.00 18.67 ? 410  ASP B CA  1 
ATOM   5876 C  C   . ASP B 1 303 ? 38.898 -11.197 -8.081  1.00 17.96 ? 410  ASP B C   1 
ATOM   5877 O  O   . ASP B 1 303 ? 39.207 -11.561 -6.950  1.00 22.48 ? 410  ASP B O   1 
ATOM   5878 C  CB  . ASP B 1 303 ? 40.338 -9.178  -7.768  1.00 20.39 ? 410  ASP B CB  1 
ATOM   5879 C  CG  . ASP B 1 303 ? 39.267 -8.571  -6.864  1.00 22.80 ? 410  ASP B CG  1 
ATOM   5880 O  OD1 . ASP B 1 303 ? 38.118 -8.396  -7.328  1.00 19.73 ? 410  ASP B OD1 1 
ATOM   5881 O  OD2 . ASP B 1 303 ? 39.569 -8.275  -5.684  1.00 24.31 ? 410  ASP B OD2 1 
ATOM   5882 N  N   . TRP B 1 304 ? 37.834 -11.686 -8.712  1.00 16.93 ? 411  TRP B N   1 
ATOM   5883 C  CA  . TRP B 1 304 ? 37.082 -12.783 -8.103  1.00 17.58 ? 411  TRP B CA  1 
ATOM   5884 C  C   . TRP B 1 304 ? 38.012 -13.976 -7.878  1.00 18.61 ? 411  TRP B C   1 
ATOM   5885 O  O   . TRP B 1 304 ? 38.723 -14.377 -8.768  1.00 24.80 ? 411  TRP B O   1 
ATOM   5886 C  CB  . TRP B 1 304 ? 35.890 -13.209 -8.960  1.00 19.06 ? 411  TRP B CB  1 
ATOM   5887 C  CG  . TRP B 1 304 ? 34.718 -12.301 -8.851  1.00 17.79 ? 411  TRP B CG  1 
ATOM   5888 C  CD1 . TRP B 1 304 ? 34.201 -11.514 -9.831  1.00 14.76 ? 411  TRP B CD1 1 
ATOM   5889 C  CD2 . TRP B 1 304 ? 33.920 -12.076 -7.687  1.00 12.98 ? 411  TRP B CD2 1 
ATOM   5890 N  NE1 . TRP B 1 304 ? 33.130 -10.808 -9.353  1.00 17.88 ? 411  TRP B NE1 1 
ATOM   5891 C  CE2 . TRP B 1 304 ? 32.934 -11.137 -8.038  1.00 15.44 ? 411  TRP B CE2 1 
ATOM   5892 C  CE3 . TRP B 1 304 ? 33.943 -12.581 -6.385  1.00 14.41 ? 411  TRP B CE3 1 
ATOM   5893 C  CZ2 . TRP B 1 304 ? 31.974 -10.695 -7.135  1.00 12.34 ? 411  TRP B CZ2 1 
ATOM   5894 C  CZ3 . TRP B 1 304 ? 32.996 -12.134 -5.485  1.00 12.80 ? 411  TRP B CZ3 1 
ATOM   5895 C  CH2 . TRP B 1 304 ? 32.026 -11.200 -5.864  1.00 10.94 ? 411  TRP B CH2 1 
ATOM   5896 N  N   . ALA B 1 305 ? 38.018 -14.518 -6.671  1.00 19.61 ? 412  ALA B N   1 
ATOM   5897 C  CA  . ALA B 1 305 ? 38.897 -15.637 -6.347  1.00 23.23 ? 412  ALA B CA  1 
ATOM   5898 C  C   . ALA B 1 305 ? 38.142 -16.646 -5.480  1.00 23.41 ? 412  ALA B C   1 
ATOM   5899 O  O   . ALA B 1 305 ? 37.229 -16.282 -4.753  1.00 20.57 ? 412  ALA B O   1 
ATOM   5900 C  CB  . ALA B 1 305 ? 40.158 -15.144 -5.632  1.00 21.09 ? 412  ALA B CB  1 
ATOM   5901 N  N   . THR B 1 306 ? 38.511 -17.914 -5.580  1.00 23.45 ? 413  THR B N   1 
ATOM   5902 C  CA  . THR B 1 306 ? 37.851 -18.963 -4.816  1.00 21.31 ? 413  THR B CA  1 
ATOM   5903 C  C   . THR B 1 306 ? 38.631 -19.201 -3.543  1.00 20.65 ? 413  THR B C   1 
ATOM   5904 O  O   . THR B 1 306 ? 39.836 -19.408 -3.606  1.00 23.12 ? 413  THR B O   1 
ATOM   5905 C  CB  . THR B 1 306 ? 37.767 -20.274 -5.610  1.00 19.98 ? 413  THR B CB  1 
ATOM   5906 O  OG1 . THR B 1 306 ? 37.057 -20.052 -6.831  1.00 21.52 ? 413  THR B OG1 1 
ATOM   5907 C  CG2 . THR B 1 306 ? 37.054 -21.332 -4.807  1.00 18.81 ? 413  THR B CG2 1 
ATOM   5908 N  N   . ASN B 1 307 ? 37.969 -19.169 -2.389  1.00 17.29 ? 414  ASN B N   1 
ATOM   5909 C  CA  . ASN B 1 307 ? 38.695 -19.417 -1.152  1.00 20.95 ? 414  ASN B CA  1 
ATOM   5910 C  C   . ASN B 1 307 ? 38.667 -20.907 -0.815  1.00 21.41 ? 414  ASN B C   1 
ATOM   5911 O  O   . ASN B 1 307 ? 38.210 -21.720 -1.618  1.00 18.20 ? 414  ASN B O   1 
ATOM   5912 C  CB  . ASN B 1 307 ? 38.146 -18.562 0.007   1.00 16.89 ? 414  ASN B CB  1 
ATOM   5913 C  CG  . ASN B 1 307 ? 36.752 -18.973 0.455   1.00 18.07 ? 414  ASN B CG  1 
ATOM   5914 O  OD1 . ASN B 1 307 ? 36.199 -19.976 0.004   1.00 15.29 ? 414  ASN B OD1 1 
ATOM   5915 N  ND2 . ASN B 1 307 ? 36.184 -18.195 1.375   1.00 17.17 ? 414  ASN B ND2 1 
ATOM   5916 N  N   . GLY B 1 308 ? 39.122 -21.244 0.387   1.00 22.66 ? 415  GLY B N   1 
ATOM   5917 C  CA  . GLY B 1 308 ? 39.284 -22.623 0.798   1.00 20.63 ? 415  GLY B CA  1 
ATOM   5918 C  C   . GLY B 1 308 ? 38.026 -23.433 1.059   1.00 28.14 ? 415  GLY B C   1 
ATOM   5919 O  O   . GLY B 1 308 ? 38.103 -24.648 1.204   1.00 27.17 ? 415  GLY B O   1 
ATOM   5920 N  N   . VAL B 1 309 ? 36.870 -22.786 1.140   1.00 25.32 ? 416  VAL B N   1 
ATOM   5921 C  CA  . VAL B 1 309 ? 35.636 -23.541 1.299   1.00 19.19 ? 416  VAL B CA  1 
ATOM   5922 C  C   . VAL B 1 309 ? 34.802 -23.442 0.045   1.00 19.98 ? 416  VAL B C   1 
ATOM   5923 O  O   . VAL B 1 309 ? 33.624 -23.783 0.044   1.00 20.30 ? 416  VAL B O   1 
ATOM   5924 C  CB  . VAL B 1 309 ? 34.815 -23.065 2.497   1.00 25.21 ? 416  VAL B CB  1 
ATOM   5925 C  CG1 . VAL B 1 309 ? 35.573 -23.348 3.790   1.00 27.56 ? 416  VAL B CG1 1 
ATOM   5926 C  CG2 . VAL B 1 309 ? 34.476 -21.572 2.364   1.00 18.03 ? 416  VAL B CG2 1 
ATOM   5927 N  N   . GLY B 1 310 ? 35.418 -22.967 -1.029  1.00 19.42 ? 417  GLY B N   1 
ATOM   5928 C  CA  . GLY B 1 310 ? 34.749 -22.923 -2.322  1.00 21.50 ? 417  GLY B CA  1 
ATOM   5929 C  C   . GLY B 1 310 ? 33.927 -21.686 -2.643  1.00 16.30 ? 417  GLY B C   1 
ATOM   5930 O  O   . GLY B 1 310 ? 33.240 -21.669 -3.650  1.00 20.74 ? 417  GLY B O   1 
ATOM   5931 N  N   . ARG B 1 311 ? 33.994 -20.646 -1.815  1.00 17.62 ? 418  ARG B N   1 
ATOM   5932 C  CA  . ARG B 1 311 ? 33.227 -19.423 -2.099  1.00 18.00 ? 418  ARG B CA  1 
ATOM   5933 C  C   . ARG B 1 311 ? 34.021 -18.424 -2.943  1.00 17.32 ? 418  ARG B C   1 
ATOM   5934 O  O   . ARG B 1 311 ? 35.229 -18.282 -2.765  1.00 17.14 ? 418  ARG B O   1 
ATOM   5935 C  CB  . ARG B 1 311 ? 32.787 -18.744 -0.797  1.00 18.13 ? 418  ARG B CB  1 
ATOM   5936 C  CG  . ARG B 1 311 ? 31.913 -19.611 0.069   1.00 19.49 ? 418  ARG B CG  1 
ATOM   5937 C  CD  . ARG B 1 311 ? 31.425 -18.866 1.304   1.00 20.20 ? 418  ARG B CD  1 
ATOM   5938 N  NE  . ARG B 1 311 ? 30.454 -19.678 2.026   1.00 22.79 ? 418  ARG B NE  1 
ATOM   5939 C  CZ  . ARG B 1 311 ? 30.572 -20.042 3.294   1.00 14.69 ? 418  ARG B CZ  1 
ATOM   5940 N  NH1 . ARG B 1 311 ? 29.640 -20.793 3.844   1.00 19.98 ? 418  ARG B NH1 1 
ATOM   5941 N  NH2 . ARG B 1 311 ? 31.620 -19.658 4.003   1.00 16.16 ? 418  ARG B NH2 1 
ATOM   5942 N  N   . LYS B 1 312 ? 33.347 -17.720 -3.849  1.00 14.89 ? 419  LYS B N   1 
ATOM   5943 C  CA  . LYS B 1 312 ? 34.004 -16.609 -4.527  1.00 16.51 ? 419  LYS B CA  1 
ATOM   5944 C  C   . LYS B 1 312 ? 34.074 -15.389 -3.596  1.00 19.22 ? 419  LYS B C   1 
ATOM   5945 O  O   . LYS B 1 312 ? 33.090 -15.033 -2.938  1.00 15.57 ? 419  LYS B O   1 
ATOM   5946 C  CB  . LYS B 1 312 ? 33.286 -16.259 -5.829  1.00 14.93 ? 419  LYS B CB  1 
ATOM   5947 C  CG  . LYS B 1 312 ? 33.422 -17.317 -6.942  1.00 17.53 ? 419  LYS B CG  1 
ATOM   5948 C  CD  . LYS B 1 312 ? 34.796 -17.254 -7.598  1.00 23.68 ? 419  LYS B CD  1 
ATOM   5949 C  CE  . LYS B 1 312 ? 34.858 -18.101 -8.878  1.00 28.88 ? 419  LYS B CE  1 
ATOM   5950 N  NZ  . LYS B 1 312 ? 34.468 -17.323 -10.089 1.00 22.01 ? 419  LYS B NZ  1 
ATOM   5951 N  N   . VAL B 1 313 ? 35.248 -14.769 -3.546  1.00 15.51 ? 420  VAL B N   1 
ATOM   5952 C  CA  . VAL B 1 313 ? 35.496 -13.582 -2.729  1.00 14.68 ? 420  VAL B CA  1 
ATOM   5953 C  C   . VAL B 1 313 ? 36.246 -12.552 -3.582  1.00 18.72 ? 420  VAL B C   1 
ATOM   5954 O  O   . VAL B 1 313 ? 37.135 -12.909 -4.358  1.00 18.49 ? 420  VAL B O   1 
ATOM   5955 C  CB  . VAL B 1 313 ? 36.330 -13.912 -1.432  1.00 19.87 ? 420  VAL B CB  1 
ATOM   5956 C  CG1 . VAL B 1 313 ? 35.734 -15.042 -0.697  1.00 21.01 ? 420  VAL B CG1 1 
ATOM   5957 C  CG2 . VAL B 1 313 ? 37.760 -14.314 -1.766  1.00 21.99 ? 420  VAL B CG2 1 
ATOM   5958 N  N   . SER B 1 314 ? 35.866 -11.286 -3.458  1.00 15.00 ? 421  SER B N   1 
ATOM   5959 C  CA  . SER B 1 314 ? 36.519 -10.189 -4.170  1.00 16.26 ? 421  SER B CA  1 
ATOM   5960 C  C   . SER B 1 314 ? 36.911 -9.081  -3.184  1.00 15.03 ? 421  SER B C   1 
ATOM   5961 O  O   . SER B 1 314 ? 36.208 -8.876  -2.201  1.00 13.17 ? 421  SER B O   1 
ATOM   5962 C  CB  . SER B 1 314 ? 35.597 -9.625  -5.255  1.00 12.77 ? 421  SER B CB  1 
ATOM   5963 O  OG  . SER B 1 314 ? 36.043 -8.341  -5.661  1.00 13.85 ? 421  SER B OG  1 
ATOM   5964 N  N   . HIS B 1 315 ? 38.023 -8.380  -3.421  1.00 14.80 ? 422  HIS B N   1 
ATOM   5965 C  CA  . HIS B 1 315 ? 38.389 -7.263  -2.535  1.00 12.41 ? 422  HIS B CA  1 
ATOM   5966 C  C   . HIS B 1 315 ? 37.551 -6.006  -2.815  1.00 14.82 ? 422  HIS B C   1 
ATOM   5967 O  O   . HIS B 1 315 ? 37.510 -5.085  -1.989  1.00 15.61 ? 422  HIS B O   1 
ATOM   5968 C  CB  . HIS B 1 315 ? 39.885 -6.933  -2.641  1.00 12.91 ? 422  HIS B CB  1 
ATOM   5969 C  CG  . HIS B 1 315 ? 40.773 -8.027  -2.132  1.00 13.53 ? 422  HIS B CG  1 
ATOM   5970 N  ND1 . HIS B 1 315 ? 41.073 -9.147  -2.880  1.00 17.09 ? 422  HIS B ND1 1 
ATOM   5971 C  CD2 . HIS B 1 315 ? 41.401 -8.190  -0.942  1.00 14.17 ? 422  HIS B CD2 1 
ATOM   5972 C  CE1 . HIS B 1 315 ? 41.855 -9.949  -2.175  1.00 16.06 ? 422  HIS B CE1 1 
ATOM   5973 N  NE2 . HIS B 1 315 ? 42.064 -9.394  -0.995  1.00 17.35 ? 422  HIS B NE2 1 
ATOM   5974 N  N   . SER B 1 316 ? 36.880 -5.978  -3.965  1.00 14.62 ? 423  SER B N   1 
ATOM   5975 C  CA  . SER B 1 316 ? 35.950 -4.892  -4.296  1.00 13.55 ? 423  SER B CA  1 
ATOM   5976 C  C   . SER B 1 316 ? 34.567 -5.122  -3.687  1.00 13.48 ? 423  SER B C   1 
ATOM   5977 O  O   . SER B 1 316 ? 33.877 -4.171  -3.345  1.00 13.00 ? 423  SER B O   1 
ATOM   5978 C  CB  . SER B 1 316 ? 35.793 -4.738  -5.815  1.00 16.58 ? 423  SER B CB  1 
ATOM   5979 O  OG  . SER B 1 316 ? 36.948 -4.184  -6.420  1.00 20.19 ? 423  SER B OG  1 
ATOM   5980 N  N   . TYR B 1 317 ? 34.169 -6.391  -3.573  1.00 13.36 ? 424  TYR B N   1 
ATOM   5981 C  CA  . TYR B 1 317 ? 32.790 -6.738  -3.234  1.00 13.49 ? 424  TYR B CA  1 
ATOM   5982 C  C   . TYR B 1 317 ? 32.599 -7.614  -1.994  1.00 14.76 ? 424  TYR B C   1 
ATOM   5983 O  O   . TYR B 1 317 ? 31.462 -7.891  -1.589  1.00 11.27 ? 424  TYR B O   1 
ATOM   5984 C  CB  . TYR B 1 317 ? 32.152 -7.468  -4.405  1.00 11.48 ? 424  TYR B CB  1 
ATOM   5985 C  CG  . TYR B 1 317 ? 32.059 -6.693  -5.690  1.00 14.89 ? 424  TYR B CG  1 
ATOM   5986 C  CD1 . TYR B 1 317 ? 31.581 -5.384  -5.713  1.00 12.73 ? 424  TYR B CD1 1 
ATOM   5987 C  CD2 . TYR B 1 317 ? 32.417 -7.282  -6.888  1.00 12.88 ? 424  TYR B CD2 1 
ATOM   5988 C  CE1 . TYR B 1 317 ? 31.462 -4.700  -6.895  1.00 12.88 ? 424  TYR B CE1 1 
ATOM   5989 C  CE2 . TYR B 1 317 ? 32.309 -6.600  -8.079  1.00 14.25 ? 424  TYR B CE2 1 
ATOM   5990 C  CZ  . TYR B 1 317 ? 31.836 -5.307  -8.077  1.00 14.55 ? 424  TYR B CZ  1 
ATOM   5991 O  OH  . TYR B 1 317 ? 31.727 -4.634  -9.264  1.00 17.88 ? 424  TYR B OH  1 
ATOM   5992 N  N   . GLY B 1 318 ? 33.692 -8.078  -1.399  1.00 12.85 ? 425  GLY B N   1 
ATOM   5993 C  CA  . GLY B 1 318 ? 33.569 -9.118  -0.390  1.00 10.54 ? 425  GLY B CA  1 
ATOM   5994 C  C   . GLY B 1 318 ? 32.941 -10.368 -0.994  1.00 12.55 ? 425  GLY B C   1 
ATOM   5995 O  O   . GLY B 1 318 ? 33.350 -10.811 -2.071  1.00 11.29 ? 425  GLY B O   1 
ATOM   5996 N  N   . TYR B 1 319 ? 31.951 -10.943 -0.315  1.00 9.62  ? 426  TYR B N   1 
ATOM   5997 C  CA  . TYR B 1 319 ? 31.294 -12.149 -0.827  1.00 11.54 ? 426  TYR B CA  1 
ATOM   5998 C  C   . TYR B 1 319 ? 30.255 -11.835 -1.899  1.00 13.74 ? 426  TYR B C   1 
ATOM   5999 O  O   . TYR B 1 319 ? 29.674 -12.733 -2.498  1.00 13.13 ? 426  TYR B O   1 
ATOM   6000 C  CB  . TYR B 1 319 ? 30.674 -12.947 0.329   1.00 11.81 ? 426  TYR B CB  1 
ATOM   6001 C  CG  . TYR B 1 319 ? 31.769 -13.603 1.122   1.00 10.67 ? 426  TYR B CG  1 
ATOM   6002 C  CD1 . TYR B 1 319 ? 32.255 -14.852 0.752   1.00 11.58 ? 426  TYR B CD1 1 
ATOM   6003 C  CD2 . TYR B 1 319 ? 32.370 -12.950 2.192   1.00 10.01 ? 426  TYR B CD2 1 
ATOM   6004 C  CE1 . TYR B 1 319 ? 33.288 -15.450 1.448   1.00 14.51 ? 426  TYR B CE1 1 
ATOM   6005 C  CE2 . TYR B 1 319 ? 33.402 -13.544 2.896   1.00 11.25 ? 426  TYR B CE2 1 
ATOM   6006 C  CZ  . TYR B 1 319 ? 33.868 -14.796 2.511   1.00 13.90 ? 426  TYR B CZ  1 
ATOM   6007 O  OH  . TYR B 1 319 ? 34.899 -15.404 3.201   1.00 12.86 ? 426  TYR B OH  1 
ATOM   6008 N  N   . GLY B 1 320 ? 30.065 -10.553 -2.181  1.00 14.24 ? 427  GLY B N   1 
ATOM   6009 C  CA  . GLY B 1 320 ? 29.193 -10.159 -3.269  1.00 11.45 ? 427  GLY B CA  1 
ATOM   6010 C  C   . GLY B 1 320 ? 27.929 -9.416  -2.873  1.00 11.44 ? 427  GLY B C   1 
ATOM   6011 O  O   . GLY B 1 320 ? 27.873 -8.705  -1.863  1.00 11.81 ? 427  GLY B O   1 
ATOM   6012 N  N   . LEU B 1 321 ? 26.903 -9.589  -3.692  1.00 13.43 ? 428  LEU B N   1 
ATOM   6013 C  CA  . LEU B 1 321 ? 25.698 -8.782  -3.597  1.00 14.70 ? 428  LEU B CA  1 
ATOM   6014 C  C   . LEU B 1 321 ? 24.758 -9.305  -2.519  1.00 13.00 ? 428  LEU B C   1 
ATOM   6015 O  O   . LEU B 1 321 ? 24.444 -10.486 -2.492  1.00 10.76 ? 428  LEU B O   1 
ATOM   6016 C  CB  . LEU B 1 321 ? 24.980 -8.758  -4.950  1.00 14.96 ? 428  LEU B CB  1 
ATOM   6017 C  CG  . LEU B 1 321 ? 23.739 -7.878  -5.043  1.00 14.23 ? 428  LEU B CG  1 
ATOM   6018 C  CD1 . LEU B 1 321 ? 24.126 -6.417  -4.987  1.00 14.82 ? 428  LEU B CD1 1 
ATOM   6019 C  CD2 . LEU B 1 321 ? 23.018 -8.197  -6.347  1.00 20.47 ? 428  LEU B CD2 1 
ATOM   6020 N  N   . LEU B 1 322 ? 24.328 -8.426  -1.625  1.00 9.77  ? 429  LEU B N   1 
ATOM   6021 C  CA  . LEU B 1 322 ? 23.309 -8.795  -0.650  1.00 14.82 ? 429  LEU B CA  1 
ATOM   6022 C  C   . LEU B 1 322 ? 22.019 -9.234  -1.330  1.00 14.11 ? 429  LEU B C   1 
ATOM   6023 O  O   . LEU B 1 322 ? 21.597 -8.668  -2.326  1.00 12.90 ? 429  LEU B O   1 
ATOM   6024 C  CB  . LEU B 1 322 ? 23.013 -7.640  0.307   1.00 14.51 ? 429  LEU B CB  1 
ATOM   6025 C  CG  . LEU B 1 322 ? 24.090 -7.270  1.318   1.00 12.24 ? 429  LEU B CG  1 
ATOM   6026 C  CD1 . LEU B 1 322 ? 23.524 -6.190  2.227   1.00 14.35 ? 429  LEU B CD1 1 
ATOM   6027 C  CD2 . LEU B 1 322 ? 24.522 -8.493  2.148   1.00 15.30 ? 429  LEU B CD2 1 
ATOM   6028 N  N   . ASP B 1 323 ? 21.404 -10.261 -0.765  1.00 14.47 ? 430  ASP B N   1 
ATOM   6029 C  CA  . ASP B 1 323 ? 20.193 -10.862 -1.305  1.00 14.03 ? 430  ASP B CA  1 
ATOM   6030 C  C   . ASP B 1 323 ? 19.180 -10.923 -0.157  1.00 14.99 ? 430  ASP B C   1 
ATOM   6031 O  O   . ASP B 1 323 ? 19.290 -11.783 0.704   1.00 13.95 ? 430  ASP B O   1 
ATOM   6032 C  CB  . ASP B 1 323 ? 20.523 -12.253 -1.873  1.00 13.29 ? 430  ASP B CB  1 
ATOM   6033 C  CG  . ASP B 1 323 ? 19.320 -12.962 -2.479  1.00 18.65 ? 430  ASP B CG  1 
ATOM   6034 O  OD1 . ASP B 1 323 ? 18.167 -12.616 -2.146  1.00 15.68 ? 430  ASP B OD1 1 
ATOM   6035 O  OD2 . ASP B 1 323 ? 19.539 -13.895 -3.282  1.00 18.59 ? 430  ASP B OD2 1 
ATOM   6036 N  N   . ALA B 1 324 ? 18.229 -9.989  -0.137  1.00 14.30 ? 431  ALA B N   1 
ATOM   6037 C  CA  . ALA B 1 324 ? 17.260 -9.868  0.957   1.00 14.09 ? 431  ALA B CA  1 
ATOM   6038 C  C   . ALA B 1 324 ? 16.382 -11.112 1.120   1.00 12.59 ? 431  ALA B C   1 
ATOM   6039 O  O   . ALA B 1 324 ? 16.186 -11.599 2.234   1.00 11.74 ? 431  ALA B O   1 
ATOM   6040 C  CB  . ALA B 1 324 ? 16.375 -8.635  0.746   1.00 10.36 ? 431  ALA B CB  1 
ATOM   6041 N  N   . GLY B 1 325 ? 15.855 -11.614 0.006   1.00 10.39 ? 432  GLY B N   1 
ATOM   6042 C  CA  . GLY B 1 325 ? 15.054 -12.828 0.020   1.00 13.90 ? 432  GLY B CA  1 
ATOM   6043 C  C   . GLY B 1 325 ? 15.784 -14.003 0.653   1.00 14.25 ? 432  GLY B C   1 
ATOM   6044 O  O   . GLY B 1 325 ? 15.238 -14.722 1.493   1.00 11.42 ? 432  GLY B O   1 
ATOM   6045 N  N   . ALA B 1 326 ? 17.044 -14.174 0.282   1.00 11.72 ? 433  ALA B N   1 
ATOM   6046 C  CA  . ALA B 1 326 ? 17.838 -15.277 0.803   1.00 13.11 ? 433  ALA B CA  1 
ATOM   6047 C  C   . ALA B 1 326 ? 18.242 -15.053 2.261   1.00 14.50 ? 433  ALA B C   1 
ATOM   6048 O  O   . ALA B 1 326 ? 18.275 -16.004 3.042   1.00 10.85 ? 433  ALA B O   1 
ATOM   6049 C  CB  . ALA B 1 326 ? 19.064 -15.491 -0.058  1.00 11.67 ? 433  ALA B CB  1 
ATOM   6050 N  N   . MET B 1 327 ? 18.534 -13.798 2.622   1.00 10.21 ? 434  MET B N   1 
ATOM   6051 C  CA  . MET B 1 327 ? 18.881 -13.477 3.998   1.00 13.59 ? 434  MET B CA  1 
ATOM   6052 C  C   . MET B 1 327 ? 17.727 -13.888 4.916   1.00 12.67 ? 434  MET B C   1 
ATOM   6053 O  O   . MET B 1 327 ? 17.915 -14.621 5.873   1.00 12.27 ? 434  MET B O   1 
ATOM   6054 C  CB  . MET B 1 327 ? 19.197 -11.976 4.158   1.00 11.10 ? 434  MET B CB  1 
ATOM   6055 C  CG  . MET B 1 327 ? 20.566 -11.593 3.619   1.00 12.80 ? 434  MET B CG  1 
ATOM   6056 S  SD  . MET B 1 327 ? 21.885 -12.020 4.806   1.00 16.20 ? 434  MET B SD  1 
ATOM   6057 C  CE  . MET B 1 327 ? 21.638 -10.696 6.006   1.00 11.45 ? 434  MET B CE  1 
ATOM   6058 N  N   . VAL B 1 328 ? 16.526 -13.442 4.577   1.00 10.74 ? 435  VAL B N   1 
ATOM   6059 C  CA  . VAL B 1 328 ? 15.371 -13.695 5.405   1.00 10.86 ? 435  VAL B CA  1 
ATOM   6060 C  C   . VAL B 1 328 ? 15.004 -15.192 5.433   1.00 12.92 ? 435  VAL B C   1 
ATOM   6061 O  O   . VAL B 1 328 ? 14.707 -15.730 6.489   1.00 12.94 ? 435  VAL B O   1 
ATOM   6062 C  CB  . VAL B 1 328 ? 14.181 -12.863 4.926   1.00 15.76 ? 435  VAL B CB  1 
ATOM   6063 C  CG1 . VAL B 1 328 ? 12.914 -13.420 5.470   1.00 21.22 ? 435  VAL B CG1 1 
ATOM   6064 C  CG2 . VAL B 1 328 ? 14.385 -11.376 5.314   1.00 14.72 ? 435  VAL B CG2 1 
ATOM   6065 N  N   . ALA B 1 329 ? 15.064 -15.870 4.294   1.00 11.02 ? 436  ALA B N   1 
ATOM   6066 C  CA  . ALA B 1 329 ? 14.729 -17.297 4.278   1.00 13.59 ? 436  ALA B CA  1 
ATOM   6067 C  C   . ALA B 1 329 ? 15.686 -18.132 5.140   1.00 14.23 ? 436  ALA B C   1 
ATOM   6068 O  O   . ALA B 1 329 ? 15.253 -19.030 5.850   1.00 16.04 ? 436  ALA B O   1 
ATOM   6069 C  CB  . ALA B 1 329 ? 14.701 -17.836 2.842   1.00 14.05 ? 436  ALA B CB  1 
ATOM   6070 N  N   . LEU B 1 330 ? 16.980 -17.842 5.100   1.00 11.82 ? 437  LEU B N   1 
ATOM   6071 C  CA  . LEU B 1 330 ? 17.932 -18.628 5.909   1.00 12.28 ? 437  LEU B CA  1 
ATOM   6072 C  C   . LEU B 1 330 ? 17.849 -18.242 7.393   1.00 11.73 ? 437  LEU B C   1 
ATOM   6073 O  O   . LEU B 1 330 ? 18.058 -19.075 8.271   1.00 12.83 ? 437  LEU B O   1 
ATOM   6074 C  CB  . LEU B 1 330 ? 19.370 -18.461 5.400   1.00 13.31 ? 437  LEU B CB  1 
ATOM   6075 C  CG  . LEU B 1 330 ? 20.433 -19.331 6.086   1.00 17.14 ? 437  LEU B CG  1 
ATOM   6076 C  CD1 . LEU B 1 330 ? 20.101 -20.789 5.872   1.00 15.15 ? 437  LEU B CD1 1 
ATOM   6077 C  CD2 . LEU B 1 330 ? 21.817 -19.017 5.546   1.00 15.93 ? 437  LEU B CD2 1 
ATOM   6078 N  N   . ALA B 1 331 ? 17.540 -16.980 7.670   1.00 11.55 ? 438  ALA B N   1 
ATOM   6079 C  CA  . ALA B 1 331 ? 17.423 -16.519 9.050   1.00 10.46 ? 438  ALA B CA  1 
ATOM   6080 C  C   . ALA B 1 331 ? 16.357 -17.299 9.800   1.00 14.06 ? 438  ALA B C   1 
ATOM   6081 O  O   . ALA B 1 331 ? 16.527 -17.639 10.970  1.00 13.99 ? 438  ALA B O   1 
ATOM   6082 C  CB  . ALA B 1 331 ? 17.113 -15.038 9.088   1.00 11.09 ? 438  ALA B CB  1 
ATOM   6083 N  N   . GLN B 1 332 ? 15.257 -17.588 9.116   1.00 12.67 ? 439  GLN B N   1 
ATOM   6084 C  CA  . GLN B 1 332 ? 14.126 -18.247 9.761   1.00 16.23 ? 439  GLN B CA  1 
ATOM   6085 C  C   . GLN B 1 332 ? 14.476 -19.592 10.412  1.00 15.76 ? 439  GLN B C   1 
ATOM   6086 O  O   . GLN B 1 332 ? 13.870 -19.969 11.404  1.00 19.02 ? 439  GLN B O   1 
ATOM   6087 C  CB  . GLN B 1 332 ? 13.010 -18.464 8.747   1.00 19.65 ? 439  GLN B CB  1 
ATOM   6088 C  CG  . GLN B 1 332 ? 12.299 -17.191 8.344   1.00 24.67 ? 439  GLN B CG  1 
ATOM   6089 C  CD  . GLN B 1 332 ? 11.319 -17.440 7.241   1.00 26.82 ? 439  GLN B CD  1 
ATOM   6090 O  OE1 . GLN B 1 332 ? 10.612 -18.442 7.248   1.00 46.65 ? 439  GLN B OE1 1 
ATOM   6091 N  NE2 . GLN B 1 332 ? 11.292 -16.555 6.263   1.00 29.46 ? 439  GLN B NE2 1 
ATOM   6092 N  N   . ASN B 1 333 ? 15.435 -20.313 9.831   1.00 14.15 ? 440  ASN B N   1 
ATOM   6093 C  CA  . ASN B 1 333 ? 15.829 -21.629 10.324  1.00 18.50 ? 440  ASN B CA  1 
ATOM   6094 C  C   . ASN B 1 333 ? 17.254 -21.702 10.827  1.00 17.89 ? 440  ASN B C   1 
ATOM   6095 O  O   . ASN B 1 333 ? 17.781 -22.803 11.015  1.00 18.66 ? 440  ASN B O   1 
ATOM   6096 C  CB  . ASN B 1 333 ? 15.637 -22.669 9.219   1.00 20.88 ? 440  ASN B CB  1 
ATOM   6097 C  CG  . ASN B 1 333 ? 14.321 -22.490 8.517   1.00 21.49 ? 440  ASN B CG  1 
ATOM   6098 O  OD1 . ASN B 1 333 ? 14.256 -22.163 7.328   1.00 29.34 ? 440  ASN B OD1 1 
ATOM   6099 N  ND2 . ASN B 1 333 ? 13.262 -22.677 9.256   1.00 21.20 ? 440  ASN B ND2 1 
ATOM   6100 N  N   . TRP B 1 334 ? 17.873 -20.545 11.054  1.00 13.84 ? 441  TRP B N   1 
ATOM   6101 C  CA  . TRP B 1 334 ? 19.284 -20.499 11.445  1.00 12.28 ? 441  TRP B CA  1 
ATOM   6102 C  C   . TRP B 1 334 ? 19.490 -20.927 12.896  1.00 15.07 ? 441  TRP B C   1 
ATOM   6103 O  O   . TRP B 1 334 ? 18.770 -20.486 13.785  1.00 17.54 ? 441  TRP B O   1 
ATOM   6104 C  CB  . TRP B 1 334 ? 19.848 -19.083 11.234  1.00 12.81 ? 441  TRP B CB  1 
ATOM   6105 C  CG  . TRP B 1 334 ? 21.296 -18.932 11.523  1.00 11.35 ? 441  TRP B CG  1 
ATOM   6106 C  CD1 . TRP B 1 334 ? 21.864 -18.362 12.632  1.00 12.48 ? 441  TRP B CD1 1 
ATOM   6107 C  CD2 . TRP B 1 334 ? 22.380 -19.341 10.679  1.00 11.51 ? 441  TRP B CD2 1 
ATOM   6108 N  NE1 . TRP B 1 334 ? 23.234 -18.392 12.523  1.00 14.40 ? 441  TRP B NE1 1 
ATOM   6109 C  CE2 . TRP B 1 334 ? 23.573 -18.985 11.337  1.00 13.07 ? 441  TRP B CE2 1 
ATOM   6110 C  CE3 . TRP B 1 334 ? 22.452 -19.963 9.423   1.00 11.59 ? 441  TRP B CE3 1 
ATOM   6111 C  CZ2 . TRP B 1 334 ? 24.826 -19.242 10.790  1.00 13.45 ? 441  TRP B CZ2 1 
ATOM   6112 C  CZ3 . TRP B 1 334 ? 23.697 -20.212 8.883   1.00 15.36 ? 441  TRP B CZ3 1 
ATOM   6113 C  CH2 . TRP B 1 334 ? 24.867 -19.857 9.566   1.00 15.81 ? 441  TRP B CH2 1 
ATOM   6114 N  N   . THR B 1 335 ? 20.471 -21.797 13.119  1.00 15.74 ? 442  THR B N   1 
ATOM   6115 C  CA  . THR B 1 335 ? 20.894 -22.170 14.462  1.00 17.43 ? 442  THR B CA  1 
ATOM   6116 C  C   . THR B 1 335 ? 22.006 -21.215 14.894  1.00 15.73 ? 442  THR B C   1 
ATOM   6117 O  O   . THR B 1 335 ? 22.971 -21.021 14.170  1.00 14.41 ? 442  THR B O   1 
ATOM   6118 C  CB  . THR B 1 335 ? 21.388 -23.642 14.528  1.00 15.46 ? 442  THR B CB  1 
ATOM   6119 O  OG1 . THR B 1 335 ? 20.299 -24.524 14.226  1.00 14.80 ? 442  THR B OG1 1 
ATOM   6120 C  CG2 . THR B 1 335 ? 21.925 -23.981 15.913  1.00 16.51 ? 442  THR B CG2 1 
ATOM   6121 N  N   . THR B 1 336 ? 21.857 -20.609 16.065  1.00 11.89 ? 443  THR B N   1 
ATOM   6122 C  CA  . THR B 1 336 ? 22.833 -19.631 16.531  1.00 15.78 ? 443  THR B CA  1 
ATOM   6123 C  C   . THR B 1 336 ? 24.217 -20.264 16.711  1.00 17.54 ? 443  THR B C   1 
ATOM   6124 O  O   . THR B 1 336 ? 24.340 -21.399 17.169  1.00 18.00 ? 443  THR B O   1 
ATOM   6125 C  CB  . THR B 1 336 ? 22.350 -18.954 17.838  1.00 20.07 ? 443  THR B CB  1 
ATOM   6126 O  OG1 . THR B 1 336 ? 21.219 -18.123 17.534  1.00 36.03 ? 443  THR B OG1 1 
ATOM   6127 C  CG2 . THR B 1 336 ? 23.433 -18.065 18.430  1.00 14.99 ? 443  THR B CG2 1 
ATOM   6128 N  N   . VAL B 1 337 ? 25.257 -19.534 16.316  1.00 16.65 ? 444  VAL B N   1 
ATOM   6129 C  CA  . VAL B 1 337 ? 26.621 -20.049 16.380  1.00 20.73 ? 444  VAL B CA  1 
ATOM   6130 C  C   . VAL B 1 337 ? 27.163 -20.078 17.819  1.00 21.43 ? 444  VAL B C   1 
ATOM   6131 O  O   . VAL B 1 337 ? 26.698 -19.328 18.673  1.00 17.70 ? 444  VAL B O   1 
ATOM   6132 C  CB  . VAL B 1 337 ? 27.554 -19.215 15.489  1.00 21.41 ? 444  VAL B CB  1 
ATOM   6133 C  CG1 . VAL B 1 337 ? 27.143 -19.369 14.026  1.00 23.24 ? 444  VAL B CG1 1 
ATOM   6134 C  CG2 . VAL B 1 337 ? 27.499 -17.747 15.901  1.00 17.61 ? 444  VAL B CG2 1 
ATOM   6135 N  N   . ALA B 1 338 ? 28.136 -20.955 18.085  1.00 18.59 ? 445  ALA B N   1 
ATOM   6136 C  CA  . ALA B 1 338 ? 28.796 -20.996 19.396  1.00 19.60 ? 445  ALA B CA  1 
ATOM   6137 C  C   . ALA B 1 338 ? 29.486 -19.663 19.723  1.00 22.58 ? 445  ALA B C   1 
ATOM   6138 O  O   . ALA B 1 338 ? 29.715 -18.848 18.822  1.00 19.69 ? 445  ALA B O   1 
ATOM   6139 C  CB  . ALA B 1 338 ? 29.808 -22.152 19.452  1.00 21.31 ? 445  ALA B CB  1 
ATOM   6140 N  N   . PRO B 1 339 ? 29.798 -19.427 21.014  1.00 21.34 ? 446  PRO B N   1 
ATOM   6141 C  CA  . PRO B 1 339 ? 30.483 -18.189 21.405  1.00 19.15 ? 446  PRO B CA  1 
ATOM   6142 C  C   . PRO B 1 339 ? 31.824 -18.023 20.711  1.00 20.62 ? 446  PRO B C   1 
ATOM   6143 O  O   . PRO B 1 339 ? 32.487 -19.001 20.336  1.00 17.75 ? 446  PRO B O   1 
ATOM   6144 C  CB  . PRO B 1 339 ? 30.673 -18.347 22.921  1.00 21.94 ? 446  PRO B CB  1 
ATOM   6145 C  CG  . PRO B 1 339 ? 29.512 -19.224 23.342  1.00 24.68 ? 446  PRO B CG  1 
ATOM   6146 C  CD  . PRO B 1 339 ? 29.400 -20.217 22.195  1.00 22.33 ? 446  PRO B CD  1 
ATOM   6147 N  N   . GLN B 1 340 ? 32.206 -16.766 20.539  1.00 15.84 ? 447  GLN B N   1 
ATOM   6148 C  CA  . GLN B 1 340 ? 33.434 -16.443 19.859  1.00 14.61 ? 447  GLN B CA  1 
ATOM   6149 C  C   . GLN B 1 340 ? 34.635 -16.896 20.662  1.00 15.00 ? 447  GLN B C   1 
ATOM   6150 O  O   . GLN B 1 340 ? 34.675 -16.744 21.876  1.00 19.11 ? 447  GLN B O   1 
ATOM   6151 C  CB  . GLN B 1 340 ? 33.512 -14.952 19.601  1.00 16.88 ? 447  GLN B CB  1 
ATOM   6152 C  CG  . GLN B 1 340 ? 34.647 -14.530 18.694  1.00 16.83 ? 447  GLN B CG  1 
ATOM   6153 C  CD  . GLN B 1 340 ? 34.846 -13.040 18.783  1.00 20.71 ? 447  GLN B CD  1 
ATOM   6154 O  OE1 . GLN B 1 340 ? 35.037 -12.507 19.876  1.00 26.65 ? 447  GLN B OE1 1 
ATOM   6155 N  NE2 . GLN B 1 340 ? 34.777 -12.352 17.649  1.00 15.72 ? 447  GLN B NE2 1 
ATOM   6156 N  N   . ARG B 1 341 ? 35.590 -17.490 19.966  1.00 16.38 ? 448  ARG B N   1 
ATOM   6157 C  CA  . ARG B 1 341 ? 36.901 -17.756 20.524  1.00 18.59 ? 448  ARG B CA  1 
ATOM   6158 C  C   . ARG B 1 341 ? 37.921 -16.861 19.830  1.00 18.78 ? 448  ARG B C   1 
ATOM   6159 O  O   . ARG B 1 341 ? 37.728 -16.432 18.686  1.00 15.12 ? 448  ARG B O   1 
ATOM   6160 C  CB  . ARG B 1 341 ? 37.287 -19.233 20.364  1.00 18.38 ? 448  ARG B CB  1 
ATOM   6161 C  CG  . ARG B 1 341 ? 36.303 -20.178 21.034  1.00 17.49 ? 448  ARG B CG  1 
ATOM   6162 C  CD  . ARG B 1 341 ? 36.637 -21.637 20.779  1.00 19.14 ? 448  ARG B CD  1 
ATOM   6163 N  NE  . ARG B 1 341 ? 35.799 -22.509 21.601  1.00 23.37 ? 448  ARG B NE  1 
ATOM   6164 C  CZ  . ARG B 1 341 ? 36.047 -23.795 21.829  1.00 26.63 ? 448  ARG B CZ  1 
ATOM   6165 N  NH1 . ARG B 1 341 ? 35.219 -24.500 22.598  1.00 22.08 ? 448  ARG B NH1 1 
ATOM   6166 N  NH2 . ARG B 1 341 ? 37.117 -24.374 21.298  1.00 19.93 ? 448  ARG B NH2 1 
ATOM   6167 N  N   . LYS B 1 342 ? 39.007 -16.582 20.536  1.00 13.55 ? 449  LYS B N   1 
ATOM   6168 C  CA  . LYS B 1 342 ? 40.051 -15.727 20.028  1.00 14.65 ? 449  LYS B CA  1 
ATOM   6169 C  C   . LYS B 1 342 ? 41.404 -16.373 20.319  1.00 15.45 ? 449  LYS B C   1 
ATOM   6170 O  O   . LYS B 1 342 ? 41.763 -16.585 21.470  1.00 21.91 ? 449  LYS B O   1 
ATOM   6171 C  CB  . LYS B 1 342 ? 39.952 -14.337 20.674  1.00 12.71 ? 449  LYS B CB  1 
ATOM   6172 C  CG  . LYS B 1 342 ? 41.044 -13.361 20.258  1.00 18.97 ? 449  LYS B CG  1 
ATOM   6173 C  CD  . LYS B 1 342 ? 40.897 -12.063 21.043  1.00 25.76 ? 449  LYS B CD  1 
ATOM   6174 C  CE  . LYS B 1 342 ? 41.900 -11.014 20.591  1.00 31.06 ? 449  LYS B CE  1 
ATOM   6175 N  NZ  . LYS B 1 342 ? 41.720 -9.752  21.356  1.00 30.74 ? 449  LYS B NZ  1 
ATOM   6176 N  N   . CYS B 1 343 ? 42.134 -16.703 19.269  1.00 17.52 ? 450  CYS B N   1 
ATOM   6177 C  CA  . CYS B 1 343 ? 43.456 -17.296 19.398  1.00 20.65 ? 450  CYS B CA  1 
ATOM   6178 C  C   . CYS B 1 343 ? 44.516 -16.296 18.929  1.00 24.89 ? 450  CYS B C   1 
ATOM   6179 O  O   . CYS B 1 343 ? 44.485 -15.849 17.783  1.00 22.58 ? 450  CYS B O   1 
ATOM   6180 C  CB  . CYS B 1 343 ? 43.530 -18.599 18.597  1.00 22.39 ? 450  CYS B CB  1 
ATOM   6181 S  SG  . CYS B 1 343 ? 45.107 -19.459 18.672  1.00 31.90 ? 450  CYS B SG  1 
ATOM   6182 N  N   . ILE B 1 344 ? 45.430 -15.940 19.831  1.00 21.70 ? 451  ILE B N   1 
ATOM   6183 C  CA  . ILE B 1 344 ? 46.505 -14.994 19.555  1.00 21.30 ? 451  ILE B CA  1 
ATOM   6184 C  C   . ILE B 1 344 ? 47.836 -15.723 19.348  1.00 30.04 ? 451  ILE B C   1 
ATOM   6185 O  O   . ILE B 1 344 ? 48.235 -16.535 20.179  1.00 27.44 ? 451  ILE B O   1 
ATOM   6186 C  CB  . ILE B 1 344 ? 46.666 -13.978 20.707  1.00 21.70 ? 451  ILE B CB  1 
ATOM   6187 C  CG1 . ILE B 1 344 ? 45.363 -13.207 20.939  1.00 27.49 ? 451  ILE B CG1 1 
ATOM   6188 C  CG2 . ILE B 1 344 ? 47.826 -13.017 20.424  1.00 23.16 ? 451  ILE B CG2 1 
ATOM   6189 C  CD1 . ILE B 1 344 ? 45.393 -12.285 22.164  1.00 27.99 ? 451  ILE B CD1 1 
ATOM   6190 N  N   . ILE B 1 345 ? 48.509 -15.446 18.232  1.00 25.44 ? 452  ILE B N   1 
ATOM   6191 C  CA  . ILE B 1 345 ? 49.785 -16.081 17.925  1.00 23.37 ? 452  ILE B CA  1 
ATOM   6192 C  C   . ILE B 1 345 ? 50.835 -15.022 17.572  1.00 28.25 ? 452  ILE B C   1 
ATOM   6193 O  O   . ILE B 1 345 ? 50.673 -14.270 16.602  1.00 24.04 ? 452  ILE B O   1 
ATOM   6194 C  CB  . ILE B 1 345 ? 49.653 -17.092 16.758  1.00 27.94 ? 452  ILE B CB  1 
ATOM   6195 C  CG1 . ILE B 1 345 ? 48.473 -18.043 16.999  1.00 30.09 ? 452  ILE B CG1 1 
ATOM   6196 C  CG2 . ILE B 1 345 ? 50.951 -17.893 16.572  1.00 26.43 ? 452  ILE B CG2 1 
ATOM   6197 C  CD1 . ILE B 1 345 ? 47.930 -18.649 15.743  1.00 25.48 ? 452  ILE B CD1 1 
ATOM   6198 N  N   . ASP B 1 346 ? 51.898 -14.935 18.366  1.00 22.80 ? 453  ASP B N   1 
ATOM   6199 C  CA  . ASP B 1 346 ? 52.976 -14.012 18.020  1.00 29.57 ? 453  ASP B CA  1 
ATOM   6200 C  C   . ASP B 1 346 ? 53.982 -14.727 17.136  1.00 30.83 ? 453  ASP B C   1 
ATOM   6201 O  O   . ASP B 1 346 ? 54.479 -15.797 17.485  1.00 35.37 ? 453  ASP B O   1 
ATOM   6202 C  CB  . ASP B 1 346 ? 53.639 -13.429 19.264  1.00 30.33 ? 453  ASP B CB  1 
ATOM   6203 C  CG  . ASP B 1 346 ? 53.325 -11.944 19.436  1.00 47.81 ? 453  ASP B CG  1 
ATOM   6204 O  OD1 . ASP B 1 346 ? 53.873 -11.107 18.660  1.00 37.09 ? 453  ASP B OD1 1 
ATOM   6205 O  OD2 . ASP B 1 346 ? 52.509 -11.620 20.328  1.00 46.17 ? 453  ASP B OD2 1 
ATOM   6206 N  N   . ILE B 1 347 ? 54.258 -14.142 15.977  1.00 26.12 ? 454  ILE B N   1 
ATOM   6207 C  CA  . ILE B 1 347 ? 54.917 -14.869 14.902  1.00 30.91 ? 454  ILE B CA  1 
ATOM   6208 C  C   . ILE B 1 347 ? 56.443 -14.702 14.898  1.00 36.44 ? 454  ILE B C   1 
ATOM   6209 O  O   . ILE B 1 347 ? 57.175 -15.670 14.718  1.00 31.80 ? 454  ILE B O   1 
ATOM   6210 C  CB  . ILE B 1 347 ? 54.362 -14.428 13.534  1.00 25.04 ? 454  ILE B CB  1 
ATOM   6211 C  CG1 . ILE B 1 347 ? 52.831 -14.547 13.506  1.00 20.67 ? 454  ILE B CG1 1 
ATOM   6212 C  CG2 . ILE B 1 347 ? 54.988 -15.228 12.406  1.00 27.24 ? 454  ILE B CG2 1 
ATOM   6213 C  CD1 . ILE B 1 347 ? 52.329 -15.953 13.374  1.00 22.49 ? 454  ILE B CD1 1 
ATOM   6214 N  N   . LEU B 1 348 ? 56.914 -13.478 15.108  1.00 30.73 ? 455  LEU B N   1 
ATOM   6215 C  CA  . LEU B 1 348 ? 58.337 -13.184 14.977  1.00 33.82 ? 455  LEU B CA  1 
ATOM   6216 C  C   . LEU B 1 348 ? 59.139 -13.565 16.207  1.00 37.89 ? 455  LEU B C   1 
ATOM   6217 O  O   . LEU B 1 348 ? 58.709 -13.337 17.341  1.00 31.58 ? 455  LEU B O   1 
ATOM   6218 C  CB  . LEU B 1 348 ? 58.564 -11.696 14.687  1.00 25.82 ? 455  LEU B CB  1 
ATOM   6219 C  CG  . LEU B 1 348 ? 58.030 -11.139 13.371  1.00 26.89 ? 455  LEU B CG  1 
ATOM   6220 C  CD1 . LEU B 1 348 ? 58.538 -9.721  13.138  1.00 25.74 ? 455  LEU B CD1 1 
ATOM   6221 C  CD2 . LEU B 1 348 ? 58.403 -12.052 12.217  1.00 29.94 ? 455  LEU B CD2 1 
ATOM   6222 N  N   . THR B 1 349 ? 60.314 -14.139 15.962  1.00 32.17 ? 456  THR B N   1 
ATOM   6223 C  CA  . THR B 1 349 ? 61.306 -14.354 17.003  1.00 40.82 ? 456  THR B CA  1 
ATOM   6224 C  C   . THR B 1 349 ? 62.263 -13.169 17.026  1.00 36.78 ? 456  THR B C   1 
ATOM   6225 O  O   . THR B 1 349 ? 62.836 -12.833 18.064  1.00 42.28 ? 456  THR B O   1 
ATOM   6226 C  CB  . THR B 1 349 ? 62.093 -15.662 16.784  1.00 38.52 ? 456  THR B CB  1 
ATOM   6227 O  OG1 . THR B 1 349 ? 62.635 -15.685 15.461  1.00 41.65 ? 456  THR B OG1 1 
ATOM   6228 C  CG2 . THR B 1 349 ? 61.186 -16.864 16.963  1.00 39.64 ? 456  THR B CG2 1 
ATOM   6229 N  N   . GLU B 1 350 ? 62.417 -12.540 15.865  1.00 32.76 ? 457  GLU B N   1 
ATOM   6230 C  CA  . GLU B 1 350 ? 63.300 -11.396 15.691  1.00 33.74 ? 457  GLU B CA  1 
ATOM   6231 C  C   . GLU B 1 350 ? 62.766 -10.503 14.563  1.00 35.11 ? 457  GLU B C   1 
ATOM   6232 O  O   . GLU B 1 350 ? 62.049 -10.990 13.687  1.00 33.51 ? 457  GLU B O   1 
ATOM   6233 C  CB  . GLU B 1 350 ? 64.720 -11.876 15.368  1.00 34.18 ? 457  GLU B CB  1 
ATOM   6234 C  CG  . GLU B 1 350 ? 64.803 -12.620 14.042  1.00 34.44 ? 457  GLU B CG  1 
ATOM   6235 C  CD  . GLU B 1 350 ? 66.065 -13.440 13.898  0.00 40.34 ? 457  GLU B CD  1 
ATOM   6236 O  OE1 . GLU B 1 350 ? 66.659 -13.810 14.932  0.00 42.23 ? 457  GLU B OE1 1 
ATOM   6237 O  OE2 . GLU B 1 350 ? 66.461 -13.718 12.747  0.00 42.65 ? 457  GLU B OE2 1 
ATOM   6238 N  N   . PRO B 1 351 ? 63.127 -9.206  14.563  1.00 28.34 ? 458  PRO B N   1 
ATOM   6239 C  CA  . PRO B 1 351 ? 62.728 -8.323  13.462  1.00 30.66 ? 458  PRO B CA  1 
ATOM   6240 C  C   . PRO B 1 351 ? 63.259 -8.789  12.114  1.00 32.63 ? 458  PRO B C   1 
ATOM   6241 O  O   . PRO B 1 351 ? 64.247 -9.519  12.054  1.00 30.61 ? 458  PRO B O   1 
ATOM   6242 C  CB  . PRO B 1 351 ? 63.345 -6.973  13.849  1.00 31.28 ? 458  PRO B CB  1 
ATOM   6243 C  CG  . PRO B 1 351 ? 64.425 -7.313  14.814  1.00 36.52 ? 458  PRO B CG  1 
ATOM   6244 C  CD  . PRO B 1 351 ? 63.907 -8.482  15.578  1.00 35.27 ? 458  PRO B CD  1 
ATOM   6245 N  N   . LYS B 1 352 ? 62.599 -8.357  11.046  1.00 27.37 ? 459  LYS B N   1 
ATOM   6246 C  CA  . LYS B 1 352 ? 62.844 -8.870  9.707   1.00 26.36 ? 459  LYS B CA  1 
ATOM   6247 C  C   . LYS B 1 352 ? 63.083 -7.741  8.708   1.00 32.79 ? 459  LYS B C   1 
ATOM   6248 O  O   . LYS B 1 352 ? 62.288 -6.802  8.627   1.00 28.20 ? 459  LYS B O   1 
ATOM   6249 C  CB  . LYS B 1 352 ? 61.650 -9.708  9.258   1.00 26.99 ? 459  LYS B CB  1 
ATOM   6250 C  CG  . LYS B 1 352 ? 61.932 -11.167 9.030   1.00 38.06 ? 459  LYS B CG  1 
ATOM   6251 C  CD  . LYS B 1 352 ? 62.491 -11.848 10.257  1.00 33.85 ? 459  LYS B CD  1 
ATOM   6252 C  CE  . LYS B 1 352 ? 62.816 -13.302 9.940   1.00 38.64 ? 459  LYS B CE  1 
ATOM   6253 N  NZ  . LYS B 1 352 ? 63.636 -13.951 10.999  0.00 39.40 ? 459  LYS B NZ  1 
ATOM   6254 N  N   . ASP B 1 353 ? 64.168 -7.823  7.946   1.00 27.10 ? 460  ASP B N   1 
ATOM   6255 C  CA  . ASP B 1 353 ? 64.419 -6.809  6.927   1.00 28.55 ? 460  ASP B CA  1 
ATOM   6256 C  C   . ASP B 1 353 ? 63.399 -6.941  5.816   1.00 29.57 ? 460  ASP B C   1 
ATOM   6257 O  O   . ASP B 1 353 ? 63.111 -8.045  5.353   1.00 27.19 ? 460  ASP B O   1 
ATOM   6258 C  CB  . ASP B 1 353 ? 65.830 -6.917  6.339   1.00 31.95 ? 460  ASP B CB  1 
ATOM   6259 C  CG  . ASP B 1 353 ? 66.106 -5.833  5.306   1.00 33.74 ? 460  ASP B CG  1 
ATOM   6260 O  OD1 . ASP B 1 353 ? 65.967 -4.639  5.647   1.00 31.11 ? 460  ASP B OD1 1 
ATOM   6261 O  OD2 . ASP B 1 353 ? 66.437 -6.167  4.146   1.00 36.01 ? 460  ASP B OD2 1 
ATOM   6262 N  N   . ILE B 1 354 ? 62.860 -5.813  5.375   1.00 25.97 ? 461  ILE B N   1 
ATOM   6263 C  CA  . ILE B 1 354 ? 61.847 -5.851  4.341   1.00 28.69 ? 461  ILE B CA  1 
ATOM   6264 C  C   . ILE B 1 354 ? 62.464 -5.792  2.956   1.00 34.47 ? 461  ILE B C   1 
ATOM   6265 O  O   . ILE B 1 354 ? 62.269 -6.704  2.152   1.00 34.43 ? 461  ILE B O   1 
ATOM   6266 C  CB  . ILE B 1 354 ? 60.844 -4.711  4.507   1.00 27.87 ? 461  ILE B CB  1 
ATOM   6267 C  CG1 . ILE B 1 354 ? 60.109 -4.869  5.846   1.00 27.56 ? 461  ILE B CG1 1 
ATOM   6268 C  CG2 . ILE B 1 354 ? 59.876 -4.714  3.345   1.00 26.16 ? 461  ILE B CG2 1 
ATOM   6269 C  CD1 . ILE B 1 354 ? 59.206 -3.698  6.195   1.00 30.56 ? 461  ILE B CD1 1 
ATOM   6270 N  N   . GLY B 1 355 ? 63.200 -4.720  2.676   1.00 33.55 ? 462  GLY B N   1 
ATOM   6271 C  CA  . GLY B 1 355 ? 63.900 -4.598  1.409   1.00 36.23 ? 462  GLY B CA  1 
ATOM   6272 C  C   . GLY B 1 355 ? 62.959 -4.602  0.223   1.00 39.98 ? 462  GLY B C   1 
ATOM   6273 O  O   . GLY B 1 355 ? 61.945 -3.906  0.240   1.00 34.51 ? 462  GLY B O   1 
ATOM   6274 N  N   . LYS B 1 356 ? 63.291 -5.392  -0.799  1.00 33.86 ? 463  LYS B N   1 
ATOM   6275 C  CA  . LYS B 1 356 ? 62.457 -5.509  -1.992  1.00 31.82 ? 463  LYS B CA  1 
ATOM   6276 C  C   . LYS B 1 356 ? 61.228 -6.367  -1.735  1.00 33.74 ? 463  LYS B C   1 
ATOM   6277 O  O   . LYS B 1 356 ? 60.138 -6.076  -2.230  1.00 29.22 ? 463  LYS B O   1 
ATOM   6278 C  CB  . LYS B 1 356 ? 63.248 -6.105  -3.159  1.00 36.36 ? 463  LYS B CB  1 
ATOM   6279 C  CG  . LYS B 1 356 ? 62.467 -6.181  -4.471  1.00 32.20 ? 463  LYS B CG  1 
ATOM   6280 C  CD  . LYS B 1 356 ? 61.970 -4.796  -4.888  1.00 37.26 ? 463  LYS B CD  1 
ATOM   6281 C  CE  . LYS B 1 356 ? 61.329 -4.807  -6.270  1.00 35.26 ? 463  LYS B CE  1 
ATOM   6282 N  NZ  . LYS B 1 356 ? 60.845 -3.450  -6.647  1.00 38.49 ? 463  LYS B NZ  1 
ATOM   6283 N  N   . ARG B 1 357 ? 61.420 -7.436  -0.972  1.00 27.97 ? 464  ARG B N   1 
ATOM   6284 C  CA  . ARG B 1 357 ? 60.369 -8.411  -0.735  1.00 30.26 ? 464  ARG B CA  1 
ATOM   6285 C  C   . ARG B 1 357 ? 60.694 -9.205  0.512   1.00 33.92 ? 464  ARG B C   1 
ATOM   6286 O  O   . ARG B 1 357 ? 61.849 -9.581  0.737   1.00 34.10 ? 464  ARG B O   1 
ATOM   6287 C  CB  . ARG B 1 357 ? 60.203 -9.347  -1.940  1.00 32.14 ? 464  ARG B CB  1 
ATOM   6288 C  CG  . ARG B 1 357 ? 59.225 -10.489 -1.711  1.00 32.12 ? 464  ARG B CG  1 
ATOM   6289 C  CD  . ARG B 1 357 ? 59.060 -11.367 -2.939  1.00 41.29 ? 464  ARG B CD  1 
ATOM   6290 N  NE  . ARG B 1 357 ? 58.236 -12.544 -2.653  1.00 51.41 ? 464  ARG B NE  1 
ATOM   6291 C  CZ  . ARG B 1 357 ? 56.975 -12.693 -3.048  1.00 48.48 ? 464  ARG B CZ  1 
ATOM   6292 N  NH1 . ARG B 1 357 ? 56.385 -11.745 -3.764  0.00 45.77 ? 464  ARG B NH1 1 
ATOM   6293 N  NH2 . ARG B 1 357 ? 56.306 -13.795 -2.737  0.00 45.89 ? 464  ARG B NH2 1 
ATOM   6294 N  N   . LEU B 1 358 ? 59.676 -9.439  1.335   1.00 26.77 ? 465  LEU B N   1 
ATOM   6295 C  CA  . LEU B 1 358 ? 59.844 -10.226 2.545   1.00 24.34 ? 465  LEU B CA  1 
ATOM   6296 C  C   . LEU B 1 358 ? 58.720 -11.239 2.652   1.00 32.51 ? 465  LEU B C   1 
ATOM   6297 O  O   . LEU B 1 358 ? 57.550 -10.912 2.444   1.00 27.51 ? 465  LEU B O   1 
ATOM   6298 C  CB  . LEU B 1 358 ? 59.877 -9.342  3.793   1.00 28.04 ? 465  LEU B CB  1 
ATOM   6299 C  CG  . LEU B 1 358 ? 59.731 -10.100 5.119   1.00 25.72 ? 465  LEU B CG  1 
ATOM   6300 C  CD1 . LEU B 1 358 ? 60.962 -10.959 5.408   1.00 28.92 ? 465  LEU B CD1 1 
ATOM   6301 C  CD2 . LEU B 1 358 ? 59.471 -9.155  6.263   1.00 19.52 ? 465  LEU B CD2 1 
ATOM   6302 N  N   . GLU B 1 359 ? 59.086 -12.469 2.987   1.00 26.69 ? 466  GLU B N   1 
ATOM   6303 C  CA  . GLU B 1 359 ? 58.118 -13.527 3.159   1.00 28.25 ? 466  GLU B CA  1 
ATOM   6304 C  C   . GLU B 1 359 ? 58.322 -14.193 4.516   1.00 29.64 ? 466  GLU B C   1 
ATOM   6305 O  O   . GLU B 1 359 ? 59.424 -14.624 4.844   1.00 31.67 ? 466  GLU B O   1 
ATOM   6306 C  CB  . GLU B 1 359 ? 58.251 -14.527 2.016   1.00 32.85 ? 466  GLU B CB  1 
ATOM   6307 C  CG  . GLU B 1 359 ? 57.236 -15.633 1.994   1.00 38.76 ? 466  GLU B CG  1 
ATOM   6308 C  CD  . GLU B 1 359 ? 57.239 -16.352 0.656   1.00 49.66 ? 466  GLU B CD  1 
ATOM   6309 O  OE1 . GLU B 1 359 ? 57.314 -17.599 0.641   1.00 53.29 ? 466  GLU B OE1 1 
ATOM   6310 O  OE2 . GLU B 1 359 ? 57.177 -15.661 -0.383  1.00 46.42 ? 466  GLU B OE2 1 
ATOM   6311 N  N   . VAL B 1 360 ? 57.257 -14.255 5.309   1.00 23.14 ? 467  VAL B N   1 
ATOM   6312 C  CA  . VAL B 1 360 ? 57.311 -14.847 6.636   1.00 22.96 ? 467  VAL B CA  1 
ATOM   6313 C  C   . VAL B 1 360 ? 56.338 -16.018 6.735   1.00 33.48 ? 467  VAL B C   1 
ATOM   6314 O  O   . VAL B 1 360 ? 55.139 -15.858 6.482   1.00 27.00 ? 467  VAL B O   1 
ATOM   6315 C  CB  . VAL B 1 360 ? 56.988 -13.814 7.720   1.00 25.43 ? 467  VAL B CB  1 
ATOM   6316 C  CG1 . VAL B 1 360 ? 56.964 -14.466 9.095   1.00 20.45 ? 467  VAL B CG1 1 
ATOM   6317 C  CG2 . VAL B 1 360 ? 58.004 -12.685 7.673   1.00 25.90 ? 467  VAL B CG2 1 
ATOM   6318 N  N   . ARG B 1 361 ? 56.863 -17.193 7.078   1.00 25.47 ? 468  ARG B N   1 
ATOM   6319 C  CA  . ARG B 1 361 ? 56.045 -18.395 7.199   1.00 28.16 ? 468  ARG B CA  1 
ATOM   6320 C  C   . ARG B 1 361 ? 56.056 -18.877 8.631   1.00 30.79 ? 468  ARG B C   1 
ATOM   6321 O  O   . ARG B 1 361 ? 57.060 -18.766 9.332   1.00 31.56 ? 468  ARG B O   1 
ATOM   6322 C  CB  . ARG B 1 361 ? 56.535 -19.506 6.273   1.00 32.06 ? 468  ARG B CB  1 
ATOM   6323 C  CG  . ARG B 1 361 ? 56.847 -19.041 4.865   1.00 38.65 ? 468  ARG B CG  1 
ATOM   6324 C  CD  . ARG B 1 361 ? 57.415 -20.163 4.024   1.00 32.15 ? 468  ARG B CD  1 
ATOM   6325 N  NE  . ARG B 1 361 ? 56.377 -20.886 3.300   1.00 42.29 ? 468  ARG B NE  1 
ATOM   6326 C  CZ  . ARG B 1 361 ? 56.002 -20.594 2.059   1.00 41.76 ? 468  ARG B CZ  1 
ATOM   6327 N  NH1 . ARG B 1 361 ? 56.589 -19.597 1.420   1.00 46.12 ? 468  ARG B NH1 1 
ATOM   6328 N  NH2 . ARG B 1 361 ? 55.048 -21.295 1.458   1.00 44.18 ? 468  ARG B NH2 1 
ATOM   6329 N  N   . LYS B 1 362 ? 54.918 -19.397 9.066   1.00 27.86 ? 469  LYS B N   1 
ATOM   6330 C  CA  . LYS B 1 362 ? 54.777 -19.921 10.412  1.00 26.33 ? 469  LYS B CA  1 
ATOM   6331 C  C   . LYS B 1 362 ? 53.638 -20.919 10.433  1.00 31.47 ? 469  LYS B C   1 
ATOM   6332 O  O   . LYS B 1 362 ? 52.555 -20.652 9.907   1.00 23.52 ? 469  LYS B O   1 
ATOM   6333 C  CB  . LYS B 1 362 ? 54.525 -18.798 11.421  1.00 33.87 ? 469  LYS B CB  1 
ATOM   6334 C  CG  . LYS B 1 362 ? 54.143 -19.285 12.811  1.00 29.80 ? 469  LYS B CG  1 
ATOM   6335 C  CD  . LYS B 1 362 ? 55.361 -19.567 13.661  1.00 34.97 ? 469  LYS B CD  1 
ATOM   6336 C  CE  . LYS B 1 362 ? 54.961 -19.816 15.106  1.00 36.42 ? 469  LYS B CE  1 
ATOM   6337 N  NZ  . LYS B 1 362 ? 56.111 -19.629 16.029  1.00 46.11 ? 469  LYS B NZ  1 
ATOM   6338 N  N   . THR B 1 363 ? 53.899 -22.079 11.024  1.00 23.17 ? 470  THR B N   1 
ATOM   6339 C  CA  . THR B 1 363 ? 52.902 -23.127 11.134  1.00 24.81 ? 470  THR B CA  1 
ATOM   6340 C  C   . THR B 1 363 ? 52.247 -22.998 12.491  1.00 22.31 ? 470  THR B C   1 
ATOM   6341 O  O   . THR B 1 363 ? 52.937 -22.944 13.499  1.00 26.82 ? 470  THR B O   1 
ATOM   6342 C  CB  . THR B 1 363 ? 53.533 -24.529 10.949  1.00 29.84 ? 470  THR B CB  1 
ATOM   6343 O  OG1 . THR B 1 363 ? 53.957 -24.677 9.588   1.00 29.97 ? 470  THR B OG1 1 
ATOM   6344 C  CG2 . THR B 1 363 ? 52.533 -25.633 11.286  1.00 25.30 ? 470  THR B CG2 1 
ATOM   6345 N  N   . VAL B 1 364 ? 50.919 -22.907 12.507  1.00 20.59 ? 471  VAL B N   1 
ATOM   6346 C  CA  . VAL B 1 364 ? 50.186 -22.691 13.745  1.00 21.22 ? 471  VAL B CA  1 
ATOM   6347 C  C   . VAL B 1 364 ? 49.241 -23.849 14.021  1.00 18.75 ? 471  VAL B C   1 
ATOM   6348 O  O   . VAL B 1 364 ? 48.800 -24.531 13.094  1.00 21.39 ? 471  VAL B O   1 
ATOM   6349 C  CB  . VAL B 1 364 ? 49.365 -21.380 13.707  1.00 25.00 ? 471  VAL B CB  1 
ATOM   6350 C  CG1 . VAL B 1 364 ? 50.254 -20.211 13.334  1.00 27.91 ? 471  VAL B CG1 1 
ATOM   6351 C  CG2 . VAL B 1 364 ? 48.226 -21.500 12.715  1.00 19.61 ? 471  VAL B CG2 1 
ATOM   6352 N  N   . THR B 1 365 ? 48.926 -24.050 15.295  1.00 19.10 ? 472  THR B N   1 
ATOM   6353 C  CA  . THR B 1 365 ? 48.018 -25.114 15.714  1.00 23.75 ? 472  THR B CA  1 
ATOM   6354 C  C   . THR B 1 365 ? 46.638 -24.555 16.031  1.00 28.57 ? 472  THR B C   1 
ATOM   6355 O  O   . THR B 1 365 ? 45.713 -25.308 16.328  1.00 25.09 ? 472  THR B O   1 
ATOM   6356 C  CB  . THR B 1 365 ? 48.538 -25.859 16.964  1.00 31.64 ? 472  THR B CB  1 
ATOM   6357 O  OG1 . THR B 1 365 ? 48.531 -24.972 18.089  1.00 29.76 ? 472  THR B OG1 1 
ATOM   6358 C  CG2 . THR B 1 365 ? 49.957 -26.382 16.735  1.00 29.28 ? 472  THR B CG2 1 
ATOM   6359 N  N   . ALA B 1 366 ? 46.523 -23.229 15.980  1.00 28.84 ? 473  ALA B N   1 
ATOM   6360 C  CA  . ALA B 1 366 ? 45.272 -22.527 16.256  1.00 26.22 ? 473  ALA B CA  1 
ATOM   6361 C  C   . ALA B 1 366 ? 44.745 -22.894 17.642  1.00 23.41 ? 473  ALA B C   1 
ATOM   6362 O  O   . ALA B 1 366 ? 43.563 -23.199 17.815  1.00 18.35 ? 473  ALA B O   1 
ATOM   6363 C  CB  . ALA B 1 366 ? 44.239 -22.829 15.173  1.00 19.21 ? 473  ALA B CB  1 
ATOM   6364 N  N   . CYS B 1 367 ? 45.660 -22.871 18.611  1.00 19.41 ? 474  CYS B N   1 
ATOM   6365 C  CA  . CYS B 1 367 ? 45.370 -23.116 20.019  1.00 27.73 ? 474  CYS B CA  1 
ATOM   6366 C  C   . CYS B 1 367 ? 44.760 -24.494 20.288  1.00 24.61 ? 474  CYS B C   1 
ATOM   6367 O  O   . CYS B 1 367 ? 43.925 -24.647 21.175  1.00 25.31 ? 474  CYS B O   1 
ATOM   6368 C  CB  . CYS B 1 367 ? 44.462 -22.011 20.560  1.00 28.21 ? 474  CYS B CB  1 
ATOM   6369 S  SG  . CYS B 1 367 ? 45.271 -20.388 20.498  1.00 31.67 ? 474  CYS B SG  1 
ATOM   6370 N  N   . LEU B 1 368 ? 45.199 -25.486 19.522  1.00 25.00 ? 475  LEU B N   1 
ATOM   6371 C  CA  . LEU B 1 368 ? 44.876 -26.884 19.787  1.00 27.43 ? 475  LEU B CA  1 
ATOM   6372 C  C   . LEU B 1 368 ? 45.205 -27.229 21.233  1.00 30.48 ? 475  LEU B C   1 
ATOM   6373 O  O   . LEU B 1 368 ? 46.286 -26.911 21.706  1.00 28.69 ? 475  LEU B O   1 
ATOM   6374 C  CB  . LEU B 1 368 ? 45.652 -27.806 18.840  1.00 28.78 ? 475  LEU B CB  1 
ATOM   6375 C  CG  . LEU B 1 368 ? 45.523 -29.311 19.103  1.00 31.06 ? 475  LEU B CG  1 
ATOM   6376 C  CD1 . LEU B 1 368 ? 44.147 -29.808 18.696  1.00 35.99 ? 475  LEU B CD1 1 
ATOM   6377 C  CD2 . LEU B 1 368 ? 46.615 -30.104 18.396  1.00 26.52 ? 475  LEU B CD2 1 
ATOM   6378 N  N   . GLY B 1 369 ? 44.264 -27.854 21.934  1.00 32.16 ? 476  GLY B N   1 
ATOM   6379 C  CA  . GLY B 1 369 ? 44.481 -28.259 23.311  1.00 33.53 ? 476  GLY B CA  1 
ATOM   6380 C  C   . GLY B 1 369 ? 44.140 -27.181 24.324  1.00 33.16 ? 476  GLY B C   1 
ATOM   6381 O  O   . GLY B 1 369 ? 44.336 -27.368 25.518  1.00 41.09 ? 476  GLY B O   1 
ATOM   6382 N  N   . GLU B 1 370 ? 43.621 -26.053 23.846  1.00 29.77 ? 477  GLU B N   1 
ATOM   6383 C  CA  . GLU B 1 370 ? 43.239 -24.938 24.710  1.00 27.43 ? 477  GLU B CA  1 
ATOM   6384 C  C   . GLU B 1 370 ? 41.755 -24.586 24.535  1.00 23.49 ? 477  GLU B C   1 
ATOM   6385 O  O   . GLU B 1 370 ? 41.159 -24.926 23.516  1.00 26.54 ? 477  GLU B O   1 
ATOM   6386 C  CB  . GLU B 1 370 ? 44.091 -23.705 24.404  1.00 29.45 ? 477  GLU B CB  1 
ATOM   6387 C  CG  . GLU B 1 370 ? 45.589 -23.886 24.510  1.00 34.56 ? 477  GLU B CG  1 
ATOM   6388 C  CD  . GLU B 1 370 ? 46.328 -22.684 23.933  1.00 44.53 ? 477  GLU B CD  1 
ATOM   6389 O  OE1 . GLU B 1 370 ? 47.239 -22.877 23.100  1.00 47.25 ? 477  GLU B OE1 1 
ATOM   6390 O  OE2 . GLU B 1 370 ? 45.982 -21.540 24.299  1.00 48.28 ? 477  GLU B OE2 1 
ATOM   6391 N  N   . PRO B 1 371 ? 41.160 -23.903 25.529  1.00 29.53 ? 478  PRO B N   1 
ATOM   6392 C  CA  . PRO B 1 371 ? 39.766 -23.434 25.431  1.00 26.50 ? 478  PRO B CA  1 
ATOM   6393 C  C   . PRO B 1 371 ? 39.477 -22.523 24.222  1.00 30.96 ? 478  PRO B C   1 
ATOM   6394 O  O   . PRO B 1 371 ? 38.322 -22.440 23.797  1.00 27.66 ? 478  PRO B O   1 
ATOM   6395 C  CB  . PRO B 1 371 ? 39.565 -22.650 26.734  1.00 31.14 ? 478  PRO B CB  1 
ATOM   6396 C  CG  . PRO B 1 371 ? 40.571 -23.205 27.682  1.00 31.65 ? 478  PRO B CG  1 
ATOM   6397 C  CD  . PRO B 1 371 ? 41.741 -23.654 26.864  1.00 26.85 ? 478  PRO B CD  1 
ATOM   6398 N  N   . ASN B 1 372 ? 40.487 -21.845 23.683  1.00 25.51 ? 479  ASN B N   1 
ATOM   6399 C  CA  . ASN B 1 372 ? 40.262 -21.001 22.507  1.00 24.98 ? 479  ASN B CA  1 
ATOM   6400 C  C   . ASN B 1 372 ? 40.670 -21.674 21.193  1.00 22.55 ? 479  ASN B C   1 
ATOM   6401 O  O   . ASN B 1 372 ? 40.888 -21.004 20.188  1.00 21.98 ? 479  ASN B O   1 
ATOM   6402 C  CB  . ASN B 1 372 ? 40.977 -19.654 22.661  1.00 24.17 ? 479  ASN B CB  1 
ATOM   6403 C  CG  . ASN B 1 372 ? 42.384 -19.786 23.219  1.00 35.31 ? 479  ASN B CG  1 
ATOM   6404 O  OD1 . ASN B 1 372 ? 42.903 -20.885 23.394  1.00 34.40 ? 479  ASN B OD1 1 
ATOM   6405 N  ND2 . ASN B 1 372 ? 43.008 -18.652 23.496  1.00 35.38 ? 479  ASN B ND2 1 
ATOM   6406 N  N   . HIS B 1 373 ? 40.753 -23.001 21.206  1.00 18.94 ? 480  HIS B N   1 
ATOM   6407 C  CA  . HIS B 1 373 ? 40.977 -23.784 19.986  1.00 19.70 ? 480  HIS B CA  1 
ATOM   6408 C  C   . HIS B 1 373 ? 39.972 -23.414 18.892  1.00 18.37 ? 480  HIS B C   1 
ATOM   6409 O  O   . HIS B 1 373 ? 38.773 -23.394 19.138  1.00 21.87 ? 480  HIS B O   1 
ATOM   6410 C  CB  . HIS B 1 373 ? 40.880 -25.281 20.300  1.00 20.55 ? 480  HIS B CB  1 
ATOM   6411 C  CG  . HIS B 1 373 ? 41.062 -26.170 19.112  1.00 17.01 ? 480  HIS B CG  1 
ATOM   6412 N  ND1 . HIS B 1 373 ? 40.361 -27.349 18.953  1.00 25.17 ? 480  HIS B ND1 1 
ATOM   6413 C  CD2 . HIS B 1 373 ? 41.870 -26.068 18.033  1.00 17.34 ? 480  HIS B CD2 1 
ATOM   6414 C  CE1 . HIS B 1 373 ? 40.731 -27.932 17.828  1.00 20.23 ? 480  HIS B CE1 1 
ATOM   6415 N  NE2 . HIS B 1 373 ? 41.648 -27.177 17.251  1.00 22.33 ? 480  HIS B NE2 1 
ATOM   6416 N  N   . ILE B 1 374 ? 40.460 -23.101 17.697  1.00 18.73 ? 481  ILE B N   1 
ATOM   6417 C  CA  . ILE B 1 374 ? 39.581 -22.744 16.584  1.00 20.42 ? 481  ILE B CA  1 
ATOM   6418 C  C   . ILE B 1 374 ? 39.757 -23.670 15.398  1.00 17.81 ? 481  ILE B C   1 
ATOM   6419 O  O   . ILE B 1 374 ? 40.840 -23.763 14.837  1.00 19.77 ? 481  ILE B O   1 
ATOM   6420 C  CB  . ILE B 1 374 ? 39.822 -21.288 16.106  1.00 16.32 ? 481  ILE B CB  1 
ATOM   6421 C  CG1 . ILE B 1 374 ? 39.323 -20.296 17.149  1.00 17.56 ? 481  ILE B CG1 1 
ATOM   6422 C  CG2 . ILE B 1 374 ? 39.116 -21.042 14.773  1.00 18.30 ? 481  ILE B CG2 1 
ATOM   6423 C  CD1 . ILE B 1 374 ? 40.064 -18.964 17.139  1.00 16.63 ? 481  ILE B CD1 1 
ATOM   6424 N  N   . THR B 1 375 ? 38.690 -24.358 15.010  1.00 17.37 ? 482  THR B N   1 
ATOM   6425 C  CA  . THR B 1 375 ? 38.735 -25.169 13.800  1.00 15.85 ? 482  THR B CA  1 
ATOM   6426 C  C   . THR B 1 375 ? 37.983 -24.494 12.671  1.00 16.79 ? 482  THR B C   1 
ATOM   6427 O  O   . THR B 1 375 ? 38.134 -24.864 11.512  1.00 18.80 ? 482  THR B O   1 
ATOM   6428 C  CB  . THR B 1 375 ? 38.135 -26.574 14.021  1.00 20.67 ? 482  THR B CB  1 
ATOM   6429 O  OG1 . THR B 1 375 ? 36.736 -26.468 14.314  1.00 22.77 ? 482  THR B OG1 1 
ATOM   6430 C  CG2 . THR B 1 375 ? 38.830 -27.272 15.163  1.00 20.84 ? 482  THR B CG2 1 
ATOM   6431 N  N   . ARG B 1 376 ? 37.149 -23.517 13.010  1.00 17.67 ? 483  ARG B N   1 
ATOM   6432 C  CA  . ARG B 1 376 ? 36.355 -22.852 11.987  1.00 17.36 ? 483  ARG B CA  1 
ATOM   6433 C  C   . ARG B 1 376 ? 36.490 -21.341 12.085  1.00 16.41 ? 483  ARG B C   1 
ATOM   6434 O  O   . ARG B 1 376 ? 35.967 -20.701 12.990  1.00 14.35 ? 483  ARG B O   1 
ATOM   6435 C  CB  . ARG B 1 376 ? 34.887 -23.258 12.070  1.00 15.04 ? 483  ARG B CB  1 
ATOM   6436 C  CG  . ARG B 1 376 ? 34.147 -22.773 10.854  1.00 25.36 ? 483  ARG B CG  1 
ATOM   6437 C  CD  . ARG B 1 376 ? 32.878 -23.523 10.605  1.00 35.43 ? 483  ARG B CD  1 
ATOM   6438 N  NE  . ARG B 1 376 ? 33.061 -24.964 10.471  1.00 36.14 ? 483  ARG B NE  1 
ATOM   6439 C  CZ  . ARG B 1 376 ? 32.058 -25.789 10.198  1.00 36.28 ? 483  ARG B CZ  1 
ATOM   6440 N  NH1 . ARG B 1 376 ? 32.262 -27.098 10.101  1.00 35.33 ? 483  ARG B NH1 1 
ATOM   6441 N  NH2 . ARG B 1 376 ? 30.841 -25.285 10.016  1.00 37.99 ? 483  ARG B NH2 1 
ATOM   6442 N  N   . LEU B 1 377 ? 37.215 -20.785 11.133  1.00 16.25 ? 484  LEU B N   1 
ATOM   6443 C  CA  . LEU B 1 377 ? 37.593 -19.393 11.191  1.00 14.22 ? 484  LEU B CA  1 
ATOM   6444 C  C   . LEU B 1 377 ? 36.429 -18.465 10.837  1.00 14.32 ? 484  LEU B C   1 
ATOM   6445 O  O   . LEU B 1 377 ? 35.603 -18.778 9.978   1.00 12.78 ? 484  LEU B O   1 
ATOM   6446 C  CB  . LEU B 1 377 ? 38.774 -19.151 10.253  1.00 13.43 ? 484  LEU B CB  1 
ATOM   6447 C  CG  . LEU B 1 377 ? 39.513 -17.825 10.356  1.00 15.55 ? 484  LEU B CG  1 
ATOM   6448 C  CD1 . LEU B 1 377 ? 40.277 -17.757 11.659  1.00 15.00 ? 484  LEU B CD1 1 
ATOM   6449 C  CD2 . LEU B 1 377 ? 40.445 -17.684 9.162   1.00 14.58 ? 484  LEU B CD2 1 
ATOM   6450 N  N   . GLU B 1 378 ? 36.370 -17.331 11.530  1.00 15.58 ? 485  GLU B N   1 
ATOM   6451 C  CA  . GLU B 1 378 ? 35.542 -16.211 11.101  1.00 11.64 ? 485  GLU B CA  1 
ATOM   6452 C  C   . GLU B 1 378 ? 36.472 -15.115 10.558  1.00 14.49 ? 485  GLU B C   1 
ATOM   6453 O  O   . GLU B 1 378 ? 36.976 -15.240 9.434   1.00 12.83 ? 485  GLU B O   1 
ATOM   6454 C  CB  . GLU B 1 378 ? 34.659 -15.732 12.253  1.00 11.65 ? 485  GLU B CB  1 
ATOM   6455 C  CG  . GLU B 1 378 ? 33.552 -16.748 12.547  1.00 14.31 ? 485  GLU B CG  1 
ATOM   6456 C  CD  . GLU B 1 378 ? 32.844 -16.555 13.888  1.00 15.85 ? 485  GLU B CD  1 
ATOM   6457 O  OE1 . GLU B 1 378 ? 32.018 -17.425 14.229  1.00 17.02 ? 485  GLU B OE1 1 
ATOM   6458 O  OE2 . GLU B 1 378 ? 33.092 -15.547 14.594  1.00 16.91 ? 485  GLU B OE2 1 
ATOM   6459 N  N   . HIS B 1 379 ? 36.713 -14.068 11.342  1.00 13.26 ? 486  HIS B N   1 
ATOM   6460 C  CA  . HIS B 1 379 ? 37.677 -13.032 10.964  1.00 12.55 ? 486  HIS B CA  1 
ATOM   6461 C  C   . HIS B 1 379 ? 39.117 -13.468 11.268  1.00 17.94 ? 486  HIS B C   1 
ATOM   6462 O  O   . HIS B 1 379 ? 39.354 -14.241 12.192  1.00 14.14 ? 486  HIS B O   1 
ATOM   6463 C  CB  . HIS B 1 379 ? 37.415 -11.722 11.711  1.00 12.89 ? 486  HIS B CB  1 
ATOM   6464 C  CG  . HIS B 1 379 ? 35.976 -11.315 11.785  1.00 14.12 ? 486  HIS B CG  1 
ATOM   6465 N  ND1 . HIS B 1 379 ? 35.120 -11.780 12.760  1.00 14.83 ? 486  HIS B ND1 1 
ATOM   6466 C  CD2 . HIS B 1 379 ? 35.257 -10.437 11.044  1.00 12.89 ? 486  HIS B CD2 1 
ATOM   6467 C  CE1 . HIS B 1 379 ? 33.928 -11.234 12.597  1.00 14.13 ? 486  HIS B CE1 1 
ATOM   6468 N  NE2 . HIS B 1 379 ? 33.985 -10.410 11.565  1.00 11.45 ? 486  HIS B NE2 1 
ATOM   6469 N  N   . ALA B 1 380 ? 40.073 -12.933 10.517  1.00 15.30 ? 487  ALA B N   1 
ATOM   6470 C  CA  . ALA B 1 380 ? 41.473 -13.037 10.897  1.00 14.88 ? 487  ALA B CA  1 
ATOM   6471 C  C   . ALA B 1 380 ? 42.123 -11.667 10.851  1.00 14.48 ? 487  ALA B C   1 
ATOM   6472 O  O   . ALA B 1 380 ? 41.821 -10.868 9.977   1.00 14.30 ? 487  ALA B O   1 
ATOM   6473 C  CB  . ALA B 1 380 ? 42.215 -13.997 9.986   1.00 14.46 ? 487  ALA B CB  1 
ATOM   6474 N  N   . GLN B 1 381 ? 43.021 -11.409 11.791  1.00 18.10 ? 488  GLN B N   1 
ATOM   6475 C  CA  . GLN B 1 381 ? 43.807 -10.182 11.779  1.00 19.12 ? 488  GLN B CA  1 
ATOM   6476 C  C   . GLN B 1 381 ? 45.292 -10.462 11.710  1.00 21.19 ? 488  GLN B C   1 
ATOM   6477 O  O   . GLN B 1 381 ? 45.789 -11.407 12.335  1.00 17.44 ? 488  GLN B O   1 
ATOM   6478 C  CB  . GLN B 1 381 ? 43.538 -9.348  13.023  1.00 25.36 ? 488  GLN B CB  1 
ATOM   6479 C  CG  . GLN B 1 381 ? 42.143 -8.796  13.121  1.00 19.50 ? 488  GLN B CG  1 
ATOM   6480 C  CD  . GLN B 1 381 ? 41.885 -8.195  14.482  1.00 22.73 ? 488  GLN B CD  1 
ATOM   6481 O  OE1 . GLN B 1 381 ? 42.318 -8.735  15.503  1.00 25.75 ? 488  GLN B OE1 1 
ATOM   6482 N  NE2 . GLN B 1 381 ? 41.200 -7.067  14.507  1.00 18.18 ? 488  GLN B NE2 1 
ATOM   6483 N  N   . ALA B 1 382 ? 45.993 -9.637  10.943  1.00 16.84 ? 489  ALA B N   1 
ATOM   6484 C  CA  . ALA B 1 382 ? 47.438 -9.570  11.046  1.00 23.60 ? 489  ALA B CA  1 
ATOM   6485 C  C   . ALA B 1 382 ? 47.790 -8.198  11.620  1.00 22.72 ? 489  ALA B C   1 
ATOM   6486 O  O   . ALA B 1 382 ? 47.624 -7.183  10.940  1.00 18.97 ? 489  ALA B O   1 
ATOM   6487 C  CB  . ALA B 1 382 ? 48.081 -9.792  9.695   1.00 17.74 ? 489  ALA B CB  1 
ATOM   6488 N  N   . ARG B 1 383 ? 48.191 -8.165  12.890  1.00 16.50 ? 490  ARG B N   1 
ATOM   6489 C  CA  . ARG B 1 383 ? 48.559 -6.911  13.526  1.00 18.25 ? 490  ARG B CA  1 
ATOM   6490 C  C   . ARG B 1 383 ? 50.032 -6.689  13.257  1.00 19.63 ? 490  ARG B C   1 
ATOM   6491 O  O   . ARG B 1 383 ? 50.876 -7.451  13.737  1.00 19.11 ? 490  ARG B O   1 
ATOM   6492 C  CB  . ARG B 1 383 ? 48.295 -6.922  15.027  1.00 19.20 ? 490  ARG B CB  1 
ATOM   6493 C  CG  . ARG B 1 383 ? 46.870 -7.271  15.453  1.00 24.61 ? 490  ARG B CG  1 
ATOM   6494 C  CD  . ARG B 1 383 ? 46.692 -7.011  16.956  1.00 26.15 ? 490  ARG B CD  1 
ATOM   6495 N  NE  . ARG B 1 383 ? 46.746 -5.586  17.239  1.00 40.33 ? 490  ARG B NE  1 
ATOM   6496 C  CZ  . ARG B 1 383 ? 45.674 -4.811  17.364  1.00 29.70 ? 490  ARG B CZ  1 
ATOM   6497 N  NH1 . ARG B 1 383 ? 45.823 -3.517  17.599  1.00 31.91 ? 490  ARG B NH1 1 
ATOM   6498 N  NH2 . ARG B 1 383 ? 44.457 -5.329  17.251  1.00 39.02 ? 490  ARG B NH2 1 
ATOM   6499 N  N   . LEU B 1 384 ? 50.344 -5.662  12.476  1.00 19.43 ? 491  LEU B N   1 
ATOM   6500 C  CA  . LEU B 1 384 ? 51.724 -5.480  12.024  1.00 20.30 ? 491  LEU B CA  1 
ATOM   6501 C  C   . LEU B 1 384 ? 52.336 -4.227  12.597  1.00 25.32 ? 491  LEU B C   1 
ATOM   6502 O  O   . LEU B 1 384 ? 51.654 -3.221  12.799  1.00 18.25 ? 491  LEU B O   1 
ATOM   6503 C  CB  . LEU B 1 384 ? 51.798 -5.435  10.496  1.00 15.64 ? 491  LEU B CB  1 
ATOM   6504 C  CG  . LEU B 1 384 ? 51.208 -6.634  9.749   1.00 19.59 ? 491  LEU B CG  1 
ATOM   6505 C  CD1 . LEU B 1 384 ? 51.367 -6.445  8.247   1.00 17.29 ? 491  LEU B CD1 1 
ATOM   6506 C  CD2 . LEU B 1 384 ? 51.856 -7.935  10.212  1.00 21.82 ? 491  LEU B CD2 1 
ATOM   6507 N  N   . THR B 1 385 ? 53.636 -4.311  12.872  1.00 23.27 ? 492  THR B N   1 
ATOM   6508 C  CA  . THR B 1 385 ? 54.416 -3.160  13.261  1.00 18.07 ? 492  THR B CA  1 
ATOM   6509 C  C   . THR B 1 385 ? 55.605 -3.146  12.309  1.00 27.03 ? 492  THR B C   1 
ATOM   6510 O  O   . THR B 1 385 ? 56.352 -4.131  12.209  1.00 20.37 ? 492  THR B O   1 
ATOM   6511 C  CB  . THR B 1 385 ? 54.856 -3.223  14.737  1.00 22.22 ? 492  THR B CB  1 
ATOM   6512 O  OG1 . THR B 1 385 ? 53.705 -3.367  15.575  1.00 20.64 ? 492  THR B OG1 1 
ATOM   6513 C  CG2 . THR B 1 385 ? 55.611 -1.954  15.149  1.00 18.33 ? 492  THR B CG2 1 
ATOM   6514 N  N   . LEU B 1 386 ? 55.731 -2.056  11.557  1.00 24.22 ? 493  LEU B N   1 
ATOM   6515 C  CA  . LEU B 1 386 ? 56.793 -1.947  10.578  1.00 22.75 ? 493  LEU B CA  1 
ATOM   6516 C  C   . LEU B 1 386 ? 57.179 -0.506  10.327  1.00 25.72 ? 493  LEU B C   1 
ATOM   6517 O  O   . LEU B 1 386 ? 56.363 0.412   10.457  1.00 24.85 ? 493  LEU B O   1 
ATOM   6518 C  CB  . LEU B 1 386 ? 56.394 -2.619  9.261   1.00 23.97 ? 493  LEU B CB  1 
ATOM   6519 C  CG  . LEU B 1 386 ? 55.283 -2.045  8.375   1.00 22.99 ? 493  LEU B CG  1 
ATOM   6520 C  CD1 . LEU B 1 386 ? 55.788 -0.971  7.416   1.00 24.63 ? 493  LEU B CD1 1 
ATOM   6521 C  CD2 . LEU B 1 386 ? 54.630 -3.182  7.615   1.00 21.95 ? 493  LEU B CD2 1 
ATOM   6522 N  N   . SER B 1 387 ? 58.441 -0.331  9.960   1.00 24.37 ? 494  SER B N   1 
ATOM   6523 C  CA  . SER B 1 387 ? 58.950 0.945   9.504   1.00 26.92 ? 494  SER B CA  1 
ATOM   6524 C  C   . SER B 1 387 ? 59.303 0.798   8.038   1.00 24.02 ? 494  SER B C   1 
ATOM   6525 O  O   . SER B 1 387 ? 59.795 -0.250  7.620   1.00 22.46 ? 494  SER B O   1 
ATOM   6526 C  CB  . SER B 1 387 ? 60.175 1.373   10.309  1.00 30.33 ? 494  SER B CB  1 
