data_5JTM
# 
_entry.id   5JTM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5JTM         
WWPDB D_1000220643 
BMRB  30081        
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
BMRB . 30081 unspecified 
PDB  . 5JTL  unspecified 
PDB  . 5JTQ  unspecified 
PDB  . 5JTN  unspecified 
PDB  . 5JTO  unspecified 
PDB  . 5JTP  unspecified 
PDB  . 5JTR  unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        5JTM 
_pdbx_database_status.recvd_initial_deposition_date   2016-05-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Huang, C.'       1 
'Saio, T.'        2 
'Rossi, P.'       3 
'Kalodimos, C.G.' 4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            537 
_citation.language                  ? 
_citation.page_first                202 
_citation.page_last                 206 
_citation.title                     'Structural basis for the antifolding activity of a molecular chaperone.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature18965 
_citation.pdbx_database_id_PubMed   27501151 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Huang, C.'       1 
primary 'Rossi, P.'       2 
primary 'Saio, T.'        3 
primary 'Kalodimos, C.G.' 4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protein-export protein SecB' 17287.266 4 ?       ? ?               ? 
2 polymer man 'Alkaline phosphatase'        2743.329  4 3.1.3.1 ? 'residues 1-25' ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        APase 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQ
GGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA
;
;MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQ
GGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA
;
A,B,C,D ? 
2 'polypeptide(L)' no no MKQSTIALALLPLLFTPVTKARTPE MKQSTIALALLPLLFTPVTKARTPE E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLU n 
1 4   GLN n 
1 5   ASN n 
1 6   ASN n 
1 7   THR n 
1 8   GLU n 
1 9   MET n 
1 10  THR n 
1 11  PHE n 
1 12  GLN n 
1 13  ILE n 
1 14  GLN n 
1 15  ARG n 
1 16  ILE n 
1 17  TYR n 
1 18  THR n 
1 19  LYS n 
1 20  ASP n 
1 21  ILE n 
1 22  SER n 
1 23  PHE n 
1 24  GLU n 
1 25  ALA n 
1 26  PRO n 
1 27  ASN n 
1 28  ALA n 
1 29  PRO n 
1 30  HIS n 
1 31  VAL n 
1 32  PHE n 
1 33  GLN n 
1 34  LYS n 
1 35  ASP n 
1 36  TRP n 
1 37  GLN n 
1 38  PRO n 
1 39  GLU n 
1 40  VAL n 
1 41  LYS n 
1 42  LEU n 
1 43  ASP n 
1 44  LEU n 
1 45  ASP n 
1 46  THR n 
1 47  ALA n 
1 48  SER n 
1 49  SER n 
1 50  GLN n 
1 51  LEU n 
1 52  ALA n 
1 53  ASP n 
1 54  ASP n 
1 55  VAL n 
1 56  TYR n 
1 57  GLU n 
1 58  VAL n 
1 59  VAL n 
1 60  LEU n 
1 61  ARG n 
1 62  VAL n 
1 63  THR n 
1 64  VAL n 
1 65  THR n 
1 66  ALA n 
1 67  SER n 
1 68  LEU n 
1 69  GLY n 
1 70  GLU n 
1 71  GLU n 
1 72  THR n 
1 73  ALA n 
1 74  PHE n 
1 75  LEU n 
1 76  CYS n 
1 77  GLU n 
1 78  VAL n 
1 79  GLN n 
1 80  GLN n 
1 81  GLY n 
1 82  GLY n 
1 83  ILE n 
1 84  PHE n 
1 85  SER n 
1 86  ILE n 
1 87  ALA n 
1 88  GLY n 
1 89  ILE n 
1 90  GLU n 
1 91  GLY n 
1 92  THR n 
1 93  GLN n 
1 94  MET n 
1 95  ALA n 
1 96  HIS n 
1 97  CYS n 
1 98  LEU n 
1 99  GLY n 
1 100 ALA n 
1 101 TYR n 
1 102 CYS n 
1 103 PRO n 
1 104 ASN n 
1 105 ILE n 
1 106 LEU n 
1 107 PHE n 
1 108 PRO n 
1 109 TYR n 
1 110 ALA n 
1 111 ARG n 
1 112 GLU n 
1 113 CYS n 
1 114 ILE n 
1 115 THR n 
1 116 SER n 
1 117 MET n 
1 118 VAL n 
1 119 SER n 
1 120 ARG n 
1 121 GLY n 
1 122 THR n 
1 123 PHE n 
1 124 PRO n 
1 125 GLN n 
1 126 LEU n 
1 127 ASN n 
1 128 LEU n 
1 129 ALA n 
1 130 PRO n 
1 131 VAL n 
1 132 ASN n 
1 133 PHE n 
1 134 ASP n 
1 135 ALA n 
1 136 LEU n 
1 137 PHE n 
1 138 MET n 
1 139 ASN n 
1 140 TYR n 
1 141 LEU n 
1 142 GLN n 
1 143 GLN n 
1 144 GLN n 
1 145 ALA n 
1 146 GLY n 
1 147 GLU n 
1 148 GLY n 
1 149 THR n 
1 150 GLU n 
1 151 GLU n 
1 152 HIS n 
1 153 GLN n 
1 154 ASP n 
1 155 ALA n 
2 1   MET n 
2 2   LYS n 
2 3   GLN n 
2 4   SER n 
2 5   THR n 
2 6   ILE n 
2 7   ALA n 
2 8   LEU n 
2 9   ALA n 
2 10  LEU n 
2 11  LEU n 
2 12  PRO n 
2 13  LEU n 
2 14  LEU n 
2 15  PHE n 
2 16  THR n 
2 17  PRO n 
2 18  VAL n 
2 19  THR n 
2 20  LYS n 
2 21  ALA n 
2 22  ARG n 
2 23  THR n 
2 24  PRO n 
2 25  GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 155 ? ? 'secB, EC55989_4076'  ? '55989 / EAEC' ? ? ? ? 'Escherichia coli (strain 55989 / EAEC)' 
585055 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 25  ? ? 'phoA, b0383, JW0374' ? K12            ? ? ? ? 'Escherichia coli (strain K12)'          
83333  ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP SECB_ECO55 B7L735 ? 1 
;MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQ
GGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA
;
1 
2 UNP PPB_ECOLI  P00634 ? 2 MKQSTIALALLPLLFTPVTKARTPE 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5JTM A 1 ? 155 ? B7L735 1 ? 155 ? 1 155 
2 1 5JTM B 1 ? 155 ? B7L735 1 ? 155 ? 1 155 
3 1 5JTM C 1 ? 155 ? B7L735 1 ? 155 ? 1 155 
4 1 5JTM D 1 ? 155 ? B7L735 1 ? 155 ? 1 155 
5 2 5JTM E 1 ? 25  ? P00634 1 ? 25  ? 1 25  
6 2 5JTM F 1 ? 25  ? P00634 1 ? 25  ? 1 25  
7 2 5JTM G 1 ? 25  ? P00634 1 ? 25  ? 1 25  
8 2 5JTM H 1 ? 25  ? P00634 1 ? 25  ? 1 25  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1 1 1 '2D 1H-15N HSQC'            1 isotropic 
2 1 1 '2D 1H-13C HSQC aliphatic'  1 isotropic 
3 1 1 '2D 1H-13C HSQC aromatic'   1 isotropic 
4 1 1 '3D 1H-13C NOESY aliphatic' 2 isotropic 
5 1 1 '3D 1H-13C NOESY aromatic'  2 isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            301 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         150 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  condition_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;300 uM [U-100% 13C; U-100% 15N] SecB, 300 uM [U-100% 13C; U-100% 15N] PhoA binding site a, 150 uM potassium chloride, 50 uM sodium phosphate, 50 uM potassium phosphate, 90% H2O/10% D2O
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
_pdbx_nmr_sample_details.label            Sample_1 
_pdbx_nmr_sample_details.type             solution 
_pdbx_nmr_sample_details.details          
;1H,13C-ILVMAT Methyl labeling otherwise uniformly deuterated, 12C
15N
Specific labelling of aromatic residues
;
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 AvanceIII ? Bruker 700 ? 
2 INOVA     ? Varian 900 ? 
# 
_pdbx_nmr_refine.entry_id           5JTM 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      5JTM 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             5JTM 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 refinement                  CNS     ? 'Brunger, Adams, Clore, Gros, Nilges and Read'      
2 'structure calculation'     CYANA   ? 'Guntert, Mumenthaler and Wuthrich'                 
3 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific'                      
4 processing                  NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5JTM 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5JTM 
_struct.title                        'The structure of chaperone SecB in complex with unstructured PhoA binding site a' 
_struct.pdbx_descriptor              'Protein-export protein SecB, Alkaline phosphatase (E.C.3.1.3.1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5JTM 
_struct_keywords.text            'Molecular chaperone, CHAPERONE-HYDROLASE complex' 
_struct_keywords.pdbx_keywords   CHAPERONE/HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 27  ? PHE A 32  ? ASN A 27  PHE A 32  1 ? 6  
HELX_P HELX_P2  AA2 GLY A 91  ? GLY A 99  ? GLY A 91  GLY A 99  1 ? 9  
HELX_P HELX_P3  AA3 ALA A 100 ? GLY A 121 ? ALA A 100 GLY A 121 1 ? 22 
HELX_P HELX_P4  AA4 ASN A 132 ? GLN A 142 ? ASN A 132 GLN A 142 1 ? 11 
HELX_P HELX_P5  AA5 ASN B 27  ? PHE B 32  ? ASN B 27  PHE B 32  1 ? 6  
HELX_P HELX_P6  AA6 GLY B 91  ? ALA B 100 ? GLY B 91  ALA B 100 1 ? 10 
HELX_P HELX_P7  AA7 ALA B 100 ? GLY B 121 ? ALA B 100 GLY B 121 1 ? 22 
HELX_P HELX_P8  AA8 ASN B 132 ? GLN B 142 ? ASN B 132 GLN B 142 1 ? 11 
HELX_P HELX_P9  AA9 ASN C 27  ? GLN C 33  ? ASN C 27  GLN C 33  1 ? 7  
HELX_P HELX_P10 AB1 GLY C 91  ? ALA C 100 ? GLY C 91  ALA C 100 1 ? 10 
HELX_P HELX_P11 AB2 ALA C 100 ? GLY C 121 ? ALA C 100 GLY C 121 1 ? 22 
HELX_P HELX_P12 AB3 ASN C 132 ? TYR C 140 ? ASN C 132 TYR C 140 1 ? 9  
HELX_P HELX_P13 AB4 ASN D 27  ? PHE D 32  ? ASN D 27  PHE D 32  1 ? 6  
HELX_P HELX_P14 AB5 THR D 92  ? ALA D 100 ? THR D 92  ALA D 100 1 ? 9  
HELX_P HELX_P15 AB6 ALA D 100 ? GLY D 121 ? ALA D 100 GLY D 121 1 ? 22 
HELX_P HELX_P16 AB7 ASN D 132 ? GLN D 142 ? ASN D 132 GLN D 142 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 8 ? 
AA3 ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA2 7 8 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA3 6 7 ? anti-parallel 
AA3 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PRO A 38 ? ALA A 52 ? PRO A 38 ALA A 52 
AA1 2 VAL A 55 ? LEU A 68 ? VAL A 55 LEU A 68 
AA1 3 GLU A 71 ? ALA A 87 ? GLU A 71 ALA A 87 
AA1 4 THR A 10 ? GLU A 24 ? THR A 10 GLU A 24 
AA1 5 ASP B 20 ? GLU B 24 ? ASP B 20 GLU B 24 
AA1 6 GLU B 71 ? ALA B 87 ? GLU B 71 ALA B 87 
AA1 7 THR B 10 ? THR B 18 ? THR B 10 THR B 18 
AA2 1 PRO A 38 ? ALA A 52 ? PRO A 38 ALA A 52 
AA2 2 VAL A 55 ? LEU A 68 ? VAL A 55 LEU A 68 
AA2 3 GLU A 71 ? ALA A 87 ? GLU A 71 ALA A 87 
AA2 4 THR A 10 ? GLU A 24 ? THR A 10 GLU A 24 
AA2 5 ASP B 20 ? GLU B 24 ? ASP B 20 GLU B 24 
AA2 6 GLU B 71 ? ALA B 87 ? GLU B 71 ALA B 87 
AA2 7 VAL B 55 ? LEU B 68 ? VAL B 55 LEU B 68 
AA2 8 GLU B 39 ? SER B 49 ? GLU B 39 SER B 49 
AA3 1 GLU C 39 ? ALA C 52 ? GLU C 39 ALA C 52 
AA3 2 VAL C 55 ? SER C 67 ? VAL C 55 SER C 67 
AA3 3 THR C 72 ? SER C 85 ? THR C 72 SER C 85 
AA3 4 ILE C 13 ? GLU C 24 ? ILE C 13 GLU C 24 
AA3 5 THR D 10 ? GLU D 24 ? THR D 10 GLU D 24 
AA3 6 GLU D 71 ? ALA D 87 ? GLU D 71 ALA D 87 
AA3 7 VAL D 55 ? LEU D 68 ? VAL D 55 LEU D 68 
AA3 8 GLU D 39 ? ALA D 52 ? GLU D 39 ALA D 52 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ASP A 43 ? N ASP A 43 O THR A 63 ? O THR A 63 
AA1 2 3 N LEU A 68 ? N LEU A 68 O GLU A 71 ? O GLU A 71 
AA1 3 4 O GLU A 77 ? O GLU A 77 N SER A 22 ? N SER A 22 
AA1 4 5 N PHE A 23 ? N PHE A 23 O ILE B 21 ? O ILE B 21 
AA1 5 6 N SER B 22 ? N SER B 22 O GLU B 77 ? O GLU B 77 
AA1 6 7 O GLY B 81 ? O GLY B 81 N TYR B 17 ? N TYR B 17 
AA2 1 2 N ASP A 43 ? N ASP A 43 O THR A 63 ? O THR A 63 
AA2 2 3 N LEU A 68 ? N LEU A 68 O GLU A 71 ? O GLU A 71 
AA2 3 4 O GLU A 77 ? O GLU A 77 N SER A 22 ? N SER A 22 
AA2 4 5 N PHE A 23 ? N PHE A 23 O ILE B 21 ? O ILE B 21 
AA2 5 6 N SER B 22 ? N SER B 22 O GLU B 77 ? O GLU B 77 
AA2 6 7 O CYS B 76 ? O CYS B 76 N VAL B 64 ? N VAL B 64 
AA2 7 8 O GLU B 57 ? O GLU B 57 N SER B 49 ? N SER B 49 
AA3 1 2 N SER C 49 ? N SER C 49 O GLU C 57 ? O GLU C 57 
AA3 2 3 N VAL C 58 ? N VAL C 58 O GLY C 82 ? O GLY C 82 
AA3 3 4 O ILE C 83 ? O ILE C 83 N ARG C 15 ? N ARG C 15 
AA3 4 5 N ILE C 21 ? N ILE C 21 O PHE D 23 ? O PHE D 23 
AA3 5 6 N GLN D 12 ? N GLN D 12 O SER D 85 ? O SER D 85 
AA3 6 7 O CYS D 76 ? O CYS D 76 N VAL D 64 ? N VAL D 64 
AA3 7 8 O GLU D 57 ? O GLU D 57 N SER D 49 ? N SER D 49 
# 
_atom_sites.entry_id                    5JTM 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . MET A 1 1   ? -7.184  26.470  34.479  1.00 70.02 ? 1   MET A N    1  
ATOM 2      C CA   . MET A 1 1   ? -6.430  26.781  33.235  1.00 53.13 ? 1   MET A CA   1  
ATOM 3      C C    . MET A 1 1   ? -5.089  26.021  33.169  1.00 73.23 ? 1   MET A C    1  
ATOM 4      O O    . MET A 1 1   ? -4.395  26.103  32.147  1.00 34.30 ? 1   MET A O    1  
ATOM 5      C CB   . MET A 1 1   ? -6.217  28.314  33.109  1.00 72.45 ? 1   MET A CB   1  
ATOM 6      C CG   . MET A 1 1   ? -5.508  28.971  34.298  1.00 45.44 ? 1   MET A CG   1  
ATOM 7      S SD   . MET A 1 1   ? -5.484  30.768  34.171  1.00 34.25 ? 1   MET A SD   1  
ATOM 8      C CE   . MET A 1 1   ? -4.805  31.236  35.759  1.00 0.22  ? 1   MET A CE   1  
ATOM 9      H H1   . MET A 1 1   ? -6.636  26.757  35.312  1.00 37.61 ? 1   MET A H1   1  
ATOM 10     H H2   . MET A 1 1   ? -7.376  25.452  34.540  1.00 37.61 ? 1   MET A H2   1  
ATOM 11     H H3   . MET A 1 1   ? -8.091  26.980  34.485  1.00 37.61 ? 1   MET A H3   1  
ATOM 12     H HA   . MET A 1 1   ? -7.039  26.445  32.402  1.00 23.55 ? 1   MET A HA   1  
ATOM 13     H HB2  . MET A 1 1   ? -5.639  28.521  32.215  1.00 64.43 ? 1   MET A HB2  1  
ATOM 14     H HB3  . MET A 1 1   ? -7.188  28.786  32.999  1.00 52.41 ? 1   MET A HB3  1  
ATOM 15     H HG2  . MET A 1 1   ? -6.023  28.698  35.212  1.00 74.33 ? 1   MET A HG2  1  
ATOM 16     H HG3  . MET A 1 1   ? -4.486  28.615  34.344  1.00 75.31 ? 1   MET A HG3  1  
ATOM 17     H HE1  . MET A 1 1   ? -4.732  32.311  35.816  1.00 13.54 ? 1   MET A HE1  1  
ATOM 18     H HE2  . MET A 1 1   ? -3.821  30.802  35.875  1.00 53.23 ? 1   MET A HE2  1  
ATOM 19     H HE3  . MET A 1 1   ? -5.451  30.879  36.549  1.00 32.44 ? 1   MET A HE3  1  
ATOM 20     N N    . SER A 1 2   ? -4.756  25.271  34.256  1.00 33.23 ? 2   SER A N    1  
ATOM 21     C CA   . SER A 1 2   ? -3.474  24.542  34.404  1.00 20.31 ? 2   SER A CA   1  
ATOM 22     C C    . SER A 1 2   ? -2.268  25.484  34.177  1.00 33.44 ? 2   SER A C    1  
ATOM 23     O O    . SER A 1 2   ? -1.550  25.391  33.173  1.00 70.42 ? 2   SER A O    1  
ATOM 24     C CB   . SER A 1 2   ? -3.430  23.285  33.494  1.00 40.01 ? 2   SER A CB   1  
ATOM 25     O OG   . SER A 1 2   ? -4.405  22.327  33.896  1.00 75.14 ? 2   SER A OG   1  
ATOM 26     H H    . SER A 1 2   ? -5.399  25.208  34.988  1.00 41.00 ? 2   SER A H    1  
ATOM 27     H HA   . SER A 1 2   ? -3.434  24.209  35.438  1.00 54.33 ? 2   SER A HA   1  
ATOM 28     H HB2  . SER A 1 2   ? -3.633  23.575  32.472  1.00 73.33 ? 2   SER A HB2  1  
ATOM 29     H HB3  . SER A 1 2   ? -2.451  22.824  33.548  1.00 14.43 ? 2   SER A HB3  1  
ATOM 30     H HG   . SER A 1 2   ? -4.177  21.988  34.768  1.00 61.53 ? 2   SER A HG   1  
ATOM 31     N N    . GLU A 1 3   ? -2.118  26.434  35.110  1.00 5.41  ? 3   GLU A N    1  
ATOM 32     C CA   . GLU A 1 3   ? -1.059  27.464  35.070  1.00 23.13 ? 3   GLU A CA   1  
ATOM 33     C C    . GLU A 1 3   ? 0.315   26.874  35.434  1.00 33.34 ? 3   GLU A C    1  
ATOM 34     O O    . GLU A 1 3   ? 1.349   27.323  34.925  1.00 2.22  ? 3   GLU A O    1  
ATOM 35     C CB   . GLU A 1 3   ? -1.417  28.634  36.028  1.00 20.34 ? 3   GLU A CB   1  
ATOM 36     C CG   . GLU A 1 3   ? -1.717  28.207  37.484  1.00 71.22 ? 3   GLU A CG   1  
ATOM 37     C CD   . GLU A 1 3   ? -1.957  29.387  38.432  1.00 44.44 ? 3   GLU A CD   1  
ATOM 38     O OE1  . GLU A 1 3   ? -1.092  29.671  39.288  1.00 14.43 ? 3   GLU A OE1  1  
ATOM 39     O OE2  . GLU A 1 3   ? -3.009  30.044  38.319  1.00 61.34 ? 3   GLU A OE2  1  
ATOM 40     H H    . GLU A 1 3   ? -2.746  26.443  35.863  1.00 3.20  ? 3   GLU A H    1  
ATOM 41     H HA   . GLU A 1 3   ? -1.010  27.850  34.056  1.00 42.13 ? 3   GLU A HA   1  
ATOM 42     H HB2  . GLU A 1 3   ? -0.590  29.338  36.045  1.00 13.13 ? 3   GLU A HB2  1  
ATOM 43     H HB3  . GLU A 1 3   ? -2.290  29.145  35.639  1.00 60.14 ? 3   GLU A HB3  1  
ATOM 44     H HG2  . GLU A 1 3   ? -2.597  27.574  37.487  1.00 64.44 ? 3   GLU A HG2  1  
ATOM 45     H HG3  . GLU A 1 3   ? -0.877  27.625  37.850  1.00 25.42 ? 3   GLU A HG3  1  
ATOM 46     N N    . GLN A 1 4   ? 0.307   25.863  36.318  1.00 75.51 ? 4   GLN A N    1  
ATOM 47     C CA   . GLN A 1 4   ? 1.528   25.230  36.846  1.00 25.01 ? 4   GLN A CA   1  
ATOM 48     C C    . GLN A 1 4   ? 1.846   23.963  36.044  1.00 10.41 ? 4   GLN A C    1  
ATOM 49     O O    . GLN A 1 4   ? 0.923   23.249  35.614  1.00 0.21  ? 4   GLN A O    1  
ATOM 50     C CB   . GLN A 1 4   ? 1.332   24.874  38.347  1.00 31.42 ? 4   GLN A CB   1  
ATOM 51     C CG   . GLN A 1 4   ? 0.864   26.056  39.218  1.00 32.23 ? 4   GLN A CG   1  
ATOM 52     C CD   . GLN A 1 4   ? 0.674   25.692  40.688  1.00 4.23  ? 4   GLN A CD   1  
ATOM 53     O OE1  . GLN A 1 4   ? 1.598   25.810  41.495  1.00 33.13 ? 4   GLN A OE1  1  
ATOM 54     N NE2  . GLN A 1 4   ? -0.519  25.233  41.045  1.00 62.44 ? 4   GLN A NE2  1  
ATOM 55     H H    . GLN A 1 4   ? -0.557  25.515  36.617  1.00 61.53 ? 4   GLN A H    1  
ATOM 56     H HA   . GLN A 1 4   ? 2.356   25.930  36.754  1.00 64.43 ? 4   GLN A HA   1  
ATOM 57     H HB2  . GLN A 1 4   ? 0.591   24.084  38.428  1.00 45.05 ? 4   GLN A HB2  1  
ATOM 58     H HB3  . GLN A 1 4   ? 2.272   24.510  38.747  1.00 35.24 ? 4   GLN A HB3  1  
ATOM 59     H HG2  . GLN A 1 4   ? 1.600   26.851  39.155  1.00 24.21 ? 4   GLN A HG2  1  
ATOM 60     H HG3  . GLN A 1 4   ? -0.077  26.424  38.826  1.00 10.01 ? 4   GLN A HG3  1  
ATOM 61     H HE21 . GLN A 1 4   ? -1.210  25.148  40.354  1.00 32.05 ? 4   GLN A HE21 1  
ATOM 62     H HE22 . GLN A 1 4   ? -0.661  24.995  41.985  1.00 73.04 ? 4   GLN A HE22 1  
ATOM 63     N N    . ASN A 1 5   ? 3.153   23.689  35.855  1.00 55.33 ? 5   ASN A N    1  
ATOM 64     C CA   . ASN A 1 5   ? 3.621   22.446  35.226  1.00 64.53 ? 5   ASN A CA   1  
ATOM 65     C C    . ASN A 1 5   ? 3.304   21.277  36.173  1.00 70.22 ? 5   ASN A C    1  
ATOM 66     O O    . ASN A 1 5   ? 3.565   21.368  37.382  1.00 74.14 ? 5   ASN A O    1  
ATOM 67     C CB   . ASN A 1 5   ? 5.146   22.516  34.881  1.00 64.11 ? 5   ASN A CB   1  
ATOM 68     C CG   . ASN A 1 5   ? 6.087   22.350  36.086  1.00 40.00 ? 5   ASN A CG   1  
ATOM 69     O OD1  . ASN A 1 5   ? 6.616   21.271  36.336  1.00 44.15 ? 5   ASN A OD1  1  
ATOM 70     N ND2  . ASN A 1 5   ? 6.269   23.400  36.863  1.00 13.04 ? 5   ASN A ND2  1  
ATOM 71     H H    . ASN A 1 5   ? 3.815   24.341  36.147  1.00 40.33 ? 5   ASN A H    1  
ATOM 72     H HA   . ASN A 1 5   ? 3.056   22.315  34.300  1.00 35.44 ? 5   ASN A HA   1  
ATOM 73     H HB2  . ASN A 1 5   ? 5.379   21.735  34.166  1.00 54.11 ? 5   ASN A HB2  1  
ATOM 74     H HB3  . ASN A 1 5   ? 5.351   23.473  34.417  1.00 32.32 ? 5   ASN A HB3  1  
ATOM 75     H HD21 . ASN A 1 5   ? 5.794   24.223  36.647  1.00 73.13 ? 5   ASN A HD21 1  
ATOM 76     H HD22 . ASN A 1 5   ? 6.871   23.306  37.627  1.00 64.11 ? 5   ASN A HD22 1  
ATOM 77     N N    . ASN A 1 6   ? 2.692   20.223  35.626  1.00 54.12 ? 6   ASN A N    1  
ATOM 78     C CA   . ASN A 1 6   ? 2.254   19.056  36.409  1.00 15.11 ? 6   ASN A CA   1  
ATOM 79     C C    . ASN A 1 6   ? 1.771   17.950  35.476  1.00 54.34 ? 6   ASN A C    1  
ATOM 80     O O    . ASN A 1 6   ? 2.097   16.784  35.683  1.00 62.25 ? 6   ASN A O    1  
ATOM 81     C CB   . ASN A 1 6   ? 1.129   19.436  37.419  1.00 12.14 ? 6   ASN A CB   1  
ATOM 82     C CG   . ASN A 1 6   ? 0.683   18.258  38.288  1.00 43.23 ? 6   ASN A CG   1  
ATOM 83     O OD1  . ASN A 1 6   ? -0.286  17.566  37.976  1.00 50.40 ? 6   ASN A OD1  1  
ATOM 84     N ND2  . ASN A 1 6   ? 1.403   18.005  39.370  1.00 13.10 ? 6   ASN A ND2  1  
ATOM 85     H H    . ASN A 1 6   ? 2.543   20.226  34.659  1.00 73.04 ? 6   ASN A H    1  
ATOM 86     H HA   . ASN A 1 6   ? 3.117   18.692  36.962  1.00 11.21 ? 6   ASN A HA   1  
ATOM 87     H HB2  . ASN A 1 6   ? 1.491   20.222  38.067  1.00 20.12 ? 6   ASN A HB2  1  
ATOM 88     H HB3  . ASN A 1 6   ? 0.269   19.806  36.872  1.00 21.11 ? 6   ASN A HB3  1  
ATOM 89     H HD21 . ASN A 1 6   ? 2.178   18.577  39.560  1.00 51.45 ? 6   ASN A HD21 1  
ATOM 90     H HD22 . ASN A 1 6   ? 1.138   17.246  39.932  1.00 11.42 ? 6   ASN A HD22 1  
ATOM 91     N N    . THR A 1 7   ? 0.998   18.357  34.444  1.00 3.21  ? 7   THR A N    1  
ATOM 92     C CA   . THR A 1 7   ? 0.277   17.445  33.537  1.00 1.32  ? 7   THR A CA   1  
ATOM 93     C C    . THR A 1 7   ? -0.868  16.760  34.317  1.00 64.40 ? 7   THR A C    1  
ATOM 94     O O    . THR A 1 7   ? -0.777  15.593  34.714  1.00 55.12 ? 7   THR A O    1  
ATOM 95     C CB   . THR A 1 7   ? 1.218   16.394  32.835  1.00 41.41 ? 7   THR A CB   1  
ATOM 96     O OG1  . THR A 1 7   ? 2.337   17.078  32.256  1.00 1.01  ? 7   THR A OG1  1  
ATOM 97     C CG2  . THR A 1 7   ? 0.497   15.570  31.744  1.00 52.44 ? 7   THR A CG2  1  
ATOM 98     H H    . THR A 1 7   ? 0.899   19.321  34.301  1.00 5.13  ? 7   THR A H    1  
ATOM 99     H HA   . THR A 1 7   ? -0.166  18.070  32.764  1.00 4.12  ? 7   THR A HA   1  
ATOM 100    H HB   . THR A 1 7   ? 1.592   15.713  33.592  1.00 4.30  ? 7   THR A HB   1  
ATOM 101    H HG1  . THR A 1 7   ? 3.156   16.697  32.600  1.00 54.12 ? 7   THR A HG1  1  
ATOM 102    H HG21 . THR A 1 7   ? 0.126   16.228  30.968  1.00 34.41 ? 7   THR A HG21 1  
ATOM 103    H HG22 . THR A 1 7   ? -0.333  15.028  32.178  1.00 72.21 ? 7   THR A HG22 1  
ATOM 104    H HG23 . THR A 1 7   ? 1.192   14.863  31.307  1.00 4.43  ? 7   THR A HG23 1  
ATOM 105    N N    . GLU A 1 8   ? -1.901  17.560  34.613  1.00 54.22 ? 8   GLU A N    1  
ATOM 106    C CA   . GLU A 1 8   ? -3.106  17.103  35.321  1.00 41.00 ? 8   GLU A CA   1  
ATOM 107    C C    . GLU A 1 8   ? -3.984  16.284  34.368  1.00 11.22 ? 8   GLU A C    1  
ATOM 108    O O    . GLU A 1 8   ? -4.394  15.163  34.685  1.00 22.32 ? 8   GLU A O    1  
ATOM 109    C CB   . GLU A 1 8   ? -3.887  18.321  35.868  1.00 51.40 ? 8   GLU A CB   1  
ATOM 110    C CG   . GLU A 1 8   ? -3.104  19.206  36.858  1.00 3.25  ? 8   GLU A CG   1  
ATOM 111    C CD   . GLU A 1 8   ? -3.898  20.447  37.299  1.00 22.24 ? 8   GLU A CD   1  
ATOM 112    O OE1  . GLU A 1 8   ? -4.833  20.306  38.114  1.00 72.30 ? 8   GLU A OE1  1  
ATOM 113    O OE2  . GLU A 1 8   ? -3.606  21.566  36.823  1.00 43.42 ? 8   GLU A OE2  1  
ATOM 114    H H    . GLU A 1 8   ? -1.850  18.497  34.347  1.00 12.44 ? 8   GLU A H    1  
ATOM 115    H HA   . GLU A 1 8   ? -2.797  16.476  36.152  1.00 60.54 ? 8   GLU A HA   1  
ATOM 116    H HB2  . GLU A 1 8   ? -4.193  18.939  35.031  1.00 40.22 ? 8   GLU A HB2  1  
ATOM 117    H HB3  . GLU A 1 8   ? -4.780  17.963  36.372  1.00 54.41 ? 8   GLU A HB3  1  
ATOM 118    H HG2  . GLU A 1 8   ? -2.859  18.616  37.736  1.00 51.21 ? 8   GLU A HG2  1  
ATOM 119    H HG3  . GLU A 1 8   ? -2.179  19.521  36.385  1.00 63.51 ? 8   GLU A HG3  1  
ATOM 120    N N    . MET A 1 9   ? -4.248  16.874  33.189  1.00 44.52 ? 9   MET A N    1  
ATOM 121    C CA   . MET A 1 9   ? -5.010  16.233  32.100  1.00 43.42 ? 9   MET A CA   1  
ATOM 122    C C    . MET A 1 9   ? -4.181  15.070  31.521  1.00 64.44 ? 9   MET A C    1  
ATOM 123    O O    . MET A 1 9   ? -2.947  15.166  31.444  1.00 73.50 ? 9   MET A O    1  
ATOM 124    C CB   . MET A 1 9   ? -5.360  17.296  31.007  1.00 23.34 ? 9   MET A CB   1  
ATOM 125    C CG   . MET A 1 9   ? -6.469  16.888  30.013  1.00 51.13 ? 9   MET A CG   1  
ATOM 126    S SD   . MET A 1 9   ? -6.002  15.554  28.889  1.00 23.14 ? 9   MET A SD   1  
ATOM 127    C CE   . MET A 1 9   ? -7.583  15.154  28.139  1.00 51.42 ? 9   MET A CE   1  
ATOM 128    H H    . MET A 1 9   ? -3.908  17.775  33.040  1.00 4.03  ? 9   MET A H    1  
ATOM 129    H HA   . MET A 1 9   ? -5.933  15.838  32.527  1.00 31.04 ? 9   MET A HA   1  
ATOM 130    H HB2  . MET A 1 9   ? -5.682  18.207  31.504  1.00 63.30 ? 9   MET A HB2  1  
ATOM 131    H HB3  . MET A 1 9   ? -4.466  17.523  30.438  1.00 61.43 ? 9   MET A HB3  1  
ATOM 132    H HG2  . MET A 1 9   ? -7.334  16.567  30.577  1.00 31.42 ? 9   MET A HG2  1  
ATOM 133    H HG3  . MET A 1 9   ? -6.741  17.753  29.417  1.00 10.10 ? 9   MET A HG3  1  
ATOM 134    H HE1  . MET A 1 9   ? -8.275  14.828  28.901  1.00 22.22 ? 9   MET A HE1  1  
ATOM 135    H HE2  . MET A 1 9   ? -7.447  14.359  27.418  1.00 3.02  ? 9   MET A HE2  1  
ATOM 136    H HE3  . MET A 1 9   ? -7.980  16.026  27.640  1.00 40.15 ? 9   MET A HE3  1  
ATOM 137    N N    . THR A 1 10  ? -4.856  13.986  31.107  1.00 43.10 ? 10  THR A N    1  
ATOM 138    C CA   . THR A 1 10  ? -4.192  12.730  30.719  1.00 12.04 ? 10  THR A CA   1  
ATOM 139    C C    . THR A 1 10  ? -4.850  12.130  29.471  1.00 1.43  ? 10  THR A C    1  
ATOM 140    O O    . THR A 1 10  ? -6.074  12.200  29.294  1.00 31.03 ? 10  THR A O    1  
ATOM 141    C CB   . THR A 1 10  ? -4.223  11.709  31.905  1.00 63.12 ? 10  THR A CB   1  
ATOM 142    O OG1  . THR A 1 10  ? -3.601  12.310  33.048  1.00 75.04 ? 10  THR A OG1  1  
ATOM 143    C CG2  . THR A 1 10  ? -3.504  10.377  31.589  1.00 24.13 ? 10  THR A CG2  1  
ATOM 144    H H    . THR A 1 10  ? -5.836  14.030  31.055  1.00 43.11 ? 10  THR A H    1  
ATOM 145    H HA   . THR A 1 10  ? -3.149  12.952  30.491  1.00 5.42  ? 10  THR A HA   1  
ATOM 146    H HB   . THR A 1 10  ? -5.259  11.496  32.153  1.00 23.25 ? 10  THR A HB   1  
ATOM 147    H HG1  . THR A 1 10  ? -3.172  13.133  32.788  1.00 60.22 ? 10  THR A HG1  1  
ATOM 148    H HG21 . THR A 1 10  ? -3.977  9.897   30.741  1.00 15.14 ? 10  THR A HG21 1  
ATOM 149    H HG22 . THR A 1 10  ? -3.560  9.719   32.447  1.00 52.41 ? 10  THR A HG22 1  
ATOM 150    H HG23 . THR A 1 10  ? -2.466  10.570  31.356  1.00 43.32 ? 10  THR A HG23 1  
ATOM 151    N N    . PHE A 1 11  ? -4.004  11.536  28.618  1.00 53.10 ? 11  PHE A N    1  
ATOM 152    C CA   . PHE A 1 11  ? -4.380  11.042  27.298  1.00 21.12 ? 11  PHE A CA   1  
ATOM 153    C C    . PHE A 1 11  ? -3.848  9.611   27.111  1.00 41.44 ? 11  PHE A C    1  
ATOM 154    O O    . PHE A 1 11  ? -2.708  9.307   27.479  1.00 50.32 ? 11  PHE A O    1  
ATOM 155    C CB   . PHE A 1 11  ? -3.788  11.999  26.227  1.00 50.22 ? 11  PHE A CB   1  
ATOM 156    C CG   . PHE A 1 11  ? -4.198  11.757  24.770  1.00 63.13 ? 11  PHE A CG   1  
ATOM 157    C CD1  . PHE A 1 11  ? -3.467  12.328  23.735  1.00 60.24 ? 11  PHE A CD1  1  
ATOM 158    C CD2  . PHE A 1 11  ? -5.317  11.007  24.428  1.00 4.13  ? 11  PHE A CD2  1  
ATOM 159    C CE1  . PHE A 1 11  ? -3.846  12.152  22.418  1.00 65.00 ? 11  PHE A CE1  1  
ATOM 160    C CE2  . PHE A 1 11  ? -5.669  10.835  23.114  1.00 21.24 ? 11  PHE A CE2  1  
ATOM 161    C CZ   . PHE A 1 11  ? -4.938  11.407  22.114  1.00 54.55 ? 11  PHE A CZ   1  
ATOM 162    H H    . PHE A 1 11  ? -3.073  11.419  28.898  1.00 75.44 ? 11  PHE A H    1  
ATOM 163    H HA   . PHE A 1 11  ? -5.465  11.037  27.213  1.00 31.34 ? 11  PHE A HA   1  
ATOM 164    H HB2  . PHE A 1 11  ? -4.088  13.012  26.470  1.00 11.23 ? 11  PHE A HB2  1  
ATOM 165    H HB3  . PHE A 1 11  ? -2.703  11.947  26.280  1.00 44.21 ? 11  PHE A HB3  1  
ATOM 166    H HD1  . PHE A 1 11  ? -2.589  12.909  23.967  1.00 70.23 ? 11  PHE A HD1  1  
ATOM 167    H HD2  . PHE A 1 11  ? -5.914  10.548  25.207  1.00 43.35 ? 11  PHE A HD2  1  
ATOM 168    H HE1  . PHE A 1 11  ? -3.287  12.596  21.628  1.00 32.31 ? 11  PHE A HE1  1  
ATOM 169    H HE2  . PHE A 1 11  ? -6.520  10.240  22.861  1.00 62.35 ? 11  PHE A HE2  1  
ATOM 170    H HZ   . PHE A 1 11  ? -5.234  11.272  21.080  1.00 70.33 ? 11  PHE A HZ   1  
ATOM 171    N N    . GLN A 1 12  ? -4.694  8.760   26.525  1.00 20.15 ? 12  GLN A N    1  
ATOM 172    C CA   . GLN A 1 12  ? -4.357  7.380   26.157  1.00 64.52 ? 12  GLN A CA   1  
ATOM 173    C C    . GLN A 1 12  ? -5.149  7.018   24.896  1.00 53.10 ? 12  GLN A C    1  
ATOM 174    O O    . GLN A 1 12  ? -6.384  7.087   24.897  1.00 42.55 ? 12  GLN A O    1  
ATOM 175    C CB   . GLN A 1 12  ? -4.681  6.387   27.314  1.00 40.25 ? 12  GLN A CB   1  
ATOM 176    C CG   . GLN A 1 12  ? -4.386  4.899   26.986  1.00 61.15 ? 12  GLN A CG   1  
ATOM 177    C CD   . GLN A 1 12  ? -2.904  4.592   26.717  1.00 14.34 ? 12  GLN A CD   1  
ATOM 178    O OE1  . GLN A 1 12  ? -2.008  5.202   27.302  1.00 31.41 ? 12  GLN A OE1  1  
ATOM 179    N NE2  . GLN A 1 12  ? -2.636  3.660   25.809  1.00 24.11 ? 12  GLN A NE2  1  
ATOM 180    H H    . GLN A 1 12  ? -5.596  9.084   26.316  1.00 23.35 ? 12  GLN A H    1  
ATOM 181    H HA   . GLN A 1 12  ? -3.292  7.333   25.933  1.00 75.21 ? 12  GLN A HA   1  
ATOM 182    H HB2  . GLN A 1 12  ? -4.097  6.665   28.183  1.00 3.32  ? 12  GLN A HB2  1  
ATOM 183    H HB3  . GLN A 1 12  ? -5.735  6.478   27.566  1.00 11.24 ? 12  GLN A HB3  1  
ATOM 184    H HG2  . GLN A 1 12  ? -4.706  4.292   27.823  1.00 61.33 ? 12  GLN A HG2  1  
ATOM 185    H HG3  . GLN A 1 12  ? -4.966  4.619   26.112  1.00 12.23 ? 12  GLN A HG3  1  
ATOM 186    H HE21 . GLN A 1 12  ? -3.386  3.223   25.356  1.00 55.10 ? 12  GLN A HE21 1  
ATOM 187    H HE22 . GLN A 1 12  ? -1.694  3.451   25.626  1.00 21.01 ? 12  GLN A HE22 1  
ATOM 188    N N    . ILE A 1 13  ? -4.438  6.670   23.815  1.00 64.23 ? 13  ILE A N    1  
ATOM 189    C CA   . ILE A 1 13  ? -5.067  6.256   22.556  1.00 25.23 ? 13  ILE A CA   1  
ATOM 190    C C    . ILE A 1 13  ? -5.370  4.761   22.609  1.00 22.42 ? 13  ILE A C    1  
ATOM 191    O O    . ILE A 1 13  ? -4.462  3.939   22.800  1.00 65.32 ? 13  ILE A O    1  
ATOM 192    C CB   . ILE A 1 13  ? -4.180  6.592   21.306  1.00 2.23  ? 13  ILE A CB   1  
ATOM 193    C CG1  . ILE A 1 13  ? -3.913  8.125   21.265  1.00 12.33 ? 13  ILE A CG1  1  
ATOM 194    C CG2  . ILE A 1 13  ? -4.854  6.099   19.993  1.00 12.03 ? 13  ILE A CG2  1  
ATOM 195    C CD1  . ILE A 1 13  ? -3.248  8.645   20.008  1.00 63.34 ? 13  ILE A CD1  1  
ATOM 196    H H    . ILE A 1 13  ? -3.462  6.682   23.870  1.00 45.12 ? 13  ILE A H    1  
ATOM 197    H HA   . ILE A 1 13  ? -6.008  6.803   22.453  1.00 23.43 ? 13  ILE A HA   1  
ATOM 198    H HB   . ILE A 1 13  ? -3.230  6.073   21.411  1.00 44.32 ? 13  ILE A HB   1  
ATOM 199    H HG12 . ILE A 1 13  ? -4.856  8.648   21.351  1.00 4.44  ? 13  ILE A HG12 1  
ATOM 200    H HG13 . ILE A 1 13  ? -3.292  8.408   22.106  1.00 65.53 ? 13  ILE A HG13 1  
ATOM 201    H HG21 . ILE A 1 13  ? -4.307  6.468   19.136  1.00 33.33 ? 13  ILE A HG21 1  
ATOM 202    H HG22 . ILE A 1 13  ? -5.874  6.460   19.943  1.00 10.53 ? 13  ILE A HG22 1  
ATOM 203    H HG23 . ILE A 1 13  ? -4.860  5.018   19.961  1.00 15.21 ? 13  ILE A HG23 1  
ATOM 204    H HD11 . ILE A 1 13  ? -3.811  8.327   19.144  1.00 41.41 ? 13  ILE A HD11 1  
ATOM 205    H HD12 . ILE A 1 13  ? -2.237  8.291   19.919  1.00 41.11 ? 13  ILE A HD12 1  
ATOM 206    H HD13 . ILE A 1 13  ? -3.248  9.728   20.036  1.00 72.23 ? 13  ILE A HD13 1  
ATOM 207    N N    . GLN A 1 14  ? -6.656  4.435   22.464  1.00 73.53 ? 14  GLN A N    1  
ATOM 208    C CA   . GLN A 1 14  ? -7.138  3.057   22.454  1.00 62.54 ? 14  GLN A CA   1  
ATOM 209    C C    . GLN A 1 14  ? -6.941  2.483   21.043  1.00 63.32 ? 14  GLN A C    1  
ATOM 210    O O    . GLN A 1 14  ? -6.451  1.357   20.888  1.00 12.21 ? 14  GLN A O    1  
ATOM 211    C CB   . GLN A 1 14  ? -8.638  3.049   22.886  1.00 34.45 ? 14  GLN A CB   1  
ATOM 212    C CG   . GLN A 1 14  ? -9.250  1.686   23.311  1.00 31.34 ? 14  GLN A CG   1  
ATOM 213    C CD   . GLN A 1 14  ? -9.565  0.720   22.161  1.00 25.34 ? 14  GLN A CD   1  
ATOM 214    O OE1  . GLN A 1 14  ? -10.642 0.787   21.567  1.00 71.22 ? 14  GLN A OE1  1  
ATOM 215    N NE2  . GLN A 1 14  ? -8.647  -0.189  21.852  1.00 1.43  ? 14  GLN A NE2  1  
ATOM 216    H H    . GLN A 1 14  ? -7.310  5.160   22.358  1.00 1.03  ? 14  GLN A H    1  
ATOM 217    H HA   . GLN A 1 14  ? -6.556  2.478   23.167  1.00 0.14  ? 14  GLN A HA   1  
ATOM 218    H HB2  . GLN A 1 14  ? -8.748  3.728   23.727  1.00 34.53 ? 14  GLN A HB2  1  
ATOM 219    H HB3  . GLN A 1 14  ? -9.233  3.443   22.070  1.00 12.23 ? 14  GLN A HB3  1  
ATOM 220    H HG2  . GLN A 1 14  ? -8.558  1.197   23.986  1.00 44.44 ? 14  GLN A HG2  1  
ATOM 221    H HG3  . GLN A 1 14  ? -10.173 1.880   23.848  1.00 34.11 ? 14  GLN A HG3  1  
ATOM 222    H HE21 . GLN A 1 14  ? -7.814  -0.200  22.368  1.00 33.41 ? 14  GLN A HE21 1  
ATOM 223    H HE22 . GLN A 1 14  ? -8.839  -0.810  21.117  1.00 42.35 ? 14  GLN A HE22 1  
ATOM 224    N N    . ARG A 1 15  ? -7.251  3.308   20.013  1.00 44.55 ? 15  ARG A N    1  
ATOM 225    C CA   . ARG A 1 15  ? -7.302  2.834   18.619  1.00 13.50 ? 15  ARG A CA   1  
ATOM 226    C C    . ARG A 1 15  ? -7.407  4.018   17.632  1.00 41.41 ? 15  ARG A C    1  
ATOM 227    O O    . ARG A 1 15  ? -7.963  5.060   17.973  1.00 55.01 ? 15  ARG A O    1  
ATOM 228    C CB   . ARG A 1 15  ? -8.513  1.867   18.470  1.00 14.51 ? 15  ARG A CB   1  
ATOM 229    C CG   . ARG A 1 15  ? -8.451  0.898   17.280  1.00 32.10 ? 15  ARG A CG   1  
ATOM 230    C CD   . ARG A 1 15  ? -9.509  -0.207  17.392  1.00 72.23 ? 15  ARG A CD   1  
ATOM 231    N NE   . ARG A 1 15  ? -9.278  -1.274  16.415  1.00 63.32 ? 15  ARG A NE   1  
ATOM 232    C CZ   . ARG A 1 15  ? -9.406  -2.582  16.654  1.00 54.52 ? 15  ARG A CZ   1  
ATOM 233    N NH1  . ARG A 1 15  ? -9.763  -3.028  17.854  1.00 73.42 ? 15  ARG A NH1  1  
ATOM 234    N NH2  . ARG A 1 15  ? -9.221  -3.440  15.671  1.00 14.22 ? 15  ARG A NH2  1  
ATOM 235    H H    . ARG A 1 15  ? -7.451  4.253   20.199  1.00 73.14 ? 15  ARG A H    1  
ATOM 236    H HA   . ARG A 1 15  ? -6.382  2.292   18.419  1.00 52.22 ? 15  ARG A HA   1  
ATOM 237    H HB2  . ARG A 1 15  ? -8.579  1.271   19.375  1.00 53.20 ? 15  ARG A HB2  1  
ATOM 238    H HB3  . ARG A 1 15  ? -9.428  2.451   18.388  1.00 30.45 ? 15  ARG A HB3  1  
ATOM 239    H HG2  . ARG A 1 15  ? -8.616  1.451   16.362  1.00 0.33  ? 15  ARG A HG2  1  
ATOM 240    H HG3  . ARG A 1 15  ? -7.467  0.441   17.248  1.00 65.44 ? 15  ARG A HG3  1  
ATOM 241    H HD2  . ARG A 1 15  ? -9.484  -0.628  18.393  1.00 30.24 ? 15  ARG A HD2  1  
ATOM 242    H HD3  . ARG A 1 15  ? -10.490 0.219   17.212  1.00 12.31 ? 15  ARG A HD3  1  
ATOM 243    H HE   . ARG A 1 15  ? -9.002  -0.991  15.518  1.00 55.44 ? 15  ARG A HE   1  
ATOM 244    H HH11 . ARG A 1 15  ? -9.944  -2.384  18.602  1.00 22.05 ? 15  ARG A HH11 1  
ATOM 245    H HH12 . ARG A 1 15  ? -9.861  -4.014  18.019  1.00 33.31 ? 15  ARG A HH12 1  
ATOM 246    H HH21 . ARG A 1 15  ? -8.988  -3.116  14.750  1.00 64.35 ? 15  ARG A HH21 1  
ATOM 247    H HH22 . ARG A 1 15  ? -9.318  -4.422  15.838  1.00 14.10 ? 15  ARG A HH22 1  
ATOM 248    N N    . ILE A 1 16  ? -6.837  3.843   16.423  1.00 45.42 ? 16  ILE A N    1  
ATOM 249    C CA   . ILE A 1 16  ? -6.919  4.816   15.302  1.00 31.44 ? 16  ILE A CA   1  
ATOM 250    C C    . ILE A 1 16  ? -7.168  4.033   14.007  1.00 42.40 ? 16  ILE A C    1  
ATOM 251    O O    . ILE A 1 16  ? -6.439  3.072   13.724  1.00 23.13 ? 16  ILE A O    1  
ATOM 252    C CB   . ILE A 1 16  ? -5.596  5.669   15.144  1.00 35.33 ? 16  ILE A CB   1  
ATOM 253    C CG1  . ILE A 1 16  ? -5.392  6.621   16.367  1.00 63.52 ? 16  ILE A CG1  1  
ATOM 254    C CG2  . ILE A 1 16  ? -5.591  6.475   13.808  1.00 14.11 ? 16  ILE A CG2  1  
ATOM 255    C CD1  . ILE A 1 16  ? -3.978  7.138   16.542  1.00 3.42  ? 16  ILE A CD1  1  
ATOM 256    H H    . ILE A 1 16  ? -6.335  3.012   16.266  1.00 71.53 ? 16  ILE A H    1  
ATOM 257    H HA   . ILE A 1 16  ? -7.757  5.490   15.482  1.00 34.31 ? 16  ILE A HA   1  
ATOM 258    H HB   . ILE A 1 16  ? -4.763  4.969   15.106  1.00 50.34 ? 16  ILE A HB   1  
ATOM 259    H HG12 . ILE A 1 16  ? -6.042  7.479   16.272  1.00 65.14 ? 16  ILE A HG12 1  
ATOM 260    H HG13 . ILE A 1 16  ? -5.652  6.092   17.277  1.00 51.52 ? 16  ILE A HG13 1  
ATOM 261    H HG21 . ILE A 1 16  ? -4.641  6.959   13.673  1.00 43.53 ? 16  ILE A HG21 1  
ATOM 262    H HG22 . ILE A 1 16  ? -6.371  7.222   13.827  1.00 1.21  ? 16  ILE A HG22 1  
ATOM 263    H HG23 . ILE A 1 16  ? -5.766  5.806   12.971  1.00 23.15 ? 16  ILE A HG23 1  
ATOM 264    H HD11 . ILE A 1 16  ? -3.986  7.959   17.242  1.00 34.31 ? 16  ILE A HD11 1  
ATOM 265    H HD12 . ILE A 1 16  ? -3.576  7.471   15.596  1.00 3.20  ? 16  ILE A HD12 1  
ATOM 266    H HD13 . ILE A 1 16  ? -3.362  6.343   16.946  1.00 64.33 ? 16  ILE A HD13 1  
ATOM 267    N N    . TYR A 1 17  ? -8.174  4.464   13.224  1.00 51.11 ? 17  TYR A N    1  
ATOM 268    C CA   . TYR A 1 17  ? -8.614  3.759   12.012  1.00 63.33 ? 17  TYR A CA   1  
ATOM 269    C C    . TYR A 1 17  ? -9.559  4.621   11.170  1.00 15.21 ? 17  TYR A C    1  
ATOM 270    O O    . TYR A 1 17  ? -10.267 5.489   11.680  1.00 23.33 ? 17  TYR A O    1  
ATOM 271    C CB   . TYR A 1 17  ? -9.321  2.418   12.376  1.00 25.43 ? 17  TYR A CB   1  
ATOM 272    C CG   . TYR A 1 17  ? -10.520 2.578   13.323  1.00 34.44 ? 17  TYR A CG   1  
ATOM 273    C CD1  . TYR A 1 17  ? -10.322 2.747   14.694  1.00 70.31 ? 17  TYR A CD1  1  
