data_5JNQ
# 
_entry.id   5JNQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5JNQ         
WWPDB D_1000220887 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5JNQ 
_pdbx_database_status.recvd_initial_deposition_date   2016-04-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_audit_author.name           'Johansson, P.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat. Chem. Biol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1552-4469 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            13 
_citation.language                  ? 
_citation.page_first                265 
_citation.page_last                 267 
_citation.title                     'MraY-antibiotic complex reveals details of tunicamycin mode of action.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nchembio.2270 
_citation.pdbx_database_id_PubMed   28068312 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hakulinen, J.K.' 1 ? 
primary 'Hering, J.'      2 ? 
primary 'Branden, G.'     3 ? 
primary 'Chen, H.'        4 ? 
primary 'Snijder, A.'     5 ? 
primary 'Ek, M.'          6 ? 
primary 'Johansson, P.'   7 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5JNQ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     92.640 
_cell.length_a_esd                 ? 
_cell.length_b                     105.540 
_cell.length_b_esd                 ? 
_cell.length_c                     134.960 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5JNQ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Phospho-N-acetylmuramoyl-pentapeptide-transferase 40947.133 1 2.7.8.13 ? ? ? 
2 non-polymer syn Tunicamycin                                       816.889   1 ?        ? ? ? 
3 non-polymer syn 'PALMITIC ACID'                                   256.424   2 ?        ? ? ? 
4 non-polymer man 'octyl beta-D-glucopyranoside'                    292.369   1 ?        ? ? ? 
5 water       nat water                                             18.015    3 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'UDP-MurNAc-pentapeptide phosphotransferase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGTSRDHMVLHEYVNAAGITGGSGGSENLYFQSMIHETILAIIIAFAISALLCPIIIPFLHKLKFGQQVRDDGPESHLKK
QGTPTMGGLIILSSIIITSVFYIPSYPKIIPVLFVTVGFGIIGFLDDYIKIVMKRSEGLKPMQKLVGQFIITGIFAWYLL
NSGEVGTDMLIPFTGGFDGGSFLSLGIFFVPALFFIMLGTDNGVNFTDGLDGLCTSVTILVATFLTIVAIGEDMGISPIT
GAVVGSLLGFLLFNVYPAKVFMGDTGSLALGGFVAASCYMMRMPLFIPVIGLIYLVEVLSVIIQVTYFKRTGGKRIFKMA
PIHHHFELCGWSETRVVAVFAIVTAILCMVAYLGLGSGSENLYFQSHHHHHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGTSRDHMVLHEYVNAAGITGGSGGSENLYFQSMIHETILAIIIAFAISALLCPIIIPFLHKLKFGQQVRDDGPESHLKK
QGTPTMGGLIILSSIIITSVFYIPSYPKIIPVLFVTVGFGIIGFLDDYIKIVMKRSEGLKPMQKLVGQFIITGIFAWYLL
NSGEVGTDMLIPFTGGFDGGSFLSLGIFFVPALFFIMLGTDNGVNFTDGLDGLCTSVTILVATFLTIVAIGEDMGISPIT
GAVVGSLLGFLLFNVYPAKVFMGDTGSLALGGFVAASCYMMRMPLFIPVIGLIYLVEVLSVIIQVTYFKRTGGKRIFKMA
PIHHHFELCGWSETRVVAVFAIVTAILCMVAYLGLGSGSENLYFQSHHHHHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   THR n 
1 4   SER n 
1 5   ARG n 
1 6   ASP n 
1 7   HIS n 
1 8   MET n 
1 9   VAL n 
1 10  LEU n 
1 11  HIS n 
1 12  GLU n 
1 13  TYR n 
1 14  VAL n 
1 15  ASN n 
1 16  ALA n 
1 17  ALA n 
1 18  GLY n 
1 19  ILE n 
1 20  THR n 
1 21  GLY n 
1 22  GLY n 
1 23  SER n 
1 24  GLY n 
1 25  GLY n 
1 26  SER n 
1 27  GLU n 
1 28  ASN n 
1 29  LEU n 
1 30  TYR n 
1 31  PHE n 
1 32  GLN n 
1 33  SER n 
1 34  MET n 
1 35  ILE n 
1 36  HIS n 
1 37  GLU n 
1 38  THR n 
1 39  ILE n 
1 40  LEU n 
1 41  ALA n 
1 42  ILE n 
1 43  ILE n 
1 44  ILE n 
1 45  ALA n 
1 46  PHE n 
1 47  ALA n 
1 48  ILE n 
1 49  SER n 
1 50  ALA n 
1 51  LEU n 
1 52  LEU n 
1 53  CYS n 
1 54  PRO n 
1 55  ILE n 
1 56  ILE n 
1 57  ILE n 
1 58  PRO n 
1 59  PHE n 
1 60  LEU n 
1 61  HIS n 
1 62  LYS n 
1 63  LEU n 
1 64  LYS n 
1 65  PHE n 
1 66  GLY n 
1 67  GLN n 
1 68  GLN n 
1 69  VAL n 
1 70  ARG n 
1 71  ASP n 
1 72  ASP n 
1 73  GLY n 
1 74  PRO n 
1 75  GLU n 
1 76  SER n 
1 77  HIS n 
1 78  LEU n 
1 79  LYS n 
1 80  LYS n 
1 81  GLN n 
1 82  GLY n 
1 83  THR n 
1 84  PRO n 
1 85  THR n 
1 86  MET n 
1 87  GLY n 
1 88  GLY n 
1 89  LEU n 
1 90  ILE n 
1 91  ILE n 
1 92  LEU n 
1 93  SER n 
1 94  SER n 
1 95  ILE n 
1 96  ILE n 
1 97  ILE n 
1 98  THR n 
1 99  SER n 
1 100 VAL n 
1 101 PHE n 
1 102 TYR n 
1 103 ILE n 
1 104 PRO n 
1 105 SER n 
1 106 TYR n 
1 107 PRO n 
1 108 LYS n 
1 109 ILE n 
1 110 ILE n 
1 111 PRO n 
1 112 VAL n 
1 113 LEU n 
1 114 PHE n 
1 115 VAL n 
1 116 THR n 
1 117 VAL n 
1 118 GLY n 
1 119 PHE n 
1 120 GLY n 
1 121 ILE n 
1 122 ILE n 
1 123 GLY n 
1 124 PHE n 
1 125 LEU n 
1 126 ASP n 
1 127 ASP n 
1 128 TYR n 
1 129 ILE n 
1 130 LYS n 
1 131 ILE n 
1 132 VAL n 
1 133 MET n 
1 134 LYS n 
1 135 ARG n 
1 136 SER n 
1 137 GLU n 
1 138 GLY n 
1 139 LEU n 
1 140 LYS n 
1 141 PRO n 
1 142 MET n 
1 143 GLN n 
1 144 LYS n 
1 145 LEU n 
1 146 VAL n 
1 147 GLY n 
1 148 GLN n 
1 149 PHE n 
1 150 ILE n 
1 151 ILE n 
1 152 THR n 
1 153 GLY n 
1 154 ILE n 
1 155 PHE n 
1 156 ALA n 
1 157 TRP n 
1 158 TYR n 
1 159 LEU n 
1 160 LEU n 
1 161 ASN n 
1 162 SER n 
1 163 GLY n 
1 164 GLU n 
1 165 VAL n 
1 166 GLY n 
1 167 THR n 
1 168 ASP n 
1 169 MET n 
1 170 LEU n 
1 171 ILE n 
1 172 PRO n 
1 173 PHE n 
1 174 THR n 
1 175 GLY n 
1 176 GLY n 
1 177 PHE n 
1 178 ASP n 
1 179 GLY n 
1 180 GLY n 
1 181 SER n 
1 182 PHE n 
1 183 LEU n 
1 184 SER n 
1 185 LEU n 
1 186 GLY n 
1 187 ILE n 
1 188 PHE n 
1 189 PHE n 
1 190 VAL n 
1 191 PRO n 
1 192 ALA n 
1 193 LEU n 
1 194 PHE n 
1 195 PHE n 
1 196 ILE n 
1 197 MET n 
1 198 LEU n 
1 199 GLY n 
1 200 THR n 
1 201 ASP n 
1 202 ASN n 
1 203 GLY n 
1 204 VAL n 
1 205 ASN n 
1 206 PHE n 
1 207 THR n 
1 208 ASP n 
1 209 GLY n 
1 210 LEU n 
1 211 ASP n 
1 212 GLY n 
1 213 LEU n 
1 214 CYS n 
1 215 THR n 
1 216 SER n 
1 217 VAL n 
1 218 THR n 
1 219 ILE n 
1 220 LEU n 
1 221 VAL n 
1 222 ALA n 
1 223 THR n 
1 224 PHE n 
1 225 LEU n 
1 226 THR n 
1 227 ILE n 
1 228 VAL n 
1 229 ALA n 
1 230 ILE n 
1 231 GLY n 
1 232 GLU n 
1 233 ASP n 
1 234 MET n 
1 235 GLY n 
1 236 ILE n 
1 237 SER n 
1 238 PRO n 
1 239 ILE n 
1 240 THR n 
1 241 GLY n 
1 242 ALA n 
1 243 VAL n 
1 244 VAL n 
1 245 GLY n 
1 246 SER n 
1 247 LEU n 
1 248 LEU n 
1 249 GLY n 
1 250 PHE n 
1 251 LEU n 
1 252 LEU n 
1 253 PHE n 
1 254 ASN n 
1 255 VAL n 
1 256 TYR n 
1 257 PRO n 
1 258 ALA n 
1 259 LYS n 
1 260 VAL n 
1 261 PHE n 
1 262 MET n 
1 263 GLY n 
1 264 ASP n 
1 265 THR n 
1 266 GLY n 
1 267 SER n 
1 268 LEU n 
1 269 ALA n 
1 270 LEU n 
1 271 GLY n 
1 272 GLY n 
1 273 PHE n 
1 274 VAL n 
1 275 ALA n 
1 276 ALA n 
1 277 SER n 
1 278 CYS n 
1 279 TYR n 
1 280 MET n 
1 281 MET n 
1 282 ARG n 
1 283 MET n 
1 284 PRO n 
1 285 LEU n 
1 286 PHE n 
1 287 ILE n 
1 288 PRO n 
1 289 VAL n 
1 290 ILE n 
1 291 GLY n 
1 292 LEU n 
1 293 ILE n 
1 294 TYR n 
1 295 LEU n 
1 296 VAL n 
1 297 GLU n 
1 298 VAL n 
1 299 LEU n 
1 300 SER n 
1 301 VAL n 
1 302 ILE n 
1 303 ILE n 
1 304 GLN n 
1 305 VAL n 
1 306 THR n 
1 307 TYR n 
1 308 PHE n 
1 309 LYS n 
1 310 ARG n 
1 311 THR n 
1 312 GLY n 
1 313 GLY n 
1 314 LYS n 
1 315 ARG n 
1 316 ILE n 
1 317 PHE n 
1 318 LYS n 
1 319 MET n 
1 320 ALA n 
1 321 PRO n 
1 322 ILE n 
1 323 HIS n 
1 324 HIS n 
1 325 HIS n 
1 326 PHE n 
1 327 GLU n 
1 328 LEU n 
1 329 CYS n 
1 330 GLY n 
1 331 TRP n 
1 332 SER n 
1 333 GLU n 
1 334 THR n 
1 335 ARG n 
1 336 VAL n 
1 337 VAL n 
1 338 ALA n 
1 339 VAL n 
1 340 PHE n 
1 341 ALA n 
1 342 ILE n 
1 343 VAL n 
1 344 THR n 
1 345 ALA n 
1 346 ILE n 
1 347 LEU n 
1 348 CYS n 
1 349 MET n 
1 350 VAL n 
1 351 ALA n 
1 352 TYR n 
1 353 LEU n 
1 354 GLY n 
1 355 LEU n 
1 356 GLY n 
1 357 SER n 
1 358 GLY n 
1 359 SER n 
1 360 GLU n 
1 361 ASN n 
1 362 LEU n 
1 363 TYR n 
1 364 PHE n 
1 365 GLN n 
1 366 SER n 
1 367 HIS n 
1 368 HIS n 
1 369 HIS n 
1 370 HIS n 
1 371 HIS n 
1 372 HIS n 
1 373 HIS n 
1 374 HIS n 
1 375 HIS n 
1 376 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   376 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'mraY, HMPREF1085_00623' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Clostridium bolteae 90A9' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     997894 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    R0BTE9_9FIRM 
_struct_ref.pdbx_db_accession          R0BTE9 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MIHETILAIIIAFAISALLCPIIIPFLHKLKFGQQVRDDGPESHLKKQGTPTMGGLIILSSIIITSVFYIPSYPKIIPVL
FVTVGFGIIGFLDDYIKIVMKRSEGLKPMQKLVGQFIITGIFAWYLLNSGEVGTDMLIPFTGGFDGGSFLSLGIFFVPAL
FFIMLGTDNGVNFTDGLDGLCTSVTILVATFLTIVAIGEDMGISPITGAVVGSLLGFLLFNVYPAKVFMGDTGSLALGGF
VAASCYMMRMPLFIPVIGLIYLVEVLSVIIQVTYFKRTGGKRIFKMAPIHHHFELCGWSETRVVAVFAIVTAILCMVAYL
GL
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5JNQ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 34 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 355 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             R0BTE9 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  322 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       322 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5JNQ MET A 1   ? UNP R0BTE9 ? ? 'initiating methionine' -32 1  
1 5JNQ GLY A 2   ? UNP R0BTE9 ? ? 'expression tag'        -31 2  
1 5JNQ THR A 3   ? UNP R0BTE9 ? ? 'expression tag'        -30 3  
1 5JNQ SER A 4   ? UNP R0BTE9 ? ? 'expression tag'        -29 4  
1 5JNQ ARG A 5   ? UNP R0BTE9 ? ? 'expression tag'        -28 5  
1 5JNQ ASP A 6   ? UNP R0BTE9 ? ? 'expression tag'        -27 6  
1 5JNQ HIS A 7   ? UNP R0BTE9 ? ? 'expression tag'        -26 7  
1 5JNQ MET A 8   ? UNP R0BTE9 ? ? 'expression tag'        -25 8  
1 5JNQ VAL A 9   ? UNP R0BTE9 ? ? 'expression tag'        -24 9  
1 5JNQ LEU A 10  ? UNP R0BTE9 ? ? 'expression tag'        -23 10 
1 5JNQ HIS A 11  ? UNP R0BTE9 ? ? 'expression tag'        -22 11 
1 5JNQ GLU A 12  ? UNP R0BTE9 ? ? 'expression tag'        -21 12 
1 5JNQ TYR A 13  ? UNP R0BTE9 ? ? 'expression tag'        -20 13 
1 5JNQ VAL A 14  ? UNP R0BTE9 ? ? 'expression tag'        -19 14 
1 5JNQ ASN A 15  ? UNP R0BTE9 ? ? 'expression tag'        -18 15 
1 5JNQ ALA A 16  ? UNP R0BTE9 ? ? 'expression tag'        -17 16 
1 5JNQ ALA A 17  ? UNP R0BTE9 ? ? 'expression tag'        -16 17 
1 5JNQ GLY A 18  ? UNP R0BTE9 ? ? 'expression tag'        -15 18 
1 5JNQ ILE A 19  ? UNP R0BTE9 ? ? 'expression tag'        -14 19 
1 5JNQ THR A 20  ? UNP R0BTE9 ? ? 'expression tag'        -13 20 
1 5JNQ GLY A 21  ? UNP R0BTE9 ? ? 'expression tag'        -12 21 
1 5JNQ GLY A 22  ? UNP R0BTE9 ? ? 'expression tag'        -11 22 
1 5JNQ SER A 23  ? UNP R0BTE9 ? ? 'expression tag'        -10 23 
1 5JNQ GLY A 24  ? UNP R0BTE9 ? ? 'expression tag'        -9  24 
1 5JNQ GLY A 25  ? UNP R0BTE9 ? ? 'expression tag'        -8  25 
1 5JNQ SER A 26  ? UNP R0BTE9 ? ? 'expression tag'        -7  26 
1 5JNQ GLU A 27  ? UNP R0BTE9 ? ? 'expression tag'        -6  27 
1 5JNQ ASN A 28  ? UNP R0BTE9 ? ? 'expression tag'        -5  28 
1 5JNQ LEU A 29  ? UNP R0BTE9 ? ? 'expression tag'        -4  29 
1 5JNQ TYR A 30  ? UNP R0BTE9 ? ? 'expression tag'        -3  30 
1 5JNQ PHE A 31  ? UNP R0BTE9 ? ? 'expression tag'        -2  31 
1 5JNQ GLN A 32  ? UNP R0BTE9 ? ? 'expression tag'        -1  32 
1 5JNQ SER A 33  ? UNP R0BTE9 ? ? 'expression tag'        0   33 
1 5JNQ GLY A 356 ? UNP R0BTE9 ? ? 'expression tag'        323 34 
1 5JNQ SER A 357 ? UNP R0BTE9 ? ? 'expression tag'        324 35 
1 5JNQ GLY A 358 ? UNP R0BTE9 ? ? 'expression tag'        325 36 
1 5JNQ SER A 359 ? UNP R0BTE9 ? ? 'expression tag'        326 37 
1 5JNQ GLU A 360 ? UNP R0BTE9 ? ? 'expression tag'        327 38 
1 5JNQ ASN A 361 ? UNP R0BTE9 ? ? 'expression tag'        328 39 
1 5JNQ LEU A 362 ? UNP R0BTE9 ? ? 'expression tag'        329 40 
1 5JNQ TYR A 363 ? UNP R0BTE9 ? ? 'expression tag'        330 41 
1 5JNQ PHE A 364 ? UNP R0BTE9 ? ? 'expression tag'        331 42 
1 5JNQ GLN A 365 ? UNP R0BTE9 ? ? 'expression tag'        332 43 
1 5JNQ SER A 366 ? UNP R0BTE9 ? ? 'expression tag'        333 44 
1 5JNQ HIS A 367 ? UNP R0BTE9 ? ? 'expression tag'        334 45 
1 5JNQ HIS A 368 ? UNP R0BTE9 ? ? 'expression tag'        335 46 
1 5JNQ HIS A 369 ? UNP R0BTE9 ? ? 'expression tag'        336 47 
1 5JNQ HIS A 370 ? UNP R0BTE9 ? ? 'expression tag'        337 48 
1 5JNQ HIS A 371 ? UNP R0BTE9 ? ? 'expression tag'        338 49 
1 5JNQ HIS A 372 ? UNP R0BTE9 ? ? 'expression tag'        339 50 
1 5JNQ HIS A 373 ? UNP R0BTE9 ? ? 'expression tag'        340 51 
1 5JNQ HIS A 374 ? UNP R0BTE9 ? ? 'expression tag'        341 52 
1 5JNQ HIS A 375 ? UNP R0BTE9 ? ? 'expression tag'        342 53 
1 5JNQ HIS A 376 ? UNP R0BTE9 ? ? 'expression tag'        343 54 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                        ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                       ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                     ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                ? 'C4 H7 N O4'     133.103 
BOG D-saccharide        n 'octyl beta-D-glucopyranoside' ? 'C14 H28 O6'     292.369 
CYS 'L-peptide linking' y CYSTEINE                       ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                      ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                        ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                      ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                          ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                     ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                        ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                         ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                     ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                  ? 'C9 H11 N O2'    165.189 
PLM non-polymer         . 'PALMITIC ACID'                ? 'C16 H32 O2'     256.424 
PRO 'L-peptide linking' y PROLINE                        ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                         ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                      ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                     ? 'C11 H12 N2 O2'  204.225 
TUM non-polymer         . Tunicamycin                    ? 'C37 H60 N4 O16' 816.889 
TYR 'L-peptide linking' y TYROSINE                       ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                         ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5JNQ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.40 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         72 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15 - 23 % (v/v) PEG 400, 100 mM Hepes pH 7.5 - 8.25, 4 % (v/v) aceton' 
_exptl_crystal_grow.pdbx_pH_range   '7.5 - 8.25' 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-02-18 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.976 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.976 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            62.66 
_reflns.entry_id                         5JNQ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.6 
_reflns.d_resolution_low                 38.2 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       14664 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.6 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -2.71440 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][2]                            -6.51590 
_refine.aniso_B[2][3]                            0.00000 
_refine.aniso_B[3][3]                            9.23030 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               82.00 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.844 
_refine.correlation_coeff_Fo_to_Fc_free          0.836 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5JNQ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.60 
_refine.ls_d_res_low                             38.19 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     14664 
_refine.ls_number_reflns_R_free                  738 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    70.9 
_refine.ls_percent_reflns_R_free                 5.030 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.228 
_refine.ls_R_factor_R_free                       0.252 
_refine.ls_R_factor_R_free_error                 0.000 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.226 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4J72 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.299 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.290 
_refine.pdbx_overall_SU_R_Blow_DPI               0.440 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.463 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5JNQ 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.40 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2342 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         95 
_refine_hist.number_atoms_solvent             3 
_refine_hist.number_atoms_total               2440 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        38.19 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? 2496 ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 1.09  ? 3383 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 823  ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 25   ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 359  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 2496 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_nbd                     ?     ?            
'X-RAY DIFFRACTION' ? 5.28  ? ?    ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 20.84 ? ?    ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 354  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 3020 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.6 
_refine_ls_shell.d_res_low                        ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_R_work             1059 
_refine_ls_shell.percent_reflns_obs               26.67 
_refine_ls_shell.percent_reflns_R_free            5.53 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.203 
_refine_ls_shell.R_factor_R_free_error            0.000 
_refine_ls_shell.R_factor_R_work                  0.209 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5JNQ 
_struct.title                        'MraY tunicamycin complex' 
_struct.pdbx_descriptor              'Phospho-N-acetylmuramoyl-pentapeptide-transferase (E.C.2.7.8.13)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5JNQ 
_struct_keywords.text            'Membrane protein, antibiotic, PNPT, Transferase-Antibiotic complex' 
_struct_keywords.pdbx_keywords   Transferase/Antibiotic 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 27  ? PHE A 65  ? GLU A -6  PHE A 32  1 ? 39 
HELX_P HELX_P2  AA2 GLY A 87  ? ILE A 103 ? GLY A 54  ILE A 70  1 ? 17 
HELX_P HELX_P3  AA3 LYS A 108 ? VAL A 132 ? LYS A 75  VAL A 99  1 ? 25 
HELX_P HELX_P4  AA4 PRO A 141 ? SER A 162 ? PRO A 108 SER A 129 1 ? 22 
HELX_P HELX_P5  AA5 PRO A 172 ? GLY A 175 ? PRO A 139 GLY A 142 5 ? 4  
HELX_P HELX_P6  AA6 LEU A 185 ? ILE A 187 ? LEU A 152 ILE A 154 5 ? 3  
HELX_P HELX_P7  AA7 PHE A 188 ? ASP A 208 ? PHE A 155 ASP A 175 1 ? 21 
HELX_P HELX_P8  AA8 GLY A 212 ? GLU A 232 ? GLY A 179 GLU A 199 1 ? 21 
HELX_P HELX_P9  AA9 ILE A 236 ? VAL A 255 ? ILE A 203 VAL A 222 1 ? 20 
HELX_P HELX_P10 AB1 ASP A 264 ? MET A 281 ? ASP A 231 MET A 248 1 ? 18 
HELX_P HELX_P11 AB2 MET A 283 ? LEU A 285 ? MET A 250 LEU A 252 5 ? 3  
HELX_P HELX_P12 AB3 PHE A 286 ? GLY A 291 ? PHE A 253 GLY A 258 1 ? 6  
HELX_P HELX_P13 AB4 GLY A 291 ? THR A 311 ? GLY A 258 THR A 278 1 ? 21 
HELX_P HELX_P14 AB5 PRO A 321 ? LEU A 328 ? PRO A 288 LEU A 295 1 ? 8  
HELX_P HELX_P15 AB6 SER A 332 ? GLY A 354 ? SER A 299 GLY A 321 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 256 A . ? TYR 223 A PRO 257 A ? PRO 224 A 1 -3.52 
2 ALA 320 A . ? ALA 287 A PRO 321 A ? PRO 288 A 1 0.33  
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     AA1 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 169 ? LEU A 170 ? MET A 136 LEU A 137 
AA1 2 PHE A 182 ? LEU A 183 ? PHE A 149 LEU A 150 
# 
_pdbx_struct_sheet_hbond.sheet_id                AA1 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   MET 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    169 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    MET 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     136 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   LEU 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    183 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    LEU 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     150 
# 
_atom_sites.entry_id                    5JNQ 
_atom_sites.fract_transf_matrix[1][1]   0.010794 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009475 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007410 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLU A 1 27  ? 195.435 158.792 261.477 1.00 115.73 ? -6  GLU A N     1 
ATOM   2    C CA    . GLU A 1 27  ? 195.315 158.850 262.935 1.00 113.31 ? -6  GLU A CA    1 
ATOM   3    C C     . GLU A 1 27  ? 193.864 159.168 263.367 1.00 111.00 ? -6  GLU A C     1 
ATOM   4    O O     . GLU A 1 27  ? 192.964 158.362 263.111 1.00 107.10 ? -6  GLU A O     1 
ATOM   5    C CB    . GLU A 1 27  ? 196.364 159.815 263.554 1.00 118.37 ? -6  GLU A CB    1 
ATOM   6    C CG    . GLU A 1 27  ? 196.517 161.168 262.861 1.00 133.23 ? -6  GLU A CG    1 
ATOM   7    C CD    . GLU A 1 27  ? 196.549 162.401 263.750 1.00 159.35 ? -6  GLU A CD    1 
ATOM   8    O OE1   . GLU A 1 27  ? 196.520 163.524 263.197 1.00 156.93 ? -6  GLU A OE1   1 
ATOM   9    O OE2   . GLU A 1 27  ? 196.605 162.253 264.993 1.00 155.37 ? -6  GLU A OE2   1 
ATOM   10   N N     . ASN A 1 28  ? 193.643 160.341 264.001 1.00 106.06 ? -5  ASN A N     1 
ATOM   11   C CA    . ASN A 1 28  ? 192.344 160.852 264.432 1.00 100.83 ? -5  ASN A CA    1 
ATOM   12   C C     . ASN A 1 28  ? 191.535 161.248 263.192 1.00 100.20 ? -5  ASN A C     1 
ATOM   13   O O     . ASN A 1 28  ? 190.308 161.135 263.207 1.00 95.81  ? -5  ASN A O     1 
ATOM   14   C CB    . ASN A 1 28  ? 192.533 162.076 265.342 1.00 106.37 ? -5  ASN A CB    1 
ATOM   15   C CG    . ASN A 1 28  ? 192.963 161.777 266.764 1.00 141.22 ? -5  ASN A CG    1 
ATOM   16   O OD1   . ASN A 1 28  ? 192.255 162.098 267.727 1.00 138.92 ? -5  ASN A OD1   1 
ATOM   17   N ND2   . ASN A 1 28  ? 194.163 161.222 266.938 1.00 135.50 ? -5  ASN A ND2   1 
ATOM   18   N N     . LEU A 1 29  ? 192.244 161.707 262.122 1.00 97.71  ? -4  LEU A N     1 
ATOM   19   C CA    . LEU A 1 29  ? 191.719 162.108 260.812 1.00 96.32  ? -4  LEU A CA    1 
ATOM   20   C C     . LEU A 1 29  ? 191.006 160.926 260.152 1.00 94.25  ? -4  LEU A C     1 
ATOM   21   O O     . LEU A 1 29  ? 189.938 161.111 259.564 1.00 91.39  ? -4  LEU A O     1 
ATOM   22   C CB    . LEU A 1 29  ? 192.874 162.611 259.913 1.00 101.99 ? -4  LEU A CB    1 
ATOM   23   C CG    . LEU A 1 29  ? 192.492 163.140 258.523 1.00 108.54 ? -4  LEU A CG    1 
ATOM   24   C CD1   . LEU A 1 29  ? 192.337 164.650 258.530 1.00 109.39 ? -4  LEU A CD1   1 
ATOM   25   C CD2   . LEU A 1 29  ? 193.517 162.733 257.487 1.00 116.69 ? -4  LEU A CD2   1 
ATOM   26   N N     . TYR A 1 30  ? 191.597 159.712 260.269 1.00 89.07  ? -3  TYR A N     1 
ATOM   27   C CA    . TYR A 1 30  ? 191.053 158.462 259.734 1.00 86.31  ? -3  TYR A CA    1 
ATOM   28   C C     . TYR A 1 30  ? 189.656 158.212 260.303 1.00 84.18  ? -3  TYR A C     1 
ATOM   29   O O     . TYR A 1 30  ? 188.713 157.992 259.537 1.00 82.78  ? -3  TYR A O     1 
ATOM   30   C CB    . TYR A 1 30  ? 191.996 157.272 260.033 1.00 88.67  ? -3  TYR A CB    1 
ATOM   31   C CG    . TYR A 1 30  ? 191.392 155.931 259.680 1.00 87.40  ? -3  TYR A CG    1 
ATOM   32   C CD1   . TYR A 1 30  ? 191.331 155.497 258.359 1.00 91.52  ? -3  TYR A CD1   1 
ATOM   33   C CD2   . TYR A 1 30  ? 190.830 155.118 260.662 1.00 84.47  ? -3  TYR A CD2   1 
ATOM   34   C CE1   . TYR A 1 30  ? 190.730 154.286 258.023 1.00 91.40  ? -3  TYR A CE1   1 
ATOM   35   C CE2   . TYR A 1 30  ? 190.218 153.909 260.337 1.00 84.31  ? -3  TYR A CE2   1 
ATOM   36   C CZ    . TYR A 1 30  ? 190.177 153.494 259.016 1.00 93.87  ? -3  TYR A CZ    1 
ATOM   37   O OH    . TYR A 1 30  ? 189.600 152.294 258.688 1.00 94.56  ? -3  TYR A OH    1 
ATOM   38   N N     . PHE A 1 31  ? 189.533 158.257 261.645 1.00 77.02  ? -2  PHE A N     1 
ATOM   39   C CA    . PHE A 1 31  ? 188.266 158.060 262.337 1.00 71.50  ? -2  PHE A CA    1 
ATOM   40   C C     . PHE A 1 31  ? 187.318 159.218 262.096 1.00 73.93  ? -2  PHE A C     1 
ATOM   41   O O     . PHE A 1 31  ? 186.134 158.964 261.900 1.00 71.26  ? -2  PHE A O     1 
ATOM   42   C CB    . PHE A 1 31  ? 188.472 157.785 263.836 1.00 71.60  ? -2  PHE A CB    1 
ATOM   43   C CG    . PHE A 1 31  ? 188.940 156.377 264.130 1.00 73.54  ? -2  PHE A CG    1 
ATOM   44   C CD1   . PHE A 1 31  ? 188.025 155.333 264.260 1.00 73.13  ? -2  PHE A CD1   1 
ATOM   45   C CD2   . PHE A 1 31  ? 190.294 156.089 264.269 1.00 78.79  ? -2  PHE A CD2   1 
ATOM   46   C CE1   . PHE A 1 31  ? 188.458 154.028 264.521 1.00 74.97  ? -2  PHE A CE1   1 
ATOM   47   C CE2   . PHE A 1 31  ? 190.724 154.784 264.535 1.00 82.31  ? -2  PHE A CE2   1 
ATOM   48   C CZ    . PHE A 1 31  ? 189.802 153.763 264.656 1.00 77.90  ? -2  PHE A CZ    1 
ATOM   49   N N     . GLN A 1 32  ? 187.838 160.479 262.056 1.00 72.22  ? -1  GLN A N     1 
ATOM   50   C CA    . GLN A 1 32  ? 187.052 161.702 261.816 1.00 70.18  ? -1  GLN A CA    1 
ATOM   51   C C     . GLN A 1 32  ? 186.359 161.656 260.453 1.00 73.38  ? -1  GLN A C     1 
ATOM   52   O O     . GLN A 1 32  ? 185.146 161.875 260.390 1.00 69.76  ? -1  GLN A O     1 
ATOM   53   C CB    . GLN A 1 32  ? 187.914 162.971 261.948 1.00 74.35  ? -1  GLN A CB    1 
ATOM   54   C CG    . GLN A 1 32  ? 187.107 164.193 262.411 1.00 92.03  ? -1  GLN A CG    1 
ATOM   55   C CD    . GLN A 1 32  ? 187.400 165.485 261.667 1.00 109.44 ? -1  GLN A CD    1 
ATOM   56   O OE1   . GLN A 1 32  ? 187.747 165.505 260.477 1.00 110.29 ? -1  GLN A OE1   1 
ATOM   57   N NE2   . GLN A 1 32  ? 187.192 166.607 262.343 1.00 91.25  ? -1  GLN A NE2   1 
ATOM   58   N N     . SER A 1 33  ? 187.118 161.328 259.376 1.00 73.52  ? 0   SER A N     1 
ATOM   59   C CA    . SER A 1 33  ? 186.590 161.194 258.012 1.00 74.76  ? 0   SER A CA    1 
ATOM   60   C C     . SER A 1 33  ? 185.528 160.086 257.931 1.00 75.58  ? 0   SER A C     1 
ATOM   61   O O     . SER A 1 33  ? 184.517 160.269 257.254 1.00 74.46  ? 0   SER A O     1 
ATOM   62   C CB    . SER A 1 33  ? 187.712 160.935 257.016 1.00 83.87  ? 0   SER A CB    1 
ATOM   63   O OG    . SER A 1 33  ? 188.387 159.728 257.328 1.00 97.02  ? 0   SER A OG    1 
ATOM   64   N N     . MET A 1 34  ? 185.745 158.961 258.655 1.00 70.59  ? 1   MET A N     1 
ATOM   65   C CA    . MET A 1 34  ? 184.808 157.834 258.760 1.00 67.60  ? 1   MET A CA    1 
ATOM   66   C C     . MET A 1 34  ? 183.494 158.301 259.422 1.00 65.58  ? 1   MET A C     1 
ATOM   67   O O     . MET A 1 34  ? 182.417 158.030 258.885 1.00 63.53  ? 1   MET A O     1 
ATOM   68   C CB    . MET A 1 34  ? 185.461 156.672 259.536 1.00 70.22  ? 1   MET A CB    1 
ATOM   69   C CG    . MET A 1 34  ? 184.500 155.582 259.983 1.00 71.16  ? 1   MET A CG    1 
ATOM   70   S SD    . MET A 1 34  ? 185.201 153.912 259.917 1.00 78.29  ? 1   MET A SD    1 
ATOM   71   C CE    . MET A 1 34  ? 186.555 154.038 261.119 1.00 76.33  ? 1   MET A CE    1 
ATOM   72   N N     . ILE A 1 35  ? 183.595 159.033 260.559 1.00 59.60  ? 2   ILE A N     1 
ATOM   73   C CA    . ILE A 1 35  ? 182.448 159.591 261.289 1.00 55.87  ? 2   ILE A CA    1 
ATOM   74   C C     . ILE A 1 35  ? 181.672 160.551 260.375 1.00 61.15  ? 2   ILE A C     1 
ATOM   75   O O     . ILE A 1 35  ? 180.446 160.473 260.317 1.00 58.68  ? 2   ILE A O     1 
ATOM   76   C CB    . ILE A 1 35  ? 182.862 160.238 262.650 1.00 57.88  ? 2   ILE A CB    1 
ATOM   77   C CG1   . ILE A 1 35  ? 183.501 159.198 263.599 1.00 57.94  ? 2   ILE A CG1   1 
ATOM   78   C CG2   . ILE A 1 35  ? 181.666 160.915 263.339 1.00 55.56  ? 2   ILE A CG2   1 
ATOM   79   C CD1   . ILE A 1 35  ? 184.459 159.756 264.654 1.00 63.29  ? 2   ILE A CD1   1 
ATOM   80   N N     . HIS A 1 36  ? 182.394 161.411 259.627 1.00 61.84  ? 3   HIS A N     1 
ATOM   81   C CA    . HIS A 1 36  ? 181.810 162.367 258.687 1.00 63.32  ? 3   HIS A CA    1 
ATOM   82   C C     . HIS A 1 36  ? 181.122 161.675 257.495 1.00 67.05  ? 3   HIS A C     1 
ATOM   83   O O     . HIS A 1 36  ? 180.049 162.111 257.084 1.00 65.93  ? 3   HIS A O     1 
ATOM   84   C CB    . HIS A 1 36  ? 182.851 163.408 258.247 1.00 68.49  ? 3   HIS A CB    1 
ATOM   85   C CG    . HIS A 1 36  ? 183.051 164.524 259.238 1.00 71.97  ? 3   HIS A CG    1 
ATOM   86   N ND1   . HIS A 1 36  ? 182.890 165.854 258.873 1.00 75.66  ? 3   HIS A ND1   1 
ATOM   87   C CD2   . HIS A 1 36  ? 183.388 164.474 260.552 1.00 72.41  ? 3   HIS A CD2   1 
ATOM   88   C CE1   . HIS A 1 36  ? 183.137 166.561 259.966 1.00 74.39  ? 3   HIS A CE1   1 
ATOM   89   N NE2   . HIS A 1 36  ? 183.430 165.776 261.004 1.00 72.81  ? 3   HIS A NE2   1 
ATOM   90   N N     . GLU A 1 37  ? 181.706 160.574 256.982 1.00 64.88  ? 4   GLU A N     1 
ATOM   91   C CA    . GLU A 1 37  ? 181.135 159.789 255.879 1.00 65.83  ? 4   GLU A CA    1 
ATOM   92   C C     . GLU A 1 37  ? 179.904 159.007 256.328 1.00 66.14  ? 4   GLU A C     1 
ATOM   93   O O     . GLU A 1 37  ? 178.976 158.823 255.539 1.00 66.06  ? 4   GLU A O     1 
ATOM   94   C CB    . GLU A 1 37  ? 182.174 158.832 255.291 1.00 70.42  ? 4   GLU A CB    1 
ATOM   95   C CG    . GLU A 1 37  ? 183.080 159.504 254.281 1.00 85.76  ? 4   GLU A CG    1 
ATOM   96   C CD    . GLU A 1 37  ? 184.378 158.772 254.016 1.00 110.06 ? 4   GLU A CD    1 
ATOM   97   O OE1   . GLU A 1 37  ? 184.325 157.620 253.527 1.00 110.29 ? 4   GLU A OE1   1 
ATOM   98   O OE2   . GLU A 1 37  ? 185.451 159.366 254.268 1.00 104.75 ? 4   GLU A OE2   1 
ATOM   99   N N     . THR A 1 38  ? 179.904 158.542 257.594 1.00 59.35  ? 5   THR A N     1 
ATOM   100  C CA    . THR A 1 38  ? 178.796 157.795 258.201 1.00 55.23  ? 5   THR A CA    1 
ATOM   101  C C     . THR A 1 38  ? 177.622 158.730 258.509 1.00 56.49  ? 5   THR A C     1 
ATOM   102  O O     . THR A 1 38  ? 176.486 158.386 258.184 1.00 55.18  ? 5   THR A O     1 
ATOM   103  C CB    . THR A 1 38  ? 179.284 157.004 259.410 1.00 54.87  ? 5   THR A CB    1 
ATOM   104  O OG1   . THR A 1 38  ? 180.398 156.210 259.006 1.00 52.75  ? 5   THR A OG1   1 
ATOM   105  C CG2   . THR A 1 38  ? 178.206 156.123 259.994 1.00 49.44  ? 5   THR A CG2   1 
ATOM   106  N N     . ILE A 1 39  ? 177.895 159.914 259.114 1.00 52.33  ? 6   ILE A N     1 
ATOM   107  C CA    . ILE A 1 39  ? 176.872 160.928 259.406 1.00 50.87  ? 6   ILE A CA    1 
ATOM   108  C C     . ILE A 1 39  ? 176.220 161.350 258.086 1.00 57.81  ? 6   ILE A C     1 
ATOM   109  O O     . ILE A 1 39  ? 174.995 161.465 258.020 1.00 56.39  ? 6   ILE A O     1 
ATOM   110  C CB    . ILE A 1 39  ? 177.433 162.123 260.241 1.00 53.81  ? 6   ILE A CB    1 
ATOM   111  C CG1   . ILE A 1 39  ? 177.694 161.684 261.701 1.00 52.30  ? 6   ILE A CG1   1 
ATOM   112  C CG2   . ILE A 1 39  ? 176.495 163.348 260.202 1.00 53.67  ? 6   ILE A CG2   1 
ATOM   113  C CD1   . ILE A 1 39  ? 178.503 162.654 262.552 1.00 60.97  ? 6   ILE A CD1   1 
ATOM   114  N N     . LEU A 1 40  ? 177.039 161.499 257.026 1.00 58.46  ? 7   LEU A N     1 
ATOM   115  C CA    . LEU A 1 40  ? 176.576 161.851 255.689 1.00 61.56  ? 7   LEU A CA    1 
ATOM   116  C C     . LEU A 1 40  ? 175.640 160.785 255.138 1.00 65.73  ? 7   LEU A C     1 
ATOM   117  O O     . LEU A 1 40  ? 174.569 161.139 254.649 1.00 66.80  ? 7   LEU A O     1 
ATOM   118  C CB    . LEU A 1 40  ? 177.750 162.096 254.740 1.00 66.06  ? 7   LEU A CB    1 
ATOM   119  C CG    . LEU A 1 40  ? 177.459 162.969 253.530 1.00 75.02  ? 7   LEU A CG    1 
ATOM   120  C CD1   . LEU A 1 40  ? 177.058 164.379 253.943 1.00 74.77  ? 7   LEU A CD1   1 
ATOM   121  C CD2   . LEU A 1 40  ? 178.667 163.040 252.629 1.00 83.23  ? 7   LEU A CD2   1 
ATOM   122  N N     . ALA A 1 41  ? 175.999 159.488 255.292 1.00 60.57  ? 8   ALA A N     1 
ATOM   123  C CA    . ALA A 1 41  ? 175.181 158.347 254.855 1.00 59.60  ? 8   ALA A CA    1 
ATOM   124  C C     . ALA A 1 41  ? 173.796 158.368 255.509 1.00 58.14  ? 8   ALA A C     1 
ATOM   125  O O     . ALA A 1 41  ? 172.809 158.069 254.838 1.00 58.47  ? 8   ALA A O     1 
ATOM   126  C CB    . ALA A 1 41  ? 175.889 157.036 255.161 1.00 60.17  ? 8   ALA A CB    1 
ATOM   127  N N     . ILE A 1 42  ? 173.725 158.768 256.798 1.00 50.01  ? 9   ILE A N     1 
ATOM   128  C CA    . ILE A 1 42  ? 172.472 158.882 257.553 1.00 46.47  ? 9   ILE A CA    1 
ATOM   129  C C     . ILE A 1 42  ? 171.574 159.960 256.912 1.00 51.26  ? 9   ILE A C     1 
ATOM   130  O O     . ILE A 1 42  ? 170.429 159.662 256.575 1.00 51.39  ? 9   ILE A O     1 
ATOM   131  C CB    . ILE A 1 42  ? 172.719 159.113 259.086 1.00 46.06  ? 9   ILE A CB    1 
ATOM   132  C CG1   . ILE A 1 42  ? 173.523 157.941 259.716 1.00 44.64  ? 9   ILE A CG1   1 
ATOM   133  C CG2   . ILE A 1 42  ? 171.395 159.362 259.850 1.00 43.99  ? 9   ILE A CG2   1 
ATOM   134  C CD1   . ILE A 1 42  ? 174.284 158.247 260.978 1.00 44.70  ? 9   ILE A CD1   1 
ATOM   135  N N     . ILE A 1 43  ? 172.111 161.184 256.704 1.00 48.30  ? 10  ILE A N     1 
ATOM   136  C CA    . ILE A 1 43  ? 171.387 162.319 256.106 1.00 49.42  ? 10  ILE A CA    1 
ATOM   137  C C     . ILE A 1 43  ? 170.963 162.011 254.638 1.00 57.01  ? 10  ILE A C     1 
ATOM   138  O O     . ILE A 1 43  ? 169.835 162.346 254.253 1.00 56.90  ? 10  ILE A O     1 
ATOM   139  C CB    . ILE A 1 43  ? 172.175 163.660 256.262 1.00 53.11  ? 10  ILE A CB    1 
ATOM   140  C CG1   . ILE A 1 43  ? 172.638 163.877 257.726 1.00 49.97  ? 10  ILE A CG1   1 
ATOM   141  C CG2   . ILE A 1 43  ? 171.351 164.861 255.765 1.00 55.21  ? 10  ILE A CG2   1 
ATOM   142  C CD1   . ILE A 1 43  ? 173.819 164.847 257.914 1.00 52.59  ? 10  ILE A CD1   1 
ATOM   143  N N     . ILE A 1 44  ? 171.853 161.345 253.848 1.00 56.33  ? 11  ILE A N     1 
ATOM   144  C CA    . ILE A 1 44  ? 171.588 160.940 252.455 1.00 60.30  ? 11  ILE A CA    1 
ATOM   145  C C     . ILE A 1 44  ? 170.358 160.014 252.429 1.00 63.37  ? 11  ILE A C     1 
ATOM   146  O O     . ILE A 1 44  ? 169.373 160.334 251.761 1.00 65.25  ? 11  ILE A O     1 
ATOM   147  C CB    . ILE A 1 44  ? 172.837 160.293 251.762 1.00 66.50  ? 11  ILE A CB    1 
ATOM   148  C CG1   . ILE A 1 44  ? 174.012 161.299 251.553 1.00 69.48  ? 11  ILE A CG1   1 
ATOM   149  C CG2   . ILE A 1 44  ? 172.473 159.584 250.449 1.00 71.33  ? 11  ILE A CG2   1 
ATOM   150  C CD1   . ILE A 1 44  ? 173.817 162.473 250.537 1.00 84.17  ? 11  ILE A CD1   1 
ATOM   151  N N     . ALA A 1 45  ? 170.402 158.903 253.195 1.00 56.61  ? 12  ALA A N     1 
ATOM   152  C CA    . ALA A 1 45  ? 169.309 157.939 253.295 1.00 55.12  ? 12  ALA A CA    1 
ATOM   153  C C     . ALA A 1 45  ? 168.058 158.547 253.929 1.00 57.05  ? 12  ALA A C     1 
ATOM   154  O O     . ALA A 1 45  ? 166.954 158.144 253.571 1.00 58.03  ? 12  ALA A O     1 
ATOM   155  C CB    . ALA A 1 45  ? 169.751 156.712 254.066 1.00 53.52  ? 12  ALA A CB    1 
ATOM   156  N N     . PHE A 1 46  ? 168.212 159.535 254.836 1.00 50.66  ? 13  PHE A N     1 
ATOM   157  C CA    . PHE A 1 46  ? 167.054 160.199 255.432 1.00 48.32  ? 13  PHE A CA    1 
ATOM   158  C C     . PHE A 1 46  ? 166.318 161.012 254.367 1.00 56.76  ? 13  PHE A C     1 
ATOM   159  O O     . PHE A 1 46  ? 165.097 160.908 254.270 1.00 57.27  ? 13  PHE A O     1 
ATOM   160  C CB    . PHE A 1 46  ? 167.435 161.059 256.655 1.00 46.93  ? 13  PHE A CB    1 
ATOM   161  C CG    . PHE A 1 46  ? 166.322 161.948 257.169 1.00 47.40  ? 13  PHE A CG    1 
ATOM   162  C CD1   . PHE A 1 46  ? 165.232 161.410 257.842 1.00 48.23  ? 13  PHE A CD1   1 
ATOM   163  C CD2   . PHE A 1 46  ? 166.361 163.324 256.970 1.00 50.47  ? 13  PHE A CD2   1 
ATOM   164  C CE1   . PHE A 1 46  ? 164.193 162.228 258.288 1.00 48.55  ? 13  PHE A CE1   1 
ATOM   165  C CE2   . PHE A 1 46  ? 165.327 164.140 257.427 1.00 52.57  ? 13  PHE A CE2   1 
ATOM   166  C CZ    . PHE A 1 46  ? 164.254 163.588 258.089 1.00 48.87  ? 13  PHE A CZ    1 
ATOM   167  N N     . ALA A 1 47  ? 167.068 161.778 253.545 1.00 56.49  ? 14  ALA A N     1 
ATOM   168  C CA    . ALA A 1 47  ? 166.529 162.605 252.461 1.00 60.12  ? 14  ALA A CA    1 
ATOM   169  C C     . ALA A 1 47  ? 165.807 161.769 251.396 1.00 66.25  ? 14  ALA A C     1 
ATOM   170  O O     . ALA A 1 47  ? 164.731 162.164 250.957 1.00 67.26  ? 14  ALA A O     1 
ATOM   171  C CB    . ALA A 1 47  ? 167.640 163.425 251.826 1.00 63.70  ? 14  ALA A CB    1 
ATOM   172  N N     . ILE A 1 48  ? 166.380 160.605 251.013 1.00 63.44  ? 15  ILE A N     1 
ATOM   173  C CA    . ILE A 1 48  ? 165.801 159.697 250.016 1.00 66.49  ? 15  ILE A CA    1 
ATOM   174  C C     . ILE A 1 48  ? 164.489 159.117 250.544 1.00 70.14  ? 15  ILE A C     1 
ATOM   175  O O     . ILE A 1 48  ? 163.461 159.244 249.877 1.00 73.01  ? 15  ILE A O     1 
ATOM   176  C CB    . ILE A 1 48  ? 166.809 158.598 249.554 1.00 70.58  ? 15  ILE A CB    1 
ATOM   177  C CG1   . ILE A 1 48  ? 168.032 159.219 248.847 1.00 73.78  ? 15  ILE A CG1   1 
ATOM   178  C CG2   . ILE A 1 48  ? 166.132 157.567 248.642 1.00 74.70  ? 15  ILE A CG2   1 
ATOM   179  C CD1   . ILE A 1 48  ? 169.274 158.374 248.892 1.00 79.82  ? 15  ILE A CD1   1 
ATOM   180  N N     . SER A 1 49  ? 164.526 158.519 251.755 1.00 63.03  ? 16  SER A N     1 
ATOM   181  C CA    . SER A 1 49  ? 163.378 157.902 252.426 1.00 60.93  ? 16  SER A CA    1 
ATOM   182  C C     . SER A 1 49  ? 162.233 158.891 252.683 1.00 66.08  ? 16  SER A C     1 
ATOM   183  O O     . SER A 1 49  ? 161.075 158.543 252.441 1.00 67.40  ? 16  SER A O     1 
ATOM   184  C CB    . SER A 1 49  ? 163.814 157.236 253.724 1.00 59.21  ? 16  SER A CB    1 
ATOM   185  O OG    . SER A 1 49  ? 162.779 156.438 254.272 1.00 65.99  ? 16  SER A OG    1 
ATOM   186  N N     . ALA A 1 50  ? 162.553 160.119 253.148 1.00 61.80  ? 17  ALA A N     1 
ATOM   187  C CA    . ALA A 1 50  ? 161.545 161.148 253.417 1.00 62.05  ? 17  ALA A CA    1 
ATOM   188  C C     . ALA A 1 50  ? 160.904 161.691 252.136 1.00 71.06  ? 17  ALA A C     1 
ATOM   189  O O     . ALA A 1 50  ? 159.727 162.054 252.166 1.00 71.76  ? 17  ALA A O     1 
ATOM   190  C CB    . ALA A 1 50  ? 162.139 162.283 254.237 1.00 60.72  ? 17  ALA A CB    1 
ATOM   191  N N     . LEU A 1 51  ? 161.664 161.738 251.018 1.00 70.62  ? 18  LEU A N     1 
ATOM   192  C CA    . LEU A 1 51  ? 161.142 162.233 249.741 1.00 75.63  ? 18  LEU A CA    1 
ATOM   193  C C     . LEU A 1 51  ? 160.419 161.162 248.927 1.00 83.76  ? 18  LEU A C     1 
ATOM   194  O O     . LEU A 1 51  ? 159.504 161.508 248.182 1.00 87.79  ? 18  LEU A O     1 
ATOM   195  C CB    . LEU A 1 51  ? 162.216 162.939 248.890 1.00 78.47  ? 18  LEU A CB    1 
ATOM   196  C CG    . LEU A 1 51  ? 162.711 164.307 249.374 1.00 81.58  ? 18  LEU A CG    1 
ATOM   197  C CD1   . LEU A 1 51  ? 163.941 164.735 248.608 1.00 84.49  ? 18  LEU A CD1   1 
ATOM   198  C CD2   . LEU A 1 51  ? 161.639 165.374 249.255 1.00 85.98  ? 18  LEU A CD2   1 
ATOM   199  N N     . LEU A 1 52  ? 160.814 159.875 249.061 1.00 79.31  ? 19  LEU A N     1 
ATOM   200  C CA    . LEU A 1 52  ? 160.169 158.779 248.332 1.00 82.65  ? 19  LEU A CA    1 
ATOM   201  C C     . LEU A 1 52  ? 158.771 158.472 248.855 1.00 87.42  ? 19  LEU A C     1 
ATOM   202  O O     . LEU A 1 52  ? 157.885 158.185 248.053 1.00 91.34  ? 19  LEU A O     1 
ATOM   203  C CB    . LEU A 1 52  ? 161.016 157.497 248.333 1.00 81.75  ? 19  LEU A CB    1 
ATOM   204  C CG    . LEU A 1 52  ? 162.172 157.384 247.332 1.00 89.87  ? 19  LEU A CG    1 
ATOM   205  C CD1   . LEU A 1 52  ? 162.892 156.069 247.509 1.00 88.84  ? 19  LEU A CD1   1 
ATOM   206  C CD2   . LEU A 1 52  ? 161.694 157.489 245.887 1.00 98.89  ? 19  LEU A CD2   1 
ATOM   207  N N     . CYS A 1 53  ? 158.576 158.524 250.191 1.00 80.36  ? 20  CYS A N     1 
ATOM   208  C CA    . CYS A 1 53  ? 157.302 158.248 250.873 1.00 79.54  ? 20  CYS A CA    1 
ATOM   209  C C     . CYS A 1 53  ? 156.089 158.998 250.271 1.00 87.56  ? 20  CYS A C     1 
ATOM   210  O O     . CYS A 1 53  ? 155.136 158.306 249.924 1.00 89.26  ? 20  CYS A O     1 
ATOM   211  C CB    . CYS A 1 53  ? 157.410 158.478 252.377 1.00 74.61  ? 20  CYS A CB    1 
ATOM   212  S SG    . CYS A 1 53  ? 158.181 157.117 253.293 1.00 74.52  ? 20  CYS A SG    1 
ATOM   213  N N     . PRO A 1 54  ? 156.073 160.351 250.086 1.00 86.08  ? 21  PRO A N     1 
ATOM   214  C CA    . PRO A 1 54  ? 154.878 160.984 249.490 1.00 90.62  ? 21  PRO A CA    1 
ATOM   215  C C     . PRO A 1 54  ? 154.667 160.680 248.001 1.00 101.57 ? 21  PRO A C     1 
ATOM   216  O O     . PRO A 1 54  ? 153.568 160.897 247.488 1.00 105.22 ? 21  PRO A O     1 
ATOM   217  C CB    . PRO A 1 54  ? 155.098 162.477 249.753 1.00 91.97  ? 21  PRO A CB    1 
ATOM   218  C CG    . PRO A 1 54  ? 156.564 162.633 249.824 1.00 93.88  ? 21  PRO A CG    1 
ATOM   219  C CD    . PRO A 1 54  ? 157.092 161.367 250.430 1.00 85.53  ? 21  PRO A CD    1 
ATOM   220  N N     . ILE A 1 55  ? 155.713 160.165 247.321 1.00 100.09 ? 22  ILE A N     1 
ATOM   221  C CA    . ILE A 1 55  ? 155.703 159.792 245.902 1.00 106.57 ? 22  ILE A CA    1 
ATOM   222  C C     . ILE A 1 55  ? 155.199 158.345 245.723 1.00 113.40 ? 22  ILE A C     1 
ATOM   223  O O     . ILE A 1 55  ? 154.414 158.082 244.810 1.00 118.68 ? 22  ILE A O     1 
ATOM   224  C CB    . ILE A 1 55  ? 157.106 160.031 245.247 1.00 110.78 ? 22  ILE A CB    1 
ATOM   225  C CG1   . ILE A 1 55  ? 157.530 161.524 245.349 1.00 110.87 ? 22  ILE A CG1   1 
ATOM   226  C CG2   . ILE A 1 55  ? 157.154 159.533 243.788 1.00 118.30 ? 22  ILE A CG2   1 
ATOM   227  C CD1   . ILE A 1 55  ? 158.985 161.869 244.920 1.00 117.80 ? 22  ILE A CD1   1 
ATOM   228  N N     . ILE A 1 56  ? 155.642 157.423 246.600 1.00 106.36 ? 23  ILE A N     1 
ATOM   229  C CA    . ILE A 1 56  ? 155.308 155.995 246.547 1.00 107.56 ? 23  ILE A CA    1 
ATOM   230  C C     . ILE A 1 56  ? 154.016 155.655 247.346 1.00 112.23 ? 23  ILE A C     1 
ATOM   231  O O     . ILE A 1 56  ? 153.392 154.632 247.053 1.00 114.21 ? 23  ILE A O     1 
ATOM   232  C CB    . ILE A 1 56  ? 156.549 155.136 246.956 1.00 107.13 ? 23  ILE A CB    1 
ATOM   233  C CG1   . ILE A 1 56  ? 157.751 155.445 246.021 1.00 110.39 ? 23  ILE A CG1   1 
ATOM   234  C CG2   . ILE A 1 56  ? 156.249 153.624 246.958 1.00 108.59 ? 23  ILE A CG2   1 
ATOM   235  C CD1   . ILE A 1 56  ? 159.109 154.829 246.418 1.00 115.78 ? 23  ILE A CD1   1 
ATOM   236  N N     . ILE A 1 57  ? 153.581 156.522 248.291 1.00 107.52 ? 24  ILE A N     1 
ATOM   237  C CA    . ILE A 1 57  ? 152.360 156.280 249.080 1.00 107.21 ? 24  ILE A CA    1 
ATOM   238  C C     . ILE A 1 57  ? 151.073 156.184 248.189 1.00 116.74 ? 24  ILE A C     1 
ATOM   239  O O     . ILE A 1 57  ? 150.308 155.249 248.441 1.00 116.83 ? 24  ILE A O     1 
ATOM   240  C CB    . ILE A 1 57  ? 152.179 157.239 250.296 1.00 106.84 ? 24  ILE A CB    1 
ATOM   241  C CG1   . ILE A 1 57  ? 151.233 156.626 251.347 1.00 105.61 ? 24  ILE A CG1   1 
ATOM   242  C CG2   . ILE A 1 57  ? 151.774 158.687 249.914 1.00 110.79 ? 24  ILE A CG2   1 
ATOM   243  C CD1   . ILE A 1 57  ? 151.416 157.178 252.696 1.00 111.06 ? 24  ILE A CD1   1 
ATOM   244  N N     . PRO A 1 58  ? 150.801 157.037 247.153 1.00 118.01 ? 25  PRO A N     1 
ATOM   245  C CA    . PRO A 1 58  ? 149.579 156.815 246.355 1.00 123.97 ? 25  PRO A CA    1 
ATOM   246  C C     . PRO A 1 58  ? 149.671 155.569 245.468 1.00 131.52 ? 25  PRO A C     1 
ATOM   247  O O     . PRO A 1 58  ? 148.653 154.925 245.215 1.00 134.65 ? 25  PRO A O     1 
ATOM   248  C CB    . PRO A 1 58  ? 149.437 158.102 245.541 1.00 130.10 ? 25  PRO A CB    1 
ATOM   249  C CG    . PRO A 1 58  ? 150.805 158.641 245.434 1.00 132.21 ? 25  PRO A CG    1 
ATOM   250  C CD    . PRO A 1 58  ? 151.562 158.204 246.649 1.00 120.35 ? 25  PRO A CD    1 
ATOM   251  N N     . PHE A 1 59  ? 150.902 155.222 245.028 1.00 127.45 ? 26  PHE A N     1 
ATOM   252  C CA    . PHE A 1 59  ? 151.226 154.058 244.199 1.00 130.84 ? 26  PHE A CA    1 
ATOM   253  C C     . PHE A 1 59  ? 150.884 152.760 244.941 1.00 131.61 ? 26  PHE A C     1 
ATOM   254  O O     . PHE A 1 59  ? 150.269 151.870 244.349 1.00 135.93 ? 26  PHE A O     1 
ATOM   255  C CB    . PHE A 1 59  ? 152.713 154.106 243.777 1.00 132.03 ? 26  PHE A CB    1 
ATOM   256  C CG    . PHE A 1 59  ? 153.290 152.861 243.140 1.00 136.40 ? 26  PHE A CG    1 
ATOM   257  C CD1   . PHE A 1 59  ? 154.114 152.007 243.865 1.00 134.75 ? 26  PHE A CD1   1 
ATOM   258  C CD2   . PHE A 1 59  ? 153.039 152.562 241.805 1.00 146.37 ? 26  PHE A CD2   1 
ATOM   259  C CE1   . PHE A 1 59  ? 154.657 150.862 243.273 1.00 138.60 ? 26  PHE A CE1   1 
ATOM   260  C CE2   . PHE A 1 59  ? 153.581 151.416 241.215 1.00 152.27 ? 26  PHE A CE2   1 
ATOM   261  C CZ    . PHE A 1 59  ? 154.387 150.574 241.953 1.00 145.51 ? 26  PHE A CZ    1 
ATOM   262  N N     . LEU A 1 60  ? 151.254 152.671 246.236 1.00 120.67 ? 27  LEU A N     1 
ATOM   263  C CA    . LEU A 1 60  ? 150.983 151.505 247.083 1.00 117.42 ? 27  LEU A CA    1 
ATOM   264  C C     . LEU A 1 60  ? 149.508 151.404 247.463 1.00 122.43 ? 27  LEU A C     1 
ATOM   265  O O     . LEU A 1 60  ? 149.008 150.295 247.655 1.00 122.99 ? 27  LEU A O     1 
ATOM   266  C CB    . LEU A 1 60  ? 151.866 151.499 248.342 1.00 110.17 ? 27  LEU A CB    1 
ATOM   267  C CG    . LEU A 1 60  ? 153.369 151.315 248.134 1.00 113.11 ? 27  LEU A CG    1 
ATOM   268  C CD1   . LEU A 1 60  ? 154.128 151.664 249.392 1.00 106.78 ? 27  LEU A CD1   1 
ATOM   269  C CD2   . LEU A 1 60  ? 153.710 149.896 247.696 1.00 117.82 ? 27  LEU A CD2   1 
ATOM   270  N N     . HIS A 1 61  ? 148.814 152.555 247.570 1.00 119.27 ? 28  HIS A N     1 
ATOM   271  C CA    . HIS A 1 61  ? 147.389 152.598 247.894 1.00 120.93 ? 28  HIS A CA    1 
ATOM   272  C C     . HIS A 1 61  ? 146.546 152.173 246.687 1.00 131.87 ? 28  HIS A C     1 
ATOM   273  O O     . HIS A 1 61  ? 145.460 151.618 246.869 1.00 133.74 ? 28  HIS A O     1 
ATOM   274  C CB    . HIS A 1 61  ? 146.974 153.984 248.394 1.00 120.26 ? 28  HIS A CB    1 
ATOM   275  C CG    . HIS A 1 61  ? 145.633 153.986 249.054 1.00 124.64 ? 28  HIS A CG    1 
ATOM   276  N ND1   . HIS A 1 61  ? 145.495 153.705 250.401 1.00 121.69 ? 28  HIS A ND1   1 
ATOM   277  C CD2   . HIS A 1 61  ? 144.407 154.199 248.522 1.00 132.08 ? 28  HIS A CD2   1 
ATOM   278  C CE1   . HIS A 1 61  ? 144.196 153.774 250.649 1.00 123.88 ? 28  HIS A CE1   1 
ATOM   279  N NE2   . HIS A 1 61  ? 143.501 154.067 249.547 1.00 130.38 ? 28  HIS A NE2   1 
ATOM   280  N N     . LYS A 1 62  ? 147.056 152.426 245.460 1.00 132.24 ? 29  LYS A N     1 
ATOM   281  C CA    . LYS A 1 62  ? 146.410 152.045 244.201 1.00 139.83 ? 29  LYS A CA    1 
ATOM   282  C C     . LYS A 1 62  ? 146.436 150.523 244.030 1.00 144.82 ? 29  LYS A C     1 
ATOM   283  O O     . LYS A 1 62  ? 145.493 149.958 243.473 1.00 150.36 ? 29  LYS A O     1 
ATOM   284  C CB    . LYS A 1 62  ? 147.076 152.742 243.005 1.00 146.51 ? 29  LYS A CB    1 
ATOM   285  C CG    . LYS A 1 62  ? 146.486 154.115 242.703 1.00 162.23 ? 29  LYS A CG    1 
ATOM   286  C CD    . LYS A 1 62  ? 147.178 154.798 241.528 1.00 175.95 ? 29  LYS A CD    1 
ATOM   287  C CE    . LYS A 1 62  ? 148.134 155.879 241.973 1.00 180.99 ? 29  LYS A CE    1 
ATOM   288  N NZ    . LYS A 1 62  ? 148.765 156.567 240.817 1.00 194.65 ? 29  LYS A NZ    1 
ATOM   289  N N     . LEU A 1 63  ? 147.508 149.868 244.530 1.00 135.88 ? 30  LEU A N     1 
ATOM   290  C CA    . LEU A 1 63  ? 147.685 148.413 244.508 1.00 136.35 ? 30  LEU A CA    1 
ATOM   291  C C     . LEU A 1 63  ? 146.723 147.746 245.499 1.00 138.31 ? 30  LEU A C     1 
ATOM   292  O O     . LEU A 1 63  ? 146.195 146.672 245.211 1.00 141.86 ? 30  LEU A O     1 
ATOM   293  C CB    . LEU A 1 63  ? 149.138 148.034 244.850 1.00 131.61 ? 30  LEU A CB    1 
ATOM   294  C CG    . LEU A 1 63  ? 150.184 148.269 243.763 1.00 139.22 ? 30  LEU A CG    1 
ATOM   295  C CD1   . LEU A 1 63  ? 151.511 148.674 244.366 1.00 133.24 ? 30  LEU A CD1   1 
ATOM   296  C CD2   . LEU A 1 63  ? 150.366 147.037 242.897 1.00 147.31 ? 30  LEU A CD2   1 
ATOM   297  N N     . LYS A 1 64  ? 146.492 148.396 246.659 1.00 129.30 ? 31  LYS A N     1 
ATOM   298  C CA    . LYS A 1 64  ? 145.607 147.921 247.724 1.00 127.06 ? 31  LYS A CA    1 
ATOM   299  C C     . LYS A 1 64  ? 144.129 148.035 247.334 1.00 136.52 ? 31  LYS A C     1 
ATOM   300  O O     . LYS A 1 64  ? 143.371 147.092 247.565 1.00 138.22 ? 31  LYS A O     1 
ATOM   301  C CB    . LYS A 1 64  ? 145.890 148.680 249.039 1.00 122.39 ? 31  LYS A CB    1 
ATOM   302  C CG    . LYS A 1 64  ? 145.522 147.923 250.319 1.00 130.60 ? 31  LYS A CG    1 
ATOM   303  C CD    . LYS A 1 64  ? 146.571 146.871 250.708 1.00 135.72 ? 31  LYS A CD    1 
ATOM   304  C CE    . LYS A 1 64  ? 146.374 146.339 252.107 1.00 141.27 ? 31  LYS A CE    1 
ATOM   305  N NZ    . LYS A 1 64  ? 146.938 147.258 253.133 1.00 144.08 ? 31  LYS A NZ    1 
ATOM   306  N N     . PHE A 1 65  ? 143.724 149.182 246.749 1.00 135.85 ? 32  PHE A N     1 
ATOM   307  C CA    . PHE A 1 65  ? 142.346 149.449 246.329 1.00 178.10 ? 32  PHE A CA    1 
ATOM   308  C C     . PHE A 1 65  ? 142.068 148.946 244.910 1.00 198.50 ? 32  PHE A C     1 
ATOM   309  O O     . PHE A 1 65  ? 142.565 149.505 243.933 1.00 155.36 ? 32  PHE A O     1 
ATOM   310  C CB    . PHE A 1 65  ? 142.017 150.948 246.458 1.00 179.43 ? 32  PHE A CB    1 
ATOM   311  C CG    . PHE A 1 65  ? 140.947 151.279 247.471 1.00 179.82 ? 32  PHE A CG    1 
ATOM   312  C CD1   . PHE A 1 65  ? 139.604 151.287 247.110 1.00 189.03 ? 32  PHE A CD1   1 
ATOM   313  C CD2   . PHE A 1 65  ? 141.283 151.611 248.779 1.00 175.25 ? 32  PHE A CD2   1 
ATOM   314  C CE1   . PHE A 1 65  ? 138.614 151.604 248.045 1.00 189.19 ? 32  PHE A CE1   1 
ATOM   315  C CE2   . PHE A 1 65  ? 140.293 151.928 249.713 1.00 177.47 ? 32  PHE A CE2   1 
ATOM   316  C CZ    . PHE A 1 65  ? 138.964 151.923 249.340 1.00 181.62 ? 32  PHE A CZ    1 
ATOM   317  N N     . GLY A 1 82  ? 144.850 148.454 257.787 1.00 101.34 ? 49  GLY A N     1 
ATOM   318  C CA    . GLY A 1 82  ? 143.892 149.329 257.121 1.00 104.81 ? 49  GLY A CA    1 
ATOM   319  C C     . GLY A 1 82  ? 144.517 150.405 256.250 1.00 107.80 ? 49  GLY A C     1 
ATOM   320  O O     . GLY A 1 82  ? 143.805 151.104 255.518 1.00 111.46 ? 49  GLY A O     1 
ATOM   321  N N     . THR A 1 83  ? 145.856 150.541 256.322 1.00 98.81  ? 50  THR A N     1 
ATOM   322  C CA    . THR A 1 83  ? 146.646 151.512 255.564 1.00 97.19  ? 50  THR A CA    1 
ATOM   323  C C     . THR A 1 83  ? 147.486 150.763 254.478 1.00 99.79  ? 50  THR A C     1 
ATOM   324  O O     . THR A 1 83  ? 147.645 149.543 254.610 1.00 99.85  ? 50  THR A O     1 
ATOM   325  C CB    . THR A 1 83  ? 147.423 152.409 256.564 1.00 102.27 ? 50  THR A CB    1 
ATOM   326  O OG1   . THR A 1 83  ? 147.163 153.783 256.269 1.00 108.36 ? 50  THR A OG1   1 
ATOM   327  C CG2   . THR A 1 83  ? 148.922 152.136 256.613 1.00 94.94  ? 50  THR A CG2   1 
ATOM   328  N N     . PRO A 1 84  ? 148.005 151.428 253.402 1.00 95.16  ? 51  PRO A N     1 
ATOM   329  C CA    . PRO A 1 84  ? 148.779 150.681 252.388 1.00 96.14  ? 51  PRO A CA    1 
ATOM   330  C C     . PRO A 1 84  ? 150.045 150.017 252.931 1.00 94.37  ? 51  PRO A C     1 
ATOM   331  O O     . PRO A 1 84  ? 150.833 150.657 253.625 1.00 89.51  ? 51  PRO A O     1 
ATOM   332  C CB    . PRO A 1 84  ? 149.100 151.742 251.326 1.00 100.12 ? 51  PRO A CB    1 
ATOM   333  C CG    . PRO A 1 84  ? 149.001 153.038 252.038 1.00 101.72 ? 51  PRO A CG    1 
ATOM   334  C CD    . PRO A 1 84  ? 147.903 152.856 253.038 1.00 96.82  ? 51  PRO A CD    1 
ATOM   335  N N     . THR A 1 85  ? 150.215 148.721 252.636 1.00 91.70  ? 52  THR A N     1 
ATOM   336  C CA    . THR A 1 85  ? 151.377 147.932 253.061 1.00 88.14  ? 52  THR A CA    1 
ATOM   337  C C     . THR A 1 85  ? 152.494 148.028 251.992 1.00 92.86  ? 52  THR A C     1 
ATOM   338  O O     . THR A 1 85  ? 152.429 148.916 251.138 1.00 94.98  ? 52  THR A O     1 
ATOM   339  C CB    . THR A 1 85  ? 150.937 146.499 253.452 1.00 94.68  ? 52  THR A CB    1 
ATOM   340  O OG1   . THR A 1 85  ? 152.041 145.784 254.005 1.00 89.34  ? 52  THR A OG1   1 
ATOM   341  C CG2   . THR A 1 85  ? 150.327 145.720 252.289 1.00 99.17  ? 52  THR A CG2   1 
ATOM   342  N N     . MET A 1 86  ? 153.519 147.143 252.056 1.00 87.75  ? 53  MET A N     1 
ATOM   343  C CA    . MET A 1 86  ? 154.648 147.051 251.114 1.00 89.02  ? 53  MET A CA    1 
ATOM   344  C C     . MET A 1 86  ? 155.524 148.320 251.068 1.00 89.09  ? 53  MET A C     1 
ATOM   345  O O     . MET A 1 86  ? 156.168 148.600 250.053 1.00 91.27  ? 53  MET A O     1 
ATOM   346  C CB    . MET A 1 86  ? 154.152 146.651 249.709 1.00 98.08  ? 53  MET A CB    1 
ATOM   347  C CG    . MET A 1 86  ? 154.981 145.579 249.049 1.00 104.81 ? 53  MET A CG    1 
ATOM   348  S SD    . MET A 1 86  ? 154.074 144.752 247.718 1.00 117.44 ? 53  MET A SD    1 
ATOM   349  C CE    . MET A 1 86  ? 154.132 146.009 246.442 1.00 118.08 ? 53  MET A CE    1 
ATOM   350  N N     . GLY A 1 87  ? 155.572 149.038 252.189 1.00 80.20  ? 54  GLY A N     1 
ATOM   351  C CA    . GLY A 1 87  ? 156.357 150.257 252.358 1.00 76.90  ? 54  GLY A CA    1 
ATOM   352  C C     . GLY A 1 87  ? 157.825 150.004 252.629 1.00 77.37  ? 54  GLY A C     1 
ATOM   353  O O     . GLY A 1 87  ? 158.613 150.953 252.694 1.00 74.99  ? 54  GLY A O     1 
ATOM   354  N N     . GLY A 1 88  ? 158.182 148.723 252.774 1.00 73.87  ? 55  GLY A N     1 
ATOM   355  C CA    . GLY A 1 88  ? 159.551 148.258 252.981 1.00 71.60  ? 55  GLY A CA    1 
ATOM   356  C C     . GLY A 1 88  ? 160.428 148.508 251.769 1.00 77.24  ? 55  GLY A C     1 
ATOM   357  O O     . GLY A 1 88  ? 161.654 148.585 251.895 1.00 74.92  ? 55  GLY A O     1 
ATOM   358  N N     . LEU A 1 89  ? 159.786 148.655 250.581 1.00 78.05  ? 56  LEU A N     1 
ATOM   359  C CA    . LEU A 1 89  ? 160.425 148.968 249.303 1.00 81.57  ? 56  LEU A CA    1 
ATOM   360  C C     . LEU A 1 89  ? 161.050 150.360 249.363 1.00 82.92  ? 56  LEU A C     1 
ATOM   361  O O     . LEU A 1 89  ? 162.117 150.556 248.794 1.00 83.85  ? 56  LEU A O     1 
ATOM   362  C CB    . LEU A 1 89  ? 159.419 148.877 248.143 1.00 87.17  ? 56  LEU A CB    1 
ATOM   363  C CG    . LEU A 1 89  ? 158.996 147.468 247.722 1.00 95.37  ? 56  LEU A CG    1 
ATOM   364  C CD1   . LEU A 1 89  ? 157.640 147.484 247.053 1.00 99.77  ? 56  LEU A CD1   1 
ATOM   365  C CD2   . LEU A 1 89  ? 160.024 146.830 246.805 1.00 101.64 ? 56  LEU A CD2   1 
ATOM   366  N N     . ILE A 1 90  ? 160.407 151.308 250.087 1.00 76.16  ? 57  ILE A N     1 
ATOM   367  C CA    . ILE A 1 90  ? 160.914 152.671 250.299 1.00 73.89  ? 57  ILE A CA    1 
ATOM   368  C C     . ILE A 1 90  ? 162.182 152.596 251.169 1.00 73.00  ? 57  ILE A C     1 
ATOM   369  O O     . ILE A 1 90  ? 163.180 153.240 250.839 1.00 73.40  ? 57  ILE A O     1 
ATOM   370  C CB    . ILE A 1 90  ? 159.839 153.637 250.900 1.00 75.20  ? 57  ILE A CB    1 
ATOM   371  C CG1   . ILE A 1 90  ? 158.575 153.715 250.006 1.00 80.06  ? 57  ILE A CG1   1 
ATOM   372  C CG2   . ILE A 1 90  ? 160.430 155.041 251.144 1.00 74.23  ? 57  ILE A CG2   1 
ATOM   373  C CD1   . ILE A 1 90  ? 157.327 154.371 250.652 1.00 85.38  ? 57  ILE A CD1   1 
ATOM   374  N N     . ILE A 1 91  ? 162.138 151.790 252.259 1.00 64.99  ? 58  ILE A N     1 
ATOM   375  C CA    . ILE A 1 91  ? 163.250 151.570 253.192 1.00 60.71  ? 58  ILE A CA    1 
ATOM   376  C C     . ILE A 1 91  ? 164.445 150.963 252.449 1.00 66.74  ? 58  ILE A C     1 
ATOM   377  O O     . ILE A 1 91  ? 165.555 151.484 252.565 1.00 65.64  ? 58  ILE A O     1 
ATOM   378  C CB    . ILE A 1 91  ? 162.824 150.723 254.428 1.00 60.56  ? 58  ILE A CB    1 
ATOM   379  C CG1   . ILE A 1 91  ? 161.712 151.431 255.240 1.00 58.57  ? 58  ILE A CG1   1 
ATOM   380  C CG2   . ILE A 1 91  ? 164.035 150.376 255.324 1.00 58.30  ? 58  ILE A CG2   1 
ATOM   381  C CD1   . ILE A 1 91  ? 160.930 150.528 256.180 1.00 62.79  ? 58  ILE A CD1   1 
ATOM   382  N N     . LEU A 1 92  ? 164.202 149.890 251.660 1.00 65.89  ? 59  LEU A N     1 
ATOM   383  C CA    . LEU A 1 92  ? 165.221 149.205 250.866 1.00 68.06  ? 59  LEU A CA    1 
ATOM   384  C C     . LEU A 1 92  ? 165.790 150.083 249.753 1.00 74.15  ? 59  LEU A C     1 
ATOM   385  O O     . LEU A 1 92  ? 167.010 150.164 249.629 1.00 73.78  ? 59  LEU A O     1 
ATOM   386  C CB    . LEU A 1 92  ? 164.695 147.876 250.313 1.00 71.60  ? 59  LEU A CB    1 
ATOM   387  C CG    . LEU A 1 92  ? 164.657 146.701 251.297 1.00 74.16  ? 59  LEU A CG    1 
ATOM   388  C CD1   . LEU A 1 92  ? 163.711 145.620 250.808 1.00 77.88  ? 59  LEU A CD1   1 
ATOM   389  C CD2   . LEU A 1 92  ? 166.050 146.110 251.524 1.00 76.41  ? 59  LEU A CD2   1 
ATOM   390  N N     . SER A 1 93  ? 164.921 150.781 248.985 1.00 73.46  ? 60  SER A N     1 
ATOM   391  C CA    . SER A 1 93  ? 165.329 151.696 247.908 1.00 77.25  ? 60  SER A CA    1 
ATOM   392  C C     . SER A 1 93  ? 166.346 152.708 248.416 1.00 78.28  ? 60  SER A C     1 
ATOM   393  O O     . SER A 1 93  ? 167.381 152.901 247.785 1.00 80.65  ? 60  SER A O     1 
ATOM   394  C CB    . SER A 1 93  ? 164.125 152.432 247.325 1.00 83.59  ? 60  SER A CB    1 
ATOM   395  O OG    . SER A 1 93  ? 163.298 151.562 246.569 1.00 98.35  ? 60  SER A OG    1 
ATOM   396  N N     . SER A 1 94  ? 166.068 153.299 249.589 1.00 69.69  ? 61  SER A N     1 
ATOM   397  C CA    . SER A 1 94  ? 166.920 154.276 250.257 1.00 66.46  ? 61  SER A CA    1 
ATOM   398  C C     . SER A 1 94  ? 168.279 153.686 250.685 1.00 69.55  ? 61  SER A C     1 
ATOM   399  O O     . SER A 1 94  ? 169.309 154.332 250.470 1.00 70.19  ? 61  SER A O     1 
ATOM   400  C CB    . SER A 1 94  ? 166.187 154.882 251.447 1.00 64.70  ? 61  SER A CB    1 
ATOM   401  O OG    . SER A 1 94  ? 166.920 155.977 251.961 1.00 71.39  ? 61  SER A OG    1 
ATOM   402  N N     . ILE A 1 95  ? 168.283 152.462 251.263 1.00 64.28  ? 62  ILE A N     1 
ATOM   403  C CA    . ILE A 1 95  ? 169.506 151.781 251.701 1.00 63.50  ? 62  ILE A CA    1 
ATOM   404  C C     . ILE A 1 95  ? 170.401 151.468 250.488 1.00 73.34  ? 62  ILE A C     1 
ATOM   405  O O     . ILE A 1 95  ? 171.577 151.843 250.501 1.00 73.94  ? 62  ILE A O     1 
ATOM   406  C CB    . ILE A 1 95  ? 169.210 150.523 252.585 1.00 64.36  ? 62  ILE A CB    1 