ATOM   6527 O  OG  . SER B 1 387 ? 59.931 1.240   11.694  1.00 32.98 ? 494  SER B OG  1 
ATOM   6528 N  N   . TYR B 1 388 ? 59.017 1.830   7.258   1.00 21.48 ? 495  TYR B N   1 
ATOM   6529 C  CA  . TYR B 1 388 ? 59.371 1.851   5.843   1.00 25.81 ? 495  TYR B CA  1 
ATOM   6530 C  C   . TYR B 1 388 ? 59.587 3.300   5.452   1.00 22.17 ? 495  TYR B C   1 
ATOM   6531 O  O   . TYR B 1 388 ? 59.065 4.187   6.114   1.00 25.10 ? 495  TYR B O   1 
ATOM   6532 C  CB  . TYR B 1 388 ? 58.281 1.220   4.993   1.00 20.48 ? 495  TYR B CB  1 
ATOM   6533 C  CG  . TYR B 1 388 ? 58.786 0.548   3.743   1.00 21.62 ? 495  TYR B CG  1 
ATOM   6534 C  CD1 . TYR B 1 388 ? 59.619 -0.567  3.819   1.00 23.07 ? 495  TYR B CD1 1 
ATOM   6535 C  CD2 . TYR B 1 388 ? 58.420 1.006   2.491   1.00 22.24 ? 495  TYR B CD2 1 
ATOM   6536 C  CE1 . TYR B 1 388 ? 60.077 -1.186  2.689   1.00 19.61 ? 495  TYR B CE1 1 
ATOM   6537 C  CE2 . TYR B 1 388 ? 58.873 0.386   1.348   1.00 22.09 ? 495  TYR B CE2 1 
ATOM   6538 C  CZ  . TYR B 1 388 ? 59.697 -0.712  1.458   1.00 23.99 ? 495  TYR B CZ  1 
ATOM   6539 O  OH  . TYR B 1 388 ? 60.159 -1.344  0.332   1.00 35.07 ? 495  TYR B OH  1 
ATOM   6540 N  N   . ASN B 1 389 ? 60.354 3.555   4.395   1.00 26.83 ? 496  ASN B N   1 
ATOM   6541 C  CA  . ASN B 1 389 ? 60.645 4.946   4.061   1.00 27.01 ? 496  ASN B CA  1 
ATOM   6542 C  C   . ASN B 1 389 ? 59.517 5.603   3.277   1.00 24.26 ? 496  ASN B C   1 
ATOM   6543 O  O   . ASN B 1 389 ? 59.333 6.806   3.384   1.00 26.29 ? 496  ASN B O   1 
ATOM   6544 C  CB  . ASN B 1 389 ? 61.976 5.078   3.299   1.00 25.41 ? 496  ASN B CB  1 
ATOM   6545 C  CG  . ASN B 1 389 ? 61.954 4.415   1.940   1.00 27.66 ? 496  ASN B CG  1 
ATOM   6546 O  OD1 . ASN B 1 389 ? 61.669 3.222   1.809   1.00 28.16 ? 496  ASN B OD1 1 
ATOM   6547 N  ND2 . ASN B 1 389 ? 62.276 5.186   0.917   1.00 28.81 ? 496  ASN B ND2 1 
ATOM   6548 N  N   . ARG B 1 390 ? 58.761 4.812   2.511   1.00 26.08 ? 497  ARG B N   1 
ATOM   6549 C  CA  . ARG B 1 390 ? 57.591 5.313   1.772   1.00 28.25 ? 497  ARG B CA  1 
ATOM   6550 C  C   . ARG B 1 390 ? 56.436 4.306   1.784   1.00 24.91 ? 497  ARG B C   1 
ATOM   6551 O  O   . ARG B 1 390 ? 56.410 3.358   0.994   1.00 20.96 ? 497  ARG B O   1 
ATOM   6552 C  CB  . ARG B 1 390 ? 57.943 5.645   0.321   1.00 29.67 ? 497  ARG B CB  1 
ATOM   6553 C  CG  . ARG B 1 390 ? 56.918 6.563   -0.336  1.00 33.12 ? 497  ARG B CG  1 
ATOM   6554 C  CD  . ARG B 1 390 ? 57.019 6.561   -1.850  1.00 36.68 ? 497  ARG B CD  1 
ATOM   6555 N  NE  . ARG B 1 390 ? 56.315 7.698   -2.439  1.00 46.59 ? 497  ARG B NE  1 
ATOM   6556 C  CZ  . ARG B 1 390 ? 55.057 7.667   -2.872  1.00 39.32 ? 497  ARG B CZ  1 
ATOM   6557 N  NH1 . ARG B 1 390 ? 54.513 8.757   -3.396  0.00 32.52 ? 497  ARG B NH1 1 
ATOM   6558 N  NH2 . ARG B 1 390 ? 54.347 6.552   -2.785  0.00 30.63 ? 497  ARG B NH2 1 
ATOM   6559 N  N   . ARG B 1 391 ? 55.470 4.556   2.658   1.00 20.71 ? 498  ARG B N   1 
ATOM   6560 C  CA  . ARG B 1 391 ? 54.440 3.581   3.006   1.00 21.31 ? 498  ARG B CA  1 
ATOM   6561 C  C   . ARG B 1 391 ? 53.627 3.116   1.804   1.00 23.75 ? 498  ARG B C   1 
ATOM   6562 O  O   . ARG B 1 391 ? 53.344 1.924   1.661   1.00 20.30 ? 498  ARG B O   1 
ATOM   6563 C  CB  . ARG B 1 391 ? 53.522 4.171   4.063   1.00 18.58 ? 498  ARG B CB  1 
ATOM   6564 C  CG  . ARG B 1 391 ? 52.660 3.145   4.763   1.00 20.19 ? 498  ARG B CG  1 
ATOM   6565 C  CD  . ARG B 1 391 ? 52.059 3.717   6.026   1.00 16.07 ? 498  ARG B CD  1 
ATOM   6566 N  NE  . ARG B 1 391 ? 51.278 4.925   5.769   1.00 21.84 ? 498  ARG B NE  1 
ATOM   6567 C  CZ  . ARG B 1 391 ? 50.927 5.795   6.711   1.00 16.90 ? 498  ARG B CZ  1 
ATOM   6568 N  NH1 . ARG B 1 391 ? 50.215 6.869   6.397   1.00 19.00 ? 498  ARG B NH1 1 
ATOM   6569 N  NH2 . ARG B 1 391 ? 51.297 5.593   7.965   1.00 16.11 ? 498  ARG B NH2 1 
ATOM   6570 N  N   . GLY B 1 392 ? 53.288 4.060   0.930   1.00 20.77 ? 499  GLY B N   1 
ATOM   6571 C  CA  . GLY B 1 392 ? 52.440 3.792   -0.215  1.00 23.11 ? 499  GLY B CA  1 
ATOM   6572 C  C   . GLY B 1 392 ? 53.003 2.844   -1.253  1.00 20.80 ? 499  GLY B C   1 
ATOM   6573 O  O   . GLY B 1 392 ? 52.279 2.381   -2.137  1.00 22.13 ? 499  GLY B O   1 
ATOM   6574 N  N   . ASP B 1 393 ? 54.299 2.568   -1.159  1.00 23.77 ? 500  ASP B N   1 
ATOM   6575 C  CA  . ASP B 1 393 ? 54.952 1.645   -2.077  1.00 20.28 ? 500  ASP B CA  1 
ATOM   6576 C  C   . ASP B 1 393 ? 54.826 0.192   -1.608  1.00 20.35 ? 500  ASP B C   1 
ATOM   6577 O  O   . ASP B 1 393 ? 55.142 -0.722  -2.356  1.00 22.26 ? 500  ASP B O   1 
ATOM   6578 C  CB  . ASP B 1 393 ? 56.440 2.004   -2.255  1.00 20.42 ? 500  ASP B CB  1 
ATOM   6579 C  CG  . ASP B 1 393 ? 56.659 3.202   -3.177  1.00 28.21 ? 500  ASP B CG  1 
ATOM   6580 O  OD1 . ASP B 1 393 ? 55.732 3.592   -3.922  1.00 31.69 ? 500  ASP B OD1 1 
ATOM   6581 O  OD2 . ASP B 1 393 ? 57.778 3.753   -3.169  1.00 32.51 ? 500  ASP B OD2 1 
ATOM   6582 N  N   . LEU B 1 394 ? 54.360 -0.023  -0.381  1.00 20.44 ? 501  LEU B N   1 
ATOM   6583 C  CA  . LEU B 1 394 ? 54.142 -1.383  0.120   1.00 16.62 ? 501  LEU B CA  1 
ATOM   6584 C  C   . LEU B 1 394 ? 52.884 -2.047  -0.418  1.00 23.43 ? 501  LEU B C   1 
ATOM   6585 O  O   . LEU B 1 394 ? 51.844 -1.401  -0.542  1.00 22.78 ? 501  LEU B O   1 
ATOM   6586 C  CB  . LEU B 1 394 ? 54.050 -1.387  1.642   1.00 16.49 ? 501  LEU B CB  1 
ATOM   6587 C  CG  . LEU B 1 394 ? 55.323 -1.027  2.388   1.00 22.45 ? 501  LEU B CG  1 
ATOM   6588 C  CD1 . LEU B 1 394 ? 55.024 -0.814  3.852   1.00 24.54 ? 501  LEU B CD1 1 
ATOM   6589 C  CD2 . LEU B 1 394 ? 56.336 -2.138  2.199   1.00 25.01 ? 501  LEU B CD2 1 
ATOM   6590 N  N   . ALA B 1 395 ? 52.992 -3.336  -0.734  1.00 20.80 ? 502  ALA B N   1 
ATOM   6591 C  CA  . ALA B 1 395 ? 51.839 -4.231  -0.805  1.00 14.08 ? 502  ALA B CA  1 
ATOM   6592 C  C   . ALA B 1 395 ? 52.044 -5.372  0.177   1.00 20.88 ? 502  ALA B C   1 
ATOM   6593 O  O   . ALA B 1 395 ? 53.139 -5.935  0.270   1.00 18.21 ? 502  ALA B O   1 
ATOM   6594 C  CB  . ALA B 1 395 ? 51.640 -4.767  -2.191  1.00 20.95 ? 502  ALA B CB  1 
ATOM   6595 N  N   . ILE B 1 396 ? 50.989 -5.704  0.915   1.00 20.65 ? 503  ILE B N   1 
ATOM   6596 C  CA  . ILE B 1 396 ? 51.040 -6.760  1.911   1.00 14.52 ? 503  ILE B CA  1 
ATOM   6597 C  C   . ILE B 1 396 ? 49.963 -7.808  1.603   1.00 18.99 ? 503  ILE B C   1 
ATOM   6598 O  O   . ILE B 1 396 ? 48.808 -7.465  1.339   1.00 18.77 ? 503  ILE B O   1 
ATOM   6599 C  CB  . ILE B 1 396 ? 50.848 -6.188  3.328   1.00 17.88 ? 503  ILE B CB  1 
ATOM   6600 C  CG1 . ILE B 1 396 ? 51.837 -5.040  3.572   1.00 18.19 ? 503  ILE B CG1 1 
ATOM   6601 C  CG2 . ILE B 1 396 ? 50.978 -7.275  4.381   1.00 16.89 ? 503  ILE B CG2 1 
ATOM   6602 C  CD1 . ILE B 1 396 ? 51.702 -4.383  4.940   1.00 15.69 ? 503  ILE B CD1 1 
ATOM   6603 N  N   . HIS B 1 397 ? 50.353 -9.078  1.601   1.00 19.08 ? 504  HIS B N   1 
ATOM   6604 C  CA  . HIS B 1 397 ? 49.419 -10.173 1.372   1.00 19.12 ? 504  HIS B CA  1 
ATOM   6605 C  C   . HIS B 1 397 ? 49.476 -11.177 2.511   1.00 21.32 ? 504  HIS B C   1 
ATOM   6606 O  O   . HIS B 1 397 ? 50.526 -11.373 3.121   1.00 22.33 ? 504  HIS B O   1 
ATOM   6607 C  CB  . HIS B 1 397 ? 49.713 -10.867 0.043   1.00 20.87 ? 504  HIS B CB  1 
ATOM   6608 C  CG  . HIS B 1 397 ? 49.376 -10.037 -1.154  1.00 22.26 ? 504  HIS B CG  1 
ATOM   6609 N  ND1 . HIS B 1 397 ? 50.197 -9.033  -1.620  1.00 21.81 ? 504  HIS B ND1 1 
ATOM   6610 C  CD2 . HIS B 1 397 ? 48.291 -10.040 -1.963  1.00 23.15 ? 504  HIS B CD2 1 
ATOM   6611 C  CE1 . HIS B 1 397 ? 49.640 -8.464  -2.673  1.00 23.42 ? 504  HIS B CE1 1 
ATOM   6612 N  NE2 . HIS B 1 397 ? 48.482 -9.057  -2.902  1.00 28.83 ? 504  HIS B NE2 1 
ATOM   6613 N  N   . LEU B 1 398 ? 48.335 -11.797 2.799   1.00 18.89 ? 505  LEU B N   1 
ATOM   6614 C  CA  . LEU B 1 398 ? 48.254 -12.853 3.801   1.00 21.03 ? 505  LEU B CA  1 
ATOM   6615 C  C   . LEU B 1 398 ? 47.649 -14.099 3.179   1.00 21.98 ? 505  LEU B C   1 
ATOM   6616 O  O   . LEU B 1 398 ? 46.553 -14.043 2.617   1.00 20.00 ? 505  LEU B O   1 
ATOM   6617 C  CB  . LEU B 1 398 ? 47.430 -12.409 5.008   1.00 21.78 ? 505  LEU B CB  1 
ATOM   6618 C  CG  . LEU B 1 398 ? 47.298 -13.413 6.154   1.00 26.39 ? 505  LEU B CG  1 
ATOM   6619 C  CD1 . LEU B 1 398 ? 48.646 -13.629 6.812   1.00 22.27 ? 505  LEU B CD1 1 
ATOM   6620 C  CD2 . LEU B 1 398 ? 46.270 -12.936 7.173   1.00 16.69 ? 505  LEU B CD2 1 
ATOM   6621 N  N   . VAL B 1 399 ? 48.370 -15.219 3.274   1.00 21.09 ? 506  VAL B N   1 
ATOM   6622 C  CA  . VAL B 1 399 ? 47.926 -16.488 2.698   1.00 18.69 ? 506  VAL B CA  1 
ATOM   6623 C  C   . VAL B 1 399 ? 47.588 -17.489 3.804   1.00 20.45 ? 506  VAL B C   1 
ATOM   6624 O  O   . VAL B 1 399 ? 48.409 -17.752 4.681   1.00 19.28 ? 506  VAL B O   1 
ATOM   6625 C  CB  . VAL B 1 399 ? 49.002 -17.113 1.770   1.00 21.47 ? 506  VAL B CB  1 
ATOM   6626 C  CG1 . VAL B 1 399 ? 48.417 -18.286 0.974   1.00 20.99 ? 506  VAL B CG1 1 
ATOM   6627 C  CG2 . VAL B 1 399 ? 49.576 -16.069 0.839   1.00 24.07 ? 506  VAL B CG2 1 
ATOM   6628 N  N   . SER B 1 400 ? 46.377 -18.031 3.758   1.00 18.81 ? 507  SER B N   1 
ATOM   6629 C  CA  . SER B 1 400 ? 45.919 -18.999 4.756   1.00 19.29 ? 507  SER B CA  1 
ATOM   6630 C  C   . SER B 1 400 ? 46.445 -20.395 4.414   1.00 18.22 ? 507  SER B C   1 
ATOM   6631 O  O   . SER B 1 400 ? 46.828 -20.642 3.269   1.00 20.38 ? 507  SER B O   1 
ATOM   6632 C  CB  . SER B 1 400 ? 44.395 -19.010 4.826   1.00 13.57 ? 507  SER B CB  1 
ATOM   6633 O  OG  . SER B 1 400 ? 43.880 -19.717 3.721   1.00 17.35 ? 507  SER B OG  1 
ATOM   6634 N  N   . PRO B 1 401 ? 46.472 -21.305 5.404   1.00 19.24 ? 508  PRO B N   1 
ATOM   6635 C  CA  . PRO B 1 401 ? 46.951 -22.672 5.138   1.00 19.17 ? 508  PRO B CA  1 
ATOM   6636 C  C   . PRO B 1 401 ? 46.203 -23.355 3.987   1.00 27.78 ? 508  PRO B C   1 
ATOM   6637 O  O   . PRO B 1 401 ? 46.774 -24.229 3.338   1.00 25.73 ? 508  PRO B O   1 
ATOM   6638 C  CB  . PRO B 1 401 ? 46.690 -23.398 6.460   1.00 21.03 ? 508  PRO B CB  1 
ATOM   6639 C  CG  . PRO B 1 401 ? 46.758 -22.334 7.496   1.00 19.68 ? 508  PRO B CG  1 
ATOM   6640 C  CD  . PRO B 1 401 ? 46.171 -21.099 6.834   1.00 16.30 ? 508  PRO B CD  1 
ATOM   6641 N  N   . MET B 1 402 ? 44.962 -22.949 3.724   1.00 19.18 ? 509  MET B N   1 
ATOM   6642 C  CA  . MET B 1 402 ? 44.192 -23.546 2.637   1.00 20.81 ? 509  MET B CA  1 
ATOM   6643 C  C   . MET B 1 402 ? 44.442 -22.836 1.317   1.00 22.58 ? 509  MET B C   1 
ATOM   6644 O  O   . MET B 1 402 ? 43.813 -23.150 0.308   1.00 20.45 ? 509  MET B O   1 
ATOM   6645 C  CB  . MET B 1 402 ? 42.694 -23.539 2.952   1.00 21.07 ? 509  MET B CB  1 
ATOM   6646 C  CG  . MET B 1 402 ? 42.295 -24.480 4.068   1.00 27.12 ? 509  MET B CG  1 
ATOM   6647 S  SD  . MET B 1 402 ? 40.509 -24.606 4.215   1.00 43.80 ? 509  MET B SD  1 
ATOM   6648 C  CE  . MET B 1 402 ? 40.361 -25.654 5.623   1.00 29.08 ? 509  MET B CE  1 
ATOM   6649 N  N   . GLY B 1 403 ? 45.351 -21.868 1.328   1.00 15.79 ? 510  GLY B N   1 
ATOM   6650 C  CA  . GLY B 1 403 ? 45.780 -21.235 0.094   1.00 21.89 ? 510  GLY B CA  1 
ATOM   6651 C  C   . GLY B 1 403 ? 45.042 -19.958 -0.307  1.00 23.61 ? 510  GLY B C   1 
ATOM   6652 O  O   . GLY B 1 403 ? 45.240 -19.443 -1.402  1.00 22.47 ? 510  GLY B O   1 
ATOM   6653 N  N   . THR B 1 404 ? 44.205 -19.433 0.580   1.00 23.94 ? 511  THR B N   1 
ATOM   6654 C  CA  . THR B 1 404 ? 43.490 -18.196 0.284   1.00 23.00 ? 511  THR B CA  1 
ATOM   6655 C  C   . THR B 1 404 ? 44.382 -16.977 0.429   1.00 18.77 ? 511  THR B C   1 
ATOM   6656 O  O   . THR B 1 404 ? 44.876 -16.693 1.511   1.00 20.91 ? 511  THR B O   1 
ATOM   6657 C  CB  . THR B 1 404 ? 42.293 -18.024 1.195   1.00 20.35 ? 511  THR B CB  1 
ATOM   6658 O  OG1 . THR B 1 404 ? 41.426 -19.148 1.032   1.00 23.53 ? 511  THR B OG1 1 
ATOM   6659 C  CG2 . THR B 1 404 ? 41.540 -16.757 0.829   1.00 21.88 ? 511  THR B CG2 1 
ATOM   6660 N  N   . ARG B 1 405 ? 44.574 -16.246 -0.659  1.00 18.88 ? 512  ARG B N   1 
ATOM   6661 C  CA  . ARG B 1 405 ? 45.398 -15.047 -0.621  1.00 16.61 ? 512  ARG B CA  1 
ATOM   6662 C  C   . ARG B 1 405 ? 44.558 -13.794 -0.328  1.00 18.03 ? 512  ARG B C   1 
ATOM   6663 O  O   . ARG B 1 405 ? 43.745 -13.379 -1.148  1.00 19.46 ? 512  ARG B O   1 
ATOM   6664 C  CB  . ARG B 1 405 ? 46.143 -14.864 -1.953  1.00 21.31 ? 512  ARG B CB  1 
ATOM   6665 C  CG  . ARG B 1 405 ? 47.021 -16.057 -2.373  1.00 28.15 ? 512  ARG B CG  1 
ATOM   6666 C  CD  . ARG B 1 405 ? 47.811 -15.726 -3.656  1.00 24.47 ? 512  ARG B CD  1 
ATOM   6667 N  NE  . ARG B 1 405 ? 48.372 -14.384 -3.578  1.00 27.98 ? 512  ARG B NE  1 
ATOM   6668 C  CZ  . ARG B 1 405 ? 49.537 -14.092 -3.016  1.00 30.66 ? 512  ARG B CZ  1 
ATOM   6669 N  NH1 . ARG B 1 405 ? 50.285 -15.058 -2.493  1.00 38.86 ? 512  ARG B NH1 1 
ATOM   6670 N  NH2 . ARG B 1 405 ? 49.961 -12.838 -2.989  1.00 32.01 ? 512  ARG B NH2 1 
ATOM   6671 N  N   . SER B 1 406 ? 44.758 -13.200 0.841   1.00 17.81 ? 513  SER B N   1 
ATOM   6672 C  CA  . SER B 1 406 ? 44.142 -11.911 1.155   1.00 17.68 ? 513  SER B CA  1 
ATOM   6673 C  C   . SER B 1 406 ? 45.121 -10.771 0.905   1.00 18.50 ? 513  SER B C   1 
ATOM   6674 O  O   . SER B 1 406 ? 46.235 -10.802 1.399   1.00 18.32 ? 513  SER B O   1 
ATOM   6675 C  CB  . SER B 1 406 ? 43.667 -11.864 2.610   1.00 16.75 ? 513  SER B CB  1 
ATOM   6676 O  OG  . SER B 1 406 ? 42.642 -12.810 2.851   1.00 17.13 ? 513  SER B OG  1 
ATOM   6677 N  N   . THR B 1 407 ? 44.705 -9.777  0.130   1.00 16.24 ? 514  THR B N   1 
ATOM   6678 C  CA  . THR B 1 407 ? 45.479 -8.548  0.007   1.00 19.11 ? 514  THR B CA  1 
ATOM   6679 C  C   . THR B 1 407 ? 45.174 -7.639  1.198   1.00 19.92 ? 514  THR B C   1 
ATOM   6680 O  O   . THR B 1 407 ? 44.095 -7.044  1.282   1.00 19.63 ? 514  THR B O   1 
ATOM   6681 C  CB  . THR B 1 407 ? 45.176 -7.817  -1.303  1.00 21.28 ? 514  THR B CB  1 
ATOM   6682 O  OG1 . THR B 1 407 ? 45.498 -8.671  -2.402  1.00 23.11 ? 514  THR B OG1 1 
ATOM   6683 C  CG2 . THR B 1 407 ? 45.997 -6.530  -1.410  1.00 19.08 ? 514  THR B CG2 1 
ATOM   6684 N  N   . LEU B 1 408 ? 46.113 -7.556  2.134   1.00 14.13 ? 515  LEU B N   1 
ATOM   6685 C  CA  . LEU B 1 408 ? 45.910 -6.755  3.333   1.00 15.70 ? 515  LEU B CA  1 
ATOM   6686 C  C   . LEU B 1 408 ? 46.122 -5.274  3.036   1.00 18.88 ? 515  LEU B C   1 
ATOM   6687 O  O   . LEU B 1 408 ? 45.548 -4.412  3.698   1.00 19.34 ? 515  LEU B O   1 
ATOM   6688 C  CB  . LEU B 1 408 ? 46.856 -7.203  4.451   1.00 17.11 ? 515  LEU B CB  1 
ATOM   6689 C  CG  . LEU B 1 408 ? 46.656 -8.607  5.001   1.00 18.72 ? 515  LEU B CG  1 
ATOM   6690 C  CD1 . LEU B 1 408 ? 47.491 -8.762  6.265   1.00 17.57 ? 515  LEU B CD1 1 
ATOM   6691 C  CD2 . LEU B 1 408 ? 45.164 -8.876  5.271   1.00 16.85 ? 515  LEU B CD2 1 
ATOM   6692 N  N   . LEU B 1 409 ? 46.943 -4.991  2.032   1.00 16.33 ? 516  LEU B N   1 
ATOM   6693 C  CA  . LEU B 1 409 ? 47.244 -3.607  1.658   1.00 19.58 ? 516  LEU B CA  1 
ATOM   6694 C  C   . LEU B 1 409 ? 47.785 -3.573  0.244   1.00 18.50 ? 516  LEU B C   1 
ATOM   6695 O  O   . LEU B 1 409 ? 48.760 -4.259  -0.074  1.00 19.25 ? 516  LEU B O   1 
ATOM   6696 C  CB  . LEU B 1 409 ? 48.254 -2.982  2.635   1.00 17.53 ? 516  LEU B CB  1 
ATOM   6697 C  CG  . LEU B 1 409 ? 48.693 -1.548  2.312   1.00 20.14 ? 516  LEU B CG  1 
ATOM   6698 C  CD1 . LEU B 1 409 ? 47.559 -0.554  2.598   1.00 17.09 ? 516  LEU B CD1 1 
ATOM   6699 C  CD2 . LEU B 1 409 ? 49.960 -1.169  3.058   1.00 17.61 ? 516  LEU B CD2 1 
ATOM   6700 N  N   . ALA B 1 410 ? 47.139 -2.799  -0.617  1.00 15.54 ? 517  ALA B N   1 
ATOM   6701 C  CA  . ALA B 1 410 ? 47.648 -2.588  -1.962  1.00 20.08 ? 517  ALA B CA  1 
ATOM   6702 C  C   . ALA B 1 410 ? 48.418 -1.276  -1.993  1.00 20.82 ? 517  ALA B C   1 
ATOM   6703 O  O   . ALA B 1 410 ? 48.299 -0.481  -1.063  1.00 20.17 ? 517  ALA B O   1 
ATOM   6704 C  CB  . ALA B 1 410 ? 46.528 -2.569  -2.959  1.00 19.31 ? 517  ALA B CB  1 
ATOM   6705 N  N   . ALA B 1 411 ? 49.194 -1.051  -3.053  1.00 18.62 ? 518  ALA B N   1 
ATOM   6706 C  CA  . ALA B 1 411 ? 49.921 0.206   -3.229  1.00 18.89 ? 518  ALA B CA  1 
ATOM   6707 C  C   . ALA B 1 411 ? 49.004 1.420   -3.117  1.00 20.10 ? 518  ALA B C   1 
ATOM   6708 O  O   . ALA B 1 411 ? 47.918 1.425   -3.675  1.00 21.12 ? 518  ALA B O   1 
ATOM   6709 C  CB  . ALA B 1 411 ? 50.627 0.227   -4.578  1.00 20.36 ? 518  ALA B CB  1 
ATOM   6710 N  N   . ARG B 1 412 ? 49.448 2.439   -2.391  1.00 20.20 ? 519  ARG B N   1 
ATOM   6711 C  CA  . ARG B 1 412 ? 48.734 3.712   -2.336  1.00 18.14 ? 519  ARG B CA  1 
ATOM   6712 C  C   . ARG B 1 412 ? 49.668 4.818   -2.821  1.00 17.11 ? 519  ARG B C   1 
ATOM   6713 O  O   . ARG B 1 412 ? 50.443 5.363   -2.046  1.00 20.20 ? 519  ARG B O   1 
ATOM   6714 C  CB  . ARG B 1 412 ? 48.221 4.001   -0.917  1.00 19.07 ? 519  ARG B CB  1 
ATOM   6715 C  CG  . ARG B 1 412 ? 47.173 3.006   -0.401  1.00 15.59 ? 519  ARG B CG  1 
ATOM   6716 C  CD  . ARG B 1 412 ? 46.303 3.637   0.702   1.00 15.29 ? 519  ARG B CD  1 
ATOM   6717 N  NE  . ARG B 1 412 ? 47.100 4.021   1.862   1.00 15.72 ? 519  ARG B NE  1 
ATOM   6718 C  CZ  . ARG B 1 412 ? 46.662 4.764   2.874   1.00 16.08 ? 519  ARG B CZ  1 
ATOM   6719 N  NH1 . ARG B 1 412 ? 47.480 5.048   3.877   1.00 18.75 ? 519  ARG B NH1 1 
ATOM   6720 N  NH2 . ARG B 1 412 ? 45.413 5.224   2.894   1.00 17.11 ? 519  ARG B NH2 1 
ATOM   6721 N  N   . PRO B 1 413 ? 49.595 5.142   -4.119  1.00 22.10 ? 520  PRO B N   1 
ATOM   6722 C  CA  . PRO B 1 413 ? 50.485 6.073   -4.830  1.00 24.30 ? 520  PRO B CA  1 
ATOM   6723 C  C   . PRO B 1 413 ? 50.620 7.460   -4.197  1.00 30.14 ? 520  PRO B C   1 
ATOM   6724 O  O   . PRO B 1 413 ? 51.652 8.099   -4.389  1.00 26.54 ? 520  PRO B O   1 
ATOM   6725 C  CB  . PRO B 1 413 ? 49.833 6.191   -6.218  1.00 27.62 ? 520  PRO B CB  1 
ATOM   6726 C  CG  . PRO B 1 413 ? 48.427 5.647   -6.054  1.00 36.34 ? 520  PRO B CG  1 
ATOM   6727 C  CD  . PRO B 1 413 ? 48.555 4.590   -5.006  1.00 25.05 ? 520  PRO B CD  1 
ATOM   6728 N  N   . HIS B 1 414 ? 49.618 7.924   -3.457  1.00 22.92 ? 521  HIS B N   1 
ATOM   6729 C  CA  . HIS B 1 414 ? 49.733 9.230   -2.811  1.00 21.29 ? 521  HIS B CA  1 
ATOM   6730 C  C   . HIS B 1 414 ? 50.222 9.148   -1.366  1.00 21.57 ? 521  HIS B C   1 
ATOM   6731 O  O   . HIS B 1 414 ? 50.414 10.174  -0.719  1.00 22.44 ? 521  HIS B O   1 
ATOM   6732 C  CB  . HIS B 1 414 ? 48.386 9.962   -2.843  1.00 24.30 ? 521  HIS B CB  1 
ATOM   6733 C  CG  . HIS B 1 414 ? 47.769 10.033  -4.207  1.00 29.23 ? 521  HIS B CG  1 
ATOM   6734 N  ND1 . HIS B 1 414 ? 48.228 10.886  -5.188  1.00 26.76 ? 521  HIS B ND1 1 
ATOM   6735 C  CD2 . HIS B 1 414 ? 46.726 9.362   -4.750  1.00 25.03 ? 521  HIS B CD2 1 
ATOM   6736 C  CE1 . HIS B 1 414 ? 47.496 10.733  -6.279  1.00 31.42 ? 521  HIS B CE1 1 
ATOM   6737 N  NE2 . HIS B 1 414 ? 46.581 9.812   -6.041  1.00 28.43 ? 521  HIS B NE2 1 
ATOM   6738 N  N   . ASP B 1 415 ? 50.402 7.941   -0.835  1.00 20.65 ? 522  ASP B N   1 
ATOM   6739 C  CA  . ASP B 1 415 ? 50.809 7.823   0.570   1.00 18.89 ? 522  ASP B CA  1 
ATOM   6740 C  C   . ASP B 1 415 ? 52.339 7.914   0.685   1.00 20.38 ? 522  ASP B C   1 
ATOM   6741 O  O   . ASP B 1 415 ? 53.055 6.958   0.410   1.00 23.69 ? 522  ASP B O   1 
ATOM   6742 C  CB  . ASP B 1 415 ? 50.270 6.514   1.178   1.00 19.93 ? 522  ASP B CB  1 
ATOM   6743 C  CG  . ASP B 1 415 ? 50.587 6.366   2.667   1.00 19.82 ? 522  ASP B CG  1 
ATOM   6744 O  OD1 . ASP B 1 415 ? 51.046 7.333   3.310   1.00 22.74 ? 522  ASP B OD1 1 
ATOM   6745 O  OD2 . ASP B 1 415 ? 50.368 5.262   3.205   1.00 22.64 ? 522  ASP B OD2 1 
ATOM   6746 N  N   . TYR B 1 416 ? 52.821 9.082   1.091   1.00 22.93 ? 523  TYR B N   1 
ATOM   6747 C  CA  . TYR B 1 416 ? 54.247 9.388   1.101   1.00 23.47 ? 523  TYR B CA  1 
ATOM   6748 C  C   . TYR B 1 416 ? 54.851 9.177   2.484   1.00 29.31 ? 523  TYR B C   1 
ATOM   6749 O  O   . TYR B 1 416 ? 56.054 9.326   2.674   1.00 30.11 ? 523  TYR B O   1 
ATOM   6750 C  CB  . TYR B 1 416 ? 54.482 10.830  0.631   1.00 28.01 ? 523  TYR B CB  1 
ATOM   6751 C  CG  . TYR B 1 416 ? 53.609 11.850  1.338   0.00 28.94 ? 523  TYR B CG  1 
ATOM   6752 C  CD1 . TYR B 1 416 ? 53.884 12.248  2.642   0.00 30.05 ? 523  TYR B CD1 1 
ATOM   6753 C  CD2 . TYR B 1 416 ? 52.511 12.414  0.701   0.00 29.69 ? 523  TYR B CD2 1 
ATOM   6754 C  CE1 . TYR B 1 416 ? 53.089 13.176  3.291   0.00 31.63 ? 523  TYR B CE1 1 
ATOM   6755 C  CE2 . TYR B 1 416 ? 51.711 13.346  1.343   0.00 32.11 ? 523  TYR B CE2 1 
ATOM   6756 C  CZ  . TYR B 1 416 ? 52.005 13.722  2.637   0.00 33.53 ? 523  TYR B CZ  1 
ATOM   6757 O  OH  . TYR B 1 416 ? 51.212 14.647  3.279   0.00 35.67 ? 523  TYR B OH  1 
ATOM   6758 N  N   . SER B 1 417 ? 54.005 8.790   3.434   1.00 24.12 ? 524  SER B N   1 
ATOM   6759 C  CA  . SER B 1 417 ? 54.362 8.720   4.845   1.00 20.28 ? 524  SER B CA  1 
ATOM   6760 C  C   . SER B 1 417 ? 55.581 7.864   5.172   1.00 21.65 ? 524  SER B C   1 
ATOM   6761 O  O   . SER B 1 417 ? 55.805 6.807   4.575   1.00 23.25 ? 524  SER B O   1 
ATOM   6762 C  CB  . SER B 1 417 ? 53.174 8.195   5.648   1.00 20.00 ? 524  SER B CB  1 
ATOM   6763 O  OG  . SER B 1 417 ? 53.412 8.270   7.041   1.00 22.74 ? 524  SER B OG  1 
ATOM   6764 N  N   . ALA B 1 418 ? 56.335 8.331   6.163   1.00 22.61 ? 525  ALA B N   1 
ATOM   6765 C  CA  . ALA B 1 418 ? 57.465 7.602   6.722   1.00 26.01 ? 525  ALA B CA  1 
ATOM   6766 C  C   . ALA B 1 418 ? 57.107 6.965   8.072   1.00 26.35 ? 525  ALA B C   1 
ATOM   6767 O  O   . ALA B 1 418 ? 57.968 6.416   8.762   1.00 25.35 ? 525  ALA B O   1 
ATOM   6768 C  CB  . ALA B 1 418 ? 58.661 8.543   6.877   1.00 27.97 ? 525  ALA B CB  1 
ATOM   6769 N  N   . ASP B 1 419 ? 55.832 7.033   8.447   1.00 25.63 ? 526  ASP B N   1 
ATOM   6770 C  CA  . ASP B 1 419 ? 55.406 6.591   9.778   1.00 26.03 ? 526  ASP B CA  1 
ATOM   6771 C  C   . ASP B 1 419 ? 55.140 5.091   9.871   1.00 23.84 ? 526  ASP B C   1 
ATOM   6772 O  O   . ASP B 1 419 ? 54.954 4.567   10.965  1.00 24.55 ? 526  ASP B O   1 
ATOM   6773 C  CB  . ASP B 1 419 ? 54.146 7.341   10.220  1.00 26.62 ? 526  ASP B CB  1 
ATOM   6774 C  CG  . ASP B 1 419 ? 54.391 8.825   10.461  1.00 33.11 ? 526  ASP B CG  1 
ATOM   6775 O  OD1 . ASP B 1 419 ? 55.540 9.212   10.748  1.00 41.27 ? 526  ASP B OD1 1 
ATOM   6776 O  OD2 . ASP B 1 419 ? 53.423 9.605   10.377  1.00 41.32 ? 526  ASP B OD2 1 
ATOM   6777 N  N   . GLY B 1 420 ? 55.105 4.415   8.731   1.00 20.37 ? 527  GLY B N   1 
ATOM   6778 C  CA  . GLY B 1 420 ? 54.851 2.983   8.695   1.00 20.09 ? 527  GLY B CA  1 
ATOM   6779 C  C   . GLY B 1 420 ? 53.535 2.593   9.354   1.00 23.83 ? 527  GLY B C   1 
ATOM   6780 O  O   . GLY B 1 420 ? 52.552 3.322   9.252   1.00 19.94 ? 527  GLY B O   1 
ATOM   6781 N  N   . PHE B 1 421 ? 53.531 1.443   10.029  1.00 20.31 ? 528  PHE B N   1 
ATOM   6782 C  CA  . PHE B 1 421 ? 52.367 0.968   10.772  1.00 17.07 ? 528  PHE B CA  1 
ATOM   6783 C  C   . PHE B 1 421 ? 52.746 0.604   12.205  1.00 21.27 ? 528  PHE B C   1 
ATOM   6784 O  O   . PHE B 1 421 ? 53.731 -0.088  12.431  1.00 18.51 ? 528  PHE B O   1 
ATOM   6785 C  CB  . PHE B 1 421 ? 51.746 -0.237  10.076  1.00 12.86 ? 528  PHE B CB  1 
ATOM   6786 C  CG  . PHE B 1 421 ? 51.124 0.090   8.760   1.00 18.17 ? 528  PHE B CG  1 
ATOM   6787 C  CD1 . PHE B 1 421 ? 49.822 0.595   8.701   1.00 19.85 ? 528  PHE B CD1 1 
ATOM   6788 C  CD2 . PHE B 1 421 ? 51.824 -0.099  7.579   1.00 15.71 ? 528  PHE B CD2 1 
ATOM   6789 C  CE1 . PHE B 1 421 ? 49.238 0.911   7.482   1.00 14.96 ? 528  PHE B CE1 1 
ATOM   6790 C  CE2 . PHE B 1 421 ? 51.252 0.210   6.363   1.00 15.80 ? 528  PHE B CE2 1 
ATOM   6791 C  CZ  . PHE B 1 421 ? 49.956 0.713   6.310   1.00 16.59 ? 528  PHE B CZ  1 
ATOM   6792 N  N   . ASN B 1 422 ? 51.950 1.066   13.164  1.00 20.22 ? 529  ASN B N   1 
ATOM   6793 C  CA  . ASN B 1 422 ? 52.210 0.797   14.568  1.00 20.44 ? 529  ASN B CA  1 
ATOM   6794 C  C   . ASN B 1 422 ? 51.139 -0.098  15.197  1.00 22.83 ? 529  ASN B C   1 
ATOM   6795 O  O   . ASN B 1 422 ? 50.097 0.390   15.663  1.00 21.50 ? 529  ASN B O   1 
ATOM   6796 C  CB  . ASN B 1 422 ? 52.317 2.105   15.352  1.00 20.21 ? 529  ASN B CB  1 
ATOM   6797 C  CG  . ASN B 1 422 ? 52.792 1.887   16.782  1.00 26.05 ? 529  ASN B CG  1 
ATOM   6798 O  OD1 . ASN B 1 422 ? 53.158 0.775   17.162  1.00 25.87 ? 529  ASN B OD1 1 
ATOM   6799 N  ND2 . ASN B 1 422 ? 52.801 2.950   17.573  1.00 23.06 ? 529  ASN B ND2 1 
ATOM   6800 N  N   . ASP B 1 423 ? 51.426 -1.397  15.232  1.00 19.13 ? 530  ASP B N   1 
ATOM   6801 C  CA  . ASP B 1 423 ? 50.487 -2.405  15.715  1.00 20.37 ? 530  ASP B CA  1 
ATOM   6802 C  C   . ASP B 1 423 ? 49.122 -2.212  15.050  1.00 22.27 ? 530  ASP B C   1 
ATOM   6803 O  O   . ASP B 1 423 ? 48.092 -2.145  15.719  1.00 21.99 ? 530  ASP B O   1 
ATOM   6804 C  CB  . ASP B 1 423 ? 50.359 -2.344  17.238  1.00 20.94 ? 530  ASP B CB  1 
ATOM   6805 C  CG  . ASP B 1 423 ? 49.579 -3.531  17.808  1.00 23.39 ? 530  ASP B CG  1 
ATOM   6806 O  OD1 . ASP B 1 423 ? 49.669 -4.648  17.258  1.00 30.20 ? 530  ASP B OD1 1 
ATOM   6807 O  OD2 . ASP B 1 423 ? 48.868 -3.348  18.801  1.00 28.20 ? 530  ASP B OD2 1 
ATOM   6808 N  N   . TRP B 1 424 ? 49.131 -2.088  13.729  1.00 19.68 ? 531  TRP B N   1 
ATOM   6809 C  CA  . TRP B 1 424 ? 47.902 -1.874  12.981  1.00 19.47 ? 531  TRP B CA  1 
ATOM   6810 C  C   . TRP B 1 424 ? 47.260 -3.205  12.602  1.00 19.97 ? 531  TRP B C   1 
ATOM   6811 O  O   . TRP B 1 424 ? 47.884 -4.050  11.948  1.00 18.28 ? 531  TRP B O   1 
ATOM   6812 C  CB  . TRP B 1 424 ? 48.162 -1.037  11.731  1.00 19.96 ? 531  TRP B CB  1 
ATOM   6813 C  CG  . TRP B 1 424 ? 46.892 -0.726  10.998  1.00 18.99 ? 531  TRP B CG  1 
ATOM   6814 C  CD1 . TRP B 1 424 ? 46.411 -1.363  9.901   1.00 14.76 ? 531  TRP B CD1 1 
ATOM   6815 C  CD2 . TRP B 1 424 ? 45.932 0.280   11.339  1.00 16.21 ? 531  TRP B CD2 1 
ATOM   6816 N  NE1 . TRP B 1 424 ? 45.207 -0.818  9.529   1.00 18.73 ? 531  TRP B NE1 1 
ATOM   6817 C  CE2 . TRP B 1 424 ? 44.892 0.194   10.396  1.00 16.79 ? 531  TRP B CE2 1 
ATOM   6818 C  CE3 . TRP B 1 424 ? 45.852 1.237   12.351  1.00 17.42 ? 531  TRP B CE3 1 
ATOM   6819 C  CZ2 . TRP B 1 424 ? 43.777 1.039   10.432  1.00 14.22 ? 531  TRP B CZ2 1 
ATOM   6820 C  CZ3 . TRP B 1 424 ? 44.741 2.075   12.390  1.00 20.22 ? 531  TRP B CZ3 1 
ATOM   6821 C  CH2 . TRP B 1 424 ? 43.722 1.969   11.429  1.00 16.03 ? 531  TRP B CH2 1 
ATOM   6822 N  N   . ALA B 1 425 ? 46.004 -3.380  12.991  1.00 20.61 ? 532  ALA B N   1 
ATOM   6823 C  CA  . ALA B 1 425 ? 45.322 -4.657  12.780  1.00 21.59 ? 532  ALA B CA  1 
ATOM   6824 C  C   . ALA B 1 425 ? 44.676 -4.788  11.401  1.00 21.46 ? 532  ALA B C   1 
ATOM   6825 O  O   . ALA B 1 425 ? 43.489 -4.502  11.255  1.00 30.94 ? 532  ALA B O   1 
ATOM   6826 C  CB  . ALA B 1 425 ? 44.259 -4.860  13.863  1.00 20.02 ? 532  ALA B CB  1 
ATOM   6827 N  N   . PHE B 1 426 ? 45.426 -5.250  10.400  1.00 19.43 ? 533  PHE B N   1 
ATOM   6828 C  CA  . PHE B 1 426 ? 44.829 -5.550  9.098   1.00 16.43 ? 533  PHE B CA  1 
ATOM   6829 C  C   . PHE B 1 426 ? 43.864 -6.723  9.237   1.00 19.69 ? 533  PHE B C   1 
ATOM   6830 O  O   . PHE B 1 426 ? 44.217 -7.735  9.828   1.00 19.12 ? 533  PHE B O   1 
ATOM   6831 C  CB  . PHE B 1 426 ? 45.896 -5.876  8.061   1.00 15.15 ? 533  PHE B CB  1 
ATOM   6832 C  CG  . PHE B 1 426 ? 46.811 -4.727  7.744   1.00 18.96 ? 533  PHE B CG  1 
ATOM   6833 C  CD1 . PHE B 1 426 ? 46.481 -3.805  6.755   1.00 18.50 ? 533  PHE B CD1 1 
ATOM   6834 C  CD2 . PHE B 1 426 ? 48.002 -4.575  8.425   1.00 14.10 ? 533  PHE B CD2 1 
ATOM   6835 C  CE1 . PHE B 1 426 ? 47.335 -2.754  6.449   1.00 15.02 ? 533  PHE B CE1 1 
ATOM   6836 C  CE2 . PHE B 1 426 ? 48.854 -3.532  8.142   1.00 17.66 ? 533  PHE B CE2 1 
ATOM   6837 C  CZ  . PHE B 1 426 ? 48.527 -2.610  7.151   1.00 16.13 ? 533  PHE B CZ  1 
ATOM   6838 N  N   . MET B 1 427 ? 42.657 -6.596  8.697   1.00 13.55 ? 534  MET B N   1 
ATOM   6839 C  CA  . MET B 1 427 ? 41.650 -7.648  8.874   1.00 16.05 ? 534  MET B CA  1 
ATOM   6840 C  C   . MET B 1 427 ? 41.225 -8.267  7.537   1.00 14.27 ? 534  MET B C   1 
ATOM   6841 O  O   . MET B 1 427 ? 41.132 -7.580  6.510   1.00 13.48 ? 534  MET B O   1 
ATOM   6842 C  CB  . MET B 1 427 ? 40.426 -7.088  9.634   1.00 15.68 ? 534  MET B CB  1 
ATOM   6843 C  CG  . MET B 1 427 ? 39.406 -8.150  10.100  1.00 16.30 ? 534  MET B CG  1 
ATOM   6844 S  SD  . MET B 1 427 ? 38.185 -8.634  8.844   1.00 15.87 ? 534  MET B SD  1 
ATOM   6845 C  CE  . MET B 1 427 ? 36.893 -7.393  9.157   1.00 14.72 ? 534  MET B CE  1 
ATOM   6846 N  N   . THR B 1 428 ? 40.997 -9.579  7.532   1.00 14.35 ? 535  THR B N   1 
ATOM   6847 C  CA  . THR B 1 428 ? 40.411 -10.203 6.356   1.00 13.72 ? 535  THR B CA  1 
ATOM   6848 C  C   . THR B 1 428 ? 39.239 -11.104 6.698   1.00 16.61 ? 535  THR B C   1 
ATOM   6849 O  O   . THR B 1 428 ? 39.253 -11.825 7.702   1.00 15.97 ? 535  THR B O   1 
ATOM   6850 C  CB  . THR B 1 428 ? 41.410 -11.038 5.537   1.00 13.60 ? 535  THR B CB  1 
ATOM   6851 O  OG1 . THR B 1 428 ? 40.701 -11.660 4.451   1.00 11.63 ? 535  THR B OG1 1 
ATOM   6852 C  CG2 . THR B 1 428 ? 42.092 -12.135 6.396   1.00 13.16 ? 535  THR B CG2 1 
ATOM   6853 N  N   . THR B 1 429 ? 38.224 -11.029 5.841   1.00 13.97 ? 536  THR B N   1 
ATOM   6854 C  CA  . THR B 1 429 ? 37.047 -11.878 5.913   1.00 13.19 ? 536  THR B CA  1 
ATOM   6855 C  C   . THR B 1 429 ? 37.107 -13.038 4.919   1.00 12.91 ? 536  THR B C   1 
ATOM   6856 O  O   . THR B 1 429 ? 36.188 -13.834 4.852   1.00 12.85 ? 536  THR B O   1 
ATOM   6857 C  CB  . THR B 1 429 ? 35.774 -11.082 5.595   1.00 13.03 ? 536  THR B CB  1 
ATOM   6858 O  OG1 . THR B 1 429 ? 35.832 -10.649 4.235   1.00 12.36 ? 536  THR B OG1 1 
ATOM   6859 C  CG2 . THR B 1 429 ? 35.642 -9.867  6.494   1.00 14.45 ? 536  THR B CG2 1 
ATOM   6860 N  N   . HIS B 1 430 ? 38.172 -13.115 4.130   1.00 11.42 ? 537  HIS B N   1 
ATOM   6861 C  CA  . HIS B 1 430 ? 38.159 -13.960 2.935   1.00 13.58 ? 537  HIS B CA  1 
ATOM   6862 C  C   . HIS B 1 430 ? 38.372 -15.450 3.245   1.00 14.63 ? 537  HIS B C   1 
ATOM   6863 O  O   . HIS B 1 430 ? 38.186 -16.292 2.376   1.00 15.65 ? 537  HIS B O   1 
ATOM   6864 C  CB  . HIS B 1 430 ? 39.221 -13.481 1.932   1.00 11.52 ? 537  HIS B CB  1 
ATOM   6865 C  CG  . HIS B 1 430 ? 38.872 -12.206 1.225   1.00 14.64 ? 537  HIS B CG  1 
ATOM   6866 N  ND1 . HIS B 1 430 ? 39.388 -11.874 -0.009  1.00 15.56 ? 537  HIS B ND1 1 
ATOM   6867 C  CD2 . HIS B 1 430 ? 38.052 -11.186 1.573   1.00 12.50 ? 537  HIS B CD2 1 
ATOM   6868 C  CE1 . HIS B 1 430 ? 38.901 -10.705 -0.391  1.00 16.09 ? 537  HIS B CE1 1 
ATOM   6869 N  NE2 . HIS B 1 430 ? 38.086 -10.268 0.553   1.00 15.66 ? 537  HIS B NE2 1 
ATOM   6870 N  N   . SER B 1 431 ? 38.748 -15.764 4.482   1.00 14.32 ? 538  SER B N   1 
ATOM   6871 C  CA  . SER B 1 431 ? 38.946 -17.155 4.909   1.00 14.81 ? 538  SER B CA  1 
ATOM   6872 C  C   . SER B 1 431 ? 37.879 -17.632 5.889   1.00 14.89 ? 538  SER B C   1 
ATOM   6873 O  O   . SER B 1 431 ? 38.095 -18.596 6.626   1.00 15.54 ? 538  SER B O   1 
ATOM   6874 C  CB  . SER B 1 431 ? 40.324 -17.321 5.554   1.00 13.33 ? 538  SER B CB  1 
ATOM   6875 O  OG  . SER B 1 431 ? 41.369 -17.192 4.602   1.00 17.82 ? 538  SER B OG  1 
ATOM   6876 N  N   . TRP B 1 432 ? 36.743 -16.942 5.907   1.00 13.44 ? 539  TRP B N   1 
ATOM   6877 C  CA  . TRP B 1 432 ? 35.599 -17.341 6.723   1.00 11.04 ? 539  TRP B CA  1 
ATOM   6878 C  C   . TRP B 1 432 ? 35.280 -18.831 6.534   1.00 11.45 ? 539  TRP B C   1 
ATOM   6879 O  O   . TRP B 1 432 ? 35.230 -19.294 5.403   1.00 14.84 ? 539  TRP B O   1 
ATOM   6880 C  CB  . TRP B 1 432 ? 34.383 -16.497 6.334   1.00 10.84 ? 539  TRP B CB  1 
ATOM   6881 C  CG  . TRP B 1 432 ? 33.300 -16.406 7.367   1.00 10.75 ? 539  TRP B CG  1 
ATOM   6882 C  CD1 . TRP B 1 432 ? 32.288 -17.293 7.572   1.00 12.82 ? 539  TRP B CD1 1 
ATOM   6883 C  CD2 . TRP B 1 432 ? 33.091 -15.340 8.293   1.00 13.38 ? 539  TRP B CD2 1 
ATOM   6884 N  NE1 . TRP B 1 432 ? 31.471 -16.865 8.584   1.00 13.51 ? 539  TRP B NE1 1 
ATOM   6885 C  CE2 . TRP B 1 432 ? 31.940 -15.665 9.047   1.00 15.26 ? 539  TRP B CE2 1 
ATOM   6886 C  CE3 . TRP B 1 432 ? 33.766 -14.147 8.565   1.00 11.42 ? 539  TRP B CE3 1 
ATOM   6887 C  CZ2 . TRP B 1 432 ? 31.446 -14.832 10.053  1.00 14.70 ? 539  TRP B CZ2 1 
ATOM   6888 C  CZ3 . TRP B 1 432 ? 33.280 -13.323 9.563   1.00 15.12 ? 539  TRP B CZ3 1 
ATOM   6889 C  CH2 . TRP B 1 432 ? 32.129 -13.669 10.300  1.00 14.44 ? 539  TRP B CH2 1 
ATOM   6890 N  N   . ASP B 1 433 ? 35.068 -19.548 7.639   1.00 14.54 ? 540  ASP B N   1 
ATOM   6891 C  CA  . ASP B 1 433 ? 34.792 -21.014 7.687   1.00 16.08 ? 540  ASP B CA  1 
ATOM   6892 C  C   . ASP B 1 433 ? 35.965 -21.958 7.314   1.00 19.44 ? 540  ASP B C   1 
ATOM   6893 O  O   . ASP B 1 433 ? 35.797 -23.181 7.325   1.00 15.53 ? 540  ASP B O   1 
ATOM   6894 C  CB  . ASP B 1 433 ? 33.583 -21.368 6.808   1.00 14.31 ? 540  ASP B CB  1 
ATOM   6895 C  CG  . ASP B 1 433 ? 32.251 -20.916 7.421   1.00 17.41 ? 540  ASP B CG  1 
ATOM   6896 O  OD1 . ASP B 1 433 ? 32.095 -20.926 8.661   1.00 18.16 ? 540  ASP B OD1 1 
ATOM   6897 O  OD2 . ASP B 1 433 ? 31.355 -20.541 6.658   1.00 17.73 ? 540  ASP B OD2 1 
ATOM   6898 N  N   . GLU B 1 434 ? 37.140 -21.412 7.000   1.00 18.21 ? 541  GLU B N   1 
ATOM   6899 C  CA  . GLU B 1 434 ? 38.319 -22.263 6.775   1.00 19.20 ? 541  GLU B CA  1 
ATOM   6900 C  C   . GLU B 1 434 ? 38.839 -22.795 8.108   1.00 20.39 ? 541  GLU B C   1 
ATOM   6901 O  O   . GLU B 1 434 ? 38.573 -22.227 9.158   1.00 17.36 ? 541  GLU B O   1 
ATOM   6902 C  CB  . GLU B 1 434 ? 39.438 -21.502 6.040   1.00 17.74 ? 541  GLU B CB  1 
ATOM   6903 C  CG  . GLU B 1 434 ? 39.074 -21.031 4.632   1.00 17.60 ? 541  GLU B CG  1 
ATOM   6904 C  CD  . GLU B 1 434 ? 40.231 -20.332 3.907   1.00 18.34 ? 541  GLU B CD  1 
ATOM   6905 O  OE1 . GLU B 1 434 ? 41.364 -20.277 4.444   1.00 21.60 ? 541  GLU B OE1 1 
ATOM   6906 O  OE2 . GLU B 1 434 ? 40.007 -19.843 2.785   1.00 19.55 ? 541  GLU B OE2 1 
ATOM   6907 N  N   . ASP B 1 435 ? 39.541 -23.921 8.063   1.00 21.67 ? 542  ASP B N   1 
ATOM   6908 C  CA  . ASP B 1 435 ? 40.306 -24.401 9.206   1.00 17.53 ? 542  ASP B CA  1 
ATOM   6909 C  C   . ASP B 1 435 ? 41.605 -23.620 9.183   1.00 15.53 ? 542  ASP B C   1 
ATOM   6910 O  O   . ASP B 1 435 ? 42.307 -23.612 8.174   1.00 20.60 ? 542  ASP B O   1 
ATOM   6911 C  CB  . ASP B 1 435 ? 40.552 -25.920 9.121   1.00 23.54 ? 542  ASP B CB  1 
ATOM   6912 C  CG  . ASP B 1 435 ? 41.205 -26.496 10.379  1.00 23.13 ? 542  ASP B CG  1 
ATOM   6913 O  OD1 . ASP B 1 435 ? 42.114 -25.857 10.944  1.00 25.99 ? 542  ASP B OD1 1 
ATOM   6914 O  OD2 . ASP B 1 435 ? 40.810 -27.602 10.805  1.00 25.15 ? 542  ASP B OD2 1 
ATOM   6915 N  N   . PRO B 1 436 ? 41.923 -22.927 10.280  1.00 18.96 ? 543  PRO B N   1 
ATOM   6916 C  CA  . PRO B 1 436 ? 43.100 -22.050 10.234  1.00 18.97 ? 543  PRO B CA  1 
ATOM   6917 C  C   . PRO B 1 436 ? 44.416 -22.717 10.678  1.00 21.82 ? 543  PRO B C   1 
ATOM   6918 O  O   . PRO B 1 436 ? 45.448 -22.042 10.732  1.00 20.72 ? 543  PRO B O   1 
ATOM   6919 C  CB  . PRO B 1 436 ? 42.716 -20.928 11.194  1.00 20.86 ? 543  PRO B CB  1 
ATOM   6920 C  CG  . PRO B 1 436 ? 41.859 -21.614 12.224  1.00 17.05 ? 543  PRO B CG  1 
ATOM   6921 C  CD  . PRO B 1 436 ? 41.194 -22.809 11.551  1.00 16.04 ? 543  PRO B CD  1 
ATOM   6922 N  N   . SER B 1 437 ? 44.397 -24.009 10.992  1.00 20.51 ? 544  SER B N   1 
ATOM   6923 C  CA  . SER B 1 437 ? 45.634 -24.657 11.439  1.00 22.49 ? 544  SER B CA  1 
ATOM   6924 C  C   . SER B 1 437 ? 46.543 -24.944 10.247  1.00 23.25 ? 544  SER B C   1 
ATOM   6925 O  O   . SER B 1 437 ? 46.078 -25.324 9.178   1.00 23.15 ? 544  SER B O   1 
ATOM   6926 C  CB  . SER B 1 437 ? 45.342 -25.944 12.212  1.00 24.29 ? 544  SER B CB  1 
ATOM   6927 O  OG  . SER B 1 437 ? 44.875 -26.956 11.346  1.00 29.61 ? 544  SER B OG  1 
ATOM   6928 N  N   . GLY B 1 438 ? 47.844 -24.749 10.423  1.00 22.64 ? 545  GLY B N   1 
ATOM   6929 C  CA  . GLY B 1 438 ? 48.769 -24.992 9.331   1.00 18.63 ? 545  GLY B CA  1 
ATOM   6930 C  C   . GLY B 1 438 ? 49.635 -23.786 9.042   1.00 21.38 ? 545  GLY B C   1 
ATOM   6931 O  O   . GLY B 1 438 ? 49.813 -22.930 9.902   1.00 23.79 ? 545  GLY B O   1 
ATOM   6932 N  N   . GLU B 1 439 ? 50.173 -23.721 7.829   1.00 24.33 ? 546  GLU B N   1 
ATOM   6933 C  CA  . GLU B 1 439 ? 51.149 -22.694 7.489   1.00 29.42 ? 546  GLU B CA  1 
ATOM   6934 C  C   . GLU B 1 439 ? 50.512 -21.424 6.919   1.00 22.19 ? 546  GLU B C   1 
ATOM   6935 O  O   . GLU B 1 439 ? 49.929 -21.433 5.836   1.00 23.02 ? 546  GLU B O   1 
ATOM   6936 C  CB  . GLU B 1 439 ? 52.181 -23.234 6.496   1.00 25.54 ? 546  GLU B CB  1 
ATOM   6937 C  CG  . GLU B 1 439 ? 53.275 -22.222 6.182   1.00 26.82 ? 546  GLU B CG  1 
ATOM   6938 C  CD  . GLU B 1 439 ? 54.342 -22.761 5.234   1.00 33.69 ? 546  GLU B CD  1 
ATOM   6939 O  OE1 . GLU B 1 439 ? 55.491 -22.952 5.673   1.00 36.77 ? 546  GLU B OE1 1 
ATOM   6940 O  OE2 . GLU B 1 439 ? 54.043 -22.980 4.046   1.00 37.99 ? 546  GLU B OE2 1 
ATOM   6941 N  N   . TRP B 1 440 ? 50.638 -20.337 7.668   1.00 19.74 ? 547  TRP B N   1 
ATOM   6942 C  CA  . TRP B 1 440 ? 50.200 -19.024 7.216   1.00 22.98 ? 547  TRP B CA  1 
ATOM   6943 C  C   . TRP B 1 440 ? 51.400 -18.334 6.584   1.00 21.94 ? 547  TRP B C   1 
ATOM   6944 O  O   . TRP B 1 440 ? 52.519 -18.536 7.030   1.00 24.42 ? 547  TRP B O   1 
ATOM   6945 C  CB  . TRP B 1 440 ? 49.646 -18.196 8.378   1.00 16.33 ? 547  TRP B CB  1 
ATOM   6946 C  CG  . TRP B 1 440 ? 48.250 -18.596 8.838   1.00 19.49 ? 547  TRP B CG  1 
ATOM   6947 C  CD1 . TRP B 1 440 ? 47.921 -19.612 9.681   1.00 22.95 ? 547  TRP B CD1 1 
ATOM   6948 C  CD2 . TRP B 1 440 ? 47.020 -17.953 8.489   1.00 18.61 ? 547  TRP B CD2 1 
ATOM   6949 N  NE1 . TRP B 1 440 ? 46.562 -19.654 9.871   1.00 18.86 ? 547  TRP B NE1 1 
ATOM   6950 C  CE2 . TRP B 1 440 ? 45.985 -18.647 9.146   1.00 19.73 ? 547  TRP B CE2 1 
ATOM   6951 C  CE3 . TRP B 1 440 ? 46.694 -16.865 7.671   1.00 17.45 ? 547  TRP B CE3 1 
ATOM   6952 C  CZ2 . TRP B 1 440 ? 44.643 -18.286 9.018   1.00 21.51 ? 547  TRP B CZ2 1 
ATOM   6953 C  CZ3 . TRP B 1 440 ? 45.357 -16.505 7.539   1.00 23.14 ? 547  TRP B CZ3 1 
ATOM   6954 C  CH2 . TRP B 1 440 ? 44.348 -17.210 8.216   1.00 23.83 ? 547  TRP B CH2 1 
ATOM   6955 N  N   . VAL B 1 441 ? 51.184 -17.559 5.529   1.00 22.51 ? 548  VAL B N   1 
ATOM   6956 C  CA  . VAL B 1 441 ? 52.284 -16.819 4.926   1.00 24.40 ? 548  VAL B CA  1 
ATOM   6957 C  C   . VAL B 1 441 ? 51.966 -15.331 4.802   1.00 24.17 ? 548  VAL B C   1 
ATOM   6958 O  O   . VAL B 1 441 ? 50.933 -14.955 4.253   1.00 22.80 ? 548  VAL B O   1 
ATOM   6959 C  CB  . VAL B 1 441 ? 52.642 -17.369 3.536   1.00 22.69 ? 548  VAL B CB  1 
ATOM   6960 C  CG1 . VAL B 1 441 ? 53.892 -16.695 3.022   1.00 23.30 ? 548  VAL B CG1 1 
ATOM   6961 C  CG2 . VAL B 1 441 ? 52.831 -18.885 3.592   1.00 21.63 ? 548  VAL B CG2 1 
ATOM   6962 N  N   . LEU B 1 442 ? 52.850 -14.504 5.349   1.00 23.63 ? 549  LEU B N   1 
ATOM   6963 C  CA  . LEU B 1 442 ? 52.796 -13.062 5.165   1.00 21.53 ? 549  LEU B CA  1 
ATOM   6964 C  C   . LEU B 1 442 ? 53.804 -12.657 4.109   1.00 25.21 ? 549  LEU B C   1 
ATOM   6965 O  O   . LEU B 1 442 ? 54.969 -13.049 4.175   1.00 25.68 ? 549  LEU B O   1 
ATOM   6966 C  CB  . LEU B 1 442 ? 53.093 -12.328 6.471   1.00 18.11 ? 549  LEU B CB  1 
ATOM   6967 C  CG  . LEU B 1 442 ? 52.952 -10.809 6.412   1.00 23.13 ? 549  LEU B CG  1 
ATOM   6968 C  CD1 . LEU B 1 442 ? 51.481 -10.430 6.506   1.00 22.06 ? 549  LEU B CD1 1 
ATOM   6969 C  CD2 . LEU B 1 442 ? 53.749 -10.149 7.523   1.00 20.14 ? 549  LEU B CD2 1 
ATOM   6970 N  N   . GLU B 1 443 ? 53.348 -11.886 3.132   1.00 23.25 ? 550  GLU B N   1 
ATOM   6971 C  CA  . GLU B 1 443 ? 54.220 -11.289 2.139   1.00 20.26 ? 550  GLU B CA  1 
ATOM   6972 C  C   . GLU B 1 443 ? 54.159 -9.771  2.238   1.00 27.61 ? 550  GLU B C   1 
ATOM   6973 O  O   . GLU B 1 443 ? 53.070 -9.197  2.269   1.00 23.72 ? 550  GLU B O   1 
ATOM   6974 C  CB  . GLU B 1 443 ? 53.816 -11.717 0.732   1.00 25.80 ? 550  GLU B CB  1 
ATOM   6975 C  CG  . GLU B 1 443 ? 53.615 -13.203 0.540   1.00 30.28 ? 550  GLU B CG  1 
ATOM   6976 C  CD  . GLU B 1 443 ? 52.984 -13.513 -0.808  1.00 37.55 ? 550  GLU B CD  1 
ATOM   6977 O  OE1 . GLU B 1 443 ? 52.663 -14.690 -1.066  1.00 39.13 ? 550  GLU B OE1 1 
ATOM   6978 O  OE2 . GLU B 1 443 ? 52.806 -12.570 -1.611  1.00 39.71 ? 550  GLU B OE2 1 
ATOM   6979 N  N   . ILE B 1 444 ? 55.326 -9.130  2.288   1.00 20.84 ? 551  ILE B N   1 
ATOM   6980 C  CA  . ILE B 1 444 ? 55.445 -7.681  2.205   1.00 16.33 ? 551  ILE B CA  1 
ATOM   6981 C  C   . ILE B 1 444 ? 56.367 -7.356  1.022   1.00 30.21 ? 551  ILE B C   1 
ATOM   6982 O  O   . ILE B 1 444 ? 57.477 -7.885  0.939   1.00 28.12 ? 551  ILE B O   1 
ATOM   6983 C  CB  . ILE B 1 444 ? 56.011 -7.090  3.510   1.00 18.39 ? 551  ILE B CB  1 
ATOM   6984 C  CG1 . ILE B 1 444 ? 55.127 -7.473  4.696   1.00 21.91 ? 551  ILE B CG1 1 
ATOM   6985 C  CG2 . ILE B 1 444 ? 56.196 -5.580  3.409   1.00 24.54 ? 551  ILE B CG2 1 
ATOM   6986 C  CD1 . ILE B 1 444 ? 55.611 -6.944  6.012   1.00 18.27 ? 551  ILE B CD1 1 
ATOM   6987 N  N   . GLU B 1 445 ? 55.919 -6.521  0.087   1.00 23.89 ? 552  GLU B N   1 
ATOM   6988 C  CA  . GLU B 1 445 ? 56.755 -6.233  -1.073  1.00 26.25 ? 552  GLU B CA  1 
ATOM   6989 C  C   . GLU B 1 445 ? 56.789 -4.760  -1.465  1.00 30.14 ? 552  GLU B C   1 
ATOM   6990 O  O   . GLU B 1 445 ? 55.830 -4.013  -1.241  1.00 21.60 ? 552  GLU B O   1 
ATOM   6991 C  CB  . GLU B 1 445 ? 56.311 -7.079  -2.272  1.00 31.91 ? 552  GLU B CB  1 
ATOM   6992 C  CG  . GLU B 1 445 ? 55.005 -6.680  -2.904  1.00 35.75 ? 552  GLU B CG  1 
ATOM   6993 C  CD  . GLU B 1 445 ? 54.421 -7.791  -3.759  0.00 33.15 ? 552  GLU B CD  1 
ATOM   6994 O  OE1 . GLU B 1 445 ? 54.869 -8.949  -3.616  0.00 37.81 ? 552  GLU B OE1 1 
ATOM   6995 O  OE2 . GLU B 1 445 ? 53.518 -7.510  -4.574  0.00 33.47 ? 552  GLU B OE2 1 
ATOM   6996 N  N   . ASN B 1 446 ? 57.928 -4.354  -2.025  1.00 22.89 ? 553  ASN B N   1 
ATOM   6997 C  CA  . ASN B 1 446 ? 58.094 -3.030  -2.595  1.00 24.48 ? 553  ASN B CA  1 
ATOM   6998 C  C   . ASN B 1 446 ? 57.582 -3.040  -4.018  1.00 26.62 ? 553  ASN B C   1 
ATOM   6999 O  O   . ASN B 1 446 ? 58.126 -3.737  -4.866  1.00 23.88 ? 553  ASN B O   1 
ATOM   7000 C  CB  . ASN B 1 446 ? 59.563 -2.603  -2.555  1.00 25.00 ? 553  ASN B CB  1 
ATOM   7001 C  CG  . ASN B 1 446 ? 59.793 -1.238  -3.166  1.00 26.60 ? 553  ASN B CG  1 
ATOM   7002 O  OD1 . ASN B 1 446 ? 58.856 -0.475  -3.393  1.00 22.98 ? 553  ASN B OD1 1 
ATOM   7003 N  ND2 . ASN B 1 446 ? 61.054 -0.921  -3.433  1.00 26.47 ? 553  ASN B ND2 1 
ATOM   7004 N  N   . THR B 1 447 ? 56.529 -2.276  -4.285  1.00 23.97 ? 554  THR B N   1 
ATOM   7005 C  CA  . THR B 1 447 ? 55.899 -2.311  -5.603  1.00 26.14 ? 554  THR B CA  1 
ATOM   7006 C  C   . THR B 1 447 ? 56.546 -1.316  -6.560  1.00 27.20 ? 554  THR B C   1 
ATOM   7007 O  O   . THR B 1 447 ? 56.171 -1.231  -7.722  1.00 30.54 ? 554  THR B O   1 
ATOM   7008 C  CB  . THR B 1 447 ? 54.397 -2.009  -5.511  1.00 28.07 ? 554  THR B CB  1 
ATOM   7009 O  OG1 . THR B 1 447 ? 54.216 -0.718  -4.917  1.00 26.50 ? 554  THR B OG1 1 
ATOM   7010 C  CG2 . THR B 1 447 ? 53.699 -3.068  -4.659  1.00 23.69 ? 554  THR B CG2 1 
ATOM   7011 N  N   . SER B 1 448 ? 57.525 -0.580  -6.061  1.00 23.57 ? 555  SER B N   1 
ATOM   7012 C  CA  . SER B 1 448 ? 58.169 0.476   -6.826  1.00 27.03 ? 555  SER B CA  1 
ATOM   7013 C  C   . SER B 1 448 ? 59.586 0.066   -7.225  1.00 31.66 ? 555  SER B C   1 
ATOM   7014 O  O   . SER B 1 448 ? 60.116 -0.920  -6.707  1.00 27.82 ? 555  SER B O   1 
ATOM   7015 C  CB  . SER B 1 448 ? 58.195 1.768   -6.009  1.00 25.37 ? 555  SER B CB  1 
ATOM   7016 O  OG  . SER B 1 448 ? 59.069 2.724   -6.564  1.00 25.66 ? 555  SER B OG  1 
ATOM   7017 N  N   . GLU B 1 449 ? 60.180 0.813   -8.156  1.00 30.34 ? 556  GLU B N   1 
ATOM   7018 C  CA  . GLU B 1 449 ? 61.550 0.556   -8.587  1.00 36.86 ? 556  GLU B CA  1 
ATOM   7019 C  C   . GLU B 1 449 ? 62.521 1.315   -7.689  1.00 29.41 ? 556  GLU B C   1 
ATOM   7020 O  O   . GLU B 1 449 ? 63.718 1.047   -7.695  1.00 31.83 ? 556  GLU B O   1 
ATOM   7021 C  CB  . GLU B 1 449 ? 61.750 0.944   -10.059 1.00 33.51 ? 556  GLU B CB  1 
ATOM   7022 C  CG  . GLU B 1 449 ? 60.960 0.071   -11.030 1.00 40.41 ? 556  GLU B CG  1 
ATOM   7023 C  CD  . GLU B 1 449 ? 61.224 0.407   -12.487 0.00 43.20 ? 556  GLU B CD  1 
ATOM   7024 O  OE1 . GLU B 1 449 ? 61.615 1.557   -12.777 0.00 43.73 ? 556  GLU B OE1 1 
ATOM   7025 O  OE2 . GLU B 1 449 ? 61.041 -0.483  -13.344 0.00 45.51 ? 556  GLU B OE2 1 
ATOM   7026 N  N   . ALA B 1 450 ? 61.992 2.249   -6.906  1.00 25.48 ? 557  ALA B N   1 
ATOM   7027 C  CA  . ALA B 1 450 ? 62.805 2.995   -5.952  1.00 30.22 ? 557  ALA B CA  1 
ATOM   7028 C  C   . ALA B 1 450 ? 63.459 2.042   -4.969  1.00 29.50 ? 557  ALA B C   1 
ATOM   7029 O  O   . ALA B 1 450 ? 62.925 0.967   -4.690  1.00 24.82 ? 557  ALA B O   1 
ATOM   7030 C  CB  . ALA B 1 450 ? 61.969 4.039   -5.216  1.00 26.67 ? 557  ALA B CB  1 
ATOM   7031 N  N   . ASN B 1 451 ? 64.627 2.437   -4.464  1.00 29.85 ? 558  ASN B N   1 
ATOM   7032 C  CA  . ASN B 1 451 ? 65.391 1.620   -3.524  1.00 31.72 ? 558  ASN B CA  1 
ATOM   7033 C  C   . ASN B 1 451 ? 64.869 1.829   -2.102  1.00 35.82 ? 558  ASN B C   1 
ATOM   7034 O  O   . ASN B 1 451 ? 65.570 2.348   -1.229  1.00 27.85 ? 558  ASN B O   1 
ATOM   7035 C  CB  . ASN B 1 451 ? 66.889 1.958   -3.622  1.00 36.82 ? 558  ASN B CB  1 
ATOM   7036 C  CG  . ASN B 1 451 ? 67.778 0.936   -2.930  1.00 39.16 ? 558  ASN B CG  1 
ATOM   7037 O  OD1 . ASN B 1 451 ? 67.467 -0.256  -2.872  1.00 35.90 ? 558  ASN B OD1 1 
ATOM   7038 N  ND2 . ASN B 1 451 ? 68.901 1.405   -2.404  1.00 44.01 ? 558  ASN B ND2 1 
ATOM   7039 N  N   . ASN B 1 452 ? 63.619 1.423   -1.888  1.00 31.46 ? 559  ASN B N   1 
ATOM   7040 C  CA  . ASN B 1 452 ? 62.959 1.571   -0.598  1.00 24.89 ? 559  ASN B CA  1 
ATOM   7041 C  C   . ASN B 1 452 ? 63.478 0.575   0.434   1.00 22.78 ? 559  ASN B C   1 
ATOM   7042 O  O   . ASN B 1 452 ? 64.037 -0.455  0.082   1.00 26.18 ? 559  ASN B O   1 
ATOM   7043 C  CB  . ASN B 1 452 ? 61.440 1.419   -0.771  1.00 23.07 ? 559  ASN B CB  1 
ATOM   7044 C  CG  . ASN B 1 452 ? 60.828 2.568   -1.554  1.00 25.82 ? 559  ASN B CG  1 
ATOM   7045 O  OD1 . ASN B 1 452 ? 61.297 3.699   -1.469  1.00 27.59 ? 559  ASN B OD1 1 
ATOM   7046 N  ND2 . ASN B 1 452 ? 59.774 2.283   -2.321  1.00 28.82 ? 559  ASN B ND2 1 
ATOM   7047 N  N   . TYR B 1 453 ? 63.278 0.881   1.711   1.00 26.20 ? 560  TYR B N   1 
ATOM   7048 C  CA  . TYR B 1 453 ? 63.855 0.077   2.779   1.00 24.82 ? 560  TYR B CA  1 
ATOM   7049 C  C   . TYR B 1 453 ? 63.116 0.209   4.104   1.00 21.34 ? 560  TYR B C   1 
ATOM   7050 O  O   . TYR B 1 453 ? 62.531 1.246   4.398   1.00 22.48 ? 560  TYR B O   1 
ATOM   7051 C  CB  . TYR B 1 453 ? 65.314 0.474   2.993   1.00 29.44 ? 560  TYR B CB  1 
ATOM   7052 C  CG  . TYR B 1 453 ? 65.473 1.908   3.442   1.00 26.08 ? 560  TYR B CG  1 
ATOM   7053 C  CD1 . TYR B 1 453 ? 65.476 2.948   2.519   1.00 27.16 ? 560  TYR B CD1 1 
ATOM   7054 C  CD2 . TYR B 1 453 ? 65.608 2.228   4.791   1.00 26.07 ? 560  TYR B CD2 1 
ATOM   7055 C  CE1 . TYR B 1 453 ? 65.614 4.263   2.928   1.00 24.02 ? 560  TYR B CE1 1 
ATOM   7056 C  CE2 . TYR B 1 453 ? 65.754 3.547   5.206   1.00 23.46 ? 560  TYR B CE2 1 
ATOM   7057 C  CZ  . TYR B 1 453 ? 65.750 4.555   4.270   1.00 22.15 ? 560  TYR B CZ  1 
ATOM   7058 O  OH  . TYR B 1 453 ? 65.892 5.860   4.668   1.00 27.29 ? 560  TYR B OH  1 
ATOM   7059 N  N   . GLY B 1 454 ? 63.189 -0.840  4.918   1.00 22.28 ? 561  GLY B N   1 
ATOM   7060 C  CA  . GLY B 1 454 ? 62.667 -0.792  6.262   1.00 22.51 ? 561  GLY B CA  1 
ATOM   7061 C  C   . GLY B 1 454 ? 62.652 -2.135  6.967   1.00 25.06 ? 561  GLY B C   1 
ATOM   7062 O  O   . GLY B 1 454 ? 63.278 -3.089  6.517   1.00 27.40 ? 561  GLY B O   1 
ATOM   7063 N  N   . THR B 1 455 ? 61.909 -2.198  8.068   1.00 21.01 ? 562  THR B N   1 
ATOM   7064 C  CA  . THR B 1 455 ? 61.923 -3.341  8.963   1.00 25.10 ? 562  THR B CA  1 
ATOM   7065 C  C   . THR B 1 455 ? 60.556 -3.683  9.543   1.00 23.66 ? 562  THR B C   1 
ATOM   7066 O  O   . THR B 1 455 ? 59.842 -2.806  10.024  1.00 23.78 ? 562  THR B O   1 
ATOM   7067 C  CB  . THR B 1 455 ? 62.862 -3.092  10.144  1.00 29.91 ? 562  THR B CB  1 
ATOM   7068 O  OG1 . THR B 1 455 ? 64.107 -2.571  9.668   1.00 25.77 ? 562  THR B OG1 1 
ATOM   7069 C  CG2 . THR B 1 455 ? 63.085 -4.365  10.944  1.00 22.82 ? 562  THR B CG2 1 
ATOM   7070 N  N   . LEU B 1 456 ? 60.217 -4.967  9.512   1.00 22.32 ? 563  LEU B N   1 
ATOM   7071 C  CA  . LEU B 1 456 ? 59.049 -5.483  10.223  1.00 21.65 ? 563  LEU B CA  1 
ATOM   7072 C  C   . LEU B 1 456 ? 59.464 -5.897  11.630  1.00 23.40 ? 563  LEU B C   1 
ATOM   7073 O  O   . LEU B 1 456 ? 60.319 -6.766  11.783  1.00 22.48 ? 563  LEU B O   1 
ATOM   7074 C  CB  . LEU B 1 456 ? 58.453 -6.659  9.467   1.00 17.56 ? 563  LEU B CB  1 
ATOM   7075 C  CG  . LEU B 1 456 ? 57.298 -7.436  10.101  1.00 18.95 ? 563  LEU B CG  1 
ATOM   7076 C  CD1 . LEU B 1 456 ? 56.021 -6.604  10.054  1.00 19.19 ? 563  LEU B CD1 1 
ATOM   7077 C  CD2 . LEU B 1 456 ? 57.123 -8.745  9.352   1.00 14.81 ? 563  LEU B CD2 1 
ATOM   7078 N  N   . THR B 1 457 ? 58.901 -5.267  12.661  1.00 19.09 ? 564  THR B N   1 
ATOM   7079 C  CA  . THR B 1 457 ? 59.343 -5.575  14.020  1.00 21.29 ? 564  THR B CA  1 
ATOM   7080 C  C   . THR B 1 457 ? 58.324 -6.358  14.844  1.00 24.47 ? 564  THR B C   1 
ATOM   7081 O  O   . THR B 1 457 ? 58.651 -6.858  15.919  1.00 24.67 ? 564  THR B O   1 
ATOM   7082 C  CB  . THR B 1 457 ? 59.723 -4.301  14.798  1.00 27.89 ? 564  THR B CB  1 
ATOM   7083 O  OG1 . THR B 1 457 ? 58.582 -3.447  14.933  1.00 26.97 ? 564  THR B OG1 1 
ATOM   7084 C  CG2 . THR B 1 457 ? 60.855 -3.549  14.092  1.00 24.14 ? 564  THR B CG2 1 
ATOM   7085 N  N   . LYS B 1 458 ? 57.092 -6.469  14.356  1.00 21.66 ? 565  LYS B N   1 
ATOM   7086 C  CA  . LYS B 1 458 ? 56.112 -7.322  15.036  1.00 20.33 ? 565  LYS B CA  1 
ATOM   7087 C  C   . LYS B 1 458 ? 55.014 -7.802  14.096  1.00 20.46 ? 565  LYS B C   1 
ATOM   7088 O  O   . LYS B 1 458 ? 54.522 -7.058  13.243  1.00 18.89 ? 565  LYS B O   1 
ATOM   7089 C  CB  . LYS B 1 458 ? 55.482 -6.603  16.231  1.00 24.70 ? 565  LYS B CB  1 
ATOM   7090 C  CG  . LYS B 1 458 ? 54.618 -7.523  17.105  1.00 23.83 ? 565  LYS B CG  1 
ATOM   7091 C  CD  . LYS B 1 458 ? 53.802 -6.751  18.115  1.00 28.40 ? 565  LYS B CD  1 
ATOM   7092 C  CE  . LYS B 1 458 ? 54.517 -6.646  19.442  1.00 35.81 ? 565  LYS B CE  1 
ATOM   7093 N  NZ  . LYS B 1 458 ? 54.429 -7.918  20.208  0.00 33.73 ? 565  LYS B NZ  1 
ATOM   7094 N  N   . PHE B 1 459 ? 54.644 -9.062  14.270  1.00 18.48 ? 566  PHE B N   1 
ATOM   7095 C  CA  . PHE B 1 459 ? 53.592 -9.689  13.496  1.00 23.90 ? 566  PHE B CA  1 
ATOM   7096 C  C   . PHE B 1 459 ? 52.848 -10.579 14.480  1.00 22.37 ? 566  PHE B C   1 
ATOM   7097 O  O   . PHE B 1 459 ? 53.369 -11.583 14.956  1.00 23.45 ? 566  PHE B O   1 
ATOM   7098 C  CB  . PHE B 1 459 ? 54.180 -10.456 12.303  1.00 23.16 ? 566  PHE B CB  1 
ATOM   7099 C  CG  . PHE B 1 459 ? 53.200 -11.343 11.556  1.00 23.09 ? 566  PHE B CG  1 
ATOM   7100 C  CD1 . PHE B 1 459 ? 51.829 -11.193 11.675  1.00 24.28 ? 566  PHE B CD1 1 
ATOM   7101 C  CD2 . PHE B 1 459 ? 53.685 -12.345 10.724  1.00 21.05 ? 566  PHE B CD2 1 
ATOM   7102 C  CE1 . PHE B 1 459 ? 50.951 -12.018 10.973  1.00 19.86 ? 566  PHE B CE1 1 
ATOM   7103 C  CE2 . PHE B 1 459 ? 52.827 -13.174 10.020  1.00 22.59 ? 566  PHE B CE2 1 
ATOM   7104 C  CZ  . PHE B 1 459 ? 51.454 -13.016 10.142  1.00 24.10 ? 566  PHE B CZ  1 
ATOM   7105 N  N   . THR B 1 460 ? 51.635 -10.162 14.817  1.00 23.08 ? 567  THR B N   1 
ATOM   7106 C  CA  . THR B 1 460 ? 50.749 -10.951 15.650  1.00 18.84 ? 567  THR B CA  1 
ATOM   7107 C  C   . THR B 1 460 ? 49.601 -11.456 14.810  1.00 21.06 ? 567  THR B C   1 
ATOM   7108 O  O   . THR B 1 460 ? 48.894 -10.670 14.198  1.00 21.97 ? 567  THR B O   1 
ATOM   7109 C  CB  . THR B 1 460 ? 50.188 -10.134 16.816  1.00 23.39 ? 567  THR B CB  1 
ATOM   7110 O  OG1 . THR B 1 460 ? 51.260 -9.564  17.560  1.00 23.37 ? 567  THR B OG1 1 
ATOM   7111 C  CG2 . THR B 1 460 ? 49.335 -11.001 17.729  1.00 20.90 ? 567  THR B CG2 1 
ATOM   7112 N  N   . LEU B 1 461 ? 49.413 -12.765 14.767  1.00 21.31 ? 568  LEU B N   1 
ATOM   7113 C  CA  . LEU B 1 461 ? 48.275 -13.319 14.054  1.00 19.52 ? 568  LEU B CA  1 
ATOM   7114 C  C   . LEU B 1 461 ? 47.135 -13.528 15.041  1.00 20.81 ? 568  LEU B C   1 
ATOM   7115 O  O   . LEU B 1 461 ? 47.290 -14.232 16.034  1.00 21.45 ? 568  LEU B O   1 
ATOM   7116 C  CB  . LEU B 1 461 ? 48.663 -14.623 13.367  1.00 21.31 ? 568  LEU B CB  1 
ATOM   7117 C  CG  . LEU B 1 461 ? 47.658 -15.332 12.458  1.00 23.69 ? 568  LEU B CG  1 
ATOM   7118 C  CD1 . LEU B 1 461 ? 47.289 -14.492 11.247  1.00 18.51 ? 568  LEU B CD1 1 
ATOM   7119 C  CD2 . LEU B 1 461 ? 48.204 -16.681 12.020  1.00 19.77 ? 568  LEU B CD2 1 
ATOM   7120 N  N   . VAL B 1 462 ? 45.998 -12.886 14.791  1.00 17.10 ? 569  VAL B N   1 
ATOM   7121 C  CA  . VAL B 1 462 ? 44.828 -13.080 15.638  1.00 17.57 ? 569  VAL B CA  1 
ATOM   7122 C  C   . VAL B 1 462 ? 43.731 -13.833 14.878  1.00 19.88 ? 569  VAL B C   1 
ATOM   7123 O  O   . VAL B 1 462 ? 43.261 -13.377 13.845  1.00 19.11 ? 569  VAL B O   1 
ATOM   7124 C  CB  . VAL B 1 462 ? 44.264 -11.740 16.148  1.00 17.52 ? 569  VAL B CB  1 
ATOM   7125 C  CG1 . VAL B 1 462 ? 43.143 -11.987 17.138  1.00 17.88 ? 569  VAL B CG1 1 
ATOM   7126 C  CG2 . VAL B 1 462 ? 45.373 -10.890 16.775  1.00 19.32 ? 569  VAL B CG2 1 
ATOM   7127 N  N   . LEU B 1 463 ? 43.341 -14.993 15.395  1.00 16.89 ? 570  LEU B N   1 
ATOM   7128 C  CA  . LEU B 1 463 ? 42.282 -15.796 14.790  1.00 15.66 ? 570  LEU B CA  1 
ATOM   7129 C  C   . LEU B 1 463 ? 40.997 -15.732 15.622  1.00 16.33 ? 570  LEU B C   1 
ATOM   7130 O  O   . LEU B 1 463 ? 41.036 -15.815 16.852  1.00 12.87 ? 570  LEU B O   1 
ATOM   7131 C  CB  . LEU B 1 463 ? 42.728 -17.256 14.647  1.00 20.20 ? 570  LEU B CB  1 
ATOM   7132 C  CG  . LEU B 1 463 ? 44.082 -17.529 13.982  1.00 21.76 ? 570  LEU B CG  1 
ATOM   7133 C  CD1 . LEU B 1 463 ? 44.422 -19.019 14.006  1.00 22.19 ? 570  LEU B CD1 1 
ATOM   7134 C  CD2 . LEU B 1 463 ? 44.094 -16.996 12.550  1.00 20.37 ? 570  LEU B CD2 1 
ATOM   7135 N  N   . TYR B 1 464 ? 39.866 -15.570 14.942  1.00 18.03 ? 571  TYR B N   1 
ATOM   7136 C  CA  . TYR B 1 464 ? 38.557 -15.637 15.582  1.00 15.41 ? 571  TYR B CA  1 
ATOM   7137 C  C   . TYR B 1 464 ? 37.754 -16.738 14.948  1.00 14.87 ? 571  TYR B C   1 
ATOM   7138 O  O   . TYR B 1 464 ? 37.858 -16.974 13.736  1.00 16.39 ? 571  TYR B O   1 
ATOM   7139 C  CB  . TYR B 1 464 ? 37.768 -14.329 15.444  1.00 12.81 ? 571  TYR B CB  1 
ATOM   7140 C  CG  . TYR B 1 464 ? 38.433 -13.113 16.008  1.00 14.45 ? 571  TYR B CG  1 
ATOM   7141 C  CD1 . TYR B 1 464 ? 39.321 -12.371 15.243  1.00 15.16 ? 571  TYR B CD1 1 
ATOM   7142 C  CD2 . TYR B 1 464 ? 38.157 -12.684 17.305  1.00 14.57 ? 571  TYR B CD2 1 
ATOM   7143 C  CE1 . TYR B 1 464 ? 39.929 -11.238 15.761  1.00 16.30 ? 571  TYR B CE1 1 
ATOM   7144 C  CE2 . TYR B 1 464 ? 38.754 -11.559 17.821  1.00 20.04 ? 571  TYR B CE2 1 
ATOM   7145 C  CZ  . TYR B 1 464 ? 39.638 -10.839 17.045  1.00 16.20 ? 571  TYR B CZ  1 
ATOM   7146 O  OH  . TYR B 1 464 ? 40.240 -9.722  17.565  1.00 20.46 ? 571  TYR B OH  1 
ATOM   7147 N  N   . GLY B 1 465 ? 36.932 -17.397 15.757  1.00 14.03 ? 572  GLY B N   1 
ATOM   7148 C  CA  . GLY B 1 465 ? 36.057 -18.422 15.240  1.00 13.77 ? 572  GLY B CA  1 
ATOM   7149 C  C   . GLY B 1 465 ? 35.570 -19.373 16.311  1.00 14.58 ? 572  GLY B C   1 
ATOM   7150 O  O   . GLY B 1 465 ? 35.500 -19.018 17.489  1.00 17.17 ? 572  GLY B O   1 
ATOM   7151 N  N   . THR B 1 466 ? 35.219 -20.582 15.888  1.00 14.93 ? 573  THR B N   1 
ATOM   7152 C  CA  . THR B 1 466 ? 34.668 -21.578 16.793  1.00 16.86 ? 573  THR B CA  1 
ATOM   7153 C  C   . THR B 1 466 ? 35.317 -22.935 16.539  1.00 15.31 ? 573  THR B C   1 
ATOM   7154 O  O   . THR B 1 466 ? 36.120 -23.081 15.623  1.00 18.57 ? 573  THR B O   1 
ATOM   7155 C  CB  . THR B 1 466 ? 33.147 -21.707 16.623  1.00 17.94 ? 573  THR B CB  1 
ATOM   7156 O  OG1 . THR B 1 466 ? 32.864 -22.200 15.310  1.00 19.22 ? 573  THR B OG1 1 
ATOM   7157 C  CG2 . THR B 1 466 ? 32.456 -20.351 16.821  1.00 15.48 ? 573  THR B CG2 1 
ATOM   7158 N  N   . ALA B 1 467 ? 34.958 -23.925 17.343  1.00 18.49 ? 574  ALA B N   1 
ATOM   7159 C  CA  . ALA B 1 467 ? 35.392 -25.298 17.106  1.00 20.81 ? 574  ALA B CA  1 
ATOM   7160 C  C   . ALA B 1 467 ? 34.218 -26.127 16.596  1.00 21.86 ? 574  ALA B C   1 
ATOM   7161 O  O   . ALA B 1 467 ? 33.186 -26.193 17.243  1.00 26.12 ? 574  ALA B O   1 
ATOM   7162 C  CB  . ALA B 1 467 ? 35.963 -25.905 18.379  1.00 22.71 ? 574  ALA B CB  1 
ATOM   7163 N  N   . SER B 1 468 ? 34.366 -26.759 15.438  1.00 27.70 ? 575  SER B N   1 
ATOM   7164 C  CA  . SER B 1 468 ? 33.262 -27.539 14.890  1.00 20.90 ? 575  SER B CA  1 
ATOM   7165 C  C   . SER B 1 468 ? 33.730 -28.671 13.993  1.00 26.11 ? 575  SER B C   1 
ATOM   7166 O  O   . SER B 1 468 ? 34.894 -29.080 14.032  1.00 22.28 ? 575  SER B O   1 
ATOM   7167 C  CB  . SER B 1 468 ? 32.306 -26.633 14.125  1.00 30.93 ? 575  SER B CB  1 
ATOM   7168 O  OG  . SER B 1 468 ? 31.052 -27.269 13.926  1.00 38.01 ? 575  SER B OG  1 
ATOM   7169 N  N   . GLY B 1 469 ? 32.809 -29.177 13.179  1.00 29.55 ? 576  GLY B N   1 
ATOM   7170 C  CA  . GLY B 1 469 ? 33.090 -30.326 12.334  1.00 29.84 ? 576  GLY B CA  1 
ATOM   7171 C  C   . GLY B 1 469 ? 33.888 -30.032 11.078  1.00 31.59 ? 576  GLY B C   1 
ATOM   7172 O  O   . GLY B 1 469 ? 34.282 -28.891 10.824  1.00 32.31 ? 576  GLY B O   1 
ATOM   7173 N  N   . SER B 1 470 ? 34.120 -31.080 10.291  1.00 30.53 ? 577  SER B N   1 
ATOM   7174 C  CA  . SER B 1 470 ? 34.830 -30.972 9.019   1.00 30.90 ? 577  SER B CA  1 
ATOM   7175 C  C   . SER B 1 470 ? 33.923 -30.540 7.875   1.00 35.09 ? 577  SER B C   1 
ATOM   7176 O  O   . SER B 1 470 ? 32.762 -30.931 7.809   1.00 33.71 ? 577  SER B O   1 
ATOM   7177 C  CB  . SER B 1 470 ? 35.475 -32.310 8.653   1.00 23.81 ? 577  SER B CB  1 
ATOM   7178 O  OG  . SER B 1 470 ? 36.453 -32.670 9.598   1.00 31.65 ? 577  SER B OG  1 