ATOM 274    C CD2  . TYR A 1 17  ? -11.840 2.594   12.852  1.00 1.31  ? 17  TYR A CD2  1  
ATOM 275    C CE1  . TYR A 1 17  ? -11.377 2.925   15.553  1.00 22.20 ? 17  TYR A CE1  1  
ATOM 276    C CE2  . TYR A 1 17  ? -12.897 2.768   13.721  1.00 63.41 ? 17  TYR A CE2  1  
ATOM 277    C CZ   . TYR A 1 17  ? -12.658 2.936   15.062  1.00 22.41 ? 17  TYR A CZ   1  
ATOM 278    O OH   . TYR A 1 17  ? -13.708 3.099   15.918  1.00 51.24 ? 17  TYR A OH   1  
ATOM 279    H H    . TYR A 1 17  ? -8.632  5.297   13.464  1.00 44.24 ? 17  TYR A H    1  
ATOM 280    H HA   . TYR A 1 17  ? -7.724  3.550   11.411  1.00 54.14 ? 17  TYR A HA   1  
ATOM 281    H HB2  . TYR A 1 17  ? -9.665  1.933   11.469  1.00 61.12 ? 17  TYR A HB2  1  
ATOM 282    H HB3  . TYR A 1 17  ? -8.600  1.762   12.858  1.00 11.43 ? 17  TYR A HB3  1  
ATOM 283    H HD1  . TYR A 1 17  ? -9.307  2.731   15.083  1.00 52.22 ? 17  TYR A HD1  1  
ATOM 284    H HD2  . TYR A 1 17  ? -12.028 2.460   11.793  1.00 45.40 ? 17  TYR A HD2  1  
ATOM 285    H HE1  . TYR A 1 17  ? -11.193 3.059   16.612  1.00 14.01 ? 17  TYR A HE1  1  
ATOM 286    H HE2  . TYR A 1 17  ? -13.914 2.779   13.346  1.00 13.24 ? 17  TYR A HE2  1  
ATOM 287    H HH   . TYR A 1 17  ? -13.636 3.953   16.361  1.00 43.23 ? 17  TYR A HH   1  
ATOM 288    N N    . THR A 1 18  ? -9.576  4.317   9.878   1.00 33.40 ? 18  THR A N    1  
ATOM 289    C CA   . THR A 1 18  ? -10.428 4.962   8.895   1.00 24.34 ? 18  THR A CA   1  
ATOM 290    C C    . THR A 1 18  ? -11.813 4.290   8.910   1.00 30.20 ? 18  THR A C    1  
ATOM 291    O O    . THR A 1 18  ? -11.917 3.071   8.744   1.00 2.05  ? 18  THR A O    1  
ATOM 292    C CB   . THR A 1 18  ? -9.755  4.838   7.494   1.00 20.33 ? 18  THR A CB   1  
ATOM 293    O OG1  . THR A 1 18  ? -9.608  3.447   7.132   1.00 55.41 ? 18  THR A OG1  1  
ATOM 294    C CG2  . THR A 1 18  ? -8.357  5.494   7.484   1.00 31.12 ? 18  THR A CG2  1  
ATOM 295    H H    . THR A 1 18  ? -8.981  3.607   9.566   1.00 64.00 ? 18  THR A H    1  
ATOM 296    H HA   . THR A 1 18  ? -10.524 6.019   9.143   1.00 60.23 ? 18  THR A HA   1  
ATOM 297    H HB   . THR A 1 18  ? -10.376 5.334   6.754   1.00 62.12 ? 18  THR A HB   1  
ATOM 298    H HG1  . THR A 1 18  ? -10.430 2.976   7.293   1.00 70.44 ? 18  THR A HG1  1  
ATOM 299    H HG21 . THR A 1 18  ? -7.827  5.209   6.595   1.00 23.44 ? 18  THR A HG21 1  
ATOM 300    H HG22 . THR A 1 18  ? -7.793  5.161   8.343   1.00 50.44 ? 18  THR A HG22 1  
ATOM 301    H HG23 . THR A 1 18  ? -8.452  6.572   7.514   1.00 52.24 ? 18  THR A HG23 1  
ATOM 302    N N    . LYS A 1 19  ? -12.855 5.079   9.155   1.00 34.53 ? 19  LYS A N    1  
ATOM 303    C CA   . LYS A 1 19  ? -14.246 4.585   9.216   1.00 53.12 ? 19  LYS A CA   1  
ATOM 304    C C    . LYS A 1 19  ? -14.939 4.752   7.858   1.00 10.01 ? 19  LYS A C    1  
ATOM 305    O O    . LYS A 1 19  ? -16.009 4.186   7.627   1.00 20.41 ? 19  LYS A O    1  
ATOM 306    C CB   . LYS A 1 19  ? -15.015 5.351   10.312  1.00 34.45 ? 19  LYS A CB   1  
ATOM 307    C CG   . LYS A 1 19  ? -14.230 5.476   11.637  1.00 74.24 ? 19  LYS A CG   1  
ATOM 308    C CD   . LYS A 1 19  ? -14.978 6.284   12.708  1.00 52.22 ? 19  LYS A CD   1  
ATOM 309    C CE   . LYS A 1 19  ? -16.284 5.624   13.163  1.00 63.32 ? 19  LYS A CE   1  
ATOM 310    N NZ   . LYS A 1 19  ? -16.853 6.317   14.342  1.00 23.33 ? 19  LYS A NZ   1  
ATOM 311    H H    . LYS A 1 19  ? -12.690 6.030   9.316   1.00 25.22 ? 19  LYS A H    1  
ATOM 312    H HA   . LYS A 1 19  ? -14.230 3.526   9.471   1.00 10.23 ? 19  LYS A HA   1  
ATOM 313    H HB2  . LYS A 1 19  ? -15.247 6.350   9.955   1.00 5.13  ? 19  LYS A HB2  1  
ATOM 314    H HB3  . LYS A 1 19  ? -15.943 4.823   10.516  1.00 3.44  ? 19  LYS A HB3  1  
ATOM 315    H HG2  . LYS A 1 19  ? -14.030 4.481   12.025  1.00 11.21 ? 19  LYS A HG2  1  
ATOM 316    H HG3  . LYS A 1 19  ? -13.282 5.965   11.430  1.00 31.04 ? 19  LYS A HG3  1  
ATOM 317    H HD2  . LYS A 1 19  ? -14.331 6.394   13.572  1.00 44.45 ? 19  LYS A HD2  1  
ATOM 318    H HD3  . LYS A 1 19  ? -15.202 7.272   12.314  1.00 40.32 ? 19  LYS A HD3  1  
ATOM 319    H HE2  . LYS A 1 19  ? -17.001 5.659   12.355  1.00 32.30 ? 19  LYS A HE2  1  
ATOM 320    H HE3  . LYS A 1 19  ? -16.091 4.591   13.427  1.00 31.14 ? 19  LYS A HE3  1  
ATOM 321    H HZ1  . LYS A 1 19  ? -17.734 5.866   14.638  1.00 63.54 ? 19  LYS A HZ1  1  
ATOM 322    H HZ2  . LYS A 1 19  ? -17.037 7.311   14.122  1.00 44.41 ? 19  LYS A HZ2  1  
ATOM 323    H HZ3  . LYS A 1 19  ? -16.184 6.267   15.131  1.00 21.11 ? 19  LYS A HZ3  1  
ATOM 324    N N    . ASP A 1 20  ? -14.325 5.564   6.983   1.00 34.53 ? 20  ASP A N    1  
ATOM 325    C CA   . ASP A 1 20  ? -14.799 5.790   5.610   1.00 14.05 ? 20  ASP A CA   1  
ATOM 326    C C    . ASP A 1 20  ? -13.615 6.303   4.781   1.00 50.32 ? 20  ASP A C    1  
ATOM 327    O O    . ASP A 1 20  ? -12.802 7.092   5.269   1.00 73.30 ? 20  ASP A O    1  
ATOM 328    C CB   . ASP A 1 20  ? -15.981 6.804   5.597   1.00 34.12 ? 20  ASP A CB   1  
ATOM 329    C CG   . ASP A 1 20  ? -16.797 6.890   4.285   1.00 54.44 ? 20  ASP A CG   1  
ATOM 330    O OD1  . ASP A 1 20  ? -18.051 6.915   4.356   1.00 61.11 ? 20  ASP A OD1  1  
ATOM 331    O OD2  . ASP A 1 20  ? -16.206 6.999   3.193   1.00 25.41 ? 20  ASP A OD2  1  
ATOM 332    H H    . ASP A 1 20  ? -13.516 6.035   7.272   1.00 1.10  ? 20  ASP A H    1  
ATOM 333    H HA   . ASP A 1 20  ? -15.133 4.838   5.209   1.00 62.21 ? 20  ASP A HA   1  
ATOM 334    H HB2  . ASP A 1 20  ? -16.659 6.540   6.400   1.00 61.13 ? 20  ASP A HB2  1  
ATOM 335    H HB3  . ASP A 1 20  ? -15.591 7.794   5.809   1.00 73.21 ? 20  ASP A HB3  1  
ATOM 336    N N    . ILE A 1 21  ? -13.512 5.816   3.543   1.00 42.50 ? 21  ILE A N    1  
ATOM 337    C CA   . ILE A 1 21  ? -12.482 6.208   2.566   1.00 74.21 ? 21  ILE A CA   1  
ATOM 338    C C    . ILE A 1 21  ? -13.168 6.277   1.195   1.00 24.30 ? 21  ILE A C    1  
ATOM 339    O O    . ILE A 1 21  ? -14.028 5.439   0.901   1.00 44.32 ? 21  ILE A O    1  
ATOM 340    C CB   . ILE A 1 21  ? -11.286 5.171   2.492   1.00 23.14 ? 21  ILE A CB   1  
ATOM 341    C CG1  . ILE A 1 21  ? -10.659 4.902   3.893   1.00 53.31 ? 21  ILE A CG1  1  
ATOM 342    C CG2  . ILE A 1 21  ? -10.197 5.641   1.502   1.00 70.13 ? 21  ILE A CG2  1  
ATOM 343    C CD1  . ILE A 1 21  ? -9.611  3.804   3.918   1.00 72.01 ? 21  ILE A CD1  1  
ATOM 344    H H    . ILE A 1 21  ? -14.187 5.174   3.249   1.00 53.15 ? 21  ILE A H    1  
ATOM 345    H HA   . ILE A 1 21  ? -12.091 7.195   2.832   1.00 70.10 ? 21  ILE A HA   1  
ATOM 346    H HB   . ILE A 1 21  ? -11.688 4.234   2.113   1.00 13.23 ? 21  ILE A HB   1  
ATOM 347    H HG12 . ILE A 1 21  ? -10.194 5.806   4.261   1.00 72.35 ? 21  ILE A HG12 1  
ATOM 348    H HG13 . ILE A 1 21  ? -11.446 4.613   4.582   1.00 44.53 ? 21  ILE A HG13 1  
ATOM 349    H HG21 . ILE A 1 21  ? -10.625 5.750   0.510   1.00 3.14  ? 21  ILE A HG21 1  
ATOM 350    H HG22 . ILE A 1 21  ? -9.396  4.918   1.458   1.00 30.54 ? 21  ILE A HG22 1  
ATOM 351    H HG23 . ILE A 1 21  ? -9.798  6.595   1.819   1.00 14.23 ? 21  ILE A HG23 1  
ATOM 352    H HD11 . ILE A 1 21  ? -9.259  3.682   4.927   1.00 72.30 ? 21  ILE A HD11 1  
ATOM 353    H HD12 . ILE A 1 21  ? -8.782  4.070   3.278   1.00 63.32 ? 21  ILE A HD12 1  
ATOM 354    H HD13 . ILE A 1 21  ? -10.048 2.877   3.583   1.00 31.14 ? 21  ILE A HD13 1  
ATOM 355    N N    . SER A 1 22  ? -12.796 7.256   0.362   1.00 1.32  ? 22  SER A N    1  
ATOM 356    C CA   . SER A 1 22  ? -13.341 7.380   -0.993  1.00 41.24 ? 22  SER A CA   1  
ATOM 357    C C    . SER A 1 22  ? -12.379 8.176   -1.881  1.00 22.41 ? 22  SER A C    1  
ATOM 358    O O    . SER A 1 22  ? -12.113 9.348   -1.628  1.00 32.33 ? 22  SER A O    1  
ATOM 359    C CB   . SER A 1 22  ? -14.743 8.039   -0.988  1.00 10.42 ? 22  SER A CB   1  
ATOM 360    O OG   . SER A 1 22  ? -15.312 8.026   -2.289  1.00 5.44  ? 22  SER A OG   1  
ATOM 361    H H    . SER A 1 22  ? -12.135 7.914   0.668   1.00 73.12 ? 22  SER A H    1  
ATOM 362    H HA   . SER A 1 22  ? -13.434 6.373   -1.403  1.00 50.22 ? 22  SER A HA   1  
ATOM 363    H HB2  . SER A 1 22  ? -15.399 7.492   -0.322  1.00 25.44 ? 22  SER A HB2  1  
ATOM 364    H HB3  . SER A 1 22  ? -14.667 9.066   -0.650  1.00 24.45 ? 22  SER A HB3  1  
ATOM 365    H HG   . SER A 1 22  ? -15.056 7.211   -2.741  1.00 74.32 ? 22  SER A HG   1  
ATOM 366    N N    . PHE A 1 23  ? -11.854 7.514   -2.915  1.00 52.25 ? 23  PHE A N    1  
ATOM 367    C CA   . PHE A 1 23  ? -11.069 8.150   -3.980  1.00 41.30 ? 23  PHE A CA   1  
ATOM 368    C C    . PHE A 1 23  ? -11.909 8.096   -5.254  1.00 32.40 ? 23  PHE A C    1  
ATOM 369    O O    . PHE A 1 23  ? -12.575 7.098   -5.505  1.00 72.23 ? 23  PHE A O    1  
ATOM 370    C CB   . PHE A 1 23  ? -9.715  7.422   -4.182  1.00 41.22 ? 23  PHE A CB   1  
ATOM 371    C CG   . PHE A 1 23  ? -8.883  7.902   -5.379  1.00 63.05 ? 23  PHE A CG   1  
ATOM 372    C CD1  . PHE A 1 23  ? -8.097  9.050   -5.283  1.00 42.34 ? 23  PHE A CD1  1  
ATOM 373    C CD2  . PHE A 1 23  ? -8.890  7.213   -6.595  1.00 13.40 ? 23  PHE A CD2  1  
ATOM 374    C CE1  . PHE A 1 23  ? -7.349  9.497   -6.354  1.00 42.51 ? 23  PHE A CE1  1  
ATOM 375    C CE2  . PHE A 1 23  ? -8.140  7.664   -7.663  1.00 21.01 ? 23  PHE A CE2  1  
ATOM 376    C CZ   . PHE A 1 23  ? -7.373  8.803   -7.543  1.00 62.40 ? 23  PHE A CZ   1  
ATOM 377    H H    . PHE A 1 23  ? -12.026 6.553   -2.983  1.00 10.23 ? 23  PHE A H    1  
ATOM 378    H HA   . PHE A 1 23  ? -10.877 9.192   -3.703  1.00 34.33 ? 23  PHE A HA   1  
ATOM 379    H HB2  . PHE A 1 23  ? -9.116  7.571   -3.294  1.00 60.24 ? 23  PHE A HB2  1  
ATOM 380    H HB3  . PHE A 1 23  ? -9.888  6.366   -4.283  1.00 51.20 ? 23  PHE A HB3  1  
ATOM 381    H HD1  . PHE A 1 23  ? -8.075  9.599   -4.350  1.00 35.14 ? 23  PHE A HD1  1  
ATOM 382    H HD2  . PHE A 1 23  ? -9.487  6.315   -6.700  1.00 63.42 ? 23  PHE A HD2  1  
ATOM 383    H HE1  . PHE A 1 23  ? -6.748  10.394  -6.261  1.00 35.34 ? 23  PHE A HE1  1  
ATOM 384    H HE2  . PHE A 1 23  ? -8.159  7.125   -8.602  1.00 31.05 ? 23  PHE A HE2  1  
ATOM 385    H HZ   . PHE A 1 23  ? -6.788  9.150   -8.383  1.00 73.21 ? 23  PHE A HZ   1  
ATOM 386    N N    . GLU A 1 24  ? -11.890 9.172   -6.036  1.00 2.31  ? 24  GLU A N    1  
ATOM 387    C CA   . GLU A 1 24  ? -12.624 9.261   -7.299  1.00 52.14 ? 24  GLU A CA   1  
ATOM 388    C C    . GLU A 1 24  ? -11.777 10.013  -8.325  1.00 34.43 ? 24  GLU A C    1  
ATOM 389    O O    . GLU A 1 24  ? -11.586 11.209  -8.194  1.00 32.23 ? 24  GLU A O    1  
ATOM 390    C CB   . GLU A 1 24  ? -13.981 10.001  -7.099  1.00 23.20 ? 24  GLU A CB   1  
ATOM 391    C CG   . GLU A 1 24  ? -15.012 9.261   -6.223  1.00 1.31  ? 24  GLU A CG   1  
ATOM 392    C CD   . GLU A 1 24  ? -16.343 10.008  -6.096  1.00 32.42 ? 24  GLU A CD   1  
ATOM 393    O OE1  . GLU A 1 24  ? -17.046 10.153  -7.116  1.00 75.02 ? 24  GLU A OE1  1  
ATOM 394    O OE2  . GLU A 1 24  ? -16.695 10.462  -4.987  1.00 73.33 ? 24  GLU A OE2  1  
ATOM 395    H H    . GLU A 1 24  ? -11.358 9.938   -5.757  1.00 72.14 ? 24  GLU A H    1  
ATOM 396    H HA   . GLU A 1 24  ? -12.819 8.253   -7.669  1.00 5.53  ? 24  GLU A HA   1  
ATOM 397    H HB2  . GLU A 1 24  ? -13.782 10.964  -6.640  1.00 54.12 ? 24  GLU A HB2  1  
ATOM 398    H HB3  . GLU A 1 24  ? -14.432 10.173  -8.071  1.00 65.13 ? 24  GLU A HB3  1  
ATOM 399    H HG2  . GLU A 1 24  ? -15.203 8.285   -6.657  1.00 71.11 ? 24  GLU A HG2  1  
ATOM 400    H HG3  . GLU A 1 24  ? -14.585 9.120   -5.235  1.00 14.30 ? 24  GLU A HG3  1  
ATOM 401    N N    . ALA A 1 25  ? -11.279 9.301   -9.333  1.00 11.42 ? 25  ALA A N    1  
ATOM 402    C CA   . ALA A 1 25  ? -10.717 9.896   -10.554 1.00 31.41 ? 25  ALA A CA   1  
ATOM 403    C C    . ALA A 1 25  ? -11.792 9.726   -11.645 1.00 51.13 ? 25  ALA A C    1  
ATOM 404    O O    . ALA A 1 25  ? -11.821 8.695   -12.327 1.00 50.31 ? 25  ALA A O    1  
ATOM 405    C CB   . ALA A 1 25  ? -9.391  9.209   -10.957 1.00 14.52 ? 25  ALA A CB   1  
ATOM 406    H H    . ALA A 1 25  ? -11.278 8.332   -9.250  1.00 51.22 ? 25  ALA A H    1  
ATOM 407    H HA   . ALA A 1 25  ? -10.529 10.956  -10.388 1.00 34.15 ? 25  ALA A HA   1  
ATOM 408    H HB1  . ALA A 1 25  ? -9.099  9.533   -11.947 1.00 41.04 ? 25  ALA A HB1  1  
ATOM 409    H HB2  . ALA A 1 25  ? -9.517  8.133   -10.962 1.00 75.14 ? 25  ALA A HB2  1  
ATOM 410    H HB3  . ALA A 1 25  ? -8.605  9.463   -10.271 1.00 13.15 ? 25  ALA A HB3  1  
ATOM 411    N N    . PRO A 1 26  ? -12.742 10.720  -11.778 1.00 21.52 ? 26  PRO A N    1  
ATOM 412    C CA   . PRO A 1 26  ? -13.954 10.566  -12.628 1.00 5.32  ? 26  PRO A CA   1  
ATOM 413    C C    . PRO A 1 26  ? -13.605 10.481  -14.123 1.00 51.13 ? 26  PRO A C    1  
ATOM 414    O O    . PRO A 1 26  ? -14.250 9.759   -14.889 1.00 2.33  ? 26  PRO A O    1  
ATOM 415    C CB   . PRO A 1 26  ? -14.784 11.838  -12.302 1.00 54.55 ? 26  PRO A CB   1  
ATOM 416    C CG   . PRO A 1 26  ? -13.777 12.855  -11.849 1.00 64.31 ? 26  PRO A CG   1  
ATOM 417    C CD   . PRO A 1 26  ? -12.701 12.069  -11.132 1.00 55.32 ? 26  PRO A CD   1  
ATOM 418    H HA   . PRO A 1 26  ? -14.520 9.682   -12.346 1.00 41.53 ? 26  PRO A HA   1  
ATOM 419    H HB2  . PRO A 1 26  ? -15.331 12.183  -13.179 1.00 51.11 ? 26  PRO A HB2  1  
ATOM 420    H HB3  . PRO A 1 26  ? -15.484 11.629  -11.501 1.00 43.23 ? 26  PRO A HB3  1  
ATOM 421    H HG2  . PRO A 1 26  ? -13.362 13.376  -12.712 1.00 42.42 ? 26  PRO A HG2  1  
ATOM 422    H HG3  . PRO A 1 26  ? -14.234 13.568  -11.172 1.00 32.22 ? 26  PRO A HG3  1  
ATOM 423    H HD2  . PRO A 1 26  ? -11.729 12.534  -11.270 1.00 35.32 ? 26  PRO A HD2  1  
ATOM 424    H HD3  . PRO A 1 26  ? -12.926 11.985  -10.073 1.00 33.12 ? 26  PRO A HD3  1  
ATOM 425    N N    . ASN A 1 27  ? -12.550 11.216  -14.500 1.00 32.23 ? 27  ASN A N    1  
ATOM 426    C CA   . ASN A 1 27  ? -12.085 11.338  -15.887 1.00 13.34 ? 27  ASN A CA   1  
ATOM 427    C C    . ASN A 1 27  ? -10.715 10.666  -16.023 1.00 73.52 ? 27  ASN A C    1  
ATOM 428    O O    . ASN A 1 27  ? -9.984  11.016  -16.932 1.00 22.41 ? 27  ASN A O    1  
ATOM 429    C CB   . ASN A 1 27  ? -11.966 12.845  -16.283 1.00 41.03 ? 27  ASN A CB   1  
ATOM 430    C CG   . ASN A 1 27  ? -13.178 13.673  -15.880 1.00 3.31  ? 27  ASN A CG   1  
ATOM 431    O OD1  . ASN A 1 27  ? -14.322 13.282  -16.104 1.00 52.01 ? 27  ASN A OD1  1  
ATOM 432    N ND2  . ASN A 1 27  ? -12.940 14.795  -15.228 1.00 52.30 ? 27  ASN A ND2  1  
ATOM 433    H H    . ASN A 1 27  ? -12.056 11.699  -13.809 1.00 74.24 ? 27  ASN A H    1  
ATOM 434    H HA   . ASN A 1 27  ? -12.798 10.844  -16.552 1.00 33.33 ? 27  ASN A HA   1  
ATOM 435    H HB2  . ASN A 1 27  ? -11.084 13.272  -15.818 1.00 55.43 ? 27  ASN A HB2  1  
ATOM 436    H HB3  . ASN A 1 27  ? -11.857 12.918  -17.366 1.00 40.13 ? 27  ASN A HB3  1  
ATOM 437    H HD21 . ASN A 1 27  ? -11.995 15.033  -15.039 1.00 4.34  ? 27  ASN A HD21 1  
ATOM 438    H HD22 . ASN A 1 27  ? -13.700 15.349  -14.962 1.00 20.13 ? 27  ASN A HD22 1  
ATOM 439    N N    . ALA A 1 28  ? -10.408 9.660   -15.151 1.00 1.10  ? 28  ALA A N    1  
ATOM 440    C CA   . ALA A 1 28  ? -9.042  9.070   -15.020 1.00 44.11 ? 28  ALA A CA   1  
ATOM 441    C C    . ALA A 1 28  ? -8.344  8.772   -16.389 1.00 33.53 ? 28  ALA A C    1  
ATOM 442    O O    . ALA A 1 28  ? -7.286  9.329   -16.627 1.00 34.15 ? 28  ALA A O    1  
ATOM 443    C CB   . ALA A 1 28  ? -9.030  7.825   -14.119 1.00 51.11 ? 28  ALA A CB   1  
ATOM 444    H H    . ALA A 1 28  ? -11.122 9.319   -14.566 1.00 30.22 ? 28  ALA A H    1  
ATOM 445    H HA   . ALA A 1 28  ? -8.446  9.835   -14.503 1.00 43.20 ? 28  ALA A HA   1  
ATOM 446    H HB1  . ALA A 1 28  ? -8.018  7.615   -13.799 1.00 13.11 ? 28  ALA A HB1  1  
ATOM 447    H HB2  . ALA A 1 28  ? -9.427  6.971   -14.654 1.00 72.24 ? 28  ALA A HB2  1  
ATOM 448    H HB3  . ALA A 1 28  ? -9.625  8.001   -13.251 1.00 63.42 ? 28  ALA A HB3  1  
ATOM 449    N N    . PRO A 1 29  ? -8.960  7.998   -17.363 1.00 10.01 ? 29  PRO A N    1  
ATOM 450    C CA   . PRO A 1 29  ? -8.299  7.696   -18.669 1.00 63.14 ? 29  PRO A CA   1  
ATOM 451    C C    . PRO A 1 29  ? -7.983  8.971   -19.492 1.00 31.42 ? 29  PRO A C    1  
ATOM 452    O O    . PRO A 1 29  ? -7.023  9.013   -20.264 1.00 51.11 ? 29  PRO A O    1  
ATOM 453    C CB   . PRO A 1 29  ? -9.332  6.806   -19.411 1.00 21.21 ? 29  PRO A CB   1  
ATOM 454    C CG   . PRO A 1 29  ? -10.257 6.299   -18.345 1.00 21.05 ? 29  PRO A CG   1  
ATOM 455    C CD   . PRO A 1 29  ? -10.319 7.388   -17.309 1.00 53.44 ? 29  PRO A CD   1  
ATOM 456    H HA   . PRO A 1 29  ? -7.383  7.141   -18.511 1.00 45.45 ? 29  PRO A HA   1  
ATOM 457    H HB2  . PRO A 1 29  ? -9.881  7.388   -20.155 1.00 71.43 ? 29  PRO A HB2  1  
ATOM 458    H HB3  . PRO A 1 29  ? -8.833  5.976   -19.902 1.00 73.52 ? 29  PRO A HB3  1  
ATOM 459    H HG2  . PRO A 1 29  ? -11.241 6.110   -18.765 1.00 21.24 ? 29  PRO A HG2  1  
ATOM 460    H HG3  . PRO A 1 29  ? -9.858  5.389   -17.904 1.00 71.41 ? 29  PRO A HG3  1  
ATOM 461    H HD2  . PRO A 1 29  ? -11.088 8.119   -17.563 1.00 3.33  ? 29  PRO A HD2  1  
ATOM 462    H HD3  . PRO A 1 29  ? -10.513 6.975   -16.327 1.00 3.43  ? 29  PRO A HD3  1  
ATOM 463    N N    . HIS A 1 30  ? -8.805  10.009  -19.277 1.00 44.23 ? 30  HIS A N    1  
ATOM 464    C CA   . HIS A 1 30  ? -8.734  11.295  -20.001 1.00 42.12 ? 30  HIS A CA   1  
ATOM 465    C C    . HIS A 1 30  ? -7.787  12.266  -19.272 1.00 64.50 ? 30  HIS A C    1  
ATOM 466    O O    . HIS A 1 30  ? -7.143  13.091  -19.895 1.00 33.40 ? 30  HIS A O    1  
ATOM 467    C CB   . HIS A 1 30  ? -10.139 11.974  -20.081 1.00 44.05 ? 30  HIS A CB   1  
ATOM 468    C CG   . HIS A 1 30  ? -11.298 11.087  -20.469 1.00 1.24  ? 30  HIS A CG   1  
ATOM 469    N ND1  . HIS A 1 30  ? -12.202 11.417  -21.455 1.00 51.13 ? 30  HIS A ND1  1  
ATOM 470    C CD2  . HIS A 1 30  ? -11.757 9.929   -19.931 1.00 64.41 ? 30  HIS A CD2  1  
ATOM 471    C CE1  . HIS A 1 30  ? -13.154 10.512  -21.497 1.00 52.23 ? 30  HIS A CE1  1  
ATOM 472    N NE2  . HIS A 1 30  ? -12.905 9.602   -20.587 1.00 70.42 ? 30  HIS A NE2  1  
ATOM 473    H H    . HIS A 1 30  ? -9.480  9.916   -18.581 1.00 54.41 ? 30  HIS A H    1  
ATOM 474    H HA   . HIS A 1 30  ? -8.360  11.115  -21.007 1.00 3.53  ? 30  HIS A HA   1  
ATOM 475    H HB2  . HIS A 1 30  ? -10.387 12.397  -19.113 1.00 72.30 ? 30  HIS A HB2  1  
ATOM 476    H HB3  . HIS A 1 30  ? -10.089 12.785  -20.804 1.00 51.34 ? 30  HIS A HB3  1  
ATOM 477    H HD1  . HIS A 1 30  ? -12.153 12.202  -22.046 1.00 22.21 ? 30  HIS A HD1  1  
ATOM 478    H HD2  . HIS A 1 30  ? -11.296 9.371   -19.127 1.00 74.51 ? 30  HIS A HD2  1  
ATOM 479    H HE1  . HIS A 1 30  ? -14.004 10.521  -22.156 1.00 10.23 ? 30  HIS A HE1  1  
ATOM 480    H HE2  . HIS A 1 30  ? -13.469 8.826   -20.396 1.00 37.61 ? 30  HIS A HE2  1  
ATOM 481    N N    . VAL A 1 31  ? -7.714  12.148  -17.944 1.00 12.34 ? 31  VAL A N    1  
ATOM 482    C CA   . VAL A 1 31  ? -7.166  13.205  -17.070 1.00 14.02 ? 31  VAL A CA   1  
ATOM 483    C C    . VAL A 1 31  ? -5.621  13.308  -17.173 1.00 60.35 ? 31  VAL A C    1  
ATOM 484    O O    . VAL A 1 31  ? -5.029  14.332  -16.814 1.00 4.02  ? 31  VAL A O    1  
ATOM 485    C CB   . VAL A 1 31  ? -7.627  12.969  -15.581 1.00 13.43 ? 31  VAL A CB   1  
ATOM 486    C CG1  . VAL A 1 31  ? -6.779  11.903  -14.856 1.00 42.24 ? 31  VAL A CG1  1  
ATOM 487    C CG2  . VAL A 1 31  ? -7.683  14.282  -14.793 1.00 43.44 ? 31  VAL A CG2  1  
ATOM 488    H H    . VAL A 1 31  ? -8.033  11.318  -17.529 1.00 11.13 ? 31  VAL A H    1  
ATOM 489    H HA   . VAL A 1 31  ? -7.590  14.149  -17.406 1.00 23.23 ? 31  VAL A HA   1  
ATOM 490    H HB   . VAL A 1 31  ? -8.644  12.581  -15.619 1.00 3.24  ? 31  VAL A HB   1  
ATOM 491    H HG11 . VAL A 1 31  ? -6.800  10.980  -15.417 1.00 55.21 ? 31  VAL A HG11 1  
ATOM 492    H HG12 . VAL A 1 31  ? -7.183  11.722  -13.867 1.00 63.42 ? 31  VAL A HG12 1  
ATOM 493    H HG13 . VAL A 1 31  ? -5.758  12.242  -14.766 1.00 34.41 ? 31  VAL A HG13 1  
ATOM 494    H HG21 . VAL A 1 31  ? -6.726  14.775  -14.829 1.00 22.32 ? 31  VAL A HG21 1  
ATOM 495    H HG22 . VAL A 1 31  ? -7.937  14.078  -13.761 1.00 34.23 ? 31  VAL A HG22 1  
ATOM 496    H HG23 . VAL A 1 31  ? -8.435  14.936  -15.216 1.00 13.23 ? 31  VAL A HG23 1  
ATOM 497    N N    . PHE A 1 32  ? -4.989  12.242  -17.705 1.00 51.42 ? 32  PHE A N    1  
ATOM 498    C CA   . PHE A 1 32  ? -3.517  12.139  -17.806 1.00 64.44 ? 32  PHE A CA   1  
ATOM 499    C C    . PHE A 1 32  ? -2.989  12.883  -19.053 1.00 22.41 ? 32  PHE A C    1  
ATOM 500    O O    . PHE A 1 32  ? -1.824  13.287  -19.088 1.00 30.40 ? 32  PHE A O    1  
ATOM 501    C CB   . PHE A 1 32  ? -3.073  10.646  -17.815 1.00 42.43 ? 32  PHE A CB   1  
ATOM 502    C CG   . PHE A 1 32  ? -3.553  9.844   -16.593 1.00 1.21  ? 32  PHE A CG   1  
ATOM 503    C CD1  . PHE A 1 32  ? -3.221  10.248  -15.294 1.00 61.33 ? 32  PHE A CD1  1  
ATOM 504    C CD2  . PHE A 1 32  ? -4.343  8.699   -16.737 1.00 40.52 ? 32  PHE A CD2  1  
ATOM 505    C CE1  . PHE A 1 32  ? -3.676  9.541   -14.191 1.00 64.41 ? 32  PHE A CE1  1  
ATOM 506    C CE2  . PHE A 1 32  ? -4.789  7.996   -15.624 1.00 52.41 ? 32  PHE A CE2  1  
ATOM 507    C CZ   . PHE A 1 32  ? -4.461  8.421   -14.361 1.00 44.41 ? 32  PHE A CZ   1  
ATOM 508    H H    . PHE A 1 32  ? -5.532  11.509  -18.055 1.00 62.24 ? 32  PHE A H    1  
ATOM 509    H HA   . PHE A 1 32  ? -3.093  12.615  -16.927 1.00 4.22  ? 32  PHE A HA   1  
ATOM 510    H HB2  . PHE A 1 32  ? -3.455  10.168  -18.712 1.00 53.11 ? 32  PHE A HB2  1  
ATOM 511    H HB3  . PHE A 1 32  ? -1.990  10.598  -17.834 1.00 3.11  ? 32  PHE A HB3  1  
ATOM 512    H HD1  . PHE A 1 32  ? -2.611  11.131  -15.150 1.00 51.50 ? 32  PHE A HD1  1  
ATOM 513    H HD2  . PHE A 1 32  ? -4.604  8.354   -17.729 1.00 52.03 ? 32  PHE A HD2  1  
ATOM 514    H HE1  . PHE A 1 32  ? -3.405  9.856   -13.194 1.00 3.50  ? 32  PHE A HE1  1  
ATOM 515    H HE2  . PHE A 1 32  ? -5.411  7.117   -15.745 1.00 21.22 ? 32  PHE A HE2  1  
ATOM 516    H HZ   . PHE A 1 32  ? -4.824  7.873   -13.496 1.00 15.41 ? 32  PHE A HZ   1  
ATOM 517    N N    . GLN A 1 33  ? -3.862  13.060  -20.074 1.00 52.12 ? 33  GLN A N    1  
ATOM 518    C CA   . GLN A 1 33  ? -3.535  13.835  -21.303 1.00 0.11  ? 33  GLN A CA   1  
ATOM 519    C C    . GLN A 1 33  ? -3.936  15.319  -21.132 1.00 10.32 ? 33  GLN A C    1  
ATOM 520    O O    . GLN A 1 33  ? -3.561  16.168  -21.949 1.00 41.40 ? 33  GLN A O    1  
ATOM 521    C CB   . GLN A 1 33  ? -4.236  13.222  -22.562 1.00 35.42 ? 33  GLN A CB   1  
ATOM 522    C CG   . GLN A 1 33  ? -5.777  13.221  -22.485 1.00 53.51 ? 33  GLN A CG   1  
ATOM 523    C CD   . GLN A 1 33  ? -6.508  12.706  -23.727 1.00 33.30 ? 33  GLN A CD   1  
ATOM 524    O OE1  . GLN A 1 33  ? -6.020  12.804  -24.853 1.00 34.41 ? 33  GLN A OE1  1  
ATOM 525    N NE2  . GLN A 1 33  ? -7.717  12.191  -23.526 1.00 50.32 ? 33  GLN A NE2  1  
ATOM 526    H H    . GLN A 1 33  ? -4.756  12.673  -19.993 1.00 60.14 ? 33  GLN A H    1  
ATOM 527    H HA   . GLN A 1 33  ? -2.459  13.793  -21.449 1.00 73.11 ? 33  GLN A HA   1  
ATOM 528    H HB2  . GLN A 1 33  ? -3.937  13.788  -23.440 1.00 34.11 ? 33  GLN A HB2  1  
ATOM 529    H HB3  . GLN A 1 33  ? -3.899  12.201  -22.681 1.00 72.23 ? 33  GLN A HB3  1  
ATOM 530    H HG2  . GLN A 1 33  ? -6.061  12.589  -21.652 1.00 13.33 ? 33  GLN A HG2  1  
ATOM 531    H HG3  . GLN A 1 33  ? -6.118  14.224  -22.278 1.00 1.01  ? 33  GLN A HG3  1  
ATOM 532    H HE21 . GLN A 1 33  ? -8.060  12.161  -22.612 1.00 54.40 ? 33  GLN A HE21 1  
ATOM 533    H HE22 . GLN A 1 33  ? -8.219  11.869  -24.301 1.00 14.34 ? 33  GLN A HE22 1  
ATOM 534    N N    . LYS A 1 34  ? -4.709  15.616  -20.067 1.00 1.12  ? 34  LYS A N    1  
ATOM 535    C CA   . LYS A 1 34  ? -5.196  16.980  -19.767 1.00 22.30 ? 34  LYS A CA   1  
ATOM 536    C C    . LYS A 1 34  ? -4.094  17.859  -19.158 1.00 11.42 ? 34  LYS A C    1  
ATOM 537    O O    . LYS A 1 34  ? -3.045  17.354  -18.741 1.00 51.14 ? 34  LYS A O    1  
ATOM 538    C CB   . LYS A 1 34  ? -6.406  16.929  -18.795 1.00 34.20 ? 34  LYS A CB   1  
ATOM 539    C CG   . LYS A 1 34  ? -7.639  16.167  -19.324 1.00 53.04 ? 34  LYS A CG   1  
ATOM 540    C CD   . LYS A 1 34  ? -8.222  16.732  -20.645 1.00 73.44 ? 34  LYS A CD   1  
ATOM 541    C CE   . LYS A 1 34  ? -8.554  18.234  -20.568 1.00 33.33 ? 34  LYS A CE   1  
ATOM 542    N NZ   . LYS A 1 34  ? -9.417  18.555  -19.405 1.00 25.44 ? 34  LYS A NZ   1  
ATOM 543    H H    . LYS A 1 34  ? -4.950  14.890  -19.453 1.00 12.33 ? 34  LYS A H    1  
ATOM 544    H HA   . LYS A 1 34  ? -5.521  17.432  -20.700 1.00 63.04 ? 34  LYS A HA   1  
ATOM 545    H HB2  . LYS A 1 34  ? -6.086  16.452  -17.872 1.00 4.21  ? 34  LYS A HB2  1  
ATOM 546    H HB3  . LYS A 1 34  ? -6.712  17.945  -18.562 1.00 32.44 ? 34  LYS A HB3  1  
ATOM 547    H HG2  . LYS A 1 34  ? -7.356  15.137  -19.489 1.00 73.12 ? 34  LYS A HG2  1  
ATOM 548    H HG3  . LYS A 1 34  ? -8.411  16.194  -18.561 1.00 30.32 ? 34  LYS A HG3  1  
ATOM 549    H HD2  . LYS A 1 34  ? -7.506  16.571  -21.442 1.00 1.45  ? 34  LYS A HD2  1  
ATOM 550    H HD3  . LYS A 1 34  ? -9.133  16.187  -20.878 1.00 71.42 ? 34  LYS A HD3  1  
ATOM 551    H HE2  . LYS A 1 34  ? -7.633  18.795  -20.480 1.00 62.45 ? 34  LYS A HE2  1  
ATOM 552    H HE3  . LYS A 1 34  ? -9.064  18.531  -21.473 1.00 21.42 ? 34  LYS A HE3  1  
ATOM 553    H HZ1  . LYS A 1 34  ? -10.349 18.107  -19.514 1.00 72.41 ? 34  LYS A HZ1  1  
ATOM 554    H HZ2  . LYS A 1 34  ? -9.545  19.581  -19.325 1.00 51.21 ? 34  LYS A HZ2  1  
ATOM 555    H HZ3  . LYS A 1 34  ? -8.981  18.205  -18.529 1.00 34.03 ? 34  LYS A HZ3  1  
ATOM 556    N N    . ASP A 1 35  ? -4.379  19.175  -19.081 1.00 20.10 ? 35  ASP A N    1  
ATOM 557    C CA   . ASP A 1 35  ? -3.460  20.181  -18.511 1.00 71.14 ? 35  ASP A CA   1  
ATOM 558    C C    . ASP A 1 35  ? -3.368  19.962  -16.996 1.00 74.51 ? 35  ASP A C    1  
ATOM 559    O O    . ASP A 1 35  ? -4.379  20.094  -16.298 1.00 34.15 ? 35  ASP A O    1  
ATOM 560    C CB   . ASP A 1 35  ? -3.965  21.633  -18.788 1.00 32.25 ? 35  ASP A CB   1  
ATOM 561    C CG   . ASP A 1 35  ? -4.500  21.832  -20.213 1.00 41.41 ? 35  ASP A CG   1  
ATOM 562    O OD1  . ASP A 1 35  ? -5.702  21.556  -20.441 1.00 43.23 ? 35  ASP A OD1  1  
ATOM 563    O OD2  . ASP A 1 35  ? -3.734  22.225  -21.116 1.00 31.04 ? 35  ASP A OD2  1  
ATOM 564    H H    . ASP A 1 35  ? -5.248  19.477  -19.413 1.00 73.44 ? 35  ASP A H    1  
ATOM 565    H HA   . ASP A 1 35  ? -2.481  20.045  -18.963 1.00 45.34 ? 35  ASP A HA   1  
ATOM 566    H HB2  . ASP A 1 35  ? -4.761  21.880  -18.086 1.00 53.50 ? 35  ASP A HB2  1  
ATOM 567    H HB3  . ASP A 1 35  ? -3.147  22.328  -18.626 1.00 70.43 ? 35  ASP A HB3  1  
ATOM 568    N N    . TRP A 1 36  ? -2.168  19.626  -16.497 1.00 24.21 ? 36  TRP A N    1  
ATOM 569    C CA   . TRP A 1 36  ? -1.953  19.370  -15.069 1.00 53.12 ? 36  TRP A CA   1  
ATOM 570    C C    . TRP A 1 36  ? -1.729  20.702  -14.329 1.00 32.34 ? 36  TRP A C    1  
ATOM 571    O O    . TRP A 1 36  ? -0.595  21.172  -14.178 1.00 0.42  ? 36  TRP A O    1  
ATOM 572    C CB   . TRP A 1 36  ? -0.784  18.365  -14.827 1.00 3.22  ? 36  TRP A CB   1  
ATOM 573    C CG   . TRP A 1 36  ? -0.636  17.933  -13.372 1.00 52.20 ? 36  TRP A CG   1  
ATOM 574    C CD1  . TRP A 1 36  ? 0.450   18.119  -12.552 1.00 11.53 ? 36  TRP A CD1  1  
ATOM 575    C CD2  . TRP A 1 36  ? -1.628  17.264  -12.565 1.00 33.24 ? 36  TRP A CD2  1  
ATOM 576    N NE1  . TRP A 1 36  ? 0.198   17.595  -11.307 1.00 24.41 ? 36  TRP A NE1  1  
ATOM 577    C CE2  . TRP A 1 36  ? -1.069  17.067  -11.290 1.00 34.24 ? 36  TRP A CE2  1  
ATOM 578    C CE3  . TRP A 1 36  ? -2.932  16.810  -12.804 1.00 11.32 ? 36  TRP A CE3  1  
ATOM 579    C CZ2  . TRP A 1 36  ? -1.769  16.438  -10.260 1.00 65.42 ? 36  TRP A CZ2  1  
ATOM 580    C CZ3  . TRP A 1 36  ? -3.627  16.191  -11.786 1.00 51.23 ? 36  TRP A CZ3  1  
ATOM 581    C CH2  . TRP A 1 36  ? -3.044  16.006  -10.525 1.00 24.34 ? 36  TRP A CH2  1  
ATOM 582    H H    . TRP A 1 36  ? -1.409  19.564  -17.109 1.00 63.54 ? 36  TRP A H    1  
ATOM 583    H HA   . TRP A 1 36  ? -2.867  18.919  -14.679 1.00 42.11 ? 36  TRP A HA   1  
ATOM 584    H HB2  . TRP A 1 36  ? -0.954  17.474  -15.418 1.00 11.43 ? 36  TRP A HB2  1  
ATOM 585    H HB3  . TRP A 1 36  ? 0.149   18.819  -15.144 1.00 65.22 ? 36  TRP A HB3  1  
ATOM 586    H HD1  . TRP A 1 36  ? 1.371   18.598  -12.857 1.00 22.10 ? 36  TRP A HD1  1  
ATOM 587    H HE1  . TRP A 1 36  ? 0.822   17.601  -10.549 1.00 45.44 ? 36  TRP A HE1  1  
ATOM 588    H HE3  . TRP A 1 36  ? -3.406  16.956  -13.767 1.00 75.22 ? 36  TRP A HE3  1  
ATOM 589    H HZ2  . TRP A 1 36  ? -1.330  16.286  -9.283  1.00 34.31 ? 36  TRP A HZ2  1  
ATOM 590    H HZ3  . TRP A 1 36  ? -4.641  15.842  -11.963 1.00 14.22 ? 36  TRP A HZ3  1  
ATOM 591    H HH2  . TRP A 1 36  ? -3.624  15.515  -9.754  1.00 11.31 ? 36  TRP A HH2  1  
ATOM 592    N N    . GLN A 1 37  ? -2.848  21.333  -13.949 1.00 1.15  ? 37  GLN A N    1  
ATOM 593    C CA   . GLN A 1 37  ? -2.878  22.512  -13.073 1.00 23.13 ? 37  GLN A CA   1  
ATOM 594    C C    . GLN A 1 37  ? -3.863  22.220  -11.917 1.00 14.23 ? 37  GLN A C    1  
ATOM 595    O O    . GLN A 1 37  ? -5.048  22.579  -11.998 1.00 51.43 ? 37  GLN A O    1  
ATOM 596    C CB   . GLN A 1 37  ? -3.274  23.785  -13.879 1.00 3.12  ? 37  GLN A CB   1  
ATOM 597    C CG   . GLN A 1 37  ? -3.152  25.105  -13.092 1.00 20.54 ? 37  GLN A CG   1  
ATOM 598    C CD   . GLN A 1 37  ? -1.722  25.377  -12.609 1.00 22.21 ? 37  GLN A CD   1  
ATOM 599    O OE1  . GLN A 1 37  ? -1.334  25.004  -11.500 1.00 30.20 ? 37  GLN A OE1  1  
ATOM 600    N NE2  . GLN A 1 37  ? -0.914  25.997  -13.453 1.00 64.51 ? 37  GLN A NE2  1  
ATOM 601    H H    . GLN A 1 37  ? -3.702  20.995  -14.289 1.00 75.41 ? 37  GLN A H    1  
ATOM 602    H HA   . GLN A 1 37  ? -1.886  22.655  -12.648 1.00 2.31  ? 37  GLN A HA   1  
ATOM 603    H HB2  . GLN A 1 37  ? -2.633  23.855  -14.753 1.00 61.53 ? 37  GLN A HB2  1  
ATOM 604    H HB3  . GLN A 1 37  ? -4.302  23.682  -14.221 1.00 62.43 ? 37  GLN A HB3  1  
ATOM 605    H HG2  . GLN A 1 37  ? -3.471  25.925  -13.726 1.00 43.24 ? 37  GLN A HG2  1  
ATOM 606    H HG3  . GLN A 1 37  ? -3.805  25.056  -12.229 1.00 21.10 ? 37  GLN A HG3  1  
ATOM 607    H HE21 . GLN A 1 37  ? -1.267  26.248  -14.332 1.00 63.35 ? 37  GLN A HE21 1  
ATOM 608    H HE22 . GLN A 1 37  ? 0.006   26.174  -13.169 1.00 60.42 ? 37  GLN A HE22 1  
ATOM 609    N N    . PRO A 1 38  ? -3.404  21.472  -10.855 1.00 52.52 ? 38  PRO A N    1  
ATOM 610    C CA   . PRO A 1 38  ? -4.284  21.033  -9.754  1.00 75.03 ? 38  PRO A CA   1  
ATOM 611    C C    . PRO A 1 38  ? -4.678  22.196  -8.810  1.00 23.53 ? 38  PRO A C    1  
ATOM 612    O O    . PRO A 1 38  ? -3.858  22.724  -8.049  1.00 1.40  ? 38  PRO A O    1  
ATOM 613    C CB   . PRO A 1 38  ? -3.445  19.941  -9.038  1.00 42.53 ? 38  PRO A CB   1  
ATOM 614    C CG   . PRO A 1 38  ? -2.014  20.322  -9.294  1.00 2.04  ? 38  PRO A CG   1  
ATOM 615    C CD   . PRO A 1 38  ? -1.998  20.994  -10.656 1.00 22.33 ? 38  PRO A CD   1  
ATOM 616    H HA   . PRO A 1 38  ? -5.193  20.578  -10.149 1.00 72.43 ? 38  PRO A HA   1  
ATOM 617    H HB2  . PRO A 1 38  ? -3.668  19.922  -7.973  1.00 41.12 ? 38  PRO A HB2  1  
ATOM 618    H HB3  . PRO A 1 38  ? -3.653  18.967  -9.469  1.00 52.30 ? 38  PRO A HB3  1  
ATOM 619    H HG2  . PRO A 1 38  ? -1.672  21.008  -8.521  1.00 34.23 ? 38  PRO A HG2  1  
ATOM 620    H HG3  . PRO A 1 38  ? -1.384  19.437  -9.306  1.00 23.15 ? 38  PRO A HG3  1  
ATOM 621    H HD2  . PRO A 1 38  ? -1.302  21.827  -10.664 1.00 52.31 ? 38  PRO A HD2  1  
ATOM 622    H HD3  . PRO A 1 38  ? -1.728  20.280  -11.429 1.00 63.51 ? 38  PRO A HD3  1  
ATOM 623    N N    . GLU A 1 39  ? -5.948  22.597  -8.907  1.00 32.15 ? 39  GLU A N    1  
ATOM 624    C CA   . GLU A 1 39  ? -6.578  23.565  -8.005  1.00 62.51 ? 39  GLU A CA   1  
ATOM 625    C C    . GLU A 1 39  ? -7.297  22.762  -6.924  1.00 60.03 ? 39  GLU A C    1  
ATOM 626    O O    . GLU A 1 39  ? -8.444  22.326  -7.107  1.00 10.31 ? 39  GLU A O    1  
ATOM 627    C CB   . GLU A 1 39  ? -7.579  24.464  -8.784  1.00 33.20 ? 39  GLU A CB   1  
ATOM 628    C CG   . GLU A 1 39  ? -6.961  25.226  -9.969  1.00 0.25  ? 39  GLU A CG   1  
ATOM 629    C CD   . GLU A 1 39  ? -5.816  26.156  -9.548  1.00 21.34 ? 39  GLU A CD   1  
ATOM 630    O OE1  . GLU A 1 39  ? -6.079  27.142  -8.827  1.00 52.45 ? 39  GLU A OE1  1  
ATOM 631    O OE2  . GLU A 1 39  ? -4.659  25.918  -9.939  1.00 13.10 ? 39  GLU A OE2  1  
ATOM 632    H H    . GLU A 1 39  ? -6.484  22.235  -9.633  1.00 41.25 ? 39  GLU A H    1  
ATOM 633    H HA   . GLU A 1 39  ? -5.809  24.187  -7.548  1.00 43.50 ? 39  GLU A HA   1  
ATOM 634    H HB2  . GLU A 1 39  ? -8.382  23.842  -9.165  1.00 62.02 ? 39  GLU A HB2  1  
ATOM 635    H HB3  . GLU A 1 39  ? -8.005  25.190  -8.102  1.00 74.12 ? 39  GLU A HB3  1  
ATOM 636    H HG2  . GLU A 1 39  ? -6.590  24.500  -10.688 1.00 54.04 ? 39  GLU A HG2  1  
ATOM 637    H HG3  . GLU A 1 39  ? -7.734  25.820  -10.446 1.00 54.31 ? 39  GLU A HG3  1  
ATOM 638    N N    . VAL A 1 40  ? -6.565  22.492  -5.840  1.00 13.44 ? 40  VAL A N    1  
ATOM 639    C CA   . VAL A 1 40  ? -7.010  21.583  -4.788  1.00 71.02 ? 40  VAL A CA   1  
ATOM 640    C C    . VAL A 1 40  ? -7.839  22.335  -3.717  1.00 21.14 ? 40  VAL A C    1  
ATOM 641    O O    . VAL A 1 40  ? -7.331  23.219  -3.022  1.00 32.44 ? 40  VAL A O    1  
ATOM 642    C CB   . VAL A 1 40  ? -5.798  20.812  -4.139  1.00 64.30 ? 40  VAL A CB   1  
ATOM 643    C CG1  . VAL A 1 40  ? -6.278  19.827  -3.041  1.00 62.32 ? 40  VAL A CG1  1  
ATOM 644    C CG2  . VAL A 1 40  ? -4.949  20.085  -5.220  1.00 23.54 ? 40  VAL A CG2  1  
ATOM 645    H H    . VAL A 1 40  ? -5.692  22.926  -5.744  1.00 20.30 ? 40  VAL A H    1  
ATOM 646    H HA   . VAL A 1 40  ? -7.650  20.836  -5.255  1.00 72.20 ? 40  VAL A HA   1  
ATOM 647    H HB   . VAL A 1 40  ? -5.156  21.548  -3.660  1.00 11.22 ? 40  VAL A HB   1  
ATOM 648    H HG11 . VAL A 1 40  ? -6.941  19.088  -3.473  1.00 63.32 ? 40  VAL A HG11 1  
ATOM 649    H HG12 . VAL A 1 40  ? -6.812  20.372  -2.270  1.00 11.52 ? 40  VAL A HG12 1  
ATOM 650    H HG13 . VAL A 1 40  ? -5.428  19.328  -2.592  1.00 62.33 ? 40  VAL A HG13 1  
ATOM 651    H HG21 . VAL A 1 40  ? -4.583  20.805  -5.943  1.00 50.03 ? 40  VAL A HG21 1  
ATOM 652    H HG22 . VAL A 1 40  ? -5.553  19.346  -5.731  1.00 40.55 ? 40  VAL A HG22 1  
ATOM 653    H HG23 . VAL A 1 40  ? -4.103  19.591  -4.755  1.00 73.30 ? 40  VAL A HG23 1  
ATOM 654    N N    . LYS A 1 41  ? -9.136  21.992  -3.650  1.00 2.23  ? 41  LYS A N    1  
ATOM 655    C CA   . LYS A 1 41  ? -10.062 22.453  -2.608  1.00 11.25 ? 41  LYS A CA   1  
ATOM 656    C C    . LYS A 1 41  ? -9.867  21.623  -1.319  1.00 4.31  ? 41  LYS A C    1  
ATOM 657    O O    . LYS A 1 41  ? -9.737  20.392  -1.375  1.00 74.44 ? 41  LYS A O    1  
ATOM 658    C CB   . LYS A 1 41  ? -11.530 22.311  -3.106  1.00 5.14  ? 41  LYS A CB   1  
ATOM 659    C CG   . LYS A 1 41  ? -12.605 22.677  -2.051  1.00 50.03 ? 41  LYS A CG   1  
ATOM 660    C CD   . LYS A 1 41  ? -14.038 22.290  -2.469  1.00 32.23 ? 41  LYS A CD   1  
ATOM 661    C CE   . LYS A 1 41  ? -15.072 22.597  -1.370  1.00 75.11 ? 41  LYS A CE   1  
ATOM 662    N NZ   . LYS A 1 41  ? -16.419 22.089  -1.731  1.00 33.05 ? 41  LYS A NZ   1  
ATOM 663    H H    . LYS A 1 41  ? -9.489  21.404  -4.345  1.00 74.53 ? 41  LYS A H    1  
ATOM 664    H HA   . LYS A 1 41  ? -9.856  23.499  -2.400  1.00 20.21 ? 41  LYS A HA   1  
ATOM 665    H HB2  . LYS A 1 41  ? -11.665 22.956  -3.968  1.00 52.02 ? 41  LYS A HB2  1  
ATOM 666    H HB3  . LYS A 1 41  ? -11.694 21.283  -3.420  1.00 32.24 ? 41  LYS A HB3  1  
ATOM 667    H HG2  . LYS A 1 41  ? -12.371 22.166  -1.124  1.00 13.12 ? 41  LYS A HG2  1  
ATOM 668    H HG3  . LYS A 1 41  ? -12.568 23.747  -1.877  1.00 2.41  ? 41  LYS A HG3  1  
ATOM 669    H HD2  . LYS A 1 41  ? -14.310 22.842  -3.363  1.00 22.22 ? 41  LYS A HD2  1  