ATOM   407  C CG1   . ILE A 1 95  ? 168.508 150.907 253.911 1.00 60.15  ? 62  ILE A CG1   1 
ATOM   408  C CG2   . ILE A 1 95  ? 170.484 149.695 252.858 1.00 64.90  ? 62  ILE A CG2   1 
ATOM   409  C CD1   . ILE A 1 95  ? 167.685 149.760 254.557 1.00 65.15  ? 62  ILE A CD1   1 
ATOM   410  N N     . ILE A 1 96  ? 169.827 150.822 249.434 1.00 73.64  ? 63  ILE A N     1 
ATOM   411  C CA    . ILE A 1 96  ? 170.529 150.424 248.204 1.00 78.67  ? 63  ILE A CA    1 
ATOM   412  C C     . ILE A 1 96  ? 171.205 151.631 247.531 1.00 84.56  ? 63  ILE A C     1 
ATOM   413  O O     . ILE A 1 96  ? 172.397 151.543 247.242 1.00 86.52  ? 63  ILE A O     1 
ATOM   414  C CB    . ILE A 1 96  ? 169.633 149.596 247.225 1.00 86.03  ? 63  ILE A CB    1 
ATOM   415  C CG1   . ILE A 1 96  ? 169.090 148.314 247.904 1.00 84.25  ? 63  ILE A CG1   1 
ATOM   416  C CG2   . ILE A 1 96  ? 170.395 149.225 245.935 1.00 93.32  ? 63  ILE A CG2   1 
ATOM   417  C CD1   . ILE A 1 96  ? 167.755 147.800 247.348 1.00 92.11  ? 63  ILE A CD1   1 
ATOM   418  N N     . ILE A 1 97  ? 170.475 152.754 247.336 1.00 80.53  ? 64  ILE A N     1 
ATOM   419  C CA    . ILE A 1 97  ? 171.008 153.977 246.713 1.00 83.01  ? 64  ILE A CA    1 
ATOM   420  C C     . ILE A 1 97  ? 172.222 154.531 247.492 1.00 85.11  ? 64  ILE A C     1 
ATOM   421  O O     . ILE A 1 97  ? 173.266 154.771 246.881 1.00 87.90  ? 64  ILE A O     1 
ATOM   422  C CB    . ILE A 1 97  ? 169.900 155.061 246.463 1.00 86.23  ? 64  ILE A CB    1 
ATOM   423  C CG1   . ILE A 1 97  ? 168.748 154.553 245.543 1.00 90.64  ? 64  ILE A CG1   1 
ATOM   424  C CG2   . ILE A 1 97  ? 170.477 156.393 245.947 1.00 89.20  ? 64  ILE A CG2   1 
ATOM   425  C CD1   . ILE A 1 97  ? 169.109 154.039 244.099 1.00 106.79 ? 64  ILE A CD1   1 
ATOM   426  N N     . THR A 1 98  ? 172.088 154.706 248.829 1.00 77.00  ? 65  THR A N     1 
ATOM   427  C CA    . THR A 1 98  ? 173.138 155.237 249.714 1.00 74.28  ? 65  THR A CA    1 
ATOM   428  C C     . THR A 1 98  ? 174.376 154.332 249.761 1.00 80.73  ? 65  THR A C     1 
ATOM   429  O O     . THR A 1 98  ? 175.485 154.804 249.497 1.00 82.40  ? 65  THR A O     1 
ATOM   430  C CB    . THR A 1 98  ? 172.574 155.540 251.120 1.00 74.32  ? 65  THR A CB    1 
ATOM   431  O OG1   . THR A 1 98  ? 171.404 156.347 250.996 1.00 74.40  ? 65  THR A OG1   1 
ATOM   432  C CG2   . THR A 1 98  ? 173.581 156.242 252.025 1.00 68.89  ? 65  THR A CG2   1 
ATOM   433  N N     . SER A 1 99  ? 174.177 153.039 250.085 1.00 77.21  ? 66  SER A N     1 
ATOM   434  C CA    . SER A 1 99  ? 175.245 152.049 250.210 1.00 78.73  ? 66  SER A CA    1 
ATOM   435  C C     . SER A 1 99  ? 176.013 151.769 248.905 1.00 89.46  ? 66  SER A C     1 
ATOM   436  O O     . SER A 1 99  ? 177.158 151.314 248.978 1.00 91.00  ? 66  SER A O     1 
ATOM   437  C CB    . SER A 1 99  ? 174.712 150.755 250.818 1.00 80.91  ? 66  SER A CB    1 
ATOM   438  O OG    . SER A 1 99  ? 173.672 150.197 250.032 1.00 93.23  ? 66  SER A OG    1 
ATOM   439  N N     . VAL A 1 100 ? 175.410 152.067 247.726 1.00 89.76  ? 67  VAL A N     1 
ATOM   440  C CA    . VAL A 1 100 ? 176.046 151.856 246.421 1.00 96.08  ? 67  VAL A CA    1 
ATOM   441  C C     . VAL A 1 100 ? 177.223 152.835 246.214 1.00 102.07 ? 67  VAL A C     1 
ATOM   442  O O     . VAL A 1 100 ? 178.175 152.487 245.511 1.00 106.65 ? 67  VAL A O     1 
ATOM   443  C CB    . VAL A 1 100 ? 175.034 151.831 245.239 1.00 104.13 ? 67  VAL A CB    1 
ATOM   444  C CG1   . VAL A 1 100 ? 174.972 153.157 244.480 1.00 106.73 ? 67  VAL A CG1   1 
ATOM   445  C CG2   . VAL A 1 100 ? 175.332 150.678 244.294 1.00 109.86 ? 67  VAL A CG2   1 
ATOM   446  N N     . PHE A 1 101 ? 177.171 154.027 246.856 1.00 95.00  ? 68  PHE A N     1 
ATOM   447  C CA    . PHE A 1 101 ? 178.237 155.031 246.782 1.00 96.43  ? 68  PHE A CA    1 
ATOM   448  C C     . PHE A 1 101 ? 179.418 154.647 247.682 1.00 97.81  ? 68  PHE A C     1 
ATOM   449  O O     . PHE A 1 101 ? 180.545 155.079 247.428 1.00 100.62 ? 68  PHE A O     1 
ATOM   450  C CB    . PHE A 1 101 ? 177.728 156.426 247.198 1.00 95.54  ? 68  PHE A CB    1 
ATOM   451  C CG    . PHE A 1 101 ? 176.477 156.953 246.531 1.00 98.63  ? 68  PHE A CG    1 
ATOM   452  C CD1   . PHE A 1 101 ? 176.431 157.147 245.154 1.00 108.34 ? 68  PHE A CD1   1 
ATOM   453  C CD2   . PHE A 1 101 ? 175.380 157.346 247.290 1.00 96.28  ? 68  PHE A CD2   1 
ATOM   454  C CE1   . PHE A 1 101 ? 175.284 157.661 244.543 1.00 110.98 ? 68  PHE A CE1   1 
ATOM   455  C CE2   . PHE A 1 101 ? 174.239 157.873 246.680 1.00 100.75 ? 68  PHE A CE2   1 
ATOM   456  C CZ    . PHE A 1 101 ? 174.196 158.023 245.310 1.00 105.30 ? 68  PHE A CZ    1 
ATOM   457  N N     . TYR A 1 102 ? 179.156 153.858 248.744 1.00 88.85  ? 69  TYR A N     1 
ATOM   458  C CA    . TYR A 1 102 ? 180.168 153.453 249.718 1.00 86.28  ? 69  TYR A CA    1 
ATOM   459  C C     . TYR A 1 102 ? 180.827 152.100 249.433 1.00 94.08  ? 69  TYR A C     1 
ATOM   460  O O     . TYR A 1 102 ? 181.911 151.857 249.962 1.00 93.80  ? 69  TYR A O     1 
ATOM   461  C CB    . TYR A 1 102 ? 179.598 153.491 251.144 1.00 80.43  ? 69  TYR A CB    1 
ATOM   462  C CG    . TYR A 1 102 ? 179.264 154.887 251.623 1.00 78.47  ? 69  TYR A CG    1 
ATOM   463  C CD1   . TYR A 1 102 ? 177.985 155.412 251.467 1.00 78.59  ? 69  TYR A CD1   1 
ATOM   464  C CD2   . TYR A 1 102 ? 180.224 155.681 252.245 1.00 78.22  ? 69  TYR A CD2   1 
ATOM   465  C CE1   . TYR A 1 102 ? 177.673 156.699 251.897 1.00 76.72  ? 69  TYR A CE1   1 
ATOM   466  C CE2   . TYR A 1 102 ? 179.922 156.969 252.686 1.00 76.76  ? 69  TYR A CE2   1 
ATOM   467  C CZ    . TYR A 1 102 ? 178.643 157.473 252.513 1.00 80.84  ? 69  TYR A CZ    1 
ATOM   468  O OH    . TYR A 1 102 ? 178.336 158.742 252.939 1.00 77.31  ? 69  TYR A OH    1 
ATOM   469  N N     . ILE A 1 103 ? 180.202 151.240 248.590 1.00 94.01  ? 70  ILE A N     1 
ATOM   470  C CA    . ILE A 1 103 ? 180.710 149.907 248.215 1.00 97.59  ? 70  ILE A CA    1 
ATOM   471  C C     . ILE A 1 103 ? 182.210 149.941 247.761 1.00 106.00 ? 70  ILE A C     1 
ATOM   472  O O     . ILE A 1 103 ? 182.973 149.141 248.308 1.00 105.31 ? 70  ILE A O     1 
ATOM   473  C CB    . ILE A 1 103 ? 179.765 149.189 247.195 1.00 104.18 ? 70  ILE A CB    1 
ATOM   474  C CG1   . ILE A 1 103 ? 178.576 148.539 247.939 1.00 100.10 ? 70  ILE A CG1   1 
ATOM   475  C CG2   . ILE A 1 103 ? 180.502 148.138 246.341 1.00 111.07 ? 70  ILE A CG2   1 
ATOM   476  C CD1   . ILE A 1 103 ? 177.291 148.379 247.131 1.00 109.33 ? 70  ILE A CD1   1 
ATOM   477  N N     . PRO A 1 104 ? 182.684 150.846 246.856 1.00 107.18 ? 71  PRO A N     1 
ATOM   478  C CA    . PRO A 1 104 ? 184.114 150.822 246.483 1.00 112.18 ? 71  PRO A CA    1 
ATOM   479  C C     . PRO A 1 104 ? 185.111 151.107 247.614 1.00 114.22 ? 71  PRO A C     1 
ATOM   480  O O     . PRO A 1 104 ? 186.221 150.573 247.586 1.00 117.50 ? 71  PRO A O     1 
ATOM   481  C CB    . PRO A 1 104 ? 184.209 151.870 245.370 1.00 118.43 ? 71  PRO A CB    1 
ATOM   482  C CG    . PRO A 1 104 ? 183.058 152.775 245.602 1.00 118.52 ? 71  PRO A CG    1 
ATOM   483  C CD    . PRO A 1 104 ? 181.962 151.879 246.081 1.00 110.05 ? 71  PRO A CD    1 
ATOM   484  N N     . SER A 1 105 ? 184.722 151.935 248.598 1.00 105.65 ? 72  SER A N     1 
ATOM   485  C CA    . SER A 1 105 ? 185.561 152.305 249.744 1.00 102.90 ? 72  SER A CA    1 
ATOM   486  C C     . SER A 1 105 ? 185.412 151.325 250.922 1.00 102.48 ? 72  SER A C     1 
ATOM   487  O O     . SER A 1 105 ? 186.398 151.012 251.590 1.00 102.26 ? 72  SER A O     1 
ATOM   488  C CB    . SER A 1 105 ? 185.242 153.728 250.191 1.00 103.95 ? 72  SER A CB    1 
ATOM   489  O OG    . SER A 1 105 ? 186.089 154.159 251.244 1.00 112.81 ? 72  SER A OG    1 
ATOM   490  N N     . TYR A 1 106 ? 184.177 150.864 251.181 1.00 95.42  ? 73  TYR A N     1 
ATOM   491  C CA    . TYR A 1 106 ? 183.832 149.939 252.260 1.00 91.33  ? 73  TYR A CA    1 
ATOM   492  C C     . TYR A 1 106 ? 183.299 148.629 251.633 1.00 97.32  ? 73  TYR A C     1 
ATOM   493  O O     . TYR A 1 106 ? 182.084 148.482 251.467 1.00 95.08  ? 73  TYR A O     1 
ATOM   494  C CB    . TYR A 1 106 ? 182.768 150.566 253.186 1.00 86.24  ? 73  TYR A CB    1 
ATOM   495  C CG    . TYR A 1 106 ? 183.174 151.825 253.923 1.00 85.25  ? 73  TYR A CG    1 
ATOM   496  C CD1   . TYR A 1 106 ? 183.164 153.064 253.288 1.00 88.34  ? 73  TYR A CD1   1 
ATOM   497  C CD2   . TYR A 1 106 ? 183.442 151.797 255.289 1.00 82.52  ? 73  TYR A CD2   1 
ATOM   498  C CE1   . TYR A 1 106 ? 183.483 154.234 253.975 1.00 86.90  ? 73  TYR A CE1   1 
ATOM   499  C CE2   . TYR A 1 106 ? 183.749 152.963 255.990 1.00 81.31  ? 73  TYR A CE2   1 
ATOM   500  C CZ    . TYR A 1 106 ? 183.772 154.179 255.328 1.00 89.93  ? 73  TYR A CZ    1 
ATOM   501  O OH    . TYR A 1 106 ? 184.080 155.328 256.016 1.00 90.13  ? 73  TYR A OH    1 
ATOM   502  N N     . PRO A 1 107 ? 184.178 147.676 251.245 1.00 98.17  ? 74  PRO A N     1 
ATOM   503  C CA    . PRO A 1 107 ? 183.679 146.447 250.593 1.00 100.73 ? 74  PRO A CA    1 
ATOM   504  C C     . PRO A 1 107 ? 182.851 145.504 251.478 1.00 100.41 ? 74  PRO A C     1 
ATOM   505  O O     . PRO A 1 107 ? 181.989 144.800 250.945 1.00 101.33 ? 74  PRO A O     1 
ATOM   506  C CB    . PRO A 1 107 ? 184.950 145.774 250.064 1.00 108.35 ? 74  PRO A CB    1 
ATOM   507  C CG    . PRO A 1 107 ? 186.042 146.297 250.909 1.00 111.61 ? 74  PRO A CG    1 
ATOM   508  C CD    . PRO A 1 107 ? 185.654 147.688 251.322 1.00 102.89 ? 74  PRO A CD    1 
ATOM   509  N N     . LYS A 1 108 ? 183.070 145.512 252.815 1.00 91.79  ? 75  LYS A N     1 
ATOM   510  C CA    . LYS A 1 108 ? 182.361 144.639 253.766 1.00 87.66  ? 75  LYS A CA    1 
ATOM   511  C C     . LYS A 1 108 ? 180.833 144.880 253.837 1.00 86.56  ? 75  LYS A C     1 
ATOM   512  O O     . LYS A 1 108 ? 180.122 144.124 254.508 1.00 83.52  ? 75  LYS A O     1 
ATOM   513  C CB    . LYS A 1 108 ? 182.998 144.708 255.160 1.00 86.84  ? 75  LYS A CB    1 
ATOM   514  C CG    . LYS A 1 108 ? 184.259 143.864 255.296 1.00 93.97  ? 75  LYS A CG    1 
ATOM   515  C CD    . LYS A 1 108 ? 184.624 143.661 256.756 1.00 96.77  ? 75  LYS A CD    1 
ATOM   516  C CE    . LYS A 1 108 ? 186.110 143.743 256.981 1.00 107.78 ? 75  LYS A CE    1 
ATOM   517  N NZ    . LYS A 1 108 ? 186.439 143.894 258.422 1.00 112.22 ? 75  LYS A NZ    1 
ATOM   518  N N     . ILE A 1 109 ? 180.339 145.904 253.114 1.00 82.37  ? 76  ILE A N     1 
ATOM   519  C CA    . ILE A 1 109 ? 178.923 146.269 252.992 1.00 78.96  ? 76  ILE A CA    1 
ATOM   520  C C     . ILE A 1 109 ? 178.183 145.213 252.144 1.00 85.84  ? 76  ILE A C     1 
ATOM   521  O O     . ILE A 1 109 ? 177.097 144.786 252.529 1.00 83.43  ? 76  ILE A O     1 
ATOM   522  C CB    . ILE A 1 109 ? 178.794 147.712 252.410 1.00 81.52  ? 76  ILE A CB    1 
ATOM   523  C CG1   . ILE A 1 109 ? 179.159 148.768 253.476 1.00 77.74  ? 76  ILE A CG1   1 
ATOM   524  C CG2   . ILE A 1 109 ? 177.407 147.977 251.793 1.00 81.97  ? 76  ILE A CG2   1 
ATOM   525  C CD1   . ILE A 1 109 ? 179.198 150.215 252.990 1.00 85.21  ? 76  ILE A CD1   1 
ATOM   526  N N     . ILE A 1 110 ? 178.783 144.799 251.003 1.00 87.74  ? 77  ILE A N     1 
ATOM   527  C CA    . ILE A 1 110 ? 178.252 143.831 250.028 1.00 91.88  ? 77  ILE A CA    1 
ATOM   528  C C     . ILE A 1 110 ? 177.518 142.630 250.710 1.00 94.41  ? 77  ILE A C     1 
ATOM   529  O O     . ILE A 1 110 ? 176.326 142.476 250.426 1.00 93.79  ? 77  ILE A O     1 
ATOM   530  C CB    . ILE A 1 110 ? 179.336 143.381 248.994 1.00 101.44 ? 77  ILE A CB    1 
ATOM   531  C CG1   . ILE A 1 110 ? 179.925 144.606 248.248 1.00 103.82 ? 77  ILE A CG1   1 
ATOM   532  C CG2   . ILE A 1 110 ? 178.773 142.346 248.001 1.00 106.77 ? 77  ILE A CG2   1 
ATOM   533  C CD1   . ILE A 1 110 ? 181.333 144.433 247.696 1.00 116.77 ? 77  ILE A CD1   1 
ATOM   534  N N     . PRO A 1 111 ? 178.135 141.815 251.620 1.00 89.92  ? 78  PRO A N     1 
ATOM   535  C CA    . PRO A 1 111 ? 177.375 140.710 252.240 1.00 88.51  ? 78  PRO A CA    1 
ATOM   536  C C     . PRO A 1 111 ? 176.156 141.157 253.038 1.00 87.17  ? 78  PRO A C     1 
ATOM   537  O O     . PRO A 1 111 ? 175.120 140.496 252.958 1.00 86.81  ? 78  PRO A O     1 
ATOM   538  C CB    . PRO A 1 111 ? 178.402 140.021 253.140 1.00 90.33  ? 78  PRO A CB    1 
ATOM   539  C CG    . PRO A 1 111 ? 179.461 141.025 253.356 1.00 93.78  ? 78  PRO A CG    1 
ATOM   540  C CD    . PRO A 1 111 ? 179.532 141.821 252.101 1.00 92.07  ? 78  PRO A CD    1 
ATOM   541  N N     . VAL A 1 112 ? 176.277 142.283 253.787 1.00 79.64  ? 79  VAL A N     1 
ATOM   542  C CA    . VAL A 1 112 ? 175.193 142.863 254.593 1.00 74.85  ? 79  VAL A CA    1 
ATOM   543  C C     . VAL A 1 112 ? 174.062 143.297 253.656 1.00 80.20  ? 79  VAL A C     1 
ATOM   544  O O     . VAL A 1 112 ? 172.917 142.935 253.903 1.00 78.50  ? 79  VAL A O     1 
ATOM   545  C CB    . VAL A 1 112 ? 175.658 144.025 255.521 1.00 74.48  ? 79  VAL A CB    1 
ATOM   546  C CG1   . VAL A 1 112 ? 174.505 144.550 256.381 1.00 69.64  ? 79  VAL A CG1   1 
ATOM   547  C CG2   . VAL A 1 112 ? 176.825 143.597 256.402 1.00 74.08  ? 79  VAL A CG2   1 
ATOM   548  N N     . LEU A 1 113 ? 174.396 144.014 252.560 1.00 79.85  ? 80  LEU A N     1 
ATOM   549  C CA    . LEU A 1 113 ? 173.432 144.484 251.565 1.00 81.50  ? 80  LEU A CA    1 
ATOM   550  C C     . LEU A 1 113 ? 172.693 143.323 250.909 1.00 89.51  ? 80  LEU A C     1 
ATOM   551  O O     . LEU A 1 113 ? 171.465 143.365 250.844 1.00 88.41  ? 80  LEU A O     1 
ATOM   552  C CB    . LEU A 1 113 ? 174.107 145.391 250.514 1.00 84.64  ? 80  LEU A CB    1 
ATOM   553  C CG    . LEU A 1 113 ? 173.205 146.056 249.456 1.00 91.58  ? 80  LEU A CG    1 
ATOM   554  C CD1   . LEU A 1 113 ? 172.139 146.954 250.089 1.00 86.98  ? 80  LEU A CD1   1 
ATOM   555  C CD2   . LEU A 1 113 ? 174.029 146.859 248.475 1.00 97.93  ? 80  LEU A CD2   1 
ATOM   556  N N     . PHE A 1 114 ? 173.437 142.276 250.475 1.00 90.33  ? 81  PHE A N     1 
ATOM   557  C CA    . PHE A 1 114 ? 172.898 141.069 249.838 1.00 94.40  ? 81  PHE A CA    1 
ATOM   558  C C     . PHE A 1 114 ? 171.891 140.332 250.729 1.00 94.08  ? 81  PHE A C     1 
ATOM   559  O O     . PHE A 1 114 ? 170.884 139.844 250.221 1.00 95.89  ? 81  PHE A O     1 
ATOM   560  C CB    . PHE A 1 114 ? 174.037 140.129 249.383 1.00 101.50 ? 81  PHE A CB    1 
ATOM   561  C CG    . PHE A 1 114 ? 173.641 138.679 249.191 1.00 107.27 ? 81  PHE A CG    1 
ATOM   562  C CD1   . PHE A 1 114 ? 172.901 138.283 248.081 1.00 115.64 ? 81  PHE A CD1   1 
ATOM   563  C CD2   . PHE A 1 114 ? 173.998 137.713 250.126 1.00 108.68 ? 81  PHE A CD2   1 
ATOM   564  C CE1   . PHE A 1 114 ? 172.518 136.949 247.916 1.00 120.29 ? 81  PHE A CE1   1 
ATOM   565  C CE2   . PHE A 1 114 ? 173.615 136.380 249.959 1.00 115.21 ? 81  PHE A CE2   1 
ATOM   566  C CZ    . PHE A 1 114 ? 172.878 136.008 248.855 1.00 118.14 ? 81  PHE A CZ    1 
ATOM   567  N N     . VAL A 1 115 ? 172.175 140.242 252.041 1.00 85.40  ? 82  VAL A N     1 
ATOM   568  C CA    . VAL A 1 115 ? 171.321 139.570 253.025 1.00 82.23  ? 82  VAL A CA    1 
ATOM   569  C C     . VAL A 1 115 ? 169.982 140.324 253.219 1.00 82.90  ? 82  VAL A C     1 
ATOM   570  O O     . VAL A 1 115 ? 168.932 139.688 253.115 1.00 84.10  ? 82  VAL A O     1 
ATOM   571  C CB    . VAL A 1 115 ? 172.077 139.292 254.356 1.00 82.66  ? 82  VAL A CB    1 
ATOM   572  C CG1   . VAL A 1 115 ? 171.124 138.984 255.504 1.00 78.90  ? 82  VAL A CG1   1 
ATOM   573  C CG2   . VAL A 1 115 ? 173.086 138.161 254.184 1.00 86.41  ? 82  VAL A CG2   1 
ATOM   574  N N     . THR A 1 116 ? 170.012 141.661 253.464 1.00 75.12  ? 83  THR A N     1 
ATOM   575  C CA    . THR A 1 116 ? 168.779 142.449 253.656 1.00 71.77  ? 83  THR A CA    1 
ATOM   576  C C     . THR A 1 116 ? 167.936 142.471 252.372 1.00 79.15  ? 83  THR A C     1 
ATOM   577  O O     . THR A 1 116 ? 166.712 142.371 252.459 1.00 78.81  ? 83  THR A O     1 
ATOM   578  C CB    . THR A 1 116 ? 169.006 143.864 254.258 1.00 73.12  ? 83  THR A CB    1 
ATOM   579  O OG1   . THR A 1 116 ? 168.748 144.891 253.300 1.00 76.11  ? 83  THR A OG1   1 
ATOM   580  C CG2   . THR A 1 116 ? 170.358 144.050 254.890 1.00 67.40  ? 83  THR A CG2   1 
ATOM   581  N N     . VAL A 1 117 ? 168.587 142.576 251.193 1.00 79.00  ? 84  VAL A N     1 
ATOM   582  C CA    . VAL A 1 117 ? 167.909 142.557 249.893 1.00 83.20  ? 84  VAL A CA    1 
ATOM   583  C C     . VAL A 1 117 ? 167.334 141.146 249.658 1.00 91.17  ? 84  VAL A C     1 
ATOM   584  O O     . VAL A 1 117 ? 166.194 141.022 249.214 1.00 92.63  ? 84  VAL A O     1 
ATOM   585  C CB    . VAL A 1 117 ? 168.815 143.087 248.743 1.00 90.59  ? 84  VAL A CB    1 
ATOM   586  C CG1   . VAL A 1 117 ? 168.243 142.771 247.362 1.00 96.66  ? 84  VAL A CG1   1 
ATOM   587  C CG2   . VAL A 1 117 ? 169.052 144.588 248.887 1.00 87.20  ? 84  VAL A CG2   1 
ATOM   588  N N     . GLY A 1 118 ? 168.092 140.121 250.051 1.00 89.28  ? 85  GLY A N     1 
ATOM   589  C CA    . GLY A 1 118 ? 167.690 138.719 249.967 1.00 92.98  ? 85  GLY A CA    1 
ATOM   590  C C     . GLY A 1 118 ? 166.468 138.409 250.810 1.00 95.44  ? 85  GLY A C     1 
ATOM   591  O O     . GLY A 1 118 ? 165.550 137.731 250.343 1.00 98.85  ? 85  GLY A O     1 
ATOM   592  N N     . PHE A 1 119 ? 166.433 138.932 252.050 1.00 86.82  ? 86  PHE A N     1 
ATOM   593  C CA    . PHE A 1 119 ? 165.304 138.773 252.968 1.00 84.31  ? 86  PHE A CA    1 
ATOM   594  C C     . PHE A 1 119 ? 164.135 139.677 252.549 1.00 89.44  ? 86  PHE A C     1 
ATOM   595  O O     . PHE A 1 119 ? 162.981 139.394 252.885 1.00 89.26  ? 86  PHE A O     1 
ATOM   596  C CB    . PHE A 1 119 ? 165.728 139.075 254.410 1.00 80.84  ? 86  PHE A CB    1 
ATOM   597  C CG    . PHE A 1 119 ? 166.301 137.907 255.176 1.00 82.96  ? 86  PHE A CG    1 
ATOM   598  C CD1   . PHE A 1 119 ? 165.472 136.917 255.689 1.00 87.21  ? 86  PHE A CD1   1 
ATOM   599  C CD2   . PHE A 1 119 ? 167.662 137.821 255.427 1.00 84.95  ? 86  PHE A CD2   1 
ATOM   600  C CE1   . PHE A 1 119 ? 166.003 135.844 256.413 1.00 89.05  ? 86  PHE A CE1   1 
ATOM   601  C CE2   . PHE A 1 119 ? 168.191 136.753 256.156 1.00 88.67  ? 86  PHE A CE2   1 
ATOM   602  C CZ    . PHE A 1 119 ? 167.358 135.772 256.645 1.00 87.85  ? 86  PHE A CZ    1 
ATOM   603  N N     . GLY A 1 120 ? 164.457 140.751 251.827 1.00 86.71  ? 87  GLY A N     1 
ATOM   604  C CA    . GLY A 1 120 ? 163.499 141.698 251.272 1.00 86.94  ? 87  GLY A CA    1 
ATOM   605  C C     . GLY A 1 120 ? 162.757 141.102 250.089 1.00 97.19  ? 87  GLY A C     1 
ATOM   606  O O     . GLY A 1 120 ? 161.607 141.474 249.835 1.00 98.06  ? 87  GLY A O     1 
ATOM   607  N N     . ILE A 1 121 ? 163.415 140.160 249.360 1.00 97.82  ? 88  ILE A N     1 
ATOM   608  C CA    . ILE A 1 121 ? 162.848 139.433 248.217 1.00 104.04 ? 88  ILE A CA    1 
ATOM   609  C C     . ILE A 1 121 ? 161.689 138.557 248.715 1.00 108.88 ? 88  ILE A C     1 
ATOM   610  O O     . ILE A 1 121 ? 160.585 138.667 248.176 1.00 111.50 ? 88  ILE A O     1 
ATOM   611  C CB    . ILE A 1 121 ? 163.938 138.620 247.430 1.00 111.93 ? 88  ILE A CB    1 
ATOM   612  C CG1   . ILE A 1 121 ? 164.926 139.540 246.646 1.00 113.66 ? 88  ILE A CG1   1 
ATOM   613  C CG2   . ILE A 1 121 ? 163.341 137.533 246.516 1.00 118.93 ? 88  ILE A CG2   1 
ATOM   614  C CD1   . ILE A 1 121 ? 164.337 140.550 245.581 1.00 124.14 ? 88  ILE A CD1   1 
ATOM   615  N N     . ILE A 1 122 ? 161.936 137.724 249.766 1.00 102.91 ? 89  ILE A N     1 
ATOM   616  C CA    . ILE A 1 122 ? 160.943 136.829 250.394 1.00 102.86 ? 89  ILE A CA    1 
ATOM   617  C C     . ILE A 1 122 ? 159.716 137.646 250.840 1.00 103.88 ? 89  ILE A C     1 
ATOM   618  O O     . ILE A 1 122 ? 158.581 137.243 250.571 1.00 106.41 ? 89  ILE A O     1 
ATOM   619  C CB    . ILE A 1 122 ? 161.546 135.993 251.569 1.00 103.13 ? 89  ILE A CB    1 
ATOM   620  C CG1   . ILE A 1 122 ? 162.877 135.322 251.183 1.00 106.13 ? 89  ILE A CG1   1 
ATOM   621  C CG2   . ILE A 1 122 ? 160.542 134.954 252.102 1.00 104.88 ? 89  ILE A CG2   1 
ATOM   622  C CD1   . ILE A 1 122 ? 163.857 135.244 252.317 1.00 109.84 ? 89  ILE A CD1   1 
ATOM   623  N N     . GLY A 1 123 ? 159.975 138.793 251.472 1.00 94.83  ? 90  GLY A N     1 
ATOM   624  C CA    . GLY A 1 123 ? 158.955 139.722 251.936 1.00 91.75  ? 90  GLY A CA    1 
ATOM   625  C C     . GLY A 1 123 ? 158.170 140.360 250.807 1.00 99.32  ? 90  GLY A C     1 
ATOM   626  O O     . GLY A 1 123 ? 156.949 140.512 250.923 1.00 99.65  ? 90  GLY A O     1 
ATOM   627  N N     . PHE A 1 124 ? 158.863 140.726 249.696 1.00 98.50  ? 91  PHE A N     1 
ATOM   628  C CA    . PHE A 1 124 ? 158.229 141.320 248.512 1.00 102.50 ? 91  PHE A CA    1 
ATOM   629  C C     . PHE A 1 124 ? 157.298 140.307 247.857 1.00 112.49 ? 91  PHE A C     1 
ATOM   630  O O     . PHE A 1 124 ? 156.217 140.681 247.402 1.00 114.46 ? 91  PHE A O     1 
ATOM   631  C CB    . PHE A 1 124 ? 159.264 141.848 247.500 1.00 106.65 ? 91  PHE A CB    1 
ATOM   632  C CG    . PHE A 1 124 ? 158.654 142.457 246.256 1.00 113.30 ? 91  PHE A CG    1 
ATOM   633  C CD1   . PHE A 1 124 ? 158.032 143.699 246.302 1.00 114.68 ? 91  PHE A CD1   1 
ATOM   634  C CD2   . PHE A 1 124 ? 158.689 141.781 245.043 1.00 122.53 ? 91  PHE A CD2   1 
ATOM   635  C CE1   . PHE A 1 124 ? 157.455 144.254 245.156 1.00 120.79 ? 91  PHE A CE1   1 
ATOM   636  C CE2   . PHE A 1 124 ? 158.112 142.338 243.897 1.00 130.63 ? 91  PHE A CE2   1 
ATOM   637  C CZ    . PHE A 1 124 ? 157.501 143.571 243.961 1.00 126.86 ? 91  PHE A CZ    1 
ATOM   638  N N     . LEU A 1 125 ? 157.719 139.027 247.821 1.00 111.96 ? 92  LEU A N     1 
ATOM   639  C CA    . LEU A 1 125 ? 156.919 137.934 247.280 1.00 117.71 ? 92  LEU A CA    1 
ATOM   640  C C     . LEU A 1 125 ? 155.735 137.666 248.206 1.00 119.96 ? 92  LEU A C     1 
ATOM   641  O O     . LEU A 1 125 ? 154.614 137.540 247.715 1.00 123.82 ? 92  LEU A O     1 
ATOM   642  C CB    . LEU A 1 125 ? 157.761 136.661 247.071 1.00 120.89 ? 92  LEU A CB    1 
ATOM   643  C CG    . LEU A 1 125 ? 158.653 136.638 245.826 1.00 130.54 ? 92  LEU A CG    1 
ATOM   644  C CD1   . LEU A 1 125 ? 159.818 135.692 246.010 1.00 131.49 ? 92  LEU A CD1   1 
ATOM   645  C CD2   . LEU A 1 125 ? 157.866 136.260 244.582 1.00 140.37 ? 92  LEU A CD2   1 
ATOM   646  N N     . ASP A 1 126 ? 155.974 137.653 249.543 1.00 110.48 ? 93  ASP A N     1 
ATOM   647  C CA    . ASP A 1 126 ? 154.955 137.435 250.579 1.00 108.10 ? 93  ASP A CA    1 
ATOM   648  C C     . ASP A 1 126 ? 153.827 138.462 250.476 1.00 111.97 ? 93  ASP A C     1 
ATOM   649  O O     . ASP A 1 126 ? 152.658 138.072 250.408 1.00 114.34 ? 93  ASP A O     1 
ATOM   650  C CB    . ASP A 1 126 ? 155.580 137.469 251.987 1.00 103.79 ? 93  ASP A CB    1 
ATOM   651  C CG    . ASP A 1 126 ? 154.827 136.669 253.034 1.00 113.56 ? 93  ASP A CG    1 
ATOM   652  O OD1   . ASP A 1 126 ? 153.626 136.944 253.246 1.00 114.72 ? 93  ASP A OD1   1 
ATOM   653  O OD2   . ASP A 1 126 ? 155.442 135.782 253.654 1.00 119.30 ? 93  ASP A OD2   1 
ATOM   654  N N     . ASP A 1 127 ? 154.183 139.766 250.430 1.00 105.72 ? 94  ASP A N     1 
ATOM   655  C CA    . ASP A 1 127 ? 153.227 140.869 250.320 1.00 105.22 ? 94  ASP A CA    1 
ATOM   656  C C     . ASP A 1 127 ? 152.518 140.926 248.959 1.00 115.13 ? 94  ASP A C     1 
ATOM   657  O O     . ASP A 1 127 ? 151.424 141.485 248.873 1.00 116.14 ? 94  ASP A O     1 
ATOM   658  C CB    . ASP A 1 127 ? 153.882 142.211 250.680 1.00 102.24 ? 94  ASP A CB    1 
ATOM   659  C CG    . ASP A 1 127 ? 154.152 142.377 252.164 1.00 107.72 ? 94  ASP A CG    1 
ATOM   660  O OD1   . ASP A 1 127 ? 153.343 141.874 252.978 1.00 108.15 ? 94  ASP A OD1   1 
ATOM   661  O OD2   . ASP A 1 127 ? 155.152 143.039 252.514 1.00 109.35 ? 94  ASP A OD2   1 
ATOM   662  N N     . TYR A 1 128 ? 153.122 140.332 247.909 1.00 115.73 ? 95  TYR A N     1 
ATOM   663  C CA    . TYR A 1 128 ? 152.517 140.261 246.580 1.00 122.53 ? 95  TYR A CA    1 
ATOM   664  C C     . TYR A 1 128 ? 151.384 139.227 246.609 1.00 129.78 ? 95  TYR A C     1 
ATOM   665  O O     . TYR A 1 128 ? 150.339 139.453 245.998 1.00 133.80 ? 95  TYR A O     1 
ATOM   666  C CB    . TYR A 1 128 ? 153.567 139.916 245.514 1.00 128.02 ? 95  TYR A CB    1 
ATOM   667  C CG    . TYR A 1 128 ? 153.101 140.168 244.097 1.00 137.44 ? 95  TYR A CG    1 
ATOM   668  C CD1   . TYR A 1 128 ? 153.099 141.454 243.561 1.00 139.77 ? 95  TYR A CD1   1 
ATOM   669  C CD2   . TYR A 1 128 ? 152.688 139.120 243.282 1.00 145.42 ? 95  TYR A CD2   1 
ATOM   670  C CE1   . TYR A 1 128 ? 152.673 141.692 242.254 1.00 148.13 ? 95  TYR A CE1   1 
ATOM   671  C CE2   . TYR A 1 128 ? 152.262 139.344 241.974 1.00 153.75 ? 95  TYR A CE2   1 
ATOM   672  C CZ    . TYR A 1 128 ? 152.257 140.633 241.463 1.00 161.91 ? 95  TYR A CZ    1 
ATOM   673  O OH    . TYR A 1 128 ? 151.836 140.857 240.174 1.00 171.21 ? 95  TYR A OH    1 
ATOM   674  N N     . ILE A 1 129 ? 151.582 138.118 247.366 1.00 124.31 ? 96  ILE A N     1 
ATOM   675  C CA    . ILE A 1 129 ? 150.595 137.049 247.586 1.00 127.14 ? 96  ILE A CA    1 
ATOM   676  C C     . ILE A 1 129 ? 149.434 137.627 248.427 1.00 128.62 ? 96  ILE A C     1 
ATOM   677  O O     . ILE A 1 129 ? 148.272 137.315 248.167 1.00 132.43 ? 96  ILE A O     1 
ATOM   678  C CB    . ILE A 1 129 ? 151.254 135.794 248.265 1.00 128.89 ? 96  ILE A CB    1 
ATOM   679  C CG1   . ILE A 1 129 ? 152.483 135.239 247.479 1.00 131.85 ? 96  ILE A CG1   1 
ATOM   680  C CG2   . ILE A 1 129 ? 150.247 134.676 248.564 1.00 133.15 ? 96  ILE A CG2   1 
ATOM   681  C CD1   . ILE A 1 129 ? 152.326 134.934 245.952 1.00 147.57 ? 96  ILE A CD1   1 
ATOM   682  N N     . LYS A 1 130 ? 149.767 138.499 249.406 1.00 119.09 ? 97  LYS A N     1 
ATOM   683  C CA    . LYS A 1 130 ? 148.844 139.184 250.321 1.00 115.87 ? 97  LYS A CA    1 
ATOM   684  C C     . LYS A 1 130 ? 147.776 140.018 249.587 1.00 123.31 ? 97  LYS A C     1 
ATOM   685  O O     . LYS A 1 130 ? 146.655 140.138 250.089 1.00 123.56 ? 97  LYS A O     1 
ATOM   686  C CB    . LYS A 1 130 ? 149.633 140.064 251.306 1.00 111.17 ? 97  LYS A CB    1 
ATOM   687  C CG    . LYS A 1 130 ? 149.263 139.868 252.769 1.00 122.82 ? 97  LYS A CG    1 
ATOM   688  C CD    . LYS A 1 130 ? 150.306 140.515 253.684 1.00 127.74 ? 97  LYS A CD    1 
ATOM   689  C CE    . LYS A 1 130 ? 149.944 140.473 255.152 1.00 135.77 ? 97  LYS A CE    1 
ATOM   690  N NZ    . LYS A 1 130 ? 148.982 141.546 255.527 1.00 143.98 ? 97  LYS A NZ    1 
ATOM   691  N N     . ILE A 1 131 ? 148.118 140.580 248.406 1.00 122.34 ? 98  ILE A N     1 
ATOM   692  C CA    . ILE A 1 131 ? 147.195 141.378 247.587 1.00 126.08 ? 98  ILE A CA    1 
ATOM   693  C C     . ILE A 1 131 ? 146.485 140.478 246.547 1.00 137.37 ? 98  ILE A C     1 
ATOM   694  O O     . ILE A 1 131 ? 145.257 140.519 246.440 1.00 140.58 ? 98  ILE A O     1 
ATOM   695  C CB    . ILE A 1 131 ? 147.890 142.628 246.962 1.00 128.12 ? 98  ILE A CB    1 
ATOM   696  C CG1   . ILE A 1 131 ? 148.555 143.505 248.053 1.00 120.78 ? 98  ILE A CG1   1 
ATOM   697  C CG2   . ILE A 1 131 ? 146.901 143.458 246.127 1.00 133.74 ? 98  ILE A CG2   1 
ATOM   698  C CD1   . ILE A 1 131 ? 149.731 144.378 247.583 1.00 126.38 ? 98  ILE A CD1   1 
ATOM   699  N N     . VAL A 1 132 ? 147.260 139.660 245.806 1.00 136.32 ? 99  VAL A N     1 
ATOM   700  C CA    . VAL A 1 132 ? 146.752 138.736 244.786 1.00 158.95 ? 99  VAL A CA    1 
ATOM   701  C C     . VAL A 1 132 ? 146.092 137.531 245.468 1.00 157.72 ? 99  VAL A C     1 
ATOM   702  O O     . VAL A 1 132 ? 144.952 137.623 245.918 1.00 108.68 ? 99  VAL A O     1 
ATOM   703  C CB    . VAL A 1 132 ? 147.868 138.306 243.789 1.00 166.33 ? 99  VAL A CB    1 
ATOM   704  C CG1   . VAL A 1 132 ? 147.347 137.304 242.761 1.00 175.21 ? 99  VAL A CG1   1 
ATOM   705  C CG2   . VAL A 1 132 ? 148.483 139.517 243.089 1.00 165.79 ? 99  VAL A CG2   1 
ATOM   706  N N     . LYS A 1 140 ? 151.911 129.196 254.462 1.00 131.50 ? 107 LYS A N     1 
ATOM   707  C CA    . LYS A 1 140 ? 152.786 130.367 254.444 1.00 126.00 ? 107 LYS A CA    1 
ATOM   708  C C     . LYS A 1 140 ? 153.826 130.395 255.590 1.00 124.82 ? 107 LYS A C     1 
ATOM   709  O O     . LYS A 1 140 ? 154.977 130.692 255.269 1.00 122.92 ? 107 LYS A O     1 
ATOM   710  C CB    . LYS A 1 140 ? 151.987 131.686 254.389 1.00 125.71 ? 107 LYS A CB    1 
ATOM   711  C CG    . LYS A 1 140 ? 152.727 132.836 253.699 1.00 133.56 ? 107 LYS A CG    1 
ATOM   712  C CD    . LYS A 1 140 ? 152.524 132.824 252.180 1.00 147.98 ? 107 LYS A CD    1 
ATOM   713  C CE    . LYS A 1 140 ? 153.500 133.706 251.440 1.00 155.24 ? 107 LYS A CE    1 
ATOM   714  N NZ    . LYS A 1 140 ? 154.874 133.134 251.422 1.00 161.99 ? 107 LYS A NZ    1 
ATOM   715  N N     . PRO A 1 141 ? 153.512 130.118 256.896 1.00 118.96 ? 108 PRO A N     1 
ATOM   716  C CA    . PRO A 1 141 ? 154.571 130.166 257.928 1.00 114.60 ? 108 PRO A CA    1 
ATOM   717  C C     . PRO A 1 141 ? 155.739 129.216 257.651 1.00 121.75 ? 108 PRO A C     1 
ATOM   718  O O     . PRO A 1 141 ? 156.893 129.597 257.853 1.00 118.14 ? 108 PRO A O     1 
ATOM   719  C CB    . PRO A 1 141 ? 153.830 129.809 259.222 1.00 115.53 ? 108 PRO A CB    1 
ATOM   720  C CG    . PRO A 1 141 ? 152.411 130.125 258.947 1.00 121.60 ? 108 PRO A CG    1 
ATOM   721  C CD    . PRO A 1 141 ? 152.215 129.762 257.509 1.00 122.07 ? 108 PRO A CD    1 
ATOM   722  N N     . MET A 1 142 ? 155.442 128.006 257.142 1.00 125.05 ? 109 MET A N     1 
ATOM   723  C CA    . MET A 1 142 ? 156.457 127.018 256.778 1.00 128.52 ? 109 MET A CA    1 
ATOM   724  C C     . MET A 1 142 ? 157.174 127.411 255.483 1.00 134.21 ? 109 MET A C     1 
ATOM   725  O O     . MET A 1 142 ? 158.353 127.093 255.328 1.00 134.46 ? 109 MET A O     1 
ATOM   726  C CB    . MET A 1 142 ? 155.854 125.612 256.689 1.00 137.20 ? 109 MET A CB    1 
ATOM   727  C CG    . MET A 1 142 ? 155.705 124.942 258.039 1.00 140.43 ? 109 MET A CG    1 
ATOM   728  S SD    . MET A 1 142 ? 157.282 124.367 258.719 1.00 143.86 ? 109 MET A SD    1 
ATOM   729  C CE    . MET A 1 142 ? 157.380 122.737 257.968 1.00 148.95 ? 109 MET A CE    1 
ATOM   730  N N     . GLN A 1 143 ? 156.474 128.130 254.575 1.00 131.62 ? 110 GLN A N     1 
ATOM   731  C CA    . GLN A 1 143 ? 157.021 128.637 253.309 1.00 132.89 ? 110 GLN A CA    1 
ATOM   732  C C     . GLN A 1 143 ? 157.996 129.795 253.578 1.00 130.40 ? 110 GLN A C     1 
ATOM   733  O O     . GLN A 1 143 ? 159.002 129.927 252.877 1.00 130.83 ? 110 GLN A O     1 
ATOM   734  C CB    . GLN A 1 143 ? 155.895 129.119 252.380 1.00 136.87 ? 110 GLN A CB    1 
ATOM   735  C CG    . GLN A 1 143 ? 155.048 128.008 251.784 1.00 156.95 ? 110 GLN A CG    1 
ATOM   736  C CD    . GLN A 1 143 ? 154.025 128.566 250.832 1.00 177.94 ? 110 GLN A CD    1 
ATOM   737  O OE1   . GLN A 1 143 ? 153.064 129.233 251.232 1.00 171.10 ? 110 GLN A OE1   1 
ATOM   738  N NE2   . GLN A 1 143 ? 154.212 128.312 249.546 1.00 175.34 ? 110 GLN A NE2   1 
ATOM   739  N N     . LYS A 1 144 ? 157.681 130.633 254.589 1.00 121.02 ? 111 LYS A N     1 
ATOM   740  C CA    . LYS A 1 144 ? 158.484 131.778 255.022 1.00 115.13 ? 111 LYS A CA    1 
ATOM   741  C C     . LYS A 1 144 ? 159.797 131.271 255.622 1.00 118.07 ? 111 LYS A C     1 
ATOM   742  O O     . LYS A 1 144 ? 160.856 131.811 255.306 1.00 116.39 ? 111 LYS A O     1 
ATOM   743  C CB    . LYS A 1 144 ? 157.708 132.618 256.051 1.00 112.73 ? 111 LYS A CB    1 
ATOM   744  C CG    . LYS A 1 144 ? 158.168 134.064 256.145 1.00 120.27 ? 111 LYS A CG    1 
ATOM   745  C CD    . LYS A 1 144 ? 157.485 134.793 257.296 1.00 125.90 ? 111 LYS A CD    1 
ATOM   746  C CE    . LYS A 1 144 ? 156.545 135.884 256.840 1.00 133.86 ? 111 LYS A CE    1 
ATOM   747  N NZ    . LYS A 1 144 ? 155.222 135.345 256.431 1.00 145.84 ? 111 LYS A NZ    1 
ATOM   748  N N     . LEU A 1 145 ? 159.720 130.205 256.447 1.00 115.71 ? 112 LEU A N     1 
ATOM   749  C CA    . LEU A 1 145 ? 160.862 129.550 257.094 1.00 115.07 ? 112 LEU A CA    1 
ATOM   750  C C     . LEU A 1 145 ? 161.782 128.856 256.075 1.00 121.60 ? 112 LEU A C     1 
ATOM   751  O O     . LEU A 1 145 ? 162.984 128.755 256.318 1.00 120.38 ? 112 LEU A O     1 
ATOM   752  C CB    . LEU A 1 145 ? 160.370 128.555 258.163 1.00 116.49 ? 112 LEU A CB    1 
ATOM   753  C CG    . LEU A 1 145 ? 160.446 129.009 259.635 1.00 116.55 ? 112 LEU A CG    1 
ATOM   754  C CD1   . LEU A 1 145 ? 159.528 130.203 259.920 1.00 112.76 ? 112 LEU A CD1   1 
ATOM   755  C CD2   . LEU A 1 145 ? 160.077 127.868 260.567 1.00 121.60 ? 112 LEU A CD2   1 
ATOM   756  N N     . VAL A 1 146 ? 161.219 128.402 254.935 1.00 121.77 ? 113 VAL A N     1 
ATOM   757  C CA    . VAL A 1 146 ? 161.964 127.772 253.838 1.00 126.17 ? 113 VAL A CA    1 
ATOM   758  C C     . VAL A 1 146 ? 162.795 128.849 253.110 1.00 126.70 ? 113 VAL A C     1 
ATOM   759  O O     . VAL A 1 146 ? 163.985 128.637 252.873 1.00 127.43 ? 113 VAL A O     1 
ATOM   760  C CB    . VAL A 1 146 ? 161.034 126.946 252.893 1.00 136.40 ? 113 VAL A CB    1 
ATOM   761  C CG1   . VAL A 1 146 ? 161.631 126.766 251.496 1.00 141.39 ? 113 VAL A CG1   1 
ATOM   762  C CG2   . VAL A 1 146 ? 160.700 125.591 253.508 1.00 139.54 ? 113 VAL A CG2   1 
ATOM   763  N N     . GLY A 1 147 ? 162.163 129.987 252.800 1.00 119.37 ? 114 GLY A N     1 
ATOM   764  C CA    . GLY A 1 147 ? 162.796 131.119 252.129 1.00 117.16 ? 114 GLY A CA    1 
ATOM   765  C C     . GLY A 1 147 ? 163.947 131.707 252.923 1.00 115.38 ? 114 GLY A C     1 
ATOM   766  O O     . GLY A 1 147 ? 165.007 132.004 252.362 1.00 115.73 ? 114 GLY A O     1 
ATOM   767  N N     . GLN A 1 148 ? 163.745 131.846 254.250 1.00 106.52 ? 115 GLN A N     1 
ATOM   768  C CA    . GLN A 1 148 ? 164.729 132.349 255.214 1.00 101.16 ? 115 GLN A CA    1 
ATOM   769  C C     . GLN A 1 148 ? 165.919 131.390 255.321 1.00 106.58 ? 115 GLN A C     1 
ATOM   770  O O     . GLN A 1 148 ? 167.037 131.839 255.561 1.00 104.30 ? 115 GLN A O     1 
ATOM   771  C CB    . GLN A 1 148 ? 164.087 132.529 256.602 1.00 98.12  ? 115 GLN A CB    1 
ATOM   772  C CG    . GLN A 1 148 ? 163.075 133.674 256.710 1.00 101.23 ? 115 GLN A CG    1 
ATOM   773  C CD    . GLN A 1 148 ? 162.213 133.612 257.957 1.00 114.66 ? 115 GLN A CD    1 
ATOM   774  O OE1   . GLN A 1 148 ? 162.089 132.583 258.630 1.00 109.65 ? 115 GLN A OE1   1 
ATOM   775  N NE2   . GLN A 1 148 ? 161.552 134.714 258.270 1.00 106.37 ? 115 GLN A NE2   1 
ATOM   776  N N     . PHE A 1 149 ? 165.670 130.075 255.143 1.00 107.45 ? 116 PHE A N     1 
ATOM   777  C CA    . PHE A 1 149 ? 166.670 129.001 255.204 1.00 110.53 ? 116 PHE A CA    1 
ATOM   778  C C     . PHE A 1 149 ? 167.659 129.047 254.032 1.00 116.91 ? 116 PHE A C     1 
ATOM   779  O O     . PHE A 1 149 ? 168.835 128.740 254.229 1.00 117.36 ? 116 PHE A O     1 
ATOM   780  C CB    . PHE A 1 149 ? 165.980 127.627 255.272 1.00 116.96 ? 116 PHE A CB    1 
ATOM   781  C CG    . PHE A 1 149 ? 166.685 126.599 256.122 1.00 120.13 ? 116 PHE A CG    1 
ATOM   782  C CD1   . PHE A 1 149 ? 166.406 126.487 257.480 1.00 120.07 ? 116 PHE A CD1   1 
ATOM   783  C CD2   . PHE A 1 149 ? 167.609 125.724 255.561 1.00 127.63 ? 116 PHE A CD2   1 
ATOM   784  C CE1   . PHE A 1 149 ? 167.057 125.532 258.267 1.00 123.13 ? 116 PHE A CE1   1 
ATOM   785  C CE2   . PHE A 1 149 ? 168.261 124.769 256.349 1.00 132.43 ? 116 PHE A CE2   1 
ATOM   786  C CZ    . PHE A 1 149 ? 167.982 124.681 257.697 1.00 127.39 ? 116 PHE A CZ    1 
ATOM   787  N N     . ILE A 1 150 ? 167.184 129.423 252.821 1.00 115.10 ? 117 ILE A N     1 
ATOM   788  C CA    . ILE A 1 150 ? 168.008 129.518 251.605 1.00 118.60 ? 117 ILE A CA    1 
ATOM   789  C C     . ILE A 1 150 ? 169.030 130.663 251.721 1.00 117.32 ? 117 ILE A C     1 
ATOM   790  O O     . ILE A 1 150 ? 170.218 130.428 251.497 1.00 118.85 ? 117 ILE A O     1 
ATOM   791  C CB    . ILE A 1 150 ? 167.159 129.623 250.294 1.00 126.05 ? 117 ILE A CB    1 
ATOM   792  C CG1   . ILE A 1 150 ? 165.941 128.644 250.267 1.00 129.92 ? 117 ILE A CG1   1 
ATOM   793  C CG2   . ILE A 1 150 ? 168.027 129.476 249.033 1.00 132.55 ? 117 ILE A CG2   1 
ATOM   794  C CD1   . ILE A 1 150 ? 166.212 127.089 250.354 1.00 143.59 ? 117 ILE A CD1   1 
ATOM   795  N N     . ILE A 1 151 ? 168.561 131.887 252.078 1.00 107.64 ? 118 ILE A N     1 
ATOM   796  C CA    . ILE A 1 151 ? 169.382 133.101 252.237 1.00 103.05 ? 118 ILE A CA    1 
ATOM   797  C C     . ILE A 1 151 ? 170.467 132.911 253.312 1.00 103.01 ? 118 ILE A C     1 
ATOM   798  O O     . ILE A 1 151 ? 171.622 133.281 253.078 1.00 103.18 ? 118 ILE A O     1 
ATOM   799  C CB    . ILE A 1 151 ? 168.509 134.377 252.471 1.00 101.31 ? 118 ILE A CB    1 
ATOM   800  C CG1   . ILE A 1 151 ? 167.384 134.543 251.399 1.00 104.75 ? 118 ILE A CG1   1 
ATOM   801  C CG2   . ILE A 1 151 ? 169.353 135.657 252.607 1.00 98.52  ? 118 ILE A CG2   1 
ATOM   802  C CD1   . ILE A 1 151 ? 167.801 134.876 249.909 1.00 116.63 ? 118 ILE A CD1   1 
ATOM   803  N N     . THR A 1 152 ? 170.101 132.302 254.463 1.00 96.23  ? 119 THR A N     1 
ATOM   804  C CA    . THR A 1 152 ? 171.019 132.014 255.576 1.00 93.72  ? 119 THR A CA    1 
ATOM   805  C C     . THR A 1 152 ? 172.158 131.081 255.125 1.00 101.70 ? 119 THR A C     1 
ATOM   806  O O     . THR A 1 152 ? 173.304 131.292 255.521 1.00 100.86 ? 119 THR A O     1 
ATOM   807  C CB    . THR A 1 152 ? 170.247 131.503 256.809 1.00 97.91  ? 119 THR A CB    1 
ATOM   808  O OG1   . THR A 1 152 ? 169.189 132.413 257.116 1.00 90.21  ? 119 THR A OG1   1 
ATOM   809  C CG2   . THR A 1 152 ? 171.137 131.327 258.042 1.00 94.96  ? 119 THR A CG2   1 
ATOM   810  N N     . GLY A 1 153 ? 171.826 130.100 254.281 1.00 102.42 ? 120 GLY A N     1 
ATOM   811  C CA    . GLY A 1 153 ? 172.772 129.148 253.709 1.00 107.45 ? 120 GLY A CA    1 
ATOM   812  C C     . GLY A 1 153 ? 173.830 129.802 252.842 1.00 111.94 ? 120 GLY A C     1 
ATOM   813  O O     . GLY A 1 153 ? 175.019 129.521 253.011 1.00 112.93 ? 120 GLY A O     1 
ATOM   814  N N     . ILE A 1 154 ? 173.411 130.705 251.923 1.00 108.16 ? 121 ILE A N     1 
ATOM   815  C CA    . ILE A 1 154 ? 174.318 131.452 251.030 1.00 109.66 ? 121 ILE A CA    1 
ATOM   816  C C     . ILE A 1 154 ? 175.250 132.342 251.872 1.00 108.41 ? 121 ILE A C     1 
ATOM   817  O O     . ILE A 1 154 ? 176.436 132.445 251.556 1.00 110.27 ? 121 ILE A O     1 
ATOM   818  C CB    . ILE A 1 154 ? 173.574 132.253 249.914 1.00 113.65 ? 121 ILE A CB    1 
ATOM   819  C CG1   . ILE A 1 154 ? 172.449 131.421 249.251 1.00 118.26 ? 121 ILE A CG1   1 
ATOM   820  C CG2   . ILE A 1 154 ? 174.562 132.765 248.849 1.00 118.16 ? 121 ILE A CG2   1 
ATOM   821  C CD1   . ILE A 1 154 ? 171.247 132.239 248.760 1.00 121.50 ? 121 ILE A CD1   1 
ATOM   822  N N     . PHE A 1 155 ? 174.713 132.951 252.958 1.00 98.57  ? 122 PHE A N     1 
ATOM   823  C CA    . PHE A 1 155 ? 175.474 133.782 253.896 1.00 93.67  ? 122 PHE A CA    1 
ATOM   824  C C     . PHE A 1 155 ? 176.452 132.923 254.713 1.00 100.51 ? 122 PHE A C     1 
ATOM   825  O O     . PHE A 1 155 ? 177.569 133.369 254.973 1.00 99.45  ? 122 PHE A O     1 
ATOM   826  C CB    . PHE A 1 155 ? 174.540 134.607 254.801 1.00 88.67  ? 122 PHE A CB    1 
ATOM   827  C CG    . PHE A 1 155 ? 175.215 135.469 255.848 1.00 85.11  ? 122 PHE A CG    1 
ATOM   828  C CD1   . PHE A 1 155 ? 176.175 136.410 255.488 1.00 87.48  ? 122 PHE A CD1   1 
ATOM   829  C CD2   . PHE A 1 155 ? 174.842 135.388 257.185 1.00 83.08  ? 122 PHE A CD2   1 
ATOM   830  C CE1   . PHE A 1 155 ? 176.786 137.215 256.454 1.00 84.36  ? 122 PHE A CE1   1 
ATOM   831  C CE2   . PHE A 1 155 ? 175.451 136.195 258.150 1.00 82.02  ? 122 PHE A CE2   1 
ATOM   832  C CZ    . PHE A 1 155 ? 176.419 137.103 257.778 1.00 79.92  ? 122 PHE A CZ    1 
ATOM   833  N N     . ALA A 1 156 ? 176.051 131.677 255.070 1.00 100.91 ? 123 ALA A N     1 
ATOM   834  C CA    . ALA A 1 156 ? 176.899 130.714 255.789 1.00 103.74 ? 123 ALA A CA    1 
ATOM   835  C C     . ALA A 1 156 ? 178.071 130.309 254.899 1.00 115.69 ? 123 ALA A C     1 
ATOM   836  O O     . ALA A 1 156 ? 179.185 130.131 255.394 1.00 116.23 ? 123 ALA A O     1 
ATOM   837  C CB    . ALA A 1 156 ? 176.096 129.481 256.179 1.00 106.35 ? 123 ALA A CB    1 
ATOM   838  N N     . TRP A 1 157 ? 177.812 130.191 253.581 1.00 118.40 ? 124 TRP A N     1 
ATOM   839  C CA    . TRP A 1 157 ? 178.792 129.853 252.551 1.00 125.49 ? 124 TRP A CA    1 
ATOM   840  C C     . TRP A 1 157 ? 179.824 130.987 252.415 1.00 129.04 ? 124 TRP A C     1 
ATOM   841  O O     . TRP A 1 157 ? 181.020 130.706 252.341 1.00 132.21 ? 124 TRP A O     1 
ATOM   842  C CB    . TRP A 1 157 ? 178.070 129.569 251.217 1.00 129.02 ? 124 TRP A CB    1 
ATOM   843  C CG    . TRP A 1 157 ? 178.966 129.196 250.076 1.00 137.35 ? 124 TRP A CG    1 
ATOM   844  C CD1   . TRP A 1 157 ? 179.343 127.940 249.708 1.00 147.09 ? 124 TRP A CD1   1 
ATOM   845  C CD2   . TRP A 1 157 ? 179.547 130.089 249.116 1.00 139.01 ? 124 TRP A CD2   1 
ATOM   846  N NE1   . TRP A 1 157 ? 180.144 127.994 248.591 1.00 152.63 ? 124 TRP A NE1   1 
ATOM   847  C CE2   . TRP A 1 157 ? 180.288 129.303 248.207 1.00 151.16 ? 124 TRP A CE2   1 
ATOM   848  C CE3   . TRP A 1 157 ? 179.527 131.486 248.944 1.00 136.19 ? 124 TRP A CE3   1 
ATOM   849  C CZ2   . TRP A 1 157 ? 181.000 129.862 247.139 1.00 154.68 ? 124 TRP A CZ2   1 
ATOM   850  C CZ3   . TRP A 1 157 ? 180.238 132.040 247.891 1.00 141.72 ? 124 TRP A CZ3   1 
ATOM   851  C CH2   . TRP A 1 157 ? 180.961 131.233 247.001 1.00 150.51 ? 124 TRP A CH2   1 
ATOM   852  N N     . TYR A 1 158 ? 179.361 132.259 252.412 1.00 121.48 ? 125 TYR A N     1 
ATOM   853  C CA    . TYR A 1 158 ? 180.226 133.440 252.318 1.00 120.22 ? 125 TYR A CA    1 
ATOM   854  C C     . TYR A 1 158 ? 181.180 133.544 253.519 1.00 123.01 ? 125 TYR A C     1 
ATOM   855  O O     . TYR A 1 158 ? 182.349 133.899 253.338 1.00 124.49 ? 125 TYR A O     1 
ATOM   856  C CB    . TYR A 1 158 ? 179.389 134.734 252.166 1.00 116.76 ? 125 TYR A CB    1 
ATOM   857  C CG    . TYR A 1 158 ? 180.204 136.011 252.256 1.00 116.27 ? 125 TYR A CG    1 
ATOM   858  C CD1   . TYR A 1 158 ? 180.854 136.528 251.138 1.00 122.28 ? 125 TYR A CD1   1 
ATOM   859  C CD2   . TYR A 1 158 ? 180.343 136.689 253.466 1.00 111.29 ? 125 TYR A CD2   1 
ATOM   860  C CE1   . TYR A 1 158 ? 181.629 137.686 251.223 1.00 121.53 ? 125 TYR A CE1   1 
ATOM   861  C CE2   . TYR A 1 158 ? 181.138 137.831 253.568 1.00 110.43 ? 125 TYR A CE2   1 
ATOM   862  C CZ    . TYR A 1 158 ? 181.759 138.341 252.438 1.00 121.49 ? 125 TYR A CZ    1 
ATOM   863  O OH    . TYR A 1 158 ? 182.522 139.484 252.529 1.00 119.82 ? 125 TYR A OH    1 
ATOM   864  N N     . LEU A 1 159 ? 180.669 133.271 254.738 1.00 116.83 ? 126 LEU A N     1 
ATOM   865  C CA    . LEU A 1 159 ? 181.435 133.355 255.986 1.00 114.93 ? 126 LEU A CA    1 
ATOM   866  C C     . LEU A 1 159 ? 182.509 132.279 256.129 1.00 126.38 ? 126 LEU A C     1 
ATOM   867  O O     . LEU A 1 159 ? 183.601 132.584 256.614 1.00 126.79 ? 126 LEU A O     1 
ATOM   868  C CB    . LEU A 1 159 ? 180.518 133.346 257.229 1.00 109.74 ? 126 LEU A CB    1 
ATOM   869  C CG    . LEU A 1 159 ? 179.531 134.508 257.425 1.00 108.41 ? 126 LEU A CG    1 
ATOM   870  C CD1   . LEU A 1 159 ? 178.642 134.261 258.632 1.00 104.93 ? 126 LEU A CD1   1 
ATOM   871  C CD2   . LEU A 1 159 ? 180.240 135.846 257.568 1.00 107.22 ? 126 LEU A CD2   1 
ATOM   872  N N     . LEU A 1 160 ? 182.200 131.025 255.742 1.00 128.31 ? 127 LEU A N     1 
ATOM   873  C CA    . LEU A 1 160 ? 183.135 129.909 255.879 1.00 134.35 ? 127 LEU A CA    1 
ATOM   874  C C     . LEU A 1 160 ? 184.165 129.792 254.762 1.00 146.12 ? 127 LEU A C     1 
ATOM   875  O O     . LEU A 1 160 ? 185.305 129.429 255.047 1.00 148.98 ? 127 LEU A O     1 
ATOM   876  C CB    . LEU A 1 160 ? 182.398 128.569 256.045 1.00 137.05 ? 127 LEU A CB    1 
ATOM   877  C CG    . LEU A 1 160 ? 181.650 128.330 257.356 1.00 137.39 ? 127 LEU A CG    1 
ATOM   878  C CD1   . LEU A 1 160 ? 180.711 127.163 257.216 1.00 140.23 ? 127 LEU A CD1   1 
ATOM   879  C CD2   . LEU A 1 160 ? 182.605 128.078 258.514 1.00 140.06 ? 127 LEU A CD2   1 
ATOM   880  N N     . ASN A 1 161 ? 183.770 130.049 253.499 1.00 146.14 ? 128 ASN A N     1 
ATOM   881  C CA    . ASN A 1 161 ? 184.671 129.912 252.350 1.00 153.10 ? 128 ASN A CA    1 
ATOM   882  C C     . ASN A 1 161 ? 185.696 131.041 252.239 1.00 156.77 ? 128 ASN A C     1 
ATOM   883  O O     . ASN A 1 161 ? 186.882 130.752 252.047 1.00 161.66 ? 128 ASN A O     1 
ATOM   884  C CB    . ASN A 1 161 ? 183.899 129.723 251.045 1.00 158.28 ? 128 ASN A CB    1 
ATOM   885  C CG    . ASN A 1 161 ? 183.573 128.278 250.747 1.00 185.86 ? 128 ASN A CG    1 
ATOM   886  O OD1   . ASN A 1 161 ? 184.142 127.665 249.837 1.00 184.63 ? 128 ASN A OD1   1 
ATOM   887  N ND2   . ASN A 1 161 ? 182.655 127.696 251.510 1.00 177.23 ? 128 ASN A ND2   1 
ATOM   888  N N     . SER A 1 162 ? 185.258 132.310 252.348 1.00 147.44 ? 129 SER A N     1 
ATOM   889  C CA    . SER A 1 162 ? 186.175 133.450 252.281 1.00 146.42 ? 129 SER A CA    1 
ATOM   890  C C     . SER A 1 162 ? 186.717 133.784 253.673 1.00 145.50 ? 129 SER A C     1 
ATOM   891  O O     . SER A 1 162 ? 186.130 133.374 254.679 1.00 142.03 ? 129 SER A O     1 
ATOM   892  C CB    . SER A 1 162 ? 185.499 134.666 251.655 1.00 147.63 ? 129 SER A CB    1 
ATOM   893  O OG    . SER A 1 162 ? 186.478 135.584 251.194 1.00 158.96 ? 129 SER A OG    1 
ATOM   894  N N     . GLY A 1 163 ? 187.837 134.505 253.713 1.00 141.82 ? 130 GLY A N     1 
ATOM   895  C CA    . GLY A 1 163 ? 188.487 134.896 254.958 1.00 138.24 ? 130 GLY A CA    1 
ATOM   896  C C     . GLY A 1 163 ? 188.439 136.382 255.245 1.00 136.21 ? 130 GLY A C     1 
ATOM   897  O O     . GLY A 1 163 ? 189.416 136.942 255.749 1.00 136.34 ? 130 GLY A O     1 
ATOM   898  N N     . GLU A 1 164 ? 187.302 137.030 254.935 1.00 127.37 ? 131 GLU A N     1 
ATOM   899  C CA    . GLU A 1 164 ? 187.116 138.464 255.154 1.00 121.61 ? 131 GLU A CA    1 
ATOM   900  C C     . GLU A 1 164 ? 186.866 138.785 256.624 1.00 118.01 ? 131 GLU A C     1 
ATOM   901  O O     . GLU A 1 164 ? 187.281 139.847 257.096 1.00 115.09 ? 131 GLU A O     1 
ATOM   902  C CB    . GLU A 1 164 ? 185.972 139.007 254.283 1.00 121.26 ? 131 GLU A CB    1 
ATOM   903  C CG    . GLU A 1 164 ? 186.436 139.889 253.138 1.00 136.83 ? 131 GLU A CG    1 
ATOM   904  C CD    . GLU A 1 164 ? 186.909 139.142 251.906 1.00 172.44 ? 131 GLU A CD    1 
ATOM   905  O OE1   . GLU A 1 164 ? 188.126 138.859 251.807 1.00 176.71 ? 131 GLU A OE1   1 
ATOM   906  O OE2   . GLU A 1 164 ? 186.059 138.832 251.041 1.00 170.86 ? 131 GLU A OE2   1 
ATOM   907  N N     . VAL A 1 165 ? 186.180 137.871 257.339 1.00 111.57 ? 132 VAL A N     1 
ATOM   908  C CA    . VAL A 1 165 ? 185.811 138.016 258.752 1.00 105.90 ? 132 VAL A CA    1 
ATOM   909  C C     . VAL A 1 165 ? 186.008 136.689 259.527 1.00 110.06 ? 132 VAL A C     1 
ATOM   910  O O     . VAL A 1 165 ? 185.926 135.609 258.937 1.00 113.36 ? 132 VAL A O     1 
ATOM   911  C CB    . VAL A 1 165 ? 184.375 138.620 258.887 1.00 104.15 ? 132 VAL A CB    1 
ATOM   912  C CG1   . VAL A 1 165 ? 183.300 137.686 258.339 1.00 104.66 ? 132 VAL A CG1   1 
ATOM   913  C CG2   . VAL A 1 165 ? 184.059 139.050 260.317 1.00 99.52  ? 132 VAL A CG2   1 
ATOM   914  N N     . GLY A 1 166 ? 186.302 136.805 260.823 1.00 103.09 ? 133 GLY A N     1 
ATOM   915  C CA    . GLY A 1 166 ? 186.488 135.679 261.729 1.00 104.05 ? 133 GLY A CA    1 
ATOM   916  C C     . GLY A 1 166 ? 185.162 135.106 262.186 1.00 103.41 ? 133 GLY A C     1 
ATOM   917  O O     . GLY A 1 166 ? 184.195 135.850 262.380 1.00 98.34  ? 133 GLY A O     1 
ATOM   918  N N     . THR A 1 167 ? 185.112 133.776 262.355 1.00 101.79 ? 134 THR A N     1 
ATOM   919  C CA    . THR A 1 167 ? 183.924 133.022 262.767 1.00 99.48  ? 134 THR A CA    1 
ATOM   920  C C     . THR A 1 167 ? 183.670 133.048 264.284 1.00 99.30  ? 134 THR A C     1 
ATOM   921  O O     . THR A 1 167 ? 182.608 132.610 264.716 1.00 97.24  ? 134 THR A O     1 
ATOM   922  C CB    . THR A 1 167 ? 183.990 131.578 262.231 1.00 114.49 ? 134 THR A CB    1 
ATOM   923  O OG1   . THR A 1 167 ? 185.222 130.977 262.633 1.00 118.64 ? 134 THR A OG1   1 
ATOM   924  C CG2   . THR A 1 167 ? 183.830 131.500 260.716 1.00 115.84 ? 134 THR A CG2   1 
ATOM   925  N N     . ASP A 1 168 ? 184.627 133.550 265.086 1.00 96.02  ? 135 ASP A N     1 
ATOM   926  C CA    . ASP A 1 168 ? 184.529 133.622 266.551 1.00 94.67  ? 135 ASP A CA    1 
ATOM   927  C C     . ASP A 1 168 ? 183.442 134.566 267.035 1.00 93.93  ? 135 ASP A C     1 
ATOM   928  O O     . ASP A 1 168 ? 183.030 135.460 266.294 1.00 91.82  ? 135 ASP A O     1 
ATOM   929  C CB    . ASP A 1 168 ? 185.874 134.029 267.168 1.00 98.57  ? 135 ASP A CB    1 
ATOM   930  C CG    . ASP A 1 168 ? 186.964 133.002 266.983 1.00 112.82 ? 135 ASP A CG    1 
ATOM   931  O OD1   . ASP A 1 168 ? 187.945 133.304 266.274 1.00 115.40 ? 135 ASP A OD1   1 
ATOM   932  O OD2   . ASP A 1 168 ? 186.837 131.894 267.548 1.00 121.34 ? 135 ASP A OD2   1 
ATOM   933  N N     . MET A 1 169 ? 182.968 134.369 268.275 1.00 88.71  ? 136 MET A N     1 
ATOM   934  C CA    . MET A 1 169 ? 181.920 135.214 268.855 1.00 83.12  ? 136 MET A CA    1 
ATOM   935  C C     . MET A 1 169 ? 182.433 135.880 270.123 1.00 83.48  ? 136 MET A C     1 
ATOM   936  O O     . MET A 1 169 ? 182.821 135.184 271.061 1.00 85.56  ? 136 MET A O     1 
ATOM   937  C CB    . MET A 1 169 ? 180.642 134.407 269.172 1.00 85.36  ? 136 MET A CB    1 
ATOM   938  C CG    . MET A 1 169 ? 179.933 133.858 267.961 1.00 90.21  ? 136 MET A CG    1 
ATOM   939  S SD    . MET A 1 169 ? 178.301 133.215 268.417 1.00 94.40  ? 136 MET A SD    1 
ATOM   940  C CE    . MET A 1 169 ? 177.931 132.202 266.981 1.00 94.04  ? 136 MET A CE    1 
ATOM   941  N N     . LEU A 1 170 ? 182.410 137.220 270.170 1.00 74.95  ? 137 LEU A N     1 
ATOM   942  C CA    . LEU A 1 170 ? 182.822 137.931 271.371 1.00 73.94  ? 137 LEU A CA    1 
ATOM   943  C C     . LEU A 1 170 ? 181.762 137.797 272.473 1.00 77.54  ? 137 LEU A C     1 
ATOM   944  O O     . LEU A 1 170 ? 180.559 138.043 272.248 1.00 73.34  ? 137 LEU A O     1 
ATOM   945  C CB    . LEU A 1 170 ? 183.146 139.414 271.098 1.00 70.85  ? 137 LEU A CB    1 
ATOM   946  C CG    . LEU A 1 170 ? 183.720 140.197 272.294 1.00 75.50  ? 137 LEU A CG    1 
ATOM   947  C CD1   . LEU A 1 170 ? 185.158 139.771 272.610 1.00 80.02  ? 137 LEU A CD1   1 
ATOM   948  C CD2   . LEU A 1 170 ? 183.635 141.687 272.068 1.00 73.87  ? 137 LEU A CD2   1 
ATOM   949  N N     . ILE A 1 171 ? 182.239 137.370 273.659 1.00 77.81  ? 138 ILE A N     1 
ATOM   950  C CA    . ILE A 1 171 ? 181.464 137.208 274.886 1.00 78.18  ? 138 ILE A CA    1 
ATOM   951  C C     . ILE A 1 171 ? 181.271 138.614 275.516 1.00 80.32  ? 138 ILE A C     1 
ATOM   952  O O     . ILE A 1 171 ? 182.270 139.322 275.697 1.00 80.95  ? 138 ILE A O     1 
ATOM   953  C CB    . ILE A 1 171 ? 182.164 136.253 275.872 1.00 86.16  ? 138 ILE A CB    1 
ATOM   954  C CG1   . ILE A 1 171 ? 182.177 134.828 275.316 1.00 89.43  ? 138 ILE A CG1   1 
ATOM   955  C CG2   . ILE A 1 171 ? 181.481 136.295 277.230 1.00 87.20  ? 138 ILE A CG2   1 
ATOM   956  C CD1   . ILE A 1 171 ? 183.067 133.880 276.088 1.00 101.32 ? 138 ILE A CD1   1 
ATOM   957  N N     . PRO A 1 172 ? 180.016 139.025 275.843 1.00 74.74  ? 139 PRO A N     1 
ATOM   958  C CA    . PRO A 1 172 ? 179.768 140.397 276.327 1.00 72.83  ? 139 PRO A CA    1 
ATOM   959  C C     . PRO A 1 172 ? 180.638 140.957 277.478 1.00 81.79  ? 139 PRO A C     1 
ATOM   960  O O     . PRO A 1 172 ? 181.503 141.792 277.184 1.00 81.98  ? 139 PRO A O     1 
ATOM   961  C CB    . PRO A 1 172 ? 178.289 140.366 276.702 1.00 72.60  ? 139 PRO A CB    1 
ATOM   962  C CG    . PRO A 1 172 ? 177.706 139.434 275.703 1.00 76.31  ? 139 PRO A CG    1 
ATOM   963  C CD    . PRO A 1 172 ? 178.736 138.327 275.598 1.00 75.67  ? 139 PRO A CD    1 
ATOM   964  N N     . PHE A 1 173 ? 180.425 140.584 278.756 1.00 80.92  ? 140 PHE A N     1 
ATOM   965  C CA    . PHE A 1 173 ? 181.212 141.238 279.815 1.00 83.10  ? 140 PHE A CA    1 
ATOM   966  C C     . PHE A 1 173 ? 182.501 140.483 280.171 1.00 90.69  ? 140 PHE A C     1 
ATOM   967  O O     . PHE A 1 173 ? 182.653 140.009 281.300 1.00 94.38  ? 140 PHE A O     1 
ATOM   968  C CB    . PHE A 1 173 ? 180.339 141.529 281.053 1.00 85.86  ? 140 PHE A CB    1 
ATOM   969  C CG    . PHE A 1 173 ? 179.224 142.523 280.797 1.00 83.24  ? 140 PHE A CG    1 
ATOM   970  C CD1   . PHE A 1 173 ? 178.001 142.105 280.277 1.00 83.88  ? 140 PHE A CD1   1 
ATOM   971  C CD2   . PHE A 1 173 ? 179.392 143.872 281.090 1.00 83.98  ? 140 PHE A CD2   1 
ATOM   972  C CE1   . PHE A 1 173 ? 176.978 143.025 280.028 1.00 80.99  ? 140 PHE A CE1   1 
ATOM   973  C CE2   . PHE A 1 173 ? 178.365 144.789 280.851 1.00 82.92  ? 140 PHE A CE2   1 
ATOM   974  C CZ    . PHE A 1 173 ? 177.168 144.359 280.319 1.00 78.66  ? 140 PHE A CZ    1 
ATOM   975  N N     . THR A 1 174 ? 183.448 140.402 279.210 1.00 86.68  ? 141 THR A N     1 
ATOM   976  C CA    . THR A 1 174 ? 184.721 139.691 279.419 1.00 91.28  ? 141 THR A CA    1 
ATOM   977  C C     . THR A 1 174 ? 185.953 140.615 279.353 1.00 95.83  ? 141 THR A C     1 
ATOM   978  O O     . THR A 1 174 ? 186.855 140.459 280.172 1.00 100.21 ? 141 THR A O     1 
ATOM   979  C CB    . THR A 1 174 ? 184.855 138.467 278.497 1.00 98.55  ? 141 THR A CB    1 
ATOM   980  O OG1   . THR A 1 174 ? 184.531 138.820 277.152 1.00 95.57  ? 141 THR A OG1   1 
ATOM   981  C CG2   . THR A 1 174 ? 183.978 137.312 278.944 1.00 96.20  ? 141 THR A CG2   1 
ATOM   982  N N     . GLY A 1 175 ? 185.972 141.561 278.416 1.00 88.45  ? 142 GLY A N     1 
ATOM   983  C CA    . GLY A 1 175 ? 187.064 142.520 278.269 1.00 88.94  ? 142 GLY A CA    1 
ATOM   984  C C     . GLY A 1 175 ? 187.232 143.122 276.886 1.00 89.95  ? 142 GLY A C     1 
ATOM   985  O O     . GLY A 1 175 ? 188.329 143.574 276.542 1.00 91.22  ? 142 GLY A O     1 
ATOM   986  N N     . GLY A 1 176 ? 186.150 143.137 276.103 1.00 82.63  ? 143 GLY A N     1 
ATOM   987  C CA    . GLY A 1 176 ? 186.120 143.693 274.752 1.00 79.40  ? 143 GLY A CA    1 
ATOM   988  C C     . GLY A 1 176 ? 186.890 142.908 273.710 1.00 84.52  ? 143 GLY A C     1 
ATOM   989  O O     . GLY A 1 176 ? 187.342 141.796 273.982 1.00 87.20  ? 143 GLY A O     1 
ATOM   990  N N     . PHE A 1 177 ? 187.048 143.487 272.503 1.00 79.45  ? 144 PHE A N     1 
ATOM   991  C CA    . PHE A 1 177 ? 187.774 142.853 271.400 1.00 81.89  ? 144 PHE A CA    1 
ATOM   992  C C     . PHE A 1 177 ? 189.268 142.698 271.684 1.00 92.28  ? 144 PHE A C     1 
ATOM   993  O O     . PHE A 1 177 ? 189.872 141.723 271.226 1.00 95.64  ? 144 PHE A O     1 
ATOM   994  C CB    . PHE A 1 177 ? 187.529 143.582 270.070 1.00 81.03  ? 144 PHE A CB    1 
ATOM   995  C CG    . PHE A 1 177 ? 186.151 143.351 269.500 1.00 79.01  ? 144 PHE A CG    1 
ATOM   996  C CD1   . PHE A 1 177 ? 185.114 144.237 269.766 1.00 77.99  ? 144 PHE A CD1   1 
ATOM   997  C CD2   . PHE A 1 177 ? 185.883 142.238 268.710 1.00 82.28  ? 144 PHE A CD2   1 
ATOM   998  C CE1   . PHE A 1 177 ? 183.837 144.023 269.243 1.00 76.16  ? 144 PHE A CE1   1 
ATOM   999  C CE2   . PHE A 1 177 ? 184.602 142.015 268.200 1.00 82.27  ? 144 PHE A CE2   1 
ATOM   1000 C CZ    . PHE A 1 177 ? 183.588 142.907 268.475 1.00 76.60  ? 144 PHE A CZ    1 
ATOM   1001 N N     . ASP A 1 178 ? 189.853 143.640 272.464 1.00 90.11  ? 145 ASP A N     1 
ATOM   1002 C CA    . ASP A 1 178 ? 191.262 143.623 272.860 1.00 94.78  ? 145 ASP A CA    1 
ATOM   1003 C C     . ASP A 1 178 ? 191.502 142.455 273.820 1.00 101.67 ? 145 ASP A C     1 
ATOM   1004 O O     . ASP A 1 178 ? 192.105 141.465 273.409 1.00 105.17 ? 145 ASP A O     1 
ATOM   1005 C CB    . ASP A 1 178 ? 191.678 144.970 273.473 1.00 96.82  ? 145 ASP A CB    1 
ATOM   1006 C CG    . ASP A 1 178 ? 193.070 145.416 273.074 1.00 112.93 ? 145 ASP A CG    1 
ATOM   1007 O OD1   . ASP A 1 178 ? 193.180 146.309 272.207 1.00 112.31 ? 145 ASP A OD1   1 
ATOM   1008 O OD2   . ASP A 1 178 ? 194.054 144.872 273.634 1.00 123.25 ? 145 ASP A OD2   1 
ATOM   1009 N N     . GLY A 1 179 ? 190.969 142.541 275.042 1.00 97.13  ? 146 GLY A N     1 
ATOM   1010 C CA    . GLY A 1 179 ? 191.067 141.471 276.032 1.00 100.61 ? 146 GLY A CA    1 
ATOM   1011 C C     . GLY A 1 179 ? 190.076 140.369 275.717 1.00 103.31 ? 146 GLY A C     1 
ATOM   1012 O O     . GLY A 1 179 ? 190.332 139.534 274.846 1.00 105.22 ? 146 GLY A O     1 
ATOM   1013 N N     . GLY A 1 180 ? 188.942 140.403 276.419 1.00 96.62  ? 147 GLY A N     1 
ATOM   1014 C CA    . GLY A 1 180 ? 187.779 139.527 276.275 1.00 94.09  ? 147 GLY A CA    1 
ATOM   1015 C C     . GLY A 1 180 ? 187.980 138.032 276.179 1.00 100.99 ? 147 GLY A C     1 
ATOM   1016 O O     . GLY A 1 180 ? 189.008 137.496 276.599 1.00 106.39 ? 147 GLY A O     1 
ATOM   1017 N N     . SER A 1 181 ? 186.956 137.359 275.649 1.00 94.58  ? 148 SER A N     1 
ATOM   1018 C CA    . SER A 1 181 ? 186.886 135.915 275.435 1.00 97.36  ? 148 SER A CA    1 
ATOM   1019 C C     . SER A 1 181 ? 186.085 135.659 274.167 1.00 96.73  ? 148 SER A C     1 
ATOM   1020 O O     . SER A 1 181 ? 185.036 136.278 273.979 1.00 92.32  ? 148 SER A O     1 
ATOM   1021 C CB    . SER A 1 181 ? 186.215 135.226 276.621 1.00 103.45 ? 148 SER A CB    1 
ATOM   1022 O OG    . SER A 1 181 ? 186.980 135.361 277.808 1.00 117.25 ? 148 SER A OG    1 
ATOM   1023 N N     . PHE A 1 182 ? 186.581 134.775 273.290 1.00 94.71  ? 149 PHE A N     1 
ATOM   1024 C CA    . PHE A 1 182 ? 185.923 134.457 272.027 1.00 92.25  ? 149 PHE A CA    1 
ATOM   1025 C C     . PHE A 1 182 ? 185.374 133.036 271.973 1.00 100.44 ? 149 PHE A C     1 
ATOM   1026 O O     . PHE A 1 182 ? 186.141 132.072 271.945 1.00 105.69 ? 149 PHE A O     1 
ATOM   1027 C CB    . PHE A 1 182 ? 186.848 134.741 270.831 1.00 94.62  ? 149 PHE A CB    1 
ATOM   1028 C CG    . PHE A 1 182 ? 187.105 136.202 270.545 1.00 92.18  ? 149 PHE A CG    1 
ATOM   1029 C CD1   . PHE A 1 182 ? 186.244 136.930 269.730 1.00 90.28  ? 149 PHE A CD1   1 
ATOM   1030 C CD2   . PHE A 1 182 ? 188.232 136.839 271.054 1.00 95.44  ? 149 PHE A CD2   1 
ATOM   1031 C CE1   . PHE A 1 182 ? 186.490 138.278 269.454 1.00 88.36  ? 149 PHE A CE1   1 
ATOM   1032 C CE2   . PHE A 1 182 ? 188.481 138.184 270.772 1.00 95.42  ? 149 PHE A CE2   1 
ATOM   1033 C CZ    . PHE A 1 182 ? 187.609 138.895 269.971 1.00 89.16  ? 149 PHE A CZ    1 
ATOM   1034 N N     . LEU A 1 183 ? 184.041 132.909 271.952 1.00 94.80  ? 150 LEU A N     1 
ATOM   1035 C CA    . LEU A 1 183 ? 183.346 131.627 271.865 1.00 97.29  ? 150 LEU A CA    1 
ATOM   1036 C C     . LEU A 1 183 ? 183.453 131.068 270.450 1.00 104.62 ? 150 LEU A C     1 