ATOM   7179 N  N   . LEU B 1 471 ? 34.472 -29.750 6.961   1.00 37.43 ? 578  LEU B N   1 
ATOM   7180 C  CA  . LEU B 1 471 ? 33.802 -29.462 5.701   1.00 41.58 ? 578  LEU B CA  1 
ATOM   7181 C  C   . LEU B 1 471 ? 34.428 -30.278 4.560   1.00 39.94 ? 578  LEU B C   1 
ATOM   7182 O  O   . LEU B 1 471 ? 33.774 -30.593 3.562   1.00 39.57 ? 578  LEU B O   1 
ATOM   7183 C  CB  . LEU B 1 471 ? 33.869 -27.965 5.397   1.00 44.03 ? 578  LEU B CB  1 
ATOM   7184 C  CG  . LEU B 1 471 ? 33.205 -27.079 6.452   1.00 37.55 ? 578  LEU B CG  1 
ATOM   7185 C  CD1 . LEU B 1 471 ? 33.125 -25.635 5.965   1.00 32.61 ? 578  LEU B CD1 1 
ATOM   7186 C  CD2 . LEU B 1 471 ? 31.828 -27.622 6.778   1.00 33.80 ? 578  LEU B CD2 1 
ATOM   7187 N  N   . GLN C 2 1   ? 73.998 34.306  36.305  1.00 48.32 ? 1    GLN C N   1 
ATOM   7188 C  CA  . GLN C 2 1   ? 72.609 33.869  36.222  1.00 54.15 ? 1    GLN C CA  1 
ATOM   7189 C  C   . GLN C 2 1   ? 72.347 32.666  37.132  1.00 54.03 ? 1    GLN C C   1 
ATOM   7190 O  O   . GLN C 2 1   ? 73.279 32.014  37.605  1.00 54.53 ? 1    GLN C O   1 
ATOM   7191 C  CB  . GLN C 2 1   ? 72.243 33.535  34.772  1.00 48.96 ? 1    GLN C CB  1 
ATOM   7192 C  CG  . GLN C 2 1   ? 73.175 32.536  34.105  0.00 54.79 ? 1    GLN C CG  1 
ATOM   7193 C  CD  . GLN C 2 1   ? 72.914 32.396  32.616  0.00 57.70 ? 1    GLN C CD  1 
ATOM   7194 O  OE1 . GLN C 2 1   ? 72.215 33.214  32.017  0.00 58.60 ? 1    GLN C OE1 1 
ATOM   7195 N  NE2 . GLN C 2 1   ? 73.475 31.355  32.013  0.00 58.79 ? 1    GLN C NE2 1 
ATOM   7196 N  N   . VAL C 2 2   ? 71.074 32.382  37.381  1.00 54.36 ? 2    VAL C N   1 
ATOM   7197 C  CA  . VAL C 2 2   ? 70.685 31.240  38.204  1.00 48.52 ? 2    VAL C CA  1 
ATOM   7198 C  C   . VAL C 2 2   ? 70.911 29.926  37.469  1.00 48.25 ? 2    VAL C C   1 
ATOM   7199 O  O   . VAL C 2 2   ? 70.343 29.704  36.400  1.00 41.66 ? 2    VAL C O   1 
ATOM   7200 C  CB  . VAL C 2 2   ? 69.212 31.334  38.618  1.00 39.80 ? 2    VAL C CB  1 
ATOM   7201 C  CG1 . VAL C 2 2   ? 68.784 30.068  39.333  1.00 40.70 ? 2    VAL C CG1 1 
ATOM   7202 C  CG2 . VAL C 2 2   ? 68.994 32.561  39.493  1.00 40.53 ? 2    VAL C CG2 1 
ATOM   7203 N  N   . GLN C 2 3   ? 71.735 29.048  38.034  1.00 51.82 ? 3    GLN C N   1 
ATOM   7204 C  CA  . GLN C 2 3   ? 72.004 27.783  37.362  1.00 42.85 ? 3    GLN C CA  1 
ATOM   7205 C  C   . GLN C 2 3   ? 72.065 26.573  38.302  1.00 47.38 ? 3    GLN C C   1 
ATOM   7206 O  O   . GLN C 2 3   ? 72.734 26.594  39.337  1.00 44.87 ? 3    GLN C O   1 
ATOM   7207 C  CB  . GLN C 2 3   ? 73.306 27.884  36.563  1.00 49.00 ? 3    GLN C CB  1 
ATOM   7208 C  CG  . GLN C 2 3   ? 73.345 26.969  35.348  0.00 49.80 ? 3    GLN C CG  1 
ATOM   7209 C  CD  . GLN C 2 3   ? 74.673 27.018  34.619  0.00 51.64 ? 3    GLN C CD  1 
ATOM   7210 O  OE1 . GLN C 2 3   ? 74.738 26.807  33.408  0.00 52.76 ? 3    GLN C OE1 1 
ATOM   7211 N  NE2 . GLN C 2 3   ? 75.742 27.290  35.357  0.00 52.08 ? 3    GLN C NE2 1 
ATOM   7212 N  N   . LEU C 2 4   ? 71.348 25.520  37.925  1.00 44.40 ? 4    LEU C N   1 
ATOM   7213 C  CA  . LEU C 2 4   ? 71.446 24.227  38.594  1.00 49.48 ? 4    LEU C CA  1 
ATOM   7214 C  C   . LEU C 2 4   ? 71.921 23.197  37.579  1.00 46.42 ? 4    LEU C C   1 
ATOM   7215 O  O   . LEU C 2 4   ? 71.265 22.980  36.560  1.00 47.98 ? 4    LEU C O   1 
ATOM   7216 C  CB  . LEU C 2 4   ? 70.102 23.801  39.192  1.00 39.20 ? 4    LEU C CB  1 
ATOM   7217 C  CG  . LEU C 2 4   ? 69.523 24.630  40.336  1.00 36.47 ? 4    LEU C CG  1 
ATOM   7218 C  CD1 . LEU C 2 4   ? 68.058 24.272  40.545  1.00 37.28 ? 4    LEU C CD1 1 
ATOM   7219 C  CD2 . LEU C 2 4   ? 70.317 24.406  41.609  1.00 43.53 ? 4    LEU C CD2 1 
ATOM   7220 N  N   . GLN C 2 5   ? 73.058 22.566  37.853  1.00 47.98 ? 5    GLN C N   1 
ATOM   7221 C  CA  . GLN C 2 5   ? 73.638 21.615  36.910  1.00 47.53 ? 5    GLN C CA  1 
ATOM   7222 C  C   . GLN C 2 5   ? 73.818 20.236  37.539  1.00 50.89 ? 5    GLN C C   1 
ATOM   7223 O  O   . GLN C 2 5   ? 74.518 20.081  38.544  1.00 45.28 ? 5    GLN C O   1 
ATOM   7224 C  CB  . GLN C 2 5   ? 74.980 22.140  36.388  1.00 46.76 ? 5    GLN C CB  1 
ATOM   7225 C  CG  . GLN C 2 5   ? 74.940 23.591  35.926  0.00 49.74 ? 5    GLN C CG  1 
ATOM   7226 C  CD  . GLN C 2 5   ? 76.312 24.131  35.568  0.00 51.19 ? 5    GLN C CD  1 
ATOM   7227 O  OE1 . GLN C 2 5   ? 76.732 25.175  36.068  0.00 51.60 ? 5    GLN C OE1 1 
ATOM   7228 N  NE2 . GLN C 2 5   ? 77.018 23.422  34.694  0.00 51.63 ? 5    GLN C NE2 1 
ATOM   7229 N  N   . GLU C 2 6   ? 73.185 19.240  36.931  1.00 47.44 ? 6    GLU C N   1 
ATOM   7230 C  CA  . GLU C 2 6   ? 73.229 17.874  37.432  1.00 51.67 ? 6    GLU C CA  1 
ATOM   7231 C  C   . GLU C 2 6   ? 74.341 17.065  36.779  1.00 53.49 ? 6    GLU C C   1 
ATOM   7232 O  O   . GLU C 2 6   ? 74.629 17.239  35.597  1.00 48.32 ? 6    GLU C O   1 
ATOM   7233 C  CB  . GLU C 2 6   ? 71.888 17.176  37.199  1.00 50.30 ? 6    GLU C CB  1 
ATOM   7234 C  CG  . GLU C 2 6   ? 70.718 17.781  37.959  1.00 48.48 ? 6    GLU C CG  1 
ATOM   7235 C  CD  . GLU C 2 6   ? 69.987 18.863  37.176  1.00 52.09 ? 6    GLU C CD  1 
ATOM   7236 O  OE1 . GLU C 2 6   ? 70.650 19.646  36.457  1.00 50.72 ? 6    GLU C OE1 1 
ATOM   7237 O  OE2 . GLU C 2 6   ? 68.742 18.926  37.284  1.00 42.58 ? 6    GLU C OE2 1 
ATOM   7238 N  N   . SER C 2 7   ? 74.947 16.170  37.555  1.00 49.17 ? 7    SER C N   1 
ATOM   7239 C  CA  . SER C 2 7   ? 75.995 15.292  37.047  1.00 47.26 ? 7    SER C CA  1 
ATOM   7240 C  C   . SER C 2 7   ? 76.011 13.960  37.788  1.00 47.24 ? 7    SER C C   1 
ATOM   7241 O  O   . SER C 2 7   ? 75.239 13.743  38.725  1.00 43.46 ? 7    SER C O   1 
ATOM   7242 C  CB  . SER C 2 7   ? 77.360 15.966  37.159  1.00 45.66 ? 7    SER C CB  1 
ATOM   7243 O  OG  . SER C 2 7   ? 77.615 16.368  38.494  1.00 49.79 ? 7    SER C OG  1 
ATOM   7244 N  N   . GLY C 2 8   ? 76.891 13.065  37.356  1.00 48.39 ? 8    GLY C N   1 
ATOM   7245 C  CA  . GLY C 2 8   ? 77.047 11.782  38.015  1.00 51.05 ? 8    GLY C CA  1 
ATOM   7246 C  C   . GLY C 2 8   ? 76.183 10.674  37.446  1.00 44.57 ? 8    GLY C C   1 
ATOM   7247 O  O   . GLY C 2 8   ? 76.222 9.537   37.923  1.00 51.48 ? 8    GLY C O   1 
ATOM   7248 N  N   . GLY C 2 9   ? 75.397 10.998  36.427  1.00 42.92 ? 9    GLY C N   1 
ATOM   7249 C  CA  . GLY C 2 9   ? 74.546 10.005  35.798  1.00 40.50 ? 9    GLY C CA  1 
ATOM   7250 C  C   . GLY C 2 9   ? 75.324 9.115   34.848  1.00 48.66 ? 9    GLY C C   1 
ATOM   7251 O  O   . GLY C 2 9   ? 76.437 9.441   34.440  1.00 52.29 ? 9    GLY C O   1 
ATOM   7252 N  N   . GLY C 2 10  ? 74.736 7.983   34.488  1.00 46.77 ? 10   GLY C N   1 
ATOM   7253 C  CA  . GLY C 2 10  ? 75.389 7.050   33.593  1.00 46.87 ? 10   GLY C CA  1 
ATOM   7254 C  C   . GLY C 2 10  ? 74.745 5.680   33.625  1.00 51.56 ? 10   GLY C C   1 
ATOM   7255 O  O   . GLY C 2 10  ? 73.707 5.488   34.262  1.00 43.82 ? 10   GLY C O   1 
ATOM   7256 N  N   . LEU C 2 11  ? 75.364 4.735   32.918  1.00 51.42 ? 11   LEU C N   1 
ATOM   7257 C  CA  . LEU C 2 11  ? 74.949 3.337   32.918  1.00 47.27 ? 11   LEU C CA  1 
ATOM   7258 C  C   . LEU C 2 11  ? 75.425 2.646   34.184  1.00 50.12 ? 11   LEU C C   1 
ATOM   7259 O  O   . LEU C 2 11  ? 76.550 2.872   34.633  1.00 49.31 ? 11   LEU C O   1 
ATOM   7260 C  CB  . LEU C 2 11  ? 75.514 2.606   31.697  0.00 49.24 ? 11   LEU C CB  1 
ATOM   7261 C  CG  . LEU C 2 11  ? 74.815 2.734   30.345  0.00 49.10 ? 11   LEU C CG  1 
ATOM   7262 C  CD1 . LEU C 2 11  ? 75.767 2.343   29.227  0.00 48.80 ? 11   LEU C CD1 1 
ATOM   7263 C  CD2 . LEU C 2 11  ? 73.581 1.853   30.317  0.00 49.18 ? 11   LEU C CD2 1 
ATOM   7264 N  N   . VAL C 2 12  ? 74.570 1.803   34.756  1.00 51.42 ? 12   VAL C N   1 
ATOM   7265 C  CA  . VAL C 2 12  ? 74.954 0.976   35.896  1.00 49.57 ? 12   VAL C CA  1 
ATOM   7266 C  C   . VAL C 2 12  ? 74.222 -0.354  35.873  1.00 46.46 ? 12   VAL C C   1 
ATOM   7267 O  O   . VAL C 2 12  ? 73.068 -0.433  35.441  1.00 48.12 ? 12   VAL C O   1 
ATOM   7268 C  CB  . VAL C 2 12  ? 74.670 1.666   37.247  1.00 51.42 ? 12   VAL C CB  1 
ATOM   7269 C  CG1 . VAL C 2 12  ? 75.829 2.564   37.653  1.00 45.13 ? 12   VAL C CG1 1 
ATOM   7270 C  CG2 . VAL C 2 12  ? 73.357 2.430   37.191  1.00 51.59 ? 12   VAL C CG2 1 
ATOM   7271 N  N   . GLN C 2 13  ? 74.907 -1.396  36.334  1.00 45.73 ? 13   GLN C N   1 
ATOM   7272 C  CA  . GLN C 2 13  ? 74.311 -2.717  36.470  1.00 51.27 ? 13   GLN C CA  1 
ATOM   7273 C  C   . GLN C 2 13  ? 73.233 -2.657  37.543  1.00 52.31 ? 13   GLN C C   1 
ATOM   7274 O  O   . GLN C 2 13  ? 73.401 -1.962  38.550  1.00 52.23 ? 13   GLN C O   1 
ATOM   7275 C  CB  . GLN C 2 13  ? 75.369 -3.764  36.839  1.00 47.90 ? 13   GLN C CB  1 
ATOM   7276 C  CG  . GLN C 2 13  ? 76.654 -3.700  36.030  0.00 54.54 ? 13   GLN C CG  1 
ATOM   7277 C  CD  . GLN C 2 13  ? 77.766 -4.530  36.648  0.00 59.56 ? 13   GLN C CD  1 
ATOM   7278 O  OE1 . GLN C 2 13  ? 77.887 -4.613  37.871  0.00 60.64 ? 13   GLN C OE1 1 
ATOM   7279 N  NE2 . GLN C 2 13  ? 78.579 -5.155  35.804  0.00 62.04 ? 13   GLN C NE2 1 
ATOM   7280 N  N   . PRO C 2 14  ? 72.118 -3.371  37.330  1.00 43.68 ? 14   PRO C N   1 
ATOM   7281 C  CA  . PRO C 2 14  ? 71.068 -3.458  38.348  1.00 40.36 ? 14   PRO C CA  1 
ATOM   7282 C  C   . PRO C 2 14  ? 71.618 -4.010  39.657  1.00 50.44 ? 14   PRO C C   1 
ATOM   7283 O  O   . PRO C 2 14  ? 72.419 -4.945  39.638  1.00 49.16 ? 14   PRO C O   1 
ATOM   7284 C  CB  . PRO C 2 14  ? 70.041 -4.413  37.726  1.00 45.15 ? 14   PRO C CB  1 
ATOM   7285 C  CG  . PRO C 2 14  ? 70.775 -5.129  36.644  1.00 49.26 ? 14   PRO C CG  1 
ATOM   7286 C  CD  . PRO C 2 14  ? 71.790 -4.155  36.131  1.00 49.12 ? 14   PRO C CD  1 
ATOM   7287 N  N   . GLY C 2 15  ? 71.198 -3.431  40.776  1.00 42.56 ? 15   GLY C N   1 
ATOM   7288 C  CA  . GLY C 2 15  ? 71.764 -3.779  42.066  1.00 41.78 ? 15   GLY C CA  1 
ATOM   7289 C  C   . GLY C 2 15  ? 72.962 -2.892  42.348  1.00 41.93 ? 15   GLY C C   1 
ATOM   7290 O  O   . GLY C 2 15  ? 73.573 -2.957  43.411  1.00 40.47 ? 15   GLY C O   1 
ATOM   7291 N  N   . GLY C 2 16  ? 73.291 -2.047  41.379  1.00 40.57 ? 16   GLY C N   1 
ATOM   7292 C  CA  . GLY C 2 16  ? 74.429 -1.159  41.494  1.00 41.39 ? 16   GLY C CA  1 
ATOM   7293 C  C   . GLY C 2 16  ? 74.141 0.100   42.280  1.00 42.72 ? 16   GLY C C   1 
ATOM   7294 O  O   . GLY C 2 16  ? 73.047 0.286   42.814  1.00 43.49 ? 16   GLY C O   1 
ATOM   7295 N  N   . SER C 2 17  ? 75.140 0.971   42.343  1.00 44.86 ? 17   SER C N   1 
ATOM   7296 C  CA  . SER C 2 17  ? 75.036 2.218   43.079  1.00 42.22 ? 17   SER C CA  1 
ATOM   7297 C  C   . SER C 2 17  ? 75.545 3.396   42.261  1.00 48.31 ? 17   SER C C   1 
ATOM   7298 O  O   . SER C 2 17  ? 76.517 3.284   41.512  1.00 46.03 ? 17   SER C O   1 
ATOM   7299 C  CB  . SER C 2 17  ? 75.811 2.127   44.394  1.00 44.82 ? 17   SER C CB  1 
ATOM   7300 O  OG  . SER C 2 17  ? 75.343 1.039   45.163  1.00 48.36 ? 17   SER C OG  1 
ATOM   7301 N  N   . LEU C 2 18  ? 74.863 4.524   42.409  1.00 46.03 ? 18   LEU C N   1 
ATOM   7302 C  CA  . LEU C 2 18  ? 75.275 5.773   41.795  1.00 39.13 ? 18   LEU C CA  1 
ATOM   7303 C  C   . LEU C 2 18  ? 75.179 6.884   42.820  1.00 41.26 ? 18   LEU C C   1 
ATOM   7304 O  O   . LEU C 2 18  ? 74.330 6.843   43.710  1.00 43.36 ? 18   LEU C O   1 
ATOM   7305 C  CB  . LEU C 2 18  ? 74.404 6.109   40.581  1.00 38.11 ? 18   LEU C CB  1 
ATOM   7306 C  CG  . LEU C 2 18  ? 74.816 5.612   39.199  0.00 43.16 ? 18   LEU C CG  1 
ATOM   7307 C  CD1 . LEU C 2 18  ? 73.699 5.872   38.204  0.00 44.09 ? 18   LEU C CD1 1 
ATOM   7308 C  CD2 . LEU C 2 18  ? 76.100 6.291   38.750  0.00 43.77 ? 18   LEU C CD2 1 
ATOM   7309 N  N   . THR C 2 19  ? 76.047 7.879   42.694  1.00 33.86 ? 19   THR C N   1 
ATOM   7310 C  CA  . THR C 2 19  ? 75.903 9.101   43.465  1.00 38.53 ? 19   THR C CA  1 
ATOM   7311 C  C   . THR C 2 19  ? 75.739 10.292  42.522  1.00 45.63 ? 19   THR C C   1 
ATOM   7312 O  O   . THR C 2 19  ? 76.600 10.561  41.679  1.00 45.40 ? 19   THR C O   1 
ATOM   7313 C  CB  . THR C 2 19  ? 77.107 9.331   44.404  1.00 33.13 ? 19   THR C CB  1 
ATOM   7314 O  OG1 . THR C 2 19  ? 77.090 8.352   45.453  1.00 43.32 ? 19   THR C OG1 1 
ATOM   7315 C  CG2 . THR C 2 19  ? 77.037 10.713  45.021  1.00 38.16 ? 19   THR C CG2 1 
ATOM   7316 N  N   . LEU C 2 20  ? 74.625 11.001  42.669  1.00 42.30 ? 20   LEU C N   1 
ATOM   7317 C  CA  . LEU C 2 20  ? 74.328 12.139  41.819  1.00 36.96 ? 20   LEU C CA  1 
ATOM   7318 C  C   . LEU C 2 20  ? 74.733 13.427  42.499  1.00 34.70 ? 20   LEU C C   1 
ATOM   7319 O  O   . LEU C 2 20  ? 74.674 13.536  43.719  1.00 33.74 ? 20   LEU C O   1 
ATOM   7320 C  CB  . LEU C 2 20  ? 72.842 12.175  41.465  1.00 40.94 ? 20   LEU C CB  1 
ATOM   7321 C  CG  . LEU C 2 20  ? 72.303 10.926  40.772  1.00 36.53 ? 20   LEU C CG  1 
ATOM   7322 C  CD1 . LEU C 2 20  ? 70.857 11.138  40.365  1.00 35.05 ? 20   LEU C CD1 1 
ATOM   7323 C  CD2 . LEU C 2 20  ? 73.167 10.581  39.564  1.00 42.78 ? 20   LEU C CD2 1 
ATOM   7324 N  N   . SER C 2 21  ? 75.154 14.402  41.705  1.00 36.87 ? 21   SER C N   1 
ATOM   7325 C  CA  . SER C 2 21  ? 75.528 15.698  42.238  1.00 39.91 ? 21   SER C CA  1 
ATOM   7326 C  C   . SER C 2 21  ? 74.764 16.794  41.518  1.00 38.07 ? 21   SER C C   1 
ATOM   7327 O  O   . SER C 2 21  ? 74.368 16.634  40.364  1.00 42.68 ? 21   SER C O   1 
ATOM   7328 C  CB  . SER C 2 21  ? 77.037 15.931  42.107  1.00 38.70 ? 21   SER C CB  1 
ATOM   7329 O  OG  . SER C 2 21  ? 77.771 14.825  42.604  0.00 39.87 ? 21   SER C OG  1 
ATOM   7330 N  N   . CYS C 2 22  ? 74.555 17.901  42.216  1.00 43.29 ? 22   CYS C N   1 
ATOM   7331 C  CA  . CYS C 2 22  ? 73.911 19.068  41.641  1.00 42.15 ? 22   CYS C CA  1 
ATOM   7332 C  C   . CYS C 2 22  ? 74.587 20.324  42.168  1.00 45.00 ? 22   CYS C C   1 
ATOM   7333 O  O   . CYS C 2 22  ? 74.458 20.660  43.345  1.00 46.84 ? 22   CYS C O   1 
ATOM   7334 C  CB  . CYS C 2 22  ? 72.421 19.078  41.973  1.00 44.35 ? 22   CYS C CB  1 
ATOM   7335 S  SG  . CYS C 2 22  ? 71.493 20.412  41.206  1.00 68.65 ? 22   CYS C SG  1 
ATOM   7336 N  N   . ALA C 2 23  ? 75.320 21.014  41.304  1.00 43.65 ? 23   ALA C N   1 
ATOM   7337 C  CA  . ALA C 2 23  ? 75.990 22.240  41.713  1.00 44.92 ? 23   ALA C CA  1 
ATOM   7338 C  C   . ALA C 2 23  ? 75.098 23.435  41.430  1.00 44.12 ? 23   ALA C C   1 
ATOM   7339 O  O   . ALA C 2 23  ? 74.443 23.497  40.390  1.00 38.42 ? 23   ALA C O   1 
ATOM   7340 C  CB  . ALA C 2 23  ? 77.327 22.388  41.005  1.00 43.60 ? 23   ALA C CB  1 
ATOM   7341 N  N   . ALA C 2 24  ? 75.078 24.379  42.365  1.00 40.95 ? 24   ALA C N   1 
ATOM   7342 C  CA  . ALA C 2 24  ? 74.198 25.535  42.269  1.00 42.22 ? 24   ALA C CA  1 
ATOM   7343 C  C   . ALA C 2 24  ? 74.979 26.844  42.236  1.00 46.16 ? 24   ALA C C   1 
ATOM   7344 O  O   . ALA C 2 24  ? 75.941 27.026  42.983  1.00 49.72 ? 24   ALA C O   1 
ATOM   7345 C  CB  . ALA C 2 24  ? 73.217 25.540  43.432  1.00 38.96 ? 24   ALA C CB  1 
ATOM   7346 N  N   . SER C 2 25  ? 74.555 27.757  41.372  1.00 43.53 ? 25   SER C N   1 
ATOM   7347 C  CA  . SER C 2 25  ? 75.192 29.064  41.273  1.00 44.74 ? 25   SER C CA  1 
ATOM   7348 C  C   . SER C 2 25  ? 74.191 30.119  40.837  1.00 42.26 ? 25   SER C C   1 
ATOM   7349 O  O   . SER C 2 25  ? 73.196 29.810  40.184  1.00 46.98 ? 25   SER C O   1 
ATOM   7350 C  CB  . SER C 2 25  ? 76.353 29.020  40.287  1.00 46.20 ? 25   SER C CB  1 
ATOM   7351 O  OG  . SER C 2 25  ? 75.865 28.846  38.969  1.00 52.29 ? 25   SER C OG  1 
ATOM   7352 N  N   . GLY C 2 26  ? 74.459 31.368  41.197  1.00 48.11 ? 26   GLY C N   1 
ATOM   7353 C  CA  . GLY C 2 26  ? 73.606 32.472  40.797  1.00 48.56 ? 26   GLY C CA  1 
ATOM   7354 C  C   . GLY C 2 26  ? 72.600 32.871  41.859  1.00 45.85 ? 26   GLY C C   1 
ATOM   7355 O  O   . GLY C 2 26  ? 71.847 33.827  41.677  1.00 47.80 ? 26   GLY C O   1 
ATOM   7356 N  N   . PHE C 2 27  ? 72.587 32.138  42.968  1.00 42.13 ? 27   PHE C N   1 
ATOM   7357 C  CA  . PHE C 2 27  ? 71.684 32.436  44.075  1.00 44.26 ? 27   PHE C CA  1 
ATOM   7358 C  C   . PHE C 2 27  ? 72.220 31.843  45.371  1.00 40.78 ? 27   PHE C C   1 
ATOM   7359 O  O   . PHE C 2 27  ? 73.137 31.029  45.351  1.00 38.20 ? 27   PHE C O   1 
ATOM   7360 C  CB  . PHE C 2 27  ? 70.272 31.907  43.780  1.00 39.82 ? 27   PHE C CB  1 
ATOM   7361 C  CG  . PHE C 2 27  ? 70.160 30.399  43.785  1.00 43.21 ? 27   PHE C CG  1 
ATOM   7362 C  CD1 . PHE C 2 27  ? 70.533 29.657  42.678  1.00 39.95 ? 27   PHE C CD1 1 
ATOM   7363 C  CD2 . PHE C 2 27  ? 69.655 29.728  44.891  1.00 40.43 ? 27   PHE C CD2 1 
ATOM   7364 C  CE1 . PHE C 2 27  ? 70.422 28.276  42.677  1.00 40.59 ? 27   PHE C CE1 1 
ATOM   7365 C  CE2 . PHE C 2 27  ? 69.540 28.344  44.894  1.00 34.61 ? 27   PHE C CE2 1 
ATOM   7366 C  CZ  . PHE C 2 27  ? 69.923 27.619  43.789  1.00 34.55 ? 27   PHE C CZ  1 
ATOM   7367 N  N   . THR C 2 28  ? 71.657 32.259  46.498  1.00 36.18 ? 28   THR C N   1 
ATOM   7368 C  CA  . THR C 2 28  ? 72.060 31.692  47.774  1.00 39.11 ? 28   THR C CA  1 
ATOM   7369 C  C   . THR C 2 28  ? 71.493 30.284  47.899  1.00 38.21 ? 28   THR C C   1 
ATOM   7370 O  O   . THR C 2 28  ? 70.297 30.109  48.114  1.00 39.47 ? 28   THR C O   1 
ATOM   7371 C  CB  . THR C 2 28  ? 71.594 32.554  48.952  1.00 38.15 ? 28   THR C CB  1 
ATOM   7372 O  OG1 . THR C 2 28  ? 72.016 33.907  48.745  1.00 49.45 ? 28   THR C OG1 1 
ATOM   7373 C  CG2 . THR C 2 28  ? 72.191 32.046  50.252  1.00 40.42 ? 28   THR C CG2 1 
ATOM   7374 N  N   . PHE C 2 29  ? 72.359 29.289  47.745  1.00 36.10 ? 29   PHE C N   1 
ATOM   7375 C  CA  . PHE C 2 29  ? 71.957 27.886  47.738  1.00 38.61 ? 29   PHE C CA  1 
ATOM   7376 C  C   . PHE C 2 29  ? 71.266 27.516  49.045  1.00 37.97 ? 29   PHE C C   1 
ATOM   7377 O  O   . PHE C 2 29  ? 70.232 26.851  49.043  1.00 35.86 ? 29   PHE C O   1 
ATOM   7378 C  CB  . PHE C 2 29  ? 73.178 26.996  47.488  1.00 39.77 ? 29   PHE C CB  1 
ATOM   7379 C  CG  . PHE C 2 29  ? 72.889 25.527  47.530  1.00 39.29 ? 29   PHE C CG  1 
ATOM   7380 C  CD1 . PHE C 2 29  ? 72.024 24.951  46.619  1.00 36.66 ? 29   PHE C CD1 1 
ATOM   7381 C  CD2 . PHE C 2 29  ? 73.500 24.718  48.470  1.00 37.38 ? 29   PHE C CD2 1 
ATOM   7382 C  CE1 . PHE C 2 29  ? 71.766 23.599  46.649  1.00 37.28 ? 29   PHE C CE1 1 
ATOM   7383 C  CE2 . PHE C 2 29  ? 73.248 23.357  48.507  1.00 36.95 ? 29   PHE C CE2 1 
ATOM   7384 C  CZ  . PHE C 2 29  ? 72.380 22.796  47.597  1.00 42.47 ? 29   PHE C CZ  1 
ATOM   7385 N  N   . SER C 2 30  ? 71.813 28.001  50.153  1.00 33.31 ? 30   SER C N   1 
ATOM   7386 C  CA  . SER C 2 30  ? 71.252 27.740  51.474  1.00 37.76 ? 30   SER C CA  1 
ATOM   7387 C  C   . SER C 2 30  ? 69.923 28.450  51.733  1.00 30.68 ? 30   SER C C   1 
ATOM   7388 O  O   . SER C 2 30  ? 69.372 28.333  52.816  1.00 32.16 ? 30   SER C O   1 
ATOM   7389 C  CB  . SER C 2 30  ? 72.249 28.158  52.558  1.00 35.86 ? 30   SER C CB  1 
ATOM   7390 O  OG  . SER C 2 30  ? 72.296 29.570  52.667  1.00 37.72 ? 30   SER C OG  1 
ATOM   7391 N  N   . SER C 2 31  ? 69.414 29.198  50.760  1.00 37.01 ? 31   SER C N   1 
ATOM   7392 C  CA  . SER C 2 31  ? 68.138 29.892  50.948  1.00 38.64 ? 31   SER C CA  1 
ATOM   7393 C  C   . SER C 2 31  ? 66.926 29.024  50.598  1.00 32.36 ? 31   SER C C   1 
ATOM   7394 O  O   . SER C 2 31  ? 65.793 29.428  50.828  1.00 33.85 ? 31   SER C O   1 
ATOM   7395 C  CB  . SER C 2 31  ? 68.092 31.180  50.123  1.00 34.09 ? 31   SER C CB  1 
ATOM   7396 O  OG  . SER C 2 31  ? 68.906 32.178  50.707  1.00 45.89 ? 31   SER C OG  1 
ATOM   7397 N  N   . TYR C 2 32  ? 67.165 27.828  50.073  1.00 32.80 ? 32   TYR C N   1 
ATOM   7398 C  CA  . TYR C 2 32  ? 66.078 27.001  49.567  1.00 28.93 ? 32   TYR C CA  1 
ATOM   7399 C  C   . TYR C 2 32  ? 66.149 25.544  49.999  1.00 33.63 ? 32   TYR C C   1 
ATOM   7400 O  O   . TYR C 2 32  ? 67.226 24.967  50.120  1.00 26.48 ? 32   TYR C O   1 
ATOM   7401 C  CB  . TYR C 2 32  ? 66.045 27.046  48.039  1.00 33.31 ? 32   TYR C CB  1 
ATOM   7402 C  CG  . TYR C 2 32  ? 65.643 28.387  47.464  1.00 33.35 ? 32   TYR C CG  1 
ATOM   7403 C  CD1 . TYR C 2 32  ? 64.306 28.731  47.331  1.00 29.61 ? 32   TYR C CD1 1 
ATOM   7404 C  CD2 . TYR C 2 32  ? 66.602 29.302  47.046  1.00 30.31 ? 32   TYR C CD2 1 
ATOM   7405 C  CE1 . TYR C 2 32  ? 63.933 29.950  46.804  1.00 34.24 ? 32   TYR C CE1 1 
ATOM   7406 C  CE2 . TYR C 2 32  ? 66.239 30.525  46.521  1.00 35.33 ? 32   TYR C CE2 1 
ATOM   7407 C  CZ  . TYR C 2 32  ? 64.901 30.844  46.399  1.00 29.81 ? 32   TYR C CZ  1 
ATOM   7408 O  OH  . TYR C 2 32  ? 64.532 32.056  45.875  1.00 25.95 ? 32   TYR C OH  1 
ATOM   7409 N  N   . SER C 2 33  ? 64.977 24.955  50.211  1.00 27.44 ? 33   SER C N   1 
ATOM   7410 C  CA  . SER C 2 33  ? 64.851 23.517  50.230  1.00 23.21 ? 33   SER C CA  1 
ATOM   7411 C  C   . SER C 2 33  ? 65.213 23.016  48.844  1.00 28.78 ? 33   SER C C   1 
ATOM   7412 O  O   . SER C 2 33  ? 65.160 23.773  47.875  1.00 25.24 ? 33   SER C O   1 
ATOM   7413 C  CB  . SER C 2 33  ? 63.435 23.091  50.616  1.00 18.87 ? 33   SER C CB  1 
ATOM   7414 O  OG  . SER C 2 33  ? 63.142 23.488  51.941  1.00 20.94 ? 33   SER C OG  1 
ATOM   7415 N  N   . MET C 2 34  ? 65.600 21.751  48.746  1.00 23.34 ? 34   MET C N   1 
ATOM   7416 C  CA  . MET C 2 34  ? 65.976 21.191  47.461  1.00 25.33 ? 34   MET C CA  1 
ATOM   7417 C  C   . MET C 2 34  ? 65.285 19.864  47.224  1.00 25.23 ? 34   MET C C   1 
ATOM   7418 O  O   . MET C 2 34  ? 64.934 19.145  48.166  1.00 26.54 ? 34   MET C O   1 
ATOM   7419 C  CB  . MET C 2 34  ? 67.502 21.016  47.360  1.00 25.15 ? 34   MET C CB  1 
ATOM   7420 C  CG  . MET C 2 34  ? 68.271 22.319  47.423  1.00 34.92 ? 34   MET C CG  1 
ATOM   7421 S  SD  . MET C 2 34  ? 67.976 23.421  46.019  1.00 31.85 ? 34   MET C SD  1 
ATOM   7422 C  CE  . MET C 2 34  ? 68.459 22.355  44.671  1.00 29.20 ? 34   MET C CE  1 
ATOM   7423 N  N   . TYR C 2 35  ? 65.107 19.550  45.949  1.00 22.15 ? 35   TYR C N   1 
ATOM   7424 C  CA  . TYR C 2 35  ? 64.307 18.422  45.527  1.00 24.79 ? 35   TYR C CA  1 
ATOM   7425 C  C   . TYR C 2 35  ? 65.019 17.614  44.461  1.00 23.42 ? 35   TYR C C   1 
ATOM   7426 O  O   . TYR C 2 35  ? 65.722 18.164  43.621  1.00 27.73 ? 35   TYR C O   1 
ATOM   7427 C  CB  . TYR C 2 35  ? 62.955 18.906  44.993  1.00 30.38 ? 35   TYR C CB  1 
ATOM   7428 C  CG  . TYR C 2 35  ? 62.110 19.592  46.048  1.00 24.66 ? 35   TYR C CG  1 
ATOM   7429 C  CD1 . TYR C 2 35  ? 62.331 20.920  46.396  1.00 20.87 ? 35   TYR C CD1 1 
ATOM   7430 C  CD2 . TYR C 2 35  ? 61.101 18.901  46.707  1.00 23.39 ? 35   TYR C CD2 1 
ATOM   7431 C  CE1 . TYR C 2 35  ? 61.564 21.536  47.368  1.00 27.57 ? 35   TYR C CE1 1 
ATOM   7432 C  CE2 . TYR C 2 35  ? 60.333 19.508  47.672  1.00 23.50 ? 35   TYR C CE2 1 
ATOM   7433 C  CZ  . TYR C 2 35  ? 60.565 20.820  47.999  1.00 20.33 ? 35   TYR C CZ  1 
ATOM   7434 O  OH  . TYR C 2 35  ? 59.802 21.408  48.967  1.00 27.08 ? 35   TYR C OH  1 
ATOM   7435 N  N   . TRP C 2 36  ? 64.853 16.302  44.517  1.00 22.89 ? 36   TRP C N   1 
ATOM   7436 C  CA  . TRP C 2 36  ? 65.181 15.461  43.380  1.00 30.36 ? 36   TRP C CA  1 
ATOM   7437 C  C   . TRP C 2 36  ? 63.874 14.953  42.810  1.00 31.97 ? 36   TRP C C   1 
ATOM   7438 O  O   . TRP C 2 36  ? 63.044 14.412  43.535  1.00 24.17 ? 36   TRP C O   1 
ATOM   7439 C  CB  . TRP C 2 36  ? 66.089 14.285  43.760  1.00 26.47 ? 36   TRP C CB  1 
ATOM   7440 C  CG  . TRP C 2 36  ? 67.518 14.666  44.065  1.00 30.06 ? 36   TRP C CG  1 
ATOM   7441 C  CD1 . TRP C 2 36  ? 68.072 14.836  45.295  1.00 30.19 ? 36   TRP C CD1 1 
ATOM   7442 C  CD2 . TRP C 2 36  ? 68.567 14.910  43.117  1.00 29.11 ? 36   TRP C CD2 1 
ATOM   7443 N  NE1 . TRP C 2 36  ? 69.397 15.175  45.177  1.00 27.93 ? 36   TRP C NE1 1 
ATOM   7444 C  CE2 . TRP C 2 36  ? 69.725 15.228  43.850  1.00 33.21 ? 36   TRP C CE2 1 
ATOM   7445 C  CE3 . TRP C 2 36  ? 68.633 14.899  41.721  1.00 35.45 ? 36   TRP C CE3 1 
ATOM   7446 C  CZ2 . TRP C 2 36  ? 70.941 15.525  43.236  1.00 37.14 ? 36   TRP C CZ2 1 
ATOM   7447 C  CZ3 . TRP C 2 36  ? 69.840 15.197  41.111  1.00 36.62 ? 36   TRP C CZ3 1 
ATOM   7448 C  CH2 . TRP C 2 36  ? 70.979 15.503  41.869  1.00 37.42 ? 36   TRP C CH2 1 
ATOM   7449 N  N   . VAL C 2 37  ? 63.690 15.159  41.513  1.00 28.51 ? 37   VAL C N   1 
ATOM   7450 C  CA  . VAL C 2 37  ? 62.549 14.626  40.794  1.00 28.78 ? 37   VAL C CA  1 
ATOM   7451 C  C   . VAL C 2 37  ? 63.079 13.922  39.557  1.00 29.89 ? 37   VAL C C   1 
ATOM   7452 O  O   . VAL C 2 37  ? 64.156 14.263  39.061  1.00 30.90 ? 37   VAL C O   1 
ATOM   7453 C  CB  . VAL C 2 37  ? 61.541 15.728  40.398  1.00 29.72 ? 37   VAL C CB  1 
ATOM   7454 C  CG1 . VAL C 2 37  ? 60.998 16.426  41.643  1.00 34.71 ? 37   VAL C CG1 1 
ATOM   7455 C  CG2 . VAL C 2 37  ? 62.193 16.740  39.486  1.00 33.85 ? 37   VAL C CG2 1 
ATOM   7456 N  N   . ARG C 2 38  ? 62.340 12.934  39.071  1.00 26.26 ? 38   ARG C N   1 
ATOM   7457 C  CA  . ARG C 2 38  ? 62.776 12.183  37.903  1.00 38.85 ? 38   ARG C CA  1 
ATOM   7458 C  C   . ARG C 2 38  ? 61.653 12.032  36.881  1.00 41.82 ? 38   ARG C C   1 
ATOM   7459 O  O   . ARG C 2 38  ? 60.480 11.935  37.242  1.00 39.68 ? 38   ARG C O   1 
ATOM   7460 C  CB  . ARG C 2 38  ? 63.299 10.801  38.314  1.00 30.37 ? 38   ARG C CB  1 
ATOM   7461 C  CG  . ARG C 2 38  ? 62.227 9.819   38.771  1.00 33.95 ? 38   ARG C CG  1 
ATOM   7462 C  CD  . ARG C 2 38  ? 62.849 8.558   39.364  1.00 32.99 ? 38   ARG C CD  1 
ATOM   7463 N  NE  . ARG C 2 38  ? 61.849 7.642   39.905  1.00 32.47 ? 38   ARG C NE  1 
ATOM   7464 C  CZ  . ARG C 2 38  ? 62.137 6.514   40.548  1.00 34.24 ? 38   ARG C CZ  1 
ATOM   7465 N  NH1 . ARG C 2 38  ? 63.400 6.162   40.733  1.00 38.28 ? 38   ARG C NH1 1 
ATOM   7466 N  NH2 . ARG C 2 38  ? 61.166 5.733   41.001  1.00 36.04 ? 38   ARG C NH2 1 
ATOM   7467 N  N   . GLN C 2 39  ? 62.017 12.018  35.602  1.00 37.47 ? 39   GLN C N   1 
ATOM   7468 C  CA  . GLN C 2 39  ? 61.053 11.720  34.554  1.00 44.08 ? 39   GLN C CA  1 
ATOM   7469 C  C   . GLN C 2 39  ? 61.512 10.508  33.751  1.00 41.58 ? 39   GLN C C   1 
ATOM   7470 O  O   . GLN C 2 39  ? 62.575 10.517  33.132  1.00 38.40 ? 39   GLN C O   1 
ATOM   7471 C  CB  . GLN C 2 39  ? 60.836 12.927  33.635  1.00 45.87 ? 39   GLN C CB  1 
ATOM   7472 C  CG  . GLN C 2 39  ? 59.612 12.787  32.737  1.00 44.74 ? 39   GLN C CG  1 
ATOM   7473 C  CD  . GLN C 2 39  ? 58.967 14.121  32.406  1.00 41.04 ? 39   GLN C CD  1 
ATOM   7474 O  OE1 . GLN C 2 39  ? 59.632 15.155  32.366  0.00 47.92 ? 39   GLN C OE1 1 
ATOM   7475 N  NE2 . GLN C 2 39  ? 57.660 14.099  32.168  0.00 46.61 ? 39   GLN C NE2 1 
ATOM   7476 N  N   . ALA C 2 40  ? 60.701 9.460   33.791  1.00 42.40 ? 40   ALA C N   1 
ATOM   7477 C  CA  . ALA C 2 40  ? 60.999 8.207   33.117  1.00 49.34 ? 40   ALA C CA  1 
ATOM   7478 C  C   . ALA C 2 40  ? 60.321 8.200   31.748  1.00 51.32 ? 40   ALA C C   1 
ATOM   7479 O  O   . ALA C 2 40  ? 59.304 8.875   31.564  1.00 51.96 ? 40   ALA C O   1 
ATOM   7480 C  CB  . ALA C 2 40  ? 60.536 7.023   33.970  1.00 44.95 ? 40   ALA C CB  1 
ATOM   7481 N  N   . PRO C 2 41  ? 60.887 7.452   30.781  1.00 52.68 ? 41   PRO C N   1 
ATOM   7482 C  CA  . PRO C 2 41  ? 60.370 7.448   29.406  1.00 52.58 ? 41   PRO C CA  1 
ATOM   7483 C  C   . PRO C 2 41  ? 58.859 7.251   29.328  1.00 54.20 ? 41   PRO C C   1 
ATOM   7484 O  O   . PRO C 2 41  ? 58.326 6.292   29.892  1.00 51.04 ? 41   PRO C O   1 
ATOM   7485 C  CB  . PRO C 2 41  ? 61.105 6.270   28.764  1.00 51.74 ? 41   PRO C CB  1 
ATOM   7486 C  CG  . PRO C 2 41  ? 62.394 6.205   29.502  1.00 56.02 ? 41   PRO C CG  1 
ATOM   7487 C  CD  . PRO C 2 41  ? 62.066 6.575   30.923  1.00 52.42 ? 41   PRO C CD  1 
ATOM   7488 N  N   . GLY C 2 42  ? 58.181 8.173   28.649  1.00 55.40 ? 42   GLY C N   1 
ATOM   7489 C  CA  . GLY C 2 42  ? 56.738 8.109   28.493  1.00 51.12 ? 42   GLY C CA  1 
ATOM   7490 C  C   . GLY C 2 42  ? 55.953 8.234   29.786  1.00 53.14 ? 42   GLY C C   1 
ATOM   7491 O  O   . GLY C 2 42  ? 54.768 7.891   29.834  1.00 54.02 ? 42   GLY C O   1 
ATOM   7492 N  N   . LYS C 2 43  ? 56.605 8.731   30.835  1.00 55.89 ? 43   LYS C N   1 
ATOM   7493 C  CA  . LYS C 2 43  ? 55.960 8.885   32.138  1.00 47.35 ? 43   LYS C CA  1 
ATOM   7494 C  C   . LYS C 2 43  ? 56.038 10.307  32.666  1.00 45.83 ? 43   LYS C C   1 
ATOM   7495 O  O   . LYS C 2 43  ? 56.922 11.078  32.282  1.00 47.03 ? 43   LYS C O   1 
ATOM   7496 C  CB  . LYS C 2 43  ? 56.579 7.929   33.157  1.00 45.55 ? 43   LYS C CB  1 
ATOM   7497 C  CG  . LYS C 2 43  ? 56.111 6.498   32.996  0.00 42.52 ? 43   LYS C CG  1 
ATOM   7498 C  CD  . LYS C 2 43  ? 56.569 5.628   34.149  0.00 37.72 ? 43   LYS C CD  1 
ATOM   7499 C  CE  . LYS C 2 43  ? 55.814 4.313   34.154  0.00 32.87 ? 43   LYS C CE  1 
ATOM   7500 N  NZ  . LYS C 2 43  ? 55.816 3.678   32.808  0.00 31.80 ? 43   LYS C NZ  1 
ATOM   7501 N  N   . GLY C 2 44  ? 55.106 10.641  33.557  1.00 49.10 ? 44   GLY C N   1 
ATOM   7502 C  CA  . GLY C 2 44  ? 55.047 11.957  34.170  1.00 42.35 ? 44   GLY C CA  1 
ATOM   7503 C  C   . GLY C 2 44  ? 56.143 12.161  35.199  1.00 43.72 ? 44   GLY C C   1 
ATOM   7504 O  O   . GLY C 2 44  ? 56.846 11.221  35.565  1.00 41.10 ? 44   GLY C O   1 
ATOM   7505 N  N   . LEU C 2 45  ? 56.292 13.397  35.662  1.00 45.01 ? 45   LEU C N   1 
ATOM   7506 C  CA  . LEU C 2 45  ? 57.280 13.717  36.685  1.00 40.29 ? 45   LEU C CA  1 
ATOM   7507 C  C   . LEU C 2 45  ? 56.986 12.984  37.990  1.00 39.96 ? 45   LEU C C   1 
ATOM   7508 O  O   . LEU C 2 45  ? 55.843 12.904  38.435  1.00 38.54 ? 45   LEU C O   1 
ATOM   7509 C  CB  . LEU C 2 45  ? 57.325 15.221  36.942  1.00 36.10 ? 45   LEU C CB  1 
ATOM   7510 C  CG  . LEU C 2 45  ? 58.713 15.855  36.972  1.00 41.71 ? 45   LEU C CG  1 
ATOM   7511 C  CD1 . LEU C 2 45  ? 59.309 15.885  35.573  0.00 41.66 ? 45   LEU C CD1 1 
ATOM   7512 C  CD2 . LEU C 2 45  ? 58.651 17.253  37.565  0.00 37.85 ? 45   LEU C CD2 1 
ATOM   7513 N  N   . GLU C 2 46  ? 58.032 12.448  38.601  1.00 38.24 ? 46   GLU C N   1 
ATOM   7514 C  CA  . GLU C 2 46  ? 57.896 11.800  39.893  1.00 38.30 ? 46   GLU C CA  1 
ATOM   7515 C  C   . GLU C 2 46  ? 58.861 12.429  40.887  1.00 33.41 ? 46   GLU C C   1 
ATOM   7516 O  O   . GLU C 2 46  ? 60.059 12.508  40.618  1.00 34.59 ? 46   GLU C O   1 
ATOM   7517 C  CB  . GLU C 2 46  ? 58.161 10.298  39.774  1.00 34.32 ? 46   GLU C CB  1 
ATOM   7518 C  CG  . GLU C 2 46  ? 58.286 9.600   41.117  1.00 32.76 ? 46   GLU C CG  1 
ATOM   7519 C  CD  . GLU C 2 46  ? 58.542 8.097   41.003  1.00 51.03 ? 46   GLU C CD  1 
ATOM   7520 O  OE1 . GLU C 2 46  ? 59.107 7.647   39.979  1.00 41.04 ? 46   GLU C OE1 1 
ATOM   7521 O  OE2 . GLU C 2 46  ? 58.176 7.358   41.947  1.00 51.09 ? 46   GLU C OE2 1 
ATOM   7522 N  N   A TRP C 2 47  ? 58.339 12.891  42.019  0.50 29.02 ? 47   TRP C N   1 
ATOM   7523 N  N   B TRP C 2 47  ? 58.355 12.895  42.026  0.50 29.01 ? 47   TRP C N   1 
ATOM   7524 C  CA  A TRP C 2 47  ? 59.188 13.345  43.113  0.50 30.04 ? 47   TRP C CA  1 
ATOM   7525 C  CA  B TRP C 2 47  ? 59.250 13.387  43.068  0.50 30.05 ? 47   TRP C CA  1 
ATOM   7526 C  C   A TRP C 2 47  ? 59.928 12.153  43.710  0.50 27.12 ? 47   TRP C C   1 
ATOM   7527 C  C   B TRP C 2 47  ? 59.922 12.191  43.731  0.50 27.12 ? 47   TRP C C   1 
ATOM   7528 O  O   A TRP C 2 47  ? 59.347 11.084  43.896  0.50 27.19 ? 47   TRP C O   1 
ATOM   7529 O  O   B TRP C 2 47  ? 59.296 11.157  43.965  0.50 27.22 ? 47   TRP C O   1 
ATOM   7530 C  CB  A TRP C 2 47  ? 58.362 14.062  44.185  0.50 32.18 ? 47   TRP C CB  1 
ATOM   7531 C  CB  B TRP C 2 47  ? 58.509 14.261  44.094  0.50 32.19 ? 47   TRP C CB  1 
ATOM   7532 C  CG  A TRP C 2 47  ? 59.072 14.199  45.496  0.50 29.18 ? 47   TRP C CG  1 
ATOM   7533 C  CG  B TRP C 2 47  ? 58.099 13.573  45.368  0.50 31.36 ? 47   TRP C CG  1 
ATOM   7534 C  CD1 A TRP C 2 47  ? 60.159 14.984  45.763  0.50 28.40 ? 47   TRP C CD1 1 
ATOM   7535 C  CD1 B TRP C 2 47  ? 56.993 12.797  45.558  0.50 30.06 ? 47   TRP C CD1 1 
ATOM   7536 C  CD2 A TRP C 2 47  ? 58.742 13.538  46.727  0.50 28.03 ? 47   TRP C CD2 1 
ATOM   7537 C  CD2 B TRP C 2 47  ? 58.772 13.626  46.637  0.50 28.06 ? 47   TRP C CD2 1 
ATOM   7538 N  NE1 A TRP C 2 47  ? 60.526 14.848  47.082  0.50 26.90 ? 47   TRP C NE1 1 
ATOM   7539 N  NE1 B TRP C 2 47  ? 56.942 12.352  46.858  0.50 27.34 ? 47   TRP C NE1 1 
ATOM   7540 C  CE2 A TRP C 2 47  ? 59.674 13.967  47.694  0.50 27.77 ? 47   TRP C CE2 1 
ATOM   7541 C  CE2 B TRP C 2 47  ? 58.020 12.846  47.540  0.50 27.55 ? 47   TRP C CE2 1 
ATOM   7542 C  CE3 A TRP C 2 47  ? 57.748 12.627  47.104  0.50 27.52 ? 47   TRP C CE3 1 
ATOM   7543 C  CE3 B TRP C 2 47  ? 59.937 14.251  47.094  0.50 28.24 ? 47   TRP C CE3 1 
ATOM   7544 C  CZ2 A TRP C 2 47  ? 59.643 13.514  49.014  0.50 27.19 ? 47   TRP C CZ2 1 
ATOM   7545 C  CZ2 B TRP C 2 47  ? 58.396 12.673  48.873  0.50 27.64 ? 47   TRP C CZ2 1 
ATOM   7546 C  CZ3 A TRP C 2 47  ? 57.721 12.178  48.415  0.50 26.85 ? 47   TRP C CZ3 1 
ATOM   7547 C  CZ3 B TRP C 2 47  ? 60.306 14.079  48.417  0.50 26.88 ? 47   TRP C CZ3 1 
ATOM   7548 C  CH2 A TRP C 2 47  ? 58.661 12.623  49.354  0.50 26.53 ? 47   TRP C CH2 1 
ATOM   7549 C  CH2 B TRP C 2 47  ? 59.539 13.294  49.290  0.50 26.83 ? 47   TRP C CH2 1 
ATOM   7550 N  N   . VAL C 2 48  ? 61.213 12.333  43.999  1.00 27.87 ? 48   VAL C N   1 
ATOM   7551 C  CA  . VAL C 2 48  ? 62.017 11.250  44.557  1.00 25.77 ? 48   VAL C CA  1 
ATOM   7552 C  C   . VAL C 2 48  ? 62.395 11.510  46.009  1.00 28.52 ? 48   VAL C C   1 
ATOM   7553 O  O   . VAL C 2 48  ? 62.201 10.666  46.879  1.00 27.04 ? 48   VAL C O   1 
ATOM   7554 C  CB  . VAL C 2 48  ? 63.317 11.049  43.744  1.00 30.32 ? 48   VAL C CB  1 
ATOM   7555 C  CG1 . VAL C 2 48  ? 64.209 10.006  44.401  1.00 25.00 ? 48   VAL C CG1 1 
ATOM   7556 C  CG2 . VAL C 2 48  ? 62.988 10.676  42.310  1.00 28.47 ? 48   VAL C CG2 1 
ATOM   7557 N  N   . SER C 2 49  ? 62.956 12.685  46.256  1.00 25.74 ? 49   SER C N   1 
ATOM   7558 C  CA  . SER C 2 49  ? 63.461 13.009  47.574  1.00 23.13 ? 49   SER C CA  1 
ATOM   7559 C  C   . SER C 2 49  ? 63.526 14.512  47.790  1.00 23.22 ? 49   SER C C   1 
ATOM   7560 O  O   . SER C 2 49  ? 63.518 15.286  46.832  1.00 27.46 ? 49   SER C O   1 
ATOM   7561 C  CB  . SER C 2 49  ? 64.839 12.384  47.772  1.00 24.63 ? 49   SER C CB  1 
ATOM   7562 O  OG  . SER C 2 49  ? 65.242 12.526  49.118  1.00 31.91 ? 49   SER C OG  1 
ATOM   7563 N  N   . SER C 2 50  ? 63.581 14.923  49.050  1.00 20.74 ? 50   SER C N   1 
ATOM   7564 C  CA  . SER C 2 50  ? 63.668 16.337  49.395  1.00 21.50 ? 50   SER C CA  1 
ATOM   7565 C  C   . SER C 2 50  ? 64.434 16.568  50.688  1.00 19.30 ? 50   SER C C   1 
ATOM   7566 O  O   . SER C 2 50  ? 64.530 15.677  51.536  1.00 22.28 ? 50   SER C O   1 
ATOM   7567 C  CB  . SER C 2 50  ? 62.275 16.939  49.536  1.00 21.67 ? 50   SER C CB  1 
ATOM   7568 O  OG  . SER C 2 50  ? 61.523 16.212  50.484  1.00 20.18 ? 50   SER C OG  1 
ATOM   7569 N  N   . ILE C 2 51  ? 64.942 17.782  50.849  1.00 17.59 ? 51   ILE C N   1 
ATOM   7570 C  CA  . ILE C 2 51  ? 65.726 18.132  52.023  1.00 21.58 ? 51   ILE C CA  1 
ATOM   7571 C  C   . ILE C 2 51  ? 65.544 19.622  52.341  1.00 24.29 ? 51   ILE C C   1 
ATOM   7572 O  O   . ILE C 2 51  ? 65.455 20.449  51.424  1.00 22.78 ? 51   ILE C O   1 
ATOM   7573 C  CB  . ILE C 2 51  ? 67.226 17.770  51.796  1.00 21.94 ? 51   ILE C CB  1 
ATOM   7574 C  CG1 . ILE C 2 51  ? 68.051 17.925  53.075  1.00 28.73 ? 51   ILE C CG1 1 
ATOM   7575 C  CG2 . ILE C 2 51  ? 67.826 18.590  50.650  1.00 22.53 ? 51   ILE C CG2 1 
ATOM   7576 C  CD1 . ILE C 2 51  ? 69.435 17.264  52.970  1.00 25.96 ? 51   ILE C CD1 1 
ATOM   7577 N  N   . ASN C 2 52  ? 65.451 19.970  53.626  1.00 21.36 ? 52   ASN C N   1 
ATOM   7578 C  CA  . ASN C 2 52  ? 65.309 21.373  53.988  1.00 22.16 ? 52   ASN C CA  1 
ATOM   7579 C  C   . ASN C 2 52  ? 66.641 22.096  53.826  1.00 22.23 ? 52   ASN C C   1 
ATOM   7580 O  O   . ASN C 2 52  ? 67.600 21.534  53.317  1.00 25.45 ? 52   ASN C O   1 
ATOM   7581 C  CB  . ASN C 2 52  ? 64.771 21.552  55.416  1.00 20.91 ? 52   ASN C CB  1 
ATOM   7582 C  CG  . ASN C 2 52  ? 65.705 21.009  56.493  1.00 22.73 ? 52   ASN C CG  1 
ATOM   7583 O  OD1 . ASN C 2 52  ? 66.779 20.485  56.217  1.00 22.45 ? 52   ASN C OD1 1 
ATOM   7584 N  ND2 . ASN C 2 52  ? 65.280 21.143  57.740  1.00 22.65 ? 52   ASN C ND2 1 
ATOM   7585 N  N   . ARG C 2 53  ? 66.692 23.337  54.281  1.00 23.40 ? 53   ARG C N   1 
ATOM   7586 C  CA  . ARG C 2 53  ? 67.805 24.214  53.944  1.00 28.29 ? 53   ARG C CA  1 
ATOM   7587 C  C   . ARG C 2 53  ? 69.121 23.798  54.588  1.00 28.03 ? 53   ARG C C   1 
ATOM   7588 O  O   . ARG C 2 53  ? 70.160 23.816  53.933  1.00 32.79 ? 53   ARG C O   1 
ATOM   7589 C  CB  . ARG C 2 53  ? 67.466 25.652  54.325  1.00 22.77 ? 53   ARG C CB  1 
ATOM   7590 C  CG  . ARG C 2 53  ? 66.290 26.204  53.543  1.00 27.92 ? 53   ARG C CG  1 
ATOM   7591 C  CD  . ARG C 2 53  ? 66.353 27.710  53.456  1.00 34.80 ? 53   ARG C CD  1 
ATOM   7592 N  NE  . ARG C 2 53  ? 66.043 28.379  54.710  1.00 37.52 ? 53   ARG C NE  1 
ATOM   7593 C  CZ  . ARG C 2 53  ? 66.408 29.624  55.003  1.00 41.07 ? 53   ARG C CZ  1 
ATOM   7594 N  NH1 . ARG C 2 53  ? 67.121 30.336  54.139  1.00 44.96 ? 53   ARG C NH1 1 
ATOM   7595 N  NH2 . ARG C 2 53  ? 66.070 30.155  56.170  1.00 46.08 ? 53   ARG C NH2 1 
ATOM   7596 N  N   . VAL C 2 54  ? 69.082 23.416  55.859  1.00 29.20 ? 54   VAL C N   1 
ATOM   7597 C  CA  . VAL C 2 54  ? 70.320 23.072  56.548  1.00 34.82 ? 54   VAL C CA  1 
ATOM   7598 C  C   . VAL C 2 54  ? 70.625 21.581  56.423  1.00 28.09 ? 54   VAL C C   1 
ATOM   7599 O  O   . VAL C 2 54  ? 71.769 21.167  56.575  1.00 34.92 ? 54   VAL C O   1 
ATOM   7600 C  CB  . VAL C 2 54  ? 70.279 23.481  58.033  1.00 31.27 ? 54   VAL C CB  1 
ATOM   7601 C  CG1 . VAL C 2 54  ? 69.718 24.895  58.168  1.00 35.97 ? 54   VAL C CG1 1 
ATOM   7602 C  CG2 . VAL C 2 54  ? 69.468 22.504  58.844  1.00 28.59 ? 54   VAL C CG2 1 
ATOM   7603 N  N   . GLY C 2 55  ? 69.607 20.783  56.121  1.00 28.15 ? 55   GLY C N   1 
ATOM   7604 C  CA  . GLY C 2 55  ? 69.804 19.365  55.877  1.00 25.83 ? 55   GLY C CA  1 
ATOM   7605 C  C   . GLY C 2 55  ? 69.354 18.499  57.041  1.00 27.29 ? 55   GLY C C   1 
ATOM   7606 O  O   . GLY C 2 55  ? 69.628 17.300  57.086  1.00 29.28 ? 55   GLY C O   1 
ATOM   7607 N  N   . SER C 2 56  ? 68.651 19.112  57.982  1.00 25.66 ? 56   SER C N   1 
ATOM   7608 C  CA  . SER C 2 56  ? 68.216 18.423  59.187  1.00 28.05 ? 56   SER C CA  1 
ATOM   7609 C  C   . SER C 2 56  ? 66.872 17.710  59.026  1.00 24.53 ? 56   SER C C   1 
ATOM   7610 O  O   . SER C 2 56  ? 66.443 16.988  59.920  1.00 29.97 ? 56   SER C O   1 
ATOM   7611 C  CB  . SER C 2 56  ? 68.121 19.416  60.337  1.00 30.50 ? 56   SER C CB  1 
ATOM   7612 O  OG  . SER C 2 56  ? 67.154 20.400  60.041  1.00 30.10 ? 56   SER C OG  1 
ATOM   7613 N  N   . ASN C 2 57  ? 66.191 17.936  57.910  1.00 25.66 ? 57   ASN C N   1 
ATOM   7614 C  CA  . ASN C 2 57  ? 64.986 17.168  57.611  1.00 24.49 ? 57   ASN C CA  1 
ATOM   7615 C  C   . ASN C 2 57  ? 65.022 16.675  56.168  1.00 22.09 ? 57   ASN C C   1 
ATOM   7616 O  O   . ASN C 2 57  ? 65.401 17.408  55.266  1.00 23.99 ? 57   ASN C O   1 
ATOM   7617 C  CB  . ASN C 2 57  ? 63.724 17.998  57.870  1.00 26.93 ? 57   ASN C CB  1 
ATOM   7618 C  CG  . ASN C 2 57  ? 62.494 17.129  58.141  1.00 26.59 ? 57   ASN C CG  1 
ATOM   7619 O  OD1 . ASN C 2 57  ? 62.519 15.913  57.933  1.00 20.23 ? 57   ASN C OD1 1 
ATOM   7620 N  ND2 . ASN C 2 57  ? 61.414 17.754  58.607  1.00 17.75 ? 57   ASN C ND2 1 
ATOM   7621 N  N   . THR C 2 58  ? 64.644 15.419  55.966  1.00 20.09 ? 58   THR C N   1 
ATOM   7622 C  CA  . THR C 2 58  ? 64.738 14.763  54.671  1.00 19.13 ? 58   THR C CA  1 
ATOM   7623 C  C   . THR C 2 58  ? 63.486 13.920  54.441  1.00 22.95 ? 58   THR C C   1 
ATOM   7624 O  O   . THR C 2 58  ? 62.945 13.333  55.384  1.00 23.57 ? 58   THR C O   1 
ATOM   7625 C  CB  . THR C 2 58  ? 65.984 13.839  54.571  1.00 17.76 ? 58   THR C CB  1 
ATOM   7626 O  OG1 . THR C 2 58  ? 65.970 12.902  55.651  1.00 19.45 ? 58   THR C OG1 1 
ATOM   7627 C  CG2 . THR C 2 58  ? 67.289 14.639  54.619  1.00 20.21 ? 58   THR C CG2 1 
ATOM   7628 N  N   . ASP C 2 59  ? 63.033 13.843  53.196  1.00 17.96 ? 59   ASP C N   1 
ATOM   7629 C  CA  . ASP C 2 59  ? 61.873 13.014  52.867  1.00 20.59 ? 59   ASP C CA  1 
ATOM   7630 C  C   . ASP C 2 59  ? 62.104 12.196  51.599  1.00 20.96 ? 59   ASP C C   1 
ATOM   7631 O  O   . ASP C 2 59  ? 62.897 12.577  50.744  1.00 22.43 ? 59   ASP C O   1 
ATOM   7632 C  CB  . ASP C 2 59  ? 60.616 13.884  52.730  1.00 19.51 ? 59   ASP C CB  1 
ATOM   7633 C  CG  . ASP C 2 59  ? 60.093 14.354  54.081  1.00 22.61 ? 59   ASP C CG  1 
ATOM   7634 O  OD1 . ASP C 2 59  ? 59.392 13.573  54.762  1.00 23.38 ? 59   ASP C OD1 1 
ATOM   7635 O  OD2 . ASP C 2 59  ? 60.401 15.499  54.476  1.00 26.30 ? 59   ASP C OD2 1 
ATOM   7636 N  N   . TYR C 2 60  ? 61.405 11.070  51.485  1.00 18.96 ? 60   TYR C N   1 
ATOM   7637 C  CA  . TYR C 2 60  ? 61.615 10.144  50.380  1.00 23.57 ? 60   TYR C CA  1 
ATOM   7638 C  C   . TYR C 2 60  ? 60.293 9.609   49.833  1.00 25.52 ? 60   TYR C C   1 
ATOM   7639 O  O   . TYR C 2 60  ? 59.368 9.329   50.593  1.00 22.64 ? 60   TYR C O   1 
ATOM   7640 C  CB  . TYR C 2 60  ? 62.503 8.973   50.833  1.00 24.01 ? 60   TYR C CB  1 
ATOM   7641 C  CG  . TYR C 2 60  ? 63.877 9.399   51.298  1.00 22.52 ? 60   TYR C CG  1 
ATOM   7642 C  CD1 . TYR C 2 60  ? 64.911 9.565   50.390  1.00 20.60 ? 60   TYR C CD1 1 
ATOM   7643 C  CD2 . TYR C 2 60  ? 64.132 9.655   52.641  1.00 22.13 ? 60   TYR C CD2 1 
ATOM   7644 C  CE1 . TYR C 2 60  ? 66.162 9.959   50.797  1.00 23.50 ? 60   TYR C CE1 1 
ATOM   7645 C  CE2 . TYR C 2 60  ? 65.386 10.059  53.062  1.00 22.41 ? 60   TYR C CE2 1 
ATOM   7646 C  CZ  . TYR C 2 60  ? 66.399 10.204  52.135  1.00 21.35 ? 60   TYR C CZ  1 
ATOM   7647 O  OH  . TYR C 2 60  ? 67.646 10.608  52.542  1.00 25.67 ? 60   TYR C OH  1 
ATOM   7648 N  N   . ALA C 2 61  ? 60.201 9.459   48.517  1.00 21.85 ? 61   ALA C N   1 
ATOM   7649 C  CA  . ALA C 2 61  ? 59.053 8.764   47.952  1.00 26.54 ? 61   ALA C CA  1 
ATOM   7650 C  C   . ALA C 2 61  ? 59.077 7.295   48.394  1.00 30.04 ? 61   ALA C C   1 
ATOM   7651 O  O   . ALA C 2 61  ? 60.144 6.716   48.599  1.00 32.70 ? 61   ALA C O   1 
ATOM   7652 C  CB  . ALA C 2 61  ? 59.044 8.880   46.432  1.00 29.24 ? 61   ALA C CB  1 
ATOM   7653 N  N   . ASP C 2 62  ? 57.898 6.707   48.559  1.00 27.76 ? 62   ASP C N   1 
ATOM   7654 C  CA  . ASP C 2 62  ? 57.772 5.331   49.011  1.00 29.29 ? 62   ASP C CA  1 
ATOM   7655 C  C   . ASP C 2 62  ? 58.595 4.350   48.170  1.00 39.98 ? 62   ASP C C   1 
ATOM   7656 O  O   . ASP C 2 62  ? 59.172 3.395   48.701  1.00 33.13 ? 62   ASP C O   1 
ATOM   7657 C  CB  . ASP C 2 62  ? 56.301 4.913   49.003  1.00 36.49 ? 62   ASP C CB  1 
ATOM   7658 C  CG  . ASP C 2 62  ? 55.550 5.397   50.229  1.00 39.77 ? 62   ASP C CG  1 
ATOM   7659 O  OD1 . ASP C 2 62  ? 56.100 6.234   50.974  0.00 35.96 ? 62   ASP C OD1 1 
ATOM   7660 O  OD2 . ASP C 2 62  ? 54.407 4.944   50.442  0.00 43.27 ? 62   ASP C OD2 1 
ATOM   7661 N  N   . SER C 2 63  ? 58.660 4.603   46.866  1.00 34.90 ? 63   SER C N   1 
ATOM   7662 C  CA  . SER C 2 63  ? 59.335 3.696   45.939  1.00 39.78 ? 63   SER C CA  1 
ATOM   7663 C  C   . SER C 2 63  ? 60.855 3.660   46.103  1.00 39.85 ? 63   SER C C   1 
ATOM   7664 O  O   . SER C 2 63  ? 61.501 2.721   45.638  1.00 39.80 ? 63   SER C O   1 
ATOM   7665 C  CB  . SER C 2 63  ? 58.992 4.066   44.494  1.00 35.78 ? 63   SER C CB  1 
ATOM   7666 O  OG  . SER C 2 63  ? 59.235 5.445   44.250  1.00 46.61 ? 63   SER C OG  1 
ATOM   7667 N  N   . VAL C 2 64  ? 61.431 4.673   46.747  1.00 32.60 ? 64   VAL C N   1 
ATOM   7668 C  CA  . VAL C 2 64  ? 62.888 4.719   46.902  1.00 31.55 ? 64   VAL C CA  1 
ATOM   7669 C  C   . VAL C 2 64  ? 63.316 4.581   48.360  1.00 34.09 ? 64   VAL C C   1 
ATOM   7670 O  O   . VAL C 2 64  ? 64.510 4.618   48.672  1.00 31.27 ? 64   VAL C O   1 
ATOM   7671 C  CB  . VAL C 2 64  ? 63.491 6.024   46.338  1.00 30.05 ? 64   VAL C CB  1 
ATOM   7672 C  CG1 . VAL C 2 64  ? 63.052 6.248   44.890  1.00 33.92 ? 64   VAL C CG1 1 
ATOM   7673 C  CG2 . VAL C 2 64  ? 63.105 7.206   47.207  1.00 30.99 ? 64   VAL C CG2 1 
ATOM   7674 N  N   . LYS C 2 65  ? 62.343 4.415   49.250  1.00 32.95 ? 65   LYS C N   1 
ATOM   7675 C  CA  . LYS C 2 65  ? 62.626 4.378   50.679  1.00 36.54 ? 65   LYS C CA  1 
ATOM   7676 C  C   . LYS C 2 65  ? 63.567 3.237   51.025  1.00 34.33 ? 65   LYS C C   1 
ATOM   7677 O  O   . LYS C 2 65  ? 63.357 2.104   50.604  1.00 35.74 ? 65   LYS C O   1 
ATOM   7678 C  CB  . LYS C 2 65  ? 61.335 4.249   51.485  1.00 34.69 ? 65   LYS C CB  1 
ATOM   7679 C  CG  . LYS C 2 65  ? 61.490 4.567   52.959  0.00 32.67 ? 65   LYS C CG  1 
ATOM   7680 C  CD  . LYS C 2 65  ? 60.201 5.130   53.535  0.00 31.40 ? 65   LYS C CD  1 
ATOM   7681 C  CE  . LYS C 2 65  ? 59.819 6.432   52.846  0.00 31.19 ? 65   LYS C CE  1 
ATOM   7682 N  NZ  . LYS C 2 65  ? 58.603 7.048   53.443  0.00 31.32 ? 65   LYS C NZ  1 
ATOM   7683 N  N   . GLY C 2 66  ? 64.613 3.552   51.779  1.00 31.62 ? 66   GLY C N   1 
ATOM   7684 C  CA  . GLY C 2 66  ? 65.566 2.552   52.218  1.00 37.91 ? 66   GLY C CA  1 
ATOM   7685 C  C   . GLY C 2 66  ? 66.643 2.249   51.198  1.00 33.64 ? 66   GLY C C   1 
ATOM   7686 O  O   . GLY C 2 66  ? 67.500 1.399   51.430  1.00 36.20 ? 66   GLY C O   1 
ATOM   7687 N  N   . ARG C 2 67  ? 66.605 2.935   50.061  1.00 30.65 ? 67   ARG C N   1 
ATOM   7688 C  CA  . ARG C 2 67  ? 67.591 2.698   49.018  1.00 30.23 ? 67   ARG C CA  1 
ATOM   7689 C  C   . ARG C 2 67  ? 68.355 3.972   48.677  1.00 34.82 ? 67   ARG C C   1 
ATOM   7690 O  O   . ARG C 2 67  ? 69.531 3.922   48.317  1.00 32.51 ? 67   ARG C O   1 
ATOM   7691 C  CB  . ARG C 2 67  ? 66.919 2.132   47.759  1.00 35.67 ? 67   ARG C CB  1 
ATOM   7692 C  CG  . ARG C 2 67  ? 66.093 0.874   48.000  1.00 28.30 ? 67   ARG C CG  1 
ATOM   7693 C  CD  . ARG C 2 67  ? 65.634 0.221   46.686  1.00 37.01 ? 67   ARG C CD  1 
ATOM   7694 N  NE  . ARG C 2 67  ? 64.676 1.034   45.934  1.00 36.72 ? 67   ARG C NE  1 
ATOM   7695 C  CZ  . ARG C 2 67  ? 64.960 1.682   44.807  1.00 41.41 ? 67   ARG C CZ  1 
ATOM   7696 N  NH1 . ARG C 2 67  ? 66.176 1.608   44.285  1.00 38.27 ? 67   ARG C NH1 1 
ATOM   7697 N  NH2 . ARG C 2 67  ? 64.028 2.400   44.195  1.00 36.01 ? 67   ARG C NH2 1 
ATOM   7698 N  N   . PHE C 2 68  ? 67.685 5.114   48.786  1.00 31.69 ? 68   PHE C N   1 
ATOM   7699 C  CA  . PHE C 2 68  ? 68.298 6.385   48.418  1.00 30.13 ? 68   PHE C CA  1 
ATOM   7700 C  C   . PHE C 2 68  ? 68.628 7.218   49.644  1.00 29.93 ? 68   PHE C C   1 
ATOM   7701 O  O   . PHE C 2 68  ? 67.976 7.097   50.678  1.00 30.61 ? 68   PHE C O   1 
ATOM   7702 C  CB  . PHE C 2 68  ? 67.382 7.199   47.499  1.00 35.21 ? 68   PHE C CB  1 
ATOM   7703 C  CG  . PHE C 2 68  ? 67.205 6.620   46.115  1.00 36.66 ? 68   PHE C CG  1 
ATOM   7704 C  CD1 . PHE C 2 68  ? 67.671 5.352   45.798  1.00 36.23 ? 68   PHE C CD1 1 
ATOM   7705 C  CD2 . PHE C 2 68  ? 66.573 7.360   45.128  1.00 31.01 ? 68   PHE C CD2 1 
ATOM   7706 C  CE1 . PHE C 2 68  ? 67.501 4.830   44.528  1.00 38.57 ? 68   PHE C CE1 1 
ATOM   7707 C  CE2 . PHE C 2 68  ? 66.403 6.846   43.856  1.00 35.94 ? 68   PHE C CE2 1 
ATOM   7708 C  CZ  . PHE C 2 68  ? 66.862 5.576   43.557  1.00 39.05 ? 68   PHE C CZ  1 
ATOM   7709 N  N   . THR C 2 69  ? 69.633 8.076   49.511  1.00 28.19 ? 69   THR C N   1 
ATOM   7710 C  CA  . THR C 2 69  ? 69.989 9.035   50.548  1.00 29.16 ? 69   THR C CA  1 
ATOM   7711 C  C   . THR C 2 69  ? 70.285 10.402  49.948  1.00 30.57 ? 69   THR C C   1 
ATOM   7712 O  O   . THR C 2 69  ? 71.223 10.560  49.162  1.00 29.08 ? 69   THR C O   1 
ATOM   7713 C  CB  . THR C 2 69  ? 71.229 8.598   51.356  1.00 32.28 ? 69   THR C CB  1 
ATOM   7714 O  OG1 . THR C 2 69  ? 71.023 7.293   51.908  1.00 32.90 ? 69   THR C OG1 1 
ATOM   7715 C  CG2 . THR C 2 69  ? 71.492 9.584   52.477  1.00 30.25 ? 69   THR C CG2 1 
ATOM   7716 N  N   . ILE C 2 70  ? 69.488 11.388  50.334  1.00 31.91 ? 70   ILE C N   1 
ATOM   7717 C  CA  . ILE C 2 70  ? 69.703 12.762  49.904  1.00 26.97 ? 70   ILE C CA  1 
ATOM   7718 C  C   . ILE C 2 70  ? 70.530 13.515  50.947  1.00 31.11 ? 70   ILE C C   1 
ATOM   7719 O  O   . ILE C 2 70  ? 70.380 13.295  52.151  1.00 26.85 ? 70   ILE C O   1 
ATOM   7720 C  CB  . ILE C 2 70  ? 68.358 13.482  49.672  1.00 23.99 ? 70   ILE C CB  1 
ATOM   7721 C  CG1 . ILE C 2 70  ? 68.573 14.843  49.002  1.00 26.57 ? 70   ILE C CG1 1 
ATOM   7722 C  CG2 . ILE C 2 70  ? 67.590 13.629  50.984  1.00 21.47 ? 70   ILE C CG2 1 
ATOM   7723 C  CD1 . ILE C 2 70  ? 67.280 15.537  48.620  1.00 25.28 ? 70   ILE C CD1 1 
ATOM   7724 N  N   . SER C 2 71  ? 71.420 14.386  50.481  1.00 30.13 ? 71   SER C N   1 
ATOM   7725 C  CA  . SER C 2 71  ? 72.239 15.201  51.369  1.00 29.08 ? 71   SER C CA  1 
ATOM   7726 C  C   . SER C 2 71  ? 72.668 16.467  50.652  1.00 26.30 ? 71   SER C C   1 
ATOM   7727 O  O   . SER C 2 71  ? 72.581 16.543  49.432  1.00 29.77 ? 71   SER C O   1 
ATOM   7728 C  CB  . SER C 2 71  ? 73.471 14.427  51.841  1.00 29.74 ? 71   SER C CB  1 
ATOM   7729 O  OG  . SER C 2 71  ? 74.282 14.070  50.737  1.00 31.78 ? 71   SER C OG  1 
ATOM   7730 N  N   . ARG C 2 72  ? 73.146 17.453  51.407  1.00 26.98 ? 72   ARG C N   1 
ATOM   7731 C  CA  . ARG C 2 72  ? 73.621 18.692  50.806  1.00 31.56 ? 72   ARG C CA  1 
ATOM   7732 C  C   . ARG C 2 72  ? 74.851 19.261  51.531  1.00 31.93 ? 72   ARG C C   1 
ATOM   7733 O  O   . ARG C 2 72  ? 75.008 19.103  52.743  1.00 30.58 ? 72   ARG C O   1 
ATOM   7734 C  CB  . ARG C 2 72  ? 72.492 19.737  50.780  1.00 24.55 ? 72   ARG C CB  1 
ATOM   7735 C  CG  . ARG C 2 72  ? 72.051 20.220  52.156  1.00 34.94 ? 72   ARG C CG  1 
ATOM   7736 C  CD  . ARG C 2 72  ? 70.767 21.049  52.084  1.00 36.91 ? 72   ARG C CD  1 
ATOM   7737 N  NE  . ARG C 2 72  ? 70.949 22.263  51.290  1.00 30.80 ? 72   ARG C NE  1 
ATOM   7738 C  CZ  . ARG C 2 72  ? 69.960 22.993  50.790  1.00 32.15 ? 72   ARG C CZ  1 
ATOM   7739 N  NH1 . ARG C 2 72  ? 68.692 22.645  50.999  1.00 23.69 ? 72   ARG C NH1 1 
ATOM   7740 N  NH2 . ARG C 2 72  ? 70.245 24.076  50.075  1.00 32.74 ? 72   ARG C NH2 1 
ATOM   7741 N  N   . ASP C 2 73  ? 75.718 19.927  50.775  1.00 28.49 ? 73   ASP C N   1 
ATOM   7742 C  CA  . ASP C 2 73  ? 76.846 20.645  51.360  1.00 43.78 ? 73   ASP C CA  1 
ATOM   7743 C  C   . ASP C 2 73  ? 76.730 22.123  51.024  1.00 39.35 ? 73   ASP C C   1 
ATOM   7744 O  O   . ASP C 2 73  ? 77.045 22.533  49.913  1.00 39.03 ? 73   ASP C O   1 
ATOM   7745 C  CB  . ASP C 2 73  ? 78.182 20.084  50.854  1.00 45.62 ? 73   ASP C CB  1 
ATOM   7746 C  CG  . ASP C 2 73  ? 79.375 20.596  51.656  1.00 45.11 ? 73   ASP C CG  1 
ATOM   7747 O  OD1 . ASP C 2 73  ? 79.375 21.776  52.076  1.00 43.90 ? 73   ASP C OD1 1 
ATOM   7748 O  OD2 . ASP C 2 73  ? 80.315 19.803  51.875  1.00 50.58 ? 73   ASP C OD2 1 
ATOM   7749 N  N   . ASN C 2 74  ? 76.284 22.917  51.990  1.00 41.44 ? 74   ASN C N   1 
ATOM   7750 C  CA  . ASN C 2 74  ? 75.987 24.323  51.748  1.00 43.96 ? 74   ASN C CA  1 
ATOM   7751 C  C   . ASN C 2 74  ? 77.219 25.176  51.464  1.00 49.37 ? 74   ASN C C   1 
ATOM   7752 O  O   . ASN C 2 74  ? 77.150 26.129  50.687  1.00 47.42 ? 74   ASN C O   1 
ATOM   7753 C  CB  . ASN C 2 74  ? 75.210 24.895  52.930  1.00 37.18 ? 74   ASN C CB  1 
ATOM   7754 C  CG  . ASN C 2 74  ? 73.748 24.492  52.897  1.00 39.07 ? 74   ASN C CG  1 
ATOM   7755 O  OD1 . ASN C 2 74  ? 73.326 23.757  52.005  1.00 32.58 ? 74   ASN C OD1 1 
ATOM   7756 N  ND2 . ASN C 2 74  ? 72.969 24.968  53.867  1.00 38.23 ? 74   ASN C ND2 1 
ATOM   7757 N  N   . ALA C 2 75  ? 78.339 24.833  52.090  1.00 46.90 ? 75   ALA C N   1 
ATOM   7758 C  CA  . ALA C 2 75  ? 79.597 25.514  51.805  1.00 51.48 ? 75   ALA C CA  1 
ATOM   7759 C  C   . ALA C 2 75  ? 79.993 25.283  50.351  1.00 51.13 ? 75   ALA C C   1 
ATOM   7760 O  O   . ALA C 2 75  ? 80.418 26.209  49.652  1.00 56.55 ? 75   ALA C O   1 
ATOM   7761 C  CB  . ALA C 2 75  ? 80.693 25.032  52.742  1.00 48.03 ? 75   ALA C CB  1 
ATOM   7762 N  N   . LYS C 2 76  ? 79.823 24.045  49.898  1.00 43.42 ? 76   LYS C N   1 
ATOM   7763 C  CA  . LYS C 2 76  ? 80.209 23.646  48.550  1.00 42.06 ? 76   LYS C CA  1 
ATOM   7764 C  C   . LYS C 2 76  ? 79.100 23.848  47.512  1.00 46.58 ? 76   LYS C C   1 
ATOM   7765 O  O   . LYS C 2 76  ? 79.236 23.411  46.368  1.00 39.34 ? 76   LYS C O   1 
ATOM   7766 C  CB  . LYS C 2 76  ? 80.640 22.178  48.546  1.00 42.35 ? 76   LYS C CB  1 
ATOM   7767 C  CG  . LYS C 2 76  ? 81.908 21.874  49.329  1.00 38.92 ? 76   LYS C CG  1 
ATOM   7768 C  CD  . LYS C 2 76  ? 82.109 20.370  49.418  0.00 45.83 ? 76   LYS C CD  1 
ATOM   7769 C  CE  . LYS C 2 76  ? 83.544 19.960  49.154  0.00 47.41 ? 76   LYS C CE  1 
ATOM   7770 N  NZ  . LYS C 2 76  ? 83.671 18.476  49.113  0.00 49.27 ? 76   LYS C NZ  1 
ATOM   7771 N  N   . ASN C 2 77  ? 78.006 24.494  47.916  1.00 46.15 ? 77   ASN C N   1 
ATOM   7772 C  CA  . ASN C 2 77  ? 76.869 24.748  47.025  1.00 44.46 ? 77   ASN C CA  1 
ATOM   7773 C  C   . ASN C 2 77  ? 76.439 23.524  46.209  1.00 41.86 ? 77   ASN C C   1 
ATOM   7774 O  O   . ASN C 2 77  ? 76.190 23.628  45.008  1.00 43.83 ? 77   ASN C O   1 
ATOM   7775 C  CB  . ASN C 2 77  ? 77.193 25.903  46.068  1.00 44.15 ? 77   ASN C CB  1 
ATOM   7776 C  CG  . ASN C 2 77  ? 77.193 27.249  46.756  1.00 41.35 ? 77   ASN C CG  1 
ATOM   7777 O  OD1 . ASN C 2 77  ? 76.249 27.600  47.460  0.00 43.78 ? 77   ASN C OD1 1 
ATOM   7778 N  ND2 . ASN C 2 77  ? 78.261 28.013  46.558  0.00 45.15 ? 77   ASN C ND2 1 
ATOM   7779 N  N   . THR C 2 78  ? 76.359 22.364  46.852  1.00 41.58 ? 78   THR C N   1 
ATOM   7780 C  CA  . THR C 2 78  ? 76.066 21.142  46.114  1.00 40.54 ? 78   THR C CA  1 
ATOM   7781 C  C   . THR C 2 78  ? 75.043 20.250  46.828  1.00 40.57 ? 78   THR C C   1 
ATOM   7782 O  O   . THR C 2 78  ? 75.025 20.155  48.060  1.00 36.26 ? 78   THR C O   1 
ATOM   7783 C  CB  . THR C 2 78  ? 77.368 20.348  45.846  1.00 45.61 ? 78   THR C CB  1 
ATOM   7784 O  OG1 . THR C 2 78  ? 78.304 21.195  45.164  1.00 48.02 ? 78   THR C OG1 1 
ATOM   7785 C  CG2 . THR C 2 78  ? 77.106 19.109  44.994  1.00 36.49 ? 78   THR C CG2 1 
ATOM   7786 N  N   . LEU C 2 79  ? 74.186 19.618  46.030  1.00 36.28 ? 79   LEU C N   1 
ATOM   7787 C  CA  . LEU C 2 79  ? 73.183 18.678  46.515  1.00 36.61 ? 79   LEU C CA  1 
ATOM   7788 C  C   . LEU C 2 79  ? 73.493 17.293  45.985  1.00 36.05 ? 79   LEU C C   1 
ATOM   7789 O  O   . LEU C 2 79  ? 73.873 17.148  44.825  1.00 38.32 ? 79   LEU C O   1 
ATOM   7790 C  CB  . LEU C 2 79  ? 71.781 19.102  46.073  1.00 37.37 ? 79   LEU C CB  1 
ATOM   7791 C  CG  . LEU C 2 79  ? 70.624 18.160  46.408  1.00 31.91 ? 79   LEU C CG  1 
ATOM   7792 C  CD1 . LEU C 2 79  ? 70.205 18.328  47.861  1.00 30.84 ? 79   LEU C CD1 1 
ATOM   7793 C  CD2 . LEU C 2 79  ? 69.455 18.401  45.473  1.00 34.68 ? 79   LEU C CD2 1 
ATOM   7794 N  N   . TYR C 2 80  ? 73.324 16.273  46.817  1.00 29.03 ? 80   TYR C N   1 
ATOM   7795 C  CA  . TYR C 2 80  ? 73.608 14.919  46.366  1.00 35.53 ? 80   TYR C CA  1 
ATOM   7796 C  C   . TYR C 2 80  ? 72.418 13.990  46.479  1.00 32.46 ? 80   TYR C C   1 
ATOM   7797 O  O   . TYR C 2 80  ? 71.499 14.220  47.260  1.00 32.05 ? 80   TYR C O   1 
ATOM   7798 C  CB  . TYR C 2 80  ? 74.769 14.314  47.158  1.00 33.68 ? 80   TYR C CB  1 
ATOM   7799 C  CG  . TYR C 2 80  ? 75.995 15.187  47.233  1.00 34.01 ? 80   TYR C CG  1 
ATOM   7800 C  CD1 . TYR C 2 80  ? 76.971 15.137  46.246  1.00 39.07 ? 80   TYR C CD1 1 
ATOM   7801 C  CD2 . TYR C 2 80  ? 76.185 16.052  48.301  1.00 40.39 ? 80   TYR C CD2 1 
ATOM   7802 C  CE1 . TYR C 2 80  ? 78.105 15.933  46.321  1.00 38.29 ? 80   TYR C CE1 1 
ATOM   7803 C  CE2 . TYR C 2 80  ? 77.310 16.848  48.385  1.00 43.93 ? 80   TYR C CE2 1 
ATOM   7804 C  CZ  . TYR C 2 80  ? 78.267 16.785  47.392  1.00 43.38 ? 80   TYR C CZ  1 
ATOM   7805 O  OH  . TYR C 2 80  ? 79.385 17.581  47.482  1.00 52.52 ? 80   TYR C OH  1 
ATOM   7806 N  N   . LEU C 2 81  ? 72.458 12.924  45.693  1.00 29.88 ? 81   LEU C N   1 
ATOM   7807 C  CA  . LEU C 2 81  ? 71.557 11.804  45.869  1.00 34.37 ? 81   LEU C CA  1 
ATOM   7808 C  C   . LEU C 2 81  ? 72.358 10.512  45.761  1.00 34.01 ? 81   LEU C C   1 
ATOM   7809 O  O   . LEU C 2 81  ? 72.841 10.166  44.689  1.00 38.10 ? 81   LEU C O   1 
ATOM   7810 C  CB  . LEU C 2 81  ? 70.433 11.823  44.836  1.00 31.14 ? 81   LEU C CB  1 
ATOM   7811 C  CG  . LEU C 2 81  ? 69.377 10.737  45.046  1.00 33.43 ? 81   LEU C CG  1 
ATOM   7812 C  CD1 . LEU C 2 81  ? 68.598 11.000  46.322  1.00 32.39 ? 81   LEU C CD1 1 
ATOM   7813 C  CD2 . LEU C 2 81  ? 68.439 10.606  43.858  1.00 29.12 ? 81   LEU C CD2 1 
ATOM   7814 N  N   . GLN C 2 82  ? 72.516 9.810   46.873  1.00 33.82 ? 82   GLN C N   1 
ATOM   7815 C  CA  . GLN C 2 82  ? 73.154 8.505   46.839  1.00 35.11 ? 82   GLN C CA  1 
ATOM   7816 C  C   . GLN C 2 82  ? 72.109 7.418   46.588  1.00 34.02 ? 82   GLN C C   1 
ATOM   7817 O  O   . GLN C 2 82  ? 71.194 7.224   47.388  1.00 32.75 ? 82   GLN C O   1 
ATOM   7818 C  CB  . GLN C 2 82  ? 73.909 8.237   48.140  1.00 31.89 ? 82   GLN C CB  1 
ATOM   7819 C  CG  . GLN C 2 82  ? 74.695 6.933   48.127  1.00 37.37 ? 82   GLN C CG  1 
ATOM   7820 C  CD  . GLN C 2 82  ? 74.773 6.293   49.497  1.00 39.42 ? 82   GLN C CD  1 
ATOM   7821 O  OE1 . GLN C 2 82  ? 74.841 5.071   49.622  0.00 42.01 ? 82   GLN C OE1 1 
ATOM   7822 N  NE2 . GLN C 2 82  ? 74.763 7.120   50.536  0.00 41.46 ? 82   GLN C NE2 1 
ATOM   7823 N  N   . MET C 2 83  ? 72.247 6.713   45.471  1.00 32.91 ? 83   MET C N   1 
ATOM   7824 C  CA  . MET C 2 83  ? 71.285 5.687   45.089  1.00 34.11 ? 83   MET C CA  1 
ATOM   7825 C  C   . MET C 2 83  ? 71.883 4.286   45.210  1.00 39.88 ? 83   MET C C   1 
ATOM   7826 O  O   . MET C 2 83  ? 72.951 4.015   44.669  1.00 43.61 ? 83   MET C O   1 
ATOM   7827 C  CB  . MET C 2 83  ? 70.793 5.938   43.660  1.00 35.30 ? 83   MET C CB  1 
ATOM   7828 C  CG  . MET C 2 83  ? 70.306 7.360   43.439  1.00 36.80 ? 83   MET C CG  1 
ATOM   7829 S  SD  . MET C 2 83  ? 70.252 7.895   41.714  1.00 45.65 ? 83   MET C SD  1 
ATOM   7830 C  CE  . MET C 2 83  ? 68.862 6.951   41.126  1.00 30.08 ? 83   MET C CE  1 