ATOM 670    H HD3  . LYS A 1 41  ? -14.067 21.228  -2.687  1.00 25.43 ? 41  LYS A HD3  1  
ATOM 671    H HE2  . LYS A 1 41  ? -14.762 22.125  -0.444  1.00 41.02 ? 41  LYS A HE2  1  
ATOM 672    H HE3  . LYS A 1 41  ? -15.132 23.667  -1.222  1.00 43.13 ? 41  LYS A HE3  1  
ATOM 673    H HZ1  . LYS A 1 41  ? -16.392 21.054  -1.831  1.00 21.22 ? 41  LYS A HZ1  1  
ATOM 674    H HZ2  . LYS A 1 41  ? -16.727 22.501  -2.634  1.00 31.41 ? 41  LYS A HZ2  1  
ATOM 675    H HZ3  . LYS A 1 41  ? -17.107 22.337  -0.995  1.00 63.12 ? 41  LYS A HZ3  1  
ATOM 676    N N    . LEU A 1 42  ? -9.860  22.316  -0.170  1.00 51.21 ? 42  LEU A N    1  
ATOM 677    C CA   . LEU A 1 42  ? -9.775  21.699  1.165   1.00 63.14 ? 42  LEU A CA   1  
ATOM 678    C C    . LEU A 1 42  ? -11.129 21.888  1.861   1.00 44.05 ? 42  LEU A C    1  
ATOM 679    O O    . LEU A 1 42  ? -11.607 23.024  1.968   1.00 45.44 ? 42  LEU A O    1  
ATOM 680    C CB   . LEU A 1 42  ? -8.639  22.346  2.022   1.00 70.11 ? 42  LEU A CB   1  
ATOM 681    C CG   . LEU A 1 42  ? -7.303  22.705  1.275   1.00 40.14 ? 42  LEU A CG   1  
ATOM 682    C CD1  . LEU A 1 42  ? -7.395  24.085  0.568   1.00 22.25 ? 42  LEU A CD1  1  
ATOM 683    C CD2  . LEU A 1 42  ? -6.084  22.641  2.221   1.00 75.44 ? 42  LEU A CD2  1  
ATOM 684    H H    . LEU A 1 42  ? -9.917  23.292  -0.222  1.00 40.35 ? 42  LEU A H    1  
ATOM 685    H HA   . LEU A 1 42  ? -9.574  20.634  1.048   1.00 63.44 ? 42  LEU A HA   1  
ATOM 686    H HB2  . LEU A 1 42  ? -9.025  23.255  2.479   1.00 74.03 ? 42  LEU A HB2  1  
ATOM 687    H HB3  . LEU A 1 42  ? -8.403  21.654  2.825   1.00 72.42 ? 42  LEU A HB3  1  
ATOM 688    H HG   . LEU A 1 42  ? -7.137  21.969  0.495   1.00 23.12 ? 42  LEU A HG   1  
ATOM 689    H HD11 . LEU A 1 42  ? -6.464  24.299  0.059   1.00 50.13 ? 42  LEU A HD11 1  
ATOM 690    H HD12 . LEU A 1 42  ? -7.592  24.861  1.294   1.00 62.43 ? 42  LEU A HD12 1  
ATOM 691    H HD13 . LEU A 1 42  ? -8.199  24.063  -0.158  1.00 43.51 ? 42  LEU A HD13 1  
ATOM 692    H HD21 . LEU A 1 42  ? -5.994  21.643  2.627   1.00 65.11 ? 42  LEU A HD21 1  
ATOM 693    H HD22 . LEU A 1 42  ? -6.206  23.347  3.032   1.00 22.25 ? 42  LEU A HD22 1  
ATOM 694    H HD23 . LEU A 1 42  ? -5.181  22.882  1.675   1.00 3.12  ? 42  LEU A HD23 1  
ATOM 695    N N    . ASP A 1 43  ? -11.739 20.793  2.324   1.00 13.23 ? 43  ASP A N    1  
ATOM 696    C CA   . ASP A 1 43  ? -13.037 20.829  3.020   1.00 64.02 ? 43  ASP A CA   1  
ATOM 697    C C    . ASP A 1 43  ? -12.977 19.922  4.257   1.00 72.12 ? 43  ASP A C    1  
ATOM 698    O O    . ASP A 1 43  ? -12.606 18.757  4.151   1.00 33.22 ? 43  ASP A O    1  
ATOM 699    C CB   . ASP A 1 43  ? -14.176 20.393  2.057   1.00 71.41 ? 43  ASP A CB   1  
ATOM 700    C CG   . ASP A 1 43  ? -15.581 20.555  2.670   1.00 53.31 ? 43  ASP A CG   1  
ATOM 701    O OD1  . ASP A 1 43  ? -16.130 21.678  2.616   1.00 3.05  ? 43  ASP A OD1  1  
ATOM 702    O OD2  . ASP A 1 43  ? -16.131 19.574  3.216   1.00 10.22 ? 43  ASP A OD2  1  
ATOM 703    H H    . ASP A 1 43  ? -11.305 19.924  2.192   1.00 24.21 ? 43  ASP A H    1  
ATOM 704    H HA   . ASP A 1 43  ? -13.223 21.854  3.345   1.00 72.13 ? 43  ASP A HA   1  
ATOM 705    H HB2  . ASP A 1 43  ? -14.120 20.995  1.155   1.00 41.21 ? 43  ASP A HB2  1  
ATOM 706    H HB3  . ASP A 1 43  ? -14.031 19.355  1.778   1.00 31.51 ? 43  ASP A HB3  1  
ATOM 707    N N    . LEU A 1 44  ? -13.319 20.478  5.431   1.00 4.51  ? 44  LEU A N    1  
ATOM 708    C CA   . LEU A 1 44  ? -13.255 19.760  6.718   1.00 13.01 ? 44  LEU A CA   1  
ATOM 709    C C    . LEU A 1 44  ? -14.668 19.437  7.217   1.00 60.33 ? 44  LEU A C    1  
ATOM 710    O O    . LEU A 1 44  ? -15.548 20.308  7.228   1.00 2.20  ? 44  LEU A O    1  
ATOM 711    C CB   . LEU A 1 44  ? -12.498 20.587  7.804   1.00 54.41 ? 44  LEU A CB   1  
ATOM 712    C CG   . LEU A 1 44  ? -10.996 20.947  7.514   1.00 75.31 ? 44  LEU A CG   1  
ATOM 713    C CD1  . LEU A 1 44  ? -10.181 19.701  7.078   1.00 32.13 ? 44  LEU A CD1  1  
ATOM 714    C CD2  . LEU A 1 44  ? -10.864 22.113  6.496   1.00 63.02 ? 44  LEU A CD2  1  
ATOM 715    H H    . LEU A 1 44  ? -13.635 21.403  5.432   1.00 73.51 ? 44  LEU A H    1  
ATOM 716    H HA   . LEU A 1 44  ? -12.714 18.826  6.559   1.00 62.04 ? 44  LEU A HA   1  
ATOM 717    H HB2  . LEU A 1 44  ? -13.046 21.510  7.970   1.00 22.42 ? 44  LEU A HB2  1  
ATOM 718    H HB3  . LEU A 1 44  ? -12.527 20.018  8.730   1.00 73.21 ? 44  LEU A HB3  1  
ATOM 719    H HG   . LEU A 1 44  ? -10.552 21.290  8.444   1.00 23.23 ? 44  LEU A HG   1  
ATOM 720    H HD11 . LEU A 1 44  ? -10.236 18.941  7.847   1.00 43.23 ? 44  LEU A HD11 1  
ATOM 721    H HD12 . LEU A 1 44  ? -9.146  19.976  6.931   1.00 0.54  ? 44  LEU A HD12 1  
ATOM 722    H HD13 . LEU A 1 44  ? -10.579 19.303  6.152   1.00 34.44 ? 44  LEU A HD13 1  
ATOM 723    H HD21 . LEU A 1 44  ? -9.822  22.367  6.368   1.00 44.51 ? 44  LEU A HD21 1  
ATOM 724    H HD22 . LEU A 1 44  ? -11.393 22.984  6.866   1.00 74.34 ? 44  LEU A HD22 1  
ATOM 725    H HD23 . LEU A 1 44  ? -11.284 21.822  5.542   1.00 21.02 ? 44  LEU A HD23 1  
ATOM 726    N N    . ASP A 1 45  ? -14.854 18.188  7.644   1.00 10.42 ? 45  ASP A N    1  
ATOM 727    C CA   . ASP A 1 45  ? -16.081 17.707  8.290   1.00 35.54 ? 45  ASP A CA   1  
ATOM 728    C C    . ASP A 1 45  ? -15.706 17.103  9.654   1.00 62.14 ? 45  ASP A C    1  
ATOM 729    O O    . ASP A 1 45  ? -14.622 16.533  9.810   1.00 2.34  ? 45  ASP A O    1  
ATOM 730    C CB   . ASP A 1 45  ? -16.792 16.662  7.387   1.00 22.30 ? 45  ASP A CB   1  
ATOM 731    C CG   . ASP A 1 45  ? -17.999 15.976  8.067   1.00 42.10 ? 45  ASP A CG   1  
ATOM 732    O OD1  . ASP A 1 45  ? -17.822 14.896  8.676   1.00 71.40 ? 45  ASP A OD1  1  
ATOM 733    O OD2  . ASP A 1 45  ? -19.123 16.516  8.003   1.00 12.23 ? 45  ASP A OD2  1  
ATOM 734    H H    . ASP A 1 45  ? -14.121 17.548  7.521   1.00 61.04 ? 45  ASP A H    1  
ATOM 735    H HA   . ASP A 1 45  ? -16.747 18.554  8.450   1.00 12.34 ? 45  ASP A HA   1  
ATOM 736    H HB2  . ASP A 1 45  ? -17.136 17.157  6.484   1.00 63.53 ? 45  ASP A HB2  1  
ATOM 737    H HB3  . ASP A 1 45  ? -16.074 15.900  7.097   1.00 13.13 ? 45  ASP A HB3  1  
ATOM 738    N N    . THR A 1 46  ? -16.604 17.250  10.639  1.00 51.24 ? 46  THR A N    1  
ATOM 739    C CA   . THR A 1 46  ? -16.412 16.732  12.003  1.00 11.42 ? 46  THR A CA   1  
ATOM 740    C C    . THR A 1 46  ? -17.527 15.729  12.349  1.00 71.32 ? 46  THR A C    1  
ATOM 741    O O    . THR A 1 46  ? -18.696 15.954  12.012  1.00 13.42 ? 46  THR A O    1  
ATOM 742    C CB   . THR A 1 46  ? -16.412 17.908  13.034  1.00 61.33 ? 46  THR A CB   1  
ATOM 743    O OG1  . THR A 1 46  ? -15.387 18.860  12.686  1.00 64.33 ? 46  THR A OG1  1  
ATOM 744    C CG2  . THR A 1 46  ? -16.184 17.422  14.477  1.00 22.04 ? 46  THR A CG2  1  
ATOM 745    H H    . THR A 1 46  ? -17.438 17.720  10.437  1.00 73.30 ? 46  THR A H    1  
ATOM 746    H HA   . THR A 1 46  ? -15.445 16.228  12.055  1.00 21.41 ? 46  THR A HA   1  
ATOM 747    H HB   . THR A 1 46  ? -17.375 18.412  12.985  1.00 22.32 ? 46  THR A HB   1  
ATOM 748    H HG1  . THR A 1 46  ? -15.152 18.750  11.760  1.00 24.31 ? 46  THR A HG1  1  
ATOM 749    H HG21 . THR A 1 46  ? -16.213 18.267  15.151  1.00 74.23 ? 46  THR A HG21 1  
ATOM 750    H HG22 . THR A 1 46  ? -15.219 16.940  14.553  1.00 11.24 ? 46  THR A HG22 1  
ATOM 751    H HG23 . THR A 1 46  ? -16.958 16.718  14.756  1.00 33.25 ? 46  THR A HG23 1  
ATOM 752    N N    . ALA A 1 47  ? -17.152 14.638  13.034  1.00 4.24  ? 47  ALA A N    1  
ATOM 753    C CA   . ALA A 1 47  ? -18.085 13.608  13.510  1.00 10.44 ? 47  ALA A CA   1  
ATOM 754    C C    . ALA A 1 47  ? -17.780 13.288  14.982  1.00 44.05 ? 47  ALA A C    1  
ATOM 755    O O    . ALA A 1 47  ? -16.616 13.086  15.348  1.00 11.24 ? 47  ALA A O    1  
ATOM 756    C CB   . ALA A 1 47  ? -17.974 12.348  12.637  1.00 4.33  ? 47  ALA A CB   1  
ATOM 757    H H    . ALA A 1 47  ? -16.199 14.520  13.230  1.00 4.41  ? 47  ALA A H    1  
ATOM 758    H HA   . ALA A 1 47  ? -19.103 13.992  13.431  1.00 1.21  ? 47  ALA A HA   1  
ATOM 759    H HB1  . ALA A 1 47  ? -18.064 12.621  11.599  1.00 24.41 ? 47  ALA A HB1  1  
ATOM 760    H HB2  . ALA A 1 47  ? -18.762 11.651  12.891  1.00 53.22 ? 47  ALA A HB2  1  
ATOM 761    H HB3  . ALA A 1 47  ? -17.015 11.875  12.795  1.00 0.33  ? 47  ALA A HB3  1  
ATOM 762    N N    . SER A 1 48  ? -18.828 13.270  15.817  1.00 23.11 ? 48  SER A N    1  
ATOM 763    C CA   . SER A 1 48  ? -18.720 12.969  17.258  1.00 14.41 ? 48  SER A CA   1  
ATOM 764    C C    . SER A 1 48  ? -19.185 11.531  17.529  1.00 64.34 ? 48  SER A C    1  
ATOM 765    O O    . SER A 1 48  ? -20.030 11.004  16.800  1.00 10.14 ? 48  SER A O    1  
ATOM 766    C CB   . SER A 1 48  ? -19.582 13.969  18.055  1.00 40.01 ? 48  SER A CB   1  
ATOM 767    O OG   . SER A 1 48  ? -19.233 15.308  17.731  1.00 11.50 ? 48  SER A OG   1  
ATOM 768    H H    . SER A 1 48  ? -19.715 13.463  15.450  1.00 51.34 ? 48  SER A H    1  
ATOM 769    H HA   . SER A 1 48  ? -17.679 13.075  17.562  1.00 30.52 ? 48  SER A HA   1  
ATOM 770    H HB2  . SER A 1 48  ? -20.630 13.822  17.821  1.00 22.14 ? 48  SER A HB2  1  
ATOM 771    H HB3  . SER A 1 48  ? -19.428 13.823  19.117  1.00 62.44 ? 48  SER A HB3  1  
ATOM 772    H HG   . SER A 1 48  ? -19.246 15.415  16.774  1.00 51.02 ? 48  SER A HG   1  
ATOM 773    N N    . SER A 1 49  ? -18.640 10.914  18.587  1.00 63.34 ? 49  SER A N    1  
ATOM 774    C CA   . SER A 1 49  ? -18.995 9.550   18.997  1.00 22.04 ? 49  SER A CA   1  
ATOM 775    C C    . SER A 1 49  ? -18.527 9.322   20.446  1.00 44.51 ? 49  SER A C    1  
ATOM 776    O O    . SER A 1 49  ? -17.380 9.619   20.781  1.00 22.54 ? 49  SER A O    1  
ATOM 777    C CB   . SER A 1 49  ? -18.347 8.519   18.028  1.00 4.41  ? 49  SER A CB   1  
ATOM 778    O OG   . SER A 1 49  ? -18.707 7.184   18.343  1.00 54.30 ? 49  SER A OG   1  
ATOM 779    H H    . SER A 1 49  ? -17.956 11.389  19.107  1.00 31.35 ? 49  SER A H    1  
ATOM 780    H HA   . SER A 1 49  ? -20.078 9.452   18.954  1.00 51.24 ? 49  SER A HA   1  
ATOM 781    H HB2  . SER A 1 49  ? -18.671 8.725   17.018  1.00 0.13  ? 49  SER A HB2  1  
ATOM 782    H HB3  . SER A 1 49  ? -17.267 8.607   18.075  1.00 72.00 ? 49  SER A HB3  1  
ATOM 783    H HG   . SER A 1 49  ? -17.949 6.606   18.173  1.00 14.50 ? 49  SER A HG   1  
ATOM 784    N N    . GLN A 1 50  ? -19.438 8.858   21.316  1.00 62.22 ? 50  GLN A N    1  
ATOM 785    C CA   . GLN A 1 50  ? -19.102 8.423   22.685  1.00 70.24 ? 50  GLN A CA   1  
ATOM 786    C C    . GLN A 1 50  ? -19.327 6.911   22.779  1.00 63.52 ? 50  GLN A C    1  
ATOM 787    O O    . GLN A 1 50  ? -20.451 6.430   22.572  1.00 32.31 ? 50  GLN A O    1  
ATOM 788    C CB   . GLN A 1 50  ? -19.952 9.171   23.743  1.00 14.53 ? 50  GLN A CB   1  
ATOM 789    C CG   . GLN A 1 50  ? -19.682 8.714   25.199  1.00 54.54 ? 50  GLN A CG   1  
ATOM 790    C CD   . GLN A 1 50  ? -20.478 9.479   26.257  1.00 23.20 ? 50  GLN A CD   1  
ATOM 791    O OE1  . GLN A 1 50  ? -21.579 9.965   26.004  1.00 44.50 ? 50  GLN A OE1  1  
ATOM 792    N NE2  . GLN A 1 50  ? -19.936 9.562   27.462  1.00 65.32 ? 50  GLN A NE2  1  
ATOM 793    H H    . GLN A 1 50  ? -20.371 8.794   21.025  1.00 51.03 ? 50  GLN A H    1  
ATOM 794    H HA   . GLN A 1 50  ? -18.047 8.637   22.867  1.00 52.23 ? 50  GLN A HA   1  
ATOM 795    H HB2  . GLN A 1 50  ? -19.741 10.234  23.671  1.00 53.24 ? 50  GLN A HB2  1  
ATOM 796    H HB3  . GLN A 1 50  ? -21.003 9.014   23.524  1.00 51.21 ? 50  GLN A HB3  1  
ATOM 797    H HG2  . GLN A 1 50  ? -19.937 7.665   25.287  1.00 54.35 ? 50  GLN A HG2  1  
ATOM 798    H HG3  . GLN A 1 50  ? -18.623 8.836   25.405  1.00 72.21 ? 50  GLN A HG3  1  
ATOM 799    H HE21 . GLN A 1 50  ? -19.066 9.137   27.610  1.00 31.13 ? 50  GLN A HE21 1  
ATOM 800    H HE22 . GLN A 1 50  ? -20.429 10.048  28.157  1.00 44.31 ? 50  GLN A HE22 1  
ATOM 801    N N    . LEU A 1 51  ? -18.252 6.171   23.079  1.00 51.23 ? 51  LEU A N    1  
ATOM 802    C CA   . LEU A 1 51  ? -18.266 4.698   23.098  1.00 64.13 ? 51  LEU A CA   1  
ATOM 803    C C    . LEU A 1 51  ? -18.491 4.159   24.515  1.00 13.14 ? 51  LEU A C    1  
ATOM 804    O O    . LEU A 1 51  ? -19.080 3.086   24.687  1.00 53.11 ? 51  LEU A O    1  
ATOM 805    C CB   . LEU A 1 51  ? -16.946 4.161   22.499  1.00 23.32 ? 51  LEU A CB   1  
ATOM 806    C CG   . LEU A 1 51  ? -16.584 4.705   21.078  1.00 4.34  ? 51  LEU A CG   1  
ATOM 807    C CD1  . LEU A 1 51  ? -15.289 4.068   20.558  1.00 60.04 ? 51  LEU A CD1  1  
ATOM 808    C CD2  . LEU A 1 51  ? -17.750 4.522   20.074  1.00 35.15 ? 51  LEU A CD2  1  
ATOM 809    H H    . LEU A 1 51  ? -17.415 6.632   23.289  1.00 5.14  ? 51  LEU A H    1  
ATOM 810    H HA   . LEU A 1 51  ? -19.088 4.360   22.471  1.00 60.12 ? 51  LEU A HA   1  
ATOM 811    H HB2  . LEU A 1 51  ? -16.135 4.415   23.179  1.00 42.12 ? 51  LEU A HB2  1  
ATOM 812    H HB3  . LEU A 1 51  ? -17.011 3.079   22.442  1.00 43.10 ? 51  LEU A HB3  1  
ATOM 813    H HG   . LEU A 1 51  ? -16.397 5.769   21.158  1.00 41.50 ? 51  LEU A HG   1  
ATOM 814    H HD11 . LEU A 1 51  ? -15.400 2.990   20.502  1.00 2.20  ? 51  LEU A HD11 1  
ATOM 815    H HD12 . LEU A 1 51  ? -14.474 4.306   21.227  1.00 4.05  ? 51  LEU A HD12 1  
ATOM 816    H HD13 . LEU A 1 51  ? -15.059 4.453   19.572  1.00 53.12 ? 51  LEU A HD13 1  
ATOM 817    H HD21 . LEU A 1 51  ? -18.034 3.478   20.018  1.00 60.32 ? 51  LEU A HD21 1  
ATOM 818    H HD22 . LEU A 1 51  ? -17.443 4.861   19.092  1.00 11.12 ? 51  LEU A HD22 1  
ATOM 819    H HD23 . LEU A 1 51  ? -18.600 5.109   20.395  1.00 73.53 ? 51  LEU A HD23 1  
ATOM 820    N N    . ALA A 1 52  ? -18.032 4.915   25.520  1.00 41.01 ? 52  ALA A N    1  
ATOM 821    C CA   . ALA A 1 52  ? -18.170 4.544   26.940  1.00 55.55 ? 52  ALA A CA   1  
ATOM 822    C C    . ALA A 1 52  ? -17.911 5.757   27.838  1.00 43.05 ? 52  ALA A C    1  
ATOM 823    O O    . ALA A 1 52  ? -17.718 6.882   27.345  1.00 4.34  ? 52  ALA A O    1  
ATOM 824    C CB   . ALA A 1 52  ? -17.212 3.377   27.304  1.00 30.10 ? 52  ALA A CB   1  
ATOM 825    H H    . ALA A 1 52  ? -17.588 5.764   25.302  1.00 13.43 ? 52  ALA A H    1  
ATOM 826    H HA   . ALA A 1 52  ? -19.189 4.210   27.103  1.00 40.02 ? 52  ALA A HA   1  
ATOM 827    H HB1  . ALA A 1 52  ? -16.190 3.727   27.302  1.00 23.13 ? 52  ALA A HB1  1  
ATOM 828    H HB2  . ALA A 1 52  ? -17.307 2.586   26.578  1.00 60.23 ? 52  ALA A HB2  1  
ATOM 829    H HB3  . ALA A 1 52  ? -17.458 2.990   28.286  1.00 10.33 ? 52  ALA A HB3  1  
ATOM 830    N N    . ASP A 1 53  ? -17.918 5.507   29.157  1.00 31.23 ? 53  ASP A N    1  
ATOM 831    C CA   . ASP A 1 53  ? -17.525 6.490   30.175  1.00 44.12 ? 53  ASP A CA   1  
ATOM 832    C C    . ASP A 1 53  ? -16.049 6.837   29.980  1.00 20.54 ? 53  ASP A C    1  
ATOM 833    O O    . ASP A 1 53  ? -15.199 5.936   30.028  1.00 74.41 ? 53  ASP A O    1  
ATOM 834    C CB   . ASP A 1 53  ? -17.717 5.926   31.601  1.00 22.23 ? 53  ASP A CB   1  
ATOM 835    C CG   . ASP A 1 53  ? -19.144 5.455   31.883  1.00 63.41 ? 53  ASP A CG   1  
ATOM 836    O OD1  . ASP A 1 53  ? -19.889 6.158   32.597  1.00 10.24 ? 53  ASP A OD1  1  
ATOM 837    O OD2  . ASP A 1 53  ? -19.539 4.386   31.368  1.00 73.35 ? 53  ASP A OD2  1  
ATOM 838    H H    . ASP A 1 53  ? -18.200 4.616   29.457  1.00 42.41 ? 53  ASP A H    1  
ATOM 839    H HA   . ASP A 1 53  ? -18.139 7.379   30.052  1.00 4.34  ? 53  ASP A HA   1  
ATOM 840    H HB2  . ASP A 1 53  ? -17.045 5.083   31.751  1.00 3.32  ? 53  ASP A HB2  1  
ATOM 841    H HB3  . ASP A 1 53  ? -17.456 6.697   32.324  1.00 4.31  ? 53  ASP A HB3  1  
ATOM 842    N N    . ASP A 1 54  ? -15.776 8.121   29.680  1.00 53.24 ? 54  ASP A N    1  
ATOM 843    C CA   . ASP A 1 54  ? -14.407 8.667   29.476  1.00 21.54 ? 54  ASP A CA   1  
ATOM 844    C C    . ASP A 1 54  ? -13.762 8.197   28.151  1.00 4.45  ? 54  ASP A C    1  
ATOM 845    O O    . ASP A 1 54  ? -12.675 8.667   27.789  1.00 62.14 ? 54  ASP A O    1  
ATOM 846    C CB   . ASP A 1 54  ? -13.470 8.374   30.685  1.00 32.22 ? 54  ASP A CB   1  
ATOM 847    C CG   . ASP A 1 54  ? -13.931 8.995   32.022  1.00 14.24 ? 54  ASP A CG   1  
ATOM 848    O OD1  . ASP A 1 54  ? -15.140 9.278   32.215  1.00 22.02 ? 54  ASP A OD1  1  
ATOM 849    O OD2  . ASP A 1 54  ? -13.082 9.153   32.909  1.00 14.42 ? 54  ASP A OD2  1  
ATOM 850    H H    . ASP A 1 54  ? -16.528 8.742   29.608  1.00 34.45 ? 54  ASP A H    1  
ATOM 851    H HA   . ASP A 1 54  ? -14.528 9.740   29.404  1.00 52.23 ? 54  ASP A HA   1  
ATOM 852    H HB2  . ASP A 1 54  ? -13.403 7.303   30.824  1.00 2.24  ? 54  ASP A HB2  1  
ATOM 853    H HB3  . ASP A 1 54  ? -12.476 8.756   30.457  1.00 14.04 ? 54  ASP A HB3  1  
ATOM 854    N N    . VAL A 1 55  ? -14.449 7.298   27.421  1.00 11.03 ? 55  VAL A N    1  
ATOM 855    C CA   . VAL A 1 55  ? -14.015 6.824   26.109  1.00 64.43 ? 55  VAL A CA   1  
ATOM 856    C C    . VAL A 1 55  ? -14.799 7.607   25.053  1.00 62.31 ? 55  VAL A C    1  
ATOM 857    O O    . VAL A 1 55  ? -16.007 7.385   24.853  1.00 33.41 ? 55  VAL A O    1  
ATOM 858    C CB   . VAL A 1 55  ? -14.250 5.283   25.907  1.00 32.42 ? 55  VAL A CB   1  
ATOM 859    C CG1  . VAL A 1 55  ? -13.729 4.834   24.523  1.00 24.14 ? 55  VAL A CG1  1  
ATOM 860    C CG2  . VAL A 1 55  ? -13.608 4.455   27.047  1.00 23.42 ? 55  VAL A CG2  1  
ATOM 861    H H    . VAL A 1 55  ? -15.290 6.958   27.772  1.00 1.10  ? 55  VAL A H    1  
ATOM 862    H HA   . VAL A 1 55  ? -12.947 7.028   25.994  1.00 11.43 ? 55  VAL A HA   1  
ATOM 863    H HB   . VAL A 1 55  ? -15.325 5.103   25.929  1.00 2.55  ? 55  VAL A HB   1  
ATOM 864    H HG11 . VAL A 1 55  ? -13.939 3.793   24.372  1.00 42.20 ? 55  VAL A HG11 1  
ATOM 865    H HG12 . VAL A 1 55  ? -12.662 4.994   24.461  1.00 23.40 ? 55  VAL A HG12 1  
ATOM 866    H HG13 . VAL A 1 55  ? -14.218 5.408   23.743  1.00 22.13 ? 55  VAL A HG13 1  
ATOM 867    H HG21 . VAL A 1 55  ? -12.538 4.554   27.014  1.00 20.52 ? 55  VAL A HG21 1  
ATOM 868    H HG22 . VAL A 1 55  ? -13.872 3.409   26.938  1.00 54.54 ? 55  VAL A HG22 1  
ATOM 869    H HG23 . VAL A 1 55  ? -13.970 4.812   28.004  1.00 75.24 ? 55  VAL A HG23 1  
ATOM 870    N N    . TYR A 1 56  ? -14.104 8.534   24.407  1.00 14.01 ? 56  TYR A N    1  
ATOM 871    C CA   . TYR A 1 56  ? -14.686 9.435   23.414  1.00 45.15 ? 56  TYR A CA   1  
ATOM 872    C C    . TYR A 1 56  ? -13.900 9.281   22.124  1.00 15.44 ? 56  TYR A C    1  
ATOM 873    O O    . TYR A 1 56  ? -12.675 9.425   22.106  1.00 23.35 ? 56  TYR A O    1  
ATOM 874    C CB   . TYR A 1 56  ? -14.633 10.905  23.905  1.00 70.54 ? 56  TYR A CB   1  
ATOM 875    C CG   . TYR A 1 56  ? -15.369 11.145  25.235  1.00 42.50 ? 56  TYR A CG   1  
ATOM 876    C CD1  . TYR A 1 56  ? -14.670 11.280  26.439  1.00 21.24 ? 56  TYR A CD1  1  
ATOM 877    C CD2  . TYR A 1 56  ? -16.764 11.224  25.287  1.00 10.22 ? 56  TYR A CD2  1  
ATOM 878    C CE1  . TYR A 1 56  ? -15.332 11.489  27.634  1.00 74.15 ? 56  TYR A CE1  1  
ATOM 879    C CE2  . TYR A 1 56  ? -17.425 11.435  26.483  1.00 62.20 ? 56  TYR A CE2  1  
ATOM 880    C CZ   . TYR A 1 56  ? -16.707 11.561  27.652  1.00 10.11 ? 56  TYR A CZ   1  
ATOM 881    O OH   . TYR A 1 56  ? -17.369 11.767  28.844  1.00 10.21 ? 56  TYR A OH   1  
ATOM 882    H H    . TYR A 1 56  ? -13.142 8.588   24.579  1.00 13.33 ? 56  TYR A H    1  
ATOM 883    H HA   . TYR A 1 56  ? -15.727 9.153   23.243  1.00 21.21 ? 56  TYR A HA   1  
ATOM 884    H HB2  . TYR A 1 56  ? -13.596 11.202  24.032  1.00 44.33 ? 56  TYR A HB2  1  
ATOM 885    H HB3  . TYR A 1 56  ? -15.086 11.548  23.155  1.00 73.14 ? 56  TYR A HB3  1  
ATOM 886    H HD1  . TYR A 1 56  ? -13.587 11.223  26.430  1.00 31.24 ? 56  TYR A HD1  1  
ATOM 887    H HD2  . TYR A 1 56  ? -17.334 11.123  24.370  1.00 51.13 ? 56  TYR A HD2  1  
ATOM 888    H HE1  . TYR A 1 56  ? -14.768 11.591  28.553  1.00 51.31 ? 56  TYR A HE1  1  
ATOM 889    H HE2  . TYR A 1 56  ? -18.505 11.490  26.500  1.00 15.10 ? 56  TYR A HE2  1  
ATOM 890    H HH   . TYR A 1 56  ? -16.892 12.427  29.365  1.00 75.00 ? 56  TYR A HH   1  
ATOM 891    N N    . GLU A 1 57  ? -14.611 8.982   21.058  1.00 41.02 ? 57  GLU A N    1  
ATOM 892    C CA   . GLU A 1 57  ? -14.042 8.870   19.733  1.00 15.31 ? 57  GLU A CA   1  
ATOM 893    C C    . GLU A 1 57  ? -14.370 10.143  18.951  1.00 52.10 ? 57  GLU A C    1  
ATOM 894    O O    . GLU A 1 57  ? -15.545 10.436  18.687  1.00 42.50 ? 57  GLU A O    1  
ATOM 895    C CB   . GLU A 1 57  ? -14.620 7.631   19.031  1.00 51.41 ? 57  GLU A CB   1  
ATOM 896    C CG   . GLU A 1 57  ? -14.100 7.437   17.598  1.00 64.30 ? 57  GLU A CG   1  
ATOM 897    C CD   . GLU A 1 57  ? -14.798 6.336   16.816  1.00 2.40  ? 57  GLU A CD   1  
ATOM 898    O OE1  . GLU A 1 57  ? -14.201 5.846   15.846  1.00 11.31 ? 57  GLU A OE1  1  
ATOM 899    O OE2  . GLU A 1 57  ? -15.967 5.990   17.118  1.00 44.13 ? 57  GLU A OE2  1  
ATOM 900    H H    . GLU A 1 57  ? -15.569 8.832   21.163  1.00 64.33 ? 57  GLU A H    1  
ATOM 901    H HA   . GLU A 1 57  ? -12.961 8.758   19.814  1.00 24.42 ? 57  GLU A HA   1  
ATOM 902    H HB2  . GLU A 1 57  ? -14.362 6.750   19.613  1.00 12.24 ? 57  GLU A HB2  1  
ATOM 903    H HB3  . GLU A 1 57  ? -15.704 7.714   18.998  1.00 12.54 ? 57  GLU A HB3  1  
ATOM 904    H HG2  . GLU A 1 57  ? -14.226 8.365   17.053  1.00 24.24 ? 57  GLU A HG2  1  
ATOM 905    H HG3  . GLU A 1 57  ? -13.040 7.204   17.648  1.00 54.04 ? 57  GLU A HG3  1  
ATOM 906    N N    . VAL A 1 58  ? -13.336 10.920  18.615  1.00 22.13 ? 58  VAL A N    1  
ATOM 907    C CA   . VAL A 1 58  ? -13.486 12.093  17.754  1.00 31.12 ? 58  VAL A CA   1  
ATOM 908    C C    . VAL A 1 58  ? -12.978 11.716  16.362  1.00 62.15 ? 58  VAL A C    1  
ATOM 909    O O    . VAL A 1 58  ? -11.972 11.005  16.218  1.00 44.13 ? 58  VAL A O    1  
ATOM 910    C CB   . VAL A 1 58  ? -12.767 13.381  18.330  1.00 61.33 ? 58  VAL A CB   1  
ATOM 911    C CG1  . VAL A 1 58  ? -13.230 13.667  19.781  1.00 53.11 ? 58  VAL A CG1  1  
ATOM 912    C CG2  . VAL A 1 58  ? -11.224 13.296  18.249  1.00 1.10  ? 58  VAL A CG2  1  
ATOM 913    H H    . VAL A 1 58  ? -12.439 10.677  18.931  1.00 23.31 ? 58  VAL A H    1  
ATOM 914    H HA   . VAL A 1 58  ? -14.556 12.313  17.666  1.00 64.51 ? 58  VAL A HA   1  
ATOM 915    H HB   . VAL A 1 58  ? -13.082 14.230  17.720  1.00 21.40 ? 58  VAL A HB   1  
ATOM 916    H HG11 . VAL A 1 58  ? -12.779 14.585  20.141  1.00 41.44 ? 58  VAL A HG11 1  
ATOM 917    H HG12 . VAL A 1 58  ? -12.936 12.851  20.430  1.00 14.40 ? 58  VAL A HG12 1  
ATOM 918    H HG13 . VAL A 1 58  ? -14.307 13.768  19.808  1.00 25.15 ? 58  VAL A HG13 1  
ATOM 919    H HG21 . VAL A 1 58  ? -10.872 12.466  18.848  1.00 62.34 ? 58  VAL A HG21 1  
ATOM 920    H HG22 . VAL A 1 58  ? -10.783 14.214  18.616  1.00 1.22  ? 58  VAL A HG22 1  
ATOM 921    H HG23 . VAL A 1 58  ? -10.919 13.145  17.221  1.00 22.31 ? 58  VAL A HG23 1  
ATOM 922    N N    . VAL A 1 59  ? -13.738 12.119  15.347  1.00 3.33  ? 59  VAL A N    1  
ATOM 923    C CA   . VAL A 1 59  ? -13.483 11.767  13.958  1.00 34.15 ? 59  VAL A CA   1  
ATOM 924    C C    . VAL A 1 59  ? -13.387 13.055  13.133  1.00 40.32 ? 59  VAL A C    1  
ATOM 925    O O    . VAL A 1 59  ? -14.180 13.986  13.339  1.00 14.43 ? 59  VAL A O    1  
ATOM 926    C CB   . VAL A 1 59  ? -14.645 10.869  13.404  1.00 62.33 ? 59  VAL A CB   1  
ATOM 927    C CG1  . VAL A 1 59  ? -14.384 10.457  11.942  1.00 14.20 ? 59  VAL A CG1  1  
ATOM 928    C CG2  . VAL A 1 59  ? -14.915 9.627   14.306  1.00 74.32 ? 59  VAL A CG2  1  
ATOM 929    H H    . VAL A 1 59  ? -14.521 12.679  15.539  1.00 53.30 ? 59  VAL A H    1  
ATOM 930    H HA   . VAL A 1 59  ? -12.545 11.217  13.887  1.00 1.04  ? 59  VAL A HA   1  
ATOM 931    H HB   . VAL A 1 59  ? -15.552 11.473  13.412  1.00 42.52 ? 59  VAL A HB   1  
ATOM 932    H HG11 . VAL A 1 59  ? -15.308 10.130  11.493  1.00 60.45 ? 59  VAL A HG11 1  
ATOM 933    H HG12 . VAL A 1 59  ? -13.667 9.646   11.893  1.00 42.11 ? 59  VAL A HG12 1  
ATOM 934    H HG13 . VAL A 1 59  ? -14.001 11.298  11.376  1.00 14.01 ? 59  VAL A HG13 1  
ATOM 935    H HG21 . VAL A 1 59  ? -15.734 9.054   13.902  1.00 3.34  ? 59  VAL A HG21 1  
ATOM 936    H HG22 . VAL A 1 59  ? -15.174 9.938   15.306  1.00 52.14 ? 59  VAL A HG22 1  
ATOM 937    H HG23 . VAL A 1 59  ? -14.032 9.003   14.344  1.00 3.14  ? 59  VAL A HG23 1  
ATOM 938    N N    . LEU A 1 60  ? -12.428 13.103  12.198  1.00 62.23 ? 60  LEU A N    1  
ATOM 939    C CA   . LEU A 1 60  ? -12.267 14.239  11.285  1.00 14.04 ? 60  LEU A CA   1  
ATOM 940    C C    . LEU A 1 60  ? -12.216 13.707  9.846   1.00 43.53 ? 60  LEU A C    1  
ATOM 941    O O    . LEU A 1 60  ? -11.283 12.989  9.465   1.00 23.13 ? 60  LEU A O    1  
ATOM 942    C CB   . LEU A 1 60  ? -11.001 15.086  11.657  1.00 23.34 ? 60  LEU A CB   1  
ATOM 943    C CG   . LEU A 1 60  ? -11.138 16.642  11.468  1.00 25.13 ? 60  LEU A CG   1  
ATOM 944    C CD1  . LEU A 1 60  ? -9.990  17.405  12.169  1.00 13.34 ? 60  LEU A CD1  1  
ATOM 945    C CD2  . LEU A 1 60  ? -11.252 17.040  9.972   1.00 10.43 ? 60  LEU A CD2  1  
ATOM 946    H H    . LEU A 1 60  ? -11.810 12.346  12.120  1.00 12.12 ? 60  LEU A H    1  
ATOM 947    H HA   . LEU A 1 60  ? -13.152 14.867  11.384  1.00 61.34 ? 60  LEU A HA   1  
ATOM 948    H HB2  . LEU A 1 60  ? -10.765 14.895  12.700  1.00 24.05 ? 60  LEU A HB2  1  
ATOM 949    H HB3  . LEU A 1 60  ? -10.154 14.743  11.059  1.00 13.42 ? 60  LEU A HB3  1  
ATOM 950    H HG   . LEU A 1 60  ? -12.056 16.959  11.950  1.00 1.15  ? 60  LEU A HG   1  
ATOM 951    H HD11 . LEU A 1 60  ? -10.127 18.472  12.041  1.00 45.22 ? 60  LEU A HD11 1  
ATOM 952    H HD12 . LEU A 1 60  ? -9.036  17.113  11.751  1.00 33.34 ? 60  LEU A HD12 1  
ATOM 953    H HD13 . LEU A 1 60  ? -10.001 17.176  13.228  1.00 50.21 ? 60  LEU A HD13 1  
ATOM 954    H HD21 . LEU A 1 60  ? -11.356 18.113  9.883   1.00 30.20 ? 60  LEU A HD21 1  
ATOM 955    H HD22 . LEU A 1 60  ? -12.125 16.567  9.538   1.00 1.45  ? 60  LEU A HD22 1  
ATOM 956    H HD23 . LEU A 1 60  ? -10.370 16.718  9.433   1.00 63.00 ? 60  LEU A HD23 1  
ATOM 957    N N    . ARG A 1 61  ? -13.255 14.044  9.076   1.00 3.14  ? 61  ARG A N    1  
ATOM 958    C CA   . ARG A 1 61  ? -13.396 13.652  7.676   1.00 52.41 ? 61  ARG A CA   1  
ATOM 959    C C    . ARG A 1 61  ? -12.822 14.764  6.781   1.00 30.52 ? 61  ARG A C    1  
ATOM 960    O O    . ARG A 1 61  ? -13.446 15.812  6.602   1.00 31.21 ? 61  ARG A O    1  
ATOM 961    C CB   . ARG A 1 61  ? -14.895 13.376  7.385   1.00 21.20 ? 61  ARG A CB   1  
ATOM 962    C CG   . ARG A 1 61  ? -15.210 12.803  5.985   1.00 21.23 ? 61  ARG A CG   1  
ATOM 963    C CD   . ARG A 1 61  ? -16.689 12.384  5.841   1.00 31.03 ? 61  ARG A CD   1  
ATOM 964    N NE   . ARG A 1 61  ? -16.927 11.642  4.587   1.00 22.53 ? 61  ARG A NE   1  
ATOM 965    C CZ   . ARG A 1 61  ? -17.548 10.451  4.481   1.00 33.12 ? 61  ARG A CZ   1  
ATOM 966    N NH1  . ARG A 1 61  ? -18.038 9.823   5.548   1.00 22.44 ? 61  ARG A NH1  1  
ATOM 967    N NH2  . ARG A 1 61  ? -17.679 9.888   3.288   1.00 10.42 ? 61  ARG A NH2  1  
ATOM 968    H H    . ARG A 1 61  ? -13.965 14.590  9.476   1.00 43.32 ? 61  ARG A H    1  
ATOM 969    H HA   . ARG A 1 61  ? -12.834 12.734  7.516   1.00 22.33 ? 61  ARG A HA   1  
ATOM 970    H HB2  . ARG A 1 61  ? -15.259 12.668  8.122   1.00 70.23 ? 61  ARG A HB2  1  
ATOM 971    H HB3  . ARG A 1 61  ? -15.447 14.301  7.505   1.00 51.21 ? 61  ARG A HB3  1  
ATOM 972    H HG2  . ARG A 1 61  ? -14.985 13.557  5.238   1.00 32.42 ? 61  ARG A HG2  1  
ATOM 973    H HG3  . ARG A 1 61  ? -14.580 11.937  5.813   1.00 12.34 ? 61  ARG A HG3  1  
ATOM 974    H HD2  . ARG A 1 61  ? -16.966 11.761  6.688   1.00 53.01 ? 61  ARG A HD2  1  
ATOM 975    H HD3  . ARG A 1 61  ? -17.307 13.274  5.840   1.00 25.41 ? 61  ARG A HD3  1  
ATOM 976    H HE   . ARG A 1 61  ? -16.612 12.070  3.761   1.00 31.45 ? 61  ARG A HE   1  
ATOM 977    H HH11 . ARG A 1 61  ? -17.956 10.234  6.461   1.00 4.02  ? 61  ARG A HH11 1  
ATOM 978    H HH12 . ARG A 1 61  ? -18.503 8.939   5.437   1.00 44.20 ? 61  ARG A HH12 1  
ATOM 979    H HH21 . ARG A 1 61  ? -17.301 10.340  2.468   1.00 13.40 ? 61  ARG A HH21 1  
ATOM 980    H HH22 . ARG A 1 61  ? -18.136 8.997   3.198   1.00 33.15 ? 61  ARG A HH22 1  
ATOM 981    N N    . VAL A 1 62  ? -11.605 14.534  6.266   1.00 64.20 ? 62  VAL A N    1  
ATOM 982    C CA   . VAL A 1 62  ? -10.880 15.505  5.429   1.00 61.32 ? 62  VAL A CA   1  
ATOM 983    C C    . VAL A 1 62  ? -11.157 15.210  3.947   1.00 42.14 ? 62  VAL A C    1  
ATOM 984    O O    . VAL A 1 62  ? -10.993 14.073  3.493   1.00 74.00 ? 62  VAL A O    1  
ATOM 985    C CB   . VAL A 1 62  ? -9.324  15.461  5.700   1.00 13.24 ? 62  VAL A CB   1  
ATOM 986    C CG1  . VAL A 1 62  ? -8.574  16.533  4.862   1.00 14.12 ? 62  VAL A CG1  1  
ATOM 987    C CG2  . VAL A 1 62  ? -9.018  15.609  7.214   1.00 22.53 ? 62  VAL A CG2  1  
ATOM 988    H H    . VAL A 1 62  ? -11.178 13.672  6.450   1.00 22.43 ? 62  VAL A H    1  
ATOM 989    H HA   . VAL A 1 62  ? -11.240 16.508  5.671   1.00 74.41 ? 62  VAL A HA   1  
ATOM 990    H HB   . VAL A 1 62  ? -8.958  14.484  5.383   1.00 44.40 ? 62  VAL A HB   1  
ATOM 991    H HG11 . VAL A 1 62  ? -7.510  16.471  5.051   1.00 34.24 ? 62  VAL A HG11 1  
ATOM 992    H HG12 . VAL A 1 62  ? -8.927  17.519  5.127   1.00 54.11 ? 62  VAL A HG12 1  
ATOM 993    H HG13 . VAL A 1 62  ? -8.756  16.362  3.806   1.00 33.53 ? 62  VAL A HG13 1  
ATOM 994    H HG21 . VAL A 1 62  ? -9.379  16.564  7.571   1.00 54.22 ? 62  VAL A HG21 1  
ATOM 995    H HG22 . VAL A 1 62  ? -7.949  15.546  7.383   1.00 34.25 ? 62  VAL A HG22 1  
ATOM 996    H HG23 . VAL A 1 62  ? -9.508  14.814  7.764   1.00 24.42 ? 62  VAL A HG23 1  
ATOM 997    N N    . THR A 1 63  ? -11.582 16.242  3.213   1.00 11.20 ? 63  THR A N    1  
ATOM 998    C CA   . THR A 1 63  ? -11.912 16.149  1.792   1.00 14.53 ? 63  THR A CA   1  
ATOM 999    C C    . THR A 1 63  ? -10.904 16.969  0.975   1.00 52.01 ? 63  THR A C    1  
ATOM 1000   O O    . THR A 1 63  ? -10.630 18.136  1.286   1.00 10.22 ? 63  THR A O    1  
ATOM 1001   C CB   . THR A 1 63  ? -13.361 16.666  1.524   1.00 45.20 ? 63  THR A CB   1  
ATOM 1002   O OG1  . THR A 1 63  ? -14.261 16.074  2.468   1.00 64.14 ? 63  THR A OG1  1  
ATOM 1003   C CG2  . THR A 1 63  ? -13.836 16.353  0.091   1.00 62.11 ? 63  THR A CG2  1  
ATOM 1004   H H    . THR A 1 63  ? -11.679 17.109  3.649   1.00 2.04  ? 63  THR A H    1  
ATOM 1005   H HA   . THR A 1 63  ? -11.854 15.104  1.488   1.00 50.53 ? 63  THR A HA   1  
ATOM 1006   H HB   . THR A 1 63  ? -13.380 17.740  1.668   1.00 53.21 ? 63  THR A HB   1  
ATOM 1007   H HG1  . THR A 1 63  ? -14.523 15.208  2.153   1.00 12.02 ? 63  THR A HG1  1  
ATOM 1008   H HG21 . THR A 1 63  ? -13.903 15.283  -0.051  1.00 15.12 ? 63  THR A HG21 1  
ATOM 1009   H HG22 . THR A 1 63  ? -13.133 16.757  -0.623  1.00 63.14 ? 63  THR A HG22 1  
ATOM 1010   H HG23 . THR A 1 63  ? -14.809 16.797  -0.079  1.00 53.11 ? 63  THR A HG23 1  
ATOM 1011   N N    . VAL A 1 64  ? -10.365 16.330  -0.061  1.00 4.43  ? 64  VAL A N    1  
ATOM 1012   C CA   . VAL A 1 64  ? -9.378  16.899  -0.983  1.00 23.31 ? 64  VAL A CA   1  
ATOM 1013   C C    . VAL A 1 64  ? -9.907  16.718  -2.406  1.00 0.21  ? 64  VAL A C    1  
ATOM 1014   O O    . VAL A 1 64  ? -9.944  15.606  -2.921  1.00 11.22 ? 64  VAL A O    1  
ATOM 1015   C CB   . VAL A 1 64  ? -7.971  16.187  -0.797  1.00 50.54 ? 64  VAL A CB   1  
ATOM 1016   C CG1  . VAL A 1 64  ? -7.011  16.392  -2.006  1.00 55.51 ? 64  VAL A CG1  1  
ATOM 1017   C CG2  . VAL A 1 64  ? -7.318  16.639  0.533   1.00 4.22  ? 64  VAL A CG2  1  
ATOM 1018   H H    . VAL A 1 64  ? -10.655 15.412  -0.225  1.00 52.23 ? 64  VAL A H    1  
ATOM 1019   H HA   . VAL A 1 64  ? -9.264  17.962  -0.772  1.00 44.42 ? 64  VAL A HA   1  
ATOM 1020   H HB   . VAL A 1 64  ? -8.154  15.118  -0.719  1.00 40.43 ? 64  VAL A HB   1  
ATOM 1021   H HG11 . VAL A 1 64  ? -7.410  15.881  -2.877  1.00 10.33 ? 64  VAL A HG11 1  
ATOM 1022   H HG12 . VAL A 1 64  ? -6.033  15.989  -1.780  1.00 50.24 ? 64  VAL A HG12 1  
ATOM 1023   H HG13 . VAL A 1 64  ? -6.921  17.438  -2.229  1.00 15.23 ? 64  VAL A HG13 1  
ATOM 1024   H HG21 . VAL A 1 64  ? -7.253  17.715  0.561   1.00 73.02 ? 64  VAL A HG21 1  
ATOM 1025   H HG22 . VAL A 1 64  ? -6.323  16.218  0.621   1.00 21.14 ? 64  VAL A HG22 1  
ATOM 1026   H HG23 . VAL A 1 64  ? -7.919  16.297  1.367   1.00 12.12 ? 64  VAL A HG23 1  
ATOM 1027   N N    . THR A 1 65  ? -10.355 17.809  -3.019  1.00 75.33 ? 65  THR A N    1  
ATOM 1028   C CA   . THR A 1 65  ? -10.792 17.810  -4.415  1.00 45.41 ? 65  THR A CA   1  
ATOM 1029   C C    . THR A 1 65  ? -9.699  18.475  -5.244  1.00 71.51 ? 65  THR A C    1  
ATOM 1030   O O    . THR A 1 65  ? -9.203  19.507  -4.840  1.00 14.55 ? 65  THR A O    1  
ATOM 1031   C CB   . THR A 1 65  ? -12.119 18.614  -4.596  1.00 61.24 ? 65  THR A CB   1  
ATOM 1032   O OG1  . THR A 1 65  ? -13.102 18.171  -3.640  1.00 13.01 ? 65  THR A OG1  1  
ATOM 1033   C CG2  . THR A 1 65  ? -12.678 18.464  -6.028  1.00 33.51 ? 65  THR A CG2  1  
ATOM 1034   H H    . THR A 1 65  ? -10.374 18.658  -2.526  1.00 33.41 ? 65  THR A H    1  
ATOM 1035   H HA   . THR A 1 65  ? -10.951 16.780  -4.750  1.00 75.14 ? 65  THR A HA   1  
ATOM 1036   H HB   . THR A 1 65  ? -11.919 19.665  -4.409  1.00 62.14 ? 65  THR A HB   1  
ATOM 1037   H HG1  . THR A 1 65  ? -12.663 17.770  -2.885  1.00 33.03 ? 65  THR A HG1  1  
ATOM 1038   H HG21 . THR A 1 65  ? -13.136 17.489  -6.141  1.00 61.22 ? 65  THR A HG21 1  
ATOM 1039   H HG22 . THR A 1 65  ? -11.875 18.563  -6.750  1.00 62.13 ? 65  THR A HG22 1  
ATOM 1040   H HG23 . THR A 1 65  ? -13.402 19.230  -6.217  1.00 71.32 ? 65  THR A HG23 1  
ATOM 1041   N N    . ALA A 1 66  ? -9.327  17.893  -6.379  1.00 3.54  ? 66  ALA A N    1  
ATOM 1042   C CA   . ALA A 1 66  ? -8.367  18.499  -7.311  1.00 22.44 ? 66  ALA A CA   1  
ATOM 1043   C C    . ALA A 1 66  ? -9.102  18.792  -8.613  1.00 13.53 ? 66  ALA A C    1  
ATOM 1044   O O    . ALA A 1 66  ? -9.772  17.903  -9.149  1.00 13.01 ? 66  ALA A O    1  
ATOM 1045   C CB   . ALA A 1 66  ? -7.163  17.567  -7.543  1.00 23.43 ? 66  ALA A CB   1  
ATOM 1046   H H    . ALA A 1 66  ? -9.731  17.039  -6.620  1.00 64.45 ? 66  ALA A H    1  
ATOM 1047   H HA   . ALA A 1 66  ? -8.006  19.438  -6.884  1.00 43.44 ? 66  ALA A HA   1  
ATOM 1048   H HB1  . ALA A 1 66  ? -6.666  17.366  -6.600  1.00 21.21 ? 66  ALA A HB1  1  
ATOM 1049   H HB2  . ALA A 1 66  ? -6.461  18.034  -8.218  1.00 51.21 ? 66  ALA A HB2  1  
ATOM 1050   H HB3  . ALA A 1 66  ? -7.498  16.629  -7.972  1.00 34.43 ? 66  ALA A HB3  1  
ATOM 1051   N N    . SER A 1 67  ? -9.015  20.043  -9.091  1.00 44.00 ? 67  SER A N    1  
ATOM 1052   C CA   . SER A 1 67  ? -9.679  20.483  -10.327 1.00 32.12 ? 67  SER A CA   1  
ATOM 1053   C C    . SER A 1 67  ? -8.656  21.141  -11.269 1.00 13.21 ? 67  SER A C    1  
ATOM 1054   O O    . SER A 1 67  ? -7.963  22.074  -10.886 1.00 62.33 ? 67  SER A O    1  
ATOM 1055   C CB   . SER A 1 67  ? -10.813 21.480  -9.974  1.00 31.24 ? 67  SER A CB   1  
ATOM 1056   O OG   . SER A 1 67  ? -11.706 20.915  -9.029  1.00 0.32  ? 67  SER A OG   1  
ATOM 1057   H H    . SER A 1 67  ? -8.506  20.705  -8.579  1.00 73.52 ? 67  SER A H    1  
ATOM 1058   H HA   . SER A 1 67  ? -10.114 19.615  -10.824 1.00 52.21 ? 67  SER A HA   1  
ATOM 1059   H HB2  . SER A 1 67  ? -10.391 22.383  -9.552  1.00 34.54 ? 67  SER A HB2  1  
ATOM 1060   H HB3  . SER A 1 67  ? -11.373 21.732  -10.862 1.00 32.33 ? 67  SER A HB3  1  
ATOM 1061   H HG   . SER A 1 67  ? -12.192 20.195  -9.442  1.00 11.02 ? 67  SER A HG   1  
ATOM 1062   N N    . LEU A 1 68  ? -8.594  20.655  -12.504 1.00 2.44  ? 68  LEU A N    1  
ATOM 1063   C CA   . LEU A 1 68  ? -7.778  21.228  -13.580 1.00 45.12 ? 68  LEU A CA   1  
ATOM 1064   C C    . LEU A 1 68  ? -8.596  22.323  -14.276 1.00 3.20  ? 68  LEU A C    1  