ATOM   1037 O O     . LEU A 1 183 ? 183.182 131.768 269.472 1.00 100.77 ? 150 LEU A O     1 
ATOM   1038 C CB    . LEU A 1 183 ? 181.867 131.769 272.302 1.00 93.74  ? 150 LEU A CB    1 
ATOM   1039 C CG    . LEU A 1 183 ? 180.927 130.557 272.142 1.00 99.94  ? 150 LEU A CG    1 
ATOM   1040 C CD1   . LEU A 1 183 ? 181.321 129.410 273.061 1.00 105.84 ? 150 LEU A CD1   1 
ATOM   1041 C CD2   . LEU A 1 183 ? 179.502 130.946 272.432 1.00 97.52  ? 150 LEU A CD2   1 
ATOM   1042 N N     . SER A 1 184 ? 183.864 129.802 270.361 1.00 108.71 ? 151 SER A N     1 
ATOM   1043 C CA    . SER A 1 184 ? 184.014 129.055 269.116 1.00 112.08 ? 151 SER A CA    1 
ATOM   1044 C C     . SER A 1 184 ? 183.473 127.649 269.322 1.00 121.85 ? 151 SER A C     1 
ATOM   1045 O O     . SER A 1 184 ? 183.645 127.094 270.408 1.00 124.33 ? 151 SER A O     1 
ATOM   1046 C CB    . SER A 1 184 ? 185.484 128.988 268.711 1.00 118.46 ? 151 SER A CB    1 
ATOM   1047 O OG    . SER A 1 184 ? 186.281 128.491 269.773 1.00 127.41 ? 151 SER A OG    1 
ATOM   1048 N N     . LEU A 1 185 ? 182.817 127.076 268.298 1.00 120.69 ? 152 LEU A N     1 
ATOM   1049 C CA    . LEU A 1 185 ? 182.309 125.702 268.374 1.00 125.62 ? 152 LEU A CA    1 
ATOM   1050 C C     . LEU A 1 185 ? 182.545 124.908 267.064 1.00 134.08 ? 152 LEU A C     1 
ATOM   1051 O O     . LEU A 1 185 ? 182.443 123.681 267.072 1.00 138.66 ? 152 LEU A O     1 
ATOM   1052 C CB    . LEU A 1 185 ? 180.843 125.642 268.851 1.00 122.95 ? 152 LEU A CB    1 
ATOM   1053 C CG    . LEU A 1 185 ? 180.494 124.543 269.894 1.00 131.71 ? 152 LEU A CG    1 
ATOM   1054 C CD1   . LEU A 1 185 ? 181.468 124.526 271.078 1.00 134.40 ? 152 LEU A CD1   1 
ATOM   1055 C CD2   . LEU A 1 185 ? 179.090 124.728 270.438 1.00 131.18 ? 152 LEU A CD2   1 
ATOM   1056 N N     . GLY A 1 186 ? 182.933 125.618 265.998 1.00 129.35 ? 153 GLY A N     1 
ATOM   1057 C CA    . GLY A 1 186 ? 183.284 125.072 264.688 1.00 133.01 ? 153 GLY A CA    1 
ATOM   1058 C C     . GLY A 1 186 ? 182.192 124.319 263.960 1.00 137.40 ? 153 GLY A C     1 
ATOM   1059 O O     . GLY A 1 186 ? 181.596 124.841 263.015 1.00 134.31 ? 153 GLY A O     1 
ATOM   1060 N N     . ILE A 1 187 ? 181.967 123.061 264.374 1.00 138.31 ? 154 ILE A N     1 
ATOM   1061 C CA    . ILE A 1 187 ? 180.953 122.143 263.834 1.00 140.13 ? 154 ILE A CA    1 
ATOM   1062 C C     . ILE A 1 187 ? 179.557 122.758 264.028 1.00 136.36 ? 154 ILE A C     1 
ATOM   1063 O O     . ILE A 1 187 ? 178.731 122.726 263.114 1.00 135.19 ? 154 ILE A O     1 
ATOM   1064 C CB    . ILE A 1 187 ? 181.051 120.745 264.512 1.00 149.13 ? 154 ILE A CB    1 
ATOM   1065 C CG1   . ILE A 1 187 ? 182.513 120.314 264.764 1.00 151.05 ? 154 ILE A CG1   1 
ATOM   1066 C CG2   . ILE A 1 187 ? 180.288 119.686 263.719 1.00 151.30 ? 154 ILE A CG2   1 
ATOM   1067 C CD1   . ILE A 1 187 ? 183.001 120.505 266.207 1.00 156.10 ? 154 ILE A CD1   1 
ATOM   1068 N N     . PHE A 1 188 ? 179.330 123.347 265.214 1.00 127.66 ? 155 PHE A N     1 
ATOM   1069 C CA    . PHE A 1 188 ? 178.082 123.980 265.610 1.00 121.92 ? 155 PHE A CA    1 
ATOM   1070 C C     . PHE A 1 188 ? 177.929 125.421 265.087 1.00 119.54 ? 155 PHE A C     1 
ATOM   1071 O O     . PHE A 1 188 ? 176.896 126.028 265.364 1.00 115.03 ? 155 PHE A O     1 
ATOM   1072 C CB    . PHE A 1 188 ? 177.918 123.937 267.139 1.00 122.64 ? 155 PHE A CB    1 
ATOM   1073 C CG    . PHE A 1 188 ? 177.768 122.570 267.765 1.00 129.53 ? 155 PHE A CG    1 
ATOM   1074 C CD1   . PHE A 1 188 ? 176.516 122.089 268.131 1.00 132.70 ? 155 PHE A CD1   1 
ATOM   1075 C CD2   . PHE A 1 188 ? 178.883 121.783 268.036 1.00 137.14 ? 155 PHE A CD2   1 
ATOM   1076 C CE1   . PHE A 1 188 ? 176.378 120.830 268.726 1.00 139.04 ? 155 PHE A CE1   1 
ATOM   1077 C CE2   . PHE A 1 188 ? 178.744 120.522 268.628 1.00 145.28 ? 155 PHE A CE2   1 
ATOM   1078 C CZ    . PHE A 1 188 ? 177.493 120.054 268.968 1.00 143.32 ? 155 PHE A CZ    1 
ATOM   1079 N N     . PHE A 1 189 ? 178.916 125.959 264.315 1.00 115.50 ? 156 PHE A N     1 
ATOM   1080 C CA    . PHE A 1 189 ? 178.842 127.323 263.761 1.00 109.85 ? 156 PHE A CA    1 
ATOM   1081 C C     . PHE A 1 189 ? 177.616 127.512 262.861 1.00 110.73 ? 156 PHE A C     1 
ATOM   1082 O O     . PHE A 1 189 ? 176.861 128.461 263.075 1.00 105.83 ? 156 PHE A O     1 
ATOM   1083 C CB    . PHE A 1 189 ? 180.147 127.752 263.044 1.00 113.14 ? 156 PHE A CB    1 
ATOM   1084 C CG    . PHE A 1 189 ? 180.120 129.141 262.429 1.00 110.39 ? 156 PHE A CG    1 
ATOM   1085 C CD1   . PHE A 1 189 ? 180.329 130.272 263.210 1.00 108.76 ? 156 PHE A CD1   1 
ATOM   1086 C CD2   . PHE A 1 189 ? 179.894 129.313 261.067 1.00 113.45 ? 156 PHE A CD2   1 
ATOM   1087 C CE1   . PHE A 1 189 ? 180.287 131.554 262.644 1.00 105.75 ? 156 PHE A CE1   1 
ATOM   1088 C CE2   . PHE A 1 189 ? 179.852 130.595 260.503 1.00 112.38 ? 156 PHE A CE2   1 
ATOM   1089 C CZ    . PHE A 1 189 ? 180.061 131.704 261.293 1.00 105.70 ? 156 PHE A CZ    1 
ATOM   1090 N N     . VAL A 1 190 ? 177.420 126.612 261.875 1.00 110.35 ? 157 VAL A N     1 
ATOM   1091 C CA    . VAL A 1 190 ? 176.290 126.643 260.937 1.00 109.42 ? 157 VAL A CA    1 
ATOM   1092 C C     . VAL A 1 190 ? 174.941 126.440 261.682 1.00 110.18 ? 157 VAL A C     1 
ATOM   1093 O O     . VAL A 1 190 ? 174.097 127.324 261.541 1.00 105.88 ? 157 VAL A O     1 
ATOM   1094 C CB    . VAL A 1 190 ? 176.461 125.697 259.718 1.00 119.66 ? 157 VAL A CB    1 
ATOM   1095 C CG1   . VAL A 1 190 ? 175.469 126.046 258.612 1.00 119.02 ? 157 VAL A CG1   1 
ATOM   1096 C CG2   . VAL A 1 190 ? 177.889 125.735 259.181 1.00 122.63 ? 157 VAL A CG2   1 
ATOM   1097 N N     . PRO A 1 191 ? 174.715 125.377 262.517 1.00 108.55 ? 158 PRO A N     1 
ATOM   1098 C CA    . PRO A 1 191 ? 173.434 125.279 263.247 1.00 106.13 ? 158 PRO A CA    1 
ATOM   1099 C C     . PRO A 1 191 ? 173.154 126.475 264.165 1.00 104.24 ? 158 PRO A C     1 
ATOM   1100 O O     . PRO A 1 191 ? 172.005 126.914 264.240 1.00 100.58 ? 158 PRO A O     1 
ATOM   1101 C CB    . PRO A 1 191 ? 173.580 123.986 264.055 1.00 112.20 ? 158 PRO A CB    1 
ATOM   1102 C CG    . PRO A 1 191 ? 174.614 123.212 263.355 1.00 121.83 ? 158 PRO A CG    1 
ATOM   1103 C CD    . PRO A 1 191 ? 175.575 124.217 262.827 1.00 115.11 ? 158 PRO A CD    1 
ATOM   1104 N N     . ALA A 1 192 ? 174.201 127.018 264.837 1.00 99.98  ? 159 ALA A N     1 
ATOM   1105 C CA    . ALA A 1 192 ? 174.073 128.190 265.713 1.00 95.14  ? 159 ALA A CA    1 
ATOM   1106 C C     . ALA A 1 192 ? 173.707 129.437 264.919 1.00 95.35  ? 159 ALA A C     1 
ATOM   1107 O O     . ALA A 1 192 ? 172.943 130.257 265.424 1.00 90.78  ? 159 ALA A O     1 
ATOM   1108 C CB    . ALA A 1 192 ? 175.354 128.430 266.494 1.00 96.18  ? 159 ALA A CB    1 
ATOM   1109 N N     . LEU A 1 193 ? 174.235 129.569 263.677 1.00 94.03  ? 160 LEU A N     1 
ATOM   1110 C CA    . LEU A 1 193 ? 173.939 130.682 262.773 1.00 91.40  ? 160 LEU A CA    1 
ATOM   1111 C C     . LEU A 1 193 ? 172.467 130.644 262.372 1.00 96.61  ? 160 LEU A C     1 
ATOM   1112 O O     . LEU A 1 193 ? 171.788 131.665 262.492 1.00 92.30  ? 160 LEU A O     1 
ATOM   1113 C CB    . LEU A 1 193 ? 174.876 130.682 261.538 1.00 94.20  ? 160 LEU A CB    1 
ATOM   1114 C CG    . LEU A 1 193 ? 174.541 131.600 260.335 1.00 97.37  ? 160 LEU A CG    1 
ATOM   1115 C CD1   . LEU A 1 193 ? 174.438 133.060 260.731 1.00 92.46  ? 160 LEU A CD1   1 
ATOM   1116 C CD2   . LEU A 1 193 ? 175.592 131.495 259.278 1.00 102.78 ? 160 LEU A CD2   1 
ATOM   1117 N N     . PHE A 1 194 ? 171.973 129.464 261.935 1.00 98.45  ? 161 PHE A N     1 
ATOM   1118 C CA    . PHE A 1 194 ? 170.581 129.266 261.538 1.00 98.92  ? 161 PHE A CA    1 
ATOM   1119 C C     . PHE A 1 194 ? 169.611 129.588 262.675 1.00 101.09 ? 161 PHE A C     1 
ATOM   1120 O O     . PHE A 1 194 ? 168.685 130.368 262.459 1.00 97.99  ? 161 PHE A O     1 
ATOM   1121 C CB    . PHE A 1 194 ? 170.356 127.852 260.982 1.00 106.40 ? 161 PHE A CB    1 
ATOM   1122 C CG    . PHE A 1 194 ? 170.650 127.728 259.506 1.00 111.39 ? 161 PHE A CG    1 
ATOM   1123 C CD1   . PHE A 1 194 ? 171.910 127.345 259.060 1.00 117.83 ? 161 PHE A CD1   1 
ATOM   1124 C CD2   . PHE A 1 194 ? 169.665 127.983 258.560 1.00 113.97 ? 161 PHE A CD2   1 
ATOM   1125 C CE1   . PHE A 1 194 ? 172.182 127.233 257.693 1.00 122.32 ? 161 PHE A CE1   1 
ATOM   1126 C CE2   . PHE A 1 194 ? 169.939 127.869 257.194 1.00 120.55 ? 161 PHE A CE2   1 
ATOM   1127 C CZ    . PHE A 1 194 ? 171.196 127.496 256.770 1.00 121.92 ? 161 PHE A CZ    1 
ATOM   1128 N N     . PHE A 1 195 ? 169.905 129.099 263.861 1.00 99.21  ? 162 PHE A N     1 
ATOM   1129 C CA    . PHE A 1 195 ? 169.082 129.312 265.024 1.00 97.38  ? 162 PHE A CA    1 
ATOM   1130 C C     . PHE A 1 195 ? 168.944 130.754 265.503 1.00 96.29  ? 162 PHE A C     1 
ATOM   1131 O O     . PHE A 1 195 ? 167.871 131.173 265.899 1.00 93.44  ? 162 PHE A O     1 
ATOM   1132 C CB    . PHE A 1 195 ? 169.649 128.489 266.141 1.00 101.97 ? 162 PHE A CB    1 
ATOM   1133 C CG    . PHE A 1 195 ? 168.878 128.584 267.391 1.00 103.00 ? 162 PHE A CG    1 
ATOM   1134 C CD1   . PHE A 1 195 ? 167.979 127.609 267.727 1.00 110.29 ? 162 PHE A CD1   1 
ATOM   1135 C CD2   . PHE A 1 195 ? 169.043 129.648 268.230 1.00 101.84 ? 162 PHE A CD2   1 
ATOM   1136 C CE1   . PHE A 1 195 ? 167.255 127.693 268.891 1.00 110.90 ? 162 PHE A CE1   1 
ATOM   1137 C CE2   . PHE A 1 195 ? 168.328 129.743 269.401 1.00 104.44 ? 162 PHE A CE2   1 
ATOM   1138 C CZ    . PHE A 1 195 ? 167.429 128.765 269.733 1.00 105.99 ? 162 PHE A CZ    1 
ATOM   1139 N N     . ILE A 1 196 ? 170.039 131.502 265.493 1.00 91.28  ? 163 ILE A N     1 
ATOM   1140 C CA    . ILE A 1 196 ? 170.033 132.925 265.839 1.00 86.45  ? 163 ILE A CA    1 
ATOM   1141 C C     . ILE A 1 196 ? 169.480 133.788 264.676 1.00 86.78  ? 163 ILE A C     1 
ATOM   1142 O O     . ILE A 1 196 ? 168.705 134.708 264.948 1.00 83.06  ? 163 ILE A O     1 
ATOM   1143 C CB    . ILE A 1 196 ? 171.396 133.426 266.399 1.00 89.10  ? 163 ILE A CB    1 
ATOM   1144 C CG1   . ILE A 1 196 ? 171.266 134.819 267.068 1.00 85.88  ? 163 ILE A CG1   1 
ATOM   1145 C CG2   . ILE A 1 196 ? 172.494 133.412 265.355 1.00 91.53  ? 163 ILE A CG2   1 
ATOM   1146 C CD1   . ILE A 1 196 ? 171.943 134.943 268.443 1.00 96.87  ? 163 ILE A CD1   1 
ATOM   1147 N N     . MET A 1 197 ? 169.834 133.476 263.404 1.00 84.16  ? 164 MET A N     1 
ATOM   1148 C CA    . MET A 1 197 ? 169.344 134.221 262.238 1.00 82.27  ? 164 MET A CA    1 
ATOM   1149 C C     . MET A 1 197 ? 167.828 134.091 262.079 1.00 84.45  ? 164 MET A C     1 
ATOM   1150 O O     . MET A 1 197 ? 167.174 135.092 261.792 1.00 81.54  ? 164 MET A O     1 
ATOM   1151 C CB    . MET A 1 197 ? 170.058 133.795 260.951 1.00 88.30  ? 164 MET A CB    1 
ATOM   1152 C CG    . MET A 1 197 ? 170.028 134.848 259.875 1.00 90.95  ? 164 MET A CG    1 
ATOM   1153 S SD    . MET A 1 197 ? 171.696 135.287 259.346 1.00 96.49  ? 164 MET A SD    1 
ATOM   1154 C CE    . MET A 1 197 ? 171.321 136.569 258.219 1.00 91.98  ? 164 MET A CE    1 
ATOM   1155 N N     . LEU A 1 198 ? 167.271 132.870 262.273 1.00 82.44  ? 165 LEU A N     1 
ATOM   1156 C CA    . LEU A 1 198 ? 165.828 132.639 262.186 1.00 82.02  ? 165 LEU A CA    1 
ATOM   1157 C C     . LEU A 1 198 ? 165.124 133.303 263.371 1.00 79.92  ? 165 LEU A C     1 
ATOM   1158 O O     . LEU A 1 198 ? 164.076 133.914 263.184 1.00 77.74  ? 165 LEU A O     1 
ATOM   1159 C CB    . LEU A 1 198 ? 165.479 131.135 262.107 1.00 86.96  ? 165 LEU A CB    1 
ATOM   1160 C CG    . LEU A 1 198 ? 165.757 130.428 260.774 1.00 96.06  ? 165 LEU A CG    1 
ATOM   1161 C CD1   . LEU A 1 198 ? 166.060 128.963 260.992 1.00 101.09 ? 165 LEU A CD1   1 
ATOM   1162 C CD2   . LEU A 1 198 ? 164.591 130.560 259.820 1.00 99.44  ? 165 LEU A CD2   1 
ATOM   1163 N N     . GLY A 1 199 ? 165.729 133.209 264.558 1.00 74.43  ? 166 GLY A N     1 
ATOM   1164 C CA    . GLY A 1 199 ? 165.218 133.821 265.782 1.00 71.29  ? 166 GLY A CA    1 
ATOM   1165 C C     . GLY A 1 199 ? 165.134 135.335 265.679 1.00 70.52  ? 166 GLY A C     1 
ATOM   1166 O O     . GLY A 1 199 ? 164.091 135.924 265.998 1.00 67.89  ? 166 GLY A O     1 
ATOM   1167 N N     . THR A 1 200 ? 166.232 135.967 265.185 1.00 65.06  ? 167 THR A N     1 
ATOM   1168 C CA    . THR A 1 200 ? 166.319 137.412 264.965 1.00 61.27  ? 167 THR A CA    1 
ATOM   1169 C C     . THR A 1 200 ? 165.302 137.850 263.896 1.00 64.43  ? 167 THR A C     1 
ATOM   1170 O O     . THR A 1 200 ? 164.522 138.762 264.160 1.00 62.33  ? 167 THR A O     1 
ATOM   1171 C CB    . THR A 1 200 ? 167.768 137.859 264.642 1.00 67.81  ? 167 THR A CB    1 
ATOM   1172 O OG1   . THR A 1 200 ? 168.648 137.423 265.678 1.00 68.12  ? 167 THR A OG1   1 
ATOM   1173 C CG2   . THR A 1 200 ? 167.896 139.371 264.483 1.00 62.30  ? 167 THR A CG2   1 
ATOM   1174 N N     . ASP A 1 201 ? 165.295 137.190 262.718 1.00 62.71  ? 168 ASP A N     1 
ATOM   1175 C CA    . ASP A 1 201 ? 164.385 137.525 261.622 1.00 63.30  ? 168 ASP A CA    1 
ATOM   1176 C C     . ASP A 1 201 ? 162.905 137.422 261.995 1.00 67.75  ? 168 ASP A C     1 
ATOM   1177 O O     . ASP A 1 201 ? 162.127 138.328 261.662 1.00 66.75  ? 168 ASP A O     1 
ATOM   1178 C CB    . ASP A 1 201 ? 164.683 136.698 260.371 1.00 69.10  ? 168 ASP A CB    1 
ATOM   1179 C CG    . ASP A 1 201 ? 164.230 137.383 259.103 1.00 77.12  ? 168 ASP A CG    1 
ATOM   1180 O OD1   . ASP A 1 201 ? 164.670 138.529 258.860 1.00 74.73  ? 168 ASP A OD1   1 
ATOM   1181 O OD2   . ASP A 1 201 ? 163.443 136.771 258.347 1.00 83.24  ? 168 ASP A OD2   1 
ATOM   1182 N N     . ASN A 1 202 ? 162.520 136.343 262.700 1.00 64.95  ? 169 ASN A N     1 
ATOM   1183 C CA    . ASN A 1 202 ? 161.138 136.169 263.144 1.00 64.90  ? 169 ASN A CA    1 
ATOM   1184 C C     . ASN A 1 202 ? 160.802 137.131 264.288 1.00 65.17  ? 169 ASN A C     1 
ATOM   1185 O O     . ASN A 1 202 ? 159.708 137.690 264.304 1.00 64.80  ? 169 ASN A O     1 
ATOM   1186 C CB    . ASN A 1 202 ? 160.822 134.705 263.471 1.00 67.45  ? 169 ASN A CB    1 
ATOM   1187 C CG    . ASN A 1 202 ? 160.914 133.796 262.267 1.00 85.87  ? 169 ASN A CG    1 
ATOM   1188 O OD1   . ASN A 1 202 ? 160.302 134.037 261.218 1.00 82.59  ? 169 ASN A OD1   1 
ATOM   1189 N ND2   . ASN A 1 202 ? 161.676 132.724 262.389 1.00 75.80  ? 169 ASN A ND2   1 
ATOM   1190 N N     . GLY A 1 203 ? 161.765 137.370 265.175 1.00 59.61  ? 170 GLY A N     1 
ATOM   1191 C CA    . GLY A 1 203 ? 161.630 138.313 266.282 1.00 56.60  ? 170 GLY A CA    1 
ATOM   1192 C C     . GLY A 1 203 ? 161.351 139.729 265.815 1.00 57.45  ? 170 GLY A C     1 
ATOM   1193 O O     . GLY A 1 203 ? 160.475 140.400 266.368 1.00 55.72  ? 170 GLY A O     1 
ATOM   1194 N N     . VAL A 1 204 ? 162.076 140.173 264.762 1.00 53.52  ? 171 VAL A N     1 
ATOM   1195 C CA    . VAL A 1 204 ? 161.917 141.491 264.130 1.00 51.52  ? 171 VAL A CA    1 
ATOM   1196 C C     . VAL A 1 204 ? 160.534 141.563 263.421 1.00 58.28  ? 171 VAL A C     1 
ATOM   1197 O O     . VAL A 1 204 ? 159.831 142.565 263.554 1.00 56.82  ? 171 VAL A O     1 
ATOM   1198 C CB    . VAL A 1 204 ? 163.118 141.847 263.196 1.00 54.57  ? 171 VAL A CB    1 
ATOM   1199 C CG1   . VAL A 1 204 ? 162.893 143.160 262.449 1.00 53.00  ? 171 VAL A CG1   1 
ATOM   1200 C CG2   . VAL A 1 204 ? 164.416 141.926 263.985 1.00 52.88  ? 171 VAL A CG2   1 
ATOM   1201 N N     . ASN A 1 205 ? 160.144 140.480 262.716 1.00 58.76  ? 172 ASN A N     1 
ATOM   1202 C CA    . ASN A 1 205 ? 158.862 140.339 262.006 1.00 60.84  ? 172 ASN A CA    1 
ATOM   1203 C C     . ASN A 1 205 ? 157.673 140.449 262.971 1.00 64.36  ? 172 ASN A C     1 
ATOM   1204 O O     . ASN A 1 205 ? 156.669 141.088 262.634 1.00 65.32  ? 172 ASN A O     1 
ATOM   1205 C CB    . ASN A 1 205 ? 158.819 139.000 261.237 1.00 64.98  ? 172 ASN A CB    1 
ATOM   1206 C CG    . ASN A 1 205 ? 157.553 138.760 260.446 1.00 87.51  ? 172 ASN A CG    1 
ATOM   1207 O OD1   . ASN A 1 205 ? 156.621 138.101 260.910 1.00 82.19  ? 172 ASN A OD1   1 
ATOM   1208 N ND2   . ASN A 1 205 ? 157.498 139.269 259.225 1.00 80.58  ? 172 ASN A ND2   1 
ATOM   1209 N N     . PHE A 1 206 ? 157.797 139.841 264.170 1.00 59.46  ? 173 PHE A N     1 
ATOM   1210 C CA    . PHE A 1 206 ? 156.763 139.858 265.206 1.00 59.12  ? 173 PHE A CA    1 
ATOM   1211 C C     . PHE A 1 206 ? 156.635 141.242 265.861 1.00 60.72  ? 173 PHE A C     1 
ATOM   1212 O O     . PHE A 1 206 ? 155.554 141.599 266.324 1.00 60.96  ? 173 PHE A O     1 
ATOM   1213 C CB    . PHE A 1 206 ? 157.014 138.767 266.266 1.00 61.76  ? 173 PHE A CB    1 
ATOM   1214 C CG    . PHE A 1 206 ? 156.830 137.313 265.869 1.00 66.29  ? 173 PHE A CG    1 
ATOM   1215 C CD1   . PHE A 1 206 ? 156.491 136.961 264.566 1.00 71.04  ? 173 PHE A CD1   1 
ATOM   1216 C CD2   . PHE A 1 206 ? 156.995 136.296 266.802 1.00 69.59  ? 173 PHE A CD2   1 
ATOM   1217 C CE1   . PHE A 1 206 ? 156.339 135.622 264.204 1.00 75.33  ? 173 PHE A CE1   1 
ATOM   1218 C CE2   . PHE A 1 206 ? 156.831 134.956 266.439 1.00 75.76  ? 173 PHE A CE2   1 
ATOM   1219 C CZ    . PHE A 1 206 ? 156.515 134.630 265.142 1.00 75.75  ? 173 PHE A CZ    1 
ATOM   1220 N N     . THR A 1 207 ? 157.730 142.023 265.873 1.00 55.18  ? 174 THR A N     1 
ATOM   1221 C CA    . THR A 1 207 ? 157.798 143.382 266.433 1.00 51.55  ? 174 THR A CA    1 
ATOM   1222 C C     . THR A 1 207 ? 157.002 144.357 265.565 1.00 54.16  ? 174 THR A C     1 
ATOM   1223 O O     . THR A 1 207 ? 156.467 145.328 266.086 1.00 52.53  ? 174 THR A O     1 
ATOM   1224 C CB    . THR A 1 207 ? 159.277 143.772 266.662 1.00 53.79  ? 174 THR A CB    1 
ATOM   1225 O OG1   . THR A 1 207 ? 159.864 142.804 267.528 1.00 52.36  ? 174 THR A OG1   1 
ATOM   1226 C CG2   . THR A 1 207 ? 159.461 145.168 267.267 1.00 50.07  ? 174 THR A CG2   1 
ATOM   1227 N N     . ASP A 1 208 ? 156.883 144.082 264.258 1.00 52.44  ? 175 ASP A N     1 
ATOM   1228 C CA    . ASP A 1 208 ? 156.145 144.949 263.332 1.00 53.10  ? 175 ASP A CA    1 
ATOM   1229 C C     . ASP A 1 208 ? 154.619 144.750 263.419 1.00 58.25  ? 175 ASP A C     1 
ATOM   1230 O O     . ASP A 1 208 ? 153.988 144.255 262.482 1.00 60.67  ? 175 ASP A O     1 
ATOM   1231 C CB    . ASP A 1 208 ? 156.684 144.773 261.901 1.00 56.60  ? 175 ASP A CB    1 
ATOM   1232 C CG    . ASP A 1 208 ? 156.287 145.865 260.934 1.00 66.72  ? 175 ASP A CG    1 
ATOM   1233 O OD1   . ASP A 1 208 ? 156.078 147.018 261.384 1.00 63.84  ? 175 ASP A OD1   1 
ATOM   1234 O OD2   . ASP A 1 208 ? 156.228 145.585 259.730 1.00 77.26  ? 175 ASP A OD2   1 
ATOM   1235 N N     . GLY A 1 209 ? 154.052 145.136 264.558 1.00 53.51  ? 176 GLY A N     1 
ATOM   1236 C CA    . GLY A 1 209 ? 152.631 144.987 264.840 1.00 55.58  ? 176 GLY A CA    1 
ATOM   1237 C C     . GLY A 1 209 ? 151.897 146.254 265.206 1.00 59.50  ? 176 GLY A C     1 
ATOM   1238 O O     . GLY A 1 209 ? 150.667 146.299 265.114 1.00 62.66  ? 176 GLY A O     1 
ATOM   1239 N N     . LEU A 1 210 ? 152.636 147.274 265.658 1.00 52.44  ? 177 LEU A N     1 
ATOM   1240 C CA    . LEU A 1 210 ? 152.077 148.569 266.032 1.00 51.56  ? 177 LEU A CA    1 
ATOM   1241 C C     . LEU A 1 210 ? 152.760 149.661 265.233 1.00 54.64  ? 177 LEU A C     1 
ATOM   1242 O O     . LEU A 1 210 ? 153.872 149.448 264.750 1.00 53.74  ? 177 LEU A O     1 
ATOM   1243 C CB    . LEU A 1 210 ? 152.229 148.831 267.545 1.00 50.36  ? 177 LEU A CB    1 
ATOM   1244 C CG    . LEU A 1 210 ? 151.454 147.916 268.504 1.00 57.19  ? 177 LEU A CG    1 
ATOM   1245 C CD1   . LEU A 1 210 ? 151.799 148.232 269.936 1.00 56.78  ? 177 LEU A CD1   1 
ATOM   1246 C CD2   . LEU A 1 210 ? 149.945 148.021 268.302 1.00 61.02  ? 177 LEU A CD2   1 
ATOM   1247 N N     . ASP A 1 211 ? 152.102 150.827 265.082 1.00 51.18  ? 178 ASP A N     1 
ATOM   1248 C CA    . ASP A 1 211 ? 152.651 151.977 264.353 1.00 49.35  ? 178 ASP A CA    1 
ATOM   1249 C C     . ASP A 1 211 ? 153.935 152.457 265.018 1.00 49.60  ? 178 ASP A C     1 
ATOM   1250 O O     . ASP A 1 211 ? 153.971 152.582 266.237 1.00 48.43  ? 178 ASP A O     1 
ATOM   1251 C CB    . ASP A 1 211 ? 151.620 153.116 264.300 1.00 52.29  ? 178 ASP A CB    1 
ATOM   1252 C CG    . ASP A 1 211 ? 150.294 152.787 263.624 1.00 60.62  ? 178 ASP A CG    1 
ATOM   1253 O OD1   . ASP A 1 211 ? 150.109 151.622 263.200 1.00 60.57  ? 178 ASP A OD1   1 
ATOM   1254 O OD2   . ASP A 1 211 ? 149.460 153.705 263.482 1.00 68.01  ? 178 ASP A OD2   1 
ATOM   1255 N N     . GLY A 1 212 ? 154.986 152.642 264.222 1.00 45.28  ? 179 GLY A N     1 
ATOM   1256 C CA    . GLY A 1 212 ? 156.298 153.101 264.678 1.00 42.91  ? 179 GLY A CA    1 
ATOM   1257 C C     . GLY A 1 212 ? 157.138 152.149 265.525 1.00 46.21  ? 179 GLY A C     1 
ATOM   1258 O O     . GLY A 1 212 ? 158.302 152.466 265.796 1.00 43.71  ? 179 GLY A O     1 
ATOM   1259 N N     . LEU A 1 213 ? 156.573 150.971 265.942 1.00 43.47  ? 180 LEU A N     1 
ATOM   1260 C CA    . LEU A 1 213 ? 157.211 149.995 266.844 1.00 42.23  ? 180 LEU A CA    1 
ATOM   1261 C C     . LEU A 1 213 ? 158.512 149.399 266.312 1.00 46.64  ? 180 LEU A C     1 
ATOM   1262 O O     . LEU A 1 213 ? 159.550 149.581 266.952 1.00 45.60  ? 180 LEU A O     1 
ATOM   1263 C CB    . LEU A 1 213 ? 156.234 148.874 267.281 1.00 43.69  ? 180 LEU A CB    1 
ATOM   1264 C CG    . LEU A 1 213 ? 156.705 147.823 268.330 1.00 47.38  ? 180 LEU A CG    1 
ATOM   1265 C CD1   . LEU A 1 213 ? 157.386 148.454 269.537 1.00 46.06  ? 180 LEU A CD1   1 
ATOM   1266 C CD2   . LEU A 1 213 ? 155.542 146.989 268.817 1.00 50.43  ? 180 LEU A CD2   1 
ATOM   1267 N N     . CYS A 1 214 ? 158.458 148.660 265.193 1.00 44.34  ? 181 CYS A N     1 
ATOM   1268 C CA    . CYS A 1 214 ? 159.634 148.021 264.607 1.00 43.51  ? 181 CYS A CA    1 
ATOM   1269 C C     . CYS A 1 214 ? 160.656 149.080 264.195 1.00 44.29  ? 181 CYS A C     1 
ATOM   1270 O O     . CYS A 1 214 ? 161.836 148.955 264.533 1.00 43.27  ? 181 CYS A O     1 
ATOM   1271 C CB    . CYS A 1 214 ? 159.243 147.121 263.439 1.00 46.40  ? 181 CYS A CB    1 
ATOM   1272 S SG    . CYS A 1 214 ? 160.591 146.078 262.828 1.00 51.65  ? 181 CYS A SG    1 
ATOM   1273 N N     . THR A 1 215 ? 160.185 150.151 263.529 1.00 39.41  ? 182 THR A N     1 
ATOM   1274 C CA    . THR A 1 215 ? 161.008 151.274 263.092 1.00 38.18  ? 182 THR A CA    1 
ATOM   1275 C C     . THR A 1 215 ? 161.774 151.875 264.274 1.00 40.23  ? 182 THR A C     1 
ATOM   1276 O O     . THR A 1 215 ? 162.995 151.851 264.230 1.00 40.61  ? 182 THR A O     1 
ATOM   1277 C CB    . THR A 1 215 ? 160.181 152.309 262.300 1.00 47.31  ? 182 THR A CB    1 
ATOM   1278 O OG1   . THR A 1 215 ? 159.320 151.649 261.368 1.00 53.93  ? 182 THR A OG1   1 
ATOM   1279 C CG2   . THR A 1 215 ? 161.046 153.297 261.560 1.00 42.61  ? 182 THR A CG2   1 
ATOM   1280 N N     . SER A 1 216 ? 161.083 152.329 265.349 1.00 35.51  ? 183 SER A N     1 
ATOM   1281 C CA    . SER A 1 216 ? 161.732 152.941 266.524 1.00 33.81  ? 183 SER A CA    1 
ATOM   1282 C C     . SER A 1 216 ? 162.791 152.063 267.181 1.00 37.70  ? 183 SER A C     1 
ATOM   1283 O O     . SER A 1 216 ? 163.901 152.549 267.442 1.00 38.05  ? 183 SER A O     1 
ATOM   1284 C CB    . SER A 1 216 ? 160.711 153.403 267.558 1.00 36.66  ? 183 SER A CB    1 
ATOM   1285 O OG    . SER A 1 216 ? 159.855 154.390 267.005 1.00 45.36  ? 183 SER A OG    1 
ATOM   1286 N N     . VAL A 1 217 ? 162.466 150.773 267.409 1.00 32.96  ? 184 VAL A N     1 
ATOM   1287 C CA    . VAL A 1 217 ? 163.373 149.818 268.044 1.00 32.61  ? 184 VAL A CA    1 
ATOM   1288 C C     . VAL A 1 217 ? 164.604 149.556 267.151 1.00 38.21  ? 184 VAL A C     1 
ATOM   1289 O O     . VAL A 1 217 ? 165.729 149.577 267.663 1.00 37.83  ? 184 VAL A O     1 
ATOM   1290 C CB    . VAL A 1 217 ? 162.642 148.514 268.508 1.00 36.73  ? 184 VAL A CB    1 
ATOM   1291 C CG1   . VAL A 1 217 ? 163.618 147.456 269.025 1.00 36.47  ? 184 VAL A CG1   1 
ATOM   1292 C CG2   . VAL A 1 217 ? 161.596 148.826 269.576 1.00 36.70  ? 184 VAL A CG2   1 
ATOM   1293 N N     . THR A 1 218 ? 164.395 149.370 265.822 1.00 36.05  ? 185 THR A N     1 
ATOM   1294 C CA    . THR A 1 218 ? 165.489 149.085 264.881 1.00 36.51  ? 185 THR A CA    1 
ATOM   1295 C C     . THR A 1 218 ? 166.406 150.301 264.685 1.00 38.99  ? 185 THR A C     1 
ATOM   1296 O O     . THR A 1 218 ? 167.604 150.086 264.515 1.00 38.84  ? 185 THR A O     1 
ATOM   1297 C CB    . THR A 1 218 ? 164.984 148.479 263.561 1.00 44.75  ? 185 THR A CB    1 
ATOM   1298 O OG1   . THR A 1 218 ? 164.022 147.462 263.861 1.00 46.11  ? 185 THR A OG1   1 
ATOM   1299 C CG2   . THR A 1 218 ? 166.107 147.848 262.737 1.00 42.15  ? 185 THR A CG2   1 
ATOM   1300 N N     . ILE A 1 219 ? 165.878 151.556 264.761 1.00 34.27  ? 186 ILE A N     1 
ATOM   1301 C CA    . ILE A 1 219 ? 166.707 152.774 264.647 1.00 33.58  ? 186 ILE A CA    1 
ATOM   1302 C C     . ILE A 1 219 ? 167.798 152.732 265.742 1.00 37.87  ? 186 ILE A C     1 
ATOM   1303 O O     . ILE A 1 219 ? 168.981 152.957 265.457 1.00 37.73  ? 186 ILE A O     1 
ATOM   1304 C CB    . ILE A 1 219 ? 165.872 154.092 264.724 1.00 35.47  ? 186 ILE A CB    1 
ATOM   1305 C CG1   . ILE A 1 219 ? 164.949 154.258 263.504 1.00 36.30  ? 186 ILE A CG1   1 
ATOM   1306 C CG2   . ILE A 1 219 ? 166.789 155.328 264.881 1.00 35.45  ? 186 ILE A CG2   1 
ATOM   1307 C CD1   . ILE A 1 219 ? 163.742 155.246 263.701 1.00 36.51  ? 186 ILE A CD1   1 
ATOM   1308 N N     . LEU A 1 220 ? 167.379 152.394 266.980 1.00 33.62  ? 187 LEU A N     1 
ATOM   1309 C CA    . LEU A 1 220 ? 168.243 152.312 268.149 1.00 32.53  ? 187 LEU A CA    1 
ATOM   1310 C C     . LEU A 1 220 ? 169.247 151.159 268.044 1.00 38.64  ? 187 LEU A C     1 
ATOM   1311 O O     . LEU A 1 220 ? 170.426 151.357 268.347 1.00 39.90  ? 187 LEU A O     1 
ATOM   1312 C CB    . LEU A 1 220 ? 167.404 152.280 269.434 1.00 31.73  ? 187 LEU A CB    1 
ATOM   1313 C CG    . LEU A 1 220 ? 166.641 153.600 269.686 1.00 34.95  ? 187 LEU A CG    1 
ATOM   1314 C CD1   . LEU A 1 220 ? 165.332 153.376 270.389 1.00 35.00  ? 187 LEU A CD1   1 
ATOM   1315 C CD2   . LEU A 1 220 ? 167.499 154.627 270.415 1.00 37.29  ? 187 LEU A CD2   1 
ATOM   1316 N N     . VAL A 1 221 ? 168.817 150.000 267.520 1.00 35.49  ? 188 VAL A N     1 
ATOM   1317 C CA    . VAL A 1 221 ? 169.695 148.846 267.307 1.00 36.46  ? 188 VAL A CA    1 
ATOM   1318 C C     . VAL A 1 221 ? 170.754 149.215 266.243 1.00 42.83  ? 188 VAL A C     1 
ATOM   1319 O O     . VAL A 1 221 ? 171.947 148.972 266.466 1.00 44.45  ? 188 VAL A O     1 
ATOM   1320 C CB    . VAL A 1 221 ? 168.888 147.555 266.967 1.00 40.64  ? 188 VAL A CB    1 
ATOM   1321 C CG1   . VAL A 1 221 ? 169.779 146.440 266.414 1.00 41.92  ? 188 VAL A CG1   1 
ATOM   1322 C CG2   . VAL A 1 221 ? 168.107 147.059 268.179 1.00 40.32  ? 188 VAL A CG2   1 
ATOM   1323 N N     . ALA A 1 222 ? 170.320 149.852 265.127 1.00 38.80  ? 189 ALA A N     1 
ATOM   1324 C CA    . ALA A 1 222 ? 171.204 150.262 264.028 1.00 39.92  ? 189 ALA A CA    1 
ATOM   1325 C C     . ALA A 1 222 ? 172.172 151.381 264.425 1.00 44.60  ? 189 ALA A C     1 
ATOM   1326 O O     . ALA A 1 222 ? 173.306 151.405 263.924 1.00 45.89  ? 189 ALA A O     1 
ATOM   1327 C CB    . ALA A 1 222 ? 170.399 150.646 262.797 1.00 41.04  ? 189 ALA A CB    1 
ATOM   1328 N N     . THR A 1 223 ? 171.741 152.286 265.345 1.00 39.37  ? 190 THR A N     1 
ATOM   1329 C CA    . THR A 1 223 ? 172.586 153.367 265.878 1.00 38.50  ? 190 THR A CA    1 
ATOM   1330 C C     . THR A 1 223 ? 173.714 152.734 266.678 1.00 42.77  ? 190 THR A C     1 
ATOM   1331 O O     . THR A 1 223 ? 174.862 153.126 266.498 1.00 44.55  ? 190 THR A O     1 
ATOM   1332 C CB    . THR A 1 223 ? 171.766 154.360 266.717 1.00 40.68  ? 190 THR A CB    1 
ATOM   1333 O OG1   . THR A 1 223 ? 170.787 154.953 265.873 1.00 36.27  ? 190 THR A OG1   1 
ATOM   1334 C CG2   . THR A 1 223 ? 172.626 155.457 267.350 1.00 36.76  ? 190 THR A CG2   1 
ATOM   1335 N N     . PHE A 1 224 ? 173.393 151.731 267.526 1.00 37.67  ? 191 PHE A N     1 
ATOM   1336 C CA    . PHE A 1 224 ? 174.393 151.020 268.318 1.00 37.83  ? 191 PHE A CA    1 
ATOM   1337 C C     . PHE A 1 224 ? 175.447 150.413 267.391 1.00 43.98  ? 191 PHE A C     1 
ATOM   1338 O O     . PHE A 1 224 ? 176.640 150.625 267.608 1.00 45.56  ? 191 PHE A O     1 
ATOM   1339 C CB    . PHE A 1 224 ? 173.736 149.934 269.203 1.00 38.90  ? 191 PHE A CB    1 
ATOM   1340 C CG    . PHE A 1 224 ? 174.716 149.003 269.886 1.00 41.26  ? 191 PHE A CG    1 
ATOM   1341 C CD1   . PHE A 1 224 ? 175.252 149.320 271.131 1.00 44.81  ? 191 PHE A CD1   1 
ATOM   1342 C CD2   . PHE A 1 224 ? 175.121 147.820 269.274 1.00 43.46  ? 191 PHE A CD2   1 
ATOM   1343 C CE1   . PHE A 1 224 ? 176.164 148.463 271.758 1.00 47.78  ? 191 PHE A CE1   1 
ATOM   1344 C CE2   . PHE A 1 224 ? 176.039 146.973 269.894 1.00 48.47  ? 191 PHE A CE2   1 
ATOM   1345 C CZ    . PHE A 1 224 ? 176.546 147.292 271.138 1.00 47.77  ? 191 PHE A CZ    1 
ATOM   1346 N N     . LEU A 1 225 ? 175.006 149.684 266.349 1.00 40.93  ? 192 LEU A N     1 
ATOM   1347 C CA    . LEU A 1 225 ? 175.904 149.041 265.386 1.00 42.90  ? 192 LEU A CA    1 
ATOM   1348 C C     . LEU A 1 225 ? 176.802 150.037 264.658 1.00 46.72  ? 192 LEU A C     1 
ATOM   1349 O O     . LEU A 1 225 ? 177.928 149.681 264.316 1.00 48.18  ? 192 LEU A O     1 
ATOM   1350 C CB    . LEU A 1 225 ? 175.144 148.159 264.378 1.00 43.81  ? 192 LEU A CB    1 
ATOM   1351 C CG    . LEU A 1 225 ? 174.187 147.114 264.947 1.00 48.24  ? 192 LEU A CG    1 
ATOM   1352 C CD1   . LEU A 1 225 ? 173.243 146.615 263.884 1.00 49.34  ? 192 LEU A CD1   1 
ATOM   1353 C CD2   . LEU A 1 225 ? 174.924 145.968 265.638 1.00 51.30  ? 192 LEU A CD2   1 
ATOM   1354 N N     . THR A 1 226 ? 176.314 151.285 264.448 1.00 40.97  ? 193 THR A N     1 
ATOM   1355 C CA    . THR A 1 226 ? 177.058 152.363 263.793 1.00 40.79  ? 193 THR A CA    1 
ATOM   1356 C C     . THR A 1 226 ? 178.193 152.824 264.694 1.00 44.86  ? 193 THR A C     1 
ATOM   1357 O O     . THR A 1 226 ? 179.333 152.861 264.239 1.00 47.72  ? 193 THR A O     1 
ATOM   1358 C CB    . THR A 1 226 ? 176.112 153.484 263.351 1.00 44.76  ? 193 THR A CB    1 
ATOM   1359 O OG1   . THR A 1 226 ? 175.182 152.957 262.410 1.00 45.53  ? 193 THR A OG1   1 
ATOM   1360 C CG2   . THR A 1 226 ? 176.838 154.645 262.727 1.00 42.64  ? 193 THR A CG2   1 
ATOM   1361 N N     . ILE A 1 227 ? 177.893 153.139 265.970 1.00 38.85  ? 194 ILE A N     1 
ATOM   1362 C CA    . ILE A 1 227 ? 178.872 153.579 266.978 1.00 38.90  ? 194 ILE A CA    1 
ATOM   1363 C C     . ILE A 1 227 ? 179.942 152.508 267.171 1.00 45.09  ? 194 ILE A C     1 
ATOM   1364 O O     . ILE A 1 227 ? 181.137 152.825 267.182 1.00 48.38  ? 194 ILE A O     1 
ATOM   1365 C CB    . ILE A 1 227 ? 178.167 153.995 268.309 1.00 40.07  ? 194 ILE A CB    1 
ATOM   1366 C CG1   . ILE A 1 227 ? 177.154 155.152 268.059 1.00 38.11  ? 194 ILE A CG1   1 
ATOM   1367 C CG2   . ILE A 1 227 ? 179.186 154.359 269.413 1.00 41.39  ? 194 ILE A CG2   1 
ATOM   1368 C CD1   . ILE A 1 227 ? 176.077 155.338 269.123 1.00 44.38  ? 194 ILE A CD1   1 
ATOM   1369 N N     . VAL A 1 228 ? 179.517 151.240 267.254 1.00 40.58  ? 195 VAL A N     1 
ATOM   1370 C CA    . VAL A 1 228 ? 180.418 150.093 267.414 1.00 42.33  ? 195 VAL A CA    1 
ATOM   1371 C C     . VAL A 1 228 ? 181.274 149.868 266.148 1.00 47.51  ? 195 VAL A C     1 
ATOM   1372 O O     . VAL A 1 228 ? 182.494 149.752 266.279 1.00 49.93  ? 195 VAL A O     1 
ATOM   1373 C CB    . VAL A 1 228 ? 179.662 148.821 267.885 1.00 45.54  ? 195 VAL A CB    1 
ATOM   1374 C CG1   . VAL A 1 228 ? 180.574 147.601 267.890 1.00 48.34  ? 195 VAL A CG1   1 
ATOM   1375 C CG2   . VAL A 1 228 ? 179.063 149.038 269.271 1.00 43.84  ? 195 VAL A CG2   1 
ATOM   1376 N N     . ALA A 1 229 ? 180.652 149.862 264.938 1.00 43.25  ? 196 ALA A N     1 
ATOM   1377 C CA    . ALA A 1 229 ? 181.352 149.671 263.654 1.00 45.85  ? 196 ALA A CA    1 
ATOM   1378 C C     . ALA A 1 229 ? 182.413 150.733 263.372 1.00 52.12  ? 196 ALA A C     1 
ATOM   1379 O O     . ALA A 1 229 ? 183.379 150.449 262.659 1.00 53.92  ? 196 ALA A O     1 
ATOM   1380 C CB    . ALA A 1 229 ? 180.371 149.579 262.495 1.00 45.93  ? 196 ALA A CB    1 
ATOM   1381 N N     . ILE A 1 230 ? 182.238 151.950 263.938 1.00 48.63  ? 197 ILE A N     1 
ATOM   1382 C CA    . ILE A 1 230 ? 183.204 153.045 263.800 1.00 50.35  ? 197 ILE A CA    1 
ATOM   1383 C C     . ILE A 1 230 ? 184.345 152.820 264.808 1.00 57.12  ? 197 ILE A C     1 
ATOM   1384 O O     . ILE A 1 230 ? 185.495 152.670 264.399 1.00 60.21  ? 197 ILE A O     1 
ATOM   1385 C CB    . ILE A 1 230 ? 182.558 154.460 263.927 1.00 51.14  ? 197 ILE A CB    1 
ATOM   1386 C CG1   . ILE A 1 230 ? 181.558 154.725 262.786 1.00 50.26  ? 197 ILE A CG1   1 
ATOM   1387 C CG2   . ILE A 1 230 ? 183.652 155.546 263.953 1.00 54.49  ? 197 ILE A CG2   1 
ATOM   1388 C CD1   . ILE A 1 230 ? 180.559 155.857 263.040 1.00 55.98  ? 197 ILE A CD1   1 
ATOM   1389 N N     . GLY A 1 231 ? 183.997 152.783 266.098 1.00 52.51  ? 198 GLY A N     1 
ATOM   1390 C CA    . GLY A 1 231 ? 184.931 152.617 267.207 1.00 54.30  ? 198 GLY A CA    1 
ATOM   1391 C C     . GLY A 1 231 ? 185.827 151.405 267.119 1.00 62.52  ? 198 GLY A C     1 
ATOM   1392 O O     . GLY A 1 231 ? 187.015 151.500 267.424 1.00 65.52  ? 198 GLY A O     1 
ATOM   1393 N N     . GLU A 1 232 ? 185.269 150.262 266.689 1.00 59.91  ? 199 GLU A N     1 
ATOM   1394 C CA    . GLU A 1 232 ? 186.012 149.003 266.582 1.00 62.82  ? 199 GLU A CA    1 
ATOM   1395 C C     . GLU A 1 232 ? 186.622 148.780 265.199 1.00 71.04  ? 199 GLU A C     1 
ATOM   1396 O O     . GLU A 1 232 ? 187.215 147.725 264.953 1.00 74.63  ? 199 GLU A O     1 
ATOM   1397 C CB    . GLU A 1 232 ? 185.150 147.812 267.027 1.00 62.77  ? 199 GLU A CB    1 
ATOM   1398 C CG    . GLU A 1 232 ? 184.830 147.814 268.516 1.00 70.22  ? 199 GLU A CG    1 
ATOM   1399 C CD    . GLU A 1 232 ? 185.956 147.527 269.498 1.00 92.81  ? 199 GLU A CD    1 
ATOM   1400 O OE1   . GLU A 1 232 ? 187.068 147.148 269.061 1.00 94.68  ? 199 GLU A OE1   1 
ATOM   1401 O OE2   . GLU A 1 232 ? 185.697 147.619 270.719 1.00 83.72  ? 199 GLU A OE2   1 
ATOM   1402 N N     . ASP A 1 233 ? 186.521 149.802 264.323 1.00 66.93  ? 200 ASP A N     1 
ATOM   1403 C CA    . ASP A 1 233 ? 187.044 149.847 262.956 1.00 69.89  ? 200 ASP A CA    1 
ATOM   1404 C C     . ASP A 1 233 ? 186.623 148.643 262.081 1.00 75.47  ? 200 ASP A C     1 
ATOM   1405 O O     . ASP A 1 233 ? 187.454 148.050 261.380 1.00 79.47  ? 200 ASP A O     1 
ATOM   1406 C CB    . ASP A 1 233 ? 188.580 150.057 262.936 1.00 76.04  ? 200 ASP A CB    1 
ATOM   1407 C CG    . ASP A 1 233 ? 189.146 150.587 261.621 1.00 90.06  ? 200 ASP A CG    1 
ATOM   1408 O OD1   . ASP A 1 233 ? 188.354 151.079 260.784 1.00 90.11  ? 200 ASP A OD1   1 
ATOM   1409 O OD2   . ASP A 1 233 ? 190.381 150.519 261.437 1.00 99.53  ? 200 ASP A OD2   1 
ATOM   1410 N N     . MET A 1 234 ? 185.321 148.303 262.097 1.00 68.56  ? 201 MET A N     1 
ATOM   1411 C CA    . MET A 1 234 ? 184.789 147.278 261.200 1.00 69.24  ? 201 MET A CA    1 
ATOM   1412 C C     . MET A 1 234 ? 184.525 148.011 259.867 1.00 72.11  ? 201 MET A C     1 
ATOM   1413 O O     . MET A 1 234 ? 184.945 149.168 259.733 1.00 72.27  ? 201 MET A O     1 
ATOM   1414 C CB    . MET A 1 234 ? 183.558 146.589 261.797 1.00 69.11  ? 201 MET A CB    1 
ATOM   1415 C CG    . MET A 1 234 ? 183.917 145.321 262.572 1.00 75.15  ? 201 MET A CG    1 
ATOM   1416 S SD    . MET A 1 234 ? 183.778 145.433 264.385 1.00 77.49  ? 201 MET A SD    1 
ATOM   1417 C CE    . MET A 1 234 ? 184.666 144.004 264.855 1.00 77.98  ? 201 MET A CE    1 
ATOM   1418 N N     . GLY A 1 235 ? 183.917 147.370 258.878 1.00 68.02  ? 202 GLY A N     1 
ATOM   1419 C CA    . GLY A 1 235 ? 183.729 148.064 257.605 1.00 69.14  ? 202 GLY A CA    1 
ATOM   1420 C C     . GLY A 1 235 ? 182.306 148.273 257.146 1.00 70.99  ? 202 GLY A C     1 
ATOM   1421 O O     . GLY A 1 235 ? 182.082 148.545 255.964 1.00 73.13  ? 202 GLY A O     1 
ATOM   1422 N N     . ILE A 1 236 ? 181.341 148.191 258.079 1.00 63.28  ? 203 ILE A N     1 
ATOM   1423 C CA    . ILE A 1 236 ? 179.905 148.233 257.789 1.00 60.58  ? 203 ILE A CA    1 
ATOM   1424 C C     . ILE A 1 236 ? 179.155 149.478 258.328 1.00 61.09  ? 203 ILE A C     1 
ATOM   1425 O O     . ILE A 1 236 ? 177.930 149.546 258.183 1.00 58.99  ? 203 ILE A O     1 
ATOM   1426 C CB    . ILE A 1 236 ? 179.246 146.907 258.286 1.00 62.68  ? 203 ILE A CB    1 
ATOM   1427 C CG1   . ILE A 1 236 ? 179.419 146.710 259.817 1.00 59.81  ? 203 ILE A CG1   1 
ATOM   1428 C CG2   . ILE A 1 236 ? 179.789 145.699 257.494 1.00 68.32  ? 203 ILE A CG2   1 
ATOM   1429 C CD1   . ILE A 1 236 ? 178.362 145.915 260.453 1.00 59.84  ? 203 ILE A CD1   1 
ATOM   1430 N N     . SER A 1 237 ? 179.872 150.464 258.905 1.00 56.59  ? 204 SER A N     1 
ATOM   1431 C CA    . SER A 1 237 ? 179.243 151.670 259.447 1.00 52.89  ? 204 SER A CA    1 
ATOM   1432 C C     . SER A 1 237 ? 178.387 152.453 258.423 1.00 57.04  ? 204 SER A C     1 
ATOM   1433 O O     . SER A 1 237 ? 177.308 152.885 258.833 1.00 54.44  ? 204 SER A O     1 
ATOM   1434 C CB    . SER A 1 237 ? 180.258 152.578 260.132 1.00 55.96  ? 204 SER A CB    1 
ATOM   1435 O OG    . SER A 1 237 ? 180.812 153.546 259.260 1.00 65.90  ? 204 SER A OG    1 
ATOM   1436 N N     . PRO A 1 238 ? 178.747 152.622 257.117 1.00 56.88  ? 205 PRO A N     1 
ATOM   1437 C CA    . PRO A 1 238 ? 177.847 153.374 256.222 1.00 57.11  ? 205 PRO A CA    1 
ATOM   1438 C C     . PRO A 1 238 ? 176.492 152.709 255.973 1.00 60.35  ? 205 PRO A C     1 
ATOM   1439 O O     . PRO A 1 238 ? 175.512 153.433 255.846 1.00 58.22  ? 205 PRO A O     1 
ATOM   1440 C CB    . PRO A 1 238 ? 178.666 153.546 254.938 1.00 63.50  ? 205 PRO A CB    1 
ATOM   1441 C CG    . PRO A 1 238 ? 180.084 153.278 255.340 1.00 69.29  ? 205 PRO A CG    1 
ATOM   1442 C CD    . PRO A 1 238 ? 179.974 152.228 256.397 1.00 62.48  ? 205 PRO A CD    1 
ATOM   1443 N N     . ILE A 1 239 ? 176.420 151.352 255.945 1.00 58.61  ? 206 ILE A N     1 
ATOM   1444 C CA    . ILE A 1 239 ? 175.149 150.627 255.747 1.00 57.88  ? 206 ILE A CA    1 
ATOM   1445 C C     . ILE A 1 239 ? 174.317 150.621 257.050 1.00 58.14  ? 206 ILE A C     1 
ATOM   1446 O O     . ILE A 1 239 ? 173.099 150.798 256.977 1.00 57.13  ? 206 ILE A O     1 
ATOM   1447 C CB    . ILE A 1 239 ? 175.293 149.212 255.092 1.00 63.86  ? 206 ILE A CB    1 
ATOM   1448 C CG1   . ILE A 1 239 ? 173.919 148.642 254.669 1.00 64.33  ? 206 ILE A CG1   1 
ATOM   1449 C CG2   . ILE A 1 239 ? 176.084 148.217 255.950 1.00 63.80  ? 206 ILE A CG2   1 
ATOM   1450 C CD1   . ILE A 1 239 ? 173.893 147.976 253.344 1.00 76.94  ? 206 ILE A CD1   1 
ATOM   1451 N N     . THR A 1 240 ? 174.966 150.464 258.231 1.00 52.79  ? 207 THR A N     1 
ATOM   1452 C CA    . THR A 1 240 ? 174.268 150.501 259.525 1.00 48.99  ? 207 THR A CA    1 
ATOM   1453 C C     . THR A 1 240 ? 173.693 151.907 259.722 1.00 50.21  ? 207 THR A C     1 
ATOM   1454 O O     . THR A 1 240 ? 172.578 152.050 260.209 1.00 47.56  ? 207 THR A O     1 
ATOM   1455 C CB    . THR A 1 240 ? 175.160 150.042 260.692 1.00 54.97  ? 207 THR A CB    1 
ATOM   1456 O OG1   . THR A 1 240 ? 176.275 150.917 260.810 1.00 55.23  ? 207 THR A OG1   1 
ATOM   1457 C CG2   . THR A 1 240 ? 175.632 148.602 260.554 1.00 53.90  ? 207 THR A CG2   1 
ATOM   1458 N N     . GLY A 1 241 ? 174.445 152.910 259.273 1.00 47.47  ? 208 GLY A N     1 
ATOM   1459 C CA    . GLY A 1 241 ? 174.048 154.309 259.293 1.00 45.72  ? 208 GLY A CA    1 
ATOM   1460 C C     . GLY A 1 241 ? 172.957 154.582 258.280 1.00 50.06  ? 208 GLY A C     1 
ATOM   1461 O O     . GLY A 1 241 ? 172.017 155.317 258.583 1.00 48.64  ? 208 GLY A O     1 
ATOM   1462 N N     . ALA A 1 242 ? 173.050 153.965 257.075 1.00 49.24  ? 209 ALA A N     1 
ATOM   1463 C CA    . ALA A 1 242 ? 172.044 154.101 256.012 1.00 50.82  ? 209 ALA A CA    1 
ATOM   1464 C C     . ALA A 1 242 ? 170.699 153.589 256.502 1.00 53.05  ? 209 ALA A C     1 
ATOM   1465 O O     . ALA A 1 242 ? 169.688 154.231 256.238 1.00 53.19  ? 209 ALA A O     1 
ATOM   1466 C CB    . ALA A 1 242 ? 172.465 153.353 254.761 1.00 55.58  ? 209 ALA A CB    1 
ATOM   1467 N N     . VAL A 1 243 ? 170.696 152.478 257.274 1.00 47.55  ? 210 VAL A N     1 
ATOM   1468 C CA    . VAL A 1 243 ? 169.496 151.911 257.904 1.00 45.33  ? 210 VAL A CA    1 
ATOM   1469 C C     . VAL A 1 243 ? 168.882 152.933 258.913 1.00 46.22  ? 210 VAL A C     1 
ATOM   1470 O O     . VAL A 1 243 ? 167.664 153.102 258.912 1.00 46.37  ? 210 VAL A O     1 
ATOM   1471 C CB    . VAL A 1 243 ? 169.787 150.509 258.517 1.00 48.64  ? 210 VAL A CB    1 
ATOM   1472 C CG1   . VAL A 1 243 ? 168.652 150.021 259.412 1.00 46.31  ? 210 VAL A CG1   1 
ATOM   1473 C CG2   . VAL A 1 243 ? 170.066 149.490 257.419 1.00 51.88  ? 210 VAL A CG2   1 
ATOM   1474 N N     . VAL A 1 244 ? 169.722 153.647 259.710 1.00 40.33  ? 211 VAL A N     1 
ATOM   1475 C CA    . VAL A 1 244 ? 169.292 154.677 260.673 1.00 37.90  ? 211 VAL A CA    1 
ATOM   1476 C C     . VAL A 1 244 ? 168.570 155.806 259.914 1.00 46.15  ? 211 VAL A C     1 
ATOM   1477 O O     . VAL A 1 244 ? 167.436 156.147 260.254 1.00 45.65  ? 211 VAL A O     1 
ATOM   1478 C CB    . VAL A 1 244 ? 170.447 155.243 261.564 1.00 39.32  ? 211 VAL A CB    1 
ATOM   1479 C CG1   . VAL A 1 244 ? 169.929 156.309 262.532 1.00 37.06  ? 211 VAL A CG1   1 
ATOM   1480 C CG2   . VAL A 1 244 ? 171.164 154.142 262.331 1.00 38.28  ? 211 VAL A CG2   1 
ATOM   1481 N N     . GLY A 1 245 ? 169.234 156.347 258.891 1.00 46.18  ? 212 GLY A N     1 
ATOM   1482 C CA    . GLY A 1 245 ? 168.706 157.414 258.050 1.00 48.00  ? 212 GLY A CA    1 
ATOM   1483 C C     . GLY A 1 245 ? 167.432 157.027 257.335 1.00 54.15  ? 212 GLY A C     1 
ATOM   1484 O O     . GLY A 1 245 ? 166.440 157.755 257.407 1.00 54.26  ? 212 GLY A O     1 
ATOM   1485 N N     . SER A 1 246 ? 167.439 155.852 256.681 1.00 52.28  ? 213 SER A N     1 
ATOM   1486 C CA    . SER A 1 246 ? 166.286 155.312 255.958 1.00 54.03  ? 213 SER A CA    1 
ATOM   1487 C C     . SER A 1 246 ? 165.085 155.129 256.882 1.00 54.62  ? 213 SER A C     1 
ATOM   1488 O O     . SER A 1 246 ? 163.976 155.519 256.518 1.00 55.59  ? 213 SER A O     1 
ATOM   1489 C CB    . SER A 1 246 ? 166.642 153.990 255.279 1.00 60.51  ? 213 SER A CB    1 
ATOM   1490 O OG    . SER A 1 246 ? 165.569 153.497 254.493 1.00 73.02  ? 213 SER A OG    1 
ATOM   1491 N N     . LEU A 1 247 ? 165.306 154.572 258.084 1.00 47.47  ? 214 LEU A N     1 
ATOM   1492 C CA    . LEU A 1 247 ? 164.219 154.355 259.034 1.00 45.38  ? 214 LEU A CA    1 
ATOM   1493 C C     . LEU A 1 247 ? 163.696 155.655 259.658 1.00 46.86  ? 214 LEU A C     1 
ATOM   1494 O O     . LEU A 1 247 ? 162.498 155.741 259.928 1.00 46.79  ? 214 LEU A O     1 
ATOM   1495 C CB    . LEU A 1 247 ? 164.581 153.318 260.104 1.00 43.66  ? 214 LEU A CB    1 
ATOM   1496 C CG    . LEU A 1 247 ? 164.666 151.855 259.653 1.00 49.11  ? 214 LEU A CG    1 
ATOM   1497 C CD1   . LEU A 1 247 ? 165.245 150.998 260.751 1.00 46.90  ? 214 LEU A CD1   1 
ATOM   1498 C CD2   . LEU A 1 247 ? 163.299 151.317 259.224 1.00 53.15  ? 214 LEU A CD2   1 
ATOM   1499 N N     . LEU A 1 248 ? 164.560 156.677 259.832 1.00 41.39  ? 215 LEU A N     1 
ATOM   1500 C CA    . LEU A 1 248 ? 164.134 157.977 260.367 1.00 39.71  ? 215 LEU A CA    1 
ATOM   1501 C C     . LEU A 1 248 ? 163.195 158.694 259.397 1.00 45.98  ? 215 LEU A C     1 
ATOM   1502 O O     . LEU A 1 248 ? 162.256 159.362 259.840 1.00 46.18  ? 215 LEU A O     1 
ATOM   1503 C CB    . LEU A 1 248 ? 165.325 158.870 260.755 1.00 38.54  ? 215 LEU A CB    1 
ATOM   1504 C CG    . LEU A 1 248 ? 166.006 158.552 262.092 1.00 40.18  ? 215 LEU A CG    1 
ATOM   1505 C CD1   . LEU A 1 248 ? 167.385 159.147 262.143 1.00 40.38  ? 215 LEU A CD1   1 
ATOM   1506 C CD2   . LEU A 1 248 ? 165.184 159.043 263.278 1.00 40.21  ? 215 LEU A CD2   1 
ATOM   1507 N N     . GLY A 1 249 ? 163.428 158.508 258.096 1.00 44.45  ? 216 GLY A N     1 
ATOM   1508 C CA    . GLY A 1 249 ? 162.587 159.050 257.034 1.00 47.44  ? 216 GLY A CA    1 
ATOM   1509 C C     . GLY A 1 249 ? 161.219 158.387 257.023 1.00 52.36  ? 216 GLY A C     1 
ATOM   1510 O O     . GLY A 1 249 ? 160.191 159.074 256.998 1.00 52.77  ? 216 GLY A O     1 
ATOM   1511 N N     . PHE A 1 250 ? 161.208 157.033 257.082 1.00 48.00  ? 217 PHE A N     1 
ATOM   1512 C CA    . PHE A 1 250 ? 159.997 156.212 257.113 1.00 47.86  ? 217 PHE A CA    1 
ATOM   1513 C C     . PHE A 1 250 ? 159.150 156.495 258.362 1.00 48.13  ? 217 PHE A C     1 
ATOM   1514 O O     . PHE A 1 250 ? 157.924 156.590 258.248 1.00 49.28  ? 217 PHE A O     1 
ATOM   1515 C CB    . PHE A 1 250 ? 160.362 154.718 257.029 1.00 49.50  ? 217 PHE A CB    1 
ATOM   1516 C CG    . PHE A 1 250 ? 159.194 153.772 256.832 1.00 52.33  ? 217 PHE A CG    1 
ATOM   1517 C CD1   . PHE A 1 250 ? 158.572 153.656 255.593 1.00 58.54  ? 217 PHE A CD1   1 
ATOM   1518 C CD2   . PHE A 1 250 ? 158.750 152.963 257.871 1.00 52.30  ? 217 PHE A CD2   1 
ATOM   1519 C CE1   . PHE A 1 250 ? 157.507 152.771 255.407 1.00 61.23  ? 217 PHE A CE1   1 
ATOM   1520 C CE2   . PHE A 1 250 ? 157.690 152.071 257.681 1.00 56.87  ? 217 PHE A CE2   1 
ATOM   1521 C CZ    . PHE A 1 250 ? 157.071 151.988 256.453 1.00 58.58  ? 217 PHE A CZ    1 
ATOM   1522 N N     . LEU A 1 251 ? 159.809 156.650 259.541 1.00 40.26  ? 218 LEU A N     1 
ATOM   1523 C CA    . LEU A 1 251 ? 159.168 156.913 260.837 1.00 37.99  ? 218 LEU A CA    1 
ATOM   1524 C C     . LEU A 1 251 ? 158.265 158.151 260.818 1.00 43.56  ? 218 LEU A C     1 
ATOM   1525 O O     . LEU A 1 251 ? 157.236 158.143 261.494 1.00 44.19  ? 218 LEU A O     1 
ATOM   1526 C CB    . LEU A 1 251 ? 160.197 156.980 261.987 1.00 35.12  ? 218 LEU A CB    1 
ATOM   1527 C CG    . LEU A 1 251 ? 159.648 156.964 263.421 1.00 37.89  ? 218 LEU A CG    1 
ATOM   1528 C CD1   . LEU A 1 251 ? 159.031 155.636 263.772 1.00 38.41  ? 218 LEU A CD1   1 
ATOM   1529 C CD2   . LEU A 1 251 ? 160.720 157.270 264.413 1.00 37.26  ? 218 LEU A CD2   1 
ATOM   1530 N N     . LEU A 1 252 ? 158.615 159.181 260.010 1.00 39.88  ? 219 LEU A N     1 
ATOM   1531 C CA    . LEU A 1 252 ? 157.809 160.397 259.856 1.00 40.41  ? 219 LEU A CA    1 
ATOM   1532 C C     . LEU A 1 252 ? 156.394 160.026 259.405 1.00 45.80  ? 219 LEU A C     1 
ATOM   1533 O O     . LEU A 1 252 ? 155.428 160.552 259.945 1.00 45.42  ? 219 LEU A O     1 
ATOM   1534 C CB    . LEU A 1 252 ? 158.425 161.364 258.809 1.00 41.91  ? 219 LEU A CB    1 
ATOM   1535 C CG    . LEU A 1 252 ? 159.794 161.991 259.085 1.00 44.24  ? 219 LEU A CG    1 
ATOM   1536 C CD1   . LEU A 1 252 ? 160.445 162.452 257.793 1.00 46.50  ? 219 LEU A CD1   1 
ATOM   1537 C CD2   . LEU A 1 252 ? 159.692 163.163 260.044 1.00 44.86  ? 219 LEU A CD2   1 
ATOM   1538 N N     . PHE A 1 253 ? 156.290 159.072 258.453 1.00 44.18  ? 220 PHE A N     1 
ATOM   1539 C CA    . PHE A 1 253 ? 155.056 158.600 257.813 1.00 46.54  ? 220 PHE A CA    1 
ATOM   1540 C C     . PHE A 1 253 ? 154.482 157.326 258.432 1.00 49.05  ? 220 PHE A C     1 
ATOM   1541 O O     . PHE A 1 253 ? 153.344 156.970 258.142 1.00 50.24  ? 220 PHE A O     1 
ATOM   1542 C CB    . PHE A 1 253 ? 155.305 158.393 256.301 1.00 51.49  ? 220 PHE A CB    1 
ATOM   1543 C CG    . PHE A 1 253 ? 155.810 159.613 255.558 1.00 54.99  ? 220 PHE A CG    1 
ATOM   1544 C CD1   . PHE A 1 253 ? 157.168 159.923 255.532 1.00 56.43  ? 220 PHE A CD1   1 
ATOM   1545 C CD2   . PHE A 1 253 ? 154.927 160.458 254.893 1.00 60.92  ? 220 PHE A CD2   1 
ATOM   1546 C CE1   . PHE A 1 253 ? 157.633 161.055 254.856 1.00 59.22  ? 220 PHE A CE1   1 
ATOM   1547 C CE2   . PHE A 1 253 ? 155.393 161.585 254.207 1.00 65.80  ? 220 PHE A CE2   1 
ATOM   1548 C CZ    . PHE A 1 253 ? 156.744 161.873 254.191 1.00 62.49  ? 220 PHE A CZ    1 
ATOM   1549 N N     . ASN A 1 254 ? 155.249 156.638 259.280 1.00 43.80  ? 221 ASN A N     1 
ATOM   1550 C CA    . ASN A 1 254 ? 154.792 155.380 259.882 1.00 43.70  ? 221 ASN A CA    1 
ATOM   1551 C C     . ASN A 1 254 ? 154.232 155.526 261.304 1.00 47.00  ? 221 ASN A C     1 
ATOM   1552 O O     . ASN A 1 254 ? 153.459 154.670 261.742 1.00 47.95  ? 221 ASN A O     1 
ATOM   1553 C CB    . ASN A 1 254 ? 155.903 154.334 259.831 1.00 42.10  ? 221 ASN A CB    1 
ATOM   1554 C CG    . ASN A 1 254 ? 155.484 152.998 260.349 1.00 62.93  ? 221 ASN A CG    1 
ATOM   1555 O OD1   . ASN A 1 254 ? 155.734 152.675 261.503 1.00 56.44  ? 221 ASN A OD1   1 
ATOM   1556 N ND2   . ASN A 1 254 ? 154.744 152.245 259.549 1.00 59.65  ? 221 ASN A ND2   1 
ATOM   1557 N N     . VAL A 1 255 ? 154.624 156.593 262.021 1.00 41.89  ? 222 VAL A N     1 
ATOM   1558 C CA    . VAL A 1 255 ? 154.167 156.903 263.377 1.00 41.15  ? 222 VAL A CA    1 
ATOM   1559 C C     . VAL A 1 255 ? 152.618 157.036 263.418 1.00 48.27  ? 222 VAL A C     1 
ATOM   1560 O O     . VAL A 1 255 ? 152.010 157.371 262.393 1.00 50.30  ? 222 VAL A O     1 
ATOM   1561 C CB    . VAL A 1 255 ? 154.952 158.136 263.900 1.00 44.00  ? 222 VAL A CB    1 
ATOM   1562 C CG1   . VAL A 1 255 ? 154.149 159.431 263.848 1.00 44.97  ? 222 VAL A CG1   1 
ATOM   1563 C CG2   . VAL A 1 255 ? 155.545 157.878 265.279 1.00 42.27  ? 222 VAL A CG2   1 
ATOM   1564 N N     . TYR A 1 256 ? 151.982 156.707 264.562 1.00 45.11  ? 223 TYR A N     1 
ATOM   1565 C CA    . TYR A 1 256 ? 150.512 156.735 264.682 1.00 47.61  ? 223 TYR A CA    1 
ATOM   1566 C C     . TYR A 1 256 ? 149.855 158.084 264.291 1.00 54.31  ? 223 TYR A C     1 
ATOM   1567 O O     . TYR A 1 256 ? 150.209 159.120 264.859 1.00 53.55  ? 223 TYR A O     1 
ATOM   1568 C CB    . TYR A 1 256 ? 150.027 156.289 266.081 1.00 48.58  ? 223 TYR A CB    1 
ATOM   1569 C CG    . TYR A 1 256 ? 148.519 156.276 266.194 1.00 53.97  ? 223 TYR A CG    1 
ATOM   1570 C CD1   . TYR A 1 256 ? 147.818 157.416 266.582 1.00 57.87  ? 223 TYR A CD1   1 
ATOM   1571 C CD2   . TYR A 1 256 ? 147.783 155.152 265.830 1.00 56.62  ? 223 TYR A CD2   1 
ATOM   1572 C CE1   . TYR A 1 256 ? 146.426 157.440 266.597 1.00 62.62  ? 223 TYR A CE1   1 
ATOM   1573 C CE2   . TYR A 1 256 ? 146.389 155.161 265.855 1.00 60.94  ? 223 TYR A CE2   1 
ATOM   1574 C CZ    . TYR A 1 256 ? 145.714 156.304 266.248 1.00 71.21  ? 223 TYR A CZ    1 
ATOM   1575 O OH    . TYR A 1 256 ? 144.339 156.320 266.294 1.00 78.42  ? 223 TYR A OH    1 
ATOM   1576 N N     . PRO A 1 257 ? 148.838 158.088 263.394 1.00 53.94  ? 224 PRO A N     1 
ATOM   1577 C CA    . PRO A 1 257 ? 148.265 156.956 262.635 1.00 55.87  ? 224 PRO A CA    1 
ATOM   1578 C C     . PRO A 1 257 ? 149.057 156.674 261.356 1.00 60.51  ? 224 PRO A C     1 
ATOM   1579 O O     . PRO A 1 257 ? 149.187 157.556 260.500 1.00 61.85  ? 224 PRO A O     1 
ATOM   1580 C CB    . PRO A 1 257 ? 146.817 157.413 262.373 1.00 61.06  ? 224 PRO A CB    1 
ATOM   1581 C CG    . PRO A 1 257 ? 146.743 158.879 262.812 1.00 64.94  ? 224 PRO A CG    1 
ATOM   1582 C CD    . PRO A 1 257 ? 148.145 159.335 263.046 1.00 56.90  ? 224 PRO A CD    1 
ATOM   1583 N N     . ALA A 1 258 ? 149.622 155.456 261.255 1.00 56.21  ? 225 ALA A N     1 
ATOM   1584 C CA    . ALA A 1 258 ? 150.471 155.025 260.136 1.00 56.25  ? 225 ALA A CA    1 
ATOM   1585 C C     . ALA A 1 258 ? 149.884 155.335 258.766 1.00 64.57  ? 225 ALA A C     1 
ATOM   1586 O O     . ALA A 1 258 ? 148.742 154.977 258.478 1.00 66.79  ? 225 ALA A O     1 
ATOM   1587 C CB    . ALA A 1 258 ? 150.814 153.542 260.247 1.00 56.05  ? 225 ALA A CB    1 
ATOM   1588 N N     . LYS A 1 259 ? 150.664 156.057 257.953 1.00 62.16  ? 226 LYS A N     1 
ATOM   1589 C CA    . LYS A 1 259 ? 150.322 156.439 256.589 1.00 66.12  ? 226 LYS A CA    1 
ATOM   1590 C C     . LYS A 1 259 ? 150.635 155.265 255.645 1.00 73.62  ? 226 LYS A C     1 
ATOM   1591 O O     . LYS A 1 259 ? 149.884 155.015 254.709 1.00 77.33  ? 226 LYS A O     1 
ATOM   1592 C CB    . LYS A 1 259 ? 151.086 157.720 256.208 1.00 67.62  ? 226 LYS A CB    1 
ATOM   1593 C CG    . LYS A 1 259 ? 150.216 158.959 256.001 1.00 82.00  ? 226 LYS A CG    1 
ATOM   1594 C CD    . LYS A 1 259 ? 149.359 159.362 257.211 1.00 89.91  ? 226 LYS A CD    1 
ATOM   1595 C CE    . LYS A 1 259 ? 148.474 160.554 256.914 1.00 106.62 ? 226 LYS A CE    1 
ATOM   1596 N NZ    . LYS A 1 259 ? 147.414 160.255 255.907 1.00 121.31 ? 226 LYS A NZ    1 
ATOM   1597 N N     . VAL A 1 260 ? 151.699 154.529 255.973 1.00 69.42  ? 227 VAL A N     1 
ATOM   1598 C CA    . VAL A 1 260 ? 152.183 153.348 255.264 1.00 71.15  ? 227 VAL A CA    1 
ATOM   1599 C C     . VAL A 1 260 ? 152.568 152.247 256.207 1.00 73.43  ? 227 VAL A C     1 
ATOM   1600 O O     . VAL A 1 260 ? 152.712 152.462 257.385 1.00 69.88  ? 227 VAL A O     1 
ATOM   1601 C CB    . VAL A 1 260 ? 153.454 153.605 254.493 1.00 75.34  ? 227 VAL A CB    1 
ATOM   1602 C CG1   . VAL A 1 260 ? 153.565 152.601 253.373 1.00 78.64  ? 227 VAL A CG1   1 
ATOM   1603 C CG2   . VAL A 1 260 ? 153.488 155.013 253.962 1.00 76.64  ? 227 VAL A CG2   1 
ATOM   1604 N N     . PHE A 1 261 ? 152.730 151.052 255.663 1.00 72.64  ? 228 PHE A N     1 
ATOM   1605 C CA    . PHE A 1 261 ? 153.183 149.894 256.415 1.00 70.79  ? 228 PHE A CA    1 
ATOM   1606 C C     . PHE A 1 261 ? 154.381 149.235 255.779 1.00 75.42  ? 228 PHE A C     1 
ATOM   1607 O O     . PHE A 1 261 ? 154.597 149.337 254.595 1.00 77.87  ? 228 PHE A O     1 
ATOM   1608 C CB    . PHE A 1 261 ? 152.106 148.852 256.442 1.00 75.42  ? 228 PHE A CB    1 
ATOM   1609 C CG    . PHE A 1 261 ? 150.991 149.136 257.370 1.00 76.65  ? 228 PHE A CG    1 
ATOM   1610 C CD1   . PHE A 1 261 ? 151.056 150.131 258.286 1.00 76.77  ? 228 PHE A CD1   1 
ATOM   1611 C CD2   . PHE A 1 261 ? 149.870 148.365 257.320 1.00 82.12  ? 228 PHE A CD2   1 
ATOM   1612 C CE1   . PHE A 1 261 ? 150.011 150.358 259.140 1.00 78.09  ? 228 PHE A CE1   1 
ATOM   1613 C CE2   . PHE A 1 261 ? 148.823 148.584 258.162 1.00 84.98  ? 228 PHE A CE2   1 
ATOM   1614 C CZ    . PHE A 1 261 ? 148.889 149.584 259.078 1.00 80.13  ? 228 PHE A CZ    1 
ATOM   1615 N N     . MET A 1 262 ? 155.194 148.595 256.598 1.00 69.75  ? 229 MET A N     1 
ATOM   1616 C CA    . MET A 1 262 ? 156.501 148.172 256.150 1.00 69.20  ? 229 MET A CA    1 
ATOM   1617 C C     . MET A 1 262 ? 156.504 147.099 255.096 1.00 79.47  ? 229 MET A C     1 
ATOM   1618 O O     . MET A 1 262 ? 157.116 147.265 254.064 1.00 82.20  ? 229 MET A O     1 
ATOM   1619 C CB    . MET A 1 262 ? 157.260 147.624 257.345 1.00 67.54  ? 229 MET A CB    1 
ATOM   1620 C CG    . MET A 1 262 ? 158.604 148.256 257.596 1.00 67.59  ? 229 MET A CG    1 
ATOM   1621 S SD    . MET A 1 262 ? 159.341 147.430 258.972 1.00 67.87  ? 229 MET A SD    1 
ATOM   1622 C CE    . MET A 1 262 ? 159.553 148.761 260.089 1.00 60.97  ? 229 MET A CE    1 
ATOM   1623 N N     . GLY A 1 263 ? 155.776 146.024 255.326 1.00 77.96  ? 230 GLY A N     1 
ATOM   1624 C CA    . GLY A 1 263 ? 156.426 144.730 255.265 1.00 79.43  ? 230 GLY A CA    1 
ATOM   1625 C C     . GLY A 1 263 ? 156.069 143.826 256.414 1.00 83.26  ? 230 GLY A C     1 
ATOM   1626 O O     . GLY A 1 263 ? 155.102 144.068 257.096 1.00 83.87  ? 230 GLY A O     1 
ATOM   1627 N N     . ASP A 1 264 ? 156.867 142.810 256.689 1.00 78.63  ? 231 ASP A N     1 
ATOM   1628 C CA    . ASP A 1 264 ? 157.225 141.711 255.794 1.00 81.81  ? 231 ASP A CA    1 
ATOM   1629 C C     . ASP A 1 264 ? 158.211 142.005 254.685 1.00 85.63  ? 231 ASP A C     1 
ATOM   1630 O O     . ASP A 1 264 ? 159.255 141.397 254.678 1.00 85.00  ? 231 ASP A O     1 
ATOM   1631 C CB    . ASP A 1 264 ? 155.994 141.002 255.239 1.00 87.71  ? 231 ASP A CB    1 
ATOM   1632 C CG    . ASP A 1 264 ? 155.544 139.860 256.112 1.00 94.43  ? 231 ASP A CG    1 
ATOM   1633 O OD1   . ASP A 1 264 ? 156.269 139.497 257.036 1.00 91.26  ? 231 ASP A OD1   1 
ATOM   1634 O OD2   . ASP A 1 264 ? 154.453 139.319 255.899 1.00 103.09 ? 231 ASP A OD2   1 
ATOM   1635 N N     . THR A 1 265 ? 157.923 142.916 253.767 1.00 82.74  ? 232 THR A N     1 
ATOM   1636 C CA    . THR A 1 265 ? 158.975 143.359 252.868 1.00 82.93  ? 232 THR A CA    1 
ATOM   1637 C C     . THR A 1 265 ? 160.069 144.073 253.614 1.00 81.26  ? 232 THR A C     1 
ATOM   1638 O O     . THR A 1 265 ? 161.225 143.788 253.411 1.00 81.05  ? 232 THR A O     1 
ATOM   1639 C CB    . THR A 1 265 ? 158.455 144.310 251.798 1.00 90.79  ? 232 THR A CB    1 
ATOM   1640 O OG1   . THR A 1 265 ? 157.431 143.659 251.063 1.00 94.76  ? 232 THR A OG1   1 
ATOM   1641 C CG2   . THR A 1 265 ? 159.549 144.696 250.861 1.00 89.26  ? 232 THR A CG2   1 
ATOM   1642 N N     . GLY A 1 266 ? 159.706 145.011 254.476 1.00 73.17  ? 233 GLY A N     1 
ATOM   1643 C CA    . GLY A 1 266 ? 160.638 145.581 255.420 1.00 68.31  ? 233 GLY A CA    1 
ATOM   1644 C C     . GLY A 1 266 ? 161.119 144.779 256.591 1.00 69.18  ? 233 GLY A C     1 
ATOM   1645 O O     . GLY A 1 266 ? 162.280 144.726 256.877 1.00 67.50  ? 233 GLY A O     1 
ATOM   1646 N N     . SER A 1 267 ? 160.201 144.140 257.274 1.00 65.31  ? 234 SER A N     1 
ATOM   1647 C CA    . SER A 1 267 ? 160.509 143.558 258.551 1.00 62.83  ? 234 SER A CA    1 
ATOM   1648 C C     . SER A 1 267 ? 161.496 142.432 258.431 1.00 67.63  ? 234 SER A C     1 
ATOM   1649 O O     . SER A 1 267 ? 162.264 142.203 259.324 1.00 65.69  ? 234 SER A O     1 
ATOM   1650 C CB    . SER A 1 267 ? 159.267 143.094 259.238 1.00 67.06  ? 234 SER A CB    1 
ATOM   1651 O OG    . SER A 1 267 ? 158.421 142.506 258.301 1.00 82.32  ? 234 SER A OG    1 
ATOM   1652 N N     . LEU A 1 268 ? 161.407 141.668 257.359 1.00 66.26  ? 235 LEU A N     1 
ATOM   1653 C CA    . LEU A 1 268 ? 162.320 140.548 257.117 1.00 67.52  ? 235 LEU A CA    1 
ATOM   1654 C C     . LEU A 1 268 ? 163.680 141.094 256.683 1.00 71.02  ? 235 LEU A C     1 
ATOM   1655 O O     . LEU A 1 268 ? 164.711 140.583 257.122 1.00 70.79  ? 235 LEU A O     1 
ATOM   1656 C CB    . LEU A 1 268 ? 161.775 139.536 256.091 1.00 72.18  ? 235 LEU A CB    1 
ATOM   1657 C CG    . LEU A 1 268 ? 160.422 138.859 256.378 1.00 77.66  ? 235 LEU A CG    1 
ATOM   1658 C CD1   . LEU A 1 268 ? 160.020 137.967 255.229 1.00 83.29  ? 235 LEU A CD1   1 
ATOM   1659 C CD2   . LEU A 1 268 ? 160.425 138.070 257.681 1.00 77.62  ? 235 LEU A CD2   1 
ATOM   1660 N N     . ALA A 1 269 ? 163.682 142.168 255.865 1.00 66.89  ? 236 ALA A N     1 
ATOM   1661 C CA    . ALA A 1 269 ? 164.901 142.832 255.400 1.00 66.05  ? 236 ALA A CA    1 
ATOM   1662 C C     . ALA A 1 269 ? 165.722 143.355 256.588 1.00 64.78  ? 236 ALA A C     1 
ATOM   1663 O O     . ALA A 1 269 ? 166.915 143.063 256.662 1.00 64.74  ? 236 ALA A O     1 
ATOM   1664 C CB    . ALA A 1 269 ? 164.553 143.973 254.454 1.00 67.63  ? 236 ALA A CB    1 
ATOM   1665 N N     . LEU A 1 270 ? 165.070 144.066 257.543 1.00 56.95  ? 237 LEU A N     1 
ATOM   1666 C CA    . LEU A 1 270 ? 165.729 144.622 258.737 1.00 52.65  ? 237 LEU A CA    1 