ATOM   7831 N  N   . ASN C 2 84  ? 71.193 3.403   45.925  1.00 37.09 ? 84   ASN C N   1 
ATOM   7832 C  CA  . ASN C 2 84  ? 71.659 2.033   46.120  1.00 37.39 ? 84   ASN C CA  1 
ATOM   7833 C  C   . ASN C 2 84  ? 70.632 1.032   45.642  1.00 35.58 ? 84   ASN C C   1 
ATOM   7834 O  O   . ASN C 2 84  ? 69.466 1.375   45.487  1.00 35.41 ? 84   ASN C O   1 
ATOM   7835 C  CB  . ASN C 2 84  ? 71.984 1.782   47.591  1.00 34.57 ? 84   ASN C CB  1 
ATOM   7836 C  CG  . ASN C 2 84  ? 73.173 2.587   48.062  1.00 37.53 ? 84   ASN C CG  1 
ATOM   7837 O  OD1 . ASN C 2 84  ? 74.219 2.594   47.419  1.00 41.92 ? 84   ASN C OD1 1 
ATOM   7838 N  ND2 . ASN C 2 84  ? 73.013 3.289   49.175  1.00 36.71 ? 84   ASN C ND2 1 
ATOM   7839 N  N   . SER C 2 85  ? 71.072 -0.202  45.413  1.00 37.00 ? 85   SER C N   1 
ATOM   7840 C  CA  . SER C 2 85  ? 70.202 -1.268  44.927  1.00 36.34 ? 85   SER C CA  1 
ATOM   7841 C  C   . SER C 2 85  ? 69.290 -0.805  43.801  1.00 37.25 ? 85   SER C C   1 
ATOM   7842 O  O   . SER C 2 85  ? 68.085 -1.035  43.840  1.00 40.25 ? 85   SER C O   1 
ATOM   7843 C  CB  . SER C 2 85  ? 69.360 -1.830  46.066  1.00 36.35 ? 85   SER C CB  1 
ATOM   7844 O  OG  . SER C 2 85  ? 70.182 -2.435  47.041  1.00 45.16 ? 85   SER C OG  1 
ATOM   7845 N  N   . LEU C 2 86  ? 69.873 -0.138  42.813  1.00 35.92 ? 86   LEU C N   1 
ATOM   7846 C  CA  . LEU C 2 86  ? 69.123 0.387   41.679  1.00 36.72 ? 86   LEU C CA  1 
ATOM   7847 C  C   . LEU C 2 86  ? 68.377 -0.709  40.930  1.00 42.58 ? 86   LEU C C   1 
ATOM   7848 O  O   . LEU C 2 86  ? 68.892 -1.808  40.754  1.00 45.65 ? 86   LEU C O   1 
ATOM   7849 C  CB  . LEU C 2 86  ? 70.068 1.124   40.734  1.00 39.00 ? 86   LEU C CB  1 
ATOM   7850 C  CG  . LEU C 2 86  ? 70.561 2.461   41.283  1.00 35.50 ? 86   LEU C CG  1 
ATOM   7851 C  CD1 . LEU C 2 86  ? 71.717 2.993   40.472  1.00 37.58 ? 86   LEU C CD1 1 
ATOM   7852 C  CD2 . LEU C 2 86  ? 69.409 3.457   41.291  1.00 39.88 ? 86   LEU C CD2 1 
ATOM   7853 N  N   . LYS C 2 87  ? 67.154 -0.404  40.509  1.00 45.71 ? 87   LYS C N   1 
ATOM   7854 C  CA  . LYS C 2 87  ? 66.343 -1.327  39.725  1.00 45.41 ? 87   LYS C CA  1 
ATOM   7855 C  C   . LYS C 2 87  ? 66.105 -0.749  38.337  1.00 46.59 ? 87   LYS C C   1 
ATOM   7856 O  O   . LYS C 2 87  ? 66.374 0.430   38.095  1.00 44.40 ? 87   LYS C O   1 
ATOM   7857 C  CB  . LYS C 2 87  ? 65.003 -1.596  40.406  1.00 42.56 ? 87   LYS C CB  1 
ATOM   7858 C  CG  . LYS C 2 87  ? 65.091 -1.961  41.873  0.00 43.37 ? 87   LYS C CG  1 
ATOM   7859 C  CD  . LYS C 2 87  ? 63.701 -2.014  42.484  0.00 42.87 ? 87   LYS C CD  1 
ATOM   7860 C  CE  . LYS C 2 87  ? 63.753 -2.284  43.976  0.00 42.07 ? 87   LYS C CE  1 
ATOM   7861 N  NZ  . LYS C 2 87  ? 62.398 -2.219  44.588  0.00 42.19 ? 87   LYS C NZ  1 
ATOM   7862 N  N   . SER C 2 88  ? 65.600 -1.578  37.429  1.00 46.29 ? 88   SER C N   1 
ATOM   7863 C  CA  . SER C 2 88  ? 65.251 -1.111  36.094  1.00 51.55 ? 88   SER C CA  1 
ATOM   7864 C  C   . SER C 2 88  ? 64.233 0.017   36.197  1.00 45.53 ? 88   SER C C   1 
ATOM   7865 O  O   . SER C 2 88  ? 64.277 0.982   35.438  1.00 44.93 ? 88   SER C O   1 
ATOM   7866 C  CB  . SER C 2 88  ? 64.700 -2.257  35.245  1.00 50.04 ? 88   SER C CB  1 
ATOM   7867 O  OG  . SER C 2 88  ? 63.586 -2.861  35.879  1.00 51.33 ? 88   SER C OG  1 
ATOM   7868 N  N   . GLU C 2 89  ? 63.342 -0.103  37.175  1.00 48.69 ? 89   GLU C N   1 
ATOM   7869 C  CA  . GLU C 2 89  ? 62.294 0.882   37.408  1.00 47.71 ? 89   GLU C CA  1 
ATOM   7870 C  C   . GLU C 2 89  ? 62.831 2.284   37.720  1.00 46.26 ? 89   GLU C C   1 
ATOM   7871 O  O   . GLU C 2 89  ? 62.079 3.253   37.666  1.00 47.22 ? 89   GLU C O   1 
ATOM   7872 C  CB  . GLU C 2 89  ? 61.391 0.411   38.549  1.00 53.95 ? 89   GLU C CB  1 
ATOM   7873 C  CG  . GLU C 2 89  ? 60.884 -1.017  38.402  0.00 50.89 ? 89   GLU C CG  1 
ATOM   7874 C  CD  . GLU C 2 89  ? 59.763 -1.144  37.389  0.00 51.99 ? 89   GLU C CD  1 
ATOM   7875 O  OE1 . GLU C 2 89  ? 59.495 -2.276  36.935  0.00 52.80 ? 89   GLU C OE1 1 
ATOM   7876 O  OE2 . GLU C 2 89  ? 59.143 -0.113  37.054  0.00 52.09 ? 89   GLU C OE2 1 
ATOM   7877 N  N   . ASP C 2 90  ? 64.123 2.391   38.032  1.00 46.54 ? 90   ASP C N   1 
ATOM   7878 C  CA  . ASP C 2 90  ? 64.733 3.677   38.387  1.00 41.37 ? 90   ASP C CA  1 
ATOM   7879 C  C   . ASP C 2 90  ? 65.308 4.454   37.193  1.00 44.53 ? 90   ASP C C   1 
ATOM   7880 O  O   . ASP C 2 90  ? 65.776 5.583   37.358  1.00 44.80 ? 90   ASP C O   1 
ATOM   7881 C  CB  . ASP C 2 90  ? 65.851 3.479   39.420  1.00 45.33 ? 90   ASP C CB  1 
ATOM   7882 C  CG  . ASP C 2 90  ? 65.342 2.959   40.759  1.00 50.06 ? 90   ASP C CG  1 
ATOM   7883 O  OD1 . ASP C 2 90  ? 64.358 3.516   41.292  1.00 46.65 ? 90   ASP C OD1 1 
ATOM   7884 O  OD2 . ASP C 2 90  ? 65.934 1.988   41.281  1.00 43.54 ? 90   ASP C OD2 1 
ATOM   7885 N  N   . THR C 2 91  ? 65.298 3.858   36.004  1.00 41.85 ? 91   THR C N   1 
ATOM   7886 C  CA  . THR C 2 91  ? 65.847 4.533   34.827  1.00 42.37 ? 91   THR C CA  1 
ATOM   7887 C  C   . THR C 2 91  ? 65.037 5.786   34.473  1.00 42.43 ? 91   THR C C   1 
ATOM   7888 O  O   . THR C 2 91  ? 63.837 5.710   34.212  1.00 40.13 ? 91   THR C O   1 
ATOM   7889 C  CB  . THR C 2 91  ? 65.901 3.589   33.600  1.00 45.48 ? 91   THR C CB  1 
ATOM   7890 O  OG1 . THR C 2 91  ? 66.888 2.570   33.813  1.00 45.84 ? 91   THR C OG1 1 
ATOM   7891 C  CG2 . THR C 2 91  ? 66.258 4.365   32.348  1.00 39.63 ? 91   THR C CG2 1 
ATOM   7892 N  N   . ALA C 2 92  ? 65.701 6.938   34.479  1.00 40.61 ? 92   ALA C N   1 
ATOM   7893 C  CA  . ALA C 2 92  ? 65.040 8.201   34.175  1.00 38.18 ? 92   ALA C CA  1 
ATOM   7894 C  C   . ALA C 2 92  ? 66.039 9.320   33.991  1.00 37.38 ? 92   ALA C C   1 
ATOM   7895 O  O   . ALA C 2 92  ? 67.230 9.163   34.251  1.00 39.46 ? 92   ALA C O   1 
ATOM   7896 C  CB  . ALA C 2 92  ? 64.052 8.574   35.283  1.00 38.80 ? 92   ALA C CB  1 
ATOM   7897 N  N   . LEU C 2 93  ? 65.538 10.457  33.532  1.00 37.09 ? 93   LEU C N   1 
ATOM   7898 C  CA  . LEU C 2 93  ? 66.274 11.694  33.637  1.00 41.55 ? 93   LEU C CA  1 
ATOM   7899 C  C   . LEU C 2 93  ? 66.013 12.182  35.057  1.00 38.32 ? 93   LEU C C   1 
ATOM   7900 O  O   . LEU C 2 93  ? 64.868 12.180  35.510  1.00 35.01 ? 93   LEU C O   1 
ATOM   7901 C  CB  . LEU C 2 93  ? 65.815 12.698  32.571  1.00 44.02 ? 93   LEU C CB  1 
ATOM   7902 C  CG  . LEU C 2 93  ? 66.686 13.905  32.224  0.00 44.52 ? 93   LEU C CG  1 
ATOM   7903 C  CD1 . LEU C 2 93  ? 68.147 13.519  32.161  0.00 44.44 ? 93   LEU C CD1 1 
ATOM   7904 C  CD2 . LEU C 2 93  ? 66.244 14.479  30.890  0.00 45.08 ? 93   LEU C CD2 1 
ATOM   7905 N  N   . TYR C 2 94  ? 67.075 12.553  35.766  1.00 42.71 ? 94   TYR C N   1 
ATOM   7906 C  CA  . TYR C 2 94  ? 66.972 13.004  37.152  1.00 35.06 ? 94   TYR C CA  1 
ATOM   7907 C  C   . TYR C 2 94  ? 67.243 14.495  37.267  1.00 37.56 ? 94   TYR C C   1 
ATOM   7908 O  O   . TYR C 2 94  ? 68.294 14.975  36.846  1.00 40.48 ? 94   TYR C O   1 
ATOM   7909 C  CB  . TYR C 2 94  ? 67.941 12.223  38.049  1.00 33.69 ? 94   TYR C CB  1 
ATOM   7910 C  CG  . TYR C 2 94  ? 67.415 10.866  38.458  1.00 35.56 ? 94   TYR C CG  1 
ATOM   7911 C  CD1 . TYR C 2 94  ? 67.319 9.834   37.539  1.00 33.58 ? 94   TYR C CD1 1 
ATOM   7912 C  CD2 . TYR C 2 94  ? 67.011 10.620  39.767  1.00 34.57 ? 94   TYR C CD2 1 
ATOM   7913 C  CE1 . TYR C 2 94  ? 66.831 8.595   37.905  1.00 38.15 ? 94   TYR C CE1 1 
ATOM   7914 C  CE2 . TYR C 2 94  ? 66.516 9.383   40.142  1.00 32.46 ? 94   TYR C CE2 1 
ATOM   7915 C  CZ  . TYR C 2 94  ? 66.432 8.374   39.206  1.00 38.46 ? 94   TYR C CZ  1 
ATOM   7916 O  OH  . TYR C 2 94  ? 65.951 7.135   39.566  1.00 36.42 ? 94   TYR C OH  1 
ATOM   7917 N  N   . TYR C 2 95  ? 66.290 15.218  37.850  1.00 38.84 ? 95   TYR C N   1 
ATOM   7918 C  CA  . TYR C 2 95  ? 66.364 16.672  37.936  1.00 34.70 ? 95   TYR C CA  1 
ATOM   7919 C  C   . TYR C 2 95  ? 66.599 17.190  39.343  1.00 37.61 ? 95   TYR C C   1 
ATOM   7920 O  O   . TYR C 2 95  ? 66.095 16.647  40.320  1.00 35.46 ? 95   TYR C O   1 
ATOM   7921 C  CB  . TYR C 2 95  ? 65.084 17.308  37.411  1.00 37.43 ? 95   TYR C CB  1 
ATOM   7922 C  CG  . TYR C 2 95  ? 64.778 17.031  35.967  1.00 38.96 ? 95   TYR C CG  1 
ATOM   7923 C  CD1 . TYR C 2 95  ? 65.321 17.816  34.958  1.00 43.94 ? 95   TYR C CD1 1 
ATOM   7924 C  CD2 . TYR C 2 95  ? 63.924 16.003  35.610  1.00 43.18 ? 95   TYR C CD2 1 
ATOM   7925 C  CE1 . TYR C 2 95  ? 65.031 17.574  33.636  1.00 44.40 ? 95   TYR C CE1 1 
ATOM   7926 C  CE2 . TYR C 2 95  ? 63.628 15.751  34.290  1.00 46.72 ? 95   TYR C CE2 1 
ATOM   7927 C  CZ  . TYR C 2 95  ? 64.183 16.540  33.307  1.00 45.78 ? 95   TYR C CZ  1 
ATOM   7928 O  OH  . TYR C 2 95  ? 63.885 16.284  31.990  1.00 56.04 ? 95   TYR C OH  1 
ATOM   7929 N  N   . CYS C 2 96  ? 67.344 18.281  39.409  1.00 36.32 ? 96   CYS C N   1 
ATOM   7930 C  CA  . CYS C 2 96  ? 67.609 19.013  40.632  1.00 36.91 ? 96   CYS C CA  1 
ATOM   7931 C  C   . CYS C 2 96  ? 66.769 20.303  40.653  1.00 38.90 ? 96   CYS C C   1 
ATOM   7932 O  O   . CYS C 2 96  ? 66.761 21.043  39.668  1.00 39.15 ? 96   CYS C O   1 
ATOM   7933 C  CB  . CYS C 2 96  ? 69.104 19.321  40.702  1.00 34.92 ? 96   CYS C CB  1 
ATOM   7934 S  SG  . CYS C 2 96  ? 69.627 20.394  42.012  1.00 59.44 ? 96   CYS C SG  1 
ATOM   7935 N  N   . ALA C 2 97  ? 66.066 20.583  41.752  1.00 32.04 ? 97   ALA C N   1 
ATOM   7936 C  CA  . ALA C 2 97  ? 65.206 21.779  41.793  1.00 34.09 ? 97   ALA C CA  1 
ATOM   7937 C  C   . ALA C 2 97  ? 64.977 22.350  43.195  1.00 30.58 ? 97   ALA C C   1 
ATOM   7938 O  O   . ALA C 2 97  ? 65.191 21.675  44.205  1.00 28.07 ? 97   ALA C O   1 
ATOM   7939 C  CB  . ALA C 2 97  ? 63.870 21.473  41.141  1.00 24.86 ? 97   ALA C CB  1 
ATOM   7940 N  N   . VAL C 2 98  ? 64.542 23.606  43.244  1.00 29.09 ? 98   VAL C N   1 
ATOM   7941 C  CA  . VAL C 2 98  ? 64.234 24.264  44.511  1.00 23.71 ? 98   VAL C CA  1 
ATOM   7942 C  C   . VAL C 2 98  ? 62.766 24.057  44.884  1.00 24.21 ? 98   VAL C C   1 
ATOM   7943 O  O   . VAL C 2 98  ? 62.320 24.444  45.955  1.00 26.04 ? 98   VAL C O   1 
ATOM   7944 C  CB  . VAL C 2 98  ? 64.529 25.762  44.451  1.00 27.45 ? 98   VAL C CB  1 
ATOM   7945 C  CG1 . VAL C 2 98  ? 66.003 25.994  44.142  1.00 27.74 ? 98   VAL C CG1 1 
ATOM   7946 C  CG2 . VAL C 2 98  ? 63.628 26.435  43.420  1.00 28.03 ? 98   VAL C CG2 1 
ATOM   7947 N  N   . GLY C 2 99  ? 62.025 23.447  43.977  1.00 24.98 ? 99   GLY C N   1 
ATOM   7948 C  CA  . GLY C 2 99  ? 60.619 23.182  44.184  1.00 28.07 ? 99   GLY C CA  1 
ATOM   7949 C  C   . GLY C 2 99  ? 60.244 22.070  43.249  1.00 23.99 ? 99   GLY C C   1 
ATOM   7950 O  O   . GLY C 2 99  ? 60.781 21.971  42.156  1.00 33.23 ? 99   GLY C O   1 
ATOM   7951 N  N   . MET C 2 100 ? 59.319 21.233  43.687  1.00 30.31 ? 100  MET C N   1 
ATOM   7952 C  CA  . MET C 2 100 ? 58.901 20.054  42.949  1.00 28.25 ? 100  MET C CA  1 
ATOM   7953 C  C   . MET C 2 100 ? 58.364 20.391  41.554  1.00 29.62 ? 100  MET C C   1 
ATOM   7954 O  O   . MET C 2 100 ? 58.552 19.640  40.607  1.00 27.58 ? 100  MET C O   1 
ATOM   7955 C  CB  . MET C 2 100 ? 57.839 19.328  43.775  1.00 33.86 ? 100  MET C CB  1 
ATOM   7956 C  CG  . MET C 2 100 ? 57.488 17.936  43.358  1.00 36.78 ? 100  MET C CG  1 
ATOM   7957 S  SD  . MET C 2 100 ? 56.316 17.283  44.575  1.00 42.30 ? 100  MET C SD  1 
ATOM   7958 C  CE  . MET C 2 100 ? 57.369 17.143  46.015  1.00 36.77 ? 100  MET C CE  1 
ATOM   7959 N  N   . TYR C 2 101 ? 57.689 21.523  41.435  1.00 27.57 ? 101  TYR C N   1 
ATOM   7960 C  CA  . TYR C 2 101 ? 57.078 21.910  40.170  1.00 32.24 ? 101  TYR C CA  1 
ATOM   7961 C  C   . TYR C 2 101 ? 57.804 23.098  39.536  1.00 29.63 ? 101  TYR C C   1 
ATOM   7962 O  O   . TYR C 2 101 ? 57.255 23.801  38.688  1.00 33.76 ? 101  TYR C O   1 
ATOM   7963 C  CB  . TYR C 2 101 ? 55.601 22.242  40.387  1.00 26.49 ? 101  TYR C CB  1 
ATOM   7964 C  CG  . TYR C 2 101 ? 54.813 21.117  41.029  1.00 28.34 ? 101  TYR C CG  1 
ATOM   7965 C  CD1 . TYR C 2 101 ? 54.474 19.981  40.303  1.00 27.79 ? 101  TYR C CD1 1 
ATOM   7966 C  CD2 . TYR C 2 101 ? 54.404 21.193  42.359  1.00 25.44 ? 101  TYR C CD2 1 
ATOM   7967 C  CE1 . TYR C 2 101 ? 53.756 18.943  40.884  1.00 27.42 ? 101  TYR C CE1 1 
ATOM   7968 C  CE2 . TYR C 2 101 ? 53.684 20.161  42.947  1.00 24.51 ? 101  TYR C CE2 1 
ATOM   7969 C  CZ  . TYR C 2 101 ? 53.364 19.041  42.200  1.00 28.22 ? 101  TYR C CZ  1 
ATOM   7970 O  OH  . TYR C 2 101 ? 52.658 18.005  42.774  1.00 33.71 ? 101  TYR C OH  1 
ATOM   7971 N  N   . ALA C 2 102 ? 59.034 23.330  39.968  1.00 30.04 ? 102  ALA C N   1 
ATOM   7972 C  CA  . ALA C 2 102 ? 59.811 24.443  39.451  1.00 32.85 ? 102  ALA C CA  1 
ATOM   7973 C  C   . ALA C 2 102 ? 60.208 24.181  38.001  1.00 30.68 ? 102  ALA C C   1 
ATOM   7974 O  O   . ALA C 2 102 ? 60.316 23.037  37.580  1.00 36.79 ? 102  ALA C O   1 
ATOM   7975 C  CB  . ALA C 2 102 ? 61.037 24.676  40.304  1.00 30.64 ? 102  ALA C CB  1 
ATOM   7976 N  N   . ALA C 2 103 ? 60.408 25.254  37.244  1.00 35.15 ? 103  ALA C N   1 
ATOM   7977 C  CA  . ALA C 2 103 ? 60.876 25.157  35.869  1.00 34.92 ? 103  ALA C CA  1 
ATOM   7978 C  C   . ALA C 2 103 ? 62.202 25.904  35.747  1.00 36.94 ? 103  ALA C C   1 
ATOM   7979 O  O   . ALA C 2 103 ? 62.554 26.670  36.644  1.00 32.85 ? 103  ALA C O   1 
ATOM   7980 C  CB  . ALA C 2 103 ? 59.832 25.723  34.908  1.00 38.32 ? 103  ALA C CB  1 
ATOM   7981 N  N   . PRO C 2 104 ? 62.959 25.666  34.658  1.00 38.50 ? 104  PRO C N   1 
ATOM   7982 C  CA  . PRO C 2 104 ? 64.222 26.400  34.503  1.00 40.84 ? 104  PRO C CA  1 
ATOM   7983 C  C   . PRO C 2 104 ? 64.015 27.912  34.601  1.00 32.35 ? 104  PRO C C   1 
ATOM   7984 O  O   . PRO C 2 104 ? 62.978 28.405  34.167  1.00 39.18 ? 104  PRO C O   1 
ATOM   7985 C  CB  . PRO C 2 104 ? 64.694 25.994  33.106  1.00 36.32 ? 104  PRO C CB  1 
ATOM   7986 C  CG  . PRO C 2 104 ? 64.132 24.640  32.914  1.00 43.20 ? 104  PRO C CG  1 
ATOM   7987 C  CD  . PRO C 2 104 ? 62.793 24.642  33.610  1.00 41.43 ? 104  PRO C CD  1 
ATOM   7988 N  N   . PRO C 2 105 ? 64.981 28.635  35.178  1.00 32.84 ? 105  PRO C N   1 
ATOM   7989 C  CA  . PRO C 2 105 ? 66.283 28.148  35.648  1.00 38.04 ? 105  PRO C CA  1 
ATOM   7990 C  C   . PRO C 2 105 ? 66.259 27.466  37.021  1.00 44.14 ? 105  PRO C C   1 
ATOM   7991 O  O   . PRO C 2 105 ? 67.309 27.032  37.498  1.00 35.75 ? 105  PRO C O   1 
ATOM   7992 C  CB  . PRO C 2 105 ? 67.115 29.427  35.719  1.00 36.04 ? 105  PRO C CB  1 
ATOM   7993 C  CG  . PRO C 2 105 ? 66.126 30.472  36.076  1.00 36.52 ? 105  PRO C CG  1 
ATOM   7994 C  CD  . PRO C 2 105 ? 64.828 30.084  35.404  1.00 36.12 ? 105  PRO C CD  1 
ATOM   7995 N  N   . TRP C 2 106 ? 65.087 27.372  37.645  1.00 39.63 ? 106  TRP C N   1 
ATOM   7996 C  CA  . TRP C 2 106 ? 65.004 26.868  39.014  1.00 38.34 ? 106  TRP C CA  1 
ATOM   7997 C  C   . TRP C 2 106 ? 64.840 25.356  39.047  1.00 34.96 ? 106  TRP C C   1 
ATOM   7998 O  O   . TRP C 2 106 ? 64.701 24.751  40.107  1.00 33.14 ? 106  TRP C O   1 
ATOM   7999 C  CB  . TRP C 2 106 ? 63.871 27.563  39.755  1.00 34.41 ? 106  TRP C CB  1 
ATOM   8000 C  CG  . TRP C 2 106 ? 64.120 29.027  39.868  1.00 31.73 ? 106  TRP C CG  1 
ATOM   8001 C  CD1 . TRP C 2 106 ? 63.581 30.018  39.090  1.00 30.47 ? 106  TRP C CD1 1 
ATOM   8002 C  CD2 . TRP C 2 106 ? 64.998 29.674  40.792  1.00 33.55 ? 106  TRP C CD2 1 
ATOM   8003 N  NE1 . TRP C 2 106 ? 64.060 31.243  39.487  1.00 36.54 ? 106  TRP C NE1 1 
ATOM   8004 C  CE2 . TRP C 2 106 ? 64.933 31.060  40.529  1.00 31.86 ? 106  TRP C CE2 1 
ATOM   8005 C  CE3 . TRP C 2 106 ? 65.828 29.219  41.822  1.00 34.55 ? 106  TRP C CE3 1 
ATOM   8006 C  CZ2 . TRP C 2 106 ? 65.659 31.992  41.263  1.00 29.41 ? 106  TRP C CZ2 1 
ATOM   8007 C  CZ3 . TRP C 2 106 ? 66.553 30.147  42.547  1.00 33.03 ? 106  TRP C CZ3 1 
ATOM   8008 C  CH2 . TRP C 2 106 ? 66.463 31.521  42.264  1.00 34.49 ? 106  TRP C CH2 1 
ATOM   8009 N  N   . ARG C 2 107 ? 64.870 24.761  37.865  1.00 37.19 ? 107  ARG C N   1 
ATOM   8010 C  CA  . ARG C 2 107 ? 65.021 23.326  37.724  1.00 40.53 ? 107  ARG C CA  1 
ATOM   8011 C  C   . ARG C 2 107 ? 66.164 23.076  36.746  1.00 43.74 ? 107  ARG C C   1 
ATOM   8012 O  O   . ARG C 2 107 ? 66.359 23.839  35.805  1.00 45.74 ? 107  ARG C O   1 
ATOM   8013 C  CB  . ARG C 2 107 ? 63.732 22.683  37.236  1.00 34.23 ? 107  ARG C CB  1 
ATOM   8014 C  CG  . ARG C 2 107 ? 63.708 21.172  37.366  1.00 35.59 ? 107  ARG C CG  1 
ATOM   8015 C  CD  . ARG C 2 107 ? 63.022 20.548  36.167  1.00 41.95 ? 107  ARG C CD  1 
ATOM   8016 N  NE  . ARG C 2 107 ? 63.874 20.626  34.988  1.00 45.65 ? 107  ARG C NE  1 
ATOM   8017 C  CZ  . ARG C 2 107 ? 63.433 20.584  33.736  1.00 50.29 ? 107  ARG C CZ  1 
ATOM   8018 N  NH1 . ARG C 2 107 ? 62.134 20.476  33.486  1.00 47.96 ? 107  ARG C NH1 1 
ATOM   8019 N  NH2 . ARG C 2 107 ? 64.297 20.657  32.734  1.00 45.84 ? 107  ARG C NH2 1 
ATOM   8020 N  N   . GLY C 2 108 ? 66.925 22.016  36.973  1.00 49.65 ? 108  GLY C N   1 
ATOM   8021 C  CA  . GLY C 2 108 ? 68.097 21.754  36.159  1.00 47.48 ? 108  GLY C CA  1 
ATOM   8022 C  C   . GLY C 2 108 ? 67.795 21.096  34.829  1.00 45.33 ? 108  GLY C C   1 
ATOM   8023 O  O   . GLY C 2 108 ? 66.659 20.717  34.540  1.00 50.72 ? 108  GLY C O   1 
ATOM   8024 N  N   . GLN C 2 109 ? 68.834 20.959  34.016  1.00 53.89 ? 109  GLN C N   1 
ATOM   8025 C  CA  . GLN C 2 109 ? 68.723 20.297  32.723  1.00 48.88 ? 109  GLN C CA  1 
ATOM   8026 C  C   . GLN C 2 109 ? 68.607 18.790  32.897  1.00 48.92 ? 109  GLN C C   1 
ATOM   8027 O  O   . GLN C 2 109 ? 67.987 18.106  32.079  1.00 46.42 ? 109  GLN C O   1 
ATOM   8028 C  CB  . GLN C 2 109 ? 69.925 20.650  31.845  1.00 48.19 ? 109  GLN C CB  1 
ATOM   8029 C  CG  . GLN C 2 109 ? 69.653 21.742  30.822  0.00 48.89 ? 109  GLN C CG  1 
ATOM   8030 C  CD  . GLN C 2 109 ? 69.077 23.012  31.422  0.00 49.77 ? 109  GLN C CD  1 
ATOM   8031 O  OE1 . GLN C 2 109 ? 68.197 23.640  30.833  0.00 49.88 ? 109  GLN C OE1 1 
ATOM   8032 N  NE2 . GLN C 2 109 ? 69.581 23.405  32.586  0.00 49.39 ? 109  GLN C NE2 1 
ATOM   8033 N  N   . GLY C 2 110 ? 69.202 18.276  33.970  1.00 47.12 ? 110  GLY C N   1 
ATOM   8034 C  CA  . GLY C 2 110 ? 69.077 16.869  34.301  1.00 41.60 ? 110  GLY C CA  1 
ATOM   8035 C  C   . GLY C 2 110 ? 70.283 16.042  33.912  1.00 47.11 ? 110  GLY C C   1 
ATOM   8036 O  O   . GLY C 2 110 ? 71.126 16.475  33.127  1.00 51.40 ? 110  GLY C O   1 
ATOM   8037 N  N   . THR C 2 111 ? 70.368 14.848  34.486  1.00 44.39 ? 111  THR C N   1 
ATOM   8038 C  CA  . THR C 2 111 ? 71.410 13.894  34.148  1.00 40.03 ? 111  THR C CA  1 
ATOM   8039 C  C   . THR C 2 111 ? 70.769 12.521  33.991  1.00 43.51 ? 111  THR C C   1 
ATOM   8040 O  O   . THR C 2 111 ? 69.949 12.115  34.814  1.00 45.70 ? 111  THR C O   1 
ATOM   8041 C  CB  . THR C 2 111 ? 72.530 13.858  35.217  1.00 49.39 ? 111  THR C CB  1 
ATOM   8042 O  OG1 . THR C 2 111 ? 73.461 12.815  34.905  1.00 53.40 ? 111  THR C OG1 1 
ATOM   8043 C  CG2 . THR C 2 111 ? 71.963 13.619  36.608  1.00 43.67 ? 111  THR C CG2 1 
ATOM   8044 N  N   . GLN C 2 112 ? 71.105 11.823  32.911  1.00 45.79 ? 112  GLN C N   1 
ATOM   8045 C  CA  . GLN C 2 112 ? 70.468 10.545  32.621  1.00 41.91 ? 112  GLN C CA  1 
ATOM   8046 C  C   . GLN C 2 112 ? 71.157 9.429   33.384  1.00 44.85 ? 112  GLN C C   1 
ATOM   8047 O  O   . GLN C 2 112 ? 72.384 9.354   33.417  1.00 42.74 ? 112  GLN C O   1 
ATOM   8048 C  CB  . GLN C 2 112 ? 70.482 10.242  31.114  1.00 49.92 ? 112  GLN C CB  1 
ATOM   8049 C  CG  . GLN C 2 112 ? 69.909 8.859   30.726  1.00 46.51 ? 112  GLN C CG  1 
ATOM   8050 C  CD  . GLN C 2 112 ? 68.390 8.752   30.901  1.00 50.27 ? 112  GLN C CD  1 
ATOM   8051 O  OE1 . GLN C 2 112 ? 67.677 9.757   30.876  1.00 56.45 ? 112  GLN C OE1 1 
ATOM   8052 N  NE2 . GLN C 2 112 ? 67.894 7.526   31.076  1.00 45.93 ? 112  GLN C NE2 1 
ATOM   8053 N  N   . VAL C 2 113 ? 70.361 8.582   34.026  1.00 40.85 ? 113  VAL C N   1 
ATOM   8054 C  CA  . VAL C 2 113 ? 70.893 7.364   34.607  1.00 49.87 ? 113  VAL C CA  1 
ATOM   8055 C  C   . VAL C 2 113 ? 70.143 6.206   33.972  1.00 50.08 ? 113  VAL C C   1 
ATOM   8056 O  O   . VAL C 2 113 ? 68.943 6.297   33.697  1.00 43.72 ? 113  VAL C O   1 
ATOM   8057 C  CB  . VAL C 2 113 ? 70.787 7.328   36.164  1.00 47.25 ? 113  VAL C CB  1 
ATOM   8058 C  CG1 . VAL C 2 113 ? 70.964 8.727   36.752  1.00 40.26 ? 113  VAL C CG1 1 
ATOM   8059 C  CG2 . VAL C 2 113 ? 69.490 6.704   36.627  1.00 37.71 ? 113  VAL C CG2 1 
ATOM   8060 N  N   . THR C 2 114 ? 70.876 5.135   33.692  1.00 44.49 ? 114  THR C N   1 
ATOM   8061 C  CA  . THR C 2 114 ? 70.319 3.994   32.992  1.00 48.99 ? 114  THR C CA  1 
ATOM   8062 C  C   . THR C 2 114 ? 70.681 2.710   33.714  1.00 48.73 ? 114  THR C C   1 
ATOM   8063 O  O   . THR C 2 114 ? 71.846 2.470   34.030  1.00 54.00 ? 114  THR C O   1 
ATOM   8064 C  CB  . THR C 2 114 ? 70.827 3.916   31.540  1.00 53.21 ? 114  THR C CB  1 
ATOM   8065 O  OG1 . THR C 2 114 ? 70.657 5.185   30.894  1.00 48.67 ? 114  THR C OG1 1 
ATOM   8066 C  CG2 . THR C 2 114 ? 70.073 2.845   30.777  1.00 46.83 ? 114  THR C CG2 1 
ATOM   8067 N  N   . VAL C 2 115 ? 69.674 1.891   33.973  1.00 45.12 ? 115  VAL C N   1 
ATOM   8068 C  CA  . VAL C 2 115 ? 69.873 0.616   34.635  1.00 46.38 ? 115  VAL C CA  1 
ATOM   8069 C  C   . VAL C 2 115 ? 69.435 -0.520  33.717  1.00 55.50 ? 115  VAL C C   1 
ATOM   8070 O  O   . VAL C 2 115 ? 68.242 -0.680  33.445  1.00 53.96 ? 115  VAL C O   1 
ATOM   8071 C  CB  . VAL C 2 115 ? 69.083 0.538   35.954  1.00 49.87 ? 115  VAL C CB  1 
ATOM   8072 C  CG1 . VAL C 2 115 ? 69.408 -0.746  36.691  1.00 48.42 ? 115  VAL C CG1 1 
ATOM   8073 C  CG2 . VAL C 2 115 ? 69.377 1.747   36.828  1.00 46.03 ? 115  VAL C CG2 1 
ATOM   8074 N  N   . GLN D 2 1   ? 74.274 -12.046 23.117  1.00 51.65 ? 1    GLN D N   1 
ATOM   8075 C  CA  . GLN D 2 1   ? 73.004 -11.338 23.218  1.00 51.70 ? 1    GLN D CA  1 
ATOM   8076 C  C   . GLN D 2 1   ? 73.007 -10.058 22.386  1.00 53.61 ? 1    GLN D C   1 
ATOM   8077 O  O   . GLN D 2 1   ? 74.044 -9.409  22.230  1.00 50.63 ? 1    GLN D O   1 
ATOM   8078 C  CB  . GLN D 2 1   ? 72.691 -11.012 24.676  1.00 50.47 ? 1    GLN D CB  1 
ATOM   8079 C  CG  . GLN D 2 1   ? 73.785 -10.242 25.388  0.00 53.39 ? 1    GLN D CG  1 
ATOM   8080 C  CD  . GLN D 2 1   ? 73.306 -9.638  26.691  0.00 55.19 ? 1    GLN D CD  1 
ATOM   8081 O  OE1 . GLN D 2 1   ? 73.724 -10.050 27.772  0.00 57.00 ? 1    GLN D OE1 1 
ATOM   8082 N  NE2 . GLN D 2 1   ? 72.423 -8.651  26.593  0.00 54.20 ? 1    GLN D NE2 1 
ATOM   8083 N  N   . VAL D 2 2   ? 71.842 -9.696  21.854  1.00 53.21 ? 2    VAL D N   1 
ATOM   8084 C  CA  . VAL D 2 2   ? 71.730 -8.502  21.020  1.00 46.33 ? 2    VAL D CA  1 
ATOM   8085 C  C   . VAL D 2 2   ? 71.707 -7.243  21.891  1.00 39.86 ? 2    VAL D C   1 
ATOM   8086 O  O   . VAL D 2 2   ? 70.975 -7.158  22.881  1.00 39.31 ? 2    VAL D O   1 
ATOM   8087 C  CB  . VAL D 2 2   ? 70.479 -8.575  20.090  1.00 46.71 ? 2    VAL D CB  1 
ATOM   8088 C  CG1 . VAL D 2 2   ? 69.573 -9.730  20.488  0.00 43.96 ? 2    VAL D CG1 1 
ATOM   8089 C  CG2 . VAL D 2 2   ? 69.722 -7.249  20.053  0.00 40.49 ? 2    VAL D CG2 1 
ATOM   8090 N  N   . GLN D 2 3   ? 72.553 -6.282  21.531  1.00 41.60 ? 3    GLN D N   1 
ATOM   8091 C  CA  . GLN D 2 3   ? 72.677 -5.032  22.271  1.00 44.44 ? 3    GLN D CA  1 
ATOM   8092 C  C   . GLN D 2 3   ? 72.858 -3.843  21.327  1.00 43.93 ? 3    GLN D C   1 
ATOM   8093 O  O   . GLN D 2 3   ? 73.537 -3.938  20.294  1.00 36.06 ? 3    GLN D O   1 
ATOM   8094 C  CB  . GLN D 2 3   ? 73.859 -5.084  23.250  1.00 43.73 ? 3    GLN D CB  1 
ATOM   8095 C  CG  . GLN D 2 3   ? 73.781 -6.169  24.314  0.00 47.46 ? 3    GLN D CG  1 
ATOM   8096 C  CD  . GLN D 2 3   ? 74.995 -6.170  25.225  0.00 49.72 ? 3    GLN D CD  1 
ATOM   8097 O  OE1 . GLN D 2 3   ? 75.809 -5.247  25.192  0.00 49.18 ? 3    GLN D OE1 1 
ATOM   8098 N  NE2 . GLN D 2 3   ? 75.123 -7.208  26.042  0.00 51.83 ? 3    GLN D NE2 1 
ATOM   8099 N  N   . LEU D 2 4   ? 72.241 -2.728  21.700  1.00 34.06 ? 4    LEU D N   1 
ATOM   8100 C  CA  . LEU D 2 4   ? 72.440 -1.445  21.045  1.00 35.52 ? 4    LEU D CA  1 
ATOM   8101 C  C   . LEU D 2 4   ? 72.731 -0.418  22.122  1.00 41.98 ? 4    LEU D C   1 
ATOM   8102 O  O   . LEU D 2 4   ? 71.945 -0.263  23.054  1.00 43.60 ? 4    LEU D O   1 
ATOM   8103 C  CB  . LEU D 2 4   ? 71.211 -1.031  20.241  1.00 37.54 ? 4    LEU D CB  1 
ATOM   8104 C  CG  . LEU D 2 4   ? 70.797 -1.948  19.096  1.00 35.37 ? 4    LEU D CG  1 
ATOM   8105 C  CD1 . LEU D 2 4   ? 69.412 -1.575  18.597  1.00 38.00 ? 4    LEU D CD1 1 
ATOM   8106 C  CD2 . LEU D 2 4   ? 71.809 -1.874  17.974  1.00 38.97 ? 4    LEU D CD2 1 
ATOM   8107 N  N   . GLN D 2 5   ? 73.861 0.270   22.007  1.00 33.18 ? 5    GLN D N   1 
ATOM   8108 C  CA  . GLN D 2 5   ? 74.270 1.220   23.029  1.00 38.97 ? 5    GLN D CA  1 
ATOM   8109 C  C   . GLN D 2 5   ? 74.558 2.573   22.409  1.00 37.46 ? 5    GLN D C   1 
ATOM   8110 O  O   . GLN D 2 5   ? 75.488 2.710   21.615  1.00 38.03 ? 5    GLN D O   1 
ATOM   8111 C  CB  . GLN D 2 5   ? 75.509 0.719   23.775  1.00 38.97 ? 5    GLN D CB  1 
ATOM   8112 C  CG  . GLN D 2 5   ? 75.491 -0.758  24.117  0.00 42.33 ? 5    GLN D CG  1 
ATOM   8113 C  CD  . GLN D 2 5   ? 76.696 -1.172  24.936  0.00 45.26 ? 5    GLN D CD  1 
ATOM   8114 O  OE1 . GLN D 2 5   ? 77.536 -1.949  24.482  0.00 46.33 ? 5    GLN D OE1 1 
ATOM   8115 N  NE2 . GLN D 2 5   ? 76.787 -0.650  26.154  0.00 46.69 ? 5    GLN D NE2 1 
ATOM   8116 N  N   . GLU D 2 6   ? 73.758 3.570   22.767  1.00 38.52 ? 6    GLU D N   1 
ATOM   8117 C  CA  . GLU D 2 6   ? 73.961 4.919   22.258  1.00 39.57 ? 6    GLU D CA  1 
ATOM   8118 C  C   . GLU D 2 6   ? 74.913 5.684   23.165  1.00 41.00 ? 6    GLU D C   1 
ATOM   8119 O  O   . GLU D 2 6   ? 75.069 5.360   24.338  1.00 32.51 ? 6    GLU D O   1 
ATOM   8120 C  CB  . GLU D 2 6   ? 72.637 5.679   22.135  1.00 37.93 ? 6    GLU D CB  1 
ATOM   8121 C  CG  . GLU D 2 6   ? 71.579 4.996   21.274  1.00 37.95 ? 6    GLU D CG  1 
ATOM   8122 C  CD  . GLU D 2 6   ? 70.652 4.109   22.087  1.00 41.80 ? 6    GLU D CD  1 
ATOM   8123 O  OE1 . GLU D 2 6   ? 71.009 3.788   23.240  1.00 45.90 ? 6    GLU D OE1 1 
ATOM   8124 O  OE2 . GLU D 2 6   ? 69.565 3.743   21.581  1.00 39.47 ? 6    GLU D OE2 1 
ATOM   8125 N  N   . SER D 2 7   ? 75.538 6.707   22.602  1.00 41.80 ? 7    SER D N   1 
ATOM   8126 C  CA  . SER D 2 7   ? 76.467 7.548   23.334  1.00 42.57 ? 7    SER D CA  1 
ATOM   8127 C  C   . SER D 2 7   ? 76.634 8.861   22.591  1.00 39.71 ? 7    SER D C   1 
ATOM   8128 O  O   . SER D 2 7   ? 76.154 9.008   21.468  1.00 34.24 ? 7    SER D O   1 
ATOM   8129 C  CB  . SER D 2 7   ? 77.815 6.846   23.500  1.00 42.41 ? 7    SER D CB  1 
ATOM   8130 O  OG  . SER D 2 7   ? 78.343 6.455   22.244  1.00 46.41 ? 7    SER D OG  1 
ATOM   8131 N  N   . GLY D 2 8   ? 77.310 9.813   23.223  1.00 38.65 ? 8    GLY D N   1 
ATOM   8132 C  CA  . GLY D 2 8   ? 77.647 11.062  22.571  1.00 36.91 ? 8    GLY D CA  1 
ATOM   8133 C  C   . GLY D 2 8   ? 76.700 12.199  22.880  1.00 40.79 ? 8    GLY D C   1 
ATOM   8134 O  O   . GLY D 2 8   ? 76.867 13.300  22.359  1.00 47.44 ? 8    GLY D O   1 
ATOM   8135 N  N   . GLY D 2 9   ? 75.705 11.944  23.724  1.00 32.29 ? 9    GLY D N   1 
ATOM   8136 C  CA  . GLY D 2 9   ? 74.740 12.973  24.081  1.00 39.12 ? 9    GLY D CA  1 
ATOM   8137 C  C   . GLY D 2 9   ? 75.273 13.944  25.117  1.00 42.54 ? 9    GLY D C   1 
ATOM   8138 O  O   . GLY D 2 9   ? 76.412 13.820  25.568  1.00 48.64 ? 9    GLY D O   1 
ATOM   8139 N  N   . GLY D 2 10  ? 74.460 14.920  25.499  1.00 39.04 ? 10   GLY D N   1 
ATOM   8140 C  CA  . GLY D 2 10  ? 74.838 15.812  26.576  1.00 38.79 ? 10   GLY D CA  1 
ATOM   8141 C  C   . GLY D 2 10  ? 74.143 17.156  26.554  1.00 43.04 ? 10   GLY D C   1 
ATOM   8142 O  O   . GLY D 2 10  ? 73.088 17.312  25.938  1.00 39.35 ? 10   GLY D O   1 
ATOM   8143 N  N   . LEU D 2 11  ? 74.746 18.124  27.240  1.00 39.17 ? 11   LEU D N   1 
ATOM   8144 C  CA  . LEU D 2 11  ? 74.212 19.478  27.319  1.00 45.90 ? 11   LEU D CA  1 
ATOM   8145 C  C   . LEU D 2 11  ? 74.985 20.424  26.405  1.00 43.25 ? 11   LEU D C   1 
ATOM   8146 O  O   . LEU D 2 11  ? 76.210 20.498  26.475  1.00 42.07 ? 11   LEU D O   1 
ATOM   8147 C  CB  . LEU D 2 11  ? 74.254 19.994  28.761  1.00 40.25 ? 11   LEU D CB  1 
ATOM   8148 C  CG  . LEU D 2 11  ? 73.841 21.457  28.948  1.00 45.06 ? 11   LEU D CG  1 
ATOM   8149 C  CD1 . LEU D 2 11  ? 72.380 21.661  28.562  1.00 44.42 ? 11   LEU D CD1 1 
ATOM   8150 C  CD2 . LEU D 2 11  ? 74.104 21.936  30.374  1.00 47.97 ? 11   LEU D CD2 1 
ATOM   8151 N  N   . VAL D 2 12  ? 74.260 21.141  25.549  1.00 43.83 ? 12   VAL D N   1 
ATOM   8152 C  CA  . VAL D 2 12  ? 74.870 22.043  24.570  1.00 46.71 ? 12   VAL D CA  1 
ATOM   8153 C  C   . VAL D 2 12  ? 74.054 23.327  24.398  1.00 48.26 ? 12   VAL D C   1 
ATOM   8154 O  O   . VAL D 2 12  ? 72.879 23.375  24.760  1.00 45.01 ? 12   VAL D O   1 
ATOM   8155 C  CB  . VAL D 2 12  ? 75.015 21.368  23.195  1.00 41.85 ? 12   VAL D CB  1 
ATOM   8156 C  CG1 . VAL D 2 12  ? 75.950 20.169  23.274  1.00 36.82 ? 12   VAL D CG1 1 
ATOM   8157 C  CG2 . VAL D 2 12  ? 73.650 20.951  22.670  1.00 43.41 ? 12   VAL D CG2 1 
ATOM   8158 N  N   . GLN D 2 13  ? 74.685 24.367  23.852  1.00 46.56 ? 13   GLN D N   1 
ATOM   8159 C  CA  . GLN D 2 13  ? 73.981 25.609  23.537  1.00 48.91 ? 13   GLN D CA  1 
ATOM   8160 C  C   . GLN D 2 13  ? 73.398 25.537  22.130  1.00 48.52 ? 13   GLN D C   1 
ATOM   8161 O  O   . GLN D 2 13  ? 73.913 24.805  21.285  1.00 45.32 ? 13   GLN D O   1 
ATOM   8162 C  CB  . GLN D 2 13  ? 74.913 26.822  23.658  1.00 53.36 ? 13   GLN D CB  1 
ATOM   8163 C  CG  . GLN D 2 13  ? 75.518 27.021  25.040  1.00 51.45 ? 13   GLN D CG  1 
ATOM   8164 C  CD  . GLN D 2 13  ? 75.911 28.458  25.303  0.00 57.69 ? 13   GLN D CD  1 
ATOM   8165 O  OE1 . GLN D 2 13  ? 75.510 29.366  24.576  0.00 58.39 ? 13   GLN D OE1 1 
ATOM   8166 N  NE2 . GLN D 2 13  ? 76.697 28.674  26.351  0.00 60.97 ? 13   GLN D NE2 1 
ATOM   8167 N  N   . PRO D 2 14  ? 72.311 26.287  21.876  1.00 46.52 ? 14   PRO D N   1 
ATOM   8168 C  CA  . PRO D 2 14  ? 71.772 26.376  20.515  1.00 46.27 ? 14   PRO D CA  1 
ATOM   8169 C  C   . PRO D 2 14  ? 72.833 26.817  19.515  1.00 48.84 ? 14   PRO D C   1 
ATOM   8170 O  O   . PRO D 2 14  ? 73.727 27.591  19.868  1.00 42.67 ? 14   PRO D O   1 
ATOM   8171 C  CB  . PRO D 2 14  ? 70.650 27.423  20.634  1.00 42.91 ? 14   PRO D CB  1 
ATOM   8172 C  CG  . PRO D 2 14  ? 70.735 27.969  22.022  1.00 50.86 ? 14   PRO D CG  1 
ATOM   8173 C  CD  . PRO D 2 14  ? 71.435 26.948  22.854  1.00 46.33 ? 14   PRO D CD  1 
ATOM   8174 N  N   . GLY D 2 15  ? 72.740 26.301  18.293  1.00 43.42 ? 15   GLY D N   1 
ATOM   8175 C  CA  . GLY D 2 15  ? 73.724 26.567  17.261  1.00 35.31 ? 15   GLY D CA  1 
ATOM   8176 C  C   . GLY D 2 15  ? 74.848 25.554  17.293  1.00 34.21 ? 15   GLY D C   1 
ATOM   8177 O  O   . GLY D 2 15  ? 75.617 25.438  16.347  1.00 43.91 ? 15   GLY D O   1 
ATOM   8178 N  N   . GLY D 2 16  ? 74.939 24.809  18.386  1.00 40.21 ? 16   GLY D N   1 
ATOM   8179 C  CA  . GLY D 2 16  ? 76.015 23.853  18.574  1.00 38.22 ? 16   GLY D CA  1 
ATOM   8180 C  C   . GLY D 2 16  ? 75.883 22.588  17.745  1.00 44.01 ? 16   GLY D C   1 
ATOM   8181 O  O   . GLY D 2 16  ? 74.932 22.418  16.980  1.00 41.00 ? 16   GLY D O   1 
ATOM   8182 N  N   . SER D 2 17  ? 76.841 21.685  17.927  1.00 40.73 ? 17   SER D N   1 
ATOM   8183 C  CA  . SER D 2 17  ? 76.930 20.475  17.129  1.00 36.44 ? 17   SER D CA  1 
ATOM   8184 C  C   . SER D 2 17  ? 77.280 19.271  17.998  1.00 39.37 ? 17   SER D C   1 
ATOM   8185 O  O   . SER D 2 17  ? 78.129 19.364  18.885  1.00 41.02 ? 17   SER D O   1 
ATOM   8186 C  CB  . SER D 2 17  ? 77.973 20.659  16.023  1.00 39.91 ? 17   SER D CB  1 
ATOM   8187 O  OG  . SER D 2 17  ? 78.140 19.478  15.264  1.00 45.49 ? 17   SER D OG  1 
ATOM   8188 N  N   . LEU D 2 18  ? 76.617 18.147  17.747  1.00 36.16 ? 18   LEU D N   1 
ATOM   8189 C  CA  . LEU D 2 18  ? 76.925 16.900  18.441  1.00 39.43 ? 18   LEU D CA  1 
ATOM   8190 C  C   . LEU D 2 18  ? 77.029 15.748  17.463  1.00 36.88 ? 18   LEU D C   1 
ATOM   8191 O  O   . LEU D 2 18  ? 76.439 15.781  16.388  1.00 40.52 ? 18   LEU D O   1 
ATOM   8192 C  CB  . LEU D 2 18  ? 75.861 16.576  19.491  1.00 37.87 ? 18   LEU D CB  1 
ATOM   8193 C  CG  . LEU D 2 18  ? 76.044 17.138  20.896  1.00 45.35 ? 18   LEU D CG  1 
ATOM   8194 C  CD1 . LEU D 2 18  ? 74.783 16.907  21.711  1.00 43.84 ? 18   LEU D CD1 1 
ATOM   8195 C  CD2 . LEU D 2 18  ? 77.241 16.490  21.568  1.00 36.86 ? 18   LEU D CD2 1 
ATOM   8196 N  N   . THR D 2 19  ? 77.775 14.722  17.844  1.00 35.48 ? 19   THR D N   1 
ATOM   8197 C  CA  . THR D 2 19  ? 77.832 13.499  17.062  1.00 39.00 ? 19   THR D CA  1 
ATOM   8198 C  C   . THR D 2 19  ? 77.406 12.323  17.926  1.00 41.18 ? 19   THR D C   1 
ATOM   8199 O  O   . THR D 2 19  ? 78.103 11.963  18.875  1.00 39.86 ? 19   THR D O   1 
ATOM   8200 C  CB  . THR D 2 19  ? 79.244 13.232  16.501  1.00 38.47 ? 19   THR D CB  1 
ATOM   8201 O  OG1 . THR D 2 19  ? 79.617 14.290  15.610  1.00 40.36 ? 19   THR D OG1 1 
ATOM   8202 C  CG2 . THR D 2 19  ? 79.274 11.907  15.748  1.00 40.78 ? 19   THR D CG2 1 
ATOM   8203 N  N   . LEU D 2 20  ? 76.260 11.732  17.603  1.00 32.40 ? 20   LEU D N   1 
ATOM   8204 C  CA  . LEU D 2 20  ? 75.785 10.569  18.332  1.00 32.04 ? 20   LEU D CA  1 
ATOM   8205 C  C   . LEU D 2 20  ? 76.323 9.298   17.685  1.00 41.66 ? 20   LEU D C   1 
ATOM   8206 O  O   . LEU D 2 20  ? 76.494 9.220   16.462  1.00 33.18 ? 20   LEU D O   1 
ATOM   8207 C  CB  . LEU D 2 20  ? 74.255 10.528  18.379  1.00 35.44 ? 20   LEU D CB  1 
ATOM   8208 C  CG  . LEU D 2 20  ? 73.492 11.769  18.837  1.00 37.64 ? 20   LEU D CG  1 
ATOM   8209 C  CD1 . LEU D 2 20  ? 72.002 11.457  18.912  1.00 36.07 ? 20   LEU D CD1 1 
ATOM   8210 C  CD2 . LEU D 2 20  ? 74.020 12.279  20.171  1.00 32.89 ? 20   LEU D CD2 1 
ATOM   8211 N  N   . SER D 2 21  ? 76.593 8.302   18.515  1.00 33.14 ? 21   SER D N   1 
ATOM   8212 C  CA  . SER D 2 21  ? 77.026 7.010   18.029  1.00 37.48 ? 21   SER D CA  1 
ATOM   8213 C  C   . SER D 2 21  ? 76.186 5.916   18.658  1.00 33.68 ? 21   SER D C   1 
ATOM   8214 O  O   . SER D 2 21  ? 75.663 6.074   19.752  1.00 33.97 ? 21   SER D O   1 
ATOM   8215 C  CB  . SER D 2 21  ? 78.508 6.781   18.332  1.00 40.74 ? 21   SER D CB  1 
ATOM   8216 O  OG  . SER D 2 21  ? 79.323 7.632   17.541  1.00 47.78 ? 21   SER D OG  1 
ATOM   8217 N  N   . CYS D 2 22  ? 76.072 4.800   17.955  1.00 34.20 ? 22   CYS D N   1 
ATOM   8218 C  CA  . CYS D 2 22  ? 75.337 3.661   18.463  1.00 37.82 ? 22   CYS D CA  1 
ATOM   8219 C  C   . CYS D 2 22  ? 76.059 2.380   18.076  1.00 39.50 ? 22   CYS D C   1 
ATOM   8220 O  O   . CYS D 2 22  ? 76.224 2.079   16.890  1.00 34.64 ? 22   CYS D O   1 
ATOM   8221 C  CB  . CYS D 2 22  ? 73.903 3.682   17.928  1.00 39.64 ? 22   CYS D CB  1 
ATOM   8222 S  SG  . CYS D 2 22  ? 72.933 2.188   18.187  1.00 57.56 ? 22   CYS D SG  1 
ATOM   8223 N  N   . ALA D 2 23  ? 76.492 1.631   19.086  1.00 38.64 ? 23   ALA D N   1 
ATOM   8224 C  CA  . ALA D 2 23  ? 77.252 0.408   18.865  1.00 36.62 ? 23   ALA D CA  1 
ATOM   8225 C  C   . ALA D 2 23  ? 76.367 -0.837  18.939  1.00 39.77 ? 23   ALA D C   1 
ATOM   8226 O  O   . ALA D 2 23  ? 75.608 -1.020  19.891  1.00 37.15 ? 23   ALA D O   1 
ATOM   8227 C  CB  . ALA D 2 23  ? 78.394 0.309   19.877  1.00 34.09 ? 23   ALA D CB  1 
ATOM   8228 N  N   . ALA D 2 24  ? 76.483 -1.696  17.931  1.00 38.05 ? 24   ALA D N   1 
ATOM   8229 C  CA  . ALA D 2 24  ? 75.674 -2.904  17.856  1.00 40.24 ? 24   ALA D CA  1 
ATOM   8230 C  C   . ALA D 2 24  ? 76.509 -4.166  18.039  1.00 39.74 ? 24   ALA D C   1 
ATOM   8231 O  O   . ALA D 2 24  ? 77.657 -4.232  17.613  1.00 37.92 ? 24   ALA D O   1 
ATOM   8232 C  CB  . ALA D 2 24  ? 74.938 -2.958  16.531  1.00 39.58 ? 24   ALA D CB  1 
ATOM   8233 N  N   . SER D 2 25  ? 75.907 -5.170  18.664  1.00 43.42 ? 25   SER D N   1 
ATOM   8234 C  CA  . SER D 2 25  ? 76.557 -6.451  18.887  1.00 46.19 ? 25   SER D CA  1 
ATOM   8235 C  C   . SER D 2 25  ? 75.515 -7.543  19.097  1.00 39.64 ? 25   SER D C   1 
ATOM   8236 O  O   . SER D 2 25  ? 74.376 -7.261  19.476  1.00 40.46 ? 25   SER D O   1 
ATOM   8237 C  CB  . SER D 2 25  ? 77.488 -6.371  20.097  1.00 39.74 ? 25   SER D CB  1 
ATOM   8238 O  OG  . SER D 2 25  ? 76.780 -5.914  21.237  1.00 45.60 ? 25   SER D OG  1 
ATOM   8239 N  N   . GLY D 2 26  ? 75.908 -8.786  18.851  1.00 44.70 ? 26   GLY D N   1 
ATOM   8240 C  CA  . GLY D 2 26  ? 75.045 -9.921  19.126  1.00 46.41 ? 26   GLY D CA  1 
ATOM   8241 C  C   . GLY D 2 26  ? 74.076 -10.243 18.005  1.00 45.13 ? 26   GLY D C   1 
ATOM   8242 O  O   . GLY D 2 26  ? 73.212 -11.108 18.153  1.00 48.52 ? 26   GLY D O   1 
ATOM   8243 N  N   . PHE D 2 27  ? 74.213 -9.530  16.891  1.00 37.27 ? 27   PHE D N   1 
ATOM   8244 C  CA  . PHE D 2 27  ? 73.473 -9.828  15.668  1.00 42.17 ? 27   PHE D CA  1 
ATOM   8245 C  C   . PHE D 2 27  ? 74.268 -9.323  14.474  1.00 37.34 ? 27   PHE D C   1 
ATOM   8246 O  O   . PHE D 2 27  ? 75.288 -8.667  14.645  1.00 40.81 ? 27   PHE D O   1 
ATOM   8247 C  CB  . PHE D 2 27  ? 72.068 -9.202  15.691  1.00 38.04 ? 27   PHE D CB  1 
ATOM   8248 C  CG  . PHE D 2 27  ? 72.050 -7.693  15.614  1.00 35.21 ? 27   PHE D CG  1 
ATOM   8249 C  CD1 . PHE D 2 27  ? 72.200 -6.922  16.755  1.00 38.11 ? 27   PHE D CD1 1 
ATOM   8250 C  CD2 . PHE D 2 27  ? 71.833 -7.048  14.407  1.00 35.09 ? 27   PHE D CD2 1 
ATOM   8251 C  CE1 . PHE D 2 27  ? 72.161 -5.535  16.688  1.00 31.80 ? 27   PHE D CE1 1 
ATOM   8252 C  CE2 . PHE D 2 27  ? 71.787 -5.661  14.334  1.00 32.20 ? 27   PHE D CE2 1 
ATOM   8253 C  CZ  . PHE D 2 27  ? 71.954 -4.904  15.477  1.00 29.54 ? 27   PHE D CZ  1 
ATOM   8254 N  N   . THR D 2 28  ? 73.816 -9.635  13.267  1.00 37.27 ? 28   THR D N   1 
ATOM   8255 C  CA  . THR D 2 28  ? 74.472 -9.100  12.083  1.00 37.11 ? 28   THR D CA  1 
ATOM   8256 C  C   . THR D 2 28  ? 73.964 -7.692  11.802  1.00 42.75 ? 28   THR D C   1 
ATOM   8257 O  O   . THR D 2 28  ? 72.827 -7.496  11.371  1.00 39.56 ? 28   THR D O   1 
ATOM   8258 C  CB  . THR D 2 28  ? 74.249 -9.982  10.853  1.00 38.07 ? 28   THR D CB  1 
ATOM   8259 O  OG1 . THR D 2 28  ? 74.520 -11.346 11.188  1.00 50.51 ? 28   THR D OG1 1 
ATOM   8260 C  CG2 . THR D 2 28  ? 75.170 -9.557  9.727   1.00 41.15 ? 28   THR D CG2 1 
ATOM   8261 N  N   . PHE D 2 29  ? 74.820 -6.713  12.056  1.00 40.04 ? 29   PHE D N   1 
ATOM   8262 C  CA  . PHE D 2 29  ? 74.468 -5.308  11.910  1.00 38.78 ? 29   PHE D CA  1 
ATOM   8263 C  C   . PHE D 2 29  ? 74.026 -4.975  10.485  1.00 39.97 ? 29   PHE D C   1 
ATOM   8264 O  O   . PHE D 2 29  ? 73.006 -4.312  10.284  1.00 37.41 ? 29   PHE D O   1 
ATOM   8265 C  CB  . PHE D 2 29  ? 75.658 -4.436  12.320  1.00 40.05 ? 29   PHE D CB  1 
ATOM   8266 C  CG  . PHE D 2 29  ? 75.368 -2.965  12.324  1.00 38.65 ? 29   PHE D CG  1 
ATOM   8267 C  CD1 . PHE D 2 29  ? 74.414 -2.433  13.177  1.00 32.30 ? 29   PHE D CD1 1 
ATOM   8268 C  CD2 . PHE D 2 29  ? 76.067 -2.111  11.495  1.00 38.01 ? 29   PHE D CD2 1 
ATOM   8269 C  CE1 . PHE D 2 29  ? 74.162 -1.083  13.196  1.00 33.87 ? 29   PHE D CE1 1 
ATOM   8270 C  CE2 . PHE D 2 29  ? 75.815 -0.757  11.507  1.00 39.80 ? 29   PHE D CE2 1 
ATOM   8271 C  CZ  . PHE D 2 29  ? 74.862 -0.241  12.359  1.00 37.81 ? 29   PHE D CZ  1 
ATOM   8272 N  N   . SER D 2 30  ? 74.771 -5.465  9.498   1.00 35.54 ? 30   SER D N   1 
ATOM   8273 C  CA  . SER D 2 30  ? 74.489 -5.144  8.101   1.00 37.55 ? 30   SER D CA  1 
ATOM   8274 C  C   . SER D 2 30  ? 73.232 -5.834  7.557   1.00 38.78 ? 30   SER D C   1 
ATOM   8275 O  O   . SER D 2 30  ? 72.896 -5.669  6.388   1.00 33.88 ? 30   SER D O   1 
ATOM   8276 C  CB  . SER D 2 30  ? 75.687 -5.511  7.221   1.00 39.99 ? 30   SER D CB  1 
ATOM   8277 O  OG  . SER D 2 30  ? 75.743 -6.907  7.012   1.00 46.58 ? 30   SER D OG  1 
ATOM   8278 N  N   . SER D 2 31  ? 72.545 -6.603  8.400   1.00 35.71 ? 31   SER D N   1 
ATOM   8279 C  CA  . SER D 2 31  ? 71.299 -7.255  8.004   1.00 36.31 ? 31   SER D CA  1 
ATOM   8280 C  C   . SER D 2 31  ? 70.070 -6.345  8.142   1.00 37.26 ? 31   SER D C   1 
ATOM   8281 O  O   . SER D 2 31  ? 69.012 -6.653  7.603   1.00 32.12 ? 31   SER D O   1 
ATOM   8282 C  CB  . SER D 2 31  ? 71.079 -8.532  8.819   1.00 37.19 ? 31   SER D CB  1 
ATOM   8283 O  OG  . SER D 2 31  ? 71.972 -9.558  8.412   1.00 53.73 ? 31   SER D OG  1 
ATOM   8284 N  N   . TYR D 2 32  ? 70.212 -5.225  8.843   1.00 34.05 ? 32   TYR D N   1 
ATOM   8285 C  CA  . TYR D 2 32  ? 69.083 -4.331  9.072   1.00 30.56 ? 32   TYR D CA  1 
ATOM   8286 C  C   . TYR D 2 32  ? 69.283 -2.882  8.611   1.00 35.16 ? 32   TYR D C   1 
ATOM   8287 O  O   . TYR D 2 32  ? 70.382 -2.327  8.693   1.00 27.59 ? 32   TYR D O   1 
ATOM   8288 C  CB  . TYR D 2 32  ? 68.731 -4.318  10.563  1.00 28.64 ? 32   TYR D CB  1 
ATOM   8289 C  CG  . TYR D 2 32  ? 68.257 -5.646  11.093  1.00 35.21 ? 32   TYR D CG  1 
ATOM   8290 C  CD1 . TYR D 2 32  ? 66.985 -6.119  10.795  1.00 31.67 ? 32   TYR D CD1 1 
ATOM   8291 C  CD2 . TYR D 2 32  ? 69.075 -6.425  11.897  1.00 28.78 ? 32   TYR D CD2 1 
ATOM   8292 C  CE1 . TYR D 2 32  ? 66.543 -7.333  11.272  1.00 26.05 ? 32   TYR D CE1 1 
ATOM   8293 C  CE2 . TYR D 2 32  ? 68.643 -7.635  12.383  1.00 32.99 ? 32   TYR D CE2 1 
ATOM   8294 C  CZ  . TYR D 2 32  ? 67.376 -8.087  12.069  1.00 37.66 ? 32   TYR D CZ  1 
ATOM   8295 O  OH  . TYR D 2 32  ? 66.944 -9.296  12.558  1.00 32.49 ? 32   TYR D OH  1 
ATOM   8296 N  N   . SER D 2 33  ? 68.196 -2.275  8.138   1.00 30.94 ? 33   SER D N   1 
ATOM   8297 C  CA  . SER D 2 33  ? 68.099 -0.826  8.075   1.00 26.28 ? 33   SER D CA  1 
ATOM   8298 C  C   . SER D 2 33  ? 68.090 -0.305  9.507   1.00 24.69 ? 33   SER D C   1 
ATOM   8299 O  O   . SER D 2 33  ? 67.674 -1.018  10.420  1.00 26.99 ? 33   SER D O   1 
ATOM   8300 C  CB  . SER D 2 33  ? 66.834 -0.378  7.340   1.00 28.98 ? 33   SER D CB  1 
ATOM   8301 O  OG  . SER D 2 33  ? 66.798 -0.864  6.009   1.00 32.38 ? 33   SER D OG  1 
ATOM   8302 N  N   . MET D 2 34  ? 68.529 0.934   9.703   1.00 22.65 ? 34   MET D N   1 
ATOM   8303 C  CA  . MET D 2 34  ? 68.646 1.501   11.047  1.00 26.56 ? 34   MET D CA  1 
ATOM   8304 C  C   . MET D 2 34  ? 67.957 2.854   11.188  1.00 24.19 ? 34   MET D C   1 
ATOM   8305 O  O   . MET D 2 34  ? 67.787 3.571   10.206  1.00 28.21 ? 34   MET D O   1 
ATOM   8306 C  CB  . MET D 2 34  ? 70.118 1.639   11.437  1.00 29.84 ? 34   MET D CB  1 
ATOM   8307 C  CG  . MET D 2 34  ? 70.839 0.313   11.577  1.00 36.54 ? 34   MET D CG  1 
ATOM   8308 S  SD  . MET D 2 34  ? 70.177 -0.709  12.904  1.00 37.24 ? 34   MET D SD  1 
ATOM   8309 C  CE  . MET D 2 34  ? 70.505 0.314   14.329  1.00 26.25 ? 34   MET D CE  1 
ATOM   8310 N  N   . TYR D 2 35  ? 67.602 3.204   12.426  1.00 23.81 ? 35   TYR D N   1 
ATOM   8311 C  CA  . TYR D 2 35  ? 66.792 4.388   12.718  1.00 25.85 ? 35   TYR D CA  1 
ATOM   8312 C  C   . TYR D 2 35  ? 67.300 5.220   13.894  1.00 27.40 ? 35   TYR D C   1 
ATOM   8313 O  O   . TYR D 2 35  ? 67.823 4.685   14.866  1.00 28.41 ? 35   TYR D O   1 
ATOM   8314 C  CB  . TYR D 2 35  ? 65.344 3.969   13.010  1.00 26.70 ? 35   TYR D CB  1 
ATOM   8315 C  CG  . TYR D 2 35  ? 64.692 3.280   11.842  1.00 26.42 ? 35   TYR D CG  1 
ATOM   8316 C  CD1 . TYR D 2 35  ? 64.931 1.934   11.580  1.00 24.72 ? 35   TYR D CD1 1 
ATOM   8317 C  CD2 . TYR D 2 35  ? 63.857 3.979   10.988  1.00 23.60 ? 35   TYR D CD2 1 
ATOM   8318 C  CE1 . TYR D 2 35  ? 64.354 1.312   10.502  1.00 28.89 ? 35   TYR D CE1 1 
ATOM   8319 C  CE2 . TYR D 2 35  ? 63.267 3.367   9.909   1.00 28.26 ? 35   TYR D CE2 1 
ATOM   8320 C  CZ  . TYR D 2 35  ? 63.519 2.033   9.669   1.00 29.21 ? 35   TYR D CZ  1 
ATOM   8321 O  OH  . TYR D 2 35  ? 62.941 1.423   8.589   1.00 30.88 ? 35   TYR D OH  1 
ATOM   8322 N  N   . TRP D 2 36  ? 67.128 6.533   13.801  1.00 25.08 ? 36   TRP D N   1 
ATOM   8323 C  CA  . TRP D 2 36  ? 67.205 7.377   14.978  1.00 28.94 ? 36   TRP D CA  1 
ATOM   8324 C  C   . TRP D 2 36  ? 65.814 7.912   15.292  1.00 28.77 ? 36   TRP D C   1 
ATOM   8325 O  O   . TRP D 2 36  ? 65.129 8.450   14.420  1.00 27.37 ? 36   TRP D O   1 
ATOM   8326 C  CB  . TRP D 2 36  ? 68.195 8.531   14.789  1.00 27.32 ? 36   TRP D CB  1 
ATOM   8327 C  CG  . TRP D 2 36  ? 69.636 8.090   14.816  1.00 30.47 ? 36   TRP D CG  1 
ATOM   8328 C  CD1 . TRP D 2 36  ? 70.441 7.851   13.739  1.00 28.24 ? 36   TRP D CD1 1 
ATOM   8329 C  CD2 . TRP D 2 36  ? 70.439 7.834   15.980  1.00 30.01 ? 36   TRP D CD2 1 
ATOM   8330 N  NE1 . TRP D 2 36  ? 71.692 7.465   14.159  1.00 28.84 ? 36   TRP D NE1 1 
ATOM   8331 C  CE2 . TRP D 2 36  ? 71.717 7.444   15.527  1.00 27.28 ? 36   TRP D CE2 1 
ATOM   8332 C  CE3 . TRP D 2 36  ? 70.200 7.892   17.356  1.00 32.63 ? 36   TRP D CE3 1 
ATOM   8333 C  CZ2 . TRP D 2 36  ? 72.756 7.119   16.403  1.00 36.06 ? 36   TRP D CZ2 1 
ATOM   8334 C  CZ3 . TRP D 2 36  ? 71.236 7.568   18.228  1.00 36.77 ? 36   TRP D CZ3 1 
ATOM   8335 C  CH2 . TRP D 2 36  ? 72.496 7.185   17.746  1.00 35.21 ? 36   TRP D CH2 1 
ATOM   8336 N  N   . VAL D 2 37  ? 65.393 7.726   16.537  1.00 24.48 ? 37   VAL D N   1 
ATOM   8337 C  CA  . VAL D 2 37  ? 64.105 8.207   16.999  1.00 29.32 ? 37   VAL D CA  1 
ATOM   8338 C  C   . VAL D 2 37  ? 64.347 8.954   18.304  1.00 30.01 ? 37   VAL D C   1 
ATOM   8339 O  O   . VAL D 2 37  ? 65.325 8.684   18.995  1.00 30.46 ? 37   VAL D O   1 
ATOM   8340 C  CB  . VAL D 2 37  ? 63.086 7.049   17.201  1.00 30.61 ? 37   VAL D CB  1 
ATOM   8341 C  CG1 . VAL D 2 37  ? 63.022 6.167   15.961  1.00 31.84 ? 37   VAL D CG1 1 
ATOM   8342 C  CG2 . VAL D 2 37  ? 63.446 6.215   18.410  1.00 35.62 ? 37   VAL D CG2 1 
ATOM   8343 N  N   . ARG D 2 38  ? 63.492 9.920   18.623  1.00 27.73 ? 38   ARG D N   1 
ATOM   8344 C  CA  . ARG D 2 38  ? 63.681 10.692  19.848  1.00 34.46 ? 38   ARG D CA  1 
ATOM   8345 C  C   . ARG D 2 38  ? 62.376 10.870  20.617  1.00 38.71 ? 38   ARG D C   1 
ATOM   8346 O  O   . ARG D 2 38  ? 61.304 10.965  20.021  1.00 39.22 ? 38   ARG D O   1 
ATOM   8347 C  CB  . ARG D 2 38  ? 64.300 12.061  19.541  1.00 29.19 ? 38   ARG D CB  1 
ATOM   8348 C  CG  . ARG D 2 38  ? 63.369 13.043  18.847  1.00 33.19 ? 38   ARG D CG  1 
ATOM   8349 C  CD  . ARG D 2 38  ? 64.110 14.306  18.421  1.00 33.08 ? 38   ARG D CD  1 
ATOM   8350 N  NE  . ARG D 2 38  ? 63.260 15.188  17.625  1.00 32.82 ? 38   ARG D NE  1 
ATOM   8351 C  CZ  . ARG D 2 38  ? 63.680 16.287  17.002  1.00 38.32 ? 38   ARG D CZ  1 
ATOM   8352 N  NH1 . ARG D 2 38  ? 64.950 16.654  17.066  1.00 30.61 ? 38   ARG D NH1 1 
ATOM   8353 N  NH2 . ARG D 2 38  ? 62.822 17.018  16.302  1.00 42.74 ? 38   ARG D NH2 1 
ATOM   8354 N  N   . GLN D 2 39  ? 62.474 10.899  21.943  1.00 38.60 ? 39   GLN D N   1 
ATOM   8355 C  CA  . GLN D 2 39  ? 61.312 11.177  22.778  1.00 45.39 ? 39   GLN D CA  1 
ATOM   8356 C  C   . GLN D 2 39  ? 61.562 12.334  23.737  1.00 42.07 ? 39   GLN D C   1 
ATOM   8357 O  O   . GLN D 2 39  ? 62.426 12.255  24.610  1.00 41.64 ? 39   GLN D O   1 
ATOM   8358 C  CB  . GLN D 2 39  ? 60.900 9.936   23.571  1.00 45.14 ? 39   GLN D CB  1 
ATOM   8359 C  CG  . GLN D 2 39  ? 59.758 10.197  24.543  1.00 48.51 ? 39   GLN D CG  1 
ATOM   8360 C  CD  . GLN D 2 39  ? 58.788 9.037   24.631  1.00 48.54 ? 39   GLN D CD  1 
ATOM   8361 O  OE1 . GLN D 2 39  ? 59.190 7.877   24.600  1.00 54.95 ? 39   GLN D OE1 1 
ATOM   8362 N  NE2 . GLN D 2 39  ? 57.501 9.346   24.730  1.00 52.74 ? 39   GLN D NE2 1 
ATOM   8363 N  N   . ALA D 2 40  ? 60.794 13.405  23.560  1.00 45.28 ? 40   ALA D N   1 
ATOM   8364 C  CA  . ALA D 2 40  ? 60.813 14.547  24.467  1.00 48.05 ? 40   ALA D CA  1 
ATOM   8365 C  C   . ALA D 2 40  ? 59.852 14.308  25.638  1.00 51.84 ? 40   ALA D C   1 
ATOM   8366 O  O   . ALA D 2 40  ? 58.944 13.478  25.534  1.00 44.84 ? 40   ALA D O   1 
ATOM   8367 C  CB  . ALA D 2 40  ? 60.446 15.822  23.717  1.00 41.88 ? 40   ALA D CB  1 
ATOM   8368 N  N   . PRO D 2 41  ? 60.061 15.017  26.765  1.00 50.28 ? 41   PRO D N   1 
ATOM   8369 C  CA  . PRO D 2 41  ? 59.154 14.895  27.916  1.00 49.91 ? 41   PRO D CA  1 
ATOM   8370 C  C   . PRO D 2 41  ? 57.715 15.270  27.577  1.00 50.98 ? 41   PRO D C   1 
ATOM   8371 O  O   . PRO D 2 41  ? 57.476 16.349  27.040  1.00 48.70 ? 41   PRO D O   1 
ATOM   8372 C  CB  . PRO D 2 41  ? 59.733 15.883  28.929  1.00 52.75 ? 41   PRO D CB  1 
ATOM   8373 C  CG  . PRO D 2 41  ? 61.169 16.011  28.563  1.00 51.74 ? 41   PRO D CG  1 
ATOM   8374 C  CD  . PRO D 2 41  ? 61.230 15.861  27.071  1.00 51.36 ? 41   PRO D CD  1 
ATOM   8375 N  N   . GLY D 2 42  ? 56.776 14.381  27.887  1.00 55.30 ? 42   GLY D N   1 
ATOM   8376 C  CA  . GLY D 2 42  ? 55.366 14.638  27.655  1.00 50.43 ? 42   GLY D CA  1 
ATOM   8377 C  C   . GLY D 2 42  ? 54.990 14.661  26.185  1.00 57.81 ? 42   GLY D C   1 
ATOM   8378 O  O   . GLY D 2 42  ? 53.927 15.154  25.812  1.00 59.23 ? 42   GLY D O   1 
ATOM   8379 N  N   . LYS D 2 43  ? 55.868 14.134  25.342  1.00 60.49 ? 43   LYS D N   1 
ATOM   8380 C  CA  . LYS D 2 43  ? 55.582 14.048  23.918  1.00 54.90 ? 43   LYS D CA  1 
ATOM   8381 C  C   . LYS D 2 43  ? 55.656 12.602  23.440  1.00 47.60 ? 43   LYS D C   1 
ATOM   8382 O  O   . LYS D 2 43  ? 56.204 11.738  24.121  1.00 54.82 ? 43   LYS D O   1 
ATOM   8383 C  CB  . LYS D 2 43  ? 56.548 14.916  23.113  1.00 51.65 ? 43   LYS D CB  1 
ATOM   8384 C  CG  . LYS D 2 43  ? 56.277 16.407  23.164  1.00 53.65 ? 43   LYS D CG  1 
ATOM   8385 C  CD  . LYS D 2 43  ? 56.777 17.072  21.890  0.00 56.65 ? 43   LYS D CD  1 
ATOM   8386 C  CE  . LYS D 2 43  ? 57.139 18.528  22.117  0.00 58.97 ? 43   LYS D CE  1 
ATOM   8387 N  NZ  . LYS D 2 43  ? 55.999 19.315  22.659  0.00 60.46 ? 43   LYS D NZ  1 
ATOM   8388 N  N   . GLY D 2 44  ? 55.102 12.349  22.261  1.00 46.01 ? 44   GLY D N   1 
ATOM   8389 C  CA  . GLY D 2 44  ? 55.172 11.035  21.660  1.00 46.06 ? 44   GLY D CA  1 
ATOM   8390 C  C   . GLY D 2 44  ? 56.505 10.804  20.975  1.00 45.33 ? 44   GLY D C   1 
ATOM   8391 O  O   . GLY D 2 44  ? 57.216 11.755  20.639  1.00 41.47 ? 44   GLY D O   1 
ATOM   8392 N  N   . LEU D 2 45  ? 56.840 9.531   20.780  1.00 43.45 ? 45   LEU D N   1 
ATOM   8393 C  CA  . LEU D 2 45  ? 58.038 9.139   20.056  1.00 39.38 ? 45   LEU D CA  1 
ATOM   8394 C  C   . LEU D 2 45  ? 58.038 9.761   18.670  1.00 39.71 ? 45   LEU D C   1 
ATOM   8395 O  O   . LEU D 2 45  ? 57.010 9.805   18.004  1.00 41.37 ? 45   LEU D O   1 
ATOM   8396 C  CB  . LEU D 2 45  ? 58.128 7.622   19.949  1.00 44.88 ? 45   LEU D CB  1 
ATOM   8397 C  CG  . LEU D 2 45  ? 59.540 7.039   19.993  1.00 44.45 ? 45   LEU D CG  1 
ATOM   8398 C  CD1 . LEU D 2 45  ? 60.051 6.980   21.428  1.00 47.03 ? 45   LEU D CD1 1 
ATOM   8399 C  CD2 . LEU D 2 45  ? 59.569 5.668   19.341  1.00 45.16 ? 45   LEU D CD2 1 
ATOM   8400 N  N   . GLU D 2 46  ? 59.197 10.245  18.245  1.00 33.52 ? 46   GLU D N   1 
ATOM   8401 C  CA  . GLU D 2 46  ? 59.315 10.954  16.980  1.00 34.00 ? 46   GLU D CA  1 
ATOM   8402 C  C   . GLU D 2 46  ? 60.471 10.377  16.158  1.00 38.19 ? 46   GLU D C   1 
ATOM   8403 O  O   . GLU D 2 46  ? 61.609 10.295  16.642  1.00 33.53 ? 46   GLU D O   1 
ATOM   8404 C  CB  . GLU D 2 46  ? 59.516 12.453  17.243  1.00 33.57 ? 46   GLU D CB  1 
ATOM   8405 C  CG  . GLU D 2 46  ? 59.630 13.344  16.010  1.00 40.53 ? 46   GLU D CG  1 
ATOM   8406 C  CD  . GLU D 2 46  ? 60.148 14.750  16.344  1.00 47.03 ? 46   GLU D CD  1 
ATOM   8407 O  OE1 . GLU D 2 46  ? 60.331 15.058  17.541  1.00 53.09 ? 46   GLU D OE1 1 
ATOM   8408 O  OE2 . GLU D 2 46  ? 60.381 15.552  15.412  1.00 50.96 ? 46   GLU D OE2 1 
ATOM   8409 N  N   A TRP D 2 47  ? 60.173 9.977   14.924  0.50 30.59 ? 47   TRP D N   1 
ATOM   8410 N  N   B TRP D 2 47  ? 60.187 9.962   14.926  0.50 30.58 ? 47   TRP D N   1 
ATOM   8411 C  CA  A TRP D 2 47  ? 61.193 9.482   14.005  0.50 30.61 ? 47   TRP D CA  1 
ATOM   8412 C  CA  B TRP D 2 47  ? 61.244 9.435   14.073  0.50 30.61 ? 47   TRP D CA  1 
ATOM   8413 C  C   A TRP D 2 47  ? 62.079 10.630  13.539  0.50 31.96 ? 47   TRP D C   1 
ATOM   8414 C  C   B TRP D 2 47  ? 62.078 10.600  13.549  0.50 31.96 ? 47   TRP D C   1 
ATOM   8415 O  O   A TRP D 2 47  ? 61.580 11.678  13.127  0.50 29.28 ? 47   TRP D O   1 
ATOM   8416 O  O   B TRP D 2 47  ? 61.546 11.626  13.124  0.50 29.27 ? 47   TRP D O   1 
ATOM   8417 C  CB  A TRP D 2 47  ? 60.547 8.779   12.805  0.50 32.35 ? 47   TRP D CB  1 
ATOM   8418 C  CB  B TRP D 2 47  ? 60.677 8.586   12.924  0.50 32.19 ? 47   TRP D CB  1 
ATOM   8419 C  CG  A TRP D 2 47  ? 61.477 8.579   11.642  0.50 32.33 ? 47   TRP D CG  1 
ATOM   8420 C  CG  B TRP D 2 47  ? 60.560 9.298   11.608  0.50 32.41 ? 47   TRP D CG  1 
ATOM   8421 C  CD1 A TRP D 2 47  ? 62.488 7.669   11.550  0.50 32.29 ? 47   TRP D CD1 1 
ATOM   8422 C  CD1 B TRP D 2 47  ? 59.559 10.136  11.220  0.50 31.11 ? 47   TRP D CD1 1 
ATOM   8423 C  CD2 A TRP D 2 47  ? 61.478 9.305   10.405  0.50 31.18 ? 47   TRP D CD2 1 
ATOM   8424 C  CD2 B TRP D 2 47  ? 61.471 9.223   10.501  0.50 31.18 ? 47   TRP D CD2 1 
ATOM   8425 N  NE1 A TRP D 2 47  ? 63.121 7.784   10.335  0.50 31.15 ? 47   TRP D NE1 1 
ATOM   8426 N  NE1 B TRP D 2 47  ? 59.793 10.600  9.950   0.50 33.51 ? 47   TRP D NE1 1 
ATOM   8427 C  CE2 A TRP D 2 47  ? 62.521 8.782   9.614   0.50 30.05 ? 47   TRP D CE2 1 
ATOM   8428 C  CE2 B TRP D 2 47  ? 60.958 10.052  9.484   0.50 31.84 ? 47   TRP D CE2 1 
ATOM   8429 C  CE3 A TRP D 2 47  ? 60.701 10.348  9.890   0.50 32.49 ? 47   TRP D CE3 1 
ATOM   8430 C  CE3 B TRP D 2 47  ? 62.669 8.540   10.275  0.50 30.63 ? 47   TRP D CE3 1 
ATOM   8431 C  CZ2 A TRP D 2 47  ? 62.804 9.262   8.337   0.50 32.04 ? 47   TRP D CZ2 1 
ATOM   8432 C  CZ2 B TRP D 2 47  ? 61.601 10.215  8.258   0.50 29.37 ? 47   TRP D CZ2 1 
ATOM   8433 C  CZ3 A TRP D 2 47  ? 60.985 10.824  8.620   0.50 29.62 ? 47   TRP D CZ3 1 
ATOM   8434 C  CZ3 B TRP D 2 47  ? 63.303 8.700   9.058   0.50 29.78 ? 47   TRP D CZ3 1 
ATOM   8435 C  CH2 A TRP D 2 47  ? 62.025 10.280  7.858   0.50 29.17 ? 47   TRP D CH2 1 
ATOM   8436 C  CH2 B TRP D 2 47  ? 62.769 9.533   8.065   0.50 32.28 ? 47   TRP D CH2 1 
ATOM   8437 N  N   . VAL D 2 48  ? 63.394 10.429  13.614  1.00 27.98 ? 48   VAL D N   1 
ATOM   8438 C  CA  . VAL D 2 48  ? 64.347 11.474  13.262  1.00 25.61 ? 48   VAL D CA  1 
ATOM   8439 C  C   . VAL D 2 48  ? 65.034 11.208  11.928  1.00 27.97 ? 48   VAL D C   1 
ATOM   8440 O  O   . VAL D 2 48  ? 65.083 12.073  11.055  1.00 29.62 ? 48   VAL D O   1 
ATOM   8441 C  CB  . VAL D 2 48  ? 65.449 11.617  14.344  1.00 28.26 ? 48   VAL D CB  1 
ATOM   8442 C  CG1 . VAL D 2 48  ? 66.423 12.728  13.980  1.00 34.93 ? 48   VAL D CG1 1 
ATOM   8443 C  CG2 . VAL D 2 48  ? 64.834 11.849  15.707  1.00 26.72 ? 48   VAL D CG2 1 
ATOM   8444 N  N   . SER D 2 49  ? 65.593 10.013  11.787  1.00 25.65 ? 49   SER D N   1 
ATOM   8445 C  CA  . SER D 2 49  ? 66.330 9.676   10.581  1.00 27.64 ? 49   SER D CA  1 
ATOM   8446 C  C   . SER D 2 49  ? 66.411 8.168   10.353  1.00 27.52 ? 49   SER D C   1 
ATOM   8447 O  O   . SER D 2 49  ? 66.278 7.379   11.286  1.00 27.08 ? 49   SER D O   1 
ATOM   8448 C  CB  . SER D 2 49  ? 67.733 10.272  10.657  1.00 30.12 ? 49   SER D CB  1 
ATOM   8449 O  OG  . SER D 2 49  ? 68.445 10.017  9.469   1.00 35.17 ? 49   SER D OG  1 
ATOM   8450 N  N   . SER D 2 50  ? 66.630 7.771   9.105   1.00 24.63 ? 50   SER D N   1 
ATOM   8451 C  CA  . SER D 2 50  ? 66.711 6.362   8.766   1.00 25.04 ? 50   SER D CA  1 
ATOM   8452 C  C   . SER D 2 50  ? 67.758 6.113   7.683   1.00 23.25 ? 50   SER D C   1 
ATOM   8453 O  O   . SER D 2 50  ? 68.105 7.013   6.920   1.00 27.49 ? 50   SER D O   1 
ATOM   8454 C  CB  . SER D 2 50  ? 65.340 5.846   8.309   1.00 26.62 ? 50   SER D CB  1 
ATOM   8455 O  OG  . SER D 2 50  ? 64.963 6.410   7.061   1.00 24.68 ? 50   SER D OG  1 
ATOM   8456 N  N   . ILE D 2 51  ? 68.261 4.887   7.626   1.00 24.09 ? 51   ILE D N   1 
ATOM   8457 C  CA  . ILE D 2 51  ? 69.288 4.517   6.663   1.00 30.32 ? 51   ILE D CA  1 
ATOM   8458 C  C   . ILE D 2 51  ? 69.105 3.064   6.256   1.00 28.02 ? 51   ILE D C   1 
ATOM   8459 O  O   . ILE D 2 51  ? 68.730 2.237   7.086   1.00 27.33 ? 51   ILE D O   1 
ATOM   8460 C  CB  . ILE D 2 51  ? 70.716 4.723   7.244   1.00 27.21 ? 51   ILE D CB  1 
ATOM   8461 C  CG1 . ILE D 2 51  ? 71.778 4.538   6.157   1.00 32.06 ? 51   ILE D CG1 1 
ATOM   8462 C  CG2 . ILE D 2 51  ? 70.976 3.781   8.403   1.00 21.70 ? 51   ILE D CG2 1 
ATOM   8463 C  CD1 . ILE D 2 51  ? 73.141 5.096   6.534   1.00 28.83 ? 51   ILE D CD1 1 
ATOM   8464 N  N   . ASN D 2 52  ? 69.352 2.742   4.987   1.00 25.55 ? 52   ASN D N   1 
ATOM   8465 C  CA  . ASN D 2 52  ? 69.233 1.349   4.581   1.00 29.22 ? 52   ASN D CA  1 
ATOM   8466 C  C   . ASN D 2 52  ? 70.479 0.582   4.989   1.00 29.64 ? 52   ASN D C   1 
ATOM   8467 O  O   . ASN D 2 52  ? 71.369 1.126   5.648   1.00 29.72 ? 52   ASN D O   1 
ATOM   8468 C  CB  . ASN D 2 52  ? 68.944 1.198   3.074   1.00 25.76 ? 52   ASN D CB  1 
ATOM   8469 C  CG  . ASN D 2 52  ? 70.061 1.713   2.180   1.00 33.51 ? 52   ASN D CG  1 
ATOM   8470 O  OD1 . ASN D 2 52  ? 71.135 2.085   2.641   1.00 30.24 ? 52   ASN D OD1 1 
ATOM   8471 N  ND2 . ASN D 2 52  ? 69.804 1.719   0.876   1.00 27.96 ? 52   ASN D ND2 1 
ATOM   8472 N  N   . ARG D 2 53  ? 70.518 -0.686  4.606   1.00 26.33 ? 53   ARG D N   1 
ATOM   8473 C  CA  . ARG D 2 53  ? 71.546 -1.604  5.060   1.00 31.22 ? 53   ARG D CA  1 
ATOM   8474 C  C   . ARG D 2 53  ? 72.967 -1.168  4.711   1.00 33.09 ? 53   ARG D C   1 
ATOM   8475 O  O   . ARG D 2 53  ? 73.867 -1.240  5.547   1.00 33.56 ? 53   ARG D O   1 
ATOM   8476 C  CB  . ARG D 2 53  ? 71.278 -2.983  4.483   1.00 30.67 ? 53   ARG D CB  1 
ATOM   8477 C  CG  . ARG D 2 53  ? 70.019 -3.612  5.015   1.00 38.94 ? 53   ARG D CG  1 
ATOM   8478 C  CD  . ARG D 2 53  ? 70.203 -5.100  5.163   1.00 40.48 ? 53   ARG D CD  1 
ATOM   8479 N  NE  . ARG D 2 53  ? 69.857 -5.840  3.958   1.00 44.77 ? 53   ARG D NE  1 
ATOM   8480 C  CZ  . ARG D 2 53  ? 70.319 -7.051  3.668   1.00 43.54 ? 53   ARG D CZ  1 
ATOM   8481 N  NH1 . ARG D 2 53  ? 71.169 -7.657  4.482   1.00 37.18 ? 53   ARG D NH1 1 