ATOM 1065   O O    . LEU A 1 68  ? -9.222  22.088  -15.324 1.00 21.54 ? 68  LEU A O    1  
ATOM 1066   C CB   . LEU A 1 68  ? -7.397  20.101  -14.575 1.00 12.04 ? 68  LEU A CB   1  
ATOM 1067   C CG   . LEU A 1 68  ? -6.741  18.846  -13.934 1.00 52.11 ? 68  LEU A CG   1  
ATOM 1068   C CD1  . LEU A 1 68  ? -6.638  17.677  -14.932 1.00 22.02 ? 68  LEU A CD1  1  
ATOM 1069   C CD2  . LEU A 1 68  ? -5.385  19.178  -13.290 1.00 31.13 ? 68  LEU A CD2  1  
ATOM 1070   H H    . LEU A 1 68  ? -9.097  19.847  -12.701 1.00 52.21 ? 68  LEU A H    1  
ATOM 1071   H HA   . LEU A 1 68  ? -6.874  21.659  -13.157 1.00 33.21 ? 68  LEU A HA   1  
ATOM 1072   H HB2  . LEU A 1 68  ? -8.303  19.787  -15.091 1.00 41.35 ? 68  LEU A HB2  1  
ATOM 1073   H HB3  . LEU A 1 68  ? -6.713  20.506  -15.314 1.00 63.22 ? 68  LEU A HB3  1  
ATOM 1074   H HG   . LEU A 1 68  ? -7.391  18.504  -13.135 1.00 41.54 ? 68  LEU A HG   1  
ATOM 1075   H HD11 . LEU A 1 68  ? -5.835  17.018  -14.658 1.00 14.23 ? 68  LEU A HD11 1  
ATOM 1076   H HD12 . LEU A 1 68  ? -6.477  18.041  -15.939 1.00 5.13  ? 68  LEU A HD12 1  
ATOM 1077   H HD13 . LEU A 1 68  ? -7.562  17.118  -14.892 1.00 50.40 ? 68  LEU A HD13 1  
ATOM 1078   H HD21 . LEU A 1 68  ? -4.967  18.284  -12.851 1.00 23.14 ? 68  LEU A HD21 1  
ATOM 1079   H HD22 . LEU A 1 68  ? -5.514  19.912  -12.516 1.00 61.13 ? 68  LEU A HD22 1  
ATOM 1080   H HD23 . LEU A 1 68  ? -4.700  19.559  -14.036 1.00 61.45 ? 68  LEU A HD23 1  
ATOM 1081   N N    . GLY A 1 69  ? -8.660  23.493  -13.621 1.00 25.10 ? 69  GLY A N    1  
ATOM 1082   C CA   . GLY A 1 69  ? -9.440  24.624  -14.106 1.00 74.00 ? 69  GLY A CA   1  
ATOM 1083   C C    . GLY A 1 69  ? -10.934 24.414  -13.870 1.00 30.31 ? 69  GLY A C    1  
ATOM 1084   O O    . GLY A 1 69  ? -11.475 24.852  -12.848 1.00 70.23 ? 69  GLY A O    1  
ATOM 1085   H H    . GLY A 1 69  ? -8.168  23.582  -12.775 1.00 13.31 ? 69  GLY A H    1  
ATOM 1086   H HA2  . GLY A 1 69  ? -9.117  25.518  -13.580 1.00 0.54  ? 69  GLY A HA2  1  
ATOM 1087   H HA3  . GLY A 1 69  ? -9.258  24.765  -15.166 1.00 51.13 ? 69  GLY A HA3  1  
ATOM 1088   N N    . GLU A 1 70  ? -11.582 23.703  -14.811 1.00 2.31  ? 70  GLU A N    1  
ATOM 1089   C CA   . GLU A 1 70  ? -13.024 23.398  -14.771 1.00 71.33 ? 70  GLU A CA   1  
ATOM 1090   C C    . GLU A 1 70  ? -13.255 21.875  -14.630 1.00 51.42 ? 70  GLU A C    1  
ATOM 1091   O O    . GLU A 1 70  ? -14.248 21.443  -14.033 1.00 1.25  ? 70  GLU A O    1  
ATOM 1092   C CB   . GLU A 1 70  ? -13.699 23.924  -16.068 1.00 54.04 ? 70  GLU A CB   1  
ATOM 1093   C CG   . GLU A 1 70  ? -15.211 23.626  -16.185 1.00 4.44  ? 70  GLU A CG   1  
ATOM 1094   C CD   . GLU A 1 70  ? -15.799 24.036  -17.541 1.00 11.00 ? 70  GLU A CD   1  
ATOM 1095   O OE1  . GLU A 1 70  ? -15.707 23.244  -18.498 1.00 22.12 ? 70  GLU A OE1  1  
ATOM 1096   O OE2  . GLU A 1 70  ? -16.348 25.151  -17.659 1.00 61.02 ? 70  GLU A OE2  1  
ATOM 1097   H H    . GLU A 1 70  ? -11.060 23.355  -15.567 1.00 12.42 ? 70  GLU A H    1  
ATOM 1098   H HA   . GLU A 1 70  ? -13.469 23.900  -13.911 1.00 21.22 ? 70  GLU A HA   1  
ATOM 1099   H HB2  . GLU A 1 70  ? -13.566 25.001  -16.113 1.00 65.02 ? 70  GLU A HB2  1  
ATOM 1100   H HB3  . GLU A 1 70  ? -13.200 23.484  -16.925 1.00 3.55  ? 70  GLU A HB3  1  
ATOM 1101   H HG2  . GLU A 1 70  ? -15.367 22.559  -16.044 1.00 54.41 ? 70  GLU A HG2  1  
ATOM 1102   H HG3  . GLU A 1 70  ? -15.733 24.156  -15.394 1.00 51.12 ? 70  GLU A HG3  1  
ATOM 1103   N N    . GLU A 1 71  ? -12.311 21.062  -15.137 1.00 42.52 ? 71  GLU A N    1  
ATOM 1104   C CA   . GLU A 1 71  ? -12.447 19.591  -15.128 1.00 12.01 ? 71  GLU A CA   1  
ATOM 1105   C C    . GLU A 1 71  ? -11.891 19.039  -13.810 1.00 11.51 ? 71  GLU A C    1  
ATOM 1106   O O    . GLU A 1 71  ? -10.806 19.432  -13.420 1.00 40.35 ? 71  GLU A O    1  
ATOM 1107   C CB   . GLU A 1 71  ? -11.680 18.946  -16.316 1.00 40.31 ? 71  GLU A CB   1  
ATOM 1108   C CG   . GLU A 1 71  ? -12.000 17.448  -16.492 1.00 74.03 ? 71  GLU A CG   1  
ATOM 1109   C CD   . GLU A 1 71  ? -11.059 16.706  -17.446 1.00 24.33 ? 71  GLU A CD   1  
ATOM 1110   O OE1  . GLU A 1 71  ? -11.354 16.634  -18.658 1.00 23.43 ? 71  GLU A OE1  1  
ATOM 1111   O OE2  . GLU A 1 71  ? -10.014 16.205  -16.985 1.00 0.34  ? 71  GLU A OE2  1  
ATOM 1112   H H    . GLU A 1 71  ? -11.486 21.455  -15.496 1.00 12.50 ? 71  GLU A H    1  
ATOM 1113   H HA   . GLU A 1 71  ? -13.504 19.342  -15.208 1.00 13.11 ? 71  GLU A HA   1  
ATOM 1114   H HB2  . GLU A 1 71  ? -11.945 19.468  -17.233 1.00 70.11 ? 71  GLU A HB2  1  
ATOM 1115   H HB3  . GLU A 1 71  ? -10.606 19.052  -16.153 1.00 3.41  ? 71  GLU A HB3  1  
ATOM 1116   H HG2  . GLU A 1 71  ? -11.947 16.969  -15.517 1.00 20.14 ? 71  GLU A HG2  1  
ATOM 1117   H HG3  . GLU A 1 71  ? -13.022 17.352  -16.858 1.00 64.14 ? 71  GLU A HG3  1  
ATOM 1118   N N    . THR A 1 72  ? -12.618 18.143  -13.129 1.00 25.11 ? 72  THR A N    1  
ATOM 1119   C CA   . THR A 1 72  ? -12.118 17.497  -11.908 1.00 13.33 ? 72  THR A CA   1  
ATOM 1120   C C    . THR A 1 72  ? -11.029 16.464  -12.257 1.00 33.43 ? 72  THR A C    1  
ATOM 1121   O O    . THR A 1 72  ? -11.261 15.547  -13.056 1.00 25.30 ? 72  THR A O    1  
ATOM 1122   C CB   . THR A 1 72  ? -13.256 16.799  -11.100 1.00 33.35 ? 72  THR A CB   1  
ATOM 1123   O OG1  . THR A 1 72  ? -14.308 17.741  -10.852 1.00 64.51 ? 72  THR A OG1  1  
ATOM 1124   C CG2  . THR A 1 72  ? -12.740 16.236  -9.754  1.00 71.25 ? 72  THR A CG2  1  
ATOM 1125   H H    . THR A 1 72  ? -13.505 17.907  -13.453 1.00 64.54 ? 72  THR A H    1  
ATOM 1126   H HA   . THR A 1 72  ? -11.686 18.274  -11.278 1.00 12.52 ? 72  THR A HA   1  
ATOM 1127   H HB   . THR A 1 72  ? -13.659 15.982  -11.690 1.00 13.23 ? 72  THR A HB   1  
ATOM 1128   H HG1  . THR A 1 72  ? -15.155 17.347  -11.087 1.00 51.25 ? 72  THR A HG1  1  
ATOM 1129   H HG21 . THR A 1 72  ? -12.392 17.046  -9.127  1.00 24.13 ? 72  THR A HG21 1  
ATOM 1130   H HG22 . THR A 1 72  ? -11.920 15.549  -9.932  1.00 71.44 ? 72  THR A HG22 1  
ATOM 1131   H HG23 . THR A 1 72  ? -13.528 15.711  -9.249  1.00 2.12  ? 72  THR A HG23 1  
ATOM 1132   N N    . ALA A 1 73  ? -9.847  16.645  -11.653 1.00 31.31 ? 73  ALA A N    1  
ATOM 1133   C CA   . ALA A 1 73  ? -8.724  15.707  -11.770 1.00 24.41 ? 73  ALA A CA   1  
ATOM 1134   C C    . ALA A 1 73  ? -9.030  14.437  -10.974 1.00 11.14 ? 73  ALA A C    1  
ATOM 1135   O O    . ALA A 1 73  ? -9.061  13.326  -11.522 1.00 12.04 ? 73  ALA A O    1  
ATOM 1136   C CB   . ALA A 1 73  ? -7.421  16.354  -11.283 1.00 40.32 ? 73  ALA A CB   1  
ATOM 1137   H H    . ALA A 1 73  ? -9.740  17.436  -11.095 1.00 53.32 ? 73  ALA A H    1  
ATOM 1138   H HA   . ALA A 1 73  ? -8.607  15.450  -12.817 1.00 22.41 ? 73  ALA A HA   1  
ATOM 1139   H HB1  . ALA A 1 73  ? -7.250  17.265  -11.826 1.00 0.31  ? 73  ALA A HB1  1  
ATOM 1140   H HB2  . ALA A 1 73  ? -6.585  15.683  -11.442 1.00 14.22 ? 73  ALA A HB2  1  
ATOM 1141   H HB3  . ALA A 1 73  ? -7.498  16.583  -10.237 1.00 34.40 ? 73  ALA A HB3  1  
ATOM 1142   N N    . PHE A 1 74  ? -9.288  14.641  -9.676  1.00 44.22 ? 74  PHE A N    1  
ATOM 1143   C CA   . PHE A 1 74  ? -9.628  13.562  -8.742  1.00 44.30 ? 74  PHE A CA   1  
ATOM 1144   C C    . PHE A 1 74  ? -10.280 14.120  -7.465  1.00 54.22 ? 74  PHE A C    1  
ATOM 1145   O O    . PHE A 1 74  ? -10.432 15.331  -7.296  1.00 53.21 ? 74  PHE A O    1  
ATOM 1146   C CB   . PHE A 1 74  ? -8.394  12.659  -8.405  1.00 44.34 ? 74  PHE A CB   1  
ATOM 1147   C CG   . PHE A 1 74  ? -7.239  13.338  -7.659  1.00 12.02 ? 74  PHE A CG   1  
ATOM 1148   C CD1  . PHE A 1 74  ? -7.282  13.519  -6.272  1.00 15.10 ? 74  PHE A CD1  1  
ATOM 1149   C CD2  . PHE A 1 74  ? -6.099  13.766  -8.337  1.00 0.20  ? 74  PHE A CD2  1  
ATOM 1150   C CE1  . PHE A 1 74  ? -6.232  14.100  -5.598  1.00 24.31 ? 74  PHE A CE1  1  
ATOM 1151   C CE2  . PHE A 1 74  ? -5.047  14.352  -7.660  1.00 15.15 ? 74  PHE A CE2  1  
ATOM 1152   C CZ   . PHE A 1 74  ? -5.115  14.514  -6.292  1.00 51.42 ? 74  PHE A CZ   1  
ATOM 1153   H H    . PHE A 1 74  ? -9.260  15.564  -9.336  1.00 41.21 ? 74  PHE A H    1  
ATOM 1154   H HA   . PHE A 1 74  ? -10.377 12.944  -9.233  1.00 4.12  ? 74  PHE A HA   1  
ATOM 1155   H HB2  . PHE A 1 74  ? -8.727  11.823  -7.799  1.00 44.12 ? 74  PHE A HB2  1  
ATOM 1156   H HB3  . PHE A 1 74  ? -8.001  12.260  -9.334  1.00 4.44  ? 74  PHE A HB3  1  
ATOM 1157   H HD1  . PHE A 1 74  ? -8.155  13.191  -5.721  1.00 74.24 ? 74  PHE A HD1  1  
ATOM 1158   H HD2  . PHE A 1 74  ? -6.039  13.641  -9.411  1.00 20.53 ? 74  PHE A HD2  1  
ATOM 1159   H HE1  . PHE A 1 74  ? -6.284  14.240  -4.522  1.00 70.43 ? 74  PHE A HE1  1  
ATOM 1160   H HE2  . PHE A 1 74  ? -4.169  14.680  -8.201  1.00 3.13  ? 74  PHE A HE2  1  
ATOM 1161   H HZ   . PHE A 1 74  ? -4.290  14.956  -5.760  1.00 43.31 ? 74  PHE A HZ   1  
ATOM 1162   N N    . LEU A 1 75  ? -10.676 13.193  -6.593  1.00 25.44 ? 75  LEU A N    1  
ATOM 1163   C CA   . LEU A 1 75  ? -11.255 13.460  -5.279  1.00 42.00 ? 75  LEU A CA   1  
ATOM 1164   C C    . LEU A 1 75  ? -10.662 12.432  -4.300  1.00 65.53 ? 75  LEU A C    1  
ATOM 1165   O O    . LEU A 1 75  ? -10.433 11.281  -4.673  1.00 52.42 ? 75  LEU A O    1  
ATOM 1166   C CB   . LEU A 1 75  ? -12.807 13.353  -5.343  1.00 52.51 ? 75  LEU A CB   1  
ATOM 1167   C CG   . LEU A 1 75  ? -13.584 13.557  -3.998  1.00 13.24 ? 75  LEU A CG   1  
ATOM 1168   C CD1  . LEU A 1 75  ? -13.289 14.937  -3.372  1.00 4.24  ? 75  LEU A CD1  1  
ATOM 1169   C CD2  . LEU A 1 75  ? -15.102 13.339  -4.198  1.00 22.35 ? 75  LEU A CD2  1  
ATOM 1170   H H    . LEU A 1 75  ? -10.559 12.256  -6.845  1.00 53.14 ? 75  LEU A H    1  
ATOM 1171   H HA   . LEU A 1 75  ? -10.967 14.465  -4.965  1.00 1.10  ? 75  LEU A HA   1  
ATOM 1172   H HB2  . LEU A 1 75  ? -13.163 14.092  -6.054  1.00 30.00 ? 75  LEU A HB2  1  
ATOM 1173   H HB3  . LEU A 1 75  ? -13.058 12.371  -5.733  1.00 71.55 ? 75  LEU A HB3  1  
ATOM 1174   H HG   . LEU A 1 75  ? -13.242 12.811  -3.289  1.00 2.34  ? 75  LEU A HG   1  
ATOM 1175   H HD11 . LEU A 1 75  ? -13.827 15.040  -2.443  1.00 41.23 ? 75  LEU A HD11 1  
ATOM 1176   H HD12 . LEU A 1 75  ? -13.595 15.724  -4.047  1.00 25.42 ? 75  LEU A HD12 1  
ATOM 1177   H HD13 . LEU A 1 75  ? -12.228 15.028  -3.179  1.00 34.35 ? 75  LEU A HD13 1  
ATOM 1178   H HD21 . LEU A 1 75  ? -15.618 13.464  -3.254  1.00 13.32 ? 75  LEU A HD21 1  
ATOM 1179   H HD22 . LEU A 1 75  ? -15.280 12.337  -4.564  1.00 13.23 ? 75  LEU A HD22 1  
ATOM 1180   H HD23 . LEU A 1 75  ? -15.490 14.053  -4.914  1.00 13.32 ? 75  LEU A HD23 1  
ATOM 1181   N N    . CYS A 1 76  ? -10.386 12.865  -3.068  1.00 1.53  ? 76  CYS A N    1  
ATOM 1182   C CA   . CYS A 1 76  ? -9.787  12.032  -2.017  1.00 13.12 ? 76  CYS A CA   1  
ATOM 1183   C C    . CYS A 1 76  ? -10.370 12.456  -0.663  1.00 25.35 ? 76  CYS A C    1  
ATOM 1184   O O    . CYS A 1 76  ? -10.037 13.526  -0.153  1.00 23.30 ? 76  CYS A O    1  
ATOM 1185   C CB   . CYS A 1 76  ? -8.248  12.189  -2.004  1.00 42.44 ? 76  CYS A CB   1  
ATOM 1186   S SG   . CYS A 1 76  ? -7.419  11.691  -3.522  1.00 72.01 ? 76  CYS A SG   1  
ATOM 1187   H H    . CYS A 1 76  ? -10.600 13.790  -2.849  1.00 41.21 ? 76  CYS A H    1  
ATOM 1188   H HA   . CYS A 1 76  ? -10.038 10.988  -2.209  1.00 44.52 ? 76  CYS A HA   1  
ATOM 1189   H HB2  . CYS A 1 76  ? -7.993  13.228  -1.829  1.00 53.23 ? 76  CYS A HB2  1  
ATOM 1190   H HB3  . CYS A 1 76  ? -7.834  11.589  -1.202  1.00 62.32 ? 76  CYS A HB3  1  
ATOM 1191   H HG   . CYS A 1 76  ? -8.345  11.473  -4.442  1.00 45.01 ? 76  CYS A HG   1  
ATOM 1192   N N    . GLU A 1 77  ? -11.243 11.626  -0.095  1.00 32.01 ? 77  GLU A N    1  
ATOM 1193   C CA   . GLU A 1 77  ? -11.979 11.945  1.130   1.00 11.30 ? 77  GLU A CA   1  
ATOM 1194   C C    . GLU A 1 77  ? -11.850 10.785  2.120   1.00 42.32 ? 77  GLU A C    1  
ATOM 1195   O O    . GLU A 1 77  ? -12.210 9.650   1.803   1.00 73.12 ? 77  GLU A O    1  
ATOM 1196   C CB   . GLU A 1 77  ? -13.461 12.220  0.791   1.00 11.15 ? 77  GLU A CB   1  
ATOM 1197   C CG   . GLU A 1 77  ? -14.311 12.642  1.999   1.00 62.34 ? 77  GLU A CG   1  
ATOM 1198   C CD   . GLU A 1 77  ? -15.777 12.895  1.637   1.00 3.44  ? 77  GLU A CD   1  
ATOM 1199   O OE1  . GLU A 1 77  ? -16.537 11.919  1.498   1.00 60.00 ? 77  GLU A OE1  1  
ATOM 1200   O OE2  . GLU A 1 77  ? -16.180 14.068  1.511   1.00 34.33 ? 77  GLU A OE2  1  
ATOM 1201   H H    . GLU A 1 77  ? -11.393 10.754  -0.503  1.00 24.14 ? 77  GLU A H    1  
ATOM 1202   H HA   . GLU A 1 77  ? -11.541 12.839  1.575   1.00 52.23 ? 77  GLU A HA   1  
ATOM 1203   H HB2  . GLU A 1 77  ? -13.506 13.010  0.047   1.00 25.41 ? 77  GLU A HB2  1  
ATOM 1204   H HB3  . GLU A 1 77  ? -13.897 11.321  0.363   1.00 24.11 ? 77  GLU A HB3  1  
ATOM 1205   H HG2  . GLU A 1 77  ? -14.264 11.860  2.749   1.00 14.30 ? 77  GLU A HG2  1  
ATOM 1206   H HG3  . GLU A 1 77  ? -13.887 13.552  2.419   1.00 72.43 ? 77  GLU A HG3  1  
ATOM 1207   N N    . VAL A 1 78  ? -11.325 11.089  3.313   1.00 31.52 ? 78  VAL A N    1  
ATOM 1208   C CA   . VAL A 1 78  ? -10.973 10.098  4.336   1.00 12.44 ? 78  VAL A CA   1  
ATOM 1209   C C    . VAL A 1 78  ? -11.533 10.538  5.697   1.00 43.32 ? 78  VAL A C    1  
ATOM 1210   O O    . VAL A 1 78  ? -11.143 11.579  6.239   1.00 22.43 ? 78  VAL A O    1  
ATOM 1211   C CB   . VAL A 1 78  ? -9.404  9.908   4.379   1.00 10.23 ? 78  VAL A CB   1  
ATOM 1212   C CG1  . VAL A 1 78  ? -8.923  9.191   5.674   1.00 53.32 ? 78  VAL A CG1  1  
ATOM 1213   C CG2  . VAL A 1 78  ? -8.931  9.159   3.098   1.00 32.02 ? 78  VAL A CG2  1  
ATOM 1214   H H    . VAL A 1 78  ? -11.167 12.032  3.519   1.00 1.43  ? 78  VAL A H    1  
ATOM 1215   H HA   . VAL A 1 78  ? -11.423 9.140   4.065   1.00 50.23 ? 78  VAL A HA   1  
ATOM 1216   H HB   . VAL A 1 78  ? -8.949  10.896  4.368   1.00 23.23 ? 78  VAL A HB   1  
ATOM 1217   H HG11 . VAL A 1 78  ? -9.134  9.817   6.533   1.00 23.12 ? 78  VAL A HG11 1  
ATOM 1218   H HG12 . VAL A 1 78  ? -7.858  9.011   5.624   1.00 21.30 ? 78  VAL A HG12 1  
ATOM 1219   H HG13 . VAL A 1 78  ? -9.437  8.254   5.790   1.00 32.23 ? 78  VAL A HG13 1  
ATOM 1220   H HG21 . VAL A 1 78  ? -9.193  8.110   3.163   1.00 50.23 ? 78  VAL A HG21 1  
ATOM 1221   H HG22 . VAL A 1 78  ? -7.869  9.259   2.981   1.00 72.21 ? 78  VAL A HG22 1  
ATOM 1222   H HG23 . VAL A 1 78  ? -9.413  9.587   2.227   1.00 53.13 ? 78  VAL A HG23 1  
ATOM 1223   N N    . GLN A 1 79  ? -12.484 9.745   6.210   1.00 22.45 ? 79  GLN A N    1  
ATOM 1224   C CA   . GLN A 1 79  ? -13.054 9.909   7.545   1.00 2.13  ? 79  GLN A CA   1  
ATOM 1225   C C    . GLN A 1 79  ? -12.138 9.198   8.553   1.00 51.14 ? 79  GLN A C    1  
ATOM 1226   O O    . GLN A 1 79  ? -12.280 7.993   8.793   1.00 4.24  ? 79  GLN A O    1  
ATOM 1227   C CB   . GLN A 1 79  ? -14.486 9.311   7.583   1.00 23.02 ? 79  GLN A CB   1  
ATOM 1228   C CG   . GLN A 1 79  ? -15.312 9.693   8.817   1.00 35.45 ? 79  GLN A CG   1  
ATOM 1229   C CD   . GLN A 1 79  ? -16.600 8.885   9.038   1.00 31.24 ? 79  GLN A CD   1  
ATOM 1230   O OE1  . GLN A 1 79  ? -17.009 8.660   10.178  1.00 3.35  ? 79  GLN A OE1  1  
ATOM 1231   N NE2  . GLN A 1 79  ? -17.267 8.476   7.971   1.00 45.51 ? 79  GLN A NE2  1  
ATOM 1232   H H    . GLN A 1 79  ? -12.819 9.016   5.655   1.00 0.24  ? 79  GLN A H    1  
ATOM 1233   H HA   . GLN A 1 79  ? -13.100 10.968  7.777   1.00 30.23 ? 79  GLN A HA   1  
ATOM 1234   H HB2  . GLN A 1 79  ? -15.027 9.631   6.698   1.00 42.24 ? 79  GLN A HB2  1  
ATOM 1235   H HB3  . GLN A 1 79  ? -14.404 8.232   7.562   1.00 31.42 ? 79  GLN A HB3  1  
ATOM 1236   H HG2  . GLN A 1 79  ? -14.688 9.554   9.684   1.00 54.34 ? 79  GLN A HG2  1  
ATOM 1237   H HG3  . GLN A 1 79  ? -15.577 10.740  8.742   1.00 24.21 ? 79  GLN A HG3  1  
ATOM 1238   H HE21 . GLN A 1 79  ? -16.915 8.700   7.089   1.00 64.33 ? 79  GLN A HE21 1  
ATOM 1239   H HE22 . GLN A 1 79  ? -18.089 7.961   8.112   1.00 63.22 ? 79  GLN A HE22 1  
ATOM 1240   N N    . GLN A 1 80  ? -11.159 9.942   9.085   1.00 55.25 ? 80  GLN A N    1  
ATOM 1241   C CA   . GLN A 1 80  ? -10.159 9.395   10.001  1.00 63.03 ? 80  GLN A CA   1  
ATOM 1242   C C    . GLN A 1 80  ? -10.717 9.414   11.431  1.00 21.41 ? 80  GLN A C    1  
ATOM 1243   O O    . GLN A 1 80  ? -10.828 10.481  12.048  1.00 25.45 ? 80  GLN A O    1  
ATOM 1244   C CB   . GLN A 1 80  ? -8.839  10.203  9.899   1.00 25.43 ? 80  GLN A CB   1  
ATOM 1245   C CG   . GLN A 1 80  ? -7.620  9.546   10.577  1.00 13.11 ? 80  GLN A CG   1  
ATOM 1246   C CD   . GLN A 1 80  ? -7.310  8.149   10.032  1.00 12.42 ? 80  GLN A CD   1  
ATOM 1247   O OE1  . GLN A 1 80  ? -7.742  7.139   10.581  1.00 75.32 ? 80  GLN A OE1  1  
ATOM 1248   N NE2  . GLN A 1 80  ? -6.593  8.085   8.919   1.00 34.15 ? 80  GLN A NE2  1  
ATOM 1249   H H    . GLN A 1 80  ? -11.116 10.896  8.859   1.00 54.45 ? 80  GLN A H    1  
ATOM 1250   H HA   . GLN A 1 80  ? -9.958  8.363   9.709   1.00 13.15 ? 80  GLN A HA   1  
ATOM 1251   H HB2  . GLN A 1 80  ? -8.601  10.349  8.849   1.00 74.43 ? 80  GLN A HB2  1  
ATOM 1252   H HB3  . GLN A 1 80  ? -8.992  11.179  10.350  1.00 45.14 ? 80  GLN A HB3  1  
ATOM 1253   H HG2  . GLN A 1 80  ? -6.751  10.178  10.426  1.00 14.00 ? 80  GLN A HG2  1  
ATOM 1254   H HG3  . GLN A 1 80  ? -7.816  9.467   11.641  1.00 75.23 ? 80  GLN A HG3  1  
ATOM 1255   H HE21 . GLN A 1 80  ? -6.307  8.923   8.504   1.00 54.33 ? 80  GLN A HE21 1  
ATOM 1256   H HE22 . GLN A 1 80  ? -6.387  7.201   8.554   1.00 24.43 ? 80  GLN A HE22 1  
ATOM 1257   N N    . GLY A 1 81  ? -11.119 8.234   11.915  1.00 55.33 ? 81  GLY A N    1  
ATOM 1258   C CA   . GLY A 1 81  ? -11.633 8.067   13.268  1.00 51.14 ? 81  GLY A CA   1  
ATOM 1259   C C    . GLY A 1 81  ? -10.533 7.687   14.236  1.00 62.03 ? 81  GLY A C    1  
ATOM 1260   O O    . GLY A 1 81  ? -9.517  7.102   13.835  1.00 50.32 ? 81  GLY A O    1  
ATOM 1261   H H    . GLY A 1 81  ? -11.036 7.445   11.344  1.00 72.22 ? 81  GLY A H    1  
ATOM 1262   H HA2  . GLY A 1 81  ? -12.111 8.986   13.600  1.00 63.14 ? 81  GLY A HA2  1  
ATOM 1263   H HA3  . GLY A 1 81  ? -12.373 7.279   13.260  1.00 22.00 ? 81  GLY A HA3  1  
ATOM 1264   N N    . GLY A 1 82  ? -10.720 8.029   15.508  1.00 62.12 ? 82  GLY A N    1  
ATOM 1265   C CA   . GLY A 1 82  ? -9.758  7.694   16.541  1.00 63.34 ? 82  GLY A CA   1  
ATOM 1266   C C    . GLY A 1 82  ? -10.410 7.642   17.899  1.00 40.41 ? 82  GLY A C    1  
ATOM 1267   O O    . GLY A 1 82  ? -11.023 8.623   18.336  1.00 34.30 ? 82  GLY A O    1  
ATOM 1268   H H    . GLY A 1 82  ? -11.527 8.529   15.753  1.00 45.33 ? 82  GLY A H    1  
ATOM 1269   H HA2  . GLY A 1 82  ? -9.303  6.730   16.318  1.00 41.32 ? 82  GLY A HA2  1  
ATOM 1270   H HA3  . GLY A 1 82  ? -8.982  8.451   16.554  1.00 43.43 ? 82  GLY A HA3  1  
ATOM 1271   N N    . ILE A 1 83  ? -10.303 6.484   18.553  1.00 64.23 ? 83  ILE A N    1  
ATOM 1272   C CA   . ILE A 1 83  ? -10.799 6.276   19.907  1.00 45.51 ? 83  ILE A CA   1  
ATOM 1273   C C    . ILE A 1 83  ? -9.751  6.789   20.907  1.00 4.02  ? 83  ILE A C    1  
ATOM 1274   O O    . ILE A 1 83  ? -8.629  6.254   20.968  1.00 55.00 ? 83  ILE A O    1  
ATOM 1275   C CB   . ILE A 1 83  ? -11.082 4.757   20.189  1.00 41.44 ? 83  ILE A CB   1  
ATOM 1276   C CG1  . ILE A 1 83  ? -11.970 4.137   19.055  1.00 23.44 ? 83  ILE A CG1  1  
ATOM 1277   C CG2  . ILE A 1 83  ? -11.717 4.568   21.604  1.00 33.13 ? 83  ILE A CG2  1  
ATOM 1278   C CD1  . ILE A 1 83  ? -12.219 2.640   19.183  1.00 50.22 ? 83  ILE A CD1  1  
ATOM 1279   H H    . ILE A 1 83  ? -9.862  5.739   18.101  1.00 50.30 ? 83  ILE A H    1  
ATOM 1280   H HA   . ILE A 1 83  ? -11.726 6.837   20.027  1.00 51.40 ? 83  ILE A HA   1  
ATOM 1281   H HB   . ILE A 1 83  ? -10.121 4.239   20.186  1.00 11.12 ? 83  ILE A HB   1  
ATOM 1282   H HG12 . ILE A 1 83  ? -12.934 4.623   19.044  1.00 1.14  ? 83  ILE A HG12 1  
ATOM 1283   H HG13 . ILE A 1 83  ? -11.488 4.300   18.098  1.00 1.21  ? 83  ILE A HG13 1  
ATOM 1284   H HG21 . ILE A 1 83  ? -11.187 3.798   22.143  1.00 44.12 ? 83  ILE A HG21 1  
ATOM 1285   H HG22 . ILE A 1 83  ? -12.755 4.284   21.520  1.00 34.52 ? 83  ILE A HG22 1  
ATOM 1286   H HG23 . ILE A 1 83  ? -11.658 5.490   22.174  1.00 20.54 ? 83  ILE A HG23 1  
ATOM 1287   H HD11 . ILE A 1 83  ? -12.812 2.304   18.345  1.00 64.42 ? 83  ILE A HD11 1  
ATOM 1288   H HD12 . ILE A 1 83  ? -12.748 2.435   20.102  1.00 10.05 ? 83  ILE A HD12 1  
ATOM 1289   H HD13 . ILE A 1 83  ? -11.274 2.114   19.185  1.00 35.52 ? 83  ILE A HD13 1  
ATOM 1290   N N    . PHE A 1 84  ? -10.118 7.821   21.677  1.00 74.53 ? 84  PHE A N    1  
ATOM 1291   C CA   . PHE A 1 84  ? -9.207  8.488   22.621  1.00 73.20 ? 84  PHE A CA   1  
ATOM 1292   C C    . PHE A 1 84  ? -9.847  8.539   24.022  1.00 43.54 ? 84  PHE A C    1  
ATOM 1293   O O    . PHE A 1 84  ? -10.937 9.094   24.198  1.00 53.23 ? 84  PHE A O    1  
ATOM 1294   C CB   . PHE A 1 84  ? -8.880  9.930   22.124  1.00 54.04 ? 84  PHE A CB   1  
ATOM 1295   C CG   . PHE A 1 84  ? -8.387  10.013  20.674  1.00 54.21 ? 84  PHE A CG   1  
ATOM 1296   C CD1  . PHE A 1 84  ? -9.094  10.722  19.710  1.00 41.22 ? 84  PHE A CD1  1  
ATOM 1297   C CD2  . PHE A 1 84  ? -7.197  9.397   20.288  1.00 11.13 ? 84  PHE A CD2  1  
ATOM 1298   C CE1  . PHE A 1 84  ? -8.623  10.818  18.412  1.00 55.20 ? 84  PHE A CE1  1  
ATOM 1299   C CE2  . PHE A 1 84  ? -6.732  9.487   18.992  1.00 20.51 ? 84  PHE A CE2  1  
ATOM 1300   C CZ   . PHE A 1 84  ? -7.444  10.197  18.056  1.00 35.04 ? 84  PHE A CZ   1  
ATOM 1301   H H    . PHE A 1 84  ? -11.040 8.144   21.610  1.00 44.14 ? 84  PHE A H    1  
ATOM 1302   H HA   . PHE A 1 84  ? -8.284  7.912   22.675  1.00 1.15  ? 84  PHE A HA   1  
ATOM 1303   H HB2  . PHE A 1 84  ? -9.764  10.550  22.220  1.00 4.25  ? 84  PHE A HB2  1  
ATOM 1304   H HB3  . PHE A 1 84  ? -8.087  10.358  22.750  1.00 4.01  ? 84  PHE A HB3  1  
ATOM 1305   H HD1  . PHE A 1 84  ? -10.027 11.199  19.981  1.00 3.42  ? 84  PHE A HD1  1  
ATOM 1306   H HD2  . PHE A 1 84  ? -6.629  8.833   21.021  1.00 60.51 ? 84  PHE A HD2  1  
ATOM 1307   H HE1  . PHE A 1 84  ? -9.185  11.374  17.673  1.00 51.23 ? 84  PHE A HE1  1  
ATOM 1308   H HE2  . PHE A 1 84  ? -5.808  8.997   18.712  1.00 12.34 ? 84  PHE A HE2  1  
ATOM 1309   H HZ   . PHE A 1 84  ? -7.077  10.273  17.041  1.00 51.13 ? 84  PHE A HZ   1  
ATOM 1310   N N    . SER A 1 85  ? -9.171  7.941   25.006  1.00 24.41 ? 85  SER A N    1  
ATOM 1311   C CA   . SER A 1 85  ? -9.566  8.025   26.414  1.00 71.32 ? 85  SER A CA   1  
ATOM 1312   C C    . SER A 1 85  ? -9.060  9.361   26.982  1.00 5.34  ? 85  SER A C    1  
ATOM 1313   O O    . SER A 1 85  ? -7.855  9.526   27.235  1.00 44.20 ? 85  SER A O    1  
ATOM 1314   C CB   . SER A 1 85  ? -8.999  6.821   27.190  1.00 64.42 ? 85  SER A CB   1  
ATOM 1315   O OG   . SER A 1 85  ? -9.475  5.605   26.636  1.00 61.53 ? 85  SER A OG   1  
ATOM 1316   H H    . SER A 1 85  ? -8.371  7.430   24.780  1.00 74.54 ? 85  SER A H    1  
ATOM 1317   H HA   . SER A 1 85  ? -10.654 7.998   26.467  1.00 74.31 ? 85  SER A HA   1  
ATOM 1318   H HB2  . SER A 1 85  ? -7.917  6.826   27.132  1.00 21.43 ? 85  SER A HB2  1  
ATOM 1319   H HB3  . SER A 1 85  ? -9.304  6.872   28.227  1.00 71.32 ? 85  SER A HB3  1  
ATOM 1320   H HG   . SER A 1 85  ? -8.808  5.241   26.047  1.00 11.21 ? 85  SER A HG   1  
ATOM 1321   N N    . ILE A 1 86  ? -9.981  10.328  27.106  1.00 60.10 ? 86  ILE A N    1  
ATOM 1322   C CA   . ILE A 1 86  ? -9.675  11.702  27.536  1.00 3.13  ? 86  ILE A CA   1  
ATOM 1323   C C    . ILE A 1 86  ? -10.569 12.092  28.732  1.00 35.33 ? 86  ILE A C    1  
ATOM 1324   O O    . ILE A 1 86  ? -11.804 12.046  28.646  1.00 43.41 ? 86  ILE A O    1  
ATOM 1325   C CB   . ILE A 1 86  ? -9.824  12.733  26.340  1.00 24.13 ? 86  ILE A CB   1  
ATOM 1326   C CG1  . ILE A 1 86  ? -11.212 12.591  25.622  1.00 23.34 ? 86  ILE A CG1  1  
ATOM 1327   C CG2  . ILE A 1 86  ? -8.654  12.585  25.327  1.00 62.11 ? 86  ILE A CG2  1  
ATOM 1328   C CD1  . ILE A 1 86  ? -11.443 13.561  24.473  1.00 42.22 ? 86  ILE A CD1  1  
ATOM 1329   H H    . ILE A 1 86  ? -10.918 10.102  26.914  1.00 0.14  ? 86  ILE A H    1  
ATOM 1330   H HA   . ILE A 1 86  ? -8.634  11.727  27.868  1.00 62.02 ? 86  ILE A HA   1  
ATOM 1331   H HB   . ILE A 1 86  ? -9.753  13.734  26.761  1.00 21.04 ? 86  ILE A HB   1  
ATOM 1332   H HG12 . ILE A 1 86  ? -11.310 11.591  25.223  1.00 73.50 ? 86  ILE A HG12 1  
ATOM 1333   H HG13 . ILE A 1 86  ? -12.003 12.753  26.347  1.00 2.24  ? 86  ILE A HG13 1  
ATOM 1334   H HG21 . ILE A 1 86  ? -8.745  13.329  24.546  1.00 73.12 ? 86  ILE A HG21 1  
ATOM 1335   H HG22 . ILE A 1 86  ? -8.677  11.599  24.880  1.00 52.13 ? 86  ILE A HG22 1  
ATOM 1336   H HG23 . ILE A 1 86  ? -7.707  12.719  25.837  1.00 21.12 ? 86  ILE A HG23 1  
ATOM 1337   H HD11 . ILE A 1 86  ? -10.705 13.398  23.703  1.00 14.33 ? 86  ILE A HD11 1  
ATOM 1338   H HD12 . ILE A 1 86  ? -11.368 14.578  24.836  1.00 31.51 ? 86  ILE A HD12 1  
ATOM 1339   H HD13 . ILE A 1 86  ? -12.430 13.401  24.066  1.00 41.51 ? 86  ILE A HD13 1  
ATOM 1340   N N    . ALA A 1 87  ? -9.908  12.441  29.845  1.00 14.25 ? 87  ALA A N    1  
ATOM 1341   C CA   . ALA A 1 87  ? -10.550 12.802  31.124  1.00 44.04 ? 87  ALA A CA   1  
ATOM 1342   C C    . ALA A 1 87  ? -9.508  13.385  32.066  1.00 30.54 ? 87  ALA A C    1  
ATOM 1343   O O    . ALA A 1 87  ? -8.292  13.303  31.804  1.00 50.23 ? 87  ALA A O    1  
ATOM 1344   C CB   . ALA A 1 87  ? -11.239 11.583  31.771  1.00 51.32 ? 87  ALA A CB   1  
ATOM 1345   H H    . ALA A 1 87  ? -8.925  12.463  29.810  1.00 43.01 ? 87  ALA A H    1  
ATOM 1346   H HA   . ALA A 1 87  ? -11.294 13.577  30.940  1.00 24.13 ? 87  ALA A HA   1  
ATOM 1347   H HB1  . ALA A 1 87  ? -10.506 10.812  31.975  1.00 50.10 ? 87  ALA A HB1  1  
ATOM 1348   H HB2  . ALA A 1 87  ? -11.987 11.186  31.095  1.00 43.41 ? 87  ALA A HB2  1  
ATOM 1349   H HB3  . ALA A 1 87  ? -11.718 11.877  32.696  1.00 44.33 ? 87  ALA A HB3  1  
ATOM 1350   N N    . GLY A 1 88  ? -9.998  13.957  33.173  1.00 71.45 ? 88  GLY A N    1  
ATOM 1351   C CA   . GLY A 1 88  ? -9.157  14.699  34.080  1.00 2.20  ? 88  GLY A CA   1  
ATOM 1352   C C    . GLY A 1 88  ? -8.919  16.099  33.553  1.00 21.35 ? 88  GLY A C    1  
ATOM 1353   O O    . GLY A 1 88  ? -8.117  16.275  32.645  1.00 30.53 ? 88  GLY A O    1  
ATOM 1354   H H    . GLY A 1 88  ? -10.960 13.882  33.364  1.00 51.10 ? 88  GLY A H    1  
ATOM 1355   H HA2  . GLY A 1 88  ? -9.642  14.748  35.046  1.00 51.01 ? 88  GLY A HA2  1  
ATOM 1356   H HA3  . GLY A 1 88  ? -8.199  14.199  34.194  1.00 32.34 ? 88  GLY A HA3  1  
ATOM 1357   N N    . ILE A 1 89  ? -9.716  17.049  34.058  1.00 75.22 ? 89  ILE A N    1  
ATOM 1358   C CA   . ILE A 1 89  ? -9.550  18.507  33.843  1.00 23.50 ? 89  ILE A CA   1  
ATOM 1359   C C    . ILE A 1 89  ? -10.291 18.939  32.560  1.00 30.13 ? 89  ILE A C    1  
ATOM 1360   O O    . ILE A 1 89  ? -9.866  18.627  31.443  1.00 50.50 ? 89  ILE A O    1  
ATOM 1361   C CB   . ILE A 1 89  ? -8.030  18.978  33.878  1.00 60.21 ? 89  ILE A CB   1  
ATOM 1362   C CG1  . ILE A 1 89  ? -7.434  18.808  35.310  1.00 4.54  ? 89  ILE A CG1  1  
ATOM 1363   C CG2  . ILE A 1 89  ? -7.840  20.421  33.371  1.00 62.30 ? 89  ILE A CG2  1  
ATOM 1364   C CD1  . ILE A 1 89  ? -8.103  19.648  36.392  1.00 24.24 ? 89  ILE A CD1  1  
ATOM 1365   H H    . ILE A 1 89  ? -10.510 16.744  34.541  1.00 53.51 ? 89  ILE A H    1  
ATOM 1366   H HA   . ILE A 1 89  ? -10.052 18.980  34.683  1.00 32.44 ? 89  ILE A HA   1  
ATOM 1367   H HB   . ILE A 1 89  ? -7.479  18.331  33.203  1.00 55.40 ? 89  ILE A HB   1  
ATOM 1368   H HG12 . ILE A 1 89  ? -7.523  17.771  35.609  1.00 50.12 ? 89  ILE A HG12 1  
ATOM 1369   H HG13 . ILE A 1 89  ? -6.384  19.072  35.291  1.00 70.21 ? 89  ILE A HG13 1  
ATOM 1370   H HG21 . ILE A 1 89  ? -8.396  21.108  33.998  1.00 14.01 ? 89  ILE A HG21 1  
ATOM 1371   H HG22 . ILE A 1 89  ? -8.199  20.502  32.354  1.00 73.34 ? 89  ILE A HG22 1  
ATOM 1372   H HG23 . ILE A 1 89  ? -6.790  20.686  33.398  1.00 74.34 ? 89  ILE A HG23 1  
ATOM 1373   H HD11 . ILE A 1 89  ? -9.135  19.346  36.497  1.00 1.41  ? 89  ILE A HD11 1  
ATOM 1374   H HD12 . ILE A 1 89  ? -8.061  20.696  36.123  1.00 20.32 ? 89  ILE A HD12 1  
ATOM 1375   H HD13 . ILE A 1 89  ? -7.588  19.499  37.329  1.00 51.40 ? 89  ILE A HD13 1  
ATOM 1376   N N    . GLU A 1 90  ? -11.413 19.669  32.768  1.00 3.23  ? 90  GLU A N    1  
ATOM 1377   C CA   . GLU A 1 90  ? -12.434 19.962  31.743  1.00 75.01 ? 90  GLU A CA   1  
ATOM 1378   C C    . GLU A 1 90  ? -12.330 21.431  31.258  1.00 43.42 ? 90  GLU A C    1  
ATOM 1379   O O    . GLU A 1 90  ? -11.308 22.089  31.465  1.00 1.22  ? 90  GLU A O    1  
ATOM 1380   C CB   . GLU A 1 90  ? -13.861 19.677  32.325  1.00 61.12 ? 90  GLU A CB   1  
ATOM 1381   C CG   . GLU A 1 90  ? -14.126 18.223  32.803  1.00 75.52 ? 90  GLU A CG   1  
ATOM 1382   C CD   . GLU A 1 90  ? -13.506 17.883  34.174  1.00 13.51 ? 90  GLU A CD   1  
ATOM 1383   O OE1  . GLU A 1 90  ? -13.922 18.491  35.188  1.00 72.32 ? 90  GLU A OE1  1  
ATOM 1384   O OE2  . GLU A 1 90  ? -12.622 17.013  34.254  1.00 63.41 ? 90  GLU A OE2  1  
ATOM 1385   H H    . GLU A 1 90  ? -11.548 20.045  33.652  1.00 30.10 ? 90  GLU A H    1  
ATOM 1386   H HA   . GLU A 1 90  ? -12.267 19.308  30.893  1.00 43.22 ? 90  GLU A HA   1  
ATOM 1387   H HB2  . GLU A 1 90  ? -14.034 20.345  33.164  1.00 42.15 ? 90  GLU A HB2  1  
ATOM 1388   H HB3  . GLU A 1 90  ? -14.594 19.910  31.555  1.00 53.31 ? 90  GLU A HB3  1  
ATOM 1389   H HG2  . GLU A 1 90  ? -15.199 18.070  32.870  1.00 5.42  ? 90  GLU A HG2  1  
ATOM 1390   H HG3  . GLU A 1 90  ? -13.731 17.542  32.057  1.00 64.15 ? 90  GLU A HG3  1  
ATOM 1391   N N    . GLY A 1 91  ? -13.402 21.912  30.592  1.00 1.10  ? 91  GLY A N    1  
ATOM 1392   C CA   . GLY A 1 91  ? -13.491 23.287  30.094  1.00 60.11 ? 91  GLY A CA   1  
ATOM 1393   C C    . GLY A 1 91  ? -12.618 23.533  28.866  1.00 53.52 ? 91  GLY A C    1  
ATOM 1394   O O    . GLY A 1 91  ? -12.416 22.616  28.067  1.00 11.24 ? 91  GLY A O    1  
ATOM 1395   H H    . GLY A 1 91  ? -14.145 21.302  30.412  1.00 14.43 ? 91  GLY A H    1  
ATOM 1396   H HA2  . GLY A 1 91  ? -14.520 23.482  29.823  1.00 11.20 ? 91  GLY A HA2  1  
ATOM 1397   H HA3  . GLY A 1 91  ? -13.209 23.974  30.886  1.00 31.43 ? 91  GLY A HA3  1  
ATOM 1398   N N    . THR A 1 92  ? -12.117 24.780  28.723  1.00 2.55  ? 92  THR A N    1  
ATOM 1399   C CA   . THR A 1 92  ? -11.208 25.194  27.627  1.00 33.22 ? 92  THR A CA   1  
ATOM 1400   C C    . THR A 1 92  ? -9.877  24.418  27.658  1.00 61.33 ? 92  THR A C    1  
ATOM 1401   O O    . THR A 1 92  ? -9.208  24.278  26.627  1.00 25.04 ? 92  THR A O    1  
ATOM 1402   C CB   . THR A 1 92  ? -10.903 26.726  27.693  1.00 1.33  ? 92  THR A CB   1  
ATOM 1403   O OG1  . THR A 1 92  ? -10.557 27.090  29.037  1.00 2.44  ? 92  THR A OG1  1  
ATOM 1404   C CG2  . THR A 1 92  ? -12.082 27.579  27.220  1.00 74.03 ? 92  THR A CG2  1  
ATOM 1405   H H    . THR A 1 92  ? -12.371 25.455  29.385  1.00 61.14 ? 92  THR A H    1  
ATOM 1406   H HA   . THR A 1 92  ? -11.709 24.984  26.686  1.00 71.00 ? 92  THR A HA   1  
ATOM 1407   H HB   . THR A 1 92  ? -10.050 26.942  27.054  1.00 3.32  ? 92  THR A HB   1  
ATOM 1408   H HG1  . THR A 1 92  ? -11.300 27.552  29.449  1.00 14.11 ? 92  THR A HG1  1  
ATOM 1409   H HG21 . THR A 1 92  ? -12.951 27.373  27.832  1.00 0.15  ? 92  THR A HG21 1  
ATOM 1410   H HG22 . THR A 1 92  ? -12.312 27.348  26.188  1.00 70.45 ? 92  THR A HG22 1  
ATOM 1411   H HG23 . THR A 1 92  ? -11.829 28.628  27.302  1.00 65.24 ? 92  THR A HG23 1  
ATOM 1412   N N    . GLN A 1 93  ? -9.518  23.940  28.855  1.00 54.03 ? 93  GLN A N    1  
ATOM 1413   C CA   . GLN A 1 93  ? -8.328  23.106  29.092  1.00 32.10 ? 93  GLN A CA   1  
ATOM 1414   C C    . GLN A 1 93  ? -8.454  21.793  28.292  1.00 74.31 ? 93  GLN A C    1  
ATOM 1415   O O    . GLN A 1 93  ? -7.582  21.458  27.475  1.00 24.44 ? 93  GLN A O    1  
ATOM 1416   C CB   . GLN A 1 93  ? -8.210  22.822  30.612  1.00 34.44 ? 93  GLN A CB   1  
ATOM 1417   C CG   . GLN A 1 93  ? -8.336  24.077  31.499  1.00 42.23 ? 93  GLN A CG   1  
ATOM 1418   C CD   . GLN A 1 93  ? -8.451  23.755  32.987  1.00 41.10 ? 93  GLN A CD   1  
ATOM 1419   O OE1  . GLN A 1 93  ? -7.456  23.693  33.704  1.00 32.44 ? 93  GLN A OE1  1  
ATOM 1420   N NE2  . GLN A 1 93  ? -9.662  23.490  33.447  1.00 34.10 ? 93  GLN A NE2  1  
ATOM 1421   H H    . GLN A 1 93  ? -10.083 24.165  29.619  1.00 2.33  ? 93  GLN A H    1  
ATOM 1422   H HA   . GLN A 1 93  ? -7.451  23.654  28.757  1.00 5.44  ? 93  GLN A HA   1  
ATOM 1423   H HB2  . GLN A 1 93  ? -8.997  22.128  30.896  1.00 10.51 ? 93  GLN A HB2  1  
ATOM 1424   H HB3  . GLN A 1 93  ? -7.251  22.357  30.813  1.00 24.34 ? 93  GLN A HB3  1  
ATOM 1425   H HG2  . GLN A 1 93  ? -7.462  24.702  31.347  1.00 3.51  ? 93  GLN A HG2  1  
ATOM 1426   H HG3  . GLN A 1 93  ? -9.220  24.631  31.196  1.00 21.11 ? 93  GLN A HG3  1  
ATOM 1427   H HE21 . GLN A 1 93  ? -10.413 23.512  32.818  1.00 51.03 ? 93  GLN A HE21 1  
ATOM 1428   H HE22 . GLN A 1 93  ? -9.756  23.277  34.396  1.00 71.04 ? 93  GLN A HE22 1  
ATOM 1429   N N    . MET A 1 94  ? -9.591  21.091  28.507  1.00 52.03 ? 94  MET A N    1  
ATOM 1430   C CA   . MET A 1 94  ? -9.933  19.857  27.768  1.00 70.21 ? 94  MET A CA   1  
ATOM 1431   C C    . MET A 1 94  ? -10.319 20.169  26.310  1.00 40.21 ? 94  MET A C    1  
ATOM 1432   O O    . MET A 1 94  ? -10.125 19.334  25.440  1.00 22.21 ? 94  MET A O    1  
ATOM 1433   C CB   . MET A 1 94  ? -11.084 19.089  28.471  1.00 13.21 ? 94  MET A CB   1  
ATOM 1434   C CG   . MET A 1 94  ? -11.384 17.689  27.896  1.00 42.51 ? 94  MET A CG   1  
ATOM 1435   S SD   . MET A 1 94  ? -12.641 16.784  28.833  1.00 12.31 ? 94  MET A SD   1  
ATOM 1436   C CE   . MET A 1 94  ? -14.048 17.891  28.740  1.00 51.33 ? 94  MET A CE   1  
ATOM 1437   H H    . MET A 1 94  ? -10.211 21.405  29.206  1.00 13.01 ? 94  MET A H    1  
ATOM 1438   H HA   . MET A 1 94  ? -9.047  19.222  27.763  1.00 32.35 ? 94  MET A HA   1  
ATOM 1439   H HB2  . MET A 1 94  ? -10.834 18.971  29.518  1.00 45.10 ? 94  MET A HB2  1  
ATOM 1440   H HB3  . MET A 1 94  ? -11.992 19.682  28.407  1.00 41.31 ? 94  MET A HB3  1  
ATOM 1441   H HG2  . MET A 1 94  ? -11.730 17.793  26.875  1.00 52.32 ? 94  MET A HG2  1  
ATOM 1442   H HG3  . MET A 1 94  ? -10.471 17.106  27.899  1.00 10.01 ? 94  MET A HG3  1  
ATOM 1443   H HE1  . MET A 1 94  ? -14.893 17.442  29.241  1.00 52.51 ? 94  MET A HE1  1  
ATOM 1444   H HE2  . MET A 1 94  ? -14.301 18.073  27.704  1.00 74.33 ? 94  MET A HE2  1  
ATOM 1445   H HE3  . MET A 1 94  ? -13.806 18.829  29.220  1.00 44.13 ? 94  MET A HE3  1  
ATOM 1446   N N    . ALA A 1 95  ? -10.847 21.380  26.048  1.00 11.14 ? 95  ALA A N    1  
ATOM 1447   C CA   . ALA A 1 95  ? -11.241 21.809  24.682  1.00 42.13 ? 95  ALA A CA   1  
ATOM 1448   C C    . ALA A 1 95  ? -10.006 21.951  23.770  1.00 22.13 ? 95  ALA A C    1  
ATOM 1449   O O    . ALA A 1 95  ? -10.065 21.660  22.571  1.00 20.11 ? 95  ALA A O    1  
ATOM 1450   C CB   . ALA A 1 95  ? -12.038 23.117  24.733  1.00 20.24 ? 95  ALA A CB   1  
ATOM 1451   H H    . ALA A 1 95  ? -10.971 22.004  26.792  1.00 53.21 ? 95  ALA A H    1  
ATOM 1452   H HA   . ALA A 1 95  ? -11.891 21.037  24.271  1.00 71.42 ? 95  ALA A HA   1  
ATOM 1453   H HB1  . ALA A 1 95  ? -11.412 23.912  25.120  1.00 53.12 ? 95  ALA A HB1  1  
ATOM 1454   H HB2  . ALA A 1 95  ? -12.896 22.995  25.380  1.00 44.53 ? 95  ALA A HB2  1  
ATOM 1455   H HB3  . ALA A 1 95  ? -12.378 23.380  23.739  1.00 4.43  ? 95  ALA A HB3  1  
ATOM 1456   N N    . HIS A 1 96  ? -8.885  22.383  24.378  1.00 71.22 ? 96  HIS A N    1  
ATOM 1457   C CA   . HIS A 1 96  ? -7.566  22.447  23.718  1.00 2.02  ? 96  HIS A CA   1  
ATOM 1458   C C    . HIS A 1 96  ? -7.026  21.021  23.440  1.00 5.23  ? 96  HIS A C    1  
ATOM 1459   O O    . HIS A 1 96  ? -6.194  20.817  22.550  1.00 11.22 ? 96  HIS A O    1  