ATOM   1667 C C     . LEU A 1 270 ? 166.230 143.544 259.695 1.00 57.47  ? 237 LEU A C     1 
ATOM   1668 O O     . LEU A 1 270 ? 167.281 143.725 260.315 1.00 55.88  ? 237 LEU A O     1 
ATOM   1669 C CB    . LEU A 1 270 ? 164.840 145.638 259.471 1.00 49.15  ? 237 LEU A CB    1 
ATOM   1670 C CG    . LEU A 1 270 ? 164.409 146.871 258.679 1.00 52.63  ? 237 LEU A CG    1 
ATOM   1671 C CD1   . LEU A 1 270 ? 163.239 147.572 259.358 1.00 50.61  ? 237 LEU A CD1   1 
ATOM   1672 C CD2   . LEU A 1 270 ? 165.575 147.809 258.414 1.00 51.92  ? 237 LEU A CD2   1 
ATOM   1673 N N     . GLY A 1 271 ? 165.486 142.437 259.780 1.00 56.03  ? 238 GLY A N     1 
ATOM   1674 C CA    . GLY A 1 271 ? 165.833 141.269 260.583 1.00 56.82  ? 238 GLY A CA    1 
ATOM   1675 C C     . GLY A 1 271 ? 167.067 140.561 260.055 1.00 63.61  ? 238 GLY A C     1 
ATOM   1676 O O     . GLY A 1 271 ? 167.821 139.954 260.823 1.00 63.74  ? 238 GLY A O     1 
ATOM   1677 N N     . GLY A 1 272 ? 167.267 140.651 258.740 1.00 62.20  ? 239 GLY A N     1 
ATOM   1678 C CA    . GLY A 1 272 ? 168.436 140.113 258.060 1.00 64.68  ? 239 GLY A CA    1 
ATOM   1679 C C     . GLY A 1 272 ? 169.637 140.990 258.342 1.00 66.23  ? 239 GLY A C     1 
ATOM   1680 O O     . GLY A 1 272 ? 170.708 140.479 258.675 1.00 67.52  ? 239 GLY A O     1 
ATOM   1681 N N     . PHE A 1 273 ? 169.442 142.327 258.249 1.00 59.12  ? 240 PHE A N     1 
ATOM   1682 C CA    . PHE A 1 273 ? 170.429 143.375 258.524 1.00 56.47  ? 240 PHE A CA    1 
ATOM   1683 C C     . PHE A 1 273 ? 171.011 143.243 259.933 1.00 57.77  ? 240 PHE A C     1 
ATOM   1684 O O     . PHE A 1 273 ? 172.226 143.361 260.094 1.00 57.66  ? 240 PHE A O     1 
ATOM   1685 C CB    . PHE A 1 273 ? 169.797 144.786 258.341 1.00 55.89  ? 240 PHE A CB    1 
ATOM   1686 C CG    . PHE A 1 273 ? 170.467 145.890 259.131 1.00 53.99  ? 240 PHE A CG    1 
ATOM   1687 C CD1   . PHE A 1 273 ? 171.665 146.443 258.703 1.00 57.12  ? 240 PHE A CD1   1 
ATOM   1688 C CD2   . PHE A 1 273 ? 169.928 146.332 260.334 1.00 52.63  ? 240 PHE A CD2   1 
ATOM   1689 C CE1   . PHE A 1 273 ? 172.310 147.421 259.460 1.00 55.71  ? 240 PHE A CE1   1 
ATOM   1690 C CE2   . PHE A 1 273 ? 170.584 147.299 261.100 1.00 52.89  ? 240 PHE A CE2   1 
ATOM   1691 C CZ    . PHE A 1 273 ? 171.761 147.849 260.649 1.00 51.69  ? 240 PHE A CZ    1 
ATOM   1692 N N     . VAL A 1 274 ? 170.131 143.067 260.950 1.00 52.22  ? 241 VAL A N     1 
ATOM   1693 C CA    . VAL A 1 274 ? 170.505 142.955 262.365 1.00 50.05  ? 241 VAL A CA    1 
ATOM   1694 C C     . VAL A 1 274 ? 171.412 141.740 262.588 1.00 56.20  ? 241 VAL A C     1 
ATOM   1695 O O     . VAL A 1 274 ? 172.504 141.906 263.138 1.00 56.57  ? 241 VAL A O     1 
ATOM   1696 C CB    . VAL A 1 274 ? 169.280 143.002 263.323 1.00 51.54  ? 241 VAL A CB    1 
ATOM   1697 C CG1   . VAL A 1 274 ? 169.685 142.679 264.761 1.00 50.68  ? 241 VAL A CG1   1 
ATOM   1698 C CG2   . VAL A 1 274 ? 168.590 144.366 263.262 1.00 48.65  ? 241 VAL A CG2   1 
ATOM   1699 N N     . ALA A 1 275 ? 170.997 140.556 262.090 1.00 53.98  ? 242 ALA A N     1 
ATOM   1700 C CA    . ALA A 1 275 ? 171.748 139.301 262.183 1.00 56.63  ? 242 ALA A CA    1 
ATOM   1701 C C     . ALA A 1 275 ? 173.059 139.334 261.386 1.00 62.25  ? 242 ALA A C     1 
ATOM   1702 O O     . ALA A 1 275 ? 174.080 138.902 261.917 1.00 62.80  ? 242 ALA A O     1 
ATOM   1703 C CB    . ALA A 1 275 ? 170.884 138.134 261.730 1.00 60.01  ? 242 ALA A CB    1 
ATOM   1704 N N     . ALA A 1 276 ? 173.038 139.860 260.137 1.00 59.80  ? 243 ALA A N     1 
ATOM   1705 C CA    . ALA A 1 276 ? 174.225 139.945 259.274 1.00 62.53  ? 243 ALA A CA    1 
ATOM   1706 C C     . ALA A 1 276 ? 175.288 140.892 259.819 1.00 64.89  ? 243 ALA A C     1 
ATOM   1707 O O     . ALA A 1 276 ? 176.473 140.550 259.767 1.00 66.49  ? 243 ALA A O     1 
ATOM   1708 C CB    . ALA A 1 276 ? 173.839 140.350 257.860 1.00 65.05  ? 243 ALA A CB    1 
ATOM   1709 N N     . SER A 1 277 ? 174.868 142.072 260.347 1.00 57.96  ? 244 SER A N     1 
ATOM   1710 C CA    . SER A 1 277 ? 175.768 143.079 260.926 1.00 56.10  ? 244 SER A CA    1 
ATOM   1711 C C     . SER A 1 277 ? 176.519 142.496 262.116 1.00 61.60  ? 244 SER A C     1 
ATOM   1712 O O     . SER A 1 277 ? 177.748 142.590 262.169 1.00 63.11  ? 244 SER A O     1 
ATOM   1713 C CB    . SER A 1 277 ? 174.996 144.323 261.354 1.00 54.68  ? 244 SER A CB    1 
ATOM   1714 O OG    . SER A 1 277 ? 174.439 144.974 260.226 1.00 61.72  ? 244 SER A OG    1 
ATOM   1715 N N     . CYS A 1 278 ? 175.779 141.847 263.040 1.00 57.46  ? 245 CYS A N     1 
ATOM   1716 C CA    . CYS A 1 278 ? 176.331 141.214 264.231 1.00 57.72  ? 245 CYS A CA    1 
ATOM   1717 C C     . CYS A 1 278 ? 177.300 140.113 263.879 1.00 66.93  ? 245 CYS A C     1 
ATOM   1718 O O     . CYS A 1 278 ? 178.325 139.985 264.539 1.00 69.43  ? 245 CYS A O     1 
ATOM   1719 C CB    . CYS A 1 278 ? 175.219 140.726 265.148 1.00 56.32  ? 245 CYS A CB    1 
ATOM   1720 S SG    . CYS A 1 278 ? 174.261 142.068 265.895 1.00 55.60  ? 245 CYS A SG    1 
ATOM   1721 N N     . TYR A 1 279 ? 177.026 139.369 262.797 1.00 64.88  ? 246 TYR A N     1 
ATOM   1722 C CA    . TYR A 1 279 ? 177.938 138.339 262.327 1.00 67.93  ? 246 TYR A CA    1 
ATOM   1723 C C     . TYR A 1 279 ? 179.173 138.955 261.697 1.00 73.14  ? 246 TYR A C     1 
ATOM   1724 O O     . TYR A 1 279 ? 180.270 138.484 261.972 1.00 75.57  ? 246 TYR A O     1 
ATOM   1725 C CB    . TYR A 1 279 ? 177.237 137.322 261.424 1.00 71.22  ? 246 TYR A CB    1 
ATOM   1726 C CG    . TYR A 1 279 ? 176.781 136.123 262.222 1.00 73.94  ? 246 TYR A CG    1 
ATOM   1727 C CD1   . TYR A 1 279 ? 175.548 136.117 262.863 1.00 72.91  ? 246 TYR A CD1   1 
ATOM   1728 C CD2   . TYR A 1 279 ? 177.624 135.033 262.421 1.00 79.01  ? 246 TYR A CD2   1 
ATOM   1729 C CE1   . TYR A 1 279 ? 175.145 135.041 263.647 1.00 74.58  ? 246 TYR A CE1   1 
ATOM   1730 C CE2   . TYR A 1 279 ? 177.232 133.948 263.204 1.00 81.57  ? 246 TYR A CE2   1 
ATOM   1731 C CZ    . TYR A 1 279 ? 175.990 133.958 263.818 1.00 85.12  ? 246 TYR A CZ    1 
ATOM   1732 O OH    . TYR A 1 279 ? 175.597 132.891 264.588 1.00 86.65  ? 246 TYR A OH    1 
ATOM   1733 N N     . MET A 1 280 ? 179.017 140.073 260.955 1.00 68.55  ? 247 MET A N     1 
ATOM   1734 C CA    . MET A 1 280 ? 180.151 140.798 260.356 1.00 69.99  ? 247 MET A CA    1 
ATOM   1735 C C     . MET A 1 280 ? 181.066 141.432 261.424 1.00 73.30  ? 247 MET A C     1 
ATOM   1736 O O     . MET A 1 280 ? 182.243 141.671 261.157 1.00 75.65  ? 247 MET A O     1 
ATOM   1737 C CB    . MET A 1 280 ? 179.680 141.872 259.350 1.00 70.77  ? 247 MET A CB    1 
ATOM   1738 C CG    . MET A 1 280 ? 179.120 141.309 258.047 1.00 76.96  ? 247 MET A CG    1 
ATOM   1739 S SD    . MET A 1 280 ? 180.163 140.160 257.103 1.00 87.14  ? 247 MET A SD    1 
ATOM   1740 C CE    . MET A 1 280 ? 181.405 141.278 256.493 1.00 85.54  ? 247 MET A CE    1 
ATOM   1741 N N     . MET A 1 281 ? 180.524 141.673 262.629 1.00 66.78  ? 248 MET A N     1 
ATOM   1742 C CA    . MET A 1 281 ? 181.234 142.288 263.749 1.00 65.81  ? 248 MET A CA    1 
ATOM   1743 C C     . MET A 1 281 ? 181.634 141.311 264.856 1.00 69.17  ? 248 MET A C     1 
ATOM   1744 O O     . MET A 1 281 ? 182.228 141.747 265.843 1.00 68.39  ? 248 MET A O     1 
ATOM   1745 C CB    . MET A 1 281 ? 180.392 143.425 264.345 1.00 64.65  ? 248 MET A CB    1 
ATOM   1746 C CG    . MET A 1 281 ? 180.292 144.633 263.455 1.00 68.33  ? 248 MET A CG    1 
ATOM   1747 S SD    . MET A 1 281 ? 179.317 145.930 264.234 1.00 69.56  ? 248 MET A SD    1 
ATOM   1748 C CE    . MET A 1 281 ? 177.726 145.328 263.971 1.00 64.63  ? 248 MET A CE    1 
ATOM   1749 N N     . ARG A 1 282 ? 181.308 140.008 264.708 1.00 66.23  ? 249 ARG A N     1 
ATOM   1750 C CA    . ARG A 1 282 ? 181.589 138.945 265.689 1.00 67.83  ? 249 ARG A CA    1 
ATOM   1751 C C     . ARG A 1 282 ? 180.801 139.138 267.000 1.00 69.41  ? 249 ARG A C     1 
ATOM   1752 O O     . ARG A 1 282 ? 181.189 138.631 268.055 1.00 71.06  ? 249 ARG A O     1 
ATOM   1753 C CB    . ARG A 1 282 ? 183.106 138.752 265.946 1.00 70.58  ? 249 ARG A CB    1 
ATOM   1754 C CG    . ARG A 1 282 ? 183.918 138.360 264.711 1.00 83.68  ? 249 ARG A CG    1 
ATOM   1755 C CD    . ARG A 1 282 ? 185.232 137.689 265.069 1.00 101.82 ? 249 ARG A CD    1 
ATOM   1756 N NE    . ARG A 1 282 ? 186.093 138.532 265.901 1.00 115.55 ? 249 ARG A NE    1 
ATOM   1757 C CZ    . ARG A 1 282 ? 187.002 139.377 265.426 1.00 134.40 ? 249 ARG A CZ    1 
ATOM   1758 N NH1   . ARG A 1 282 ? 187.180 139.505 264.117 1.00 125.44 ? 249 ARG A NH1   1 
ATOM   1759 N NH2   . ARG A 1 282 ? 187.739 140.102 266.257 1.00 122.23 ? 249 ARG A NH2   1 
ATOM   1760 N N     . MET A 1 283 ? 179.648 139.808 266.903 1.00 62.83  ? 250 MET A N     1 
ATOM   1761 C CA    . MET A 1 283 ? 178.755 140.114 268.022 1.00 60.10  ? 250 MET A CA    1 
ATOM   1762 C C     . MET A 1 283 ? 177.351 139.410 268.001 1.00 63.27  ? 250 MET A C     1 
ATOM   1763 O O     . MET A 1 283 ? 176.386 140.060 268.403 1.00 59.35  ? 250 MET A O     1 
ATOM   1764 C CB    . MET A 1 283 ? 178.578 141.631 268.120 1.00 58.66  ? 250 MET A CB    1 
ATOM   1765 C CG    . MET A 1 283 ? 179.824 142.364 268.530 1.00 62.74  ? 250 MET A CG    1 
ATOM   1766 S SD    . MET A 1 283 ? 179.577 144.137 268.319 1.00 63.07  ? 250 MET A SD    1 
ATOM   1767 C CE    . MET A 1 283 ? 178.752 144.532 269.835 1.00 57.71  ? 250 MET A CE    1 
ATOM   1768 N N     . PRO A 1 284 ? 177.181 138.105 267.631 1.00 62.79  ? 251 PRO A N     1 
ATOM   1769 C CA    . PRO A 1 284 ? 175.833 137.503 267.698 1.00 62.16  ? 251 PRO A CA    1 
ATOM   1770 C C     . PRO A 1 284 ? 175.345 137.331 269.139 1.00 65.06  ? 251 PRO A C     1 
ATOM   1771 O O     . PRO A 1 284 ? 174.139 137.369 269.386 1.00 62.93  ? 251 PRO A O     1 
ATOM   1772 C CB    . PRO A 1 284 ? 176.009 136.145 267.000 1.00 67.93  ? 251 PRO A CB    1 
ATOM   1773 C CG    . PRO A 1 284 ? 177.344 136.198 266.326 1.00 74.11  ? 251 PRO A CG    1 
ATOM   1774 C CD    . PRO A 1 284 ? 178.165 137.110 267.167 1.00 68.26  ? 251 PRO A CD    1 
ATOM   1775 N N     . LEU A 1 285 ? 176.297 137.173 270.089 1.00 63.22  ? 252 LEU A N     1 
ATOM   1776 C CA    . LEU A 1 285 ? 176.067 137.034 271.530 1.00 63.46  ? 252 LEU A CA    1 
ATOM   1777 C C     . LEU A 1 285 ? 175.530 138.340 272.170 1.00 64.44  ? 252 LEU A C     1 
ATOM   1778 O O     . LEU A 1 285 ? 175.106 138.322 273.330 1.00 65.40  ? 252 LEU A O     1 
ATOM   1779 C CB    . LEU A 1 285 ? 177.367 136.575 272.212 1.00 66.74  ? 252 LEU A CB    1 
ATOM   1780 C CG    . LEU A 1 285 ? 177.464 135.113 272.697 1.00 75.60  ? 252 LEU A CG    1 
ATOM   1781 C CD1   . LEU A 1 285 ? 176.793 134.125 271.739 1.00 76.72  ? 252 LEU A CD1   1 
ATOM   1782 C CD2   . LEU A 1 285 ? 178.918 134.713 272.915 1.00 81.51  ? 252 LEU A CD2   1 
ATOM   1783 N N     . PHE A 1 286 ? 175.537 139.458 271.406 1.00 56.55  ? 253 PHE A N     1 
ATOM   1784 C CA    . PHE A 1 286 ? 175.016 140.754 271.833 1.00 52.67  ? 253 PHE A CA    1 
ATOM   1785 C C     . PHE A 1 286 ? 173.555 140.929 271.407 1.00 54.51  ? 253 PHE A C     1 
ATOM   1786 O O     . PHE A 1 286 ? 172.864 141.761 271.987 1.00 52.19  ? 253 PHE A O     1 
ATOM   1787 C CB    . PHE A 1 286 ? 175.877 141.906 271.300 1.00 52.57  ? 253 PHE A CB    1 
ATOM   1788 C CG    . PHE A 1 286 ? 177.178 142.130 272.037 1.00 55.54  ? 253 PHE A CG    1 
ATOM   1789 C CD1   . PHE A 1 286 ? 178.299 141.349 271.761 1.00 60.68  ? 253 PHE A CD1   1 
ATOM   1790 C CD2   . PHE A 1 286 ? 177.305 143.167 272.960 1.00 55.87  ? 253 PHE A CD2   1 
ATOM   1791 C CE1   . PHE A 1 286 ? 179.515 141.589 272.409 1.00 63.02  ? 253 PHE A CE1   1 
ATOM   1792 C CE2   . PHE A 1 286 ? 178.522 143.400 273.613 1.00 59.85  ? 253 PHE A CE2   1 
ATOM   1793 C CZ    . PHE A 1 286 ? 179.613 142.607 273.336 1.00 60.73  ? 253 PHE A CZ    1 
ATOM   1794 N N     . ILE A 1 287 ? 173.075 140.132 270.418 1.00 52.29  ? 254 ILE A N     1 
ATOM   1795 C CA    . ILE A 1 287 ? 171.678 140.162 269.946 1.00 50.99  ? 254 ILE A CA    1 
ATOM   1796 C C     . ILE A 1 287 ? 170.681 139.917 271.124 1.00 54.53  ? 254 ILE A C     1 
ATOM   1797 O O     . ILE A 1 287 ? 169.724 140.675 271.206 1.00 51.10  ? 254 ILE A O     1 
ATOM   1798 C CB    . ILE A 1 287 ? 171.398 139.248 268.708 1.00 55.91  ? 254 ILE A CB    1 
ATOM   1799 C CG1   . ILE A 1 287 ? 172.367 139.564 267.541 1.00 56.70  ? 254 ILE A CG1   1 
ATOM   1800 C CG2   . ILE A 1 287 ? 169.935 139.369 268.240 1.00 55.69  ? 254 ILE A CG2   1 
ATOM   1801 C CD1   . ILE A 1 287 ? 172.326 138.579 266.304 1.00 64.56  ? 254 ILE A CD1   1 
ATOM   1802 N N     . PRO A 1 288 ? 170.890 138.969 272.087 1.00 54.23  ? 255 PRO A N     1 
ATOM   1803 C CA    . PRO A 1 288 ? 169.918 138.844 273.197 1.00 54.59  ? 255 PRO A CA    1 
ATOM   1804 C C     . PRO A 1 288 ? 169.777 140.102 274.070 1.00 56.92  ? 255 PRO A C     1 
ATOM   1805 O O     . PRO A 1 288 ? 168.731 140.281 274.696 1.00 56.37  ? 255 PRO A O     1 
ATOM   1806 C CB    . PRO A 1 288 ? 170.457 137.664 274.018 1.00 59.77  ? 255 PRO A CB    1 
ATOM   1807 C CG    . PRO A 1 288 ? 171.339 136.919 273.092 1.00 65.57  ? 255 PRO A CG    1 
ATOM   1808 C CD    . PRO A 1 288 ? 171.952 137.945 272.205 1.00 58.55  ? 255 PRO A CD    1 
ATOM   1809 N N     . VAL A 1 289 ? 170.818 140.953 274.133 1.00 52.70  ? 256 VAL A N     1 
ATOM   1810 C CA    . VAL A 1 289 ? 170.790 142.169 274.957 1.00 51.29  ? 256 VAL A CA    1 
ATOM   1811 C C     . VAL A 1 289 ? 170.368 143.382 274.112 1.00 51.59  ? 256 VAL A C     1 
ATOM   1812 O O     . VAL A 1 289 ? 169.437 144.076 274.510 1.00 50.38  ? 256 VAL A O     1 
ATOM   1813 C CB    . VAL A 1 289 ? 172.085 142.399 275.803 1.00 56.97  ? 256 VAL A CB    1 
ATOM   1814 C CG1   . VAL A 1 289 ? 173.322 141.780 275.160 1.00 58.05  ? 256 VAL A CG1   1 
ATOM   1815 C CG2   . VAL A 1 289 ? 172.308 143.868 276.167 1.00 55.09  ? 256 VAL A CG2   1 
ATOM   1816 N N     . ILE A 1 290 ? 171.008 143.612 272.949 1.00 46.74  ? 257 ILE A N     1 
ATOM   1817 C CA    . ILE A 1 290 ? 170.684 144.713 272.022 1.00 43.58  ? 257 ILE A CA    1 
ATOM   1818 C C     . ILE A 1 290 ? 169.260 144.551 271.423 1.00 44.93  ? 257 ILE A C     1 
ATOM   1819 O O     . ILE A 1 290 ? 168.559 145.547 271.208 1.00 42.36  ? 257 ILE A O     1 
ATOM   1820 C CB    . ILE A 1 290 ? 171.825 144.840 270.955 1.00 46.54  ? 257 ILE A CB    1 
ATOM   1821 C CG1   . ILE A 1 290 ? 172.785 145.919 271.342 1.00 46.64  ? 257 ILE A CG1   1 
ATOM   1822 C CG2   . ILE A 1 290 ? 171.397 144.974 269.498 1.00 46.41  ? 257 ILE A CG2   1 
ATOM   1823 C CD1   . ILE A 1 290 ? 173.887 145.323 271.912 1.00 63.18  ? 257 ILE A CD1   1 
ATOM   1824 N N     . GLY A 1 291 ? 168.865 143.304 271.192 1.00 41.26  ? 258 GLY A N     1 
ATOM   1825 C CA    . GLY A 1 291 ? 167.577 142.941 270.630 1.00 40.46  ? 258 GLY A CA    1 
ATOM   1826 C C     . GLY A 1 291 ? 166.727 142.112 271.566 1.00 45.30  ? 258 GLY A C     1 
ATOM   1827 O O     . GLY A 1 291 ? 166.062 141.176 271.113 1.00 46.20  ? 258 GLY A O     1 
ATOM   1828 N N     . LEU A 1 292 ? 166.721 142.465 272.881 1.00 41.83  ? 259 LEU A N     1 
ATOM   1829 C CA    . LEU A 1 292 ? 165.893 141.799 273.888 1.00 43.61  ? 259 LEU A CA    1 
ATOM   1830 C C     . LEU A 1 292 ? 164.412 141.913 273.514 1.00 46.83  ? 259 LEU A C     1 
ATOM   1831 O O     . LEU A 1 292 ? 163.668 140.952 273.718 1.00 49.41  ? 259 LEU A O     1 
ATOM   1832 C CB    . LEU A 1 292 ? 166.139 142.331 275.309 1.00 44.63  ? 259 LEU A CB    1 
ATOM   1833 C CG    . LEU A 1 292 ? 165.349 141.604 276.410 1.00 53.63  ? 259 LEU A CG    1 
ATOM   1834 C CD1   . LEU A 1 292 ? 166.049 140.332 276.868 1.00 57.35  ? 259 LEU A CD1   1 
ATOM   1835 C CD2   . LEU A 1 292 ? 165.030 142.516 277.561 1.00 58.45  ? 259 LEU A CD2   1 
ATOM   1836 N N     . ILE A 1 293 ? 164.000 143.050 272.914 1.00 39.35  ? 260 ILE A N     1 
ATOM   1837 C CA    . ILE A 1 293 ? 162.621 143.250 272.453 1.00 38.48  ? 260 ILE A CA    1 
ATOM   1838 C C     . ILE A 1 293 ? 162.295 142.205 271.381 1.00 46.41  ? 260 ILE A C     1 
ATOM   1839 O O     . ILE A 1 293 ? 161.263 141.538 271.490 1.00 48.32  ? 260 ILE A O     1 
ATOM   1840 C CB    . ILE A 1 293 ? 162.375 144.707 271.969 1.00 37.95  ? 260 ILE A CB    1 
ATOM   1841 C CG1   . ILE A 1 293 ? 162.472 145.757 273.135 1.00 37.30  ? 260 ILE A CG1   1 
ATOM   1842 C CG2   . ILE A 1 293 ? 161.085 144.848 271.176 1.00 37.25  ? 260 ILE A CG2   1 
ATOM   1843 C CD1   . ILE A 1 293 ? 161.885 145.398 274.509 1.00 43.90  ? 260 ILE A CD1   1 
ATOM   1844 N N     . TYR A 1 294 ? 163.211 142.010 270.395 1.00 42.91  ? 261 TYR A N     1 
ATOM   1845 C CA    . TYR A 1 294 ? 163.027 141.023 269.330 1.00 43.87  ? 261 TYR A CA    1 
ATOM   1846 C C     . TYR A 1 294 ? 162.910 139.625 269.934 1.00 51.26  ? 261 TYR A C     1 
ATOM   1847 O O     . TYR A 1 294 ? 162.036 138.858 269.535 1.00 51.44  ? 261 TYR A O     1 
ATOM   1848 C CB    . TYR A 1 294 ? 164.199 141.047 268.333 1.00 44.07  ? 261 TYR A CB    1 
ATOM   1849 C CG    . TYR A 1 294 ? 164.545 142.376 267.694 1.00 42.57  ? 261 TYR A CG    1 
ATOM   1850 C CD1   . TYR A 1 294 ? 163.547 143.250 267.265 1.00 43.35  ? 261 TYR A CD1   1 
ATOM   1851 C CD2   . TYR A 1 294 ? 165.867 142.705 267.403 1.00 42.13  ? 261 TYR A CD2   1 
ATOM   1852 C CE1   . TYR A 1 294 ? 163.860 144.449 266.627 1.00 41.67  ? 261 TYR A CE1   1 
ATOM   1853 C CE2   . TYR A 1 294 ? 166.192 143.901 266.767 1.00 40.82  ? 261 TYR A CE2   1 
ATOM   1854 C CZ    . TYR A 1 294 ? 165.185 144.763 266.370 1.00 47.96  ? 261 TYR A CZ    1 
ATOM   1855 O OH    . TYR A 1 294 ? 165.510 145.929 265.728 1.00 48.97  ? 261 TYR A OH    1 
ATOM   1856 N N     . LEU A 1 295 ? 163.786 139.317 270.918 1.00 50.68  ? 262 LEU A N     1 
ATOM   1857 C CA    . LEU A 1 295 ? 163.850 138.038 271.624 1.00 54.66  ? 262 LEU A CA    1 
ATOM   1858 C C     . LEU A 1 295 ? 162.578 137.752 272.405 1.00 61.35  ? 262 LEU A C     1 
ATOM   1859 O O     . LEU A 1 295 ? 162.046 136.653 272.292 1.00 64.74  ? 262 LEU A O     1 
ATOM   1860 C CB    . LEU A 1 295 ? 165.079 138.003 272.545 1.00 55.54  ? 262 LEU A CB    1 
ATOM   1861 C CG    . LEU A 1 295 ? 165.239 136.792 273.466 1.00 64.05  ? 262 LEU A CG    1 
ATOM   1862 C CD1   . LEU A 1 295 ? 165.628 135.554 272.683 1.00 66.76  ? 262 LEU A CD1   1 
ATOM   1863 C CD2   . LEU A 1 295 ? 166.270 137.077 274.538 1.00 67.38  ? 262 LEU A CD2   1 
ATOM   1864 N N     . VAL A 1 296 ? 162.085 138.741 273.172 1.00 56.37  ? 263 VAL A N     1 
ATOM   1865 C CA    . VAL A 1 296 ? 160.871 138.653 273.987 1.00 57.79  ? 263 VAL A CA    1 
ATOM   1866 C C     . VAL A 1 296 ? 159.613 138.478 273.092 1.00 62.24  ? 263 VAL A C     1 
ATOM   1867 O O     . VAL A 1 296 ? 158.691 137.768 273.493 1.00 63.99  ? 263 VAL A O     1 
ATOM   1868 C CB    . VAL A 1 296 ? 160.796 139.839 274.992 1.00 60.38  ? 263 VAL A CB    1 
ATOM   1869 C CG1   . VAL A 1 296 ? 159.404 140.035 275.572 1.00 61.50  ? 263 VAL A CG1   1 
ATOM   1870 C CG2   . VAL A 1 296 ? 161.811 139.648 276.117 1.00 61.67  ? 263 VAL A CG2   1 
ATOM   1871 N N     . GLU A 1 297 ? 159.617 139.044 271.864 1.00 57.33  ? 264 GLU A N     1 
ATOM   1872 C CA    . GLU A 1 297 ? 158.516 138.903 270.897 1.00 57.99  ? 264 GLU A CA    1 
ATOM   1873 C C     . GLU A 1 297 ? 158.366 137.458 270.390 1.00 66.25  ? 264 GLU A C     1 
ATOM   1874 O O     . GLU A 1 297 ? 157.247 136.941 270.422 1.00 68.98  ? 264 GLU A O     1 
ATOM   1875 C CB    . GLU A 1 297 ? 158.643 139.898 269.735 1.00 56.82  ? 264 GLU A CB    1 
ATOM   1876 C CG    . GLU A 1 297 ? 158.493 141.347 270.161 1.00 66.90  ? 264 GLU A CG    1 
ATOM   1877 C CD    . GLU A 1 297 ? 157.075 141.872 270.183 1.00 93.05  ? 264 GLU A CD    1 
ATOM   1878 O OE1   . GLU A 1 297 ? 156.430 141.856 269.112 1.00 94.07  ? 264 GLU A OE1   1 
ATOM   1879 O OE2   . GLU A 1 297 ? 156.624 142.340 271.253 1.00 85.93  ? 264 GLU A OE2   1 
ATOM   1880 N N     . VAL A 1 298 ? 159.476 136.797 269.949 1.00 63.66  ? 265 VAL A N     1 
ATOM   1881 C CA    . VAL A 1 298 ? 159.437 135.386 269.512 1.00 67.49  ? 265 VAL A CA    1 
ATOM   1882 C C     . VAL A 1 298 ? 159.147 134.476 270.691 1.00 72.81  ? 265 VAL A C     1 
ATOM   1883 O O     . VAL A 1 298 ? 158.272 133.619 270.585 1.00 75.70  ? 265 VAL A O     1 
ATOM   1884 C CB    . VAL A 1 298 ? 160.658 134.839 268.710 1.00 72.86  ? 265 VAL A CB    1 
ATOM   1885 C CG1   . VAL A 1 298 ? 160.414 134.885 267.209 1.00 73.38  ? 265 VAL A CG1   1 
ATOM   1886 C CG2   . VAL A 1 298 ? 161.981 135.500 269.101 1.00 70.06  ? 265 VAL A CG2   1 
ATOM   1887 N N     . LEU A 1 299 ? 159.888 134.671 271.808 1.00 67.25  ? 266 LEU A N     1 
ATOM   1888 C CA    . LEU A 1 299 ? 159.787 133.902 273.046 1.00 69.20  ? 266 LEU A CA    1 
ATOM   1889 C C     . LEU A 1 299 ? 158.364 133.888 273.639 1.00 72.23  ? 266 LEU A C     1 
ATOM   1890 O O     . LEU A 1 299 ? 157.892 132.815 274.014 1.00 75.66  ? 266 LEU A O     1 
ATOM   1891 C CB    . LEU A 1 299 ? 160.835 134.394 274.056 1.00 68.26  ? 266 LEU A CB    1 
ATOM   1892 C CG    . LEU A 1 299 ? 161.255 133.467 275.203 1.00 77.06  ? 266 LEU A CG    1 
ATOM   1893 C CD1   . LEU A 1 299 ? 161.660 132.069 274.707 1.00 80.92  ? 266 LEU A CD1   1 
ATOM   1894 C CD2   . LEU A 1 299 ? 162.395 134.087 275.994 1.00 77.21  ? 266 LEU A CD2   1 
ATOM   1895 N N     . SER A 1 300 ? 157.659 135.045 273.645 1.00 64.30  ? 267 SER A N     1 
ATOM   1896 C CA    . SER A 1 300 ? 156.272 135.141 274.140 1.00 64.67  ? 267 SER A CA    1 
ATOM   1897 C C     . SER A 1 300 ? 155.312 134.298 273.293 1.00 71.44  ? 267 SER A C     1 
ATOM   1898 O O     . SER A 1 300 ? 154.383 133.697 273.844 1.00 75.37  ? 267 SER A O     1 
ATOM   1899 C CB    . SER A 1 300 ? 155.801 136.591 274.210 1.00 62.26  ? 267 SER A CB    1 
ATOM   1900 O OG    . SER A 1 300 ? 155.871 137.233 272.948 1.00 61.58  ? 267 SER A OG    1 
ATOM   1901 N N     . VAL A 1 301 ? 155.555 134.229 271.962 1.00 65.72  ? 268 VAL A N     1 
ATOM   1902 C CA    . VAL A 1 301 ? 154.764 133.416 271.028 1.00 67.79  ? 268 VAL A CA    1 
ATOM   1903 C C     . VAL A 1 301 ? 155.054 131.931 271.306 1.00 75.14  ? 268 VAL A C     1 
ATOM   1904 O O     . VAL A 1 301 ? 154.103 131.171 271.491 1.00 78.34  ? 268 VAL A O     1 
ATOM   1905 C CB    . VAL A 1 301 ? 154.980 133.825 269.543 1.00 69.54  ? 268 VAL A CB    1 
ATOM   1906 C CG1   . VAL A 1 301 ? 154.430 132.780 268.581 1.00 72.76  ? 268 VAL A CG1   1 
ATOM   1907 C CG2   . VAL A 1 301 ? 154.355 135.184 269.256 1.00 66.74  ? 268 VAL A CG2   1 
ATOM   1908 N N     . ILE A 1 302 ? 156.358 131.537 271.404 1.00 70.67  ? 269 ILE A N     1 
ATOM   1909 C CA    . ILE A 1 302 ? 156.768 130.154 271.708 1.00 74.24  ? 269 ILE A CA    1 
ATOM   1910 C C     . ILE A 1 302 ? 156.099 129.673 273.008 1.00 80.17  ? 269 ILE A C     1 
ATOM   1911 O O     . ILE A 1 302 ? 155.550 128.579 273.025 1.00 83.57  ? 269 ILE A O     1 
ATOM   1912 C CB    . ILE A 1 302 ? 158.322 129.938 271.726 1.00 76.63  ? 269 ILE A CB    1 
ATOM   1913 C CG1   . ILE A 1 302 ? 159.041 130.469 270.445 1.00 74.55  ? 269 ILE A CG1   1 
ATOM   1914 C CG2   . ILE A 1 302 ? 158.703 128.468 272.001 1.00 81.72  ? 269 ILE A CG2   1 
ATOM   1915 C CD1   . ILE A 1 302 ? 158.512 129.992 269.021 1.00 85.77  ? 269 ILE A CD1   1 
ATOM   1916 N N     . ILE A 1 303 ? 156.107 130.512 274.068 1.00 74.86  ? 270 ILE A N     1 
ATOM   1917 C CA    . ILE A 1 303 ? 155.493 130.201 275.364 1.00 77.57  ? 270 ILE A CA    1 
ATOM   1918 C C     . ILE A 1 303 ? 153.952 130.119 275.230 1.00 83.17  ? 270 ILE A C     1 
ATOM   1919 O O     . ILE A 1 303 ? 153.377 129.122 275.677 1.00 88.10  ? 270 ILE A O     1 
ATOM   1920 C CB    . ILE A 1 303 ? 155.975 131.145 276.517 1.00 78.75  ? 270 ILE A CB    1 
ATOM   1921 C CG1   . ILE A 1 303 ? 157.524 131.136 276.649 1.00 77.47  ? 270 ILE A CG1   1 
ATOM   1922 C CG2   . ILE A 1 303 ? 155.339 130.745 277.857 1.00 83.73  ? 270 ILE A CG2   1 
ATOM   1923 C CD1   . ILE A 1 303 ? 158.148 132.332 277.401 1.00 79.13  ? 270 ILE A CD1   1 
ATOM   1924 N N     . GLN A 1 304 ? 153.298 131.117 274.581 1.00 74.87  ? 271 GLN A N     1 
ATOM   1925 C CA    . GLN A 1 304 ? 151.835 131.104 274.393 1.00 76.01  ? 271 GLN A CA    1 
ATOM   1926 C C     . GLN A 1 304 ? 151.329 129.916 273.600 1.00 81.81  ? 271 GLN A C     1 
ATOM   1927 O O     . GLN A 1 304 ? 150.412 129.251 274.064 1.00 85.87  ? 271 GLN A O     1 
ATOM   1928 C CB    . GLN A 1 304 ? 151.319 132.393 273.742 1.00 73.51  ? 271 GLN A CB    1 
ATOM   1929 C CG    . GLN A 1 304 ? 151.003 133.490 274.727 1.00 75.67  ? 271 GLN A CG    1 
ATOM   1930 C CD    . GLN A 1 304 ? 149.598 133.457 275.227 1.00 87.14  ? 271 GLN A CD    1 
ATOM   1931 O OE1   . GLN A 1 304 ? 149.358 133.069 276.365 1.00 87.66  ? 271 GLN A OE1   1 
ATOM   1932 N NE2   . GLN A 1 304 ? 148.650 133.935 274.420 1.00 75.44  ? 271 GLN A NE2   1 
ATOM   1933 N N     . VAL A 1 305 ? 151.906 129.663 272.405 1.00 76.55  ? 272 VAL A N     1 
ATOM   1934 C CA    . VAL A 1 305 ? 151.515 128.562 271.511 1.00 80.37  ? 272 VAL A CA    1 
ATOM   1935 C C     . VAL A 1 305 ? 151.750 127.183 272.168 1.00 88.85  ? 272 VAL A C     1 
ATOM   1936 O O     . VAL A 1 305 ? 150.865 126.337 272.093 1.00 93.19  ? 272 VAL A O     1 
ATOM   1937 C CB    . VAL A 1 305 ? 152.157 128.672 270.094 1.00 82.29  ? 272 VAL A CB    1 
ATOM   1938 C CG1   . VAL A 1 305 ? 151.681 127.546 269.177 1.00 87.01  ? 272 VAL A CG1   1 
ATOM   1939 C CG2   . VAL A 1 305 ? 151.854 130.023 269.452 1.00 77.79  ? 272 VAL A CG2   1 
ATOM   1940 N N     . THR A 1 306 ? 152.909 126.975 272.829 1.00 84.87  ? 273 THR A N     1 
ATOM   1941 C CA    . THR A 1 306 ? 153.243 125.711 273.499 1.00 89.63  ? 273 THR A CA    1 
ATOM   1942 C C     . THR A 1 306 ? 152.346 125.460 274.723 1.00 98.62  ? 273 THR A C     1 
ATOM   1943 O O     . THR A 1 306 ? 151.786 124.361 274.846 1.00 103.45 ? 273 THR A O     1 
ATOM   1944 C CB    . THR A 1 306 ? 154.748 125.622 273.824 1.00 91.89  ? 273 THR A CB    1 
ATOM   1945 O OG1   . THR A 1 306 ? 155.502 125.915 272.647 1.00 86.01  ? 273 THR A OG1   1 
ATOM   1946 C CG2   . THR A 1 306 ? 155.157 124.256 274.353 1.00 94.32  ? 273 THR A CG2   1 
ATOM   1947 N N     . TYR A 1 307 ? 152.211 126.471 275.616 1.00 93.50  ? 274 TYR A N     1 
ATOM   1948 C CA    . TYR A 1 307 ? 151.386 126.380 276.827 1.00 97.29  ? 274 TYR A CA    1 
ATOM   1949 C C     . TYR A 1 307 ? 149.895 126.117 276.499 1.00 104.41 ? 274 TYR A C     1 
ATOM   1950 O O     . TYR A 1 307 ? 149.284 125.250 277.128 1.00 108.78 ? 274 TYR A O     1 
ATOM   1951 C CB    . TYR A 1 307 ? 151.596 127.614 277.729 1.00 95.51  ? 274 TYR A CB    1 
ATOM   1952 C CG    . TYR A 1 307 ? 150.788 127.619 279.008 1.00 101.66 ? 274 TYR A CG    1 
ATOM   1953 C CD1   . TYR A 1 307 ? 151.188 126.871 280.112 1.00 108.00 ? 274 TYR A CD1   1 
ATOM   1954 C CD2   . TYR A 1 307 ? 149.651 128.408 279.133 1.00 102.52 ? 274 TYR A CD2   1 
ATOM   1955 C CE1   . TYR A 1 307 ? 150.449 126.876 281.295 1.00 113.55 ? 274 TYR A CE1   1 
ATOM   1956 C CE2   . TYR A 1 307 ? 148.909 128.429 280.312 1.00 107.83 ? 274 TYR A CE2   1 
ATOM   1957 C CZ    . TYR A 1 307 ? 149.308 127.656 281.389 1.00 120.96 ? 274 TYR A CZ    1 
ATOM   1958 O OH    . TYR A 1 307 ? 148.565 127.666 282.545 1.00 128.19 ? 274 TYR A OH    1 
ATOM   1959 N N     . PHE A 1 308 ? 149.350 126.821 275.476 1.00 98.33  ? 275 PHE A N     1 
ATOM   1960 C CA    . PHE A 1 308 ? 147.976 126.696 274.972 1.00 100.90 ? 275 PHE A CA    1 
ATOM   1961 C C     . PHE A 1 308 ? 147.660 125.256 274.572 1.00 111.12 ? 275 PHE A C     1 
ATOM   1962 O O     . PHE A 1 308 ? 146.577 124.761 274.889 1.00 115.99 ? 275 PHE A O     1 
ATOM   1963 C CB    . PHE A 1 308 ? 147.758 127.645 273.774 1.00 98.56  ? 275 PHE A CB    1 
ATOM   1964 C CG    . PHE A 1 308 ? 146.393 127.607 273.124 1.00 102.88 ? 275 PHE A CG    1 
ATOM   1965 C CD1   . PHE A 1 308 ? 145.370 128.437 273.567 1.00 105.42 ? 275 PHE A CD1   1 
ATOM   1966 C CD2   . PHE A 1 308 ? 146.141 126.768 272.043 1.00 107.83 ? 275 PHE A CD2   1 
ATOM   1967 C CE1   . PHE A 1 308 ? 144.115 128.413 272.957 1.00 108.88 ? 275 PHE A CE1   1 
ATOM   1968 C CE2   . PHE A 1 308 ? 144.881 126.736 271.441 1.00 113.28 ? 275 PHE A CE2   1 
ATOM   1969 C CZ    . PHE A 1 308 ? 143.879 127.562 271.899 1.00 111.12 ? 275 PHE A CZ    1 
ATOM   1970 N N     . LYS A 1 309 ? 148.599 124.598 273.868 1.00 107.76 ? 276 LYS A N     1 
ATOM   1971 C CA    . LYS A 1 309 ? 148.456 123.216 273.400 1.00 113.08 ? 276 LYS A CA    1 
ATOM   1972 C C     . LYS A 1 309 ? 148.650 122.192 274.520 1.00 122.12 ? 276 LYS A C     1 
ATOM   1973 O O     . LYS A 1 309 ? 147.932 121.202 274.549 1.00 127.84 ? 276 LYS A O     1 
ATOM   1974 C CB    . LYS A 1 309 ? 149.392 122.940 272.211 1.00 114.03 ? 276 LYS A CB    1 
ATOM   1975 C CG    . LYS A 1 309 ? 149.005 123.710 270.950 1.00 124.42 ? 276 LYS A CG    1 
ATOM   1976 C CD    . LYS A 1 309 ? 150.029 123.559 269.837 1.00 130.92 ? 276 LYS A CD    1 
ATOM   1977 C CE    . LYS A 1 309 ? 149.653 124.349 268.605 1.00 138.46 ? 276 LYS A CE    1 
ATOM   1978 N NZ    . LYS A 1 309 ? 148.621 123.660 267.784 1.00 152.00 ? 276 LYS A NZ    1 
ATOM   1979 N N     . ARG A 1 310 ? 149.598 122.441 275.446 1.00 117.58 ? 277 ARG A N     1 
ATOM   1980 C CA    . ARG A 1 310 ? 149.908 121.590 276.604 1.00 122.13 ? 277 ARG A CA    1 
ATOM   1981 C C     . ARG A 1 310 ? 148.757 121.558 277.614 1.00 129.96 ? 277 ARG A C     1 
ATOM   1982 O O     . ARG A 1 310 ? 148.612 120.580 278.349 1.00 136.23 ? 277 ARG A O     1 
ATOM   1983 C CB    . ARG A 1 310 ? 151.184 122.087 277.304 1.00 120.99 ? 277 ARG A CB    1 
ATOM   1984 C CG    . ARG A 1 310 ? 152.489 121.577 276.699 1.00 136.19 ? 277 ARG A CG    1 
ATOM   1985 C CD    . ARG A 1 310 ? 153.018 120.346 277.424 1.00 161.81 ? 277 ARG A CD    1 
ATOM   1986 N NE    . ARG A 1 310 ? 153.512 120.652 278.771 1.00 173.84 ? 277 ARG A NE    1 
ATOM   1987 C CZ    . ARG A 1 310 ? 153.660 119.753 279.741 1.00 187.12 ? 277 ARG A CZ    1 
ATOM   1988 N NH1   . ARG A 1 310 ? 154.114 120.123 280.931 1.00 180.79 ? 277 ARG A NH1   1 
ATOM   1989 N NH2   . ARG A 1 310 ? 153.348 118.480 279.531 1.00 179.44 ? 277 ARG A NH2   1 
ATOM   1990 N N     . THR A 1 311 ? 147.953 122.633 277.660 1.00 123.20 ? 278 THR A N     1 
ATOM   1991 C CA    . THR A 1 311 ? 146.801 122.771 278.556 1.00 126.41 ? 278 THR A CA    1 
ATOM   1992 C C     . THR A 1 311 ? 145.493 122.625 277.755 1.00 131.90 ? 278 THR A C     1 
ATOM   1993 O O     . THR A 1 311 ? 145.522 122.223 276.590 1.00 131.13 ? 278 THR A O     1 
ATOM   1994 C CB    . THR A 1 311 ? 146.887 124.102 279.341 1.00 131.46 ? 278 THR A CB    1 
ATOM   1995 O OG1   . THR A 1 311 ? 146.922 125.194 278.422 1.00 124.75 ? 278 THR A OG1   1 
ATOM   1996 C CG2   . THR A 1 311 ? 148.095 124.167 280.274 1.00 129.01 ? 278 THR A CG2   1 
ATOM   1997 N N     . GLY A 1 312 ? 144.365 122.951 278.377 1.00 131.00 ? 279 GLY A N     1 
ATOM   1998 C CA    . GLY A 1 312 ? 143.062 122.876 277.729 1.00 133.76 ? 279 GLY A CA    1 
ATOM   1999 C C     . GLY A 1 312 ? 142.688 124.148 276.993 1.00 133.00 ? 279 GLY A C     1 
ATOM   2000 O O     . GLY A 1 312 ? 141.504 124.495 276.918 1.00 135.14 ? 279 GLY A O     1 
ATOM   2001 N N     . GLY A 1 313 ? 143.698 124.828 276.450 1.00 122.69 ? 280 GLY A N     1 
ATOM   2002 C CA    . GLY A 1 313 ? 143.544 126.085 275.732 1.00 116.97 ? 280 GLY A CA    1 
ATOM   2003 C C     . GLY A 1 313 ? 143.794 127.301 276.601 1.00 117.08 ? 280 GLY A C     1 
ATOM   2004 O O     . GLY A 1 313 ? 143.403 128.410 276.230 1.00 113.66 ? 280 GLY A O     1 
ATOM   2005 N N     . LYS A 1 314 ? 144.457 127.103 277.762 1.00 114.38 ? 281 LYS A N     1 
ATOM   2006 C CA    . LYS A 1 314 ? 144.790 128.155 278.735 1.00 111.50 ? 281 LYS A CA    1 
ATOM   2007 C C     . LYS A 1 314 ? 145.788 129.176 278.174 1.00 108.47 ? 281 LYS A C     1 
ATOM   2008 O O     . LYS A 1 314 ? 146.560 128.855 277.269 1.00 105.38 ? 281 LYS A O     1 
ATOM   2009 C CB    . LYS A 1 314 ? 145.331 127.551 280.046 1.00 117.45 ? 281 LYS A CB    1 
ATOM   2010 C CG    . LYS A 1 314 ? 144.348 126.659 280.799 1.00 138.53 ? 281 LYS A CG    1 
ATOM   2011 C CD    . LYS A 1 314 ? 144.994 126.075 282.044 1.00 151.58 ? 281 LYS A CD    1 
ATOM   2012 C CE    . LYS A 1 314 ? 144.069 125.151 282.790 1.00 170.31 ? 281 LYS A CE    1 
ATOM   2013 N NZ    . LYS A 1 314 ? 144.696 124.639 284.036 1.00 179.30 ? 281 LYS A NZ    1 
ATOM   2014 N N     . ARG A 1 315 ? 145.769 130.406 278.717 1.00 102.77 ? 282 ARG A N     1 
ATOM   2015 C CA    . ARG A 1 315 ? 146.654 131.492 278.285 1.00 96.25  ? 282 ARG A CA    1 
ATOM   2016 C C     . ARG A 1 315 ? 147.660 131.895 279.356 1.00 98.78  ? 282 ARG A C     1 
ATOM   2017 O O     . ARG A 1 315 ? 147.301 132.057 280.521 1.00 101.07 ? 282 ARG A O     1 
ATOM   2018 C CB    . ARG A 1 315 ? 145.833 132.709 277.829 1.00 93.56  ? 282 ARG A CB    1 
ATOM   2019 C CG    . ARG A 1 315 ? 145.588 132.744 276.323 1.00 101.79 ? 282 ARG A CG    1 
ATOM   2020 C CD    . ARG A 1 315 ? 144.211 133.269 275.945 1.00 114.81 ? 282 ARG A CD    1 
ATOM   2021 N NE    . ARG A 1 315 ? 144.064 134.699 276.218 1.00 126.57 ? 282 ARG A NE    1 
ATOM   2022 C CZ    . ARG A 1 315 ? 143.302 135.206 277.182 1.00 149.02 ? 282 ARG A CZ    1 
ATOM   2023 N NH1   . ARG A 1 315 ? 143.234 136.520 277.360 1.00 133.83 ? 282 ARG A NH1   1 
ATOM   2024 N NH2   . ARG A 1 315 ? 142.593 134.405 277.970 1.00 144.90 ? 282 ARG A NH2   1 
ATOM   2025 N N     . ILE A 1 316 ? 148.920 132.066 278.949 1.00 92.40  ? 283 ILE A N     1 
ATOM   2026 C CA    . ILE A 1 316 ? 150.013 132.496 279.826 1.00 90.94  ? 283 ILE A CA    1 
ATOM   2027 C C     . ILE A 1 316 ? 150.188 134.032 279.759 1.00 90.64  ? 283 ILE A C     1 
ATOM   2028 O O     . ILE A 1 316 ? 150.737 134.634 280.681 1.00 90.34  ? 283 ILE A O     1 
ATOM   2029 C CB    . ILE A 1 316 ? 151.307 131.682 279.551 1.00 93.29  ? 283 ILE A CB    1 
ATOM   2030 C CG1   . ILE A 1 316 ? 152.186 131.571 280.805 1.00 95.40  ? 283 ILE A CG1   1 
ATOM   2031 C CG2   . ILE A 1 316 ? 152.081 132.186 278.343 1.00 88.75  ? 283 ILE A CG2   1 
ATOM   2032 C CD1   . ILE A 1 316 ? 151.784 130.416 281.745 1.00 109.45 ? 283 ILE A CD1   1 
ATOM   2033 N N     . PHE A 1 317 ? 149.697 134.647 278.665 1.00 84.00  ? 284 PHE A N     1 
ATOM   2034 C CA    . PHE A 1 317 ? 149.658 136.087 278.409 1.00 79.77  ? 284 PHE A CA    1 
ATOM   2035 C C     . PHE A 1 317 ? 148.251 136.422 277.899 1.00 83.83  ? 284 PHE A C     1 
ATOM   2036 O O     . PHE A 1 317 ? 147.557 135.525 277.407 1.00 85.66  ? 284 PHE A O     1 
ATOM   2037 C CB    . PHE A 1 317 ? 150.704 136.498 277.354 1.00 76.91  ? 284 PHE A CB    1 
ATOM   2038 C CG    . PHE A 1 317 ? 152.151 136.266 277.719 1.00 77.33  ? 284 PHE A CG    1 
ATOM   2039 C CD1   . PHE A 1 317 ? 152.749 136.980 278.750 1.00 80.58  ? 284 PHE A CD1   1 
ATOM   2040 C CD2   . PHE A 1 317 ? 152.938 135.391 276.981 1.00 79.08  ? 284 PHE A CD2   1 
ATOM   2041 C CE1   . PHE A 1 317 ? 154.096 136.773 279.078 1.00 81.00  ? 284 PHE A CE1   1 
ATOM   2042 C CE2   . PHE A 1 317 ? 154.279 135.177 277.312 1.00 81.49  ? 284 PHE A CE2   1 
ATOM   2043 C CZ    . PHE A 1 317 ? 154.854 135.877 278.352 1.00 79.36  ? 284 PHE A CZ    1 
ATOM   2044 N N     . LYS A 1 318 ? 147.829 137.705 277.994 1.00 78.19  ? 285 LYS A N     1 
ATOM   2045 C CA    . LYS A 1 318 ? 146.510 138.135 277.494 1.00 78.87  ? 285 LYS A CA    1 
ATOM   2046 C C     . LYS A 1 318 ? 146.434 137.871 275.982 1.00 80.59  ? 285 LYS A C     1 
ATOM   2047 O O     . LYS A 1 318 ? 145.428 137.350 275.500 1.00 81.10  ? 285 LYS A O     1 
ATOM   2048 C CB    . LYS A 1 318 ? 146.223 139.609 277.843 1.00 79.03  ? 285 LYS A CB    1 
ATOM   2049 C CG    . LYS A 1 318 ? 146.017 139.833 279.339 1.00 90.34  ? 285 LYS A CG    1 
ATOM   2050 C CD    . LYS A 1 318 ? 145.464 141.203 279.670 1.00 97.85  ? 285 LYS A CD    1 
ATOM   2051 C CE    . LYS A 1 318 ? 145.233 141.356 281.154 1.00 111.34 ? 285 LYS A CE    1 
ATOM   2052 N NZ    . LYS A 1 318 ? 144.524 142.621 281.480 1.00 123.02 ? 285 LYS A NZ    1 
ATOM   2053 N N     . MET A 1 319 ? 147.558 138.148 275.267 1.00 74.64  ? 286 MET A N     1 
ATOM   2054 C CA    . MET A 1 319 ? 147.768 137.911 273.835 1.00 73.42  ? 286 MET A CA    1 
ATOM   2055 C C     . MET A 1 319 ? 149.266 137.944 273.510 1.00 72.84  ? 286 MET A C     1 
ATOM   2056 O O     . MET A 1 319 ? 150.007 138.702 274.137 1.00 70.33  ? 286 MET A O     1 
ATOM   2057 C CB    . MET A 1 319 ? 147.023 138.957 272.996 1.00 75.01  ? 286 MET A CB    1 
ATOM   2058 C CG    . MET A 1 319 ? 146.803 138.549 271.563 1.00 80.11  ? 286 MET A CG    1 
ATOM   2059 S SD    . MET A 1 319 ? 145.821 139.789 270.696 1.00 85.37  ? 286 MET A SD    1 
ATOM   2060 C CE    . MET A 1 319 ? 145.627 138.992 269.113 1.00 84.20  ? 286 MET A CE    1 
ATOM   2061 N N     . ALA A 1 320 ? 149.703 137.134 272.526 1.00 68.81  ? 287 ALA A N     1 
ATOM   2062 C CA    . ALA A 1 320 ? 151.084 137.111 272.044 1.00 65.90  ? 287 ALA A CA    1 
ATOM   2063 C C     . ALA A 1 320 ? 151.159 137.621 270.590 1.00 69.39  ? 287 ALA A C     1 
ATOM   2064 O O     . ALA A 1 320 ? 150.221 137.365 269.830 1.00 71.67  ? 287 ALA A O     1 
ATOM   2065 C CB    . ALA A 1 320 ? 151.676 135.723 272.140 1.00 68.77  ? 287 ALA A CB    1 
ATOM   2066 N N     . PRO A 1 321 ? 152.230 138.348 270.164 1.00 62.16  ? 288 PRO A N     1 
ATOM   2067 C CA    . PRO A 1 321 ? 153.428 138.757 270.917 1.00 59.57  ? 288 PRO A CA    1 
ATOM   2068 C C     . PRO A 1 321 ? 153.096 139.678 272.094 1.00 63.77  ? 288 PRO A C     1 
ATOM   2069 O O     . PRO A 1 321 ? 151.981 140.198 272.181 1.00 64.11  ? 288 PRO A O     1 
ATOM   2070 C CB    . PRO A 1 321 ? 154.302 139.427 269.843 1.00 58.21  ? 288 PRO A CB    1 
ATOM   2071 C CG    . PRO A 1 321 ? 153.778 138.927 268.534 1.00 63.75  ? 288 PRO A CG    1 
ATOM   2072 C CD    . PRO A 1 321 ? 152.314 138.817 268.770 1.00 61.91  ? 288 PRO A CD    1 
ATOM   2073 N N     . ILE A 1 322 ? 154.067 139.865 273.004 1.00 60.00  ? 289 ILE A N     1 
ATOM   2074 C CA    . ILE A 1 322 ? 153.949 140.635 274.243 1.00 59.69  ? 289 ILE A CA    1 
ATOM   2075 C C     . ILE A 1 322 ? 153.454 142.090 274.039 1.00 61.55  ? 289 ILE A C     1 
ATOM   2076 O O     . ILE A 1 322 ? 152.905 142.643 274.988 1.00 63.34  ? 289 ILE A O     1 
ATOM   2077 C CB    . ILE A 1 322 ? 155.270 140.561 275.060 1.00 62.21  ? 289 ILE A CB    1 
ATOM   2078 C CG1   . ILE A 1 322 ? 154.996 140.712 276.580 1.00 65.23  ? 289 ILE A CG1   1 
ATOM   2079 C CG2   . ILE A 1 322 ? 156.335 141.535 274.538 1.00 58.84  ? 289 ILE A CG2   1 
ATOM   2080 C CD1   . ILE A 1 322 ? 156.125 140.242 277.537 1.00 75.16  ? 289 ILE A CD1   1 
ATOM   2081 N N     . HIS A 1 323 ? 153.610 142.703 272.837 1.00 54.70  ? 290 HIS A N     1 
ATOM   2082 C CA    . HIS A 1 323 ? 153.108 144.072 272.634 1.00 52.78  ? 290 HIS A CA    1 
ATOM   2083 C C     . HIS A 1 323 ? 151.572 144.129 272.737 1.00 60.60  ? 290 HIS A C     1 
ATOM   2084 O O     . HIS A 1 323 ? 151.042 145.089 273.299 1.00 61.14  ? 290 HIS A O     1 
ATOM   2085 C CB    . HIS A 1 323 ? 153.640 144.736 271.349 1.00 50.34  ? 290 HIS A CB    1 
ATOM   2086 C CG    . HIS A 1 323 ? 153.240 144.065 270.074 1.00 54.36  ? 290 HIS A CG    1 
ATOM   2087 N ND1   . HIS A 1 323 ? 154.109 143.246 269.399 1.00 55.52  ? 290 HIS A ND1   1 
ATOM   2088 C CD2   . HIS A 1 323 ? 152.089 144.155 269.369 1.00 57.85  ? 290 HIS A CD2   1 
ATOM   2089 C CE1   . HIS A 1 323 ? 153.463 142.842 268.320 1.00 56.60  ? 290 HIS A CE1   1 
ATOM   2090 N NE2   . HIS A 1 323 ? 152.244 143.363 268.258 1.00 58.34  ? 290 HIS A NE2   1 
ATOM   2091 N N     . HIS A 1 324 ? 150.876 143.067 272.257 1.00 59.19  ? 291 HIS A N     1 
ATOM   2092 C CA    . HIS A 1 324 ? 149.423 142.917 272.349 1.00 62.38  ? 291 HIS A CA    1 
ATOM   2093 C C     . HIS A 1 324 ? 149.007 142.667 273.798 1.00 68.06  ? 291 HIS A C     1 
ATOM   2094 O O     . HIS A 1 324 ? 147.905 143.042 274.172 1.00 70.78  ? 291 HIS A O     1 
ATOM   2095 C CB    . HIS A 1 324 ? 148.914 141.764 271.470 1.00 66.07  ? 291 HIS A CB    1 
ATOM   2096 C CG    . HIS A 1 324 ? 149.163 141.923 270.001 1.00 68.60  ? 291 HIS A CG    1 
ATOM   2097 N ND1   . HIS A 1 324 ? 148.688 143.019 269.298 1.00 69.67  ? 291 HIS A ND1   1 
ATOM   2098 C CD2   . HIS A 1 324 ? 149.771 141.079 269.136 1.00 70.42  ? 291 HIS A CD2   1 
ATOM   2099 C CE1   . HIS A 1 324 ? 149.058 142.822 268.042 1.00 68.66  ? 291 HIS A CE1   1 
ATOM   2100 N NE2   . HIS A 1 324 ? 149.715 141.668 267.898 1.00 69.38  ? 291 HIS A NE2   1 
ATOM   2101 N N     . HIS A 1 325 ? 149.878 142.031 274.607 1.00 64.27  ? 292 HIS A N     1 
ATOM   2102 C CA    . HIS A 1 325 ? 149.628 141.766 276.025 1.00 67.05  ? 292 HIS A CA    1 
ATOM   2103 C C     . HIS A 1 325 ? 149.449 143.079 276.804 1.00 69.89  ? 292 HIS A C     1 
ATOM   2104 O O     . HIS A 1 325 ? 148.464 143.215 277.524 1.00 72.81  ? 292 HIS A O     1 
ATOM   2105 C CB    . HIS A 1 325 ? 150.747 140.896 276.642 1.00 68.41  ? 292 HIS A CB    1 
ATOM   2106 C CG    . HIS A 1 325 ? 150.661 140.765 278.134 1.00 75.17  ? 292 HIS A CG    1 
ATOM   2107 N ND1   . HIS A 1 325 ? 149.760 139.898 278.732 1.00 81.72  ? 292 HIS A ND1   1 
ATOM   2108 C CD2   . HIS A 1 325 ? 151.353 141.411 279.101 1.00 76.56  ? 292 HIS A CD2   1 
ATOM   2109 C CE1   . HIS A 1 325 ? 149.930 140.048 280.036 1.00 83.32  ? 292 HIS A CE1   1 
ATOM   2110 N NE2   . HIS A 1 325 ? 150.871 140.952 280.307 1.00 80.78  ? 292 HIS A NE2   1 
ATOM   2111 N N     . PHE A 1 326 ? 150.384 144.039 276.641 1.00 62.59  ? 293 PHE A N     1 
ATOM   2112 C CA    . PHE A 1 326 ? 150.346 145.342 277.311 1.00 61.63  ? 293 PHE A CA    1 
ATOM   2113 C C     . PHE A 1 326 ? 149.154 146.187 276.877 1.00 66.41  ? 293 PHE A C     1 
ATOM   2114 O O     . PHE A 1 326 ? 148.539 146.848 277.715 1.00 67.99  ? 293 PHE A O     1 
ATOM   2115 C CB    . PHE A 1 326 ? 151.669 146.105 277.133 1.00 59.19  ? 293 PHE A CB    1 
ATOM   2116 C CG    . PHE A 1 326 ? 152.846 145.423 277.787 1.00 60.39  ? 293 PHE A CG    1 
ATOM   2117 C CD1   . PHE A 1 326 ? 152.936 145.329 279.172 1.00 66.13  ? 293 PHE A CD1   1 
ATOM   2118 C CD2   . PHE A 1 326 ? 153.868 144.879 277.019 1.00 60.17  ? 293 PHE A CD2   1 
ATOM   2119 C CE1   . PHE A 1 326 ? 154.019 144.686 279.775 1.00 67.66  ? 293 PHE A CE1   1 
ATOM   2120 C CE2   . PHE A 1 326 ? 154.955 144.239 277.623 1.00 63.42  ? 293 PHE A CE2   1 
ATOM   2121 C CZ    . PHE A 1 326 ? 155.028 144.154 278.997 1.00 64.38  ? 293 PHE A CZ    1 
ATOM   2122 N N     . GLU A 1 327 ? 148.808 146.141 275.577 1.00 61.71  ? 294 GLU A N     1 
ATOM   2123 C CA    . GLU A 1 327 ? 147.657 146.851 275.028 1.00 62.87  ? 294 GLU A CA    1 
ATOM   2124 C C     . GLU A 1 327 ? 146.386 146.389 275.763 1.00 71.80  ? 294 GLU A C     1 
ATOM   2125 O O     . GLU A 1 327 ? 145.573 147.222 276.182 1.00 73.51  ? 294 GLU A O     1 
ATOM   2126 C CB    . GLU A 1 327 ? 147.524 146.557 273.535 1.00 63.25  ? 294 GLU A CB    1 
ATOM   2127 C CG    . GLU A 1 327 ? 148.424 147.385 272.648 1.00 71.98  ? 294 GLU A CG    1 
ATOM   2128 C CD    . GLU A 1 327 ? 147.943 147.354 271.214 1.00 104.80 ? 294 GLU A CD    1 
ATOM   2129 O OE1   . GLU A 1 327 ? 148.137 146.313 270.545 1.00 103.08 ? 294 GLU A OE1   1 
ATOM   2130 O OE2   . GLU A 1 327 ? 147.306 148.343 270.782 1.00 106.52 ? 294 GLU A OE2   1 
ATOM   2131 N N     . LEU A 1 328 ? 146.263 145.058 275.970 1.00 70.23  ? 295 LEU A N     1 
ATOM   2132 C CA    . LEU A 1 328 ? 145.155 144.432 276.680 1.00 74.73  ? 295 LEU A CA    1 
ATOM   2133 C C     . LEU A 1 328 ? 145.219 144.683 278.191 1.00 81.65  ? 295 LEU A C     1 
ATOM   2134 O O     . LEU A 1 328 ? 144.229 144.450 278.889 1.00 85.67  ? 295 LEU A O     1 
ATOM   2135 C CB    . LEU A 1 328 ? 145.049 142.938 276.343 1.00 76.52  ? 295 LEU A CB    1 
ATOM   2136 C CG    . LEU A 1 328 ? 144.631 142.577 274.907 1.00 80.61  ? 295 LEU A CG    1 
ATOM   2137 C CD1   . LEU A 1 328 ? 144.584 141.085 274.723 1.00 82.82  ? 295 LEU A CD1   1 
ATOM   2138 C CD2   . LEU A 1 328 ? 143.273 143.164 274.543 1.00 85.07  ? 295 LEU A CD2   1 
ATOM   2139 N N     . CYS A 1 329 ? 146.364 145.209 278.683 1.00 76.39  ? 296 CYS A N     1 
ATOM   2140 C CA    . CYS A 1 329 ? 146.568 145.601 280.083 1.00 78.80  ? 296 CYS A CA    1 
ATOM   2141 C C     . CYS A 1 329 ? 146.110 147.066 280.287 1.00 81.54  ? 296 CYS A C     1 
ATOM   2142 O O     . CYS A 1 329 ? 146.014 147.535 281.425 1.00 83.77  ? 296 CYS A O     1 
ATOM   2143 C CB    . CYS A 1 329 ? 148.024 145.404 280.502 1.00 77.44  ? 296 CYS A CB    1 
ATOM   2144 S SG    . CYS A 1 329 ? 148.526 143.670 280.670 1.00 83.21  ? 296 CYS A SG    1 
ATOM   2145 N N     . GLY A 1 330 ? 145.821 147.755 279.182 1.00 74.39  ? 297 GLY A N     1 
ATOM   2146 C CA    . GLY A 1 330 ? 145.364 149.138 279.186 1.00 74.04  ? 297 GLY A CA    1 
ATOM   2147 C C     . GLY A 1 330 ? 146.379 150.144 278.675 1.00 73.39  ? 297 GLY A C     1 
ATOM   2148 O O     . GLY A 1 330 ? 146.125 151.351 278.733 1.00 74.12  ? 297 GLY A O     1 
ATOM   2149 N N     . TRP A 1 331 ? 147.533 149.663 278.165 1.00 64.45  ? 298 TRP A N     1 
ATOM   2150 C CA    . TRP A 1 331 ? 148.587 150.515 277.620 1.00 59.48  ? 298 TRP A CA    1 
ATOM   2151 C C     . TRP A 1 331 ? 148.200 151.037 276.253 1.00 61.69  ? 298 TRP A C     1 
ATOM   2152 O O     . TRP A 1 331 ? 147.725 150.289 275.403 1.00 61.10  ? 298 TRP A O     1 
ATOM   2153 C CB    . TRP A 1 331 ? 149.923 149.761 277.486 1.00 55.05  ? 298 TRP A CB    1 
ATOM   2154 C CG    . TRP A 1 331 ? 150.625 149.389 278.760 1.00 57.10  ? 298 TRP A CG    1 
ATOM   2155 C CD1   . TRP A 1 331 ? 150.053 149.017 279.941 1.00 64.08  ? 298 TRP A CD1   1 
ATOM   2156 C CD2   . TRP A 1 331 ? 152.040 149.216 278.928 1.00 54.63  ? 298 TRP A CD2   1 
ATOM   2157 N NE1   . TRP A 1 331 ? 151.026 148.693 280.857 1.00 64.13  ? 298 TRP A NE1   1 
ATOM   2158 C CE2   . TRP A 1 331 ? 152.256 148.800 280.261 1.00 61.45  ? 298 TRP A CE2   1 
ATOM   2159 C CE3   . TRP A 1 331 ? 153.153 149.394 278.086 1.00 51.78  ? 298 TRP A CE3   1 
ATOM   2160 C CZ2   . TRP A 1 331 ? 153.536 148.568 280.775 1.00 59.69  ? 298 TRP A CZ2   1 
ATOM   2161 C CZ3   . TRP A 1 331 ? 154.418 149.157 278.595 1.00 52.37  ? 298 TRP A CZ3   1 
ATOM   2162 C CH2   . TRP A 1 331 ? 154.601 148.750 279.924 1.00 55.93  ? 298 TRP A CH2   1 
ATOM   2163 N N     . SER A 1 332 ? 148.470 152.315 276.033 1.00 58.27  ? 299 SER A N     1 
ATOM   2164 C CA    . SER A 1 332 ? 148.276 153.021 274.771 1.00 57.24  ? 299 SER A CA    1 
ATOM   2165 C C     . SER A 1 332 ? 149.239 152.442 273.720 1.00 59.70  ? 299 SER A C     1 
ATOM   2166 O O     . SER A 1 332 ? 150.339 151.987 274.071 1.00 57.20  ? 299 SER A O     1 
ATOM   2167 C CB    . SER A 1 332 ? 148.609 154.499 274.960 1.00 59.86  ? 299 SER A CB    1 
ATOM   2168 O OG    . SER A 1 332 ? 148.553 154.868 276.330 1.00 71.84  ? 299 SER A OG    1 
ATOM   2169 N N     . GLU A 1 333 ? 148.837 152.492 272.431 1.00 56.33  ? 300 GLU A N     1 
ATOM   2170 C CA    . GLU A 1 333 ? 149.648 152.062 271.284 1.00 53.30  ? 300 GLU A CA    1 
ATOM   2171 C C     . GLU A 1 333 ? 151.012 152.778 271.370 1.00 53.12  ? 300 GLU A C     1 
ATOM   2172 O O     . GLU A 1 333 ? 152.044 152.128 271.272 1.00 50.92  ? 300 GLU A O     1 
ATOM   2173 C CB    . GLU A 1 333 ? 148.909 152.412 269.973 1.00 55.67  ? 300 GLU A CB    1 
ATOM   2174 C CG    . GLU A 1 333 ? 149.437 151.729 268.720 1.00 67.95  ? 300 GLU A CG    1 
ATOM   2175 C CD    . GLU A 1 333 ? 148.426 151.422 267.626 1.00 98.77  ? 300 GLU A CD    1 
ATOM   2176 O OE1   . GLU A 1 333 ? 147.239 151.798 267.771 1.00 109.91 ? 300 GLU A OE1   1 
ATOM   2177 O OE2   . GLU A 1 333 ? 148.822 150.782 266.624 1.00 89.05  ? 300 GLU A OE2   1 
ATOM   2178 N N     . THR A 1 334 ? 150.987 154.098 271.679 1.00 49.39  ? 301 THR A N     1 
ATOM   2179 C CA    . THR A 1 334 ? 152.134 155.008 271.858 1.00 46.05  ? 301 THR A CA    1 
ATOM   2180 C C     . THR A 1 334 ? 152.989 154.672 273.084 1.00 47.45  ? 301 THR A C     1 
ATOM   2181 O O     . THR A 1 334 ? 154.205 154.792 272.996 1.00 45.74  ? 301 THR A O     1 
ATOM   2182 C CB    . THR A 1 334 ? 151.668 156.467 271.863 1.00 54.28  ? 301 THR A CB    1 
ATOM   2183 O OG1   . THR A 1 334 ? 150.399 156.546 272.529 1.00 60.89  ? 301 THR A OG1   1 
ATOM   2184 C CG2   . THR A 1 334 ? 151.530 157.022 270.460 1.00 49.95  ? 301 THR A CG2   1 
ATOM   2185 N N     . ARG A 1 335 ? 152.372 154.244 274.209 1.00 45.41  ? 302 ARG A N     1 
ATOM   2186 C CA    . ARG A 1 335 ? 153.076 153.810 275.427 1.00 45.39  ? 302 ARG A CA    1 
ATOM   2187 C C     . ARG A 1 335 ? 153.964 152.625 275.116 1.00 49.35  ? 302 ARG A C     1 
ATOM   2188 O O     . ARG A 1 335 ? 155.128 152.617 275.513 1.00 48.58  ? 302 ARG A O     1 
ATOM   2189 C CB    . ARG A 1 335 ? 152.087 153.329 276.486 1.00 47.01  ? 302 ARG A CB    1 
ATOM   2190 C CG    . ARG A 1 335 ? 151.727 154.368 277.477 1.00 55.10  ? 302 ARG A CG    1 
ATOM   2191 C CD    . ARG A 1 335 ? 152.631 154.355 278.687 1.00 53.30  ? 302 ARG A CD    1 
ATOM   2192 N NE    . ARG A 1 335 ? 153.185 155.687 278.928 1.00 59.52  ? 302 ARG A NE    1 
ATOM   2193 C CZ    . ARG A 1 335 ? 152.466 156.790 279.117 1.00 66.63  ? 302 ARG A CZ    1 
ATOM   2194 N NH1   . ARG A 1 335 ? 153.069 157.954 279.315 1.00 62.79  ? 302 ARG A NH1   1 
ATOM   2195 N NH2   . ARG A 1 335 ? 151.137 156.741 279.091 1.00 34.92  ? 302 ARG A NH2   1 
ATOM   2196 N N     . VAL A 1 336 ? 153.393 151.606 274.432 1.00 46.29  ? 303 VAL A N     1 
ATOM   2197 C CA    . VAL A 1 336 ? 154.091 150.389 274.050 1.00 45.77  ? 303 VAL A CA    1 
ATOM   2198 C C     . VAL A 1 336 ? 155.295 150.760 273.172 1.00 48.74  ? 303 VAL A C     1 
ATOM   2199 O O     . VAL A 1 336 ? 156.413 150.332 273.476 1.00 48.20  ? 303 VAL A O     1 
ATOM   2200 C CB    . VAL A 1 336 ? 153.158 149.325 273.407 1.00 50.93  ? 303 VAL A CB    1 
ATOM   2201 C CG1   . VAL A 1 336 ? 153.936 148.057 273.052 1.00 50.21  ? 303 VAL A CG1   1 
ATOM   2202 C CG2   . VAL A 1 336 ? 151.981 148.989 274.327 1.00 53.64  ? 303 VAL A CG2   1 
ATOM   2203 N N     . VAL A 1 337 ? 155.083 151.627 272.155 1.00 44.11  ? 304 VAL A N     1 
ATOM   2204 C CA    . VAL A 1 337 ? 156.151 152.094 271.257 1.00 41.01  ? 304 VAL A CA    1 
ATOM   2205 C C     . VAL A 1 337 ? 157.261 152.809 272.048 1.00 42.41  ? 304 VAL A C     1 
ATOM   2206 O O     . VAL A 1 337 ? 158.436 152.488 271.856 1.00 41.83  ? 304 VAL A O     1 
ATOM   2207 C CB    . VAL A 1 337 ? 155.611 152.929 270.065 1.00 44.30  ? 304 VAL A CB    1 
ATOM   2208 C CG1   . VAL A 1 337 ? 156.738 153.364 269.133 1.00 42.08  ? 304 VAL A CG1   1 
ATOM   2209 C CG2   . VAL A 1 337 ? 154.572 152.137 269.283 1.00 45.72  ? 304 VAL A CG2   1 
ATOM   2210 N N     . ALA A 1 338 ? 156.887 153.695 272.985 1.00 37.90  ? 305 ALA A N     1 
ATOM   2211 C CA    . ALA A 1 338 ? 157.850 154.428 273.810 1.00 36.93  ? 305 ALA A CA    1 
ATOM   2212 C C     . ALA A 1 338 ? 158.627 153.538 274.794 1.00 40.95  ? 305 ALA A C     1 
ATOM   2213 O O     . ALA A 1 338 ? 159.853 153.636 274.846 1.00 39.72  ? 305 ALA A O     1 
ATOM   2214 C CB    . ALA A 1 338 ? 157.168 155.579 274.539 1.00 39.11  ? 305 ALA A CB    1 
ATOM   2215 N N     . VAL A 1 339 ? 157.928 152.662 275.543 1.00 39.12  ? 306 VAL A N     1 
ATOM   2216 C CA    . VAL A 1 339 ? 158.528 151.768 276.542 1.00 40.14  ? 306 VAL A CA    1 
ATOM   2217 C C     . VAL A 1 339 ? 159.518 150.797 275.894 1.00 44.14  ? 306 VAL A C     1 
ATOM   2218 O O     . VAL A 1 339 ? 160.630 150.622 276.403 1.00 44.57  ? 306 VAL A O     1 
ATOM   2219 C CB    . VAL A 1 339 ? 157.456 151.058 277.418 1.00 46.57  ? 306 VAL A CB    1 
ATOM   2220 C CG1   . VAL A 1 339 ? 158.065 149.940 278.267 1.00 48.10  ? 306 VAL A CG1   1 
ATOM   2221 C CG2   . VAL A 1 339 ? 156.724 152.063 278.307 1.00 48.11  ? 306 VAL A CG2   1 
ATOM   2222 N N     . PHE A 1 340 ? 159.141 150.214 274.748 1.00 39.95  ? 307 PHE A N     1 
ATOM   2223 C CA    . PHE A 1 340 ? 159.995 149.272 274.023 1.00 38.75  ? 307 PHE A CA    1 
ATOM   2224 C C     . PHE A 1 340 ? 161.270 149.941 273.485 1.00 41.14  ? 307 PHE A C     1 
ATOM   2225 O O     . PHE A 1 340 ? 162.336 149.332 273.516 1.00 41.09  ? 307 PHE A O     1 
ATOM   2226 C CB    . PHE A 1 340 ? 159.200 148.585 272.903 1.00 40.41  ? 307 PHE A CB    1 
ATOM   2227 C CG    . PHE A 1 340 ? 158.303 147.443 273.329 1.00 44.15  ? 307 PHE A CG    1 
ATOM   2228 C CD1   . PHE A 1 340 ? 157.600 147.493 274.531 1.00 49.20  ? 307 PHE A CD1   1 
ATOM   2229 C CD2   . PHE A 1 340 ? 158.103 146.349 272.497 1.00 47.21  ? 307 PHE A CD2   1 
ATOM   2230 C CE1   . PHE A 1 340 ? 156.745 146.452 274.907 1.00 52.67  ? 307 PHE A CE1   1 
ATOM   2231 C CE2   . PHE A 1 340 ? 157.256 145.300 272.878 1.00 52.41  ? 307 PHE A CE2   1 
ATOM   2232 C CZ    . PHE A 1 340 ? 156.581 145.361 274.078 1.00 52.33  ? 307 PHE A CZ    1 
ATOM   2233 N N     . ALA A 1 341 ? 161.160 151.200 273.030 1.00 36.61  ? 308 ALA A N     1 
ATOM   2234 C CA    . ALA A 1 341 ? 162.269 151.988 272.491 1.00 34.58  ? 308 ALA A CA    1 
ATOM   2235 C C     . ALA A 1 341 ? 163.238 152.435 273.596 1.00 38.08  ? 308 ALA A C     1 
ATOM   2236 O O     . ALA A 1 341 ? 164.448 152.306 273.416 1.00 36.25  ? 308 ALA A O     1 
ATOM   2237 C CB    . ALA A 1 341 ? 161.728 153.189 271.730 1.00 34.62  ? 308 ALA A CB    1 
ATOM   2238 N N     . ILE A 1 342 ? 162.700 152.942 274.742 1.00 36.37  ? 309 ILE A N     1 
ATOM   2239 C CA    . ILE A 1 342 ? 163.461 153.380 275.932 1.00 36.86  ? 309 ILE A CA    1 
ATOM   2240 C C     . ILE A 1 342 ? 164.256 152.183 276.505 1.00 41.37  ? 309 ILE A C     1 
ATOM   2241 O O     . ILE A 1 342 ? 165.430 152.344 276.839 1.00 42.09  ? 309 ILE A O     1 
ATOM   2242 C CB    . ILE A 1 342 ? 162.532 154.063 276.992 1.00 41.48  ? 309 ILE A CB    1 
ATOM   2243 C CG1   . ILE A 1 342 ? 162.017 155.431 276.477 1.00 41.19  ? 309 ILE A CG1   1 
ATOM   2244 C CG2   . ILE A 1 342 ? 163.235 154.221 278.353 1.00 43.50  ? 309 ILE A CG2   1 
ATOM   2245 C CD1   . ILE A 1 342 ? 160.740 156.003 277.176 1.00 49.72  ? 309 ILE A CD1   1 
ATOM   2246 N N     . VAL A 1 343 ? 163.618 150.987 276.585 1.00 37.19  ? 310 VAL A N     1 
ATOM   2247 C CA    . VAL A 1 343 ? 164.235 149.743 277.054 1.00 37.62  ? 310 VAL A CA    1 
ATOM   2248 C C     . VAL A 1 343 ? 165.416 149.392 276.133 1.00 40.57  ? 310 VAL A C     1 
ATOM   2249 O O     . VAL A 1 343 ? 166.527 149.210 276.632 1.00 41.89  ? 310 VAL A O     1 
ATOM   2250 C CB    . VAL A 1 343 ? 163.188 148.605 277.218 1.00 42.21  ? 310 VAL A CB    1 
ATOM   2251 C CG1   . VAL A 1 343 ? 163.817 147.224 277.139 1.00 42.70  ? 310 VAL A CG1   1 
ATOM   2252 C CG2   . VAL A 1 343 ? 162.417 148.763 278.519 1.00 44.54  ? 310 VAL A CG2   1 
ATOM   2253 N N     . THR A 1 344 ? 165.197 149.395 274.797 1.00 34.61  ? 311 THR A N     1 
ATOM   2254 C CA    . THR A 1 344 ? 166.241 149.152 273.787 1.00 32.96  ? 311 THR A CA    1 
ATOM   2255 C C     . THR A 1 344 ? 167.429 150.110 273.991 1.00 36.66  ? 311 THR A C     1 
ATOM   2256 O O     . THR A 1 344 ? 168.571 149.659 273.983 1.00 38.16  ? 311 THR A O     1 
ATOM   2257 C CB    . THR A 1 344 ? 165.657 149.273 272.364 1.00 34.62  ? 311 THR A CB    1 
ATOM   2258 O OG1   . THR A 1 344 ? 164.527 148.413 272.254 1.00 35.02  ? 311 THR A OG1   1 
ATOM   2259 C CG2   . THR A 1 344 ? 166.677 148.946 271.263 1.00 29.38  ? 311 THR A CG2   1 
ATOM   2260 N N     . ALA A 1 345 ? 167.154 151.412 274.195 1.00 31.62  ? 312 ALA A N     1 
ATOM   2261 C CA    . ALA A 1 345 ? 168.176 152.435 274.410 1.00 31.26  ? 312 ALA A CA    1 
ATOM   2262 C C     . ALA A 1 345 ? 169.054 152.114 275.629 1.00 39.00  ? 312 ALA A C     1 
ATOM   2263 O O     . ALA A 1 345 ? 170.277 152.124 275.505 1.00 39.73  ? 312 ALA A O     1 
ATOM   2264 C CB    . ALA A 1 345 ? 167.531 153.809 274.556 1.00 31.13  ? 312 ALA A CB    1 
ATOM   2265 N N     . ILE A 1 346 ? 168.429 151.762 276.775 1.00 37.36  ? 313 ILE A N     1 
ATOM   2266 C CA    . ILE A 1 346 ? 169.115 151.443 278.028 1.00 39.40  ? 313 ILE A CA    1 
ATOM   2267 C C     . ILE A 1 346 ? 169.970 150.199 277.871 1.00 44.43  ? 313 ILE A C     1 
ATOM   2268 O O     . ILE A 1 346 ? 171.119 150.195 278.322 1.00 46.45  ? 313 ILE A O     1 
ATOM   2269 C CB    . ILE A 1 346 ? 168.116 151.377 279.227 1.00 44.52  ? 313 ILE A CB    1 
ATOM   2270 C CG1   . ILE A 1 346 ? 167.493 152.772 279.540 1.00 44.79  ? 313 ILE A CG1   1 
ATOM   2271 C CG2   . ILE A 1 346 ? 168.720 150.739 280.490 1.00 48.58  ? 313 ILE A CG2   1 
ATOM   2272 C CD1   . ILE A 1 346 ? 168.486 153.988 279.757 1.00 50.00  ? 313 ILE A CD1   1 
ATOM   2273 N N     . LEU A 1 347 ? 169.434 149.173 277.192 1.00 39.89  ? 314 LEU A N     1 
ATOM   2274 C CA    . LEU A 1 347 ? 170.131 147.914 276.943 1.00 40.62  ? 314 LEU A CA    1 
ATOM   2275 C C     . LEU A 1 347 ? 171.278 148.052 275.953 1.00 44.49  ? 314 LEU A C     1 
ATOM   2276 O O     . LEU A 1 347 ? 172.248 147.294 276.066 1.00 46.44  ? 314 LEU A O     1 
ATOM   2277 C CB    . LEU A 1 347 ? 169.169 146.807 276.519 1.00 40.56  ? 314 LEU A CB    1 
ATOM   2278 C CG    . LEU A 1 347 ? 168.315 146.229 277.631 1.00 47.82  ? 314 LEU A CG    1 
ATOM   2279 C CD1   . LEU A 1 347 ? 167.101 145.552 277.064 1.00 48.02  ? 314 LEU A CD1   1 
ATOM   2280 C CD2   . LEU A 1 347 ? 169.105 145.255 278.491 1.00 53.43  ? 314 LEU A CD2   1 
ATOM   2281 N N     . CYS A 1 348 ? 171.190 149.024 275.002 1.00 38.22  ? 315 CYS A N     1 
ATOM   2282 C CA    . CYS A 1 348 ? 172.263 149.305 274.041 1.00 37.31  ? 315 CYS A CA    1 
ATOM   2283 C C     . CYS A 1 348 ? 173.428 149.912 274.797 1.00 42.98  ? 315 CYS A C     1 
ATOM   2284 O O     . CYS A 1 348 ? 174.582 149.600 274.503 1.00 44.67  ? 315 CYS A O     1 
ATOM   2285 C CB    . CYS A 1 348 ? 171.789 150.219 272.915 1.00 35.57  ? 315 CYS A CB    1 
ATOM   2286 S SG    . CYS A 1 348 ? 170.733 149.402 271.685 1.00 38.66  ? 315 CYS A SG    1 
ATOM   2287 N N     . MET A 1 349 ? 173.126 150.730 275.814 1.00 39.89  ? 316 MET A N     1 
ATOM   2288 C CA    . MET A 1 349 ? 174.142 151.346 276.664 1.00 42.06  ? 316 MET A CA    1 
ATOM   2289 C C     . MET A 1 349 ? 174.784 150.288 277.554 1.00 47.68  ? 316 MET A C     1 
ATOM   2290 O O     . MET A 1 349 ? 175.988 150.343 277.777 1.00 48.96  ? 316 MET A O     1 
ATOM   2291 C CB    . MET A 1 349 ? 173.543 152.465 277.525 1.00 45.05  ? 316 MET A CB    1 
ATOM   2292 C CG    . MET A 1 349 ? 173.183 153.696 276.755 1.00 46.93  ? 316 MET A CG    1 
ATOM   2293 S SD    . MET A 1 349 ? 172.230 154.784 277.820 1.00 52.89  ? 316 MET A SD    1 
ATOM   2294 C CE    . MET A 1 349 ? 170.889 155.227 276.708 1.00 46.84  ? 316 MET A CE    1 
ATOM   2295 N N     . VAL A 1 350 ? 173.979 149.336 278.063 1.00 44.60  ? 317 VAL A N     1 
ATOM   2296 C CA    . VAL A 1 350 ? 174.444 148.231 278.909 1.00 47.91  ? 317 VAL A CA    1 
ATOM   2297 C C     . VAL A 1 350 ? 175.375 147.326 278.088 1.00 51.56  ? 317 VAL A C     1 