ATOM   8482 N  NH2 . ARG D 2 53  ? 69.935 -7.653  2.553   1.00 49.07 ? 53   ARG D NH2 1 
ATOM   8483 N  N   . VAL D 2 54  ? 73.163 -0.712  3.482   1.00 36.30 ? 54   VAL D N   1 
ATOM   8484 C  CA  . VAL D 2 54  ? 74.504 -0.390  3.011   1.00 36.04 ? 54   VAL D CA  1 
ATOM   8485 C  C   . VAL D 2 54  ? 74.824 1.090   3.133   1.00 38.07 ? 54   VAL D C   1 
ATOM   8486 O  O   . VAL D 2 54  ? 75.976 1.490   2.989   1.00 39.85 ? 54   VAL D O   1 
ATOM   8487 C  CB  . VAL D 2 54  ? 74.700 -0.813  1.547   1.00 35.94 ? 54   VAL D CB  1 
ATOM   8488 C  CG1 . VAL D 2 54  ? 74.504 -2.308  1.398   1.00 37.86 ? 54   VAL D CG1 1 
ATOM   8489 C  CG2 . VAL D 2 54  ? 73.745 -0.061  0.648   1.00 37.89 ? 54   VAL D CG2 1 
ATOM   8490 N  N   . GLY D 2 55  ? 73.802 1.901   3.392   1.00 35.45 ? 55   GLY D N   1 
ATOM   8491 C  CA  . GLY D 2 55  ? 73.986 3.335   3.517   1.00 31.30 ? 55   GLY D CA  1 
ATOM   8492 C  C   . GLY D 2 55  ? 73.760 4.115   2.236   1.00 31.40 ? 55   GLY D C   1 
ATOM   8493 O  O   . GLY D 2 55  ? 74.031 5.310   2.186   1.00 36.56 ? 55   GLY D O   1 
ATOM   8494 N  N   . SER D 2 56  ? 73.264 3.446   1.199   1.00 34.59 ? 56   SER D N   1 
ATOM   8495 C  CA  . SER D 2 56  ? 73.050 4.084   -0.105  1.00 31.44 ? 56   SER D CA  1 
ATOM   8496 C  C   . SER D 2 56  ? 71.724 4.844   -0.210  1.00 37.52 ? 56   SER D C   1 
ATOM   8497 O  O   . SER D 2 56  ? 71.453 5.512   -1.212  1.00 36.07 ? 56   SER D O   1 
ATOM   8498 C  CB  . SER D 2 56  ? 73.107 3.041   -1.219  1.00 37.86 ? 56   SER D CB  1 
ATOM   8499 O  OG  . SER D 2 56  ? 72.000 2.155   -1.142  1.00 42.92 ? 56   SER D OG  1 
ATOM   8500 N  N   . ASN D 2 57  ? 70.887 4.729   0.811   1.00 32.59 ? 57   ASN D N   1 
ATOM   8501 C  CA  . ASN D 2 57  ? 69.669 5.524   0.863   1.00 30.53 ? 57   ASN D CA  1 
ATOM   8502 C  C   . ASN D 2 57  ? 69.388 5.939   2.298   1.00 27.16 ? 57   ASN D C   1 
ATOM   8503 O  O   . ASN D 2 57  ? 69.595 5.163   3.227   1.00 29.38 ? 57   ASN D O   1 
ATOM   8504 C  CB  . ASN D 2 57  ? 68.484 4.754   0.273   1.00 25.57 ? 57   ASN D CB  1 
ATOM   8505 C  CG  . ASN D 2 57  ? 67.333 5.671   -0.137  1.00 31.84 ? 57   ASN D CG  1 
ATOM   8506 O  OD1 . ASN D 2 57  ? 67.455 6.892   -0.109  1.00 27.41 ? 57   ASN D OD1 1 
ATOM   8507 N  ND2 . ASN D 2 57  ? 66.209 5.074   -0.528  1.00 36.39 ? 57   ASN D ND2 1 
ATOM   8508 N  N   . THR D 2 58  ? 68.938 7.175   2.470   1.00 27.66 ? 58   THR D N   1 
ATOM   8509 C  CA  . THR D 2 58  ? 68.743 7.763   3.791   1.00 35.82 ? 58   THR D CA  1 
ATOM   8510 C  C   . THR D 2 58  ? 67.512 8.660   3.771   1.00 30.01 ? 58   THR D C   1 
ATOM   8511 O  O   . THR D 2 58  ? 67.071 9.091   2.710   1.00 34.80 ? 58   THR D O   1 
ATOM   8512 C  CB  . THR D 2 58  ? 69.963 8.610   4.249   1.00 31.23 ? 58   THR D CB  1 
ATOM   8513 O  OG1 . THR D 2 58  ? 70.104 9.748   3.390   1.00 27.23 ? 58   THR D OG1 1 
ATOM   8514 C  CG2 . THR D 2 58  ? 71.259 7.793   4.228   1.00 26.08 ? 58   THR D CG2 1 
ATOM   8515 N  N   . ASP D 2 59  ? 66.960 8.945   4.942   1.00 27.64 ? 59   ASP D N   1 
ATOM   8516 C  CA  . ASP D 2 59  ? 65.825 9.851   5.029   1.00 29.68 ? 59   ASP D CA  1 
ATOM   8517 C  C   . ASP D 2 59  ? 65.817 10.589  6.356   1.00 29.92 ? 59   ASP D C   1 
ATOM   8518 O  O   . ASP D 2 59  ? 66.430 10.141  7.328   1.00 27.03 ? 59   ASP D O   1 
ATOM   8519 C  CB  . ASP D 2 59  ? 64.510 9.089   4.844   1.00 28.79 ? 59   ASP D CB  1 
ATOM   8520 C  CG  . ASP D 2 59  ? 63.615 9.725   3.798   1.00 41.50 ? 59   ASP D CG  1 
ATOM   8521 O  OD1 . ASP D 2 59  ? 63.171 10.876  4.011   1.00 41.40 ? 59   ASP D OD1 1 
ATOM   8522 O  OD2 . ASP D 2 59  ? 63.356 9.072   2.761   1.00 53.06 ? 59   ASP D OD2 1 
ATOM   8523 N  N   . TYR D 2 60  ? 65.109 11.715  6.386   1.00 23.77 ? 60   TYR D N   1 
ATOM   8524 C  CA  . TYR D 2 60  ? 65.053 12.580  7.554   1.00 27.50 ? 60   TYR D CA  1 
ATOM   8525 C  C   . TYR D 2 60  ? 63.664 13.155  7.773   1.00 31.89 ? 60   TYR D C   1 
ATOM   8526 O  O   . TYR D 2 60  ? 62.959 13.457  6.809   1.00 30.46 ? 60   TYR D O   1 
ATOM   8527 C  CB  . TYR D 2 60  ? 66.043 13.741  7.412   1.00 28.56 ? 60   TYR D CB  1 
ATOM   8528 C  CG  . TYR D 2 60  ? 67.454 13.293  7.177   1.00 24.58 ? 60   TYR D CG  1 
ATOM   8529 C  CD1 . TYR D 2 60  ? 67.929 13.089  5.894   1.00 24.40 ? 60   TYR D CD1 1 
ATOM   8530 C  CD2 . TYR D 2 60  ? 68.311 13.051  8.244   1.00 29.05 ? 60   TYR D CD2 1 
ATOM   8531 C  CE1 . TYR D 2 60  ? 69.234 12.661  5.675   1.00 32.63 ? 60   TYR D CE1 1 
ATOM   8532 C  CE2 . TYR D 2 60  ? 69.614 12.629  8.035   1.00 25.01 ? 60   TYR D CE2 1 
ATOM   8533 C  CZ  . TYR D 2 60  ? 70.067 12.438  6.749   1.00 26.02 ? 60   TYR D CZ  1 
ATOM   8534 O  OH  . TYR D 2 60  ? 71.357 12.011  6.530   1.00 29.59 ? 60   TYR D OH  1 
ATOM   8535 N  N   . ALA D 2 61  ? 63.289 13.322  9.039   1.00 27.31 ? 61   ALA D N   1 
ATOM   8536 C  CA  . ALA D 2 61  ? 62.122 14.112  9.392   1.00 30.06 ? 61   ALA D CA  1 
ATOM   8537 C  C   . ALA D 2 61  ? 62.311 15.532  8.877   1.00 36.68 ? 61   ALA D C   1 
ATOM   8538 O  O   . ALA D 2 61  ? 63.432 16.037  8.838   1.00 37.77 ? 61   ALA D O   1 
ATOM   8539 C  CB  . ALA D 2 61  ? 61.906 14.116  10.886  1.00 26.76 ? 61   ALA D CB  1 
ATOM   8540 N  N   . ASP D 2 62  ? 61.216 16.171  8.483   1.00 39.09 ? 62   ASP D N   1 
ATOM   8541 C  CA  . ASP D 2 62  ? 61.280 17.509  7.904   1.00 42.04 ? 62   ASP D CA  1 
ATOM   8542 C  C   . ASP D 2 62  ? 61.933 18.498  8.861   1.00 36.70 ? 62   ASP D C   1 
ATOM   8543 O  O   . ASP D 2 62  ? 62.625 19.415  8.436   1.00 39.84 ? 62   ASP D O   1 
ATOM   8544 C  CB  . ASP D 2 62  ? 59.878 18.000  7.515   1.00 45.71 ? 62   ASP D CB  1 
ATOM   8545 C  CG  . ASP D 2 62  ? 59.449 17.513  6.142   1.00 50.10 ? 62   ASP D CG  1 
ATOM   8546 O  OD1 . ASP D 2 62  ? 59.933 16.448  5.710   1.00 49.05 ? 62   ASP D OD1 1 
ATOM   8547 O  OD2 . ASP D 2 62  ? 58.631 18.195  5.491   1.00 56.42 ? 62   ASP D OD2 1 
ATOM   8548 N  N   . SER D 2 63  ? 61.721 18.288  10.156  1.00 34.32 ? 63   SER D N   1 
ATOM   8549 C  CA  . SER D 2 63  ? 62.216 19.205  11.178  1.00 39.44 ? 63   SER D CA  1 
ATOM   8550 C  C   . SER D 2 63  ? 63.736 19.194  11.334  1.00 36.11 ? 63   SER D C   1 
ATOM   8551 O  O   . SER D 2 63  ? 64.302 20.108  11.927  1.00 35.36 ? 63   SER D O   1 
ATOM   8552 C  CB  . SER D 2 63  ? 61.578 18.878  12.527  1.00 37.84 ? 63   SER D CB  1 
ATOM   8553 O  OG  . SER D 2 63  ? 61.824 17.528  12.876  1.00 40.47 ? 63   SER D OG  1 
ATOM   8554 N  N   . VAL D 2 64  ? 64.395 18.159  10.824  1.00 36.57 ? 64   VAL D N   1 
ATOM   8555 C  CA  . VAL D 2 64  ? 65.840 18.048  11.005  1.00 37.12 ? 64   VAL D CA  1 
ATOM   8556 C  C   . VAL D 2 64  ? 66.591 17.955  9.679   1.00 38.34 ? 64   VAL D C   1 
ATOM   8557 O  O   . VAL D 2 64  ? 67.824 17.907  9.659   1.00 33.94 ? 64   VAL D O   1 
ATOM   8558 C  CB  . VAL D 2 64  ? 66.210 16.829  11.881  1.00 33.77 ? 64   VAL D CB  1 
ATOM   8559 C  CG1 . VAL D 2 64  ? 65.449 16.871  13.206  1.00 30.09 ? 64   VAL D CG1 1 
ATOM   8560 C  CG2 . VAL D 2 64  ? 65.945 15.531  11.142  1.00 28.13 ? 64   VAL D CG2 1 
ATOM   8561 N  N   . LYS D 2 65  ? 65.850 17.942  8.573   1.00 36.51 ? 65   LYS D N   1 
ATOM   8562 C  CA  . LYS D 2 65  ? 66.468 17.866  7.251   1.00 36.17 ? 65   LYS D CA  1 
ATOM   8563 C  C   . LYS D 2 65  ? 67.366 19.079  6.996   1.00 38.42 ? 65   LYS D C   1 
ATOM   8564 O  O   . LYS D 2 65  ? 67.000 20.211  7.306   1.00 38.41 ? 65   LYS D O   1 
ATOM   8565 C  CB  . LYS D 2 65  ? 65.399 17.747  6.164   1.00 34.30 ? 65   LYS D CB  1 
ATOM   8566 C  CG  . LYS D 2 65  ? 65.885 18.080  4.765   0.00 38.05 ? 65   LYS D CG  1 
ATOM   8567 C  CD  . LYS D 2 65  ? 65.400 17.068  3.739   0.00 38.95 ? 65   LYS D CD  1 
ATOM   8568 C  CE  . LYS D 2 65  ? 66.522 16.124  3.336   0.00 38.67 ? 65   LYS D CE  1 
ATOM   8569 N  NZ  . LYS D 2 65  ? 66.182 15.349  2.112   0.00 41.36 ? 65   LYS D NZ  1 
ATOM   8570 N  N   . GLY D 2 66  ? 68.550 18.827  6.448   1.00 37.67 ? 66   GLY D N   1 
ATOM   8571 C  CA  . GLY D 2 66  ? 69.523 19.880  6.221   1.00 36.53 ? 66   GLY D CA  1 
ATOM   8572 C  C   . GLY D 2 66  ? 70.451 20.127  7.404   1.00 36.66 ? 66   GLY D C   1 
ATOM   8573 O  O   . GLY D 2 66  ? 71.526 20.693  7.242   1.00 36.79 ? 66   GLY D O   1 
ATOM   8574 N  N   . ARG D 2 67  ? 70.040 19.712  8.598   1.00 37.63 ? 67   ARG D N   1 
ATOM   8575 C  CA  . ARG D 2 67  ? 70.862 19.923  9.787   1.00 33.50 ? 67   ARG D CA  1 
ATOM   8576 C  C   . ARG D 2 67  ? 71.500 18.622  10.280  1.00 39.57 ? 67   ARG D C   1 
ATOM   8577 O  O   . ARG D 2 67  ? 72.618 18.632  10.806  1.00 31.74 ? 67   ARG D O   1 
ATOM   8578 C  CB  . ARG D 2 67  ? 70.032 20.560  10.903  1.00 31.99 ? 67   ARG D CB  1 
ATOM   8579 C  CG  . ARG D 2 67  ? 69.425 21.909  10.525  1.00 35.17 ? 67   ARG D CG  1 
ATOM   8580 C  CD  . ARG D 2 67  ? 68.766 22.583  11.714  1.00 33.33 ? 67   ARG D CD  1 
ATOM   8581 N  NE  . ARG D 2 67  ? 67.666 21.787  12.250  1.00 39.31 ? 67   ARG D NE  1 
ATOM   8582 C  CZ  . ARG D 2 67  ? 67.659 21.234  13.459  1.00 37.55 ? 67   ARG D CZ  1 
ATOM   8583 N  NH1 . ARG D 2 67  ? 68.690 21.394  14.272  1.00 33.76 ? 67   ARG D NH1 1 
ATOM   8584 N  NH2 . ARG D 2 67  ? 66.612 20.524  13.858  1.00 39.41 ? 67   ARG D NH2 1 
ATOM   8585 N  N   . PHE D 2 68  ? 70.791 17.509  10.106  1.00 30.25 ? 68   PHE D N   1 
ATOM   8586 C  CA  . PHE D 2 68  ? 71.267 16.211  10.587  1.00 33.68 ? 68   PHE D CA  1 
ATOM   8587 C  C   . PHE D 2 68  ? 71.823 15.350  9.460   1.00 31.38 ? 68   PHE D C   1 
ATOM   8588 O  O   . PHE D 2 68  ? 71.401 15.460  8.312   1.00 34.13 ? 68   PHE D O   1 
ATOM   8589 C  CB  . PHE D 2 68  ? 70.146 15.435  11.290  1.00 34.66 ? 68   PHE D CB  1 
ATOM   8590 C  CG  . PHE D 2 68  ? 69.749 15.990  12.633  1.00 35.16 ? 68   PHE D CG  1 
ATOM   8591 C  CD1 . PHE D 2 68  ? 70.203 17.230  13.065  1.00 36.11 ? 68   PHE D CD1 1 
ATOM   8592 C  CD2 . PHE D 2 68  ? 68.923 15.258  13.473  1.00 31.22 ? 68   PHE D CD2 1 
ATOM   8593 C  CE1 . PHE D 2 68  ? 69.831 17.727  14.306  1.00 32.76 ? 68   PHE D CE1 1 
ATOM   8594 C  CE2 . PHE D 2 68  ? 68.547 15.751  14.713  1.00 34.86 ? 68   PHE D CE2 1 
ATOM   8595 C  CZ  . PHE D 2 68  ? 69.001 16.989  15.126  1.00 36.88 ? 68   PHE D CZ  1 
ATOM   8596 N  N   . THR D 2 69  ? 72.757 14.473  9.797   1.00 27.37 ? 69   THR D N   1 
ATOM   8597 C  CA  . THR D 2 69  ? 73.270 13.525  8.829   1.00 28.99 ? 69   THR D CA  1 
ATOM   8598 C  C   . THR D 2 69  ? 73.456 12.156  9.466   1.00 33.58 ? 69   THR D C   1 
ATOM   8599 O  O   . THR D 2 69  ? 74.185 12.007  10.447  1.00 33.83 ? 69   THR D O   1 
ATOM   8600 C  CB  . THR D 2 69  ? 74.610 13.982  8.230   1.00 34.80 ? 69   THR D CB  1 
ATOM   8601 O  OG1 . THR D 2 69  ? 74.469 15.288  7.645   1.00 32.83 ? 69   THR D OG1 1 
ATOM   8602 C  CG2 . THR D 2 69  ? 75.066 12.990  7.176   1.00 26.95 ? 69   THR D CG2 1 
ATOM   8603 N  N   . ILE D 2 70  ? 72.798 11.155  8.899   1.00 28.93 ? 70   ILE D N   1 
ATOM   8604 C  CA  . ILE D 2 70  ? 72.913 9.793   9.398   1.00 31.66 ? 70   ILE D CA  1 
ATOM   8605 C  C   . ILE D 2 70  ? 73.903 8.999   8.542   1.00 31.60 ? 70   ILE D C   1 
ATOM   8606 O  O   . ILE D 2 70  ? 73.990 9.199   7.328   1.00 32.04 ? 70   ILE D O   1 
ATOM   8607 C  CB  . ILE D 2 70  ? 71.525 9.084   9.419   1.00 28.33 ? 70   ILE D CB  1 
ATOM   8608 C  CG1 . ILE D 2 70  ? 71.578 7.793   10.243  1.00 28.08 ? 70   ILE D CG1 1 
ATOM   8609 C  CG2 . ILE D 2 70  ? 71.008 8.834   7.998   1.00 26.68 ? 70   ILE D CG2 1 
ATOM   8610 C  CD1 . ILE D 2 70  ? 70.268 7.002   10.227  1.00 28.87 ? 70   ILE D CD1 1 
ATOM   8611 N  N   . SER D 2 71  ? 74.657 8.107   9.177   1.00 24.27 ? 71   SER D N   1 
ATOM   8612 C  CA  . SER D 2 71  ? 75.593 7.254   8.457   1.00 28.50 ? 71   SER D CA  1 
ATOM   8613 C  C   . SER D 2 71  ? 75.902 6.026   9.282   1.00 26.36 ? 71   SER D C   1 
ATOM   8614 O  O   . SER D 2 71  ? 75.584 5.983   10.463  1.00 30.25 ? 71   SER D O   1 
ATOM   8615 C  CB  . SER D 2 71  ? 76.889 8.003   8.135   1.00 35.70 ? 71   SER D CB  1 
ATOM   8616 O  OG  . SER D 2 71  ? 77.566 8.374   9.322   1.00 28.33 ? 71   SER D OG  1 
ATOM   8617 N  N   . ARG D 2 72  ? 76.539 5.036   8.663   1.00 27.59 ? 72   ARG D N   1 
ATOM   8618 C  CA  . ARG D 2 72  ? 76.891 3.807   9.361   1.00 32.13 ? 72   ARG D CA  1 
ATOM   8619 C  C   . ARG D 2 72  ? 78.223 3.231   8.886   1.00 35.76 ? 72   ARG D C   1 
ATOM   8620 O  O   . ARG D 2 72  ? 78.624 3.418   7.742   1.00 28.11 ? 72   ARG D O   1 
ATOM   8621 C  CB  . ARG D 2 72  ? 75.784 2.757   9.190   1.00 30.36 ? 72   ARG D CB  1 
ATOM   8622 C  CG  . ARG D 2 72  ? 75.575 2.286   7.757   1.00 35.46 ? 72   ARG D CG  1 
ATOM   8623 C  CD  . ARG D 2 72  ? 74.282 1.469   7.605   1.00 34.16 ? 72   ARG D CD  1 
ATOM   8624 N  NE  . ARG D 2 72  ? 74.297 0.243   8.403   1.00 32.34 ? 72   ARG D NE  1 
ATOM   8625 C  CZ  . ARG D 2 72  ? 73.228 -0.518  8.628   1.00 35.73 ? 72   ARG D CZ  1 
ATOM   8626 N  NH1 . ARG D 2 72  ? 72.046 -0.176  8.118   1.00 31.01 ? 72   ARG D NH1 1 
ATOM   8627 N  NH2 . ARG D 2 72  ? 73.337 -1.620  9.363   1.00 28.93 ? 72   ARG D NH2 1 
ATOM   8628 N  N   . ASP D 2 73  ? 78.906 2.536   9.787   1.00 33.05 ? 73   ASP D N   1 
ATOM   8629 C  CA  . ASP D 2 73  ? 80.120 1.807   9.446   1.00 43.49 ? 73   ASP D CA  1 
ATOM   8630 C  C   . ASP D 2 73  ? 79.869 0.339   9.731   1.00 37.53 ? 73   ASP D C   1 
ATOM   8631 O  O   . ASP D 2 73  ? 79.926 -0.091  10.877  1.00 39.65 ? 73   ASP D O   1 
ATOM   8632 C  CB  . ASP D 2 73  ? 81.322 2.326   10.249  1.00 44.47 ? 73   ASP D CB  1 
ATOM   8633 C  CG  . ASP D 2 73  ? 82.662 1.775   9.749   1.00 47.13 ? 73   ASP D CG  1 
ATOM   8634 O  OD1 . ASP D 2 73  ? 82.748 0.565   9.445   1.00 41.21 ? 73   ASP D OD1 1 
ATOM   8635 O  OD2 . ASP D 2 73  ? 83.632 2.563   9.661   1.00 42.04 ? 73   ASP D OD2 1 
ATOM   8636 N  N   . ASN D 2 74  ? 79.578 -0.429  8.690   1.00 35.90 ? 74   ASN D N   1 
ATOM   8637 C  CA  . ASN D 2 74  ? 79.217 -1.821  8.889   1.00 37.18 ? 74   ASN D CA  1 
ATOM   8638 C  C   . ASN D 2 74  ? 80.396 -2.647  9.394   1.00 45.64 ? 74   ASN D C   1 
ATOM   8639 O  O   . ASN D 2 74  ? 80.206 -3.622  10.118  1.00 47.15 ? 74   ASN D O   1 
ATOM   8640 C  CB  . ASN D 2 74  ? 78.642 -2.405  7.599   1.00 42.56 ? 74   ASN D CB  1 
ATOM   8641 C  CG  . ASN D 2 74  ? 77.251 -1.863  7.297   1.00 44.90 ? 74   ASN D CG  1 
ATOM   8642 O  OD1 . ASN D 2 74  ? 76.550 -1.409  8.202   1.00 41.39 ? 74   ASN D OD1 1 
ATOM   8643 N  ND2 . ASN D 2 74  ? 76.851 -1.901  6.031   1.00 36.20 ? 74   ASN D ND2 1 
ATOM   8644 N  N   . ALA D 2 75  ? 81.610 -2.235  9.040   1.00 44.14 ? 75   ALA D N   1 
ATOM   8645 C  CA  . ALA D 2 75  ? 82.809 -2.882  9.563   1.00 46.79 ? 75   ALA D CA  1 
ATOM   8646 C  C   . ALA D 2 75  ? 82.926 -2.660  11.069  1.00 44.66 ? 75   ALA D C   1 
ATOM   8647 O  O   . ALA D 2 75  ? 83.255 -3.578  11.819  1.00 42.30 ? 75   ALA D O   1 
ATOM   8648 C  CB  . ALA D 2 75  ? 84.053 -2.368  8.850   1.00 40.03 ? 75   ALA D CB  1 
ATOM   8649 N  N   . LYS D 2 76  ? 82.640 -1.437  11.503  1.00 43.13 ? 76   LYS D N   1 
ATOM   8650 C  CA  . LYS D 2 76  ? 82.744 -1.070  12.911  1.00 38.62 ? 76   LYS D CA  1 
ATOM   8651 C  C   . LYS D 2 76  ? 81.463 -1.368  13.700  1.00 49.03 ? 76   LYS D C   1 
ATOM   8652 O  O   . LYS D 2 76  ? 81.403 -1.101  14.901  1.00 41.62 ? 76   LYS D O   1 
ATOM   8653 C  CB  . LYS D 2 76  ? 83.097 0.419   13.042  1.00 39.13 ? 76   LYS D CB  1 
ATOM   8654 C  CG  . LYS D 2 76  ? 84.564 0.735   12.811  1.00 45.06 ? 76   LYS D CG  1 
ATOM   8655 C  CD  . LYS D 2 76  ? 84.782 2.210   12.549  1.00 44.61 ? 76   LYS D CD  1 
ATOM   8656 C  CE  . LYS D 2 76  ? 86.157 2.461   11.947  0.00 45.50 ? 76   LYS D CE  1 
ATOM   8657 N  NZ  . LYS D 2 76  ? 86.197 3.717   11.146  0.00 46.35 ? 76   LYS D NZ  1 
ATOM   8658 N  N   . ASN D 2 77  ? 80.450 -1.919  13.027  1.00 46.49 ? 77   ASN D N   1 
ATOM   8659 C  CA  . ASN D 2 77  ? 79.158 -2.197  13.658  1.00 44.07 ? 77   ASN D CA  1 
ATOM   8660 C  C   . ASN D 2 77  ? 78.607 -0.981  14.408  1.00 42.72 ? 77   ASN D C   1 
ATOM   8661 O  O   . ASN D 2 77  ? 78.184 -1.081  15.561  1.00 36.14 ? 77   ASN D O   1 
ATOM   8662 C  CB  . ASN D 2 77  ? 79.277 -3.389  14.612  1.00 42.87 ? 77   ASN D CB  1 
ATOM   8663 C  CG  . ASN D 2 77  ? 79.546 -4.690  13.886  1.00 49.03 ? 77   ASN D CG  1 
ATOM   8664 O  OD1 . ASN D 2 77  ? 79.002 -4.936  12.811  1.00 50.78 ? 77   ASN D OD1 1 
ATOM   8665 N  ND2 . ASN D 2 77  ? 80.397 -5.530  14.466  1.00 53.23 ? 77   ASN D ND2 1 
ATOM   8666 N  N   . THR D 2 78  ? 78.624 0.170   13.744  1.00 38.39 ? 78   THR D N   1 
ATOM   8667 C  CA  . THR D 2 78  ? 78.315 1.427   14.405  1.00 40.14 ? 78   THR D CA  1 
ATOM   8668 C  C   . THR D 2 78  ? 77.443 2.346   13.543  1.00 39.43 ? 78   THR D C   1 
ATOM   8669 O  O   . THR D 2 78  ? 77.652 2.474   12.340  1.00 39.88 ? 78   THR D O   1 
ATOM   8670 C  CB  . THR D 2 78  ? 79.616 2.171   14.802  1.00 40.99 ? 78   THR D CB  1 
ATOM   8671 O  OG1 . THR D 2 78  ? 80.404 1.338   15.659  1.00 40.54 ? 78   THR D OG1 1 
ATOM   8672 C  CG2 . THR D 2 78  ? 79.299 3.464   15.533  1.00 40.86 ? 78   THR D CG2 1 
ATOM   8673 N  N   . LEU D 2 79  ? 76.464 2.977   14.185  1.00 34.63 ? 79   LEU D N   1 
ATOM   8674 C  CA  . LEU D 2 79  ? 75.570 3.920   13.541  1.00 35.85 ? 79   LEU D CA  1 
ATOM   8675 C  C   . LEU D 2 79  ? 75.824 5.330   14.067  1.00 32.11 ? 79   LEU D C   1 
ATOM   8676 O  O   . LEU D 2 79  ? 76.021 5.523   15.271  1.00 33.89 ? 79   LEU D O   1 
ATOM   8677 C  CB  . LEU D 2 79  ? 74.115 3.511   13.785  1.00 35.60 ? 79   LEU D CB  1 
ATOM   8678 C  CG  . LEU D 2 79  ? 72.998 4.418   13.272  1.00 35.32 ? 79   LEU D CG  1 
ATOM   8679 C  CD1 . LEU D 2 79  ? 72.854 4.300   11.758  1.00 32.19 ? 79   LEU D CD1 1 
ATOM   8680 C  CD2 . LEU D 2 79  ? 71.698 4.059   13.962  1.00 30.63 ? 79   LEU D CD2 1 
ATOM   8681 N  N   . TYR D 2 80  ? 75.804 6.315   13.177  1.00 29.36 ? 80   TYR D N   1 
ATOM   8682 C  CA  . TYR D 2 80  ? 76.094 7.690   13.573  1.00 30.02 ? 80   TYR D CA  1 
ATOM   8683 C  C   . TYR D 2 80  ? 74.962 8.666   13.261  1.00 33.55 ? 80   TYR D C   1 
ATOM   8684 O  O   . TYR D 2 80  ? 74.239 8.513   12.276  1.00 29.06 ? 80   TYR D O   1 
ATOM   8685 C  CB  . TYR D 2 80  ? 77.375 8.181   12.889  1.00 30.46 ? 80   TYR D CB  1 
ATOM   8686 C  CG  . TYR D 2 80  ? 78.587 7.304   13.128  1.00 30.25 ? 80   TYR D CG  1 
ATOM   8687 C  CD1 . TYR D 2 80  ? 79.359 7.446   14.273  1.00 32.91 ? 80   TYR D CD1 1 
ATOM   8688 C  CD2 . TYR D 2 80  ? 78.959 6.338   12.203  1.00 36.05 ? 80   TYR D CD2 1 
ATOM   8689 C  CE1 . TYR D 2 80  ? 80.469 6.644   14.490  1.00 36.08 ? 80   TYR D CE1 1 
ATOM   8690 C  CE2 . TYR D 2 80  ? 80.066 5.538   12.408  1.00 37.72 ? 80   TYR D CE2 1 
ATOM   8691 C  CZ  . TYR D 2 80  ? 80.817 5.697   13.551  1.00 38.15 ? 80   TYR D CZ  1 
ATOM   8692 O  OH  . TYR D 2 80  ? 81.914 4.896   13.752  1.00 46.29 ? 80   TYR D OH  1 
ATOM   8693 N  N   . LEU D 2 81  ? 74.822 9.676   14.110  1.00 26.85 ? 81   LEU D N   1 
ATOM   8694 C  CA  . LEU D 2 81  ? 73.963 10.805  13.799  1.00 30.12 ? 81   LEU D CA  1 
ATOM   8695 C  C   . LEU D 2 81  ? 74.734 12.086  14.023  1.00 32.71 ? 81   LEU D C   1 
ATOM   8696 O  O   . LEU D 2 81  ? 75.112 12.393  15.148  1.00 34.58 ? 81   LEU D O   1 
ATOM   8697 C  CB  . LEU D 2 81  ? 72.691 10.804  14.646  1.00 28.94 ? 81   LEU D CB  1 
ATOM   8698 C  CG  . LEU D 2 81  ? 71.715 11.926  14.281  1.00 30.40 ? 81   LEU D CG  1 
ATOM   8699 C  CD1 . LEU D 2 81  ? 71.306 11.811  12.818  1.00 32.31 ? 81   LEU D CD1 1 
ATOM   8700 C  CD2 . LEU D 2 81  ? 70.483 11.920  15.178  1.00 36.90 ? 81   LEU D CD2 1 
ATOM   8701 N  N   . GLN D 2 82  ? 74.967 12.831  12.951  1.00 27.70 ? 82   GLN D N   1 
ATOM   8702 C  CA  . GLN D 2 82  ? 75.653 14.113  13.048  1.00 35.46 ? 82   GLN D CA  1 
ATOM   8703 C  C   . GLN D 2 82  ? 74.638 15.238  13.127  1.00 33.02 ? 82   GLN D C   1 
ATOM   8704 O  O   . GLN D 2 82  ? 73.921 15.495  12.170  1.00 38.78 ? 82   GLN D O   1 
ATOM   8705 C  CB  . GLN D 2 82  ? 76.585 14.327  11.851  1.00 32.00 ? 82   GLN D CB  1 
ATOM   8706 C  CG  . GLN D 2 82  ? 77.256 15.686  11.836  1.00 34.48 ? 82   GLN D CG  1 
ATOM   8707 C  CD  . GLN D 2 82  ? 78.200 15.883  13.007  1.00 48.68 ? 82   GLN D CD  1 
ATOM   8708 O  OE1 . GLN D 2 82  ? 79.019 15.010  13.318  1.00 47.35 ? 82   GLN D OE1 1 
ATOM   8709 N  NE2 . GLN D 2 82  ? 78.087 17.030  13.671  1.00 44.31 ? 82   GLN D NE2 1 
ATOM   8710 N  N   . MET D 2 83  ? 74.577 15.909  14.270  1.00 35.32 ? 83   MET D N   1 
ATOM   8711 C  CA  . MET D 2 83  ? 73.586 16.957  14.482  1.00 37.87 ? 83   MET D CA  1 
ATOM   8712 C  C   . MET D 2 83  ? 74.224 18.348  14.436  1.00 40.36 ? 83   MET D C   1 
ATOM   8713 O  O   . MET D 2 83  ? 75.092 18.662  15.247  1.00 39.26 ? 83   MET D O   1 
ATOM   8714 C  CB  . MET D 2 83  ? 72.871 16.746  15.822  1.00 42.40 ? 83   MET D CB  1 
ATOM   8715 C  CG  . MET D 2 83  ? 72.258 15.356  16.005  1.00 38.71 ? 83   MET D CG  1 
ATOM   8716 S  SD  . MET D 2 83  ? 71.986 14.941  17.743  1.00 42.80 ? 83   MET D SD  1 
ATOM   8717 C  CE  . MET D 2 83  ? 70.537 15.889  18.126  1.00 36.84 ? 83   MET D CE  1 
ATOM   8718 N  N   . ASN D 2 84  ? 73.793 19.171  13.485  1.00 34.62 ? 84   ASN D N   1 
ATOM   8719 C  CA  . ASN D 2 84  ? 74.281 20.544  13.372  1.00 35.40 ? 84   ASN D CA  1 
ATOM   8720 C  C   . ASN D 2 84  ? 73.186 21.577  13.608  1.00 36.11 ? 84   ASN D C   1 
ATOM   8721 O  O   . ASN D 2 84  ? 72.001 21.272  13.480  1.00 35.53 ? 84   ASN D O   1 
ATOM   8722 C  CB  . ASN D 2 84  ? 74.901 20.781  11.997  1.00 34.50 ? 84   ASN D CB  1 
ATOM   8723 C  CG  . ASN D 2 84  ? 76.122 19.932  11.758  1.00 39.34 ? 84   ASN D CG  1 
ATOM   8724 O  OD1 . ASN D 2 84  ? 76.925 19.702  12.665  1.00 39.31 ? 84   ASN D OD1 1 
ATOM   8725 N  ND2 . ASN D 2 84  ? 76.273 19.458  10.531  1.00 40.23 ? 84   ASN D ND2 1 
ATOM   8726 N  N   . SER D 2 85  ? 73.599 22.800  13.936  1.00 35.15 ? 85   SER D N   1 
ATOM   8727 C  CA  . SER D 2 85  ? 72.677 23.904  14.181  1.00 35.62 ? 85   SER D CA  1 
ATOM   8728 C  C   . SER D 2 85  ? 71.584 23.511  15.165  1.00 39.57 ? 85   SER D C   1 
ATOM   8729 O  O   . SER D 2 85  ? 70.402 23.750  14.916  1.00 43.65 ? 85   SER D O   1 
ATOM   8730 C  CB  . SER D 2 85  ? 72.047 24.383  12.870  1.00 39.11 ? 85   SER D CB  1 
ATOM   8731 O  OG  . SER D 2 85  ? 73.007 25.011  12.043  1.00 47.53 ? 85   SER D OG  1 
ATOM   8732 N  N   . LEU D 2 86  ? 71.986 22.898  16.274  1.00 37.41 ? 86   LEU D N   1 
ATOM   8733 C  CA  . LEU D 2 86  ? 71.045 22.408  17.275  1.00 42.22 ? 86   LEU D CA  1 
ATOM   8734 C  C   . LEU D 2 86  ? 70.106 23.496  17.808  1.00 42.88 ? 86   LEU D C   1 
ATOM   8735 O  O   . LEU D 2 86  ? 70.523 24.623  18.064  1.00 36.09 ? 86   LEU D O   1 
ATOM   8736 C  CB  . LEU D 2 86  ? 71.806 21.768  18.433  1.00 38.11 ? 86   LEU D CB  1 
ATOM   8737 C  CG  . LEU D 2 86  ? 72.352 20.376  18.133  1.00 42.18 ? 86   LEU D CG  1 
ATOM   8738 C  CD1 . LEU D 2 86  ? 73.316 19.944  19.218  1.00 42.14 ? 86   LEU D CD1 1 
ATOM   8739 C  CD2 . LEU D 2 86  ? 71.200 19.385  18.007  1.00 40.24 ? 86   LEU D CD2 1 
ATOM   8740 N  N   . LYS D 2 87  ? 68.838 23.127  17.964  1.00 40.09 ? 87   LYS D N   1 
ATOM   8741 C  CA  . LYS D 2 87  ? 67.796 24.023  18.439  1.00 33.66 ? 87   LYS D CA  1 
ATOM   8742 C  C   . LYS D 2 87  ? 67.209 23.508  19.746  1.00 45.34 ? 87   LYS D C   1 
ATOM   8743 O  O   . LYS D 2 87  ? 67.327 22.324  20.056  1.00 42.98 ? 87   LYS D O   1 
ATOM   8744 C  CB  . LYS D 2 87  ? 66.682 24.152  17.401  1.00 47.05 ? 87   LYS D CB  1 
ATOM   8745 C  CG  . LYS D 2 87  ? 67.138 24.503  15.990  1.00 46.14 ? 87   LYS D CG  1 
ATOM   8746 C  CD  . LYS D 2 87  ? 65.940 24.469  15.044  1.00 46.38 ? 87   LYS D CD  1 
ATOM   8747 C  CE  . LYS D 2 87  ? 66.299 24.923  13.638  1.00 47.90 ? 87   LYS D CE  1 
ATOM   8748 N  NZ  . LYS D 2 87  ? 65.097 24.906  12.753  1.00 48.98 ? 87   LYS D NZ  1 
ATOM   8749 N  N   . SER D 2 88  ? 66.558 24.389  20.500  1.00 38.72 ? 88   SER D N   1 
ATOM   8750 C  CA  . SER D 2 88  ? 65.923 23.992  21.751  1.00 43.28 ? 88   SER D CA  1 
ATOM   8751 C  C   . SER D 2 88  ? 64.876 22.895  21.526  1.00 46.07 ? 88   SER D C   1 
ATOM   8752 O  O   . SER D 2 88  ? 64.642 22.066  22.404  1.00 46.65 ? 88   SER D O   1 
ATOM   8753 C  CB  . SER D 2 88  ? 65.282 25.202  22.436  1.00 47.45 ? 88   SER D CB  1 
ATOM   8754 O  OG  . SER D 2 88  ? 64.212 25.718  21.666  1.00 58.05 ? 88   SER D OG  1 
ATOM   8755 N  N   . GLU D 2 89  ? 64.272 22.885  20.339  1.00 41.63 ? 89   GLU D N   1 
ATOM   8756 C  CA  . GLU D 2 89  ? 63.293 21.864  19.967  1.00 41.02 ? 89   GLU D CA  1 
ATOM   8757 C  C   . GLU D 2 89  ? 63.913 20.478  19.788  1.00 43.33 ? 89   GLU D C   1 
ATOM   8758 O  O   . GLU D 2 89  ? 63.197 19.489  19.665  1.00 43.28 ? 89   GLU D O   1 
ATOM   8759 C  CB  . GLU D 2 89  ? 62.568 22.255  18.673  1.00 43.87 ? 89   GLU D CB  1 
ATOM   8760 C  CG  . GLU D 2 89  ? 61.480 23.301  18.836  1.00 46.16 ? 89   GLU D CG  1 
ATOM   8761 C  CD  . GLU D 2 89  ? 60.280 23.032  17.945  0.00 51.40 ? 89   GLU D CD  1 
ATOM   8762 O  OE1 . GLU D 2 89  ? 59.552 22.051  18.209  0.00 52.36 ? 89   GLU D OE1 1 
ATOM   8763 O  OE2 . GLU D 2 89  ? 60.066 23.796  16.981  0.00 53.09 ? 89   GLU D OE2 1 
ATOM   8764 N  N   . ASP D 2 90  ? 65.239 20.404  19.760  1.00 34.07 ? 90   ASP D N   1 
ATOM   8765 C  CA  . ASP D 2 90  ? 65.901 19.126  19.560  1.00 36.34 ? 90   ASP D CA  1 
ATOM   8766 C  C   . ASP D 2 90  ? 66.172 18.430  20.891  1.00 33.12 ? 90   ASP D C   1 
ATOM   8767 O  O   . ASP D 2 90  ? 66.708 17.327  20.920  1.00 42.73 ? 90   ASP D O   1 
ATOM   8768 C  CB  . ASP D 2 90  ? 67.203 19.308  18.772  1.00 36.76 ? 90   ASP D CB  1 
ATOM   8769 C  CG  . ASP D 2 90  ? 66.958 19.766  17.340  1.00 42.02 ? 90   ASP D CG  1 
ATOM   8770 O  OD1 . ASP D 2 90  ? 65.953 19.330  16.743  1.00 40.20 ? 90   ASP D OD1 1 
ATOM   8771 O  OD2 . ASP D 2 90  ? 67.766 20.561  16.809  1.00 36.67 ? 90   ASP D OD2 1 
ATOM   8772 N  N   . THR D 2 91  ? 65.797 19.074  21.988  1.00 33.60 ? 91   THR D N   1 
ATOM   8773 C  CA  . THR D 2 91  ? 65.970 18.485  23.311  1.00 36.65 ? 91   THR D CA  1 
ATOM   8774 C  C   . THR D 2 91  ? 65.105 17.236  23.454  1.00 36.80 ? 91   THR D C   1 
ATOM   8775 O  O   . THR D 2 91  ? 63.883 17.319  23.363  1.00 37.18 ? 91   THR D O   1 
ATOM   8776 C  CB  . THR D 2 91  ? 65.619 19.488  24.429  1.00 39.30 ? 91   THR D CB  1 
ATOM   8777 O  OG1 . THR D 2 91  ? 66.528 20.594  24.392  1.00 40.34 ? 91   THR D OG1 1 
ATOM   8778 C  CG2 . THR D 2 91  ? 65.704 18.819  25.796  1.00 37.14 ? 91   THR D CG2 1 
ATOM   8779 N  N   . ALA D 2 92  ? 65.749 16.087  23.665  1.00 35.32 ? 92   ALA D N   1 
ATOM   8780 C  CA  . ALA D 2 92  ? 65.053 14.803  23.791  1.00 35.13 ? 92   ALA D CA  1 
ATOM   8781 C  C   . ALA D 2 92  ? 65.997 13.673  24.191  1.00 38.60 ? 92   ALA D C   1 
ATOM   8782 O  O   . ALA D 2 92  ? 67.220 13.849  24.236  1.00 33.25 ? 92   ALA D O   1 
ATOM   8783 C  CB  . ALA D 2 92  ? 64.356 14.443  22.485  1.00 30.31 ? 92   ALA D CB  1 
ATOM   8784 N  N   . LEU D 2 93  ? 65.418 12.512  24.490  1.00 35.89 ? 93   LEU D N   1 
ATOM   8785 C  CA  . LEU D 2 93  ? 66.184 11.278  24.599  1.00 42.56 ? 93   LEU D CA  1 
ATOM   8786 C  C   . LEU D 2 93  ? 66.242 10.642  23.209  1.00 35.51 ? 93   LEU D C   1 
ATOM   8787 O  O   . LEU D 2 93  ? 65.207 10.468  22.572  1.00 34.06 ? 93   LEU D O   1 
ATOM   8788 C  CB  . LEU D 2 93  ? 65.555 10.324  25.618  1.00 37.52 ? 93   LEU D CB  1 
ATOM   8789 C  CG  . LEU D 2 93  ? 66.434 9.191   26.149  1.00 41.29 ? 93   LEU D CG  1 
ATOM   8790 C  CD1 . LEU D 2 93  ? 67.633 9.754   26.888  0.00 41.01 ? 93   LEU D CD1 1 
ATOM   8791 C  CD2 . LEU D 2 93  ? 65.637 8.277   27.061  0.00 42.57 ? 93   LEU D CD2 1 
ATOM   8792 N  N   . TYR D 2 94  ? 67.448 10.316  22.742  1.00 37.01 ? 94   TYR D N   1 
ATOM   8793 C  CA  . TYR D 2 94  ? 67.658 9.804   21.379  1.00 32.67 ? 94   TYR D CA  1 
ATOM   8794 C  C   . TYR D 2 94  ? 68.007 8.323   21.355  1.00 34.88 ? 94   TYR D C   1 
ATOM   8795 O  O   . TYR D 2 94  ? 68.971 7.897   21.989  1.00 34.07 ? 94   TYR D O   1 
ATOM   8796 C  CB  . TYR D 2 94  ? 68.769 10.585  20.672  1.00 28.06 ? 94   TYR D CB  1 
ATOM   8797 C  CG  . TYR D 2 94  ? 68.329 11.923  20.132  1.00 33.67 ? 94   TYR D CG  1 
ATOM   8798 C  CD1 . TYR D 2 94  ? 68.034 12.971  20.985  1.00 29.26 ? 94   TYR D CD1 1 
ATOM   8799 C  CD2 . TYR D 2 94  ? 68.216 12.138  18.769  1.00 28.65 ? 94   TYR D CD2 1 
ATOM   8800 C  CE1 . TYR D 2 94  ? 67.636 14.192  20.500  1.00 32.75 ? 94   TYR D CE1 1 
ATOM   8801 C  CE2 . TYR D 2 94  ? 67.814 13.360  18.275  1.00 34.92 ? 94   TYR D CE2 1 
ATOM   8802 C  CZ  . TYR D 2 94  ? 67.523 14.385  19.147  1.00 29.35 ? 94   TYR D CZ  1 
ATOM   8803 O  OH  . TYR D 2 94  ? 67.116 15.609  18.670  1.00 30.43 ? 94   TYR D OH  1 
ATOM   8804 N  N   . TYR D 2 95  ? 67.233 7.553   20.596  1.00 29.27 ? 95   TYR D N   1 
ATOM   8805 C  CA  . TYR D 2 95  ? 67.408 6.112   20.532  1.00 29.95 ? 95   TYR D CA  1 
ATOM   8806 C  C   . TYR D 2 95  ? 67.901 5.651   19.175  1.00 35.48 ? 95   TYR D C   1 
ATOM   8807 O  O   . TYR D 2 95  ? 67.582 6.244   18.144  1.00 33.31 ? 95   TYR D O   1 
ATOM   8808 C  CB  . TYR D 2 95  ? 66.100 5.376   20.819  1.00 37.64 ? 95   TYR D CB  1 
ATOM   8809 C  CG  . TYR D 2 95  ? 65.424 5.693   22.128  1.00 39.65 ? 95   TYR D CG  1 
ATOM   8810 C  CD1 . TYR D 2 95  ? 65.856 5.115   23.317  1.00 40.99 ? 95   TYR D CD1 1 
ATOM   8811 C  CD2 . TYR D 2 95  ? 64.316 6.527   22.168  1.00 40.56 ? 95   TYR D CD2 1 
ATOM   8812 C  CE1 . TYR D 2 95  ? 65.220 5.386   24.512  1.00 43.10 ? 95   TYR D CE1 1 
ATOM   8813 C  CE2 . TYR D 2 95  ? 63.676 6.808   23.356  1.00 42.67 ? 95   TYR D CE2 1 
ATOM   8814 C  CZ  . TYR D 2 95  ? 64.127 6.235   24.524  1.00 48.47 ? 95   TYR D CZ  1 
ATOM   8815 O  OH  . TYR D 2 95  ? 63.479 6.512   25.705  1.00 48.60 ? 95   TYR D OH  1 
ATOM   8816 N  N   . CYS D 2 96  ? 68.648 4.558   19.201  1.00 28.81 ? 96   CYS D N   1 
ATOM   8817 C  CA  . CYS D 2 96  ? 69.043 3.828   18.018  1.00 32.09 ? 96   CYS D CA  1 
ATOM   8818 C  C   . CYS D 2 96  ? 68.212 2.535   17.956  1.00 32.11 ? 96   CYS D C   1 
ATOM   8819 O  O   . CYS D 2 96  ? 67.977 1.907   18.987  1.00 31.71 ? 96   CYS D O   1 
ATOM   8820 C  CB  . CYS D 2 96  ? 70.551 3.556   18.078  1.00 35.91 ? 96   CYS D CB  1 
ATOM   8821 S  SG  . CYS D 2 96  ? 71.156 2.134   17.186  1.00 53.60 ? 96   CYS D SG  1 
ATOM   8822 N  N   . ALA D 2 97  ? 67.741 2.153   16.768  1.00 28.01 ? 97   ALA D N   1 
ATOM   8823 C  CA  . ALA D 2 97  ? 66.897 0.958   16.634  1.00 28.57 ? 97   ALA D CA  1 
ATOM   8824 C  C   . ALA D 2 97  ? 66.850 0.419   15.203  1.00 27.50 ? 97   ALA D C   1 
ATOM   8825 O  O   . ALA D 2 97  ? 67.198 1.126   14.255  1.00 25.74 ? 97   ALA D O   1 
ATOM   8826 C  CB  . ALA D 2 97  ? 65.479 1.259   17.123  1.00 25.37 ? 97   ALA D CB  1 
ATOM   8827 N  N   . VAL D 2 98  ? 66.415 -0.832  15.050  1.00 26.96 ? 98   VAL D N   1 
ATOM   8828 C  CA  . VAL D 2 98  ? 66.252 -1.422  13.720  1.00 24.76 ? 98   VAL D CA  1 
ATOM   8829 C  C   . VAL D 2 98  ? 64.856 -1.138  13.151  1.00 26.16 ? 98   VAL D C   1 
ATOM   8830 O  O   . VAL D 2 98  ? 64.584 -1.434  11.993  1.00 32.70 ? 98   VAL D O   1 
ATOM   8831 C  CB  . VAL D 2 98  ? 66.480 -2.945  13.714  1.00 30.18 ? 98   VAL D CB  1 
ATOM   8832 C  CG1 . VAL D 2 98  ? 67.932 -3.282  14.047  1.00 35.65 ? 98   VAL D CG1 1 
ATOM   8833 C  CG2 . VAL D 2 98  ? 65.517 -3.643  14.665  1.00 30.29 ? 98   VAL D CG2 1 
ATOM   8834 N  N   . GLY D 2 99  ? 63.986 -0.565  13.971  1.00 23.36 ? 99   GLY D N   1 
ATOM   8835 C  CA  . GLY D 2 99  ? 62.688 -0.088  13.521  1.00 30.67 ? 99   GLY D CA  1 
ATOM   8836 C  C   . GLY D 2 99  ? 62.194 1.010   14.447  1.00 24.56 ? 99   GLY D C   1 
ATOM   8837 O  O   . GLY D 2 99  ? 62.555 1.020   15.621  1.00 29.15 ? 99   GLY D O   1 
ATOM   8838 N  N   . MET D 2 100 ? 61.372 1.919   13.930  1.00 25.86 ? 100  MET D N   1 
ATOM   8839 C  CA  . MET D 2 100 ? 60.877 3.062   14.702  1.00 27.84 ? 100  MET D CA  1 
ATOM   8840 C  C   . MET D 2 100 ? 60.219 2.653   16.009  1.00 30.66 ? 100  MET D C   1 
ATOM   8841 O  O   . MET D 2 100 ? 60.380 3.317   17.035  1.00 31.45 ? 100  MET D O   1 
ATOM   8842 C  CB  . MET D 2 100 ? 59.848 3.867   13.902  1.00 35.94 ? 100  MET D CB  1 
ATOM   8843 C  CG  . MET D 2 100 ? 60.322 4.472   12.604  1.00 41.66 ? 100  MET D CG  1 
ATOM   8844 S  SD  . MET D 2 100 ? 58.993 5.455   11.873  1.00 42.95 ? 100  MET D SD  1 
ATOM   8845 C  CE  . MET D 2 100 ? 58.109 5.993   13.336  0.00 33.04 ? 100  MET D CE  1 
ATOM   8846 N  N   . TYR D 2 101 ? 59.448 1.573   15.944  1.00 28.74 ? 101  TYR D N   1 
ATOM   8847 C  CA  . TYR D 2 101 ? 58.668 1.103   17.080  1.00 32.35 ? 101  TYR D CA  1 
ATOM   8848 C  C   . TYR D 2 101 ? 59.261 -0.179  17.677  1.00 32.40 ? 101  TYR D C   1 
ATOM   8849 O  O   . TYR D 2 101 ? 58.550 -0.952  18.324  1.00 31.82 ? 101  TYR D O   1 
ATOM   8850 C  CB  . TYR D 2 101 ? 57.208 0.860   16.664  1.00 28.61 ? 101  TYR D CB  1 
ATOM   8851 C  CG  . TYR D 2 101 ? 56.611 1.930   15.766  1.00 25.75 ? 101  TYR D CG  1 
ATOM   8852 C  CD1 . TYR D 2 101 ? 56.223 3.160   16.283  1.00 30.24 ? 101  TYR D CD1 1 
ATOM   8853 C  CD2 . TYR D 2 101 ? 56.431 1.707   14.407  1.00 23.03 ? 101  TYR D CD2 1 
ATOM   8854 C  CE1 . TYR D 2 101 ? 55.690 4.140   15.478  1.00 27.78 ? 101  TYR D CE1 1 
ATOM   8855 C  CE2 . TYR D 2 101 ? 55.888 2.689   13.586  1.00 26.74 ? 101  TYR D CE2 1 
ATOM   8856 C  CZ  . TYR D 2 101 ? 55.520 3.901   14.133  1.00 31.31 ? 101  TYR D CZ  1 
ATOM   8857 O  OH  . TYR D 2 101 ? 54.980 4.885   13.334  1.00 31.44 ? 101  TYR D OH  1 
ATOM   8858 N  N   . ALA D 2 102 ? 60.551 -0.417  17.442  1.00 29.54 ? 102  ALA D N   1 
ATOM   8859 C  CA  . ALA D 2 102 ? 61.229 -1.570  18.033  1.00 29.23 ? 102  ALA D CA  1 
ATOM   8860 C  C   . ALA D 2 102 ? 61.352 -1.404  19.545  1.00 30.94 ? 102  ALA D C   1 
ATOM   8861 O  O   . ALA D 2 102 ? 61.561 -0.301  20.041  1.00 36.99 ? 102  ALA D O   1 
ATOM   8862 C  CB  . ALA D 2 102 ? 62.611 -1.769  17.407  1.00 31.19 ? 102  ALA D CB  1 
ATOM   8863 N  N   . ALA D 2 103 ? 61.202 -2.502  20.274  1.00 35.35 ? 103  ALA D N   1 
ATOM   8864 C  CA  . ALA D 2 103 ? 61.399 -2.497  21.718  1.00 37.37 ? 103  ALA D CA  1 
ATOM   8865 C  C   . ALA D 2 103 ? 62.745 -3.129  22.066  1.00 35.94 ? 103  ALA D C   1 
ATOM   8866 O  O   . ALA D 2 103 ? 63.285 -3.905  21.270  1.00 30.21 ? 103  ALA D O   1 
ATOM   8867 C  CB  . ALA D 2 103 ? 60.259 -3.242  22.418  1.00 36.84 ? 103  ALA D CB  1 
ATOM   8868 N  N   . PRO D 2 104 ? 63.297 -2.787  23.248  1.00 33.54 ? 104  PRO D N   1 
ATOM   8869 C  CA  . PRO D 2 104 ? 64.508 -3.464  23.723  1.00 31.65 ? 104  PRO D CA  1 
ATOM   8870 C  C   . PRO D 2 104 ? 64.307 -4.972  23.680  1.00 34.18 ? 104  PRO D C   1 
ATOM   8871 O  O   . PRO D 2 104 ? 63.217 -5.436  24.015  1.00 39.87 ? 104  PRO D O   1 
ATOM   8872 C  CB  . PRO D 2 104 ? 64.658 -2.956  25.159  1.00 35.89 ? 104  PRO D CB  1 
ATOM   8873 C  CG  . PRO D 2 104 ? 64.032 -1.602  25.133  1.00 33.13 ? 104  PRO D CG  1 
ATOM   8874 C  CD  . PRO D 2 104 ? 62.874 -1.710  24.163  1.00 36.95 ? 104  PRO D CD  1 
ATOM   8875 N  N   . PRO D 2 105 ? 65.332 -5.728  23.262  1.00 33.48 ? 105  PRO D N   1 
ATOM   8876 C  CA  . PRO D 2 105 ? 66.705 -5.266  23.014  1.00 37.17 ? 105  PRO D CA  1 
ATOM   8877 C  C   . PRO D 2 105 ? 66.954 -4.646  21.637  1.00 33.52 ? 105  PRO D C   1 
ATOM   8878 O  O   . PRO D 2 105 ? 68.092 -4.295  21.335  1.00 32.30 ? 105  PRO D O   1 
ATOM   8879 C  CB  . PRO D 2 105 ? 67.513 -6.553  23.146  1.00 33.99 ? 105  PRO D CB  1 
ATOM   8880 C  CG  . PRO D 2 105 ? 66.582 -7.600  22.603  1.00 35.14 ? 105  PRO D CG  1 
ATOM   8881 C  CD  . PRO D 2 105 ? 65.179 -7.164  22.960  1.00 33.49 ? 105  PRO D CD  1 
ATOM   8882 N  N   . TRP D 2 106 ? 65.919 -4.517  20.815  1.00 30.67 ? 106  TRP D N   1 
ATOM   8883 C  CA  . TRP D 2 106 ? 66.124 -4.102  19.432  1.00 28.00 ? 106  TRP D CA  1 
ATOM   8884 C  C   . TRP D 2 106 ? 66.088 -2.590  19.297  1.00 26.41 ? 106  TRP D C   1 
ATOM   8885 O  O   . TRP D 2 106 ? 66.121 -2.045  18.202  1.00 28.48 ? 106  TRP D O   1 
ATOM   8886 C  CB  . TRP D 2 106 ? 65.092 -4.771  18.531  1.00 33.69 ? 106  TRP D CB  1 
ATOM   8887 C  CG  . TRP D 2 106 ? 65.366 -6.230  18.432  1.00 34.59 ? 106  TRP D CG  1 
ATOM   8888 C  CD1 . TRP D 2 106 ? 64.726 -7.233  19.094  1.00 32.94 ? 106  TRP D CD1 1 
ATOM   8889 C  CD2 . TRP D 2 106 ? 66.406 -6.851  17.666  1.00 33.55 ? 106  TRP D CD2 1 
ATOM   8890 N  NE1 . TRP D 2 106 ? 65.281 -8.445  18.762  1.00 31.43 ? 106  TRP D NE1 1 
ATOM   8891 C  CE2 . TRP D 2 106 ? 66.315 -8.236  17.889  1.00 37.22 ? 106  TRP D CE2 1 
ATOM   8892 C  CE3 . TRP D 2 106 ? 67.392 -6.370  16.799  1.00 38.15 ? 106  TRP D CE3 1 
ATOM   8893 C  CZ2 . TRP D 2 106 ? 67.178 -9.148  17.278  1.00 36.79 ? 106  TRP D CZ2 1 
ATOM   8894 C  CZ3 . TRP D 2 106 ? 68.248 -7.278  16.193  1.00 31.84 ? 106  TRP D CZ3 1 
ATOM   8895 C  CH2 . TRP D 2 106 ? 68.134 -8.648  16.437  1.00 32.41 ? 106  TRP D CH2 1 
ATOM   8896 N  N   . ARG D 2 107 ? 66.030 -1.939  20.449  1.00 29.91 ? 107  ARG D N   1 
ATOM   8897 C  CA  . ARG D 2 107 ? 66.153 -0.505  20.585  1.00 35.38 ? 107  ARG D CA  1 
ATOM   8898 C  C   . ARG D 2 107 ? 67.030 -0.268  21.809  1.00 38.13 ? 107  ARG D C   1 
ATOM   8899 O  O   . ARG D 2 107 ? 66.874 -0.950  22.819  1.00 35.45 ? 107  ARG D O   1 
ATOM   8900 C  CB  . ARG D 2 107 ? 64.780 0.152   20.755  1.00 33.31 ? 107  ARG D CB  1 
ATOM   8901 C  CG  . ARG D 2 107 ? 64.805 1.674   20.822  1.00 37.46 ? 107  ARG D CG  1 
ATOM   8902 C  CD  . ARG D 2 107 ? 63.738 2.193   21.771  1.00 40.11 ? 107  ARG D CD  1 
ATOM   8903 N  NE  . ARG D 2 107 ? 64.053 1.815   23.144  1.00 48.77 ? 107  ARG D NE  1 
ATOM   8904 C  CZ  . ARG D 2 107 ? 63.313 2.125   24.203  1.00 53.34 ? 107  ARG D CZ  1 
ATOM   8905 N  NH1 . ARG D 2 107 ? 63.698 1.734   25.413  1.00 47.35 ? 107  ARG D NH1 1 
ATOM   8906 N  NH2 . ARG D 2 107 ? 62.193 2.822   24.054  1.00 48.83 ? 107  ARG D NH2 1 
ATOM   8907 N  N   . GLY D 2 108 ? 67.950 0.686   21.726  1.00 40.88 ? 108  GLY D N   1 
ATOM   8908 C  CA  . GLY D 2 108 ? 68.834 0.978   22.841  1.00 37.44 ? 108  GLY D CA  1 
ATOM   8909 C  C   . GLY D 2 108 ? 68.171 1.753   23.967  1.00 39.81 ? 108  GLY D C   1 
ATOM   8910 O  O   . GLY D 2 108 ? 67.002 2.126   23.887  1.00 40.78 ? 108  GLY D O   1 
ATOM   8911 N  N   . GLN D 2 109 ? 68.929 2.004   25.027  1.00 38.59 ? 109  GLN D N   1 
ATOM   8912 C  CA  . GLN D 2 109 ? 68.406 2.710   26.191  1.00 41.95 ? 109  GLN D CA  1 
ATOM   8913 C  C   . GLN D 2 109 ? 68.387 4.222   25.966  1.00 42.91 ? 109  GLN D C   1 
ATOM   8914 O  O   . GLN D 2 109 ? 67.735 4.966   26.703  1.00 39.86 ? 109  GLN D O   1 
ATOM   8915 C  CB  . GLN D 2 109 ? 69.228 2.364   27.429  1.00 44.56 ? 109  GLN D CB  1 
ATOM   8916 C  CG  . GLN D 2 109 ? 69.098 0.912   27.873  1.00 51.00 ? 109  GLN D CG  1 
ATOM   8917 C  CD  . GLN D 2 109 ? 67.731 0.602   28.452  0.00 46.80 ? 109  GLN D CD  1 
ATOM   8918 O  OE1 . GLN D 2 109 ? 67.285 1.247   29.403  0.00 47.18 ? 109  GLN D OE1 1 
ATOM   8919 N  NE2 . GLN D 2 109 ? 67.054 -0.385  27.878  0.00 45.93 ? 109  GLN D NE2 1 
ATOM   8920 N  N   . GLY D 2 110 ? 69.107 4.673   24.946  1.00 36.30 ? 110  GLY D N   1 
ATOM   8921 C  CA  . GLY D 2 110 ? 69.056 6.068   24.554  1.00 41.78 ? 110  GLY D CA  1 
ATOM   8922 C  C   . GLY D 2 110 ? 70.099 6.950   25.204  1.00 35.80 ? 110  GLY D C   1 
ATOM   8923 O  O   . GLY D 2 110 ? 70.704 6.592   26.208  1.00 39.77 ? 110  GLY D O   1 
ATOM   8924 N  N   . THR D 2 111 ? 70.308 8.120   24.615  1.00 40.88 ? 111  THR D N   1 
ATOM   8925 C  CA  . THR D 2 111 ? 71.277 9.073   25.132  1.00 36.78 ? 111  THR D CA  1 
ATOM   8926 C  C   . THR D 2 111 ? 70.668 10.474  25.118  1.00 39.01 ? 111  THR D C   1 
ATOM   8927 O  O   . THR D 2 111 ? 70.141 10.937  24.103  1.00 40.94 ? 111  THR D O   1 
ATOM   8928 C  CB  . THR D 2 111 ? 72.603 9.028   24.323  1.00 41.14 ? 111  THR D CB  1 
ATOM   8929 O  OG1 . THR D 2 111 ? 73.523 9.999   24.836  1.00 39.39 ? 111  THR D OG1 1 
ATOM   8930 C  CG2 . THR D 2 111 ? 72.362 9.275   22.833  1.00 36.56 ? 111  THR D CG2 1 
ATOM   8931 N  N   . GLN D 2 112 ? 70.720 11.137  26.265  1.00 36.79 ? 112  GLN D N   1 
ATOM   8932 C  CA  . GLN D 2 112 ? 70.044 12.414  26.440  1.00 39.85 ? 112  GLN D CA  1 
ATOM   8933 C  C   . GLN D 2 112 ? 70.791 13.550  25.758  1.00 38.43 ? 112  GLN D C   1 
ATOM   8934 O  O   . GLN D 2 112 ? 72.002 13.688  25.917  1.00 36.81 ? 112  GLN D O   1 
ATOM   8935 C  CB  . GLN D 2 112 ? 69.878 12.713  27.934  1.00 34.79 ? 112  GLN D CB  1 
ATOM   8936 C  CG  . GLN D 2 112 ? 69.294 14.076  28.243  1.00 43.24 ? 112  GLN D CG  1 
ATOM   8937 C  CD  . GLN D 2 112 ? 67.884 14.263  27.703  1.00 40.60 ? 112  GLN D CD  1 
ATOM   8938 O  OE1 . GLN D 2 112 ? 67.093 13.323  27.648  1.00 46.26 ? 112  GLN D OE1 1 
ATOM   8939 N  NE2 . GLN D 2 112 ? 67.565 15.486  27.303  1.00 42.01 ? 112  GLN D NE2 1 
ATOM   8940 N  N   . VAL D 2 113 ? 70.081 14.362  24.983  1.00 40.18 ? 113  VAL D N   1 
ATOM   8941 C  CA  . VAL D 2 113 ? 70.686 15.599  24.505  1.00 41.99 ? 113  VAL D CA  1 
ATOM   8942 C  C   . VAL D 2 113 ? 69.795 16.784  24.869  1.00 39.04 ? 113  VAL D C   1 
ATOM   8943 O  O   . VAL D 2 113 ? 68.583 16.793  24.639  1.00 39.82 ? 113  VAL D O   1 
ATOM   8944 C  CB  . VAL D 2 113 ? 71.004 15.558  22.970  1.00 42.96 ? 113  VAL D CB  1 
ATOM   8945 C  CG1 . VAL D 2 113 ? 70.969 14.131  22.442  1.00 39.14 ? 113  VAL D CG1 1 
ATOM   8946 C  CG2 . VAL D 2 113 ? 70.100 16.476  22.156  1.00 39.00 ? 113  VAL D CG2 1 
ATOM   8947 N  N   . THR D 2 114 ? 70.408 17.774  25.501  1.00 42.47 ? 114  THR D N   1 
ATOM   8948 C  CA  . THR D 2 114 ? 69.677 18.950  25.927  1.00 42.40 ? 114  THR D CA  1 
ATOM   8949 C  C   . THR D 2 114 ? 70.288 20.190  25.303  1.00 40.89 ? 114  THR D C   1 
ATOM   8950 O  O   . THR D 2 114 ? 71.491 20.423  25.419  1.00 36.55 ? 114  THR D O   1 
ATOM   8951 C  CB  . THR D 2 114 ? 69.668 19.102  27.459  1.00 44.49 ? 114  THR D CB  1 
ATOM   8952 O  OG1 . THR D 2 114 ? 69.306 17.857  28.069  1.00 46.39 ? 114  THR D OG1 1 
ATOM   8953 C  CG2 . THR D 2 114 ? 68.673 20.169  27.863  1.00 45.52 ? 114  THR D CG2 1 
ATOM   8954 N  N   . VAL D 2 115 ? 69.444 20.966  24.631  1.00 41.65 ? 115  VAL D N   1 
ATOM   8955 C  CA  . VAL D 2 115 ? 69.839 22.226  24.017  1.00 48.56 ? 115  VAL D CA  1 
ATOM   8956 C  C   . VAL D 2 115 ? 69.153 23.380  24.746  1.00 51.71 ? 115  VAL D C   1 
ATOM   8957 O  O   . VAL D 2 115 ? 67.923 23.457  24.769  1.00 54.66 ? 115  VAL D O   1 
ATOM   8958 C  CB  . VAL D 2 115 ? 69.464 22.271  22.517  1.00 41.75 ? 115  VAL D CB  1 
ATOM   8959 C  CG1 . VAL D 2 115 ? 70.032 23.507  21.857  1.00 42.17 ? 115  VAL D CG1 1 
ATOM   8960 C  CG2 . VAL D 2 115 ? 69.942 21.021  21.801  1.00 42.01 ? 115  VAL D CG2 1 
ATOM   8961 N  N   . SER D 2 116 ? 69.938 24.273  25.342  1.00 54.11 ? 116  SER D N   1 
ATOM   8962 C  CA  . SER D 2 116 ? 69.364 25.414  26.054  1.00 56.33 ? 116  SER D CA  1 
ATOM   8963 C  C   . SER D 2 116 ? 70.351 26.567  26.217  1.00 56.69 ? 116  SER D C   1 
ATOM   8964 O  O   . SER D 2 116 ? 71.563 26.356  26.234  1.00 55.44 ? 116  SER D O   1 
ATOM   8965 C  CB  . SER D 2 116 ? 68.856 24.976  27.428  0.00 55.01 ? 116  SER D CB  1 
ATOM   8966 O  OG  . SER D 2 116 ? 68.215 26.047  28.099  0.00 56.79 ? 116  SER D OG  1 
ATOM   8967 N  N   . SER D 2 117 ? 69.803 27.777  26.350  1.00 63.70 ? 117  SER D N   1 
ATOM   8968 C  CA  . SER D 2 117 ? 70.560 29.022  26.544  1.00 60.60 ? 117  SER D CA  1 
ATOM   8969 C  C   . SER D 2 117 ? 71.430 29.356  25.341  1.00 60.33 ? 117  SER D C   1 
ATOM   8970 O  O   . SER D 2 117 ? 71.048 30.172  24.502  1.00 59.85 ? 117  SER D O   1 
ATOM   8971 C  CB  . SER D 2 117 ? 71.424 28.955  27.809  1.00 49.16 ? 117  SER D CB  1 
ATOM   8972 O  OG  . SER D 2 117 ? 72.514 28.067  27.642  0.00 56.74 ? 117  SER D OG  1 
HETATM 8973 C  C1  . DKA E 3 1   ? 35.434 9.879   43.137  1.00 16.67 ? 1    DKA G C1  1 
HETATM 8974 O  O1  . DKA E 3 1   ? 35.936 10.914  43.573  1.00 17.34 ? 1    DKA G O1  1 
HETATM 8975 C  C2  . DKA E 3 1   ? 36.307 8.709   42.696  1.00 19.53 ? 1    DKA G C2  1 
HETATM 8976 C  C3  . DKA E 3 1   ? 37.137 8.221   43.886  1.00 22.75 ? 1    DKA G C3  1 
HETATM 8977 C  C4  . DKA E 3 1   ? 36.179 7.664   44.941  1.00 22.06 ? 1    DKA G C4  1 
HETATM 8978 C  C5  . DKA E 3 1   ? 36.953 7.294   46.202  1.00 27.82 ? 1    DKA G C5  1 
HETATM 8979 C  C6  . DKA E 3 1   ? 35.978 6.692   47.208  1.00 32.31 ? 1    DKA G C6  1 
HETATM 8980 C  C7  . DKA E 3 1   ? 35.716 5.239   46.814  1.00 32.17 ? 1    DKA G C7  1 
HETATM 8981 C  C8  . DKA E 3 1   ? 36.955 4.399   47.128  0.00 29.30 ? 1    DKA G C8  1 
HETATM 8982 C  C9  . DKA E 3 1   ? 36.651 3.447   48.288  0.00 29.33 ? 1    DKA G C9  1 
HETATM 8983 C  C10 . DKA E 3 1   ? 36.780 4.188   49.622  0.00 28.81 ? 1    DKA G C10 1 
ATOM   8984 N  N   . ARG E 3 2   ? 34.116 9.700   42.980  1.00 16.34 ? 2    ARG G N   1 
ATOM   8985 C  CA  . ARG E 3 2   ? 33.152 10.737  43.363  1.00 16.91 ? 2    ARG G CA  1 
ATOM   8986 C  C   . ARG E 3 2   ? 32.181 10.123  44.390  1.00 18.39 ? 2    ARG G C   1 
ATOM   8987 O  O   . ARG E 3 2   ? 31.607 9.052   44.166  1.00 21.51 ? 2    ARG G O   1 
ATOM   8988 C  CB  . ARG E 3 2   ? 32.419 11.254  42.109  1.00 19.56 ? 2    ARG G CB  1 
ATOM   8989 C  CG  . ARG E 3 2   ? 33.422 11.858  41.101  1.00 15.65 ? 2    ARG G CG  1 
ATOM   8990 C  CD  . ARG E 3 2   ? 33.933 13.208  41.609  1.00 14.07 ? 2    ARG G CD  1 
ATOM   8991 N  NE  . ARG E 3 2   ? 34.932 13.844  40.718  1.00 13.92 ? 2    ARG G NE  1 
ATOM   8992 C  CZ  . ARG E 3 2   ? 36.265 13.812  40.897  1.00 14.47 ? 2    ARG G CZ  1 
ATOM   8993 N  NH1 . ARG E 3 2   ? 36.819 13.123  41.903  1.00 15.92 ? 2    ARG G NH1 1 
ATOM   8994 N  NH2 . ARG E 3 2   ? 37.063 14.483  40.069  1.00 13.64 ? 2    ARG G NH2 1 
ATOM   8995 N  N   . VAL E 3 3   ? 32.018 10.804  45.527  1.00 16.00 ? 3    VAL G N   1 
ATOM   8996 C  CA  . VAL E 3 3   ? 31.135 10.298  46.597  1.00 16.62 ? 3    VAL G CA  1 
ATOM   8997 C  C   . VAL E 3 3   ? 29.873 11.160  46.656  1.00 19.62 ? 3    VAL G C   1 
ATOM   8998 O  O   . VAL E 3 3   ? 29.924 12.347  46.340  1.00 17.52 ? 3    VAL G O   1 
ATOM   8999 C  CB  . VAL E 3 3   ? 31.865 10.345  47.955  1.00 18.60 ? 3    VAL G CB  1 
ATOM   9000 C  CG1 . VAL E 3 3   ? 33.197 9.611   47.806  1.00 19.20 ? 3    VAL G CG1 1 
ATOM   9001 C  CG2 . VAL E 3 3   ? 32.158 11.796  48.402  1.00 17.65 ? 3    VAL G CG2 1 
ATOM   9002 N  N   . LYS E 3 4   ? 28.759 10.507  47.040  1.00 14.28 ? 4    LYS G N   1 
ATOM   9003 C  CA  . LYS E 3 4   ? 27.454 11.158  47.177  1.00 18.85 ? 4    LYS G CA  1 
ATOM   9004 C  C   . LYS E 3 4   ? 27.456 11.911  48.495  1.00 19.57 ? 4    LYS G C   1 
ATOM   9005 O  O   . LYS E 3 4   ? 28.030 11.443  49.482  1.00 19.39 ? 4    LYS G O   1 
ATOM   9006 C  CB  . LYS E 3 4   ? 26.352 10.095  47.301  1.00 21.02 ? 4    LYS G CB  1 
ATOM   9007 C  CG  . LYS E 3 4   ? 26.226 9.287   46.017  1.00 19.17 ? 4    LYS G CG  1 
ATOM   9008 C  CD  . LYS E 3 4   ? 25.340 8.062   46.294  1.00 20.31 ? 4    LYS G CD  1 
ATOM   9009 C  CE  . LYS E 3 4   ? 25.377 7.156   45.076  1.00 21.33 ? 4    LYS G CE  1 
ATOM   9010 N  NZ  . LYS E 3 4   ? 24.432 6.037   45.231  1.00 20.95 ? 4    LYS G NZ  1 
HETATM 9011 N  N   . AR7 E 3 5   ? 26.794 13.068  48.492  1.00 16.25 ? 5    AR7 G N   1 
HETATM 9012 C  CA  . AR7 E 3 5   ? 26.672 13.871  49.714  1.00 17.06 ? 5    AR7 G CA  1 
HETATM 9013 C  C   . AR7 E 3 5   ? 25.161 13.907  50.117  1.00 16.99 ? 5    AR7 G C   1 
HETATM 9014 O  O   . AR7 E 3 5   ? 25.007 14.346  51.473  1.00 17.71 ? 5    AR7 G O   1 
HETATM 9015 C  CB  . AR7 E 3 5   ? 27.268 15.290  49.474  1.00 14.60 ? 5    AR7 G CB  1 
HETATM 9016 C  CG  . AR7 E 3 5   ? 28.803 15.240  49.421  1.00 17.07 ? 5    AR7 G CG  1 
HETATM 9017 C  CD  . AR7 E 3 5   ? 29.428 16.578  48.919  1.00 15.15 ? 5    AR7 G CD  1 
HETATM 9018 N  NE  . AR7 E 3 5   ? 30.882 16.361  48.749  1.00 15.22 ? 5    AR7 G NE  1 
HETATM 9019 C  CZ  . AR7 E 3 5   ? 31.717 17.107  48.015  1.00 18.24 ? 5    AR7 G CZ  1 
HETATM 9020 N  NH1 . AR7 E 3 5   ? 31.275 18.220  47.390  1.00 15.77 ? 5    AR7 G NH1 1 
HETATM 9021 N  NH2 . AR7 E 3 5   ? 33.009 16.739  47.912  1.00 15.44 ? 5    AR7 G NH2 1 
HETATM 9022 C  C1  . 0QE E 3 6   ? 24.512 12.493  50.054  1.00 13.94 ? 6    0QE G C1  1 
HETATM 9023 C  C1  . DKA F 3 1   ? 38.035 13.327  10.497  1.00 19.00 ? 2    DKA H C1  1 
HETATM 9024 O  O1  . DKA F 3 1   ? 38.639 12.334  10.100  1.00 19.05 ? 2    DKA H O1  1 
HETATM 9025 C  C2  . DKA F 3 1   ? 38.810 14.511  11.093  1.00 23.60 ? 2    DKA H C2  1 
HETATM 9026 C  C3  . DKA F 3 1   ? 39.820 14.968  10.043  1.00 28.33 ? 2    DKA H C3  1 
HETATM 9027 C  C4  . DKA F 3 1   ? 39.008 15.442  8.837   1.00 24.48 ? 2    DKA H C4  1 
HETATM 9028 C  C5  . DKA F 3 1   ? 39.915 15.612  7.636   1.00 29.11 ? 2    DKA H C5  1 
HETATM 9029 C  C6  . DKA F 3 1   ? 39.059 16.083  6.464   1.00 36.64 ? 2    DKA H C6  1 
HETATM 9030 C  C7  . DKA F 3 1   ? 38.584 17.511  6.741   1.00 34.80 ? 2    DKA H C7  1 
HETATM 9031 C  C8  . DKA F 3 1   ? 39.804 18.436  6.711   0.00 32.14 ? 2    DKA H C8  1 
HETATM 9032 C  C9  . DKA F 3 1   ? 39.990 19.089  8.079   0.00 31.99 ? 2    DKA H C9  1 
HETATM 9033 C  C10 . DKA F 3 1   ? 38.732 19.880  8.407   0.00 32.28 ? 2    DKA H C10 1 
ATOM   9034 N  N   . ARG F 3 2   ? 36.700 13.481  10.430  1.00 16.23 ? 3    ARG H N   1 
ATOM   9035 C  CA  . ARG F 3 2   ? 35.818 12.424  9.899   1.00 17.49 ? 3    ARG H CA  1 
ATOM   9036 C  C   . ARG F 3 2   ? 34.996 12.990  8.717   1.00 18.88 ? 3    ARG H C   1 
ATOM   9037 O  O   . ARG F 3 2   ? 34.396 14.053  8.820   1.00 20.97 ? 3    ARG H O   1 
ATOM   9038 C  CB  . ARG F 3 2   ? 34.902 11.931  11.031  1.00 15.44 ? 3    ARG H CB  1 
ATOM   9039 C  CG  . ARG F 3 2   ? 35.732 11.281  12.171  1.00 14.74 ? 3    ARG H CG  1 
ATOM   9040 C  CD  . ARG F 3 2   ? 36.340 9.935   11.722  1.00 10.69 ? 3    ARG H CD  1 
ATOM   9041 N  NE  . ARG F 3 2   ? 37.136 9.334   12.813  1.00 15.54 ? 3    ARG H NE  1 
ATOM   9042 C  CZ  . ARG F 3 2   ? 38.483 9.325   12.823  1.00 15.48 ? 3    ARG H CZ  1 
ATOM   9043 N  NH1 . ARG F 3 2   ? 39.163 9.916   11.831  1.00 13.62 ? 3    ARG H NH1 1 
ATOM   9044 N  NH2 . ARG F 3 2   ? 39.156 8.743   13.818  1.00 13.18 ? 3    ARG H NH2 1 
ATOM   9045 N  N   . VAL F 3 3   ? 35.032 12.313  7.562   1.00 15.49 ? 4    VAL H N   1 
ATOM   9046 C  CA  . VAL F 3 3   ? 34.266 12.819  6.400   1.00 14.94 ? 4    VAL H CA  1 
ATOM   9047 C  C   . VAL F 3 3   ? 33.036 11.952  6.143   1.00 19.08 ? 4    VAL H C   1 
ATOM   9048 O  O   . VAL F 3 3   ? 33.046 10.757  6.411   1.00 17.57 ? 4    VAL H O   1 
ATOM   9049 C  CB  . VAL F 3 3   ? 35.142 12.790  5.151   1.00 15.83 ? 4    VAL H CB  1 
ATOM   9050 C  CG1 . VAL F 3 3   ? 36.410 13.599  5.440   1.00 15.92 ? 4    VAL H CG1 1 
ATOM   9051 C  CG2 . VAL F 3 3   ? 35.534 11.345  4.790   1.00 16.68 ? 4    VAL H CG2 1 
ATOM   9052 N  N   . LYS F 3 4   ? 32.000 12.604  5.595   1.00 16.16 ? 5    LYS H N   1 
ATOM   9053 C  CA  . LYS F 3 4   ? 30.737 11.970  5.215   1.00 18.75 ? 5    LYS H CA  1 
ATOM   9054 C  C   . LYS F 3 4   ? 30.945 11.185  3.918   1.00 17.78 ? 5    LYS H C   1 
ATOM   9055 O  O   . LYS F 3 4   ? 31.656 11.632  3.012   1.00 20.27 ? 5    LYS H O   1 
ATOM   9056 C  CB  . LYS F 3 4   ? 29.737 13.103  4.892   1.00 21.04 ? 5    LYS H CB  1 
ATOM   9057 C  CG  . LYS F 3 4   ? 29.300 13.811  6.175   1.00 19.25 ? 5    LYS H CG  1 
ATOM   9058 C  CD  . LYS F 3 4   ? 28.356 14.982  5.816   1.00 21.50 ? 5    LYS H CD  1 
ATOM   9059 C  CE  . LYS F 3 4   ? 28.378 16.012  6.949   1.00 20.95 ? 5    LYS H CE  1 
ATOM   9060 N  NZ  . LYS F 3 4   ? 27.290 16.988  6.814   1.00 17.78 ? 5    LYS H NZ  1 
HETATM 9061 N  N   . AR7 F 3 5   ? 30.269 10.032  3.817   1.00 16.58 ? 6    AR7 H N   1 
HETATM 9062 C  CA  . AR7 F 3 5   ? 30.321 9.223   2.590   1.00 15.25 ? 6    AR7 H CA  1 
HETATM 9063 C  C   . AR7 F 3 5   ? 28.902 9.156   1.930   1.00 14.78 ? 6    AR7 H C   1 
HETATM 9064 O  O   . AR7 F 3 5   ? 29.095 8.666   0.609   1.00 14.55 ? 6    AR7 H O   1 
HETATM 9065 C  CB  . AR7 F 3 5   ? 30.908 7.801   2.887   1.00 16.40 ? 6    AR7 H CB  1 
HETATM 9066 C  CG  . AR7 F 3 5   ? 32.366 7.918   3.402   1.00 14.82 ? 6    AR7 H CG  1 
HETATM 9067 C  CD  . AR7 F 3 5   ? 32.884 6.547   3.929   1.00 13.55 ? 6    AR7 H CD  1 
HETATM 9068 N  NE  . AR7 F 3 5   ? 34.295 6.745   4.323   1.00 14.57 ? 6    AR7 H NE  1 
HETATM 9069 C  CZ  . AR7 F 3 5   ? 35.057 5.954   5.095   1.00 13.68 ? 6    AR7 H CZ  1 
HETATM 9070 N  NH1 . AR7 F 3 5   ? 36.329 6.327   5.338   1.00 13.59 ? 6    AR7 H NH1 1 
HETATM 9071 N  NH2 . AR7 F 3 5   ? 34.552 4.828   5.641   1.00 11.46 ? 6    AR7 H NH2 1 
HETATM 9072 C  C1  . 0QE F 3 6   ? 28.177 10.526  1.795   1.00 12.88 ? 7    0QE H C1  1 
HETATM 9073 C  C1  . NAG G 4 .   ? 12.949 40.360  30.929  1.00 24.92 ? 601  NAG A C1  1 
HETATM 9074 C  C2  . NAG G 4 .   ? 12.191 41.408  31.762  1.00 24.92 ? 601  NAG A C2  1 
HETATM 9075 C  C3  . NAG G 4 .   ? 10.922 41.885  31.030  1.00 24.92 ? 601  NAG A C3  1 
HETATM 9076 C  C4  . NAG G 4 .   ? 11.237 42.291  29.577  1.00 24.92 ? 601  NAG A C4  1 
HETATM 9077 C  C5  . NAG G 4 .   ? 12.001 41.152  28.871  1.00 24.92 ? 601  NAG A C5  1 
HETATM 9078 C  C6  . NAG G 4 .   ? 12.398 41.445  27.423  1.00 24.92 ? 601  NAG A C6  1 
HETATM 9079 C  C7  . NAG G 4 .   ? 12.226 41.443  34.172  1.00 24.92 ? 601  NAG A C7  1 
HETATM 9080 C  C8  . NAG G 4 .   ? 12.301 40.587  35.436  1.00 24.92 ? 601  NAG A C8  1 
HETATM 9081 N  N2  . NAG G 4 .   ? 11.829 40.845  33.049  1.00 24.92 ? 601  NAG A N2  1 
HETATM 9082 O  O3  . NAG G 4 .   ? 10.346 42.990  31.727  1.00 24.92 ? 601  NAG A O3  1 
HETATM 9083 O  O4  . NAG G 4 .   ? 10.026 42.575  28.881  1.00 24.92 ? 601  NAG A O4  1 
HETATM 9084 O  O5  . NAG G 4 .   ? 13.214 40.848  29.601  1.00 24.92 ? 601  NAG A O5  1 
HETATM 9085 O  O6  . NAG G 4 .   ? 12.693 42.823  27.225  1.00 24.92 ? 601  NAG A O6  1 
HETATM 9086 O  O7  . NAG G 4 .   ? 12.534 42.639  34.216  1.00 24.92 ? 601  NAG A O7  1 
HETATM 9087 C  C1  . NAG H 4 .   ? 9.420  45.377  40.995  1.00 34.87 ? 602  NAG A C1  1 
HETATM 9088 C  C2  . NAG H 4 .   ? 8.660  46.684  41.229  1.00 40.20 ? 602  NAG A C2  1 
HETATM 9089 C  C3  . NAG H 4 .   ? 7.185  46.407  41.520  1.00 34.49 ? 602  NAG A C3  1 
HETATM 9090 C  C4  . NAG H 4 .   ? 6.585  45.548  40.419  1.00 41.78 ? 602  NAG A C4  1 
HETATM 9091 C  C5  . NAG H 4 .   ? 7.406  44.267  40.302  1.00 45.56 ? 602  NAG A C5  1 
HETATM 9092 C  C6  . NAG H 4 .   ? 6.923  43.330  39.218  1.00 40.62 ? 602  NAG A C6  1 
HETATM 9093 C  C7  . NAG H 4 .   ? 9.815  48.634  42.162  1.00 38.83 ? 602  NAG A C7  1 
HETATM 9094 C  C8  . NAG H 4 .   ? 9.822  49.176  40.765  1.00 29.66 ? 602  NAG A C8  1 
HETATM 9095 N  N2  . NAG H 4 .   ? 9.257  47.431  42.320  1.00 33.80 ? 602  NAG A N2  1 
HETATM 9096 O  O3  . NAG H 4 .   ? 6.481  47.641  41.625  1.00 48.07 ? 602  NAG A O3  1 
HETATM 9097 O  O4  . NAG H 4 .   ? 5.221  45.253  40.703  1.00 54.48 ? 602  NAG A O4  1 
HETATM 9098 O  O5  . NAG H 4 .   ? 8.764  44.608  39.984  1.00 37.74 ? 602  NAG A O5  1 
HETATM 9099 O  O6  . NAG H 4 .   ? 6.642  44.019  38.007  1.00 62.79 ? 602  NAG A O6  1 
HETATM 9100 O  O7  . NAG H 4 .   ? 10.298 49.254  43.105  1.00 40.34 ? 602  NAG A O7  1 
HETATM 9101 CA CA  . CA  I 5 .   ? 18.458 3.468   32.321  1.00 17.23 ? 603  CA  A CA  1 
HETATM 9102 CA CA  . CA  J 5 .   ? 3.254  15.852  48.140  1.00 18.87 ? 604  CA  A CA  1 
HETATM 9103 CA CA  . CA  K 5 .   ? 35.259 17.966  50.842  1.00 14.85 ? 605  CA  A CA  1 
HETATM 9104 NA NA  . NA  L 6 .   ? 31.507 27.443  43.521  1.00 15.43 ? 606  NA  A NA  1 
HETATM 9105 C  C1  . NAG M 4 .   ? 13.647 -17.229 19.021  1.00 38.17 ? 601  NAG B C1  1 
HETATM 9106 C  C2  . NAG M 4 .   ? 13.026 -18.258 18.071  1.00 39.50 ? 601  NAG B C2  1 
HETATM 9107 C  C3  . NAG M 4 .   ? 11.657 -18.709 18.583  1.00 44.89 ? 601  NAG B C3  1 
HETATM 9108 C  C4  . NAG M 4 .   ? 11.757 -19.184 20.028  1.00 43.52 ? 601  NAG B C4  1 
HETATM 9109 C  C5  . NAG M 4 .   ? 12.397 -18.094 20.885  1.00 44.26 ? 601  NAG B C5  1 
HETATM 9110 C  C6  . NAG M 4 .   ? 12.611 -18.508 22.323  1.00 42.90 ? 601  NAG B C6  1 
HETATM 9111 C  C7  . NAG M 4 .   ? 13.438 -18.308 15.645  1.00 35.87 ? 601  NAG B C7  1 
HETATM 9112 C  C8  . NAG M 4 .   ? 13.180 -17.632 14.326  1.00 34.73 ? 601  NAG B C8  1 
HETATM 9113 N  N2  . NAG M 4 .   ? 12.902 -17.719 16.718  1.00 33.50 ? 601  NAG B N2  1 
HETATM 9114 O  O3  . NAG M 4 .   ? 11.169 -19.761 17.762  1.00 46.49 ? 601  NAG B O3  1 
HETATM 9115 O  O4  . NAG M 4 .   ? 10.459 -19.501 20.526  1.00 51.99 ? 601  NAG B O4  1 
HETATM 9116 O  O5  . NAG M 4 .   ? 13.687 -17.769 20.352  1.00 42.38 ? 601  NAG B O5  1 
HETATM 9117 O  O6  . NAG M 4 .   ? 12.896 -19.896 22.426  1.00 49.33 ? 601  NAG B O6  1 
HETATM 9118 O  O7  . NAG M 4 .   ? 14.112 -19.333 15.731  1.00 43.55 ? 601  NAG B O7  1 
HETATM 9119 C  C1  . NAG N 4 .   ? 11.953 -22.483 8.725   1.00 24.92 ? 602  NAG B C1  1 
HETATM 9120 C  C2  . NAG N 4 .   ? 11.177 -23.754 8.408   1.00 24.92 ? 602  NAG B C2  1 
HETATM 9121 C  C3  . NAG N 4 .   ? 9.748  -23.440 7.983   1.00 24.92 ? 602  NAG B C3  1 
HETATM 9122 C  C4  . NAG N 4 .   ? 9.081  -22.537 8.999   1.00 24.92 ? 602  NAG B C4  1 
HETATM 9123 C  C5  . NAG N 4 .   ? 9.938  -21.307 9.203   1.00 24.92 ? 602  NAG B C5  1 
HETATM 9124 C  C6  . NAG N 4 .   ? 9.301  -20.307 10.154  1.00 24.92 ? 602  NAG B C6  1 
HETATM 9125 C  C7  . NAG N 4 .   ? 12.390 -25.662 7.633   1.00 24.92 ? 602  NAG B C7  1 
HETATM 9126 C  C8  . NAG N 4 .   ? 13.639 -26.037 6.843   1.00 24.92 ? 602  NAG B C8  1 
HETATM 9127 N  N2  . NAG N 4 .   ? 11.839 -24.487 7.354   1.00 24.92 ? 602  NAG B N2  1 
HETATM 9128 O  O3  . NAG N 4 .   ? 9.006  -24.646 7.879   1.00 24.92 ? 602  NAG B O3  1 
HETATM 9129 O  O4  . NAG N 4 .   ? 7.797  -22.139 8.501   1.00 24.92 ? 602  NAG B O4  1 
HETATM 9130 O  O5  . NAG N 4 .   ? 11.242 -21.698 9.699   1.00 24.92 ? 602  NAG B O5  1 
HETATM 9131 O  O6  . NAG N 4 .   ? 9.299  -20.800 11.502  1.00 24.92 ? 602  NAG B O6  1 
HETATM 9132 O  O7  . NAG N 4 .   ? 11.943 -26.428 8.503   1.00 24.92 ? 602  NAG B O7  1 
HETATM 9133 CA CA  . CA  O 5 .   ? 19.465 19.594  18.441  1.00 14.27 ? 603  CA  B CA  1 