ATOM 1460   C CB   . HIS A 1 96  ? -6.575  23.250  24.609  1.00 33.33 ? 96  HIS A CB   1  
ATOM 1461   C CG   . HIS A 1 96  ? -5.154  23.248  24.102  1.00 21.32 ? 96  HIS A CG   1  
ATOM 1462   N ND1  . HIS A 1 96  ? -4.167  22.463  24.658  1.00 51.22 ? 96  HIS A ND1  1  
ATOM 1463   C CD2  . HIS A 1 96  ? -4.573  23.886  23.058  1.00 32.32 ? 96  HIS A CD2  1  
ATOM 1464   C CE1  . HIS A 1 96  ? -3.052  22.610  23.979  1.00 73.05 ? 96  HIS A CE1  1  
ATOM 1465   N NE2  . HIS A 1 96  ? -3.265  23.469  23.006  1.00 64.20 ? 96  HIS A NE2  1  
ATOM 1466   H H    . HIS A 1 96  ? -8.950  22.673  25.314  1.00 34.11 ? 96  HIS A H    1  
ATOM 1467   H HA   . HIS A 1 96  ? -7.689  22.966  22.770  1.00 31.32 ? 96  HIS A HA   1  
ATOM 1468   H HB2  . HIS A 1 96  ? -6.905  24.281  24.670  1.00 32.12 ? 96  HIS A HB2  1  
ATOM 1469   H HB3  . HIS A 1 96  ? -6.572  22.829  25.609  1.00 74.14 ? 96  HIS A HB3  1  
ATOM 1470   H HD1  . HIS A 1 96  ? -4.269  21.889  25.445  1.00 23.43 ? 96  HIS A HD1  1  
ATOM 1471   H HD2  . HIS A 1 96  ? -5.049  24.587  22.384  1.00 11.14 ? 96  HIS A HD2  1  
ATOM 1472   H HE1  . HIS A 1 96  ? -2.120  22.108  24.180  1.00 45.21 ? 96  HIS A HE1  1  
ATOM 1473   H HE2  . HIS A 1 96  ? -2.550  23.909  22.492  1.00 37.61 ? 96  HIS A HE2  1  
ATOM 1474   N N    . CYS A 1 97  ? -7.485  20.046  24.227  1.00 51.40 ? 97  CYS A N    1  
ATOM 1475   C CA   . CYS A 1 97  ? -7.118  18.641  24.037  1.00 12.44 ? 97  CYS A CA   1  
ATOM 1476   C C    . CYS A 1 97  ? -7.877  18.037  22.836  1.00 10.30 ? 97  CYS A C    1  
ATOM 1477   O O    . CYS A 1 97  ? -7.278  17.748  21.796  1.00 72.33 ? 97  CYS A O    1  
ATOM 1478   C CB   . CYS A 1 97  ? -7.406  17.846  25.334  1.00 11.23 ? 97  CYS A CB   1  
ATOM 1479   S SG   . CYS A 1 97  ? -6.534  18.471  26.785  1.00 53.44 ? 97  CYS A SG   1  
ATOM 1480   H H    . CYS A 1 97  ? -8.082  20.281  24.966  1.00 41.25 ? 97  CYS A H    1  
ATOM 1481   H HA   . CYS A 1 97  ? -6.044  18.600  23.832  1.00 20.41 ? 97  CYS A HA   1  
ATOM 1482   H HB2  . CYS A 1 97  ? -8.463  17.878  25.555  1.00 12.41 ? 97  CYS A HB2  1  
ATOM 1483   H HB3  . CYS A 1 97  ? -7.105  16.816  25.201  1.00 22.11 ? 97  CYS A HB3  1  
ATOM 1484   H HG   . CYS A 1 97  ? -5.867  17.451  27.320  1.00 2.15  ? 97  CYS A HG   1  
ATOM 1485   N N    . LEU A 1 98  ? -9.211  17.956  22.972  1.00 24.14 ? 98  LEU A N    1  
ATOM 1486   C CA   . LEU A 1 98  ? -10.099 17.231  22.036  1.00 74.42 ? 98  LEU A CA   1  
ATOM 1487   C C    . LEU A 1 98  ? -10.233 17.940  20.674  1.00 1.43  ? 98  LEU A C    1  
ATOM 1488   O O    . LEU A 1 98  ? -10.380 17.281  19.641  1.00 61.33 ? 98  LEU A O    1  
ATOM 1489   C CB   . LEU A 1 98  ? -11.497 17.001  22.718  1.00 24.24 ? 98  LEU A CB   1  
ATOM 1490   C CG   . LEU A 1 98  ? -12.192 18.258  23.380  1.00 12.05 ? 98  LEU A CG   1  
ATOM 1491   C CD1  . LEU A 1 98  ? -12.849 19.202  22.364  1.00 12.01 ? 98  LEU A CD1  1  
ATOM 1492   C CD2  . LEU A 1 98  ? -13.197 17.853  24.472  1.00 34.31 ? 98  LEU A CD2  1  
ATOM 1493   H H    . LEU A 1 98  ? -9.620  18.405  23.736  1.00 10.21 ? 98  LEU A H    1  
ATOM 1494   H HA   . LEU A 1 98  ? -9.648  16.256  21.858  1.00 2.44  ? 98  LEU A HA   1  
ATOM 1495   H HB2  . LEU A 1 98  ? -12.175 16.583  21.981  1.00 33.04 ? 98  LEU A HB2  1  
ATOM 1496   H HB3  . LEU A 1 98  ? -11.355 16.254  23.492  1.00 33.10 ? 98  LEU A HB3  1  
ATOM 1497   H HG   . LEU A 1 98  ? -11.422 18.838  23.872  1.00 61.15 ? 98  LEU A HG   1  
ATOM 1498   H HD11 . LEU A 1 98  ? -13.610 18.673  21.806  1.00 64.35 ? 98  LEU A HD11 1  
ATOM 1499   H HD12 . LEU A 1 98  ? -12.102 19.575  21.682  1.00 13.12 ? 98  LEU A HD12 1  
ATOM 1500   H HD13 . LEU A 1 98  ? -13.300 20.039  22.881  1.00 25.12 ? 98  LEU A HD13 1  
ATOM 1501   H HD21 . LEU A 1 98  ? -12.695 17.261  25.224  1.00 24.55 ? 98  LEU A HD21 1  
ATOM 1502   H HD22 . LEU A 1 98  ? -14.001 17.273  24.037  1.00 33.51 ? 98  LEU A HD22 1  
ATOM 1503   H HD23 . LEU A 1 98  ? -13.610 18.740  24.938  1.00 75.32 ? 98  LEU A HD23 1  
ATOM 1504   N N    . GLY A 1 99  ? -10.164 19.284  20.690  1.00 14.45 ? 99  GLY A N    1  
ATOM 1505   C CA   . GLY A 1 99  ? -10.448 20.105  19.507  1.00 33.35 ? 99  GLY A CA   1  
ATOM 1506   C C    . GLY A 1 99  ? -9.206  20.691  18.862  1.00 40.12 ? 99  GLY A C    1  
ATOM 1507   O O    . GLY A 1 99  ? -9.319  21.440  17.880  1.00 73.03 ? 99  GLY A O    1  
ATOM 1508   H H    . GLY A 1 99  ? -9.925  19.731  21.527  1.00 12.51 ? 99  GLY A H    1  
ATOM 1509   H HA2  . GLY A 1 99  ? -10.980 19.520  18.768  1.00 33.41 ? 99  GLY A HA2  1  
ATOM 1510   H HA3  . GLY A 1 99  ? -11.088 20.922  19.817  1.00 4.54  ? 99  GLY A HA3  1  
ATOM 1511   N N    . ALA A 1 100 ? -8.008  20.349  19.388  1.00 70.42 ? 100 ALA A N    1  
ATOM 1512   C CA   . ALA A 1 100 ? -6.738  20.895  18.868  1.00 32.25 ? 100 ALA A CA   1  
ATOM 1513   C C    . ALA A 1 100 ? -5.648  19.811  18.746  1.00 40.05 ? 100 ALA A C    1  
ATOM 1514   O O    . ALA A 1 100 ? -5.175  19.543  17.635  1.00 12.40 ? 100 ALA A O    1  
ATOM 1515   C CB   . ALA A 1 100 ? -6.279  22.076  19.734  1.00 23.02 ? 100 ALA A CB   1  
ATOM 1516   H H    . ALA A 1 100 ? -7.984  19.715  20.134  1.00 25.52 ? 100 ALA A H    1  
ATOM 1517   H HA   . ALA A 1 100 ? -6.928  21.284  17.868  1.00 24.13 ? 100 ALA A HA   1  
ATOM 1518   H HB1  . ALA A 1 100 ? -5.954  21.724  20.705  1.00 4.31  ? 100 ALA A HB1  1  
ATOM 1519   H HB2  . ALA A 1 100 ? -7.099  22.770  19.867  1.00 52.53 ? 100 ALA A HB2  1  
ATOM 1520   H HB3  . ALA A 1 100 ? -5.463  22.586  19.248  1.00 53.21 ? 100 ALA A HB3  1  
ATOM 1521   N N    . TYR A 1 101 ? -5.265  19.164  19.873  1.00 63.45 ? 101 TYR A N    1  
ATOM 1522   C CA   . TYR A 1 101 ? -4.141  18.184  19.864  1.00 22.01 ? 101 TYR A CA   1  
ATOM 1523   C C    . TYR A 1 101 ? -4.570  16.814  19.312  1.00 64.41 ? 101 TYR A C    1  
ATOM 1524   O O    . TYR A 1 101 ? -3.787  16.126  18.659  1.00 12.40 ? 101 TYR A O    1  
ATOM 1525   C CB   . TYR A 1 101 ? -3.378  18.147  21.243  1.00 31.31 ? 101 TYR A CB   1  
ATOM 1526   C CG   . TYR A 1 101 ? -3.841  17.321  22.482  1.00 4.53  ? 101 TYR A CG   1  
ATOM 1527   C CD1  . TYR A 1 101 ? -3.550  17.812  23.770  1.00 1.11  ? 101 TYR A CD1  1  
ATOM 1528   C CD2  . TYR A 1 101 ? -4.491  16.087  22.422  1.00 22.12 ? 101 TYR A CD2  1  
ATOM 1529   C CE1  . TYR A 1 101 ? -3.892  17.118  24.912  1.00 72.14 ? 101 TYR A CE1  1  
ATOM 1530   C CE2  . TYR A 1 101 ? -4.840  15.395  23.572  1.00 21.22 ? 101 TYR A CE2  1  
ATOM 1531   C CZ   . TYR A 1 101 ? -4.538  15.915  24.806  1.00 13.22 ? 101 TYR A CZ   1  
ATOM 1532   O OH   . TYR A 1 101 ? -4.892  15.231  25.944  1.00 30.12 ? 101 TYR A OH   1  
ATOM 1533   H H    . TYR A 1 101 ? -5.735  19.344  20.715  1.00 63.44 ? 101 TYR A H    1  
ATOM 1534   H HA   . TYR A 1 101 ? -3.431  18.578  19.132  1.00 34.23 ? 101 TYR A HA   1  
ATOM 1535   H HB2  . TYR A 1 101 ? -2.357  17.858  21.064  1.00 54.04 ? 101 TYR A HB2  1  
ATOM 1536   H HB3  . TYR A 1 101 ? -3.378  19.166  21.570  1.00 31.14 ? 101 TYR A HB3  1  
ATOM 1537   H HD1  . TYR A 1 101 ? -3.048  18.766  23.864  1.00 72.11 ? 101 TYR A HD1  1  
ATOM 1538   H HD2  . TYR A 1 101 ? -4.735  15.668  21.455  1.00 52.05 ? 101 TYR A HD2  1  
ATOM 1539   H HE1  . TYR A 1 101 ? -3.654  17.523  25.885  1.00 20.41 ? 101 TYR A HE1  1  
ATOM 1540   H HE2  . TYR A 1 101 ? -5.353  14.438  23.493  1.00 52.25 ? 101 TYR A HE2  1  
ATOM 1541   H HH   . TYR A 1 101 ? -4.614  14.325  25.865  1.00 73.44 ? 101 TYR A HH   1  
ATOM 1542   N N    . CYS A 1 102 ? -5.823  16.439  19.602  1.00 33.32 ? 102 CYS A N    1  
ATOM 1543   C CA   . CYS A 1 102 ? -6.445  15.187  19.083  1.00 21.14 ? 102 CYS A CA   1  
ATOM 1544   C C    . CYS A 1 102 ? -6.605  15.201  17.526  1.00 31.32 ? 102 CYS A C    1  
ATOM 1545   O O    . CYS A 1 102 ? -6.351  14.166  16.893  1.00 5.24  ? 102 CYS A O    1  
ATOM 1546   C CB   . CYS A 1 102 ? -7.788  14.887  19.798  1.00 54.40 ? 102 CYS A CB   1  
ATOM 1547   S SG   . CYS A 1 102 ? -7.585  14.604  21.565  1.00 41.15 ? 102 CYS A SG   1  
ATOM 1548   H H    . CYS A 1 102 ? -6.330  17.014  20.208  1.00 0.02  ? 102 CYS A H    1  
ATOM 1549   H HA   . CYS A 1 102 ? -5.756  14.384  19.334  1.00 3.12  ? 102 CYS A HA   1  
ATOM 1550   H HB2  . CYS A 1 102 ? -8.460  15.725  19.675  1.00 51.32 ? 102 CYS A HB2  1  
ATOM 1551   H HB3  . CYS A 1 102 ? -8.241  13.998  19.374  1.00 34.04 ? 102 CYS A HB3  1  
ATOM 1552   H HG   . CYS A 1 102 ? -6.284  14.647  21.805  1.00 14.12 ? 102 CYS A HG   1  
ATOM 1553   N N    . PRO A 1 103 ? -7.071  16.339  16.875  1.00 34.51 ? 103 PRO A N    1  
ATOM 1554   C CA   . PRO A 1 103 ? -6.912  16.553  15.411  1.00 63.32 ? 103 PRO A CA   1  
ATOM 1555   C C    . PRO A 1 103 ? -5.476  16.294  14.908  1.00 53.43 ? 103 PRO A C    1  
ATOM 1556   O O    . PRO A 1 103 ? -5.292  15.614  13.902  1.00 32.21 ? 103 PRO A O    1  
ATOM 1557   C CB   . PRO A 1 103 ? -7.288  18.041  15.222  1.00 42.02 ? 103 PRO A CB   1  
ATOM 1558   C CG   . PRO A 1 103 ? -8.297  18.299  16.291  1.00 11.13 ? 103 PRO A CG   1  
ATOM 1559   C CD   . PRO A 1 103 ? -7.896  17.427  17.470  1.00 61.04 ? 103 PRO A CD   1  
ATOM 1560   H HA   . PRO A 1 103 ? -7.609  15.930  14.853  1.00 41.01 ? 103 PRO A HA   1  
ATOM 1561   H HB2  . PRO A 1 103 ? -6.410  18.680  15.348  1.00 70.31 ? 103 PRO A HB2  1  
ATOM 1562   H HB3  . PRO A 1 103 ? -7.725  18.204  14.244  1.00 62.43 ? 103 PRO A HB3  1  
ATOM 1563   H HG2  . PRO A 1 103 ? -8.284  19.351  16.569  1.00 12.14 ? 103 PRO A HG2  1  
ATOM 1564   H HG3  . PRO A 1 103 ? -9.288  18.025  15.945  1.00 10.43 ? 103 PRO A HG3  1  
ATOM 1565   H HD2  . PRO A 1 103 ? -7.312  17.992  18.182  1.00 12.43 ? 103 PRO A HD2  1  
ATOM 1566   H HD3  . PRO A 1 103 ? -8.775  17.019  17.959  1.00 63.52 ? 103 PRO A HD3  1  
ATOM 1567   N N    . ASN A 1 104 ? -4.475  16.822  15.653  1.00 41.34 ? 104 ASN A N    1  
ATOM 1568   C CA   . ASN A 1 104 ? -3.031  16.686  15.311  1.00 22.24 ? 104 ASN A CA   1  
ATOM 1569   C C    . ASN A 1 104 ? -2.559  15.220  15.368  1.00 72.24 ? 104 ASN A C    1  
ATOM 1570   O O    . ASN A 1 104 ? -1.533  14.880  14.775  1.00 70.34 ? 104 ASN A O    1  
ATOM 1571   C CB   . ASN A 1 104 ? -2.144  17.555  16.251  1.00 54.13 ? 104 ASN A CB   1  
ATOM 1572   C CG   . ASN A 1 104 ? -2.345  19.064  16.086  1.00 32.23 ? 104 ASN A CG   1  
ATOM 1573   O OD1  . ASN A 1 104 ? -2.685  19.555  15.012  1.00 31.04 ? 104 ASN A OD1  1  
ATOM 1574   N ND2  . ASN A 1 104 ? -2.111  19.811  17.151  1.00 51.20 ? 104 ASN A ND2  1  
ATOM 1575   H H    . ASN A 1 104 ? -4.716  17.329  16.459  1.00 61.54 ? 104 ASN A H    1  
ATOM 1576   H HA   . ASN A 1 104 ? -2.906  17.041  14.292  1.00 60.13 ? 104 ASN A HA   1  
ATOM 1577   H HB2  . ASN A 1 104 ? -2.370  17.297  17.280  1.00 11.02 ? 104 ASN A HB2  1  
ATOM 1578   H HB3  . ASN A 1 104 ? -1.098  17.338  16.063  1.00 22.12 ? 104 ASN A HB3  1  
ATOM 1579   H HD21 . ASN A 1 104 ? -1.824  19.366  17.976  1.00 64.33 ? 104 ASN A HD21 1  
ATOM 1580   H HD22 . ASN A 1 104 ? -2.216  20.779  17.070  1.00 63.40 ? 104 ASN A HD22 1  
ATOM 1581   N N    . ILE A 1 105 ? -3.295  14.374  16.108  1.00 43.31 ? 105 ILE A N    1  
ATOM 1582   C CA   . ILE A 1 105 ? -3.033  12.925  16.162  1.00 53.54 ? 105 ILE A CA   1  
ATOM 1583   C C    . ILE A 1 105 ? -3.515  12.261  14.855  1.00 12.05 ? 105 ILE A C    1  
ATOM 1584   O O    . ILE A 1 105 ? -2.779  11.500  14.224  1.00 31.11 ? 105 ILE A O    1  
ATOM 1585   C CB   . ILE A 1 105 ? -3.769  12.241  17.375  1.00 62.02 ? 105 ILE A CB   1  
ATOM 1586   C CG1  . ILE A 1 105 ? -3.406  12.933  18.735  1.00 30.02 ? 105 ILE A CG1  1  
ATOM 1587   C CG2  . ILE A 1 105 ? -3.479  10.721  17.441  1.00 53.32 ? 105 ILE A CG2  1  
ATOM 1588   C CD1  . ILE A 1 105 ? -1.926  12.924  19.111  1.00 54.44 ? 105 ILE A CD1  1  
ATOM 1589   H H    . ILE A 1 105 ? -4.034  14.735  16.637  1.00 1.14  ? 105 ILE A H    1  
ATOM 1590   H HA   . ILE A 1 105 ? -1.962  12.772  16.274  1.00 4.11  ? 105 ILE A HA   1  
ATOM 1591   H HB   . ILE A 1 105 ? -4.841  12.360  17.211  1.00 74.24 ? 105 ILE A HB   1  
ATOM 1592   H HG12 . ILE A 1 105 ? -3.719  13.965  18.696  1.00 12.32 ? 105 ILE A HG12 1  
ATOM 1593   H HG13 . ILE A 1 105 ? -3.949  12.443  19.538  1.00 23.20 ? 105 ILE A HG13 1  
ATOM 1594   H HG21 . ILE A 1 105 ? -4.314  10.217  17.906  1.00 32.20 ? 105 ILE A HG21 1  
ATOM 1595   H HG22 . ILE A 1 105 ? -2.593  10.540  18.033  1.00 72.44 ? 105 ILE A HG22 1  
ATOM 1596   H HG23 . ILE A 1 105 ? -3.321  10.302  16.471  1.00 20.41 ? 105 ILE A HG23 1  
ATOM 1597   H HD11 . ILE A 1 105 ? -1.799  13.409  20.067  1.00 3.11  ? 105 ILE A HD11 1  
ATOM 1598   H HD12 . ILE A 1 105 ? -1.357  13.458  18.362  1.00 61.25 ? 105 ILE A HD12 1  
ATOM 1599   H HD13 . ILE A 1 105 ? -1.570  11.905  19.175  1.00 63.35 ? 105 ILE A HD13 1  
ATOM 1600   N N    . LEU A 1 106 ? -4.761  12.588  14.467  1.00 53.53 ? 106 LEU A N    1  
ATOM 1601   C CA   . LEU A 1 106 ? -5.445  11.964  13.315  1.00 3.24  ? 106 LEU A CA   1  
ATOM 1602   C C    . LEU A 1 106 ? -4.921  12.495  11.967  1.00 2.52  ? 106 LEU A C    1  
ATOM 1603   O O    . LEU A 1 106 ? -4.967  11.787  10.960  1.00 21.34 ? 106 LEU A O    1  
ATOM 1604   C CB   . LEU A 1 106 ? -6.977  12.213  13.410  1.00 42.30 ? 106 LEU A CB   1  
ATOM 1605   C CG   . LEU A 1 106 ? -7.716  11.462  14.558  1.00 71.11 ? 106 LEU A CG   1  
ATOM 1606   C CD1  . LEU A 1 106 ? -9.203  11.886  14.649  1.00 53.12 ? 106 LEU A CD1  1  
ATOM 1607   C CD2  . LEU A 1 106 ? -7.571  9.930   14.383  1.00 32.45 ? 106 LEU A CD2  1  
ATOM 1608   H H    . LEU A 1 106 ? -5.237  13.280  14.971  1.00 65.03 ? 106 LEU A H    1  
ATOM 1609   H HA   . LEU A 1 106 ? -5.262  10.893  13.374  1.00 25.53 ? 106 LEU A HA   1  
ATOM 1610   H HB2  . LEU A 1 106 ? -7.139  13.281  13.537  1.00 2.12  ? 106 LEU A HB2  1  
ATOM 1611   H HB3  . LEU A 1 106 ? -7.434  11.917  12.469  1.00 41.15 ? 106 LEU A HB3  1  
ATOM 1612   H HG   . LEU A 1 106 ? -7.252  11.727  15.502  1.00 4.24  ? 106 LEU A HG   1  
ATOM 1613   H HD11 . LEU A 1 106 ? -9.666  11.409  15.504  1.00 74.24 ? 106 LEU A HD11 1  
ATOM 1614   H HD12 . LEU A 1 106 ? -9.729  11.590  13.750  1.00 31.31 ? 106 LEU A HD12 1  
ATOM 1615   H HD13 . LEU A 1 106 ? -9.270  12.960  14.764  1.00 13.51 ? 106 LEU A HD13 1  
ATOM 1616   H HD21 . LEU A 1 106 ? -8.124  9.419   15.154  1.00 44.42 ? 106 LEU A HD21 1  
ATOM 1617   H HD22 . LEU A 1 106 ? -6.528  9.651   14.458  1.00 52.24 ? 106 LEU A HD22 1  
ATOM 1618   H HD23 . LEU A 1 106 ? -7.951  9.629   13.416  1.00 51.22 ? 106 LEU A HD23 1  
ATOM 1619   N N    . PHE A 1 107 ? -4.411  13.739  11.980  1.00 42.53 ? 107 PHE A N    1  
ATOM 1620   C CA   . PHE A 1 107 ? -4.057  14.500  10.761  1.00 23.45 ? 107 PHE A CA   1  
ATOM 1621   C C    . PHE A 1 107 ? -2.912  13.847  9.919   1.00 63.22 ? 107 PHE A C    1  
ATOM 1622   O O    . PHE A 1 107 ? -3.035  13.822  8.693   1.00 64.23 ? 107 PHE A O    1  
ATOM 1623   C CB   . PHE A 1 107 ? -3.726  15.981  11.119  1.00 71.23 ? 107 PHE A CB   1  
ATOM 1624   C CG   . PHE A 1 107 ? -3.457  16.888  9.915   1.00 3.41  ? 107 PHE A CG   1  
ATOM 1625   C CD1  . PHE A 1 107 ? -4.387  16.996  8.877   1.00 21.51 ? 107 PHE A CD1  1  
ATOM 1626   C CD2  . PHE A 1 107 ? -2.280  17.628  9.820   1.00 14.52 ? 107 PHE A CD2  1  
ATOM 1627   C CE1  . PHE A 1 107 ? -4.139  17.809  7.787   1.00 22.11 ? 107 PHE A CE1  1  
ATOM 1628   C CE2  . PHE A 1 107 ? -2.038  18.441  8.732   1.00 33.15 ? 107 PHE A CE2  1  
ATOM 1629   C CZ   . PHE A 1 107 ? -2.963  18.530  7.715   1.00 54.20 ? 107 PHE A CZ   1  
ATOM 1630   H H    . PHE A 1 107 ? -4.273  14.170  12.847  1.00 42.44 ? 107 PHE A H    1  
ATOM 1631   H HA   . PHE A 1 107 ? -4.955  14.506  10.141  1.00 61.43 ? 107 PHE A HA   1  
ATOM 1632   H HB2  . PHE A 1 107 ? -4.560  16.407  11.666  1.00 70.22 ? 107 PHE A HB2  1  
ATOM 1633   H HB3  . PHE A 1 107 ? -2.852  15.996  11.765  1.00 44.35 ? 107 PHE A HB3  1  
ATOM 1634   H HD1  . PHE A 1 107 ? -5.311  16.434  8.927   1.00 71.22 ? 107 PHE A HD1  1  
ATOM 1635   H HD2  . PHE A 1 107 ? -1.546  17.564  10.615  1.00 50.11 ? 107 PHE A HD2  1  
ATOM 1636   H HE1  . PHE A 1 107 ? -4.866  17.882  6.990   1.00 32.25 ? 107 PHE A HE1  1  
ATOM 1637   H HE2  . PHE A 1 107 ? -1.116  19.005  8.674   1.00 23.52 ? 107 PHE A HE2  1  
ATOM 1638   H HZ   . PHE A 1 107 ? -2.767  19.164  6.861   1.00 54.04 ? 107 PHE A HZ   1  
ATOM 1639   N N    . PRO A 1 108 ? -1.774  13.331  10.521  1.00 42.50 ? 108 PRO A N    1  
ATOM 1640   C CA   . PRO A 1 108 ? -0.740  12.571  9.752   1.00 70.01 ? 108 PRO A CA   1  
ATOM 1641   C C    . PRO A 1 108 ? -1.318  11.329  9.031   1.00 44.12 ? 108 PRO A C    1  
ATOM 1642   O O    . PRO A 1 108 ? -0.959  11.045  7.882   1.00 75.33 ? 108 PRO A O    1  
ATOM 1643   C CB   . PRO A 1 108 ? 0.296   12.155  10.834  1.00 13.02 ? 108 PRO A CB   1  
ATOM 1644   C CG   . PRO A 1 108 ? 0.122   13.172  11.921  1.00 10.44 ? 108 PRO A CG   1  
ATOM 1645   C CD   . PRO A 1 108 ? -1.357  13.484  11.942  1.00 32.25 ? 108 PRO A CD   1  
ATOM 1646   H HA   . PRO A 1 108 ? -0.261  13.215  9.018   1.00 32.04 ? 108 PRO A HA   1  
ATOM 1647   H HB2  . PRO A 1 108 ? 0.086   11.147  11.201  1.00 43.33 ? 108 PRO A HB2  1  
ATOM 1648   H HB3  . PRO A 1 108 ? 1.303   12.197  10.436  1.00 30.02 ? 108 PRO A HB3  1  
ATOM 1649   H HG2  . PRO A 1 108 ? 0.443   12.761  12.875  1.00 31.14 ? 108 PRO A HG2  1  
ATOM 1650   H HG3  . PRO A 1 108 ? 0.689   14.070  11.692  1.00 41.54 ? 108 PRO A HG3  1  
ATOM 1651   H HD2  . PRO A 1 108 ? -1.890  12.783  12.578  1.00 0.42  ? 108 PRO A HD2  1  
ATOM 1652   H HD3  . PRO A 1 108 ? -1.529  14.500  12.283  1.00 24.23 ? 108 PRO A HD3  1  
ATOM 1653   N N    . TYR A 1 109 ? -2.231  10.617  9.722   1.00 44.13 ? 109 TYR A N    1  
ATOM 1654   C CA   . TYR A 1 109 ? -2.894  9.405   9.191   1.00 51.24 ? 109 TYR A CA   1  
ATOM 1655   C C    . TYR A 1 109 ? -3.872  9.752   8.052   1.00 21.32 ? 109 TYR A C    1  
ATOM 1656   O O    . TYR A 1 109 ? -3.960  9.025   7.060   1.00 73.21 ? 109 TYR A O    1  
ATOM 1657   C CB   . TYR A 1 109 ? -3.663  8.667   10.314  1.00 43.51 ? 109 TYR A CB   1  
ATOM 1658   C CG   . TYR A 1 109 ? -2.784  8.105   11.436  1.00 62.15 ? 109 TYR A CG   1  
ATOM 1659   C CD1  . TYR A 1 109 ? -2.519  8.851   12.585  1.00 65.35 ? 109 TYR A CD1  1  
ATOM 1660   C CD2  . TYR A 1 109 ? -2.235  6.822   11.351  1.00 65.13 ? 109 TYR A CD2  1  
ATOM 1661   C CE1  . TYR A 1 109 ? -1.746  8.339   13.607  1.00 2.41  ? 109 TYR A CE1  1  
ATOM 1662   C CE2  . TYR A 1 109 ? -1.457  6.309   12.371  1.00 43.11 ? 109 TYR A CE2  1  
ATOM 1663   C CZ   . TYR A 1 109 ? -1.218  7.071   13.495  1.00 41.45 ? 109 TYR A CZ   1  
ATOM 1664   O OH   . TYR A 1 109 ? -0.462  6.557   14.520  1.00 52.42 ? 109 TYR A OH   1  
ATOM 1665   H H    . TYR A 1 109 ? -2.466  10.920  10.624  1.00 63.32 ? 109 TYR A H    1  
ATOM 1666   H HA   . TYR A 1 109 ? -2.121  8.745   8.804   1.00 63.01 ? 109 TYR A HA   1  
ATOM 1667   H HB2  . TYR A 1 109 ? -4.377  9.354   10.761  1.00 20.04 ? 109 TYR A HB2  1  
ATOM 1668   H HB3  . TYR A 1 109 ? -4.218  7.839   9.881   1.00 20.10 ? 109 TYR A HB3  1  
ATOM 1669   H HD1  . TYR A 1 109 ? -2.934  9.849   12.673  1.00 40.22 ? 109 TYR A HD1  1  
ATOM 1670   H HD2  . TYR A 1 109 ? -2.421  6.224   10.467  1.00 43.33 ? 109 TYR A HD2  1  
ATOM 1671   H HE1  . TYR A 1 109 ? -1.554  8.938   14.490  1.00 21.43 ? 109 TYR A HE1  1  
ATOM 1672   H HE2  . TYR A 1 109 ? -1.041  5.313   12.285  1.00 23.41 ? 109 TYR A HE2  1  
ATOM 1673   H HH   . TYR A 1 109 ? -0.874  6.777   15.359  1.00 74.41 ? 109 TYR A HH   1  
ATOM 1674   N N    . ALA A 1 110 ? -4.621  10.858  8.230   1.00 11.14 ? 110 ALA A N    1  
ATOM 1675   C CA   . ALA A 1 110 ? -5.617  11.336  7.244   1.00 70.52 ? 110 ALA A CA   1  
ATOM 1676   C C    . ALA A 1 110 ? -4.910  11.873  5.990   1.00 74.13 ? 110 ALA A C    1  
ATOM 1677   O O    . ALA A 1 110 ? -5.399  11.689  4.874   1.00 32.21 ? 110 ALA A O    1  
ATOM 1678   C CB   . ALA A 1 110 ? -6.530  12.398  7.882   1.00 41.24 ? 110 ALA A CB   1  
ATOM 1679   H H    . ALA A 1 110 ? -4.492  11.379  9.049   1.00 41.30 ? 110 ALA A H    1  
ATOM 1680   H HA   . ALA A 1 110 ? -6.237  10.485  6.960   1.00 13.11 ? 110 ALA A HA   1  
ATOM 1681   H HB1  . ALA A 1 110 ? -7.208  12.808  7.142   1.00 51.34 ? 110 ALA A HB1  1  
ATOM 1682   H HB2  . ALA A 1 110 ? -5.934  13.195  8.303   1.00 51.13 ? 110 ALA A HB2  1  
ATOM 1683   H HB3  . ALA A 1 110 ? -7.115  11.933  8.665   1.00 64.44 ? 110 ALA A HB3  1  
ATOM 1684   N N    . ARG A 1 111 ? -3.742  12.520  6.209   1.00 24.33 ? 111 ARG A N    1  
ATOM 1685   C CA   . ARG A 1 111 ? -2.829  12.960  5.132   1.00 31.10 ? 111 ARG A CA   1  
ATOM 1686   C C    . ARG A 1 111 ? -2.410  11.753  4.289   1.00 21.11 ? 111 ARG A C    1  
ATOM 1687   O O    . ARG A 1 111 ? -2.629  11.726  3.086   1.00 24.33 ? 111 ARG A O    1  
ATOM 1688   C CB   . ARG A 1 111 ? -1.555  13.651  5.719   1.00 71.02 ? 111 ARG A CB   1  
ATOM 1689   C CG   . ARG A 1 111 ? -0.402  13.882  4.693   1.00 64.11 ? 111 ARG A CG   1  
ATOM 1690   C CD   . ARG A 1 111 ? 0.885   14.433  5.337   1.00 65.12 ? 111 ARG A CD   1  
ATOM 1691   N NE   . ARG A 1 111 ? 0.684   15.794  5.851   1.00 10.52 ? 111 ARG A NE   1  
ATOM 1692   C CZ   . ARG A 1 111 ? 0.828   16.193  7.120   1.00 51.40 ? 111 ARG A CZ   1  
ATOM 1693   N NH1  . ARG A 1 111 ? 1.218   15.357  8.073   1.00 63.45 ? 111 ARG A NH1  1  
ATOM 1694   N NH2  . ARG A 1 111 ? 0.608   17.455  7.419   1.00 22.20 ? 111 ARG A NH2  1  
ATOM 1695   H H    . ARG A 1 111 ? -3.482  12.699  7.132   1.00 61.03 ? 111 ARG A H    1  
ATOM 1696   H HA   . ARG A 1 111 ? -3.364  13.669  4.507   1.00 42.31 ? 111 ARG A HA   1  
ATOM 1697   H HB2  . ARG A 1 111 ? -1.840  14.611  6.133   1.00 5.43  ? 111 ARG A HB2  1  
ATOM 1698   H HB3  . ARG A 1 111 ? -1.169  13.033  6.526   1.00 52.53 ? 111 ARG A HB3  1  
ATOM 1699   H HG2  . ARG A 1 111 ? -0.167  12.937  4.217   1.00 44.05 ? 111 ARG A HG2  1  
ATOM 1700   H HG3  . ARG A 1 111 ? -0.741  14.580  3.936   1.00 74.53 ? 111 ARG A HG3  1  
ATOM 1701   H HD2  . ARG A 1 111 ? 1.190   13.775  6.145   1.00 51.12 ? 111 ARG A HD2  1  
ATOM 1702   H HD3  . ARG A 1 111 ? 1.670   14.460  4.590   1.00 43.33 ? 111 ARG A HD3  1  
ATOM 1703   H HE   . ARG A 1 111 ? 0.422   16.466  5.191   1.00 61.24 ? 111 ARG A HE   1  
ATOM 1704   H HH11 . ARG A 1 111 ? 1.399   14.399  7.864   1.00 1.52  ? 111 ARG A HH11 1  
ATOM 1705   H HH12 . ARG A 1 111 ? 1.313   15.685  9.019   1.00 42.52 ? 111 ARG A HH12 1  
ATOM 1706   H HH21 . ARG A 1 111 ? 0.334   18.106  6.698   1.00 72.54 ? 111 ARG A HH21 1  
ATOM 1707   H HH22 . ARG A 1 111 ? 0.714   17.777  8.365   1.00 24.53 ? 111 ARG A HH22 1  
ATOM 1708   N N    . GLU A 1 112 ? -1.847  10.745  4.979   1.00 32.52 ? 112 GLU A N    1  
ATOM 1709   C CA   . GLU A 1 112 ? -1.240  9.558   4.356   1.00 30.34 ? 112 GLU A CA   1  
ATOM 1710   C C    . GLU A 1 112 ? -2.278  8.723   3.593   1.00 53.04 ? 112 GLU A C    1  
ATOM 1711   O O    . GLU A 1 112 ? -1.992  8.237   2.503   1.00 10.53 ? 112 GLU A O    1  
ATOM 1712   C CB   . GLU A 1 112 ? -0.530  8.723   5.451   1.00 75.13 ? 112 GLU A CB   1  
ATOM 1713   C CG   . GLU A 1 112 ? 0.234   7.454   4.976   1.00 52.34 ? 112 GLU A CG   1  
ATOM 1714   C CD   . GLU A 1 112 ? -0.631  6.187   4.840   1.00 75.34 ? 112 GLU A CD   1  
ATOM 1715   O OE1  . GLU A 1 112 ? -1.236  5.770   5.854   1.00 24.45 ? 112 GLU A OE1  1  
ATOM 1716   O OE2  . GLU A 1 112 ? -0.727  5.623   3.727   1.00 43.24 ? 112 GLU A OE2  1  
ATOM 1717   H H    . GLU A 1 112 ? -1.838  10.802  5.958   1.00 44.23 ? 112 GLU A H    1  
ATOM 1718   H HA   . GLU A 1 112 ? -0.488  9.910   3.652   1.00 73.32 ? 112 GLU A HA   1  
ATOM 1719   H HB2  . GLU A 1 112 ? 0.183   9.372   5.954   1.00 13.25 ? 112 GLU A HB2  1  
ATOM 1720   H HB3  . GLU A 1 112 ? -1.269  8.417   6.185   1.00 71.21 ? 112 GLU A HB3  1  
ATOM 1721   H HG2  . GLU A 1 112 ? 0.697   7.672   4.017   1.00 61.23 ? 112 GLU A HG2  1  
ATOM 1722   H HG3  . GLU A 1 112 ? 1.024   7.243   5.690   1.00 23.21 ? 112 GLU A HG3  1  
ATOM 1723   N N    . CYS A 1 113 ? -3.481  8.565   4.178   1.00 62.04 ? 113 CYS A N    1  
ATOM 1724   C CA   . CYS A 1 113 ? -4.562  7.752   3.580   1.00 52.51 ? 113 CYS A CA   1  
ATOM 1725   C C    . CYS A 1 113 ? -5.079  8.388   2.270   1.00 70.45 ? 113 CYS A C    1  
ATOM 1726   O O    . CYS A 1 113 ? -5.513  7.681   1.348   1.00 72.33 ? 113 CYS A O    1  
ATOM 1727   C CB   . CYS A 1 113 ? -5.714  7.558   4.587   1.00 33.21 ? 113 CYS A CB   1  
ATOM 1728   S SG   . CYS A 1 113 ? -6.996  6.400   4.040   1.00 20.31 ? 113 CYS A SG   1  
ATOM 1729   H H    . CYS A 1 113 ? -3.643  9.005   5.039   1.00 64.30 ? 113 CYS A H    1  
ATOM 1730   H HA   . CYS A 1 113 ? -4.143  6.776   3.347   1.00 23.34 ? 113 CYS A HA   1  
ATOM 1731   H HB2  . CYS A 1 113 ? -5.315  7.177   5.517   1.00 32.02 ? 113 CYS A HB2  1  
ATOM 1732   H HB3  . CYS A 1 113 ? -6.195  8.512   4.777   1.00 12.34 ? 113 CYS A HB3  1  
ATOM 1733   H HG   . CYS A 1 113 ? -7.143  6.534   2.727   1.00 24.11 ? 113 CYS A HG   1  
ATOM 1734   N N    . ILE A 1 114 ? -5.017  9.732   2.208   1.00 62.21 ? 114 ILE A N    1  
ATOM 1735   C CA   . ILE A 1 114 ? -5.319  10.515  0.990   1.00 53.43 ? 114 ILE A CA   1  
ATOM 1736   C C    . ILE A 1 114 ? -4.176  10.351  -0.036  1.00 21.41 ? 114 ILE A C    1  
ATOM 1737   O O    . ILE A 1 114 ? -4.420  9.974   -1.187  1.00 5.32  ? 114 ILE A O    1  
ATOM 1738   C CB   . ILE A 1 114 ? -5.558  12.039  1.360   1.00 2.10  ? 114 ILE A CB   1  
ATOM 1739   C CG1  . ILE A 1 114 ? -6.941  12.199  2.084   1.00 10.12 ? 114 ILE A CG1  1  
ATOM 1740   C CG2  . ILE A 1 114 ? -5.438  12.987  0.132   1.00 21.54 ? 114 ILE A CG2  1  
ATOM 1741   C CD1  . ILE A 1 114 ? -7.239  13.586  2.618   1.00 25.30 ? 114 ILE A CD1  1  
ATOM 1742   H H    . ILE A 1 114 ? -4.749  10.221  3.015   1.00 12.55 ? 114 ILE A H    1  
ATOM 1743   H HA   . ILE A 1 114 ? -6.239  10.121  0.557   1.00 2.32  ? 114 ILE A HA   1  
ATOM 1744   H HB   . ILE A 1 114 ? -4.776  12.328  2.057   1.00 21.33 ? 114 ILE A HB   1  
ATOM 1745   H HG12 . ILE A 1 114 ? -7.734  11.946  1.397   1.00 4.43  ? 114 ILE A HG12 1  
ATOM 1746   H HG13 . ILE A 1 114 ? -6.980  11.516  2.927   1.00 11.42 ? 114 ILE A HG13 1  
ATOM 1747   H HG21 . ILE A 1 114 ? -4.443  12.914  -0.292  1.00 52.34 ? 114 ILE A HG21 1  
ATOM 1748   H HG22 . ILE A 1 114 ? -5.617  14.010  0.434   1.00 23.41 ? 114 ILE A HG22 1  
ATOM 1749   H HG23 . ILE A 1 114 ? -6.163  12.707  -0.616  1.00 11.43 ? 114 ILE A HG23 1  
ATOM 1750   H HD11 . ILE A 1 114 ? -7.313  14.283  1.797   1.00 3.00  ? 114 ILE A HD11 1  
ATOM 1751   H HD12 . ILE A 1 114 ? -6.446  13.898  3.284   1.00 61.02 ? 114 ILE A HD12 1  
ATOM 1752   H HD13 . ILE A 1 114 ? -8.174  13.569  3.160   1.00 32.51 ? 114 ILE A HD13 1  
ATOM 1753   N N    . THR A 1 115 ? -2.931  10.578  0.437   1.00 31.51 ? 115 THR A N    1  
ATOM 1754   C CA   . THR A 1 115 ? -1.696  10.496  -0.372  1.00 21.41 ? 115 THR A CA   1  
ATOM 1755   C C    . THR A 1 115 ? -1.529  9.099   -1.011  1.00 44.45 ? 115 THR A C    1  
ATOM 1756   O O    . THR A 1 115 ? -1.041  8.969   -2.144  1.00 10.04 ? 115 THR A O    1  
ATOM 1757   C CB   . THR A 1 115 ? -0.445  10.821  0.523   1.00 72.45 ? 115 THR A CB   1  
ATOM 1758   O OG1  . THR A 1 115 ? -0.600  12.116  1.132   1.00 11.35 ? 115 THR A OG1  1  
ATOM 1759   C CG2  . THR A 1 115 ? 0.878   10.778  -0.266  1.00 64.34 ? 115 THR A CG2  1  
ATOM 1760   H H    . THR A 1 115 ? -2.835  10.812  1.377   1.00 12.54 ? 115 THR A H    1  
ATOM 1761   H HA   . THR A 1 115 ? -1.761  11.241  -1.155  1.00 51.12 ? 115 THR A HA   1  
ATOM 1762   H HB   . THR A 1 115 ? -0.395  10.083  1.321   1.00 22.12 ? 115 THR A HB   1  
ATOM 1763   H HG1  . THR A 1 115 ? -0.266  12.794  0.535   1.00 1.02  ? 115 THR A HG1  1  
ATOM 1764   H HG21 . THR A 1 115 ? 1.016   9.795   -0.700  1.00 31.33 ? 115 THR A HG21 1  
ATOM 1765   H HG22 . THR A 1 115 ? 1.707   10.989  0.397   1.00 42.34 ? 115 THR A HG22 1  
ATOM 1766   H HG23 . THR A 1 115 ? 0.859   11.518  -1.057  1.00 63.52 ? 115 THR A HG23 1  
ATOM 1767   N N    . SER A 1 116 ? -1.983  8.068   -0.274  1.00 73.31 ? 116 SER A N    1  
ATOM 1768   C CA   . SER A 1 116 ? -1.892  6.668   -0.698  1.00 33.33 ? 116 SER A CA   1  
ATOM 1769   C C    . SER A 1 116 ? -2.802  6.432   -1.911  1.00 21.31 ? 116 SER A C    1  
ATOM 1770   O O    . SER A 1 116 ? -2.362  5.867   -2.902  1.00 42.14 ? 116 SER A O    1  
ATOM 1771   C CB   . SER A 1 116 ? -2.270  5.720   0.465   1.00 54.43 ? 116 SER A CB   1  
ATOM 1772   O OG   . SER A 1 116 ? -2.053  4.349   0.125   1.00 25.41 ? 116 SER A OG   1  
ATOM 1773   H H    . SER A 1 116 ? -2.405  8.266   0.585   1.00 33.23 ? 116 SER A H    1  
ATOM 1774   H HA   . SER A 1 116 ? -0.860  6.474   -0.985  1.00 31.44 ? 116 SER A HA   1  
ATOM 1775   H HB2  . SER A 1 116 ? -1.664  5.955   1.330   1.00 12.51 ? 116 SER A HB2  1  
ATOM 1776   H HB3  . SER A 1 116 ? -3.317  5.851   0.721   1.00 21.33 ? 116 SER A HB3  1  
ATOM 1777   H HG   . SER A 1 116 ? -1.334  3.994   0.670   1.00 5.00  ? 116 SER A HG   1  
ATOM 1778   N N    . MET A 1 117 ? -4.053  6.934   -1.835  1.00 32.12 ? 117 MET A N    1  
ATOM 1779   C CA   . MET A 1 117 ? -5.050  6.776   -2.919  1.00 72.11 ? 117 MET A CA   1  
ATOM 1780   C C    . MET A 1 117 ? -4.644  7.563   -4.177  1.00 20.42 ? 117 MET A C    1  
ATOM 1781   O O    . MET A 1 117 ? -4.902  7.113   -5.297  1.00 70.40 ? 117 MET A O    1  
ATOM 1782   C CB   . MET A 1 117 ? -6.449  7.234   -2.461  1.00 11.14 ? 117 MET A CB   1  
ATOM 1783   C CG   . MET A 1 117 ? -7.066  6.425   -1.316  1.00 25.12 ? 117 MET A CG   1  
ATOM 1784   S SD   . MET A 1 117 ? -8.790  6.874   -1.017  1.00 23.33 ? 117 MET A SD   1  
ATOM 1785   C CE   . MET A 1 117 ? -8.717  8.666   -0.939  1.00 30.02 ? 117 MET A CE   1  
ATOM 1786   H H    . MET A 1 117 ? -4.312  7.432   -1.027  1.00 3.33  ? 117 MET A H    1  
ATOM 1787   H HA   . MET A 1 117 ? -5.096  5.718   -3.172  1.00 23.43 ? 117 MET A HA   1  
ATOM 1788   H HB2  . MET A 1 117 ? -6.388  8.268   -2.140  1.00 4.20  ? 117 MET A HB2  1  
ATOM 1789   H HB3  . MET A 1 117 ? -7.129  7.182   -3.305  1.00 21.25 ? 117 MET A HB3  1  
ATOM 1790   H HG2  . MET A 1 117 ? -7.027  5.370   -1.562  1.00 54.11 ? 117 MET A HG2  1  
ATOM 1791   H HG3  . MET A 1 117 ? -6.502  6.600   -0.410  1.00 51.23 ? 117 MET A HG3  1  
ATOM 1792   H HE1  . MET A 1 117 ? -8.612  9.070   -1.940  1.00 53.32 ? 117 MET A HE1  1  
ATOM 1793   H HE2  . MET A 1 117 ? -7.875  8.960   -0.362  1.00 74.12 ? 117 MET A HE2  1  
ATOM 1794   H HE3  . MET A 1 117 ? -9.617  9.053   -0.487  1.00 44.24 ? 117 MET A HE3  1  
ATOM 1795   N N    . VAL A 1 118 ? -4.033  8.746   -3.969  1.00 43.04 ? 118 VAL A N    1  
ATOM 1796   C CA   . VAL A 1 118 ? -3.476  9.575   -5.057  1.00 23.31 ? 118 VAL A CA   1  
ATOM 1797   C C    . VAL A 1 118 ? -2.359  8.803   -5.793  1.00 45.22 ? 118 VAL A C    1  
ATOM 1798   O O    . VAL A 1 118 ? -2.347  8.728   -7.027  1.00 42.32 ? 118 VAL A O    1  
ATOM 1799   C CB   . VAL A 1 118 ? -2.911  10.946  -4.502  1.00 14.13 ? 118 VAL A CB   1  
ATOM 1800   C CG1  . VAL A 1 118 ? -2.171  11.759  -5.594  1.00 72.23 ? 118 VAL A CG1  1  
ATOM 1801   C CG2  . VAL A 1 118 ? -4.038  11.793  -3.857  1.00 53.03 ? 118 VAL A CG2  1  
ATOM 1802   H H    . VAL A 1 118 ? -3.957  9.075   -3.048  1.00 72.13 ? 118 VAL A H    1  
ATOM 1803   H HA   . VAL A 1 118 ? -4.283  9.791   -5.756  1.00 52.32 ? 118 VAL A HA   1  
ATOM 1804   H HB   . VAL A 1 118 ? -2.188  10.712  -3.724  1.00 41.44 ? 118 VAL A HB   1  
ATOM 1805   H HG11 . VAL A 1 118 ? -2.877  12.133  -6.325  1.00 33.14 ? 118 VAL A HG11 1  
ATOM 1806   H HG12 . VAL A 1 118 ? -1.452  11.136  -6.090  1.00 20.11 ? 118 VAL A HG12 1  
ATOM 1807   H HG13 . VAL A 1 118 ? -1.647  12.576  -5.154  1.00 52.52 ? 118 VAL A HG13 1  
ATOM 1808   H HG21 . VAL A 1 118 ? -4.869  11.893  -4.546  1.00 51.42 ? 118 VAL A HG21 1  
ATOM 1809   H HG22 . VAL A 1 118 ? -3.666  12.779  -3.608  1.00 34.23 ? 118 VAL A HG22 1  
ATOM 1810   H HG23 . VAL A 1 118 ? -4.386  11.318  -2.957  1.00 2.14  ? 118 VAL A HG23 1  
ATOM 1811   N N    . SER A 1 119 ? -1.455  8.199   -5.000  1.00 50.44 ? 119 SER A N    1  
ATOM 1812   C CA   . SER A 1 119 ? -0.299  7.443   -5.511  1.00 22.51 ? 119 SER A CA   1  
ATOM 1813   C C    . SER A 1 119 ? -0.753  6.150   -6.234  1.00 53.03 ? 119 SER A C    1  
ATOM 1814   O O    . SER A 1 119 ? -0.172  5.755   -7.255  1.00 34.51 ? 119 SER A O    1  
ATOM 1815   C CB   . SER A 1 119 ? 0.667   7.103   -4.345  1.00 34.12 ? 119 SER A CB   1  
ATOM 1816   O OG   . SER A 1 119 ? 1.765   6.321   -4.780  1.00 23.21 ? 119 SER A OG   1  
ATOM 1817   H H    . SER A 1 119 ? -1.573  8.265   -4.030  1.00 63.40 ? 119 SER A H    1  
ATOM 1818   H HA   . SER A 1 119 ? 0.217   8.092   -6.216  1.00 0.11  ? 119 SER A HA   1  
ATOM 1819   H HB2  . SER A 1 119 ? 1.054   8.019   -3.920  1.00 4.42  ? 119 SER A HB2  1  
ATOM 1820   H HB3  . SER A 1 119 ? 0.134   6.555   -3.577  1.00 14.15 ? 119 SER A HB3  1  
ATOM 1821   H HG   . SER A 1 119 ? 2.211   6.768   -5.507  1.00 21.45 ? 119 SER A HG   1  
ATOM 1822   N N    . ARG A 1 120 ? -1.821  5.521   -5.699  1.00 44.30 ? 120 ARG A N    1  
ATOM 1823   C CA   . ARG A 1 120 ? -2.436  4.305   -6.282  1.00 50.44 ? 120 ARG A CA   1  
ATOM 1824   C C    . ARG A 1 120 ? -3.211  4.671   -7.556  1.00 75.14 ? 120 ARG A C    1  
ATOM 1825   O O    . ARG A 1 120 ? -3.318  3.858   -8.479  1.00 4.52  ? 120 ARG A O    1  
ATOM 1826   C CB   . ARG A 1 120 ? -3.369  3.610   -5.244  1.00 60.13 ? 120 ARG A CB   1  
ATOM 1827   C CG   . ARG A 1 120 ? -2.620  3.015   -4.027  1.00 72.14 ? 120 ARG A CG   1  
ATOM 1828   C CD   . ARG A 1 120 ? -3.558  2.487   -2.921  1.00 1.21  ? 120 ARG A CD   1  
ATOM 1829   N NE   . ARG A 1 120 ? -2.789  2.028   -1.744  1.00 5.00  ? 120 ARG A NE   1  
ATOM 1830   C CZ   . ARG A 1 120 ? -2.403  0.761   -1.503  1.00 2.03  ? 120 ARG A CZ   1  
ATOM 1831   N NH1  . ARG A 1 120 ? -2.700  -0.215  -2.357  1.00 24.35 ? 120 ARG A NH1  1  
ATOM 1832   N NH2  . ARG A 1 120 ? -1.691  0.483   -0.419  1.00 4.30  ? 120 ARG A NH2  1  
ATOM 1833   H H    . ARG A 1 120 ? -2.221  5.900   -4.893  1.00 34.21 ? 120 ARG A H    1  
ATOM 1834   H HA   . ARG A 1 120 ? -1.633  3.619   -6.548  1.00 54.11 ? 120 ARG A HA   1  
ATOM 1835   H HB2  . ARG A 1 120 ? -4.088  4.340   -4.882  1.00 73.42 ? 120 ARG A HB2  1  
ATOM 1836   H HB3  . ARG A 1 120 ? -3.908  2.808   -5.735  1.00 34.31 ? 120 ARG A HB3  1  
ATOM 1837   H HG2  . ARG A 1 120 ? -1.997  2.197   -4.366  1.00 61.44 ? 120 ARG A HG2  1  
ATOM 1838   H HG3  . ARG A 1 120 ? -1.985  3.785   -3.602  1.00 74.43 ? 120 ARG A HG3  1  
ATOM 1839   H HD2  . ARG A 1 120 ? -4.220  3.288   -2.610  1.00 13.20 ? 120 ARG A HD2  1  
ATOM 1840   H HD3  . ARG A 1 120 ? -4.150  1.666   -3.310  1.00 24.24 ? 120 ARG A HD3  1  
ATOM 1841   H HE   . ARG A 1 120 ? -2.541  2.717   -1.086  1.00 73.11 ? 120 ARG A HE   1  
ATOM 1842   H HH11 . ARG A 1 120 ? -3.220  -0.019  -3.189  1.00 75.11 ? 120 ARG A HH11 1  
ATOM 1843   H HH12 . ARG A 1 120 ? -2.399  -1.156  -2.163  1.00 63.31 ? 120 ARG A HH12 1  
ATOM 1844   H HH21 . ARG A 1 120 ? -1.439  1.212   0.232   1.00 54.03 ? 120 ARG A HH21 1  
ATOM 1845   H HH22 . ARG A 1 120 ? -1.401  -0.462  -0.240  1.00 20.14 ? 120 ARG A HH22 1  
ATOM 1846   N N    . GLY A 1 121 ? -3.724  5.921   -7.590  1.00 31.31 ? 121 GLY A N    1  
ATOM 1847   C CA   . GLY A 1 121 ? -4.370  6.494   -8.767  1.00 45.14 ? 121 GLY A CA   1  
ATOM 1848   C C    . GLY A 1 121 ? -3.362  7.104   -9.739  1.00 3.43  ? 121 GLY A C    1  
ATOM 1849   O O    . GLY A 1 121 ? -3.753  7.829   -10.654 1.00 50.54 ? 121 GLY A O    1  
ATOM 1850   H H    . GLY A 1 121 ? -3.641  6.480   -6.791  1.00 52.33 ? 121 GLY A H    1  
ATOM 1851   H HA2  . GLY A 1 121 ? -4.934  5.722   -9.284  1.00 22.51 ? 121 GLY A HA2  1  
ATOM 1852   H HA3  . GLY A 1 121 ? -5.057  7.264   -8.439  1.00 4.22  ? 121 GLY A HA3  1  
ATOM 1853   N N    . THR A 1 122 ? -2.055  6.827   -9.481  1.00 64.42 ? 122 THR A N    1  
ATOM 1854   C CA   . THR A 1 122 ? -0.892  7.126   -10.355 1.00 43.03 ? 122 THR A CA   1  