ATOM   2298 O O     . VAL A 1 350 ? 176.470 146.987 278.551 1.00 53.80  ? 317 VAL A O     1 
ATOM   2299 C CB    . VAL A 1 350 ? 173.257 147.469 279.548 1.00 53.17  ? 317 VAL A CB    1 
ATOM   2300 C CG1   . VAL A 1 350 ? 173.686 146.109 280.096 1.00 56.39  ? 317 VAL A CG1   1 
ATOM   2301 C CG2   . VAL A 1 350 ? 172.601 148.310 280.641 1.00 54.13  ? 317 VAL A CG2   1 
ATOM   2302 N N     . ALA A 1 351 ? 174.962 147.013 276.842 1.00 44.82  ? 318 ALA A N     1 
ATOM   2303 C CA    . ALA A 1 351 ? 175.726 146.227 275.879 1.00 44.71  ? 318 ALA A CA    1 
ATOM   2304 C C     . ALA A 1 351 ? 177.070 146.864 275.581 1.00 51.41  ? 318 ALA A C     1 
ATOM   2305 O O     . ALA A 1 351 ? 178.065 146.147 275.507 1.00 54.03  ? 318 ALA A O     1 
ATOM   2306 C CB    . ALA A 1 351 ? 174.951 146.093 274.601 1.00 42.52  ? 318 ALA A CB    1 
ATOM   2307 N N     . TYR A 1 352 ? 177.097 148.206 275.406 1.00 47.33  ? 319 TYR A N     1 
ATOM   2308 C CA    . TYR A 1 352 ? 178.308 148.983 275.136 1.00 48.29  ? 319 TYR A CA    1 
ATOM   2309 C C     . TYR A 1 352 ? 179.312 148.819 276.271 1.00 56.11  ? 319 TYR A C     1 
ATOM   2310 O O     . TYR A 1 352 ? 180.489 148.589 275.996 1.00 57.23  ? 319 TYR A O     1 
ATOM   2311 C CB    . TYR A 1 352 ? 177.980 150.466 274.900 1.00 47.43  ? 319 TYR A CB    1 
ATOM   2312 C CG    . TYR A 1 352 ? 179.139 151.261 274.338 1.00 49.71  ? 319 TYR A CG    1 
ATOM   2313 C CD1   . TYR A 1 352 ? 179.995 151.970 275.178 1.00 53.88  ? 319 TYR A CD1   1 
ATOM   2314 C CD2   . TYR A 1 352 ? 179.369 151.324 272.968 1.00 49.40  ? 319 TYR A CD2   1 
ATOM   2315 C CE1   . TYR A 1 352 ? 181.052 152.722 274.667 1.00 55.43  ? 319 TYR A CE1   1 
ATOM   2316 C CE2   . TYR A 1 352 ? 180.424 152.069 272.445 1.00 51.57  ? 319 TYR A CE2   1 
ATOM   2317 C CZ    . TYR A 1 352 ? 181.259 152.774 273.298 1.00 63.16  ? 319 TYR A CZ    1 
ATOM   2318 O OH    . TYR A 1 352 ? 182.299 153.518 272.785 1.00 68.90  ? 319 TYR A OH    1 
ATOM   2319 N N     . LEU A 1 353 ? 178.835 148.862 277.542 1.00 54.47  ? 320 LEU A N     1 
ATOM   2320 C CA    . LEU A 1 353 ? 179.665 148.657 278.739 1.00 58.07  ? 320 LEU A CA    1 
ATOM   2321 C C     . LEU A 1 353 ? 180.283 147.248 278.741 1.00 65.62  ? 320 LEU A C     1 
ATOM   2322 O O     . LEU A 1 353 ? 181.250 146.996 279.459 1.00 68.66  ? 320 LEU A O     1 
ATOM   2323 C CB    . LEU A 1 353 ? 178.853 148.880 280.027 1.00 58.93  ? 320 LEU A CB    1 
ATOM   2324 C CG    . LEU A 1 353 ? 178.380 150.290 280.331 1.00 61.40  ? 320 LEU A CG    1 
ATOM   2325 C CD1   . LEU A 1 353 ? 177.349 150.268 281.421 1.00 62.48  ? 320 LEU A CD1   1 
ATOM   2326 C CD2   . LEU A 1 353 ? 179.530 151.185 280.744 1.00 65.93  ? 320 LEU A CD2   1 
ATOM   2327 N N     . GLY A 1 354 ? 179.722 146.365 277.914 1.00 62.29  ? 321 GLY A N     1 
ATOM   2328 C CA    . GLY A 1 354 ? 180.200 145.006 277.702 1.00 65.43  ? 321 GLY A CA    1 
ATOM   2329 C C     . GLY A 1 354 ? 181.172 144.927 276.537 1.00 70.84  ? 321 GLY A C     1 
ATOM   2330 O O     . GLY A 1 354 ? 181.163 143.946 275.787 1.00 71.81  ? 321 GLY A O     1 
ATOM   2331 N N     . LEU A 1 355 ? 182.004 145.980 276.362 1.00 66.20  ? 322 LEU A N     1 
ATOM   2332 C CA    . LEU A 1 355 ? 183.033 146.093 275.322 1.00 65.90  ? 322 LEU A CA    1 
ATOM   2333 C C     . LEU A 1 355 ? 184.337 146.725 275.889 1.00 72.58  ? 322 LEU A C     1 
ATOM   2334 O O     . LEU A 1 355 ? 185.354 146.802 275.189 1.00 72.96  ? 322 LEU A O     1 
ATOM   2335 C CB    . LEU A 1 355 ? 182.508 146.891 274.103 1.00 61.90  ? 322 LEU A CB    1 
ATOM   2336 C CG    . LEU A 1 355 ? 181.427 146.232 273.243 1.00 63.56  ? 322 LEU A CG    1 
ATOM   2337 C CD1   . LEU A 1 355 ? 180.656 147.264 272.456 1.00 59.85  ? 322 LEU A CD1   1 
ATOM   2338 C CD2   . LEU A 1 355 ? 182.017 145.184 272.309 1.00 67.77  ? 322 LEU A CD2   1 
ATOM   2339 N N     . GLY A 1 356 ? 184.283 147.148 277.153 1.00 70.71  ? 323 GLY A N     1 
ATOM   2340 C CA    . GLY A 1 356 ? 185.403 147.764 277.854 1.00 109.02 ? 323 GLY A CA    1 
ATOM   2341 C C     . GLY A 1 356 ? 186.392 146.756 278.398 1.00 148.65 ? 323 GLY A C     1 
ATOM   2342 O O     . GLY A 1 356 ? 187.259 146.278 277.667 1.00 116.68 ? 323 GLY A O     1 
HETATM 2343 C C4    . TUM B 2 .   ? 155.220 134.734 260.309 1.00 74.82  ? 401 TUM A C4    1 
HETATM 2344 C C5    . TUM B 2 .   ? 154.074 135.538 260.754 1.00 74.45  ? 401 TUM A C5    1 
HETATM 2345 C C8    . TUM B 2 .   ? 153.052 137.684 260.075 1.00 71.69  ? 401 TUM A C8    1 
HETATM 2346 C C13   . TUM B 2 .   ? 152.062 140.402 259.997 1.00 71.02  ? 401 TUM A C13   1 
HETATM 2347 C C15   . TUM B 2 .   ? 151.317 142.746 260.580 1.00 69.32  ? 401 TUM A C15   1 
HETATM 2348 C C17   . TUM B 2 .   ? 150.066 143.578 260.845 1.00 70.08  ? 401 TUM A C17   1 
HETATM 2349 C C20   . TUM B 2 .   ? 148.975 145.641 260.336 1.00 71.78  ? 401 TUM A C20   1 
HETATM 2350 C C22   . TUM B 2 .   ? 149.568 144.422 259.683 1.00 71.58  ? 401 TUM A C22   1 
HETATM 2351 C C26   . TUM B 2 .   ? 152.839 147.621 261.040 1.00 67.09  ? 401 TUM A C26   1 
HETATM 2352 O O6    . TUM B 2 .   ? 153.180 135.058 261.436 1.00 75.38  ? 401 TUM A O6    1 
HETATM 2353 N N7    . TUM B 2 .   ? 154.191 136.834 260.319 1.00 73.28  ? 401 TUM A N7    1 
HETATM 2354 C C9    . TUM B 2 .   ? 153.339 138.577 258.881 1.00 71.59  ? 401 TUM A C9    1 
HETATM 2355 O O10   . TUM B 2 .   ? 153.392 137.750 257.734 1.00 72.95  ? 401 TUM A O10   1 
HETATM 2356 C C11   . TUM B 2 .   ? 152.324 139.695 258.671 1.00 71.28  ? 401 TUM A C11   1 
HETATM 2357 O O12   . TUM B 2 .   ? 151.115 139.167 258.131 1.00 72.04  ? 401 TUM A O12   1 
HETATM 2358 C C14   . TUM B 2 .   ? 150.967 141.444 259.889 1.00 70.27  ? 401 TUM A C14   1 
HETATM 2359 O O16   . TUM B 2 .   ? 152.264 143.455 259.791 1.00 68.68  ? 401 TUM A O16   1 
HETATM 2360 O O18   . TUM B 2 .   ? 150.282 144.459 261.952 1.00 69.45  ? 401 TUM A O18   1 
HETATM 2361 C C19   . TUM B 2 .   ? 149.693 145.735 261.666 1.00 70.29  ? 401 TUM A C19   1 
HETATM 2362 O O21   . TUM B 2 .   ? 147.581 145.444 260.569 1.00 72.89  ? 401 TUM A O21   1 
HETATM 2363 O O23   . TUM B 2 .   ? 148.580 143.731 258.931 1.00 72.94  ? 401 TUM A O23   1 
HETATM 2364 N N24   . TUM B 2 .   ? 150.657 146.836 261.711 1.00 69.40  ? 401 TUM A N24   1 
HETATM 2365 C C25   . TUM B 2 .   ? 151.877 146.697 261.082 1.00 68.21  ? 401 TUM A C25   1 
HETATM 2366 C C27   . TUM B 2 .   ? 152.561 148.888 261.741 1.00 66.32  ? 401 TUM A C27   1 
HETATM 2367 O O28   . TUM B 2 .   ? 153.406 149.771 261.745 1.00 64.21  ? 401 TUM A O28   1 
HETATM 2368 N N29   . TUM B 2 .   ? 151.326 148.976 262.353 1.00 67.35  ? 401 TUM A N29   1 
HETATM 2369 C C30   . TUM B 2 .   ? 150.341 148.008 262.385 1.00 67.99  ? 401 TUM A C30   1 
HETATM 2370 O O31   . TUM B 2 .   ? 149.289 148.208 262.978 1.00 67.03  ? 401 TUM A O31   1 
HETATM 2371 O O32   . TUM B 2 .   ? 151.673 139.435 260.973 1.00 70.79  ? 401 TUM A O32   1 
HETATM 2372 C C33   . TUM B 2 .   ? 152.752 138.548 261.287 1.00 70.52  ? 401 TUM A C33   1 
HETATM 2373 O O34   . TUM B 2 .   ? 152.333 137.703 262.350 1.00 70.47  ? 401 TUM A O34   1 
HETATM 2374 C C35   . TUM B 2 .   ? 152.964 138.012 263.595 1.00 71.60  ? 401 TUM A C35   1 
HETATM 2375 O O36   . TUM B 2 .   ? 153.092 139.414 263.898 1.00 72.76  ? 401 TUM A O36   1 
HETATM 2376 C C37   . TUM B 2 .   ? 151.851 140.081 264.196 1.00 73.26  ? 401 TUM A C37   1 
HETATM 2377 C C38   . TUM B 2 .   ? 152.144 141.549 264.385 1.00 72.08  ? 401 TUM A C38   1 
HETATM 2378 O O39   . TUM B 2 .   ? 153.000 141.720 265.501 1.00 70.68  ? 401 TUM A O39   1 
HETATM 2379 C C40   . TUM B 2 .   ? 151.131 139.451 265.377 1.00 73.17  ? 401 TUM A C40   1 
HETATM 2380 O O41   . TUM B 2 .   ? 149.844 140.031 265.541 1.00 73.81  ? 401 TUM A O41   1 
HETATM 2381 C C42   . TUM B 2 .   ? 150.937 137.978 265.114 1.00 72.16  ? 401 TUM A C42   1 
HETATM 2382 O O43   . TUM B 2 .   ? 150.435 137.399 266.307 1.00 72.10  ? 401 TUM A O43   1 
HETATM 2383 C C44   . TUM B 2 .   ? 152.228 137.280 264.716 1.00 72.07  ? 401 TUM A C44   1 
HETATM 2384 N N45   . TUM B 2 .   ? 151.911 135.923 264.351 1.00 72.58  ? 401 TUM A N45   1 
HETATM 2385 C C46   . TUM B 2 .   ? 152.536 134.831 264.898 1.00 73.31  ? 401 TUM A C46   1 
HETATM 2386 O O47   . TUM B 2 .   ? 153.386 134.169 264.327 1.00 74.19  ? 401 TUM A O47   1 
HETATM 2387 C C48   . TUM B 2 .   ? 152.032 134.475 266.262 1.00 73.43  ? 401 TUM A C48   1 
HETATM 2388 C C2    . PLM C 3 .   ? 175.990 153.551 272.878 1.00 52.95  ? 402 PLM A C2    1 
HETATM 2389 C C3    . PLM C 3 .   ? 174.510 153.785 273.162 1.00 53.44  ? 402 PLM A C3    1 
HETATM 2390 C C4    . PLM C 3 .   ? 173.673 153.814 271.883 1.00 52.39  ? 402 PLM A C4    1 
HETATM 2391 C C5    . PLM C 3 .   ? 172.185 153.930 272.196 1.00 50.37  ? 402 PLM A C5    1 
HETATM 2392 C C6    . PLM C 3 .   ? 171.636 155.284 271.762 1.00 50.75  ? 402 PLM A C6    1 
HETATM 2393 C C7    . PLM C 3 .   ? 171.098 156.083 272.950 1.00 50.74  ? 402 PLM A C7    1 
HETATM 2394 C C8    . PLM C 3 .   ? 170.611 157.468 272.525 1.00 48.36  ? 402 PLM A C8    1 
HETATM 2395 C C9    . PLM C 3 .   ? 169.365 157.896 273.289 1.00 45.38  ? 402 PLM A C9    1 
HETATM 2396 C CA    . PLM C 3 .   ? 168.211 158.187 272.334 1.00 44.30  ? 402 PLM A CA    1 
HETATM 2397 C CB    . PLM C 3 .   ? 166.892 157.671 272.905 1.00 43.49  ? 402 PLM A CB    1 
HETATM 2398 C CC    . PLM C 3 .   ? 165.706 157.925 271.976 1.00 43.34  ? 402 PLM A CC    1 
HETATM 2399 C CD    . PLM C 3 .   ? 164.378 157.623 272.672 1.00 43.84  ? 402 PLM A CD    1 
HETATM 2400 C CE    . PLM C 3 .   ? 163.409 156.892 271.742 1.00 46.01  ? 402 PLM A CE    1 
HETATM 2401 C CF    . PLM C 3 .   ? 161.971 156.970 272.257 1.00 47.49  ? 402 PLM A CF    1 
HETATM 2402 C CG    . PLM C 3 .   ? 160.937 156.866 271.152 1.00 47.36  ? 402 PLM A CG    1 
HETATM 2403 C C2    . PLM D 3 .   ? 149.912 154.421 286.818 1.00 65.35  ? 403 PLM A C2    1 
HETATM 2404 C C3    . PLM D 3 .   ? 150.934 153.502 287.483 1.00 65.62  ? 403 PLM A C3    1 
HETATM 2405 C C4    . PLM D 3 .   ? 150.788 152.055 287.010 1.00 65.80  ? 403 PLM A C4    1 
HETATM 2406 C C5    . PLM D 3 .   ? 152.099 151.287 287.184 1.00 65.34  ? 403 PLM A C5    1 
HETATM 2407 C C6    . PLM D 3 .   ? 152.244 150.147 286.177 1.00 64.15  ? 403 PLM A C6    1 
HETATM 2408 C C7    . PLM D 3 .   ? 153.709 149.733 286.023 1.00 62.02  ? 403 PLM A C7    1 
HETATM 2409 C C8    . PLM D 3 .   ? 153.860 148.592 285.017 1.00 60.32  ? 403 PLM A C8    1 
HETATM 2410 C C9    . PLM D 3 .   ? 155.249 147.962 285.105 1.00 59.66  ? 403 PLM A C9    1 
HETATM 2411 C CA    . PLM D 3 .   ? 155.477 146.932 284.002 1.00 59.04  ? 403 PLM A CA    1 
HETATM 2412 C CB    . PLM D 3 .   ? 156.919 146.924 283.506 1.00 58.96  ? 403 PLM A CB    1 
HETATM 2413 C CC    . PLM D 3 .   ? 157.075 146.040 282.270 1.00 59.81  ? 403 PLM A CC    1 
HETATM 2414 C CD    . PLM D 3 .   ? 158.302 146.412 281.435 1.00 60.28  ? 403 PLM A CD    1 
HETATM 2415 C CE    . PLM D 3 .   ? 158.112 146.030 279.967 1.00 60.10  ? 403 PLM A CE    1 
HETATM 2416 C CF    . PLM D 3 .   ? 159.445 145.896 279.232 1.00 58.69  ? 403 PLM A CF    1 
HETATM 2417 C CG    . PLM D 3 .   ? 159.327 145.040 277.985 1.00 56.84  ? 403 PLM A CG    1 
HETATM 2418 C C1    . BOG E 4 .   ? 187.504 156.633 267.940 1.00 88.93  ? 404 BOG A C1    1 
HETATM 2419 O O1    . BOG E 4 .   ? 186.290 157.389 267.962 1.00 83.37  ? 404 BOG A O1    1 
HETATM 2420 C C2    . BOG E 4 .   ? 188.701 157.531 268.291 1.00 90.62  ? 404 BOG A C2    1 
HETATM 2421 O O2    . BOG E 4 .   ? 188.835 158.564 267.308 1.00 90.45  ? 404 BOG A O2    1 
HETATM 2422 C C3    . BOG E 4 .   ? 189.978 156.680 268.371 1.00 92.56  ? 404 BOG A C3    1 
HETATM 2423 O O3    . BOG E 4 .   ? 191.125 157.458 268.737 1.00 93.41  ? 404 BOG A O3    1 
HETATM 2424 C C4    . BOG E 4 .   ? 189.815 155.505 269.342 1.00 93.71  ? 404 BOG A C4    1 
HETATM 2425 O O4    . BOG E 4 .   ? 191.008 154.700 269.320 1.00 95.52  ? 404 BOG A O4    1 
HETATM 2426 C C5    . BOG E 4 .   ? 188.554 154.682 269.008 1.00 92.27  ? 404 BOG A C5    1 
HETATM 2427 O O5    . BOG E 4 .   ? 187.403 155.537 268.871 1.00 91.19  ? 404 BOG A O5    1 
HETATM 2428 C C6    . BOG E 4 .   ? 188.242 153.661 270.100 1.00 92.45  ? 404 BOG A C6    1 
HETATM 2429 O O6    . BOG E 4 .   ? 186.879 153.222 270.006 1.00 92.90  ? 404 BOG A O6    1 
HETATM 2430 C "C1'" . BOG E 4 .   ? 185.215 156.719 267.303 1.00 78.73  ? 404 BOG A "C1'" 1 
HETATM 2431 C "C2'" . BOG E 4 .   ? 184.049 156.565 268.272 1.00 75.69  ? 404 BOG A "C2'" 1 
HETATM 2432 C "C3'" . BOG E 4 .   ? 182.720 156.501 267.526 1.00 72.87  ? 404 BOG A "C3'" 1 
HETATM 2433 C "C4'" . BOG E 4 .   ? 181.740 157.545 268.049 1.00 69.96  ? 404 BOG A "C4'" 1 
HETATM 2434 C "C5'" . BOG E 4 .   ? 180.671 157.859 267.010 1.00 67.88  ? 404 BOG A "C5'" 1 
HETATM 2435 C "C6'" . BOG E 4 .   ? 180.327 159.341 267.034 1.00 67.27  ? 404 BOG A "C6'" 1 
HETATM 2436 C "C7'" . BOG E 4 .   ? 178.830 159.574 267.211 1.00 66.64  ? 404 BOG A "C7'" 1 
HETATM 2437 C "C8'" . BOG E 4 .   ? 178.521 161.055 267.254 1.00 66.68  ? 404 BOG A "C8'" 1 
HETATM 2438 O O     . HOH F 5 .   ? 156.114 148.397 263.703 1.00 40.41  ? 501 HOH A O     1 
HETATM 2439 O O     . HOH F 5 .   ? 155.472 149.258 259.934 1.00 40.57  ? 502 HOH A O     1 
HETATM 2440 O O     . HOH F 5 .   ? 146.606 150.055 264.001 1.00 54.96  ? 503 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 27  ? 0.7481 1.1782 2.4708 0.0693  0.4017  0.1764  -6  GLU A N   
2    C CA  . GLU A 27  ? 0.7114 1.1381 2.4558 0.0492  0.3169  0.1737  -6  GLU A CA  
3    C C   . GLU A 27  ? 0.7457 1.1345 2.3374 0.0414  0.2788  0.1604  -6  GLU A C   
4    O O   . GLU A 27  ? 0.7367 1.1057 2.2268 0.0558  0.2812  0.1430  -6  GLU A O   
5    C CB  . GLU A 27  ? 0.7219 1.1734 2.6021 0.0264  0.2937  0.1938  -6  GLU A CB  
6    C CG  . GLU A 27  ? 0.9068 1.3571 2.7981 0.0171  0.3395  0.2124  -6  GLU A CG  
7    C CD  . GLU A 27  ? 1.2292 1.6731 3.1521 -0.0119 0.2902  0.2188  -6  GLU A CD  
8    O OE1 . GLU A 27  ? 1.2010 1.6374 3.1242 -0.0195 0.3253  0.2345  -6  GLU A OE1 
9    O OE2 . GLU A 27  ? 1.1704 1.6157 3.1171 -0.0275 0.2165  0.2082  -6  GLU A OE2 
10   N N   . ASN A 28  ? 0.6892 1.0682 2.2725 0.0187  0.2457  0.1667  -5  ASN A N   
11   C CA  . ASN A 28  ? 0.6762 1.0215 2.1333 0.0097  0.2143  0.1548  -5  ASN A CA  
12   C C   . ASN A 28  ? 0.7080 1.0337 2.0652 0.0236  0.2707  0.1576  -5  ASN A C   
13   O O   . ASN A 28  ? 0.7009 1.0001 1.9392 0.0276  0.2574  0.1438  -5  ASN A O   
14   C CB  . ASN A 28  ? 0.7335 1.0759 2.2322 -0.0176 0.1726  0.1590  -5  ASN A CB  
15   C CG  . ASN A 28  ? 1.1534 1.5066 2.7056 -0.0353 0.1000  0.1512  -5  ASN A CG  
16   O OD1 . ASN A 28  ? 1.1529 1.4865 2.6388 -0.0505 0.0502  0.1366  -5  ASN A OD1 
17   N ND2 . ASN A 28  ? 1.0286 1.4144 2.7055 -0.0344 0.0921  0.1616  -5  ASN A ND2 
18   N N   . LEU A 29  ? 0.6544 0.9948 2.0633 0.0306  0.3333  0.1776  -4  LEU A N   
19   C CA  . LEU A 29  ? 0.6689 0.9961 1.9946 0.0442  0.3932  0.1880  -4  LEU A CA  
20   C C   . LEU A 29  ? 0.6800 0.9971 1.9041 0.0673  0.4116  0.1672  -4  LEU A C   
21   O O   . LEU A 29  ? 0.6912 0.9849 1.7964 0.0747  0.4222  0.1637  -4  LEU A O   
22   C CB  . LEU A 29  ? 0.7005 1.0526 2.1219 0.0466  0.4579  0.2154  -4  LEU A CB  
23   C CG  . LEU A 29  ? 0.8141 1.1554 2.1545 0.0586  0.5240  0.2345  -4  LEU A CG  
24   C CD1 . LEU A 29  ? 0.8260 1.1540 2.1765 0.0415  0.5242  0.2622  -4  LEU A CD1 
25   C CD2 . LEU A 29  ? 0.8883 1.2571 2.2883 0.0733  0.5976  0.2465  -4  LEU A CD2 
26   N N   . TYR A 30  ? 0.5906 0.9249 1.8688 0.0784  0.4121  0.1529  -3  TYR A N   
27   C CA  . TYR A 30  ? 0.5835 0.9085 1.7874 0.0996  0.4264  0.1282  -3  TYR A CA  
28   C C   . TYR A 30  ? 0.6044 0.8998 1.6944 0.0963  0.3757  0.1099  -3  TYR A C   
29   O O   . TYR A 30  ? 0.6298 0.9064 1.6092 0.1085  0.3940  0.0979  -3  TYR A O   
30   C CB  . TYR A 30  ? 0.5709 0.9184 1.8800 0.1088  0.4244  0.1176  -3  TYR A CB  
31   C CG  . TYR A 30  ? 0.5814 0.9150 1.8244 0.1283  0.4287  0.0882  -3  TYR A CG  
32   C CD1 . TYR A 30  ? 0.6519 0.9828 1.8426 0.1492  0.4922  0.0740  -3  TYR A CD1 
33   C CD2 . TYR A 30  ? 0.5541 0.8748 1.7806 0.1249  0.3691  0.0740  -3  TYR A CD2 
34   C CE1 . TYR A 30  ? 0.6762 0.9912 1.8056 0.1659  0.4937  0.0420  -3  TYR A CE1 
35   C CE2 . TYR A 30  ? 0.5760 0.8809 1.7465 0.1413  0.3719  0.0470  -3  TYR A CE2 
36   C CZ  . TYR A 30  ? 0.7132 1.0148 1.8387 0.1618  0.4331  0.0289  -3  TYR A CZ  
37   O OH  . TYR A 30  ? 0.7437 1.0284 1.8207 0.1772  0.4345  -0.0023 -3  TYR A OH  
38   N N   . PHE A 31  ? 0.5052 0.7980 1.6232 0.0793  0.3125  0.1082  -2  PHE A N   
39   C CA  . PHE A 31  ? 0.4754 0.7431 1.4980 0.0736  0.2651  0.0929  -2  PHE A CA  
40   C C   . PHE A 31  ? 0.5412 0.7881 1.4795 0.0667  0.2674  0.0985  -2  PHE A C   
41   O O   . PHE A 31  ? 0.5479 0.7742 1.3855 0.0729  0.2596  0.0850  -2  PHE A O   
42   C CB  . PHE A 31  ? 0.4587 0.7308 1.5308 0.0569  0.2011  0.0913  -2  PHE A CB  
43   C CG  . PHE A 31  ? 0.4624 0.7455 1.5862 0.0669  0.1877  0.0840  -2  PHE A CG  
44   C CD1 . PHE A 31  ? 0.4869 0.7519 1.5400 0.0755  0.1708  0.0668  -2  PHE A CD1 
45   C CD2 . PHE A 31  ? 0.4764 0.7878 1.7295 0.0678  0.1918  0.0956  -2  PHE A CD2 
46   C CE1 . PHE A 31  ? 0.4890 0.7613 1.5982 0.0851  0.1588  0.0622  -2  PHE A CE1 
47   C CE2 . PHE A 31  ? 0.4988 0.8192 1.8093 0.0784  0.1785  0.0910  -2  PHE A CE2 
48   C CZ  . PHE A 31  ? 0.4744 0.7738 1.7116 0.0871  0.1624  0.0747  -2  PHE A CZ  
49   N N   . GLN A 32  ? 0.5013 0.7539 1.4888 0.0544  0.2794  0.1193  -1  GLN A N   
50   C CA  . GLN A 32  ? 0.5021 0.7347 1.4298 0.0477  0.2834  0.1292  -1  GLN A CA  
51   C C   . GLN A 32  ? 0.5776 0.7990 1.4116 0.0664  0.3278  0.1332  -1  GLN A C   
52   O O   . GLN A 32  ? 0.5695 0.7690 1.3122 0.0682  0.3123  0.1265  -1  GLN A O   
53   C CB  . GLN A 32  ? 0.5217 0.7632 1.5400 0.0317  0.2927  0.1523  -1  GLN A CB  
54   C CG  . GLN A 32  ? 0.7655 0.9829 1.7484 0.0171  0.2681  0.1544  -1  GLN A CG  
55   C CD  . GLN A 32  ? 0.9764 1.1901 1.9917 0.0133  0.3060  0.1839  -1  GLN A CD  
56   O OE1 . GLN A 32  ? 0.9857 1.2076 1.9974 0.0263  0.3596  0.2057  -1  GLN A OE1 
57   N NE2 . GLN A 32  ? 0.7424 0.9409 1.7836 -0.0047 0.2798  0.1849  -1  GLN A NE2 
58   N N   . SER A 33  ? 0.5669 0.8041 1.4225 0.0806  0.3823  0.1427  0   SER A N   
59   C CA  . SER A 33  ? 0.6169 0.8460 1.3775 0.0987  0.4267  0.1453  0   SER A CA  
60   C C   . SER A 33  ? 0.6641 0.8783 1.3295 0.1110  0.4051  0.1139  0   SER A C   
61   O O   . SER A 33  ? 0.6892 0.8865 1.2533 0.1185  0.4091  0.1129  0   SER A O   
62   C CB  . SER A 33  ? 0.7095 0.9606 1.5167 0.1105  0.4903  0.1563  0   SER A CB  
63   O OG  . SER A 33  ? 0.8498 1.1172 1.7191 0.1176  0.4888  0.1340  0   SER A OG  
64   N N   . MET A 34  ? 0.5858 0.8061 1.2901 0.1121  0.3787  0.0905  1   MET A N   
65   C CA  . MET A 34  ? 0.5755 0.7816 1.2114 0.1209  0.3536  0.0608  1   MET A CA  
66   C C   . MET A 34  ? 0.5794 0.7645 1.1478 0.1103  0.3076  0.0576  1   MET A C   
67   O O   . MET A 34  ? 0.5888 0.7585 1.0664 0.1190  0.3047  0.0447  1   MET A O   
68   C CB  . MET A 34  ? 0.5787 0.7961 1.2931 0.1214  0.3332  0.0456  1   MET A CB  
69   C CG  . MET A 34  ? 0.6130 0.8141 1.2767 0.1248  0.2967  0.0199  1   MET A CG  
70   S SD  . MET A 34  ? 0.6790 0.8885 1.4072 0.1399  0.3059  -0.0023 1   MET A SD  
71   C CE  . MET A 34  ? 0.5985 0.8326 1.4693 0.1261  0.2810  0.0202  1   MET A CE  
72   N N   . ILE A 35  ? 0.4882 0.6732 1.1032 0.0915  0.2732  0.0678  2   ILE A N   
73   C CA  . ILE A 35  ? 0.4641 0.6307 1.0281 0.0803  0.2344  0.0637  2   ILE A CA  
74   C C   . ILE A 35  ? 0.5579 0.7111 1.0544 0.0857  0.2545  0.0767  2   ILE A C   
75   O O   . ILE A 35  ? 0.5561 0.6940 0.9796 0.0891  0.2368  0.0662  2   ILE A O   
76   C CB  . ILE A 35  ? 0.4669 0.6365 1.0956 0.0587  0.1984  0.0685  2   ILE A CB  
77   C CG1 . ILE A 35  ? 0.4450 0.6271 1.1294 0.0536  0.1697  0.0588  2   ILE A CG1 
78   C CG2 . ILE A 35  ? 0.4623 0.6119 1.0367 0.0481  0.1671  0.0614  2   ILE A CG2 
79   C CD1 . ILE A 35  ? 0.4798 0.6744 1.2506 0.0343  0.1431  0.0678  2   ILE A CD1 
80   N N   . HIS A 36  ? 0.5547 0.7149 1.0801 0.0870  0.2922  0.1021  3   HIS A N   
81   C CA  . HIS A 36  ? 0.5962 0.7447 1.0649 0.0924  0.3138  0.1234  3   HIS A CA  
82   C C   . HIS A 36  ? 0.6776 0.8212 1.0486 0.1116  0.3328  0.1151  3   HIS A C   
83   O O   . HIS A 36  ? 0.6921 0.8210 0.9922 0.1156  0.3226  0.1205  3   HIS A O   
84   C CB  . HIS A 36  ? 0.6371 0.7948 1.1705 0.0872  0.3508  0.1568  3   HIS A CB  
85   C CG  . HIS A 36  ? 0.6593 0.8115 1.2638 0.0673  0.3263  0.1668  3   HIS A CG  
86   N ND1 . HIS A 36  ? 0.7076 0.8478 1.3194 0.0624  0.3396  0.1957  3   HIS A ND1 
87   C CD2 . HIS A 36  ? 0.6426 0.7984 1.3104 0.0512  0.2888  0.1504  3   HIS A CD2 
88   C CE1 . HIS A 36  ? 0.6693 0.8050 1.3522 0.0436  0.3113  0.1913  3   HIS A CE1 
89   N NE2 . HIS A 36  ? 0.6362 0.7816 1.3488 0.0359  0.2791  0.1635  3   HIS A NE2 
90   N N   . GLU A 37  ? 0.6465 0.8019 1.0168 0.1233  0.3571  0.0992  4   GLU A N   
91   C CA  . GLU A 37  ? 0.6909 0.8414 0.9690 0.1408  0.3738  0.0826  4   GLU A CA  
92   C C   . GLU A 37  ? 0.7168 0.8535 0.9427 0.1419  0.3292  0.0528  4   GLU A C   
93   O O   . GLU A 37  ? 0.7483 0.8749 0.8867 0.1516  0.3261  0.0445  4   GLU A O   
94   C CB  . GLU A 37  ? 0.7351 0.9009 1.0399 0.1524  0.4148  0.0685  4   GLU A CB  
95   C CG  . GLU A 37  ? 0.9226 1.1005 1.2354 0.1575  0.4733  0.0970  4   GLU A CG  
96   C CD  . GLU A 37  ? 1.2003 1.3987 1.5828 0.1651  0.5168  0.0873  4   GLU A CD  
97   O OE1 . GLU A 37  ? 1.2152 1.4128 1.5625 0.1792  0.5298  0.0544  4   GLU A OE1 
98   O OE2 . GLU A 37  ? 1.0956 1.3108 1.5738 0.1571  0.5391  0.1117  4   GLU A OE2 
99   N N   . THR A 38  ? 0.6125 0.7495 0.8930 0.1313  0.2938  0.0384  5   THR A N   
100  C CA  . THR A 38  ? 0.5755 0.7008 0.8221 0.1295  0.2528  0.0136  5   THR A CA  
101  C C   . THR A 38  ? 0.6089 0.7213 0.8161 0.1221  0.2257  0.0232  5   THR A C   
102  O O   . THR A 38  ? 0.6164 0.7191 0.7612 0.1279  0.2088  0.0096  5   THR A O   
103  C CB  . THR A 38  ? 0.5458 0.6768 0.8623 0.1205  0.2288  0.0016  5   THR A CB  
104  O OG1 . THR A 38  ? 0.4991 0.6428 0.8622 0.1298  0.2572  -0.0050 5   THR A OG1 
105  C CG2 . THR A 38  ? 0.4913 0.6108 0.7766 0.1187  0.1925  -0.0209 5   THR A CG2 
106  N N   . ILE A 39  ? 0.5420 0.6542 0.7920 0.1096  0.2217  0.0449  6   ILE A N   
107  C CA  . ILE A 39  ? 0.5357 0.6349 0.7623 0.1034  0.2012  0.0542  6   ILE A CA  
108  C C   . ILE A 39  ? 0.6490 0.7419 0.8056 0.1169  0.2167  0.0686  6   ILE A C   
109  O O   . ILE A 39  ? 0.6493 0.7324 0.7610 0.1196  0.1937  0.0636  6   ILE A O   
110  C CB  . ILE A 39  ? 0.5509 0.6491 0.8443 0.0875  0.1977  0.0710  6   ILE A CB  
111  C CG1 . ILE A 39  ? 0.5152 0.6166 0.8554 0.0725  0.1680  0.0525  6   ILE A CG1 
112  C CG2 . ILE A 39  ? 0.5606 0.6435 0.8351 0.0851  0.1888  0.0848  6   ILE A CG2 
113  C CD1 . ILE A 39  ? 0.6007 0.7041 1.0120 0.0555  0.1623  0.0621  6   ILE A CD1 
114  N N   . LEU A 40  ? 0.6581 0.7584 0.8047 0.1256  0.2555  0.0864  7   LEU A N   
115  C CA  . LEU A 40  ? 0.7243 0.8201 0.7946 0.1385  0.2730  0.1040  7   LEU A CA  
116  C C   . LEU A 40  ? 0.8043 0.8965 0.7967 0.1498  0.2559  0.0755  7   LEU A C   
117  O O   . LEU A 40  ? 0.8398 0.9237 0.7748 0.1548  0.2372  0.0824  7   LEU A O   
118  C CB  . LEU A 40  ? 0.7763 0.8826 0.8508 0.1445  0.3237  0.1272  7   LEU A CB  
119  C CG  . LEU A 40  ? 0.9132 1.0141 0.9230 0.1527  0.3448  0.1629  7   LEU A CG  
120  C CD1 . LEU A 40  ? 0.9019 0.9913 0.9479 0.1433  0.3294  0.1958  7   LEU A CD1 
121  C CD2 . LEU A 40  ? 1.0123 1.1257 1.0244 0.1582  0.4012  0.1832  7   LEU A CD2 
122  N N   . ALA A 41  ? 0.7344 0.8323 0.7347 0.1530  0.2578  0.0430  8   ALA A N   
123  C CA  . ALA A 41  ? 0.7438 0.8368 0.6838 0.1620  0.2403  0.0096  8   ALA A CA  
124  C C   . ALA A 41  ? 0.7317 0.8155 0.6616 0.1560  0.1938  0.0000  8   ALA A C   
125  O O   . ALA A 41  ? 0.7589 0.8375 0.6252 0.1634  0.1761  -0.0116 8   ALA A O   
126  C CB  . ALA A 41  ? 0.7366 0.8349 0.7145 0.1640  0.2489  -0.0212 8   ALA A CB  
127  N N   . ILE A 42  ? 0.6083 0.6910 0.6007 0.1423  0.1748  0.0049  9   ILE A N   
128  C CA  . ILE A 42  ? 0.5655 0.6412 0.5588 0.1354  0.1377  -0.0030 9   ILE A CA  
129  C C   . ILE A 42  ? 0.6409 0.7109 0.5957 0.1403  0.1295  0.0191  9   ILE A C   
130  O O   . ILE A 42  ? 0.6566 0.7235 0.5725 0.1453  0.1052  0.0081  9   ILE A O   
131  C CB  . ILE A 42  ? 0.5375 0.6133 0.5991 0.1191  0.1248  -0.0037 9   ILE A CB  
132  C CG1 . ILE A 42  ? 0.5051 0.5869 0.6042 0.1151  0.1257  -0.0218 9   ILE A CG1 
133  C CG2 . ILE A 42  ? 0.5139 0.5830 0.5747 0.1122  0.0943  -0.0109 9   ILE A CG2 
134  C CD1 . ILE A 42  ? 0.4832 0.5689 0.6461 0.1001  0.1203  -0.0152 9   ILE A CD1 
135  N N   . ILE A 43  ? 0.5982 0.6669 0.5699 0.1390  0.1489  0.0518  10  ILE A N   
136  C CA  . ILE A 43  ? 0.6229 0.6847 0.5699 0.1439  0.1428  0.0807  10  ILE A CA  
137  C C   . ILE A 43  ? 0.7478 0.8109 0.6075 0.1590  0.1440  0.0863  10  ILE A C   
138  O O   . ILE A 43  ? 0.7584 0.8173 0.5863 0.1642  0.1176  0.0941  10  ILE A O   
139  C CB  . ILE A 43  ? 0.6544 0.7125 0.6510 0.1376  0.1653  0.1155  10  ILE A CB  
140  C CG1 . ILE A 43  ? 0.5886 0.6456 0.6645 0.1213  0.1599  0.1029  10  ILE A CG1 
141  C CG2 . ILE A 43  ? 0.6884 0.7363 0.6731 0.1425  0.1555  0.1478  10  ILE A CG2 
142  C CD1 . ILE A 43  ? 0.6018 0.6585 0.7380 0.1129  0.1854  0.1274  10  ILE A CD1 
143  N N   . ILE A 44  ? 0.7495 0.8188 0.5718 0.1658  0.1735  0.0801  11  ILE A N   
144  C CA  . ILE A 44  ? 0.8310 0.9013 0.5590 0.1793  0.1783  0.0786  11  ILE A CA  
145  C C   . ILE A 44  ? 0.8823 0.9504 0.5749 0.1822  0.1367  0.0436  11  ILE A C   
146  O O   . ILE A 44  ? 0.9242 0.9899 0.5650 0.1883  0.1108  0.0540  11  ILE A O   
147  C CB  . ILE A 44  ? 0.9153 0.9927 0.6186 0.1854  0.2237  0.0695  11  ILE A CB  
148  C CG1 . ILE A 44  ? 0.9409 1.0228 0.6761 0.1832  0.2685  0.1106  11  ILE A CG1 
149  C CG2 . ILE A 44  ? 1.0120 1.0889 0.6092 0.1984  0.2250  0.0516  11  ILE A CG2 
150  C CD1 . ILE A 44  ? 1.1465 1.2244 0.8270 0.1887  0.2804  0.1598  11  ILE A CD1 
151  N N   . ALA A 45  ? 0.7842 0.8534 0.5133 0.1771  0.1279  0.0053  12  ALA A N   
152  C CA  . ALA A 45  ? 0.7713 0.8383 0.4847 0.1775  0.0908  -0.0292 12  ALA A CA  
153  C C   . ALA A 45  ? 0.7864 0.8518 0.5295 0.1717  0.0539  -0.0193 12  ALA A C   
154  O O   . ALA A 45  ? 0.8082 0.8737 0.5229 0.1749  0.0211  -0.0345 12  ALA A O   
155  C CB  . ALA A 45  ? 0.7356 0.8027 0.4951 0.1721  0.0940  -0.0639 12  ALA A CB  
156  N N   . PHE A 46  ? 0.6859 0.7500 0.4889 0.1634  0.0592  0.0043  13  PHE A N   
157  C CA  . PHE A 46  ? 0.6458 0.7081 0.4821 0.1592  0.0306  0.0125  13  PHE A CA  
158  C C   . PHE A 46  ? 0.7681 0.8296 0.5591 0.1697  0.0151  0.0398  13  PHE A C   
159  O O   . PHE A 46  ? 0.7747 0.8384 0.5628 0.1722  -0.0191 0.0328  13  PHE A O   
160  C CB  . PHE A 46  ? 0.6054 0.6642 0.5135 0.1476  0.0420  0.0252  13  PHE A CB  
161  C CG  . PHE A 46  ? 0.6005 0.6560 0.5446 0.1452  0.0210  0.0352  13  PHE A CG  
162  C CD1 . PHE A 46  ? 0.6023 0.6609 0.5694 0.1408  -0.0036 0.0117  13  PHE A CD1 
163  C CD2 . PHE A 46  ? 0.6354 0.6844 0.5978 0.1476  0.0282  0.0688  13  PHE A CD2 
164  C CE1 . PHE A 46  ? 0.5935 0.6507 0.6004 0.1399  -0.0186 0.0192  13  PHE A CE1 
165  C CE2 . PHE A 46  ? 0.6494 0.6943 0.6538 0.1471  0.0107  0.0758  13  PHE A CE2 
166  C CZ  . PHE A 46  ? 0.5935 0.6434 0.6201 0.1436  -0.0115 0.0497  13  PHE A CZ  
167  N N   . ALA A 47  ? 0.7766 0.8357 0.5342 0.1758  0.0398  0.0729  14  ALA A N   
168  C CA  . ALA A 47  ? 0.8396 0.8971 0.5475 0.1861  0.0275  0.1082  14  ALA A CA  
169  C C   . ALA A 47  ? 0.9435 1.0057 0.5681 0.1954  -0.0002 0.0903  14  ALA A C   
170  O O   . ALA A 47  ? 0.9611 1.0248 0.5695 0.2009  -0.0359 0.1048  14  ALA A O   
171  C CB  . ALA A 47  ? 0.8929 0.9472 0.5802 0.1891  0.0664  0.1473  14  ALA A CB  
172  N N   . ILE A 48  ? 0.9224 0.9870 0.5010 0.1969  0.0141  0.0566  15  ILE A N   
173  C CA  . ILE A 48  ? 0.9873 1.0544 0.4845 0.2043  -0.0107 0.0297  15  ILE A CA  
174  C C   . ILE A 48  ? 1.0200 1.0901 0.5550 0.2001  -0.0584 0.0012  15  ILE A C   
175  O O   . ILE A 48  ? 1.0673 1.1409 0.5659 0.2054  -0.0980 0.0062  15  ILE A O   
176  C CB  . ILE A 48  ? 1.0549 1.1211 0.5059 0.2071  0.0219  -0.0045 15  ILE A CB  
177  C CG1 . ILE A 48  ? 1.1096 1.1758 0.5180 0.2124  0.0719  0.0272  15  ILE A CG1 
178  C CG2 . ILE A 48  ? 1.1330 1.1989 0.5065 0.2129  -0.0075 -0.0432 15  ILE A CG2 
179  C CD1 . ILE A 48  ? 1.1835 1.2507 0.5985 0.2127  0.1166  -0.0006 15  ILE A CD1 
180  N N   . SER A 49  ? 0.9047 0.9744 0.5158 0.1900  -0.0550 -0.0252 16  SER A N   
181  C CA  . SER A 49  ? 0.8605 0.9338 0.5209 0.1837  -0.0914 -0.0517 16  SER A CA  
182  C C   . SER A 49  ? 0.9103 0.9885 0.6117 0.1838  -0.1209 -0.0256 16  SER A C   
183  O O   . SER A 49  ? 0.9238 1.0084 0.6285 0.1850  -0.1610 -0.0388 16  SER A O   
184  C CB  . SER A 49  ? 0.8160 0.8872 0.5464 0.1722  -0.0741 -0.0738 16  SER A CB  
185  O OG  . SER A 49  ? 0.8872 0.9616 0.6584 0.1656  -0.1040 -0.1010 16  SER A OG  
186  N N   . ALA A 50  ? 0.8446 0.9196 0.5839 0.1829  -0.1018 0.0101  17  ALA A N   
187  C CA  . ALA A 50  ? 0.8304 0.9079 0.6194 0.1845  -0.1244 0.0353  17  ALA A CA  
188  C C   . ALA A 50  ? 0.9616 1.0424 0.6958 0.1969  -0.1550 0.0636  17  ALA A C   
189  O O   . ALA A 50  ? 0.9555 1.0429 0.7280 0.1998  -0.1902 0.0718  17  ALA A O   
190  C CB  . ALA A 50  ? 0.7973 0.8670 0.6428 0.1799  -0.0944 0.0610  17  ALA A CB  
191  N N   . LEU A 51  ? 0.9868 1.0641 0.6325 0.2043  -0.1416 0.0797  18  LEU A N   
192  C CA  . LEU A 51  ? 1.0724 1.1524 0.6489 0.2156  -0.1709 0.1107  18  LEU A CA  
193  C C   . LEU A 51  ? 1.1944 1.2823 0.7057 0.2187  -0.2119 0.0776  18  LEU A C   
194  O O   . LEU A 51  ? 1.2525 1.3467 0.7364 0.2258  -0.2557 0.0969  18  LEU A O   
195  C CB  . LEU A 51  ? 1.1338 1.2064 0.6414 0.2217  -0.1362 0.1511  18  LEU A CB  
196  C CG  . LEU A 51  ? 1.1554 1.2192 0.7252 0.2205  -0.1078 0.1975  18  LEU A CG  
197  C CD1 . LEU A 51  ? 1.2151 1.2730 0.7223 0.2236  -0.0649 0.2300  18  LEU A CD1 
198  C CD2 . LEU A 51  ? 1.1974 1.2610 0.8087 0.2269  -0.1440 0.2368  18  LEU A CD2 
199  N N   . LEU A 52  ? 1.1451 1.2320 0.6365 0.2134  -0.2009 0.0279  19  LEU A N   
200  C CA  . LEU A 52  ? 1.2042 1.2958 0.6402 0.2147  -0.2392 -0.0116 19  LEU A CA  
201  C C   . LEU A 52  ? 1.2360 1.3378 0.7479 0.2098  -0.2880 -0.0294 19  LEU A C   
202  O O   . LEU A 52  ? 1.2956 1.4050 0.7698 0.2133  -0.3369 -0.0386 19  LEU A O   
203  C CB  . LEU A 52  ? 1.2055 1.2903 0.6103 0.2110  -0.2110 -0.0604 19  LEU A CB  
204  C CG  . LEU A 52  ? 1.3452 1.4233 0.6460 0.2182  -0.1738 -0.0595 19  LEU A CG  
205  C CD1 . LEU A 52  ? 1.3352 1.4067 0.6338 0.2149  -0.1477 -0.1123 19  LEU A CD1 
206  C CD2 . LEU A 52  ? 1.4972 1.5778 0.6825 0.2271  -0.2066 -0.0524 19  LEU A CD2 
207  N N   . CYS A 53  ? 1.1108 1.2139 0.7287 0.2010  -0.2745 -0.0346 20  CYS A N   
208  C CA  . CYS A 53  ? 1.0673 1.1816 0.7732 0.1949  -0.3094 -0.0504 20  CYS A CA  
209  C C   . CYS A 53  ? 1.1606 1.2873 0.8791 0.2027  -0.3599 -0.0228 20  CYS A C   
210  O O   . CYS A 53  ? 1.1760 1.3133 0.9022 0.2010  -0.4051 -0.0474 20  CYS A O   
211  C CB  . CYS A 53  ? 0.9727 1.0855 0.7766 0.1855  -0.2777 -0.0499 20  CYS A CB  
212  S SG  . CYS A 53  ? 0.9678 1.0728 0.7910 0.1728  -0.2453 -0.0936 20  CYS A SG  
213  N N   . PRO A 54  ? 1.1397 1.2656 0.8653 0.2111  -0.3577 0.0275  21  PRO A N   
214  C CA  . PRO A 54  ? 1.1862 1.3250 0.9319 0.2195  -0.4112 0.0548  21  PRO A CA  
215  C C   . PRO A 54  ? 1.3605 1.5034 0.9955 0.2269  -0.4555 0.0577  21  PRO A C   
216  O O   . PRO A 54  ? 1.3965 1.5532 1.0481 0.2320  -0.5116 0.0707  21  PRO A O   
217  C CB  . PRO A 54  ? 1.1920 1.3241 0.9784 0.2262  -0.3896 0.1075  21  PRO A CB  
218  C CG  . PRO A 54  ? 1.2397 1.3552 0.9721 0.2241  -0.3341 0.1146  21  PRO A CG  
219  C CD  . PRO A 54  ? 1.1360 1.2494 0.8642 0.2130  -0.3097 0.0624  21  PRO A CD  
220  N N   . ILE A 55  ? 1.3825 1.5143 0.9063 0.2275  -0.4305 0.0441  22  ILE A N   
221  C CA  . ILE A 55  ? 1.5066 1.6393 0.9031 0.2335  -0.4629 0.0398  22  ILE A CA  
222  C C   . ILE A 55  ? 1.5961 1.7337 0.9787 0.2261  -0.4957 -0.0242 22  ILE A C   
223  O O   . ILE A 55  ? 1.6768 1.8234 1.0089 0.2287  -0.5537 -0.0323 22  ILE A O   
224  C CB  . ILE A 55  ? 1.6018 1.7201 0.8873 0.2383  -0.4120 0.0576  22  ILE A CB  
225  C CG1 . ILE A 55  ? 1.5975 1.7104 0.9045 0.2447  -0.3845 0.1253  22  ILE A CG1 
226  C CG2 . ILE A 55  ? 1.7460 1.8643 0.8847 0.2437  -0.4388 0.0454  22  ILE A CG2 
227  C CD1 . ILE A 55  ? 1.7162 1.8163 0.9434 0.2474  -0.3238 0.1482  22  ILE A CD1 
228  N N   . ILE A 56  ? 1.4931 1.6239 0.9242 0.2164  -0.4614 -0.0680 23  ILE A N   
229  C CA  . ILE A 56  ? 1.5082 1.6390 0.9397 0.2082  -0.4834 -0.1299 23  ILE A CA  
230  C C   . ILE A 56  ? 1.5204 1.6658 1.0779 0.1994  -0.5217 -0.1459 23  ILE A C   
231  O O   . ILE A 56  ? 1.5430 1.6922 1.1044 0.1932  -0.5601 -0.1896 23  ILE A O   
232  C CB  . ILE A 56  ? 1.5142 1.6285 0.9278 0.2035  -0.4255 -0.1650 23  ILE A CB  
233  C CG1 . ILE A 56  ? 1.6005 1.7039 0.8901 0.2128  -0.3885 -0.1508 23  ILE A CG1 
234  C CG2 . ILE A 56  ? 1.5297 1.6399 0.9561 0.1949  -0.4449 -0.2295 23  ILE A CG2 
235  C CD1 . ILE A 56  ? 1.6759 1.7652 0.9579 0.2107  -0.3251 -0.1749 23  ILE A CD1 
236  N N   . ILE A 57  ? 1.4237 1.5775 1.0840 0.1989  -0.5120 -0.1118 24  ILE A N   
237  C CA  . ILE A 57  ? 1.3728 1.5427 1.1578 0.1910  -0.5402 -0.1236 24  ILE A CA  
238  C C   . ILE A 57  ? 1.4862 1.6746 1.2748 0.1937  -0.6168 -0.1269 24  ILE A C   
239  O O   . ILE A 57  ? 1.4632 1.6607 1.3150 0.1837  -0.6444 -0.1646 24  ILE A O   
240  C CB  . ILE A 57  ? 1.3311 1.5054 1.2228 0.1903  -0.5081 -0.0911 24  ILE A CB  
241  C CG1 . ILE A 57  ? 1.2701 1.4573 1.2853 0.1784  -0.5140 -0.1163 24  ILE A CG1 
242  C CG2 . ILE A 57  ? 1.3753 1.5568 1.2776 0.2030  -0.5260 -0.0371 24  ILE A CG2 
243  C CD1 . ILE A 57  ? 1.3130 1.4980 1.4088 0.1740  -0.4650 -0.1019 24  ILE A CD1 
244  N N   . PRO A 58  ? 1.5210 1.7158 1.2470 0.2056  -0.6551 -0.0897 25  PRO A N   
245  C CA  . PRO A 58  ? 1.5875 1.8015 1.3212 0.2064  -0.7341 -0.0969 25  PRO A CA  
246  C C   . PRO A 58  ? 1.7161 1.9244 1.3566 0.2004  -0.7654 -0.1510 25  PRO A C   
247  O O   . PRO A 58  ? 1.7367 1.9595 1.4201 0.1939  -0.8238 -0.1802 25  PRO A O   
248  C CB  . PRO A 58  ? 1.6800 1.8992 1.3641 0.2210  -0.7610 -0.0364 25  PRO A CB  
249  C CG  . PRO A 58  ? 1.7441 1.9418 1.3374 0.2269  -0.6999 -0.0114 25  PRO A CG  
250  C CD  . PRO A 58  ? 1.5793 1.7646 1.2287 0.2178  -0.6321 -0.0376 25  PRO A CD  
251  N N   . PHE A 59  ? 1.7116 1.8983 1.2325 0.2023  -0.7243 -0.1670 26  PHE A N   
252  C CA  . PHE A 59  ? 1.7916 1.9670 1.2125 0.1981  -0.7392 -0.2231 26  PHE A CA  
253  C C   . PHE A 59  ? 1.7710 1.9443 1.2853 0.1835  -0.7394 -0.2813 26  PHE A C   
254  O O   . PHE A 59  ? 1.8295 2.0055 1.3297 0.1770  -0.7909 -0.3268 26  PHE A O   
255  C CB  . PHE A 59  ? 1.8554 2.0091 1.1519 0.2046  -0.6785 -0.2217 26  PHE A CB  
256  C CG  . PHE A 59  ? 1.9466 2.0840 1.1521 0.2009  -0.6717 -0.2856 26  PHE A CG  
257  C CD1 . PHE A 59  ? 1.9189 2.0401 1.1608 0.1949  -0.6166 -0.3227 26  PHE A CD1 
258  C CD2 . PHE A 59  ? 2.1142 2.2514 1.1956 0.2038  -0.7200 -0.3085 26  PHE A CD2 
259  C CE1 . PHE A 59  ? 1.9980 2.1024 1.1657 0.1929  -0.6080 -0.3835 26  PHE A CE1 
260  C CE2 . PHE A 59  ? 2.2227 2.3426 1.2203 0.2008  -0.7103 -0.3735 26  PHE A CE2 
261  C CZ  . PHE A 59  ? 2.1264 2.2295 1.1728 0.1959  -0.6529 -0.4111 26  PHE A CZ  
262  N N   . LEU A 60  ? 1.6020 1.7702 1.2129 0.1777  -0.6845 -0.2783 27  LEU A N   
263  C CA  . LEU A 60  ? 1.5295 1.6946 1.2375 0.1634  -0.6770 -0.3230 27  LEU A CA  
264  C C   . LEU A 60  ? 1.5435 1.7320 1.3764 0.1551  -0.7282 -0.3246 27  LEU A C   
265  O O   . LEU A 60  ? 1.5306 1.7191 1.4234 0.1426  -0.7485 -0.3687 27  LEU A O   
266  C CB  . LEU A 60  ? 1.4237 1.5768 1.1854 0.1597  -0.6041 -0.3129 27  LEU A CB  
267  C CG  . LEU A 60  ? 1.5000 1.6307 1.1670 0.1651  -0.5496 -0.3207 27  LEU A CG  
268  C CD1 . LEU A 60  ? 1.4021 1.5268 1.1284 0.1626  -0.4875 -0.2961 27  LEU A CD1 
269  C CD2 . LEU A 60  ? 1.5774 1.6914 1.2079 0.1597  -0.5530 -0.3823 27  LEU A CD2 
270  N N   . HIS A 61  ? 1.4808 1.6893 1.3617 0.1620  -0.7478 -0.2762 28  HIS A N   
271  C CA  . HIS A 61  ? 1.4504 1.6852 1.4591 0.1562  -0.7950 -0.2725 28  HIS A CA  
272  C C   . HIS A 61  ? 1.5970 1.8442 1.5693 0.1553  -0.8785 -0.2966 28  HIS A C   
273  O O   . HIS A 61  ? 1.5797 1.8450 1.6569 0.1450  -0.9213 -0.3185 28  HIS A O   
274  C CB  . HIS A 61  ? 1.4138 1.6645 1.4912 0.1657  -0.7856 -0.2148 28  HIS A CB  
275  C CG  . HIS A 61  ? 1.4079 1.6855 1.6424 0.1590  -0.8123 -0.2126 28  HIS A CG  
276  N ND1 . HIS A 61  ? 1.3325 1.6123 1.6789 0.1486  -0.7643 -0.2196 28  HIS A ND1 
277  C CD2 . HIS A 61  ? 1.4730 1.7771 1.7685 0.1611  -0.8813 -0.2046 28  HIS A CD2 
278  C CE1 . HIS A 61  ? 1.3086 1.6162 1.7821 0.1449  -0.7998 -0.2158 28  HIS A CE1 
279  N NE2 . HIS A 61  ? 1.3920 1.7158 1.8462 0.1524  -0.8721 -0.2070 28  HIS A NE2 
280  N N   . LYS A 62  ? 1.6547 1.8926 1.4773 0.1652  -0.9011 -0.2928 29  LYS A N   
281  C CA  . LYS A 62  ? 1.7705 2.0170 1.5254 0.1646  -0.9816 -0.3174 29  LYS A CA  
282  C C   . LYS A 62  ? 1.8407 2.0740 1.5877 0.1503  -0.9945 -0.3919 29  LYS A C   
283  O O   . LYS A 62  ? 1.8982 2.1445 1.6702 0.1425  -1.0660 -0.4239 29  LYS A O   
284  C CB  . LYS A 62  ? 1.9154 2.1530 1.4983 0.1786  -0.9908 -0.2904 29  LYS A CB  
285  C CG  . LYS A 62  ? 2.1033 2.3610 1.6998 0.1912  -1.0257 -0.2215 29  LYS A CG  
286  C CD  . LYS A 62  ? 2.3384 2.5859 1.7610 0.2042  -1.0312 -0.1885 29  LYS A CD  
287  C CE  . LYS A 62  ? 2.4121 2.6473 1.8172 0.2149  -0.9591 -0.1325 29  LYS A CE  
288  N NZ  . LYS A 62  ? 2.6424 2.8688 1.8846 0.2267  -0.9630 -0.0942 29  LYS A NZ  
289  N N   . LEU A 63  ? 1.7446 1.9519 1.4666 0.1469  -0.9271 -0.4191 30  LEU A N   
290  C CA  . LEU A 63  ? 1.7547 1.9439 1.4820 0.1343  -0.9265 -0.4882 30  LEU A CA  
291  C C   . LEU A 63  ? 1.7168 1.9187 1.6198 0.1183  -0.9389 -0.5046 30  LEU A C   
292  O O   . LEU A 63  ? 1.7512 1.9503 1.6886 0.1059  -0.9799 -0.5578 30  LEU A O   
293  C CB  . LEU A 63  ? 1.7249 1.8845 1.3913 0.1374  -0.8471 -0.5019 30  LEU A CB  
294  C CG  . LEU A 63  ? 1.8857 2.0284 1.3756 0.1500  -0.8298 -0.5063 30  LEU A CG  
295  C CD1 . LEU A 63  ? 1.8237 1.9512 1.2875 0.1577  -0.7451 -0.4786 30  LEU A CD1 
296  C CD2 . LEU A 63  ? 2.0197 2.1433 1.4339 0.1448  -0.8527 -0.5807 30  LEU A CD2 
297  N N   . LYS A 64  ? 1.5610 1.7766 1.5751 0.1182  -0.9019 -0.4595 31  LYS A N   
298  C CA  . LYS A 64  ? 1.4717 1.7018 1.6543 0.1037  -0.9008 -0.4643 31  LYS A CA  
299  C C   . LYS A 64  ? 1.5517 1.8136 1.8217 0.0988  -0.9787 -0.4639 31  LYS A C   
300  O O   . LYS A 64  ? 1.5368 1.8054 1.9096 0.0831  -1.0061 -0.4989 31  LYS A O   
301  C CB  . LYS A 64  ? 1.3874 1.6215 1.6414 0.1062  -0.8329 -0.4167 31  LYS A CB  
302  C CG  . LYS A 64  ? 1.4442 1.6803 1.8375 0.0899  -0.8003 -0.4275 31  LYS A CG  
303  C CD  . LYS A 64  ? 1.5304 1.7351 1.8912 0.0828  -0.7530 -0.4591 31  LYS A CD  
304  C CE  . LYS A 64  ? 1.5592 1.7645 2.0441 0.0684  -0.7097 -0.4536 31  LYS A CE  
305  N NZ  . LYS A 64  ? 1.5934 1.7994 2.0815 0.0741  -0.6474 -0.4077 31  LYS A NZ  
306  N N   . PHE A 65  ? 1.5476 1.8291 1.7849 0.1121  -1.0152 -0.4222 32  PHE A N   
307  C CA  . PHE A 65  ? 2.0435 2.3585 2.3649 0.1103  -1.0934 -0.4136 32  PHE A CA  
308  C C   . PHE A 65  ? 2.3347 2.6492 2.5582 0.1087  -1.1753 -0.4518 32  PHE A C   
309  O O   . PHE A 65  ? 1.8400 2.1470 1.9160 0.1215  -1.1938 -0.4371 32  PHE A O   
310  C CB  . PHE A 65  ? 2.0441 2.3802 2.3931 0.1261  -1.0934 -0.3464 32  PHE A CB  
311  C CG  . PHE A 65  ? 1.9763 2.3420 2.5139 0.1216  -1.0884 -0.3232 32  PHE A CG  
312  C CD1 . PHE A 65  ? 2.0464 2.4460 2.6899 0.1181  -1.1636 -0.3230 32  PHE A CD1 
313  C CD2 . PHE A 65  ? 1.8963 2.2573 2.5052 0.1210  -1.0083 -0.3015 32  PHE A CD2 
314  C CE1 . PHE A 65  ? 1.9780 2.4070 2.8033 0.1147  -1.1533 -0.3018 32  PHE A CE1 
315  C CE2 . PHE A 65  ? 1.8589 2.2475 2.6368 0.1171  -0.9979 -0.2824 32  PHE A CE2 
316  C CZ  . PHE A 65  ? 1.8632 2.2860 2.7516 0.1145  -1.0677 -0.2825 32  PHE A CZ  
317  N N   . GLY A 82  ? 0.9028 1.1684 1.7791 0.0455  -0.5122 -0.3108 49  GLY A N   
318  C CA  . GLY A 82  ? 0.9256 1.2178 1.8390 0.0558  -0.5561 -0.3000 49  GLY A CA  
319  C C   . GLY A 82  ? 1.0023 1.2877 1.8060 0.0755  -0.5714 -0.2835 49  GLY A C   
320  O O   . GLY A 82  ? 1.0366 1.3413 1.8571 0.0857  -0.6164 -0.2722 49  GLY A O   
321  N N   . THR A 83  ? 0.9333 1.1919 1.6290 0.0808  -0.5345 -0.2792 50  THR A N   
322  C CA  . THR A 83  ? 0.9528 1.2012 1.5387 0.0980  -0.5378 -0.2609 50  THR A CA  
323  C C   . THR A 83  ? 1.0310 1.2579 1.5026 0.1008  -0.5604 -0.2892 50  THR A C   
324  O O   . THR A 83  ? 1.0318 1.2471 1.5149 0.0892  -0.5585 -0.3214 50  THR A O   
325  C CB  . THR A 83  ? 1.0254 1.2644 1.5960 0.1016  -0.4752 -0.2319 50  THR A CB  
326  O OG1 . THR A 83  ? 1.0993 1.3486 1.6691 0.1160  -0.4836 -0.2004 50  THR A OG1 
327  C CG2 . THR A 83  ? 0.9758 1.1866 1.4447 0.1024  -0.4394 -0.2367 50  THR A CG2 
328  N N   . PRO A 84  ? 1.0101 1.2308 1.3747 0.1156  -0.5800 -0.2786 51  PRO A N   
329  C CA  . PRO A 84  ? 1.0658 1.2668 1.3205 0.1180  -0.5954 -0.3097 51  PRO A CA  
330  C C   . PRO A 84  ? 1.0651 1.2405 1.2799 0.1136  -0.5411 -0.3242 51  PRO A C   
331  O O   . PRO A 84  ? 1.0106 1.1789 1.2115 0.1170  -0.4920 -0.2973 51  PRO A O   
332  C CB  . PRO A 84  ? 1.1501 1.3517 1.3023 0.1348  -0.6144 -0.2832 51  PRO A CB  
333  C CG  . PRO A 84  ? 1.1515 1.3627 1.3505 0.1413  -0.5865 -0.2361 51  PRO A CG  
334  C CD  . PRO A 84  ? 1.0361 1.2665 1.3762 0.1306  -0.5876 -0.2377 51  PRO A CD  
335  N N   . THR A 85  ? 1.0390 1.2005 1.2445 0.1058  -0.5522 -0.3678 52  THR A N   
336  C CA  . THR A 85  ? 1.0113 1.1481 1.1894 0.1022  -0.5071 -0.3851 52  THR A CA  
337  C C   . THR A 85  ? 1.1208 1.2407 1.1666 0.1154  -0.4997 -0.3965 52  THR A C   
338  O O   . THR A 85  ? 1.1689 1.2966 1.1434 0.1268  -0.5199 -0.3788 52  THR A O   
339  C CB  . THR A 85  ? 1.0695 1.1990 1.3290 0.0865  -0.5174 -0.4224 52  THR A CB  
340  O OG1 . THR A 85  ? 1.0130 1.1193 1.2622 0.0835  -0.4725 -0.4317 52  THR A OG1 
341  C CG2 . THR A 85  ? 1.1328 1.2608 1.3742 0.0845  -0.5757 -0.4683 52  THR A CG2 
342  N N   . MET A 86  ? 1.0732 1.1704 1.0904 0.1141  -0.4685 -0.4229 53  MET A N   
343  C CA  . MET A 86  ? 1.1331 1.2134 1.0357 0.1258  -0.4519 -0.4400 53  MET A CA  
344  C C   . MET A 86  ? 1.1555 1.2386 0.9909 0.1379  -0.4158 -0.3957 53  MET A C   
345  O O   . MET A 86  ? 1.2198 1.2969 0.9510 0.1491  -0.4112 -0.3992 53  MET A O   
346  C CB  . MET A 86  ? 1.2721 1.3512 1.1033 0.1295  -0.5035 -0.4793 53  MET A CB  
347  C CG  . MET A 86  ? 1.3855 1.4403 1.1564 0.1320  -0.4910 -0.5309 53  MET A CG  
348  S SD  . MET A 86  ? 1.5616 1.6134 1.2869 0.1289  -0.5610 -0.5923 53  MET A SD  
349  C CE  . MET A 86  ? 1.6146 1.6792 1.1925 0.1442  -0.5819 -0.5649 53  MET A CE  
350  N N   . GLY A 87  ? 1.0199 1.1108 0.9164 0.1345  -0.3879 -0.3562 54  GLY A N   
351  C CA  . GLY A 87  ? 0.9906 1.0832 0.8480 0.1431  -0.3528 -0.3136 54  GLY A CA  
352  C C   . GLY A 87  ? 1.0118 1.0886 0.8391 0.1455  -0.3021 -0.3153 54  GLY A C   
353  O O   . GLY A 87  ? 0.9927 1.0698 0.7869 0.1520  -0.2714 -0.2831 54  GLY A O   
354  N N   . GLY A 88  ? 0.9653 1.0285 0.8129 0.1403  -0.2946 -0.3525 55  GLY A N   
355  C CA  . GLY A 88  ? 0.9466 0.9950 0.7790 0.1431  -0.2507 -0.3602 55  GLY A CA  
356  C C   . GLY A 88  ? 1.0547 1.0972 0.7827 0.1570  -0.2349 -0.3679 55  GLY A C   
357  O O   . GLY A 88  ? 1.0329 1.0690 0.7447 0.1620  -0.1921 -0.3599 55  GLY A O   
358  N N   . LEU A 89  ? 1.0876 1.1339 0.7441 0.1630  -0.2701 -0.3819 56  LEU A N   
359  C CA  . LEU A 89  ? 1.1721 1.2147 0.7127 0.1758  -0.2594 -0.3869 56  LEU A CA  
360  C C   . LEU A 89  ? 1.1966 1.2475 0.7064 0.1825  -0.2289 -0.3320 56  LEU A C   
361  O O   . LEU A 89  ? 1.2319 1.2776 0.6763 0.1912  -0.1915 -0.3279 56  LEU A O   
362  C CB  . LEU A 89  ? 1.2639 1.3108 0.7374 0.1782  -0.3134 -0.4089 56  LEU A CB  
363  C CG  . LEU A 89  ? 1.3703 1.4051 0.8483 0.1732  -0.3422 -0.4732 56  LEU A CG  
364  C CD1 . LEU A 89  ? 1.4283 1.4735 0.8889 0.1697  -0.4097 -0.4862 56  LEU A CD1 
365  C CD2 . LEU A 89  ? 1.4850 1.5028 0.8739 0.1823  -0.3120 -0.5136 56  LEU A CD2 
366  N N   . ILE A 90  ? 1.0885 1.1515 0.6537 0.1781  -0.2416 -0.2913 57  ILE A N   
367  C CA  . ILE A 90  ? 1.0605 1.1293 0.6176 0.1826  -0.2149 -0.2391 57  ILE A CA  
368  C C   . ILE A 90  ? 1.0383 1.1004 0.6350 0.1797  -0.1626 -0.2322 57  ILE A C   
369  O O   . ILE A 90  ? 1.0576 1.1183 0.6131 0.1863  -0.1273 -0.2090 57  ILE A O   
370  C CB  . ILE A 90  ? 1.0524 1.1338 0.6708 0.1788  -0.2422 -0.2045 57  ILE A CB  
371  C CG1 . ILE A 90  ? 1.1208 1.2117 0.7093 0.1823  -0.2994 -0.2088 57  ILE A CG1 
372  C CG2 . ILE A 90  ? 1.0399 1.1230 0.6576 0.1831  -0.2125 -0.1539 57  ILE A CG2 
373  C CD1 . ILE A 90  ? 1.1550 1.2603 0.8288 0.1781  -0.3310 -0.1856 57  ILE A CD1 
374  N N   . ILE A 91  ? 0.9108 0.9694 0.5890 0.1695  -0.1592 -0.2505 58  ILE A N   
375  C CA  . ILE A 91  ? 0.8427 0.8961 0.5678 0.1652  -0.1189 -0.2454 58  ILE A CA  
376  C C   . ILE A 91  ? 0.9384 0.9829 0.6146 0.1739  -0.0871 -0.2671 58  ILE A C   
377  O O   . ILE A 91  ? 0.9254 0.9709 0.5978 0.1772  -0.0491 -0.2453 58  ILE A O   
378  C CB  . ILE A 91  ? 0.8118 0.8630 0.6261 0.1521  -0.1281 -0.2592 58  ILE A CB  
379  C CG1 . ILE A 91  ? 0.7660 0.8278 0.6315 0.1437  -0.1494 -0.2361 58  ILE A CG1 
380  C CG2 . ILE A 91  ? 0.7709 0.8163 0.6277 0.1481  -0.0920 -0.2541 58  ILE A CG2 
381  C CD1 . ILE A 91  ? 0.7944 0.8561 0.7351 0.1309  -0.1653 -0.2521 58  ILE A CD1 
382  N N   . LEU A 92  ? 0.9418 0.9779 0.5839 0.1775  -0.1020 -0.3117 59  LEU A N   
383  C CA  . LEU A 92  ? 0.9884 1.0148 0.5830 0.1869  -0.0713 -0.3417 59  LEU A CA  
384  C C   . LEU A 92  ? 1.0964 1.1275 0.5933 0.1985  -0.0479 -0.3228 59  LEU A C   
385  O O   . LEU A 92  ? 1.0948 1.1250 0.5834 0.2045  -0.0015 -0.3168 59  LEU A O   
386  C CB  . LEU A 92  ? 1.0407 1.0548 0.6250 0.1870  -0.0963 -0.3988 59  LEU A CB  
387  C CG  . LEU A 92  ? 1.0434 1.0471 0.7273 0.1779  -0.1002 -0.4225 59  LEU A CG  
388  C CD1 . LEU A 92  ? 1.0938 1.0867 0.7788 0.1744  -0.1395 -0.4726 59  LEU A CD1 
389  C CD2 . LEU A 92  ? 1.0648 1.0595 0.7789 0.1834  -0.0540 -0.4327 59  LEU A CD2 
390  N N   . SER A 93  ? 1.1082 1.1454 0.5376 0.2013  -0.0795 -0.3085 60  SER A N   
391  C CA  . SER A 93  ? 1.1878 1.2294 0.5180 0.2114  -0.0617 -0.2818 60  SER A CA  
392  C C   . SER A 93  ? 1.1888 1.2360 0.5496 0.2120  -0.0166 -0.2337 60  SER A C   
393  O O   . SER A 93  ? 1.2354 1.2824 0.5466 0.2196  0.0271  -0.2267 60  SER A O   
394  C CB  . SER A 93  ? 1.2821 1.3312 0.5627 0.2122  -0.1107 -0.2602 60  SER A CB  
395  O OG  . SER A 93  ? 1.4868 1.5318 0.7183 0.2126  -0.1528 -0.3057 60  SER A OG  
396  N N   . SER A 94  ? 1.0495 1.1016 0.4968 0.2030  -0.0255 -0.2043 61  SER A N   
397  C CA  . SER A 94  ? 0.9921 1.0486 0.4846 0.2005  0.0091  -0.1620 61  SER A CA  
398  C C   . SER A 94  ? 1.0180 1.0723 0.5522 0.2003  0.0543  -0.1753 61  SER A C   
399  O O   . SER A 94  ? 1.0275 1.0857 0.5537 0.2038  0.0944  -0.1492 61  SER A O   
400  C CB  . SER A 94  ? 0.9418 1.0020 0.5145 0.1902  -0.0152 -0.1396 61  SER A CB  
401  O OG  . SER A 94  ? 1.0142 1.0771 0.6211 0.1876  0.0132  -0.0996 61  SER A OG  
402  N N   . ILE A 95  ? 0.9365 0.9850 0.5211 0.1961  0.0475  -0.2136 62  ILE A N   
403  C CA  . ILE A 95  ? 0.9101 0.9566 0.5461 0.1967  0.0841  -0.2271 62  ILE A CA  
404  C C   . ILE A 95  ? 1.0574 1.1023 0.6270 0.2098  0.1237  -0.2455 62  ILE A C   
405  O O   . ILE A 95  ? 1.0564 1.1076 0.6453 0.2130  0.1671  -0.2265 62  ILE A O   
406  C CB  . ILE A 95  ? 0.8995 0.9382 0.6077 0.1895  0.0639  -0.2595 62  ILE A CB  
407  C CG1 . ILE A 95  ? 0.8226 0.8649 0.5979 0.1755  0.0362  -0.2362 62  ILE A CG1 
408  C CG2 . ILE A 95  ? 0.8901 0.9257 0.6502 0.1929  0.0992  -0.2756 62  ILE A CG2 
409  C CD1 . ILE A 95  ? 0.8721 0.9066 0.6969 0.1674  0.0052  -0.2644 62  ILE A CD1 
410  N N   . ILE A 96  ? 1.0898 1.1272 0.5809 0.2168  0.1089  -0.2829 63  ILE A N   
411  C CA  . ILE A 96  ? 1.1810 1.2150 0.5930 0.2294  0.1456  -0.3096 63  ILE A CA  
412  C C   . ILE A 96  ? 1.2720 1.3164 0.6244 0.2351  0.1837  -0.2651 63  ILE A C   
413  O O   . ILE A 96  ? 1.2943 1.3423 0.6508 0.2418  0.2370  -0.2663 63  ILE A O   
414  C CB  . ILE A 96  ? 1.3052 1.3283 0.6351 0.2336  0.1138  -0.3599 63  ILE A CB  
415  C CG1 . ILE A 96  ? 1.2616 1.2726 0.6668 0.2271  0.0823  -0.4047 63  ILE A CG1 
416  C CG2 . ILE A 96  ? 1.4303 1.4491 0.6662 0.2467  0.1569  -0.3909 63  ILE A CG2 
417  C CD1 . ILE A 96  ? 1.3800 1.3834 0.7362 0.2243  0.0275  -0.4402 63  ILE A CD1 
418  N N   . ILE A 97  ? 1.2334 1.2829 0.5434 0.2324  0.1582  -0.2236 64  ILE A N   
419  C CA  . ILE A 97  ? 1.2795 1.3369 0.5375 0.2366  0.1903  -0.1738 64  ILE A CA  
420  C C   . ILE A 97  ? 1.2735 1.3389 0.6212 0.2328  0.2350  -0.1413 64  ILE A C   
421  O O   . ILE A 97  ? 1.3155 1.3865 0.6378 0.2392  0.2877  -0.1289 64  ILE A O   
422  C CB  . ILE A 97  ? 1.3345 1.3938 0.5481 0.2344  0.1474  -0.1328 64  ILE A CB  
423  C CG1 . ILE A 97  ? 1.4236 1.4781 0.5421 0.2385  0.1003  -0.1628 64  ILE A CG1 
424  C CG2 . ILE A 97  ? 1.3822 1.4475 0.5596 0.2374  0.1809  -0.0730 64  ILE A CG2 
425  C CD1 . ILE A 97  ? 1.6728 1.7236 0.6613 0.2492  0.1237  -0.1918 64  ILE A CD1 
426  N N   . THR A 98  ? 1.1357 1.2024 0.5874 0.2219  0.2143  -0.1295 65  THR A N   
427  C CA  . THR A 98  ? 1.0680 1.1422 0.6121 0.2156  0.2447  -0.1012 65  THR A CA  
428  C C   . THR A 98  ? 1.1336 1.2116 0.7220 0.2202  0.2873  -0.1279 65  THR A C   
429  O O   . THR A 98  ? 1.1463 1.2336 0.7510 0.2231  0.3347  -0.1056 65  THR A O   
430  C CB  . THR A 98  ? 1.0405 1.1138 0.6697 0.2023  0.2070  -0.0895 65  THR A CB  
431  O OG1 . THR A 98  ? 1.0542 1.1246 0.6479 0.2002  0.1708  -0.0679 65  THR A OG1 
432  C CG2 . THR A 98  ? 0.9402 1.0208 0.6564 0.1940  0.2308  -0.0593 65  THR A CG2 
433  N N   . SER A 99  ? 1.0824 1.1532 0.6981 0.2211  0.2709  -0.1740 66  SER A N   
434  C CA  . SER A 99  ? 1.0822 1.1544 0.7546 0.2265  0.3050  -0.2028 66  SER A CA  
435  C C   . SER A 99  ? 1.2394 1.3138 0.8460 0.2409  0.3581  -0.2217 66  SER A C   
436  O O   . SER A 99  ? 1.2366 1.3175 0.9034 0.2463  0.4002  -0.2319 66  SER A O   
437  C CB  . SER A 99  ? 1.0991 1.1597 0.8154 0.2240  0.2712  -0.2448 66  SER A CB  
438  O OG  . SER A 99  ? 1.2863 1.3349 0.9212 0.2283  0.2447  -0.2801 66  SER A OG  
439  N N   . VAL A 100 ? 1.2853 1.3555 0.7699 0.2472  0.3572  -0.2248 67  VAL A N   
440  C CA  . VAL A 100 ? 1.3930 1.4646 0.7931 0.2604  0.4089  -0.2431 67  VAL A CA  
441  C C   . VAL A 100 ? 1.4567 1.5446 0.8768 0.2618  0.4675  -0.1960 67  VAL A C   
442  O O   . VAL A 100 ? 1.5182 1.6118 0.9224 0.2720  0.5259  -0.2122 67  VAL A O   
443  C CB  . VAL A 100 ? 1.5463 1.6085 0.8018 0.2655  0.3854  -0.2611 67  VAL A CB  
444  C CG1 . VAL A 100 ? 1.6057 1.6756 0.7738 0.2662  0.3989  -0.2065 67  VAL A CG1 
445  C CG2 . VAL A 100 ? 1.6427 1.6960 0.8356 0.2775  0.4142  -0.3238 67  VAL A CG2 
446  N N   . PHE A 101 ? 1.3502 1.4453 0.8141 0.2514  0.4538  -0.1405 68  PHE A N   
447  C CA  . PHE A 101 ? 1.3511 1.4609 0.8520 0.2497  0.5036  -0.0921 68  PHE A CA  
448  C C   . PHE A 101 ? 1.3192 1.4404 0.9568 0.2470  0.5300  -0.0971 68  PHE A C   
449  O O   . PHE A 101 ? 1.3371 1.4730 1.0131 0.2490  0.5847  -0.0736 68  PHE A O   
450  C CB  . PHE A 101 ? 1.3366 1.4466 0.8468 0.2388  0.4755  -0.0351 68  PHE A CB  
451  C CG  . PHE A 101 ? 1.4157 1.5157 0.8162 0.2400  0.4376  -0.0201 68  PHE A CG  
452  C CD1 . PHE A 101 ? 1.5802 1.6797 0.8564 0.2496  0.4636  -0.0116 68  PHE A CD1 
453  C CD2 . PHE A 101 ? 1.3803 1.4730 0.8049 0.2314  0.3775  -0.0096 68  PHE A CD2 
454  C CE1 . PHE A 101 ? 1.6490 1.7406 0.8272 0.2507  0.4228  0.0071  68  PHE A CE1 
455  C CE2 . PHE A 101 ? 1.4684 1.5542 0.8056 0.2333  0.3407  0.0077  68  PHE A CE2 
456  C CZ  . PHE A 101 ? 1.5667 1.6521 0.7821 0.2429  0.3605  0.0171  68  PHE A CZ  
457  N N   . TYR A 102 ? 1.1817 1.2976 0.8965 0.2418  0.4901  -0.1240 69  TYR A N   
458  C CA  . TYR A 102 ? 1.1016 1.2279 0.9488 0.2382  0.5018  -0.1262 69  TYR A CA  
459  C C   . TYR A 102 ? 1.1897 1.3158 1.0689 0.2507  0.5318  -0.1745 69  TYR A C   
460  O O   . TYR A 102 ? 1.1455 1.2848 1.1337 0.2511  0.5559  -0.1706 69  TYR A O   
461  C CB  . TYR A 102 ? 1.0054 1.1269 0.9237 0.2237  0.4426  -0.1182 69  TYR A CB  
462  C CG  . TYR A 102 ? 0.9783 1.1022 0.9010 0.2109  0.4223  -0.0708 69  TYR A CG  
463  C CD1 . TYR A 102 ? 1.0089 1.1211 0.8559 0.2076  0.3846  -0.0621 69  TYR A CD1 
464  C CD2 . TYR A 102 ? 0.9410 1.0787 0.9524 0.2020  0.4392  -0.0363 69  TYR A CD2 
465  C CE1 . TYR A 102 ? 0.9811 1.0936 0.8403 0.1972  0.3680  -0.0208 69  TYR A CE1 
466  C CE2 . TYR A 102 ? 0.9197 1.0564 0.9405 0.1900  0.4211  0.0028  69  TYR A CE2 
467  C CZ  . TYR A 102 ? 1.0011 1.1243 0.9462 0.1882  0.3870  0.0101  69  TYR A CZ  
468  O OH  . TYR A 102 ? 0.9517 1.0720 0.9136 0.1777  0.3710  0.0465  69  TYR A OH  
469  N N   . ILE A 103 ? 1.2235 1.3348 1.0139 0.2611  0.5298  -0.2206 70  ILE A N   
470  C CA  . ILE A 103 ? 1.2629 1.3689 1.0763 0.2743  0.5582  -0.2747 70  ILE A CA  
471  C C   . ILE A 103 ? 1.3450 1.4698 1.2127 0.2845  0.6340  -0.2700 70  ILE A C   
472  O O   . ILE A 103 ? 1.2972 1.4266 1.2776 0.2888  0.6458  -0.2885 70  ILE A O   
473  C CB  . ILE A 103 ? 1.3941 1.4804 1.0837 0.2827  0.5463  -0.3252 70  ILE A CB  
474  C CG1 . ILE A 103 ? 1.3436 1.4122 1.0477 0.2743  0.4753  -0.3470 70  ILE A CG1 
475  C CG2 . ILE A 103 ? 1.4855 1.5678 1.1667 0.2995  0.6007  -0.3797 70  ILE A CG2 
476  C CD1 . ILE A 103 ? 1.5076 1.5605 1.0858 0.2750  0.4401  -0.3747 70  ILE A CD1 
477  N N   . PRO A 104 ? 1.3768 1.5141 1.1817 0.2879  0.6853  -0.2416 71  PRO A N   
478  C CA  . PRO A 104 ? 1.4111 1.5686 1.2826 0.2970  0.7605  -0.2377 71  PRO A CA  
479  C C   . PRO A 104 ? 1.3751 1.5527 1.4122 0.2890  0.7620  -0.2042 71  PRO A C   
480  O O   . PRO A 104 ? 1.3804 1.5724 1.5116 0.2982  0.8087  -0.2182 71  PRO A O   
481  C CB  . PRO A 104 ? 1.5245 1.6897 1.2857 0.2986  0.8064  -0.2040 71  PRO A CB  
482  C CG  . PRO A 104 ? 1.5526 1.7073 1.2432 0.2859  0.7468  -0.1686 71  PRO A CG  
483  C CD  . PRO A 104 ? 1.4579 1.5919 1.1317 0.2844  0.6803  -0.2108 71  PRO A CD  
484  N N   . SER A 105 ? 1.2535 1.4325 1.3283 0.2721  0.7106  -0.1625 72  SER A N   
485  C CA  . SER A 105 ? 1.1639 1.3607 1.3851 0.2613  0.7003  -0.1301 72  SER A CA  
486  C C   . SER A 105 ? 1.1310 1.3208 1.4419 0.2578  0.6477  -0.1529 72  SER A C   
487  O O   . SER A 105 ? 1.0798 1.2854 1.5203 0.2574  0.6548  -0.1474 72  SER A O   
488  C CB  . SER A 105 ? 1.1790 1.3789 1.3916 0.2444  0.6740  -0.0770 72  SER A CB  
489  O OG  . SER A 105 ? 1.2402 1.4575 1.5885 0.2325  0.6641  -0.0481 72  SER A OG  
490  N N   . TYR A 106 ? 1.0711 1.2382 1.3163 0.2547  0.5940  -0.1748 73  TYR A N   
491  C CA  . TYR A 106 ? 1.0005 1.1573 1.3124 0.2501  0.5418  -0.1929 73  TYR A CA  
492  C C   . TYR A 106 ? 1.0994 1.2357 1.3626 0.2637  0.5431  -0.2493 73  TYR A C   
493  O O   . TYR A 106 ? 1.1069 1.2244 1.2814 0.2607  0.5067  -0.2659 73  TYR A O   
494  C CB  . TYR A 106 ? 0.9483 1.0957 1.2329 0.2324  0.4776  -0.1686 73  TYR A CB  
495  C CG  . TYR A 106 ? 0.9144 1.0768 1.2481 0.2173  0.4681  -0.1198 73  TYR A CG  
496  C CD1 . TYR A 106 ? 0.9702 1.1382 1.2479 0.2146  0.4923  -0.0899 73  TYR A CD1 
497  C CD2 . TYR A 106 ? 0.8462 1.0144 1.2749 0.2042  0.4287  -0.1035 73  TYR A CD2 
498  C CE1 . TYR A 106 ? 0.9319 1.1102 1.2597 0.1997  0.4813  -0.0484 73  TYR A CE1 
499  C CE2 . TYR A 106 ? 0.8137 0.9931 1.2825 0.1888  0.4154  -0.0649 73  TYR A CE2 
500  C CZ  . TYR A 106 ? 0.9368 1.1204 1.3596 0.1866  0.4423  -0.0392 73  TYR A CZ  
501  O OH  . TYR A 106 ? 0.9207 1.1127 1.3912 0.1709  0.4291  -0.0043 73  TYR A OH  
502  N N   . PRO A 107 ? 1.0888 1.2283 1.4130 0.2789  0.5852  -0.2816 74  PRO A N   
503  C CA  . PRO A 107 ? 1.1439 1.2609 1.4225 0.2917  0.5885  -0.3408 74  PRO A CA  
504  C C   . PRO A 107 ? 1.1347 1.2309 1.4496 0.2854  0.5264  -0.3593 74  PRO A C   
505  O O   . PRO A 107 ? 1.1772 1.2510 1.4220 0.2899  0.5122  -0.4021 74  PRO A O   
506  C CB  . PRO A 107 ? 1.2113 1.3389 1.5666 0.3094  0.6537  -0.3670 74  PRO A CB  
507  C CG  . PRO A 107 ? 1.2003 1.3546 1.6858 0.3035  0.6614  -0.3211 74  PRO A CG  
508  C CD  . PRO A 107 ? 1.1015 1.2653 1.5427 0.2855  0.6338  -0.2684 74  PRO A CD  
509  N N   . LYS A 108 ? 0.9886 1.0916 1.4073 0.2739  0.4879  -0.3264 75  LYS A N   
510  C CA  . LYS A 108 ? 0.9281 1.0130 1.3895 0.2664  0.4316  -0.3347 75  LYS A CA  
511  C C   . LYS A 108 ? 0.9537 1.0216 1.3137 0.2546  0.3838  -0.3373 75  LYS A C   
512  O O   . LYS A 108 ? 0.9120 0.9637 1.2978 0.2482  0.3411  -0.3468 75  LYS A O   
513  C CB  . LYS A 108 ? 0.8728 0.9715 1.4552 0.2557  0.4030  -0.2933 75  LYS A CB  
514  C CG  . LYS A 108 ? 0.9167 1.0242 1.6295 0.2686  0.4306  -0.3017 75  LYS A CG  
515  C CD  . LYS A 108 ? 0.9127 1.0277 1.7366 0.2570  0.3849  -0.2645 75  LYS A CD  
516  C CE  . LYS A 108 ? 1.0018 1.1434 1.9499 0.2633  0.4122  -0.2439 75  LYS A CE  
517  N NZ  . LYS A 108 ? 1.0256 1.1791 2.0593 0.2479  0.3609  -0.1990 75  LYS A NZ  
518  N N   . ILE A 109 ? 0.9355 1.0077 1.1865 0.2524  0.3927  -0.3275 76  ILE A N   
519  C CA  . ILE A 109 ? 0.9289 0.9889 1.0822 0.2435  0.3524  -0.3288 76  ILE A CA  
520  C C   . ILE A 109 ? 1.0429 1.0807 1.1380 0.2525  0.3472  -0.3855 76  ILE A C   
521  O O   . ILE A 109 ? 1.0210 1.0442 1.1047 0.2443  0.3010  -0.3968 76  ILE A O   
522  C CB  . ILE A 109 ? 0.9859 1.0584 1.0530 0.2406  0.3673  -0.2965 76  ILE A CB  
523  C CG1 . ILE A 109 ? 0.9130 1.0014 1.0393 0.2267  0.3539  -0.2433 76  ILE A CG1 
524  C CG2 . ILE A 109 ? 1.0344 1.0943 0.9858 0.2381  0.3370  -0.3081 76  ILE A CG2 
525  C CD1 . ILE A 109 ? 1.0238 1.1234 1.0904 0.2236  0.3719  -0.2071 76  ILE A CD1 
526  N N   . ILE A 110 ? 1.0790 1.1146 1.1403 0.2687  0.3959  -0.4224 77  ILE A N   
527  C CA  . ILE A 110 ? 1.1596 1.1739 1.1577 0.2786  0.3991  -0.4843 77  ILE A CA  
528  C C   . ILE A 110 ? 1.1782 1.1701 1.2387 0.2732  0.3522  -0.5131 77  ILE A C   
529  O O   . ILE A 110 ? 1.1979 1.1761 1.1898 0.2673  0.3144  -0.5337 77  ILE A O   
530  C CB  . ILE A 110 ? 1.2820 1.2980 1.2743 0.2976  0.4672  -0.5217 77  ILE A CB  
531  C CG1 . ILE A 110 ? 1.3295 1.3671 1.2482 0.3011  0.5144  -0.4895 77  ILE A CG1 
532  C CG2 . ILE A 110 ? 1.3809 1.3718 1.3040 0.3071  0.4687  -0.5935 77  ILE A CG2 
533  C CD1 . ILE A 110 ? 1.4744 1.5251 1.4371 0.3165  0.5892  -0.5011 77  ILE A CD1 