HETATM 9134 CA CA  . CA  P 5 .   ? 6.999  7.126   0.450   1.00 12.86 ? 604  CA  B CA  1 
HETATM 9135 CA CA  . CA  Q 5 .   ? 39.082 5.162   2.856   1.00 16.30 ? 605  CA  B CA  1 
HETATM 9136 NA NA  . NA  R 6 .   ? 34.169 -4.394  9.580   1.00 18.30 ? 606  NA  B NA  1 
HETATM 9137 O  O   . HOH S 7 .   ? 28.082 22.135  22.585  1.00 37.86 ? 701  HOH A O   1 
HETATM 9138 O  O   . HOH S 7 .   ? 62.783 26.367  50.123  1.00 22.15 ? 702  HOH A O   1 
HETATM 9139 O  O   . HOH S 7 .   ? 7.960  32.972  54.770  1.00 26.68 ? 703  HOH A O   1 
HETATM 9140 O  O   . HOH S 7 .   ? 9.941  17.518  28.341  1.00 35.70 ? 704  HOH A O   1 
HETATM 9141 O  O   . HOH S 7 .   ? 10.370 25.348  30.570  1.00 32.85 ? 705  HOH A O   1 
HETATM 9142 O  O   . HOH S 7 .   ? 30.001 21.830  64.217  1.00 30.28 ? 706  HOH A O   1 
HETATM 9143 O  O   . HOH S 7 .   ? 8.654  29.425  54.745  1.00 27.24 ? 707  HOH A O   1 
HETATM 9144 O  O   . HOH S 7 .   ? 31.084 12.742  51.752  1.00 21.25 ? 708  HOH A O   1 
HETATM 9145 O  O   . HOH S 7 .   ? 25.738 23.094  22.321  1.00 39.13 ? 709  HOH A O   1 
HETATM 9146 O  O   . HOH S 7 .   ? -2.788 11.126  52.348  1.00 37.72 ? 710  HOH A O   1 
HETATM 9147 O  O   . HOH S 7 .   ? 8.731  23.679  34.081  1.00 20.38 ? 711  HOH A O   1 
HETATM 9148 O  O   . HOH S 7 .   ? 55.335 18.858  47.694  1.00 32.80 ? 712  HOH A O   1 
HETATM 9149 O  O   . HOH S 7 .   ? 2.832  12.744  41.287  1.00 23.06 ? 713  HOH A O   1 
HETATM 9150 O  O   . HOH S 7 .   ? 40.112 12.041  43.617  1.00 38.80 ? 714  HOH A O   1 
HETATM 9151 O  O   . HOH S 7 .   ? 39.182 52.255  41.728  1.00 32.31 ? 715  HOH A O   1 
HETATM 9152 O  O   . HOH S 7 .   ? 33.204 49.995  41.764  1.00 30.80 ? 716  HOH A O   1 
HETATM 9153 O  O   . HOH S 7 .   ? 23.592 21.365  66.466  1.00 23.20 ? 717  HOH A O   1 
HETATM 9154 O  O   . HOH S 7 .   ? 16.947 47.929  38.934  1.00 15.57 ? 718  HOH A O   1 
HETATM 9155 O  O   . HOH S 7 .   ? 2.609  19.091  39.950  1.00 27.84 ? 719  HOH A O   1 
HETATM 9156 O  O   . HOH S 7 .   ? -0.121 25.205  48.153  1.00 27.73 ? 720  HOH A O   1 
HETATM 9157 O  O   . HOH S 7 .   ? 22.441 45.768  32.346  1.00 27.27 ? 721  HOH A O   1 
HETATM 9158 O  O   . HOH S 7 .   ? 34.869 53.673  39.845  1.00 25.01 ? 722  HOH A O   1 
HETATM 9159 O  O   . HOH S 7 .   ? 41.290 38.301  30.857  1.00 37.76 ? 723  HOH A O   1 
HETATM 9160 O  O   . HOH S 7 .   ? 12.327 18.689  51.630  1.00 21.12 ? 724  HOH A O   1 
HETATM 9161 O  O   . HOH S 7 .   ? 37.248 0.702   33.014  1.00 28.93 ? 725  HOH A O   1 
HETATM 9162 O  O   . HOH S 7 .   ? 6.305  24.027  35.441  1.00 20.58 ? 726  HOH A O   1 
HETATM 9163 O  O   . HOH S 7 .   ? 35.930 25.760  37.480  1.00 25.85 ? 727  HOH A O   1 
HETATM 9164 O  O   . HOH S 7 .   ? 38.471 49.599  30.868  1.00 26.94 ? 728  HOH A O   1 
HETATM 9165 O  O   . HOH S 7 .   ? 53.045 23.573  37.420  1.00 37.45 ? 729  HOH A O   1 
HETATM 9166 O  O   . HOH S 7 .   ? 45.372 10.769  57.430  1.00 27.65 ? 730  HOH A O   1 
HETATM 9167 O  O   . HOH S 7 .   ? 5.030  37.526  50.259  1.00 35.77 ? 731  HOH A O   1 
HETATM 9168 O  O   . HOH S 7 .   ? 34.085 7.593   29.722  1.00 25.02 ? 732  HOH A O   1 
HETATM 9169 O  O   . HOH S 7 .   ? 57.555 37.024  49.996  1.00 37.17 ? 733  HOH A O   1 
HETATM 9170 O  O   . HOH S 7 .   ? 24.126 39.763  52.418  1.00 25.96 ? 734  HOH A O   1 
HETATM 9171 O  O   . HOH S 7 .   ? 37.573 24.278  39.571  1.00 20.26 ? 735  HOH A O   1 
HETATM 9172 O  O   . HOH S 7 .   ? 40.334 10.685  56.765  1.00 27.39 ? 736  HOH A O   1 
HETATM 9173 O  O   . HOH S 7 .   ? 26.178 0.886   35.942  1.00 33.47 ? 737  HOH A O   1 
HETATM 9174 O  O   . HOH S 7 .   ? 41.780 31.009  36.849  1.00 23.94 ? 738  HOH A O   1 
HETATM 9175 O  O   . HOH S 7 .   ? 21.216 3.703   39.894  1.00 10.89 ? 739  HOH A O   1 
HETATM 9176 O  O   . HOH S 7 .   ? 14.634 10.959  28.673  1.00 21.18 ? 740  HOH A O   1 
HETATM 9177 O  O   . HOH S 7 .   ? 26.918 33.976  29.778  1.00 22.00 ? 741  HOH A O   1 
HETATM 9178 O  O   . HOH S 7 .   ? 40.141 49.066  40.855  1.00 24.80 ? 742  HOH A O   1 
HETATM 9179 O  O   . HOH S 7 .   ? 39.657 38.324  50.867  1.00 18.95 ? 743  HOH A O   1 
HETATM 9180 O  O   . HOH S 7 .   ? 31.559 26.312  54.079  1.00 17.70 ? 744  HOH A O   1 
HETATM 9181 O  O   . HOH S 7 .   ? 33.165 18.835  27.539  1.00 20.76 ? 745  HOH A O   1 
HETATM 9182 O  O   . HOH S 7 .   ? 47.304 49.108  34.857  1.00 34.03 ? 746  HOH A O   1 
HETATM 9183 O  O   . HOH S 7 .   ? 11.226 46.552  38.221  1.00 36.12 ? 747  HOH A O   1 
HETATM 9184 O  O   . HOH S 7 .   ? 42.510 9.822   49.750  1.00 35.32 ? 748  HOH A O   1 
HETATM 9185 O  O   . HOH S 7 .   ? 52.744 25.920  38.132  1.00 28.30 ? 749  HOH A O   1 
HETATM 9186 O  O   . HOH S 7 .   ? 63.762 34.343  38.780  1.00 39.92 ? 750  HOH A O   1 
HETATM 9187 O  O   . HOH S 7 .   ? 47.803 19.546  60.276  1.00 31.97 ? 751  HOH A O   1 
HETATM 9188 O  O   . HOH S 7 .   ? 20.709 10.424  55.170  1.00 30.92 ? 752  HOH A O   1 
HETATM 9189 O  O   . HOH S 7 .   ? 20.064 10.690  52.847  1.00 27.92 ? 753  HOH A O   1 
HETATM 9190 O  O   . HOH S 7 .   ? 21.090 25.791  31.116  1.00 15.52 ? 754  HOH A O   1 
HETATM 9191 O  O   . HOH S 7 .   ? 39.996 25.858  54.425  1.00 28.91 ? 755  HOH A O   1 
HETATM 9192 O  O   . HOH S 7 .   ? 32.082 24.906  58.734  1.00 22.93 ? 756  HOH A O   1 
HETATM 9193 O  O   . HOH S 7 .   ? 40.882 52.037  33.144  1.00 26.73 ? 757  HOH A O   1 
HETATM 9194 O  O   . HOH S 7 .   ? 13.359 2.816   50.191  1.00 29.93 ? 758  HOH A O   1 
HETATM 9195 O  O   . HOH S 7 .   ? 14.143 43.693  36.025  1.00 33.96 ? 759  HOH A O   1 
HETATM 9196 O  O   . HOH S 7 .   ? 40.785 49.163  47.062  1.00 24.26 ? 760  HOH A O   1 
HETATM 9197 O  O   . HOH S 7 .   ? 38.604 40.012  57.325  1.00 30.71 ? 761  HOH A O   1 
HETATM 9198 O  O   . HOH S 7 .   ? 2.641  20.508  42.725  1.00 19.29 ? 762  HOH A O   1 
HETATM 9199 O  O   . HOH S 7 .   ? 35.634 11.944  37.642  1.00 17.50 ? 763  HOH A O   1 
HETATM 9200 O  O   . HOH S 7 .   ? 36.206 15.586  35.349  1.00 14.70 ? 764  HOH A O   1 
HETATM 9201 O  O   . HOH S 7 .   ? 30.846 28.927  45.244  1.00 14.44 ? 765  HOH A O   1 
HETATM 9202 O  O   . HOH S 7 .   ? 56.032 26.393  39.608  1.00 26.71 ? 766  HOH A O   1 
HETATM 9203 O  O   . HOH S 7 .   ? 11.224 26.283  61.519  1.00 30.14 ? 767  HOH A O   1 
HETATM 9204 O  O   . HOH S 7 .   ? 20.509 1.051   28.443  1.00 22.72 ? 768  HOH A O   1 
HETATM 9205 O  O   . HOH S 7 .   ? 17.905 2.907   34.662  1.00 16.83 ? 769  HOH A O   1 
HETATM 9206 O  O   . HOH S 7 .   ? 4.142  29.948  40.036  1.00 30.60 ? 770  HOH A O   1 
HETATM 9207 O  O   . HOH S 7 .   ? 49.795 33.541  34.266  1.00 43.96 ? 771  HOH A O   1 
HETATM 9208 O  O   . HOH S 7 .   ? 14.282 19.097  25.389  1.00 28.83 ? 772  HOH A O   1 
HETATM 9209 O  O   . HOH S 7 .   ? 32.986 57.277  41.754  1.00 19.18 ? 773  HOH A O   1 
HETATM 9210 O  O   . HOH S 7 .   ? 19.103 34.757  49.926  1.00 16.52 ? 774  HOH A O   1 
HETATM 9211 O  O   . HOH S 7 .   ? 32.673 31.085  52.438  1.00 11.13 ? 775  HOH A O   1 
HETATM 9212 O  O   . HOH S 7 .   ? 40.533 22.195  57.625  1.00 24.24 ? 776  HOH A O   1 
HETATM 9213 O  O   . HOH S 7 .   ? 8.141  38.790  38.010  1.00 36.41 ? 777  HOH A O   1 
HETATM 9214 O  O   . HOH S 7 .   ? 17.212 14.312  27.750  1.00 21.99 ? 778  HOH A O   1 
HETATM 9215 O  O   . HOH S 7 .   ? 23.036 43.213  50.795  1.00 22.55 ? 779  HOH A O   1 
HETATM 9216 O  O   . HOH S 7 .   ? 39.395 13.557  29.723  1.00 30.82 ? 780  HOH A O   1 
HETATM 9217 O  O   . HOH S 7 .   ? 14.781 -8.375  48.604  1.00 19.82 ? 781  HOH A O   1 
HETATM 9218 O  O   . HOH S 7 .   ? 53.519 17.847  61.771  1.00 22.54 ? 782  HOH A O   1 
HETATM 9219 O  O   . HOH S 7 .   ? 17.358 41.586  34.900  1.00 23.15 ? 783  HOH A O   1 
HETATM 9220 O  O   . HOH S 7 .   ? 17.617 7.838   43.337  1.00 13.83 ? 784  HOH A O   1 
HETATM 9221 O  O   . HOH S 7 .   ? 0.352  27.382  44.684  1.00 31.89 ? 785  HOH A O   1 
HETATM 9222 O  O   . HOH S 7 .   ? 27.892 2.130   41.264  1.00 29.31 ? 786  HOH A O   1 
HETATM 9223 O  O   . HOH S 7 .   ? -2.752 17.051  50.363  1.00 25.31 ? 787  HOH A O   1 
HETATM 9224 O  O   . HOH S 7 .   ? 30.630 42.718  42.182  1.00 16.33 ? 788  HOH A O   1 
HETATM 9225 O  O   . HOH S 7 .   ? 30.132 21.630  54.154  1.00 16.80 ? 789  HOH A O   1 
HETATM 9226 O  O   . HOH S 7 .   ? 5.277  14.820  34.558  1.00 30.26 ? 790  HOH A O   1 
HETATM 9227 O  O   . HOH S 7 .   ? 45.325 48.257  52.116  1.00 31.14 ? 791  HOH A O   1 
HETATM 9228 O  O   . HOH S 7 .   ? 60.991 25.883  54.062  1.00 23.94 ? 792  HOH A O   1 
HETATM 9229 O  O   . HOH S 7 .   ? 15.398 32.606  55.262  1.00 21.87 ? 793  HOH A O   1 
HETATM 9230 O  O   . HOH S 7 .   ? 32.272 28.332  64.120  1.00 33.51 ? 794  HOH A O   1 
HETATM 9231 O  O   . HOH S 7 .   ? 52.843 18.450  50.094  1.00 20.71 ? 795  HOH A O   1 
HETATM 9232 O  O   . HOH S 7 .   ? 19.210 22.317  24.878  1.00 13.80 ? 796  HOH A O   1 
HETATM 9233 O  O   . HOH S 7 .   ? 31.304 35.031  64.994  1.00 30.80 ? 797  HOH A O   1 
HETATM 9234 O  O   . HOH S 7 .   ? 32.832 36.451  38.038  1.00 17.08 ? 798  HOH A O   1 
HETATM 9235 O  O   . HOH S 7 .   ? 26.217 21.185  65.350  1.00 31.85 ? 799  HOH A O   1 
HETATM 9236 O  O   . HOH S 7 .   ? 19.698 39.504  30.894  1.00 26.68 ? 800  HOH A O   1 
HETATM 9237 O  O   . HOH S 7 .   ? 23.134 15.113  60.592  1.00 21.46 ? 801  HOH A O   1 
HETATM 9238 O  O   . HOH S 7 .   ? 63.124 28.142  56.362  1.00 32.02 ? 802  HOH A O   1 
HETATM 9239 O  O   . HOH S 7 .   ? 56.441 19.359  71.599  1.00 36.54 ? 803  HOH A O   1 
HETATM 9240 O  O   . HOH S 7 .   ? 44.358 14.261  46.302  1.00 26.60 ? 804  HOH A O   1 
HETATM 9241 O  O   . HOH S 7 .   ? 55.277 41.083  40.565  1.00 37.10 ? 805  HOH A O   1 
HETATM 9242 O  O   . HOH S 7 .   ? 13.413 45.024  44.656  1.00 26.68 ? 806  HOH A O   1 
HETATM 9243 O  O   . HOH S 7 .   ? 28.076 25.115  57.722  1.00 16.16 ? 807  HOH A O   1 
HETATM 9244 O  O   . HOH S 7 .   ? 33.944 19.341  49.494  1.00 12.44 ? 808  HOH A O   1 
HETATM 9245 O  O   . HOH S 7 .   ? 48.563 17.460  58.647  1.00 22.33 ? 809  HOH A O   1 
HETATM 9246 O  O   . HOH S 7 .   ? 32.553 17.759  63.458  1.00 35.26 ? 810  HOH A O   1 
HETATM 9247 O  O   . HOH S 7 .   ? 22.683 29.193  23.332  1.00 28.00 ? 811  HOH A O   1 
HETATM 9248 O  O   . HOH S 7 .   ? 18.969 20.086  61.892  1.00 18.09 ? 812  HOH A O   1 
HETATM 9249 O  O   . HOH S 7 .   ? 36.468 22.487  57.812  1.00 22.10 ? 813  HOH A O   1 
HETATM 9250 O  O   . HOH S 7 .   ? 27.631 45.226  42.468  1.00 27.42 ? 814  HOH A O   1 
HETATM 9251 O  O   . HOH S 7 .   ? 40.228 34.386  57.482  1.00 23.77 ? 815  HOH A O   1 
HETATM 9252 O  O   . HOH S 7 .   ? 30.013 41.267  49.652  1.00 19.27 ? 816  HOH A O   1 
HETATM 9253 O  O   . HOH S 7 .   ? 24.557 34.177  66.548  1.00 42.39 ? 817  HOH A O   1 
HETATM 9254 O  O   . HOH S 7 .   ? 19.533 16.049  62.977  1.00 23.73 ? 818  HOH A O   1 
HETATM 9255 O  O   . HOH S 7 .   ? 45.515 20.433  52.935  1.00 18.45 ? 819  HOH A O   1 
HETATM 9256 O  O   . HOH S 7 .   ? 48.327 31.636  56.637  1.00 25.09 ? 820  HOH A O   1 
HETATM 9257 O  O   . HOH S 7 .   ? 5.180  11.455  34.687  1.00 31.59 ? 821  HOH A O   1 
HETATM 9258 O  O   . HOH S 7 .   ? 27.903 54.229  43.055  1.00 28.36 ? 822  HOH A O   1 
HETATM 9259 O  O   . HOH S 7 .   ? -1.175 22.670  44.240  1.00 34.49 ? 823  HOH A O   1 
HETATM 9260 O  O   . HOH S 7 .   ? 42.054 50.354  39.281  1.00 32.41 ? 824  HOH A O   1 
HETATM 9261 O  O   . HOH S 7 .   ? 13.171 14.967  60.834  1.00 22.82 ? 825  HOH A O   1 
HETATM 9262 O  O   . HOH S 7 .   ? 6.672  9.248   35.509  1.00 25.29 ? 826  HOH A O   1 
HETATM 9263 O  O   . HOH S 7 .   ? 31.927 46.659  33.773  1.00 19.39 ? 827  HOH A O   1 
HETATM 9264 O  O   . HOH S 7 .   ? 37.690 44.108  55.372  1.00 32.04 ? 828  HOH A O   1 
HETATM 9265 O  O   . HOH S 7 .   ? 30.256 6.705   41.924  1.00 22.67 ? 829  HOH A O   1 
HETATM 9266 O  O   . HOH S 7 .   ? 4.897  20.654  36.876  1.00 32.39 ? 830  HOH A O   1 
HETATM 9267 O  O   . HOH S 7 .   ? 35.579 37.555  46.587  1.00 13.90 ? 831  HOH A O   1 
HETATM 9268 O  O   . HOH S 7 .   ? -4.519 24.889  53.105  1.00 36.79 ? 832  HOH A O   1 
HETATM 9269 O  O   . HOH S 7 .   ? 22.440 -4.519  39.473  1.00 26.99 ? 833  HOH A O   1 
HETATM 9270 O  O   . HOH S 7 .   ? 12.121 2.309   34.257  1.00 35.17 ? 834  HOH A O   1 
HETATM 9271 O  O   . HOH S 7 .   ? 54.113 13.995  54.930  1.00 24.65 ? 835  HOH A O   1 
HETATM 9272 O  O   . HOH S 7 .   ? 5.153  2.623   38.944  1.00 43.31 ? 836  HOH A O   1 
HETATM 9273 O  O   . HOH S 7 .   ? 32.159 44.579  31.742  1.00 23.31 ? 837  HOH A O   1 
HETATM 9274 O  O   . HOH S 7 .   ? 42.179 16.574  57.309  1.00 17.56 ? 838  HOH A O   1 
HETATM 9275 O  O   . HOH S 7 .   ? 47.399 42.370  35.380  1.00 34.58 ? 839  HOH A O   1 
HETATM 9276 O  O   . HOH S 7 .   ? 52.260 33.985  38.184  1.00 27.84 ? 840  HOH A O   1 
HETATM 9277 O  O   . HOH S 7 .   ? 22.352 -3.971  48.462  1.00 23.20 ? 841  HOH A O   1 
HETATM 9278 O  O   . HOH S 7 .   ? 13.958 19.469  67.253  1.00 28.52 ? 842  HOH A O   1 
HETATM 9279 O  O   . HOH S 7 .   ? 30.839 2.094   34.230  1.00 38.70 ? 843  HOH A O   1 
HETATM 9280 O  O   . HOH S 7 .   ? 34.134 41.510  29.378  1.00 24.30 ? 844  HOH A O   1 
HETATM 9281 O  O   . HOH S 7 .   ? 32.632 14.302  58.529  1.00 21.60 ? 845  HOH A O   1 
HETATM 9282 O  O   . HOH S 7 .   ? 60.281 18.092  63.036  1.00 30.48 ? 846  HOH A O   1 
HETATM 9283 O  O   . HOH S 7 .   ? -3.200 24.190  49.485  1.00 32.18 ? 847  HOH A O   1 
HETATM 9284 O  O   . HOH S 7 .   ? 30.353 43.113  39.488  1.00 16.91 ? 848  HOH A O   1 
HETATM 9285 O  O   . HOH S 7 .   ? 49.971 17.670  39.286  1.00 37.64 ? 849  HOH A O   1 
HETATM 9286 O  O   . HOH S 7 .   ? 17.781 7.553   55.974  1.00 31.70 ? 850  HOH A O   1 
HETATM 9287 O  O   . HOH S 7 .   ? 25.481 42.605  30.570  1.00 26.72 ? 851  HOH A O   1 
HETATM 9288 O  O   . HOH S 7 .   ? 56.298 40.467  49.383  1.00 24.91 ? 852  HOH A O   1 
HETATM 9289 O  O   . HOH S 7 .   ? 25.752 38.472  54.899  1.00 20.28 ? 853  HOH A O   1 
HETATM 9290 O  O   . HOH S 7 .   ? 40.032 6.184   48.741  1.00 39.96 ? 854  HOH A O   1 
HETATM 9291 O  O   . HOH S 7 .   ? 14.764 26.196  62.569  1.00 27.65 ? 855  HOH A O   1 
HETATM 9292 O  O   . HOH S 7 .   ? 62.979 23.043  58.135  1.00 29.04 ? 856  HOH A O   1 
HETATM 9293 O  O   . HOH S 7 .   ? 58.689 24.574  66.254  1.00 39.06 ? 857  HOH A O   1 
HETATM 9294 O  O   . HOH S 7 .   ? 2.629  10.006  52.192  1.00 27.08 ? 858  HOH A O   1 
HETATM 9295 O  O   . HOH S 7 .   ? 19.465 1.282   32.887  1.00 19.14 ? 859  HOH A O   1 
HETATM 9296 O  O   . HOH S 7 .   ? 36.333 36.645  55.639  1.00 23.21 ? 860  HOH A O   1 
HETATM 9297 O  O   . HOH S 7 .   ? 51.205 39.563  35.377  1.00 34.96 ? 861  HOH A O   1 
HETATM 9298 O  O   . HOH S 7 .   ? 39.535 44.985  48.444  1.00 21.21 ? 862  HOH A O   1 
HETATM 9299 O  O   . HOH S 7 .   ? 9.959  43.604  44.869  1.00 31.14 ? 863  HOH A O   1 
HETATM 9300 O  O   . HOH S 7 .   ? 0.448  10.635  43.451  1.00 34.98 ? 864  HOH A O   1 
HETATM 9301 O  O   . HOH S 7 .   ? 29.652 34.640  31.349  1.00 29.42 ? 865  HOH A O   1 
HETATM 9302 O  O   . HOH S 7 .   ? 46.750 44.802  37.134  1.00 28.95 ? 866  HOH A O   1 
HETATM 9303 O  O   . HOH S 7 .   ? 21.461 17.558  44.236  1.00 13.58 ? 867  HOH A O   1 
HETATM 9304 O  O   . HOH S 7 .   ? 36.021 45.035  28.180  1.00 25.58 ? 868  HOH A O   1 
HETATM 9305 O  O   . HOH S 7 .   ? 15.664 0.028   37.780  1.00 18.59 ? 869  HOH A O   1 
HETATM 9306 O  O   . HOH S 7 .   ? 40.464 12.764  39.424  1.00 37.64 ? 870  HOH A O   1 
HETATM 9307 O  O   . HOH S 7 .   ? 26.119 28.728  37.261  1.00 12.83 ? 871  HOH A O   1 
HETATM 9308 O  O   . HOH S 7 .   ? 38.462 28.350  41.575  1.00 21.00 ? 872  HOH A O   1 
HETATM 9309 O  O   . HOH S 7 .   ? 22.830 15.383  43.198  1.00 18.27 ? 873  HOH A O   1 
HETATM 9310 O  O   . HOH S 7 .   ? 32.648 25.658  48.986  1.00 17.43 ? 874  HOH A O   1 
HETATM 9311 O  O   . HOH S 7 .   ? 30.405 31.016  43.411  1.00 21.30 ? 875  HOH A O   1 
HETATM 9312 O  O   . HOH S 7 .   ? 11.162 20.726  49.978  1.00 15.75 ? 876  HOH A O   1 
HETATM 9313 O  O   . HOH S 7 .   ? 25.952 42.609  44.489  1.00 25.76 ? 877  HOH A O   1 
HETATM 9314 O  O   . HOH S 7 .   ? 58.994 37.417  43.850  1.00 32.39 ? 878  HOH A O   1 
HETATM 9315 O  O   . HOH S 7 .   ? 20.626 5.008   56.197  1.00 41.08 ? 879  HOH A O   1 
HETATM 9316 O  O   . HOH S 7 .   ? 48.654 45.724  38.602  1.00 32.65 ? 880  HOH A O   1 
HETATM 9317 O  O   . HOH S 7 .   ? 25.203 23.205  30.758  1.00 14.31 ? 881  HOH A O   1 
HETATM 9318 O  O   . HOH S 7 .   ? 33.727 24.944  26.571  1.00 23.38 ? 882  HOH A O   1 
HETATM 9319 O  O   . HOH S 7 .   ? 25.480 39.267  33.460  1.00 35.24 ? 883  HOH A O   1 
HETATM 9320 O  O   . HOH S 7 .   ? 39.295 11.220  40.703  1.00 33.29 ? 884  HOH A O   1 
HETATM 9321 O  O   . HOH S 7 .   ? 19.751 45.864  40.079  1.00 16.99 ? 885  HOH A O   1 
HETATM 9322 O  O   . HOH S 7 .   ? 19.442 0.786   45.218  1.00 17.40 ? 886  HOH A O   1 
HETATM 9323 O  O   . HOH S 7 .   ? 34.752 35.151  57.774  1.00 24.18 ? 887  HOH A O   1 
HETATM 9324 O  O   . HOH S 7 .   ? 4.822  7.854   48.653  1.00 28.46 ? 888  HOH A O   1 
HETATM 9325 O  O   . HOH S 7 .   ? 53.118 45.929  48.062  1.00 37.77 ? 889  HOH A O   1 
HETATM 9326 O  O   . HOH S 7 .   ? 13.945 6.774   55.979  1.00 24.14 ? 890  HOH A O   1 
HETATM 9327 O  O   . HOH S 7 .   ? 14.317 1.508   33.649  1.00 39.60 ? 891  HOH A O   1 
HETATM 9328 O  O   . HOH S 7 .   ? 36.480 14.908  64.455  1.00 35.83 ? 892  HOH A O   1 
HETATM 9329 O  O   . HOH S 7 .   ? 12.387 8.839   58.414  1.00 29.52 ? 893  HOH A O   1 
HETATM 9330 O  O   . HOH S 7 .   ? 38.390 31.888  34.024  1.00 36.40 ? 894  HOH A O   1 
HETATM 9331 O  O   . HOH S 7 .   ? 45.131 43.940  31.224  1.00 38.58 ? 895  HOH A O   1 
HETATM 9332 O  O   . HOH S 7 .   ? 32.578 38.192  29.574  1.00 33.33 ? 896  HOH A O   1 
HETATM 9333 O  O   . HOH S 7 .   ? 25.796 30.907  38.939  1.00 12.52 ? 897  HOH A O   1 
HETATM 9334 O  O   . HOH S 7 .   ? 46.059 22.163  55.109  1.00 17.86 ? 898  HOH A O   1 
HETATM 9335 O  O   . HOH S 7 .   ? 29.982 37.719  31.029  1.00 25.08 ? 899  HOH A O   1 
HETATM 9336 O  O   . HOH S 7 .   ? 33.952 10.810  51.534  1.00 24.05 ? 900  HOH A O   1 
HETATM 9337 O  O   . HOH S 7 .   ? 39.140 15.525  51.121  1.00 17.24 ? 901  HOH A O   1 
HETATM 9338 O  O   . HOH S 7 .   ? 46.940 50.438  42.791  1.00 25.44 ? 902  HOH A O   1 
HETATM 9339 O  O   . HOH S 7 .   ? 26.396 46.029  46.949  1.00 36.99 ? 903  HOH A O   1 
HETATM 9340 O  O   . HOH S 7 .   ? 15.823 31.730  32.292  1.00 21.66 ? 904  HOH A O   1 
HETATM 9341 O  O   . HOH S 7 .   ? 44.810 40.225  32.667  1.00 25.20 ? 905  HOH A O   1 
HETATM 9342 O  O   . HOH S 7 .   ? 38.224 40.611  30.796  1.00 27.93 ? 906  HOH A O   1 
HETATM 9343 O  O   . HOH S 7 .   ? 53.910 45.883  44.961  1.00 32.78 ? 907  HOH A O   1 
HETATM 9344 O  O   . HOH S 7 .   ? 27.317 45.862  36.276  1.00 29.16 ? 908  HOH A O   1 
HETATM 9345 O  O   . HOH S 7 .   ? 51.088 10.845  59.127  1.00 21.47 ? 909  HOH A O   1 
HETATM 9346 O  O   . HOH S 7 .   ? 7.621  15.010  49.538  1.00 20.96 ? 910  HOH A O   1 
HETATM 9347 O  O   . HOH S 7 .   ? 59.530 29.811  40.573  1.00 36.41 ? 911  HOH A O   1 
HETATM 9348 O  O   . HOH S 7 .   ? 42.459 24.596  40.327  1.00 26.93 ? 912  HOH A O   1 
HETATM 9349 O  O   . HOH S 7 .   ? 27.376 22.739  29.121  1.00 19.45 ? 913  HOH A O   1 
HETATM 9350 O  O   . HOH S 7 .   ? 18.445 44.280  33.094  1.00 24.44 ? 914  HOH A O   1 
HETATM 9351 O  O   . HOH S 7 .   ? 19.973 11.618  39.512  1.00 16.49 ? 915  HOH A O   1 
HETATM 9352 O  O   . HOH S 7 .   ? 18.905 30.062  65.648  1.00 43.82 ? 916  HOH A O   1 
HETATM 9353 O  O   . HOH S 7 .   ? 38.231 10.087  33.396  1.00 28.72 ? 917  HOH A O   1 
HETATM 9354 O  O   . HOH S 7 .   ? -3.216 29.231  53.413  1.00 27.81 ? 918  HOH A O   1 
HETATM 9355 O  O   . HOH S 7 .   ? 16.248 21.580  23.667  1.00 41.14 ? 919  HOH A O   1 
HETATM 9356 O  O   . HOH S 7 .   ? 29.462 5.315   33.666  1.00 20.75 ? 920  HOH A O   1 
HETATM 9357 O  O   . HOH S 7 .   ? 6.799  17.426  32.527  1.00 37.29 ? 921  HOH A O   1 
HETATM 9358 O  O   . HOH S 7 .   ? 36.091 54.147  42.454  1.00 40.41 ? 922  HOH A O   1 
HETATM 9359 O  O   . HOH S 7 .   ? 44.423 26.156  60.342  1.00 22.65 ? 923  HOH A O   1 
HETATM 9360 O  O   . HOH S 7 .   ? 9.749  16.951  49.629  1.00 21.67 ? 924  HOH A O   1 
HETATM 9361 O  O   . HOH S 7 .   ? 21.353 8.373   50.694  1.00 38.02 ? 925  HOH A O   1 
HETATM 9362 O  O   . HOH S 7 .   ? 27.909 22.542  55.540  1.00 15.66 ? 926  HOH A O   1 
HETATM 9363 O  O   . HOH S 7 .   ? 57.311 14.461  52.224  1.00 25.71 ? 927  HOH A O   1 
HETATM 9364 O  O   . HOH S 7 .   ? 16.392 13.656  64.116  1.00 37.95 ? 928  HOH A O   1 
HETATM 9365 O  O   . HOH S 7 .   ? 12.387 24.811  63.712  1.00 32.49 ? 929  HOH A O   1 
HETATM 9366 O  O   . HOH S 7 .   ? 26.646 36.897  33.600  1.00 25.84 ? 930  HOH A O   1 
HETATM 9367 O  O   . HOH S 7 .   ? 7.048  5.927   53.639  1.00 29.48 ? 931  HOH A O   1 
HETATM 9368 O  O   . HOH S 7 .   ? 27.970 26.721  65.423  1.00 28.96 ? 932  HOH A O   1 
HETATM 9369 O  O   . HOH S 7 .   ? 34.714 41.724  61.525  1.00 32.98 ? 933  HOH A O   1 
HETATM 9370 O  O   . HOH S 7 .   ? 8.225  31.379  56.940  1.00 39.43 ? 934  HOH A O   1 
HETATM 9371 O  O   . HOH S 7 .   ? 37.184 30.421  59.859  1.00 34.90 ? 935  HOH A O   1 
HETATM 9372 O  O   . HOH S 7 .   ? 25.287 1.193   27.320  1.00 31.66 ? 936  HOH A O   1 
HETATM 9373 O  O   . HOH S 7 .   ? 52.282 11.701  49.356  1.00 32.53 ? 937  HOH A O   1 
HETATM 9374 O  O   . HOH S 7 .   ? 34.057 6.289   39.460  1.00 21.25 ? 938  HOH A O   1 
HETATM 9375 O  O   . HOH S 7 .   ? 19.895 10.557  60.166  1.00 42.68 ? 939  HOH A O   1 
HETATM 9376 O  O   . HOH S 7 .   ? 25.532 40.883  56.318  1.00 29.21 ? 940  HOH A O   1 
HETATM 9377 O  O   . HOH S 7 .   ? 25.568 5.065   42.674  1.00 25.06 ? 941  HOH A O   1 
HETATM 9378 O  O   . HOH S 7 .   ? 63.139 32.638  49.589  1.00 28.53 ? 942  HOH A O   1 
HETATM 9379 O  O   . HOH S 7 .   ? 59.217 32.976  58.845  1.00 41.91 ? 943  HOH A O   1 
HETATM 9380 O  O   . HOH S 7 .   ? 66.132 23.640  60.259  1.00 31.18 ? 944  HOH A O   1 
HETATM 9381 O  O   . HOH S 7 .   ? 21.900 25.381  70.008  1.00 35.95 ? 945  HOH A O   1 
HETATM 9382 O  O   . HOH S 7 .   ? 42.107 16.650  32.218  1.00 28.05 ? 946  HOH A O   1 
HETATM 9383 O  O   . HOH S 7 .   ? 47.556 15.359  45.581  1.00 34.67 ? 947  HOH A O   1 
HETATM 9384 O  O   . HOH S 7 .   ? 36.105 16.758  48.749  1.00 14.85 ? 948  HOH A O   1 
HETATM 9385 O  O   . HOH S 7 .   ? 17.899 28.377  63.633  1.00 33.83 ? 949  HOH A O   1 
HETATM 9386 O  O   . HOH S 7 .   ? 20.223 0.723   53.810  1.00 42.02 ? 950  HOH A O   1 
HETATM 9387 O  O   . HOH S 7 .   ? 9.313  4.108   36.155  1.00 29.14 ? 951  HOH A O   1 
HETATM 9388 O  O   . HOH S 7 .   ? 54.131 33.759  40.281  1.00 21.11 ? 952  HOH A O   1 
HETATM 9389 O  O   . HOH S 7 .   ? 38.682 17.399  48.390  1.00 17.50 ? 953  HOH A O   1 
HETATM 9390 O  O   . HOH S 7 .   ? 7.135  23.837  61.252  1.00 35.93 ? 954  HOH A O   1 
HETATM 9391 O  O   . HOH S 7 .   ? 37.195 19.106  49.890  1.00 15.34 ? 955  HOH A O   1 
HETATM 9392 O  O   . HOH S 7 .   ? 58.067 24.755  63.197  1.00 31.00 ? 956  HOH A O   1 
HETATM 9393 O  O   . HOH S 7 .   ? 56.548 40.213  52.639  1.00 35.83 ? 957  HOH A O   1 
HETATM 9394 O  O   . HOH S 7 .   ? 51.474 27.221  35.842  1.00 33.99 ? 958  HOH A O   1 
HETATM 9395 O  O   . HOH S 7 .   ? 29.116 47.740  35.464  1.00 30.77 ? 959  HOH A O   1 
HETATM 9396 O  O   . HOH S 7 .   ? 40.674 26.542  37.650  1.00 34.01 ? 960  HOH A O   1 
HETATM 9397 O  O   . HOH S 7 .   ? 12.700 24.963  29.316  1.00 23.25 ? 961  HOH A O   1 
HETATM 9398 O  O   . HOH S 7 .   ? 37.128 3.858   37.935  1.00 30.28 ? 962  HOH A O   1 
HETATM 9399 O  O   . HOH S 7 .   ? 10.945 37.536  33.403  1.00 31.85 ? 963  HOH A O   1 
HETATM 9400 O  O   . HOH S 7 .   ? 57.072 23.679  43.579  1.00 21.78 ? 964  HOH A O   1 
HETATM 9401 O  O   . HOH S 7 .   ? 24.334 46.939  35.611  1.00 34.29 ? 965  HOH A O   1 
HETATM 9402 O  O   . HOH S 7 .   ? 20.573 38.893  58.990  1.00 30.12 ? 966  HOH A O   1 
HETATM 9403 O  O   . HOH S 7 .   ? 40.580 20.498  38.737  1.00 28.02 ? 967  HOH A O   1 
HETATM 9404 O  O   . HOH S 7 .   ? 38.474 29.486  36.758  1.00 29.37 ? 968  HOH A O   1 
HETATM 9405 O  O   . HOH S 7 .   ? 39.552 14.583  37.862  1.00 28.74 ? 969  HOH A O   1 
HETATM 9406 O  O   . HOH S 7 .   ? 47.098 20.391  43.131  1.00 19.42 ? 970  HOH A O   1 
HETATM 9407 O  O   . HOH S 7 .   ? 17.375 0.901   53.352  1.00 37.81 ? 971  HOH A O   1 
HETATM 9408 O  O   . HOH S 7 .   ? 45.894 49.054  49.658  1.00 28.81 ? 972  HOH A O   1 
HETATM 9409 O  O   . HOH S 7 .   ? 18.537 41.951  30.589  1.00 39.86 ? 973  HOH A O   1 
HETATM 9410 O  O   . HOH S 7 .   ? 22.354 33.890  22.269  1.00 28.63 ? 974  HOH A O   1 
HETATM 9411 O  O   . HOH S 7 .   ? 55.525 16.829  60.247  1.00 26.20 ? 975  HOH A O   1 
HETATM 9412 O  O   . HOH S 7 .   ? 18.421 24.465  21.530  1.00 40.32 ? 976  HOH A O   1 
HETATM 9413 O  O   . HOH S 7 .   ? 0.233  22.026  42.055  1.00 37.52 ? 977  HOH A O   1 
HETATM 9414 O  O   . HOH S 7 .   ? 46.367 20.238  40.650  1.00 42.86 ? 978  HOH A O   1 
HETATM 9415 O  O   . HOH S 7 .   ? 25.511 18.610  64.094  1.00 26.01 ? 979  HOH A O   1 
HETATM 9416 O  O   . HOH S 7 .   ? 15.089 -4.204  49.685  1.00 32.63 ? 980  HOH A O   1 
HETATM 9417 O  O   . HOH S 7 .   ? 23.870 -0.447  35.375  1.00 36.54 ? 981  HOH A O   1 
HETATM 9418 O  O   . HOH S 7 .   ? 36.677 10.285  30.006  1.00 25.09 ? 982  HOH A O   1 
HETATM 9419 O  O   . HOH S 7 .   ? 36.547 28.528  38.277  1.00 18.24 ? 983  HOH A O   1 
HETATM 9420 O  O   . HOH S 7 .   ? 9.747  -2.232  46.680  1.00 34.55 ? 984  HOH A O   1 
HETATM 9421 O  O   . HOH S 7 .   ? 53.030 19.401  36.025  1.00 46.77 ? 985  HOH A O   1 
HETATM 9422 O  O   . HOH S 7 .   ? 36.141 8.036   39.020  1.00 26.00 ? 986  HOH A O   1 
HETATM 9423 O  O   . HOH S 7 .   ? 17.323 26.361  29.712  1.00 26.16 ? 987  HOH A O   1 
HETATM 9424 O  O   . HOH S 7 .   ? 56.230 32.259  39.142  1.00 32.02 ? 988  HOH A O   1 
HETATM 9425 O  O   . HOH S 7 .   ? 27.281 33.801  65.791  1.00 32.90 ? 989  HOH A O   1 
HETATM 9426 O  O   . HOH S 7 .   ? -1.568 18.262  42.580  1.00 31.49 ? 990  HOH A O   1 
HETATM 9427 O  O   . HOH S 7 .   ? 19.994 29.395  22.035  1.00 38.51 ? 991  HOH A O   1 
HETATM 9428 O  O   . HOH S 7 .   ? 40.266 24.569  41.758  1.00 32.62 ? 992  HOH A O   1 
HETATM 9429 O  O   . HOH S 7 .   ? 3.074  34.609  38.949  1.00 39.23 ? 993  HOH A O   1 
HETATM 9430 O  O   . HOH S 7 .   ? 20.593 40.894  53.364  1.00 33.50 ? 994  HOH A O   1 
HETATM 9431 O  O   . HOH S 7 .   ? 25.521 -1.906  32.682  1.00 32.16 ? 995  HOH A O   1 
HETATM 9432 O  O   . HOH S 7 .   ? 53.896 14.524  60.629  1.00 25.22 ? 996  HOH A O   1 
HETATM 9433 O  O   . HOH S 7 .   ? 38.566 24.152  56.988  1.00 32.24 ? 997  HOH A O   1 
HETATM 9434 O  O   . HOH S 7 .   ? 16.522 28.359  28.250  1.00 27.12 ? 998  HOH A O   1 
HETATM 9435 O  O   . HOH S 7 .   ? -0.268 25.746  42.989  1.00 39.60 ? 999  HOH A O   1 
HETATM 9436 O  O   . HOH S 7 .   ? 54.670 18.315  65.602  1.00 21.53 ? 1000 HOH A O   1 
HETATM 9437 O  O   . HOH S 7 .   ? 33.531 44.291  29.308  1.00 29.55 ? 1001 HOH A O   1 
HETATM 9438 O  O   . HOH S 7 .   ? 0.038  13.388  42.261  1.00 30.50 ? 1002 HOH A O   1 
HETATM 9439 O  O   . HOH S 7 .   ? 31.186 11.973  55.121  1.00 36.03 ? 1003 HOH A O   1 
HETATM 9440 O  O   . HOH S 7 .   ? 30.842 2.374   26.011  1.00 30.92 ? 1004 HOH A O   1 
HETATM 9441 O  O   . HOH S 7 .   ? 57.260 17.986  65.703  1.00 26.95 ? 1005 HOH A O   1 
HETATM 9442 O  O   . HOH S 7 .   ? 31.940 27.610  25.050  1.00 29.05 ? 1006 HOH A O   1 
HETATM 9443 O  O   . HOH S 7 .   ? 24.484 37.397  29.136  1.00 36.30 ? 1007 HOH A O   1 
HETATM 9444 O  O   . HOH S 7 .   ? 16.490 2.055   31.789  1.00 17.89 ? 1008 HOH A O   1 
HETATM 9445 O  O   . HOH S 7 .   ? 58.092 38.989  48.124  1.00 40.24 ? 1009 HOH A O   1 
HETATM 9446 O  O   . HOH S 7 .   ? 26.155 36.008  31.264  1.00 25.92 ? 1010 HOH A O   1 
HETATM 9447 O  O   . HOH S 7 .   ? 13.871 -6.175  47.340  1.00 24.92 ? 1011 HOH A O   1 
HETATM 9448 O  O   . HOH S 7 .   ? 31.093 20.783  26.680  1.00 30.63 ? 1012 HOH A O   1 
HETATM 9449 O  O   . HOH S 7 .   ? 15.821 12.600  26.426  1.00 29.91 ? 1013 HOH A O   1 
HETATM 9450 O  O   . HOH S 7 .   ? 37.345 13.273  36.315  1.00 18.26 ? 1014 HOH A O   1 
HETATM 9451 O  O   . HOH S 7 .   ? 27.891 44.530  39.689  1.00 32.91 ? 1015 HOH A O   1 
HETATM 9452 O  O   . HOH S 7 .   ? 15.983 1.681   29.071  1.00 35.86 ? 1016 HOH A O   1 
HETATM 9453 O  O   . HOH S 7 .   ? 5.313  34.011  55.377  1.00 32.91 ? 1017 HOH A O   1 
HETATM 9454 O  O   . HOH S 7 .   ? 36.782 42.044  28.973  1.00 32.21 ? 1018 HOH A O   1 
HETATM 9455 O  O   . HOH S 7 .   ? 23.205 24.522  22.631  1.00 32.58 ? 1019 HOH A O   1 
HETATM 9456 O  O   . HOH S 7 .   ? 38.957 26.375  40.224  1.00 33.84 ? 1020 HOH A O   1 
HETATM 9457 O  O   . HOH S 7 .   ? 15.328 30.700  29.532  1.00 36.35 ? 1021 HOH A O   1 
HETATM 9458 O  O   . HOH S 7 .   ? 18.817 -1.150  31.984  1.00 33.25 ? 1022 HOH A O   1 
HETATM 9459 O  O   . HOH S 7 .   ? 35.965 47.486  26.879  1.00 23.33 ? 1023 HOH A O   1 
HETATM 9460 O  O   . HOH S 7 .   ? 13.369 13.656  25.554  1.00 20.78 ? 1024 HOH A O   1 
HETATM 9461 O  O   . HOH S 7 .   ? 0.635  17.021  39.435  1.00 32.36 ? 1025 HOH A O   1 
HETATM 9462 O  O   . HOH S 7 .   ? 12.930 -8.333  50.724  1.00 29.08 ? 1026 HOH A O   1 
HETATM 9463 O  O   . HOH S 7 .   ? 12.879 10.410  27.049  1.00 24.48 ? 1027 HOH A O   1 
HETATM 9464 O  O   . HOH S 7 .   ? 45.662 51.922  40.868  1.00 29.69 ? 1028 HOH A O   1 
HETATM 9465 O  O   . HOH S 7 .   ? 60.460 36.116  51.059  1.00 30.50 ? 1029 HOH A O   1 
HETATM 9466 O  O   . HOH S 7 .   ? 38.422 11.964  25.594  1.00 24.28 ? 1030 HOH A O   1 
HETATM 9467 O  O   . HOH S 7 .   ? 13.014 49.167  37.492  1.00 38.38 ? 1031 HOH A O   1 
HETATM 9468 O  O   . HOH S 7 .   ? 24.214 41.337  58.472  1.00 33.98 ? 1032 HOH A O   1 
HETATM 9469 O  O   . HOH S 7 .   ? 38.186 11.170  28.197  1.00 23.03 ? 1033 HOH A O   1 
HETATM 9470 O  O   . HOH S 7 .   ? 38.532 26.263  59.168  1.00 27.87 ? 1034 HOH A O   1 
HETATM 9471 O  O   . HOH T 7 .   ? 15.931 -9.989  -7.908  1.00 33.25 ? 701  HOH B O   1 
HETATM 9472 O  O   . HOH T 7 .   ? 21.360 19.346  -1.694  1.00 26.85 ? 702  HOH B O   1 
HETATM 9473 O  O   . HOH T 7 .   ? 13.058 -6.878  -5.241  1.00 23.71 ? 703  HOH B O   1 
HETATM 9474 O  O   . HOH T 7 .   ? 58.254 8.941   1.868   1.00 36.22 ? 704  HOH B O   1 
HETATM 9475 O  O   . HOH T 7 .   ? 67.341 -5.250  2.089   1.00 38.89 ? 705  HOH B O   1 
HETATM 9476 O  O   . HOH T 7 .   ? 10.474 -15.786 11.170  1.00 33.31 ? 706  HOH B O   1 
HETATM 9477 O  O   . HOH T 7 .   ? 45.135 9.174   -7.904  1.00 32.32 ? 707  HOH B O   1 
HETATM 9478 O  O   . HOH T 7 .   ? 66.006 -3.927  7.989   1.00 26.77 ? 708  HOH B O   1 
HETATM 9479 O  O   . HOH T 7 .   ? 3.396  6.144   11.929  1.00 39.97 ? 709  HOH B O   1 
HETATM 9480 O  O   . HOH T 7 .   ? 36.300 -22.168 25.196  1.00 30.84 ? 710  HOH B O   1 
HETATM 9481 O  O   . HOH T 7 .   ? 42.172 10.421  14.799  1.00 34.42 ? 711  HOH B O   1 
HETATM 9482 O  O   . HOH T 7 .   ? 28.273 -9.693  -15.589 1.00 33.78 ? 712  HOH B O   1 
HETATM 9483 O  O   . HOH T 7 .   ? 5.739  -0.689  -9.547  1.00 44.09 ? 713  HOH B O   1 
HETATM 9484 O  O   . HOH T 7 .   ? 34.808 0.209   30.585  1.00 30.97 ? 714  HOH B O   1 
HETATM 9485 O  O   . HOH T 7 .   ? 32.964 -19.832 10.735  1.00 19.62 ? 715  HOH B O   1 
HETATM 9486 O  O   . HOH T 7 .   ? 29.474 3.772   -17.608 1.00 32.60 ? 716  HOH B O   1 
HETATM 9487 O  O   . HOH T 7 .   ? 12.499 -9.790  -5.216  1.00 17.89 ? 717  HOH B O   1 
HETATM 9488 O  O   . HOH T 7 .   ? 11.233 -0.767  -8.914  1.00 26.67 ? 718  HOH B O   1 
HETATM 9489 O  O   . HOH T 7 .   ? 8.485  -4.254  -8.966  1.00 34.77 ? 719  HOH B O   1 
HETATM 9490 O  O   . HOH T 7 .   ? 28.911 -22.540 16.264  1.00 30.89 ? 720  HOH B O   1 
HETATM 9491 O  O   . HOH T 7 .   ? 8.392  13.800  13.173  1.00 18.45 ? 721  HOH B O   1 
HETATM 9492 O  O   . HOH T 7 .   ? 18.488 -24.654 15.998  1.00 33.11 ? 722  HOH B O   1 
HETATM 9493 O  O   . HOH T 7 .   ? 38.192 22.320  20.629  1.00 27.82 ? 723  HOH B O   1 
HETATM 9494 O  O   . HOH T 7 .   ? 34.816 -21.136 -7.354  1.00 23.23 ? 724  HOH B O   1 
HETATM 9495 O  O   . HOH T 7 .   ? 19.940 23.512  4.723   1.00 26.89 ? 725  HOH B O   1 
HETATM 9496 O  O   . HOH T 7 .   ? 1.449  11.192  2.688   1.00 17.09 ? 726  HOH B O   1 
HETATM 9497 O  O   . HOH T 7 .   ? 17.590 22.971  12.506  1.00 18.69 ? 727  HOH B O   1 
HETATM 9498 O  O   . HOH T 7 .   ? 65.447 4.839   -4.736  1.00 37.99 ? 728  HOH B O   1 
HETATM 9499 O  O   . HOH T 7 .   ? 43.923 15.756  2.295   1.00 39.85 ? 729  HOH B O   1 
HETATM 9500 O  O   . HOH T 7 .   ? 45.013 12.319  -2.323  1.00 32.37 ? 730  HOH B O   1 
HETATM 9501 O  O   . HOH T 7 .   ? 6.859  11.452  13.837  1.00 25.14 ? 731  HOH B O   1 
HETATM 9502 O  O   . HOH T 7 .   ? 45.234 0.984   -2.957  1.00 23.50 ? 732  HOH B O   1 
HETATM 9503 O  O   . HOH T 7 .   ? 47.121 -12.358 -4.576  1.00 28.83 ? 733  HOH B O   1 
HETATM 9504 O  O   . HOH T 7 .   ? 13.507 13.835  18.611  1.00 19.42 ? 734  HOH B O   1 
HETATM 9505 O  O   . HOH T 7 .   ? 19.141 -24.879 11.751  1.00 12.53 ? 735  HOH B O   1 
HETATM 9506 O  O   . HOH T 7 .   ? 35.727 -26.816 11.408  1.00 33.41 ? 736  HOH B O   1 
HETATM 9507 O  O   . HOH T 7 .   ? 5.704  16.047  7.898   1.00 33.44 ? 737  HOH B O   1 
HETATM 9508 O  O   . HOH T 7 .   ? 35.128 10.385  1.165   1.00 27.05 ? 738  HOH B O   1 
HETATM 9509 O  O   . HOH T 7 .   ? 20.760 3.376   -16.674 1.00 27.91 ? 739  HOH B O   1 
HETATM 9510 O  O   . HOH T 7 .   ? 45.122 -11.216 -2.789  1.00 28.99 ? 740  HOH B O   1 
HETATM 9511 O  O   . HOH T 7 .   ? 30.019 1.653   -14.571 1.00 22.43 ? 741  HOH B O   1 
HETATM 9512 O  O   . HOH T 7 .   ? 20.230 -16.320 20.137  1.00 24.27 ? 742  HOH B O   1 
HETATM 9513 O  O   . HOH T 7 .   ? 23.371 19.402  11.493  1.00 10.92 ? 743  HOH B O   1 
HETATM 9514 O  O   . HOH T 7 .   ? 27.972 18.314  9.211   1.00 27.61 ? 744  HOH B O   1 
HETATM 9515 O  O   . HOH T 7 .   ? 9.881  -7.553  15.012  1.00 32.10 ? 745  HOH B O   1 
HETATM 9516 O  O   . HOH T 7 .   ? 20.165 -13.956 -12.888 1.00 27.50 ? 746  HOH B O   1 
HETATM 9517 O  O   . HOH T 7 .   ? 1.049  -2.025  -6.224  1.00 29.31 ? 747  HOH B O   1 
HETATM 9518 O  O   . HOH T 7 .   ? 17.084 20.080  -0.223  1.00 25.84 ? 748  HOH B O   1 
HETATM 9519 O  O   . HOH T 7 .   ? 35.710 -3.031  -0.742  1.00 15.04 ? 749  HOH B O   1 
HETATM 9520 O  O   . HOH T 7 .   ? 37.490 3.707   3.939   1.00 10.08 ? 750  HOH B O   1 
HETATM 9521 O  O   . HOH T 7 .   ? 27.049 -10.851 22.353  1.00 23.31 ? 751  HOH B O   1 
HETATM 9522 O  O   . HOH T 7 .   ? 21.865 -22.811 11.133  1.00 15.54 ? 752  HOH B O   1 
HETATM 9523 O  O   . HOH T 7 .   ? 43.399 -7.946  17.768  1.00 24.88 ? 753  HOH B O   1 
HETATM 9524 O  O   . HOH T 7 .   ? 42.523 7.162   16.162  1.00 37.74 ? 754  HOH B O   1 
HETATM 9525 O  O   . HOH T 7 .   ? 18.775 16.178  -5.730  1.00 30.35 ? 755  HOH B O   1 
HETATM 9526 O  O   . HOH T 7 .   ? 40.729 -5.277  12.631  1.00 23.38 ? 756  HOH B O   1 
HETATM 9527 O  O   . HOH T 7 .   ? 19.345 20.106  16.048  1.00 15.76 ? 757  HOH B O   1 
HETATM 9528 O  O   . HOH T 7 .   ? 17.757 -15.775 -3.777  1.00 27.68 ? 758  HOH B O   1 
HETATM 9529 O  O   . HOH T 7 .   ? 24.190 12.221  -1.241  1.00 28.92 ? 759  HOH B O   1 
HETATM 9530 O  O   . HOH T 7 .   ? 22.481 15.518  -4.957  1.00 37.17 ? 760  HOH B O   1 
HETATM 9531 O  O   . HOH T 7 .   ? 57.813 -3.461  17.460  1.00 33.88 ? 761  HOH B O   1 
HETATM 9532 O  O   . HOH T 7 .   ? 1.722  4.596   4.622   1.00 23.50 ? 762  HOH B O   1 
HETATM 9533 O  O   . HOH T 7 .   ? 34.212 -18.170 3.237   1.00 15.82 ? 763  HOH B O   1 
HETATM 9534 O  O   . HOH T 7 .   ? 36.961 -30.650 13.525  1.00 25.23 ? 764  HOH B O   1 
HETATM 9535 O  O   . HOH T 7 .   ? 37.568 8.799   -4.881  1.00 19.53 ? 765  HOH B O   1 
HETATM 9536 O  O   . HOH T 7 .   ? 54.251 -2.754  18.092  1.00 34.46 ? 766  HOH B O   1 
HETATM 9537 O  O   . HOH T 7 .   ? 23.011 -22.423 19.220  1.00 32.95 ? 767  HOH B O   1 
HETATM 9538 O  O   . HOH T 7 .   ? 15.238 12.043  21.370  1.00 16.57 ? 768  HOH B O   1 
HETATM 9539 O  O   . HOH T 7 .   ? 32.779 -21.458 21.286  1.00 23.70 ? 769  HOH B O   1 
HETATM 9540 O  O   . HOH T 7 .   ? 34.590 1.399   -1.164  1.00 14.83 ? 770  HOH B O   1 
HETATM 9541 O  O   . HOH T 7 .   ? 38.163 -5.315  -10.615 1.00 26.57 ? 771  HOH B O   1 
HETATM 9542 O  O   . HOH T 7 .   ? 37.538 -2.504  16.260  1.00 26.65 ? 772  HOH B O   1 
HETATM 9543 O  O   . HOH T 7 .   ? 13.888 21.279  15.964  1.00 37.40 ? 773  HOH B O   1 
HETATM 9544 O  O   . HOH T 7 .   ? 18.354 31.504  1.899   1.00 13.16 ? 774  HOH B O   1 
HETATM 9545 O  O   . HOH T 7 .   ? 49.358 -24.815 3.535   1.00 30.31 ? 775  HOH B O   1 
HETATM 9546 O  O   . HOH T 7 .   ? 37.366 -1.696  -5.480  1.00 21.06 ? 776  HOH B O   1 
HETATM 9547 O  O   . HOH T 7 .   ? 21.162 -10.177 -8.840  1.00 33.41 ? 777  HOH B O   1 
HETATM 9548 O  O   . HOH T 7 .   ? 21.932 -2.714  20.128  1.00 12.32 ? 778  HOH B O   1 
HETATM 9549 O  O   . HOH T 7 .   ? 24.042 -5.489  -12.166 1.00 22.66 ? 779  HOH B O   1 
HETATM 9550 O  O   . HOH T 7 .   ? 32.228 -20.664 -5.897  1.00 18.97 ? 780  HOH B O   1 
HETATM 9551 O  O   . HOH T 7 .   ? 29.195 -16.890 -0.150  1.00 20.73 ? 781  HOH B O   1 
HETATM 9552 O  O   . HOH T 7 .   ? 36.058 -2.612  4.404   1.00 16.97 ? 782  HOH B O   1 
HETATM 9553 O  O   . HOH T 7 .   ? 20.482 15.261  7.519   1.00 13.17 ? 783  HOH B O   1 
HETATM 9554 O  O   . HOH T 7 .   ? 13.156 -20.469 5.034   1.00 25.19 ? 784  HOH B O   1 
HETATM 9555 O  O   . HOH T 7 .   ? 61.457 6.223   -2.328  1.00 30.33 ? 785  HOH B O   1 
HETATM 9556 O  O   . HOH T 7 .   ? 41.435 0.508   -3.663  1.00 21.58 ? 786  HOH B O   1 
HETATM 9557 O  O   . HOH T 7 .   ? 42.239 -25.947 13.613  1.00 24.82 ? 787  HOH B O   1 
HETATM 9558 O  O   . HOH T 7 .   ? 16.615 4.318   -1.535  1.00 15.59 ? 788  HOH B O   1 
HETATM 9559 O  O   . HOH T 7 .   ? 43.403 -15.245 3.660   1.00 20.51 ? 789  HOH B O   1 
HETATM 9560 O  O   . HOH T 7 .   ? 37.484 7.617   18.279  1.00 14.51 ? 790  HOH B O   1 
HETATM 9561 O  O   . HOH T 7 .   ? 30.907 -11.036 -13.774 1.00 27.07 ? 791  HOH B O   1 
HETATM 9562 O  O   . HOH T 7 .   ? 33.265 -4.274  -15.883 1.00 37.21 ? 792  HOH B O   1 
HETATM 9563 O  O   . HOH T 7 .   ? 5.589  2.436   5.553   1.00 10.96 ? 793  HOH B O   1 
HETATM 9564 O  O   . HOH T 7 .   ? 31.503 -32.536 6.073   1.00 37.27 ? 794  HOH B O   1 
HETATM 9565 O  O   . HOH T 7 .   ? 40.851 3.903   4.005   1.00 15.43 ? 795  HOH B O   1 
HETATM 9566 O  O   . HOH T 7 .   ? 37.210 11.145  15.816  1.00 16.55 ? 796  HOH B O   1 
HETATM 9567 O  O   . HOH T 7 .   ? 39.213 -1.104  14.662  1.00 21.13 ? 797  HOH B O   1 
HETATM 9568 O  O   . HOH T 7 .   ? 8.018  -0.912  13.540  1.00 19.96 ? 798  HOH B O   1 
HETATM 9569 O  O   . HOH T 7 .   ? 33.084 4.333   25.642  1.00 19.31 ? 799  HOH B O   1 
HETATM 9570 O  O   . HOH T 7 .   ? 34.487 -13.268 15.139  1.00 15.12 ? 800  HOH B O   1 
HETATM 9571 O  O   . HOH T 7 .   ? 26.843 -7.236  -14.947 1.00 27.40 ? 801  HOH B O   1 
HETATM 9572 O  O   . HOH T 7 .   ? 34.740 -9.908  20.515  1.00 33.45 ? 802  HOH B O   1 
HETATM 9573 O  O   . HOH T 7 .   ? 30.042 -22.220 9.831   1.00 33.30 ? 803  HOH B O   1 
HETATM 9574 O  O   . HOH T 7 .   ? 0.682  -8.019  -6.688  1.00 37.93 ? 804  HOH B O   1 
HETATM 9575 O  O   . HOH T 7 .   ? 28.283 9.747   -12.076 1.00 38.33 ? 805  HOH B O   1 
HETATM 9576 O  O   . HOH T 7 .   ? 5.177  6.994   -10.735 1.00 36.63 ? 806  HOH B O   1 
HETATM 9577 O  O   . HOH T 7 .   ? 52.093 -5.532  15.584  1.00 25.67 ? 807  HOH B O   1 
HETATM 9578 O  O   . HOH T 7 .   ? 56.261 4.452   6.291   1.00 20.17 ? 808  HOH B O   1 
HETATM 9579 O  O   . HOH T 7 .   ? 16.639 17.542  -3.633  1.00 33.34 ? 809  HOH B O   1 
HETATM 9580 O  O   . HOH T 7 .   ? 48.398 -19.225 20.366  1.00 36.21 ? 810  HOH B O   1 
HETATM 9581 O  O   . HOH T 7 .   ? 33.736 -5.903  7.712   1.00 11.75 ? 811  HOH B O   1 
HETATM 9582 O  O   . HOH T 7 .   ? 24.571 2.981   -10.615 1.00 12.13 ? 812  HOH B O   1 
HETATM 9583 O  O   . HOH T 7 .   ? 26.166 -19.690 21.303  1.00 27.70 ? 813  HOH B O   1 
HETATM 9584 O  O   . HOH T 7 .   ? 17.564 8.734   22.791  1.00 24.83 ? 814  HOH B O   1 
HETATM 9585 O  O   . HOH T 7 .   ? 65.306 -2.581  4.013   1.00 32.89 ? 815  HOH B O   1 
HETATM 9586 O  O   . HOH T 7 .   ? 30.204 21.350  10.978  1.00 32.02 ? 816  HOH B O   1 
HETATM 9587 O  O   . HOH T 7 .   ? 50.294 10.265  4.862   1.00 30.73 ? 817  HOH B O   1 
HETATM 9588 O  O   . HOH T 7 .   ? 19.179 0.770   26.005  1.00 15.43 ? 818  HOH B O   1 
HETATM 9589 O  O   . HOH T 7 .   ? 33.077 -1.951  -4.960  1.00 14.34 ? 819  HOH B O   1 
HETATM 9590 O  O   . HOH T 7 .   ? 26.314 1.792   25.438  1.00 20.07 ? 820  HOH B O   1 
HETATM 9591 O  O   . HOH T 7 .   ? 7.094  -9.367  12.555  1.00 35.93 ? 821  HOH B O   1 
HETATM 9592 O  O   . HOH T 7 .   ? 25.572 7.773   8.422   1.00 14.05 ? 822  HOH B O   1 
HETATM 9593 O  O   . HOH T 7 .   ? 20.189 -9.617  -4.587  1.00 16.81 ? 823  HOH B O   1 
HETATM 9594 O  O   . HOH T 7 .   ? 43.050 -22.051 6.072   1.00 23.34 ? 824  HOH B O   1 
HETATM 9595 O  O   . HOH T 7 .   ? 36.640 -8.016  1.109   1.00 14.75 ? 825  HOH B O   1 
HETATM 9596 O  O   . HOH T 7 .   ? 37.763 12.210  2.120   1.00 24.13 ? 826  HOH B O   1 
HETATM 9597 O  O   . HOH T 7 .   ? 0.034  -15.609 -4.270  1.00 38.85 ? 827  HOH B O   1 
HETATM 9598 O  O   . HOH T 7 .   ? 26.709 -20.363 0.966   1.00 21.33 ? 828  HOH B O   1 
HETATM 9599 O  O   . HOH T 7 .   ? 36.977 -16.287 -10.321 1.00 24.22 ? 829  HOH B O   1 
HETATM 9600 O  O   . HOH T 7 .   ? 10.192 -0.749  15.249  1.00 17.55 ? 830  HOH B O   1 
HETATM 9601 O  O   . HOH T 7 .   ? 43.227 -1.405  -2.180  1.00 28.43 ? 831  HOH B O   1 
HETATM 9602 O  O   . HOH T 7 .   ? 28.597 7.998   -8.691  1.00 19.36 ? 832  HOH B O   1 
HETATM 9603 O  O   . HOH T 7 .   ? 13.282 25.278  3.624   1.00 36.04 ? 833  HOH B O   1 
HETATM 9604 O  O   . HOH T 7 .   ? 37.323 -11.943 -11.824 1.00 22.71 ? 834  HOH B O   1 
HETATM 9605 O  O   . HOH T 7 .   ? 3.494  12.434  4.562   1.00 33.72 ? 835  HOH B O   1 
HETATM 9606 O  O   . HOH T 7 .   ? 30.430 -15.450 -2.462  1.00 15.25 ? 836  HOH B O   1 
HETATM 9607 O  O   . HOH T 7 .   ? 27.768 22.195  16.363  1.00 31.25 ? 837  HOH B O   1 
HETATM 9608 O  O   . HOH T 7 .   ? 12.805 -0.668  23.616  1.00 32.23 ? 838  HOH B O   1 
HETATM 9609 O  O   . HOH T 7 .   ? 37.015 -0.625  28.581  1.00 32.94 ? 839  HOH B O   1 
HETATM 9610 O  O   . HOH T 7 .   ? 40.877 -13.569 -1.562  1.00 18.39 ? 840  HOH B O   1 
HETATM 9611 O  O   . HOH T 7 .   ? 60.619 5.746   8.926   1.00 33.76 ? 841  HOH B O   1 
HETATM 9612 O  O   . HOH T 7 .   ? 41.421 -29.365 12.811  1.00 34.54 ? 842  HOH B O   1 
HETATM 9613 O  O   . HOH T 7 .   ? 6.901  12.916  -3.788  1.00 21.73 ? 843  HOH B O   1 
HETATM 9614 O  O   . HOH T 7 .   ? 35.182 -34.182 11.502  1.00 20.48 ? 844  HOH B O   1 
HETATM 9615 O  O   . HOH T 7 .   ? 47.044 6.739   -2.425  1.00 16.75 ? 845  HOH B O   1 
HETATM 9616 O  O   . HOH T 7 .   ? 43.752 -27.336 15.490  1.00 31.63 ? 846  HOH B O   1 
HETATM 9617 O  O   . HOH T 7 .   ? 22.503 22.247  6.071   1.00 15.88 ? 847  HOH B O   1 
HETATM 9618 O  O   . HOH T 7 .   ? 61.150 -6.766  17.096  1.00 37.70 ? 848  HOH B O   1 
HETATM 9619 O  O   . HOH T 7 .   ? 1.806  6.146   -3.004  1.00 16.81 ? 849  HOH B O   1 
HETATM 9620 O  O   . HOH T 7 .   ? 63.840 -9.437  2.655   1.00 36.12 ? 850  HOH B O   1 
HETATM 9621 O  O   . HOH T 7 .   ? 24.306 5.620   7.221   1.00 12.71 ? 851  HOH B O   1 
HETATM 9622 O  O   . HOH T 7 .   ? 8.459  -14.080 -1.714  1.00 17.51 ? 852  HOH B O   1 
HETATM 9623 O  O   . HOH T 7 .   ? 34.840 15.426  23.681  1.00 29.25 ? 853  HOH B O   1 
HETATM 9624 O  O   . HOH T 7 .   ? 2.023  -0.954  3.343   1.00 20.84 ? 854  HOH B O   1 
HETATM 9625 O  O   . HOH T 7 .   ? 3.364  -2.458  -0.471  1.00 16.68 ? 855  HOH B O   1 
HETATM 9626 O  O   . HOH T 7 .   ? 33.678 -23.746 -5.435  1.00 29.54 ? 856  HOH B O   1 
HETATM 9627 O  O   . HOH T 7 .   ? 32.698 16.475  10.799  1.00 23.77 ? 857  HOH B O   1 
HETATM 9628 O  O   . HOH T 7 .   ? 17.024 -3.648  -11.469 1.00 26.56 ? 858  HOH B O   1 
HETATM 9629 O  O   . HOH T 7 .   ? 18.798 8.070   -10.465 1.00 25.16 ? 859  HOH B O   1 
HETATM 9630 O  O   . HOH T 7 .   ? 16.637 27.961  5.636   1.00 26.91 ? 860  HOH B O   1 
HETATM 9631 O  O   . HOH T 7 .   ? 9.865  -10.273 14.480  1.00 30.66 ? 861  HOH B O   1 
HETATM 9632 O  O   . HOH T 7 .   ? 14.004 2.308   -12.547 1.00 29.28 ? 862  HOH B O   1 
HETATM 9633 O  O   . HOH T 7 .   ? 22.338 -5.664  28.170  1.00 31.25 ? 863  HOH B O   1 
HETATM 9634 O  O   . HOH T 7 .   ? 50.242 1.023   0.240   1.00 18.16 ? 864  HOH B O   1 
HETATM 9635 O  O   . HOH T 7 .   ? 13.498 -1.912  20.499  1.00 16.49 ? 865  HOH B O   1 
HETATM 9636 O  O   . HOH T 7 .   ? 20.682 -3.344  -12.030 1.00 17.79 ? 866  HOH B O   1 
HETATM 9637 O  O   . HOH T 7 .   ? 32.135 1.988   -12.877 1.00 20.01 ? 867  HOH B O   1 
HETATM 9638 O  O   . HOH T 7 .   ? 41.844 -28.897 21.020  1.00 31.58 ? 868  HOH B O   1 
HETATM 9639 O  O   . HOH T 7 .   ? 34.328 -18.269 24.186  1.00 29.58 ? 869  HOH B O   1 
HETATM 9640 O  O   . HOH T 7 .   ? 11.511 17.089  -4.289  1.00 24.77 ? 870  HOH B O   1 
HETATM 9641 O  O   . HOH T 7 .   ? 16.381 22.339  -1.468  1.00 36.19 ? 871  HOH B O   1 
HETATM 9642 O  O   . HOH T 7 .   ? 19.633 -21.187 17.658  1.00 20.79 ? 872  HOH B O   1 
HETATM 9643 O  O   . HOH T 7 .   ? 15.193 2.393   -0.264  1.00 13.24 ? 873  HOH B O   1 
HETATM 9644 O  O   . HOH T 7 .   ? -3.626 -8.419  -3.225  1.00 14.78 ? 874  HOH B O   1 
HETATM 9645 O  O   . HOH T 7 .   ? 10.701 -5.124  18.878  1.00 40.29 ? 875  HOH B O   1 
HETATM 9646 O  O   . HOH T 7 .   ? 30.550 -17.909 -3.885  1.00 16.70 ? 876  HOH B O   1 
HETATM 9647 O  O   . HOH T 7 .   ? 28.986 -19.615 7.840   1.00 21.08 ? 877  HOH B O   1 
HETATM 9648 O  O   . HOH T 7 .   ? 43.927 -26.019 7.517   1.00 26.69 ? 878  HOH B O   1 
HETATM 9649 O  O   . HOH T 7 .   ? 25.279 6.908   -11.533 1.00 17.57 ? 879  HOH B O   1 
HETATM 9650 O  O   . HOH T 7 .   ? 29.696 -12.020 -11.422 1.00 23.86 ? 880  HOH B O   1 
HETATM 9651 O  O   . HOH T 7 .   ? 42.121 -21.378 -1.063  1.00 24.19 ? 881  HOH B O   1 
HETATM 9652 O  O   . HOH T 7 .   ? 13.500 -13.885 -5.734  1.00 42.15 ? 882  HOH B O   1 
HETATM 9653 O  O   . HOH T 7 .   ? 20.941 22.148  22.726  1.00 24.40 ? 883  HOH B O   1 
HETATM 9654 O  O   . HOH T 7 .   ? 13.576 -24.040 11.696  1.00 34.94 ? 884  HOH B O   1 
HETATM 9655 O  O   . HOH T 7 .   ? 33.138 -23.359 19.415  1.00 21.25 ? 885  HOH B O   1 
HETATM 9656 O  O   . HOH T 7 .   ? 0.624  -1.270  -2.249  1.00 15.33 ? 886  HOH B O   1 
HETATM 9657 O  O   . HOH T 7 .   ? 27.822 -5.608  14.775  1.00 9.98  ? 887  HOH B O   1 
HETATM 9658 O  O   . HOH T 7 .   ? 26.125 -17.751 -1.466  1.00 28.63 ? 888  HOH B O   1 
HETATM 9659 O  O   . HOH T 7 .   ? 63.597 -2.197  -2.090  1.00 34.87 ? 889  HOH B O   1 
HETATM 9660 O  O   . HOH T 7 .   ? 55.775 -10.836 16.222  1.00 26.02 ? 890  HOH B O   1 
HETATM 9661 O  O   . HOH T 7 .   ? 24.617 -22.241 12.233  1.00 25.64 ? 891  HOH B O   1 
HETATM 9662 O  O   . HOH T 7 .   ? 31.543 4.394   -11.661 1.00 17.39 ? 892  HOH B O   1 
HETATM 9663 O  O   . HOH T 7 .   ? 23.051 -11.644 1.067   1.00 12.04 ? 893  HOH B O   1 
HETATM 9664 O  O   . HOH T 7 .   ? 32.545 0.373   -3.063  1.00 14.88 ? 894  HOH B O   1 
HETATM 9665 O  O   . HOH T 7 .   ? 25.903 -0.189  21.095  1.00 14.95 ? 895  HOH B O   1 
HETATM 9666 O  O   . HOH T 7 .   ? 7.128  2.242   11.878  1.00 27.21 ? 896  HOH B O   1 
HETATM 9667 O  O   . HOH T 7 .   ? 17.282 -9.321  23.008  1.00 33.23 ? 897  HOH B O   1 
HETATM 9668 O  O   . HOH T 7 .   ? 38.704 -14.566 7.244   1.00 12.49 ? 898  HOH B O   1 
HETATM 9669 O  O   . HOH T 7 .   ? 33.024 -7.838  9.492   1.00 16.49 ? 899  HOH B O   1 
HETATM 9670 O  O   . HOH T 7 .   ? 11.579 8.054   -0.261  1.00 14.51 ? 900  HOH B O   1 
HETATM 9671 O  O   . HOH T 7 .   ? 10.682 5.058   21.549  1.00 28.96 ? 901  HOH B O   1 
HETATM 9672 O  O   . HOH T 7 .   ? 16.422 -6.400  -11.641 1.00 26.54 ? 902  HOH B O   1 
HETATM 9673 O  O   . HOH T 7 .   ? 13.986 -9.361  -10.913 1.00 33.87 ? 903  HOH B O   1 
HETATM 9674 O  O   . HOH T 7 .   ? 40.844 -18.424 -7.129  1.00 23.66 ? 904  HOH B O   1 
HETATM 9675 O  O   . HOH T 7 .   ? 16.953 -8.543  18.232  1.00 26.53 ? 905  HOH B O   1 
HETATM 9676 O  O   . HOH T 7 .   ? 28.870 21.276  18.733  1.00 32.71 ? 906  HOH B O   1 
HETATM 9677 O  O   . HOH T 7 .   ? 5.410  10.212  7.218   1.00 15.77 ? 907  HOH B O   1 
HETATM 9678 O  O   . HOH T 7 .   ? 27.782 -7.844  13.146  1.00 13.22 ? 908  HOH B O   1 
HETATM 9679 O  O   . HOH T 7 .   ? 38.516 5.776   -10.005 1.00 38.34 ? 909  HOH B O   1 
HETATM 9680 O  O   . HOH T 7 .   ? 49.600 2.678   2.167   1.00 20.51 ? 910  HOH B O   1 
HETATM 9681 O  O   . HOH T 7 .   ? 24.056 -5.270  29.945  1.00 40.81 ? 911  HOH B O   1 
HETATM 9682 O  O   . HOH T 7 .   ? 36.000 16.849  13.929  1.00 24.55 ? 912  HOH B O   1 
HETATM 9683 O  O   . HOH T 7 .   ? 30.478 -11.596 21.274  1.00 27.41 ? 913  HOH B O   1 
HETATM 9684 O  O   . HOH T 7 .   ? 32.875 -14.970 -9.782  1.00 26.01 ? 914  HOH B O   1 
HETATM 9685 O  O   . HOH T 7 .   ? 42.933 7.520   3.317   1.00 17.57 ? 915  HOH B O   1 
HETATM 9686 O  O   . HOH T 7 .   ? 67.416 -0.060  -0.012  1.00 33.49 ? 916  HOH B O   1 
HETATM 9687 O  O   . HOH T 7 .   ? 63.523 -1.572  -5.883  1.00 39.00 ? 917  HOH B O   1 
HETATM 9688 O  O   . HOH T 7 .   ? 44.544 -1.361  14.414  1.00 24.96 ? 918  HOH B O   1 
HETATM 9689 O  O   . HOH T 7 .   ? 49.684 2.663   12.414  1.00 21.22 ? 919  HOH B O   1 
HETATM 9690 O  O   . HOH T 7 .   ? 1.108  4.290   -8.095  1.00 32.02 ? 920  HOH B O   1 
HETATM 9691 O  O   . HOH T 7 .   ? 15.916 -20.758 13.996  1.00 30.18 ? 921  HOH B O   1 
HETATM 9692 O  O   . HOH T 7 .   ? 49.683 -21.032 3.000   1.00 34.66 ? 922  HOH B O   1 
HETATM 9693 O  O   . HOH T 7 .   ? 39.507 6.347   5.032   1.00 14.43 ? 923  HOH B O   1 
HETATM 9694 O  O   . HOH T 7 .   ? 47.462 8.873   8.844   1.00 30.42 ? 924  HOH B O   1 
HETATM 9695 O  O   . HOH T 7 .   ? 19.531 18.959  -0.060  1.00 24.37 ? 925  HOH B O   1 
HETATM 9696 O  O   . HOH T 7 .   ? 11.016 19.830  16.550  1.00 35.91 ? 926  HOH B O   1 
HETATM 9697 O  O   . HOH T 7 .   ? 27.301 -15.560 -10.392 1.00 24.49 ? 927  HOH B O   1 
HETATM 9698 O  O   . HOH T 7 .   ? 48.239 -21.608 18.361  1.00 32.29 ? 928  HOH B O   1 
HETATM 9699 O  O   . HOH T 7 .   ? 14.136 3.877   24.849  1.00 24.43 ? 929  HOH B O   1 
HETATM 9700 O  O   . HOH T 7 .   ? 39.242 12.810  20.757  1.00 25.65 ? 930  HOH B O   1 
HETATM 9701 O  O   . HOH T 7 .   ? 25.993 26.893  3.241   1.00 21.00 ? 931  HOH B O   1 
HETATM 9702 O  O   . HOH T 7 .   ? 18.186 -9.893  -7.875  1.00 31.71 ? 932  HOH B O   1 
HETATM 9703 O  O   . HOH T 7 .   ? 42.129 5.720   5.780   1.00 20.35 ? 933  HOH B O   1 
HETATM 9704 O  O   . HOH T 7 .   ? 20.594 21.718  18.215  1.00 15.97 ? 934  HOH B O   1 
HETATM 9705 O  O   . HOH T 7 .   ? 36.615 -27.954 7.700   1.00 36.51 ? 935  HOH B O   1 
HETATM 9706 O  O   . HOH T 7 .   ? 39.824 -12.016 -3.777  1.00 26.33 ? 936  HOH B O   1 
HETATM 9707 O  O   . HOH T 7 .   ? 38.893 0.558   24.524  1.00 29.81 ? 937  HOH B O   1 
HETATM 9708 O  O   . HOH T 7 .   ? 24.929 12.741  -8.823  1.00 32.72 ? 938  HOH B O   1 
HETATM 9709 O  O   . HOH T 7 .   ? 18.718 -18.284 15.696  1.00 21.46 ? 939  HOH B O   1 
HETATM 9710 O  O   . HOH T 7 .   ? 27.816 26.567  8.649   1.00 36.71 ? 940  HOH B O   1 
HETATM 9711 O  O   . HOH T 7 .   ? 32.418 -20.161 13.304  1.00 14.55 ? 941  HOH B O   1 
HETATM 9712 O  O   . HOH T 7 .   ? 50.008 -17.935 -2.664  1.00 36.11 ? 942  HOH B O   1 
HETATM 9713 O  O   . HOH T 7 .   ? 16.639 -18.863 17.311  1.00 40.24 ? 943  HOH B O   1 
HETATM 9714 O  O   . HOH T 7 .   ? 61.797 -13.224 2.277   1.00 31.49 ? 944  HOH B O   1 
HETATM 9715 O  O   . HOH T 7 .   ? 52.898 3.695   -4.658  1.00 30.60 ? 945  HOH B O   1 
HETATM 9716 O  O   . HOH T 7 .   ? 44.071 -2.664  -0.024  1.00 32.61 ? 946  HOH B O   1 
HETATM 9717 O  O   . HOH T 7 .   ? 15.002 -4.111  -14.291 1.00 34.50 ? 947  HOH B O   1 
HETATM 9718 O  O   . HOH T 7 .   ? 4.976  -15.690 5.557   1.00 35.39 ? 948  HOH B O   1 
HETATM 9719 O  O   . HOH T 7 .   ? 7.588  10.083  16.245  1.00 34.08 ? 949  HOH B O   1 
HETATM 9720 O  O   . HOH T 7 .   ? 25.095 7.511   24.618  1.00 32.47 ? 950  HOH B O   1 
HETATM 9721 O  O   . HOH T 7 .   ? 42.367 2.434   15.778  1.00 31.78 ? 951  HOH B O   1 
HETATM 9722 O  O   . HOH T 7 .   ? 31.537 20.761  18.778  1.00 30.06 ? 952  HOH B O   1 
HETATM 9723 O  O   . HOH T 7 .   ? 30.546 17.755  19.024  1.00 17.81 ? 953  HOH B O   1 
HETATM 9724 O  O   . HOH T 7 .   ? 12.151 -22.988 4.855   1.00 30.07 ? 954  HOH B O   1 
HETATM 9725 O  O   . HOH T 7 .   ? 22.034 11.505  11.615  1.00 14.91 ? 955  HOH B O   1 
HETATM 9726 O  O   . HOH T 7 .   ? 37.006 12.740  23.681  1.00 21.20 ? 956  HOH B O   1 
HETATM 9727 O  O   . HOH T 7 .   ? 18.797 -2.033  -13.481 1.00 24.09 ? 957  HOH B O   1 
HETATM 9728 O  O   . HOH T 7 .   ? 27.621 -13.981 18.822  1.00 27.45 ? 958  HOH B O   1 
HETATM 9729 O  O   . HOH T 7 .   ? 30.531 -14.590 21.597  1.00 23.35 ? 959  HOH B O   1 
HETATM 9730 O  O   . HOH T 7 .   ? 30.635 -30.861 9.844   1.00 33.29 ? 960  HOH B O   1 
HETATM 9731 O  O   . HOH T 7 .   ? 8.520  15.041  -0.055  1.00 31.96 ? 961  HOH B O   1 
HETATM 9732 O  O   . HOH T 7 .   ? 59.094 -0.791  13.658  1.00 20.78 ? 962  HOH B O   1 
HETATM 9733 O  O   . HOH T 7 .   ? 26.821 24.856  19.507  1.00 35.37 ? 963  HOH B O   1 
HETATM 9734 O  O   . HOH T 7 .   ? 43.109 -16.954 -3.119  1.00 29.52 ? 964  HOH B O   1 
HETATM 9735 O  O   . HOH T 7 .   ? 56.137 11.059  7.270   1.00 32.63 ? 965  HOH B O   1 
HETATM 9736 O  O   . HOH T 7 .   ? 56.304 -23.208 8.560   1.00 40.22 ? 966  HOH B O   1 
HETATM 9737 O  O   . HOH T 7 .   ? 45.534 -17.003 22.585  1.00 29.60 ? 967  HOH B O   1 
HETATM 9738 O  O   . HOH T 7 .   ? 31.253 -4.826  27.942  1.00 37.73 ? 968  HOH B O   1 
HETATM 9739 O  O   . HOH T 7 .   ? 0.000  -5.683  0.000   0.50 18.82 ? 969  HOH B O   1 
HETATM 9740 O  O   . HOH T 7 .   ? 17.598 14.464  -8.019  1.00 25.90 ? 970  HOH B O   1 
HETATM 9741 O  O   . HOH T 7 .   ? 15.982 1.361   26.711  1.00 37.83 ? 971  HOH B O   1 
HETATM 9742 O  O   . HOH T 7 .   ? 23.583 -9.094  -9.948  1.00 19.80 ? 972  HOH B O   1 
HETATM 9743 O  O   . HOH T 7 .   ? 41.554 -11.570 -5.131  1.00 33.30 ? 973  HOH B O   1 
HETATM 9744 O  O   . HOH T 7 .   ? 49.675 -25.900 5.868   1.00 29.84 ? 974  HOH B O   1 
HETATM 9745 O  O   . HOH T 7 .   ? 42.280 -3.391  16.659  1.00 28.53 ? 975  HOH B O   1 
HETATM 9746 O  O   . HOH T 7 .   ? 23.063 9.590   -13.414 1.00 36.30 ? 976  HOH B O   1 
HETATM 9747 O  O   . HOH T 7 .   ? 11.012 19.019  13.248  1.00 28.81 ? 977  HOH B O   1 
HETATM 9748 O  O   . HOH T 7 .   ? 56.685 -22.754 11.833  1.00 33.21 ? 978  HOH B O   1 
HETATM 9749 O  O   . HOH T 7 .   ? 25.151 23.473  16.122  1.00 27.78 ? 979  HOH B O   1 
HETATM 9750 O  O   . HOH T 7 .   ? 2.024  -5.420  -6.995  1.00 28.84 ? 980  HOH B O   1 
HETATM 9751 O  O   . HOH T 7 .   ? 49.402 -3.246  -5.061  1.00 23.71 ? 981  HOH B O   1 
HETATM 9752 O  O   . HOH T 7 .   ? 28.344 -4.656  -17.475 1.00 39.34 ? 982  HOH B O   1 
HETATM 9753 O  O   . HOH T 7 .   ? 4.908  2.464   -7.381  1.00 33.19 ? 983  HOH B O   1 
HETATM 9754 O  O   . HOH T 7 .   ? 17.030 6.176   -9.903  1.00 29.10 ? 984  HOH B O   1 
HETATM 9755 O  O   . HOH T 7 .   ? 26.417 -16.088 -8.092  1.00 19.19 ? 985  HOH B O   1 
HETATM 9756 O  O   . HOH T 7 .   ? 12.241 -14.837 1.453   1.00 25.48 ? 986  HOH B O   1 
HETATM 9757 O  O   . HOH T 7 .   ? 44.317 -8.720  20.255  1.00 40.21 ? 987  HOH B O   1 
HETATM 9758 O  O   . HOH T 7 .   ? 39.731 9.233   27.822  1.00 42.58 ? 988  HOH B O   1 
HETATM 9759 O  O   . HOH T 7 .   ? 38.787 -17.459 23.411  1.00 30.40 ? 989  HOH B O   1 
HETATM 9760 O  O   . HOH T 7 .   ? 38.303 -5.410  15.470  1.00 19.39 ? 990  HOH B O   1 
HETATM 9761 O  O   . HOH T 7 .   ? 42.630 6.857   22.518  1.00 29.04 ? 991  HOH B O   1 
HETATM 9762 O  O   . HOH T 7 .   ? 34.181 -3.444  -12.935 1.00 23.09 ? 992  HOH B O   1 
HETATM 9763 O  O   . HOH T 7 .   ? 8.179  5.638   16.847  1.00 25.12 ? 993  HOH B O   1 
HETATM 9764 O  O   . HOH T 7 .   ? 3.130  9.333   5.684   1.00 19.99 ? 994  HOH B O   1 
HETATM 9765 O  O   . HOH T 7 .   ? 42.392 -1.329  12.622  1.00 29.77 ? 995  HOH B O   1 
HETATM 9766 O  O   . HOH T 7 .   ? 10.701 -16.602 3.268   1.00 36.70 ? 996  HOH B O   1 
HETATM 9767 O  O   . HOH T 7 .   ? 12.957 -1.065  -11.975 1.00 36.68 ? 997  HOH B O   1 
HETATM 9768 O  O   . HOH T 7 .   ? 27.563 0.186   23.285  1.00 23.04 ? 998  HOH B O   1 
HETATM 9769 O  O   . HOH T 7 .   ? 13.026 -8.291  -7.610  1.00 40.89 ? 999  HOH B O   1 
HETATM 9770 O  O   . HOH T 7 .   ? 3.093  0.628   5.596   1.00 29.35 ? 1000 HOH B O   1 
HETATM 9771 O  O   . HOH T 7 .   ? 11.642 -13.690 15.110  1.00 29.55 ? 1001 HOH B O   1 
HETATM 9772 O  O   . HOH T 7 .   ? 34.066 3.388   -14.970 1.00 38.54 ? 1002 HOH B O   1 
HETATM 9773 O  O   . HOH T 7 .   ? 24.361 2.403   -20.815 1.00 41.11 ? 1003 HOH B O   1 
HETATM 9774 O  O   . HOH T 7 .   ? 13.706 6.110   -0.164  1.00 15.18 ? 1004 HOH B O   1 
HETATM 9775 O  O   . HOH T 7 .   ? 44.123 5.001   14.882  1.00 34.10 ? 1005 HOH B O   1 
HETATM 9776 O  O   . HOH T 7 .   ? 38.155 -30.910 11.534  1.00 37.67 ? 1006 HOH B O   1 
HETATM 9777 O  O   . HOH T 7 .   ? 12.690 13.765  -7.538  1.00 39.99 ? 1007 HOH B O   1 
HETATM 9778 O  O   . HOH T 7 .   ? 16.616 -5.135  22.114  1.00 27.87 ? 1008 HOH B O   1 
HETATM 9779 O  O   . HOH T 7 .   ? 38.095 15.069  14.543  1.00 28.09 ? 1009 HOH B O   1 
HETATM 9780 O  O   . HOH T 7 .   ? 29.571 11.171  -5.812  1.00 41.69 ? 1010 HOH B O   1 
HETATM 9781 O  O   . HOH T 7 .   ? 19.604 -17.747 -3.099  1.00 29.08 ? 1011 HOH B O   1 
HETATM 9782 O  O   . HOH T 7 .   ? 33.474 -1.995  26.937  1.00 29.84 ? 1012 HOH B O   1 
HETATM 9783 O  O   . HOH T 7 .   ? 33.883 -21.125 23.719  1.00 30.48 ? 1013 HOH B O   1 
HETATM 9784 O  O   . HOH T 7 .   ? 17.789 25.198  -0.604  1.00 32.13 ? 1014 HOH B O   1 
HETATM 9785 O  O   . HOH T 7 .   ? 14.026 -15.193 -2.597  1.00 26.41 ? 1015 HOH B O   1 