ATOM 1855   C C    . THR A 1 122 ? -0.691  8.649   -10.612 1.00 15.41 ? 122 THR A C    1  
ATOM 1856   O O    . THR A 1 122 ? 0.024   9.045   -11.544 1.00 13.21 ? 122 THR A O    1  
ATOM 1857   C CB   . THR A 1 122 ? -0.914  6.275   -11.698 1.00 22.22 ? 122 THR A CB   1  
ATOM 1858   O OG1  . THR A 1 122 ? 0.409   6.174   -12.261 1.00 4.53  ? 122 THR A OG1  1  
ATOM 1859   C CG2  . THR A 1 122 ? -1.834  6.863   -12.772 1.00 54.31 ? 122 THR A CG2  1  
ATOM 1860   H H    . THR A 1 122 ? -1.856  6.395   -8.630  1.00 72.01 ? 122 THR A H    1  
ATOM 1861   H HA   . THR A 1 122 ? -0.023  6.794   -9.795  1.00 35.23 ? 122 THR A HA   1  
ATOM 1862   H HB   . THR A 1 122 ? -1.264  5.273   -11.461 1.00 71.45 ? 122 THR A HB   1  
ATOM 1863   H HG1  . THR A 1 122 ? 0.780   5.311   -12.049 1.00 13.15 ? 122 THR A HG1  1  
ATOM 1864   H HG21 . THR A 1 122 ? -1.521  7.874   -13.009 1.00 14.31 ? 122 THR A HG21 1  
ATOM 1865   H HG22 . THR A 1 122 ? -2.846  6.885   -12.423 1.00 62.10 ? 122 THR A HG22 1  
ATOM 1866   H HG23 . THR A 1 122 ? -1.795  6.267   -13.663 1.00 42.23 ? 122 THR A HG23 1  
ATOM 1867   N N    . PHE A 1 123 ? -1.268  9.499   -9.734  1.00 55.04 ? 123 PHE A N    1  
ATOM 1868   C CA   . PHE A 1 123 ? -1.097  10.960  -9.803  1.00 33.02 ? 123 PHE A CA   1  
ATOM 1869   C C    . PHE A 1 123 ? 0.213   11.365  -9.086  1.00 11.31 ? 123 PHE A C    1  
ATOM 1870   O O    . PHE A 1 123 ? 0.689   10.618  -8.217  1.00 3.21  ? 123 PHE A O    1  
ATOM 1871   C CB   . PHE A 1 123 ? -2.312  11.685  -9.162  1.00 2.02  ? 123 PHE A CB   1  
ATOM 1872   C CG   . PHE A 1 123 ? -3.612  11.555  -9.948  1.00 33.22 ? 123 PHE A CG   1  
ATOM 1873   C CD1  . PHE A 1 123 ? -3.854  12.372  -11.053 1.00 71.22 ? 123 PHE A CD1  1  
ATOM 1874   C CD2  . PHE A 1 123 ? -4.593  10.631  -9.586  1.00 72.21 ? 123 PHE A CD2  1  
ATOM 1875   C CE1  . PHE A 1 123 ? -5.031  12.270  -11.766 1.00 54.51 ? 123 PHE A CE1  1  
ATOM 1876   C CE2  . PHE A 1 123 ? -5.769  10.529  -10.305 1.00 71.03 ? 123 PHE A CE2  1  
ATOM 1877   C CZ   . PHE A 1 123 ? -5.987  11.347  -11.393 1.00 4.20  ? 123 PHE A CZ   1  
ATOM 1878   H H    . PHE A 1 123 ? -1.799  9.134   -8.994  1.00 43.50 ? 123 PHE A H    1  
ATOM 1879   H HA   . PHE A 1 123 ? -1.026  11.246  -10.850 1.00 1.03  ? 123 PHE A HA   1  
ATOM 1880   H HB2  . PHE A 1 123 ? -2.476  11.287  -8.168  1.00 0.43  ? 123 PHE A HB2  1  
ATOM 1881   H HB3  . PHE A 1 123 ? -2.085  12.745  -9.072  1.00 4.33  ? 123 PHE A HB3  1  
ATOM 1882   H HD1  . PHE A 1 123 ? -3.108  13.098  -11.353 1.00 10.31 ? 123 PHE A HD1  1  
ATOM 1883   H HD2  . PHE A 1 123 ? -4.428  9.985   -8.731  1.00 73.34 ? 123 PHE A HD2  1  
ATOM 1884   H HE1  . PHE A 1 123 ? -5.203  12.911  -12.622 1.00 61.03 ? 123 PHE A HE1  1  
ATOM 1885   H HE2  . PHE A 1 123 ? -6.520  9.807   -10.015 1.00 44.12 ? 123 PHE A HE2  1  
ATOM 1886   H HZ   . PHE A 1 123 ? -6.911  11.267  -11.954 1.00 14.12 ? 123 PHE A HZ   1  
ATOM 1887   N N    . PRO A 1 124 ? 0.828   12.541  -9.463  1.00 72.14 ? 124 PRO A N    1  
ATOM 1888   C CA   . PRO A 1 124 ? 2.042   13.089  -8.787  1.00 65.02 ? 124 PRO A CA   1  
ATOM 1889   C C    . PRO A 1 124 ? 1.896   13.234  -7.253  1.00 22.11 ? 124 PRO A C    1  
ATOM 1890   O O    . PRO A 1 124 ? 0.776   13.292  -6.725  1.00 75.15 ? 124 PRO A O    1  
ATOM 1891   C CB   . PRO A 1 124 ? 2.226   14.472  -9.468  1.00 45.20 ? 124 PRO A CB   1  
ATOM 1892   C CG   . PRO A 1 124 ? 1.611   14.308  -10.824 1.00 10.04 ? 124 PRO A CG   1  
ATOM 1893   C CD   . PRO A 1 124 ? 0.416   13.409  -10.606 1.00 33.30 ? 124 PRO A CD   1  
ATOM 1894   H HA   . PRO A 1 124 ? 2.906   12.464  -8.996  1.00 51.34 ? 124 PRO A HA   1  
ATOM 1895   H HB2  . PRO A 1 124 ? 1.713   15.250  -8.899  1.00 5.23  ? 124 PRO A HB2  1  
ATOM 1896   H HB3  . PRO A 1 124 ? 3.277   14.716  -9.557  1.00 23.31 ? 124 PRO A HB3  1  
ATOM 1897   H HG2  . PRO A 1 124 ? 1.302   15.277  -11.214 1.00 23.31 ? 124 PRO A HG2  1  
ATOM 1898   H HG3  . PRO A 1 124 ? 2.313   13.839  -11.507 1.00 23.20 ? 124 PRO A HG3  1  
ATOM 1899   H HD2  . PRO A 1 124 ? -0.463  13.990  -10.345 1.00 60.54 ? 124 PRO A HD2  1  
ATOM 1900   H HD3  . PRO A 1 124 ? 0.217   12.813  -11.490 1.00 72.12 ? 124 PRO A HD3  1  
ATOM 1901   N N    . GLN A 1 125 ? 3.052   13.306  -6.561  1.00 22.43 ? 125 GLN A N    1  
ATOM 1902   C CA   . GLN A 1 125 ? 3.117   13.338  -5.091  1.00 33.32 ? 125 GLN A CA   1  
ATOM 1903   C C    . GLN A 1 125 ? 2.403   14.588  -4.520  1.00 23.40 ? 125 GLN A C    1  
ATOM 1904   O O    . GLN A 1 125 ? 2.705   15.726  -4.897  1.00 5.22  ? 125 GLN A O    1  
ATOM 1905   C CB   . GLN A 1 125 ? 4.598   13.250  -4.614  1.00 12.13 ? 125 GLN A CB   1  
ATOM 1906   C CG   . GLN A 1 125 ? 4.804   13.310  -3.082  1.00 43.24 ? 125 GLN A CG   1  
ATOM 1907   C CD   . GLN A 1 125 ? 3.946   12.304  -2.300  1.00 4.13  ? 125 GLN A CD   1  
ATOM 1908   O OE1  . GLN A 1 125 ? 2.843   12.612  -1.871  1.00 4.31  ? 125 GLN A OE1  1  
ATOM 1909   N NE2  . GLN A 1 125 ? 4.441   11.105  -2.109  1.00 20.52 ? 125 GLN A NE2  1  
ATOM 1910   H H    . GLN A 1 125 ? 3.892   13.344  -7.064  1.00 54.14 ? 125 GLN A H    1  
ATOM 1911   H HA   . GLN A 1 125 ? 2.597   12.450  -4.737  1.00 35.53 ? 125 GLN A HA   1  
ATOM 1912   H HB2  . GLN A 1 125 ? 5.019   12.316  -4.972  1.00 52.11 ? 125 GLN A HB2  1  
ATOM 1913   H HB3  . GLN A 1 125 ? 5.156   14.066  -5.063  1.00 21.01 ? 125 GLN A HB3  1  
ATOM 1914   H HG2  . GLN A 1 125 ? 5.848   13.122  -2.860  1.00 32.02 ? 125 GLN A HG2  1  
ATOM 1915   H HG3  . GLN A 1 125 ? 4.555   14.309  -2.741  1.00 22.43 ? 125 GLN A HG3  1  
ATOM 1916   H HE21 . GLN A 1 125 ? 5.324   10.911  -2.464  1.00 22.31 ? 125 GLN A HE21 1  
ATOM 1917   H HE22 . GLN A 1 125 ? 3.910   10.461  -1.600  1.00 11.21 ? 125 GLN A HE22 1  
ATOM 1918   N N    . LEU A 1 126 ? 1.456   14.333  -3.608  1.00 61.23 ? 126 LEU A N    1  
ATOM 1919   C CA   . LEU A 1 126 ? 0.584   15.344  -3.003  1.00 10.23 ? 126 LEU A CA   1  
ATOM 1920   C C    . LEU A 1 126 ? 0.599   15.182  -1.468  1.00 63.41 ? 126 LEU A C    1  
ATOM 1921   O O    . LEU A 1 126 ? 0.129   14.163  -0.951  1.00 4.22  ? 126 LEU A O    1  
ATOM 1922   C CB   . LEU A 1 126 ? -0.863  15.175  -3.555  1.00 71.34 ? 126 LEU A CB   1  
ATOM 1923   C CG   . LEU A 1 126 ? -1.955  16.106  -2.926  1.00 32.34 ? 126 LEU A CG   1  
ATOM 1924   C CD1  . LEU A 1 126 ? -1.712  17.595  -3.275  1.00 53.14 ? 126 LEU A CD1  1  
ATOM 1925   C CD2  . LEU A 1 126 ? -3.373  15.642  -3.320  1.00 41.10 ? 126 LEU A CD2  1  
ATOM 1926   H H    . LEU A 1 126 ? 1.345   13.404  -3.309  1.00 33.34 ? 126 LEU A H    1  
ATOM 1927   H HA   . LEU A 1 126 ? 0.950   16.336  -3.263  1.00 64.45 ? 126 LEU A HA   1  
ATOM 1928   H HB2  . LEU A 1 126 ? -0.835  15.359  -4.628  1.00 64.24 ? 126 LEU A HB2  1  
ATOM 1929   H HB3  . LEU A 1 126 ? -1.167  14.137  -3.410  1.00 34.35 ? 126 LEU A HB3  1  
ATOM 1930   H HG   . LEU A 1 126 ? -1.883  16.025  -1.847  1.00 23.42 ? 126 LEU A HG   1  
ATOM 1931   H HD11 . LEU A 1 126 ? -1.737  17.734  -4.348  1.00 2.41  ? 126 LEU A HD11 1  
ATOM 1932   H HD12 . LEU A 1 126 ? -0.745  17.902  -2.898  1.00 12.34 ? 126 LEU A HD12 1  
ATOM 1933   H HD13 . LEU A 1 126 ? -2.477  18.206  -2.815  1.00 5.21  ? 126 LEU A HD13 1  
ATOM 1934   H HD21 . LEU A 1 126 ? -3.575  14.679  -2.868  1.00 74.21 ? 126 LEU A HD21 1  
ATOM 1935   H HD22 . LEU A 1 126 ? -3.443  15.548  -4.393  1.00 3.24  ? 126 LEU A HD22 1  
ATOM 1936   H HD23 . LEU A 1 126 ? -4.108  16.357  -2.972  1.00 35.22 ? 126 LEU A HD23 1  
ATOM 1937   N N    . ASN A 1 127 ? 1.161   16.179  -0.750  1.00 64.32 ? 127 ASN A N    1  
ATOM 1938   C CA   . ASN A 1 127 ? 1.162   16.216  0.733   1.00 31.15 ? 127 ASN A CA   1  
ATOM 1939   C C    . ASN A 1 127 ? 0.646   17.578  1.213   1.00 24.12 ? 127 ASN A C    1  
ATOM 1940   O O    . ASN A 1 127 ? 1.181   18.625  0.821   1.00 71.51 ? 127 ASN A O    1  
ATOM 1941   C CB   . ASN A 1 127 ? 2.574   15.954  1.335   1.00 64.43 ? 127 ASN A CB   1  
ATOM 1942   C CG   . ASN A 1 127 ? 3.148   14.591  0.950   1.00 73.21 ? 127 ASN A CG   1  
ATOM 1943   O OD1  . ASN A 1 127 ? 2.768   13.562  1.506   1.00 1.42  ? 127 ASN A OD1  1  
ATOM 1944   N ND2  . ASN A 1 127 ? 4.094   14.573  0.028   1.00 45.24 ? 127 ASN A ND2  1  
ATOM 1945   H H    . ASN A 1 127 ? 1.586   16.917  -1.232  1.00 71.55 ? 127 ASN A H    1  
ATOM 1946   H HA   . ASN A 1 127 ? 0.483   15.442  1.093   1.00 31.12 ? 127 ASN A HA   1  
ATOM 1947   H HB2  . ASN A 1 127 ? 3.256   16.725  0.987   1.00 30.12 ? 127 ASN A HB2  1  
ATOM 1948   H HB3  . ASN A 1 127 ? 2.521   16.005  2.420   1.00 51.01 ? 127 ASN A HB3  1  
ATOM 1949   H HD21 . ASN A 1 127 ? 4.378   15.426  -0.360  1.00 73.14 ? 127 ASN A HD21 1  
ATOM 1950   H HD22 . ASN A 1 127 ? 4.455   13.707  -0.237  1.00 2.32  ? 127 ASN A HD22 1  
ATOM 1951   N N    . LEU A 1 128 ? -0.414  17.546  2.035   1.00 21.34 ? 128 LEU A N    1  
ATOM 1952   C CA   . LEU A 1 128 ? -0.990  18.740  2.676   1.00 12.24 ? 128 LEU A CA   1  
ATOM 1953   C C    . LEU A 1 128 ? -0.035  19.193  3.811   1.00 24.00 ? 128 LEU A C    1  
ATOM 1954   O O    . LEU A 1 128 ? 0.331   18.377  4.663   1.00 62.05 ? 128 LEU A O    1  
ATOM 1955   C CB   . LEU A 1 128 ? -2.426  18.392  3.203   1.00 52.53 ? 128 LEU A CB   1  
ATOM 1956   C CG   . LEU A 1 128 ? -3.439  19.579  3.393   1.00 45.01 ? 128 LEU A CG   1  
ATOM 1957   C CD1  . LEU A 1 128 ? -4.875  19.053  3.633   1.00 30.12 ? 128 LEU A CD1  1  
ATOM 1958   C CD2  . LEU A 1 128 ? -3.017  20.545  4.523   1.00 64.30 ? 128 LEU A CD2  1  
ATOM 1959   H H    . LEU A 1 128 ? -0.827  16.679  2.219   1.00 14.40 ? 128 LEU A H    1  
ATOM 1960   H HA   . LEU A 1 128 ? -1.066  19.526  1.928   1.00 64.01 ? 128 LEU A HA   1  
ATOM 1961   H HB2  . LEU A 1 128 ? -2.871  17.693  2.498   1.00 35.22 ? 128 LEU A HB2  1  
ATOM 1962   H HB3  . LEU A 1 128 ? -2.328  17.874  4.152   1.00 24.12 ? 128 LEU A HB3  1  
ATOM 1963   H HG   . LEU A 1 128 ? -3.467  20.152  2.474   1.00 74.04 ? 128 LEU A HG   1  
ATOM 1964   H HD11 . LEU A 1 128 ? -4.910  18.461  4.540   1.00 52.32 ? 128 LEU A HD11 1  
ATOM 1965   H HD12 . LEU A 1 128 ? -5.181  18.442  2.796   1.00 10.31 ? 128 LEU A HD12 1  
ATOM 1966   H HD13 . LEU A 1 128 ? -5.560  19.889  3.725   1.00 12.23 ? 128 LEU A HD13 1  
ATOM 1967   H HD21 . LEU A 1 128 ? -3.742  21.345  4.608   1.00 14.33 ? 128 LEU A HD21 1  
ATOM 1968   H HD22 . LEU A 1 128 ? -2.051  20.972  4.290   1.00 21.51 ? 128 LEU A HD22 1  
ATOM 1969   H HD23 . LEU A 1 128 ? -2.956  20.015  5.464   1.00 14.31 ? 128 LEU A HD23 1  
ATOM 1970   N N    . ALA A 1 129 ? 0.357   20.483  3.810   1.00 31.30 ? 129 ALA A N    1  
ATOM 1971   C CA   . ALA A 1 129 ? 1.349   21.026  4.764   1.00 74.41 ? 129 ALA A CA   1  
ATOM 1972   C C    . ALA A 1 129 ? 0.825   20.995  6.237   1.00 65.23 ? 129 ALA A C    1  
ATOM 1973   O O    . ALA A 1 129 ? -0.350  21.295  6.478   1.00 63.50 ? 129 ALA A O    1  
ATOM 1974   C CB   . ALA A 1 129 ? 1.763   22.448  4.343   1.00 65.14 ? 129 ALA A CB   1  
ATOM 1975   H H    . ALA A 1 129 ? -0.035  21.090  3.144   1.00 24.42 ? 129 ALA A H    1  
ATOM 1976   H HA   . ALA A 1 129 ? 2.231   20.393  4.694   1.00 34.44 ? 129 ALA A HA   1  
ATOM 1977   H HB1  . ALA A 1 129 ? 2.540   22.818  5.000   1.00 33.53 ? 129 ALA A HB1  1  
ATOM 1978   H HB2  . ALA A 1 129 ? 0.909   23.109  4.396   1.00 75.22 ? 129 ALA A HB2  1  
ATOM 1979   H HB3  . ALA A 1 129 ? 2.136   22.434  3.326   1.00 52.32 ? 129 ALA A HB3  1  
ATOM 1980   N N    . PRO A 1 130 ? 1.695   20.587  7.233   1.00 15.10 ? 130 PRO A N    1  
ATOM 1981   C CA   . PRO A 1 130 ? 1.318   20.467  8.672   1.00 54.31 ? 130 PRO A CA   1  
ATOM 1982   C C    . PRO A 1 130 ? 0.934   21.810  9.318   1.00 1.23  ? 130 PRO A C    1  
ATOM 1983   O O    . PRO A 1 130 ? 1.695   22.781  9.249   1.00 4.42  ? 130 PRO A O    1  
ATOM 1984   C CB   . PRO A 1 130 ? 2.595   19.867  9.335   1.00 24.53 ? 130 PRO A CB   1  
ATOM 1985   C CG   . PRO A 1 130 ? 3.346   19.259  8.194   1.00 3.32  ? 130 PRO A CG   1  
ATOM 1986   C CD   . PRO A 1 130 ? 3.112   20.192  7.036   1.00 4.43  ? 130 PRO A CD   1  
ATOM 1987   H HA   . PRO A 1 130 ? 0.496   19.766  8.790   1.00 71.20 ? 130 PRO A HA   1  
ATOM 1988   H HB2  . PRO A 1 130 ? 3.185   20.650  9.817   1.00 73.11 ? 130 PRO A HB2  1  
ATOM 1989   H HB3  . PRO A 1 130 ? 2.336   19.108  10.063  1.00 54.25 ? 130 PRO A HB3  1  
ATOM 1990   H HG2  . PRO A 1 130 ? 4.401   19.193  8.431   1.00 60.21 ? 130 PRO A HG2  1  
ATOM 1991   H HG3  . PRO A 1 130 ? 2.956   18.271  7.962   1.00 21.33 ? 130 PRO A HG3  1  
ATOM 1992   H HD2  . PRO A 1 130 ? 3.771   21.055  7.086   1.00 74.23 ? 130 PRO A HD2  1  
ATOM 1993   H HD3  . PRO A 1 130 ? 3.245   19.672  6.094   1.00 73.34 ? 130 PRO A HD3  1  
ATOM 1994   N N    . VAL A 1 131 ? -0.251  21.841  9.949   1.00 4.45  ? 131 VAL A N    1  
ATOM 1995   C CA   . VAL A 1 131 ? -0.783  23.023  10.644  1.00 3.32  ? 131 VAL A CA   1  
ATOM 1996   C C    . VAL A 1 131 ? -0.941  22.689  12.136  1.00 53.22 ? 131 VAL A C    1  
ATOM 1997   O O    . VAL A 1 131 ? -1.726  21.805  12.494  1.00 12.22 ? 131 VAL A O    1  
ATOM 1998   C CB   . VAL A 1 131 ? -2.165  23.468  10.028  1.00 12.01 ? 131 VAL A CB   1  
ATOM 1999   C CG1  . VAL A 1 131 ? -2.707  24.760  10.699  1.00 4.52  ? 131 VAL A CG1  1  
ATOM 2000   C CG2  . VAL A 1 131 ? -2.054  23.627  8.489   1.00 63.15 ? 131 VAL A CG2  1  
ATOM 2001   H H    . VAL A 1 131 ? -0.795  21.029  9.952   1.00 22.42 ? 131 VAL A H    1  
ATOM 2002   H HA   . VAL A 1 131 ? -0.075  23.846  10.531  1.00 64.11 ? 131 VAL A HA   1  
ATOM 2003   H HB   . VAL A 1 131 ? -2.886  22.675  10.222  1.00 13.44 ? 131 VAL A HB   1  
ATOM 2004   H HG11 . VAL A 1 131 ? -3.665  25.025  10.269  1.00 11.22 ? 131 VAL A HG11 1  
ATOM 2005   H HG12 . VAL A 1 131 ? -2.011  25.574  10.548  1.00 1.20  ? 131 VAL A HG12 1  
ATOM 2006   H HG13 . VAL A 1 131 ? -2.830  24.592  11.763  1.00 23.01 ? 131 VAL A HG13 1  
ATOM 2007   H HG21 . VAL A 1 131 ? -1.335  24.400  8.247   1.00 23.21 ? 131 VAL A HG21 1  
ATOM 2008   H HG22 . VAL A 1 131 ? -3.016  23.894  8.073   1.00 71.24 ? 131 VAL A HG22 1  
ATOM 2009   H HG23 . VAL A 1 131 ? -1.730  22.690  8.049   1.00 41.22 ? 131 VAL A HG23 1  
ATOM 2010   N N    . ASN A 1 132 ? -0.159  23.373  12.991  1.00 65.13 ? 132 ASN A N    1  
ATOM 2011   C CA   . ASN A 1 132 ? -0.218  23.209  14.455  1.00 51.41 ? 132 ASN A CA   1  
ATOM 2012   C C    . ASN A 1 132 ? -1.354  24.082  15.012  1.00 4.13  ? 132 ASN A C    1  
ATOM 2013   O O    . ASN A 1 132 ? -1.151  25.264  15.331  1.00 54.25 ? 132 ASN A O    1  
ATOM 2014   C CB   . ASN A 1 132 ? 1.147   23.576  15.110  1.00 24.23 ? 132 ASN A CB   1  
ATOM 2015   C CG   . ASN A 1 132 ? 2.284   22.645  14.673  1.00 43.44 ? 132 ASN A CG   1  
ATOM 2016   O OD1  . ASN A 1 132 ? 2.550   21.624  15.309  1.00 74.21 ? 132 ASN A OD1  1  
ATOM 2017   N ND2  . ASN A 1 132 ? 2.963   22.988  13.584  1.00 63.23 ? 132 ASN A ND2  1  
ATOM 2018   H H    . ASN A 1 132 ? 0.471   24.022  12.623  1.00 74.30 ? 132 ASN A H    1  
ATOM 2019   H HA   . ASN A 1 132 ? -0.438  22.165  14.672  1.00 1.15  ? 132 ASN A HA   1  
ATOM 2020   H HB2  . ASN A 1 132 ? 1.409   24.592  14.840  1.00 40.44 ? 132 ASN A HB2  1  
ATOM 2021   H HB3  . ASN A 1 132 ? 1.052   23.516  16.189  1.00 30.42 ? 132 ASN A HB3  1  
ATOM 2022   H HD21 . ASN A 1 132 ? 2.709   23.807  13.118  1.00 33.13 ? 132 ASN A HD21 1  
ATOM 2023   H HD22 . ASN A 1 132 ? 3.686   22.396  13.285  1.00 1.02  ? 132 ASN A HD22 1  
ATOM 2024   N N    . PHE A 1 133 ? -2.566  23.493  15.052  1.00 51.55 ? 133 PHE A N    1  
ATOM 2025   C CA   . PHE A 1 133 ? -3.784  24.165  15.550  1.00 4.33  ? 133 PHE A CA   1  
ATOM 2026   C C    . PHE A 1 133 ? -3.633  24.520  17.043  1.00 2.51  ? 133 PHE A C    1  
ATOM 2027   O O    . PHE A 1 133 ? -3.931  25.642  17.470  1.00 14.41 ? 133 PHE A O    1  
ATOM 2028   C CB   . PHE A 1 133 ? -5.040  23.259  15.356  1.00 1.21  ? 133 PHE A CB   1  
ATOM 2029   C CG   . PHE A 1 133 ? -5.239  22.732  13.929  1.00 21.31 ? 133 PHE A CG   1  
ATOM 2030   C CD1  . PHE A 1 133 ? -5.787  23.538  12.929  1.00 4.31  ? 133 PHE A CD1  1  
ATOM 2031   C CD2  . PHE A 1 133 ? -4.891  21.418  13.593  1.00 52.53 ? 133 PHE A CD2  1  
ATOM 2032   C CE1  . PHE A 1 133 ? -5.966  23.050  11.643  1.00 43.10 ? 133 PHE A CE1  1  
ATOM 2033   C CE2  . PHE A 1 133 ? -5.071  20.936  12.307  1.00 11.23 ? 133 PHE A CE2  1  
ATOM 2034   C CZ   . PHE A 1 133 ? -5.614  21.751  11.335  1.00 35.32 ? 133 PHE A CZ   1  
ATOM 2035   H H    . PHE A 1 133 ? -2.641  22.571  14.723  1.00 44.03 ? 133 PHE A H    1  
ATOM 2036   H HA   . PHE A 1 133 ? -3.916  25.079  14.980  1.00 61.15 ? 133 PHE A HA   1  
ATOM 2037   H HB2  . PHE A 1 133 ? -4.970  22.406  16.023  1.00 21.22 ? 133 PHE A HB2  1  
ATOM 2038   H HB3  . PHE A 1 133 ? -5.926  23.828  15.624  1.00 62.35 ? 133 PHE A HB3  1  
ATOM 2039   H HD1  . PHE A 1 133 ? -6.066  24.560  13.158  1.00 14.12 ? 133 PHE A HD1  1  
ATOM 2040   H HD2  . PHE A 1 133 ? -4.465  20.773  14.350  1.00 11.52 ? 133 PHE A HD2  1  
ATOM 2041   H HE1  . PHE A 1 133 ? -6.389  23.686  10.880  1.00 34.04 ? 133 PHE A HE1  1  
ATOM 2042   H HE2  . PHE A 1 133 ? -4.793  19.918  12.065  1.00 33.21 ? 133 PHE A HE2  1  
ATOM 2043   H HZ   . PHE A 1 133 ? -5.758  21.374  10.328  1.00 74.05 ? 133 PHE A HZ   1  
ATOM 2044   N N    . ASP A 1 134 ? -3.106  23.540  17.792  1.00 63.44 ? 134 ASP A N    1  
ATOM 2045   C CA   . ASP A 1 134 ? -3.036  23.541  19.265  1.00 65.23 ? 134 ASP A CA   1  
ATOM 2046   C C    . ASP A 1 134 ? -2.270  24.746  19.834  1.00 62.02 ? 134 ASP A C    1  
ATOM 2047   O O    . ASP A 1 134 ? -2.707  25.344  20.824  1.00 21.11 ? 134 ASP A O    1  
ATOM 2048   C CB   . ASP A 1 134 ? -2.417  22.200  19.765  1.00 24.10 ? 134 ASP A CB   1  
ATOM 2049   C CG   . ASP A 1 134 ? -0.957  21.959  19.307  1.00 64.41 ? 134 ASP A CG   1  
ATOM 2050   O OD1  . ASP A 1 134 ? -0.116  21.561  20.140  1.00 43.14 ? 134 ASP A OD1  1  
ATOM 2051   O OD2  . ASP A 1 134 ? -0.652  22.166  18.108  1.00 61.32 ? 134 ASP A OD2  1  
ATOM 2052   H H    . ASP A 1 134 ? -2.725  22.770  17.322  1.00 70.23 ? 134 ASP A H    1  
ATOM 2053   H HA   . ASP A 1 134 ? -4.060  23.594  19.623  1.00 10.43 ? 134 ASP A HA   1  
ATOM 2054   H HB2  . ASP A 1 134 ? -2.450  22.186  20.850  1.00 24.11 ? 134 ASP A HB2  1  
ATOM 2055   H HB3  . ASP A 1 134 ? -3.024  21.378  19.398  1.00 65.22 ? 134 ASP A HB3  1  
ATOM 2056   N N    . ALA A 1 135 ? -1.147  25.097  19.195  1.00 24.31 ? 135 ALA A N    1  
ATOM 2057   C CA   . ALA A 1 135 ? -0.298  26.232  19.613  1.00 64.31 ? 135 ALA A CA   1  
ATOM 2058   C C    . ALA A 1 135 ? -1.052  27.570  19.478  1.00 51.12 ? 135 ALA A C    1  
ATOM 2059   O O    . ALA A 1 135 ? -1.002  28.422  20.370  1.00 2.15  ? 135 ALA A O    1  
ATOM 2060   C CB   . ALA A 1 135 ? 0.992   26.244  18.784  1.00 32.51 ? 135 ALA A CB   1  
ATOM 2061   H H    . ALA A 1 135 ? -0.868  24.565  18.418  1.00 25.34 ? 135 ALA A H    1  
ATOM 2062   H HA   . ALA A 1 135 ? -0.028  26.082  20.656  1.00 2.54  ? 135 ALA A HA   1  
ATOM 2063   H HB1  . ALA A 1 135 ? 0.754   26.388  17.738  1.00 63.02 ? 135 ALA A HB1  1  
ATOM 2064   H HB2  . ALA A 1 135 ? 1.511   25.303  18.904  1.00 3.45  ? 135 ALA A HB2  1  
ATOM 2065   H HB3  . ALA A 1 135 ? 1.636   27.050  19.119  1.00 24.10 ? 135 ALA A HB3  1  
ATOM 2066   N N    . LEU A 1 136 ? -1.787  27.715  18.365  1.00 24.02 ? 136 LEU A N    1  
ATOM 2067   C CA   . LEU A 1 136 ? -2.576  28.929  18.065  1.00 61.40 ? 136 LEU A CA   1  
ATOM 2068   C C    . LEU A 1 136 ? -3.881  28.982  18.897  1.00 4.44  ? 136 LEU A C    1  
ATOM 2069   O O    . LEU A 1 136 ? -4.515  30.034  18.981  1.00 21.53 ? 136 LEU A O    1  
ATOM 2070   C CB   . LEU A 1 136 ? -2.878  28.999  16.548  1.00 73.14 ? 136 LEU A CB   1  
ATOM 2071   C CG   . LEU A 1 136 ? -1.630  29.040  15.603  1.00 62.13 ? 136 LEU A CG   1  
ATOM 2072   C CD1  . LEU A 1 136 ? -2.053  29.082  14.113  1.00 11.42 ? 136 LEU A CD1  1  
ATOM 2073   C CD2  . LEU A 1 136 ? -0.690  30.221  15.963  1.00 21.51 ? 136 LEU A CD2  1  
ATOM 2074   H H    . LEU A 1 136 ? -1.801  26.979  17.716  1.00 20.44 ? 136 LEU A H    1  
ATOM 2075   H HA   . LEU A 1 136 ? -1.969  29.797  18.333  1.00 35.33 ? 136 LEU A HA   1  
ATOM 2076   H HB2  . LEU A 1 136 ? -3.477  28.132  16.286  1.00 14.41 ? 136 LEU A HB2  1  
ATOM 2077   H HB3  . LEU A 1 136 ? -3.474  29.887  16.359  1.00 34.05 ? 136 LEU A HB3  1  
ATOM 2078   H HG   . LEU A 1 136 ? -1.065  28.126  15.743  1.00 1.35  ? 136 LEU A HG   1  
ATOM 2079   H HD11 . LEU A 1 136 ? -1.173  29.088  13.482  1.00 44.45 ? 136 LEU A HD11 1  
ATOM 2080   H HD12 . LEU A 1 136 ? -2.637  29.972  13.917  1.00 73.41 ? 136 LEU A HD12 1  
ATOM 2081   H HD13 . LEU A 1 136 ? -2.649  28.208  13.880  1.00 64.02 ? 136 LEU A HD13 1  
ATOM 2082   H HD21 . LEU A 1 136 ? -1.222  31.161  15.867  1.00 41.32 ? 136 LEU A HD21 1  
ATOM 2083   H HD22 . LEU A 1 136 ? 0.164   30.226  15.300  1.00 73.24 ? 136 LEU A HD22 1  
ATOM 2084   H HD23 . LEU A 1 136 ? -0.342  30.111  16.982  1.00 43.12 ? 136 LEU A HD23 1  
ATOM 2085   N N    . PHE A 1 137 ? -4.278  27.843  19.502  1.00 61.44 ? 137 PHE A N    1  
ATOM 2086   C CA   . PHE A 1 137 ? -5.378  27.807  20.496  1.00 74.14 ? 137 PHE A CA   1  
ATOM 2087   C C    . PHE A 1 137 ? -4.856  28.163  21.903  1.00 71.12 ? 137 PHE A C    1  
ATOM 2088   O O    . PHE A 1 137 ? -5.615  28.671  22.732  1.00 14.12 ? 137 PHE A O    1  
ATOM 2089   C CB   . PHE A 1 137 ? -6.113  26.436  20.490  1.00 73.12 ? 137 PHE A CB   1  
ATOM 2090   C CG   . PHE A 1 137 ? -7.074  26.263  19.302  1.00 63.23 ? 137 PHE A CG   1  
ATOM 2091   C CD1  . PHE A 1 137 ? -8.185  27.103  19.163  1.00 35.24 ? 137 PHE A CD1  1  
ATOM 2092   C CD2  . PHE A 1 137 ? -6.882  25.277  18.336  1.00 54.23 ? 137 PHE A CD2  1  
ATOM 2093   C CE1  . PHE A 1 137 ? -9.060  26.959  18.099  1.00 32.23 ? 137 PHE A CE1  1  
ATOM 2094   C CE2  . PHE A 1 137 ? -7.758  25.135  17.272  1.00 64.01 ? 137 PHE A CE2  1  
ATOM 2095   C CZ   . PHE A 1 137 ? -8.847  25.975  17.155  1.00 0.40  ? 137 PHE A CZ   1  
ATOM 2096   H H    . PHE A 1 137 ? -3.828  27.006  19.265  1.00 72.45 ? 137 PHE A H    1  
ATOM 2097   H HA   . PHE A 1 137 ? -6.096  28.577  20.212  1.00 2.25  ? 137 PHE A HA   1  
ATOM 2098   H HB2  . PHE A 1 137 ? -5.376  25.637  20.461  1.00 21.14 ? 137 PHE A HB2  1  
ATOM 2099   H HB3  . PHE A 1 137 ? -6.695  26.331  21.401  1.00 2.04  ? 137 PHE A HB3  1  
ATOM 2100   H HD1  . PHE A 1 137 ? -8.361  27.880  19.899  1.00 51.35 ? 137 PHE A HD1  1  
ATOM 2101   H HD2  . PHE A 1 137 ? -6.028  24.615  18.419  1.00 13.41 ? 137 PHE A HD2  1  
ATOM 2102   H HE1  . PHE A 1 137 ? -9.914  27.617  18.007  1.00 51.40 ? 137 PHE A HE1  1  
ATOM 2103   H HE2  . PHE A 1 137 ? -7.588  24.361  16.532  1.00 13.32 ? 137 PHE A HE2  1  
ATOM 2104   H HZ   . PHE A 1 137 ? -9.533  25.861  16.326  1.00 52.10 ? 137 PHE A HZ   1  
ATOM 2105   N N    . MET A 1 138 ? -3.549  27.907  22.159  1.00 64.14 ? 138 MET A N    1  
ATOM 2106   C CA   . MET A 1 138 ? -2.863  28.389  23.391  1.00 31.24 ? 138 MET A CA   1  
ATOM 2107   C C    . MET A 1 138 ? -2.694  29.913  23.336  1.00 10.21 ? 138 MET A C    1  
ATOM 2108   O O    . MET A 1 138 ? -2.670  30.580  24.372  1.00 32.33 ? 138 MET A O    1  
ATOM 2109   C CB   . MET A 1 138 ? -1.473  27.720  23.589  1.00 41.34 ? 138 MET A CB   1  
ATOM 2110   C CG   . MET A 1 138 ? -1.531  26.214  23.849  1.00 42.23 ? 138 MET A CG   1  
ATOM 2111   S SD   . MET A 1 138 ? -2.482  25.784  25.326  1.00 31.11 ? 138 MET A SD   1  
ATOM 2112   C CE   . MET A 1 138 ? -1.460  26.454  26.642  1.00 53.23 ? 138 MET A CE   1  
ATOM 2113   H H    . MET A 1 138 ? -3.035  27.385  21.507  1.00 14.22 ? 138 MET A H    1  
ATOM 2114   H HA   . MET A 1 138 ? -3.498  28.143  24.240  1.00 73.22 ? 138 MET A HA   1  
ATOM 2115   H HB2  . MET A 1 138 ? -0.871  27.889  22.702  1.00 64.52 ? 138 MET A HB2  1  
ATOM 2116   H HB3  . MET A 1 138 ? -0.977  28.185  24.436  1.00 64.30 ? 138 MET A HB3  1  
ATOM 2117   H HG2  . MET A 1 138 ? -1.991  25.729  22.998  1.00 20.41 ? 138 MET A HG2  1  
ATOM 2118   H HG3  . MET A 1 138 ? -0.522  25.836  23.966  1.00 63.44 ? 138 MET A HG3  1  
ATOM 2119   H HE1  . MET A 1 138 ? -1.289  27.507  26.471  1.00 62.24 ? 138 MET A HE1  1  
ATOM 2120   H HE2  . MET A 1 138 ? -0.518  25.933  26.668  1.00 2.24  ? 138 MET A HE2  1  
ATOM 2121   H HE3  . MET A 1 138 ? -1.966  26.324  27.588  1.00 41.30 ? 138 MET A HE3  1  
ATOM 2122   N N    . ASN A 1 139 ? -2.592  30.433  22.096  1.00 2.52  ? 139 ASN A N    1  
ATOM 2123   C CA   . ASN A 1 139 ? -2.489  31.877  21.791  1.00 45.41 ? 139 ASN A CA   1  
ATOM 2124   C C    . ASN A 1 139 ? -3.724  32.637  22.333  1.00 3.14  ? 139 ASN A C    1  
ATOM 2125   O O    . ASN A 1 139 ? -3.622  33.782  22.780  1.00 25.10 ? 139 ASN A O    1  
ATOM 2126   C CB   . ASN A 1 139 ? -2.349  32.049  20.249  1.00 75.34 ? 139 ASN A CB   1  
ATOM 2127   C CG   . ASN A 1 139 ? -1.846  33.420  19.779  1.00 40.11 ? 139 ASN A CG   1  
ATOM 2128   O OD1  . ASN A 1 139 ? -2.080  34.452  20.403  1.00 45.23 ? 139 ASN A OD1  1  
ATOM 2129   N ND2  . ASN A 1 139 ? -1.155  33.431  18.650  1.00 65.23 ? 139 ASN A ND2  1  
ATOM 2130   H H    . ASN A 1 139 ? -2.569  29.805  21.344  1.00 75.12 ? 139 ASN A H    1  
ATOM 2131   H HA   . ASN A 1 139 ? -1.596  32.255  22.277  1.00 34.24 ? 139 ASN A HA   1  
ATOM 2132   H HB2  . ASN A 1 139 ? -1.654  31.301  19.884  1.00 43.44 ? 139 ASN A HB2  1  
ATOM 2133   H HB3  . ASN A 1 139 ? -3.312  31.867  19.784  1.00 62.43 ? 139 ASN A HB3  1  
ATOM 2134   H HD21 . ASN A 1 139 ? -1.000  32.579  18.193  1.00 74.33 ? 139 ASN A HD21 1  
ATOM 2135   H HD22 . ASN A 1 139 ? -0.821  34.288  18.322  1.00 4.32  ? 139 ASN A HD22 1  
ATOM 2136   N N    . TYR A 1 140 ? -4.884  31.971  22.292  1.00 54.01 ? 140 TYR A N    1  
ATOM 2137   C CA   . TYR A 1 140 ? -6.157  32.514  22.808  1.00 43.22 ? 140 TYR A CA   1  
ATOM 2138   C C    . TYR A 1 140 ? -6.423  32.073  24.255  1.00 1.03  ? 140 TYR A C    1  
ATOM 2139   O O    . TYR A 1 140 ? -7.101  32.791  24.998  1.00 43.41 ? 140 TYR A O    1  
ATOM 2140   C CB   . TYR A 1 140 ? -7.323  32.124  21.866  1.00 74.40 ? 140 TYR A CB   1  
ATOM 2141   C CG   . TYR A 1 140 ? -7.290  32.906  20.541  1.00 52.04 ? 140 TYR A CG   1  
ATOM 2142   C CD1  . TYR A 1 140 ? -6.482  32.499  19.475  1.00 10.23 ? 140 TYR A CD1  1  
ATOM 2143   C CD2  . TYR A 1 140 ? -8.045  34.074  20.374  1.00 41.21 ? 140 TYR A CD2  1  
ATOM 2144   C CE1  . TYR A 1 140 ? -6.431  33.221  18.299  1.00 42.31 ? 140 TYR A CE1  1  
ATOM 2145   C CE2  . TYR A 1 140 ? -7.998  34.791  19.197  1.00 11.43 ? 140 TYR A CE2  1  
ATOM 2146   C CZ   . TYR A 1 140 ? -7.190  34.363  18.166  1.00 15.51 ? 140 TYR A CZ   1  
ATOM 2147   O OH   . TYR A 1 140 ? -7.141  35.085  16.994  1.00 74.22 ? 140 TYR A OH   1  
ATOM 2148   H H    . TYR A 1 140 ? -4.890  31.075  21.895  1.00 20.34 ? 140 TYR A H    1  
ATOM 2149   H HA   . TYR A 1 140 ? -6.072  33.600  22.811  1.00 40.30 ? 140 TYR A HA   1  
ATOM 2150   H HB2  . TYR A 1 140 ? -7.267  31.064  21.641  1.00 75.10 ? 140 TYR A HB2  1  
ATOM 2151   H HB3  . TYR A 1 140 ? -8.270  32.328  22.356  1.00 43.30 ? 140 TYR A HB3  1  
ATOM 2152   H HD1  . TYR A 1 140 ? -5.887  31.602  19.578  1.00 61.33 ? 140 TYR A HD1  1  
ATOM 2153   H HD2  . TYR A 1 140 ? -8.678  34.415  21.185  1.00 43.33 ? 140 TYR A HD2  1  
ATOM 2154   H HE1  . TYR A 1 140 ? -5.797  32.890  17.488  1.00 1.11  ? 140 TYR A HE1  1  
ATOM 2155   H HE2  . TYR A 1 140 ? -8.591  35.691  19.089  1.00 21.44 ? 140 TYR A HE2  1  
ATOM 2156   H HH   . TYR A 1 140 ? -7.164  36.029  17.202  1.00 33.34 ? 140 TYR A HH   1  
ATOM 2157   N N    . LEU A 1 141 ? -5.910  30.887  24.645  1.00 31.03 ? 141 LEU A N    1  
ATOM 2158   C CA   . LEU A 1 141 ? -6.093  30.356  26.012  1.00 74.00 ? 141 LEU A CA   1  
ATOM 2159   C C    . LEU A 1 141 ? -5.416  31.275  27.048  1.00 63.51 ? 141 LEU A C    1  
ATOM 2160   O O    . LEU A 1 141 ? -6.041  31.671  28.036  1.00 25.33 ? 141 LEU A O    1  
ATOM 2161   C CB   . LEU A 1 141 ? -5.524  28.912  26.141  1.00 42.03 ? 141 LEU A CB   1  
ATOM 2162   C CG   . LEU A 1 141 ? -5.788  28.198  27.515  1.00 63.14 ? 141 LEU A CG   1  
ATOM 2163   C CD1  . LEU A 1 141 ? -7.295  27.927  27.733  1.00 13.23 ? 141 LEU A CD1  1  
ATOM 2164   C CD2  . LEU A 1 141 ? -4.947  26.906  27.661  1.00 23.45 ? 141 LEU A CD2  1  
ATOM 2165   H H    . LEU A 1 141 ? -5.405  30.357  23.995  1.00 31.43 ? 141 LEU A H    1  
ATOM 2166   H HA   . LEU A 1 141 ? -7.160  30.329  26.210  1.00 22.33 ? 141 LEU A HA   1  
ATOM 2167   H HB2  . LEU A 1 141 ? -5.956  28.306  25.349  1.00 12.42 ? 141 LEU A HB2  1  
ATOM 2168   H HB3  . LEU A 1 141 ? -4.451  28.956  25.978  1.00 3.23  ? 141 LEU A HB3  1  
ATOM 2169   H HG   . LEU A 1 141 ? -5.479  28.869  28.309  1.00 72.31 ? 141 LEU A HG   1  
ATOM 2170   H HD11 . LEU A 1 141 ? -7.675  27.284  26.948  1.00 2.44  ? 141 LEU A HD11 1  
ATOM 2171   H HD12 . LEU A 1 141 ? -7.838  28.863  27.719  1.00 51.31 ? 141 LEU A HD12 1  
ATOM 2172   H HD13 . LEU A 1 141 ? -7.446  27.450  28.692  1.00 13.42 ? 141 LEU A HD13 1  
ATOM 2173   H HD21 . LEU A 1 141 ? -3.900  27.169  27.719  1.00 64.50 ? 141 LEU A HD21 1  
ATOM 2174   H HD22 . LEU A 1 141 ? -5.101  26.260  26.807  1.00 44.52 ? 141 LEU A HD22 1  
ATOM 2175   H HD23 . LEU A 1 141 ? -5.230  26.382  28.565  1.00 4.40  ? 141 LEU A HD23 1  
ATOM 2176   N N    . GLN A 1 142 ? -4.142  31.625  26.781  1.00 73.15 ? 142 GLN A N    1  
ATOM 2177   C CA   . GLN A 1 142 ? -3.317  32.457  27.684  1.00 72.21 ? 142 GLN A CA   1  
ATOM 2178   C C    . GLN A 1 142 ? -2.073  33.003  26.960  1.00 2.12  ? 142 GLN A C    1  
ATOM 2179   O O    . GLN A 1 142 ? -1.059  33.301  27.604  1.00 1.44  ? 142 GLN A O    1  
ATOM 2180   C CB   . GLN A 1 142 ? -2.912  31.636  28.947  1.00 1.34  ? 142 GLN A CB   1  
ATOM 2181   C CG   . GLN A 1 142 ? -2.167  30.308  28.666  1.00 73.31 ? 142 GLN A CG   1  
ATOM 2182   C CD   . GLN A 1 142 ? -1.837  29.514  29.939  1.00 62.04 ? 142 GLN A CD   1  
ATOM 2183   O OE1  . GLN A 1 142 ? -1.632  30.081  31.011  1.00 42.45 ? 142 GLN A OE1  1  
ATOM 2184   N NE2  . GLN A 1 142 ? -1.773  28.195  29.831  1.00 32.53 ? 142 GLN A NE2  1  
ATOM 2185   H H    . GLN A 1 142 ? -3.737  31.305  25.950  1.00 72.04 ? 142 GLN A H    1  
ATOM 2186   H HA   . GLN A 1 142 ? -3.916  33.307  27.996  1.00 72.30 ? 142 GLN A HA   1  
ATOM 2187   H HB2  . GLN A 1 142 ? -2.276  32.255  29.571  1.00 12.14 ? 142 GLN A HB2  1  
ATOM 2188   H HB3  . GLN A 1 142 ? -3.813  31.406  29.506  1.00 11.40 ? 142 GLN A HB3  1  
ATOM 2189   H HG2  . GLN A 1 142 ? -2.786  29.692  28.023  1.00 4.30  ? 142 GLN A HG2  1  
ATOM 2190   H HG3  . GLN A 1 142 ? -1.239  30.531  28.152  1.00 43.24 ? 142 GLN A HG3  1  
ATOM 2191   H HE21 . GLN A 1 142 ? -1.937  27.792  28.956  1.00 50.13 ? 142 GLN A HE21 1  
ATOM 2192   H HE22 . GLN A 1 142 ? -1.573  27.673  30.639  1.00 2.31  ? 142 GLN A HE22 1  
ATOM 2193   N N    . GLN A 1 143 ? -2.185  33.160  25.617  1.00 13.41 ? 143 GLN A N    1  
ATOM 2194   C CA   . GLN A 1 143 ? -1.105  33.666  24.728  1.00 73.43 ? 143 GLN A CA   1  
ATOM 2195   C C    . GLN A 1 143 ? 0.082   32.681  24.620  1.00 61.44 ? 143 GLN A C    1  
ATOM 2196   O O    . GLN A 1 143 ? 0.200   31.741  25.406  1.00 34.32 ? 143 GLN A O    1  
ATOM 2197   C CB   . GLN A 1 143 ? -0.627  35.083  25.146  1.00 20.12 ? 143 GLN A CB   1  
ATOM 2198   C CG   . GLN A 1 143 ? -1.735  36.157  25.161  1.00 4.01  ? 143 GLN A CG   1  
ATOM 2199   C CD   . GLN A 1 143 ? -1.215  37.551  25.533  1.00 5.34  ? 143 GLN A CD   1  
ATOM 2200   O OE1  . GLN A 1 143 ? -0.243  37.693  26.277  1.00 63.33 ? 143 GLN A OE1  1  
ATOM 2201   N NE2  . GLN A 1 143 ? -1.858  38.588  25.030  1.00 14.34 ? 143 GLN A NE2  1  
ATOM 2202   H H    . GLN A 1 143 ? -3.040  32.928  25.199  1.00 42.32 ? 143 GLN A H    1  
ATOM 2203   H HA   . GLN A 1 143 ? -1.546  33.743  23.739  1.00 3.13  ? 143 GLN A HA   1  
ATOM 2204   H HB2  . GLN A 1 143 ? -0.200  35.022  26.144  1.00 53.43 ? 143 GLN A HB2  1  
ATOM 2205   H HB3  . GLN A 1 143 ? 0.150   35.406  24.462  1.00 14.23 ? 143 GLN A HB3  1  
ATOM 2206   H HG2  . GLN A 1 143 ? -2.189  36.204  24.178  1.00 4.05  ? 143 GLN A HG2  1  
ATOM 2207   H HG3  . GLN A 1 143 ? -2.490  35.872  25.885  1.00 52.54 ? 143 GLN A HG3  1  
ATOM 2208   H HE21 . GLN A 1 143 ? -2.628  38.422  24.447  1.00 5.23  ? 143 GLN A HE21 1  
ATOM 2209   H HE22 . GLN A 1 143 ? -1.534  39.484  25.257  1.00 21.42 ? 143 GLN A HE22 1  
ATOM 2210   N N    . GLN A 1 144 ? 0.940   32.895  23.609  1.00 5.34  ? 144 GLN A N    1  
ATOM 2211   C CA   . GLN A 1 144 ? 2.138   32.067  23.370  1.00 2.23  ? 144 GLN A CA   1  
ATOM 2212   C C    . GLN A 1 144 ? 3.393   32.778  23.912  1.00 32.34 ? 144 GLN A C    1  
ATOM 2213   O O    . GLN A 1 144 ? 3.894   33.725  23.298  1.00 31.20 ? 144 GLN A O    1  
ATOM 2214   C CB   . GLN A 1 144 ? 2.287   31.754  21.855  1.00 33.35 ? 144 GLN A CB   1  
ATOM 2215   C CG   . GLN A 1 144 ? 1.188   30.837  21.287  1.00 53.14 ? 144 GLN A CG   1  
ATOM 2216   C CD   . GLN A 1 144 ? 1.346   30.570  19.786  1.00 32.34 ? 144 GLN A CD   1  
ATOM 2217   O OE1  . GLN A 1 144 ? 0.804   31.293  18.951  1.00 1.34  ? 144 GLN A OE1  1  
ATOM 2218   N NE2  . GLN A 1 144 ? 2.089   29.532  19.429  1.00 43.21 ? 144 GLN A NE2  1  
ATOM 2219   H H    . GLN A 1 144 ? 0.770   33.646  23.000  1.00 55.11 ? 144 GLN A H    1  
ATOM 2220   H HA   . GLN A 1 144 ? 2.017   31.122  23.905  1.00 65.20 ? 144 GLN A HA   1  
ATOM 2221   H HB2  . GLN A 1 144 ? 2.274   32.687  21.303  1.00 43.34 ? 144 GLN A HB2  1  
ATOM 2222   H HB3  . GLN A 1 144 ? 3.247   31.270  21.690  1.00 61.31 ? 144 GLN A HB3  1  
ATOM 2223   H HG2  . GLN A 1 144 ? 1.214   29.890  21.816  1.00 64.42 ? 144 GLN A HG2  1  
ATOM 2224   H HG3  . GLN A 1 144 ? 0.224   31.301  21.455  1.00 44.11 ? 144 GLN A HG3  1  
ATOM 2225   H HE21 . GLN A 1 144 ? 2.500   28.991  20.138  1.00 64.00 ? 144 GLN A HE21 1  
ATOM 2226   H HE22 . GLN A 1 144 ? 2.197   29.349  18.475  1.00 64.02 ? 144 GLN A HE22 1  
ATOM 2227   N N    . ALA A 1 145 ? 3.859   32.341  25.093  1.00 75.41 ? 145 ALA A N    1  
ATOM 2228   C CA   . ALA A 1 145 ? 5.120   32.799  25.707  1.00 24.22 ? 145 ALA A CA   1  
ATOM 2229   C C    . ALA A 1 145 ? 5.967   31.582  26.107  1.00 2.40  ? 145 ALA A C    1  
ATOM 2230   O O    . ALA A 1 145 ? 5.481   30.446  26.086  1.00 22.04 ? 145 ALA A O    1  
ATOM 2231   C CB   . ALA A 1 145 ? 4.836   33.697  26.927  1.00 1.11  ? 145 ALA A CB   1  
ATOM 2232   H H    . ALA A 1 145 ? 3.330   31.680  25.579  1.00 33.20 ? 145 ALA A H    1  
ATOM 2233   H HA   . ALA A 1 145 ? 5.678   33.382  24.974  1.00 51.24 ? 145 ALA A HA   1  
ATOM 2234   H HB1  . ALA A 1 145 ? 5.769   34.045  27.354  1.00 3.32  ? 145 ALA A HB1  1  
ATOM 2235   H HB2  . ALA A 1 145 ? 4.289   33.137  27.676  1.00 62.12 ? 145 ALA A HB2  1  
ATOM 2236   H HB3  . ALA A 1 145 ? 4.244   34.551  26.623  1.00 70.21 ? 145 ALA A HB3  1  
ATOM 2237   N N    . GLY A 1 146 ? 7.227   31.834  26.483  1.00 13.24 ? 146 GLY A N    1  
ATOM 2238   C CA   . GLY A 1 146 ? 8.161   30.771  26.856  1.00 42.15 ? 146 GLY A CA   1  
ATOM 2239   C C    . GLY A 1 146 ? 9.113   30.451  25.714  1.00 70.03 ? 146 GLY A C    1  
ATOM 2240   O O    . GLY A 1 146 ? 9.129   29.325  25.199  1.00 53.13 ? 146 GLY A O    1  
ATOM 2241   H H    . GLY A 1 146 ? 7.536   32.763  26.494  1.00 23.32 ? 146 GLY A H    1  
ATOM 2242   H HA2  . GLY A 1 146 ? 8.736   31.103  27.711  1.00 52.31 ? 146 GLY A HA2  1  
ATOM 2243   H HA3  . GLY A 1 146 ? 7.617   29.872  27.137  1.00 34.01 ? 146 GLY A HA3  1  
ATOM 2244   N N    . GLU A 1 147 ? 9.894   31.471  25.308  1.00 32.34 ? 147 GLU A N    1  
ATOM 2245   C CA   . GLU A 1 147 ? 10.894  31.345  24.246  1.00 2.43  ? 147 GLU A CA   1  
ATOM 2246   C C    . GLU A 1 147 ? 12.125  30.596  24.795  1.00 73.25 ? 147 GLU A C    1  
ATOM 2247   O O    . GLU A 1 147 ? 12.928  31.163  25.551  1.00 2.41  ? 147 GLU A O    1  
ATOM 2248   C CB   . GLU A 1 147 ? 11.298  32.746  23.698  1.00 45.25 ? 147 GLU A CB   1  
ATOM 2249   C CG   . GLU A 1 147 ? 12.391  32.709  22.603  1.00 34.23 ? 147 GLU A CG   1  
ATOM 2250   C CD   . GLU A 1 147 ? 12.873  34.101  22.169  1.00 12.24 ? 147 GLU A CD   1  