534  N N   . PRO A 111 ? 1.0792 1.0676 1.2698 0.2738  0.3498  -0.5104 78  PRO A N   
535  C CA  . PRO A 111 ? 1.0503 1.0159 1.2968 0.2674  0.3058  -0.5319 78  PRO A CA  
536  C C   . PRO A 111 ? 1.0413 1.0064 1.2643 0.2484  0.2490  -0.5005 78  PRO A C   
537  O O   . PRO A 111 ? 1.0484 0.9946 1.2552 0.2432  0.2154  -0.5294 78  PRO A O   
538  C CB  . PRO A 111 ? 1.0248 0.9921 1.4150 0.2711  0.3153  -0.5171 78  PRO A CB  
539  C CG  . PRO A 111 ? 1.0518 1.0477 1.4638 0.2724  0.3456  -0.4729 78  PRO A CG  
540  C CD  . PRO A 111 ? 1.0653 1.0702 1.3627 0.2802  0.3850  -0.4865 78  PRO A CD  
541  N N   . VAL A 112 ? 0.9384 0.9242 1.1632 0.2378  0.2401  -0.4440 79  VAL A N   
542  C CA  . VAL A 112 ? 0.8839 0.8721 1.0880 0.2203  0.1934  -0.4118 79  VAL A CA  
543  C C   . VAL A 112 ? 0.9910 0.9749 1.0812 0.2197  0.1781  -0.4317 79  VAL A C   
544  O O   . VAL A 112 ? 0.9754 0.9485 1.0587 0.2105  0.1383  -0.4421 79  VAL A O   
545  C CB  . VAL A 112 ? 0.8640 0.8739 1.0921 0.2103  0.1919  -0.3537 79  VAL A CB  
546  C CG1 . VAL A 112 ? 0.8086 0.8190 1.0184 0.1929  0.1476  -0.3268 79  VAL A CG1 
547  C CG2 . VAL A 112 ? 0.8195 0.8359 1.1594 0.2109  0.2021  -0.3339 79  VAL A CG2 
548  N N   . LEU A 113 ? 1.0121 1.0047 1.0171 0.2294  0.2098  -0.4365 80  LEU A N   
549  C CA  . LEU A 113 ? 1.0724 1.0626 0.9615 0.2303  0.1953  -0.4513 80  LEU A CA  
550  C C   . LEU A 113 ? 1.1896 1.1582 1.0532 0.2337  0.1754  -0.5111 80  LEU A C   
551  O O   . LEU A 113 ? 1.1900 1.1538 1.0153 0.2254  0.1321  -0.5176 80  LEU A O   
552  C CB  . LEU A 113 ? 1.1359 1.1388 0.9413 0.2408  0.2390  -0.4410 80  LEU A CB  
553  C CG  . LEU A 113 ? 1.2667 1.2698 0.9431 0.2420  0.2237  -0.4447 80  LEU A CG  
554  C CD1 . LEU A 113 ? 1.2085 1.2184 0.8778 0.2286  0.1772  -0.4043 80  LEU A CD1 
555  C CD2 . LEU A 113 ? 1.3681 1.3829 0.9696 0.2524  0.2739  -0.4296 80  LEU A CD2 
556  N N   . PHE A 114 ? 1.1935 1.1490 1.0896 0.2455  0.2060  -0.5557 81  PHE A N   
557  C CA  . PHE A 114 ? 1.2572 1.1885 1.1410 0.2496  0.1920  -0.6208 81  PHE A CA  
558  C C   . PHE A 114 ? 1.2335 1.1510 1.1901 0.2356  0.1396  -0.6243 81  PHE A C   
559  O O   . PHE A 114 ? 1.2740 1.1775 1.1918 0.2318  0.1068  -0.6631 81  PHE A O   
560  C CB  . PHE A 114 ? 1.3359 1.2558 1.2647 0.2655  0.2410  -0.6641 81  PHE A CB  
561  C CG  . PHE A 114 ? 1.4042 1.2946 1.3770 0.2677  0.2247  -0.7274 81  PHE A CG  
562  C CD1 . PHE A 114 ? 1.5468 1.4211 1.4257 0.2702  0.2110  -0.7865 81  PHE A CD1 
563  C CD2 . PHE A 114 ? 1.3807 1.2582 1.4904 0.2665  0.2201  -0.7271 81  PHE A CD2 
564  C CE1 . PHE A 114 ? 1.5996 1.4444 1.5264 0.2708  0.1938  -0.8483 81  PHE A CE1 
565  C CE2 . PHE A 114 ? 1.4566 1.3041 1.6167 0.2678  0.2047  -0.7839 81  PHE A CE2 
566  C CZ  . PHE A 114 ? 1.5291 1.3598 1.5999 0.2697  0.1922  -0.8463 81  PHE A CZ  
567  N N   . VAL A 115 ? 1.0872 1.0091 1.1484 0.2273  0.1320  -0.5836 82  VAL A N   
568  C CA  . VAL A 115 ? 1.0255 0.9360 1.1629 0.2130  0.0889  -0.5767 82  VAL A CA  
569  C C   . VAL A 115 ? 1.0482 0.9682 1.1332 0.1988  0.0467  -0.5544 82  VAL A C   
570  O O   . VAL A 115 ? 1.0656 0.9725 1.1572 0.1914  0.0118  -0.5821 82  VAL A O   
571  C CB  . VAL A 115 ? 0.9915 0.9050 1.2444 0.2084  0.0945  -0.5356 82  VAL A CB  
572  C CG1 . VAL A 115 ? 0.9263 0.8350 1.2366 0.1903  0.0518  -0.5096 82  VAL A CG1 
573  C CG2 . VAL A 115 ? 1.0180 0.9154 1.3497 0.2217  0.1233  -0.5676 82  VAL A CG2 
574  N N   . THR A 116 ? 0.9572 0.8995 0.9977 0.1954  0.0501  -0.5070 83  THR A N   
575  C CA  . THR A 116 ? 0.9249 0.8773 0.9248 0.1838  0.0134  -0.4844 83  THR A CA  
576  C C   . THR A 116 ? 1.0506 0.9988 0.9580 0.1883  -0.0061 -0.5230 83  THR A C   
577  O O   . THR A 116 ? 1.0464 0.9935 0.9545 0.1785  -0.0474 -0.5290 83  THR A O   
578  C CB  . THR A 116 ? 0.9399 0.9139 0.9243 0.1793  0.0215  -0.4271 83  THR A CB  
579  O OG1 . THR A 116 ? 1.0068 0.9910 0.8940 0.1851  0.0238  -0.4214 83  THR A OG1 
580  C CG2 . THR A 116 ? 0.8479 0.8289 0.8840 0.1823  0.0558  -0.3995 83  THR A CG2 
581  N N   . VAL A 117 ? 1.0753 1.0218 0.9046 0.2025  0.0232  -0.5489 84  VAL A N   
582  C CA  . VAL A 117 ? 1.1642 1.1060 0.8911 0.2075  0.0053  -0.5880 84  VAL A CA  
583  C C   . VAL A 117 ? 1.2612 1.1797 1.0233 0.2047  -0.0205 -0.6490 84  VAL A C   
584  O O   . VAL A 117 ? 1.2923 1.2082 1.0189 0.1984  -0.0644 -0.6714 84  VAL A O   
585  C CB  . VAL A 117 ? 1.2896 1.2365 0.9161 0.2227  0.0491  -0.5951 84  VAL A CB  
586  C CG1 . VAL A 117 ? 1.4062 1.3436 0.9227 0.2283  0.0326  -0.6469 84  VAL A CG1 
587  C CG2 . VAL A 117 ? 1.2521 1.2211 0.8399 0.2223  0.0624  -0.5325 84  VAL A CG2 
588  N N   . GLY A 118 ? 1.2147 1.1173 1.0603 0.2083  0.0033  -0.6712 85  GLY A N   
589  C CA  . GLY A 118 ? 1.2508 1.1276 1.1543 0.2055  -0.0163 -0.7267 85  GLY A CA  
590  C C   . GLY A 118 ? 1.2593 1.1341 1.2330 0.1876  -0.0663 -0.7131 85  GLY A C   
591  O O   . GLY A 118 ? 1.3077 1.1689 1.2793 0.1818  -0.1022 -0.7574 85  GLY A O   
592  N N   . PHE A 119 ? 1.1249 1.0141 1.1597 0.1780  -0.0687 -0.6527 86  PHE A N   
593  C CA  . PHE A 119 ? 1.0703 0.9618 1.1715 0.1604  -0.1080 -0.6308 86  PHE A CA  
594  C C   . PHE A 119 ? 1.1526 1.0615 1.1844 0.1545  -0.1432 -0.6213 86  PHE A C   
595  O O   . PHE A 119 ? 1.1356 1.0450 1.2109 0.1413  -0.1811 -0.6233 86  PHE A O   
596  C CB  . PHE A 119 ? 0.9982 0.8995 1.1739 0.1527  -0.0944 -0.5710 86  PHE A CB  
597  C CG  . PHE A 119 ? 0.9958 0.8782 1.2782 0.1506  -0.0839 -0.5731 86  PHE A CG  
598  C CD1 . PHE A 119 ? 1.0278 0.8947 1.3911 0.1376  -0.1116 -0.5832 86  PHE A CD1 
599  C CD2 . PHE A 119 ? 1.0120 0.8932 1.3227 0.1610  -0.0472 -0.5599 86  PHE A CD2 
600  C CE1 . PHE A 119 ? 1.0232 0.8711 1.4892 0.1357  -0.1030 -0.5787 86  PHE A CE1 
601  C CE2 . PHE A 119 ? 1.0297 0.8938 1.4458 0.1598  -0.0412 -0.5566 86  PHE A CE2 
602  C CZ  . PHE A 119 ? 1.0002 0.8466 1.4910 0.1473  -0.0693 -0.5646 86  PHE A CZ  
603  N N   . GLY A 120 ? 1.1463 1.0700 1.0785 0.1643  -0.1295 -0.6084 87  GLY A N   
604  C CA  . GLY A 120 ? 1.1683 1.1086 1.0265 0.1623  -0.1608 -0.5966 87  GLY A CA  
605  C C   . GLY A 120 ? 1.3199 1.2498 1.1230 0.1637  -0.1957 -0.6542 87  GLY A C   
606  O O   . GLY A 120 ? 1.3340 1.2749 1.1168 0.1570  -0.2396 -0.6515 87  GLY A O   
607  N N   . ILE A 121 ? 1.3419 1.2505 1.1242 0.1724  -0.1771 -0.7092 88  ILE A N   
608  C CA  . ILE A 121 ? 1.4438 1.3375 1.1719 0.1736  -0.2077 -0.7758 88  ILE A CA  
609  C C   . ILE A 121 ? 1.4755 1.3604 1.3008 0.1572  -0.2558 -0.7970 88  ILE A C   
610  O O   . ILE A 121 ? 1.5173 1.4088 1.3104 0.1505  -0.3055 -0.8140 88  ILE A O   
611  C CB  . ILE A 121 ? 1.5631 1.4343 1.2556 0.1875  -0.1671 -0.8321 88  ILE A CB  
612  C CG1 . ILE A 121 ? 1.6202 1.5029 1.1957 0.2033  -0.1217 -0.8166 88  ILE A CG1 
613  C CG2 . ILE A 121 ? 1.6667 1.5146 1.3374 0.1853  -0.2000 -0.9124 88  ILE A CG2 
614  C CD1 . ILE A 121 ? 1.7947 1.6936 1.2284 0.2060  -0.1469 -0.8079 88  ILE A CD1 
615  N N   . ILE A 122 ? 1.3635 1.2349 1.3117 0.1503  -0.2422 -0.7908 89  ILE A N   
616  C CA  . ILE A 122 ? 1.3292 1.1908 1.3882 0.1335  -0.2791 -0.8029 89  ILE A CA  
617  C C   . ILE A 122 ? 1.3291 1.2171 1.4008 0.1209  -0.3171 -0.7611 89  ILE A C   
618  O O   . ILE A 122 ? 1.3518 1.2396 1.4519 0.1099  -0.3640 -0.7879 89  ILE A O   
619  C CB  . ILE A 122 ? 1.2966 1.1423 1.4795 0.1290  -0.2515 -0.7846 89  ILE A CB  
620  C CG1 . ILE A 122 ? 1.3432 1.1663 1.5230 0.1443  -0.2086 -0.8184 89  ILE A CG1 
621  C CG2 . ILE A 122 ? 1.2852 1.1170 1.5829 0.1113  -0.2867 -0.8003 89  ILE A CG2 
622  C CD1 . ILE A 122 ? 1.3643 1.1870 1.6221 0.1463  -0.1707 -0.7710 89  ILE A CD1 
623  N N   . GLY A 123 ? 1.2131 1.1234 1.2667 0.1230  -0.2962 -0.6992 90  GLY A N   
624  C CA  . GLY A 123 ? 1.1616 1.0978 1.2267 0.1141  -0.3223 -0.6561 90  GLY A CA  
625  C C   . GLY A 123 ? 1.2822 1.2321 1.2595 0.1178  -0.3624 -0.6716 90  GLY A C   
626  O O   . GLY A 123 ? 1.2685 1.2327 1.2852 0.1073  -0.4044 -0.6655 90  GLY A O   
627  N N   . PHE A 124 ? 1.3122 1.2589 1.1715 0.1326  -0.3498 -0.6903 91  PHE A N   
628  C CA  . PHE A 124 ? 1.3930 1.3510 1.1503 0.1373  -0.3885 -0.7036 91  PHE A CA  
629  C C   . PHE A 124 ? 1.5180 1.4650 1.2912 0.1287  -0.4414 -0.7653 91  PHE A C   
630  O O   . PHE A 124 ? 1.5437 1.5066 1.2988 0.1238  -0.4938 -0.7654 91  PHE A O   
631  C CB  . PHE A 124 ? 1.4910 1.4460 1.1151 0.1543  -0.3563 -0.7086 91  PHE A CB  
632  C CG  . PHE A 124 ? 1.6107 1.5765 1.1177 0.1591  -0.3968 -0.7176 91  PHE A CG  
633  C CD1 . PHE A 124 ? 1.6271 1.6177 1.1126 0.1594  -0.4194 -0.6632 91  PHE A CD1 
634  C CD2 . PHE A 124 ? 1.7621 1.7127 1.1807 0.1634  -0.4140 -0.7807 91  PHE A CD2 
635  C CE1 . PHE A 124 ? 1.7363 1.7371 1.1160 0.1641  -0.4615 -0.6660 91  PHE A CE1 
636  C CE2 . PHE A 124 ? 1.9002 1.8614 1.2018 0.1671  -0.4561 -0.7865 91  PHE A CE2 
637  C CZ  . PHE A 124 ? 1.8497 1.8365 1.1337 0.1675  -0.4810 -0.7261 91  PHE A CZ  
638  N N   . LEU A 125 ? 1.5065 1.4259 1.3214 0.1268  -0.4293 -0.8177 92  LEU A N   
639  C CA  . LEU A 125 ? 1.5741 1.4778 1.4205 0.1170  -0.4768 -0.8827 92  LEU A CA  
640  C C   . LEU A 125 ? 1.5543 1.4687 1.5351 0.0983  -0.5124 -0.8629 92  LEU A C   
641  O O   . LEU A 125 ? 1.5973 1.5202 1.5872 0.0891  -0.5702 -0.8870 92  LEU A O   
642  C CB  . LEU A 125 ? 1.6188 1.4874 1.4871 0.1208  -0.4481 -0.9422 92  LEU A CB  
643  C CG  . LEU A 125 ? 1.7910 1.6461 1.5229 0.1373  -0.4246 -0.9885 92  LEU A CG  
644  C CD1 . LEU A 125 ? 1.7985 1.6244 1.5732 0.1454  -0.3716 -1.0211 92  LEU A CD1 
645  C CD2 . LEU A 125 ? 1.9437 1.7919 1.5980 0.1338  -0.4806 -1.0547 92  LEU A CD2 
646  N N   . ASP A 126 ? 1.3999 1.3167 1.4811 0.0925  -0.4781 -0.8155 93  ASP A N   
647  C CA  . ASP A 126 ? 1.3229 1.2508 1.5338 0.0747  -0.4982 -0.7883 93  ASP A CA  
648  C C   . ASP A 126 ? 1.3644 1.3256 1.5643 0.0707  -0.5377 -0.7572 93  ASP A C   
649  O O   . ASP A 126 ? 1.3687 1.3377 1.6379 0.0573  -0.5850 -0.7749 93  ASP A O   
650  C CB  . ASP A 126 ? 1.2436 1.1705 1.5293 0.0718  -0.4481 -0.7355 93  ASP A CB  
651  C CG  . ASP A 126 ? 1.3209 1.2447 1.7490 0.0526  -0.4566 -0.7239 93  ASP A CG  
652  O OD1 . ASP A 126 ? 1.3117 1.2566 1.7904 0.0409  -0.4894 -0.7100 93  ASP A OD1 
653  O OD2 . ASP A 126 ? 1.3796 1.2807 1.8727 0.0495  -0.4292 -0.7255 93  ASP A OD2 
654  N N   . ASP A 127 ? 1.3055 1.2859 1.4254 0.0824  -0.5192 -0.7118 94  ASP A N   
655  C CA  . ASP A 127 ? 1.2927 1.3040 1.4012 0.0820  -0.5521 -0.6770 94  ASP A CA  
656  C C   . ASP A 127 ? 1.4404 1.4580 1.4760 0.0845  -0.6130 -0.7148 94  ASP A C   
657  O O   . ASP A 127 ? 1.4352 1.4777 1.4999 0.0799  -0.6565 -0.6966 94  ASP A O   
658  C CB  . ASP A 127 ? 1.2691 1.2946 1.3210 0.0937  -0.5129 -0.6185 94  ASP A CB  
659  C CG  . ASP A 127 ? 1.3088 1.3376 1.4465 0.0872  -0.4690 -0.5737 94  ASP A CG  
660  O OD1 . ASP A 127 ? 1.2758 1.3097 1.5235 0.0724  -0.4794 -0.5692 94  ASP A OD1 
661  O OD2 . ASP A 127 ? 1.3444 1.3719 1.4385 0.0960  -0.4250 -0.5419 94  ASP A OD2 
662  N N   . TYR A 128 ? 1.4860 1.4816 1.4297 0.0916  -0.6169 -0.7685 95  TYR A N   
663  C CA  . TYR A 128 ? 1.5988 1.5970 1.4597 0.0929  -0.6765 -0.8118 95  TYR A CA  
664  C C   . TYR A 128 ? 1.6557 1.6514 1.6239 0.0747  -0.7313 -0.8562 95  TYR A C   
665  O O   . TYR A 128 ? 1.7025 1.7166 1.6646 0.0696  -0.7953 -0.8660 95  TYR A O   
666  C CB  . TYR A 128 ? 1.7212 1.6952 1.4477 0.1056  -0.6556 -0.8587 95  TYR A CB  
667  C CG  . TYR A 128 ? 1.8805 1.8604 1.4812 0.1098  -0.7107 -0.8905 95  TYR A CG  
668  C CD1 . TYR A 128 ? 1.9380 1.9392 1.4335 0.1210  -0.7185 -0.8435 95  TYR A CD1 
669  C CD2 . TYR A 128 ? 1.9930 1.9555 1.5768 0.1024  -0.7560 -0.9673 95  TYR A CD2 
670  C CE1 . TYR A 128 ? 2.0832 2.0902 1.4549 0.1246  -0.7721 -0.8676 95  TYR A CE1 
671  C CE2 . TYR A 128 ? 2.1388 2.1068 1.5960 0.1053  -0.8107 -0.9979 95  TYR A CE2 
672  C CZ  . TYR A 128 ? 2.2710 2.2620 1.6189 0.1166  -0.8190 -0.9455 95  TYR A CZ  
673  O OH  . TYR A 128 ? 2.4307 2.4275 1.6469 0.1192  -0.8758 -0.9706 95  TYR A OH  
674  N N   . ILE A 129 ? 1.5577 1.5317 1.6337 0.0644  -0.7071 -0.8782 96  ILE A N   
675  C CA  . ILE A 129 ? 1.5531 1.5213 1.7564 0.0450  -0.7488 -0.9153 96  ILE A CA  
676  C C   . ILE A 129 ? 1.5232 1.5255 1.8382 0.0335  -0.7700 -0.8626 96  ILE A C   
677  O O   . ILE A 129 ? 1.5442 1.5594 1.9280 0.0203  -0.8285 -0.8843 96  ILE A O   
678  C CB  . ILE A 129 ? 1.5573 1.4914 1.8486 0.0387  -0.7076 -0.9405 96  ILE A CB  
679  C CG1 . ILE A 129 ? 1.6394 1.5399 1.8305 0.0525  -0.6781 -0.9929 96  ILE A CG1 
680  C CG2 . ILE A 129 ? 1.5653 1.4915 2.0021 0.0171  -0.7466 -0.9735 96  ILE A CG2 
681  C CD1 . ILE A 129 ? 1.8798 1.7687 1.9584 0.0565  -0.7246 -1.0674 96  ILE A CD1 
682  N N   . LYS A 130 ? 1.3919 1.4094 1.7235 0.0387  -0.7219 -0.7955 97  LYS A N   
683  C CA  . LYS A 130 ? 1.3082 1.3574 1.7370 0.0307  -0.7251 -0.7411 97  LYS A CA  
684  C C   . LYS A 130 ? 1.3988 1.4796 1.8067 0.0327  -0.7862 -0.7334 97  LYS A C   
685  O O   . LYS A 130 ? 1.3557 1.4614 1.8775 0.0213  -0.8107 -0.7141 97  LYS A O   
686  C CB  . LYS A 130 ? 1.2524 1.3071 1.6644 0.0395  -0.6603 -0.6795 97  LYS A CB  
687  C CG  . LYS A 130 ? 1.3536 1.4158 1.8972 0.0256  -0.6281 -0.6420 97  LYS A CG  
688  C CD  . LYS A 130 ? 1.4283 1.4871 1.9381 0.0338  -0.5632 -0.5942 97  LYS A CD  
689  C CE  . LYS A 130 ? 1.4902 1.5586 2.1098 0.0205  -0.5299 -0.5528 97  LYS A CE  
690  N NZ  . LYS A 130 ? 1.5705 1.6728 2.2275 0.0194  -0.5383 -0.5154 97  LYS A NZ  
691  N N   . ILE A 131 ? 1.4337 1.5143 1.7002 0.0471  -0.8102 -0.7465 98  ILE A N   
692  C CA  . ILE A 131 ? 1.4835 1.5923 1.7148 0.0507  -0.8735 -0.7370 98  ILE A CA  
693  C C   . ILE A 131 ? 1.6296 1.7332 1.8565 0.0408  -0.9474 -0.8039 98  ILE A C   
694  O O   . ILE A 131 ? 1.6342 1.7630 1.9444 0.0308  -1.0067 -0.8044 98  ILE A O   
695  C CB  . ILE A 131 ? 1.5569 1.6711 1.6401 0.0711  -0.8592 -0.7011 98  ILE A CB  
696  C CG1 . ILE A 131 ? 1.4560 1.5746 1.5584 0.0786  -0.7890 -0.6387 98  ILE A CG1 
697  C CG2 . ILE A 131 ? 1.6285 1.7719 1.6810 0.0752  -0.9291 -0.6848 98  ILE A CG2 
698  C CD1 . ILE A 131 ? 1.5775 1.6872 1.5374 0.0969  -0.7503 -0.6134 98  ILE A CD1 
699  N N   . VAL A 132 ? 1.6574 1.7285 1.7936 0.0434  -0.9431 -0.8624 99  VAL A N   
700  C CA  . VAL A 132 ? 1.9546 2.0141 2.0709 0.0340  -1.0086 -0.9364 99  VAL A CA  
701  C C   . VAL A 132 ? 1.8851 1.9357 2.1720 0.0126  -1.0209 -0.9687 99  VAL A C   
702  O O   . VAL A 132 ? 1.2126 1.2855 1.6313 0.0141  -1.0370 -0.9318 99  VAL A O   
703  C CB  . VAL A 132 ? 2.1119 2.1379 2.0698 0.0453  -0.9907 -0.9903 99  VAL A CB  
704  C CG1 . VAL A 132 ? 2.2371 2.2478 2.1725 0.0345  -1.0579 -1.0750 99  VAL A CG1 
705  C CG2 . VAL A 132 ? 2.1573 2.1937 1.9481 0.0652  -0.9773 -0.9533 99  VAL A CG2 
706  N N   . LYS A 140 ? 1.3540 1.1478 2.4947 -0.0403 -0.5540 -0.8833 107 LYS A N   
707  C CA  . LYS A 140 ? 1.3221 1.1342 2.3312 -0.0205 -0.5217 -0.8502 107 LYS A CA  
708  C C   . LYS A 140 ? 1.3036 1.1086 2.3305 -0.0153 -0.4653 -0.7908 107 LYS A C   
709  O O   . LYS A 140 ? 1.3112 1.1081 2.2510 0.0035  -0.4377 -0.7964 107 LYS A O   
710  C CB  . LYS A 140 ? 1.3231 1.1791 2.2742 -0.0209 -0.5403 -0.8175 107 LYS A CB  
711  C CG  . LYS A 140 ? 1.4702 1.3401 2.2645 0.0008  -0.5285 -0.8150 107 LYS A CG  
712  C CD  . LYS A 140 ? 1.6842 1.5495 2.3888 0.0084  -0.5721 -0.8834 107 LYS A CD  
713  C CE  . LYS A 140 ? 1.8263 1.6957 2.3762 0.0305  -0.5508 -0.8853 107 LYS A CE  
714  N NZ  . LYS A 140 ? 1.9297 1.7686 2.4564 0.0432  -0.5045 -0.9030 107 LYS A NZ  
715  N N   . PRO A 141 ? 1.1934 1.0020 2.3245 -0.0308 -0.4466 -0.7332 108 PRO A N   
716  C CA  . PRO A 141 ? 1.1397 0.9417 2.2730 -0.0251 -0.3986 -0.6780 108 PRO A CA  
717  C C   . PRO A 141 ? 1.2382 1.0011 2.3868 -0.0134 -0.3811 -0.7092 108 PRO A C   
718  O O   . PRO A 141 ? 1.2121 0.9740 2.3026 0.0019  -0.3482 -0.6873 108 PRO A O   
719  C CB  . PRO A 141 ? 1.1108 0.9194 2.3593 -0.0471 -0.3900 -0.6217 108 PRO A CB  
720  C CG  . PRO A 141 ? 1.1693 1.0033 2.4475 -0.0606 -0.4246 -0.6330 108 PRO A CG  
721  C CD  . PRO A 141 ? 1.1895 1.0097 2.4387 -0.0544 -0.4665 -0.7130 108 PRO A CD  
722  N N   . MET A 142 ? 1.2633 0.9944 2.4939 -0.0200 -0.4039 -0.7636 109 MET A N   
723  C CA  . MET A 142 ? 1.3110 1.0018 2.5703 -0.0083 -0.3891 -0.8035 109 MET A CA  
724  C C   . MET A 142 ? 1.4261 1.1134 2.5598 0.0138  -0.3875 -0.8646 109 MET A C   
725  O O   . MET A 142 ? 1.4408 1.1075 2.5605 0.0303  -0.3572 -0.8781 109 MET A O   
726  C CB  . MET A 142 ? 1.3870 1.0428 2.7833 -0.0237 -0.4135 -0.8430 109 MET A CB  
727  C CG  . MET A 142 ? 1.3870 1.0327 2.9162 -0.0402 -0.3976 -0.7775 109 MET A CG  
728  S SD  . MET A 142 ? 1.4284 1.0450 2.9925 -0.0249 -0.3535 -0.7427 109 MET A SD  
729  C CE  . MET A 142 ? 1.4724 1.0324 3.1544 -0.0247 -0.3699 -0.8227 109 MET A CE  
730  N N   . GLN A 143 ? 1.4164 1.1255 2.4590 0.0144  -0.4185 -0.8973 110 GLN A N   
731  C CA  . GLN A 143 ? 1.4777 1.1883 2.3830 0.0336  -0.4186 -0.9494 110 GLN A CA  
732  C C   . GLN A 143 ? 1.4717 1.2058 2.2769 0.0502  -0.3779 -0.8985 110 GLN A C   
733  O O   . GLN A 143 ? 1.5070 1.2325 2.2315 0.0691  -0.3529 -0.9275 110 GLN A O   
734  C CB  . GLN A 143 ? 1.5428 1.2730 2.3844 0.0272  -0.4694 -0.9862 110 GLN A CB  
735  C CG  . GLN A 143 ? 1.7801 1.4855 2.6980 0.0131  -0.5151 -1.0556 110 GLN A CG  
736  C CD  . GLN A 143 ? 2.0628 1.7908 2.9073 0.0082  -0.5691 -1.0897 110 GLN A CD  
737  O OE1 . GLN A 143 ? 1.9582 1.7195 2.8234 -0.0033 -0.5929 -1.0472 110 GLN A OE1 
738  N NE2 . GLN A 143 ? 2.0648 1.7760 2.8213 0.0171  -0.5897 -1.1672 110 GLN A NE2 
739  N N   . LYS A 144 ? 1.3400 1.1040 2.1540 0.0424  -0.3700 -0.8246 111 LYS A N   
740  C CA  . LYS A 144 ? 1.2837 1.0712 2.0194 0.0540  -0.3351 -0.7704 111 LYS A CA  
741  C C   . LYS A 144 ? 1.3138 1.0819 2.0905 0.0634  -0.2934 -0.7508 111 LYS A C   
742  O O   . LYS A 144 ? 1.3161 1.0887 2.0175 0.0806  -0.2638 -0.7485 111 LYS A O   
743  C CB  . LYS A 144 ? 1.2360 1.0552 1.9920 0.0405  -0.3390 -0.7034 111 LYS A CB  
744  C CG  . LYS A 144 ? 1.3561 1.2043 2.0092 0.0513  -0.3182 -0.6625 111 LYS A CG  
745  C CD  . LYS A 144 ? 1.4078 1.2827 2.0930 0.0380  -0.3156 -0.5992 111 LYS A CD  
746  C CE  . LYS A 144 ? 1.5181 1.4225 2.1454 0.0373  -0.3404 -0.5956 111 LYS A CE  
747  N NZ  . LYS A 144 ? 1.6497 1.5557 2.3358 0.0242  -0.3843 -0.6278 111 LYS A NZ  
748  N N   . LEU A 145 ? 1.2495 0.9956 2.1514 0.0520  -0.2923 -0.7364 112 LEU A N   
749  C CA  . LEU A 145 ? 1.2271 0.9524 2.1928 0.0591  -0.2603 -0.7143 112 LEU A CA  
750  C C   . LEU A 145 ? 1.3231 1.0193 2.2780 0.0777  -0.2461 -0.7809 112 LEU A C   
751  O O   . LEU A 145 ? 1.3063 0.9956 2.2718 0.0915  -0.2130 -0.7656 112 LEU A O   
752  C CB  . LEU A 145 ? 1.2045 0.9126 2.3090 0.0405  -0.2684 -0.6809 112 LEU A CB  
753  C CG  . LEU A 145 ? 1.1902 0.9177 2.3206 0.0300  -0.2521 -0.5933 112 LEU A CG  
754  C CD1 . LEU A 145 ? 1.1511 0.9166 2.2165 0.0200  -0.2616 -0.5615 112 LEU A CD1 
755  C CD2 . LEU A 145 ? 1.2164 0.9214 2.4826 0.0130  -0.2570 -0.5633 112 LEU A CD2 
756  N N   . VAL A 146 ? 1.3374 1.0181 2.2713 0.0781  -0.2712 -0.8560 113 VAL A N   
757  C CA  . VAL A 146 ? 1.4106 1.0634 2.3199 0.0953  -0.2576 -0.9311 113 VAL A CA  
758  C C   . VAL A 146 ? 1.4575 1.1321 2.2245 0.1150  -0.2294 -0.9360 113 VAL A C   
759  O O   . VAL A 146 ? 1.4722 1.1351 2.2345 0.1327  -0.1911 -0.9508 113 VAL A O   
760  C CB  . VAL A 146 ? 1.5419 1.1706 2.4700 0.0868  -0.2972 -1.0121 113 VAL A CB  
761  C CG1 . VAL A 146 ? 1.6410 1.2525 2.4788 0.1052  -0.2858 -1.0960 113 VAL A CG1 
762  C CG2 . VAL A 146 ? 1.5386 1.1329 2.6304 0.0731  -0.3095 -1.0181 113 VAL A CG2 
763  N N   . GLY A 147 ? 1.3887 1.0951 2.0518 0.1115  -0.2473 -0.9197 114 GLY A N   
764  C CA  . GLY A 147 ? 1.3985 1.1276 1.9256 0.1273  -0.2241 -0.9154 114 GLY A CA  
765  C C   . GLY A 147 ? 1.3694 1.1129 1.9015 0.1368  -0.1804 -0.8541 114 GLY A C   
766  O O   . GLY A 147 ? 1.3935 1.1386 1.8652 0.1546  -0.1438 -0.8676 114 GLY A O   
767  N N   . GLN A 148 ? 1.2284 0.9827 1.8360 0.1241  -0.1837 -0.7872 115 GLN A N   
768  C CA  . GLN A 148 ? 1.1495 0.9178 1.7763 0.1288  -0.1513 -0.7239 115 GLN A CA  
769  C C   . GLN A 148 ? 1.2008 0.9442 1.9048 0.1412  -0.1214 -0.7385 115 GLN A C   
770  O O   . GLN A 148 ? 1.1720 0.9266 1.8642 0.1530  -0.0888 -0.7102 115 GLN A O   
771  C CB  . GLN A 148 ? 1.0854 0.8664 1.7762 0.1097  -0.1668 -0.6573 115 GLN A CB  
772  C CG  . GLN A 148 ? 1.1372 0.9483 1.7610 0.0993  -0.1874 -0.6299 115 GLN A CG  
773  C CD  . GLN A 148 ? 1.2803 1.0996 1.9766 0.0789  -0.2030 -0.5797 115 GLN A CD  
774  O OE1 . GLN A 148 ? 1.1895 0.9894 1.9873 0.0691  -0.2070 -0.5705 115 GLN A OE1 
775  N NE2 . GLN A 148 ? 1.1823 1.0298 1.8295 0.0719  -0.2108 -0.5463 115 GLN A NE2 
776  N N   . PHE A 149 ? 1.1936 0.9034 1.9855 0.1386  -0.1334 -0.7829 116 PHE A N   
777  C CA  . PHE A 149 ? 1.2110 0.8917 2.0970 0.1506  -0.1089 -0.8033 116 PHE A CA  
778  C C   . PHE A 149 ? 1.3152 0.9903 2.1367 0.1738  -0.0731 -0.8604 116 PHE A C   
779  O O   . PHE A 149 ? 1.3050 0.9737 2.1804 0.1882  -0.0390 -0.8527 116 PHE A O   
780  C CB  . PHE A 149 ? 1.2669 0.9111 2.2658 0.1399  -0.1344 -0.8386 116 PHE A CB  
781  C CG  . PHE A 149 ? 1.2682 0.8875 2.4088 0.1421  -0.1216 -0.8124 116 PHE A CG  
782  C CD1 . PHE A 149 ? 1.2395 0.8641 2.4585 0.1260  -0.1348 -0.7368 116 PHE A CD1 
783  C CD2 . PHE A 149 ? 1.3541 0.9441 2.5513 0.1604  -0.0962 -0.8630 116 PHE A CD2 
784  C CE1 . PHE A 149 ? 1.2428 0.8441 2.5915 0.1279  -0.1266 -0.7066 116 PHE A CE1 
785  C CE2 . PHE A 149 ? 1.3756 0.9423 2.7139 0.1635  -0.0871 -0.8350 116 PHE A CE2 
786  C CZ  . PHE A 149 ? 1.2852 0.8576 2.6972 0.1470  -0.1045 -0.7545 116 PHE A CZ  
787  N N   . ILE A 150 ? 1.3291 1.0075 2.0368 0.1773  -0.0806 -0.9161 117 ILE A N   
788  C CA  . ILE A 150 ? 1.4024 1.0766 2.0274 0.1981  -0.0446 -0.9737 117 ILE A CA  
789  C C   . ILE A 150 ? 1.3970 1.1031 1.9573 0.2101  -0.0050 -0.9251 117 ILE A C   
790  O O   . ILE A 150 ? 1.4099 1.1110 1.9949 0.2276  0.0391  -0.9386 117 ILE A O   
791  C CB  . ILE A 150 ? 1.5369 1.2064 2.0461 0.1966  -0.0684 -1.0429 117 ILE A CB  
792  C CG1 . ILE A 150 ? 1.5724 1.2158 2.1481 0.1795  -0.1187 -1.0843 117 ILE A CG1 
793  C CG2 . ILE A 150 ? 1.6493 1.3076 2.0794 0.2177  -0.0270 -1.1112 117 ILE A CG2 
794  C CD1 . ILE A 150 ? 1.7146 1.3134 2.4277 0.1817  -0.1136 -1.1340 117 ILE A CD1 
795  N N   . ILE A 151 ? 1.2878 1.0262 1.7756 0.2006  -0.0203 -0.8697 118 ILE A N   
796  C CA  . ILE A 151 ? 1.2396 1.0092 1.6665 0.2084  0.0109  -0.8194 118 ILE A CA  
797  C C   . ILE A 151 ? 1.2025 0.9754 1.7359 0.2124  0.0358  -0.7701 118 ILE A C   
798  O O   . ILE A 151 ? 1.2052 0.9894 1.7258 0.2273  0.0774  -0.7637 118 ILE A O   
799  C CB  . ILE A 151 ? 1.2355 1.0343 1.5797 0.1956  -0.0164 -0.7726 118 ILE A CB  
800  C CG1 . ILE A 151 ? 1.3125 1.1095 1.5581 0.1915  -0.0488 -0.8185 118 ILE A CG1 
801  C CG2 . ILE A 151 ? 1.2096 1.0379 1.4958 0.2028  0.0154  -0.7227 118 ILE A CG2 
802  C CD1 . ILE A 151 ? 1.5055 1.3030 1.6230 0.2075  -0.0244 -0.8686 118 ILE A CD1 
803  N N   . THR A 152 ? 1.0842 0.8476 1.7246 0.1989  0.0100  -0.7353 119 THR A N   
804  C CA  . THR A 152 ? 1.0166 0.7814 1.7630 0.2004  0.0230  -0.6845 119 THR A CA  
805  C C   . THR A 152 ? 1.0998 0.8439 1.9205 0.2202  0.0582  -0.7245 119 THR A C   
806  O O   . THR A 152 ? 1.0706 0.8277 1.9339 0.2302  0.0853  -0.6924 119 THR A O   
807  C CB  . THR A 152 ? 1.0439 0.8003 1.8760 0.1806  -0.0137 -0.6410 119 THR A CB  
808  O OG1 . THR A 152 ? 0.9632 0.7404 1.7240 0.1642  -0.0398 -0.6113 119 THR A OG1 
809  C CG2 . THR A 152 ? 0.9735 0.7349 1.8996 0.1799  -0.0070 -0.5788 119 THR A CG2 
810  N N   . GLY A 153 ? 1.1139 0.8272 1.9504 0.2256  0.0571  -0.7961 120 GLY A N   
811  C CA  . GLY A 153 ? 1.1628 0.8519 2.0680 0.2453  0.0923  -0.8483 120 GLY A CA  
812  C C   . GLY A 153 ? 1.2380 0.9453 2.0698 0.2652  0.1437  -0.8692 120 GLY A C   
813  O O   . GLY A 153 ? 1.2237 0.9322 2.1351 0.2805  0.1793  -0.8617 120 GLY A O   
814  N N   . ILE A 154 ? 1.2342 0.9577 1.9177 0.2651  0.1480  -0.8909 121 ILE A N   
815  C CA  . ILE A 154 ? 1.2762 1.0192 1.8713 0.2819  0.1989  -0.9059 121 ILE A CA  
816  C C   . ILE A 154 ? 1.2386 1.0145 1.8661 0.2833  0.2183  -0.8295 121 ILE A C   
817  O O   . ILE A 154 ? 1.2515 1.0375 1.9007 0.3001  0.2676  -0.8341 121 ILE A O   
818  C CB  . ILE A 154 ? 1.3802 1.1329 1.8052 0.2794  0.1928  -0.9364 121 ILE A CB  
819  C CG1 . ILE A 154 ? 1.4583 1.1807 1.8545 0.2725  0.1566  -1.0056 121 ILE A CG1 
820  C CG2 . ILE A 154 ? 1.4615 1.2272 1.8007 0.2984  0.2532  -0.9626 121 ILE A CG2 
821  C CD1 . ILE A 154 ? 1.5390 1.2748 1.8026 0.2594  0.1164  -1.0042 121 ILE A CD1 
822  N N   . PHE A 155 ? 1.1054 0.8978 1.7422 0.2653  0.1800  -0.7618 122 PHE A N   
823  C CA  . PHE A 155 ? 1.0225 0.8440 1.6924 0.2627  0.1879  -0.6893 122 PHE A CA  
824  C C   . PHE A 155 ? 1.0611 0.8748 1.8832 0.2697  0.1972  -0.6692 122 PHE A C   
825  O O   . PHE A 155 ? 1.0281 0.8633 1.8874 0.2781  0.2249  -0.6376 122 PHE A O   
826  C CB  . PHE A 155 ? 0.9665 0.8040 1.5987 0.2411  0.1443  -0.6319 122 PHE A CB  
827  C CG  . PHE A 155 ? 0.9022 0.7674 1.5640 0.2354  0.1456  -0.5605 122 PHE A CG  
828  C CD1 . PHE A 155 ? 0.9366 0.8266 1.5605 0.2449  0.1824  -0.5455 122 PHE A CD1 
829  C CD2 . PHE A 155 ? 0.8563 0.7231 1.5772 0.2188  0.1093  -0.5085 122 PHE A CD2 
830  C CE1 . PHE A 155 ? 0.8786 0.7934 1.5334 0.2380  0.1795  -0.4835 122 PHE A CE1 
831  C CE2 . PHE A 155 ? 0.8284 0.7199 1.5681 0.2123  0.1071  -0.4474 122 PHE A CE2 
832  C CZ  . PHE A 155 ? 0.8041 0.7191 1.5134 0.2217  0.1401  -0.4370 122 PHE A CZ  
833  N N   . ALA A 156 ? 1.0452 0.8278 1.9610 0.2667  0.1737  -0.6878 123 ALA A N   
834  C CA  . ALA A 156 ? 1.0341 0.8040 2.1035 0.2743  0.1783  -0.6704 123 ALA A CA  
835  C C   . ALA A 156 ? 1.1735 0.9392 2.2831 0.2996  0.2330  -0.7192 123 ALA A C   
836  O O   . ALA A 156 ? 1.1423 0.9178 2.3561 0.3100  0.2511  -0.6899 123 ALA A O   
837  C CB  . ALA A 156 ? 1.0518 0.7855 2.2036 0.2654  0.1435  -0.6855 123 ALA A CB  
838  N N   . TRP A 157 ? 1.2405 0.9932 2.2649 0.3093  0.2591  -0.7936 124 TRP A N   
839  C CA  . TRP A 157 ? 1.3281 1.0760 2.3640 0.3334  0.3184  -0.8519 124 TRP A CA  
840  C C   . TRP A 157 ? 1.3728 1.1607 2.3694 0.3418  0.3602  -0.8164 124 TRP A C   
841  O O   . TRP A 157 ? 1.3804 1.1751 2.4679 0.3595  0.4030  -0.8206 124 TRP A O   
842  C CB  . TRP A 157 ? 1.4174 1.1425 2.3424 0.3371  0.3284  -0.9376 124 TRP A CB  
843  C CG  . TRP A 157 ? 1.5278 1.2452 2.4457 0.3611  0.3928  -1.0068 124 TRP A CG  
844  C CD1 . TRP A 157 ? 1.6298 1.3135 2.6455 0.3764  0.4158  -1.0708 124 TRP A CD1 
845  C CD2 . TRP A 157 ? 1.5790 1.3214 2.3815 0.3723  0.4454  -1.0218 124 TRP A CD2 
846  N NE1 . TRP A 157 ? 1.7149 1.4023 2.6823 0.3970  0.4822  -1.1275 124 TRP A NE1 
847  C CE2 . TRP A 157 ? 1.7283 1.4523 2.5626 0.3946  0.5024  -1.0965 124 TRP A CE2 
848  C CE3 . TRP A 157 ? 1.5724 1.3504 2.2519 0.3657  0.4523  -0.9775 124 TRP A CE3 
849  C CZ2 . TRP A 157 ? 1.7983 1.5400 2.5388 0.4098  0.5682  -1.1269 124 TRP A CZ2 
850  C CZ3 . TRP A 157 ? 1.6660 1.4605 2.2581 0.3803  0.5146  -1.0036 124 TRP A CZ3 
851  C CH2 . TRP A 157 ? 1.7741 1.5515 2.3931 0.4018  0.5730  -1.0769 124 TRP A CH2 
852  N N   . TYR A 158 ? 1.3093 1.1237 2.1829 0.3289  0.3474  -0.7796 125 TYR A N   
853  C CA  . TYR A 158 ? 1.2942 1.1460 2.1277 0.3332  0.3825  -0.7408 125 TYR A CA  
854  C C   . TYR A 158 ? 1.2788 1.1509 2.2439 0.3323  0.3768  -0.6749 125 TYR A C   
855  O O   . TYR A 158 ? 1.2762 1.1710 2.2828 0.3449  0.4210  -0.6641 125 TYR A O   
856  C CB  . TYR A 158 ? 1.2932 1.1639 1.9791 0.3178  0.3612  -0.7123 125 TYR A CB  
857  C CG  . TYR A 158 ? 1.2840 1.1919 1.9418 0.3183  0.3895  -0.6621 125 TYR A CG  
858  C CD1 . TYR A 158 ? 1.3792 1.3006 1.9663 0.3322  0.4476  -0.6865 125 TYR A CD1 
859  C CD2 . TYR A 158 ? 1.1986 1.1273 1.9026 0.3043  0.3593  -0.5909 125 TYR A CD2 
860  C CE1 . TYR A 158 ? 1.3628 1.3176 1.9370 0.3318  0.4753  -0.6384 125 TYR A CE1 
861  C CE2 . TYR A 158 ? 1.1808 1.1420 1.8730 0.3040  0.3839  -0.5476 125 TYR A CE2 
862  C CZ  . TYR A 158 ? 1.3373 1.3115 1.9674 0.3173  0.4416  -0.5702 125 TYR A CZ  
863  O OH  . TYR A 158 ? 1.3072 1.3128 1.9325 0.3156  0.4665  -0.5255 125 TYR A OH  
864  N N   . LEU A 159 ? 1.1823 1.0478 2.2090 0.3162  0.3218  -0.6293 126 LEU A N   
865  C CA  . LEU A 159 ? 1.1144 0.9978 2.2545 0.3119  0.3038  -0.5628 126 LEU A CA  
866  C C   . LEU A 159 ? 1.2097 1.0836 2.5087 0.3301  0.3252  -0.5738 126 LEU A C   
867  O O   . LEU A 159 ? 1.1793 1.0787 2.5596 0.3355  0.3372  -0.5340 126 LEU A O   
868  C CB  . LEU A 159 ? 1.0485 0.9263 2.1950 0.2888  0.2407  -0.5118 126 LEU A CB  
869  C CG  . LEU A 159 ? 1.0701 0.9625 2.0865 0.2692  0.2142  -0.4849 126 LEU A CG  
870  C CD1 . LEU A 159 ? 1.0217 0.9048 2.0604 0.2485  0.1595  -0.4426 126 LEU A CD1 
871  C CD2 . LEU A 159 ? 1.0561 0.9849 2.0329 0.2672  0.2308  -0.4445 126 LEU A CD2 
872  N N   . LEU A 160 ? 1.2285 1.0657 2.5809 0.3390  0.3271  -0.6265 127 LEU A N   
873  C CA  . LEU A 160 ? 1.2553 1.0784 2.7711 0.3574  0.3454  -0.6396 127 LEU A CA  
874  C C   . LEU A 160 ? 1.3947 1.2239 2.9334 0.3831  0.4165  -0.6947 127 LEU A C   
875  O O   . LEU A 160 ? 1.3816 1.2212 3.0576 0.3980  0.4381  -0.6793 127 LEU A O   
876  C CB  . LEU A 160 ? 1.2816 1.0597 2.8662 0.3555  0.3161  -0.6691 127 LEU A CB  
877  C CG  . LEU A 160 ? 1.2763 1.0456 2.8984 0.3334  0.2509  -0.6064 127 LEU A CG  
878  C CD1 . LEU A 160 ? 1.3157 1.0400 2.9722 0.3294  0.2290  -0.6474 127 LEU A CD1 
879  C CD2 . LEU A 160 ? 1.2580 1.0406 3.0230 0.3356  0.2327  -0.5377 127 LEU A CD2 
880  N N   . ASN A 161 ? 1.4403 1.2628 2.8496 0.3886  0.4529  -0.7587 128 ASN A N   
881  C CA  . ASN A 161 ? 1.5258 1.3520 2.9391 0.4127  0.5271  -0.8177 128 ASN A CA  
882  C C   . ASN A 161 ? 1.5622 1.4340 2.9603 0.4178  0.5689  -0.7796 128 ASN A C   
883  O O   . ASN A 161 ? 1.5832 1.4673 3.0917 0.4374  0.6179  -0.7891 128 ASN A O   
884  C CB  . ASN A 161 ? 1.6456 1.4471 2.9210 0.4163  0.5496  -0.9006 128 ASN A CB  
885  C CG  . ASN A 161 ? 2.0088 1.7549 3.2983 0.4306  0.5339  -0.9432 128 ASN A CG  
886  O OD1 . ASN A 161 ? 2.0177 1.7383 3.2593 0.4592  0.5725  -0.9796 128 ASN A OD1 
887  N ND2 . ASN A 161 ? 1.8716 1.6012 3.2611 0.4096  0.4832  -0.9521 128 ASN A ND2 
888  N N   . SER A 162 ? 1.4775 1.3742 2.7503 0.4007  0.5515  -0.7374 129 SER A N   
889  C CA  . SER A 162 ? 1.4547 1.3936 2.7152 0.4026  0.5877  -0.6971 129 SER A CA  
890  C C   . SER A 162 ? 1.3968 1.3601 2.7713 0.3919  0.5468  -0.6171 129 SER A C   
891  O O   . SER A 162 ? 1.3442 1.2929 2.7595 0.3784  0.4854  -0.5861 129 SER A O   
892  C CB  . SER A 162 ? 1.5270 1.4788 2.6036 0.3906  0.5920  -0.6921 129 SER A CB  
893  O OG  . SER A 162 ? 1.6631 1.6495 2.7271 0.3978  0.6477  -0.6739 129 SER A OG  
894  N N   . GLY A 163 ? 1.3209 1.3211 2.7464 0.3973  0.5815  -0.5848 130 GLY A N   
895  C CA  . GLY A 163 ? 1.2306 1.2579 2.7639 0.3874  0.5447  -0.5121 130 GLY A CA  
896  C C   . GLY A 163 ? 1.2233 1.2816 2.6705 0.3693  0.5327  -0.4613 130 GLY A C   
897  O O   . GLY A 163 ? 1.1858 1.2769 2.7177 0.3677  0.5370  -0.4174 130 GLY A O   
898  N N   . GLU A 164 ? 1.1683 1.2163 2.4550 0.3553  0.5156  -0.4671 131 GLU A N   
899  C CA  . GLU A 164 ? 1.1168 1.1891 2.3147 0.3380  0.5036  -0.4225 131 GLU A CA  
900  C C   . GLU A 164 ? 1.0560 1.1353 2.2925 0.3170  0.4343  -0.3620 131 GLU A C   
901  O O   . GLU A 164 ? 1.0097 1.1163 2.2469 0.3055  0.4265  -0.3173 131 GLU A O   
902  C CB  . GLU A 164 ? 1.1762 1.2342 2.1967 0.3322  0.5083  -0.4498 131 GLU A CB  
903  C CG  . GLU A 164 ? 1.3937 1.4706 2.3346 0.3402  0.5717  -0.4611 131 GLU A CG  
904  C CD  . GLU A 164 ? 1.8485 1.9159 2.7875 0.3633  0.6382  -0.5242 131 GLU A CD  
905  O OE1 . GLU A 164 ? 1.8582 1.9428 2.9131 0.3780  0.6842  -0.5269 131 GLU A OE1 
906  O OE2 . GLU A 164 ? 1.8752 1.9184 2.6985 0.3668  0.6440  -0.5729 131 GLU A OE2 
907  N N   . VAL A 165 ? 0.9730 1.0268 2.2395 0.3112  0.3853  -0.3616 132 VAL A N   
908  C CA  . VAL A 165 ? 0.8923 0.9480 2.1833 0.2908  0.3192  -0.3075 132 VAL A CA  
909  C C   . VAL A 165 ? 0.9079 0.9461 2.3275 0.2951  0.2879  -0.2993 132 VAL A C   
910  O O   . VAL A 165 ? 0.9450 0.9583 2.4037 0.3105  0.3079  -0.3443 132 VAL A O   
911  C CB  . VAL A 165 ? 0.9219 0.9649 2.0705 0.2718  0.2855  -0.3035 132 VAL A CB  
912  C CG1 . VAL A 165 ? 0.9561 0.9641 2.0564 0.2756  0.2802  -0.3513 132 VAL A CG1 
913  C CG2 . VAL A 165 ? 0.8582 0.9089 2.0141 0.2495  0.2269  -0.2465 132 VAL A CG2 
914  N N   . GLY A 166 ? 0.7939 0.8449 2.2782 0.2817  0.2397  -0.2418 133 GLY A N   
915  C CA  . GLY A 166 ? 0.7713 0.8084 2.3738 0.2825  0.2014  -0.2180 133 GLY A CA  
916  C C   . GLY A 166 ? 0.7928 0.7978 2.3384 0.2691  0.1612  -0.2177 133 GLY A C   
917  O O   . GLY A 166 ? 0.7685 0.7731 2.1948 0.2514  0.1420  -0.2091 133 GLY A O   
918  N N   . THR A 167 ? 0.7498 0.7279 2.3897 0.2776  0.1498  -0.2267 134 THR A N   
919  C CA  . THR A 167 ? 0.7400 0.6851 2.3545 0.2660  0.1149  -0.2267 134 THR A CA  
920  C C   . THR A 167 ? 0.7313 0.6803 2.3615 0.2446  0.0552  -0.1562 134 THR A C   
921  O O   . THR A 167 ? 0.7245 0.6505 2.3196 0.2311  0.0273  -0.1483 134 THR A O   
922  C CB  . THR A 167 ? 0.9081 0.8194 2.6226 0.2844  0.1317  -0.2694 134 THR A CB  
923  O OG1 . THR A 167 ? 0.9061 0.8253 2.7765 0.2987  0.1319  -0.2446 134 THR A OG1 
924  C CG2 . THR A 167 ? 0.9477 0.8468 2.6069 0.3010  0.1861  -0.3488 134 THR A CG2 
925  N N   . ASP A 168 ? 0.6628 0.6411 2.3445 0.2406  0.0357  -0.1056 135 ASP A N   
926  C CA  . ASP A 168 ? 0.6404 0.6255 2.3312 0.2201  -0.0217 -0.0376 135 ASP A CA  
927  C C   . ASP A 168 ? 0.6779 0.6667 2.2243 0.1958  -0.0426 -0.0226 135 ASP A C   
928  O O   . ASP A 168 ? 0.6819 0.6783 2.1286 0.1948  -0.0149 -0.0558 135 ASP A O   
929  C CB  . ASP A 168 ? 0.6503 0.6689 2.4259 0.2220  -0.0378 0.0054  135 ASP A CB  
930  C CG  . ASP A 168 ? 0.7758 0.7923 2.7184 0.2447  -0.0279 0.0047  135 ASP A CG  
931  O OD1 . ASP A 168 ? 0.7826 0.8204 2.7816 0.2614  0.0105  -0.0183 135 ASP A OD1 
932  O OD2 . ASP A 168 ? 0.8647 0.8581 2.8875 0.2459  -0.0568 0.0288  135 ASP A OD2 
933  N N   . MET A 169 ? 0.6173 0.6007 2.1528 0.1764  -0.0898 0.0284  136 MET A N   
934  C CA  . MET A 169 ? 0.5883 0.5751 1.9949 0.1529  -0.1085 0.0441  136 MET A CA  
935  C C   . MET A 169 ? 0.5881 0.5992 1.9845 0.1357  -0.1487 0.1017  136 MET A C   
936  O O   . MET A 169 ? 0.5920 0.6002 2.0587 0.1312  -0.1851 0.1485  136 MET A O   
937  C CB  . MET A 169 ? 0.6353 0.5917 2.0163 0.1421  -0.1234 0.0472  136 MET A CB  
938  C CG  . MET A 169 ? 0.7079 0.6397 2.0801 0.1544  -0.0904 -0.0138 136 MET A CG  
939  S SD  . MET A 169 ? 0.7846 0.6875 2.1145 0.1359  -0.1105 -0.0071 136 MET A SD  
940  C CE  . MET A 169 ? 0.7755 0.6469 2.1507 0.1553  -0.0786 -0.0804 136 MET A CE  
941  N N   . LEU A 170 ? 0.5022 0.5355 1.8100 0.1253  -0.1447 0.0990  137 LEU A N   
942  C CA  . LEU A 170 ? 0.4896 0.5444 1.7753 0.1068  -0.1842 0.1463  137 LEU A CA  
943  C C   . LEU A 170 ? 0.5645 0.6062 1.7757 0.0842  -0.2168 0.1790  137 LEU A C   
944  O O   . LEU A 170 ? 0.5450 0.5738 1.6678 0.0767  -0.2015 0.1572  137 LEU A O   
945  C CB  . LEU A 170 ? 0.4628 0.5430 1.6862 0.1020  -0.1695 0.1314  137 LEU A CB  
946  C CG  . LEU A 170 ? 0.5185 0.6218 1.7282 0.0830  -0.2117 0.1733  137 LEU A CG  
947  C CD1 . LEU A 170 ? 0.5268 0.6487 1.8650 0.0912  -0.2346 0.2020  137 LEU A CD1 
948  C CD2 . LEU A 170 ? 0.5198 0.6393 1.6479 0.0742  -0.1965 0.1543  137 LEU A CD2 
949  N N   . ILE A 171 ? 0.5527 0.5988 1.8050 0.0738  -0.2617 0.2334  138 ILE A N   
950  C CA  . ILE A 171 ? 0.5818 0.6191 1.7696 0.0511  -0.2956 0.2758  138 ILE A CA  
951  C C   . ILE A 171 ? 0.6400 0.6972 1.7145 0.0310  -0.3067 0.2792  138 ILE A C   
952  O O   . ILE A 171 ? 0.6336 0.7146 1.7275 0.0301  -0.3215 0.2858  138 ILE A O   
953  C CB  . ILE A 171 ? 0.6550 0.6907 1.9281 0.0485  -0.3410 0.3355  138 ILE A CB  
954  C CG1 . ILE A 171 ? 0.6674 0.6775 2.0529 0.0669  -0.3292 0.3318  138 ILE A CG1 
955  C CG2 . ILE A 171 ? 0.6980 0.7300 1.8851 0.0223  -0.3762 0.3839  138 ILE A CG2 
956  C CD1 . ILE A 171 ? 0.7809 0.7903 2.2786 0.0701  -0.3715 0.3892  138 ILE A CD1 
957  N N   . PRO A 172 ? 0.6088 0.6567 1.5744 0.0151  -0.2988 0.2730  139 PRO A N   
958  C CA  . PRO A 172 ? 0.6139 0.6776 1.4755 -0.0019 -0.3023 0.2667  139 PRO A CA  
959  C C   . PRO A 172 ? 0.7252 0.8093 1.5733 -0.0176 -0.3464 0.3033  139 PRO A C   
960  O O   . PRO A 172 ? 0.7144 0.8180 1.5826 -0.0139 -0.3468 0.2883  139 PRO A O   
961  C CB  . PRO A 172 ? 0.6460 0.6939 1.4184 -0.0161 -0.2915 0.2654  139 PRO A CB  
962  C CG  . PRO A 172 ? 0.6835 0.7109 1.5051 -0.0003 -0.2634 0.2405  139 PRO A CG  
963  C CD  . PRO A 172 ? 0.6370 0.6598 1.5782 0.0140  -0.2794 0.2619  139 PRO A CD  
964  N N   . PHE A 173 ? 0.7279 0.8086 1.5382 -0.0361 -0.3830 0.3495  140 PHE A N   
965  C CA  . PHE A 173 ? 0.7584 0.8591 1.5398 -0.0527 -0.4275 0.3775  140 PHE A CA  
966  C C   . PHE A 173 ? 0.8145 0.9259 1.7055 -0.0462 -0.4706 0.4196  140 PHE A C   
967  O O   . PHE A 173 ? 0.8659 0.9774 1.7426 -0.0602 -0.5152 0.4705  140 PHE A O   
968  C CB  . PHE A 173 ? 0.8361 0.9317 1.4943 -0.0788 -0.4441 0.4002  140 PHE A CB  
969  C CG  . PHE A 173 ? 0.8382 0.9292 1.3954 -0.0859 -0.4052 0.3570  140 PHE A CG  
970  C CD1 . PHE A 173 ? 0.8591 0.9318 1.3963 -0.0811 -0.3666 0.3397  140 PHE A CD1 
971  C CD2 . PHE A 173 ? 0.8653 0.9702 1.3554 -0.0977 -0.4092 0.3337  140 PHE A CD2 
972  C CE1 . PHE A 173 ? 0.8504 0.9209 1.3059 -0.0864 -0.3329 0.3017  140 PHE A CE1 
973  C CE2 . PHE A 173 ? 0.8810 0.9807 1.2889 -0.1027 -0.3732 0.2950  140 PHE A CE2 
974  C CZ  . PHE A 173 ? 0.8375 0.9211 1.2300 -0.0965 -0.3357 0.2805  140 PHE A CZ  
975  N N   . THR A 174 ? 0.7235 0.8454 1.7247 -0.0250 -0.4571 0.3996  141 THR A N   
976  C CA  . THR A 174 ? 0.7353 0.8699 1.8631 -0.0152 -0.4938 0.4357  141 THR A CA  
977  C C   . THR A 174 ? 0.7664 0.9325 1.9421 -0.0150 -0.5112 0.4273  141 THR A C   
978  O O   . THR A 174 ? 0.7997 0.9827 2.0252 -0.0219 -0.5648 0.4684  141 THR A O   
979  C CB  . THR A 174 ? 0.7932 0.9117 2.0394 0.0105  -0.4669 0.4291  141 THR A CB  
980  O OG1 . THR A 174 ? 0.7576 0.8710 2.0024 0.0266  -0.4079 0.3695  141 THR A OG1 
981  C CG2 . THR A 174 ? 0.7766 0.8664 2.0122 0.0068  -0.4735 0.4600  141 THR A CG2 
982  N N   . GLY A 175 ? 0.6748 0.8489 1.8370 -0.0081 -0.4687 0.3779  142 GLY A N   
983  C CA  . GLY A 175 ? 0.6555 0.8586 1.8652 -0.0090 -0.4777 0.3671  142 GLY A CA  
984  C C   . GLY A 175 ? 0.6560 0.8645 1.8970 0.0082  -0.4184 0.3181  142 GLY A C   
985  O O   . GLY A 175 ? 0.6354 0.8684 1.9621 0.0142  -0.4177 0.3134  142 GLY A O   
986  N N   . GLY A 176 ? 0.5935 0.7804 1.7658 0.0152  -0.3697 0.2837  143 GLY A N   
987  C CA  . GLY A 176 ? 0.5501 0.7385 1.7281 0.0309  -0.3117 0.2383  143 GLY A CA  
988  C C   . GLY A 176 ? 0.5732 0.7654 1.8727 0.0574  -0.2796 0.2262  143 GLY A C   
989  O O   . GLY A 176 ? 0.5785 0.7681 1.9665 0.0661  -0.3002 0.2511  143 GLY A O   
990  N N   . PHE A 177 ? 0.5053 0.7031 1.8103 0.0708  -0.2272 0.1885  144 PHE A N   
991  C CA  . PHE A 177 ? 0.4998 0.7020 1.9096 0.0967  -0.1860 0.1693  144 PHE A CA  
992  C C   . PHE A 177 ? 0.5747 0.8058 2.1255 0.1020  -0.2066 0.1948  144 PHE A C   
993  O O   . PHE A 177 ? 0.5804 0.8119 2.2415 0.1223  -0.1911 0.1932  144 PHE A O   
994  C CB  . PHE A 177 ? 0.5046 0.7063 1.8678 0.1076  -0.1241 0.1258  144 PHE A CB  
995  C CG  . PHE A 177 ? 0.5235 0.6961 1.7824 0.1106  -0.0991 0.0965  144 PHE A CG  
996  C CD1 . PHE A 177 ? 0.5540 0.7183 1.6910 0.0940  -0.1050 0.0912  144 PHE A CD1 
997  C CD2 . PHE A 177 ? 0.5613 0.7146 1.8503 0.1298  -0.0712 0.0723  144 PHE A CD2 
998  C CE1 . PHE A 177 ? 0.5674 0.7077 1.6187 0.0967  -0.0852 0.0655  144 PHE A CE1 
999  C CE2 . PHE A 177 ? 0.6001 0.7277 1.7980 0.1310  -0.0539 0.0444  144 PHE A CE2 
1000 C CZ  . PHE A 177 ? 0.5685 0.6913 1.6505 0.1144  -0.0622 0.0430  144 PHE A CZ  
1001 N N   . ASP A 178 ? 0.5386 0.7936 2.0917 0.0835  -0.2436 0.2168  145 ASP A N   
1002 C CA  . ASP A 178 ? 0.5422 0.8288 2.2300 0.0845  -0.2732 0.2440  145 ASP A CA  
1003 C C   . ASP A 178 ? 0.6092 0.8920 2.3619 0.0842  -0.3288 0.2860  145 ASP A C   
1004 O O   . ASP A 178 ? 0.6125 0.8972 2.4863 0.1052  -0.3163 0.2903  145 ASP A O   
1005 C CB  . ASP A 178 ? 0.5695 0.8790 2.2303 0.0617  -0.3029 0.2526  145 ASP A CB  
1006 C CG  . ASP A 178 ? 0.7165 1.0616 2.5127 0.0682  -0.2918 0.2548  145 ASP A CG  
1007 O OD1 . ASP A 178 ? 0.7099 1.0625 2.4949 0.0712  -0.2423 0.2281  145 ASP A OD1 
1008 O OD2 . ASP A 178 ? 0.7995 1.1656 2.7179 0.0701  -0.3332 0.2860  145 ASP A OD2 
1009 N N   . GLY A 179 ? 0.5823 0.8573 2.2508 0.0614  -0.3852 0.3155  146 GLY A N   
1010 C CA  . GLY A 179 ? 0.6152 0.8838 2.3239 0.0581  -0.4409 0.3624  146 GLY A CA  
1011 C C   . GLY A 179 ? 0.6712 0.9045 2.3497 0.0695  -0.4167 0.3564  146 GLY A C   
1012 O O   . GLY A 179 ? 0.6667 0.8923 2.4391 0.0938  -0.3802 0.3401  146 GLY A O   
1013 N N   . GLY A 180 ? 0.6366 0.8487 2.1858 0.0513  -0.4348 0.3667  147 GLY A N   
1014 C CA  . GLY A 180 ? 0.6334 0.8111 2.1306 0.0551  -0.4159 0.3620  147 GLY A CA  
1015 C C   . GLY A 180 ? 0.6892 0.8504 2.2977 0.0724  -0.4209 0.3836  147 GLY A C   
1016 O O   . GLY A 180 ? 0.7136 0.8892 2.4396 0.0786  -0.4568 0.4201  147 GLY A O   
1017 N N   . SER A 181 ? 0.6297 0.7597 2.2044 0.0796  -0.3872 0.3613  148 SER A N   
1018 C CA  . SER A 181 ? 0.6412 0.7467 2.3113 0.0958  -0.3834 0.3718  148 SER A CA  
1019 C C   . SER A 181 ? 0.6490 0.7308 2.2954 0.1107  -0.3224 0.3121  148 SER A C   
1020 O O   . SER A 181 ? 0.6373 0.7105 2.1600 0.0995  -0.3026 0.2862  148 SER A O   
1021 C CB  . SER A 181 ? 0.7378 0.8245 2.3684 0.0782  -0.4283 0.4259  148 SER A CB  
1022 O OG  . SER A 181 ? 0.8991 1.0066 2.5493 0.0646  -0.4900 0.4840  148 SER A OG  
1023 N N   . PHE A 182 ? 0.5872 0.6590 2.3523 0.1360  -0.2932 0.2881  149 PHE A N   
1024 C CA  . PHE A 182 ? 0.5694 0.6184 2.3175 0.1513  -0.2374 0.2270  149 PHE A CA  
1025 C C   . PHE A 182 ? 0.6649 0.6773 2.4742 0.1592  -0.2383 0.2286  149 PHE A C   
1026 O O   . PHE A 182 ? 0.6872 0.6933 2.6352 0.1757  -0.2444 0.2419  149 PHE A O   
1027 C CB  . PHE A 182 ? 0.5715 0.6371 2.3864 0.1744  -0.1891 0.1811  149 PHE A CB  
1028 C CG  . PHE A 182 ? 0.5566 0.6516 2.2941 0.1673  -0.1717 0.1649  149 PHE A CG  
1029 C CD1 . PHE A 182 ? 0.5746 0.6628 2.1929 0.1649  -0.1331 0.1200  149 PHE A CD1 
1030 C CD2 . PHE A 182 ? 0.5680 0.6971 2.3612 0.1632  -0.1951 0.1950  149 PHE A CD2 
1031 C CE1 . PHE A 182 ? 0.5631 0.6761 2.1181 0.1587  -0.1165 0.1087  149 PHE A CE1 
1032 C CE2 . PHE A 182 ? 0.5796 0.7337 2.3120 0.1560  -0.1779 0.1800  149 PHE A CE2 
1033 C CZ  . PHE A 182 ? 0.5430 0.6878 2.1570 0.1540  -0.1374 0.1380  149 PHE A CZ  
1034 N N   . LEU A 183 ? 0.6332 0.6210 2.3479 0.1474  -0.2318 0.2149  150 LEU A N   
1035 C CA  . LEU A 183 ? 0.6607 0.6113 2.4247 0.1514  -0.2309 0.2124  150 LEU A CA  
1036 C C   . LEU A 183 ? 0.7389 0.6723 2.5640 0.1766  -0.1814 0.1441  150 LEU A C   
1037 O O   . LEU A 183 ? 0.7131 0.6527 2.4631 0.1818  -0.1427 0.0896  150 LEU A O   
1038 C CB  . LEU A 183 ? 0.6610 0.5953 2.3054 0.1288  -0.2387 0.2188  150 LEU A CB  
1039 C CG  . LEU A 183 ? 0.7399 0.6350 2.4224 0.1291  -0.2342 0.2106  150 LEU A CG  
1040 C CD1 . LEU A 183 ? 0.7824 0.6617 2.5773 0.1281  -0.2713 0.2728  150 LEU A CD1 
1041 C CD2 . LEU A 183 ? 0.7524 0.6400 2.3130 0.1072  -0.2341 0.2094  150 LEU A CD2 
1042 N N   . SER A 184 ? 0.7526 0.6635 2.7143 0.1921  -0.1836 0.1483  151 SER A N   
1043 C CA  . SER A 184 ? 0.7774 0.6665 2.8147 0.2167  -0.1391 0.0832  151 SER A CA  
1044 C C   . SER A 184 ? 0.8866 0.7339 3.0092 0.2182  -0.1529 0.0918  151 SER A C   
1045 O O   . SER A 184 ? 0.8982 0.7404 3.0854 0.2098  -0.1958 0.1590  151 SER A O   
1046 C CB  . SER A 184 ? 0.8111 0.7204 2.9696 0.2404  -0.1205 0.0752  151 SER A CB  
1047 O OG  . SER A 184 ? 0.8839 0.8010 3.1561 0.2398  -0.1660 0.1441  151 SER A OG  
1048 N N   . LEU A 185 ? 0.8820 0.6990 3.0047 0.2277  -0.1189 0.0256  152 LEU A N   
1049 C CA  . LEU A 185 ? 0.9274 0.7011 3.1447 0.2298  -0.1284 0.0251  152 LEU A CA  
1050 C C   . LEU A 185 ? 1.0159 0.7628 3.3157 0.2558  -0.0837 -0.0561 152 LEU A C   
1051 O O   . LEU A 185 ? 1.0473 0.7575 3.4637 0.2629  -0.0890 -0.0599 152 LEU A O   
1052 C CB  . LEU A 185 ? 0.9299 0.6853 3.0564 0.2040  -0.1489 0.0412  152 LEU A CB  
1053 C CG  . LEU A 185 ? 1.0208 0.7479 3.2358 0.1924  -0.1873 0.1057  152 LEU A CG  
1054 C CD1 . LEU A 185 ? 1.0271 0.7736 3.3058 0.1901  -0.2270 0.1908  152 LEU A CD1 
1055 C CD2 . LEU A 185 ? 1.0514 0.7705 3.1623 0.1645  -0.2028 0.1271  152 LEU A CD2 
1056 N N   . GLY A 186 ? 0.9684 0.7341 3.2121 0.2697  -0.0399 -0.1169 153 GLY A N   
1057 C CA  . GLY A 186 ? 1.0026 0.7499 3.3012 0.2950  0.0099  -0.1994 153 GLY A CA  
1058 C C   . GLY A 186 ? 1.0793 0.7844 3.3569 0.2936  0.0215  -0.2619 153 GLY A C   
1059 O O   . GLY A 186 ? 1.0791 0.7851 3.2390 0.2926  0.0481  -0.3227 153 GLY A O   
1060 N N   . ILE A 187 ? 1.0627 0.7298 3.4625 0.2939  0.0002  -0.2472 154 ILE A N   
1061 C CA  . ILE A 187 ? 1.0961 0.7176 3.5105 0.2907  0.0033  -0.3006 154 ILE A CA  
1062 C C   . ILE A 187 ? 1.0967 0.7218 3.3628 0.2630  -0.0180 -0.2937 154 ILE A C   
1063 O O   . ILE A 187 ? 1.1102 0.7190 3.3073 0.2611  -0.0020 -0.3625 154 ILE A O   
1064 C CB  . ILE A 187 ? 1.1649 0.7477 3.7536 0.2931  -0.0227 -0.2640 154 ILE A CB  
1065 C CG1 . ILE A 187 ? 1.1838 0.7733 3.7823 0.3167  -0.0145 -0.2250 154 ILE A CG1 
1066 C CG2 . ILE A 187 ? 1.2268 0.7580 3.7639 0.2964  -0.0081 -0.3261 154 ILE A CG2 
1067 C CD1 . ILE A 187 ? 1.2620 0.8759 3.7931 0.3052  -0.0574 -0.1151 154 ILE A CD1 
1068 N N   . PHE A 188 ? 0.9949 0.6433 3.2124 0.2420  -0.0538 -0.2118 155 PHE A N   
1069 C CA  . PHE A 188 ? 0.9620 0.6185 3.0518 0.2153  -0.0743 -0.1924 155 PHE A CA  
1070 C C   . PHE A 188 ? 0.9730 0.6660 2.9031 0.2122  -0.0561 -0.2180 155 PHE A C   
1071 O O   . PHE A 188 ? 0.9479 0.6498 2.7728 0.1917  -0.0706 -0.2054 155 PHE A O   
1072 C CB  . PHE A 188 ? 0.9628 0.6262 3.0706 0.1944  -0.1169 -0.0946 155 PHE A CB  
1073 C CG  . PHE A 188 ? 1.0163 0.6418 3.2635 0.1912  -0.1401 -0.0572 155 PHE A CG  
1074 C CD1 . PHE A 188 ? 1.0676 0.6694 3.3050 0.1698  -0.1569 -0.0432 155 PHE A CD1 
1075 C CD2 . PHE A 188 ? 1.0668 0.6816 3.4622 0.2089  -0.1458 -0.0300 155 PHE A CD2 
1076 C CE1 . PHE A 188 ? 1.1154 0.6809 3.4866 0.1656  -0.1773 -0.0030 155 PHE A CE1 
1077 C CE2 . PHE A 188 ? 1.1374 0.7152 3.6675 0.2060  -0.1685 0.0102  155 PHE A CE2 
1078 C CZ  . PHE A 188 ? 1.1258 0.6783 3.6413 0.1839  -0.1836 0.0243  155 PHE A CZ  
1079 N N   . PHE A 189 ? 0.9192 0.6328 2.8364 0.2324  -0.0224 -0.2535 156 PHE A N   
1080 C CA  . PHE A 189 ? 0.8844 0.6309 2.6584 0.2305  -0.0026 -0.2754 156 PHE A CA  
1081 C C   . PHE A 189 ? 0.9354 0.6691 2.6026 0.2237  0.0064  -0.3356 156 PHE A C   
1082 O O   . PHE A 189 ? 0.9054 0.6582 2.4574 0.2069  -0.0057 -0.3189 156 PHE A O   
1083 C CB  . PHE A 189 ? 0.9120 0.6805 2.7061 0.2538  0.0369  -0.3021 156 PHE A CB  
1084 C CG  . PHE A 189 ? 0.9132 0.7137 2.5674 0.2523  0.0602  -0.3214 156 PHE A CG  
1085 C CD1 . PHE A 189 ? 0.9010 0.7360 2.4954 0.2389  0.0429  -0.2650 156 PHE A CD1 
1086 C CD2 . PHE A 189 ? 0.9779 0.7724 2.5603 0.2639  0.0984  -0.3956 156 PHE A CD2 
1087 C CE1 . PHE A 189 ? 0.8941 0.7557 2.3684 0.2373  0.0642  -0.2806 156 PHE A CE1 
1088 C CE2 . PHE A 189 ? 0.9975 0.8202 2.4521 0.2622  0.1187  -0.4067 156 PHE A CE2 
1089 C CZ  . PHE A 189 ? 0.9177 0.7732 2.3254 0.2493  0.1023  -0.3482 156 PHE A CZ  
1090 N N   . VAL A 190 ? 0.9274 0.6289 2.6364 0.2364  0.0256  -0.4059 157 VAL A N   
1091 C CA  . VAL A 190 ? 0.9505 0.6372 2.5698 0.2309  0.0294  -0.4697 157 VAL A CA  
1092 C C   . VAL A 190 ? 0.9691 0.6442 2.5732 0.2048  -0.0108 -0.4379 157 VAL A C   
1093 O O   . VAL A 190 ? 0.9479 0.6408 2.4343 0.1918  -0.0185 -0.4401 157 VAL A O   
1094 C CB  . VAL A 190 ? 1.0748 0.7286 2.7431 0.2503  0.0581  -0.5573 157 VAL A CB  
1095 C CG1 . VAL A 190 ? 1.1100 0.7589 2.6532 0.2461  0.0631  -0.6253 157 VAL A CG1 
1096 C CG2 . VAL A 190 ? 1.0936 0.7581 2.8076 0.2765  0.1016  -0.5792 157 VAL A CG2 
1097 N N   . PRO A 191 ? 0.9185 0.5672 2.6386 0.1962  -0.0355 -0.4021 158 PRO A N   
1098 C CA  . PRO A 191 ? 0.8963 0.5386 2.5975 0.1702  -0.0679 -0.3671 158 PRO A CA  
1099 C C   . PRO A 191 ? 0.8927 0.5725 2.4954 0.1526  -0.0824 -0.3021 158 PRO A C   
1100 O O   . PRO A 191 ? 0.8690 0.5554 2.3970 0.1351  -0.0948 -0.3019 158 PRO A O   
1101 C CB  . PRO A 191 ? 0.9333 0.5439 2.7858 0.1670  -0.0859 -0.3274 158 PRO A CB  
1102 C CG  . PRO A 191 ? 1.0291 0.6184 2.9814 0.1929  -0.0624 -0.3729 158 PRO A CG  
1103 C CD  . PRO A 191 ? 0.9575 0.5806 2.8354 0.2096  -0.0339 -0.3896 158 PRO A CD  
1104 N N   . ALA A 192 ? 0.8295 0.5341 2.4352 0.1575  -0.0810 -0.2507 159 ALA A N   
1105 C CA  . ALA A 192 ? 0.7874 0.5268 2.3005 0.1419  -0.0937 -0.1940 159 ALA A CA  
1106 C C   . ALA A 192 ? 0.8265 0.5903 2.2060 0.1427  -0.0771 -0.2325 159 ALA A C   
1107 O O   . ALA A 192 ? 0.7907 0.5724 2.0863 0.1254  -0.0891 -0.2059 159 ALA A O   
1108 C CB  . ALA A 192 ? 0.7803 0.5389 2.3353 0.1479  -0.0987 -0.1395 159 ALA A CB  
1109 N N   . LEU A 193 ? 0.8161 0.5798 2.1769 0.1629  -0.0479 -0.2942 160 LEU A N   
1110 C CA  . LEU A 193 ? 0.8174 0.6013 2.0540 0.1659  -0.0305 -0.3322 160 LEU A CA  
1111 C C   . LEU A 193 ? 0.9063 0.6791 2.0853 0.1529  -0.0449 -0.3632 160 LEU A C   
1112 O O   . LEU A 193 ? 0.8762 0.6703 1.9603 0.1414  -0.0521 -0.3494 160 LEU A O   
1113 C CB  . LEU A 193 ? 0.8534 0.6371 2.0886 0.1906  0.0072  -0.3890 160 LEU A CB  
1114 C CG  . LEU A 193 ? 0.9312 0.7281 2.0404 0.1963  0.0284  -0.4384 160 LEU A CG  
1115 C CD1 . LEU A 193 ? 0.8900 0.7211 1.9020 0.1861  0.0246  -0.3973 160 LEU A CD1 
1116 C CD2 . LEU A 193 ? 0.9967 0.7933 2.1151 0.2201  0.0701  -0.4856 160 LEU A CD2 
1117 N N   . PHE A 194 ? 0.9185 0.6580 2.1643 0.1543  -0.0507 -0.4040 161 PHE A N   
1118 C CA  . PHE A 194 ? 0.9395 0.6667 2.1525 0.1413  -0.0687 -0.4367 161 PHE A CA  
1119 C C   . PHE A 194 ? 0.9672 0.7060 2.1679 0.1169  -0.0942 -0.3780 161 PHE A C   
1120 O O   . PHE A 194 ? 0.9507 0.7058 2.0667 0.1072  -0.1021 -0.3857 161 PHE A O   
1121 C CB  . PHE A 194 ? 1.0161 0.7028 2.3240 0.1462  -0.0720 -0.4888 161 PHE A CB  
1122 C CG  . PHE A 194 ? 1.0958 0.7716 2.3648 0.1652  -0.0496 -0.5725 161 PHE A CG  
1123 C CD1 . PHE A 194 ? 1.1642 0.8315 2.4812 0.1876  -0.0187 -0.5973 161 PHE A CD1 
1124 C CD2 . PHE A 194 ? 1.1570 0.8317 2.3418 0.1608  -0.0594 -0.6269 161 PHE A CD2 
1125 C CE1 . PHE A 194 ? 1.2393 0.8966 2.5117 0.2050  0.0074  -0.6768 161 PHE A CE1 
1126 C CE2 . PHE A 194 ? 1.2604 0.9246 2.3955 0.1776  -0.0392 -0.7045 161 PHE A CE2 
1127 C CZ  . PHE A 194 ? 1.2673 0.9224 2.4426 0.1995  -0.0034 -0.7299 161 PHE A CZ  
1128 N N   . PHE A 195 ? 0.9195 0.6532 2.1970 0.1084  -0.1045 -0.3179 162 PHE A N   
1129 C CA  . PHE A 195 ? 0.8959 0.6393 2.1649 0.0852  -0.1234 -0.2589 162 PHE A CA  
1130 C C   . PHE A 195 ? 0.9063 0.6862 2.0659 0.0770  -0.1217 -0.2257 162 PHE A C   
1131 O O   . PHE A 195 ? 0.8807 0.6709 1.9987 0.0601  -0.1311 -0.2102 162 PHE A O   
1132 C CB  . PHE A 195 ? 0.9257 0.6558 2.2930 0.0805  -0.1330 -0.1995 162 PHE A CB  
1133 C CG  . PHE A 195 ? 0.9384 0.6761 2.2989 0.0565  -0.1487 -0.1355 162 PHE A CG  
1134 C CD1 . PHE A 195 ? 1.0141 0.7281 2.4482 0.0418  -0.1604 -0.1244 162 PHE A CD1 
1135 C CD2 . PHE A 195 ? 0.9401 0.7081 2.2213 0.0477  -0.1497 -0.0878 162 PHE A CD2 
1136 C CE1 . PHE A 195 ? 1.0220 0.7442 2.4474 0.0190  -0.1692 -0.0632 162 PHE A CE1 
1137 C CE2 . PHE A 195 ? 0.9754 0.7505 2.2421 0.0253  -0.1599 -0.0310 162 PHE A CE2 
1138 C CZ  . PHE A 195 ? 0.9790 0.7322 2.3160 0.0111  -0.1677 -0.0172 162 PHE A CZ  
1139 N N   . ILE A 196 ? 0.8490 0.6482 1.9712 0.0888  -0.1088 -0.2147 163 ILE A N   
1140 C CA  . ILE A 196 ? 0.8102 0.6418 1.8325 0.0829  -0.1056 -0.1902 163 ILE A CA  
1141 C C   . ILE A 196 ? 0.8411 0.6841 1.7719 0.0893  -0.0951 -0.2412 163 ILE A C   
1142 O O   . ILE A 196 ? 0.8112 0.6724 1.6724 0.0777  -0.1001 -0.2275 163 ILE A O   
1143 C CB  . ILE A 196 ? 0.8370 0.6859 1.8626 0.0898  -0.1001 -0.1530 163 ILE A CB  
1144 C CG1 . ILE A 196 ? 0.8168 0.6955 1.7508 0.0780  -0.1025 -0.1194 163 ILE A CG1 
1145 C CG2 . ILE A 196 ? 0.8624 0.7112 1.9040 0.1132  -0.0776 -0.1932 163 ILE A CG2 
1146 C CD1 . ILE A 196 ? 0.9460 0.8355 1.8992 0.0675  -0.1175 -0.0556 163 ILE A CD1 
1147 N N   . MET A 197 ? 0.8117 0.6434 1.7427 0.1072  -0.0807 -0.2990 164 MET A N   
1148 C CA  . MET A 197 ? 0.8151 0.6560 1.6549 0.1137  -0.0732 -0.3456 164 MET A CA  
1149 C C   . MET A 197 ? 0.8502 0.6859 1.6724 0.0999  -0.0949 -0.3630 164 MET A C   
1150 O O   . MET A 197 ? 0.8340 0.6886 1.5754 0.0961  -0.0987 -0.3660 164 MET A O   
1151 C CB  . MET A 197 ? 0.8952 0.7231 1.7366 0.1350  -0.0517 -0.4041 164 MET A CB  
1152 C CG  . MET A 197 ? 0.9598 0.8046 1.6914 0.1443  -0.0370 -0.4346 164 MET A CG  
1153 S SD  . MET A 197 ? 1.0294 0.8863 1.7505 0.1657  0.0037  -0.4394 164 MET A SD  
1154 C CE  . MET A 197 ? 1.0115 0.8873 1.5960 0.1707  0.0151  -0.4630 164 MET A CE  
1155 N N   . LEU A 198 ? 0.8053 0.6158 1.7115 0.0921  -0.1098 -0.3726 165 LEU A N   
1156 C CA  . LEU A 198 ? 0.7999 0.6060 1.7104 0.0772  -0.1318 -0.3873 165 LEU A CA  
1157 C C   . LEU A 198 ? 0.7717 0.5987 1.6662 0.0580  -0.1395 -0.3292 165 LEU A C   
1158 O O   . LEU A 198 ? 0.7542 0.5957 1.6039 0.0498  -0.1496 -0.3366 165 LEU A O   
1159 C CB  . LEU A 198 ? 0.8382 0.6104 1.8554 0.0728  -0.1442 -0.4118 165 LEU A CB  
1160 C CG  . LEU A 198 ? 0.9578 0.7060 1.9861 0.0888  -0.1408 -0.4870 165 LEU A CG  
1161 C CD1 . LEU A 198 ? 0.9915 0.7038 2.1455 0.0895  -0.1427 -0.4961 165 LEU A CD1 
1162 C CD2 . LEU A 198 ? 1.0163 0.7651 1.9967 0.0839  -0.1612 -0.5389 165 LEU A CD2 
1163 N N   . GLY A 199 ? 0.6899 0.5192 1.6188 0.0518  -0.1344 -0.2731 166 GLY A N   
1164 C CA  . GLY A 199 ? 0.6511 0.4991 1.5583 0.0339  -0.1370 -0.2171 166 GLY A CA  
1165 C C   . GLY A 199 ? 0.6655 0.5427 1.4714 0.0357  -0.1295 -0.2136 166 GLY A C   
1166 O O   . GLY A 199 ? 0.6374 0.5292 1.4129 0.0233  -0.1335 -0.2033 166 GLY A O   
1167 N N   . THR A 200 ? 0.6086 0.4939 1.3697 0.0516  -0.1167 -0.2237 167 THR A N   
1168 C CA  . THR A 200 ? 0.5822 0.4921 1.2538 0.0555  -0.1079 -0.2219 167 THR A CA  
1169 C C   . THR A 200 ? 0.6366 0.5515 1.2598 0.0586  -0.1142 -0.2632 167 THR A C   
1170 O O   . THR A 200 ? 0.6185 0.5509 1.1988 0.0504  -0.1175 -0.2499 167 THR A O   
1171 C CB  . THR A 200 ? 0.6698 0.5859 1.3208 0.0712  -0.0912 -0.2222 167 THR A CB  
1172 O OG1 . THR A 200 ? 0.6570 0.5702 1.3609 0.0672  -0.0922 -0.1814 167 THR A OG1 
1173 C CG2 . THR A 200 ? 0.6200 0.5596 1.1875 0.0735  -0.0816 -0.2152 167 THR A CG2 
1174 N N   . ASP A 201 ? 0.6172 0.5165 1.2492 0.0701  -0.1174 -0.3134 168 ASP A N   
1175 C CA  . ASP A 201 ? 0.6397 0.5430 1.2225 0.0735  -0.1294 -0.3545 168 ASP A CA  
1176 C C   . ASP A 201 ? 0.6859 0.5937 1.2946 0.0567  -0.1511 -0.3492 168 ASP A C   
1177 O O   . ASP A 201 ? 0.6843 0.6100 1.2418 0.0553  -0.1598 -0.3526 168 ASP A O   
1178 C CB  . ASP A 201 ? 0.7184 0.6012 1.3059 0.0873  -0.1300 -0.4123 168 ASP A CB  
1179 C CG  . ASP A 201 ? 0.8458 0.7376 1.3468 0.0961  -0.1372 -0.4504 168 ASP A CG  
1180 O OD1 . ASP A 201 ? 0.8339 0.7439 1.2616 0.1038  -0.1231 -0.4356 168 ASP A OD1 
1181 O OD2 . ASP A 201 ? 0.9250 0.8052 1.4327 0.0947  -0.1587 -0.4941 168 ASP A OD2 
1182 N N   . ASN A 202 ? 0.6270 0.5197 1.3213 0.0440  -0.1588 -0.3374 169 ASN A N   
1183 C CA  . ASN A 202 ? 0.6113 0.5095 1.3453 0.0264  -0.1748 -0.3283 169 ASN A CA  
1184 C C   . ASN A 202 ? 0.6150 0.5366 1.3245 0.0147  -0.1639 -0.2771 169 ASN A C   
1185 O O   . ASN A 202 ? 0.6079 0.5463 1.3077 0.0070  -0.1716 -0.2766 169 ASN A O   
1186 C CB  . ASN A 202 ? 0.6173 0.4906 1.4548 0.0158  -0.1841 -0.3315 169 ASN A CB  
1187 C CG  . ASN A 202 ? 0.8500 0.6992 1.7133 0.0258  -0.1976 -0.3928 169 ASN A CG  
1188 O OD1 . ASN A 202 ? 0.8197 0.6733 1.6451 0.0301  -0.2149 -0.4376 169 ASN A OD1 
1189 N ND2 . ASN A 202 ? 0.7095 0.5320 1.6384 0.0298  -0.1915 -0.3971 169 ASN A ND2 
1190 N N   . GLY A 203 ? 0.5479 0.4714 1.2455 0.0145  -0.1468 -0.2381 170 GLY A N   
1191 C CA  . GLY A 203 ? 0.5145 0.4579 1.1780 0.0041  -0.1347 -0.1939 170 GLY A CA  
1192 C C   . GLY A 203 ? 0.5431 0.5082 1.1316 0.0107  -0.1317 -0.2039 170 GLY A C   
1193 O O   . GLY A 203 ? 0.5192 0.5006 1.0973 0.0006  -0.1284 -0.1874 170 GLY A O   
1194 N N   . VAL A 204 ? 0.5097 0.4744 1.0495 0.0282  -0.1309 -0.2309 171 VAL A N   
1195 C CA  . VAL A 204 ? 0.5021 0.4841 0.9713 0.0368  -0.1292 -0.2400 171 VAL A CA  
1196 C C   . VAL A 204 ? 0.5839 0.5727 1.0576 0.0350  -0.1495 -0.2657 171 VAL A C   
1197 O O   . VAL A 204 ? 0.5675 0.5743 1.0169 0.0324  -0.1503 -0.2550 171 VAL A O   
1198 C CB  . VAL A 204 ? 0.5584 0.5373 0.9779 0.0551  -0.1194 -0.2575 171 VAL A CB  
1199 C CG1 . VAL A 204 ? 0.5568 0.5512 0.9059 0.0638  -0.1188 -0.2638 171 VAL A CG1 
1200 C CG2 . VAL A 204 ? 0.5354 0.5132 0.9605 0.0556  -0.1020 -0.2281 171 VAL A CG2 
1201 N N   . ASN A 205 ? 0.5819 0.5560 1.0947 0.0357  -0.1674 -0.2998 172 ASN A N   
1202 C CA  . ASN A 205 ? 0.6010 0.5802 1.1305 0.0325  -0.1939 -0.3282 172 ASN A CA  
1203 C C   . ASN A 205 ? 0.6227 0.6164 1.2063 0.0151  -0.1957 -0.3020 172 ASN A C   
1204 O O   . ASN A 205 ? 0.6305 0.6418 1.2094 0.0141  -0.2102 -0.3082 172 ASN A O   
1205 C CB  . ASN A 205 ? 0.6469 0.6033 1.2187 0.0341  -0.2119 -0.3711 172 ASN A CB  
1206 C CG  . ASN A 205 ? 0.9238 0.8844 1.5165 0.0299  -0.2455 -0.4056 172 ASN A CG  
1207 O OD1 . ASN A 205 ? 0.8302 0.7901 1.5026 0.0147  -0.2578 -0.4031 172 ASN A OD1 
1208 N ND2 . ASN A 205 ? 0.8576 0.8231 1.3809 0.0425  -0.2624 -0.4374 172 ASN A ND2 
1209 N N   . PHE A 206 ? 0.5455 0.5327 1.1810 0.0017  -0.1799 -0.2705 173 PHE A N   
1210 C CA  . PHE A 206 ? 0.5199 0.5200 1.2062 -0.0161 -0.1728 -0.2418 173 PHE A CA  
1211 C C   . PHE A 206 ? 0.5493 0.5717 1.1861 -0.0168 -0.1538 -0.2144 173 PHE A C   
1212 O O   . PHE A 206 ? 0.5366 0.5761 1.2035 -0.0267 -0.1497 -0.2036 173 PHE A O   
1213 C CB  . PHE A 206 ? 0.5383 0.5228 1.2855 -0.0302 -0.1603 -0.2126 173 PHE A CB  
1214 C CG  . PHE A 206 ? 0.5771 0.5385 1.4030 -0.0346 -0.1771 -0.2343 173 PHE A CG  
1215 C CD1 . PHE A 206 ? 0.6365 0.5907 1.4719 -0.0263 -0.2040 -0.2856 173 PHE A CD1 
1216 C CD2 . PHE A 206 ? 0.6028 0.5483 1.4931 -0.0476 -0.1674 -0.2034 173 PHE A CD2 
1217 C CE1 . PHE A 206 ? 0.6736 0.6037 1.5849 -0.0309 -0.2199 -0.3110 173 PHE A CE1 
1218 C CE2 . PHE A 206 ? 0.6614 0.5826 1.6344 -0.0518 -0.1826 -0.2235 173 PHE A CE2 
1219 C CZ  . PHE A 206 ? 0.6602 0.5732 1.6450 -0.0434 -0.2084 -0.2800 173 PHE A CZ  
1220 N N   . THR A 207 ? 0.5021 0.5244 1.0700 -0.0062 -0.1415 -0.2057 174 THR A N   
1221 C CA  . THR A 207 ? 0.4672 0.5062 0.9855 -0.0056 -0.1240 -0.1845 174 THR A CA  
1222 C C   . THR A 207 ? 0.5016 0.5566 0.9996 0.0035  -0.1366 -0.2030 174 THR A C   