HETATM 9786 O  O   . HOH T 7 .   ? 37.669 -28.091 10.383  1.00 40.76 ? 1016 HOH B O   1 
HETATM 9787 O  O   . HOH T 7 .   ? 28.850 25.322  1.425   1.00 41.50 ? 1017 HOH B O   1 
HETATM 9788 O  O   . HOH T 7 .   ? 24.478 -6.613  -14.613 1.00 31.20 ? 1018 HOH B O   1 
HETATM 9789 O  O   . HOH T 7 .   ? 51.171 4.505   11.923  1.00 34.56 ? 1019 HOH B O   1 
HETATM 9790 O  O   . HOH T 7 .   ? 45.921 0.217   16.183  1.00 33.72 ? 1020 HOH B O   1 
HETATM 9791 O  O   . HOH T 7 .   ? 14.209 -4.353  21.600  1.00 39.88 ? 1021 HOH B O   1 
HETATM 9792 O  O   . HOH T 7 .   ? 70.622 -1.056  -1.156  1.00 38.21 ? 1022 HOH B O   1 
HETATM 9793 O  O   . HOH T 7 .   ? 28.745 -2.621  -18.468 1.00 39.70 ? 1023 HOH B O   1 
HETATM 9794 O  O   . HOH T 7 .   ? 39.780 -6.384  17.452  1.00 31.94 ? 1024 HOH B O   1 
HETATM 9795 O  O   . HOH T 7 .   ? 43.007 -4.822  -0.962  1.00 28.66 ? 1025 HOH B O   1 
HETATM 9796 O  O   . HOH T 7 .   ? 36.191 11.137  -1.653  1.00 33.43 ? 1026 HOH B O   1 
HETATM 9797 O  O   . HOH T 7 .   ? -0.000 -2.930  -0.000  0.50 23.01 ? 1027 HOH B O   1 
HETATM 9798 O  O   . HOH T 7 .   ? 42.726 -7.055  -5.922  1.00 40.84 ? 1028 HOH B O   1 
HETATM 9799 O  O   . HOH T 7 .   ? 17.607 20.949  18.707  1.00 18.47 ? 1029 HOH B O   1 
HETATM 9800 O  O   . HOH T 7 .   ? 24.422 -14.229 22.697  1.00 39.08 ? 1030 HOH B O   1 
HETATM 9801 O  O   . HOH T 7 .   ? 17.265 29.131  3.062   1.00 26.17 ? 1031 HOH B O   1 
HETATM 9802 O  O   . HOH T 7 .   ? 0.497  7.176   -4.874  1.00 31.20 ? 1032 HOH B O   1 
HETATM 9803 O  O   . HOH T 7 .   ? 61.037 8.121   -0.581  1.00 40.22 ? 1033 HOH B O   1 
HETATM 9804 O  O   . HOH T 7 .   ? 39.244 0.860   27.168  1.00 34.65 ? 1034 HOH B O   1 
HETATM 9805 O  O   . HOH T 7 .   ? 40.527 -3.564  14.350  1.00 32.51 ? 1035 HOH B O   1 
HETATM 9806 O  O   . HOH T 7 .   ? 15.001 28.647  1.854   1.00 29.54 ? 1036 HOH B O   1 
HETATM 9807 O  O   . HOH T 7 .   ? 61.682 -9.317  17.886  1.00 39.29 ? 1037 HOH B O   1 
HETATM 9808 O  O   . HOH T 7 .   ? 15.815 10.663  23.842  1.00 27.75 ? 1038 HOH B O   1 
HETATM 9809 O  O   . HOH T 7 .   ? 10.107 -10.964 -6.211  1.00 27.67 ? 1039 HOH B O   1 
HETATM 9810 O  O   . HOH T 7 .   ? 28.850 10.536  -8.247  1.00 30.23 ? 1040 HOH B O   1 
HETATM 9811 O  O   . HOH T 7 .   ? 30.007 -21.502 12.867  1.00 26.82 ? 1041 HOH B O   1 
HETATM 9812 O  O   . HOH T 7 .   ? 46.829 -27.517 6.133   1.00 40.18 ? 1042 HOH B O   1 
HETATM 9813 O  O   . HOH T 7 .   ? 37.129 -2.112  24.801  1.00 31.21 ? 1043 HOH B O   1 
HETATM 9814 O  O   . HOH T 7 .   ? 31.421 6.263   26.145  1.00 29.73 ? 1044 HOH B O   1 
HETATM 9815 O  O   . HOH T 7 .   ? 15.308 -23.556 13.907  1.00 41.22 ? 1045 HOH B O   1 
HETATM 9816 O  O   . HOH T 7 .   ? 26.919 -13.115 20.896  1.00 27.31 ? 1046 HOH B O   1 
HETATM 9817 O  O   . HOH T 7 .   ? 32.576 -10.657 22.286  1.00 40.49 ? 1047 HOH B O   1 
HETATM 9818 O  O   . HOH T 7 .   ? 7.962  -0.811  -10.485 1.00 39.24 ? 1048 HOH B O   1 
HETATM 9819 O  O   . HOH T 7 .   ? 6.067  -0.165  14.696  1.00 35.20 ? 1049 HOH B O   1 
HETATM 9820 O  O   . HOH T 7 .   ? 8.676  14.613  -2.260  1.00 36.17 ? 1050 HOH B O   1 
HETATM 9821 O  O   . HOH T 7 .   ? -7.201 -13.475 4.123   1.00 30.34 ? 1051 HOH B O   1 
HETATM 9822 O  O   . HOH T 7 .   ? 36.181 -24.367 26.663  1.00 23.48 ? 1052 HOH B O   1 
HETATM 9823 O  O   . HOH T 7 .   ? 13.446 9.529   24.495  1.00 26.52 ? 1053 HOH B O   1 
HETATM 9824 O  O   . HOH T 7 .   ? 40.533 -31.779 11.482  1.00 36.56 ? 1054 HOH B O   1 
HETATM 9825 O  O   . HOH T 7 .   ? 16.762 31.268  -0.475  1.00 27.05 ? 1055 HOH B O   1 
HETATM 9826 O  O   . HOH T 7 .   ? 43.115 -5.258  -3.346  1.00 29.64 ? 1056 HOH B O   1 
HETATM 9827 O  O   . HOH T 7 .   ? 43.721 -0.619  -4.224  1.00 30.71 ? 1057 HOH B O   1 
HETATM 9828 O  O   . HOH T 7 .   ? 39.644 15.135  18.862  1.00 35.69 ? 1058 HOH B O   1 
HETATM 9829 O  O   . HOH T 7 .   ? 2.750  6.940   8.274   1.00 35.18 ? 1059 HOH B O   1 
HETATM 9830 O  O   . HOH T 7 .   ? 43.948 -15.435 -5.240  1.00 36.73 ? 1060 HOH B O   1 
HETATM 9831 O  O   . HOH T 7 .   ? 14.952 -26.095 12.770  1.00 29.18 ? 1061 HOH B O   1 
HETATM 9832 O  O   . HOH T 7 .   ? 5.685  15.699  0.174   1.00 29.50 ? 1062 HOH B O   1 
HETATM 9833 O  O   . HOH T 7 .   ? 1.469  6.839   5.984   1.00 29.21 ? 1063 HOH B O   1 
HETATM 9834 O  O   . HOH T 7 .   ? 43.745 -2.811  -4.827  1.00 27.76 ? 1064 HOH B O   1 
HETATM 9835 O  O   . HOH T 7 .   ? 14.786 -19.779 -0.501  1.00 37.35 ? 1065 HOH B O   1 
HETATM 9836 O  O   . HOH U 7 .   ? 58.986 20.027  50.681  1.00 27.08 ? 201  HOH C O   1 
HETATM 9837 O  O   . HOH U 7 .   ? 67.982 10.987  55.009  1.00 26.04 ? 202  HOH C O   1 
HETATM 9838 O  O   . HOH U 7 .   ? 69.530 26.217  36.215  1.00 42.42 ? 203  HOH C O   1 
HETATM 9839 O  O   . HOH U 7 .   ? 72.593 6.998   31.032  1.00 47.61 ? 204  HOH C O   1 
HETATM 9840 O  O   . HOH U 7 .   ? 80.598 17.335  50.886  1.00 52.81 ? 205  HOH C O   1 
HETATM 9841 O  O   . HOH U 7 .   ? 59.023 17.232  50.665  1.00 30.72 ? 206  HOH C O   1 
HETATM 9842 O  O   . HOH U 7 .   ? 71.361 15.600  55.882  1.00 28.27 ? 207  HOH C O   1 
HETATM 9843 O  O   . HOH U 7 .   ? 59.208 11.096  53.657  1.00 26.82 ? 208  HOH C O   1 
HETATM 9844 O  O   . HOH U 7 .   ? 58.500 9.054   35.993  1.00 44.07 ? 209  HOH C O   1 
HETATM 9845 O  O   . HOH U 7 .   ? 56.718 10.145  44.253  1.00 33.53 ? 210  HOH C O   1 
HETATM 9846 O  O   . HOH U 7 .   ? 55.556 8.145   48.070  1.00 32.86 ? 211  HOH C O   1 
HETATM 9847 O  O   . HOH U 7 .   ? 55.554 13.185  42.483  1.00 40.98 ? 212  HOH C O   1 
HETATM 9848 O  O   . HOH U 7 .   ? 66.003 5.969   52.422  1.00 34.23 ? 213  HOH C O   1 
HETATM 9849 O  O   . HOH U 7 .   ? 57.771 14.794  56.803  1.00 28.32 ? 214  HOH C O   1 
HETATM 9850 O  O   . HOH U 7 .   ? 59.765 27.868  38.321  1.00 36.79 ? 215  HOH C O   1 
HETATM 9851 O  O   . HOH U 7 .   ? 56.486 9.711   50.536  1.00 42.36 ? 216  HOH C O   1 
HETATM 9852 O  O   . HOH U 7 .   ? 61.361 2.935   41.776  1.00 47.03 ? 217  HOH C O   1 
HETATM 9853 O  O   . HOH U 7 .   ? 56.242 5.957   45.856  1.00 33.57 ? 218  HOH C O   1 
HETATM 9854 O  O   . HOH U 7 .   ? 59.458 9.247   55.306  1.00 31.44 ? 219  HOH C O   1 
HETATM 9855 O  O   . HOH U 7 .   ? 59.184 15.749  59.000  1.00 20.66 ? 220  HOH C O   1 
HETATM 9856 O  O   . HOH U 7 .   ? 72.910 17.100  54.414  1.00 38.33 ? 221  HOH C O   1 
HETATM 9857 O  O   . HOH U 7 .   ? 75.362 21.736  54.666  1.00 40.74 ? 222  HOH C O   1 
HETATM 9858 O  O   . HOH U 7 .   ? 66.591 24.094  57.533  1.00 33.76 ? 223  HOH C O   1 
HETATM 9859 O  O   . HOH U 7 .   ? 73.413 13.380  31.502  1.00 44.25 ? 224  HOH C O   1 
HETATM 9860 O  O   . HOH U 7 .   ? 64.484 6.209   54.284  1.00 34.62 ? 225  HOH C O   1 
HETATM 9861 O  O   . HOH U 7 .   ? 56.804 11.900  52.427  1.00 29.40 ? 226  HOH C O   1 
HETATM 9862 O  O   . HOH U 7 .   ? 58.721 1.495   52.299  1.00 46.98 ? 227  HOH C O   1 
HETATM 9863 O  O   . HOH V 7 .   ? 79.648 10.085  19.256  1.00 40.87 ? 201  HOH D O   1 
HETATM 9864 O  O   . HOH V 7 .   ? 76.262 -8.325  22.330  1.00 48.89 ? 202  HOH D O   1 
HETATM 9865 O  O   . HOH V 7 .   ? 72.005 11.241  3.908   1.00 33.83 ? 203  HOH D O   1 
HETATM 9866 O  O   . HOH V 7 .   ? 61.780 8.245   26.269  1.00 52.41 ? 204  HOH D O   1 
HETATM 9867 O  O   . HOH V 7 .   ? 62.456 2.791   6.516   1.00 27.10 ? 205  HOH D O   1 
HETATM 9868 O  O   . HOH V 7 .   ? 62.487 6.260   6.512   1.00 26.65 ? 206  HOH D O   1 
HETATM 9869 O  O   . HOH V 7 .   ? 59.166 13.746  21.564  1.00 43.09 ? 207  HOH D O   1 
HETATM 9870 O  O   . HOH V 7 .   ? 76.729 10.744  9.987   1.00 29.61 ? 208  HOH D O   1 
HETATM 9871 O  O   . HOH V 7 .   ? 60.799 2.415   19.464  1.00 35.97 ? 209  HOH D O   1 
HETATM 9872 O  O   . HOH V 7 .   ? 83.345 4.857   11.533  1.00 40.95 ? 210  HOH D O   1 
HETATM 9873 O  O   . HOH V 7 .   ? 59.112 12.598  12.629  1.00 37.00 ? 211  HOH D O   1 
HETATM 9874 O  O   . HOH V 7 .   ? 70.020 4.021   -2.942  1.00 46.22 ? 212  HOH D O   1 
HETATM 9875 O  O   . HOH V 7 .   ? 77.502 -7.284  12.414  1.00 42.68 ? 213  HOH D O   1 
HETATM 9876 O  O   . HOH V 7 .   ? 76.862 5.437   5.939   1.00 36.04 ? 214  HOH D O   1 
HETATM 9877 O  O   . HOH V 7 .   ? 75.553 6.821   3.967   1.00 36.95 ? 215  HOH D O   1 
HETATM 9878 O  O   . HOH V 7 .   ? 78.058 -5.933  10.355  1.00 46.29 ? 216  HOH D O   1 
HETATM 9879 O  O   . HOH V 7 .   ? 60.947 -5.145  19.268  1.00 35.16 ? 217  HOH D O   1 
HETATM 9880 O  O   . HOH V 7 .   ? 68.934 -10.973 13.721  1.00 36.78 ? 218  HOH D O   1 
HETATM 9881 O  O   . HOH V 7 .   ? 76.418 23.172  14.323  1.00 39.99 ? 219  HOH D O   1 
HETATM 9882 O  O   . HOH V 7 .   ? 76.570 27.801  19.464  1.00 39.17 ? 220  HOH D O   1 
HETATM 9883 O  O   . HOH V 7 .   ? 69.571 16.159  5.807   1.00 35.00 ? 221  HOH D O   1 
HETATM 9884 O  O   . HOH V 7 .   ? 70.524 9.002   0.546   1.00 42.23 ? 222  HOH D O   1 
HETATM 9885 O  O   . HOH V 7 .   ? 65.203 8.782   0.421   1.00 45.11 ? 223  HOH D O   1 
HETATM 9886 O  O   . HOH V 7 .   ? 68.635 11.645  1.512   1.00 39.36 ? 224  HOH D O   1 
HETATM 9887 O  O   . HOH V 7 .   ? 58.647 14.414  8.630   1.00 36.90 ? 225  HOH D O   1 
HETATM 9888 O  O   . HOH V 7 .   ? 71.033 -1.638  1.382   1.00 36.79 ? 226  HOH D O   1 
HETATM 9889 O  O   . HOH V 7 .   ? 80.222 -2.536  18.583  1.00 42.30 ? 227  HOH D O   1 
HETATM 9890 O  O   . HOH V 7 .   ? 79.894 22.769  18.059  1.00 38.59 ? 228  HOH D O   1 
HETATM 9891 O  O   . HOH V 7 .   ? 77.091 30.357  21.029  1.00 41.17 ? 229  HOH D O   1 
HETATM 9892 O  O   . HOH W 7 .   ? 24.970 12.483  53.318  1.00 28.12 ? 101  HOH G O   1 
HETATM 9893 O  O   . HOH W 7 .   ? 37.909 11.587  45.230  1.00 16.63 ? 102  HOH G O   1 
HETATM 9894 O  O   . HOH W 7 .   ? 25.813 4.649   47.051  1.00 37.60 ? 103  HOH G O   1 
HETATM 9895 O  O   . HOH W 7 .   ? 29.176 7.810   44.275  1.00 24.93 ? 104  HOH G O   1 
HETATM 9896 O  O   . HOH W 7 .   ? 29.134 7.776   47.840  1.00 24.30 ? 105  HOH G O   1 
HETATM 9897 O  O   . HOH W 7 .   ? 36.810 10.678  39.664  1.00 23.81 ? 106  HOH G O   1 
HETATM 9898 O  O   . HOH X 7 .   ? 40.754 11.568  8.802   1.00 16.93 ? 101  HOH H O   1 
HETATM 9899 O  O   . HOH X 7 .   ? 32.847 11.095  0.577   1.00 28.49 ? 102  HOH H O   1 
HETATM 9900 O  O   . HOH X 7 .   ? 29.137 10.392  -1.554  1.00 31.27 ? 103  HOH H O   1 
HETATM 9901 O  O   . HOH X 7 .   ? 31.996 15.494  8.353   1.00 23.19 ? 104  HOH H O   1 
HETATM 9902 O  O   . HOH X 7 .   ? 32.517 15.475  4.967   1.00 25.16 ? 105  HOH H O   1 
HETATM 9903 O  O   . HOH X 7 .   ? 29.183 18.791  5.262   1.00 35.04 ? 106  HOH H O   1 
HETATM 9904 O  O   . HOH X 7 .   ? 38.851 12.523  13.994  1.00 21.59 ? 107  HOH H O   1 
HETATM 9905 O  O   . HOH X 7 .   ? 38.934 9.616   17.603  1.00 18.33 ? 108  HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   108 ?   ?   ?   A . n 
A 1 2   VAL 2   109 ?   ?   ?   A . n 
A 1 3   TYR 3   110 110 TYR TYR A . n 
A 1 4   GLN 4   111 111 GLN GLN A . n 
A 1 5   GLU 5   112 112 GLU GLU A . n 
A 1 6   PRO 6   113 113 PRO PRO A . n 
A 1 7   THR 7   114 114 THR THR A . n 
A 1 8   ASP 8   115 115 ASP ASP A . n 
A 1 9   PRO 9   116 116 PRO PRO A . n 
A 1 10  LYS 10  117 117 LYS LYS A . n 
A 1 11  PHE 11  118 118 PHE PHE A . n 
A 1 12  PRO 12  119 119 PRO PRO A . n 
A 1 13  GLN 13  120 120 GLN GLN A . n 
A 1 14  GLN 14  121 121 GLN GLN A . n 
A 1 15  TRP 15  122 122 TRP TRP A . n 
A 1 16  TYR 16  123 123 TYR TYR A . n 
A 1 17  LEU 17  124 124 LEU LEU A . n 
A 1 18  SER 18  125 125 SER SER A . n 
A 1 19  GLY 19  126 126 GLY GLY A . n 
A 1 20  VAL 20  127 127 VAL VAL A . n 
A 1 21  THR 21  128 128 THR THR A . n 
A 1 22  GLN 22  129 129 GLN GLN A . n 
A 1 23  ARG 23  130 130 ARG ARG A . n 
A 1 24  ASP 24  131 131 ASP ASP A . n 
A 1 25  LEU 25  132 132 LEU LEU A . n 
A 1 26  ASN 26  133 133 ASN ASN A . n 
A 1 27  VAL 27  134 134 VAL VAL A . n 
A 1 28  LYS 28  135 135 LYS LYS A . n 
A 1 29  ALA 29  136 136 ALA ALA A . n 
A 1 30  ALA 30  137 137 ALA ALA A . n 
A 1 31  TRP 31  138 138 TRP TRP A . n 
A 1 32  ALA 32  139 139 ALA ALA A . n 
A 1 33  GLN 33  140 140 GLN GLN A . n 
A 1 34  GLY 34  141 141 GLY GLY A . n 
A 1 35  TYR 35  142 142 TYR TYR A . n 
A 1 36  THR 36  143 143 THR THR A . n 
A 1 37  GLY 37  144 144 GLY GLY A . n 
A 1 38  HIS 38  145 145 HIS HIS A . n 
A 1 39  GLY 39  146 146 GLY GLY A . n 
A 1 40  ILE 40  147 147 ILE ILE A . n 
A 1 41  VAL 41  148 148 VAL VAL A . n 
A 1 42  VAL 42  149 149 VAL VAL A . n 
A 1 43  SER 43  150 150 SER SER A . n 
A 1 44  ILE 44  151 151 ILE ILE A . n 
A 1 45  LEU 45  152 152 LEU LEU A . n 
A 1 46  ASP 46  153 153 ASP ASP A . n 
A 1 47  ASP 47  154 154 ASP ASP A . n 
A 1 48  GLY 48  155 155 GLY GLY A . n 
A 1 49  ILE 49  156 156 ILE ILE A . n 
A 1 50  GLU 50  157 157 GLU GLU A . n 
A 1 51  LYS 51  158 158 LYS LYS A . n 
A 1 52  ASN 52  159 159 ASN ASN A . n 
A 1 53  HIS 53  160 160 HIS HIS A . n 
A 1 54  PRO 54  161 161 PRO PRO A . n 
A 1 55  ASP 55  162 162 ASP ASP A . n 
A 1 56  LEU 56  163 163 LEU LEU A . n 
A 1 57  ALA 57  164 164 ALA ALA A . n 
A 1 58  GLY 58  165 165 GLY GLY A . n 
A 1 59  ASN 59  166 166 ASN ASN A . n 
A 1 60  TYR 60  167 167 TYR TYR A . n 
A 1 61  ASP 61  168 168 ASP ASP A . n 
A 1 62  PRO 62  169 169 PRO PRO A . n 
A 1 63  GLY 63  170 170 GLY GLY A . n 
A 1 64  ALA 64  171 171 ALA ALA A . n 
A 1 65  SER 65  172 172 SER SER A . n 
A 1 66  PHE 66  173 173 PHE PHE A . n 
A 1 67  ASP 67  174 174 ASP ASP A . n 
A 1 68  VAL 68  175 175 VAL VAL A . n 
A 1 69  ASN 69  176 176 ASN ASN A . n 
A 1 70  ASP 70  177 177 ASP ASP A . n 
A 1 71  GLN 71  178 178 GLN GLN A . n 
A 1 72  ASP 72  179 179 ASP ASP A . n 
A 1 73  PRO 73  180 180 PRO PRO A . n 
A 1 74  ASP 74  181 181 ASP ASP A . n 
A 1 75  PRO 75  182 182 PRO PRO A . n 
A 1 76  GLN 76  183 183 GLN GLN A . n 
A 1 77  PRO 77  184 184 PRO PRO A . n 
A 1 78  ARG 78  185 185 ARG ARG A . n 
A 1 79  TYR 79  186 186 TYR TYR A . n 
A 1 80  THR 80  187 187 THR THR A . n 
A 1 81  GLN 81  188 188 GLN GLN A . n 
A 1 82  MET 82  189 189 MET MET A . n 
A 1 83  ASN 83  190 190 ASN ASN A . n 
A 1 84  ASP 84  191 191 ASP ASP A . n 
A 1 85  ASN 85  192 192 ASN ASN A . n 
A 1 86  ARG 86  193 193 ARG ARG A . n 
A 1 87  HIS 87  194 194 HIS HIS A . n 
A 1 88  GLY 88  195 195 GLY GLY A . n 
A 1 89  THR 89  196 196 THR THR A . n 
A 1 90  ARG 90  197 197 ARG ARG A . n 
A 1 91  CYS 91  198 198 CYS CYS A . n 
A 1 92  ALA 92  199 199 ALA ALA A . n 
A 1 93  GLY 93  200 200 GLY GLY A . n 
A 1 94  GLU 94  201 201 GLU GLU A . n 
A 1 95  VAL 95  202 202 VAL VAL A . n 
A 1 96  ALA 96  203 203 ALA ALA A . n 
A 1 97  ALA 97  204 204 ALA ALA A . n 
A 1 98  VAL 98  205 205 VAL VAL A . n 
A 1 99  ALA 99  206 206 ALA ALA A . n 
A 1 100 ASN 100 207 207 ASN ASN A . n 
A 1 101 ASN 101 208 208 ASN ASN A . n 
A 1 102 GLY 102 209 209 GLY GLY A . n 
A 1 103 VAL 103 210 210 VAL VAL A . n 
A 1 104 CYS 104 211 211 CYS CYS A . n 
A 1 105 GLY 105 212 212 GLY GLY A . n 
A 1 106 VAL 106 213 213 VAL VAL A . n 
A 1 107 GLY 107 214 214 GLY GLY A . n 
A 1 108 VAL 108 215 215 VAL VAL A . n 
A 1 109 ALA 109 216 216 ALA ALA A . n 
A 1 110 TYR 110 217 217 TYR TYR A . n 
A 1 111 ASN 111 218 218 ASN ASN A . n 
A 1 112 ALA 112 219 219 ALA ALA A . n 
A 1 113 ARG 113 220 220 ARG ARG A . n 
A 1 114 ILE 114 221 221 ILE ILE A . n 
A 1 115 GLY 115 222 222 GLY GLY A . n 
A 1 116 GLY 116 223 223 GLY GLY A . n 
A 1 117 VAL 117 224 224 VAL VAL A . n 
A 1 118 ARG 118 225 225 ARG ARG A . n 
A 1 119 MET 119 226 226 MET MET A . n 
A 1 120 LEU 120 227 227 LEU LEU A . n 
A 1 121 ASP 121 228 228 ASP ASP A . n 
A 1 122 GLY 122 229 229 GLY GLY A . n 
A 1 123 GLU 123 230 230 GLU GLU A . n 
A 1 124 VAL 124 231 231 VAL VAL A . n 
A 1 125 THR 125 232 232 THR THR A . n 
A 1 126 ASP 126 233 233 ASP ASP A . n 
A 1 127 ALA 127 234 234 ALA ALA A . n 
A 1 128 VAL 128 235 235 VAL VAL A . n 
A 1 129 GLU 129 236 236 GLU GLU A . n 
A 1 130 ALA 130 237 237 ALA ALA A . n 
A 1 131 ARG 131 238 238 ARG ARG A . n 
A 1 132 SER 132 239 239 SER SER A . n 
A 1 133 LEU 133 240 240 LEU LEU A . n 
A 1 134 GLY 134 241 241 GLY GLY A . n 
A 1 135 LEU 135 242 242 LEU LEU A . n 
A 1 136 ASN 136 243 243 ASN ASN A . n 
A 1 137 PRO 137 244 244 PRO PRO A . n 
A 1 138 ASN 138 245 245 ASN ASN A . n 
A 1 139 HIS 139 246 246 HIS HIS A . n 
A 1 140 ILE 140 247 247 ILE ILE A . n 
A 1 141 HIS 141 248 248 HIS HIS A . n 
A 1 142 ILE 142 249 249 ILE ILE A . n 
A 1 143 TYR 143 250 250 TYR TYR A . n 
A 1 144 SER 144 251 251 SER SER A . n 
A 1 145 ALA 145 252 252 ALA ALA A . n 
A 1 146 SER 146 253 253 SER SER A . n 
A 1 147 TRP 147 254 254 TRP TRP A . n 
A 1 148 GLY 148 255 255 GLY GLY A . n 
A 1 149 PRO 149 256 256 PRO PRO A . n 
A 1 150 GLU 150 257 257 GLU GLU A . n 
A 1 151 ASP 151 258 258 ASP ASP A . n 
A 1 152 ASP 152 259 259 ASP ASP A . n 
A 1 153 GLY 153 260 260 GLY GLY A . n 
A 1 154 LYS 154 261 261 LYS LYS A . n 
A 1 155 THR 155 262 262 THR THR A . n 
A 1 156 VAL 156 263 263 VAL VAL A . n 
A 1 157 ASP 157 264 264 ASP ASP A . n 
A 1 158 GLY 158 265 265 GLY GLY A . n 
A 1 159 PRO 159 266 266 PRO PRO A . n 
A 1 160 ALA 160 267 267 ALA ALA A . n 
A 1 161 ARG 161 268 268 ARG ARG A . n 
A 1 162 LEU 162 269 269 LEU LEU A . n 
A 1 163 ALA 163 270 270 ALA ALA A . n 
A 1 164 GLU 164 271 271 GLU GLU A . n 
A 1 165 GLU 165 272 272 GLU GLU A . n 
A 1 166 ALA 166 273 273 ALA ALA A . n 
A 1 167 PHE 167 274 274 PHE PHE A . n 
A 1 168 PHE 168 275 275 PHE PHE A . n 
A 1 169 ARG 169 276 276 ARG ARG A . n 
A 1 170 GLY 170 277 277 GLY GLY A . n 
A 1 171 VAL 171 278 278 VAL VAL A . n 
A 1 172 SER 172 279 279 SER SER A . n 
A 1 173 GLN 173 280 280 GLN GLN A . n 
A 1 174 GLY 174 281 281 GLY GLY A . n 
A 1 175 ARG 175 282 282 ARG ARG A . n 
A 1 176 GLY 176 283 283 GLY GLY A . n 
A 1 177 GLY 177 284 284 GLY GLY A . n 
A 1 178 LEU 178 285 285 LEU LEU A . n 
A 1 179 GLY 179 286 286 GLY GLY A . n 
A 1 180 SER 180 287 287 SER SER A . n 
A 1 181 ILE 181 288 288 ILE ILE A . n 
A 1 182 PHE 182 289 289 PHE PHE A . n 
A 1 183 VAL 183 290 290 VAL VAL A . n 
A 1 184 TRP 184 291 291 TRP TRP A . n 
A 1 185 ALA 185 292 292 ALA ALA A . n 
A 1 186 SER 186 293 293 SER SER A . n 
A 1 187 GLY 187 294 294 GLY GLY A . n 
A 1 188 ASN 188 295 295 ASN ASN A . n 
A 1 189 GLY 189 296 296 GLY GLY A . n 
A 1 190 GLY 190 297 297 GLY GLY A . n 
A 1 191 ARG 191 298 298 ARG ARG A . n 
A 1 192 GLU 192 299 299 GLU GLU A . n 
A 1 193 HIS 193 300 300 HIS HIS A . n 
A 1 194 ASP 194 301 301 ASP ASP A . n 
A 1 195 SER 195 302 302 SER SER A . n 
A 1 196 CYS 196 303 303 CYS CYS A . n 
A 1 197 ASN 197 304 304 ASN ASN A . n 
A 1 198 CYS 198 305 305 CYS CYS A . n 
A 1 199 ASP 199 306 306 ASP ASP A . n 
A 1 200 GLY 200 307 307 GLY GLY A . n 
A 1 201 TYR 201 308 308 TYR TYR A . n 
A 1 202 THR 202 309 309 THR THR A . n 
A 1 203 ASN 203 310 310 ASN ASN A . n 
A 1 204 SER 204 311 311 SER SER A . n 
A 1 205 ILE 205 312 312 ILE ILE A . n 
A 1 206 TYR 206 313 313 TYR TYR A . n 
A 1 207 THR 207 314 314 THR THR A . n 
A 1 208 LEU 208 315 315 LEU LEU A . n 
A 1 209 SER 209 316 316 SER SER A . n 
A 1 210 ILE 210 317 317 ILE ILE A . n 
A 1 211 SER 211 318 318 SER SER A . n 
A 1 212 SER 212 319 319 SER SER A . n 
A 1 213 ALA 213 320 320 ALA ALA A . n 
A 1 214 THR 214 321 321 THR THR A . n 
A 1 215 GLN 215 322 322 GLN GLN A . n 
A 1 216 PHE 216 323 323 PHE PHE A . n 
A 1 217 GLY 217 324 324 GLY GLY A . n 
A 1 218 ASN 218 325 325 ASN ASN A . n 
A 1 219 VAL 219 326 326 VAL VAL A . n 
A 1 220 PRO 220 327 327 PRO PRO A . n 
A 1 221 TRP 221 328 328 TRP TRP A . n 
A 1 222 TYR 222 329 329 TYR TYR A . n 
A 1 223 SER 223 330 330 SER SER A . n 
A 1 224 GLU 224 331 331 GLU GLU A . n 
A 1 225 ALA 225 332 332 ALA ALA A . n 
A 1 226 CYS 226 333 333 CYS CYS A . n 
A 1 227 SER 227 334 334 SER SER A . n 
A 1 228 SER 228 335 335 SER SER A . n 
A 1 229 THR 229 336 336 THR THR A . n 
A 1 230 LEU 230 337 337 LEU LEU A . n 
A 1 231 ALA 231 338 338 ALA ALA A . n 
A 1 232 THR 232 339 339 THR THR A . n 
A 1 233 THR 233 340 340 THR THR A . n 
A 1 234 TYR 234 341 341 TYR TYR A . n 
A 1 235 SER 235 342 342 SER SER A . n 
A 1 236 SER 236 343 343 SER SER A . n 
A 1 237 GLY 237 344 344 GLY GLY A . n 
A 1 238 ASN 238 345 345 ASN ASN A . n 
A 1 239 GLN 239 346 346 GLN GLN A . n 
A 1 240 ASN 240 347 347 ASN ASN A . n 
A 1 241 GLU 241 348 348 GLU GLU A . n 
A 1 242 LYS 242 349 349 LYS LYS A . n 
A 1 243 GLN 243 350 350 GLN GLN A . n 
A 1 244 ILE 244 351 351 ILE ILE A . n 
A 1 245 VAL 245 352 352 VAL VAL A . n 
A 1 246 THR 246 353 353 THR THR A . n 
A 1 247 THR 247 354 354 THR THR A . n 
A 1 248 ASP 248 355 355 ASP ASP A . n 
A 1 249 LEU 249 356 356 LEU LEU A . n 
A 1 250 ARG 250 357 357 ARG ARG A . n 
A 1 251 GLN 251 358 358 GLN GLN A . n 
A 1 252 LYS 252 359 359 LYS LYS A . n 
A 1 253 CYS 253 360 360 CYS CYS A . n 
A 1 254 THR 254 361 361 THR THR A . n 
A 1 255 GLU 255 362 362 GLU GLU A . n 
A 1 256 SER 256 363 363 SER SER A . n 
A 1 257 HIS 257 364 364 HIS HIS A . n 
A 1 258 THR 258 365 365 THR THR A . n 
A 1 259 GLY 259 366 366 GLY GLY A . n 
A 1 260 THR 260 367 367 THR THR A . n 
A 1 261 SER 261 368 368 SER SER A . n 
A 1 262 ALA 262 369 369 ALA ALA A . n 
A 1 263 SER 263 370 370 SER SER A . n 
A 1 264 ALA 264 371 371 ALA ALA A . n 
A 1 265 PRO 265 372 372 PRO PRO A . n 
A 1 266 LEU 266 373 373 LEU LEU A . n 
A 1 267 ALA 267 374 374 ALA ALA A . n 
A 1 268 ALA 268 375 375 ALA ALA A . n 
A 1 269 GLY 269 376 376 GLY GLY A . n 
A 1 270 ILE 270 377 377 ILE ILE A . n 
A 1 271 ILE 271 378 378 ILE ILE A . n 
A 1 272 ALA 272 379 379 ALA ALA A . n 
A 1 273 LEU 273 380 380 LEU LEU A . n 
A 1 274 THR 274 381 381 THR THR A . n 
A 1 275 LEU 275 382 382 LEU LEU A . n 
A 1 276 GLU 276 383 383 GLU GLU A . n 
A 1 277 ALA 277 384 384 ALA ALA A . n 
A 1 278 ASN 278 385 385 ASN ASN A . n 
A 1 279 LYS 279 386 386 LYS LYS A . n 
A 1 280 ASN 280 387 387 ASN ASN A . n 
A 1 281 LEU 281 388 388 LEU LEU A . n 
A 1 282 THR 282 389 389 THR THR A . n 
A 1 283 TRP 283 390 390 TRP TRP A . n 
A 1 284 ARG 284 391 391 ARG ARG A . n 
A 1 285 ASP 285 392 392 ASP ASP A . n 
A 1 286 MET 286 393 393 MET MET A . n 
A 1 287 GLN 287 394 394 GLN GLN A . n 
A 1 288 HIS 288 395 395 HIS HIS A . n 
A 1 289 LEU 289 396 396 LEU LEU A . n 
A 1 290 VAL 290 397 397 VAL VAL A . n 
A 1 291 VAL 291 398 398 VAL VAL A . n 
A 1 292 GLN 292 399 399 GLN GLN A . n 
A 1 293 THR 293 400 400 THR THR A . n 
A 1 294 SER 294 401 401 SER SER A . n 
A 1 295 LYS 295 402 402 LYS LYS A . n 
A 1 296 PRO 296 403 403 PRO PRO A . n 
A 1 297 ALA 297 404 404 ALA ALA A . n 
A 1 298 HIS 298 405 405 HIS HIS A . n 
A 1 299 LEU 299 406 406 LEU LEU A . n 
A 1 300 ASN 300 407 407 ASN ASN A . n 
A 1 301 ALA 301 408 408 ALA ALA A . n 
A 1 302 ASN 302 409 409 ASN ASN A . n 
A 1 303 ASP 303 410 410 ASP ASP A . n 
A 1 304 TRP 304 411 411 TRP TRP A . n 
A 1 305 ALA 305 412 412 ALA ALA A . n 
A 1 306 THR 306 413 413 THR THR A . n 
A 1 307 ASN 307 414 414 ASN ASN A . n 
A 1 308 GLY 308 415 415 GLY GLY A . n 
A 1 309 VAL 309 416 416 VAL VAL A . n 
A 1 310 GLY 310 417 417 GLY GLY A . n 
A 1 311 ARG 311 418 418 ARG ARG A . n 
A 1 312 LYS 312 419 419 LYS LYS A . n 
A 1 313 VAL 313 420 420 VAL VAL A . n 
A 1 314 SER 314 421 421 SER SER A . n 
A 1 315 HIS 315 422 422 HIS HIS A . n 
A 1 316 SER 316 423 423 SER SER A . n 
A 1 317 TYR 317 424 424 TYR TYR A . n 
A 1 318 GLY 318 425 425 GLY GLY A . n 
A 1 319 TYR 319 426 426 TYR TYR A . n 
A 1 320 GLY 320 427 427 GLY GLY A . n 
A 1 321 LEU 321 428 428 LEU LEU A . n 
A 1 322 LEU 322 429 429 LEU LEU A . n 
A 1 323 ASP 323 430 430 ASP ASP A . n 
A 1 324 ALA 324 431 431 ALA ALA A . n 
A 1 325 GLY 325 432 432 GLY GLY A . n 
A 1 326 ALA 326 433 433 ALA ALA A . n 
A 1 327 MET 327 434 434 MET MET A . n 
A 1 328 VAL 328 435 435 VAL VAL A . n 
A 1 329 ALA 329 436 436 ALA ALA A . n 
A 1 330 LEU 330 437 437 LEU LEU A . n 
A 1 331 ALA 331 438 438 ALA ALA A . n 
A 1 332 GLN 332 439 439 GLN GLN A . n 
A 1 333 ASN 333 440 440 ASN ASN A . n 
A 1 334 TRP 334 441 441 TRP TRP A . n 
A 1 335 THR 335 442 442 THR THR A . n 
A 1 336 THR 336 443 443 THR THR A . n 
A 1 337 VAL 337 444 444 VAL VAL A . n 
A 1 338 ALA 338 445 445 ALA ALA A . n 
A 1 339 PRO 339 446 446 PRO PRO A . n 
A 1 340 GLN 340 447 447 GLN GLN A . n 
A 1 341 ARG 341 448 448 ARG ARG A . n 
A 1 342 LYS 342 449 449 LYS LYS A . n 
A 1 343 CYS 343 450 450 CYS CYS A . n 
A 1 344 ILE 344 451 451 ILE ILE A . n 
A 1 345 ILE 345 452 452 ILE ILE A . n 
A 1 346 ASP 346 453 453 ASP ASP A . n 
A 1 347 ILE 347 454 454 ILE ILE A . n 
A 1 348 LEU 348 455 455 LEU LEU A . n 
A 1 349 THR 349 456 456 THR THR A . n 
A 1 350 GLU 350 457 457 GLU GLU A . n 
A 1 351 PRO 351 458 458 PRO PRO A . n 
A 1 352 LYS 352 459 459 LYS LYS A . n 
A 1 353 ASP 353 460 460 ASP ASP A . n 
A 1 354 ILE 354 461 461 ILE ILE A . n 
A 1 355 GLY 355 462 462 GLY GLY A . n 
A 1 356 LYS 356 463 463 LYS LYS A . n 
A 1 357 ARG 357 464 464 ARG ARG A . n 
A 1 358 LEU 358 465 465 LEU LEU A . n 
A 1 359 GLU 359 466 466 GLU GLU A . n 
A 1 360 VAL 360 467 467 VAL VAL A . n 
A 1 361 ARG 361 468 468 ARG ARG A . n 
A 1 362 LYS 362 469 469 LYS LYS A . n 
A 1 363 THR 363 470 470 THR THR A . n 
A 1 364 VAL 364 471 471 VAL VAL A . n 
A 1 365 THR 365 472 472 THR THR A . n 
A 1 366 ALA 366 473 473 ALA ALA A . n 
A 1 367 CYS 367 474 474 CYS CYS A . n 
A 1 368 LEU 368 475 475 LEU LEU A . n 
A 1 369 GLY 369 476 476 GLY GLY A . n 
A 1 370 GLU 370 477 477 GLU GLU A . n 
A 1 371 PRO 371 478 478 PRO PRO A . n 
A 1 372 ASN 372 479 479 ASN ASN A . n 
A 1 373 HIS 373 480 480 HIS HIS A . n 
A 1 374 ILE 374 481 481 ILE ILE A . n 
A 1 375 THR 375 482 482 THR THR A . n 
A 1 376 ARG 376 483 483 ARG ARG A . n 
A 1 377 LEU 377 484 484 LEU LEU A . n 
A 1 378 GLU 378 485 485 GLU GLU A . n 
A 1 379 HIS 379 486 486 HIS HIS A . n 
A 1 380 ALA 380 487 487 ALA ALA A . n 
A 1 381 GLN 381 488 488 GLN GLN A . n 
A 1 382 ALA 382 489 489 ALA ALA A . n 
A 1 383 ARG 383 490 490 ARG ARG A . n 
A 1 384 LEU 384 491 491 LEU LEU A . n 
A 1 385 THR 385 492 492 THR THR A . n 
A 1 386 LEU 386 493 493 LEU LEU A . n 
A 1 387 SER 387 494 494 SER SER A . n 
A 1 388 TYR 388 495 495 TYR TYR A . n 
A 1 389 ASN 389 496 496 ASN ASN A . n 
A 1 390 ARG 390 497 497 ARG ARG A . n 
A 1 391 ARG 391 498 498 ARG ARG A . n 
A 1 392 GLY 392 499 499 GLY GLY A . n 
A 1 393 ASP 393 500 500 ASP ASP A . n 
A 1 394 LEU 394 501 501 LEU LEU A . n 
A 1 395 ALA 395 502 502 ALA ALA A . n 
A 1 396 ILE 396 503 503 ILE ILE A . n 
A 1 397 HIS 397 504 504 HIS HIS A . n 
A 1 398 LEU 398 505 505 LEU LEU A . n 
A 1 399 VAL 399 506 506 VAL VAL A . n 
A 1 400 SER 400 507 507 SER SER A . n 
A 1 401 PRO 401 508 508 PRO PRO A . n 
A 1 402 MET 402 509 509 MET MET A . n 
A 1 403 GLY 403 510 510 GLY GLY A . n 
A 1 404 THR 404 511 511 THR THR A . n 
A 1 405 ARG 405 512 512 ARG ARG A . n 
A 1 406 SER 406 513 513 SER SER A . n 
A 1 407 THR 407 514 514 THR THR A . n 
A 1 408 LEU 408 515 515 LEU LEU A . n 
A 1 409 LEU 409 516 516 LEU LEU A . n 
A 1 410 ALA 410 517 517 ALA ALA A . n 
A 1 411 ALA 411 518 518 ALA ALA A . n 
A 1 412 ARG 412 519 519 ARG ARG A . n 
A 1 413 PRO 413 520 520 PRO PRO A . n 
A 1 414 HIS 414 521 521 HIS HIS A . n 
A 1 415 ASP 415 522 522 ASP ASP A . n 
A 1 416 TYR 416 523 523 TYR TYR A . n 
A 1 417 SER 417 524 524 SER SER A . n 
A 1 418 ALA 418 525 525 ALA ALA A . n 
A 1 419 ASP 419 526 526 ASP ASP A . n 
A 1 420 GLY 420 527 527 GLY GLY A . n 
A 1 421 PHE 421 528 528 PHE PHE A . n 
A 1 422 ASN 422 529 529 ASN ASN A . n 
A 1 423 ASP 423 530 530 ASP ASP A . n 
A 1 424 TRP 424 531 531 TRP TRP A . n 
A 1 425 ALA 425 532 532 ALA ALA A . n 
A 1 426 PHE 426 533 533 PHE PHE A . n 
A 1 427 MET 427 534 534 MET MET A . n 
A 1 428 THR 428 535 535 THR THR A . n 
A 1 429 THR 429 536 536 THR THR A . n 
A 1 430 HIS 430 537 537 HIS HIS A . n 
A 1 431 SER 431 538 538 SER SER A . n 
A 1 432 TRP 432 539 539 TRP TRP A . n 
A 1 433 ASP 433 540 540 ASP ASP A . n 
A 1 434 GLU 434 541 541 GLU GLU A . n 
A 1 435 ASP 435 542 542 ASP ASP A . n 
A 1 436 PRO 436 543 543 PRO PRO A . n 
A 1 437 SER 437 544 544 SER SER A . n 
A 1 438 GLY 438 545 545 GLY GLY A . n 
A 1 439 GLU 439 546 546 GLU GLU A . n 
A 1 440 TRP 440 547 547 TRP TRP A . n 
A 1 441 VAL 441 548 548 VAL VAL A . n 
A 1 442 LEU 442 549 549 LEU LEU A . n 
A 1 443 GLU 443 550 550 GLU GLU A . n 
A 1 444 ILE 444 551 551 ILE ILE A . n 
A 1 445 GLU 445 552 552 GLU GLU A . n 
A 1 446 ASN 446 553 553 ASN ASN A . n 
A 1 447 THR 447 554 554 THR THR A . n 
A 1 448 SER 448 555 555 SER SER A . n 
A 1 449 GLU 449 556 556 GLU GLU A . n 
A 1 450 ALA 450 557 557 ALA ALA A . n 
A 1 451 ASN 451 558 558 ASN ASN A . n 
A 1 452 ASN 452 559 559 ASN ASN A . n 
A 1 453 TYR 453 560 560 TYR TYR A . n 
A 1 454 GLY 454 561 561 GLY GLY A . n 
A 1 455 THR 455 562 562 THR THR A . n 
A 1 456 LEU 456 563 563 LEU LEU A . n 
A 1 457 THR 457 564 564 THR THR A . n 
A 1 458 LYS 458 565 565 LYS LYS A . n 
A 1 459 PHE 459 566 566 PHE PHE A . n 
A 1 460 THR 460 567 567 THR THR A . n 
A 1 461 LEU 461 568 568 LEU LEU A . n 
A 1 462 VAL 462 569 569 VAL VAL A . n 
A 1 463 LEU 463 570 570 LEU LEU A . n 
A 1 464 TYR 464 571 571 TYR TYR A . n 
A 1 465 GLY 465 572 572 GLY GLY A . n 
A 1 466 THR 466 573 573 THR THR A . n 
A 1 467 ALA 467 574 574 ALA ALA A . n 
A 1 468 SER 468 575 575 SER SER A . n 
A 1 469 GLY 469 576 576 GLY GLY A . n 
A 1 470 SER 470 577 577 SER SER A . n 
A 1 471 LEU 471 578 578 LEU LEU A . n 
A 1 472 VAL 472 579 ?   ?   ?   A . n 
A 1 473 PRO 473 580 ?   ?   ?   A . n 
A 1 474 ARG 474 581 ?   ?   ?   A . n 
A 1 475 GLY 475 582 ?   ?   ?   A . n 
A 1 476 SER 476 583 ?   ?   ?   A . n 
A 1 477 HIS 477 584 ?   ?   ?   A . n 
A 1 478 HIS 478 585 ?   ?   ?   A . n 
A 1 479 HIS 479 586 ?   ?   ?   A . n 
A 1 480 HIS 480 587 ?   ?   ?   A . n 
A 1 481 HIS 481 588 ?   ?   ?   A . n 
A 1 482 HIS 482 589 ?   ?   ?   A . n 
B 1 1   ASP 1   108 108 ASP ASP B . n 
B 1 2   VAL 2   109 109 VAL VAL B . n 
B 1 3   TYR 3   110 110 TYR TYR B . n 
B 1 4   GLN 4   111 111 GLN GLN B . n 
B 1 5   GLU 5   112 112 GLU GLU B . n 
B 1 6   PRO 6   113 113 PRO PRO B . n 
B 1 7   THR 7   114 114 THR THR B . n 
B 1 8   ASP 8   115 115 ASP ASP B . n 
B 1 9   PRO 9   116 116 PRO PRO B . n 
B 1 10  LYS 10  117 117 LYS LYS B . n 
B 1 11  PHE 11  118 118 PHE PHE B . n 
B 1 12  PRO 12  119 119 PRO PRO B . n 
B 1 13  GLN 13  120 120 GLN GLN B . n 
B 1 14  GLN 14  121 121 GLN GLN B . n 
B 1 15  TRP 15  122 122 TRP TRP B . n 
B 1 16  TYR 16  123 123 TYR TYR B . n 
B 1 17  LEU 17  124 124 LEU LEU B . n 
B 1 18  SER 18  125 125 SER SER B . n 
B 1 19  GLY 19  126 126 GLY GLY B . n 
B 1 20  VAL 20  127 127 VAL VAL B . n 
B 1 21  THR 21  128 128 THR THR B . n 
B 1 22  GLN 22  129 129 GLN GLN B . n 
B 1 23  ARG 23  130 130 ARG ARG B . n 
B 1 24  ASP 24  131 131 ASP ASP B . n 
B 1 25  LEU 25  132 132 LEU LEU B . n 
B 1 26  ASN 26  133 133 ASN ASN B . n 
B 1 27  VAL 27  134 134 VAL VAL B . n 
B 1 28  LYS 28  135 135 LYS LYS B . n 
B 1 29  ALA 29  136 136 ALA ALA B . n 
B 1 30  ALA 30  137 137 ALA ALA B . n 
B 1 31  TRP 31  138 138 TRP TRP B . n 
B 1 32  ALA 32  139 139 ALA ALA B . n 
B 1 33  GLN 33  140 140 GLN GLN B . n 
B 1 34  GLY 34  141 141 GLY GLY B . n 
B 1 35  TYR 35  142 142 TYR TYR B . n 
B 1 36  THR 36  143 143 THR THR B . n 
B 1 37  GLY 37  144 144 GLY GLY B . n 
B 1 38  HIS 38  145 145 HIS HIS B . n 
B 1 39  GLY 39  146 146 GLY GLY B . n 
B 1 40  ILE 40  147 147 ILE ILE B . n 
B 1 41  VAL 41  148 148 VAL VAL B . n 
B 1 42  VAL 42  149 149 VAL VAL B . n 
B 1 43  SER 43  150 150 SER SER B . n 
B 1 44  ILE 44  151 151 ILE ILE B . n 
B 1 45  LEU 45  152 152 LEU LEU B . n 
B 1 46  ASP 46  153 153 ASP ASP B . n 
B 1 47  ASP 47  154 154 ASP ASP B . n 
B 1 48  GLY 48  155 155 GLY GLY B . n 
B 1 49  ILE 49  156 156 ILE ILE B . n 
B 1 50  GLU 50  157 157 GLU GLU B . n 
B 1 51  LYS 51  158 158 LYS LYS B . n 
B 1 52  ASN 52  159 159 ASN ASN B . n 
B 1 53  HIS 53  160 160 HIS HIS B . n 
B 1 54  PRO 54  161 161 PRO PRO B . n 
B 1 55  ASP 55  162 162 ASP ASP B . n 
B 1 56  LEU 56  163 163 LEU LEU B . n 
B 1 57  ALA 57  164 164 ALA ALA B . n 
B 1 58  GLY 58  165 165 GLY GLY B . n 
B 1 59  ASN 59  166 166 ASN ASN B . n 
B 1 60  TYR 60  167 167 TYR TYR B . n 
B 1 61  ASP 61  168 168 ASP ASP B . n 
B 1 62  PRO 62  169 169 PRO PRO B . n 
B 1 63  GLY 63  170 170 GLY GLY B . n 
B 1 64  ALA 64  171 171 ALA ALA B . n 
B 1 65  SER 65  172 172 SER SER B . n 
B 1 66  PHE 66  173 173 PHE PHE B . n 
B 1 67  ASP 67  174 174 ASP ASP B . n 
B 1 68  VAL 68  175 175 VAL VAL B . n 
B 1 69  ASN 69  176 176 ASN ASN B . n 
B 1 70  ASP 70  177 177 ASP ASP B . n 
B 1 71  GLN 71  178 178 GLN GLN B . n 
B 1 72  ASP 72  179 179 ASP ASP B . n 
B 1 73  PRO 73  180 180 PRO PRO B . n 
B 1 74  ASP 74  181 181 ASP ASP B . n 
B 1 75  PRO 75  182 182 PRO PRO B . n 
B 1 76  GLN 76  183 183 GLN GLN B . n 
B 1 77  PRO 77  184 184 PRO PRO B . n 
B 1 78  ARG 78  185 185 ARG ARG B . n 
B 1 79  TYR 79  186 186 TYR TYR B . n 
B 1 80  THR 80  187 187 THR THR B . n 
B 1 81  GLN 81  188 188 GLN GLN B . n 
B 1 82  MET 82  189 189 MET MET B . n 
B 1 83  ASN 83  190 190 ASN ASN B . n 
B 1 84  ASP 84  191 191 ASP ASP B . n 
B 1 85  ASN 85  192 192 ASN ASN B . n 
B 1 86  ARG 86  193 193 ARG ARG B . n 
B 1 87  HIS 87  194 194 HIS HIS B . n 
B 1 88  GLY 88  195 195 GLY GLY B . n 
B 1 89  THR 89  196 196 THR THR B . n 
B 1 90  ARG 90  197 197 ARG ARG B . n 
B 1 91  CYS 91  198 198 CYS CYS B . n 
B 1 92  ALA 92  199 199 ALA ALA B . n 
B 1 93  GLY 93  200 200 GLY GLY B . n 
B 1 94  GLU 94  201 201 GLU GLU B . n 
B 1 95  VAL 95  202 202 VAL VAL B . n 
B 1 96  ALA 96  203 203 ALA ALA B . n 
B 1 97  ALA 97  204 204 ALA ALA B . n 
B 1 98  VAL 98  205 205 VAL VAL B . n 
B 1 99  ALA 99  206 206 ALA ALA B . n 
B 1 100 ASN 100 207 207 ASN ASN B . n 
B 1 101 ASN 101 208 208 ASN ASN B . n 
B 1 102 GLY 102 209 209 GLY GLY B . n 
B 1 103 VAL 103 210 210 VAL VAL B . n 
B 1 104 CYS 104 211 211 CYS CYS B . n 
B 1 105 GLY 105 212 212 GLY GLY B . n 
B 1 106 VAL 106 213 213 VAL VAL B . n 
B 1 107 GLY 107 214 214 GLY GLY B . n 
B 1 108 VAL 108 215 215 VAL VAL B . n 
B 1 109 ALA 109 216 216 ALA ALA B . n 
B 1 110 TYR 110 217 217 TYR TYR B . n 
B 1 111 ASN 111 218 218 ASN ASN B . n 
B 1 112 ALA 112 219 219 ALA ALA B . n 
B 1 113 ARG 113 220 220 ARG ARG B . n 
B 1 114 ILE 114 221 221 ILE ILE B . n 
B 1 115 GLY 115 222 222 GLY GLY B . n 
B 1 116 GLY 116 223 223 GLY GLY B . n 
B 1 117 VAL 117 224 224 VAL VAL B . n 
B 1 118 ARG 118 225 225 ARG ARG B . n 
B 1 119 MET 119 226 226 MET MET B . n 
B 1 120 LEU 120 227 227 LEU LEU B . n 
B 1 121 ASP 121 228 228 ASP ASP B . n 
B 1 122 GLY 122 229 229 GLY GLY B . n 
B 1 123 GLU 123 230 230 GLU GLU B . n 
B 1 124 VAL 124 231 231 VAL VAL B . n 
B 1 125 THR 125 232 232 THR THR B . n 
B 1 126 ASP 126 233 233 ASP ASP B . n 
B 1 127 ALA 127 234 234 ALA ALA B . n 
B 1 128 VAL 128 235 235 VAL VAL B . n 
B 1 129 GLU 129 236 236 GLU GLU B . n 
B 1 130 ALA 130 237 237 ALA ALA B . n 
B 1 131 ARG 131 238 238 ARG ARG B . n 
B 1 132 SER 132 239 239 SER SER B . n 
B 1 133 LEU 133 240 240 LEU LEU B . n 
B 1 134 GLY 134 241 241 GLY GLY B . n 
B 1 135 LEU 135 242 242 LEU LEU B . n 
B 1 136 ASN 136 243 243 ASN ASN B . n 
B 1 137 PRO 137 244 244 PRO PRO B . n 
B 1 138 ASN 138 245 245 ASN ASN B . n 
B 1 139 HIS 139 246 246 HIS HIS B . n 
B 1 140 ILE 140 247 247 ILE ILE B . n 
B 1 141 HIS 141 248 248 HIS HIS B . n 
B 1 142 ILE 142 249 249 ILE ILE B . n 
B 1 143 TYR 143 250 250 TYR TYR B . n 
B 1 144 SER 144 251 251 SER SER B . n 
B 1 145 ALA 145 252 252 ALA ALA B . n 
B 1 146 SER 146 253 253 SER SER B . n 
B 1 147 TRP 147 254 254 TRP TRP B . n 
B 1 148 GLY 148 255 255 GLY GLY B . n 
B 1 149 PRO 149 256 256 PRO PRO B . n 
B 1 150 GLU 150 257 257 GLU GLU B . n 
B 1 151 ASP 151 258 258 ASP ASP B . n 
B 1 152 ASP 152 259 259 ASP ASP B . n 
B 1 153 GLY 153 260 260 GLY GLY B . n 
B 1 154 LYS 154 261 261 LYS LYS B . n 
B 1 155 THR 155 262 262 THR THR B . n 
B 1 156 VAL 156 263 263 VAL VAL B . n 
B 1 157 ASP 157 264 264 ASP ASP B . n 
B 1 158 GLY 158 265 265 GLY GLY B . n 
B 1 159 PRO 159 266 266 PRO PRO B . n 
B 1 160 ALA 160 267 267 ALA ALA B . n 
B 1 161 ARG 161 268 268 ARG ARG B . n 
B 1 162 LEU 162 269 269 LEU LEU B . n 
B 1 163 ALA 163 270 270 ALA ALA B . n 
B 1 164 GLU 164 271 271 GLU GLU B . n 
B 1 165 GLU 165 272 272 GLU GLU B . n 
B 1 166 ALA 166 273 273 ALA ALA B . n 
B 1 167 PHE 167 274 274 PHE PHE B . n 
B 1 168 PHE 168 275 275 PHE PHE B . n 
B 1 169 ARG 169 276 276 ARG ARG B . n 
B 1 170 GLY 170 277 277 GLY GLY B . n 
B 1 171 VAL 171 278 278 VAL VAL B . n 
B 1 172 SER 172 279 279 SER SER B . n 
B 1 173 GLN 173 280 280 GLN GLN B . n 
B 1 174 GLY 174 281 281 GLY GLY B . n 
B 1 175 ARG 175 282 282 ARG ARG B . n 
B 1 176 GLY 176 283 283 GLY GLY B . n 
B 1 177 GLY 177 284 284 GLY GLY B . n 
B 1 178 LEU 178 285 285 LEU LEU B . n 
B 1 179 GLY 179 286 286 GLY GLY B . n 
B 1 180 SER 180 287 287 SER SER B . n 
B 1 181 ILE 181 288 288 ILE ILE B . n 
B 1 182 PHE 182 289 289 PHE PHE B . n 
B 1 183 VAL 183 290 290 VAL VAL B . n 
B 1 184 TRP 184 291 291 TRP TRP B . n 
B 1 185 ALA 185 292 292 ALA ALA B . n 
B 1 186 SER 186 293 293 SER SER B . n 
B 1 187 GLY 187 294 294 GLY GLY B . n 
B 1 188 ASN 188 295 295 ASN ASN B . n 
B 1 189 GLY 189 296 296 GLY GLY B . n 
B 1 190 GLY 190 297 297 GLY GLY B . n 
B 1 191 ARG 191 298 298 ARG ARG B . n 
B 1 192 GLU 192 299 299 GLU GLU B . n 
B 1 193 HIS 193 300 300 HIS HIS B . n 
B 1 194 ASP 194 301 301 ASP ASP B . n 
B 1 195 SER 195 302 302 SER SER B . n 
B 1 196 CYS 196 303 303 CYS CYS B . n 
B 1 197 ASN 197 304 304 ASN ASN B . n 
B 1 198 CYS 198 305 305 CYS CYS B . n 
B 1 199 ASP 199 306 306 ASP ASP B . n 
B 1 200 GLY 200 307 307 GLY GLY B . n 
B 1 201 TYR 201 308 308 TYR TYR B . n 
B 1 202 THR 202 309 309 THR THR B . n 
B 1 203 ASN 203 310 310 ASN ASN B . n 
B 1 204 SER 204 311 311 SER SER B . n 
B 1 205 ILE 205 312 312 ILE ILE B . n 
B 1 206 TYR 206 313 313 TYR TYR B . n 
B 1 207 THR 207 314 314 THR THR B . n 
B 1 208 LEU 208 315 315 LEU LEU B . n 
B 1 209 SER 209 316 316 SER SER B . n 
B 1 210 ILE 210 317 317 ILE ILE B . n 
B 1 211 SER 211 318 318 SER SER B . n 
B 1 212 SER 212 319 319 SER SER B . n 
B 1 213 ALA 213 320 320 ALA ALA B . n 
B 1 214 THR 214 321 321 THR THR B . n 
B 1 215 GLN 215 322 322 GLN GLN B . n 
B 1 216 PHE 216 323 323 PHE PHE B . n 
B 1 217 GLY 217 324 324 GLY GLY B . n 
B 1 218 ASN 218 325 325 ASN ASN B . n 
B 1 219 VAL 219 326 326 VAL VAL B . n 
B 1 220 PRO 220 327 327 PRO PRO B . n 
B 1 221 TRP 221 328 328 TRP TRP B . n 
B 1 222 TYR 222 329 329 TYR TYR B . n 
B 1 223 SER 223 330 330 SER SER B . n 
B 1 224 GLU 224 331 331 GLU GLU B . n 
B 1 225 ALA 225 332 332 ALA ALA B . n 
B 1 226 CYS 226 333 333 CYS CYS B . n 
B 1 227 SER 227 334 334 SER SER B . n 
B 1 228 SER 228 335 335 SER SER B . n 
B 1 229 THR 229 336 336 THR THR B . n 
B 1 230 LEU 230 337 337 LEU LEU B . n 
B 1 231 ALA 231 338 338 ALA ALA B . n 
B 1 232 THR 232 339 339 THR THR B . n 
B 1 233 THR 233 340 340 THR THR B . n 
B 1 234 TYR 234 341 341 TYR TYR B . n 
B 1 235 SER 235 342 342 SER SER B . n 
B 1 236 SER 236 343 343 SER SER B . n 
B 1 237 GLY 237 344 344 GLY GLY B . n 
B 1 238 ASN 238 345 345 ASN ASN B . n 
B 1 239 GLN 239 346 346 GLN GLN B . n 
B 1 240 ASN 240 347 347 ASN ASN B . n 
B 1 241 GLU 241 348 348 GLU GLU B . n 
B 1 242 LYS 242 349 349 LYS LYS B . n 
B 1 243 GLN 243 350 350 GLN GLN B . n 
B 1 244 ILE 244 351 351 ILE ILE B . n 
B 1 245 VAL 245 352 352 VAL VAL B . n 
B 1 246 THR 246 353 353 THR THR B . n 
B 1 247 THR 247 354 354 THR THR B . n 
B 1 248 ASP 248 355 355 ASP ASP B . n 
B 1 249 LEU 249 356 356 LEU LEU B . n 
B 1 250 ARG 250 357 357 ARG ARG B . n 
B 1 251 GLN 251 358 358 GLN GLN B . n 
B 1 252 LYS 252 359 359 LYS LYS B . n 
B 1 253 CYS 253 360 360 CYS CYS B . n 
B 1 254 THR 254 361 361 THR THR B . n 
B 1 255 GLU 255 362 362 GLU GLU B . n 
B 1 256 SER 256 363 363 SER SER B . n 
B 1 257 HIS 257 364 364 HIS HIS B . n 
B 1 258 THR 258 365 365 THR THR B . n 
B 1 259 GLY 259 366 366 GLY GLY B . n 
B 1 260 THR 260 367 367 THR THR B . n 
B 1 261 SER 261 368 368 SER SER B . n 
B 1 262 ALA 262 369 369 ALA ALA B . n 
B 1 263 SER 263 370 370 SER SER B . n 
B 1 264 ALA 264 371 371 ALA ALA B . n 
B 1 265 PRO 265 372 372 PRO PRO B . n 
B 1 266 LEU 266 373 373 LEU LEU B . n 
B 1 267 ALA 267 374 374 ALA ALA B . n 
B 1 268 ALA 268 375 375 ALA ALA B . n 
B 1 269 GLY 269 376 376 GLY GLY B . n 
B 1 270 ILE 270 377 377 ILE ILE B . n 
B 1 271 ILE 271 378 378 ILE ILE B . n 
B 1 272 ALA 272 379 379 ALA ALA B . n 
B 1 273 LEU 273 380 380 LEU LEU B . n 
B 1 274 THR 274 381 381 THR THR B . n 
B 1 275 LEU 275 382 382 LEU LEU B . n 
B 1 276 GLU 276 383 383 GLU GLU B . n 
B 1 277 ALA 277 384 384 ALA ALA B . n 
B 1 278 ASN 278 385 385 ASN ASN B . n 
B 1 279 LYS 279 386 386 LYS LYS B . n 
B 1 280 ASN 280 387 387 ASN ASN B . n 
B 1 281 LEU 281 388 388 LEU LEU B . n 
B 1 282 THR 282 389 389 THR THR B . n 
B 1 283 TRP 283 390 390 TRP TRP B . n 
B 1 284 ARG 284 391 391 ARG ARG B . n 
B 1 285 ASP 285 392 392 ASP ASP B . n 
B 1 286 MET 286 393 393 MET MET B . n 
B 1 287 GLN 287 394 394 GLN GLN B . n 
B 1 288 HIS 288 395 395 HIS HIS B . n 
B 1 289 LEU 289 396 396 LEU LEU B . n 
B 1 290 VAL 290 397 397 VAL VAL B . n 
B 1 291 VAL 291 398 398 VAL VAL B . n 
B 1 292 GLN 292 399 399 GLN GLN B . n 
B 1 293 THR 293 400 400 THR THR B . n 
B 1 294 SER 294 401 401 SER SER B . n 
B 1 295 LYS 295 402 402 LYS LYS B . n 
B 1 296 PRO 296 403 403 PRO PRO B . n 
B 1 297 ALA 297 404 404 ALA ALA B . n 
B 1 298 HIS 298 405 405 HIS HIS B . n 
B 1 299 LEU 299 406 406 LEU LEU B . n 
B 1 300 ASN 300 407 407 ASN ASN B . n 
B 1 301 ALA 301 408 408 ALA ALA B . n 
B 1 302 ASN 302 409 409 ASN ASN B . n 
B 1 303 ASP 303 410 410 ASP ASP B . n 
B 1 304 TRP 304 411 411 TRP TRP B . n 
B 1 305 ALA 305 412 412 ALA ALA B . n 
B 1 306 THR 306 413 413 THR THR B . n 
B 1 307 ASN 307 414 414 ASN ASN B . n 
B 1 308 GLY 308 415 415 GLY GLY B . n 
B 1 309 VAL 309 416 416 VAL VAL B . n 
B 1 310 GLY 310 417 417 GLY GLY B . n 
B 1 311 ARG 311 418 418 ARG ARG B . n 
B 1 312 LYS 312 419 419 LYS LYS B . n 
B 1 313 VAL 313 420 420 VAL VAL B . n 
B 1 314 SER 314 421 421 SER SER B . n 
B 1 315 HIS 315 422 422 HIS HIS B . n 
B 1 316 SER 316 423 423 SER SER B . n 
B 1 317 TYR 317 424 424 TYR TYR B . n 
B 1 318 GLY 318 425 425 GLY GLY B . n 
B 1 319 TYR 319 426 426 TYR TYR B . n 
B 1 320 GLY 320 427 427 GLY GLY B . n 
B 1 321 LEU 321 428 428 LEU LEU B . n 
B 1 322 LEU 322 429 429 LEU LEU B . n 
B 1 323 ASP 323 430 430 ASP ASP B . n 
B 1 324 ALA 324 431 431 ALA ALA B . n 
B 1 325 GLY 325 432 432 GLY GLY B . n 
B 1 326 ALA 326 433 433 ALA ALA B . n 
B 1 327 MET 327 434 434 MET MET B . n 
B 1 328 VAL 328 435 435 VAL VAL B . n 
B 1 329 ALA 329 436 436 ALA ALA B . n 
B 1 330 LEU 330 437 437 LEU LEU B . n 
B 1 331 ALA 331 438 438 ALA ALA B . n 
B 1 332 GLN 332 439 439 GLN GLN B . n 
B 1 333 ASN 333 440 440 ASN ASN B . n 
B 1 334 TRP 334 441 441 TRP TRP B . n 
B 1 335 THR 335 442 442 THR THR B . n 
B 1 336 THR 336 443 443 THR THR B . n 
B 1 337 VAL 337 444 444 VAL VAL B . n 
B 1 338 ALA 338 445 445 ALA ALA B . n 
B 1 339 PRO 339 446 446 PRO PRO B . n 
B 1 340 GLN 340 447 447 GLN GLN B . n 
B 1 341 ARG 341 448 448 ARG ARG B . n 
B 1 342 LYS 342 449 449 LYS LYS B . n 
B 1 343 CYS 343 450 450 CYS CYS B . n 
B 1 344 ILE 344 451 451 ILE ILE B . n 
B 1 345 ILE 345 452 452 ILE ILE B . n 
B 1 346 ASP 346 453 453 ASP ASP B . n 
B 1 347 ILE 347 454 454 ILE ILE B . n 
B 1 348 LEU 348 455 455 LEU LEU B . n 
B 1 349 THR 349 456 456 THR THR B . n 
B 1 350 GLU 350 457 457 GLU GLU B . n 
B 1 351 PRO 351 458 458 PRO PRO B . n 
B 1 352 LYS 352 459 459 LYS LYS B . n 
B 1 353 ASP 353 460 460 ASP ASP B . n 
B 1 354 ILE 354 461 461 ILE ILE B . n 
B 1 355 GLY 355 462 462 GLY GLY B . n 
B 1 356 LYS 356 463 463 LYS LYS B . n 
B 1 357 ARG 357 464 464 ARG ARG B . n 
B 1 358 LEU 358 465 465 LEU LEU B . n 
B 1 359 GLU 359 466 466 GLU GLU B . n 
B 1 360 VAL 360 467 467 VAL VAL B . n 
B 1 361 ARG 361 468 468 ARG ARG B . n 
B 1 362 LYS 362 469 469 LYS LYS B . n 
B 1 363 THR 363 470 470 THR THR B . n 
B 1 364 VAL 364 471 471 VAL VAL B . n 
B 1 365 THR 365 472 472 THR THR B . n 
B 1 366 ALA 366 473 473 ALA ALA B . n 
B 1 367 CYS 367 474 474 CYS CYS B . n 
B 1 368 LEU 368 475 475 LEU LEU B . n 
B 1 369 GLY 369 476 476 GLY GLY B . n 
B 1 370 GLU 370 477 477 GLU GLU B . n 
B 1 371 PRO 371 478 478 PRO PRO B . n 
B 1 372 ASN 372 479 479 ASN ASN B . n 
B 1 373 HIS 373 480 480 HIS HIS B . n 
B 1 374 ILE 374 481 481 ILE ILE B . n 
B 1 375 THR 375 482 482 THR THR B . n 
B 1 376 ARG 376 483 483 ARG ARG B . n 
B 1 377 LEU 377 484 484 LEU LEU B . n 
B 1 378 GLU 378 485 485 GLU GLU B . n 
B 1 379 HIS 379 486 486 HIS HIS B . n 
B 1 380 ALA 380 487 487 ALA ALA B . n 
B 1 381 GLN 381 488 488 GLN GLN B . n 
B 1 382 ALA 382 489 489 ALA ALA B . n 
B 1 383 ARG 383 490 490 ARG ARG B . n 
B 1 384 LEU 384 491 491 LEU LEU B . n 
B 1 385 THR 385 492 492 THR THR B . n 
B 1 386 LEU 386 493 493 LEU LEU B . n 
B 1 387 SER 387 494 494 SER SER B . n 
B 1 388 TYR 388 495 495 TYR TYR B . n 
B 1 389 ASN 389 496 496 ASN ASN B . n 
B 1 390 ARG 390 497 497 ARG ARG B . n 
B 1 391 ARG 391 498 498 ARG ARG B . n 
B 1 392 GLY 392 499 499 GLY GLY B . n 
B 1 393 ASP 393 500 500 ASP ASP B . n 
B 1 394 LEU 394 501 501 LEU LEU B . n 
B 1 395 ALA 395 502 502 ALA ALA B . n 
B 1 396 ILE 396 503 503 ILE ILE B . n 
B 1 397 HIS 397 504 504 HIS HIS B . n 
B 1 398 LEU 398 505 505 LEU LEU B . n 
B 1 399 VAL 399 506 506 VAL VAL B . n 
B 1 400 SER 400 507 507 SER SER B . n 
B 1 401 PRO 401 508 508 PRO PRO B . n 
B 1 402 MET 402 509 509 MET MET B . n 
B 1 403 GLY 403 510 510 GLY GLY B . n 
B 1 404 THR 404 511 511 THR THR B . n 
B 1 405 ARG 405 512 512 ARG ARG B . n 
B 1 406 SER 406 513 513 SER SER B . n 
B 1 407 THR 407 514 514 THR THR B . n 
B 1 408 LEU 408 515 515 LEU LEU B . n 
B 1 409 LEU 409 516 516 LEU LEU B . n 
B 1 410 ALA 410 517 517 ALA ALA B . n 
B 1 411 ALA 411 518 518 ALA ALA B . n 
B 1 412 ARG 412 519 519 ARG ARG B . n 
B 1 413 PRO 413 520 520 PRO PRO B . n 
B 1 414 HIS 414 521 521 HIS HIS B . n 
B 1 415 ASP 415 522 522 ASP ASP B . n 
B 1 416 TYR 416 523 523 TYR TYR B . n 
B 1 417 SER 417 524 524 SER SER B . n 
B 1 418 ALA 418 525 525 ALA ALA B . n 
B 1 419 ASP 419 526 526 ASP ASP B . n 
B 1 420 GLY 420 527 527 GLY GLY B . n 
B 1 421 PHE 421 528 528 PHE PHE B . n 
B 1 422 ASN 422 529 529 ASN ASN B . n 
B 1 423 ASP 423 530 530 ASP ASP B . n 
B 1 424 TRP 424 531 531 TRP TRP B . n 
B 1 425 ALA 425 532 532 ALA ALA B . n 
B 1 426 PHE 426 533 533 PHE PHE B . n 
B 1 427 MET 427 534 534 MET MET B . n 
B 1 428 THR 428 535 535 THR THR B . n 
B 1 429 THR 429 536 536 THR THR B . n 
B 1 430 HIS 430 537 537 HIS HIS B . n 
B 1 431 SER 431 538 538 SER SER B . n 
B 1 432 TRP 432 539 539 TRP TRP B . n 
B 1 433 ASP 433 540 540 ASP ASP B . n 
B 1 434 GLU 434 541 541 GLU GLU B . n 
B 1 435 ASP 435 542 542 ASP ASP B . n 
B 1 436 PRO 436 543 543 PRO PRO B . n 
B 1 437 SER 437 544 544 SER SER B . n 
B 1 438 GLY 438 545 545 GLY GLY B . n 
B 1 439 GLU 439 546 546 GLU GLU B . n 
B 1 440 TRP 440 547 547 TRP TRP B . n 
B 1 441 VAL 441 548 548 VAL VAL B . n 
B 1 442 LEU 442 549 549 LEU LEU B . n 
B 1 443 GLU 443 550 550 GLU GLU B . n 
B 1 444 ILE 444 551 551 ILE ILE B . n 
B 1 445 GLU 445 552 552 GLU GLU B . n 
B 1 446 ASN 446 553 553 ASN ASN B . n 
B 1 447 THR 447 554 554 THR THR B . n 
B 1 448 SER 448 555 555 SER SER B . n 
B 1 449 GLU 449 556 556 GLU GLU B . n 
B 1 450 ALA 450 557 557 ALA ALA B . n 
B 1 451 ASN 451 558 558 ASN ASN B . n 
B 1 452 ASN 452 559 559 ASN ASN B . n 
B 1 453 TYR 453 560 560 TYR TYR B . n 
B 1 454 GLY 454 561 561 GLY GLY B . n 
B 1 455 THR 455 562 562 THR THR B . n 
B 1 456 LEU 456 563 563 LEU LEU B . n 
B 1 457 THR 457 564 564 THR THR B . n 
B 1 458 LYS 458 565 565 LYS LYS B . n 
B 1 459 PHE 459 566 566 PHE PHE B . n 
B 1 460 THR 460 567 567 THR THR B . n 
B 1 461 LEU 461 568 568 LEU LEU B . n 
B 1 462 VAL 462 569 569 VAL VAL B . n 
B 1 463 LEU 463 570 570 LEU LEU B . n 
B 1 464 TYR 464 571 571 TYR TYR B . n 
B 1 465 GLY 465 572 572 GLY GLY B . n 
B 1 466 THR 466 573 573 THR THR B . n 
B 1 467 ALA 467 574 574 ALA ALA B . n 
B 1 468 SER 468 575 575 SER SER B . n 
B 1 469 GLY 469 576 576 GLY GLY B . n 
B 1 470 SER 470 577 577 SER SER B . n 
B 1 471 LEU 471 578 578 LEU LEU B . n 
B 1 472 VAL 472 579 ?   ?   ?   B . n 
B 1 473 PRO 473 580 ?   ?   ?   B . n 
B 1 474 ARG 474 581 ?   ?   ?   B . n 
B 1 475 GLY 475 582 ?   ?   ?   B . n 
B 1 476 SER 476 583 ?   ?   ?   B . n 
B 1 477 HIS 477 584 ?   ?   ?   B . n 
B 1 478 HIS 478 585 ?   ?   ?   B . n 
B 1 479 HIS 479 586 ?   ?   ?   B . n 
B 1 480 HIS 480 587 ?   ?   ?   B . n 
B 1 481 HIS 481 588 ?   ?   ?   B . n 
B 1 482 HIS 482 589 ?   ?   ?   B . n 
C 2 1   GLN 1   1   1   GLN GLN C . n 
C 2 2   VAL 2   2   2   VAL VAL C . n 
C 2 3   GLN 3   3   3   GLN GLN C . n 
C 2 4   LEU 4   4   4   LEU LEU C . n 
C 2 5   GLN 5   5   5   GLN GLN C . n 
C 2 6   GLU 6   6   6   GLU GLU C . n 
C 2 7   SER 7   7   7   SER SER C . n 
C 2 8   GLY 8   8   8   GLY GLY C . n 
C 2 9   GLY 9   9   9   GLY GLY C . n 
C 2 10  GLY 10  10  10  GLY GLY C . n 
C 2 11  LEU 11  11  11  LEU LEU C . n 
C 2 12  VAL 12  12  12  VAL VAL C . n 
C 2 13  GLN 13  13  13  GLN GLN C . n 
C 2 14  PRO 14  14  14  PRO PRO C . n 
C 2 15  GLY 15  15  15  GLY GLY C . n 
C 2 16  GLY 16  16  16  GLY GLY C . n 
C 2 17  SER 17  17  17  SER SER C . n 
C 2 18  LEU 18  18  18  LEU LEU C . n 
C 2 19  THR 19  19  19  THR THR C . n 
C 2 20  LEU 20  20  20  LEU LEU C . n 
C 2 21  SER 21  21  21  SER SER C . n 
C 2 22  CYS 22  22  22  CYS CYS C . n 
C 2 23  ALA 23  23  23  ALA ALA C . n 
C 2 24  ALA 24  24  24  ALA ALA C . n 
C 2 25  SER 25  25  25  SER SER C . n 
C 2 26  GLY 26  26  26  GLY GLY C . n 
C 2 27  PHE 27  27  27  PHE PHE C . n 
C 2 28  THR 28  28  28  THR THR C . n 
C 2 29  PHE 29  29  29  PHE PHE C . n 
C 2 30  SER 30  30  30  SER SER C . n 
C 2 31  SER 31  31  31  SER SER C . n 
C 2 32  TYR 32  32  32  TYR TYR C . n 
C 2 33  SER 33  33  33  SER SER C . n 
C 2 34  MET 34  34  34  MET MET C . n 
C 2 35  TYR 35  35  35  TYR TYR C . n 
C 2 36  TRP 36  36  36  TRP TRP C . n 
C 2 37  VAL 37  37  37  VAL VAL C . n 
C 2 38  ARG 38  38  38  ARG ARG C . n 
C 2 39  GLN 39  39  39  GLN GLN C . n 
C 2 40  ALA 40  40  40  ALA ALA C . n 
C 2 41  PRO 41  41  41  PRO PRO C . n 
C 2 42  GLY 42  42  42  GLY GLY C . n 
C 2 43  LYS 43  43  43  LYS LYS C . n 
C 2 44  GLY 44  44  44  GLY GLY C . n 
C 2 45  LEU 45  45  45  LEU LEU C . n 
C 2 46  GLU 46  46  46  GLU GLU C . n 
C 2 47  TRP 47  47  47  TRP TRP C . n 
C 2 48  VAL 48  48  48  VAL VAL C . n 
C 2 49  SER 49  49  49  SER SER C . n 
C 2 50  SER 50  50  50  SER SER C . n 
C 2 51  ILE 51  51  51  ILE ILE C . n 
C 2 52  ASN 52  52  52  ASN ASN C . n 
C 2 53  ARG 53  53  53  ARG ARG C . n 
C 2 54  VAL 54  54  54  VAL VAL C . n 
C 2 55  GLY 55  55  55  GLY GLY C . n 
C 2 56  SER 56  56  56  SER SER C . n 
C 2 57  ASN 57  57  57  ASN ASN C . n 
C 2 58  THR 58  58  58  THR THR C . n 
C 2 59  ASP 59  59  59  ASP ASP C . n 
C 2 60  TYR 60  60  60  TYR TYR C . n 
C 2 61  ALA 61  61  61  ALA ALA C . n 
C 2 62  ASP 62  62  62  ASP ASP C . n 
C 2 63  SER 63  63  63  SER SER C . n 
C 2 64  VAL 64  64  64  VAL VAL C . n 
C 2 65  LYS 65  65  65  LYS LYS C . n 
C 2 66  GLY 66  66  66  GLY GLY C . n 
C 2 67  ARG 67  67  67  ARG ARG C . n 
C 2 68  PHE 68  68  68  PHE PHE C . n 
C 2 69  THR 69  69  69  THR THR C . n 
C 2 70  ILE 70  70  70  ILE ILE C . n 
C 2 71  SER 71  71  71  SER SER C . n 
C 2 72  ARG 72  72  72  ARG ARG C . n 
C 2 73  ASP 73  73  73  ASP ASP C . n 
C 2 74  ASN 74  74  74  ASN ASN C . n 
C 2 75  ALA 75  75  75  ALA ALA C . n 
C 2 76  LYS 76  76  76  LYS LYS C . n 
C 2 77  ASN 77  77  77  ASN ASN C . n 
C 2 78  THR 78  78  78  THR THR C . n 
C 2 79  LEU 79  79  79  LEU LEU C . n 
C 2 80  TYR 80  80  80  TYR TYR C . n 
C 2 81  LEU 81  81  81  LEU LEU C . n 
C 2 82  GLN 82  82  82  GLN GLN C . n 
C 2 83  MET 83  83  83  MET MET C . n 
C 2 84  ASN 84  84  84  ASN ASN C . n 
C 2 85  SER 85  85  85  SER SER C . n 
C 2 86  LEU 86  86  86  LEU LEU C . n 
C 2 87  LYS 87  87  87  LYS LYS C . n 
C 2 88  SER 88  88  88  SER SER C . n 
C 2 89  GLU 89  89  89  GLU GLU C . n 
C 2 90  ASP 90  90  90  ASP ASP C . n 
C 2 91  THR 91  91  91  THR THR C . n 
C 2 92  ALA 92  92  92  ALA ALA C . n 
C 2 93  LEU 93  93  93  LEU LEU C . n 
C 2 94  TYR 94  94  94  TYR TYR C . n 
C 2 95  TYR 95  95  95  TYR TYR C . n 
C 2 96  CYS 96  96  96  CYS CYS C . n 
C 2 97  ALA 97  97  97  ALA ALA C . n 
C 2 98  VAL 98  98  98  VAL VAL C . n 
C 2 99  GLY 99  99  99  GLY GLY C . n 
C 2 100 MET 100 100 100 MET MET C . n 
C 2 101 TYR 101 101 101 TYR TYR C . n 
C 2 102 ALA 102 102 102 ALA ALA C . n 
C 2 103 ALA 103 103 103 ALA ALA C . n 
C 2 104 PRO 104 104 104 PRO PRO C . n 
C 2 105 PRO 105 105 105 PRO PRO C . n 
C 2 106 TRP 106 106 106 TRP TRP C . n 
C 2 107 ARG 107 107 107 ARG ARG C . n 
C 2 108 GLY 108 108 108 GLY GLY C . n 
C 2 109 GLN 109 109 109 GLN GLN C . n 
C 2 110 GLY 110 110 110 GLY GLY C . n 
C 2 111 THR 111 111 111 THR THR C . n 
C 2 112 GLN 112 112 112 GLN GLN C . n 
C 2 113 VAL 113 113 113 VAL VAL C . n 
C 2 114 THR 114 114 114 THR THR C . n 
C 2 115 VAL 115 115 115 VAL VAL C . n 
C 2 116 SER 116 116 ?   ?   ?   C . n 
C 2 117 SER 117 117 ?   ?   ?   C . n 
D 2 1   GLN 1   1   1   GLN GLN D . n 
D 2 2   VAL 2   2   2   VAL VAL D . n 
D 2 3   GLN 3   3   3   GLN GLN D . n 
D 2 4   LEU 4   4   4   LEU LEU D . n 
D 2 5   GLN 5   5   5   GLN GLN D . n 
D 2 6   GLU 6   6   6   GLU GLU D . n 
D 2 7   SER 7   7   7   SER SER D . n 
D 2 8   GLY 8   8   8   GLY GLY D . n 
D 2 9   GLY 9   9   9   GLY GLY D . n 
D 2 10  GLY 10  10  10  GLY GLY D . n 
D 2 11  LEU 11  11  11  LEU LEU D . n 
D 2 12  VAL 12  12  12  VAL VAL D . n 
D 2 13  GLN 13  13  13  GLN GLN D . n 
D 2 14  PRO 14  14  14  PRO PRO D . n 
D 2 15  GLY 15  15  15  GLY GLY D . n 
D 2 16  GLY 16  16  16  GLY GLY D . n 
D 2 17  SER 17  17  17  SER SER D . n 
D 2 18  LEU 18  18  18  LEU LEU D . n 
D 2 19  THR 19  19  19  THR THR D . n 
D 2 20  LEU 20  20  20  LEU LEU D . n 
D 2 21  SER 21  21  21  SER SER D . n 
D 2 22  CYS 22  22  22  CYS CYS D . n 
D 2 23  ALA 23  23  23  ALA ALA D . n 
D 2 24  ALA 24  24  24  ALA ALA D . n 
D 2 25  SER 25  25  25  SER SER D . n 
D 2 26  GLY 26  26  26  GLY GLY D . n 
D 2 27  PHE 27  27  27  PHE PHE D . n 
D 2 28  THR 28  28  28  THR THR D . n 
D 2 29  PHE 29  29  29  PHE PHE D . n 
D 2 30  SER 30  30  30  SER SER D . n 
D 2 31  SER 31  31  31  SER SER D . n 
D 2 32  TYR 32  32  32  TYR TYR D . n 
D 2 33  SER 33  33  33  SER SER D . n 
D 2 34  MET 34  34  34  MET MET D . n 
D 2 35  TYR 35  35  35  TYR TYR D . n 
D 2 36  TRP 36  36  36  TRP TRP D . n 
D 2 37  VAL 37  37  37  VAL VAL D . n 
D 2 38  ARG 38  38  38  ARG ARG D . n 
D 2 39  GLN 39  39  39  GLN GLN D . n 
D 2 40  ALA 40  40  40  ALA ALA D . n 
D 2 41  PRO 41  41  41  PRO PRO D . n 
D 2 42  GLY 42  42  42  GLY GLY D . n 
D 2 43  LYS 43  43  43  LYS LYS D . n 
D 2 44  GLY 44  44  44  GLY GLY D . n 
D 2 45  LEU 45  45  45  LEU LEU D . n 
D 2 46  GLU 46  46  46  GLU GLU D . n 
D 2 47  TRP 47  47  47  TRP TRP D . n 
D 2 48  VAL 48  48  48  VAL VAL D . n 
D 2 49  SER 49  49  49  SER SER D . n 
D 2 50  SER 50  50  50  SER SER D . n 
D 2 51  ILE 51  51  51  ILE ILE D . n 
D 2 52  ASN 52  52  52  ASN ASN D . n 
D 2 53  ARG 53  53  53  ARG ARG D . n 
D 2 54  VAL 54  54  54  VAL VAL D . n 
D 2 55  GLY 55  55  55  GLY GLY D . n 
D 2 56  SER 56  56  56  SER SER D . n 
D 2 57  ASN 57  57  57  ASN ASN D . n 
D 2 58  THR 58  58  58  THR THR D . n 
D 2 59  ASP 59  59  59  ASP ASP D . n 
D 2 60  TYR 60  60  60  TYR TYR D . n 
D 2 61  ALA 61  61  61  ALA ALA D . n 
D 2 62  ASP 62  62  62  ASP ASP D . n 
D 2 63  SER 63  63  63  SER SER D . n 
D 2 64  VAL 64  64  64  VAL VAL D . n 
D 2 65  LYS 65  65  65  LYS LYS D . n 
D 2 66  GLY 66  66  66  GLY GLY D . n 
D 2 67  ARG 67  67  67  ARG ARG D . n 
D 2 68  PHE 68  68  68  PHE PHE D . n 
D 2 69  THR 69  69  69  THR THR D . n 
D 2 70  ILE 70  70  70  ILE ILE D . n 
D 2 71  SER 71  71  71  SER SER D . n 
D 2 72  ARG 72  72  72  ARG ARG D . n 
D 2 73  ASP 73  73  73  ASP ASP D . n 
D 2 74  ASN 74  74  74  ASN ASN D . n 
D 2 75  ALA 75  75  75  ALA ALA D . n 
D 2 76  LYS 76  76  76  LYS LYS D . n 
D 2 77  ASN 77  77  77  ASN ASN D . n 
D 2 78  THR 78  78  78  THR THR D . n 
D 2 79  LEU 79  79  79  LEU LEU D . n 
D 2 80  TYR 80  80  80  TYR TYR D . n 
D 2 81  LEU 81  81  81  LEU LEU D . n 
D 2 82  GLN 82  82  82  GLN GLN D . n 
D 2 83  MET 83  83  83  MET MET D . n 
D 2 84  ASN 84  84  84  ASN ASN D . n 
D 2 85  SER 85  85  85  SER SER D . n 
D 2 86  LEU 86  86  86  LEU LEU D . n 
D 2 87  LYS 87  87  87  LYS LYS D . n 
D 2 88  SER 88  88  88  SER SER D . n 
D 2 89  GLU 89  89  89  GLU GLU D . n 
D 2 90  ASP 90  90  90  ASP ASP D . n 
D 2 91  THR 91  91  91  THR THR D . n 
D 2 92  ALA 92  92  92  ALA ALA D . n 
D 2 93  LEU 93  93  93  LEU LEU D . n 
D 2 94  TYR 94  94  94  TYR TYR D . n 
D 2 95  TYR 95  95  95  TYR TYR D . n 
D 2 96  CYS 96  96  96  CYS CYS D . n 
D 2 97  ALA 97  97  97  ALA ALA D . n 
D 2 98  VAL 98  98  98  VAL VAL D . n 
D 2 99  GLY 99  99  99  GLY GLY D . n 
D 2 100 MET 100 100 100 MET MET D . n 
D 2 101 TYR 101 101 101 TYR TYR D . n 
D 2 102 ALA 102 102 102 ALA ALA D . n 
D 2 103 ALA 103 103 103 ALA ALA D . n 
D 2 104 PRO 104 104 104 PRO PRO D . n 
D 2 105 PRO 105 105 105 PRO PRO D . n 
D 2 106 TRP 106 106 106 TRP TRP D . n 
D 2 107 ARG 107 107 107 ARG ARG D . n 
D 2 108 GLY 108 108 108 GLY GLY D . n 
D 2 109 GLN 109 109 109 GLN GLN D . n 
D 2 110 GLY 110 110 110 GLY GLY D . n 
D 2 111 THR 111 111 111 THR THR D . n 
D 2 112 GLN 112 112 112 GLN GLN D . n 
D 2 113 VAL 113 113 113 VAL VAL D . n 
D 2 114 THR 114 114 114 THR THR D . n 
D 2 115 VAL 115 115 115 VAL VAL D . n 
D 2 116 SER 116 116 116 SER SER D . n 
D 2 117 SER 117 117 117 SER SER D . n 
E 3 1   DKA 1   1   1   DKA DKA G . n 
E 3 2   ARG 2   2   1   ARG ARG G . n 
E 3 3   VAL 3   3   1   VAL VAL G . n 
E 3 4   LYS 4   4   1   LYS LYS G . n 
E 3 5   AR7 5   5   1   AR7 AR7 G . n 
E 3 6   0QE 6   6   1   0QE 0QE G . n 
F 3 1   DKA 1   2   2   DKA DKA H . n 
F 3 2   ARG 2   3   2   ARG ARG H . n 
F 3 3   VAL 3   4   2   VAL VAL H . n 
F 3 4   LYS 4   5   2   LYS LYS H . n 
F 3 5   AR7 5   6   2   AR7 AR7 H . n 
F 3 6   0QE 6   7   2   0QE 0QE H . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 NAG 1   601  600  NAG NAG A . 