ATOM 2251   O OE1  . GLU A 1 147 ? 13.601  34.750  22.945  1.00 31.44 ? 147 GLU A OE1  1  
ATOM 2252   O OE2  . GLU A 1 147 ? 12.539  34.548  21.054  1.00 61.51 ? 147 GLU A OE2  1  
ATOM 2253   H H    . GLU A 1 147 ? 9.806   32.336  25.759  1.00 44.12 ? 147 GLU A H    1  
ATOM 2254   H HA   . GLU A 1 147 ? 10.453  30.768  23.433  1.00 2.02  ? 147 GLU A HA   1  
ATOM 2255   H HB2  . GLU A 1 147 ? 10.416  33.224  23.281  1.00 13.24 ? 147 GLU A HB2  1  
ATOM 2256   H HB3  . GLU A 1 147 ? 11.659  33.353  24.522  1.00 32.33 ? 147 GLU A HB3  1  
ATOM 2257   H HG2  . GLU A 1 147 ? 13.242  32.155  22.984  1.00 70.11 ? 147 GLU A HG2  1  
ATOM 2258   H HG3  . GLU A 1 147 ? 11.997  32.181  21.739  1.00 71.34 ? 147 GLU A HG3  1  
ATOM 2259   N N    . GLY A 1 148 ? 12.207  29.300  24.473  1.00 60.20 ? 148 GLY A N    1  
ATOM 2260   C CA   . GLY A 1 148 ? 13.378  28.488  24.772  1.00 53.44 ? 148 GLY A CA   1  
ATOM 2261   C C    . GLY A 1 148 ? 14.376  28.531  23.625  1.00 21.52 ? 148 GLY A C    1  
ATOM 2262   O O    . GLY A 1 148 ? 13.970  28.633  22.460  1.00 14.40 ? 148 GLY A O    1  
ATOM 2263   H H    . GLY A 1 148 ? 11.447  28.886  24.013  1.00 32.42 ? 148 GLY A H    1  
ATOM 2264   H HA2  . GLY A 1 148 ? 13.854  28.836  25.687  1.00 74.00 ? 148 GLY A HA2  1  
ATOM 2265   H HA3  . GLY A 1 148 ? 13.061  27.466  24.915  1.00 61.12 ? 148 GLY A HA3  1  
ATOM 2266   N N    . THR A 1 149 ? 15.672  28.476  23.955  1.00 13.40 ? 149 THR A N    1  
ATOM 2267   C CA   . THR A 1 149 ? 16.771  28.383  22.975  1.00 22.41 ? 149 THR A CA   1  
ATOM 2268   C C    . THR A 1 149 ? 17.952  27.647  23.628  1.00 55.33 ? 149 THR A C    1  
ATOM 2269   O O    . THR A 1 149 ? 19.001  28.239  23.931  1.00 4.15  ? 149 THR A O    1  
ATOM 2270   C CB   . THR A 1 149 ? 17.215  29.798  22.418  1.00 72.21 ? 149 THR A CB   1  
ATOM 2271   O OG1  . THR A 1 149 ? 17.191  30.766  23.482  1.00 61.55 ? 149 THR A OG1  1  
ATOM 2272   C CG2  . THR A 1 149 ? 16.342  30.290  21.241  1.00 74.32 ? 149 THR A CG2  1  
ATOM 2273   H H    . THR A 1 149 ? 15.906  28.497  24.906  1.00 62.23 ? 149 THR A H    1  
ATOM 2274   H HA   . THR A 1 149 ? 16.429  27.773  22.139  1.00 15.33 ? 149 THR A HA   1  
ATOM 2275   H HB   . THR A 1 149 ? 18.241  29.720  22.064  1.00 63.31 ? 149 THR A HB   1  
ATOM 2276   H HG1  . THR A 1 149 ? 16.665  31.526  23.213  1.00 42.34 ? 149 THR A HG1  1  
ATOM 2277   H HG21 . THR A 1 149 ? 16.697  31.256  20.906  1.00 11.53 ? 149 THR A HG21 1  
ATOM 2278   H HG22 . THR A 1 149 ? 15.313  30.381  21.561  1.00 30.25 ? 149 THR A HG22 1  
ATOM 2279   H HG23 . THR A 1 149 ? 16.400  29.584  20.421  1.00 72.14 ? 149 THR A HG23 1  
ATOM 2280   N N    . GLU A 1 150 ? 17.738  26.349  23.911  1.00 23.43 ? 150 GLU A N    1  
ATOM 2281   C CA   . GLU A 1 150 ? 18.786  25.453  24.418  1.00 12.03 ? 150 GLU A CA   1  
ATOM 2282   C C    . GLU A 1 150 ? 19.671  25.042  23.233  1.00 30.24 ? 150 GLU A C    1  
ATOM 2283   O O    . GLU A 1 150 ? 19.397  24.053  22.550  1.00 43.51 ? 150 GLU A O    1  
ATOM 2284   C CB   . GLU A 1 150 ? 18.158  24.227  25.140  1.00 33.23 ? 150 GLU A CB   1  
ATOM 2285   C CG   . GLU A 1 150 ? 17.186  24.607  26.277  1.00 73.11 ? 150 GLU A CG   1  
ATOM 2286   C CD   . GLU A 1 150 ? 16.646  23.405  27.071  1.00 62.30 ? 150 GLU A CD   1  
ATOM 2287   O OE1  . GLU A 1 150 ? 15.616  22.821  26.670  1.00 60.43 ? 150 GLU A OE1  1  
ATOM 2288   O OE2  . GLU A 1 150 ? 17.249  23.050  28.108  1.00 21.52 ? 150 GLU A OE2  1  
ATOM 2289   H H    . GLU A 1 150 ? 16.840  25.981  23.769  1.00 10.23 ? 150 GLU A H    1  
ATOM 2290   H HA   . GLU A 1 150 ? 19.393  26.008  25.133  1.00 14.02 ? 150 GLU A HA   1  
ATOM 2291   H HB2  . GLU A 1 150 ? 17.617  23.629  24.414  1.00 74.24 ? 150 GLU A HB2  1  
ATOM 2292   H HB3  . GLU A 1 150 ? 18.954  23.623  25.561  1.00 54.43 ? 150 GLU A HB3  1  
ATOM 2293   H HG2  . GLU A 1 150 ? 17.700  25.274  26.963  1.00 22.43 ? 150 GLU A HG2  1  
ATOM 2294   H HG3  . GLU A 1 150 ? 16.347  25.143  25.845  1.00 42.20 ? 150 GLU A HG3  1  
ATOM 2295   N N    . GLU A 1 151 ? 20.687  25.875  22.961  1.00 23.41 ? 151 GLU A N    1  
ATOM 2296   C CA   . GLU A 1 151 ? 21.535  25.783  21.761  1.00 42.23 ? 151 GLU A CA   1  
ATOM 2297   C C    . GLU A 1 151 ? 22.791  24.923  22.031  1.00 43.15 ? 151 GLU A C    1  
ATOM 2298   O O    . GLU A 1 151 ? 23.208  24.755  23.181  1.00 1.13  ? 151 GLU A O    1  
ATOM 2299   C CB   . GLU A 1 151 ? 21.921  27.220  21.312  1.00 31.12 ? 151 GLU A CB   1  
ATOM 2300   C CG   . GLU A 1 151 ? 22.653  27.311  19.956  1.00 23.13 ? 151 GLU A CG   1  
ATOM 2301   C CD   . GLU A 1 151 ? 22.962  28.755  19.546  1.00 33.21 ? 151 GLU A CD   1  
ATOM 2302   O OE1  . GLU A 1 151 ? 22.103  29.399  18.912  1.00 73.34 ? 151 GLU A OE1  1  
ATOM 2303   O OE2  . GLU A 1 151 ? 24.050  29.263  19.878  1.00 70.25 ? 151 GLU A OE2  1  
ATOM 2304   H H    . GLU A 1 151 ? 20.881  26.589  23.606  1.00 53.00 ? 151 GLU A H    1  
ATOM 2305   H HA   . GLU A 1 151 ? 20.954  25.315  20.969  1.00 64.24 ? 151 GLU A HA   1  
ATOM 2306   H HB2  . GLU A 1 151 ? 21.013  27.811  21.240  1.00 65.42 ? 151 GLU A HB2  1  
ATOM 2307   H HB3  . GLU A 1 151 ? 22.556  27.667  22.072  1.00 73.02 ? 151 GLU A HB3  1  
ATOM 2308   H HG2  . GLU A 1 151 ? 23.585  26.755  20.024  1.00 15.14 ? 151 GLU A HG2  1  
ATOM 2309   H HG3  . GLU A 1 151 ? 22.032  26.852  19.193  1.00 43.01 ? 151 GLU A HG3  1  
ATOM 2310   N N    . HIS A 1 152 ? 23.377  24.390  20.949  1.00 53.35 ? 152 HIS A N    1  
ATOM 2311   C CA   . HIS A 1 152 ? 24.546  23.508  20.994  1.00 65.31 ? 152 HIS A CA   1  
ATOM 2312   C C    . HIS A 1 152 ? 25.396  23.760  19.736  1.00 70.33 ? 152 HIS A C    1  
ATOM 2313   O O    . HIS A 1 152 ? 25.149  23.156  18.681  1.00 42.45 ? 152 HIS A O    1  
ATOM 2314   C CB   . HIS A 1 152 ? 24.069  22.034  21.089  1.00 2.40  ? 152 HIS A CB   1  
ATOM 2315   C CG   . HIS A 1 152 ? 25.161  20.990  21.125  1.00 53.52 ? 152 HIS A CG   1  
ATOM 2316   N ND1  . HIS A 1 152 ? 25.669  20.388  19.993  1.00 22.02 ? 152 HIS A ND1  1  
ATOM 2317   C CD2  . HIS A 1 152 ? 25.785  20.395  22.162  1.00 53.41 ? 152 HIS A CD2  1  
ATOM 2318   C CE1  . HIS A 1 152 ? 26.541  19.468  20.341  1.00 3.31  ? 152 HIS A CE1  1  
ATOM 2319   N NE2  . HIS A 1 152 ? 26.632  19.455  21.648  1.00 32.04 ? 152 HIS A NE2  1  
ATOM 2320   H H    . HIS A 1 152 ? 23.002  24.604  20.071  1.00 74.30 ? 152 HIS A H    1  
ATOM 2321   H HA   . HIS A 1 152 ? 25.139  23.753  21.875  1.00 33.34 ? 152 HIS A HA   1  
ATOM 2322   H HB2  . HIS A 1 152 ? 23.477  21.914  21.990  1.00 53.11 ? 152 HIS A HB2  1  
ATOM 2323   H HB3  . HIS A 1 152 ? 23.433  21.815  20.237  1.00 61.12 ? 152 HIS A HB3  1  
ATOM 2324   H HD1  . HIS A 1 152 ? 25.436  20.622  19.067  1.00 62.22 ? 152 HIS A HD1  1  
ATOM 2325   H HD2  . HIS A 1 152 ? 25.642  20.622  23.211  1.00 34.42 ? 152 HIS A HD2  1  
ATOM 2326   H HE1  . HIS A 1 152 ? 27.088  18.827  19.665  1.00 74.43 ? 152 HIS A HE1  1  
ATOM 2327   H HE2  . HIS A 1 152 ? 27.308  18.959  22.158  1.00 37.61 ? 152 HIS A HE2  1  
ATOM 2328   N N    . GLN A 1 153 ? 26.352  24.707  19.837  1.00 0.31  ? 153 GLN A N    1  
ATOM 2329   C CA   . GLN A 1 153 ? 27.247  25.066  18.719  1.00 45.23 ? 153 GLN A CA   1  
ATOM 2330   C C    . GLN A 1 153 ? 28.300  23.958  18.563  1.00 1.25  ? 153 GLN A C    1  
ATOM 2331   O O    . GLN A 1 153 ? 29.245  23.874  19.362  1.00 12.44 ? 153 GLN A O    1  
ATOM 2332   C CB   . GLN A 1 153 ? 27.910  26.469  18.949  1.00 33.21 ? 153 GLN A CB   1  
ATOM 2333   C CG   . GLN A 1 153 ? 28.531  27.133  17.683  1.00 41.24 ? 153 GLN A CG   1  
ATOM 2334   C CD   . GLN A 1 153 ? 29.875  26.548  17.209  1.00 22.01 ? 153 GLN A CD   1  
ATOM 2335   O OE1  . GLN A 1 153 ? 30.689  26.082  18.005  1.00 63.11 ? 153 GLN A OE1  1  
ATOM 2336   N NE2  . GLN A 1 153 ? 30.112  26.562  15.906  1.00 34.21 ? 153 GLN A NE2  1  
ATOM 2337   H H    . GLN A 1 153 ? 26.461  25.177  20.692  1.00 52.44 ? 153 GLN A H    1  
ATOM 2338   H HA   . GLN A 1 153 ? 26.645  25.115  17.813  1.00 5.23  ? 153 GLN A HA   1  
ATOM 2339   H HB2  . GLN A 1 153 ? 27.150  27.140  19.338  1.00 13.13 ? 153 GLN A HB2  1  
ATOM 2340   H HB3  . GLN A 1 153 ? 28.686  26.372  19.701  1.00 30.54 ? 153 GLN A HB3  1  
ATOM 2341   H HG2  . GLN A 1 153 ? 27.822  27.051  16.872  1.00 24.15 ? 153 GLN A HG2  1  
ATOM 2342   H HG3  . GLN A 1 153 ? 28.686  28.189  17.891  1.00 23.53 ? 153 GLN A HG3  1  
ATOM 2343   H HE21 . GLN A 1 153 ? 29.435  26.950  15.313  1.00 74.14 ? 153 GLN A HE21 1  
ATOM 2344   H HE22 . GLN A 1 153 ? 30.959  26.188  15.589  1.00 63.41 ? 153 GLN A HE22 1  
ATOM 2345   N N    . ASP A 1 154 ? 28.083  23.094  17.559  1.00 21.41 ? 154 ASP A N    1  
ATOM 2346   C CA   . ASP A 1 154 ? 28.960  21.959  17.236  1.00 30.41 ? 154 ASP A CA   1  
ATOM 2347   C C    . ASP A 1 154 ? 28.460  21.289  15.948  1.00 34.11 ? 154 ASP A C    1  
ATOM 2348   O O    . ASP A 1 154 ? 27.267  21.371  15.622  1.00 3.54  ? 154 ASP A O    1  
ATOM 2349   C CB   . ASP A 1 154 ? 28.988  20.929  18.405  1.00 74.10 ? 154 ASP A CB   1  
ATOM 2350   C CG   . ASP A 1 154 ? 30.023  19.800  18.234  1.00 22.53 ? 154 ASP A CG   1  
ATOM 2351   O OD1  . ASP A 1 154 ? 29.639  18.638  18.029  1.00 12.23 ? 154 ASP A OD1  1  
ATOM 2352   O OD2  . ASP A 1 154 ? 31.235  20.079  18.319  1.00 35.41 ? 154 ASP A OD2  1  
ATOM 2353   H H    . ASP A 1 154 ? 27.282  23.227  17.002  1.00 74.01 ? 154 ASP A H    1  
ATOM 2354   H HA   . ASP A 1 154 ? 29.959  22.346  17.070  1.00 43.44 ? 154 ASP A HA   1  
ATOM 2355   H HB2  . ASP A 1 154 ? 29.217  21.457  19.324  1.00 31.52 ? 154 ASP A HB2  1  
ATOM 2356   H HB3  . ASP A 1 154 ? 28.000  20.490  18.506  1.00 52.01 ? 154 ASP A HB3  1  
ATOM 2357   N N    . ALA A 1 155 ? 29.376  20.634  15.229  1.00 74.14 ? 155 ALA A N    1  
ATOM 2358   C CA   . ALA A 1 155 ? 29.076  19.885  14.004  1.00 34.02 ? 155 ALA A CA   1  
ATOM 2359   C C    . ALA A 1 155 ? 29.794  18.514  14.073  1.00 64.22 ? 155 ALA A C    1  
ATOM 2360   O O    . ALA A 1 155 ? 31.009  18.450  13.789  1.00 74.54 ? 155 ALA A O    1  
ATOM 2361   C CB   . ALA A 1 155 ? 29.486  20.711  12.762  1.00 71.12 ? 155 ALA A CB   1  
ATOM 2362   O OXT  . ALA A 1 155 ? 29.155  17.514  14.454  1.00 37.61 ? 155 ALA A OXT  1  
ATOM 2363   H H    . ALA A 1 155 ? 30.304  20.649  15.538  1.00 62.52 ? 155 ALA A H    1  
ATOM 2364   H HA   . ALA A 1 155 ? 27.997  19.720  13.957  1.00 71.11 ? 155 ALA A HA   1  
ATOM 2365   H HB1  . ALA A 1 155 ? 30.556  20.874  12.767  1.00 10.45 ? 155 ALA A HB1  1  
ATOM 2366   H HB2  . ALA A 1 155 ? 28.981  21.669  12.776  1.00 1.23  ? 155 ALA A HB2  1  
ATOM 2367   H HB3  . ALA A 1 155 ? 29.208  20.176  11.864  1.00 43.34 ? 155 ALA A HB3  1  
ATOM 2368   N N    . MET B 1 1   ? -5.715  -19.328 -45.487 1.00 71.10 ? 1   MET B N    1  
ATOM 2369   C CA   . MET B 1 1   ? -6.847  -18.376 -45.590 1.00 4.12  ? 1   MET B CA   1  
ATOM 2370   C C    . MET B 1 1   ? -7.335  -17.953 -44.195 1.00 15.04 ? 1   MET B C    1  
ATOM 2371   O O    . MET B 1 1   ? -7.539  -16.759 -43.943 1.00 62.13 ? 1   MET B O    1  
ATOM 2372   C CB   . MET B 1 1   ? -8.008  -18.988 -46.416 1.00 33.31 ? 1   MET B CB   1  
ATOM 2373   C CG   . MET B 1 1   ? -7.649  -19.260 -47.883 1.00 54.54 ? 1   MET B CG   1  
ATOM 2374   S SD   . MET B 1 1   ? -7.134  -17.757 -48.743 1.00 63.21 ? 1   MET B SD   1  
ATOM 2375   C CE   . MET B 1 1   ? -6.586  -18.395 -50.324 1.00 11.01 ? 1   MET B CE   1  
ATOM 2376   H H1   . MET B 1 1   ? -5.379  -19.591 -46.433 1.00 37.61 ? 1   MET B H1   1  
ATOM 2377   H H2   . MET B 1 1   ? -6.009  -20.185 -44.983 1.00 37.61 ? 1   MET B H2   1  
ATOM 2378   H H3   . MET B 1 1   ? -4.930  -18.889 -44.965 1.00 37.61 ? 1   MET B H3   1  
ATOM 2379   H HA   . MET B 1 1   ? -6.476  -17.497 -46.107 1.00 53.21 ? 1   MET B HA   1  
ATOM 2380   H HB2  . MET B 1 1   ? -8.311  -19.925 -45.958 1.00 20.11 ? 1   MET B HB2  1  
ATOM 2381   H HB3  . MET B 1 1   ? -8.854  -18.307 -46.398 1.00 34.40 ? 1   MET B HB3  1  
ATOM 2382   H HG2  . MET B 1 1   ? -6.838  -19.976 -47.921 1.00 41.34 ? 1   MET B HG2  1  
ATOM 2383   H HG3  . MET B 1 1   ? -8.515  -19.669 -48.392 1.00 1.33  ? 1   MET B HG3  1  
ATOM 2384   H HE1  . MET B 1 1   ? -5.766  -19.081 -50.172 1.00 21.12 ? 1   MET B HE1  1  
ATOM 2385   H HE2  . MET B 1 1   ? -6.258  -17.577 -50.948 1.00 15.04 ? 1   MET B HE2  1  
ATOM 2386   H HE3  . MET B 1 1   ? -7.402  -18.911 -50.807 1.00 71.22 ? 1   MET B HE3  1  
ATOM 2387   N N    . SER B 1 2   ? -7.514  -18.939 -43.296 1.00 74.44 ? 2   SER B N    1  
ATOM 2388   C CA   . SER B 1 2   ? -8.027  -18.715 -41.935 1.00 75.44 ? 2   SER B CA   1  
ATOM 2389   C C    . SER B 1 2   ? -7.708  -19.939 -41.055 1.00 2.42  ? 2   SER B C    1  
ATOM 2390   O O    . SER B 1 2   ? -8.511  -20.875 -40.945 1.00 11.23 ? 2   SER B O    1  
ATOM 2391   C CB   . SER B 1 2   ? -9.553  -18.417 -41.975 1.00 3.03  ? 2   SER B CB   1  
ATOM 2392   O OG   . SER B 1 2   ? -10.252 -19.397 -42.734 1.00 42.14 ? 2   SER B OG   1  
ATOM 2393   H H    . SER B 1 2   ? -7.292  -19.855 -43.555 1.00 52.14 ? 2   SER B H    1  
ATOM 2394   H HA   . SER B 1 2   ? -7.511  -17.852 -41.518 1.00 21.41 ? 2   SER B HA   1  
ATOM 2395   H HB2  . SER B 1 2   ? -9.957  -18.409 -40.970 1.00 71.44 ? 2   SER B HB2  1  
ATOM 2396   H HB3  . SER B 1 2   ? -9.720  -17.449 -42.431 1.00 52.13 ? 2   SER B HB3  1  
ATOM 2397   H HG   . SER B 1 2   ? -9.891  -20.272 -42.539 1.00 14.33 ? 2   SER B HG   1  
ATOM 2398   N N    . GLU B 1 3   ? -6.499  -19.947 -40.474 1.00 30.43 ? 3   GLU B N    1  
ATOM 2399   C CA   . GLU B 1 3   ? -6.039  -21.028 -39.585 1.00 25.22 ? 3   GLU B CA   1  
ATOM 2400   C C    . GLU B 1 3   ? -6.619  -20.774 -38.177 1.00 31.41 ? 3   GLU B C    1  
ATOM 2401   O O    . GLU B 1 3   ? -6.552  -19.641 -37.687 1.00 61.42 ? 3   GLU B O    1  
ATOM 2402   C CB   . GLU B 1 3   ? -4.471  -21.084 -39.577 1.00 42.21 ? 3   GLU B CB   1  
ATOM 2403   C CG   . GLU B 1 3   ? -3.860  -22.492 -39.411 1.00 61.11 ? 3   GLU B CG   1  
ATOM 2404   C CD   . GLU B 1 3   ? -4.188  -23.156 -38.065 1.00 42.45 ? 3   GLU B CD   1  
ATOM 2405   O OE1  . GLU B 1 3   ? -3.541  -22.821 -37.058 1.00 32.00 ? 3   GLU B OE1  1  
ATOM 2406   O OE2  . GLU B 1 3   ? -5.093  -24.013 -38.007 1.00 20.32 ? 3   GLU B OE2  1  
ATOM 2407   H H    . GLU B 1 3   ? -5.894  -19.196 -40.643 1.00 73.41 ? 3   GLU B H    1  
ATOM 2408   H HA   . GLU B 1 3   ? -6.429  -21.972 -39.967 1.00 1.35  ? 3   GLU B HA   1  
ATOM 2409   H HB2  . GLU B 1 3   ? -4.106  -20.679 -40.517 1.00 64.10 ? 3   GLU B HB2  1  
ATOM 2410   H HB3  . GLU B 1 3   ? -4.095  -20.456 -38.778 1.00 64.41 ? 3   GLU B HB3  1  
ATOM 2411   H HG2  . GLU B 1 3   ? -4.228  -23.122 -40.215 1.00 13.13 ? 3   GLU B HG2  1  
ATOM 2412   H HG3  . GLU B 1 3   ? -2.782  -22.416 -39.507 1.00 45.14 ? 3   GLU B HG3  1  
ATOM 2413   N N    . GLN B 1 4   ? -7.192  -21.820 -37.548 1.00 22.22 ? 4   GLN B N    1  
ATOM 2414   C CA   . GLN B 1 4   ? -7.852  -21.709 -36.230 1.00 21.30 ? 4   GLN B CA   1  
ATOM 2415   C C    . GLN B 1 4   ? -6.802  -21.582 -35.106 1.00 61.34 ? 4   GLN B C    1  
ATOM 2416   O O    . GLN B 1 4   ? -6.505  -22.546 -34.394 1.00 10.40 ? 4   GLN B O    1  
ATOM 2417   C CB   . GLN B 1 4   ? -8.792  -22.923 -35.989 1.00 11.20 ? 4   GLN B CB   1  
ATOM 2418   C CG   . GLN B 1 4   ? -9.971  -23.026 -36.977 1.00 25.20 ? 4   GLN B CG   1  
ATOM 2419   C CD   . GLN B 1 4   ? -10.920 -24.185 -36.658 1.00 33.12 ? 4   GLN B CD   1  
ATOM 2420   O OE1  . GLN B 1 4   ? -11.085 -24.568 -35.497 1.00 72.14 ? 4   GLN B OE1  1  
ATOM 2421   N NE2  . GLN B 1 4   ? -11.557 -24.745 -37.675 1.00 21.03 ? 4   GLN B NE2  1  
ATOM 2422   H H    . GLN B 1 4   ? -7.153  -22.702 -37.978 1.00 53.11 ? 4   GLN B H    1  
ATOM 2423   H HA   . GLN B 1 4   ? -8.458  -20.805 -36.237 1.00 31.31 ? 4   GLN B HA   1  
ATOM 2424   H HB2  . GLN B 1 4   ? -8.208  -23.837 -36.061 1.00 61.22 ? 4   GLN B HB2  1  
ATOM 2425   H HB3  . GLN B 1 4   ? -9.199  -22.858 -34.983 1.00 44.22 ? 4   GLN B HB3  1  
ATOM 2426   H HG2  . GLN B 1 4   ? -10.541 -22.103 -36.942 1.00 63.00 ? 4   GLN B HG2  1  
ATOM 2427   H HG3  . GLN B 1 4   ? -9.575  -23.161 -37.977 1.00 3.35  ? 4   GLN B HG3  1  
ATOM 2428   H HE21 . GLN B 1 4   ? -11.395 -24.395 -38.574 1.00 12.10 ? 4   GLN B HE21 1  
ATOM 2429   H HE22 . GLN B 1 4   ? -12.163 -25.491 -37.486 1.00 61.51 ? 4   GLN B HE22 1  
ATOM 2430   N N    . ASN B 1 5   ? -6.250  -20.372 -34.978 1.00 32.14 ? 5   ASN B N    1  
ATOM 2431   C CA   . ASN B 1 5   ? -5.156  -20.043 -34.044 1.00 44.15 ? 5   ASN B CA   1  
ATOM 2432   C C    . ASN B 1 5   ? -5.192  -18.520 -33.800 1.00 23.14 ? 5   ASN B C    1  
ATOM 2433   O O    . ASN B 1 5   ? -5.779  -17.783 -34.605 1.00 10.41 ? 5   ASN B O    1  
ATOM 2434   C CB   . ASN B 1 5   ? -3.792  -20.496 -34.665 1.00 61.11 ? 5   ASN B CB   1  
ATOM 2435   C CG   . ASN B 1 5   ? -2.595  -20.541 -33.696 1.00 34.54 ? 5   ASN B CG   1  
ATOM 2436   O OD1  . ASN B 1 5   ? -2.528  -19.812 -32.707 1.00 14.23 ? 5   ASN B OD1  1  
ATOM 2437   N ND2  . ASN B 1 5   ? -1.621  -21.393 -33.990 1.00 60.41 ? 5   ASN B ND2  1  
ATOM 2438   H H    . ASN B 1 5   ? -6.594  -19.652 -35.547 1.00 54.31 ? 5   ASN B H    1  
ATOM 2439   H HA   . ASN B 1 5   ? -5.327  -20.561 -33.105 1.00 42.42 ? 5   ASN B HA   1  
ATOM 2440   H HB2  . ASN B 1 5   ? -3.921  -21.492 -35.074 1.00 40.14 ? 5   ASN B HB2  1  
ATOM 2441   H HB3  . ASN B 1 5   ? -3.538  -19.829 -35.479 1.00 43.44 ? 5   ASN B HB3  1  
ATOM 2442   H HD21 . ASN B 1 5   ? -1.711  -21.943 -34.799 1.00 50.34 ? 5   ASN B HD21 1  
ATOM 2443   H HD22 . ASN B 1 5   ? -0.848  -21.440 -33.388 1.00 20.41 ? 5   ASN B HD22 1  
ATOM 2444   N N    . ASN B 1 6   ? -4.594  -18.054 -32.691 1.00 60.24 ? 6   ASN B N    1  
ATOM 2445   C CA   . ASN B 1 6   ? -4.505  -16.619 -32.369 1.00 25.20 ? 6   ASN B CA   1  
ATOM 2446   C C    . ASN B 1 6   ? -3.604  -15.900 -33.392 1.00 61.52 ? 6   ASN B C    1  
ATOM 2447   O O    . ASN B 1 6   ? -2.381  -15.819 -33.221 1.00 15.11 ? 6   ASN B O    1  
ATOM 2448   C CB   . ASN B 1 6   ? -4.005  -16.407 -30.912 1.00 71.40 ? 6   ASN B CB   1  
ATOM 2449   C CG   . ASN B 1 6   ? -4.912  -17.039 -29.837 1.00 15.01 ? 6   ASN B CG   1  
ATOM 2450   O OD1  . ASN B 1 6   ? -4.436  -17.473 -28.787 1.00 53.24 ? 6   ASN B OD1  1  
ATOM 2451   N ND2  . ASN B 1 6   ? -6.222  -17.078 -30.071 1.00 52.01 ? 6   ASN B ND2  1  
ATOM 2452   H H    . ASN B 1 6   ? -4.192  -18.696 -32.071 1.00 42.34 ? 6   ASN B H    1  
ATOM 2453   H HA   . ASN B 1 6   ? -5.510  -16.203 -32.449 1.00 31.22 ? 6   ASN B HA   1  
ATOM 2454   H HB2  . ASN B 1 6   ? -3.018  -16.841 -30.816 1.00 32.25 ? 6   ASN B HB2  1  
ATOM 2455   H HB3  . ASN B 1 6   ? -3.939  -15.344 -30.707 1.00 61.42 ? 6   ASN B HB3  1  
ATOM 2456   H HD21 . ASN B 1 6   ? -6.561  -16.704 -30.909 1.00 55.44 ? 6   ASN B HD21 1  
ATOM 2457   H HD22 . ASN B 1 6   ? -6.793  -17.489 -29.393 1.00 51.32 ? 6   ASN B HD22 1  
ATOM 2458   N N    . THR B 1 7   ? -4.235  -15.428 -34.481 1.00 45.43 ? 7   THR B N    1  
ATOM 2459   C CA   . THR B 1 7   ? -3.547  -14.791 -35.606 1.00 75.44 ? 7   THR B CA   1  
ATOM 2460   C C    . THR B 1 7   ? -3.069  -13.377 -35.222 1.00 21.22 ? 7   THR B C    1  
ATOM 2461   O O    . THR B 1 7   ? -3.860  -12.558 -34.731 1.00 72.33 ? 7   THR B O    1  
ATOM 2462   C CB   . THR B 1 7   ? -4.456  -14.748 -36.887 1.00 14.12 ? 7   THR B CB   1  
ATOM 2463   O OG1  . THR B 1 7   ? -3.745  -14.146 -37.977 1.00 1.15  ? 7   THR B OG1  1  
ATOM 2464   C CG2  . THR B 1 7   ? -5.789  -13.996 -36.665 1.00 31.32 ? 7   THR B CG2  1  
ATOM 2465   H H    . THR B 1 7   ? -5.208  -15.516 -34.523 1.00 50.14 ? 7   THR B H    1  
ATOM 2466   H HA   . THR B 1 7   ? -2.675  -15.406 -35.844 1.00 13.52 ? 7   THR B HA   1  
ATOM 2467   H HB   . THR B 1 7   ? -4.689  -15.773 -37.166 1.00 64.11 ? 7   THR B HB   1  
ATOM 2468   H HG1  . THR B 1 7   ? -4.095  -13.265 -38.142 1.00 0.43  ? 7   THR B HG1  1  
ATOM 2469   H HG21 . THR B 1 7   ? -5.587  -12.970 -36.382 1.00 35.31 ? 7   THR B HG21 1  
ATOM 2470   H HG22 . THR B 1 7   ? -6.357  -14.476 -35.878 1.00 42.23 ? 7   THR B HG22 1  
ATOM 2471   H HG23 . THR B 1 7   ? -6.368  -14.006 -37.578 1.00 2.23  ? 7   THR B HG23 1  
ATOM 2472   N N    . GLU B 1 8   ? -1.755  -13.137 -35.423 1.00 14.04 ? 8   GLU B N    1  
ATOM 2473   C CA   . GLU B 1 8   ? -1.080  -11.846 -35.188 1.00 25.45 ? 8   GLU B CA   1  
ATOM 2474   C C    . GLU B 1 8   ? -1.168  -11.415 -33.709 1.00 0.30  ? 8   GLU B C    1  
ATOM 2475   O O    . GLU B 1 8   ? -0.259  -11.691 -32.924 1.00 51.44 ? 8   GLU B O    1  
ATOM 2476   C CB   . GLU B 1 8   ? -1.624  -10.732 -36.144 1.00 61.25 ? 8   GLU B CB   1  
ATOM 2477   C CG   . GLU B 1 8   ? -1.583  -11.091 -37.644 1.00 72.44 ? 8   GLU B CG   1  
ATOM 2478   C CD   . GLU B 1 8   ? -0.157  -11.283 -38.184 1.00 3.24  ? 8   GLU B CD   1  
ATOM 2479   O OE1  . GLU B 1 8   ? 0.451   -10.296 -38.647 1.00 3.51  ? 8   GLU B OE1  1  
ATOM 2480   O OE2  . GLU B 1 8   ? 0.369   -12.414 -38.138 1.00 22.44 ? 8   GLU B OE2  1  
ATOM 2481   H H    . GLU B 1 8   ? -1.204  -13.878 -35.744 1.00 42.24 ? 8   GLU B H    1  
ATOM 2482   H HA   . GLU B 1 8   ? -0.034  -12.005 -35.427 1.00 72.42 ? 8   GLU B HA   1  
ATOM 2483   H HB2  . GLU B 1 8   ? -2.653  -10.519 -35.875 1.00 4.33  ? 8   GLU B HB2  1  
ATOM 2484   H HB3  . GLU B 1 8   ? -1.041  -9.829  -35.997 1.00 43.34 ? 8   GLU B HB3  1  
ATOM 2485   H HG2  . GLU B 1 8   ? -2.143  -12.007 -37.796 1.00 20.42 ? 8   GLU B HG2  1  
ATOM 2486   H HG3  . GLU B 1 8   ? -2.067  -10.298 -38.206 1.00 32.44 ? 8   GLU B HG3  1  
ATOM 2487   N N    . MET B 1 9   ? -2.303  -10.771 -33.356 1.00 52.30 ? 9   MET B N    1  
ATOM 2488   C CA   . MET B 1 9   ? -2.563  -10.140 -32.042 1.00 21.55 ? 9   MET B CA   1  
ATOM 2489   C C    . MET B 1 9   ? -1.572  -8.967  -31.787 1.00 74.21 ? 9   MET B C    1  
ATOM 2490   O O    . MET B 1 9   ? -0.594  -8.788  -32.509 1.00 62.21 ? 9   MET B O    1  
ATOM 2491   C CB   . MET B 1 9   ? -2.540  -11.211 -30.882 1.00 71.03 ? 9   MET B CB   1  
ATOM 2492   C CG   . MET B 1 9   ? -3.525  -10.962 -29.710 1.00 22.33 ? 9   MET B CG   1  
ATOM 2493   S SD   . MET B 1 9   ? -3.082  -9.586  -28.632 1.00 14.42 ? 9   MET B SD   1  
ATOM 2494   C CE   . MET B 1 9   ? -4.573  -9.364  -27.657 1.00 44.32 ? 9   MET B CE   1  
ATOM 2495   H H    . MET B 1 9   ? -3.019  -10.730 -34.022 1.00 51.34 ? 9   MET B H    1  
ATOM 2496   H HA   . MET B 1 9   ? -3.560  -9.723  -32.107 1.00 1.10  ? 9   MET B HA   1  
ATOM 2497   H HB2  . MET B 1 9   ? -2.779  -12.182 -31.310 1.00 42.01 ? 9   MET B HB2  1  
ATOM 2498   H HB3  . MET B 1 9   ? -1.539  -11.268 -30.472 1.00 54.04 ? 9   MET B HB3  1  
ATOM 2499   H HG2  . MET B 1 9   ? -4.507  -10.767 -30.121 1.00 34.44 ? 9   MET B HG2  1  
ATOM 2500   H HG3  . MET B 1 9   ? -3.572  -11.856 -29.103 1.00 11.21 ? 9   MET B HG3  1  
ATOM 2501   H HE1  . MET B 1 9   ? -4.425  -8.552  -26.960 1.00 10.13 ? 9   MET B HE1  1  
ATOM 2502   H HE2  . MET B 1 9   ? -4.789  -10.271 -27.114 1.00 44.31 ? 9   MET B HE2  1  
ATOM 2503   H HE3  . MET B 1 9   ? -5.403  -9.126  -28.307 1.00 43.54 ? 9   MET B HE3  1  
ATOM 2504   N N    . THR B 1 10  ? -1.872  -8.158  -30.780 1.00 72.30 ? 10  THR B N    1  
ATOM 2505   C CA   . THR B 1 10  ? -0.984  -7.109  -30.249 1.00 25.13 ? 10  THR B CA   1  
ATOM 2506   C C    . THR B 1 10  ? -1.456  -6.833  -28.825 1.00 23.15 ? 10  THR B C    1  
ATOM 2507   O O    . THR B 1 10  ? -2.639  -6.582  -28.629 1.00 73.25 ? 10  THR B O    1  
ATOM 2508   C CB   . THR B 1 10  ? -1.039  -5.777  -31.090 1.00 74.21 ? 10  THR B CB   1  
ATOM 2509   O OG1  . THR B 1 10  ? -0.607  -6.015  -32.445 1.00 73.30 ? 10  THR B OG1  1  
ATOM 2510   C CG2  . THR B 1 10  ? -0.178  -4.654  -30.472 1.00 61.12 ? 10  THR B CG2  1  
ATOM 2511   H H    . THR B 1 10  ? -2.757  -8.251  -30.364 1.00 25.22 ? 10  THR B H    1  
ATOM 2512   H HA   . THR B 1 10  ? 0.040   -7.487  -30.234 1.00 62.03 ? 10  THR B HA   1  
ATOM 2513   H HB   . THR B 1 10  ? -2.071  -5.438  -31.123 1.00 14.22 ? 10  THR B HB   1  
ATOM 2514   H HG1  . THR B 1 10  ? -1.177  -6.676  -32.849 1.00 42.13 ? 10  THR B HG1  1  
ATOM 2515   H HG21 . THR B 1 10  ? -0.532  -4.427  -29.474 1.00 51.43 ? 10  THR B HG21 1  
ATOM 2516   H HG22 . THR B 1 10  ? -0.249  -3.765  -31.084 1.00 72.45 ? 10  THR B HG22 1  
ATOM 2517   H HG23 . THR B 1 10  ? 0.856   -4.969  -30.421 1.00 24.32 ? 10  THR B HG23 1  
ATOM 2518   N N    . PHE B 1 11  ? -0.562  -6.926  -27.837 1.00 64.41 ? 11  PHE B N    1  
ATOM 2519   C CA   . PHE B 1 11  ? -0.909  -6.670  -26.436 1.00 31.02 ? 11  PHE B CA   1  
ATOM 2520   C C    . PHE B 1 11  ? 0.214   -5.869  -25.779 1.00 43.33 ? 11  PHE B C    1  
ATOM 2521   O O    . PHE B 1 11  ? 1.381   -6.286  -25.803 1.00 15.42 ? 11  PHE B O    1  
ATOM 2522   C CB   . PHE B 1 11  ? -1.163  -7.997  -25.662 1.00 73.41 ? 11  PHE B CB   1  
ATOM 2523   C CG   . PHE B 1 11  ? -1.824  -7.784  -24.292 1.00 22.04 ? 11  PHE B CG   1  
ATOM 2524   C CD1  . PHE B 1 11  ? -3.213  -7.821  -24.158 1.00 70.52 ? 11  PHE B CD1  1  
ATOM 2525   C CD2  . PHE B 1 11  ? -1.063  -7.514  -23.149 1.00 33.33 ? 11  PHE B CD2  1  
ATOM 2526   C CE1  . PHE B 1 11  ? -3.817  -7.599  -22.936 1.00 44.40 ? 11  PHE B CE1  1  
ATOM 2527   C CE2  . PHE B 1 11  ? -1.670  -7.295  -21.927 1.00 14.23 ? 11  PHE B CE2  1  
ATOM 2528   C CZ   . PHE B 1 11  ? -3.047  -7.337  -21.823 1.00 3.33  ? 11  PHE B CZ   1  
ATOM 2529   H H    . PHE B 1 11  ? 0.363   -7.168  -28.055 1.00 12.15 ? 11  PHE B H    1  
ATOM 2530   H HA   . PHE B 1 11  ? -1.824  -6.072  -26.414 1.00 62.50 ? 11  PHE B HA   1  
ATOM 2531   H HB2  . PHE B 1 11  ? -1.815  -8.631  -26.257 1.00 0.12  ? 11  PHE B HB2  1  
ATOM 2532   H HB3  . PHE B 1 11  ? -0.224  -8.517  -25.511 1.00 65.14 ? 11  PHE B HB3  1  
ATOM 2533   H HD1  . PHE B 1 11  ? -3.826  -8.028  -25.029 1.00 1.21  ? 11  PHE B HD1  1  
ATOM 2534   H HD2  . PHE B 1 11  ? 0.017   -7.479  -23.225 1.00 60.31 ? 11  PHE B HD2  1  
ATOM 2535   H HE1  . PHE B 1 11  ? -4.895  -7.629  -22.853 1.00 62.21 ? 11  PHE B HE1  1  
ATOM 2536   H HE2  . PHE B 1 11  ? -1.066  -7.085  -21.048 1.00 62.40 ? 11  PHE B HE2  1  
ATOM 2537   H HZ   . PHE B 1 11  ? -3.523  -7.162  -20.866 1.00 42.52 ? 11  PHE B HZ   1  
ATOM 2538   N N    . GLN B 1 12  ? -0.148  -4.724  -25.189 1.00 61.51 ? 12  GLN B N    1  
ATOM 2539   C CA   . GLN B 1 12  ? 0.780   -3.900  -24.415 1.00 43.12 ? 12  GLN B CA   1  
ATOM 2540   C C    . GLN B 1 12  ? 0.015   -3.193  -23.294 1.00 21.41 ? 12  GLN B C    1  
ATOM 2541   O O    . GLN B 1 12  ? -1.104  -2.716  -23.513 1.00 43.12 ? 12  GLN B O    1  
ATOM 2542   C CB   . GLN B 1 12  ? 1.499   -2.861  -25.328 1.00 31.12 ? 12  GLN B CB   1  
ATOM 2543   C CG   . GLN B 1 12  ? 2.743   -2.197  -24.682 1.00 74.43 ? 12  GLN B CG   1  
ATOM 2544   C CD   . GLN B 1 12  ? 4.036   -3.052  -24.696 1.00 51.01 ? 12  GLN B CD   1  
ATOM 2545   O OE1  . GLN B 1 12  ? 5.137   -2.502  -24.703 1.00 45.01 ? 12  GLN B OE1  1  
ATOM 2546   N NE2  . GLN B 1 12  ? 3.945   -4.386  -24.736 1.00 73.04 ? 12  GLN B NE2  1  
ATOM 2547   H H    . GLN B 1 12  ? -1.077  -4.418  -25.288 1.00 52.21 ? 12  GLN B H    1  
ATOM 2548   H HA   . GLN B 1 12  ? 1.526   -4.555  -23.968 1.00 44.03 ? 12  GLN B HA   1  
ATOM 2549   H HB2  . GLN B 1 12  ? 1.815   -3.358  -26.240 1.00 1.12  ? 12  GLN B HB2  1  
ATOM 2550   H HB3  . GLN B 1 12  ? 0.793   -2.079  -25.596 1.00 61.11 ? 12  GLN B HB3  1  
ATOM 2551   H HG2  . GLN B 1 12  ? 2.950   -1.275  -25.212 1.00 54.33 ? 12  GLN B HG2  1  
ATOM 2552   H HG3  . GLN B 1 12  ? 2.511   -1.953  -23.650 1.00 45.02 ? 12  GLN B HG3  1  
ATOM 2553   H HE21 . GLN B 1 12  ? 3.064   -4.802  -24.758 1.00 40.21 ? 12  GLN B HE21 1  
ATOM 2554   H HE22 . GLN B 1 12  ? 4.780   -4.898  -24.746 1.00 64.51 ? 12  GLN B HE22 1  
ATOM 2555   N N    . ILE B 1 13  ? 0.608   -3.151  -22.089 1.00 53.04 ? 13  ILE B N    1  
ATOM 2556   C CA   . ILE B 1 13  ? 0.047   -2.397  -20.966 1.00 20.34 ? 13  ILE B CA   1  
ATOM 2557   C C    . ILE B 1 13  ? 0.521   -0.942  -21.068 1.00 22.32 ? 13  ILE B C    1  
ATOM 2558   O O    . ILE B 1 13  ? 1.729   -0.673  -21.093 1.00 22.02 ? 13  ILE B O    1  
ATOM 2559   C CB   . ILE B 1 13  ? 0.446   -2.991  -19.569 1.00 2.13  ? 13  ILE B CB   1  
ATOM 2560   C CG1  . ILE B 1 13  ? 0.123   -4.523  -19.506 1.00 61.23 ? 13  ILE B CG1  1  
ATOM 2561   C CG2  . ILE B 1 13  ? -0.285  -2.206  -18.442 1.00 63.01 ? 13  ILE B CG2  1  
ATOM 2562   C CD1  . ILE B 1 13  ? 0.543   -5.222  -18.221 1.00 74.32 ? 13  ILE B CD1  1  
ATOM 2563   H H    . ILE B 1 13  ? 1.453   -3.625  -21.962 1.00 44.32 ? 13  ILE B H    1  
ATOM 2564   H HA   . ILE B 1 13  ? -1.043  -2.429  -21.048 1.00 32.31 ? 13  ILE B HA   1  
ATOM 2565   H HB   . ILE B 1 13  ? 1.517   -2.853  -19.433 1.00 70.54 ? 13  ILE B HB   1  
ATOM 2566   H HG12 . ILE B 1 13  ? -0.940  -4.672  -19.617 1.00 21.44 ? 13  ILE B HG12 1  
ATOM 2567   H HG13 . ILE B 1 13  ? 0.629   -5.026  -20.323 1.00 63.51 ? 13  ILE B HG13 1  
ATOM 2568   H HG21 . ILE B 1 13  ? -0.093  -2.654  -17.489 1.00 21.44 ? 13  ILE B HG21 1  
ATOM 2569   H HG22 . ILE B 1 13  ? -1.352  -2.210  -18.618 1.00 43.32 ? 13  ILE B HG22 1  
ATOM 2570   H HG23 . ILE B 1 13  ? 0.062   -1.182  -18.414 1.00 63.13 ? 13  ILE B HG23 1  
ATOM 2571   H HD11 . ILE B 1 13  ? 0.184   -6.240  -18.237 1.00 45.33 ? 13  ILE B HD11 1  
ATOM 2572   H HD12 . ILE B 1 13  ? 0.125   -4.707  -17.367 1.00 63.31 ? 13  ILE B HD12 1  
ATOM 2573   H HD13 . ILE B 1 13  ? 1.619   -5.229  -18.148 1.00 30.34 ? 13  ILE B HD13 1  
ATOM 2574   N N    . GLN B 1 14  ? -0.443  -0.028  -21.126 1.00 72.43 ? 14  GLN B N    1  
ATOM 2575   C CA   . GLN B 1 14  ? -0.195  1.405   -21.324 1.00 51.32 ? 14  GLN B CA   1  
ATOM 2576   C C    . GLN B 1 14  ? -0.015  2.100   -19.965 1.00 2.01  ? 14  GLN B C    1  
ATOM 2577   O O    . GLN B 1 14  ? 0.922   2.887   -19.783 1.00 1.31  ? 14  GLN B O    1  
ATOM 2578   C CB   . GLN B 1 14  ? -1.375  2.025   -22.125 1.00 12.32 ? 14  GLN B CB   1  
ATOM 2579   C CG   . GLN B 1 14  ? -1.653  1.330   -23.476 1.00 3.22  ? 14  GLN B CG   1  
ATOM 2580   C CD   . GLN B 1 14  ? -0.498  1.457   -24.467 1.00 73.32 ? 14  GLN B CD   1  
ATOM 2581   O OE1  . GLN B 1 14  ? 0.424   0.640   -24.474 1.00 14.14 ? 14  GLN B OE1  1  
ATOM 2582   N NE2  . GLN B 1 14  ? -0.574  2.442   -25.356 1.00 23.32 ? 14  GLN B NE2  1  
ATOM 2583   H H    . GLN B 1 14  ? -1.366  -0.330  -21.017 1.00 62.33 ? 14  GLN B H    1  
ATOM 2584   H HA   . GLN B 1 14  ? 0.718   1.523   -21.903 1.00 50.11 ? 14  GLN B HA   1  
ATOM 2585   H HB2  . GLN B 1 14  ? -2.275  1.959   -21.524 1.00 52.43 ? 14  GLN B HB2  1  
ATOM 2586   H HB3  . GLN B 1 14  ? -1.171  3.071   -22.318 1.00 45.31 ? 14  GLN B HB3  1  
ATOM 2587   H HG2  . GLN B 1 14  ? -1.837  0.277   -23.295 1.00 43.23 ? 14  GLN B HG2  1  
ATOM 2588   H HG3  . GLN B 1 14  ? -2.545  1.767   -23.918 1.00 15.23 ? 14  GLN B HG3  1  
ATOM 2589   H HE21 . GLN B 1 14  ? -1.367  3.023   -25.342 1.00 11.13 ? 14  GLN B HE21 1  
ATOM 2590   H HE22 . GLN B 1 14  ? 0.164   2.553   -25.988 1.00 70.12 ? 14  GLN B HE22 1  
ATOM 2591   N N    . ARG B 1 15  ? -0.888  1.746   -18.996 1.00 55.10 ? 15  ARG B N    1  
ATOM 2592   C CA   . ARG B 1 15  ? -0.949  2.417   -17.682 1.00 73.12 ? 15  ARG B CA   1  
ATOM 2593   C C    . ARG B 1 15  ? -2.030  1.749   -16.821 1.00 63.21 ? 15  ARG B C    1  
ATOM 2594   O O    . ARG B 1 15  ? -3.155  1.567   -17.280 1.00 74.13 ? 15  ARG B O    1  
ATOM 2595   C CB   . ARG B 1 15  ? -1.246  3.949   -17.830 1.00 71.34 ? 15  ARG B CB   1  
ATOM 2596   C CG   . ARG B 1 15  ? -1.041  4.772   -16.538 1.00 52.31 ? 15  ARG B CG   1  
ATOM 2597   C CD   . ARG B 1 15  ? -1.107  6.296   -16.773 1.00 32.41 ? 15  ARG B CD   1  
ATOM 2598   N NE   . ARG B 1 15  ? -0.566  7.018   -15.612 1.00 40.05 ? 15  ARG B NE   1  
ATOM 2599   C CZ   . ARG B 1 15  ? -0.102  8.277   -15.600 1.00 62.13 ? 15  ARG B CZ   1  
ATOM 2600   N NH1  . ARG B 1 15  ? -0.088  9.013   -16.701 1.00 71.51 ? 15  ARG B NH1  1  
ATOM 2601   N NH2  . ARG B 1 15  ? 0.356   8.791   -14.464 1.00 3.04  ? 15  ARG B NH2  1  
ATOM 2602   H H    . ARG B 1 15  ? -1.478  0.971   -19.152 1.00 53.14 ? 15  ARG B H    1  
ATOM 2603   H HA   . ARG B 1 15  ? 0.019   2.285   -17.205 1.00 73.11 ? 15  ARG B HA   1  
ATOM 2604   H HB2  . ARG B 1 15  ? -0.584  4.350   -18.590 1.00 25.53 ? 15  ARG B HB2  1  
ATOM 2605   H HB3  . ARG B 1 15  ? -2.272  4.085   -18.168 1.00 64.12 ? 15  ARG B HB3  1  
ATOM 2606   H HG2  . ARG B 1 15  ? -1.812  4.498   -15.823 1.00 41.35 ? 15  ARG B HG2  1  
ATOM 2607   H HG3  . ARG B 1 15  ? -0.073  4.524   -16.117 1.00 21.40 ? 15  ARG B HG3  1  
ATOM 2608   H HD2  . ARG B 1 15  ? -0.527  6.551   -17.654 1.00 35.25 ? 15  ARG B HD2  1  
ATOM 2609   H HD3  . ARG B 1 15  ? -2.139  6.593   -16.919 1.00 33.01 ? 15  ARG B HD3  1  
ATOM 2610   H HE   . ARG B 1 15  ? -0.557  6.522   -14.772 1.00 72.11 ? 15  ARG B HE   1  
ATOM 2611   H HH11 . ARG B 1 15  ? -0.440  8.639   -17.560 1.00 64.52 ? 15  ARG B HH11 1  
ATOM 2612   H HH12 . ARG B 1 15  ? 0.265   9.954   -16.675 1.00 11.52 ? 15  ARG B HH12 1  
ATOM 2613   H HH21 . ARG B 1 15  ? 0.356   8.243   -13.619 1.00 20.12 ? 15  ARG B HH21 1  
ATOM 2614   H HH22 . ARG B 1 15  ? 0.713   9.731   -14.442 1.00 51.41 ? 15  ARG B HH22 1  
ATOM 2615   N N    . ILE B 1 16  ? -1.679  1.399   -15.574 1.00 74.05 ? 16  ILE B N    1  
ATOM 2616   C CA   . ILE B 1 16  ? -2.603  0.784   -14.598 1.00 63.53 ? 16  ILE B CA   1  
ATOM 2617   C C    . ILE B 1 16  ? -2.758  1.742   -13.412 1.00 13.44 ? 16  ILE B C    1  
ATOM 2618   O O    . ILE B 1 16  ? -1.778  2.335   -12.966 1.00 41.31 ? 16  ILE B O    1  
ATOM 2619   C CB   . ILE B 1 16  ? -2.078  -0.623  -14.128 1.00 43.11 ? 16  ILE B CB   1  
ATOM 2620   C CG1  . ILE B 1 16  ? -2.055  -1.612  -15.336 1.00 61.23 ? 16  ILE B CG1  1  
ATOM 2621   C CG2  . ILE B 1 16  ? -2.921  -1.193  -12.957 1.00 10.21 ? 16  ILE B CG2  1  
ATOM 2622   C CD1  . ILE B 1 16  ? -1.501  -2.988  -15.027 1.00 75.25 ? 16  ILE B CD1  1  
ATOM 2623   H H    . ILE B 1 16  ? -0.759  1.579   -15.281 1.00 72.24 ? 16  ILE B H    1  
ATOM 2624   H HA   . ILE B 1 16  ? -3.579  0.650   -15.074 1.00 72.14 ? 16  ILE B HA   1  
ATOM 2625   H HB   . ILE B 1 16  ? -1.059  -0.494  -13.767 1.00 52.12 ? 16  ILE B HB   1  
ATOM 2626   H HG12 . ILE B 1 16  ? -3.061  -1.748  -15.709 1.00 52.24 ? 16  ILE B HG12 1  
ATOM 2627   H HG13 . ILE B 1 16  ? -1.446  -1.191  -16.127 1.00 1.11  ? 16  ILE B HG13 1  
ATOM 2628   H HG21 . ILE B 1 16  ? -3.950  -1.288  -13.264 1.00 52.43 ? 16  ILE B HG21 1  
ATOM 2629   H HG22 . ILE B 1 16  ? -2.871  -0.532  -12.111 1.00 53.33 ? 16  ILE B HG22 1  
ATOM 2630   H HG23 . ILE B 1 16  ? -2.545  -2.166  -12.667 1.00 1.34  ? 16  ILE B HG23 1  
ATOM 2631   H HD11 . ILE B 1 16  ? -1.568  -3.609  -15.903 1.00 1.45  ? 16  ILE B HD11 1  
ATOM 2632   H HD12 . ILE B 1 16  ? -2.059  -3.442  -14.220 1.00 32.42 ? 16  ILE B HD12 1  
ATOM 2633   H HD13 . ILE B 1 16  ? -0.474  -2.891  -14.744 1.00 60.41 ? 16  ILE B HD13 1  
ATOM 2634   N N    . TYR B 1 17  ? -3.990  1.917   -12.927 1.00 0.24  ? 17  TYR B N    1  
ATOM 2635   C CA   . TYR B 1 17  ? -4.313  2.943   -11.932 1.00 64.44 ? 17  TYR B CA   1  
ATOM 2636   C C    . TYR B 1 17  ? -5.656  2.656   -11.258 1.00 13.33 ? 17  TYR B C    1  
ATOM 2637   O O    . TYR B 1 17  ? -6.595  2.143   -11.881 1.00 1.25  ? 17  TYR B O    1  
ATOM 2638   C CB   . TYR B 1 17  ? -4.320  4.357   -12.594 1.00 31.13 ? 17  TYR B CB   1  
ATOM 2639   C CG   . TYR B 1 17  ? -5.153  4.464   -13.891 1.00 44.34 ? 17  TYR B CG   1  
ATOM 2640   C CD1  . TYR B 1 17  ? -4.622  4.073   -15.129 1.00 44.53 ? 17  TYR B CD1  1  
ATOM 2641   C CD2  . TYR B 1 17  ? -6.463  4.938   -13.880 1.00 21.44 ? 17  TYR B CD2  1  
ATOM 2642   C CE1  . TYR B 1 17  ? -5.366  4.149   -16.287 1.00 1.13  ? 17  TYR B CE1  1  
ATOM 2643   C CE2  . TYR B 1 17  ? -7.199  5.016   -15.042 1.00 75.12 ? 17  TYR B CE2  1  
ATOM 2644   C CZ   . TYR B 1 17  ? -6.654  4.620   -16.232 1.00 23.21 ? 17  TYR B CZ   1  
ATOM 2645   O OH   . TYR B 1 17  ? -7.404  4.699   -17.373 1.00 1.41  ? 17  TYR B OH   1  