1223 O O   . THR A 207 ? 0.4780 0.5488 0.9693 0.0003  -0.1247 -0.1886 174 THR A O   
1224 C CB  . THR A 207 ? 0.5156 0.5475 0.9808 0.0016  -0.1109 -0.1711 174 THR A CB  
1225 O OG1 . THR A 207 ? 0.4916 0.5105 0.9874 -0.0079 -0.1044 -0.1498 174 THR A OG1 
1226 C CG2 . THR A 207 ? 0.4800 0.5257 0.8967 0.0012  -0.0939 -0.1523 174 THR A CG2 
1227 N N   . ASP A 208 ? 0.4839 0.5344 0.9741 0.0145  -0.1616 -0.2352 175 ASP A N   
1228 C CA  . ASP A 208 ? 0.4947 0.5599 0.9629 0.0239  -0.1805 -0.2501 175 ASP A CA  
1229 C C   . ASP A 208 ? 0.5316 0.6118 1.0699 0.0141  -0.1971 -0.2552 175 ASP A C   
1230 O O   . ASP A 208 ? 0.5548 0.6354 1.1150 0.0163  -0.2288 -0.2830 175 ASP A O   
1231 C CB  . ASP A 208 ? 0.5592 0.6142 0.9772 0.0393  -0.2008 -0.2810 175 ASP A CB  
1232 C CG  . ASP A 208 ? 0.6990 0.7674 1.0686 0.0515  -0.2177 -0.2868 175 ASP A CG  
1233 O OD1 . ASP A 208 ? 0.6611 0.7432 1.0211 0.0524  -0.2057 -0.2624 175 ASP A OD1 
1234 O OD2 . ASP A 208 ? 0.8442 0.9081 1.1830 0.0604  -0.2428 -0.3153 175 ASP A OD2 
1235 N N   . GLY A 209 ? 0.4553 0.5484 1.0293 0.0027  -0.1749 -0.2295 176 GLY A N   
1236 C CA  . GLY A 209 ? 0.4495 0.5601 1.1020 -0.0080 -0.1812 -0.2289 176 GLY A CA  
1237 C C   . GLY A 209 ? 0.4893 0.6225 1.1489 -0.0061 -0.1687 -0.2150 176 GLY A C   
1238 O O   . GLY A 209 ? 0.5007 0.6524 1.2278 -0.0102 -0.1803 -0.2195 176 GLY A O   
1239 N N   . LEU A 210 ? 0.4203 0.5521 1.0201 -0.0003 -0.1446 -0.1988 177 LEU A N   
1240 C CA  . LEU A 210 ? 0.4019 0.5510 1.0062 0.0030  -0.1291 -0.1878 177 LEU A CA  
1241 C C   . LEU A 210 ? 0.4645 0.6100 1.0015 0.0204  -0.1385 -0.1896 177 LEU A C   
1242 O O   . LEU A 210 ? 0.4781 0.6075 0.9564 0.0268  -0.1435 -0.1935 177 LEU A O   
1243 C CB  . LEU A 210 ? 0.3868 0.5369 0.9898 -0.0097 -0.0857 -0.1661 177 LEU A CB  
1244 C CG  . LEU A 210 ? 0.4492 0.6058 1.1182 -0.0284 -0.0670 -0.1561 177 LEU A CG  
1245 C CD1 . LEU A 210 ? 0.4539 0.6089 1.0944 -0.0401 -0.0248 -0.1345 177 LEU A CD1 
1246 C CD2 . LEU A 210 ? 0.4607 0.6409 1.2170 -0.0305 -0.0737 -0.1632 177 LEU A CD2 
1247 N N   . ASP A 211 ? 0.4110 0.5712 0.9624 0.0282  -0.1392 -0.1851 178 ASP A N   
1248 C CA  . ASP A 211 ? 0.4073 0.5642 0.9036 0.0442  -0.1466 -0.1808 178 ASP A CA  
1249 C C   . ASP A 211 ? 0.4352 0.5772 0.8724 0.0430  -0.1165 -0.1690 178 ASP A C   
1250 O O   . ASP A 211 ? 0.4163 0.5585 0.8652 0.0318  -0.0863 -0.1607 178 ASP A O   
1251 C CB  . ASP A 211 ? 0.4233 0.5980 0.9656 0.0512  -0.1491 -0.1742 178 ASP A CB  
1252 C CG  . ASP A 211 ? 0.4993 0.6932 1.1108 0.0531  -0.1839 -0.1836 178 ASP A CG  
1253 O OD1 . ASP A 211 ? 0.4947 0.6872 1.1195 0.0473  -0.2071 -0.1985 178 ASP A OD1 
1254 O OD2 . ASP A 211 ? 0.5726 0.7822 1.2293 0.0608  -0.1904 -0.1768 178 ASP A OD2 
1255 N N   . GLY A 212 ? 0.4054 0.5351 0.7800 0.0534  -0.1252 -0.1692 179 GLY A N   
1256 C CA  . GLY A 212 ? 0.3965 0.5134 0.7205 0.0532  -0.1019 -0.1585 179 GLY A CA  
1257 C C   . GLY A 212 ? 0.4451 0.5514 0.7592 0.0412  -0.0865 -0.1567 179 GLY A C   
1258 O O   . GLY A 212 ? 0.4294 0.5265 0.7049 0.0415  -0.0731 -0.1485 179 GLY A O   
1259 N N   . LEU A 213 ? 0.3964 0.5042 0.7512 0.0302  -0.0900 -0.1619 180 LEU A N   
1260 C CA  . LEU A 213 ? 0.3834 0.4813 0.7398 0.0176  -0.0773 -0.1543 180 LEU A CA  
1261 C C   . LEU A 213 ? 0.4558 0.5388 0.7776 0.0240  -0.0839 -0.1578 180 LEU A C   
1262 O O   . LEU A 213 ? 0.4535 0.5302 0.7490 0.0207  -0.0696 -0.1446 180 LEU A O   
1263 C CB  . LEU A 213 ? 0.3805 0.4823 0.7972 0.0049  -0.0802 -0.1559 180 LEU A CB  
1264 C CG  . LEU A 213 ? 0.4268 0.5186 0.8547 -0.0100 -0.0669 -0.1404 180 LEU A CG  
1265 C CD1 . LEU A 213 ? 0.4235 0.5141 0.8124 -0.0181 -0.0418 -0.1198 180 LEU A CD1 
1266 C CD2 . LEU A 213 ? 0.4410 0.5396 0.9354 -0.0236 -0.0641 -0.1370 180 LEU A CD2 
1267 N N   . CYS A 214 ? 0.4273 0.5050 0.7525 0.0324  -0.1052 -0.1772 181 CYS A N   
1268 C CA  . CYS A 214 ? 0.4301 0.4938 0.7294 0.0399  -0.1077 -0.1858 181 CYS A CA  
1269 C C   . CYS A 214 ? 0.4581 0.5216 0.7033 0.0511  -0.0970 -0.1788 181 CYS A C   
1270 O O   . CYS A 214 ? 0.4517 0.5082 0.6841 0.0510  -0.0842 -0.1699 181 CYS A O   
1271 C CB  . CYS A 214 ? 0.4653 0.5232 0.7745 0.0469  -0.1314 -0.2146 181 CYS A CB  
1272 S SG  . CYS A 214 ? 0.5435 0.5820 0.8371 0.0553  -0.1290 -0.2315 181 CYS A SG  
1273 N N   . THR A 215 ? 0.4012 0.4732 0.6229 0.0599  -0.1025 -0.1793 182 THR A N   
1274 C CA  . THR A 215 ? 0.4006 0.4726 0.5776 0.0697  -0.0917 -0.1688 182 THR A CA  
1275 C C   . THR A 215 ? 0.4263 0.4975 0.6046 0.0609  -0.0699 -0.1493 182 THR A C   
1276 O O   . THR A 215 ? 0.4390 0.5045 0.5993 0.0635  -0.0596 -0.1442 182 THR A O   
1277 C CB  . THR A 215 ? 0.5179 0.5988 0.6808 0.0791  -0.1040 -0.1669 182 THR A CB  
1278 O OG1 . THR A 215 ? 0.5996 0.6832 0.7663 0.0840  -0.1310 -0.1862 182 THR A OG1 
1279 C CG2 . THR A 215 ? 0.4751 0.5535 0.5904 0.0908  -0.0949 -0.1553 182 THR A CG2 
1280 N N   . SER A 216 ? 0.3568 0.4338 0.5585 0.0497  -0.0627 -0.1407 183 SER A N   
1281 C CA  . SER A 216 ? 0.3377 0.4133 0.5334 0.0396  -0.0446 -0.1266 183 SER A CA  
1282 C C   . SER A 216 ? 0.3896 0.4584 0.5843 0.0317  -0.0413 -0.1196 183 SER A C   
1283 O O   . SER A 216 ? 0.4004 0.4666 0.5786 0.0311  -0.0340 -0.1107 183 SER A O   
1284 C CB  . SER A 216 ? 0.3644 0.4468 0.5817 0.0286  -0.0350 -0.1241 183 SER A CB  
1285 O OG  . SER A 216 ? 0.4691 0.5581 0.6964 0.0373  -0.0373 -0.1278 183 SER A OG  
1286 N N   . VAL A 217 ? 0.3222 0.3880 0.5420 0.0259  -0.0486 -0.1223 184 VAL A N   
1287 C CA  . VAL A 217 ? 0.3170 0.3755 0.5464 0.0188  -0.0488 -0.1119 184 VAL A CA  
1288 C C   . VAL A 217 ? 0.3926 0.4453 0.6140 0.0317  -0.0508 -0.1172 184 VAL A C   
1289 O O   . VAL A 217 ? 0.3885 0.4397 0.6091 0.0287  -0.0469 -0.1041 184 VAL A O   
1290 C CB  . VAL A 217 ? 0.3577 0.4125 0.6252 0.0090  -0.0550 -0.1100 184 VAL A CB  
1291 C CG1 . VAL A 217 ? 0.3520 0.3971 0.6368 0.0042  -0.0586 -0.0960 184 VAL A CG1 
1292 C CG2 . VAL A 217 ? 0.3523 0.4151 0.6270 -0.0055 -0.0448 -0.1001 184 VAL A CG2 
1293 N N   . THR A 218 ? 0.3683 0.4190 0.5826 0.0456  -0.0564 -0.1368 185 THR A N   
1294 C CA  . THR A 218 ? 0.3793 0.4249 0.5830 0.0588  -0.0522 -0.1458 185 THR A CA  
1295 C C   . THR A 218 ? 0.4182 0.4692 0.5940 0.0643  -0.0383 -0.1344 185 THR A C   
1296 O O   . THR A 218 ? 0.4147 0.4642 0.5970 0.0692  -0.0292 -0.1314 185 THR A O   
1297 C CB  . THR A 218 ? 0.4882 0.5290 0.6829 0.0707  -0.0617 -0.1731 185 THR A CB  
1298 O OG1 . THR A 218 ? 0.4948 0.5311 0.7261 0.0627  -0.0763 -0.1827 185 THR A OG1 
1299 C CG2 . THR A 218 ? 0.4593 0.4924 0.6498 0.0829  -0.0527 -0.1872 185 THR A CG2 
1300 N N   . ILE A 219 ? 0.3632 0.4204 0.5186 0.0629  -0.0357 -0.1271 186 ILE A N   
1301 C CA  . ILE A 219 ? 0.3590 0.4194 0.4974 0.0661  -0.0225 -0.1144 186 ILE A CA  
1302 C C   . ILE A 219 ? 0.4063 0.4672 0.5653 0.0553  -0.0179 -0.1005 186 ILE A C   
1303 O O   . ILE A 219 ? 0.4024 0.4650 0.5661 0.0599  -0.0083 -0.0942 186 ILE A O   
1304 C CB  . ILE A 219 ? 0.3857 0.4497 0.5123 0.0649  -0.0218 -0.1085 186 ILE A CB  
1305 C CG1 . ILE A 219 ? 0.4024 0.4679 0.5090 0.0774  -0.0308 -0.1170 186 ILE A CG1 
1306 C CG2 . ILE A 219 ? 0.3867 0.4510 0.5092 0.0641  -0.0083 -0.0939 186 ILE A CG2 
1307 C CD1 . ILE A 219 ? 0.4010 0.4709 0.5155 0.0760  -0.0364 -0.1128 186 ILE A CD1 
1308 N N   . LEU A 220 ? 0.3484 0.4089 0.5202 0.0407  -0.0254 -0.0950 187 LEU A N   
1309 C CA  . LEU A 220 ? 0.3301 0.3915 0.5142 0.0280  -0.0281 -0.0804 187 LEU A CA  
1310 C C   . LEU A 220 ? 0.3987 0.4580 0.6115 0.0316  -0.0328 -0.0760 187 LEU A C   
1311 O O   . LEU A 220 ? 0.4082 0.4714 0.6363 0.0298  -0.0328 -0.0649 187 LEU A O   
1312 C CB  . LEU A 220 ? 0.3221 0.3836 0.5000 0.0116  -0.0326 -0.0751 187 LEU A CB  
1313 C CG  . LEU A 220 ? 0.3687 0.4325 0.5269 0.0080  -0.0238 -0.0808 187 LEU A CG  
1314 C CD1 . LEU A 220 ? 0.3691 0.4342 0.5263 -0.0013 -0.0213 -0.0841 187 LEU A CD1 
1315 C CD2 . LEU A 220 ? 0.4015 0.4657 0.5497 -0.0007 -0.0215 -0.0752 187 LEU A CD2 
1316 N N   . VAL A 221 ? 0.3557 0.4091 0.5836 0.0380  -0.0368 -0.0865 188 VAL A N   
1317 C CA  . VAL A 221 ? 0.3573 0.4060 0.6220 0.0439  -0.0392 -0.0864 188 VAL A CA  
1318 C C   . VAL A 221 ? 0.4364 0.4888 0.7019 0.0590  -0.0237 -0.0940 188 VAL A C   
1319 O O   . VAL A 221 ? 0.4445 0.5004 0.7440 0.0603  -0.0216 -0.0837 188 VAL A O   
1320 C CB  . VAL A 221 ? 0.4070 0.4452 0.6920 0.0466  -0.0465 -0.1007 188 VAL A CB  
1321 C CG1 . VAL A 221 ? 0.4120 0.4425 0.7381 0.0576  -0.0445 -0.1094 188 VAL A CG1 
1322 C CG2 . VAL A 221 ? 0.3997 0.4353 0.6970 0.0298  -0.0579 -0.0846 188 VAL A CG2 
1323 N N   . ALA A 222 ? 0.3971 0.4504 0.6267 0.0697  -0.0129 -0.1088 189 ALA A N   
1324 C CA  . ALA A 222 ? 0.4132 0.4703 0.6331 0.0838  0.0071  -0.1142 189 ALA A CA  
1325 C C   . ALA A 222 ? 0.4665 0.5332 0.6949 0.0793  0.0166  -0.0939 189 ALA A C   
1326 O O   . ALA A 222 ? 0.4740 0.5461 0.7233 0.0873  0.0336  -0.0914 189 ALA A O   
1327 C CB  . ALA A 222 ? 0.4444 0.4994 0.6154 0.0947  0.0123  -0.1304 189 ALA A CB  
1328 N N   . THR A 223 ? 0.4030 0.4717 0.6210 0.0659  0.0069  -0.0816 190 THR A N   
1329 C CA  . THR A 223 ? 0.3855 0.4611 0.6164 0.0582  0.0110  -0.0656 190 THR A CA  
1330 C C   . THR A 223 ? 0.4221 0.5031 0.6999 0.0516  0.0019  -0.0546 190 THR A C   
1331 O O   . THR A 223 ? 0.4317 0.5209 0.7401 0.0538  0.0113  -0.0461 190 THR A O   
1332 C CB  . THR A 223 ? 0.4210 0.4945 0.6301 0.0454  0.0023  -0.0622 190 THR A CB  
1333 O OG1 . THR A 223 ? 0.3769 0.4469 0.5543 0.0539  0.0095  -0.0695 190 THR A OG1 
1334 C CG2 . THR A 223 ? 0.3643 0.4422 0.5900 0.0353  0.0030  -0.0508 190 THR A CG2 
1335 N N   . PHE A 224 ? 0.3553 0.4321 0.6439 0.0438  -0.0168 -0.0521 191 PHE A N   
1336 C CA  . PHE A 224 ? 0.3402 0.4216 0.6755 0.0378  -0.0312 -0.0370 191 PHE A CA  
1337 C C   . PHE A 224 ? 0.4012 0.4868 0.7829 0.0537  -0.0159 -0.0410 191 PHE A C   
1338 O O   . PHE A 224 ? 0.4029 0.4994 0.8289 0.0527  -0.0163 -0.0286 191 PHE A O   
1339 C CB  . PHE A 224 ? 0.3559 0.4295 0.6926 0.0288  -0.0510 -0.0304 191 PHE A CB  
1340 C CG  . PHE A 224 ? 0.3673 0.4436 0.7569 0.0255  -0.0685 -0.0111 191 PHE A CG  
1341 C CD1 . PHE A 224 ? 0.4089 0.4922 0.8015 0.0093  -0.0912 0.0108  191 PHE A CD1 
1342 C CD2 . PHE A 224 ? 0.3804 0.4519 0.8188 0.0388  -0.0641 -0.0156 191 PHE A CD2 
1343 C CE1 . PHE A 224 ? 0.4280 0.5151 0.8725 0.0066  -0.1126 0.0331  191 PHE A CE1 
1344 C CE2 . PHE A 224 ? 0.4231 0.4971 0.9215 0.0372  -0.0816 0.0051  191 PHE A CE2 
1345 C CZ  . PHE A 224 ? 0.4103 0.4929 0.9120 0.0211  -0.1076 0.0320  191 PHE A CZ  
1346 N N   . LEU A 225 ? 0.3679 0.4455 0.7416 0.0682  -0.0018 -0.0607 192 LEU A N   
1347 C CA  . LEU A 225 ? 0.3795 0.4590 0.7915 0.0849  0.0187  -0.0716 192 LEU A CA  
1348 C C   . LEU A 225 ? 0.4229 0.5147 0.8378 0.0919  0.0450  -0.0686 192 LEU A C   
1349 O O   . LEU A 225 ? 0.4208 0.5208 0.8890 0.1008  0.0608  -0.0676 192 LEU A O   
1350 C CB  . LEU A 225 ? 0.4028 0.4691 0.7928 0.0977  0.0282  -0.0999 192 LEU A CB  
1351 C CG  . LEU A 225 ? 0.4614 0.5142 0.8572 0.0911  0.0054  -0.1043 192 LEU A CG  
1352 C CD1 . LEU A 225 ? 0.4905 0.5316 0.8527 0.1009  0.0115  -0.1357 192 LEU A CD1 
1353 C CD2 . LEU A 225 ? 0.4771 0.5267 0.9455 0.0899  -0.0066 -0.0922 192 LEU A CD2 
1354 N N   . THR A 226 ? 0.3659 0.4591 0.7317 0.0878  0.0508  -0.0653 193 THR A N   
1355 C CA  . THR A 226 ? 0.3597 0.4629 0.7273 0.0922  0.0760  -0.0571 193 THR A CA  
1356 C C   . THR A 226 ? 0.3866 0.5028 0.8152 0.0809  0.0672  -0.0366 193 THR A C   
1357 O O   . THR A 226 ? 0.4024 0.5306 0.8802 0.0878  0.0882  -0.0311 193 THR A O   
1358 C CB  . THR A 226 ? 0.4327 0.5306 0.7374 0.0912  0.0805  -0.0568 193 THR A CB  
1359 O OG1 . THR A 226 ? 0.4623 0.5509 0.7168 0.1028  0.0855  -0.0761 193 THR A OG1 
1360 C CG2 . THR A 226 ? 0.4016 0.5074 0.7111 0.0942  0.1062  -0.0426 193 THR A CG2 
1361 N N   . ILE A 227 ? 0.3115 0.4263 0.7382 0.0634  0.0364  -0.0268 194 ILE A N   
1362 C CA  . ILE A 227 ? 0.2916 0.4179 0.7687 0.0493  0.0180  -0.0098 194 ILE A CA  
1363 C C   . ILE A 227 ? 0.3422 0.4787 0.8921 0.0540  0.0115  -0.0022 194 ILE A C   
1364 O O   . ILE A 227 ? 0.3575 0.5096 0.9710 0.0533  0.0160  0.0090  194 ILE A O   
1365 C CB  . ILE A 227 ? 0.3199 0.4399 0.7625 0.0296  -0.0140 -0.0062 194 ILE A CB  
1366 C CG1 . ILE A 227 ? 0.3175 0.4279 0.7028 0.0270  -0.0036 -0.0150 194 ILE A CG1 
1367 C CG2 . ILE A 227 ? 0.3178 0.4492 0.8056 0.0134  -0.0403 0.0084  194 ILE A CG2 
1368 C CD1 . ILE A 227 ? 0.4153 0.5163 0.7546 0.0126  -0.0244 -0.0200 194 ILE A CD1 
1369 N N   . VAL A 228 ? 0.2881 0.4158 0.8378 0.0597  0.0024  -0.0081 195 VAL A N   
1370 C CA  . VAL A 228 ? 0.2831 0.4170 0.9084 0.0663  -0.0045 -0.0009 195 VAL A CA  
1371 C C   . VAL A 228 ? 0.3307 0.4727 1.0018 0.0861  0.0354  -0.0123 195 VAL A C   
1372 O O   . VAL A 228 ? 0.3287 0.4870 1.0813 0.0884  0.0370  -0.0001 195 VAL A O   
1373 C CB  . VAL A 228 ? 0.3315 0.4503 0.9485 0.0658  -0.0250 -0.0023 195 VAL A CB  
1374 C CG1 . VAL A 228 ? 0.3369 0.4590 1.0409 0.0760  -0.0287 0.0043  195 VAL A CG1 
1375 C CG2 . VAL A 228 ? 0.3233 0.4385 0.9039 0.0448  -0.0614 0.0149  195 VAL A CG2 
1376 N N   . ALA A 229 ? 0.2973 0.4297 0.9161 0.0997  0.0674  -0.0351 196 ALA A N   
1377 C CA  . ALA A 229 ? 0.3205 0.4590 0.9628 0.1187  0.1113  -0.0497 196 ALA A CA  
1378 C C   . ALA A 229 ? 0.3808 0.5390 1.0604 0.1177  0.1352  -0.0343 196 ALA A C   
1379 O O   . ALA A 229 ? 0.3815 0.5514 1.1158 0.1309  0.1691  -0.0384 196 ALA A O   
1380 C CB  . ALA A 229 ? 0.3537 0.4775 0.9138 0.1302  0.1342  -0.0760 196 ALA A CB  
1381 N N   . ILE A 230 ? 0.3433 0.5049 0.9995 0.1019  0.1196  -0.0176 197 ILE A N   
1382 C CA  . ILE A 230 ? 0.3448 0.5237 1.0447 0.0972  0.1374  -0.0007 197 ILE A CA  
1383 C C   . ILE A 230 ? 0.3911 0.5877 1.1915 0.0878  0.1110  0.0165  197 ILE A C   
1384 O O   . ILE A 230 ? 0.3970 0.6118 1.2791 0.0958  0.1349  0.0221  197 ILE A O   
1385 C CB  . ILE A 230 ? 0.3761 0.5485 1.0183 0.0847  0.1324  0.0073  197 ILE A CB  
1386 C CG1 . ILE A 230 ? 0.3992 0.5576 0.9527 0.0962  0.1590  -0.0046 197 ILE A CG1 
1387 C CG2 . ILE A 230 ? 0.3915 0.5809 1.0981 0.0768  0.1455  0.0266  197 ILE A CG2 
1388 C CD1 . ILE A 230 ? 0.4960 0.6425 0.9885 0.0855  0.1448  0.0005  197 ILE A CD1 
1389 N N   . GLY A 231 ? 0.3369 0.5290 1.1292 0.0710  0.0625  0.0248  198 GLY A N   
1390 C CA  . GLY A 231 ? 0.3279 0.5355 1.1996 0.0588  0.0251  0.0433  198 GLY A CA  
1391 C C   . GLY A 231 ? 0.3980 0.6171 1.3605 0.0715  0.0266  0.0479  198 GLY A C   
1392 O O   . GLY A 231 ? 0.3967 0.6377 1.4550 0.0686  0.0179  0.0635  198 GLY A O   
1393 N N   . GLU A 232 ? 0.3769 0.5812 1.3182 0.0859  0.0369  0.0335  199 GLU A N   
1394 C CA  . GLU A 232 ? 0.3819 0.5922 1.4128 0.1001  0.0397  0.0345  199 GLU A CA  
1395 C C   . GLU A 232 ? 0.4703 0.6879 1.5408 0.1222  0.0985  0.0157  199 GLU A C   
1396 O O   . GLU A 232 ? 0.4890 0.7098 1.6368 0.1371  0.1097  0.0100  199 GLU A O   
1397 C CB  . GLU A 232 ? 0.3980 0.5868 1.4002 0.1016  0.0143  0.0303  199 GLU A CB  
1398 C CG  . GLU A 232 ? 0.4992 0.6853 1.4835 0.0804  -0.0430 0.0555  199 GLU A CG  
1399 C CD  . GLU A 232 ? 0.7469 0.9519 1.8274 0.0730  -0.0825 0.0858  199 GLU A CD  
1400 O OE1 . GLU A 232 ? 0.7302 0.9518 1.9153 0.0864  -0.0668 0.0889  199 GLU A OE1 
1401 O OE2 . GLU A 232 ? 0.6422 0.8454 1.6933 0.0542  -0.1300 0.1068  199 GLU A OE2 
1402 N N   . ASP A 233 ? 0.4338 0.6543 1.4548 0.1240  0.1370  0.0079  200 ASP A N   
1403 C CA  . ASP A 233 ? 0.4640 0.6922 1.4993 0.1425  0.1990  -0.0076 200 ASP A CA  
1404 C C   . ASP A 233 ? 0.5487 0.7600 1.5590 0.1629  0.2263  -0.0399 200 ASP A C   
1405 O O   . ASP A 233 ? 0.5737 0.7945 1.6512 0.1801  0.2658  -0.0527 200 ASP A O   
1406 C CB  . ASP A 233 ? 0.4892 0.7478 1.6520 0.1451  0.2182  0.0091  200 ASP A CB  
1407 C CG  . ASP A 233 ? 0.6610 0.9319 1.8290 0.1579  0.2867  0.0020  200 ASP A CG  
1408 O OD1 . ASP A 233 ? 0.7021 0.9586 1.7631 0.1612  0.3140  -0.0099 200 ASP A OD1 
1409 O OD2 . ASP A 233 ? 0.7349 1.0311 2.0158 0.1643  0.3128  0.0106  200 ASP A OD2 
1410 N N   . MET A 234 ? 0.5008 0.6870 1.4172 0.1610  0.2072  -0.0557 201 MET A N   
1411 C CA  . MET A 234 ? 0.5274 0.6949 1.4084 0.1781  0.2306  -0.0912 201 MET A CA  
1412 C C   . MET A 234 ? 0.5928 0.7594 1.3878 0.1868  0.2783  -0.1078 201 MET A C   
1413 O O   . MET A 234 ? 0.5913 0.7733 1.3814 0.1806  0.2943  -0.0869 201 MET A O   
1414 C CB  . MET A 234 ? 0.5506 0.6939 1.3816 0.1710  0.1885  -0.0991 201 MET A CB  
1415 C CG  . MET A 234 ? 0.5981 0.7366 1.5205 0.1731  0.1615  -0.0941 201 MET A CG  
1416 S SD  . MET A 234 ? 0.6182 0.7599 1.5661 0.1492  0.0950  -0.0514 201 MET A SD  
1417 C CE  . MET A 234 ? 0.5808 0.7230 1.6590 0.1591  0.0804  -0.0423 201 MET A CE  
1418 N N   . GLY A 235 ? 0.5675 0.7171 1.2999 0.2005  0.3011  -0.1433 202 GLY A N   
1419 C CA  . GLY A 235 ? 0.6106 0.7607 1.2556 0.2086  0.3446  -0.1552 202 GLY A CA  
1420 C C   . GLY A 235 ? 0.6819 0.8122 1.2032 0.2060  0.3284  -0.1704 202 GLY A C   
1421 O O   . GLY A 235 ? 0.7364 0.8636 1.1785 0.2157  0.3621  -0.1864 202 GLY A O   
1422 N N   . ILE A 236 ? 0.5940 0.7125 1.0979 0.1924  0.2771  -0.1630 203 ILE A N   
1423 C CA  . ILE A 236 ? 0.5985 0.6990 1.0044 0.1893  0.2547  -0.1782 203 ILE A CA  
1424 C C   . ILE A 236 ? 0.6204 0.7230 0.9777 0.1736  0.2282  -0.1495 203 ILE A C   
1425 O O   . ILE A 236 ? 0.6210 0.7111 0.9093 0.1705  0.2065  -0.1591 203 ILE A O   
1426 C CB  . ILE A 236 ? 0.6233 0.7055 1.0527 0.1886  0.2226  -0.2009 203 ILE A CB  
1427 C CG1 . ILE A 236 ? 0.5607 0.6463 1.0655 0.1739  0.1841  -0.1722 203 ILE A CG1 
1428 C CG2 . ILE A 236 ? 0.6860 0.7603 1.1496 0.2066  0.2523  -0.2388 203 ILE A CG2 
1429 C CD1 . ILE A 236 ? 0.5693 0.6372 1.0671 0.1660  0.1462  -0.1796 203 ILE A CD1 
1430 N N   . SER A 237 ? 0.5448 0.6629 0.9426 0.1642  0.2304  -0.1170 204 SER A N   
1431 C CA  . SER A 237 ? 0.5098 0.6279 0.8719 0.1497  0.2081  -0.0932 204 SER A CA  
1432 C C   . SER A 237 ? 0.5962 0.7076 0.8635 0.1546  0.2203  -0.0950 204 SER A C   
1433 O O   . SER A 237 ? 0.5793 0.6823 0.8068 0.1460  0.1909  -0.0907 204 SER A O   
1434 C CB  . SER A 237 ? 0.5215 0.6560 0.9488 0.1390  0.2105  -0.0632 204 SER A CB  
1435 O OG  . SER A 237 ? 0.6481 0.7920 1.0638 0.1438  0.2486  -0.0494 204 SER A OG  
1436 N N   . PRO A 238 ? 0.6067 0.7212 0.8333 0.1683  0.2609  -0.1006 205 PRO A N   
1437 C CA  . PRO A 238 ? 0.6435 0.7512 0.7753 0.1718  0.2638  -0.0966 205 PRO A CA  
1438 C C   . PRO A 238 ? 0.7110 0.8034 0.7787 0.1745  0.2334  -0.1237 205 PRO A C   
1439 O O   . PRO A 238 ? 0.7033 0.7908 0.7181 0.1708  0.2138  -0.1130 205 PRO A O   
1440 C CB  . PRO A 238 ? 0.7314 0.8468 0.8347 0.1854  0.3163  -0.0958 205 PRO A CB  
1441 C CG  . PRO A 238 ? 0.7668 0.8973 0.9688 0.1857  0.3427  -0.0900 205 PRO A CG  
1442 C CD  . PRO A 238 ? 0.6618 0.7874 0.9247 0.1808  0.3075  -0.1075 205 PRO A CD  
1443 N N   . ILE A 239 ? 0.6866 0.7713 0.7692 0.1803  0.2276  -0.1578 206 ILE A N   
1444 C CA  . ILE A 239 ? 0.6979 0.7679 0.7334 0.1811  0.1965  -0.1861 206 ILE A CA  
1445 C C   . ILE A 239 ? 0.6908 0.7570 0.7612 0.1657  0.1535  -0.1755 206 ILE A C   
1446 O O   . ILE A 239 ? 0.6947 0.7547 0.7212 0.1621  0.1271  -0.1798 206 ILE A O   
1447 C CB  . ILE A 239 ? 0.7772 0.8371 0.8120 0.1931  0.2076  -0.2305 206 ILE A CB  
1448 C CG1 . ILE A 239 ? 0.8074 0.8525 0.7842 0.1933  0.1751  -0.2606 206 ILE A CG1 
1449 C CG2 . ILE A 239 ? 0.7434 0.8025 0.8780 0.1919  0.2083  -0.2370 206 ILE A CG2 
1450 C CD1 . ILE A 239 ? 0.9909 1.0274 0.9052 0.2073  0.1933  -0.3018 206 ILE A CD1 
1451 N N   . THR A 240 ? 0.5957 0.6669 0.7433 0.1563  0.1468  -0.1600 207 THR A N   
1452 C CA  . THR A 240 ? 0.5399 0.6083 0.7133 0.1407  0.1111  -0.1477 207 THR A CA  
1453 C C   . THR A 240 ? 0.5655 0.6379 0.7041 0.1328  0.1034  -0.1247 207 THR A C   
1454 O O   . THR A 240 ? 0.5392 0.6067 0.6611 0.1248  0.0779  -0.1247 207 THR A O   
1455 C CB  . THR A 240 ? 0.5872 0.6606 0.8408 0.1324  0.1042  -0.1342 207 THR A CB  
1456 O OG1 . THR A 240 ? 0.5760 0.6632 0.8593 0.1309  0.1231  -0.1117 207 THR A OG1 
1457 C CG2 . THR A 240 ? 0.5603 0.6273 0.8604 0.1409  0.1087  -0.1552 207 THR A CG2 
1458 N N   . GLY A 241 ? 0.5300 0.6108 0.6629 0.1359  0.1282  -0.1060 208 GLY A N   
1459 C CA  . GLY A 241 ? 0.5158 0.5983 0.6231 0.1306  0.1262  -0.0832 208 GLY A CA  
1460 C C   . GLY A 241 ? 0.5970 0.6734 0.6316 0.1389  0.1210  -0.0894 208 GLY A C   
1461 O O   . GLY A 241 ? 0.5850 0.6585 0.6046 0.1332  0.1015  -0.0794 208 GLY A O   
1462 N N   . ALA A 242 ? 0.6023 0.6768 0.5919 0.1527  0.1368  -0.1079 209 ALA A N   
1463 C CA  . ALA A 242 ? 0.6497 0.7191 0.5622 0.1610  0.1269  -0.1162 209 ALA A CA  
1464 C C   . ALA A 242 ? 0.6801 0.7431 0.5925 0.1550  0.0870  -0.1331 209 ALA A C   
1465 O O   . ALA A 242 ? 0.6932 0.7556 0.5720 0.1550  0.0673  -0.1246 209 ALA A O   
1466 C CB  . ALA A 242 ? 0.7270 0.7946 0.5904 0.1752  0.1502  -0.1404 209 ALA A CB  
1467 N N   . VAL A 243 ? 0.5960 0.6552 0.5554 0.1493  0.0753  -0.1530 210 VAL A N   
1468 C CA  . VAL A 243 ? 0.5644 0.6185 0.5393 0.1412  0.0415  -0.1662 210 VAL A CA  
1469 C C   . VAL A 243 ? 0.5673 0.6256 0.5633 0.1292  0.0273  -0.1411 210 VAL A C   
1470 O O   . VAL A 243 ? 0.5735 0.6313 0.5572 0.1269  0.0047  -0.1442 210 VAL A O   
1471 C CB  . VAL A 243 ? 0.5914 0.6390 0.6178 0.1375  0.0370  -0.1866 210 VAL A CB  
1472 C CG1 . VAL A 243 ? 0.5536 0.5974 0.6088 0.1256  0.0070  -0.1908 210 VAL A CG1 
1473 C CG2 . VAL A 243 ? 0.6425 0.6826 0.6460 0.1503  0.0474  -0.2203 210 VAL A CG2 
1474 N N   . VAL A 244 ? 0.4801 0.5428 0.5093 0.1220  0.0410  -0.1185 211 VAL A N   
1475 C CA  . VAL A 244 ? 0.4424 0.5071 0.4905 0.1106  0.0322  -0.0995 211 VAL A CA  
1476 C C   . VAL A 244 ? 0.5590 0.6239 0.5704 0.1170  0.0299  -0.0872 211 VAL A C   
1477 O O   . VAL A 244 ? 0.5518 0.6163 0.5663 0.1131  0.0115  -0.0871 211 VAL A O   
1478 C CB  . VAL A 244 ? 0.4457 0.5142 0.5339 0.1014  0.0453  -0.0818 211 VAL A CB  
1479 C CG1 . VAL A 244 ? 0.4128 0.4805 0.5146 0.0895  0.0363  -0.0698 211 VAL A CG1 
1480 C CG2 . VAL A 244 ? 0.4190 0.4884 0.5471 0.0955  0.0425  -0.0887 211 VAL A CG2 
1481 N N   . GLY A 245 ? 0.5692 0.6354 0.5503 0.1270  0.0496  -0.0748 212 GLY A N   
1482 C CA  . GLY A 245 ? 0.6047 0.6703 0.5487 0.1344  0.0485  -0.0560 212 GLY A CA  
1483 C C   . GLY A 245 ? 0.6962 0.7611 0.6000 0.1414  0.0222  -0.0695 212 GLY A C   
1484 O O   . GLY A 245 ? 0.6964 0.7616 0.6037 0.1409  0.0038  -0.0584 212 GLY A O   
1485 N N   . SER A 246 ? 0.6832 0.7470 0.5564 0.1474  0.0185  -0.0960 213 SER A N   
1486 C CA  . SER A 246 ? 0.7178 0.7811 0.5541 0.1528  -0.0107 -0.1154 213 SER A CA  
1487 C C   . SER A 246 ? 0.7089 0.7740 0.5924 0.1431  -0.0393 -0.1230 213 SER A C   
1488 O O   . SER A 246 ? 0.7234 0.7921 0.5965 0.1458  -0.0646 -0.1192 213 SER A O   
1489 C CB  . SER A 246 ? 0.8110 0.8699 0.6183 0.1587  -0.0071 -0.1497 213 SER A CB  
1490 O OG  . SER A 246 ? 0.9829 1.0408 0.7509 0.1632  -0.0383 -0.1715 213 SER A OG  
1491 N N   . LEU A 247 ? 0.6009 0.6646 0.5379 0.1318  -0.0348 -0.1307 214 LEU A N   
1492 C CA  . LEU A 247 ? 0.5588 0.6250 0.5405 0.1214  -0.0547 -0.1363 214 LEU A CA  
1493 C C   . LEU A 247 ? 0.5684 0.6386 0.5733 0.1171  -0.0548 -0.1136 214 LEU A C   
1494 O O   . LEU A 247 ? 0.5579 0.6329 0.5869 0.1141  -0.0733 -0.1170 214 LEU A O   
1495 C CB  . LEU A 247 ? 0.5239 0.5867 0.5482 0.1102  -0.0499 -0.1479 214 LEU A CB  
1496 C CG  . LEU A 247 ? 0.5952 0.6519 0.6190 0.1129  -0.0571 -0.1756 214 LEU A CG  
1497 C CD1 . LEU A 247 ? 0.5531 0.6053 0.6236 0.1027  -0.0494 -0.1764 214 LEU A CD1 
1498 C CD2 . LEU A 247 ? 0.6451 0.7030 0.6712 0.1128  -0.0865 -0.1952 214 LEU A CD2 
1499 N N   . LEU A 248 ? 0.5002 0.5684 0.5040 0.1172  -0.0339 -0.0921 215 LEU A N   
1500 C CA  . LEU A 248 ? 0.4702 0.5387 0.4997 0.1139  -0.0320 -0.0736 215 LEU A CA  
1501 C C   . LEU A 248 ? 0.5546 0.6257 0.5666 0.1251  -0.0493 -0.0615 215 LEU A C   
1502 O O   . LEU A 248 ? 0.5446 0.6181 0.5918 0.1234  -0.0586 -0.0561 215 LEU A O   
1503 C CB  . LEU A 248 ? 0.4537 0.5176 0.4932 0.1102  -0.0077 -0.0558 215 LEU A CB  
1504 C CG  . LEU A 248 ? 0.4641 0.5269 0.5359 0.0956  0.0019  -0.0631 215 LEU A CG  
1505 C CD1 . LEU A 248 ? 0.4649 0.5255 0.5437 0.0936  0.0219  -0.0487 215 LEU A CD1 
1506 C CD2 . LEU A 248 ? 0.4538 0.5159 0.5583 0.0846  -0.0027 -0.0673 215 LEU A CD2 
1507 N N   . GLY A 249 ? 0.5531 0.6243 0.5114 0.1367  -0.0538 -0.0580 216 GLY A N   
1508 C CA  . GLY A 249 ? 0.5996 0.6740 0.5288 0.1479  -0.0761 -0.0442 216 GLY A CA  
1509 C C   . GLY A 249 ? 0.6534 0.7356 0.6006 0.1472  -0.1102 -0.0641 216 GLY A C   
1510 O O   . GLY A 249 ? 0.6472 0.7349 0.6229 0.1502  -0.1299 -0.0519 216 GLY A O   
1511 N N   . PHE A 250 ? 0.5997 0.6824 0.5415 0.1428  -0.1168 -0.0949 217 PHE A N   
1512 C CA  . PHE A 250 ? 0.5869 0.6767 0.5549 0.1395  -0.1479 -0.1175 217 PHE A CA  
1513 C C   . PHE A 250 ? 0.5629 0.6590 0.6070 0.1294  -0.1478 -0.1152 217 PHE A C   
1514 O O   . PHE A 250 ? 0.5630 0.6692 0.6404 0.1305  -0.1736 -0.1170 217 PHE A O   
1515 C CB  . PHE A 250 ? 0.6134 0.6981 0.5694 0.1356  -0.1485 -0.1501 217 PHE A CB  
1516 C CG  . PHE A 250 ? 0.6393 0.7295 0.6195 0.1322  -0.1828 -0.1761 217 PHE A CG  
1517 C CD1 . PHE A 250 ? 0.7307 0.8248 0.6686 0.1408  -0.2164 -0.1862 217 PHE A CD1 
1518 C CD2 . PHE A 250 ? 0.6172 0.7084 0.6614 0.1194  -0.1824 -0.1901 217 PHE A CD2 
1519 C CE1 . PHE A 250 ? 0.7530 0.8526 0.7208 0.1362  -0.2516 -0.2127 217 PHE A CE1 
1520 C CE2 . PHE A 250 ? 0.6626 0.7589 0.7394 0.1149  -0.2130 -0.2134 217 PHE A CE2 
1521 C CZ  . PHE A 250 ? 0.6942 0.7949 0.7366 0.1231  -0.2486 -0.2262 217 PHE A CZ  
1522 N N   . LEU A 251 ? 0.4558 0.5469 0.5268 0.1196  -0.1187 -0.1114 218 LEU A N   
1523 C CA  . LEU A 251 ? 0.4055 0.5010 0.5370 0.1086  -0.1102 -0.1114 218 LEU A CA  
1524 C C   . LEU A 251 ? 0.4629 0.5644 0.6277 0.1142  -0.1167 -0.0957 218 LEU A C   
1525 O O   . LEU A 251 ? 0.4499 0.5602 0.6691 0.1087  -0.1199 -0.1022 218 LEU A O   
1526 C CB  . LEU A 251 ? 0.3701 0.4578 0.5067 0.0976  -0.0804 -0.1088 218 LEU A CB  
1527 C CG  . LEU A 251 ? 0.3886 0.4796 0.5714 0.0837  -0.0686 -0.1139 218 LEU A CG  
1528 C CD1 . LEU A 251 ? 0.3862 0.4820 0.5914 0.0753  -0.0778 -0.1295 218 LEU A CD1 
1529 C CD2 . LEU A 251 ? 0.3858 0.4689 0.5612 0.0740  -0.0451 -0.1089 218 LEU A CD2 
1530 N N   . LEU A 252 ? 0.4268 0.5240 0.5644 0.1255  -0.1180 -0.0737 219 LEU A N   
1531 C CA  . LEU A 252 ? 0.4203 0.5210 0.5943 0.1332  -0.1267 -0.0545 219 LEU A CA  
1532 C C   . LEU A 252 ? 0.4728 0.5886 0.6789 0.1377  -0.1614 -0.0613 219 LEU A C   
1533 O O   . LEU A 252 ? 0.4431 0.5670 0.7157 0.1374  -0.1633 -0.0596 219 LEU A O   
1534 C CB  . LEU A 252 ? 0.4559 0.5488 0.5878 0.1456  -0.1277 -0.0248 219 LEU A CB  
1535 C CG  . LEU A 252 ? 0.4962 0.5755 0.6090 0.1425  -0.0951 -0.0116 219 LEU A CG  
1536 C CD1 . LEU A 252 ? 0.5456 0.6200 0.6010 0.1540  -0.0966 0.0156  219 LEU A CD1 
1537 C CD2 . LEU A 252 ? 0.4866 0.5590 0.6588 0.1381  -0.0770 -0.0036 219 LEU A CD2 
1538 N N   . PHE A 253 ? 0.4651 0.5851 0.6283 0.1412  -0.1881 -0.0726 220 PHE A N   
1539 C CA  . PHE A 253 ? 0.4829 0.6175 0.6678 0.1450  -0.2294 -0.0815 220 PHE A CA  
1540 C C   . PHE A 253 ? 0.4986 0.6406 0.7246 0.1326  -0.2343 -0.1118 220 PHE A C   
1541 O O   . PHE A 253 ? 0.4948 0.6512 0.7630 0.1328  -0.2664 -0.1206 220 PHE A O   
1542 C CB  . PHE A 253 ? 0.5731 0.7059 0.6773 0.1559  -0.2586 -0.0774 220 PHE A CB  
1543 C CG  . PHE A 253 ? 0.6344 0.7605 0.6945 0.1681  -0.2553 -0.0412 220 PHE A CG  
1544 C CD1 . PHE A 253 ? 0.6744 0.7861 0.6837 0.1686  -0.2199 -0.0299 220 PHE A CD1 
1545 C CD2 . PHE A 253 ? 0.7009 0.8357 0.7781 0.1789  -0.2880 -0.0153 220 PHE A CD2 
1546 C CE1 . PHE A 253 ? 0.7233 0.8283 0.6987 0.1786  -0.2140 0.0072  220 PHE A CE1 
1547 C CE2 . PHE A 253 ? 0.7780 0.9049 0.8173 0.1898  -0.2847 0.0238  220 PHE A CE2 
1548 C CZ  . PHE A 253 ? 0.7583 0.8698 0.7461 0.1891  -0.2461 0.0350  220 PHE A CZ  
1549 N N   . ASN A 254 ? 0.4371 0.5700 0.6570 0.1214  -0.2047 -0.1252 221 ASN A N   
1550 C CA  . ASN A 254 ? 0.4215 0.5586 0.6804 0.1088  -0.2070 -0.1489 221 ASN A CA  
1551 C C   . ASN A 254 ? 0.4375 0.5813 0.7669 0.0969  -0.1819 -0.1475 221 ASN A C   
1552 O O   . ASN A 254 ? 0.4298 0.5822 0.8099 0.0871  -0.1874 -0.1609 221 ASN A O   
1553 C CB  . ASN A 254 ? 0.4219 0.5447 0.6331 0.1044  -0.1953 -0.1640 221 ASN A CB  
1554 C CG  . ASN A 254 ? 0.6715 0.7952 0.9245 0.0920  -0.1997 -0.1853 221 ASN A CG  
1555 O OD1 . ASN A 254 ? 0.5812 0.7016 0.8616 0.0803  -0.1740 -0.1829 221 ASN A OD1 
1556 N ND2 . ASN A 254 ? 0.6246 0.7535 0.8884 0.0933  -0.2343 -0.2049 221 ASN A ND2 
1557 N N   . VAL A 255 ? 0.3735 0.5126 0.7057 0.0968  -0.1531 -0.1325 222 VAL A N   
1558 C CA  . VAL A 255 ? 0.3446 0.4885 0.7304 0.0862  -0.1243 -0.1331 222 VAL A CA  
1559 C C   . VAL A 255 ? 0.4013 0.5651 0.8677 0.0874  -0.1378 -0.1360 222 VAL A C   
1560 O O   . VAL A 255 ? 0.4197 0.5921 0.8992 0.0994  -0.1705 -0.1304 222 VAL A O   
1561 C CB  . VAL A 255 ? 0.3911 0.5236 0.7572 0.0879  -0.0966 -0.1207 222 VAL A CB  
1562 C CG1 . VAL A 255 ? 0.3850 0.5235 0.8001 0.0972  -0.0963 -0.1108 222 VAL A CG1 
1563 C CG2 . VAL A 255 ? 0.3739 0.4993 0.7327 0.0723  -0.0635 -0.1270 222 VAL A CG2 
1564 N N   . TYR A 256 ? 0.3405 0.5128 0.8608 0.0747  -0.1139 -0.1436 223 TYR A N   
1565 C CA  . TYR A 256 ? 0.3350 0.5292 0.9448 0.0744  -0.1212 -0.1472 223 TYR A CA  
1566 C C   . TYR A 256 ? 0.4022 0.6049 1.0564 0.0893  -0.1292 -0.1362 223 TYR A C   
1567 O O   . TYR A 256 ? 0.3970 0.5907 1.0469 0.0918  -0.1007 -0.1308 223 TYR A O   
1568 C CB  . TYR A 256 ? 0.3295 0.5309 0.9854 0.0578  -0.0830 -0.1541 223 TYR A CB  
1569 C CG  . TYR A 256 ? 0.3552 0.5818 1.1136 0.0572  -0.0862 -0.1577 223 TYR A CG  
1570 C CD1 . TYR A 256 ? 0.3815 0.6187 1.1987 0.0641  -0.0665 -0.1553 223 TYR A CD1 
1571 C CD2 . TYR A 256 ? 0.3683 0.6085 1.1743 0.0508  -0.1113 -0.1646 223 TYR A CD2 
1572 C CE1 . TYR A 256 ? 0.3976 0.6607 1.3210 0.0656  -0.0708 -0.1578 223 TYR A CE1 
1573 C CE2 . TYR A 256 ? 0.3792 0.6454 1.2909 0.0505  -0.1176 -0.1669 223 TYR A CE2 
1574 C CZ  . TYR A 256 ? 0.4850 0.7640 1.4567 0.0582  -0.0964 -0.1626 223 TYR A CZ  
1575 O OH  . TYR A 256 ? 0.5281 0.8355 1.6159 0.0586  -0.1003 -0.1645 223 TYR A OH  
1576 N N   . PRO A 257 ? 0.3742 0.5946 1.0809 0.0985  -0.1685 -0.1333 224 PRO A N   
1577 C CA  . PRO A 257 ? 0.3892 0.6217 1.1118 0.0957  -0.2094 -0.1434 224 PRO A CA  
1578 C C   . PRO A 257 ? 0.4821 0.7016 1.1153 0.1040  -0.2459 -0.1421 224 PRO A C   
1579 O O   . PRO A 257 ? 0.5093 0.7266 1.1140 0.1186  -0.2671 -0.1256 224 PRO A O   
1580 C CB  . PRO A 257 ? 0.4113 0.6702 1.2385 0.1028  -0.2328 -0.1390 224 PRO A CB  
1581 C CG  . PRO A 257 ? 0.4510 0.7082 1.3082 0.1131  -0.2059 -0.1242 224 PRO A CG  
1582 C CD  . PRO A 257 ? 0.3899 0.6197 1.1522 0.1134  -0.1789 -0.1189 224 PRO A CD  
1583 N N   . ALA A 258 ? 0.4457 0.6554 1.0345 0.0948  -0.2496 -0.1585 225 ALA A N   
1584 C CA  . ALA A 258 ? 0.4806 0.6763 0.9803 0.1012  -0.2751 -0.1641 225 ALA A CA  
1585 C C   . ALA A 258 ? 0.5866 0.7922 1.0745 0.1143  -0.3271 -0.1601 225 ALA A C   
1586 O O   . ALA A 258 ? 0.5869 0.8111 1.1396 0.1126  -0.3614 -0.1687 225 ALA A O   
1587 C CB  . ALA A 258 ? 0.4856 0.6726 0.9713 0.0891  -0.2757 -0.1877 225 ALA A CB  
1588 N N   . LYS A 259 ? 0.5866 0.7808 0.9944 0.1270  -0.3325 -0.1440 226 LYS A N   
1589 C CA  . LYS A 259 ? 0.6472 0.8475 1.0176 0.1402  -0.3803 -0.1338 226 LYS A CA  
1590 C C   . LYS A 259 ? 0.7676 0.9612 1.0684 0.1382  -0.4093 -0.1614 226 LYS A C   
1591 O O   . LYS A 259 ? 0.8116 1.0165 1.1101 0.1419  -0.4601 -0.1693 226 LYS A O   
1592 C CB  . LYS A 259 ? 0.6889 0.8779 1.0026 0.1532  -0.3661 -0.1008 226 LYS A CB  
1593 C CG  . LYS A 259 ? 0.8476 1.0495 1.2187 0.1647  -0.3860 -0.0704 226 LYS A CG  
1594 C CD  . LYS A 259 ? 0.9043 1.1186 1.3932 0.1597  -0.3635 -0.0708 226 LYS A CD  
1595 C CE  . LYS A 259 ? 1.0894 1.3163 1.6454 0.1732  -0.3857 -0.0420 226 LYS A CE  
1596 N NZ  . LYS A 259 ? 1.2599 1.5079 1.8415 0.1792  -0.4495 -0.0399 226 LYS A NZ  
1597 N N   . VAL A 260 ? 0.7360 0.9117 0.9899 0.1315  -0.3771 -0.1780 227 VAL A N   
1598 C CA  . VAL A 260 ? 0.7818 0.9461 0.9754 0.1291  -0.3916 -0.2095 227 VAL A CA  
1599 C C   . VAL A 260 ? 0.8026 0.9571 1.0304 0.1152  -0.3626 -0.2316 227 VAL A C   
1600 O O   . VAL A 260 ? 0.7424 0.8967 1.0161 0.1080  -0.3267 -0.2190 227 VAL A O   
1601 C CB  . VAL A 260 ? 0.8771 1.0248 0.9609 0.1390  -0.3759 -0.2037 227 VAL A CB  
1602 C CG1 . VAL A 260 ? 0.9429 1.0839 0.9613 0.1407  -0.4060 -0.2379 227 VAL A CG1 
1603 C CG2 . VAL A 260 ? 0.9036 1.0555 0.9531 0.1521  -0.3804 -0.1654 227 VAL A CG2 
1604 N N   . PHE A 261 ? 0.8038 0.9491 1.0073 0.1116  -0.3798 -0.2652 228 PHE A N   
1605 C CA  . PHE A 261 ? 0.7746 0.9069 1.0081 0.0996  -0.3557 -0.2854 228 PHE A CA  
1606 C C   . PHE A 261 ? 0.8664 0.9778 1.0215 0.1047  -0.3445 -0.3067 228 PHE A C   
1607 O O   . PHE A 261 ? 0.9236 1.0317 1.0034 0.1150  -0.3648 -0.3184 228 PHE A O   
1608 C CB  . PHE A 261 ? 0.8059 0.9452 1.1146 0.0882  -0.3874 -0.3118 228 PHE A CB  
1609 C CG  . PHE A 261 ? 0.7809 0.9400 1.1914 0.0789  -0.3858 -0.2953 228 PHE A CG  
1610 C CD1 . PHE A 261 ? 0.7733 0.9395 1.2040 0.0795  -0.3514 -0.2637 228 PHE A CD1 
1611 C CD2 . PHE A 261 ? 0.8197 0.9903 1.3103 0.0687  -0.4175 -0.3146 228 PHE A CD2 
1612 C CE1 . PHE A 261 ? 0.7524 0.9372 1.2775 0.0713  -0.3447 -0.2523 228 PHE A CE1 
1613 C CE2 . PHE A 261 ? 0.8154 1.0065 1.4071 0.0599  -0.4117 -0.3000 228 PHE A CE2 
1614 C CZ  . PHE A 261 ? 0.7464 0.9448 1.3535 0.0617  -0.3732 -0.2690 228 PHE A CZ  
1615 N N   . MET A 262 ? 0.7934 0.8912 0.9657 0.0979  -0.3099 -0.3096 229 MET A N   
1616 C CA  . MET A 262 ? 0.8142 0.8937 0.9215 0.1047  -0.2887 -0.3230 229 MET A CA  
1617 C C   . MET A 262 ? 0.9585 1.0262 1.0347 0.1074  -0.3136 -0.3672 229 MET A C   
1618 O O   . MET A 262 ? 1.0233 1.0847 1.0153 0.1191  -0.3136 -0.3786 229 MET A O   
1619 C CB  . MET A 262 ? 0.7822 0.8514 0.9324 0.0957  -0.2524 -0.3151 229 MET A CB  
1620 C CG  . MET A 262 ? 0.7998 0.8631 0.9054 0.1022  -0.2148 -0.2935 229 MET A CG  
1621 S SD  . MET A 262 ? 0.7879 0.8405 0.9505 0.0903  -0.1852 -0.2858 229 MET A SD  
1622 C CE  . MET A 262 ? 0.6949 0.7584 0.8632 0.0860  -0.1600 -0.2443 229 MET A CE  
1623 N N   . GLY A 263 ? 0.9179 0.9825 1.0617 0.0962  -0.3347 -0.3929 230 GLY A N   
1624 C CA  . GLY A 263 ? 0.9404 0.9832 1.0944 0.0936  -0.3250 -0.4263 230 GLY A CA  
1625 C C   . GLY A 263 ? 0.9562 0.9942 1.2130 0.0778  -0.3179 -0.4239 230 GLY A C   
1626 O O   . GLY A 263 ? 0.9378 0.9910 1.2578 0.0676  -0.3268 -0.4049 230 GLY A O   
1627 N N   . ASP A 264 ? 0.8974 0.9146 1.1757 0.0757  -0.2986 -0.4391 231 ASP A N   
1628 C CA  . ASP A 264 ? 0.9498 0.9454 1.2132 0.0800  -0.3100 -0.4885 231 ASP A CA  
1629 C C   . ASP A 264 ? 1.0351 1.0229 1.1954 0.0972  -0.2982 -0.5086 231 ASP A C   
1630 O O   . ASP A 264 ? 1.0341 1.0043 1.1912 0.1027  -0.2713 -0.5223 231 ASP A O   
1631 C CB  . ASP A 264 ? 1.0105 1.0061 1.3160 0.0714  -0.3567 -0.5255 231 ASP A CB  
1632 C CG  . ASP A 264 ? 1.0611 1.0460 1.4809 0.0549  -0.3582 -0.5293 231 ASP A CG  
1633 O OD1 . ASP A 264 ? 1.0124 0.9865 1.4687 0.0517  -0.3247 -0.5069 231 ASP A OD1 
1634 O OD2 . ASP A 264 ? 1.1503 1.1381 1.6284 0.0442  -0.3942 -0.5519 231 ASP A OD2 
1635 N N   . THR A 265 ? 1.0210 1.0219 1.1007 0.1061  -0.3157 -0.5079 232 THR A N   
1636 C CA  . THR A 265 ? 1.0590 1.0549 1.0371 0.1219  -0.2933 -0.5143 232 THR A CA  
1637 C C   . THR A 265 ? 1.0380 1.0374 1.0122 0.1263  -0.2468 -0.4718 232 THR A C   
1638 O O   . THR A 265 ? 1.0476 1.0353 0.9967 0.1346  -0.2144 -0.4815 232 THR A O   
1639 C CB  . THR A 265 ? 1.1834 1.1936 1.0724 0.1300  -0.3206 -0.5108 232 THR A CB  
1640 O OG1 . THR A 265 ? 1.2340 1.2426 1.1240 0.1252  -0.3704 -0.5522 232 THR A OG1 
1641 C CG2 . THR A 265 ? 1.2016 1.2058 0.9841 0.1452  -0.2927 -0.5160 232 THR A CG2 
1642 N N   . GLY A 266 ? 0.9204 0.9361 0.9235 0.1207  -0.2434 -0.4268 233 GLY A N   
1643 C CA  . GLY A 266 ? 0.8530 0.8712 0.8713 0.1206  -0.2046 -0.3888 233 GLY A CA  
1644 C C   . GLY A 266 ? 0.8418 0.8505 0.9364 0.1112  -0.1851 -0.3820 233 GLY A C   
1645 O O   . GLY A 266 ? 0.8233 0.8258 0.9156 0.1155  -0.1549 -0.3725 233 GLY A O   
1646 N N   . SER A 267 ? 0.7688 0.7771 0.9353 0.0979  -0.2036 -0.3842 234 SER A N   
1647 C CA  . SER A 267 ? 0.7159 0.7181 0.9531 0.0868  -0.1867 -0.3648 234 SER A CA  
1648 C C   . SER A 267 ? 0.7769 0.7582 1.0345 0.0910  -0.1727 -0.3864 234 SER A C   
1649 O O   . SER A 267 ? 0.7423 0.7190 1.0347 0.0876  -0.1519 -0.3635 234 SER A O   
1650 C CB  . SER A 267 ? 0.7438 0.7505 1.0536 0.0713  -0.2066 -0.3610 234 SER A CB  
1651 O OG  . SER A 267 ? 0.9362 0.9393 1.2522 0.0715  -0.2394 -0.3993 234 SER A OG  
1652 N N   . LEU A 268 ? 0.7690 0.7370 1.0114 0.0977  -0.1869 -0.4322 235 LEU A N   
1653 C CA  . LEU A 268 ? 0.7842 0.7299 1.0515 0.1037  -0.1723 -0.4608 235 LEU A CA  
1654 C C   . LEU A 268 ? 0.8475 0.7947 1.0564 0.1191  -0.1386 -0.4559 235 LEU A C   
1655 O O   . LEU A 268 ? 0.8345 0.7721 1.0831 0.1224  -0.1148 -0.4499 235 LEU A O   
1656 C CB  . LEU A 268 ? 0.8478 0.7765 1.1181 0.1055  -0.1974 -0.5189 235 LEU A CB  
1657 C CG  . LEU A 268 ? 0.8947 0.8207 1.2354 0.0896  -0.2333 -0.5306 235 LEU A CG  
1658 C CD1 . LEU A 268 ? 0.9744 0.8830 1.3070 0.0923  -0.2597 -0.5939 235 LEU A CD1 
1659 C CD2 . LEU A 268 ? 0.8626 0.7794 1.3073 0.0761  -0.2247 -0.5035 235 LEU A CD2 
1660 N N   . ALA A 269 ? 0.8198 0.7804 0.9413 0.1280  -0.1365 -0.4534 236 ALA A N   
1661 C CA  . ALA A 269 ? 0.8267 0.7918 0.8912 0.1415  -0.1020 -0.4442 236 ALA A CA  
1662 C C   . ALA A 269 ? 0.7939 0.7678 0.8995 0.1372  -0.0780 -0.3969 236 ALA A C   
1663 O O   . ALA A 269 ? 0.7889 0.7579 0.9132 0.1443  -0.0499 -0.3963 236 ALA A O   
1664 C CB  . ALA A 269 ? 0.8735 0.8523 0.8437 0.1486  -0.1083 -0.4390 236 ALA A CB  
1665 N N   . LEU A 270 ? 0.6841 0.6706 0.8093 0.1252  -0.0900 -0.3602 237 LEU A N   
1666 C CA  . LEU A 270 ? 0.6162 0.6110 0.7731 0.1186  -0.0728 -0.3178 237 LEU A CA  
1667 C C   . LEU A 270 ? 0.6553 0.6389 0.8895 0.1118  -0.0689 -0.3120 237 LEU A C   
1668 O O   . LEU A 270 ? 0.6272 0.6140 0.8819 0.1122  -0.0507 -0.2881 237 LEU A O   
1669 C CB  . LEU A 270 ? 0.5682 0.5775 0.7216 0.1078  -0.0850 -0.2870 237 LEU A CB  
1670 C CG  . LEU A 270 ? 0.6302 0.6512 0.7182 0.1146  -0.0891 -0.2817 237 LEU A CG  
1671 C CD1 . LEU A 270 ? 0.5952 0.6276 0.7002 0.1042  -0.1059 -0.2617 237 LEU A CD1 
1672 C CD2 . LEU A 270 ? 0.6323 0.6588 0.6815 0.1234  -0.0611 -0.2626 237 LEU A CD2 
1673 N N   . GLY A 271 ? 0.6260 0.5967 0.9060 0.1054  -0.0881 -0.3325 238 GLY A N   
1674 C CA  . GLY A 271 ? 0.6144 0.5708 0.9737 0.0991  -0.0879 -0.3272 238 GLY A CA  
1675 C C   . GLY A 271 ? 0.6983 0.6417 1.0769 0.1130  -0.0683 -0.3483 238 GLY A C   
1676 O O   . GLY A 271 ? 0.6814 0.6181 1.1224 0.1112  -0.0611 -0.3296 238 GLY A O   
1677 N N   . GLY A 272 ? 0.6994 0.6399 1.0239 0.1273  -0.0592 -0.3865 239 GLY A N   
1678 C CA  . GLY A 272 ? 0.7315 0.6620 1.0640 0.1429  -0.0331 -0.4126 239 GLY A CA  
1679 C C   . GLY A 272 ? 0.7497 0.6964 1.0705 0.1488  -0.0052 -0.3795 239 GLY A C   
1680 O O   . GLY A 272 ? 0.7477 0.6906 1.1272 0.1543  0.0123  -0.3732 239 GLY A O   
1681 N N   . PHE A 273 ? 0.6755 0.6408 0.9301 0.1469  -0.0030 -0.3565 240 PHE A N   
1682 C CA  . PHE A 273 ? 0.6408 0.6231 0.8819 0.1495  0.0199  -0.3228 240 PHE A CA  
1683 C C   . PHE A 273 ? 0.6317 0.6180 0.9452 0.1393  0.0162  -0.2850 240 PHE A C   
1684 O O   . PHE A 273 ? 0.6179 0.6109 0.9619 0.1450  0.0366  -0.2714 240 PHE A O   
1685 C CB  . PHE A 273 ? 0.6521 0.6494 0.8219 0.1457  0.0142  -0.3029 240 PHE A CB  
1686 C CG  . PHE A 273 ? 0.6205 0.6333 0.7975 0.1401  0.0254  -0.2605 240 PHE A CG  
1687 C CD1 . PHE A 273 ? 0.6602 0.6817 0.8285 0.1495  0.0561  -0.2519 240 PHE A CD1 
1688 C CD2 . PHE A 273 ? 0.5946 0.6129 0.7922 0.1247  0.0067  -0.2312 240 PHE A CD2 
1689 C CE1 . PHE A 273 ? 0.6321 0.6670 0.8175 0.1427  0.0633  -0.2154 240 PHE A CE1 
1690 C CE2 . PHE A 273 ? 0.5912 0.6215 0.7970 0.1185  0.0149  -0.1978 240 PHE A CE2 
1691 C CZ  . PHE A 273 ? 0.5747 0.6129 0.7764 0.1271  0.0408  -0.1905 240 PHE A CZ  
1692 N N   . VAL A 274 ? 0.5541 0.5382 0.8920 0.1236  -0.0099 -0.2661 241 VAL A N   
1693 C CA  . VAL A 274 ? 0.5076 0.4951 0.8991 0.1112  -0.0184 -0.2276 241 VAL A CA  
1694 C C   . VAL A 274 ? 0.5633 0.5389 1.0330 0.1167  -0.0143 -0.2301 241 VAL A C   
1695 O O   . VAL A 274 ? 0.5537 0.5379 1.0580 0.1176  -0.0070 -0.2051 241 VAL A O   
1696 C CB  . VAL A 274 ? 0.5262 0.5138 0.9182 0.0934  -0.0417 -0.2089 241 VAL A CB  
1697 C CG1 . VAL A 274 ? 0.4988 0.4871 0.9397 0.0803  -0.0506 -0.1706 241 VAL A CG1 
1698 C CG2 . VAL A 274 ? 0.5061 0.5081 0.8343 0.0890  -0.0426 -0.2005 241 VAL A CG2 
1699 N N   . ALA A 275 ? 0.5310 0.4870 1.0330 0.1213  -0.0195 -0.2622 242 ALA A N   
1700 C CA  . ALA A 275 ? 0.5418 0.4819 1.1279 0.1284  -0.0156 -0.2701 242 ALA A CA  
1701 C C   . ALA A 275 ? 0.6078 0.5519 1.2054 0.1473  0.0154  -0.2884 242 ALA A C   
1702 O O   . ALA A 275 ? 0.5902 0.5352 1.2606 0.1510  0.0204  -0.2689 242 ALA A O   
1703 C CB  . ALA A 275 ? 0.5830 0.4991 1.1981 0.1284  -0.0279 -0.3065 242 ALA A CB  
1704 N N   . ALA A 276 ? 0.5989 0.5469 1.1264 0.1589  0.0363  -0.3226 243 ALA A N   
1705 C CA  . ALA A 276 ? 0.6310 0.5843 1.1606 0.1769  0.0734  -0.3421 243 ALA A CA  
1706 C C   . ALA A 276 ? 0.6484 0.6253 1.1919 0.1761  0.0872  -0.3008 243 ALA A C   
1707 O O   . ALA A 276 ? 0.6458 0.6269 1.2534 0.1868  0.1092  -0.3001 243 ALA A O   
1708 C CB  . ALA A 276 ? 0.6942 0.6467 1.1305 0.1870  0.0911  -0.3830 243 ALA A CB  
1709 N N   . SER A 277 ? 0.5727 0.5650 1.0646 0.1632  0.0741  -0.2682 244 SER A N   
1710 C CA  . SER A 277 ? 0.5383 0.5521 1.0413 0.1591  0.0819  -0.2302 244 SER A CA  
1711 C C   . SER A 277 ? 0.5764 0.5923 1.1719 0.1531  0.0658  -0.1997 244 SER A C   
1712 O O   . SER A 277 ? 0.5733 0.6018 1.2230 0.1599  0.0820  -0.1879 244 SER A O   
1713 C CB  . SER A 277 ? 0.5390 0.5628 0.9756 0.1452  0.0663  -0.2065 244 SER A CB  
1714 O OG  . SER A 277 ? 0.6550 0.6795 1.0106 0.1520  0.0802  -0.2275 244 SER A OG  
1715 N N   . CYS A 278 ? 0.5206 0.5246 1.1381 0.1405  0.0339  -0.1858 245 CYS A N   
1716 C CA  . CYS A 278 ? 0.4975 0.5011 1.1944 0.1330  0.0123  -0.1517 245 CYS A CA  
1717 C C   . CYS A 278 ? 0.5863 0.5818 1.3749 0.1489  0.0257  -0.1652 245 CYS A C   
1718 O O   . CYS A 278 ? 0.5909 0.5969 1.4502 0.1492  0.0192  -0.1362 245 CYS A O   
1719 C CB  . CYS A 278 ? 0.4859 0.4767 1.1773 0.1165  -0.0187 -0.1349 245 CYS A CB  
1720 S SG  . CYS A 278 ? 0.5019 0.5059 1.1049 0.0967  -0.0335 -0.1115 245 CYS A SG  
1721 N N   . TYR A 279 ? 0.5659 0.5440 1.3553 0.1628  0.0449  -0.2115 246 TYR A N   
1722 C CA  . TYR A 279 ? 0.5782 0.5467 1.4561 0.1804  0.0646  -0.2333 246 TYR A CA  
1723 C C   . TYR A 279 ? 0.6332 0.6224 1.5234 0.1945  0.1014  -0.2387 246 TYR A C   
1724 O O   . TYR A 279 ? 0.6295 0.6247 1.6172 0.2030  0.1082  -0.2261 246 TYR A O   
1725 C CB  . TYR A 279 ? 0.6298 0.5706 1.5055 0.1894  0.0725  -0.2858 246 TYR A CB  
1726 C CG  . TYR A 279 ? 0.6465 0.5645 1.5984 0.1817  0.0424  -0.2731 246 TYR A CG  
1727 C CD1 . TYR A 279 ? 0.6480 0.5583 1.5638 0.1630  0.0114  -0.2560 246 TYR A CD1 
1728 C CD2 . TYR A 279 ? 0.6758 0.5815 1.7447 0.1926  0.0455  -0.2715 246 TYR A CD2 
1729 C CE1 . TYR A 279 ? 0.6517 0.5419 1.6401 0.1543  -0.0140 -0.2372 246 TYR A CE1 
1730 C CE2 . TYR A 279 ? 0.6903 0.5740 1.8350 0.1848  0.0168  -0.2520 246 TYR A CE2 
1731 C CZ  . TYR A 279 ? 0.7523 0.6282 1.8537 0.1650  -0.0122 -0.2335 246 TYR A CZ  
1732 O OH  . TYR A 279 ? 0.7537 0.6077 1.9309 0.1562  -0.0374 -0.2100 246 TYR A OH  
1733 N N   . MET A 280 ? 0.6012 0.6037 1.3998 0.1955  0.1232  -0.2499 247 MET A N   
1734 C CA  . MET A 280 ? 0.6099 0.6342 1.4153 0.2066  0.1618  -0.2496 247 MET A CA  
1735 C C   . MET A 280 ? 0.6241 0.6723 1.4889 0.1971  0.1469  -0.1991 247 MET A C   
1736 O O   . MET A 280 ? 0.6291 0.6954 1.5497 0.2067  0.1747  -0.1942 247 MET A O   
1737 C CB  . MET A 280 ? 0.6562 0.6871 1.3458 0.2080  0.1856  -0.2664 247 MET A CB  
1738 C CG  . MET A 280 ? 0.7603 0.7728 1.3911 0.2212  0.2082  -0.3211 247 MET A CG  
1739 S SD  . MET A 280 ? 0.8683 0.8717 1.5709 0.2456  0.2555  -0.3684 247 MET A SD  
1740 C CE  . MET A 280 ? 0.8408 0.8750 1.5341 0.2547  0.3079  -0.3532 247 MET A CE  
1741 N N   . MET A 281 ? 0.5448 0.5933 1.3993 0.1778  0.1033  -0.1634 248 MET A N   
1742 C CA  . MET A 281 ? 0.5120 0.5808 1.4076 0.1652  0.0797  -0.1176 248 MET A CA  
1743 C C   . MET A 281 ? 0.5247 0.5895 1.5138 0.1607  0.0449  -0.0885 248 MET A C   
1744 O O   . MET A 281 ? 0.4984 0.5800 1.5201 0.1492  0.0188  -0.0501 248 MET A O   
1745 C CB  . MET A 281 ? 0.5256 0.5992 1.3317 0.1457  0.0574  -0.0980 248 MET A CB  
1746 C CG  . MET A 281 ? 0.5933 0.6768 1.3263 0.1485  0.0870  -0.1110 248 MET A CG  
1747 S SD  . MET A 281 ? 0.6366 0.7232 1.2830 0.1268  0.0602  -0.0890 248 MET A SD  
1748 C CE  . MET A 281 ? 0.6034 0.6671 1.1851 0.1255  0.0491  -0.1127 248 MET A CE  
1749 N N   . ARG A 282 ? 0.4807 0.5225 1.5131 0.1688  0.0419  -0.1056 249 ARG A N   
1750 C CA  . ARG A 282 ? 0.4733 0.5061 1.5979 0.1658  0.0088  -0.0757 249 ARG A CA  
1751 C C   . ARG A 282 ? 0.5093 0.5394 1.5888 0.1419  -0.0364 -0.0350 249 ARG A C   
1752 O O   . ARG A 282 ? 0.5096 0.5407 1.6497 0.1344  -0.0700 0.0055  249 ARG A O   
1753 C CB  . ARG A 282 ? 0.4625 0.5147 1.7044 0.1756  0.0100  -0.0538 249 ARG A CB  
1754 C CG  . ARG A 282 ? 0.6073 0.6610 1.9110 0.2007  0.0597  -0.0945 249 ARG A CG  
1755 C CD  . ARG A 282 ? 0.7841 0.8494 2.2351 0.2123  0.0554  -0.0733 249 ARG A CD  
1756 N NE  . ARG A 282 ? 0.9368 1.0337 2.4198 0.2013  0.0312  -0.0285 249 ARG A NE  
1757 C CZ  . ARG A 282 ? 1.1594 1.2839 2.6633 0.2069  0.0606  -0.0323 249 ARG A CZ  
1758 N NH1 . ARG A 282 ? 1.0508 1.1759 2.5394 0.2240  0.1191  -0.0763 249 ARG A NH1 
1759 N NH2 . ARG A 282 ? 0.9844 1.1362 2.5238 0.1945  0.0317  0.0079  249 ARG A NH2 
1760 N N   . MET A 283 ? 0.4627 0.4883 1.4363 0.1306  -0.0362 -0.0463 250 MET A N   
1761 C CA  . MET A 283 ? 0.4478 0.4714 1.3641 0.1083  -0.0689 -0.0156 250 MET A CA  
1762 C C   . MET A 283 ? 0.5072 0.5065 1.3903 0.1022  -0.0750 -0.0287 250 MET A C   
1763 O O   . MET A 283 ? 0.4826 0.4838 1.2885 0.0874  -0.0834 -0.0225 250 MET A O   
1764 C CB  . MET A 283 ? 0.4520 0.4939 1.2827 0.0978  -0.0652 -0.0127 250 MET A CB  
1765 C CG  . MET A 283 ? 0.4843 0.5501 1.3496 0.0959  -0.0711 0.0104  250 MET A CG  
1766 S SD  . MET A 283 ? 0.5138 0.5954 1.2870 0.0870  -0.0577 0.0026  250 MET A SD  
1767 C CE  . MET A 283 ? 0.4667 0.5465 1.1794 0.0608  -0.0967 0.0331  250 MET A CE  
1768 N N   . PRO A 284 ? 0.4875 0.4642 1.4341 0.1117  -0.0726 -0.0450 251 PRO A N   
1769 C CA  . PRO A 284 ? 0.4947 0.4503 1.4170 0.1027  -0.0814 -0.0543 251 PRO A CA  
1770 C C   . PRO A 284 ? 0.5333 0.4875 1.4514 0.0812  -0.1129 -0.0030 251 PRO A C   
1771 O O   . PRO A 284 ? 0.5245 0.4717 1.3948 0.0682  -0.1178 -0.0030 251 PRO A O   
1772 C CB  . PRO A 284 ? 0.5472 0.4784 1.5553 0.1183  -0.0719 -0.0835 251 PRO A CB  
1773 C CG  . PRO A 284 ? 0.6055 0.5467 1.6638 0.1382  -0.0488 -0.1002 251 PRO A CG  
1774 C CD  . PRO A 284 ? 0.5246 0.4930 1.5759 0.1304  -0.0615 -0.0568 251 PRO A CD  
1775 N N   . LEU A 285 ? 0.4907 0.4534 1.4579 0.0773  -0.1341 0.0417  252 LEU A N   
1776 C CA  . LEU A 285 ? 0.4964 0.4603 1.4544 0.0570  -0.1656 0.0966  252 LEU A CA  
1777 C C   . LEU A 285 ? 0.5387 0.5204 1.3892 0.0391  -0.1699 0.1077  252 LEU A C   
1778 O O   . LEU A 285 ? 0.5613 0.5433 1.3804 0.0203  -0.1903 0.1466  252 LEU A O   
1779 C CB  . LEU A 285 ? 0.5084 0.4790 1.5484 0.0604  -0.1898 0.1378  252 LEU A CB  
1780 C CG  . LEU A 285 ? 0.5960 0.5446 1.7319 0.0616  -0.2094 0.1702  252 LEU A CG  
1781 C CD1 . LEU A 285 ? 0.6039 0.5244 1.7866 0.0731  -0.1878 0.1295  252 LEU A CD1 
1782 C CD2 . LEU A 285 ? 0.6343 0.5917 1.8709 0.0735  -0.2265 0.1961  252 LEU A CD2 
1783 N N   . PHE A 286 ? 0.4527 0.4479 1.2478 0.0449  -0.1486 0.0735  253 PHE A N   
1784 C CA  . PHE A 286 ? 0.4298 0.4394 1.1320 0.0309  -0.1480 0.0754  253 PHE A CA  
1785 C C   . PHE A 286 ? 0.4748 0.4756 1.1206 0.0269  -0.1327 0.0493  253 PHE A C   
1786 O O   . PHE A 286 ? 0.4654 0.4738 1.0436 0.0127  -0.1338 0.0562  253 PHE A O   
1787 C CB  . PHE A 286 ? 0.4280 0.4566 1.1128 0.0387  -0.1355 0.0592  253 PHE A CB  
1788 C CG  . PHE A 286 ? 0.4472 0.4917 1.1712 0.0352  -0.1569 0.0904  253 PHE A CG  
1789 C CD1 . PHE A 286 ? 0.4801 0.5259 1.2997 0.0493  -0.1601 0.0971  253 PHE A CD1 
1790 C CD2 . PHE A 286 ? 0.4645 0.5235 1.1348 0.0182  -0.1740 0.1094  253 PHE A CD2 
1791 C CE1 . PHE A 286 ? 0.4885 0.5523 1.3538 0.0462  -0.1831 0.1262  253 PHE A CE1 
1792 C CE2 . PHE A 286 ? 0.4967 0.5717 1.2055 0.0139  -0.1989 0.1357  253 PHE A CE2 
1793 C CZ  . PHE A 286 ? 0.4735 0.5521 1.2818 0.0277  -0.2048 0.1458  253 PHE A CZ  
1794 N N   . ILE A 287 ? 0.4413 0.4262 1.1191 0.0389  -0.1197 0.0178  254 ILE A N   
1795 C CA  . ILE A 287 ? 0.4404 0.4175 1.0793 0.0355  -0.1104 -0.0081 254 ILE A CA  
1796 C C   . ILE A 287 ? 0.4919 0.4655 1.1145 0.0143  -0.1230 0.0241  254 ILE A C   
1797 O O   . ILE A 287 ? 0.4652 0.4461 1.0301 0.0060  -0.1159 0.0159  254 ILE A O   
1798 C CB  . ILE A 287 ? 0.4949 0.4543 1.1751 0.0508  -0.0999 -0.0499 254 ILE A CB  
1799 C CG1 . ILE A 287 ? 0.5023 0.4667 1.1854 0.0713  -0.0808 -0.0824 254 ILE A CG1 
1800 C CG2 . ILE A 287 ? 0.5067 0.4616 1.1476 0.0456  -0.0967 -0.0759 254 ILE A CG2 
1801 C CD1 . ILE A 287 ? 0.5947 0.5400 1.3183 0.0881  -0.0684 -0.1286 254 ILE A CD1 
1802 N N   . PRO A 288 ? 0.4757 0.4399 1.1450 0.0050  -0.1397 0.0638  255 PRO A N   
1803 C CA  . PRO A 288 ? 0.4899 0.4527 1.1317 -0.0161 -0.1454 0.0963  255 PRO A CA  
1804 C C   . PRO A 288 ? 0.5414 0.5232 1.0980 -0.0303 -0.1446 0.1119  255 PRO A C   
1805 O O   . PRO A 288 ? 0.5466 0.5302 1.0651 -0.0454 -0.1378 0.1223  255 PRO A O   
1806 C CB  . PRO A 288 ? 0.5382 0.4881 1.2448 -0.0214 -0.1649 0.1416  255 PRO A CB  
1807 C CG  . PRO A 288 ? 0.5886 0.5271 1.3756 -0.0010 -0.1658 0.1205  255 PRO A CG  
1808 C CD  . PRO A 288 ? 0.5061 0.4600 1.2584 0.0133  -0.1527 0.0833  255 PRO A CD  
1809 N N   . VAL A 289 ? 0.4915 0.4870 1.0241 -0.0260 -0.1502 0.1124  256 VAL A N   
1810 C CA  . VAL A 289 ? 0.4938 0.5049 0.9500 -0.0395 -0.1514 0.1222  256 VAL A CA  
1811 C C   . VAL A 289 ? 0.5093 0.5293 0.9214 -0.0321 -0.1311 0.0817  256 VAL A C   
1812 O O   . VAL A 289 ? 0.5101 0.5348 0.8692 -0.0427 -0.1208 0.0770  256 VAL A O   
1813 C CB  . VAL A 289 ? 0.5628 0.5835 1.0183 -0.0450 -0.1760 0.1531  256 VAL A CB  
1814 C CG1 . VAL A 289 ? 0.5500 0.5693 1.0863 -0.0279 -0.1858 0.1531  256 VAL A CG1 
1815 C CG2 . VAL A 289 ? 0.5566 0.5930 0.9436 -0.0526 -0.1750 0.1431  256 VAL A CG2 
1816 N N   . ILE A 290 ? 0.4394 0.4613 0.8753 -0.0139 -0.1235 0.0542  257 ILE A N   
1817 C CA  . ILE A 290 ? 0.4098 0.4386 0.8075 -0.0052 -0.1053 0.0206  257 ILE A CA  
1818 C C   . ILE A 290 ? 0.4331 0.4556 0.8186 -0.0036 -0.0935 -0.0026 257 ILE A C   
1819 O O   . ILE A 290 ? 0.4127 0.4422 0.7547 -0.0047 -0.0831 -0.0177 257 ILE A O   
1820 C CB  . ILE A 290 ? 0.4358 0.4681 0.8646 0.0134  -0.0981 0.0033  257 ILE A CB  
1821 C CG1 . ILE A 290 ? 0.4378 0.4845 0.8497 0.0098  -0.1014 0.0135  257 ILE A CG1 
1822 C CG2 . ILE A 290 ? 0.4380 0.4668 0.8585 0.0297  -0.0791 -0.0339 257 ILE A CG2 
1823 C CD1 . ILE A 290 ? 0.6301 0.6794 1.0909 0.0084  -0.1190 0.0382  257 ILE A CD1 
1824 N N   . GLY A 291 ? 0.3756 0.3848 0.8073 -0.0014 -0.0973 -0.0042 258 GLY A N   
1825 C CA  . GLY A 291 ? 0.3657 0.3686 0.8028 -0.0010 -0.0919 -0.0258 258 GLY A CA  
1826 C C   . GLY A 291 ? 0.4217 0.4176 0.8820 -0.0173 -0.0966 -0.0017 258 GLY A C   
1827 O O   . GLY A 291 ? 0.4222 0.4064 0.9268 -0.0159 -0.0986 -0.0138 258 GLY A O   
1828 N N   . LEU A 292 ? 0.3860 0.3889 0.8146 -0.0338 -0.0978 0.0321  259 LEU A N   
1829 C CA  . LEU A 292 ? 0.4064 0.4051 0.8454 -0.0515 -0.0968 0.0612  259 LEU A CA  
1830 C C   . LEU A 292 ? 0.4452 0.4469 0.8872 -0.0549 -0.0830 0.0399  259 LEU A C   
1831 O O   . LEU A 292 ? 0.4657 0.4589 0.9529 -0.0631 -0.0823 0.0508  259 LEU A O   
1832 C CB  . LEU A 292 ? 0.4344 0.4418 0.8194 -0.0686 -0.0976 0.0963  259 LEU A CB  
1833 C CG  . LEU A 292 ? 0.5488 0.5520 0.9370 -0.0879 -0.0927 0.1324  259 LEU A CG  
1834 C CD1 . LEU A 292 ? 0.5840 0.5731 1.0220 -0.0910 -0.1118 0.1713  259 LEU A CD1 
1835 C CD2 . LEU A 292 ? 0.6313 0.6470 0.9427 -0.1045 -0.0810 0.1473  259 LEU A CD2 
1836 N N   . ILE A 293 ? 0.3590 0.3725 0.7634 -0.0479 -0.0739 0.0108  260 ILE A N   
1837 C CA  . ILE A 293 ? 0.3427 0.3621 0.7573 -0.0488 -0.0648 -0.0107 260 ILE A CA  
1838 C C   . ILE A 293 ? 0.4273 0.4346 0.9014 -0.0398 -0.0762 -0.0339 260 ILE A C   
1839 O O   . ILE A 293 ? 0.4378 0.4428 0.9554 -0.0487 -0.0752 -0.0327 260 ILE A O   
1840 C CB  . ILE A 293 ? 0.3470 0.3802 0.7147 -0.0409 -0.0567 -0.0341 260 ILE A CB  
1841 C CG1 . ILE A 293 ? 0.3534 0.3967 0.6672 -0.0526 -0.0430 -0.0169 260 ILE A CG1 
1842 C CG2 . ILE A 293 ? 0.3285 0.3680 0.7188 -0.0367 -0.0554 -0.0596 260 ILE A CG2 
1843 C CD1 . ILE A 293 ? 0.4382 0.4837 0.7460 -0.0729 -0.0305 0.0119  260 ILE A CD1 
1844 N N   . TYR A 294 ? 0.3839 0.3829 0.8635 -0.0232 -0.0858 -0.0551 261 TYR A N   
1845 C CA  . TYR A 294 ? 0.3844 0.3693 0.9132 -0.0137 -0.0965 -0.0842 261 TYR A CA  
1846 C C   . TYR A 294 ? 0.4606 0.4291 1.0579 -0.0242 -0.1022 -0.0631 261 TYR A C   
1847 O O   . TYR A 294 ? 0.4489 0.4090 1.0965 -0.0275 -0.1084 -0.0793 261 TYR A O   
1848 C CB  . TYR A 294 ? 0.3926 0.3713 0.9106 0.0053  -0.0989 -0.1074 261 TYR A CB  
1849 C CG  . TYR A 294 ? 0.3903 0.3829 0.8444 0.0165  -0.0916 -0.1224 261 TYR A CG  
1850 C CD1 . TYR A 294 ? 0.4073 0.4117 0.8282 0.0169  -0.0910 -0.1372 261 TYR A CD1 
1851 C CD2 . TYR A 294 ? 0.3901 0.3834 0.8271 0.0278  -0.0857 -0.1221 261 TYR A CD2 
1852 C CE1 . TYR A 294 ? 0.4003 0.4151 0.7681 0.0276  -0.0850 -0.1473 261 TYR A CE1 
1853 C CE2 . TYR A 294 ? 0.3872 0.3919 0.7718 0.0375  -0.0770 -0.1331 261 TYR A CE2 
1854 C CZ  . TYR A 294 ? 0.4867 0.5007 0.8350 0.0374  -0.0771 -0.1448 261 TYR A CZ  
1855 O OH  . TYR A 294 ? 0.5121 0.5352 0.8133 0.0471  -0.0691 -0.1511 261 TYR A OH  
1856 N N   . LEU A 295 ? 0.4531 0.4171 1.0554 -0.0303 -0.1022 -0.0247 262 LEU A N   
1857 C CA  . LEU A 295 ? 0.4878 0.4352 1.1538 -0.0404 -0.1085 0.0068  262 LEU A CA  
1858 C C   . LEU A 295 ? 0.5656 0.5158 1.2496 -0.0600 -0.1006 0.0293  262 LEU A C   
1859 O O   . LEU A 295 ? 0.5897 0.5246 1.3453 -0.0653 -0.1053 0.0303  262 LEU A O   
1860 C CB  . LEU A 295 ? 0.5030 0.4497 1.1575 -0.0426 -0.1139 0.0475  262 LEU A CB  
1861 C CG  . LEU A 295 ? 0.5966 0.5276 1.3093 -0.0540 -0.1226 0.0932  262 LEU A CG  
1862 C CD1 . LEU A 295 ? 0.6093 0.5164 1.4111 -0.0419 -0.1326 0.0758  262 LEU A CD1 
1863 C CD2 . LEU A 295 ? 0.6480 0.5857 1.3266 -0.0597 -0.1315 0.1378  262 LEU A CD2 
1864 N N   . VAL A 296 ? 0.5161 0.4853 1.1404 -0.0709 -0.0865 0.0452  263 VAL A N   
1865 C CA  . VAL A 296 ? 0.5286 0.5053 1.1620 -0.0897 -0.0708 0.0670  263 VAL A CA  
1866 C C   . VAL A 296 ? 0.5675 0.5471 1.2501 -0.0882 -0.0704 0.0312  263 VAL A C   
1867 O O   . VAL A 296 ? 0.5722 0.5493 1.3099 -0.1024 -0.0634 0.0471  263 VAL A O   
1868 C CB  . VAL A 296 ? 0.5822 0.5779 1.1341 -0.0994 -0.0531 0.0859  263 VAL A CB  
1869 C CG1 . VAL A 296 ? 0.5904 0.5991 1.1473 -0.1148 -0.0292 0.0938  263 VAL A CG1 
1870 C CG2 . VAL A 296 ? 0.6115 0.6024 1.1293 -0.1079 -0.0581 0.1305  263 VAL A CG2 
1871 N N   . GLU A 297 ? 0.5090 0.4929 1.1765 -0.0715 -0.0803 -0.0146 264 GLU A N   
1872 C CA  . GLU A 297 ? 0.5022 0.4895 1.2118 -0.0686 -0.0886 -0.0514 264 GLU A CA  
1873 C C   . GLU A 297 ? 0.5857 0.5508 1.3806 -0.0698 -0.1047 -0.0639 264 GLU A C   
1874 O O   . GLU A 297 ? 0.5992 0.5659 1.4560 -0.0814 -0.1055 -0.0660 264 GLU A O   
1875 C CB  . GLU A 297 ? 0.5005 0.4975 1.1609 -0.0506 -0.0976 -0.0918 264 GLU A CB  
1876 C CG  . GLU A 297 ? 0.6429 0.6610 1.2381 -0.0506 -0.0821 -0.0837 264 GLU A CG  
1877 C CD  . GLU A 297 ? 0.9612 0.9981 1.5760 -0.0571 -0.0755 -0.0911 264 GLU A CD  
1878 O OE1 . GLU A 297 ? 0.9647 1.0051 1.6043 -0.0492 -0.0934 -0.1231 264 GLU A OE1 
1879 O OE2 . GLU A 297 ? 0.8707 0.9197 1.4745 -0.0695 -0.0527 -0.0662 264 GLU A OE2 
1880 N N   . VAL A 298 ? 0.5558 0.5003 1.3627 -0.0584 -0.1161 -0.0728 265 VAL A N   
1881 C CA  . VAL A 298 ? 0.5839 0.5028 1.4778 -0.0589 -0.1300 -0.0868 265 VAL A CA  
1882 C C   . VAL A 298 ? 0.6338 0.5427 1.5901 -0.0782 -0.1222 -0.0368 265 VAL A C   
1883 O O   . VAL A 298 ? 0.6472 0.5462 1.6828 -0.0886 -0.1273 -0.0421 265 VAL A O   
1884 C CB  . VAL A 298 ? 0.6558 0.5535 1.5591 -0.0405 -0.1403 -0.1131 265 VAL A CB  
1885 C CG1 . VAL A 298 ? 0.6662 0.5605 1.5615 -0.0263 -0.1541 -0.1765 265 VAL A CG1 
1886 C CG2 . VAL A 298 ? 0.6384 0.5425 1.4811 -0.0311 -0.1317 -0.0907 265 VAL A CG2 
1887 N N   . LEU A 299 ? 0.5746 0.4860 1.4945 -0.0837 -0.1113 0.0128  266 LEU A N   
1888 C CA  . LEU A 299 ? 0.5891 0.4918 1.5484 -0.1020 -0.1033 0.0708  266 LEU A CA  
1889 C C   . LEU A 299 ? 0.6148 0.5302 1.5994 -0.1224 -0.0859 0.0891  266 LEU A C   
1890 O O   . LEU A 299 ? 0.6362 0.5366 1.7017 -0.1358 -0.0845 0.1144  266 LEU A O   
1891 C CB  . LEU A 299 ? 0.5978 0.5068 1.4888 -0.1032 -0.0989 0.1150  266 LEU A CB  
1892 C CG  . LEU A 299 ? 0.7028 0.5970 1.6280 -0.1163 -0.1005 0.1782  266 LEU A CG  
1893 C CD1 . LEU A 299 ? 0.7268 0.5899 1.7578 -0.1098 -0.1176 0.1755  266 LEU A CD1 
1894 C CD2 . LEU A 299 ? 0.7271 0.6302 1.5764 -0.1146 -0.1049 0.2112  266 LEU A CD2 
1895 N N   . SER A 300 ? 0.5244 0.4666 1.4520 -0.1239 -0.0721 0.0743  267 SER A N   
1896 C CA  . SER A 300 ? 0.5138 0.4724 1.4709 -0.1414 -0.0515 0.0868  267 SER A CA  
1897 C C   . SER A 300 ? 0.5676 0.5183 1.6283 -0.1443 -0.0651 0.0559  267 SER A C   
1898 O O   . SER A 300 ? 0.5941 0.5464 1.7233 -0.1627 -0.0512 0.0812  267 SER A O   
1899 C CB  . SER A 300 ? 0.4981 0.4858 1.3816 -0.1387 -0.0353 0.0714  267 SER A CB  
1900 O OG  . SER A 300 ? 0.4942 0.4872 1.3584 -0.1199 -0.0544 0.0188  267 SER A OG  
1901 N N   . VAL A 301 ? 0.4944 0.4362 1.5665 -0.1271 -0.0922 0.0015  268 VAL A N   
1902 C CA  . VAL A 301 ? 0.4933 0.4248 1.6574 -0.1287 -0.1130 -0.0373 268 VAL A CA  
1903 C C   . VAL A 301 ? 0.5668 0.4663 1.8220 -0.1373 -0.1188 -0.0160 268 VAL A C   
1904 O O   . VAL A 301 ? 0.5776 0.4729 1.9259 -0.1538 -0.1172 -0.0070 268 VAL A O   
1905 C CB  . VAL A 301 ? 0.5264 0.4575 1.6584 -0.1080 -0.1401 -0.1021 268 VAL A CB  
1906 C CG1 . VAL A 301 ? 0.5430 0.4557 1.7659 -0.1094 -0.1672 -0.1454 268 VAL A CG1 
1907 C CG2 . VAL A 301 ? 0.5011 0.4639 1.5711 -0.1029 -0.1368 -0.1186 268 VAL A CG2 
1908 N N   . ILE A 302 ? 0.5237 0.4015 1.7601 -0.1268 -0.1240 -0.0037 269 ILE A N   
1909 C CA  . ILE A 302 ? 0.5499 0.3949 1.8760 -0.1326 -0.1300 0.0211  269 ILE A CA  
1910 C C   . ILE A 302 ? 0.6088 0.4557 1.9817 -0.1575 -0.1087 0.0876  269 ILE A C   
1911 O O   . ILE A 302 ? 0.6222 0.4497 2.1031 -0.1697 -0.1126 0.0955  269 ILE A O   
1912 C CB  . ILE A 302 ? 0.5955 0.4219 1.8944 -0.1163 -0.1372 0.0308  269 ILE A CB  