H 4 NAG 1   602  601  NAG NAG A . 
I 5 CA  1   603  1    CA  CA  A . 
J 5 CA  1   604  2    CA  CA  A . 
K 5 CA  1   605  3    CA  CA  A . 
L 6 NA  1   606  7    NA  NA  A . 
M 4 NAG 1   601  600  NAG NAG B . 
N 4 NAG 1   602  601  NAG NAG B . 
O 5 CA  1   603  4    CA  CA  B . 
P 5 CA  1   604  5    CA  CA  B . 
Q 5 CA  1   605  6    CA  CA  B . 
R 6 NA  1   606  8    NA  NA  B . 
S 7 HOH 1   701  389  HOH HOH A . 
S 7 HOH 2   702  144  HOH HOH A . 
S 7 HOH 3   703  229  HOH HOH A . 
S 7 HOH 4   704  617  HOH HOH A . 
S 7 HOH 5   705  497  HOH HOH A . 
S 7 HOH 6   706  335  HOH HOH A . 
S 7 HOH 7   707  74   HOH HOH A . 
S 7 HOH 8   708  116  HOH HOH A . 
S 7 HOH 9   709  997  HOH HOH A . 
S 7 HOH 10  710  795  HOH HOH A . 
S 7 HOH 11  711  187  HOH HOH A . 
S 7 HOH 12  712  990  HOH HOH A . 
S 7 HOH 13  713  230  HOH HOH A . 
S 7 HOH 14  714  628  HOH HOH A . 
S 7 HOH 15  715  1010 HOH HOH A . 
S 7 HOH 16  716  326  HOH HOH A . 
S 7 HOH 17  717  224  HOH HOH A . 
S 7 HOH 18  718  49   HOH HOH A . 
S 7 HOH 19  719  318  HOH HOH A . 
S 7 HOH 20  720  378  HOH HOH A . 
S 7 HOH 21  721  734  HOH HOH A . 
S 7 HOH 22  722  349  HOH HOH A . 
S 7 HOH 23  723  845  HOH HOH A . 
S 7 HOH 24  724  158  HOH HOH A . 
S 7 HOH 25  725  348  HOH HOH A . 
S 7 HOH 26  726  233  HOH HOH A . 
S 7 HOH 27  727  225  HOH HOH A . 
S 7 HOH 28  728  533  HOH HOH A . 
S 7 HOH 29  729  1066 HOH HOH A . 
S 7 HOH 30  730  495  HOH HOH A . 
S 7 HOH 31  731  1081 HOH HOH A . 
S 7 HOH 32  732  379  HOH HOH A . 
S 7 HOH 33  733  595  HOH HOH A . 
S 7 HOH 34  734  440  HOH HOH A . 
S 7 HOH 35  735  151  HOH HOH A . 
S 7 HOH 36  736  195  HOH HOH A . 
S 7 HOH 37  737  1003 HOH HOH A . 
S 7 HOH 38  738  198  HOH HOH A . 
S 7 HOH 39  739  16   HOH HOH A . 
S 7 HOH 40  740  196  HOH HOH A . 
S 7 HOH 41  741  309  HOH HOH A . 
S 7 HOH 42  742  244  HOH HOH A . 
S 7 HOH 43  743  679  HOH HOH A . 
S 7 HOH 44  744  48   HOH HOH A . 
S 7 HOH 45  745  217  HOH HOH A . 
S 7 HOH 46  746  563  HOH HOH A . 
S 7 HOH 47  747  558  HOH HOH A . 
S 7 HOH 48  748  546  HOH HOH A . 
S 7 HOH 49  749  246  HOH HOH A . 
S 7 HOH 50  750  978  HOH HOH A . 
S 7 HOH 51  751  1011 HOH HOH A . 
S 7 HOH 52  752  992  HOH HOH A . 
S 7 HOH 53  753  338  HOH HOH A . 
S 7 HOH 54  754  23   HOH HOH A . 
S 7 HOH 55  755  169  HOH HOH A . 
S 7 HOH 56  756  176  HOH HOH A . 
S 7 HOH 57  757  438  HOH HOH A . 
S 7 HOH 58  758  609  HOH HOH A . 
S 7 HOH 59  759  804  HOH HOH A . 
S 7 HOH 60  760  441  HOH HOH A . 
S 7 HOH 61  761  650  HOH HOH A . 
S 7 HOH 62  762  148  HOH HOH A . 
S 7 HOH 63  763  24   HOH HOH A . 
S 7 HOH 64  764  68   HOH HOH A . 
S 7 HOH 65  765  13   HOH HOH A . 
S 7 HOH 66  766  435  HOH HOH A . 
S 7 HOH 67  767  293  HOH HOH A . 
S 7 HOH 68  768  180  HOH HOH A . 
S 7 HOH 69  769  1    HOH HOH A . 
S 7 HOH 70  770  206  HOH HOH A . 
S 7 HOH 71  771  947  HOH HOH A . 
S 7 HOH 72  772  509  HOH HOH A . 
S 7 HOH 73  773  165  HOH HOH A . 
S 7 HOH 74  774  70   HOH HOH A . 
S 7 HOH 75  775  17   HOH HOH A . 
S 7 HOH 76  776  971  HOH HOH A . 
S 7 HOH 77  777  1053 HOH HOH A . 
S 7 HOH 78  778  285  HOH HOH A . 
S 7 HOH 79  779  253  HOH HOH A . 
S 7 HOH 80  780  555  HOH HOH A . 
S 7 HOH 81  781  154  HOH HOH A . 
S 7 HOH 82  782  152  HOH HOH A . 
S 7 HOH 83  783  201  HOH HOH A . 
S 7 HOH 84  784  19   HOH HOH A . 
S 7 HOH 85  785  655  HOH HOH A . 
S 7 HOH 86  786  288  HOH HOH A . 
S 7 HOH 87  787  260  HOH HOH A . 
S 7 HOH 88  788  43   HOH HOH A . 
S 7 HOH 89  789  40   HOH HOH A . 
S 7 HOH 90  790  1095 HOH HOH A . 
S 7 HOH 91  791  600  HOH HOH A . 
S 7 HOH 92  792  247  HOH HOH A . 
S 7 HOH 93  793  254  HOH HOH A . 
S 7 HOH 94  794  330  HOH HOH A . 
S 7 HOH 95  795  46   HOH HOH A . 
S 7 HOH 96  796  90   HOH HOH A . 
S 7 HOH 97  797  341  HOH HOH A . 
S 7 HOH 98  798  21   HOH HOH A . 
S 7 HOH 99  799  408  HOH HOH A . 
S 7 HOH 100 800  175  HOH HOH A . 
S 7 HOH 101 801  159  HOH HOH A . 
S 7 HOH 102 802  496  HOH HOH A . 
S 7 HOH 103 803  969  HOH HOH A . 
S 7 HOH 104 804  332  HOH HOH A . 
S 7 HOH 105 805  1004 HOH HOH A . 
S 7 HOH 106 806  475  HOH HOH A . 
S 7 HOH 107 807  53   HOH HOH A . 
S 7 HOH 108 808  5    HOH HOH A . 
S 7 HOH 109 809  240  HOH HOH A . 
S 7 HOH 110 810  1023 HOH HOH A . 
S 7 HOH 111 811  232  HOH HOH A . 
S 7 HOH 112 812  36   HOH HOH A . 
S 7 HOH 113 813  182  HOH HOH A . 
S 7 HOH 114 814  470  HOH HOH A . 
S 7 HOH 115 815  106  HOH HOH A . 
S 7 HOH 116 816  99   HOH HOH A . 
S 7 HOH 117 817  1079 HOH HOH A . 
S 7 HOH 118 818  62   HOH HOH A . 
S 7 HOH 119 819  143  HOH HOH A . 
S 7 HOH 120 820  213  HOH HOH A . 
S 7 HOH 121 821  541  HOH HOH A . 
S 7 HOH 122 822  630  HOH HOH A . 
S 7 HOH 123 823  665  HOH HOH A . 
S 7 HOH 124 824  964  HOH HOH A . 
S 7 HOH 125 825  263  HOH HOH A . 
S 7 HOH 126 826  490  HOH HOH A . 
S 7 HOH 127 827  157  HOH HOH A . 
S 7 HOH 128 828  1086 HOH HOH A . 
S 7 HOH 129 829  282  HOH HOH A . 
S 7 HOH 130 830  554  HOH HOH A . 
S 7 HOH 131 831  78   HOH HOH A . 
S 7 HOH 132 832  621  HOH HOH A . 
S 7 HOH 133 833  191  HOH HOH A . 
S 7 HOH 134 834  1039 HOH HOH A . 
S 7 HOH 135 835  413  HOH HOH A . 
S 7 HOH 136 836  634  HOH HOH A . 
S 7 HOH 137 837  306  HOH HOH A . 
S 7 HOH 138 838  86   HOH HOH A . 
S 7 HOH 139 839  553  HOH HOH A . 
S 7 HOH 140 840  392  HOH HOH A . 
S 7 HOH 141 841  208  HOH HOH A . 
S 7 HOH 142 842  501  HOH HOH A . 
S 7 HOH 143 843  519  HOH HOH A . 
S 7 HOH 144 844  460  HOH HOH A . 
S 7 HOH 145 845  133  HOH HOH A . 
S 7 HOH 146 846  278  HOH HOH A . 
S 7 HOH 147 847  644  HOH HOH A . 
S 7 HOH 148 848  65   HOH HOH A . 
S 7 HOH 149 849  1075 HOH HOH A . 
S 7 HOH 150 850  127  HOH HOH A . 
S 7 HOH 151 851  385  HOH HOH A . 
S 7 HOH 152 852  235  HOH HOH A . 
S 7 HOH 153 853  110  HOH HOH A . 
S 7 HOH 154 854  1055 HOH HOH A . 
S 7 HOH 155 855  1038 HOH HOH A . 
S 7 HOH 156 856  364  HOH HOH A . 
S 7 HOH 157 857  1034 HOH HOH A . 
S 7 HOH 158 858  693  HOH HOH A . 
S 7 HOH 159 859  2    HOH HOH A . 
S 7 HOH 160 860  222  HOH HOH A . 
S 7 HOH 161 861  1065 HOH HOH A . 
S 7 HOH 162 862  170  HOH HOH A . 
S 7 HOH 163 863  453  HOH HOH A . 
S 7 HOH 164 864  991  HOH HOH A . 
S 7 HOH 165 865  963  HOH HOH A . 
S 7 HOH 166 866  369  HOH HOH A . 
S 7 HOH 167 867  84   HOH HOH A . 
S 7 HOH 168 868  324  HOH HOH A . 
S 7 HOH 169 869  134  HOH HOH A . 
S 7 HOH 170 870  350  HOH HOH A . 
S 7 HOH 171 871  56   HOH HOH A . 
S 7 HOH 172 872  398  HOH HOH A . 
S 7 HOH 173 873  61   HOH HOH A . 
S 7 HOH 174 874  113  HOH HOH A . 
S 7 HOH 175 875  251  HOH HOH A . 
S 7 HOH 176 876  241  HOH HOH A . 
S 7 HOH 177 877  280  HOH HOH A . 
S 7 HOH 178 878  578  HOH HOH A . 
S 7 HOH 179 879  869  HOH HOH A . 
S 7 HOH 180 880  989  HOH HOH A . 
S 7 HOH 181 881  93   HOH HOH A . 
S 7 HOH 182 882  210  HOH HOH A . 
S 7 HOH 183 883  1048 HOH HOH A . 
S 7 HOH 184 884  1012 HOH HOH A . 
S 7 HOH 185 885  42   HOH HOH A . 
S 7 HOH 186 886  47   HOH HOH A . 
S 7 HOH 187 887  374  HOH HOH A . 
S 7 HOH 188 888  968  HOH HOH A . 
S 7 HOH 189 889  782  HOH HOH A . 
S 7 HOH 190 890  259  HOH HOH A . 
S 7 HOH 191 891  366  HOH HOH A . 
S 7 HOH 192 892  1041 HOH HOH A . 
S 7 HOH 193 893  476  HOH HOH A . 
S 7 HOH 194 894  381  HOH HOH A . 
S 7 HOH 195 895  436  HOH HOH A . 
S 7 HOH 196 896  494  HOH HOH A . 
S 7 HOH 197 897  67   HOH HOH A . 
S 7 HOH 198 898  89   HOH HOH A . 
S 7 HOH 199 899  245  HOH HOH A . 
S 7 HOH 200 900  141  HOH HOH A . 
S 7 HOH 201 901  44   HOH HOH A . 
S 7 HOH 202 902  431  HOH HOH A . 
S 7 HOH 203 903  1071 HOH HOH A . 
S 7 HOH 204 904  484  HOH HOH A . 
S 7 HOH 205 905  391  HOH HOH A . 
S 7 HOH 206 906  57   HOH HOH A . 
S 7 HOH 207 907  1090 HOH HOH A . 
S 7 HOH 208 908  286  HOH HOH A . 
S 7 HOH 209 909  290  HOH HOH A . 
S 7 HOH 210 910  71   HOH HOH A . 
S 7 HOH 211 911  987  HOH HOH A . 
S 7 HOH 212 912  405  HOH HOH A . 
S 7 HOH 213 913  118  HOH HOH A . 
S 7 HOH 214 914  354  HOH HOH A . 
S 7 HOH 215 915  97   HOH HOH A . 
S 7 HOH 216 916  646  HOH HOH A . 
S 7 HOH 217 917  300  HOH HOH A . 
S 7 HOH 218 918  386  HOH HOH A . 
S 7 HOH 219 919  1094 HOH HOH A . 
S 7 HOH 220 920  289  HOH HOH A . 
S 7 HOH 221 921  422  HOH HOH A . 
S 7 HOH 222 922  1072 HOH HOH A . 
S 7 HOH 223 923  219  HOH HOH A . 
S 7 HOH 224 924  342  HOH HOH A . 
S 7 HOH 225 925  411  HOH HOH A . 
S 7 HOH 226 926  58   HOH HOH A . 
S 7 HOH 227 927  140  HOH HOH A . 
S 7 HOH 228 928  938  HOH HOH A . 
S 7 HOH 229 929  1008 HOH HOH A . 
S 7 HOH 230 930  179  HOH HOH A . 
S 7 HOH 231 931  769  HOH HOH A . 
S 7 HOH 232 932  499  HOH HOH A . 
S 7 HOH 233 933  1025 HOH HOH A . 
S 7 HOH 234 934  653  HOH HOH A . 
S 7 HOH 235 935  1067 HOH HOH A . 
S 7 HOH 236 936  394  HOH HOH A . 
S 7 HOH 237 937  1046 HOH HOH A . 
S 7 HOH 238 938  147  HOH HOH A . 
S 7 HOH 239 939  433  HOH HOH A . 
S 7 HOH 240 940  982  HOH HOH A . 
S 7 HOH 241 941  262  HOH HOH A . 
S 7 HOH 242 942  303  HOH HOH A . 
S 7 HOH 243 943  988  HOH HOH A . 
S 7 HOH 244 944  277  HOH HOH A . 
S 7 HOH 245 945  437  HOH HOH A . 
S 7 HOH 246 946  273  HOH HOH A . 
S 7 HOH 247 947  432  HOH HOH A . 
S 7 HOH 248 948  4    HOH HOH A . 
S 7 HOH 249 949  310  HOH HOH A . 
S 7 HOH 250 950  479  HOH HOH A . 
S 7 HOH 251 951  426  HOH HOH A . 
S 7 HOH 252 952  270  HOH HOH A . 
S 7 HOH 253 953  69   HOH HOH A . 
S 7 HOH 254 954  1020 HOH HOH A . 
S 7 HOH 255 955  6    HOH HOH A . 
S 7 HOH 256 956  491  HOH HOH A . 
S 7 HOH 257 957  580  HOH HOH A . 
S 7 HOH 258 958  660  HOH HOH A . 
S 7 HOH 259 959  692  HOH HOH A . 
S 7 HOH 260 960  467  HOH HOH A . 
S 7 HOH 261 961  92   HOH HOH A . 
S 7 HOH 262 962  1009 HOH HOH A . 
S 7 HOH 263 963  1091 HOH HOH A . 
S 7 HOH 264 964  121  HOH HOH A . 
S 7 HOH 265 965  662  HOH HOH A . 
S 7 HOH 266 966  1052 HOH HOH A . 
S 7 HOH 267 967  291  HOH HOH A . 
S 7 HOH 268 968  791  HOH HOH A . 
S 7 HOH 269 969  305  HOH HOH A . 
S 7 HOH 270 970  79   HOH HOH A . 
S 7 HOH 271 971  512  HOH HOH A . 
S 7 HOH 272 972  192  HOH HOH A . 
S 7 HOH 273 973  461  HOH HOH A . 
S 7 HOH 274 974  694  HOH HOH A . 
S 7 HOH 275 975  167  HOH HOH A . 
S 7 HOH 276 976  911  HOH HOH A . 
S 7 HOH 277 977  569  HOH HOH A . 
S 7 HOH 278 978  656  HOH HOH A . 
S 7 HOH 279 979  257  HOH HOH A . 
S 7 HOH 280 980  800  HOH HOH A . 
S 7 HOH 281 981  419  HOH HOH A . 
S 7 HOH 282 982  412  HOH HOH A . 
S 7 HOH 283 983  287  HOH HOH A . 
S 7 HOH 284 984  352  HOH HOH A . 
S 7 HOH 285 985  525  HOH HOH A . 
S 7 HOH 286 986  427  HOH HOH A . 
S 7 HOH 287 987  709  HOH HOH A . 
S 7 HOH 288 988  608  HOH HOH A . 
S 7 HOH 289 989  365  HOH HOH A . 
S 7 HOH 290 990  448  HOH HOH A . 
S 7 HOH 291 991  1083 HOH HOH A . 
S 7 HOH 292 992  1082 HOH HOH A . 
S 7 HOH 293 993  749  HOH HOH A . 
S 7 HOH 294 994  672  HOH HOH A . 
S 7 HOH 295 995  996  HOH HOH A . 
S 7 HOH 296 996  142  HOH HOH A . 
S 7 HOH 297 997  743  HOH HOH A . 
S 7 HOH 298 998  353  HOH HOH A . 
S 7 HOH 299 999  382  HOH HOH A . 
S 7 HOH 300 1000 370  HOH HOH A . 
S 7 HOH 301 1001 680  HOH HOH A . 
S 7 HOH 302 1002 351  HOH HOH A . 
S 7 HOH 303 1003 771  HOH HOH A . 
S 7 HOH 304 1004 854  HOH HOH A . 
S 7 HOH 305 1005 597  HOH HOH A . 
S 7 HOH 306 1006 733  HOH HOH A . 
S 7 HOH 307 1007 826  HOH HOH A . 
S 7 HOH 308 1008 3    HOH HOH A . 
S 7 HOH 309 1009 899  HOH HOH A . 
S 7 HOH 310 1010 269  HOH HOH A . 
S 7 HOH 311 1011 683  HOH HOH A . 
S 7 HOH 312 1012 900  HOH HOH A . 
S 7 HOH 313 1013 534  HOH HOH A . 
S 7 HOH 314 1014 138  HOH HOH A . 
S 7 HOH 315 1015 226  HOH HOH A . 
S 7 HOH 316 1016 1070 HOH HOH A . 
S 7 HOH 317 1017 451  HOH HOH A . 
S 7 HOH 318 1018 551  HOH HOH A . 
S 7 HOH 319 1019 691  HOH HOH A . 
S 7 HOH 320 1020 641  HOH HOH A . 
S 7 HOH 321 1021 586  HOH HOH A . 
S 7 HOH 322 1022 818  HOH HOH A . 
S 7 HOH 323 1023 593  HOH HOH A . 
S 7 HOH 324 1024 190  HOH HOH A . 
S 7 HOH 325 1025 588  HOH HOH A . 
S 7 HOH 326 1026 698  HOH HOH A . 
S 7 HOH 327 1027 645  HOH HOH A . 
S 7 HOH 328 1028 500  HOH HOH A . 
S 7 HOH 329 1029 904  HOH HOH A . 
S 7 HOH 330 1030 421  HOH HOH A . 
S 7 HOH 331 1031 612  HOH HOH A . 
S 7 HOH 332 1032 1073 HOH HOH A . 
S 7 HOH 333 1033 296  HOH HOH A . 
S 7 HOH 334 1034 724  HOH HOH A . 
T 7 HOH 1   701  331  HOH HOH B . 
T 7 HOH 2   702  466  HOH HOH B . 
T 7 HOH 3   703  284  HOH HOH B . 
T 7 HOH 4   704  1085 HOH HOH B . 
T 7 HOH 5   705  1058 HOH HOH B . 
T 7 HOH 6   706  1042 HOH HOH B . 
T 7 HOH 7   707  654  HOH HOH B . 
T 7 HOH 8   708  83   HOH HOH B . 
T 7 HOH 9   709  424  HOH HOH B . 
T 7 HOH 10  710  1040 HOH HOH B . 
T 7 HOH 11  711  1030 HOH HOH B . 
T 7 HOH 12  712  428  HOH HOH B . 
T 7 HOH 13  713  489  HOH HOH B . 
T 7 HOH 14  714  980  HOH HOH B . 
T 7 HOH 15  715  236  HOH HOH B . 
T 7 HOH 16  716  444  HOH HOH B . 
T 7 HOH 17  717  108  HOH HOH B . 
T 7 HOH 18  718  227  HOH HOH B . 
T 7 HOH 19  719  504  HOH HOH B . 
T 7 HOH 20  720  333  HOH HOH B . 
T 7 HOH 21  721  103  HOH HOH B . 
T 7 HOH 22  722  1026 HOH HOH B . 
T 7 HOH 23  723  485  HOH HOH B . 
T 7 HOH 24  724  429  HOH HOH B . 
T 7 HOH 25  725  1024 HOH HOH B . 
T 7 HOH 26  726  164  HOH HOH B . 
T 7 HOH 27  727  149  HOH HOH B . 
T 7 HOH 28  728  712  HOH HOH B . 
T 7 HOH 29  729  1051 HOH HOH B . 
T 7 HOH 30  730  1064 HOH HOH B . 
T 7 HOH 31  731  304  HOH HOH B . 
T 7 HOH 32  732  315  HOH HOH B . 
T 7 HOH 33  733  981  HOH HOH B . 
T 7 HOH 34  734  178  HOH HOH B . 
T 7 HOH 35  735  22   HOH HOH B . 
T 7 HOH 36  736  966  HOH HOH B . 
T 7 HOH 37  737  543  HOH HOH B . 
T 7 HOH 38  738  321  HOH HOH B . 
T 7 HOH 39  739  188  HOH HOH B . 
T 7 HOH 40  740  258  HOH HOH B . 
T 7 HOH 41  741  88   HOH HOH B . 
T 7 HOH 42  742  339  HOH HOH B . 
T 7 HOH 43  743  15   HOH HOH B . 
T 7 HOH 44  744  977  HOH HOH B . 
T 7 HOH 45  745  1021 HOH HOH B . 
T 7 HOH 46  746  676  HOH HOH B . 
T 7 HOH 47  747  450  HOH HOH B . 
T 7 HOH 48  748  397  HOH HOH B . 
T 7 HOH 49  749  20   HOH HOH B . 
T 7 HOH 50  750  12   HOH HOH B . 
T 7 HOH 51  751  301  HOH HOH B . 
T 7 HOH 52  752  50   HOH HOH B . 
T 7 HOH 53  753  177  HOH HOH B . 
T 7 HOH 54  754  1099 HOH HOH B . 
T 7 HOH 55  755  410  HOH HOH B . 
T 7 HOH 56  756  125  HOH HOH B . 
T 7 HOH 57  757  9    HOH HOH B . 
T 7 HOH 58  758  511  HOH HOH B . 
T 7 HOH 59  759  211  HOH HOH B . 
T 7 HOH 60  760  455  HOH HOH B . 
T 7 HOH 61  761  1061 HOH HOH B . 
T 7 HOH 62  762  126  HOH HOH B . 
T 7 HOH 63  763  32   HOH HOH B . 
T 7 HOH 64  764  685  HOH HOH B . 
T 7 HOH 65  765  76   HOH HOH B . 
T 7 HOH 66  766  1084 HOH HOH B . 
T 7 HOH 67  767  376  HOH HOH B . 
T 7 HOH 68  768  100  HOH HOH B . 
T 7 HOH 69  769  299  HOH HOH B . 
T 7 HOH 70  770  35   HOH HOH B . 
T 7 HOH 71  771  128  HOH HOH B . 
T 7 HOH 72  772  202  HOH HOH B . 
T 7 HOH 73  773  234  HOH HOH B . 
T 7 HOH 74  774  27   HOH HOH B . 
T 7 HOH 75  775  695  HOH HOH B . 
T 7 HOH 76  776  81   HOH HOH B . 
T 7 HOH 77  777  454  HOH HOH B . 
T 7 HOH 78  778  25   HOH HOH B . 
T 7 HOH 79  779  173  HOH HOH B . 
T 7 HOH 80  780  96   HOH HOH B . 
T 7 HOH 81  781  487  HOH HOH B . 
T 7 HOH 82  782  104  HOH HOH B . 
T 7 HOH 83  783  30   HOH HOH B . 
T 7 HOH 84  784  311  HOH HOH B . 
T 7 HOH 85  785  849  HOH HOH B . 
T 7 HOH 86  786  199  HOH HOH B . 
T 7 HOH 87  787  334  HOH HOH B . 
T 7 HOH 88  788  228  HOH HOH B . 
T 7 HOH 89  789  313  HOH HOH B . 
T 7 HOH 90  790  60   HOH HOH B . 
T 7 HOH 91  791  390  HOH HOH B . 
T 7 HOH 92  792  1054 HOH HOH B . 
T 7 HOH 93  793  109  HOH HOH B . 
T 7 HOH 94  794  970  HOH HOH B . 
T 7 HOH 95  795  10   HOH HOH B . 
T 7 HOH 96  796  94   HOH HOH B . 
T 7 HOH 97  797  153  HOH HOH B . 
T 7 HOH 98  798  95   HOH HOH B . 
T 7 HOH 99  799  117  HOH HOH B . 
T 7 HOH 100 800  51   HOH HOH B . 
T 7 HOH 101 801  472  HOH HOH B . 
T 7 HOH 102 802  830  HOH HOH B . 
T 7 HOH 103 803  1016 HOH HOH B . 
T 7 HOH 104 804  972  HOH HOH B . 
T 7 HOH 105 805  1074 HOH HOH B . 
T 7 HOH 106 806  1088 HOH HOH B . 
T 7 HOH 107 807  316  HOH HOH B . 
T 7 HOH 108 808  115  HOH HOH B . 
T 7 HOH 109 809  1022 HOH HOH B . 
T 7 HOH 110 810  1045 HOH HOH B . 
T 7 HOH 111 811  14   HOH HOH B . 
T 7 HOH 112 812  85   HOH HOH B . 
T 7 HOH 113 813  480  HOH HOH B . 
T 7 HOH 114 814  322  HOH HOH B . 
T 7 HOH 115 815  135  HOH HOH B . 
T 7 HOH 116 816  601  HOH HOH B . 
T 7 HOH 117 817  506  HOH HOH B . 
T 7 HOH 118 818  107  HOH HOH B . 
T 7 HOH 119 819  26   HOH HOH B . 
T 7 HOH 120 820  279  HOH HOH B . 
T 7 HOH 121 821  1032 HOH HOH B . 
T 7 HOH 122 822  54   HOH HOH B . 
T 7 HOH 123 823  265  HOH HOH B . 
T 7 HOH 124 824  160  HOH HOH B . 
T 7 HOH 125 825  31   HOH HOH B . 
T 7 HOH 126 826  203  HOH HOH B . 
T 7 HOH 127 827  1098 HOH HOH B . 
T 7 HOH 128 828  255  HOH HOH B . 
T 7 HOH 129 829  101  HOH HOH B . 
T 7 HOH 130 830  122  HOH HOH B . 
T 7 HOH 131 831  544  HOH HOH B . 
T 7 HOH 132 832  252  HOH HOH B . 
T 7 HOH 133 833  1068 HOH HOH B . 
T 7 HOH 134 834  215  HOH HOH B . 
T 7 HOH 135 835  1007 HOH HOH B . 
T 7 HOH 136 836  98   HOH HOH B . 
T 7 HOH 137 837  1031 HOH HOH B . 
T 7 HOH 138 838  1018 HOH HOH B . 
T 7 HOH 139 839  1014 HOH HOH B . 
T 7 HOH 140 840  87   HOH HOH B . 
T 7 HOH 141 841  984  HOH HOH B . 
T 7 HOH 142 842  550  HOH HOH B . 
T 7 HOH 143 843  218  HOH HOH B . 
T 7 HOH 144 844  123  HOH HOH B . 
T 7 HOH 145 845  200  HOH HOH B . 
T 7 HOH 146 846  1093 HOH HOH B . 
T 7 HOH 147 847  41   HOH HOH B . 
T 7 HOH 148 848  994  HOH HOH B . 
T 7 HOH 149 849  186  HOH HOH B . 
T 7 HOH 150 850  536  HOH HOH B . 
T 7 HOH 151 851  18   HOH HOH B . 
T 7 HOH 152 852  184  HOH HOH B . 
T 7 HOH 153 853  345  HOH HOH B . 
T 7 HOH 154 854  328  HOH HOH B . 
T 7 HOH 155 855  34   HOH HOH B . 
T 7 HOH 156 856  325  HOH HOH B . 
T 7 HOH 157 857  145  HOH HOH B . 
T 7 HOH 158 858  388  HOH HOH B . 
T 7 HOH 159 859  197  HOH HOH B . 
T 7 HOH 160 860  568  HOH HOH B . 
T 7 HOH 161 861  399  HOH HOH B . 
T 7 HOH 162 862  581  HOH HOH B . 
T 7 HOH 163 863  209  HOH HOH B . 
T 7 HOH 164 864  207  HOH HOH B . 
T 7 HOH 165 865  136  HOH HOH B . 
T 7 HOH 166 866  146  HOH HOH B . 
T 7 HOH 167 867  119  HOH HOH B . 
T 7 HOH 168 868  402  HOH HOH B . 
T 7 HOH 169 869  574  HOH HOH B . 
T 7 HOH 170 870  344  HOH HOH B . 
T 7 HOH 171 871  1043 HOH HOH B . 
T 7 HOH 172 872  320  HOH HOH B . 
T 7 HOH 173 873  55   HOH HOH B . 
T 7 HOH 174 874  45   HOH HOH B . 
T 7 HOH 175 875  383  HOH HOH B . 
T 7 HOH 176 876  185  HOH HOH B . 
T 7 HOH 177 877  401  HOH HOH B . 
T 7 HOH 178 878  459  HOH HOH B . 
T 7 HOH 179 879  91   HOH HOH B . 
T 7 HOH 180 880  166  HOH HOH B . 
T 7 HOH 181 881  267  HOH HOH B . 
T 7 HOH 182 882  483  HOH HOH B . 
T 7 HOH 183 883  295  HOH HOH B . 
T 7 HOH 184 884  1056 HOH HOH B . 
T 7 HOH 185 885  237  HOH HOH B . 
T 7 HOH 186 886  39   HOH HOH B . 
T 7 HOH 187 887  28   HOH HOH B . 
T 7 HOH 188 888  689  HOH HOH B . 
T 7 HOH 189 889  967  HOH HOH B . 
T 7 HOH 190 890  129  HOH HOH B . 
T 7 HOH 191 891  162  HOH HOH B . 
T 7 HOH 192 892  75   HOH HOH B . 
T 7 HOH 193 893  64   HOH HOH B . 
T 7 HOH 194 894  59   HOH HOH B . 
T 7 HOH 195 895  82   HOH HOH B . 
T 7 HOH 196 896  604  HOH HOH B . 
T 7 HOH 197 897  343  HOH HOH B . 
T 7 HOH 198 898  29   HOH HOH B . 
T 7 HOH 199 899  163  HOH HOH B . 
T 7 HOH 200 900  73   HOH HOH B . 
T 7 HOH 201 901  359  HOH HOH B . 
T 7 HOH 202 902  312  HOH HOH B . 
T 7 HOH 203 903  592  HOH HOH B . 
T 7 HOH 204 904  193  HOH HOH B . 
T 7 HOH 205 905  214  HOH HOH B . 
T 7 HOH 206 906  635  HOH HOH B . 
T 7 HOH 207 907  77   HOH HOH B . 
T 7 HOH 208 908  38   HOH HOH B . 
T 7 HOH 209 909  1000 HOH HOH B . 
T 7 HOH 210 910  172  HOH HOH B . 
T 7 HOH 211 911  1097 HOH HOH B . 
T 7 HOH 212 912  393  HOH HOH B . 
T 7 HOH 213 913  508  HOH HOH B . 
T 7 HOH 214 914  275  HOH HOH B . 
T 7 HOH 215 915  137  HOH HOH B . 
T 7 HOH 216 916  249  HOH HOH B . 
T 7 HOH 217 917  1047 HOH HOH B . 
T 7 HOH 218 918  294  HOH HOH B . 
T 7 HOH 219 919  130  HOH HOH B . 
T 7 HOH 220 920  768  HOH HOH B . 
T 7 HOH 221 921  337  HOH HOH B . 
T 7 HOH 222 922  993  HOH HOH B . 
T 7 HOH 223 923  11   HOH HOH B . 
T 7 HOH 224 924  513  HOH HOH B . 
T 7 HOH 225 925  565  HOH HOH B . 
T 7 HOH 226 926  417  HOH HOH B . 
T 7 HOH 227 927  319  HOH HOH B . 
T 7 HOH 228 928  515  HOH HOH B . 
T 7 HOH 229 929  443  HOH HOH B . 
T 7 HOH 230 930  355  HOH HOH B . 
T 7 HOH 231 931  102  HOH HOH B . 
T 7 HOH 232 932  975  HOH HOH B . 
T 7 HOH 233 933  105  HOH HOH B . 
T 7 HOH 234 934  8    HOH HOH B . 
T 7 HOH 235 935  603  HOH HOH B . 
T 7 HOH 236 936  976  HOH HOH B . 
T 7 HOH 237 937  231  HOH HOH B . 
T 7 HOH 238 938  998  HOH HOH B . 
T 7 HOH 239 939  250  HOH HOH B . 
T 7 HOH 240 940  414  HOH HOH B . 
T 7 HOH 241 941  33   HOH HOH B . 
T 7 HOH 242 942  446  HOH HOH B . 
T 7 HOH 243 943  1033 HOH HOH B . 
T 7 HOH 244 944  1063 HOH HOH B . 
T 7 HOH 245 945  658  HOH HOH B . 
T 7 HOH 246 946  425  HOH HOH B . 
T 7 HOH 247 947  986  HOH HOH B . 
T 7 HOH 248 948  613  HOH HOH B . 
T 7 HOH 249 949  1100 HOH HOH B . 
T 7 HOH 250 950  396  HOH HOH B . 
T 7 HOH 251 951  640  HOH HOH B . 
T 7 HOH 252 952  375  HOH HOH B . 
T 7 HOH 253 953  131  HOH HOH B . 
T 7 HOH 254 954  346  HOH HOH B . 
T 7 HOH 255 955  111  HOH HOH B . 
T 7 HOH 256 956  307  HOH HOH B . 
T 7 HOH 257 957  556  HOH HOH B . 
T 7 HOH 258 958  409  HOH HOH B . 
T 7 HOH 259 959  274  HOH HOH B . 
T 7 HOH 260 960  721  HOH HOH B . 
T 7 HOH 261 961  1037 HOH HOH B . 
T 7 HOH 262 962  66   HOH HOH B . 
T 7 HOH 263 963  742  HOH HOH B . 
T 7 HOH 264 964  223  HOH HOH B . 
T 7 HOH 265 965  439  HOH HOH B . 
T 7 HOH 266 966  585  HOH HOH B . 
T 7 HOH 267 967  706  HOH HOH B . 
T 7 HOH 268 968  1044 HOH HOH B . 
T 7 HOH 269 969  150  HOH HOH B . 
T 7 HOH 270 970  684  HOH HOH B . 
T 7 HOH 271 971  1049 HOH HOH B . 
T 7 HOH 272 972  120  HOH HOH B . 
T 7 HOH 273 973  624  HOH HOH B . 
T 7 HOH 274 974  404  HOH HOH B . 
T 7 HOH 275 975  298  HOH HOH B . 
T 7 HOH 276 976  1062 HOH HOH B . 
T 7 HOH 277 977  723  HOH HOH B . 
T 7 HOH 278 978  434  HOH HOH B . 
T 7 HOH 279 979  266  HOH HOH B . 
T 7 HOH 280 980  361  HOH HOH B . 
T 7 HOH 281 981  220  HOH HOH B . 
T 7 HOH 282 982  561  HOH HOH B . 
T 7 HOH 283 983  614  HOH HOH B . 
T 7 HOH 284 984  1013 HOH HOH B . 
T 7 HOH 285 985  112  HOH HOH B . 
T 7 HOH 286 986  340  HOH HOH B . 
T 7 HOH 287 987  1077 HOH HOH B . 
T 7 HOH 288 988  1029 HOH HOH B . 
T 7 HOH 289 989  1001 HOH HOH B . 
T 7 HOH 290 990  276  HOH HOH B . 
T 7 HOH 291 991  406  HOH HOH B . 
T 7 HOH 292 992  297  HOH HOH B . 
T 7 HOH 293 993  243  HOH HOH B . 
T 7 HOH 294 994  114  HOH HOH B . 
T 7 HOH 295 995  1080 HOH HOH B . 
T 7 HOH 296 996  837  HOH HOH B . 
T 7 HOH 297 997  357  HOH HOH B . 
T 7 HOH 298 998  347  HOH HOH B . 
T 7 HOH 299 999  657  HOH HOH B . 
T 7 HOH 300 1000 527  HOH HOH B . 
T 7 HOH 301 1001 1015 HOH HOH B . 
T 7 HOH 302 1002 363  HOH HOH B . 
T 7 HOH 303 1003 898  HOH HOH B . 
T 7 HOH 304 1004 72   HOH HOH B . 
T 7 HOH 305 1005 492  HOH HOH B . 
T 7 HOH 306 1006 766  HOH HOH B . 
T 7 HOH 307 1007 715  HOH HOH B . 
T 7 HOH 308 1008 1060 HOH HOH B . 
T 7 HOH 309 1009 264  HOH HOH B . 
T 7 HOH 310 1010 507  HOH HOH B . 
T 7 HOH 311 1011 974  HOH HOH B . 
T 7 HOH 312 1012 510  HOH HOH B . 
T 7 HOH 313 1013 368  HOH HOH B . 
T 7 HOH 314 1014 701  HOH HOH B . 
T 7 HOH 315 1015 696  HOH HOH B . 
T 7 HOH 316 1016 430  HOH HOH B . 
T 7 HOH 317 1017 415  HOH HOH B . 
T 7 HOH 318 1018 1092 HOH HOH B . 
T 7 HOH 319 1019 502  HOH HOH B . 
T 7 HOH 320 1020 965  HOH HOH B . 
T 7 HOH 321 1021 1002 HOH HOH B . 
T 7 HOH 322 1022 598  HOH HOH B . 
T 7 HOH 323 1023 1005 HOH HOH B . 
T 7 HOH 324 1024 503  HOH HOH B . 
T 7 HOH 325 1025 521  HOH HOH B . 
T 7 HOH 326 1026 677  HOH HOH B . 
T 7 HOH 327 1027 221  HOH HOH B . 
T 7 HOH 328 1028 528  HOH HOH B . 
T 7 HOH 329 1029 7    HOH HOH B . 
T 7 HOH 330 1030 741  HOH HOH B . 
T 7 HOH 331 1031 194  HOH HOH B . 
T 7 HOH 332 1032 465  HOH HOH B . 
T 7 HOH 333 1033 817  HOH HOH B . 
T 7 HOH 334 1034 571  HOH HOH B . 
T 7 HOH 335 1035 400  HOH HOH B . 
T 7 HOH 336 1036 773  HOH HOH B . 
T 7 HOH 337 1037 754  HOH HOH B . 
T 7 HOH 338 1038 360  HOH HOH B . 
T 7 HOH 339 1039 181  HOH HOH B . 
T 7 HOH 340 1040 699  HOH HOH B . 
T 7 HOH 341 1041 171  HOH HOH B . 
T 7 HOH 342 1042 855  HOH HOH B . 
T 7 HOH 343 1043 486  HOH HOH B . 
T 7 HOH 344 1044 373  HOH HOH B . 
T 7 HOH 345 1045 1078 HOH HOH B . 
T 7 HOH 346 1046 584  HOH HOH B . 
T 7 HOH 347 1047 418  HOH HOH B . 
T 7 HOH 348 1048 897  HOH HOH B . 
T 7 HOH 349 1049 587  HOH HOH B . 
T 7 HOH 350 1050 1089 HOH HOH B . 
T 7 HOH 351 1051 856  HOH HOH B . 
T 7 HOH 352 1052 681  HOH HOH B . 
T 7 HOH 353 1053 526  HOH HOH B . 
T 7 HOH 354 1054 760  HOH HOH B . 
T 7 HOH 355 1055 520  HOH HOH B . 
T 7 HOH 356 1056 535  HOH HOH B . 
T 7 HOH 357 1057 395  HOH HOH B . 
T 7 HOH 358 1058 632  HOH HOH B . 
T 7 HOH 359 1059 780  HOH HOH B . 
T 7 HOH 360 1060 537  HOH HOH B . 
T 7 HOH 361 1061 216  HOH HOH B . 
T 7 HOH 362 1062 1102 HOH HOH B . 
T 7 HOH 363 1063 1104 HOH HOH B . 
T 7 HOH 364 1064 256  HOH HOH B . 
T 7 HOH 365 1065 261  HOH HOH B . 
U 7 HOH 1   201  156  HOH HOH C . 
U 7 HOH 2   202  416  HOH HOH C . 
U 7 HOH 3   203  738  HOH HOH C . 
U 7 HOH 4   204  1036 HOH HOH C . 
U 7 HOH 5   205  449  HOH HOH C . 
U 7 HOH 6   206  576  HOH HOH C . 
U 7 HOH 7   207  463  HOH HOH C . 
U 7 HOH 8   208  302  HOH HOH C . 
U 7 HOH 9   209  1059 HOH HOH C . 
U 7 HOH 10  210  566  HOH HOH C . 
U 7 HOH 11  211  540  HOH HOH C . 
U 7 HOH 12  212  838  HOH HOH C . 
U 7 HOH 13  213  474  HOH HOH C . 
U 7 HOH 14  214  674  HOH HOH C . 
U 7 HOH 15  215  518  HOH HOH C . 
U 7 HOH 16  216  985  HOH HOH C . 
U 7 HOH 17  217  1057 HOH HOH C . 
U 7 HOH 18  218  358  HOH HOH C . 
U 7 HOH 19  219  473  HOH HOH C . 
U 7 HOH 20  220  292  HOH HOH C . 
U 7 HOH 21  221  1087 HOH HOH C . 
U 7 HOH 22  222  962  HOH HOH C . 
U 7 HOH 23  223  579  HOH HOH C . 
U 7 HOH 24  224  939  HOH HOH C . 
U 7 HOH 25  225  720  HOH HOH C . 
U 7 HOH 26  226  464  HOH HOH C . 
U 7 HOH 27  227  1103 HOH HOH C . 
V 7 HOH 1   201  573  HOH HOH D . 
V 7 HOH 2   202  371  HOH HOH D . 
V 7 HOH 3   203  248  HOH HOH D . 
V 7 HOH 4   204  1096 HOH HOH D . 
V 7 HOH 5   205  168  HOH HOH D . 
V 7 HOH 6   206  161  HOH HOH D . 
V 7 HOH 7   207  1105 HOH HOH D . 
V 7 HOH 8   208  407  HOH HOH D . 
V 7 HOH 9   209  539  HOH HOH D . 
V 7 HOH 10  210  983  HOH HOH D . 
V 7 HOH 11  211  1028 HOH HOH D . 
V 7 HOH 12  212  1006 HOH HOH D . 
V 7 HOH 13  213  1027 HOH HOH D . 
V 7 HOH 14  214  973  HOH HOH D . 
V 7 HOH 15  215  272  HOH HOH D . 
V 7 HOH 16  216  1076 HOH HOH D . 
V 7 HOH 17  217  367  HOH HOH D . 
V 7 HOH 18  218  1069 HOH HOH D . 
V 7 HOH 19  219  1050 HOH HOH D . 
V 7 HOH 20  220  1019 HOH HOH D . 
V 7 HOH 21  221  979  HOH HOH D . 
V 7 HOH 22  222  1101 HOH HOH D . 
V 7 HOH 23  223  589  HOH HOH D . 
V 7 HOH 24  224  372  HOH HOH D . 
V 7 HOH 25  225  314  HOH HOH D . 
V 7 HOH 26  226  482  HOH HOH D . 
V 7 HOH 27  227  775  HOH HOH D . 
V 7 HOH 28  228  308  HOH HOH D . 
V 7 HOH 29  229  1035 HOH HOH D . 
W 7 HOH 1   101  995  HOH HOH G . 
W 7 HOH 2   102  124  HOH HOH G . 
W 7 HOH 3   103  1017 HOH HOH G . 
W 7 HOH 4   104  462  HOH HOH G . 
W 7 HOH 5   105  239  HOH HOH G . 
W 7 HOH 6   106  139  HOH HOH G . 
X 7 HOH 1   101  63   HOH HOH H . 
X 7 HOH 2   102  687  HOH HOH H . 
X 7 HOH 3   103  999  HOH HOH H . 
X 7 HOH 4   104  327  HOH HOH H . 
X 7 HOH 5   105  362  HOH HOH H . 
X 7 HOH 6   106  498  HOH HOH H . 
X 7 HOH 7   107  356  HOH HOH H . 
X 7 HOH 8   108  155  HOH HOH H . 
# 
_pdbx_molecule_features.prd_id    PRD_000278 
_pdbx_molecule_features.name      DECANOYL-ARG-VAL-LYS-ARG-CHLOROMETHYLKETONE 
_pdbx_molecule_features.type      Peptide-like 
_pdbx_molecule_features.class     Inhibitor 
_pdbx_molecule_features.details   ? 
# 
loop_
_pdbx_molecule.instance_id 
_pdbx_molecule.prd_id 
_pdbx_molecule.asym_id 
1 PRD_000278 E 
2 PRD_000278 F 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G,H,I,J,K,L,S,U,W 
2 1 B,D,F,M,N,O,P,Q,R,T,V,X 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3440  ? 
1 MORE         -32   ? 
1 'SSA (A^2)'  22290 ? 
2 'ABSA (A^2)' 3480  ? 
2 MORE         -33   ? 
2 'SSA (A^2)'  22830 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 B HOH 969  ? T HOH . 
2 1 B HOH 1027 ? T HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   OD2 ? A ASP 8   ? A ASP 115 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 OD1 ? A ASP 55  ? A ASP 162  ? 1_555 148.0 ? 
2   OD2 ? A ASP 8   ? A ASP 115 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 OD2 ? A ASP 55  ? A ASP 162  ? 1_555 159.8 ? 
3   OD1 ? A ASP 55  ? A ASP 162 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 OD2 ? A ASP 55  ? A ASP 162  ? 1_555 51.1  ? 
4   OD2 ? A ASP 8   ? A ASP 115 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 O   ? A VAL 98  ? A VAL 205  ? 1_555 90.0  ? 
5   OD1 ? A ASP 55  ? A ASP 162 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 O   ? A VAL 98  ? A VAL 205  ? 1_555 86.4  ? 
6   OD2 ? A ASP 55  ? A ASP 162 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 O   ? A VAL 98  ? A VAL 205  ? 1_555 99.7  ? 
7   OD2 ? A ASP 8   ? A ASP 115 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 OD1 ? A ASN 101 ? A ASN 208  ? 1_555 75.0  ? 
8   OD1 ? A ASP 55  ? A ASP 162 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 OD1 ? A ASN 101 ? A ASN 208  ? 1_555 73.4  ? 
9   OD2 ? A ASP 55  ? A ASP 162 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 OD1 ? A ASN 101 ? A ASN 208  ? 1_555 121.8 ? 
10  O   ? A VAL 98  ? A VAL 205 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 OD1 ? A ASN 101 ? A ASN 208  ? 1_555 91.8  ? 
11  OD2 ? A ASP 8   ? A ASP 115 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 O   ? A VAL 103 ? A VAL 210  ? 1_555 93.7  ? 
12  OD1 ? A ASP 55  ? A ASP 162 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 O   ? A VAL 103 ? A VAL 210  ? 1_555 89.2  ? 
13  OD2 ? A ASP 55  ? A ASP 162 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 O   ? A VAL 103 ? A VAL 210  ? 1_555 77.5  ? 
14  O   ? A VAL 98  ? A VAL 205 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 O   ? A VAL 103 ? A VAL 210  ? 1_555 175.6 ? 
15  OD1 ? A ASN 101 ? A ASN 208 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 O   ? A VAL 103 ? A VAL 210  ? 1_555 86.9  ? 
16  OD2 ? A ASP 8   ? A ASP 115 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 O   ? A GLY 105 ? A GLY 212  ? 1_555 83.8  ? 
17  OD1 ? A ASP 55  ? A ASP 162 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 O   ? A GLY 105 ? A GLY 212  ? 1_555 127.6 ? 
18  OD2 ? A ASP 55  ? A ASP 162 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 O   ? A GLY 105 ? A GLY 212  ? 1_555 79.1  ? 
19  O   ? A VAL 98  ? A VAL 205 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 O   ? A GLY 105 ? A GLY 212  ? 1_555 87.3  ? 
20  OD1 ? A ASN 101 ? A ASN 208 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 O   ? A GLY 105 ? A GLY 212  ? 1_555 158.8 ? 
21  O   ? A VAL 103 ? A VAL 210 ? 1_555 CA ? J CA . ? A CA 604 ? 1_555 O   ? A GLY 105 ? A GLY 212  ? 1_555 95.5  ? 
22  OD2 ? A ASP 67  ? A ASP 174 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 OD1 ? A ASP 72  ? A ASP 179  ? 1_555 99.3  ? 
23  OD2 ? A ASP 67  ? A ASP 174 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 OD2 ? A ASP 72  ? A ASP 179  ? 1_555 88.3  ? 
24  OD1 ? A ASP 72  ? A ASP 179 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 OD2 ? A ASP 72  ? A ASP 179  ? 1_555 50.9  ? 
25  OD2 ? A ASP 67  ? A ASP 174 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? A ASP 74  ? A ASP 181  ? 1_555 95.2  ? 
26  OD1 ? A ASP 72  ? A ASP 179 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? A ASP 74  ? A ASP 181  ? 1_555 73.8  ? 
27  OD2 ? A ASP 72  ? A ASP 179 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? A ASP 74  ? A ASP 181  ? 1_555 124.3 ? 
28  OD2 ? A ASP 67  ? A ASP 174 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 769  ? 1_555 91.2  ? 
29  OD1 ? A ASP 72  ? A ASP 179 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 769  ? 1_555 154.8 ? 
30  OD2 ? A ASP 72  ? A ASP 179 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 769  ? 1_555 153.0 ? 
31  O   ? A ASP 74  ? A ASP 181 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 769  ? 1_555 82.6  ? 
32  OD2 ? A ASP 67  ? A ASP 174 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 859  ? 1_555 85.3  ? 
33  OD1 ? A ASP 72  ? A ASP 179 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 859  ? 1_555 132.3 ? 
34  OD2 ? A ASP 72  ? A ASP 179 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 859  ? 1_555 82.2  ? 
35  O   ? A ASP 74  ? A ASP 181 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 859  ? 1_555 153.6 ? 
36  O   ? S HOH .   ? A HOH 769 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 859  ? 1_555 70.9  ? 
37  OD2 ? A ASP 67  ? A ASP 174 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 1008 ? 1_555 167.7 ? 
38  OD1 ? A ASP 72  ? A ASP 179 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 1008 ? 1_555 89.5  ? 
39  OD2 ? A ASP 72  ? A ASP 179 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 1008 ? 1_555 90.8  ? 
40  O   ? A ASP 74  ? A ASP 181 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 1008 ? 1_555 95.4  ? 
41  O   ? S HOH .   ? A HOH 769 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 1008 ? 1_555 84.0  ? 
42  O   ? S HOH .   ? A HOH 859 ? 1_555 CA ? I CA . ? A CA 603 ? 1_555 O   ? S HOH .   ? A HOH 1008 ? 1_555 82.4  ? 
43  OD1 ? A ASP 151 ? A ASP 258 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 OD2 ? A ASP 194 ? A ASP 301  ? 1_555 99.2  ? 
44  OD1 ? A ASP 151 ? A ASP 258 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 OE1 ? A GLU 224 ? A GLU 331  ? 1_555 79.3  ? 
45  OD2 ? A ASP 194 ? A ASP 301 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 OE1 ? A GLU 224 ? A GLU 331  ? 1_555 87.8  ? 
46  OD1 ? A ASP 151 ? A ASP 258 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 OE2 ? A GLU 224 ? A GLU 331  ? 1_555 131.9 ? 
47  OD2 ? A ASP 194 ? A ASP 301 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 OE2 ? A GLU 224 ? A GLU 331  ? 1_555 84.2  ? 
48  OE1 ? A GLU 224 ? A GLU 331 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 OE2 ? A GLU 224 ? A GLU 331  ? 1_555 52.8  ? 
49  OD1 ? A ASP 151 ? A ASP 258 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 808  ? 1_555 96.8  ? 
50  OD2 ? A ASP 194 ? A ASP 301 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 808  ? 1_555 164.0 ? 
51  OE1 ? A GLU 224 ? A GLU 331 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 808  ? 1_555 95.9  ? 
52  OE2 ? A GLU 224 ? A GLU 331 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 808  ? 1_555 85.7  ? 
53  OD1 ? A ASP 151 ? A ASP 258 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 948  ? 1_555 74.3  ? 
54  OD2 ? A ASP 194 ? A ASP 301 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 948  ? 1_555 94.0  ? 
55  OE1 ? A GLU 224 ? A GLU 331 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 948  ? 1_555 153.5 ? 
56  OE2 ? A GLU 224 ? A GLU 331 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 948  ? 1_555 153.7 ? 
57  O   ? S HOH .   ? A HOH 808 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 948  ? 1_555 89.5  ? 
58  OD1 ? A ASP 151 ? A ASP 258 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 955  ? 1_555 142.9 ? 
59  OD2 ? A ASP 194 ? A ASP 301 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 955  ? 1_555 79.9  ? 
60  OE1 ? A GLU 224 ? A GLU 331 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 955  ? 1_555 137.2 ? 
61  OE2 ? A GLU 224 ? A GLU 331 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 955  ? 1_555 85.1  ? 
62  O   ? S HOH .   ? A HOH 808 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 955  ? 1_555 86.9  ? 
63  O   ? S HOH .   ? A HOH 948 ? 1_555 CA ? K CA . ? A CA 605 ? 1_555 O   ? S HOH .   ? A HOH 955  ? 1_555 68.9  ? 
64  O   ? A THR 202 ? A THR 309 ? 1_555 NA ? L NA . ? A NA 606 ? 1_555 O   ? A SER 204 ? A SER 311  ? 1_555 104.3 ? 
65  O   ? A THR 202 ? A THR 309 ? 1_555 NA ? L NA . ? A NA 606 ? 1_555 O   ? A THR 207 ? A THR 314  ? 1_555 162.1 ? 
66  O   ? A SER 204 ? A SER 311 ? 1_555 NA ? L NA . ? A NA 606 ? 1_555 O   ? A THR 207 ? A THR 314  ? 1_555 91.2  ? 
67  O   ? A THR 202 ? A THR 309 ? 1_555 NA ? L NA . ? A NA 606 ? 1_555 OG1 ? A THR 207 ? A THR 314  ? 1_555 93.0  ? 
68  O   ? A SER 204 ? A SER 311 ? 1_555 NA ? L NA . ? A NA 606 ? 1_555 OG1 ? A THR 207 ? A THR 314  ? 1_555 90.3  ? 
69  O   ? A THR 207 ? A THR 314 ? 1_555 NA ? L NA . ? A NA 606 ? 1_555 OG1 ? A THR 207 ? A THR 314  ? 1_555 77.8  ? 
70  O   ? A THR 202 ? A THR 309 ? 1_555 NA ? L NA . ? A NA 606 ? 1_555 O   ? S HOH .   ? A HOH 765  ? 1_555 97.6  ? 
71  O   ? A SER 204 ? A SER 311 ? 1_555 NA ? L NA . ? A NA 606 ? 1_555 O   ? S HOH .   ? A HOH 765  ? 1_555 121.1 ? 
72  O   ? A THR 207 ? A THR 314 ? 1_555 NA ? L NA . ? A NA 606 ? 1_555 O   ? S HOH .   ? A HOH 765  ? 1_555 81.4  ? 
73  OG1 ? A THR 207 ? A THR 314 ? 1_555 NA ? L NA . ? A NA 606 ? 1_555 O   ? S HOH .   ? A HOH 765  ? 1_555 142.5 ? 
74  OD2 ? B ASP 8   ? B ASP 115 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 OD1 ? B ASP 55  ? B ASP 162  ? 1_555 151.1 ? 
75  OD2 ? B ASP 8   ? B ASP 115 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 OD2 ? B ASP 55  ? B ASP 162  ? 1_555 157.9 ? 
76  OD1 ? B ASP 55  ? B ASP 162 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 OD2 ? B ASP 55  ? B ASP 162  ? 1_555 50.5  ? 
77  OD2 ? B ASP 8   ? B ASP 115 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 O   ? B VAL 98  ? B VAL 205  ? 1_555 91.3  ? 
78  OD1 ? B ASP 55  ? B ASP 162 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 O   ? B VAL 98  ? B VAL 205  ? 1_555 85.1  ? 
79  OD2 ? B ASP 55  ? B ASP 162 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 O   ? B VAL 98  ? B VAL 205  ? 1_555 97.3  ? 
80  OD2 ? B ASP 8   ? B ASP 115 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 OD1 ? B ASN 101 ? B ASN 208  ? 1_555 75.4  ? 
81  OD1 ? B ASP 55  ? B ASP 162 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 OD1 ? B ASN 101 ? B ASN 208  ? 1_555 75.9  ? 
82  OD2 ? B ASP 55  ? B ASP 162 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 OD1 ? B ASN 101 ? B ASN 208  ? 1_555 124.9 ? 
83  O   ? B VAL 98  ? B VAL 205 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 OD1 ? B ASN 101 ? B ASN 208  ? 1_555 88.8  ? 
84  OD2 ? B ASP 8   ? B ASP 115 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 O   ? B VAL 103 ? B VAL 210  ? 1_555 90.9  ? 
85  OD1 ? B ASP 55  ? B ASP 162 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 O   ? B VAL 103 ? B VAL 210  ? 1_555 92.0  ? 
86  OD2 ? B ASP 55  ? B ASP 162 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 O   ? B VAL 103 ? B VAL 210  ? 1_555 81.3  ? 
87  O   ? B VAL 98  ? B VAL 205 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 O   ? B VAL 103 ? B VAL 210  ? 1_555 177.1 ? 
88  OD1 ? B ASN 101 ? B ASN 208 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 O   ? B VAL 103 ? B VAL 210  ? 1_555 89.8  ? 
89  OD2 ? B ASP 8   ? B ASP 115 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 O   ? B GLY 105 ? B GLY 212  ? 1_555 84.6  ? 
90  OD1 ? B ASP 55  ? B ASP 162 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 O   ? B GLY 105 ? B GLY 212  ? 1_555 123.9 ? 
91  OD2 ? B ASP 55  ? B ASP 162 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 O   ? B GLY 105 ? B GLY 212  ? 1_555 75.3  ? 
92  O   ? B VAL 98  ? B VAL 205 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 O   ? B GLY 105 ? B GLY 212  ? 1_555 88.7  ? 
93  OD1 ? B ASN 101 ? B ASN 208 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 O   ? B GLY 105 ? B GLY 212  ? 1_555 159.7 ? 
94  O   ? B VAL 103 ? B VAL 210 ? 1_555 CA ? P CA . ? B CA 604 ? 1_555 O   ? B GLY 105 ? B GLY 212  ? 1_555 93.5  ? 
95  OD2 ? B ASP 67  ? B ASP 174 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 OD1 ? B ASP 72  ? B ASP 179  ? 1_555 97.1  ? 
96  OD2 ? B ASP 67  ? B ASP 174 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 OD2 ? B ASP 72  ? B ASP 179  ? 1_555 87.9  ? 
97  OD1 ? B ASP 72  ? B ASP 179 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 OD2 ? B ASP 72  ? B ASP 179  ? 1_555 50.6  ? 
98  OD2 ? B ASP 67  ? B ASP 174 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? B ASP 74  ? B ASP 181  ? 1_555 96.4  ? 
99  OD1 ? B ASP 72  ? B ASP 179 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? B ASP 74  ? B ASP 181  ? 1_555 74.9  ? 
100 OD2 ? B ASP 72  ? B ASP 179 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? B ASP 74  ? B ASP 181  ? 1_555 125.3 ? 
101 OD2 ? B ASP 67  ? B ASP 174 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 757  ? 1_555 90.9  ? 
102 OD1 ? B ASP 72  ? B ASP 179 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 757  ? 1_555 156.9 ? 
103 OD2 ? B ASP 72  ? B ASP 179 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 757  ? 1_555 151.9 ? 
104 O   ? B ASP 74  ? B ASP 181 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 757  ? 1_555 82.7  ? 
105 OD2 ? B ASP 67  ? B ASP 174 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 934  ? 1_555 83.8  ? 
106 OD1 ? B ASP 72  ? B ASP 179 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 934  ? 1_555 126.9 ? 
107 OD2 ? B ASP 72  ? B ASP 179 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 934  ? 1_555 76.6  ? 
108 O   ? B ASP 74  ? B ASP 181 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 934  ? 1_555 158.1 ? 
109 O   ? T HOH .   ? B HOH 757 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 934  ? 1_555 75.4  ? 
110 OD2 ? B ASP 67  ? B ASP 174 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 1029 ? 1_555 166.3 ? 
111 OD1 ? B ASP 72  ? B ASP 179 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 1029 ? 1_555 89.8  ? 
112 OD2 ? B ASP 72  ? B ASP 179 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 1029 ? 1_555 87.4  ? 
113 O   ? B ASP 74  ? B ASP 181 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 1029 ? 1_555 96.8  ? 
114 O   ? T HOH .   ? B HOH 757 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 1029 ? 1_555 87.2  ? 
115 O   ? T HOH .   ? B HOH 934 ? 1_555 CA ? O CA . ? B CA 603 ? 1_555 O   ? T HOH .   ? B HOH 1029 ? 1_555 82.6  ? 
116 OD1 ? B ASP 151 ? B ASP 258 ? 1_555 CA ? Q CA . ? B CA 605 ? 1_555 OD2 ? B ASP 194 ? B ASP 301  ? 1_555 96.4  ? 
117 OD1 ? B ASP 151 ? B ASP 258 ? 1_555 CA ? Q CA . ? B CA 605 ? 1_555 OE1 ? B GLU 224 ? B GLU 331  ? 1_555 77.6  ? 
118 OD2 ? B ASP 194 ? B ASP 301 ? 1_555 CA ? Q CA . ? B CA 605 ? 1_555 OE1 ? B GLU 224 ? B GLU 331  ? 1_555 84.4  ? 
119 OD1 ? B ASP 151 ? B ASP 258 ? 1_555 CA ? Q CA . ? B CA 605 ? 1_555 OE2 ? B GLU 224 ? B GLU 331  ? 1_555 130.5 ? 
120 OD2 ? B ASP 194 ? B ASP 301 ? 1_555 CA ? Q CA . ? B CA 605 ? 1_555 OE2 ? B GLU 224 ? B GLU 331  ? 1_555 83.7  ? 
121 OE1 ? B GLU 224 ? B GLU 331 ? 1_555 CA ? Q CA . ? B CA 605 ? 1_555 OE2 ? B GLU 224 ? B GLU 331  ? 1_555 53.1  ? 
122 OD1 ? B ASP 151 ? B ASP 258 ? 1_555 CA ? Q CA . ? B CA 605 ? 1_555 O   ? T HOH .   ? B HOH 750  ? 1_555 96.9  ? 
123 OD2 ? B ASP 194 ? B ASP 301 ? 1_555 CA ? Q CA . ? B CA 605 ? 1_555 O   ? T HOH .   ? B HOH 750  ? 1_555 165.8 ? 
124 OE1 ? B GLU 224 ? B GLU 331 ? 1_555 CA ? Q CA . ? B CA 605 ? 1_555 O   ? T HOH .   ? B HOH 750  ? 1_555 93.6  ? 
125 OE2 ? B GLU 224 ? B GLU 331 ? 1_555 CA ? Q CA . ? B CA 605 ? 1_555