1913 C CG1 . ILE A 302 ? 0.5864 0.4131 1.8330 -0.0915 -0.1509 -0.0330 269 ILE A CG1 
1914 C CG2 . ILE A 302 ? 0.6357 0.4262 2.0429 -0.1209 -0.1451 0.0565  269 ILE A CG2 
1915 C CD1 . ILE A 302 ? 0.7166 0.5298 2.0126 -0.0834 -0.1707 -0.1062 269 ILE A CD1 
1916 N N   . ILE A 303 ? 0.5611 0.4313 1.8520 -0.1656 -0.0847 0.1329  270 ILE A N   
1917 C CA  . ILE A 303 ? 0.5868 0.4625 1.8983 -0.1894 -0.0580 0.1982  270 ILE A CA  
1918 C C   . ILE A 303 ? 0.6290 0.5200 2.0109 -0.2049 -0.0445 0.1855  270 ILE A C   
1919 O O   . ILE A 303 ? 0.6642 0.5424 2.1409 -0.2229 -0.0358 0.2192  270 ILE A O   
1920 C CB  . ILE A 303 ? 0.6345 0.5300 1.8275 -0.1935 -0.0363 0.2437  270 ILE A CB  
1921 C CG1 . ILE A 303 ? 0.6405 0.5216 1.7814 -0.1794 -0.0553 0.2582  270 ILE A CG1 
1922 C CG2 . ILE A 303 ? 0.6914 0.5912 1.8987 -0.2190 -0.0058 0.3124  270 ILE A CG2 
1923 C CD1 . ILE A 303 ? 0.6972 0.5998 1.7095 -0.1777 -0.0451 0.2773  270 ILE A CD1 
1924 N N   . GLN A 304 ? 0.5266 0.4442 1.8739 -0.1980 -0.0446 0.1385  271 GLN A N   
1925 C CA  . GLN A 304 ? 0.5098 0.4460 1.9323 -0.2112 -0.0355 0.1237  271 GLN A CA  
1926 C C   . GLN A 304 ? 0.5469 0.4614 2.0999 -0.2161 -0.0609 0.0955  271 GLN A C   
1927 O O   . GLN A 304 ? 0.5663 0.4817 2.2146 -0.2367 -0.0460 0.1225  271 GLN A O   
1928 C CB  . GLN A 304 ? 0.4863 0.4536 1.8534 -0.1997 -0.0382 0.0776  271 GLN A CB  
1929 C CG  . GLN A 304 ? 0.5292 0.5262 1.8197 -0.2059 -0.0001 0.1079  271 GLN A CG  
1930 C CD  . GLN A 304 ? 0.6425 0.6626 2.0059 -0.2250 0.0290  0.1247  271 GLN A CD  
1931 O OE1 . GLN A 304 ? 0.6442 0.6653 2.0210 -0.2437 0.0636  0.1787  271 GLN A OE1 
1932 N NE2 . GLN A 304 ? 0.4722 0.5140 1.8799 -0.2206 0.0174  0.0814  271 GLN A NE2 
1933 N N   . VAL A 305 ? 0.4851 0.3801 2.0432 -0.1981 -0.0974 0.0396  272 VAL A N   
1934 C CA  . VAL A 305 ? 0.5031 0.3737 2.1770 -0.2008 -0.1268 -0.0009 272 VAL A CA  
1935 C C   . VAL A 305 ? 0.5888 0.4256 2.3614 -0.2150 -0.1209 0.0443  272 VAL A C   
1936 O O   . VAL A 305 ? 0.6065 0.4344 2.4998 -0.2317 -0.1253 0.0428  272 VAL A O   
1937 C CB  . VAL A 305 ? 0.5439 0.4011 2.1817 -0.1772 -0.1631 -0.0739 272 VAL A CB  
1938 C CG1 . VAL A 305 ? 0.5735 0.4050 2.3275 -0.1815 -0.1943 -0.1225 272 VAL A CG1 
1939 C CG2 . VAL A 305 ? 0.5066 0.3967 2.0524 -0.1645 -0.1697 -0.1109 272 VAL A CG2 
1940 N N   . THR A 306 ? 0.5592 0.3783 2.2871 -0.2092 -0.1124 0.0872  273 THR A N   
1941 C CA  . THR A 306 ? 0.6009 0.3868 2.4178 -0.2208 -0.1085 0.1383  273 THR A CA  
1942 C C   . THR A 306 ? 0.6960 0.4938 2.5574 -0.2483 -0.0749 0.2093  273 THR A C   
1943 O O   . THR A 306 ? 0.7214 0.4985 2.7106 -0.2649 -0.0749 0.2278  273 THR A O   
1944 C CB  . THR A 306 ? 0.6554 0.4224 2.4134 -0.2054 -0.1133 0.1648  273 THR A CB  
1945 O OG1 . THR A 306 ? 0.5966 0.3565 2.3150 -0.1803 -0.1378 0.0964  273 THR A OG1 
1946 C CG2 . THR A 306 ? 0.6642 0.3930 2.5267 -0.2138 -0.1165 0.2133  273 THR A CG2 
1947 N N   . TYR A 307 ? 0.6547 0.4850 2.4129 -0.2536 -0.0442 0.2476  274 TYR A N   
1948 C CA  . TYR A 307 ? 0.6909 0.5368 2.4688 -0.2789 -0.0043 0.3146  274 TYR A CA  
1949 C C   . TYR A 307 ? 0.7383 0.5986 2.6301 -0.2957 0.0043  0.2940  274 TYR A C   
1950 O O   . TYR A 307 ? 0.7639 0.6154 2.7537 -0.3180 0.0241  0.3423  274 TYR A O   
1951 C CB  . TYR A 307 ? 0.7063 0.5836 2.3391 -0.2785 0.0258  0.3449  274 TYR A CB  
1952 C CG  . TYR A 307 ? 0.7783 0.6737 2.4107 -0.3037 0.0732  0.4112  274 TYR A CG  
1953 C CD1 . TYR A 307 ? 0.8640 0.7413 2.4981 -0.3185 0.0890  0.4901  274 TYR A CD1 
1954 C CD2 . TYR A 307 ? 0.7793 0.7111 2.4051 -0.3121 0.1040  0.3970  274 TYR A CD2 
1955 C CE1 . TYR A 307 ? 0.9323 0.8266 2.5557 -0.3425 0.1369  0.5530  274 TYR A CE1 
1956 C CE2 . TYR A 307 ? 0.8413 0.7912 2.4644 -0.3350 0.1544  0.4559  274 TYR A CE2 
1957 C CZ  . TYR A 307 ? 1.0159 0.9467 2.6332 -0.3507 0.1721  0.5338  274 TYR A CZ  
1958 O OH  . TYR A 307 ? 1.1048 1.0537 2.7121 -0.3740 0.2257  0.5931  274 TYR A OH  
1959 N N   . PHE A 308 ? 0.6562 0.5378 2.5423 -0.2849 -0.0137 0.2238  275 PHE A N   
1960 C CA  . PHE A 308 ? 0.6468 0.5462 2.6406 -0.2972 -0.0162 0.1926  275 PHE A CA  
1961 C C   . PHE A 308 ? 0.7351 0.6011 2.8858 -0.3097 -0.0379 0.1859  275 PHE A C   
1962 O O   . PHE A 308 ? 0.7559 0.6306 3.0205 -0.3322 -0.0210 0.2074  275 PHE A O   
1963 C CB  . PHE A 308 ? 0.6254 0.5461 2.5733 -0.2781 -0.0463 0.1151  275 PHE A CB  
1964 C CG  . PHE A 308 ? 0.6375 0.5794 2.6922 -0.2881 -0.0595 0.0764  275 PHE A CG  
1965 C CD1 . PHE A 308 ? 0.6551 0.6393 2.7111 -0.2969 -0.0294 0.0896  275 PHE A CD1 
1966 C CD2 . PHE A 308 ? 0.6737 0.5942 2.8293 -0.2880 -0.1040 0.0229  275 PHE A CD2 
1967 C CE1 . PHE A 308 ? 0.6550 0.6619 2.8200 -0.3056 -0.0452 0.0550  275 PHE A CE1 
1968 C CE2 . PHE A 308 ? 0.7016 0.6435 2.9589 -0.2982 -0.1224 -0.0134 275 PHE A CE2 
1969 C CZ  . PHE A 308 ? 0.6570 0.6433 2.9216 -0.3068 -0.0941 0.0046  275 PHE A CZ  
1970 N N   . LYS A 309 ? 0.7012 0.5293 2.8638 -0.2952 -0.0736 0.1542  276 LYS A N   
1971 C CA  . LYS A 309 ? 0.7324 0.5218 3.0423 -0.3039 -0.0980 0.1385  276 LYS A CA  
1972 C C   . LYS A 309 ? 0.8315 0.5946 3.2139 -0.3223 -0.0725 0.2215  276 LYS A C   
1973 O O   . LYS A 309 ? 0.8608 0.6073 3.3891 -0.3420 -0.0732 0.2326  276 LYS A O   
1974 C CB  . LYS A 309 ? 0.7604 0.5191 3.0529 -0.2800 -0.1412 0.0686  276 LYS A CB  
1975 C CG  . LYS A 309 ? 0.8998 0.6797 3.1481 -0.2658 -0.1721 -0.0163 276 LYS A CG  
1976 C CD  . LYS A 309 ? 1.0061 0.7583 3.2100 -0.2409 -0.2064 -0.0820 276 LYS A CD  
1977 C CE  . LYS A 309 ? 1.1136 0.8872 3.2600 -0.2275 -0.2368 -0.1600 276 LYS A CE  
1978 N NZ  . LYS A 309 ? 1.2472 1.0135 3.5145 -0.2401 -0.2703 -0.2139 276 LYS A NZ  
1979 N N   . ARG A 310 ? 0.8081 0.5682 3.0911 -0.3170 -0.0518 0.2817  277 ARG A N   
1980 C CA  . ARG A 310 ? 0.8593 0.5966 3.1844 -0.3328 -0.0289 0.3711  277 ARG A CA  
1981 C C   . ARG A 310 ? 0.9359 0.6974 3.3047 -0.3619 0.0163  0.4342  277 ARG A C   
1982 O O   . ARG A 310 ? 0.9930 0.7325 3.4507 -0.3812 0.0330  0.5010  277 ARG A O   
1983 C CB  . ARG A 310 ? 0.8914 0.6279 3.0777 -0.3188 -0.0230 0.4142  277 ARG A CB  
1984 C CG  . ARG A 310 ? 1.0947 0.7942 3.2858 -0.2961 -0.0594 0.3882  277 ARG A CG  
1985 C CD  . ARG A 310 ? 1.4033 1.0636 3.6812 -0.3052 -0.0596 0.4602  277 ARG A CD  
1986 N NE  . ARG A 310 ? 1.6264 1.2926 3.6860 -0.3115 -0.0304 0.5233  277 ARG A NE  
1987 C CZ  . ARG A 310 ? 1.9058 1.5290 3.6748 -0.3236 -0.0049 0.5248  277 ARG A CZ  
1988 N NH1 . ARG A 310 ? 1.8008 1.4405 3.6278 -0.3313 0.0057  0.6300  277 ARG A NH1 
1989 N NH2 . ARG A 310 ? 1.7759 1.3633 3.6785 -0.3336 -0.0123 0.5346  277 ARG A NH2 
1990 N N   . THR A 311 ? 0.8552 0.6617 3.1640 -0.3646 0.0384  0.4152  278 THR A N   
1991 C CA  . THR A 311 ? 0.8741 0.7107 3.2180 -0.3902 0.0877  0.4658  278 THR A CA  
1992 C C   . THR A 311 ? 0.8936 0.7468 3.3713 -0.4005 0.0784  0.4132  278 THR A C   
1993 O O   . THR A 311 ? 0.8666 0.7011 3.4146 -0.3907 0.0313  0.3453  278 THR A O   
1994 C CB  . THR A 311 ? 0.9795 0.8550 3.1603 -0.3860 0.1247  0.4881  278 THR A CB  
1995 O OG1 . THR A 311 ? 0.9112 0.8096 3.0192 -0.3643 0.1016  0.4111  278 THR A OG1 
1996 C CG2 . THR A 311 ? 0.9945 0.8548 3.0525 -0.3810 0.1332  0.5481  278 THR A CG2 
1997 N N   . GLY A 312 ? 0.8586 0.7477 3.3711 -0.4202 0.1227  0.4432  279 GLY A N   
1998 C CA  . GLY A 312 ? 0.8415 0.7531 3.4878 -0.4316 0.1160  0.4002  279 GLY A CA  
1999 C C   . GLY A 312 ? 0.8419 0.7926 3.4188 -0.4142 0.1012  0.3321  279 GLY A C   
2000 O O   . GLY A 312 ? 0.8322 0.8193 3.4833 -0.4252 0.1171  0.3192  279 GLY A O   
2001 N N   . GLY A 313 ? 0.7583 0.7018 3.2015 -0.3871 0.0711  0.2913  280 GLY A N   
2002 C CA  . GLY A 313 ? 0.7030 0.6787 3.0629 -0.3675 0.0541  0.2309  280 GLY A CA  
2003 C C   . GLY A 313 ? 0.7437 0.7483 2.9565 -0.3608 0.0973  0.2619  280 GLY A C   
2004 O O   . GLY A 313 ? 0.7060 0.7435 2.8689 -0.3492 0.0966  0.2242  280 GLY A O   
2005 N N   . LYS A 314 ? 0.7372 0.7285 2.8800 -0.3682 0.1330  0.3304  281 LYS A N   
2006 C CA  . LYS A 314 ? 0.7424 0.7560 2.7381 -0.3647 0.1752  0.3640  281 LYS A CA  
2007 C C   . LYS A 314 ? 0.7507 0.7645 2.6060 -0.3366 0.1457  0.3183  281 LYS A C   
2008 O O   . LYS A 314 ? 0.7212 0.7089 2.5741 -0.3205 0.0978  0.2800  281 LYS A O   
2009 C CB  . LYS A 314 ? 0.8375 0.8323 2.7929 -0.3804 0.2103  0.4485  281 LYS A CB  
2010 C CG  . LYS A 314 ? 1.0627 1.0603 3.1405 -0.4103 0.2521  0.5073  281 LYS A CG  
2011 C CD  . LYS A 314 ? 1.2536 1.2299 3.2761 -0.4241 0.2810  0.5942  281 LYS A CD  
2012 C CE  . LYS A 314 ? 1.4504 1.4271 3.5934 -0.4545 0.3246  0.6591  281 LYS A CE  
2013 N NZ  . LYS A 314 ? 1.6543 1.5977 3.5605 -0.4727 0.3370  0.6991  281 LYS A NZ  
2014 N N   . ARG A 315 ? 0.7067 0.7495 2.4488 -0.3311 0.1770  0.3215  282 ARG A N   
2015 C CA  . ARG A 315 ? 0.6667 0.7127 2.2775 -0.3065 0.1553  0.2829  282 ARG A CA  
2016 C C   . ARG A 315 ? 0.7470 0.7865 2.2195 -0.3059 0.1780  0.3277  282 ARG A C   
2017 O O   . ARG A 315 ? 0.7828 0.8363 2.2210 -0.3224 0.2267  0.3760  282 ARG A O   
2018 C CB  . ARG A 315 ? 0.6239 0.7074 2.2236 -0.2973 0.1626  0.2371  282 ARG A CB  
2019 C CG  . ARG A 315 ? 0.7080 0.7914 2.3681 -0.2818 0.1094  0.1696  282 ARG A CG  
2020 C CD  . ARG A 315 ? 0.8330 0.9532 2.5762 -0.2851 0.1166  0.1418  282 ARG A CD  
2021 N NE  . ARG A 315 ? 1.0011 1.1511 2.6568 -0.2742 0.1422  0.1318  282 ARG A NE  
2022 C CZ  . ARG A 315 ? 1.2741 1.4524 2.9355 -0.2861 0.1981  0.1598  282 ARG A CZ  
2023 N NH1 . ARG A 315 ? 1.0999 1.3012 2.6839 -0.2741 0.2186  0.1441  282 ARG A NH1 
2024 N NH2 . ARG A 315 ? 1.1914 1.3746 2.9395 -0.3100 0.2366  0.2033  282 ARG A NH2 
2025 N N   . ILE A 316 ? 0.6996 0.7188 2.0925 -0.2874 0.1426  0.3103  283 ILE A N   
2026 C CA  . ILE A 316 ? 0.7268 0.7397 1.9886 -0.2845 0.1519  0.3453  283 ILE A CA  
2027 C C   . ILE A 316 ? 0.7527 0.7901 1.9010 -0.2700 0.1595  0.3094  283 ILE A C   
2028 O O   . ILE A 316 ? 0.7840 0.8262 1.8221 -0.2726 0.1795  0.3362  283 ILE A O   
2029 C CB  . ILE A 316 ? 0.7696 0.7464 2.0288 -0.2749 0.1118  0.3559  283 ILE A CB  
2030 C CG1 . ILE A 316 ? 0.8292 0.7964 1.9992 -0.2834 0.1251  0.4212  283 ILE A CG1 
2031 C CG2 . ILE A 316 ? 0.7251 0.6958 1.9513 -0.2486 0.0703  0.2933  283 ILE A CG2 
2032 C CD1 . ILE A 316 ? 0.9896 0.9434 2.2254 -0.3078 0.1483  0.4932  283 ILE A CD1 
2033 N N   . PHE A 317 ? 0.6536 0.7054 1.8324 -0.2556 0.1415  0.2495  284 PHE A N   
2034 C CA  . PHE A 317 ? 0.6185 0.6934 1.7190 -0.2412 0.1466  0.2112  284 PHE A CA  
2035 C C   . PHE A 317 ? 0.6317 0.7338 1.8196 -0.2430 0.1573  0.1807  284 PHE A C   
2036 O O   . PHE A 317 ? 0.6171 0.7158 1.9218 -0.2506 0.1442  0.1755  284 PHE A O   
2037 C CB  . PHE A 317 ? 0.6037 0.6653 1.6531 -0.2170 0.1015  0.1683  284 PHE A CB  
2038 C CG  . PHE A 317 ? 0.6422 0.6804 1.6155 -0.2120 0.0863  0.1920  284 PHE A CG  
2039 C CD1 . PHE A 317 ? 0.7175 0.7615 1.5828 -0.2156 0.1076  0.2195  284 PHE A CD1 
2040 C CD2 . PHE A 317 ? 0.6608 0.6721 1.6718 -0.2025 0.0488  0.1819  284 PHE A CD2 
2041 C CE1 . PHE A 317 ? 0.7500 0.7750 1.5527 -0.2113 0.0883  0.2420  284 PHE A CE1 
2042 C CE2 . PHE A 317 ? 0.7168 0.7089 1.6707 -0.1969 0.0344  0.2048  284 PHE A CE2 
2043 C CZ  . PHE A 317 ? 0.7211 0.7213 1.5729 -0.2014 0.0520  0.2360  284 PHE A CZ  
2044 N N   . LYS A 318 ? 0.5672 0.6959 1.7077 -0.2359 0.1786  0.1591  285 LYS A N   
2045 C CA  . LYS A 318 ? 0.5371 0.6948 1.7649 -0.2352 0.1863  0.1301  285 LYS A CA  
2046 C C   . LYS A 318 ? 0.5398 0.6911 1.8313 -0.2207 0.1291  0.0831  285 LYS A C   
2047 O O   . LYS A 318 ? 0.5037 0.6658 1.9121 -0.2277 0.1190  0.0709  285 LYS A O   
2048 C CB  . LYS A 318 ? 0.5523 0.7355 1.7149 -0.2271 0.2169  0.1142  285 LYS A CB  
2049 C CG  . LYS A 318 ? 0.7089 0.9023 1.8213 -0.2441 0.2795  0.1545  285 LYS A CG  
2050 C CD  . LYS A 318 ? 0.8063 1.0266 1.8848 -0.2377 0.3159  0.1331  285 LYS A CD  
2051 C CE  . LYS A 318 ? 0.9922 1.2216 2.0165 -0.2558 0.3812  0.1691  285 LYS A CE  
2052 N NZ  . LYS A 318 ? 1.1348 1.3912 2.1481 -0.2502 0.4234  0.1437  285 LYS A NZ  
2053 N N   . MET A 319 ? 0.4967 0.6290 1.7101 -0.2019 0.0918  0.0585  286 MET A N   
2054 C CA  . MET A 319 ? 0.4760 0.5970 1.7167 -0.1865 0.0381  0.0135  286 MET A CA  
2055 C C   . MET A 319 ? 0.5090 0.6038 1.6547 -0.1715 0.0149  0.0067  286 MET A C   
2056 O O   . MET A 319 ? 0.5093 0.6046 1.5584 -0.1671 0.0337  0.0224  286 MET A O   
2057 C CB  . MET A 319 ? 0.4833 0.6307 1.7361 -0.1730 0.0229  -0.0261 286 MET A CB  
2058 C CG  . MET A 319 ? 0.5321 0.6739 1.8380 -0.1632 -0.0310 -0.0700 286 MET A CG  
2059 S SD  . MET A 319 ? 0.5808 0.7568 1.9061 -0.1492 -0.0501 -0.1056 286 MET A SD  
2060 C CE  . MET A 319 ? 0.5509 0.7153 1.9329 -0.1427 -0.1174 -0.1530 286 MET A CE  
2061 N N   . ALA A 320 ? 0.4551 0.5274 1.6320 -0.1640 -0.0251 -0.0193 287 ALA A N   
2062 C CA  . ALA A 320 ? 0.4506 0.4995 1.5537 -0.1480 -0.0471 -0.0319 287 ALA A CA  
2063 C C   . ALA A 320 ? 0.5012 0.5525 1.5828 -0.1278 -0.0840 -0.0860 287 ALA A C   
2064 O O   . ALA A 320 ? 0.5040 0.5633 1.6558 -0.1292 -0.1062 -0.1148 287 ALA A O   
2065 C CB  . ALA A 320 ? 0.4814 0.4992 1.6324 -0.1543 -0.0580 -0.0167 287 ALA A CB  
2066 N N   . PRO A 321 ? 0.4429 0.4887 1.4302 -0.1099 -0.0921 -0.0996 288 PRO A N   
2067 C CA  . PRO A 321 ? 0.4405 0.4786 1.3443 -0.1064 -0.0735 -0.0717 288 PRO A CA  
2068 C C   . PRO A 321 ? 0.5004 0.5590 1.3635 -0.1159 -0.0374 -0.0404 288 PRO A C   
2069 O O   . PRO A 321 ? 0.4872 0.5680 1.3807 -0.1206 -0.0250 -0.0454 288 PRO A O   
2070 C CB  . PRO A 321 ? 0.4476 0.4815 1.2826 -0.0843 -0.0948 -0.1056 288 PRO A CB  
2071 C CG  . PRO A 321 ? 0.5034 0.5327 1.3860 -0.0773 -0.1275 -0.1492 288 PRO A CG  
2072 C CD  . PRO A 321 ? 0.4484 0.4960 1.4079 -0.0913 -0.1245 -0.1464 288 PRO A CD  
2073 N N   . ILE A 322 ? 0.4771 0.5283 1.2743 -0.1186 -0.0212 -0.0097 289 ILE A N   
2074 C CA  . ILE A 322 ? 0.4861 0.5515 1.2304 -0.1291 0.0134  0.0196  289 ILE A CA  
2075 C C   . ILE A 322 ? 0.5147 0.6025 1.2212 -0.1205 0.0246  -0.0040 289 ILE A C   
2076 O O   . ILE A 322 ? 0.5379 0.6405 1.2281 -0.1310 0.0577  0.0120  289 ILE A O   
2077 C CB  . ILE A 322 ? 0.5460 0.5972 1.2203 -0.1313 0.0161  0.0505  289 ILE A CB  
2078 C CG1 . ILE A 322 ? 0.5934 0.6530 1.2320 -0.1508 0.0515  0.0920  289 ILE A CG1 
2079 C CG2 . ILE A 322 ? 0.5283 0.5785 1.1289 -0.1137 0.0017  0.0285  289 ILE A CG2 
2080 C CD1 . ILE A 322 ? 0.7411 0.7855 1.3292 -0.1588 0.0490  0.1339  289 ILE A CD1 
2081 N N   . HIS A 323 ? 0.4314 0.5213 1.1257 -0.1019 -0.0004 -0.0403 290 HIS A N   
2082 C CA  . HIS A 323 ? 0.4089 0.5183 1.0781 -0.0933 0.0086  -0.0583 290 HIS A CA  
2083 C C   . HIS A 323 ? 0.4751 0.6063 1.2211 -0.1011 0.0227  -0.0621 290 HIS A C   
2084 O O   . HIS A 323 ? 0.4801 0.6283 1.2146 -0.1027 0.0502  -0.0602 290 HIS A O   
2085 C CB  . HIS A 323 ? 0.3904 0.4968 1.0256 -0.0721 -0.0206 -0.0889 290 HIS A CB  
2086 C CG  . HIS A 323 ? 0.4255 0.5285 1.1115 -0.0643 -0.0548 -0.1156 290 HIS A CG  
2087 N ND1 . HIS A 323 ? 0.4501 0.5325 1.1271 -0.0577 -0.0776 -0.1265 290 HIS A ND1 
2088 C CD2 . HIS A 323 ? 0.4455 0.5636 1.1888 -0.0618 -0.0706 -0.1356 290 HIS A CD2 
2089 C CE1 . HIS A 323 ? 0.4484 0.5322 1.1698 -0.0524 -0.1057 -0.1552 290 HIS A CE1 
2090 N NE2 . HIS A 323 ? 0.4496 0.5552 1.2119 -0.0550 -0.1056 -0.1604 290 HIS A NE2 
2091 N N   . HIS A 324 ? 0.4292 0.5595 1.2602 -0.1070 0.0056  -0.0675 291 HIS A N   
2092 C CA  . HIS A 324 ? 0.4315 0.5834 1.3553 -0.1166 0.0163  -0.0689 291 HIS A CA  
2093 C C   . HIS A 324 ? 0.4964 0.6554 1.4342 -0.1369 0.0642  -0.0323 291 HIS A C   
2094 O O   . HIS A 324 ? 0.5055 0.6881 1.4958 -0.1434 0.0904  -0.0305 291 HIS A O   
2095 C CB  . HIS A 324 ? 0.4507 0.5966 1.4630 -0.1196 -0.0183 -0.0854 291 HIS A CB  
2096 C CG  . HIS A 324 ? 0.4892 0.6295 1.4878 -0.1013 -0.0654 -0.1242 291 HIS A CG  
2097 N ND1 . HIS A 324 ? 0.4999 0.6592 1.4880 -0.0875 -0.0796 -0.1455 291 HIS A ND1 
2098 C CD2 . HIS A 324 ? 0.5202 0.6382 1.5173 -0.0957 -0.0995 -0.1445 291 HIS A CD2 
2099 C CE1 . HIS A 324 ? 0.4972 0.6454 1.4661 -0.0746 -0.1220 -0.1751 291 HIS A CE1 
2100 N NE2 . HIS A 324 ? 0.5135 0.6369 1.4857 -0.0788 -0.1335 -0.1786 291 HIS A NE2 
2101 N N   . HIS A 325 ? 0.4700 0.6096 1.3622 -0.1468 0.0760  -0.0018 292 HIS A N   
2102 C CA  . HIS A 325 ? 0.5065 0.6501 1.3910 -0.1668 0.1208  0.0384  292 HIS A CA  
2103 C C   . HIS A 325 ? 0.5581 0.7193 1.3779 -0.1662 0.1589  0.0374  292 HIS A C   
2104 O O   . HIS A 325 ? 0.5767 0.7569 1.4329 -0.1783 0.1992  0.0489  292 HIS A O   
2105 C CB  . HIS A 325 ? 0.5477 0.6655 1.3860 -0.1748 0.1165  0.0727  292 HIS A CB  
2106 C CG  . HIS A 325 ? 0.6447 0.7656 1.4459 -0.1945 0.1600  0.1174  292 HIS A CG  
2107 N ND1 . HIS A 325 ? 0.7013 0.8276 1.5760 -0.2139 0.1869  0.1482  292 HIS A ND1 
2108 C CD2 . HIS A 325 ? 0.6976 0.8173 1.3941 -0.1981 0.1801  0.1348  292 HIS A CD2 
2109 C CE1 . HIS A 325 ? 0.7442 0.8726 1.5491 -0.2281 0.2247  0.1852  292 HIS A CE1 
2110 N NE2 . HIS A 325 ? 0.7501 0.8745 1.4446 -0.2194 0.2202  0.1766  292 HIS A NE2 
2111 N N   . PHE A 326 ? 0.4975 0.6521 1.2285 -0.1525 0.1477  0.0218  293 PHE A N   
2112 C CA  . PHE A 326 ? 0.5026 0.6688 1.1701 -0.1507 0.1794  0.0144  293 PHE A CA  
2113 C C   . PHE A 326 ? 0.5342 0.7248 1.2645 -0.1427 0.1920  -0.0122 293 PHE A C   
2114 O O   . PHE A 326 ? 0.5509 0.7567 1.2756 -0.1490 0.2357  -0.0111 293 PHE A O   
2115 C CB  . PHE A 326 ? 0.5083 0.6598 1.0810 -0.1383 0.1590  0.0033  293 PHE A CB  
2116 C CG  . PHE A 326 ? 0.5510 0.6826 1.0610 -0.1472 0.1510  0.0326  293 PHE A CG  
2117 C CD1 . PHE A 326 ? 0.6415 0.7730 1.0981 -0.1651 0.1835  0.0626  293 PHE A CD1 
2118 C CD2 . PHE A 326 ? 0.5562 0.6698 1.0604 -0.1373 0.1110  0.0308  293 PHE A CD2 
2119 C CE1 . PHE A 326 ? 0.6849 0.7992 1.0869 -0.1733 0.1702  0.0939  293 PHE A CE1 
2120 C CE2 . PHE A 326 ? 0.6179 0.7146 1.0771 -0.1444 0.1015  0.0600  293 PHE A CE2 
2121 C CZ  . PHE A 326 ? 0.6465 0.7440 1.0556 -0.1623 0.1282  0.0929  293 PHE A CZ  
2122 N N   . GLU A 327 ? 0.4527 0.6473 1.2445 -0.1288 0.1536  -0.0361 294 GLU A N   
2123 C CA  . GLU A 327 ? 0.4350 0.6538 1.3002 -0.1200 0.1551  -0.0585 294 GLU A CA  
2124 C C   . GLU A 327 ? 0.5115 0.7518 1.4646 -0.1367 0.1945  -0.0437 294 GLU A C   
2125 O O   . GLU A 327 ? 0.5163 0.7779 1.4989 -0.1358 0.2294  -0.0511 294 GLU A O   
2126 C CB  . GLU A 327 ? 0.4237 0.6414 1.3380 -0.1063 0.1005  -0.0807 294 GLU A CB  
2127 C CG  . GLU A 327 ? 0.5616 0.7677 1.4056 -0.0863 0.0687  -0.0999 294 GLU A CG  
2128 C CD  . GLU A 327 ? 0.9580 1.1708 1.8533 -0.0726 0.0215  -0.1233 294 GLU A CD  
2129 O OE1 . GLU A 327 ? 0.9337 1.1350 1.8478 -0.0742 -0.0109 -0.1293 294 GLU A OE1 
2130 O OE2 . GLU A 327 ? 0.9651 1.1951 1.8870 -0.0610 0.0165  -0.1358 294 GLU A OE2 
2131 N N   . LEU A 328 ? 0.4794 0.7129 1.4763 -0.1523 0.1926  -0.0213 295 LEU A N   
2132 C CA  . LEU A 328 ? 0.5013 0.7528 1.5855 -0.1711 0.2310  -0.0004 295 LEU A CA  
2133 C C   . LEU A 328 ? 0.6092 0.8634 1.6296 -0.1860 0.2932  0.0267  295 LEU A C   
2134 O O   . LEU A 328 ? 0.6325 0.9064 1.7163 -0.2004 0.3384  0.0428  295 LEU A O   
2135 C CB  . LEU A 328 ? 0.5036 0.7436 1.6601 -0.1829 0.2058  0.0148  295 LEU A CB  
2136 C CG  . LEU A 328 ? 0.5263 0.7689 1.7677 -0.1725 0.1494  -0.0160 295 LEU A CG  
2137 C CD1 . LEU A 328 ? 0.5364 0.7634 1.8471 -0.1864 0.1295  -0.0029 295 LEU A CD1 
2138 C CD2 . LEU A 328 ? 0.5374 0.8144 1.8803 -0.1690 0.1540  -0.0348 295 LEU A CD2 
2139 N N   . CYS A 329 ? 0.5904 0.8266 1.4856 -0.1825 0.2959  0.0299  296 CYS A N   
2140 C CA  . CYS A 329 ? 0.6493 0.8858 1.4591 -0.1953 0.3483  0.0492  296 CYS A CA  
2141 C C   . CYS A 329 ? 0.6838 0.9374 1.4769 -0.1851 0.3797  0.0180  296 CYS A C   
2142 O O   . CYS A 329 ? 0.7300 0.9884 1.4645 -0.1951 0.4306  0.0240  296 CYS A O   
2143 C CB  . CYS A 329 ? 0.6806 0.8896 1.3723 -0.1978 0.3292  0.0669  296 CYS A CB  
2144 S SG  . CYS A 329 ? 0.7544 0.9424 1.4648 -0.2132 0.3079  0.1130  296 CYS A SG  
2145 N N   . GLY A 330 ? 0.5732 0.8349 1.4186 -0.1654 0.3489  -0.0147 297 GLY A N   
2146 C CA  . GLY A 330 ? 0.5621 0.8382 1.4129 -0.1526 0.3711  -0.0447 297 GLY A CA  
2147 C C   . GLY A 330 ? 0.5860 0.8448 1.3579 -0.1351 0.3397  -0.0674 297 GLY A C   
2148 O O   . GLY A 330 ? 0.5933 0.8592 1.3639 -0.1244 0.3579  -0.0916 297 GLY A O   
2149 N N   . TRP A 331 ? 0.4998 0.7357 1.2134 -0.1318 0.2943  -0.0598 298 TRP A N   
2150 C CA  . TRP A 331 ? 0.4657 0.6851 1.1094 -0.1163 0.2635  -0.0773 298 TRP A CA  
2151 C C   . TRP A 331 ? 0.4701 0.6971 1.1769 -0.0958 0.2268  -0.0992 298 TRP A C   
2152 O O   . TRP A 331 ? 0.4373 0.6707 1.2135 -0.0931 0.1968  -0.0979 298 TRP A O   
2153 C CB  . TRP A 331 ? 0.4408 0.6361 1.0146 -0.1192 0.2293  -0.0607 298 TRP A CB  
2154 C CG  . TRP A 331 ? 0.4984 0.6822 0.9892 -0.1369 0.2525  -0.0364 298 TRP A CG  
2155 C CD1 . TRP A 331 ? 0.5861 0.7781 1.0707 -0.1556 0.2975  -0.0165 298 TRP A CD1 
2156 C CD2 . TRP A 331 ? 0.5021 0.6649 0.9086 -0.1380 0.2278  -0.0250 298 TRP A CD2 
2157 N NE1 . TRP A 331 ? 0.6230 0.7996 1.0142 -0.1684 0.3001  0.0069  298 TRP A NE1 
2158 C CE2 . TRP A 331 ? 0.6095 0.7686 0.9568 -0.1578 0.2557  0.0019  298 TRP A CE2 
2159 C CE3 . TRP A 331 ? 0.4810 0.6290 0.8575 -0.1243 0.1858  -0.0340 298 TRP A CE3 
2160 C CZ2 . TRP A 331 ? 0.6209 0.7628 0.8844 -0.1640 0.2373  0.0203  298 TRP A CZ2 
2161 C CZ3 . TRP A 331 ? 0.5186 0.6505 0.8206 -0.1303 0.1722  -0.0173 298 TRP A CZ3 
2162 C CH2 . TRP A 331 ? 0.5825 0.7117 0.8309 -0.1498 0.1948  0.0096  298 TRP A CH2 
2163 N N   . SER A 332 ? 0.4373 0.6614 1.1154 -0.0819 0.2261  -0.1188 299 SER A N   
2164 C CA  . SER A 332 ? 0.4094 0.6375 1.1280 -0.0612 0.1905  -0.1353 299 SER A CA  
2165 C C   . SER A 332 ? 0.4585 0.6699 1.1399 -0.0537 0.1390  -0.1313 299 SER A C   
2166 O O   . SER A 332 ? 0.4573 0.6504 1.0657 -0.0606 0.1352  -0.1209 299 SER A O   
2167 C CB  . SER A 332 ? 0.4571 0.6791 1.1384 -0.0506 0.2055  -0.1518 299 SER A CB  
2168 O OG  . SER A 332 ? 0.6209 0.8426 1.2661 -0.0635 0.2571  -0.1554 299 SER A OG  
2169 N N   . GLU A 333 ? 0.3972 0.6155 1.1277 -0.0392 0.0996  -0.1403 300 GLU A N   
2170 C CA  . GLU A 333 ? 0.3752 0.5792 1.0708 -0.0296 0.0529  -0.1421 300 GLU A CA  
2171 C C   . GLU A 333 ? 0.4107 0.5945 1.0133 -0.0237 0.0539  -0.1413 300 GLU A C   
2172 O O   . GLU A 333 ? 0.4053 0.5730 0.9563 -0.0265 0.0407  -0.1350 300 GLU A O   
2173 C CB  . GLU A 333 ? 0.3825 0.5992 1.1337 -0.0135 0.0150  -0.1536 300 GLU A CB  
2174 C CG  . GLU A 333 ? 0.5498 0.7558 1.2763 -0.0057 -0.0327 -0.1593 300 GLU A CG  
2175 C CD  . GLU A 333 ? 0.9116 1.1335 1.7076 0.0010  -0.0730 -0.1701 300 GLU A CD  
2176 O OE1 . GLU A 333 ? 1.0180 1.2625 1.8957 0.0011  -0.0673 -0.1709 300 GLU A OE1 
2177 O OE2 . GLU A 333 ? 0.8002 1.0123 1.5709 0.0060  -0.1110 -0.1793 300 GLU A OE2 
2178 N N   . THR A 334 ? 0.3668 0.5519 0.9578 -0.0172 0.0736  -0.1477 301 THR A N   
2179 C CA  . THR A 334 ? 0.3543 0.5224 0.8730 -0.0129 0.0786  -0.1492 301 THR A CA  
2180 C C   . THR A 334 ? 0.3973 0.5536 0.8520 -0.0294 0.1023  -0.1418 301 THR A C   
2181 O O   . THR A 334 ? 0.4005 0.5416 0.7958 -0.0281 0.0902  -0.1383 301 THR A O   
2182 C CB  . THR A 334 ? 0.4485 0.6212 0.9928 -0.0022 0.0932  -0.1601 301 THR A CB  
2183 O OG1 . THR A 334 ? 0.5039 0.6948 1.1150 -0.0077 0.1233  -0.1661 301 THR A OG1 
2184 C CG2 . THR A 334 ? 0.3848 0.5592 0.9537 0.0174  0.0574  -0.1599 301 THR A CG2 
2185 N N   . ARG A 335 ? 0.3646 0.5291 0.8317 -0.0452 0.1352  -0.1375 302 ARG A N   
2186 C CA  . ARG A 335 ? 0.3892 0.5440 0.7916 -0.0628 0.1553  -0.1257 302 ARG A CA  
2187 C C   . ARG A 335 ? 0.4513 0.5949 0.8287 -0.0664 0.1264  -0.1080 302 ARG A C   
2188 O O   . ARG A 335 ? 0.4674 0.5973 0.7813 -0.0709 0.1201  -0.1005 302 ARG A O   
2189 C CB  . ARG A 335 ? 0.3966 0.5647 0.8250 -0.0788 0.1942  -0.1187 302 ARG A CB  
2190 C CG  . ARG A 335 ? 0.5045 0.6765 0.9127 -0.0836 0.2367  -0.1339 302 ARG A CG  
2191 C CD  . ARG A 335 ? 0.5179 0.6768 0.8305 -0.0997 0.2531  -0.1271 302 ARG A CD  
2192 N NE  . ARG A 335 ? 0.6151 0.7636 0.8829 -0.0947 0.2594  -0.1511 302 ARG A NE  
2193 C CZ  . ARG A 335 ? 0.6934 0.8475 0.9908 -0.0887 0.2889  -0.1771 302 ARG A CZ  
2194 N NH1 . ARG A 335 ? 0.6619 0.8026 0.9214 -0.0849 0.2913  -0.1993 302 ARG A NH1 
2195 N NH2 . ARG A 335 ? 0.2597 0.4328 0.6343 -0.0861 0.3158  -0.1816 302 ARG A NH2 
2196 N N   . VAL A 336 ? 0.3918 0.5410 0.8262 -0.0649 0.1086  -0.1027 303 VAL A N   
2197 C CA  . VAL A 336 ? 0.3911 0.5286 0.8193 -0.0671 0.0822  -0.0899 303 VAL A CA  
2198 C C   . VAL A 336 ? 0.4474 0.5717 0.8326 -0.0527 0.0540  -0.0973 303 VAL A C   
2199 O O   . VAL A 336 ? 0.4591 0.5706 0.8016 -0.0569 0.0467  -0.0852 303 VAL A O   
2200 C CB  . VAL A 336 ? 0.4279 0.5729 0.9342 -0.0679 0.0675  -0.0902 303 VAL A CB  
2201 C CG1 . VAL A 336 ? 0.4253 0.5541 0.9283 -0.0699 0.0425  -0.0804 303 VAL A CG1 
2202 C CG2 . VAL A 336 ? 0.4404 0.6004 0.9971 -0.0834 0.1008  -0.0796 303 VAL A CG2 
2203 N N   . VAL A 337 ? 0.3835 0.5120 0.7804 -0.0364 0.0404  -0.1141 304 VAL A N   
2204 C CA  . VAL A 337 ? 0.3608 0.4787 0.7185 -0.0224 0.0190  -0.1193 304 VAL A CA  
2205 C C   . VAL A 337 ? 0.4013 0.5097 0.7003 -0.0272 0.0322  -0.1136 304 VAL A C   
2206 O O   . VAL A 337 ? 0.4082 0.5060 0.6752 -0.0255 0.0190  -0.1073 304 VAL A O   
2207 C CB  . VAL A 337 ? 0.3929 0.5177 0.7727 -0.0051 0.0031  -0.1325 304 VAL A CB  
2208 C CG1 . VAL A 337 ? 0.3832 0.4970 0.7185 0.0083  -0.0143 -0.1337 304 VAL A CG1 
2209 C CG2 . VAL A 337 ? 0.3887 0.5235 0.8250 -0.0019 -0.0174 -0.1397 304 VAL A CG2 
2210 N N   . ALA A 338 ? 0.3460 0.4585 0.6356 -0.0343 0.0582  -0.1174 305 ALA A N   
2211 C CA  . ALA A 338 ? 0.3549 0.4584 0.5900 -0.0410 0.0688  -0.1169 305 ALA A CA  
2212 C C   . ALA A 338 ? 0.4210 0.5183 0.6165 -0.0570 0.0688  -0.0994 305 ALA A C   
2213 O O   . ALA A 338 ? 0.4203 0.5086 0.5802 -0.0573 0.0551  -0.0939 305 ALA A O   
2214 C CB  . ALA A 338 ? 0.3804 0.4883 0.6174 -0.0444 0.0976  -0.1316 305 ALA A CB  
2215 N N   . VAL A 339 ? 0.3923 0.4949 0.5992 -0.0701 0.0828  -0.0875 306 VAL A N   
2216 C CA  . VAL A 339 ? 0.4190 0.5159 0.5903 -0.0862 0.0827  -0.0641 306 VAL A CA  
2217 C C   . VAL A 339 ? 0.4701 0.5577 0.6494 -0.0806 0.0518  -0.0501 306 VAL A C   
2218 O O   . VAL A 339 ? 0.4904 0.5707 0.6322 -0.0865 0.0401  -0.0360 306 VAL A O   
2219 C CB  . VAL A 339 ? 0.4922 0.5972 0.6801 -0.1014 0.1087  -0.0503 306 VAL A CB  
2220 C CG1 . VAL A 339 ? 0.5237 0.6213 0.6824 -0.1166 0.1027  -0.0179 306 VAL A CG1 
2221 C CG2 . VAL A 339 ? 0.5163 0.6295 0.6822 -0.1088 0.1455  -0.0650 306 VAL A CG2 
2222 N N   . PHE A 340 ? 0.4000 0.4882 0.6298 -0.0687 0.0374  -0.0567 307 PHE A N   
2223 C CA  . PHE A 340 ? 0.3833 0.4616 0.6275 -0.0613 0.0121  -0.0503 307 PHE A CA  
2224 C C   . PHE A 340 ? 0.4254 0.4983 0.6394 -0.0502 -0.0013 -0.0570 307 PHE A C   
2225 O O   . PHE A 340 ? 0.4288 0.4942 0.6381 -0.0500 -0.0151 -0.0447 307 PHE A O   
2226 C CB  . PHE A 340 ? 0.3852 0.4650 0.6854 -0.0518 0.0007  -0.0633 307 PHE A CB  
2227 C CG  . PHE A 340 ? 0.4164 0.4974 0.7637 -0.0638 0.0060  -0.0510 307 PHE A CG  
2228 C CD1 . PHE A 340 ? 0.4790 0.5675 0.8227 -0.0803 0.0320  -0.0351 307 PHE A CD1 
2229 C CD2 . PHE A 340 ? 0.4406 0.5149 0.8383 -0.0590 -0.0125 -0.0573 307 PHE A CD2 
2230 C CE1 . PHE A 340 ? 0.5057 0.5962 0.8995 -0.0924 0.0404  -0.0202 307 PHE A CE1 
2231 C CE2 . PHE A 340 ? 0.4882 0.5626 0.9404 -0.0714 -0.0078 -0.0454 307 PHE A CE2 
2232 C CZ  . PHE A 340 ? 0.4843 0.5675 0.9366 -0.0881 0.0193  -0.0244 307 PHE A CZ  
2233 N N   . ALA A 341 ? 0.3710 0.4481 0.5718 -0.0413 0.0042  -0.0741 308 ALA A N   
2234 C CA  . ALA A 341 ? 0.3541 0.4271 0.5326 -0.0314 -0.0039 -0.0792 308 ALA A CA  
2235 C C   . ALA A 341 ? 0.4120 0.4822 0.5526 -0.0436 -0.0021 -0.0690 308 ALA A C   
2236 O O   . ALA A 341 ? 0.3919 0.4582 0.5271 -0.0407 -0.0154 -0.0619 308 ALA A O   
2237 C CB  . ALA A 341 ? 0.3519 0.4290 0.5346 -0.0196 0.0018  -0.0958 308 ALA A CB  
2238 N N   . ILE A 342 ? 0.3978 0.4707 0.5134 -0.0576 0.0143  -0.0700 309 ILE A N   
2239 C CA  . ILE A 342 ? 0.4201 0.4903 0.4899 -0.0722 0.0143  -0.0641 309 ILE A CA  
2240 C C   . ILE A 342 ? 0.4810 0.5484 0.5423 -0.0815 -0.0035 -0.0372 309 ILE A C   
2241 O O   . ILE A 342 ? 0.4971 0.5623 0.5399 -0.0854 -0.0202 -0.0294 309 ILE A O   
2242 C CB  . ILE A 342 ? 0.4872 0.5603 0.5285 -0.0849 0.0403  -0.0754 309 ILE A CB  
2243 C CG1 . ILE A 342 ? 0.4784 0.5519 0.5348 -0.0746 0.0546  -0.1018 309 ILE A CG1 
2244 C CG2 . ILE A 342 ? 0.5337 0.6037 0.5155 -0.1035 0.0375  -0.0683 309 ILE A CG2 
2245 C CD1 . ILE A 342 ? 0.5851 0.6635 0.6408 -0.0808 0.0867  -0.1181 309 ILE A CD1 
2246 N N   . VAL A 343 ? 0.4204 0.4879 0.5046 -0.0848 -0.0017 -0.0218 310 VAL A N   
2247 C CA  . VAL A 343 ? 0.4256 0.4884 0.5154 -0.0921 -0.0185 0.0077  310 VAL A CA  
2248 C C   . VAL A 343 ? 0.4539 0.5125 0.5753 -0.0780 -0.0411 0.0089  310 VAL A C   
2249 O O   . VAL A 343 ? 0.4744 0.5317 0.5857 -0.0829 -0.0591 0.0262  310 VAL A O   
2250 C CB  . VAL A 343 ? 0.4737 0.5358 0.5944 -0.0979 -0.0087 0.0224  310 VAL A CB  
2251 C CG1 . VAL A 343 ? 0.4710 0.5244 0.6270 -0.0976 -0.0292 0.0486  310 VAL A CG1 
2252 C CG2 . VAL A 343 ? 0.5154 0.5821 0.5947 -0.1169 0.0140  0.0338  310 VAL A CG2 
2253 N N   . THR A 344 ? 0.3667 0.4246 0.5237 -0.0606 -0.0397 -0.0107 311 THR A N   
2254 C CA  . THR A 344 ? 0.3378 0.3925 0.5219 -0.0455 -0.0529 -0.0151 311 THR A CA  
2255 C C   . THR A 344 ? 0.3907 0.4489 0.5533 -0.0458 -0.0591 -0.0146 311 THR A C   
2256 O O   . THR A 344 ? 0.4033 0.4610 0.5857 -0.0434 -0.0736 -0.0019 311 THR A O   
2257 C CB  . THR A 344 ? 0.3519 0.4064 0.5569 -0.0284 -0.0469 -0.0399 311 THR A CB  
2258 O OG1 . THR A 344 ? 0.3492 0.4015 0.5800 -0.0306 -0.0448 -0.0421 311 THR A OG1 
2259 C CG2 . THR A 344 ? 0.2795 0.3304 0.5065 -0.0124 -0.0543 -0.0470 311 THR A CG2 
2260 N N   . ALA A 345 ? 0.3361 0.3979 0.4675 -0.0490 -0.0483 -0.0283 312 ALA A N   
2261 C CA  . ALA A 345 ? 0.3357 0.3998 0.4524 -0.0513 -0.0538 -0.0310 312 ALA A CA  
2262 C C   . ALA A 345 ? 0.4388 0.5042 0.5388 -0.0671 -0.0732 -0.0105 312 ALA A C   
2263 O O   . ALA A 345 ? 0.4401 0.5085 0.5609 -0.0647 -0.0889 -0.0026 312 ALA A O   
2264 C CB  . ALA A 345 ? 0.3424 0.4066 0.4337 -0.0539 -0.0380 -0.0505 312 ALA A CB  
2265 N N   . ILE A 346 ? 0.4300 0.4944 0.4950 -0.0831 -0.0723 0.0005  313 ILE A N   
2266 C CA  . ILE A 346 ? 0.4655 0.5311 0.5006 -0.1001 -0.0932 0.0233  313 ILE A CA  
2267 C C   . ILE A 346 ? 0.5148 0.5799 0.5935 -0.0956 -0.1159 0.0511  313 ILE A C   
2268 O O   . ILE A 346 ? 0.5374 0.6067 0.6206 -0.1007 -0.1413 0.0660  313 ILE A O   
2269 C CB  . ILE A 346 ? 0.5495 0.6139 0.5283 -0.1179 -0.0802 0.0290  313 ILE A CB  
2270 C CG1 . ILE A 346 ? 0.5665 0.6310 0.5043 -0.1232 -0.0584 -0.0026 313 ILE A CG1 
2271 C CG2 . ILE A 346 ? 0.6130 0.6779 0.5549 -0.1356 -0.1041 0.0614  313 ILE A CG2 
2272 C CD1 . ILE A 346 ? 0.6384 0.7029 0.5583 -0.1273 -0.0723 -0.0203 313 ILE A CD1 
2273 N N   . LEU A 347 ? 0.4456 0.5058 0.5643 -0.0854 -0.1082 0.0559  314 LEU A N   
2274 C CA  . LEU A 347 ? 0.4383 0.4948 0.6105 -0.0788 -0.1258 0.0785  314 LEU A CA  
2275 C C   . LEU A 347 ? 0.4701 0.5300 0.6902 -0.0624 -0.1324 0.0684  314 LEU A C   
2276 O O   . LEU A 347 ? 0.4804 0.5408 0.7433 -0.0598 -0.1521 0.0893  314 LEU A O   
2277 C CB  . LEU A 347 ? 0.4296 0.4772 0.6341 -0.0741 -0.1147 0.0813  314 LEU A CB  
2278 C CG  . LEU A 347 ? 0.5317 0.5760 0.7094 -0.0918 -0.1115 0.1064  314 LEU A CG  
2279 C CD1 . LEU A 347 ? 0.5254 0.5636 0.7356 -0.0877 -0.0936 0.0975  314 LEU A CD1 
2280 C CD2 . LEU A 347 ? 0.5995 0.6400 0.7907 -0.1007 -0.1373 0.1488  314 LEU A CD2 
2281 N N   . CYS A 348 ? 0.3909 0.4539 0.6075 -0.0512 -0.1151 0.0393  315 CYS A N   
2282 C CA  . CYS A 348 ? 0.3645 0.4323 0.6206 -0.0364 -0.1144 0.0301  315 CYS A CA  
2283 C C   . CYS A 348 ? 0.4332 0.5102 0.6898 -0.0464 -0.1342 0.0429  315 CYS A C   
2284 O O   . CYS A 348 ? 0.4354 0.5186 0.7435 -0.0392 -0.1447 0.0521  315 CYS A O   
2285 C CB  . CYS A 348 ? 0.3465 0.4146 0.5905 -0.0242 -0.0910 0.0022  315 CYS A CB  
2286 S SG  . CYS A 348 ? 0.3840 0.4436 0.6414 -0.0085 -0.0753 -0.0161 315 CYS A SG  
2287 N N   . MET A 349 ? 0.4114 0.4899 0.6145 -0.0635 -0.1402 0.0425  316 MET A N   
2288 C CA  . MET A 349 ? 0.4386 0.5251 0.6345 -0.0766 -0.1645 0.0512  316 MET A CA  
2289 C C   . MET A 349 ? 0.5038 0.5931 0.7147 -0.0852 -0.1965 0.0851  316 MET A C   
2290 O O   . MET A 349 ? 0.5047 0.6037 0.7516 -0.0873 -0.2216 0.0977  316 MET A O   
2291 C CB  . MET A 349 ? 0.4998 0.5840 0.6281 -0.0930 -0.1610 0.0356  316 MET A CB  
2292 C CG  . MET A 349 ? 0.5251 0.6070 0.6510 -0.0854 -0.1362 0.0061  316 MET A CG  
2293 S SD  . MET A 349 ? 0.6273 0.7027 0.6796 -0.1032 -0.1267 -0.0152 316 MET A SD  
2294 C CE  . MET A 349 ? 0.5506 0.6198 0.6092 -0.0869 -0.0888 -0.0372 316 MET A CE  
2295 N N   . VAL A 350 ? 0.4746 0.5560 0.6639 -0.0906 -0.1965 0.1026  317 VAL A N   
2296 C CA  . VAL A 350 ? 0.5119 0.5933 0.7153 -0.0987 -0.2263 0.1416  317 VAL A CA  
2297 C C   . VAL A 350 ? 0.5266 0.6096 0.8230 -0.0809 -0.2347 0.1530  317 VAL A C   
2298 O O   . VAL A 350 ? 0.5395 0.6305 0.8740 -0.0836 -0.2664 0.1783  317 VAL A O   
2299 C CB  . VAL A 350 ? 0.5954 0.6666 0.7582 -0.1085 -0.2170 0.1586  317 VAL A CB  
2300 C CG1 . VAL A 350 ? 0.6256 0.6929 0.8241 -0.1115 -0.2434 0.2033  317 VAL A CG1 
2301 C CG2 . VAL A 350 ? 0.6382 0.7104 0.7081 -0.1287 -0.2125 0.1528  317 VAL A CG2 
2302 N N   . ALA A 351 ? 0.4310 0.5076 0.7644 -0.0624 -0.2063 0.1310  318 ALA A N   
2303 C CA  . ALA A 351 ? 0.4016 0.4778 0.8193 -0.0431 -0.2037 0.1304  318 ALA A CA  
2304 C C   . ALA A 351 ? 0.4671 0.5586 0.9277 -0.0373 -0.2119 0.1271  318 ALA A C   
2305 O O   . ALA A 351 ? 0.4741 0.5706 1.0084 -0.0295 -0.2270 0.1445  318 ALA A O   
2306 C CB  . ALA A 351 ? 0.3746 0.4418 0.7991 -0.0270 -0.1704 0.0985  318 ALA A CB  
2307 N N   . TYR A 352 ? 0.4253 0.5241 0.8490 -0.0410 -0.2008 0.1057  319 TYR A N   
2308 C CA  . TYR A 352 ? 0.4185 0.5325 0.8838 -0.0382 -0.2056 0.1018  319 TYR A CA  
2309 C C   . TYR A 352 ? 0.5053 0.6309 0.9958 -0.0519 -0.2493 0.1318  319 TYR A C   
2310 O O   . TYR A 352 ? 0.4885 0.6269 1.0592 -0.0440 -0.2599 0.1419  319 TYR A O   
2311 C CB  . TYR A 352 ? 0.4230 0.5385 0.8405 -0.0430 -0.1878 0.0764  319 TYR A CB  
2312 C CG  . TYR A 352 ? 0.4295 0.5590 0.9004 -0.0377 -0.1831 0.0705  319 TYR A CG  
2313 C CD1 . TYR A 352 ? 0.4745 0.6158 0.9571 -0.0533 -0.2121 0.0789  319 TYR A CD1 
2314 C CD2 . TYR A 352 ? 0.4123 0.5436 0.9209 -0.0182 -0.1490 0.0562  319 TYR A CD2 
2315 C CE1 . TYR A 352 ? 0.4696 0.6247 1.0119 -0.0499 -0.2067 0.0746  319 TYR A CE1 
2316 C CE2 . TYR A 352 ? 0.4180 0.5630 0.9784 -0.0141 -0.1393 0.0541  319 TYR A CE2 
2317 C CZ  . TYR A 352 ? 0.5533 0.7106 1.1361 -0.0302 -0.1677 0.0639  319 TYR A CZ  
2318 O OH  . TYR A 352 ? 0.6005 0.7722 1.2452 -0.0275 -0.1573 0.0629  319 TYR A OH  
2319 N N   . LEU A 353 ? 0.5081 0.6299 0.9318 -0.0722 -0.2748 0.1472  320 LEU A N   
2320 C CA  . LEU A 353 ? 0.5483 0.6802 0.9780 -0.0878 -0.3230 0.1788  320 LEU A CA  
2321 C C   . LEU A 353 ? 0.6170 0.7502 1.1262 -0.0780 -0.3430 0.2133  320 LEU A C   
2322 O O   . LEU A 353 ? 0.6389 0.7842 1.1855 -0.0852 -0.3853 0.2426  320 LEU A O   
2323 C CB  . LEU A 353 ? 0.5960 0.7207 0.9223 -0.1107 -0.3390 0.1872  320 LEU A CB  
2324 C CG  . LEU A 353 ? 0.6529 0.7763 0.9036 -0.1237 -0.3276 0.1547  320 LEU A CG  
2325 C CD1 . LEU A 353 ? 0.7033 0.8169 0.8536 -0.1418 -0.3287 0.1598  320 LEU A CD1 
2326 C CD2 . LEU A 353 ? 0.6992 0.8370 0.9687 -0.1345 -0.3597 0.1501  320 LEU A CD2 
2327 N N   . GLY A 354 ? 0.5690 0.6892 1.1083 -0.0614 -0.3141 0.2080  321 GLY A N   
2328 C CA  . GLY A 354 ? 0.5812 0.6977 1.2072 -0.0484 -0.3239 0.2328  321 GLY A CA  
2329 C C   . GLY A 354 ? 0.6136 0.7397 1.3381 -0.0265 -0.3051 0.2157  321 GLY A C   
2330 O O   . GLY A 354 ? 0.6086 0.7250 1.3950 -0.0088 -0.2869 0.2116  321 GLY A O   
2331 N N   . LEU A 355 ? 0.5432 0.6878 1.2841 -0.0280 -0.3064 0.2035  322 LEU A N   
2332 C CA  . LEU A 355 ? 0.5040 0.6624 1.3375 -0.0097 -0.2852 0.1892  322 LEU A CA  
2333 C C   . LEU A 355 ? 0.5619 0.7455 1.4501 -0.0189 -0.3194 0.2060  322 LEU A C   
2334 O O   . LEU A 355 ? 0.5305 0.7303 1.5113 -0.0058 -0.3058 0.2009  322 LEU A O   
2335 C CB  . LEU A 355 ? 0.4670 0.6208 1.2641 0.0009  -0.2341 0.1481  322 LEU A CB  
2336 C CG  . LEU A 355 ? 0.5051 0.6380 1.2720 0.0144  -0.1995 0.1262  322 LEU A CG  
2337 C CD1 . LEU A 355 ? 0.4829 0.6114 1.1796 0.0163  -0.1647 0.0939  322 LEU A CD1 
2338 C CD2 . LEU A 355 ? 0.5286 0.6597 1.3866 0.0371  -0.1792 0.1195  322 LEU A CD2 
2339 N N   . GLY A 356 ? 0.5560 0.7433 1.3873 -0.0420 -0.3630 0.2248  323 GLY A N   
2340 C CA  . GLY A 356 ? 1.0204 1.2305 1.8914 -0.0553 -0.4055 0.2396  323 GLY A CA  
2341 C C   . GLY A 356 ? 1.4865 1.7095 2.4520 -0.0526 -0.4502 0.2806  323 GLY A C   
2342 O O   . GLY A 356 ? 1.0387 1.2737 2.1209 -0.0339 -0.4375 0.2835  323 GLY A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -32 ?   ?   ?   A . n 
A 1 2   GLY 2   -31 ?   ?   ?   A . n 
A 1 3   THR 3   -30 ?   ?   ?   A . n 
A 1 4   SER 4   -29 ?   ?   ?   A . n 
A 1 5   ARG 5   -28 ?   ?   ?   A . n 
A 1 6   ASP 6   -27 ?   ?   ?   A . n 
A 1 7   HIS 7   -26 ?   ?   ?   A . n 
A 1 8   MET 8   -25 ?   ?   ?   A . n 
A 1 9   VAL 9   -24 ?   ?   ?   A . n 
A 1 10  LEU 10  -23 ?   ?   ?   A . n 
A 1 11  HIS 11  -22 ?   ?   ?   A . n 
A 1 12  GLU 12  -21 ?   ?   ?   A . n 
A 1 13  TYR 13  -20 ?   ?   ?   A . n 
A 1 14  VAL 14  -19 ?   ?   ?   A . n 
A 1 15  ASN 15  -18 ?   ?   ?   A . n 
A 1 16  ALA 16  -17 ?   ?   ?   A . n 
A 1 17  ALA 17  -16 ?   ?   ?   A . n 
A 1 18  GLY 18  -15 ?   ?   ?   A . n 
A 1 19  ILE 19  -14 ?   ?   ?   A . n 
A 1 20  THR 20  -13 ?   ?   ?   A . n 
A 1 21  GLY 21  -12 ?   ?   ?   A . n 
A 1 22  GLY 22  -11 ?   ?   ?   A . n 
A 1 23  SER 23  -10 ?   ?   ?   A . n 
A 1 24  GLY 24  -9  ?   ?   ?   A . n 
A 1 25  GLY 25  -8  ?   ?   ?   A . n 
A 1 26  SER 26  -7  ?   ?   ?   A . n 
A 1 27  GLU 27  -6  -6  GLU GLU A . n 
A 1 28  ASN 28  -5  -5  ASN ASN A . n 
A 1 29  LEU 29  -4  -4  LEU LEU A . n 
A 1 30  TYR 30  -3  -3  TYR TYR A . n 
A 1 31  PHE 31  -2  -2  PHE PHE A . n 
A 1 32  GLN 32  -1  -1  GLN GLN A . n 
A 1 33  SER 33  0   0   SER SER A . n 
A 1 34  MET 34  1   1   MET MET A . n 
A 1 35  ILE 35  2   2   ILE ILE A . n 
A 1 36  HIS 36  3   3   HIS HIS A . n 
A 1 37  GLU 37  4   4   GLU GLU A . n 
A 1 38  THR 38  5   5   THR THR A . n 
A 1 39  ILE 39  6   6   ILE ILE A . n 
A 1 40  LEU 40  7   7   LEU LEU A . n 
A 1 41  ALA 41  8   8   ALA ALA A . n 
A 1 42  ILE 42  9   9   ILE ILE A . n 
A 1 43  ILE 43  10  10  ILE ILE A . n 
A 1 44  ILE 44  11  11  ILE ILE A . n 
A 1 45  ALA 45  12  12  ALA ALA A . n 
A 1 46  PHE 46  13  13  PHE PHE A . n 
A 1 47  ALA 47  14  14  ALA ALA A . n 
A 1 48  ILE 48  15  15  ILE ILE A . n 
A 1 49  SER 49  16  16  SER SER A . n 
A 1 50  ALA 50  17  17  ALA ALA A . n 
A 1 51  LEU 51  18  18  LEU LEU A . n 
A 1 52  LEU 52  19  19  LEU LEU A . n 
A 1 53  CYS 53  20  20  CYS CYS A . n 
A 1 54  PRO 54  21  21  PRO PRO A . n 
A 1 55  ILE 55  22  22  ILE ILE A . n 
A 1 56  ILE 56  23  23  ILE ILE A . n 
A 1 57  ILE 57  24  24  ILE ILE A . n 
A 1 58  PRO 58  25  25  PRO PRO A . n 
A 1 59  PHE 59  26  26  PHE PHE A . n 
A 1 60  LEU 60  27  27  LEU LEU A . n 
A 1 61  HIS 61  28  28  HIS HIS A . n 
A 1 62  LYS 62  29  29  LYS LYS A . n 
A 1 63  LEU 63  30  30  LEU LEU A . n 
A 1 64  LYS 64  31  31  LYS LYS A . n 
A 1 65  PHE 65  32  32  PHE PHE A . n 
A 1 66  GLY 66  33  ?   ?   ?   A . n 
A 1 67  GLN 67  34  ?   ?   ?   A . n 
A 1 68  GLN 68  35  ?   ?   ?   A . n 
A 1 69  VAL 69  36  ?   ?   ?   A . n 
A 1 70  ARG 70  37  ?   ?   ?   A . n 
A 1 71  ASP 71  38  ?   ?   ?   A . n 
A 1 72  ASP 72  39  ?   ?   ?   A . n 
A 1 73  GLY 73  40  ?   ?   ?   A . n 
A 1 74  PRO 74  41  ?   ?   ?   A . n 
A 1 75  GLU 75  42  ?   ?   ?   A . n 
A 1 76  SER 76  43  ?   ?   ?   A . n 
A 1 77  HIS 77  44  ?   ?   ?   A . n 
A 1 78  LEU 78  45  ?   ?   ?   A . n 
A 1 79  LYS 79  46  ?   ?   ?   A . n 
A 1 80  LYS 80  47  ?   ?   ?   A . n 
A 1 81  GLN 81  48  ?   ?   ?   A . n 
A 1 82  GLY 82  49  49  GLY GLY A . n 
A 1 83  THR 83  50  50  THR THR A . n 
A 1 84  PRO 84  51  51  PRO PRO A . n 
A 1 85  THR 85  52  52  THR THR A . n 
A 1 86  MET 86  53  53  MET MET A . n 
A 1 87  GLY 87  54  54  GLY GLY A . n 
A 1 88  GLY 88  55  55  GLY GLY A . n 
A 1 89  LEU 89  56  56  LEU LEU A . n 
A 1 90  ILE 90  57  57  ILE ILE A . n 
A 1 91  ILE 91  58  58  ILE ILE A . n 
A 1 92  LEU 92  59  59  LEU LEU A . n 
A 1 93  SER 93  60  60  SER SER A . n 
A 1 94  SER 94  61  61  SER SER A . n 
A 1 95  ILE 95  62  62  ILE ILE A . n 
A 1 96  ILE 96  63  63  ILE ILE A . n 
A 1 97  ILE 97  64  64  ILE ILE A . n 
A 1 98  THR 98  65  65  THR THR A . n 
A 1 99  SER 99  66  66  SER SER A . n 
A 1 100 VAL 100 67  67  VAL VAL A . n 
A 1 101 PHE 101 68  68  PHE PHE A . n 
A 1 102 TYR 102 69  69  TYR TYR A . n 
A 1 103 ILE 103 70  70  ILE ILE A . n 
A 1 104 PRO 104 71  71  PRO PRO A . n 
A 1 105 SER 105 72  72  SER SER A . n 
A 1 106 TYR 106 73  73  TYR TYR A . n 
A 1 107 PRO 107 74  74  PRO PRO A . n 
A 1 108 LYS 108 75  75  LYS LYS A . n 
A 1 109 ILE 109 76  76  ILE ILE A . n 
A 1 110 ILE 110 77  77  ILE ILE A . n 
A 1 111 PRO 111 78  78  PRO PRO A . n 
A 1 112 VAL 112 79  79  VAL VAL A . n 
A 1 113 LEU 113 80  80  LEU LEU A . n 
A 1 114 PHE 114 81  81  PHE PHE A . n 
A 1 115 VAL 115 82  82  VAL VAL A . n 
A 1 116 THR 116 83  83  THR THR A . n 
A 1 117 VAL 117 84  84  VAL VAL A . n 
A 1 118 GLY 118 85  85  GLY GLY A . n 
A 1 119 PHE 119 86  86  PHE PHE A . n 
A 1 120 GLY 120 87  87  GLY GLY A . n 
A 1 121 ILE 121 88  88  ILE ILE A . n 
A 1 122 ILE 122 89  89  ILE ILE A . n 
A 1 123 GLY 123 90  90  GLY GLY A . n 
A 1 124 PHE 124 91  91  PHE PHE A . n 
A 1 125 LEU 125 92  92  LEU LEU A . n 
A 1 126 ASP 126 93  93  ASP ASP A . n 
A 1 127 ASP 127 94  94  ASP ASP A . n 
A 1 128 TYR 128 95  95  TYR TYR A . n 
A 1 129 ILE 129 96  96  ILE ILE A . n 
A 1 130 LYS 130 97  97  LYS LYS A . n 
A 1 131 ILE 131 98  98  ILE ILE A . n 
A 1 132 VAL 132 99  99  VAL VAL A . n 
A 1 133 MET 133 100 ?   ?   ?   A . n 
A 1 134 LYS 134 101 ?   ?   ?   A . n 
A 1 135 ARG 135 102 ?   ?   ?   A . n 
A 1 136 SER 136 103 ?   ?   ?   A . n 
A 1 137 GLU 137 104 ?   ?   ?   A . n 
A 1 138 GLY 138 105 ?   ?   ?   A . n 
A 1 139 LEU 139 106 ?   ?   ?   A . n 
A 1 140 LYS 140 107 107 LYS LYS A . n 
A 1 141 PRO 141 108 108 PRO PRO A . n 
A 1 142 MET 142 109 109 MET MET A . n 
A 1 143 GLN 143 110 110 GLN GLN A . n 
A 1 144 LYS 144 111 111 LYS LYS A . n 
A 1 145 LEU 145 112 112 LEU LEU A . n 
A 1 146 VAL 146 113 113 VAL VAL A . n 
A 1 147 GLY 147 114 114 GLY GLY A . n 
A 1 148 GLN 148 115 115 GLN GLN A . n 
A 1 149 PHE 149 116 116 PHE PHE A . n 
A 1 150 ILE 150 117 117 ILE ILE A . n 
A 1 151 ILE 151 118 118 ILE ILE A . n 
A 1 152 THR 152 119 119 THR THR A . n 
A 1 153 GLY 153 120 120 GLY GLY A . n 
A 1 154 ILE 154 121 121 ILE ILE A . n 
A 1 155 PHE 155 122 122 PHE PHE A . n 
A 1 156 ALA 156 123 123 ALA ALA A . n 
A 1 157 TRP 157 124 124 TRP TRP A . n 
A 1 158 TYR 158 125 125 TYR TYR A . n 
A 1 159 LEU 159 126 126 LEU LEU A . n 
A 1 160 LEU 160 127 127 LEU LEU A . n 
A 1 161 ASN 161 128 128 ASN ASN A . n 
A 1 162 SER 162 129 129 SER SER A . n 
A 1 163 GLY 163 130 130 GLY GLY A . n 
A 1 164 GLU 164 131 131 GLU GLU A . n 
A 1 165 VAL 165 132 132 VAL VAL A . n 
A 1 166 GLY 166 133 133 GLY GLY A . n 
A 1 167 THR 167 134 134 THR THR A . n 
A 1 168 ASP 168 135 135 ASP ASP A . n 
A 1 169 MET 169 136 136 MET MET A . n 
A 1 170 LEU 170 137 137 LEU LEU A . n 
A 1 171 ILE 171 138 138 ILE ILE A . n 
A 1 172 PRO 172 139 139 PRO PRO A . n 
A 1 173 PHE 173 140 140 PHE PHE A . n 
A 1 174 THR 174 141 141 THR THR A . n 
A 1 175 GLY 175 142 142 GLY GLY A . n 
A 1 176 GLY 176 143 143 GLY GLY A . n 
A 1 177 PHE 177 144 144 PHE PHE A . n 
A 1 178 ASP 178 145 145 ASP ASP A . n 
A 1 179 GLY 179 146 146 GLY GLY A . n 
A 1 180 GLY 180 147 147 GLY GLY A . n 
A 1 181 SER 181 148 148 SER SER A . n 
A 1 182 PHE 182 149 149 PHE PHE A . n 
A 1 183 LEU 183 150 150 LEU LEU A . n 
A 1 184 SER 184 151 151 SER SER A . n 
A 1 185 LEU 185 152 152 LEU LEU A . n 
A 1 186 GLY 186 153 153 GLY GLY A . n 
A 1 187 ILE 187 154 154 ILE ILE A . n 
A 1 188 PHE 188 155 155 PHE PHE A . n 
A 1 189 PHE 189 156 156 PHE PHE A . n 
A 1 190 VAL 190 157 157 VAL VAL A . n 
A 1 191 PRO 191 158 158 PRO PRO A . n 
A 1 192 ALA 192 159 159 ALA ALA A . n 
A 1 193 LEU 193 160 160 LEU LEU A . n 
A 1 194 PHE 194 161 161 PHE PHE A . n 
A 1 195 PHE 195 162 162 PHE PHE A . n 
A 1 196 ILE 196 163 163 ILE ILE A . n 
A 1 197 MET 197 164 164 MET MET A . n 
A 1 198 LEU 198 165 165 LEU LEU A . n 
A 1 199 GLY 199 166 166 GLY GLY A . n 
A 1 200 THR 200 167 167 THR THR A . n 
A 1 201 ASP 201 168 168 ASP ASP A . n 
A 1 202 ASN 202 169 169 ASN ASN A . n 
A 1 203 GLY 203 170 170 GLY GLY A . n 
A 1 204 VAL 204 171 171 VAL VAL A . n 
A 1 205 ASN 205 172 172 ASN ASN A . n 
A 1 206 PHE 206 173 173 PHE PHE A . n 
A 1 207 THR 207 174 174 THR THR A . n 
A 1 208 ASP 208 175 175 ASP ASP A . n 
A 1 209 GLY 209 176 176 GLY GLY A . n 
A 1 210 LEU 210 177 177 LEU LEU A . n 
A 1 211 ASP 211 178 178 ASP ASP A . n 
A 1 212 GLY 212 179 179 GLY GLY A . n 
A 1 213 LEU 213 180 180 LEU LEU A . n 
A 1 214 CYS 214 181 181 CYS CYS A . n 
A 1 215 THR 215 182 182 THR THR A . n 
A 1 216 SER 216 183 183 SER SER A . n 
A 1 217 VAL 217 184 184 VAL VAL A . n 
A 1 218 THR 218 185 185 THR THR A . n 
A 1 219 ILE 219 186 186 ILE ILE A . n 
A 1 220 LEU 220 187 187 LEU LEU A . n 
A 1 221 VAL 221 188 188 VAL VAL A . n 
A 1 222 ALA 222 189 189 ALA ALA A . n 
A 1 223 THR 223 190 190 THR THR A . n 
A 1 224 PHE 224 191 191 PHE PHE A . n 
A 1 225 LEU 225 192 192 LEU LEU A . n 
A 1 226 THR 226 193 193 THR THR A . n 
A 1 227 ILE 227 194 194 ILE ILE A . n 
A 1 228 VAL 228 195 195 VAL VAL A . n 
A 1 229 ALA 229 196 196 ALA ALA A . n 
A 1 230 ILE 230 197 197 ILE ILE A . n 
A 1 231 GLY 231 198 198 GLY GLY A . n 
A 1 232 GLU 232 199 199 GLU GLU A . n 
A 1 233 ASP 233 200 200 ASP ASP A . n 
A 1 234 MET 234 201 201 MET MET A . n 
A 1 235 GLY 235 202 202 GLY GLY A . n 
A 1 236 ILE 236 203 203 ILE ILE A . n 
A 1 237 SER 237 204 204 SER SER A . n 
A 1 238 PRO 238 205 205 PRO PRO A . n 
A 1 239 ILE 239 206 206 ILE ILE A . n 
A 1 240 THR 240 207 207 THR THR A . n 
A 1 241 GLY 241 208 208 GLY GLY A . n 
A 1 242 ALA 242 209 209 ALA ALA A . n 
A 1 243 VAL 243 210 210 VAL VAL A . n 
A 1 244 VAL 244 211 211 VAL VAL A . n 
A 1 245 GLY 245 212 212 GLY GLY A . n 
A 1 246 SER 246 213 213 SER SER A . n 
A 1 247 LEU 247 214 214 LEU LEU A . n 
A 1 248 LEU 248 215 215 LEU LEU A . n 
A 1 249 GLY 249 216 216 GLY GLY A . n 
A 1 250 PHE 250 217 217 PHE PHE A . n 
A 1 251 LEU 251 218 218 LEU LEU A . n 
A 1 252 LEU 252 219 219 LEU LEU A . n 
A 1 253 PHE 253 220 220 PHE PHE A . n 
A 1 254 ASN 254 221 221 ASN ASN A . n 
A 1 255 VAL 255 222 222 VAL VAL A . n 
A 1 256 TYR 256 223 223 TYR TYR A . n 
A 1 257 PRO 257 224 224 PRO PRO A . n 
A 1 258 ALA 258 225 225 ALA ALA A . n 
A 1 259 LYS 259 226 226 LYS LYS A . n 
A 1 260 VAL 260 227 227 VAL VAL A . n 
A 1 261 PHE 261 228 228 PHE PHE A . n 
A 1 262 MET 262 229 229 MET MET A . n 
A 1 263 GLY 263 230 230 GLY GLY A . n 
A 1 264 ASP 264 231 231 ASP ASP A . n 
A 1 265 THR 265 232 232 THR THR A . n 
A 1 266 GLY 266 233 233 GLY GLY A . n 
A 1 267 SER 267 234 234 SER SER A . n 
A 1 268 LEU 268 235 235 LEU LEU A . n 
A 1 269 ALA 269 236 236 ALA ALA A . n 
A 1 270 LEU 270 237 237 LEU LEU A . n 
A 1 271 GLY 271 238 238 GLY GLY A . n 
A 1 272 GLY 272 239 239 GLY GLY A . n 
A 1 273 PHE 273 240 240 PHE PHE A . n 
A 1 274 VAL 274 241 241 VAL VAL A . n 
A 1 275 ALA 275 242 242 ALA ALA A . n 
A 1 276 ALA 276 243 243 ALA ALA A . n 
A 1 277 SER 277 244 244 SER SER A . n 
A 1 278 CYS 278 245 245 CYS CYS A . n 
A 1 279 TYR 279 246 246 TYR TYR A . n 
A 1 280 MET 280 247 247 MET MET A . n 
A 1 281 MET 281 248 248 MET MET A . n 
A 1 282 ARG 282 249 249 ARG ARG A . n 
A 1 283 MET 283 250 250 MET MET A . n 
A 1 284 PRO 284 251 251 PRO PRO A . n 
A 1 285 LEU 285 252 252 LEU LEU A . n 
A 1 286 PHE 286 253 253 PHE PHE A . n 
A 1 287 ILE 287 254 254 ILE ILE A . n 
A 1 288 PRO 288 255 255 PRO PRO A . n 
A 1 289 VAL 289 256 256 VAL VAL A . n 
A 1 290 ILE 290 257 257 ILE ILE A . n 
A 1 291 GLY 291 258 258 GLY GLY A . n 
A 1 292 LEU 292 259 259 LEU LEU A . n 
A 1 293 ILE 293 260 260 ILE ILE A . n 
A 1 294 TYR 294 261 261 TYR TYR A . n 
A 1 295 LEU 295 262 262 LEU LEU A . n 
A 1 296 VAL 296 263 263 VAL VAL A . n 
A 1 297 GLU 297 264 264 GLU GLU A . n 
A 1 298 VAL 298 265 265 VAL VAL A . n 
A 1 299 LEU 299 266 266 LEU LEU A . n 
A 1 300 SER 300 267 267 SER SER A . n 
A 1 301 VAL 301 268 268 VAL VAL A . n 
A 1 302 ILE 302 269 269 ILE ILE A . n 
A 1 303 ILE 303 270 270 ILE ILE A . n 
A 1 304 GLN 304 271 271 GLN GLN A . n 
A 1 305 VAL 305 272 272 VAL VAL A . n 
A 1 306 THR 306 273 273 THR THR A . n 
A 1 307 TYR 307 274 274 TYR TYR A . n 
A 1 308 PHE 308 275 275 PHE PHE A . n 
A 1 309 LYS 309 276 276 LYS LYS A . n 
A 1 310 ARG 310 277 277 ARG ARG A . n 
A 1 311 THR 311 278 278 THR THR A . n 
A 1 312 GLY 312 279 279 GLY GLY A . n 
A 1 313 GLY 313 280 280 GLY GLY A . n 
A 1 314 LYS 314 281 281 LYS LYS A . n 
A 1 315 ARG 315 282 282 ARG ARG A . n 
A 1 316 ILE 316 283 283 ILE ILE A . n 
A 1 317 PHE 317 284 284 PHE PHE A . n 
A 1 318 LYS 318 285 285 LYS LYS A . n 
A 1 319 MET 319 286 286 MET MET A . n 
A 1 320 ALA 320 287 287 ALA ALA A . n 
A 1 321 PRO 321 288 288 PRO PRO A . n 
A 1 322 ILE 322 289 289 ILE ILE A . n 
A 1 323 HIS 323 290 290 HIS HIS A . n 
A 1 324 HIS 324 291 291 HIS HIS A . n 
A 1 325 HIS 325 292 292 HIS HIS A . n 
A 1 326 PHE 326 293 293 PHE PHE A . n 
A 1 327 GLU 327 294 294 GLU GLU A . n 
A 1 328 LEU 328 295 295 LEU LEU A . n 
A 1 329 CYS 329 296 296 CYS CYS A . n 
A 1 330 GLY 330 297 297 GLY GLY A . n 
A 1 331 TRP 331 298 298 TRP TRP A . n 
A 1 332 SER 332 299 299 SER SER A . n 
A 1 333 GLU 333 300 300 GLU GLU A . n 
A 1 334 THR 334 301 301 THR THR A . n 
A 1 335 ARG 335 302 302 ARG ARG A . n 
A 1 336 VAL 336 303 303 VAL VAL A . n 
A 1 337 VAL 337 304 304 VAL VAL A . n 
A 1 338 ALA 338 305 305 ALA ALA A . n 
A 1 339 VAL 339 306 306 VAL VAL A . n 
A 1 340 PHE 340 307 307 PHE PHE A . n 
A 1 341 ALA 341 308 308 ALA ALA A . n 
A 1 342 ILE 342 309 309 ILE ILE A . n 
A 1 343 VAL 343 310 310 VAL VAL A . n 
A 1 344 THR 344 311 311 THR THR A . n 
A 1 345 ALA 345 312 312 ALA ALA A . n 
A 1 346 ILE 346 313 313 ILE ILE A . n 
A 1 347 LEU 347 314 314 LEU LEU A . n 
A 1 348 CYS 348 315 315 CYS CYS A . n 
A 1 349 MET 349 316 316 MET MET A . n 
A 1 350 VAL 350 317 317 VAL VAL A . n 
A 1 351 ALA 351 318 318 ALA ALA A . n 
A 1 352 TYR 352 319 319 TYR TYR A . n 
A 1 353 LEU 353 320 320 LEU LEU A . n 
A 1 354 GLY 354 321 321 GLY GLY A . n 
A 1 355 LEU 355 322 322 LEU LEU A . n 
A 1 356 GLY 356 323 323 GLY GLY A . n 
A 1 357 SER 357 324 ?   ?   ?   A . n 
A 1 358 GLY 358 325 ?   ?   ?   A . n 
A 1 359 SER 359 326 ?   ?   ?   A . n 
A 1 360 GLU 360 327 ?   ?   ?   A . n 
A 1 361 ASN 361 328 ?   ?   ?   A . n 
A 1 362 LEU 362 329 ?   ?   ?   A . n 
A 1 363 TYR 363 330 ?   ?   ?   A . n 
A 1 364 PHE 364 331 ?   ?   ?   A . n 
A 1 365 GLN 365 332 ?   ?   ?   A . n 
A 1 366 SER 366 333 ?   ?   ?   A . n 
A 1 367 HIS 367 334 ?   ?   ?   A . n 
A 1 368 HIS 368 335 ?   ?   ?   A . n 
A 1 369 HIS 369 336 ?   ?   ?   A . n 
A 1 370 HIS 370 337 ?   ?   ?   A . n 
A 1 371 HIS 371 338 ?   ?   ?   A . n 
A 1 372 HIS 372 339 ?   ?   ?   A . n 
A 1 373 HIS 373 340 ?   ?   ?   A . n 
A 1 374 HIS 374 341 ?   ?   ?   A . n 
A 1 375 HIS 375 342 ?   ?   ?   A . n 
A 1 376 HIS 376 343 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 TUM 1 401 1 TUM LIG A . 
C 3 PLM 1 402 1 PLM PLM A . 
D 3 PLM 1 403 2 PLM PLM A . 
E 4 BOG 1 404 1 BOG BOG A . 
F 5 HOH 1 501 1 HOH HOH A . 
F 5 HOH 2 502 2 HOH HOH A . 
F 5 HOH 3 503 3 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F 
1 2 A,B,C,D,E,F 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_589 x,-y+3,-z+4 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 316.6200000000 0.0000000000 0.0000000000 -1.0000000000 539.8400000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-01-11 
2 'Structure model' 1 1 2017-01-18 
3 'Structure model' 1 2 2017-02-22 
4 'Structure model' 1 3 2019-02-20 
5 'Structure model' 1 4 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Database references'  
3 4 'Structure model' Advisory               
4 4 'Structure model' 'Data collection'      
5 4 'Structure model' 'Derived calculations' 
6 5 'Structure model' 'Data collection'      
7 5 'Structure model' 'Derived calculations' 
8 5 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' pdbx_data_processing_status 
2  4 'Structure model' pdbx_validate_symm_contact  
3  4 'Structure model' struct_conn                 
4  4 'Structure model' struct_conn_type            
5  5 'Structure model' chem_comp                   
6  5 'Structure model' entity                      
7  5 'Structure model' pdbx_chem_comp_identifier   
8  5 'Structure model' pdbx_entity_nonpoly         
9  5 'Structure model' struct_site                 
10 5 'Structure model' struct_site_gen             
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_chem_comp.mon_nstd_flag'  
2 5 'Structure model' '_chem_comp.name'           
3 5 'Structure model' '_chem_comp.type'           
4 5 'Structure model' '_entity.pdbx_description'  
5 5 'Structure model' '_pdbx_entity_nonpoly.name' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         166.1930 
_pdbx_refine_tls.origin_y         144.8100 
_pdbx_refine_tls.origin_z         261.7380 
_pdbx_refine_tls.T[1][1]          -0.5380 
_pdbx_refine_tls.T[2][2]          -0.5348 
_pdbx_refine_tls.T[3][3]          -0.2823 
_pdbx_refine_tls.T[1][2]          0.0920 
_pdbx_refine_tls.T[1][3]          -0.0660 
_pdbx_refine_tls.T[2][3]          -0.2439 
_pdbx_refine_tls.L[1][1]          6.4388 
_pdbx_refine_tls.L[2][2]          6.4955 
_pdbx_refine_tls.L[3][3]          1.5281 
_pdbx_refine_tls.L[1][2]          0.3840 
_pdbx_refine_tls.L[1][3]          -0.0296 
_pdbx_refine_tls.L[2][3]          -0.3295 
_pdbx_refine_tls.S[1][1]          0.2890 
_pdbx_refine_tls.S[1][2]          0.7642 
_pdbx_refine_tls.S[1][3]          -1.2990 
_pdbx_refine_tls.S[2][1]          -0.8277 
_pdbx_refine_tls.S[2][2]          -0.2928 
_pdbx_refine_tls.S[2][3]          -0.0677 
_pdbx_refine_tls.S[3][1]          0.3075 
_pdbx_refine_tls.S[3][2]          -0.0296 
_pdbx_refine_tls.S[3][3]          0.0038 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   '{ A|* }' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER  ? ? ? 2.11.6 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM  ? ? ? .      2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .      3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .      4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NH1 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ARG 
_pdbx_validate_symm_contact.auth_seq_id_1     249 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    GLY 
_pdbx_validate_symm_contact.auth_seq_id_2     279 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   8_579 
_pdbx_validate_symm_contact.dist              1.37 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 139 ? ? -50.12  -76.84  
2 1 ASP A 231 ? ? 74.89   -60.60  
3 1 THR A 278 ? ? -106.62 -168.79 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 MET A 229 ? ? GLY A 230 ? ? -125.12 
2 1 GLY A 230 ? ? ASP A 231 ? ? -59.23  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 N 1 A TUM 401 ? C1  ? B TUM 1 C1  
2  1 N 1 A TUM 401 ? C2  ? B TUM 1 C2  
3  1 N 1 A TUM 401 ? C3  ? B TUM 1 C3  
4  1 N 1 A TUM 401 ? C6  ? B TUM 1 C6  
5  1 N 1 A TUM 401 ? C7  ? B TUM 1 C7  
6  1 N 1 A TUM 401 ? C10 ? B TUM 1 C10 
7  1 N 1 A TUM 401 ? C12 ? B TUM 1 C12 
8  1 N 1 A TUM 401 ? C16 ? B TUM 1 C16 
9  1 N 1 A TUM 401 ? C18 ? B TUM 1 C18 
10 1 N 1 A TUM 401 ? C21 ? B TUM 1 C21 
11 1 N 1 A TUM 401 ? C23 ? B TUM 1 C23 
12 1 N 1 A TUM 401 ? C24 ? B TUM 1 C24 
13 1 N 1 A PLM 402 ? C1  ? C PLM 1 C1  
14 1 N 1 A PLM 402 ? O1  ? C PLM 1 O1  
15 1 N 1 A PLM 402 ? O2  ? C PLM 1 O2  
16 1 N 1 A PLM 403 ? C1  ? D PLM 1 C1  
17 1 N 1 A PLM 403 ? O1  ? D PLM 1 O1  
18 1 N 1 A PLM 403 ? O2  ? D PLM 1 O2  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -32 ? A MET 1   
2  1 Y 1 A GLY -31 ? A GLY 2   
3  1 Y 1 A THR -30 ? A THR 3   
4  1 Y 1 A SER -29 ? A SER 4   
5  1 Y 1 A ARG -28 ? A ARG 5   
6  1 Y 1 A ASP -27 ? A ASP 6   
7  1 Y 1 A HIS -26 ? A HIS 7   
8  1 Y 1 A MET -25 ? A MET 8   
9  1 Y 1 A VAL -24 ? A VAL 9   
10 1 Y 1 A LEU -23 ? A LEU 10  
11 1 Y 1 A HIS -22 ? A HIS 11  
12 1 Y 1 A GLU -21 ? A GLU 12  
13 1 Y 1 A TYR -20 ? A TYR 13  
14 1 Y 1 A VAL -19 ? A VAL 14  
15 1 Y 1 A ASN -18 ? A ASN 15  
16 1 Y 1 A ALA -17 ? A ALA 16  
17 1 Y 1 A ALA -16 ? A ALA 17  
18 1 Y 1 A GLY -15 ? A GLY 18  
19 1 Y 1 A ILE -14 ? A ILE 19  
20 1 Y 1 A THR -13 ? A THR 20  
21 1 Y 1 A GLY -12 ? A GLY 21  
22 1 Y 1 A GLY -11 ? A GLY 22  
23 1 Y 1 A SER -10 ? A SER 23  
24 1 Y 1 A GLY -9  ? A GLY 24  
25 1 Y 1 A GLY -8  ? A GLY 25  
26 1 Y 1 A SER -7  ? A SER 26  
27 1 Y 1 A GLY 33  ? A GLY 66  
28 1 Y 1 A GLN 34  ? A GLN 67  
29 1 Y 1 A GLN 35  ? A GLN 68  
30 1 Y 1 A VAL 36  ? A VAL 69  
31 1 Y 1 A ARG 37  ? A ARG 70  
32 1 Y 1 A ASP 38  ? A ASP 71  
33 1 Y 1 A ASP 39  ? A ASP 72  
34 1 Y 1 A GLY 40  ? A GLY 73  
35 1 Y 1 A PRO 41  ? A PRO 74  
36 1 Y 1 A GLU 42  ? A GLU 75  
37 1 Y 1 A SER 43  ? A SER 76  
38 1 Y 1 A HIS 44  ? A HIS 77  
39 1 Y 1 A LEU 45  ? A LEU 78  
40 1 Y 1 A LYS 46  ? A LYS 79  
41 1 Y 1 A LYS 47  ? A LYS 80  
42 1 Y 1 A GLN 48  ? A GLN 81  
43 1 Y 1 A MET 100 ? A MET 133 
44 1 Y 1 A LYS 101 ? A LYS 134 
45 1 Y 1 A ARG 102 ? A ARG 135 
46 1 Y 1 A SER 103 ? A SER 136 
47 1 Y 1 A GLU 104 ? A GLU 137 
48 1 Y 1 A GLY 105 ? A GLY 138 
49 1 Y 1 A LEU 106 ? A LEU 139 
50 1 Y 1 A SER 324 ? A SER 357 
51 1 Y 1 A GLY 325 ? A GLY 358 
52 1 Y 1 A SER 326 ? A SER 359 
53 1 Y 1 A GLU 327 ? A GLU 360 
54 1 Y 1 A ASN 328 ? A ASN 361 
55 1 Y 1 A LEU 329 ? A LEU 362 
56 1 Y 1 A TYR 330 ? A TYR 363 
57 1 Y 1 A PHE 331 ? A PHE 364 
58 1 Y 1 A GLN 332 ? A GLN 365 
59 1 Y 1 A SER 333 ? A SER 366 
60 1 Y 1 A HIS 334 ? A HIS 367 
61 1 Y 1 A HIS 335 ? A HIS 368 
62 1 Y 1 A HIS 336 ? A HIS 369 
63 1 Y 1 A HIS 337 ? A HIS 370 
64 1 Y 1 A HIS 338 ? A HIS 371 
65 1 Y 1 A HIS 339 ? A HIS 372 
66 1 Y 1 A HIS 340 ? A HIS 373 
67 1 Y 1 A HIS 341 ? A HIS 374 
68 1 Y 1 A HIS 342 ? A HIS 375 
69 1 Y 1 A HIS 343 ? A HIS 376 
# 
_pdbx_chem_comp_identifier.comp_id           BOG 
_pdbx_chem_comp_identifier.type              'IUPAC CARBOHYDRATE SYMBOL' 
_pdbx_chem_comp_identifier.program           PDB-CARE 
_pdbx_chem_comp_identifier.program_version   1.0 
_pdbx_chem_comp_identifier.identifier        b-octylglucoside 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 Tunicamycin                    TUM 
3 'PALMITIC ACID'                PLM 
4 'octyl beta-D-glucopyranoside' BOG 
5 water                          HOH 
#