ATOM 2646   H H    . TYR B 1 17  ? -4.710  1.333   -13.244 1.00 24.22 ? 17  TYR B H    1  
ATOM 2647   H HA   . TYR B 1 17  ? -3.533  2.919   -11.171 1.00 45.34 ? 17  TYR B HA   1  
ATOM 2648   H HB2  . TYR B 1 17  ? -4.698  5.087   -11.884 1.00 43.13 ? 17  TYR B HB2  1  
ATOM 2649   H HB3  . TYR B 1 17  ? -3.297  4.625   -12.839 1.00 21.24 ? 17  TYR B HB3  1  
ATOM 2650   H HD1  . TYR B 1 17  ? -3.606  3.702   -15.173 1.00 4.32  ? 17  TYR B HD1  1  
ATOM 2651   H HD2  . TYR B 1 17  ? -6.904  5.254   -12.943 1.00 32.25 ? 17  TYR B HD2  1  
ATOM 2652   H HE1  . TYR B 1 17  ? -4.934  3.840   -17.232 1.00 11.11 ? 17  TYR B HE1  1  
ATOM 2653   H HE2  . TYR B 1 17  ? -8.216  5.385   -15.009 1.00 31.42 ? 17  TYR B HE2  1  
ATOM 2654   H HH   . TYR B 1 17  ? -7.519  3.815   -17.735 1.00 41.14 ? 17  TYR B HH   1  
ATOM 2655   N N    . THR B 1 18  ? -5.714  3.003   -9.975  1.00 35.15 ? 18  THR B N    1  
ATOM 2656   C CA   . THR B 1 18  ? -6.933  3.002   -9.190  1.00 1.14  ? 18  THR B CA   1  
ATOM 2657   C C    . THR B 1 18  ? -7.787  4.206   -9.631  1.00 11.13 ? 18  THR B C    1  
ATOM 2658   O O    . THR B 1 18  ? -7.342  5.352   -9.546  1.00 13.02 ? 18  THR B O    1  
ATOM 2659   C CB   . THR B 1 18  ? -6.583  3.102   -7.675  1.00 14.23 ? 18  THR B CB   1  
ATOM 2660   O OG1  . THR B 1 18  ? -5.782  1.970   -7.280  1.00 21.53 ? 18  THR B OG1  1  
ATOM 2661   C CG2  . THR B 1 18  ? -7.827  3.192   -6.787  1.00 0.24  ? 18  THR B CG2  1  
ATOM 2662   H H    . THR B 1 18  ? -4.891  3.293   -9.543  1.00 52.35 ? 18  THR B H    1  
ATOM 2663   H HA   . THR B 1 18  ? -7.473  2.069   -9.370  1.00 63.14 ? 18  THR B HA   1  
ATOM 2664   H HB   . THR B 1 18  ? -5.990  4.002   -7.524  1.00 63.20 ? 18  THR B HB   1  
ATOM 2665   H HG1  . THR B 1 18  ? -4.884  2.086   -7.609  1.00 30.44 ? 18  THR B HG1  1  
ATOM 2666   H HG21 . THR B 1 18  ? -8.427  4.045   -7.070  1.00 52.04 ? 18  THR B HG21 1  
ATOM 2667   H HG22 . THR B 1 18  ? -7.525  3.303   -5.760  1.00 44.33 ? 18  THR B HG22 1  
ATOM 2668   H HG23 . THR B 1 18  ? -8.421  2.296   -6.867  1.00 62.12 ? 18  THR B HG23 1  
ATOM 2669   N N    . LYS B 1 19  ? -8.972  3.918   -10.157 1.00 13.20 ? 19  LYS B N    1  
ATOM 2670   C CA   . LYS B 1 19  ? -9.904  4.932   -10.683 1.00 51.11 ? 19  LYS B CA   1  
ATOM 2671   C C    . LYS B 1 19  ? -10.894 5.379   -9.619  1.00 13.44 ? 19  LYS B C    1  
ATOM 2672   O O    . LYS B 1 19  ? -11.446 6.474   -9.710  1.00 12.01 ? 19  LYS B O    1  
ATOM 2673   C CB   . LYS B 1 19  ? -10.693 4.361   -11.879 1.00 40.42 ? 19  LYS B CB   1  
ATOM 2674   C CG   . LYS B 1 19  ? -9.809  3.790   -12.993 1.00 41.13 ? 19  LYS B CG   1  
ATOM 2675   C CD   . LYS B 1 19  ? -10.615 3.416   -14.246 1.00 63.30 ? 19  LYS B CD   1  
ATOM 2676   C CE   . LYS B 1 19  ? -11.229 4.631   -14.956 1.00 42.23 ? 19  LYS B CE   1  
ATOM 2677   N NZ   . LYS B 1 19  ? -12.049 4.233   -16.122 1.00 12.25 ? 19  LYS B NZ   1  
ATOM 2678   H H    . LYS B 1 19  ? -9.233  2.984   -10.201 1.00 51.04 ? 19  LYS B H    1  
ATOM 2679   H HA   . LYS B 1 19  ? -9.331  5.793   -11.020 1.00 71.21 ? 19  LYS B HA   1  
ATOM 2680   H HB2  . LYS B 1 19  ? -11.346 3.566   -11.526 1.00 13.40 ? 19  LYS B HB2  1  
ATOM 2681   H HB3  . LYS B 1 19  ? -11.307 5.150   -12.302 1.00 54.15 ? 19  LYS B HB3  1  
ATOM 2682   H HG2  . LYS B 1 19  ? -9.062  4.530   -13.263 1.00 73.33 ? 19  LYS B HG2  1  
ATOM 2683   H HG3  . LYS B 1 19  ? -9.307  2.904   -12.619 1.00 52.02 ? 19  LYS B HG3  1  
ATOM 2684   H HD2  . LYS B 1 19  ? -9.959  2.906   -14.943 1.00 72.23 ? 19  LYS B HD2  1  
ATOM 2685   H HD3  . LYS B 1 19  ? -11.414 2.737   -13.961 1.00 33.33 ? 19  LYS B HD3  1  
ATOM 2686   H HE2  . LYS B 1 19  ? -11.855 5.169   -14.261 1.00 45.52 ? 19  LYS B HE2  1  
ATOM 2687   H HE3  . LYS B 1 19  ? -10.432 5.281   -15.297 1.00 23.32 ? 19  LYS B HE3  1  
ATOM 2688   H HZ1  . LYS B 1 19  ? -12.231 5.050   -16.733 1.00 51.12 ? 19  LYS B HZ1  1  
ATOM 2689   H HZ2  . LYS B 1 19  ? -12.959 3.843   -15.808 1.00 32.32 ? 19  LYS B HZ2  1  
ATOM 2690   H HZ3  . LYS B 1 19  ? -11.551 3.505   -16.672 1.00 40.20 ? 19  LYS B HZ3  1  
ATOM 2691   N N    . ASP B 1 20  ? -11.138 4.508   -8.633  1.00 71.33 ? 20  ASP B N    1  
ATOM 2692   C CA   . ASP B 1 20  ? -12.184 4.728   -7.626  1.00 54.20 ? 20  ASP B CA   1  
ATOM 2693   C C    . ASP B 1 20  ? -11.955 3.803   -6.428  1.00 2.34  ? 20  ASP B C    1  
ATOM 2694   O O    . ASP B 1 20  ? -11.472 2.677   -6.588  1.00 63.41 ? 20  ASP B O    1  
ATOM 2695   C CB   . ASP B 1 20  ? -13.590 4.484   -8.239  1.00 70.34 ? 20  ASP B CB   1  
ATOM 2696   C CG   . ASP B 1 20  ? -14.748 4.990   -7.360  1.00 25.35 ? 20  ASP B CG   1  
ATOM 2697   O OD1  . ASP B 1 20  ? -15.143 4.286   -6.409  1.00 74.20 ? 20  ASP B OD1  1  
ATOM 2698   O OD2  . ASP B 1 20  ? -15.276 6.092   -7.631  1.00 35.25 ? 20  ASP B OD2  1  
ATOM 2699   H H    . ASP B 1 20  ? -10.586 3.699   -8.566  1.00 61.22 ? 20  ASP B H    1  
ATOM 2700   H HA   . ASP B 1 20  ? -12.113 5.760   -7.294  1.00 53.21 ? 20  ASP B HA   1  
ATOM 2701   H HB2  . ASP B 1 20  ? -13.643 4.983   -9.202  1.00 75.41 ? 20  ASP B HB2  1  
ATOM 2702   H HB3  . ASP B 1 20  ? -13.723 3.419   -8.409  1.00 75.05 ? 20  ASP B HB3  1  
ATOM 2703   N N    . ILE B 1 21  ? -12.328 4.301   -5.239  1.00 71.33 ? 21  ILE B N    1  
ATOM 2704   C CA   . ILE B 1 21  ? -12.213 3.603   -3.951  1.00 44.14 ? 21  ILE B CA   1  
ATOM 2705   C C    . ILE B 1 21  ? -13.443 3.931   -3.114  1.00 2.21  ? 21  ILE B C    1  
ATOM 2706   O O    . ILE B 1 21  ? -13.983 5.047   -3.178  1.00 60.42 ? 21  ILE B O    1  
ATOM 2707   C CB   . ILE B 1 21  ? -10.899 4.009   -3.136  1.00 20.41 ? 21  ILE B CB   1  
ATOM 2708   C CG1  . ILE B 1 21  ? -9.622  3.483   -3.855  1.00 72.32 ? 21  ILE B CG1  1  
ATOM 2709   C CG2  . ILE B 1 21  ? -10.928 3.532   -1.647  1.00 41.54 ? 21  ILE B CG2  1  
ATOM 2710   C CD1  . ILE B 1 21  ? -9.577  1.979   -4.031  1.00 53.43 ? 21  ILE B CD1  1  
ATOM 2711   H H    . ILE B 1 21  ? -12.756 5.179   -5.233  1.00 12.12 ? 21  ILE B H    1  
ATOM 2712   H HA   . ILE B 1 21  ? -12.191 2.529   -4.140  1.00 14.31 ? 21  ILE B HA   1  
ATOM 2713   H HB   . ILE B 1 21  ? -10.854 5.094   -3.122  1.00 20.33 ? 21  ILE B HB   1  
ATOM 2714   H HG12 . ILE B 1 21  ? -9.581  3.914   -4.847  1.00 43.24 ? 21  ILE B HG12 1  
ATOM 2715   H HG13 . ILE B 1 21  ? -8.737  3.777   -3.321  1.00 45.44 ? 21  ILE B HG13 1  
ATOM 2716   H HG21 . ILE B 1 21  ? -10.098 3.949   -1.113  1.00 25.41 ? 21  ILE B HG21 1  
ATOM 2717   H HG22 . ILE B 1 21  ? -10.875 2.453   -1.600  1.00 12.25 ? 21  ILE B HG22 1  
ATOM 2718   H HG23 . ILE B 1 21  ? -11.847 3.859   -1.173  1.00 21.54 ? 21  ILE B HG23 1  
ATOM 2719   H HD11 . ILE B 1 21  ? -10.344 1.676   -4.723  1.00 10.35 ? 21  ILE B HD11 1  
ATOM 2720   H HD12 . ILE B 1 21  ? -9.736  1.482   -3.098  1.00 34.13 ? 21  ILE B HD12 1  
ATOM 2721   H HD13 . ILE B 1 21  ? -8.614  1.695   -4.426  1.00 24.25 ? 21  ILE B HD13 1  
ATOM 2722   N N    . SER B 1 22  ? -13.868 2.941   -2.341  1.00 64.34 ? 22  SER B N    1  
ATOM 2723   C CA   . SER B 1 22  ? -14.836 3.103   -1.280  1.00 52.31 ? 22  SER B CA   1  
ATOM 2724   C C    . SER B 1 22  ? -14.451 2.168   -0.127  1.00 72.14 ? 22  SER B C    1  
ATOM 2725   O O    . SER B 1 22  ? -13.963 1.058   -0.344  1.00 63.35 ? 22  SER B O    1  
ATOM 2726   C CB   . SER B 1 22  ? -16.266 2.810   -1.788  1.00 14.34 ? 22  SER B CB   1  
ATOM 2727   O OG   . SER B 1 22  ? -17.221 2.930   -0.745  1.00 1.51  ? 22  SER B OG   1  
ATOM 2728   H H    . SER B 1 22  ? -13.498 2.049   -2.490  1.00 25.20 ? 22  SER B H    1  
ATOM 2729   H HA   . SER B 1 22  ? -14.773 4.133   -0.925  1.00 65.42 ? 22  SER B HA   1  
ATOM 2730   H HB2  . SER B 1 22  ? -16.519 3.516   -2.568  1.00 52.20 ? 22  SER B HB2  1  
ATOM 2731   H HB3  . SER B 1 22  ? -16.314 1.805   -2.188  1.00 52.15 ? 22  SER B HB3  1  
ATOM 2732   H HG   . SER B 1 22  ? -18.102 3.018   -1.124  1.00 64.52 ? 22  SER B HG   1  
ATOM 2733   N N    . PHE B 1 23  ? -14.621 2.663   1.089   1.00 15.45 ? 23  PHE B N    1  
ATOM 2734   C CA   . PHE B 1 23  ? -14.488 1.895   2.320   1.00 20.02 ? 23  PHE B CA   1  
ATOM 2735   C C    . PHE B 1 23  ? -15.479 2.499   3.310   1.00 63.14 ? 23  PHE B C    1  
ATOM 2736   O O    . PHE B 1 23  ? -15.508 3.709   3.478   1.00 24.12 ? 23  PHE B O    1  
ATOM 2737   C CB   . PHE B 1 23  ? -13.032 1.932   2.880   1.00 34.35 ? 23  PHE B CB   1  
ATOM 2738   C CG   . PHE B 1 23  ? -12.826 1.087   4.146   1.00 72.30 ? 23  PHE B CG   1  
ATOM 2739   C CD1  . PHE B 1 23  ? -12.600 -0.287  4.057   1.00 55.22 ? 23  PHE B CD1  1  
ATOM 2740   C CD2  . PHE B 1 23  ? -12.877 1.660   5.423   1.00 74.51 ? 23  PHE B CD2  1  
ATOM 2741   C CE1  . PHE B 1 23  ? -12.437 -1.062  5.190   1.00 60.10 ? 23  PHE B CE1  1  
ATOM 2742   C CE2  . PHE B 1 23  ? -12.709 0.882   6.554   1.00 12.13 ? 23  PHE B CE2  1  
ATOM 2743   C CZ   . PHE B 1 23  ? -12.490 -0.477  6.439   1.00 21.53 ? 23  PHE B CZ   1  
ATOM 2744   H H    . PHE B 1 23  ? -14.865 3.610   1.170   1.00 53.02 ? 23  PHE B H    1  
ATOM 2745   H HA   . PHE B 1 23  ? -14.770 0.859   2.114   1.00 73.13 ? 23  PHE B HA   1  
ATOM 2746   H HB2  . PHE B 1 23  ? -12.356 1.561   2.117   1.00 22.32 ? 23  PHE B HB2  1  
ATOM 2747   H HB3  . PHE B 1 23  ? -12.755 2.960   3.109   1.00 52.54 ? 23  PHE B HB3  1  
ATOM 2748   H HD1  . PHE B 1 23  ? -12.557 -0.754  3.079   1.00 52.23 ? 23  PHE B HD1  1  
ATOM 2749   H HD2  . PHE B 1 23  ? -13.049 2.725   5.523   1.00 73.03 ? 23  PHE B HD2  1  
ATOM 2750   H HE1  . PHE B 1 23  ? -12.265 -2.128  5.097   1.00 5.12  ? 23  PHE B HE1  1  
ATOM 2751   H HE2  . PHE B 1 23  ? -12.751 1.338   7.535   1.00 74.55 ? 23  PHE B HE2  1  
ATOM 2752   H HZ   . PHE B 1 23  ? -12.363 -1.084  7.327   1.00 54.54 ? 23  PHE B HZ   1  
ATOM 2753   N N    . GLU B 1 24  ? -16.340 1.665   3.888   1.00 61.24 ? 24  GLU B N    1  
ATOM 2754   C CA   . GLU B 1 24  ? -17.293 2.073   4.924   1.00 1.34  ? 24  GLU B CA   1  
ATOM 2755   C C    . GLU B 1 24  ? -17.267 1.027   6.031   1.00 35.43 ? 24  GLU B C    1  
ATOM 2756   O O    . GLU B 1 24  ? -17.611 -0.124  5.785   1.00 33.25 ? 24  GLU B O    1  
ATOM 2757   C CB   . GLU B 1 24  ? -18.726 2.172   4.342   1.00 63.43 ? 24  GLU B CB   1  
ATOM 2758   C CG   . GLU B 1 24  ? -18.892 3.167   3.181   1.00 22.32 ? 24  GLU B CG   1  
ATOM 2759   C CD   . GLU B 1 24  ? -20.347 3.267   2.720   1.00 1.11  ? 24  GLU B CD   1  
ATOM 2760   O OE1  . GLU B 1 24  ? -21.072 4.170   3.194   1.00 3.33  ? 24  GLU B OE1  1  
ATOM 2761   O OE2  . GLU B 1 24  ? -20.792 2.415   1.927   1.00 53.15 ? 24  GLU B OE2  1  
ATOM 2762   H H    . GLU B 1 24  ? -16.350 0.735   3.597   1.00 71.24 ? 24  GLU B H    1  
ATOM 2763   H HA   . GLU B 1 24  ? -16.999 3.042   5.331   1.00 55.31 ? 24  GLU B HA   1  
ATOM 2764   H HB2  . GLU B 1 24  ? -19.024 1.189   3.984   1.00 4.32  ? 24  GLU B HB2  1  
ATOM 2765   H HB3  . GLU B 1 24  ? -19.404 2.466   5.135   1.00 65.02 ? 24  GLU B HB3  1  
ATOM 2766   H HG2  . GLU B 1 24  ? -18.547 4.148   3.501   1.00 60.32 ? 24  GLU B HG2  1  
ATOM 2767   H HG3  . GLU B 1 24  ? -18.277 2.837   2.349   1.00 25.13 ? 24  GLU B HG3  1  
ATOM 2768   N N    . ALA B 1 25  ? -16.858 1.416   7.234   1.00 64.54 ? 25  ALA B N    1  
ATOM 2769   C CA   . ALA B 1 25  ? -16.901 0.547   8.410   1.00 2.24  ? 25  ALA B CA   1  
ATOM 2770   C C    . ALA B 1 25  ? -18.055 1.035   9.308   1.00 53.13 ? 25  ALA B C    1  
ATOM 2771   O O    . ALA B 1 25  ? -17.846 1.888   10.172  1.00 42.11 ? 25  ALA B O    1  
ATOM 2772   C CB   . ALA B 1 25  ? -15.539 0.549   9.126   1.00 43.53 ? 25  ALA B CB   1  
ATOM 2773   H H    . ALA B 1 25  ? -16.508 2.322   7.336   1.00 0.04  ? 25  ALA B H    1  
ATOM 2774   H HA   . ALA B 1 25  ? -17.114 -0.473  8.094   1.00 51.02 ? 25  ALA B HA   1  
ATOM 2775   H HB1  . ALA B 1 25  ? -14.740 0.438   8.404   1.00 62.44 ? 25  ALA B HB1  1  
ATOM 2776   H HB2  . ALA B 1 25  ? -15.496 -0.272  9.823   1.00 41.23 ? 25  ALA B HB2  1  
ATOM 2777   H HB3  . ALA B 1 25  ? -15.404 1.465   9.680   1.00 22.01 ? 25  ALA B HB3  1  
ATOM 2778   N N    . PRO B 1 26  ? -19.323 0.544   9.052   1.00 21.11 ? 26  PRO B N    1  
ATOM 2779   C CA   . PRO B 1 26  ? -20.546 1.108   9.674   1.00 50.30 ? 26  PRO B CA   1  
ATOM 2780   C C    . PRO B 1 26  ? -20.564 0.900   11.201  1.00 2.33  ? 26  PRO B C    1  
ATOM 2781   O O    . PRO B 1 26  ? -20.721 1.852   11.968  1.00 25.41 ? 26  PRO B O    1  
ATOM 2782   C CB   . PRO B 1 26  ? -21.702 0.349   8.955   1.00 45.45 ? 26  PRO B CB   1  
ATOM 2783   C CG   . PRO B 1 26  ? -21.089 -0.938  8.474   1.00 52.50 ? 26  PRO B CG   1  
ATOM 2784   C CD   . PRO B 1 26  ? -19.653 -0.603  8.148   1.00 14.50 ? 26  PRO B CD   1  
ATOM 2785   H HA   . PRO B 1 26  ? -20.629 2.171   9.466   1.00 2.42  ? 26  PRO B HA   1  
ATOM 2786   H HB2  . PRO B 1 26  ? -22.530 0.162   9.638   1.00 0.31  ? 26  PRO B HB2  1  
ATOM 2787   H HB3  . PRO B 1 26  ? -22.055 0.926   8.109   1.00 54.23 ? 26  PRO B HB3  1  
ATOM 2788   H HG2  . PRO B 1 26  ? -21.139 -1.689  9.262   1.00 53.41 ? 26  PRO B HG2  1  
ATOM 2789   H HG3  . PRO B 1 26  ? -21.599 -1.300  7.586   1.00 21.04 ? 26  PRO B HG3  1  
ATOM 2790   H HD2  . PRO B 1 26  ? -19.005 -1.451  8.348   1.00 73.03 ? 26  PRO B HD2  1  
ATOM 2791   H HD3  . PRO B 1 26  ? -19.555 -0.302  7.109   1.00 41.03 ? 26  PRO B HD3  1  
ATOM 2792   N N    . ASN B 1 27  ? -20.324 -0.349  11.619  1.00 21.22 ? 27  ASN B N    1  
ATOM 2793   C CA   . ASN B 1 27  ? -20.385 -0.758  13.030  1.00 2.25  ? 27  ASN B CA   1  
ATOM 2794   C C    . ASN B 1 27  ? -18.986 -0.755  13.671  1.00 54.11 ? 27  ASN B C    1  
ATOM 2795   O O    . ASN B 1 27  ? -18.840 -1.252  14.791  1.00 65.14 ? 27  ASN B O    1  
ATOM 2796   C CB   . ASN B 1 27  ? -21.024 -2.170  13.141  1.00 72.35 ? 27  ASN B CB   1  
ATOM 2797   C CG   . ASN B 1 27  ? -22.454 -2.248  12.593  1.00 42.41 ? 27  ASN B CG   1  
ATOM 2798   O OD1  . ASN B 1 27  ? -23.185 -1.256  12.573  1.00 11.32 ? 27  ASN B OD1  1  
ATOM 2799   N ND2  . ASN B 1 27  ? -22.879 -3.433  12.179  1.00 10.21 ? 27  ASN B ND2  1  
ATOM 2800   H H    . ASN B 1 27  ? -20.077 -1.023  10.954  1.00 62.34 ? 27  ASN B H    1  
ATOM 2801   H HA   . ASN B 1 27  ? -21.015 -0.047  13.567  1.00 12.11 ? 27  ASN B HA   1  
ATOM 2802   H HB2  . ASN B 1 27  ? -20.411 -2.880  12.598  1.00 12.10 ? 27  ASN B HB2  1  
ATOM 2803   H HB3  . ASN B 1 27  ? -21.050 -2.462  14.185  1.00 3.25  ? 27  ASN B HB3  1  
ATOM 2804   H HD21 . ASN B 1 27  ? -22.261 -4.196  12.245  1.00 4.54  ? 27  ASN B HD21 1  
ATOM 2805   H HD22 . ASN B 1 27  ? -23.786 -3.501  11.824  1.00 75.12 ? 27  ASN B HD22 1  
ATOM 2806   N N    . ALA B 1 28  ? -18.007 -0.087  12.987  1.00 35.35 ? 28  ALA B N    1  
ATOM 2807   C CA   . ALA B 1 28  ? -16.543 -0.209  13.242  1.00 33.24 ? 28  ALA B CA   1  
ATOM 2808   C C    . ALA B 1 28  ? -16.151 -0.281  14.750  1.00 2.31  ? 28  ALA B C    1  
ATOM 2809   O O    . ALA B 1 28  ? -15.739 -1.354  15.195  1.00 53.14 ? 28  ALA B O    1  
ATOM 2810   C CB   . ALA B 1 28  ? -15.753 0.902   12.515  1.00 42.42 ? 28  ALA B CB   1  
ATOM 2811   H H    . ALA B 1 28  ? -18.290 0.519   12.271  1.00 2.12  ? 28  ALA B H    1  
ATOM 2812   H HA   . ALA B 1 28  ? -16.242 -1.147  12.773  1.00 52.42 ? 28  ALA B HA   1  
ATOM 2813   H HB1  . ALA B 1 28  ? -15.854 1.842   13.040  1.00 61.41 ? 28  ALA B HB1  1  
ATOM 2814   H HB2  . ALA B 1 28  ? -16.140 1.023   11.514  1.00 33.21 ? 28  ALA B HB2  1  
ATOM 2815   H HB3  . ALA B 1 28  ? -14.706 0.635   12.457  1.00 41.32 ? 28  ALA B HB3  1  
ATOM 2816   N N    . PRO B 1 29  ? -16.377 0.806   15.589  1.00 62.11 ? 29  PRO B N    1  
ATOM 2817   C CA   . PRO B 1 29  ? -15.820 0.874   16.974  1.00 43.34 ? 29  PRO B CA   1  
ATOM 2818   C C    . PRO B 1 29  ? -16.351 -0.225  17.916  1.00 34.20 ? 29  PRO B C    1  
ATOM 2819   O O    . PRO B 1 29  ? -15.673 -0.616  18.878  1.00 1.03  ? 29  PRO B O    1  
ATOM 2820   C CB   . PRO B 1 29  ? -16.240 2.286   17.471  1.00 33.30 ? 29  PRO B CB   1  
ATOM 2821   C CG   . PRO B 1 29  ? -17.410 2.684   16.622  1.00 43.30 ? 29  PRO B CG   1  
ATOM 2822   C CD   . PRO B 1 29  ? -17.195 2.025   15.285  1.00 42.45 ? 29  PRO B CD   1  
ATOM 2823   H HA   . PRO B 1 29  ? -14.740 0.809   16.950  1.00 74.34 ? 29  PRO B HA   1  
ATOM 2824   H HB2  . PRO B 1 29  ? -16.507 2.267   18.528  1.00 11.14 ? 29  PRO B HB2  1  
ATOM 2825   H HB3  . PRO B 1 29  ? -15.424 2.982   17.322  1.00 11.14 ? 29  PRO B HB3  1  
ATOM 2826   H HG2  . PRO B 1 29  ? -18.337 2.337   17.076  1.00 2.25  ? 29  PRO B HG2  1  
ATOM 2827   H HG3  . PRO B 1 29  ? -17.436 3.761   16.503  1.00 44.34 ? 29  PRO B HG3  1  
ATOM 2828   H HD2  . PRO B 1 29  ? -18.151 1.754   14.835  1.00 65.53 ? 29  PRO B HD2  1  
ATOM 2829   H HD3  . PRO B 1 29  ? -16.647 2.681   14.618  1.00 3.33  ? 29  PRO B HD3  1  
ATOM 2830   N N    . HIS B 1 30  ? -17.551 -0.732  17.613  1.00 54.11 ? 30  HIS B N    1  
ATOM 2831   C CA   . HIS B 1 30  ? -18.244 -1.716  18.457  1.00 65.34 ? 30  HIS B CA   1  
ATOM 2832   C C    . HIS B 1 30  ? -17.960 -3.146  17.987  1.00 71.35 ? 30  HIS B C    1  
ATOM 2833   O O    . HIS B 1 30  ? -17.689 -4.022  18.809  1.00 52.12 ? 30  HIS B O    1  
ATOM 2834   C CB   . HIS B 1 30  ? -19.758 -1.431  18.455  1.00 1.35  ? 30  HIS B CB   1  
ATOM 2835   C CG   . HIS B 1 30  ? -20.109 -0.124  19.104  1.00 63.12 ? 30  HIS B CG   1  
ATOM 2836   N ND1  . HIS B 1 30  ? -20.090 1.079   18.435  1.00 12.40 ? 30  HIS B ND1  1  
ATOM 2837   C CD2  . HIS B 1 30  ? -20.451 0.164   20.379  1.00 40.32 ? 30  HIS B CD2  1  
ATOM 2838   C CE1  . HIS B 1 30  ? -20.392 2.047   19.276  1.00 1.02  ? 30  HIS B CE1  1  
ATOM 2839   N NE2  . HIS B 1 30  ? -20.615 1.519   20.460  1.00 63.33 ? 30  HIS B NE2  1  
ATOM 2840   H H    . HIS B 1 30  ? -17.976 -0.453  16.777  1.00 51.43 ? 30  HIS B H    1  
ATOM 2841   H HA   . HIS B 1 30  ? -17.875 -1.609  19.477  1.00 54.14 ? 30  HIS B HA   1  
ATOM 2842   H HB2  . HIS B 1 30  ? -20.119 -1.403  17.433  1.00 33.20 ? 30  HIS B HB2  1  
ATOM 2843   H HB3  . HIS B 1 30  ? -20.279 -2.222  18.988  1.00 43.11 ? 30  HIS B HB3  1  
ATOM 2844   H HD1  . HIS B 1 30  ? -19.902 1.206   17.480  1.00 41.44 ? 30  HIS B HD1  1  
ATOM 2845   H HD2  . HIS B 1 30  ? -20.563 -0.548  21.191  1.00 43.40 ? 30  HIS B HD2  1  
ATOM 2846   H HE1  . HIS B 1 30  ? -20.449 3.097   19.035  1.00 2.22  ? 30  HIS B HE1  1  
ATOM 2847   H HE2  . HIS B 1 30  ? -21.054 1.986   21.200  1.00 37.61 ? 30  HIS B HE2  1  
ATOM 2848   N N    . VAL B 1 31  ? -17.966 -3.351  16.659  1.00 73.32 ? 31  VAL B N    1  
ATOM 2849   C CA   . VAL B 1 31  ? -17.878 -4.692  16.037  1.00 41.14 ? 31  VAL B CA   1  
ATOM 2850   C C    . VAL B 1 31  ? -16.469 -5.321  16.225  1.00 23.31 ? 31  VAL B C    1  
ATOM 2851   O O    . VAL B 1 31  ? -16.287 -6.517  16.008  1.00 53.24 ? 31  VAL B O    1  
ATOM 2852   C CB   . VAL B 1 31  ? -18.268 -4.622  14.510  1.00 13.41 ? 31  VAL B CB   1  
ATOM 2853   C CG1  . VAL B 1 31  ? -17.155 -3.970  13.662  1.00 12.22 ? 31  VAL B CG1  1  
ATOM 2854   C CG2  . VAL B 1 31  ? -18.662 -6.001  13.946  1.00 62.12 ? 31  VAL B CG2  1  
ATOM 2855   H H    . VAL B 1 31  ? -18.022 -2.569  16.070  1.00 12.25 ? 31  VAL B H    1  
ATOM 2856   H HA   . VAL B 1 31  ? -18.604 -5.327  16.542  1.00 55.44 ? 31  VAL B HA   1  
ATOM 2857   H HB   . VAL B 1 31  ? -19.144 -3.978  14.433  1.00 73.53 ? 31  VAL B HB   1  
ATOM 2858   H HG11 . VAL B 1 31  ? -16.858 -3.034  14.110  1.00 24.14 ? 31  VAL B HG11 1  
ATOM 2859   H HG12 . VAL B 1 31  ? -17.515 -3.782  12.659  1.00 11.34 ? 31  VAL B HG12 1  
ATOM 2860   H HG13 . VAL B 1 31  ? -16.295 -4.626  13.615  1.00 61.12 ? 31  VAL B HG13 1  
ATOM 2861   H HG21 . VAL B 1 31  ? -17.788 -6.636  13.892  1.00 22.31 ? 31  VAL B HG21 1  
ATOM 2862   H HG22 . VAL B 1 31  ? -19.082 -5.890  12.955  1.00 64.52 ? 31  VAL B HG22 1  
ATOM 2863   H HG23 . VAL B 1 31  ? -19.392 -6.468  14.589  1.00 71.23 ? 31  VAL B HG23 1  
ATOM 2864   N N    . PHE B 1 32  ? -15.485 -4.494  16.662  1.00 12.15 ? 32  PHE B N    1  
ATOM 2865   C CA   . PHE B 1 32  ? -14.111 -4.956  16.999  1.00 24.15 ? 32  PHE B CA   1  
ATOM 2866   C C    . PHE B 1 32  ? -14.086 -5.959  18.178  1.00 71.03 ? 32  PHE B C    1  
ATOM 2867   O O    . PHE B 1 32  ? -13.059 -6.610  18.419  1.00 52.12 ? 32  PHE B O    1  
ATOM 2868   C CB   . PHE B 1 32  ? -13.193 -3.750  17.327  1.00 44.41 ? 32  PHE B CB   1  
ATOM 2869   C CG   . PHE B 1 32  ? -12.887 -2.823  16.150  1.00 53.41 ? 32  PHE B CG   1  
ATOM 2870   C CD1  . PHE B 1 32  ? -12.575 -3.340  14.890  1.00 22.43 ? 32  PHE B CD1  1  
ATOM 2871   C CD2  . PHE B 1 32  ? -12.874 -1.439  16.312  1.00 21.12 ? 32  PHE B CD2  1  
ATOM 2872   C CE1  . PHE B 1 32  ? -12.270 -2.499  13.837  1.00 3.13  ? 32  PHE B CE1  1  
ATOM 2873   C CE2  . PHE B 1 32  ? -12.574 -0.606  15.255  1.00 31.55 ? 32  PHE B CE2  1  
ATOM 2874   C CZ   . PHE B 1 32  ? -12.272 -1.133  14.020  1.00 1.33  ? 32  PHE B CZ   1  
ATOM 2875   H H    . PHE B 1 32  ? -15.687 -3.536  16.746  1.00 24.43 ? 32  PHE B H    1  
ATOM 2876   H HA   . PHE B 1 32  ? -13.719 -5.460  16.123  1.00 51.25 ? 32  PHE B HA   1  
ATOM 2877   H HB2  . PHE B 1 32  ? -13.658 -3.162  18.108  1.00 51.40 ? 32  PHE B HB2  1  
ATOM 2878   H HB3  . PHE B 1 32  ? -12.239 -4.119  17.699  1.00 32.04 ? 32  PHE B HB3  1  
ATOM 2879   H HD1  . PHE B 1 32  ? -12.578 -4.412  14.735  1.00 34.15 ? 32  PHE B HD1  1  
ATOM 2880   H HD2  . PHE B 1 32  ? -13.109 -1.012  17.281  1.00 42.35 ? 32  PHE B HD2  1  
ATOM 2881   H HE1  . PHE B 1 32  ? -12.031 -2.913  12.866  1.00 24.23 ? 32  PHE B HE1  1  
ATOM 2882   H HE2  . PHE B 1 32  ? -12.574 0.463   15.397  1.00 61.21 ? 32  PHE B HE2  1  
ATOM 2883   H HZ   . PHE B 1 32  ? -12.034 -0.475  13.192  1.00 32.31 ? 32  PHE B HZ   1  
ATOM 2884   N N    . GLN B 1 33  ? -15.206 -6.052  18.918  1.00 64.50 ? 33  GLN B N    1  
ATOM 2885   C CA   . GLN B 1 33  ? -15.410 -7.072  19.978  1.00 41.32 ? 33  GLN B CA   1  
ATOM 2886   C C    . GLN B 1 33  ? -15.343 -8.502  19.391  1.00 11.44 ? 33  GLN B C    1  
ATOM 2887   O O    . GLN B 1 33  ? -14.958 -9.459  20.069  1.00 30.33 ? 33  GLN B O    1  
ATOM 2888   C CB   . GLN B 1 33  ? -16.787 -6.842  20.668  1.00 12.42 ? 33  GLN B CB   1  
ATOM 2889   C CG   . GLN B 1 33  ? -18.009 -6.987  19.730  1.00 64.32 ? 33  GLN B CG   1  
ATOM 2890   C CD   . GLN B 1 33  ? -19.340 -6.692  20.413  1.00 73.33 ? 33  GLN B CD   1  
ATOM 2891   O OE1  . GLN B 1 33  ? -19.992 -7.594  20.943  1.00 60.44 ? 33  GLN B OE1  1  
ATOM 2892   N NE2  . GLN B 1 33  ? -19.744 -5.427  20.422  1.00 11.24 ? 33  GLN B NE2  1  
ATOM 2893   H H    . GLN B 1 33  ? -15.924 -5.408  18.749  1.00 63.02 ? 33  GLN B H    1  
ATOM 2894   H HA   . GLN B 1 33  ? -14.618 -6.954  20.713  1.00 62.51 ? 33  GLN B HA   1  
ATOM 2895   H HB2  . GLN B 1 33  ? -16.895 -7.550  21.484  1.00 42.53 ? 33  GLN B HB2  1  
ATOM 2896   H HB3  . GLN B 1 33  ? -16.798 -5.840  21.082  1.00 11.04 ? 33  GLN B HB3  1  
ATOM 2897   H HG2  . GLN B 1 33  ? -17.889 -6.306  18.894  1.00 54.23 ? 33  GLN B HG2  1  
ATOM 2898   H HG3  . GLN B 1 33  ? -18.033 -8.002  19.347  1.00 22.11 ? 33  GLN B HG3  1  
ATOM 2899   H HE21 . GLN B 1 33  ? -19.174 -4.757  19.996  1.00 75.40 ? 33  GLN B HE21 1  
ATOM 2900   H HE22 . GLN B 1 33  ? -20.599 -5.213  20.854  1.00 73.41 ? 33  GLN B HE22 1  
ATOM 2901   N N    . LYS B 1 34  ? -15.724 -8.606  18.114  1.00 74.31 ? 34  LYS B N    1  
ATOM 2902   C CA   . LYS B 1 34  ? -15.804 -9.857  17.365  1.00 35.44 ? 34  LYS B CA   1  
ATOM 2903   C C    . LYS B 1 34  ? -14.493 -10.095 16.600  1.00 61.13 ? 34  LYS B C    1  
ATOM 2904   O O    . LYS B 1 34  ? -14.186 -9.381  15.643  1.00 10.33 ? 34  LYS B O    1  
ATOM 2905   C CB   . LYS B 1 34  ? -17.021 -9.753  16.413  1.00 51.44 ? 34  LYS B CB   1  
ATOM 2906   C CG   . LYS B 1 34  ? -18.381 -9.787  17.152  1.00 32.35 ? 34  LYS B CG   1  
ATOM 2907   C CD   . LYS B 1 34  ? -19.587 -9.610  16.208  1.00 53.13 ? 34  LYS B CD   1  
ATOM 2908   C CE   . LYS B 1 34  ? -20.934 -9.822  16.917  1.00 62.01 ? 34  LYS B CE   1  
ATOM 2909   N NZ   . LYS B 1 34  ? -22.072 -9.676  15.977  1.00 23.21 ? 34  LYS B NZ   1  
ATOM 2910   H H    . LYS B 1 34  ? -15.957 -7.781  17.639  1.00 40.14 ? 34  LYS B H    1  
ATOM 2911   H HA   . LYS B 1 34  ? -15.970 -10.678 18.062  1.00 13.43 ? 34  LYS B HA   1  
ATOM 2912   H HB2  . LYS B 1 34  ? -16.952 -8.815  15.864  1.00 12.42 ? 34  LYS B HB2  1  
ATOM 2913   H HB3  . LYS B 1 34  ? -16.992 -10.564 15.694  1.00 23.31 ? 34  LYS B HB3  1  
ATOM 2914   H HG2  . LYS B 1 34  ? -18.473 -10.741 17.659  1.00 24.52 ? 34  LYS B HG2  1  
ATOM 2915   H HG3  . LYS B 1 34  ? -18.395 -8.993  17.891  1.00 44.25 ? 34  LYS B HG3  1  
ATOM 2916   H HD2  . LYS B 1 34  ? -19.567 -8.608  15.794  1.00 33.53 ? 34  LYS B HD2  1  
ATOM 2917   H HD3  . LYS B 1 34  ? -19.505 -10.327 15.398  1.00 44.23 ? 34  LYS B HD3  1  
ATOM 2918   H HE2  . LYS B 1 34  ? -20.963 -10.819 17.339  1.00 4.01  ? 34  LYS B HE2  1  
ATOM 2919   H HE3  . LYS B 1 34  ? -21.040 -9.092  17.711  1.00 21.54 ? 34  LYS B HE3  1  
ATOM 2920   H HZ1  . LYS B 1 34  ? -22.965 -9.909  16.454  1.00 32.51 ? 34  LYS B HZ1  1  
ATOM 2921   H HZ2  . LYS B 1 34  ? -21.950 -10.310 15.166  1.00 62.10 ? 34  LYS B HZ2  1  
ATOM 2922   H HZ3  . LYS B 1 34  ? -22.125 -8.699  15.632  1.00 62.10 ? 34  LYS B HZ3  1  
ATOM 2923   N N    . ASP B 1 35  ? -13.704 -11.077 17.062  1.00 34.23 ? 35  ASP B N    1  
ATOM 2924   C CA   . ASP B 1 35  ? -12.407 -11.420 16.453  1.00 42.44 ? 35  ASP B CA   1  
ATOM 2925   C C    . ASP B 1 35  ? -12.453 -12.835 15.854  1.00 54.34 ? 35  ASP B C    1  
ATOM 2926   O O    . ASP B 1 35  ? -12.488 -13.827 16.589  1.00 71.14 ? 35  ASP B O    1  
ATOM 2927   C CB   . ASP B 1 35  ? -11.262 -11.299 17.494  1.00 23.51 ? 35  ASP B CB   1  
ATOM 2928   C CG   . ASP B 1 35  ? -9.871  -11.627 16.907  1.00 71.02 ? 35  ASP B CG   1  
ATOM 2929   O OD1  . ASP B 1 35  ? -9.141  -12.475 17.474  1.00 73.12 ? 35  ASP B OD1  1  
ATOM 2930   O OD2  . ASP B 1 35  ? -9.506  -11.047 15.862  1.00 33.32 ? 35  ASP B OD2  1  
ATOM 2931   H H    . ASP B 1 35  ? -14.005 -11.594 17.835  1.00 72.20 ? 35  ASP B H    1  
ATOM 2932   H HA   . ASP B 1 35  ? -12.210 -10.709 15.649  1.00 65.33 ? 35  ASP B HA   1  
ATOM 2933   H HB2  . ASP B 1 35  ? -11.239 -10.284 17.872  1.00 21.13 ? 35  ASP B HB2  1  
ATOM 2934   H HB3  . ASP B 1 35  ? -11.465 -11.970 18.323  1.00 32.25 ? 35  ASP B HB3  1  
ATOM 2935   N N    . TRP B 1 36  ? -12.514 -12.893 14.519  1.00 74.33 ? 36  TRP B N    1  
ATOM 2936   C CA   . TRP B 1 36  ? -12.354 -14.124 13.718  1.00 35.51 ? 36  TRP B CA   1  
ATOM 2937   C C    . TRP B 1 36  ? -12.135 -13.715 12.250  1.00 40.31 ? 36  TRP B C    1  
ATOM 2938   O O    . TRP B 1 36  ? -11.820 -12.549 11.986  1.00 60.44 ? 36  TRP B O    1  
ATOM 2939   C CB   . TRP B 1 36  ? -13.571 -15.096 13.893  1.00 2.21  ? 36  TRP B CB   1  
ATOM 2940   C CG   . TRP B 1 36  ? -14.946 -14.493 13.639  1.00 52.51 ? 36  TRP B CG   1  
ATOM 2941   C CD1  . TRP B 1 36  ? -15.537 -14.236 12.432  1.00 15.01 ? 36  TRP B CD1  1  
ATOM 2942   C CD2  . TRP B 1 36  ? -15.913 -14.116 14.631  1.00 72.42 ? 36  TRP B CD2  1  
ATOM 2943   N NE1  . TRP B 1 36  ? -16.784 -13.702 12.614  1.00 65.53 ? 36  TRP B NE1  1  
ATOM 2944   C CE2  . TRP B 1 36  ? -17.043 -13.630 13.954  1.00 52.03 ? 36  TRP B CE2  1  
ATOM 2945   C CE3  . TRP B 1 36  ? -15.927 -14.141 16.030  1.00 61.44 ? 36  TRP B CE3  1  
ATOM 2946   C CZ2  . TRP B 1 36  ? -18.168 -13.176 14.622  1.00 30.24 ? 36  TRP B CZ2  1  
ATOM 2947   C CZ3  . TRP B 1 36  ? -17.050 -13.690 16.691  1.00 4.40  ? 36  TRP B CZ3  1  
ATOM 2948   C CH2  . TRP B 1 36  ? -18.159 -13.216 15.985  1.00 20.24 ? 36  TRP B CH2  1  
ATOM 2949   H H    . TRP B 1 36  ? -12.685 -12.055 14.036  1.00 31.52 ? 36  TRP B H    1  
ATOM 2950   H HA   . TRP B 1 36  ? -11.450 -14.620 14.061  1.00 71.34 ? 36  TRP B HA   1  
ATOM 2951   H HB2  . TRP B 1 36  ? -13.450 -15.932 13.217  1.00 63.31 ? 36  TRP B HB2  1  
ATOM 2952   H HB3  . TRP B 1 36  ? -13.559 -15.479 14.909  1.00 15.40 ? 36  TRP B HB3  1  
ATOM 2953   H HD1  . TRP B 1 36  ? -15.068 -14.410 11.478  1.00 71.34 ? 36  TRP B HD1  1  
ATOM 2954   H HE1  . TRP B 1 36  ? -17.395 -13.424 11.896  1.00 0.41  ? 36  TRP B HE1  1  
ATOM 2955   H HE3  . TRP B 1 36  ? -15.075 -14.504 16.593  1.00 5.32  ? 36  TRP B HE3  1  
ATOM 2956   H HZ2  . TRP B 1 36  ? -19.031 -12.810 14.091  1.00 51.32 ? 36  TRP B HZ2  1  
ATOM 2957   H HZ3  . TRP B 1 36  ? -17.080 -13.704 17.774  1.00 74.43 ? 36  TRP B HZ3  1  
ATOM 2958   H HH2  . TRP B 1 36  ? -19.020 -12.871 16.543  1.00 11.41 ? 36  TRP B HH2  1  
ATOM 2959   N N    . GLN B 1 37  ? -12.252 -14.672 11.308  1.00 44.44 ? 37  GLN B N    1  
ATOM 2960   C CA   . GLN B 1 37  ? -12.234 -14.375 9.861   1.00 0.12  ? 37  GLN B CA   1  
ATOM 2961   C C    . GLN B 1 37  ? -13.648 -13.921 9.439   1.00 31.50 ? 37  GLN B C    1  
ATOM 2962   O O    . GLN B 1 37  ? -14.550 -14.769 9.353   1.00 22.53 ? 37  GLN B O    1  
ATOM 2963   C CB   . GLN B 1 37  ? -11.786 -15.625 9.045   1.00 64.13 ? 37  GLN B CB   1  
ATOM 2964   C CG   . GLN B 1 37  ? -11.679 -15.406 7.512   1.00 21.32 ? 37  GLN B CG   1  
ATOM 2965   C CD   . GLN B 1 37  ? -10.632 -14.358 7.111   1.00 14.30 ? 37  GLN B CD   1  
ATOM 2966   O OE1  . GLN B 1 37  ? -9.454  -14.673 6.943   1.00 51.10 ? 37  GLN B OE1  1  
ATOM 2967   N NE2  . GLN B 1 37  ? -11.052 -13.115 6.923   1.00 30.32 ? 37  GLN B NE2  1  
ATOM 2968   H H    . GLN B 1 37  ? -12.361 -15.602 11.594  1.00 45.01 ? 37  GLN B H    1  
ATOM 2969   H HA   . GLN B 1 37  ? -11.531 -13.566 9.687   1.00 72.43 ? 37  GLN B HA   1  
ATOM 2970   H HB2  . GLN B 1 37  ? -10.815 -15.944 9.406   1.00 50.01 ? 37  GLN B HB2  1  
ATOM 2971   H HB3  . GLN B 1 37  ? -12.495 -16.431 9.224   1.00 52.11 ? 37  GLN B HB3  1  
ATOM 2972   H HG2  . GLN B 1 37  ? -11.415 -16.347 7.042   1.00 75.23 ? 37  GLN B HG2  1  
ATOM 2973   H HG3  . GLN B 1 37  ? -12.648 -15.092 7.138   1.00 10.40 ? 37  GLN B HG3  1  
ATOM 2974   H HE21 . GLN B 1 37  ? -12.003 -12.922 7.041   1.00 42.10 ? 37  GLN B HE21 1  
ATOM 2975   H HE22 . GLN B 1 37  ? -10.383 -12.438 6.675   1.00 32.05 ? 37  GLN B HE22 1  
ATOM 2976   N N    . PRO B 1 38  ? -13.883 -12.574 9.220   1.00 24.43 ? 38  PRO B N    1  
ATOM 2977   C CA   . PRO B 1 38  ? -15.230 -12.031 8.949   1.00 41.02 ? 38  PRO B CA   1  
ATOM 2978   C C    . PRO B 1 38  ? -15.911 -12.683 7.733   1.00 61.45 ? 38  PRO B C    1  
ATOM 2979   O O    . PRO B 1 38  ? -15.247 -13.075 6.766   1.00 14.03 ? 38  PRO B O    1  
ATOM 2980   C CB   . PRO B 1 38  ? -14.993 -10.502 8.719   1.00 23.30 ? 38  PRO B CB   1  
ATOM 2981   C CG   . PRO B 1 38  ? -13.526 -10.365 8.454   1.00 54.23 ? 38  PRO B CG   1  
ATOM 2982   C CD   . PRO B 1 38  ? -12.872 -11.479 9.240   1.00 33.43 ? 38  PRO B CD   1  
ATOM 2983   H HA   . PRO B 1 38  ? -15.868 -12.165 9.818   1.00 70.14 ? 38  PRO B HA   1  
ATOM 2984   H HB2  . PRO B 1 38  ? -15.581 -10.136 7.878   1.00 65.04 ? 38  PRO B HB2  1  
ATOM 2985   H HB3  . PRO B 1 38  ? -15.262 -9.946  9.612   1.00 32.54 ? 38  PRO B HB3  1  
ATOM 2986   H HG2  . PRO B 1 38  ? -13.328 -10.475 7.389   1.00 22.45 ? 38  PRO B HG2  1  
ATOM 2987   H HG3  . PRO B 1 38  ? -13.166 -9.399  8.800   1.00 54.13 ? 38  PRO B HG3  1  
ATOM 2988   H HD2  . PRO B 1 38  ? -11.948 -11.791 8.765   1.00 75.12 ? 38  PRO B HD2  1  
ATOM 2989   H HD3  . PRO B 1 38  ? -12.677 -11.162 10.261  1.00 42.31 ? 38  PRO B HD3  1  
ATOM 2990   N N    . GLU B 1 39  ? -17.230 -12.837 7.862   1.00 70.32 ? 39  GLU B N    1  
ATOM 2991   C CA   . GLU B 1 39  ? -18.143 -13.289 6.812   1.00 61.15 ? 39  GLU B CA   1  
ATOM 2992   C C    . GLU B 1 39  ? -18.012 -12.397 5.573   1.00 64.42 ? 39  GLU B C    1  
ATOM 2993   O O    . GLU B 1 39  ? -18.529 -11.272 5.539   1.00 41.44 ? 39  GLU B O    1  
ATOM 2994   C CB   . GLU B 1 39  ? -19.602 -13.276 7.360   1.00 12.43 ? 39  GLU B CB   1  
ATOM 2995   C CG   . GLU B 1 39  ? -19.937 -14.417 8.352   1.00 63.20 ? 39  GLU B CG   1  
ATOM 2996   C CD   . GLU B 1 39  ? -19.028 -14.468 9.599   1.00 4.15  ? 39  GLU B CD   1  
ATOM 2997   O OE1  . GLU B 1 39  ? -19.046 -13.521 10.397  1.00 13.32 ? 39  GLU B OE1  1  
ATOM 2998   O OE2  . GLU B 1 39  ? -18.287 -15.457 9.777   1.00 21.43 ? 39  GLU B OE2  1  
ATOM 2999   H H    . GLU B 1 39  ? -17.617 -12.637 8.737   1.00 24.21 ? 39  GLU B H    1  
ATOM 3000   H HA   . GLU B 1 39  ? -17.878 -14.309 6.550   1.00 44.52 ? 39  GLU B HA   1  
ATOM 3001   H HB2  . GLU B 1 39  ? -19.775 -12.331 7.867   1.00 52.40 ? 39  GLU B HB2  1  
ATOM 3002   H HB3  . GLU B 1 39  ? -20.297 -13.341 6.527   1.00 33.15 ? 39  GLU B HB3  1  
ATOM 3003   H HG2  . GLU B 1 39  ? -20.965 -14.303 8.677   1.00 42.12 ? 39  GLU B HG2  1  
ATOM 3004   H HG3  . GLU B 1 39  ? -19.849 -15.354 7.815   1.00 5.31  ? 39  GLU B HG3  1  
ATOM 3005   N N    . VAL B 1 40  ? -17.321 -12.928 4.561   1.00 63.11 ? 40  VAL B N    1  
ATOM 3006   C CA   . VAL B 1 40  ? -16.985 -12.191 3.336   1.00 65.03 ? 40  VAL B CA   1  
ATOM 3007   C C    . VAL B 1 40  ? -18.160 -12.297 2.345   1.00 54.30 ? 40  VAL B C    1  
ATOM 3008   O O    . VAL B 1 40  ? -18.999 -13.185 2.455   1.00 44.43 ? 40  VAL B O    1  
ATOM 3009   C CB   . VAL B 1 40  ? -15.653 -12.744 2.663   1.00 43.25 ? 40  VAL B CB   1  
ATOM 3010   C CG1  . VAL B 1 40  ? -15.164 -11.843 1.493   1.00 71.13 ? 40  VAL B CG1  1  
ATOM 3011   C CG2  . VAL B 1 40  ? -14.526 -12.949 3.709   1.00 22.23 ? 40  VAL B CG2  1  
ATOM 3012   H H    . VAL B 1 40  ? -17.031 -13.861 4.638   1.00 22.12 ? 40  VAL B H    1  
ATOM 3013   H HA   . VAL B 1 40  ? -16.832 -11.144 3.599   1.00 53.12 ? 40  VAL B HA   1  
ATOM 3014   H HB   . VAL B 1 40  ? -15.879 -13.721 2.242   1.00 72.42 ? 40  VAL B HB   1  
ATOM 3015   H HG11 . VAL B 1 40  ? -14.274 -12.270 1.047   1.00 65.11 ? 40  VAL B HG11 1  
ATOM 3016   H HG12 . VAL B 1 40  ? -14.938 -10.852 1.860   1.00 12.11 ? 40  VAL B HG12 1  
ATOM 3017   H HG13 . VAL B 1 40  ? -15.941 -11.774 0.740   1.00 0.23  ? 40  VAL B HG13 1  
ATOM 3018   H HG21 . VAL B 1 40  ? -14.272 -12.002 4.170   1.00 14.52 ? 40  VAL B HG21 1  
ATOM 3019   H HG22 . VAL B 1 40  ? -13.644 -13.358 3.230   1.00 4.01  ? 40  VAL B HG22 1  
ATOM 3020   H HG23 . VAL B 1 40  ? -14.860 -13.637 4.476   1.00 13.33 ? 40  VAL B HG23 1  
ATOM 3021   N N    . LYS B 1 41  ? -18.252 -11.323 1.457   1.00 71.43 ? 41  LYS B N    1  
ATOM 3022   C CA   . LYS B 1 41  ? -19.093 -11.369 0.274   1.00 22.35 ? 41  LYS B CA   1  
ATOM 3023   C C    . LYS B 1 41  ? -18.412 -10.489 -0.765  1.00 15.34 ? 41  LYS B C    1  
ATOM 3024   O O    . LYS B 1 41  ? -18.457 -9.265  -0.661  1.00 70.13 ? 41  LYS B O    1  
ATOM 3025   C CB   . LYS B 1 41  ? -20.535 -10.860 0.554   1.00 30.43 ? 41  LYS B CB   1  
ATOM 3026   C CG   . LYS B 1 41  ? -21.461 -10.870 -0.689  1.00 52.31 ? 41  LYS B CG   1  
ATOM 3027   C CD   . LYS B 1 41  ? -22.760 -10.064 -0.476  1.00 64.04 ? 41  LYS B CD   1  
ATOM 3028   C CE   . LYS B 1 41  ? -23.737 -10.189 -1.658  1.00 34.53 ? 41  LYS B CE   1  
ATOM 3029   N NZ   . LYS B 1 41  ? -23.163 -9.672  -2.928  1.00 72.23 ? 41  LYS B NZ   1  
ATOM 3030   H H    . LYS B 1 41  ? -17.704 -10.527 1.593   1.00 74.22 ? 41  LYS B H    1  
ATOM 3031   H HA   . LYS B 1 41  ? -19.130 -12.396 -0.091  1.00 52.31 ? 41  LYS B HA   1  
ATOM 3032   H HB2  . LYS B 1 41  ? -20.981 -11.488 1.318   1.00 23.32 ? 41  LYS B HB2  1  
ATOM 3033   H HB3  . LYS B 1 41  ? -20.482 -9.846  0.935   1.00 40.20 ? 41  LYS B HB3  1  
ATOM 3034   H HG2  . LYS B 1 41  ? -20.922 -10.444 -1.531  1.00 53.32 ? 41  LYS B HG2  1  
ATOM 3035   H HG3  . LYS B 1 41  ? -21.716 -11.898 -0.920  1.00 4.43  ? 41  LYS B HG3  1  
ATOM 3036   H HD2  . LYS B 1 41  ? -23.254 -10.422 0.420   1.00 43.34 ? 41  LYS B HD2  1  
ATOM 3037   H HD3  . LYS B 1 41  ? -22.507 -9.017  -0.343  1.00 34.33 ? 41  LYS B HD3  1  
ATOM 3038   H HE2  . LYS B 1 41  ? -23.994 -11.232 -1.794  1.00 32.01 ? 41  LYS B HE2  1  
ATOM 3039   H HE3  . LYS B 1 41  ? -24.635 -9.632  -1.432  1.00 44.30 ? 41  LYS B HE3  1  
ATOM 3040   H HZ1  . LYS B 1 41  ? -22.968 -8.656  -2.849  1.00 13.33 ? 41  LYS B HZ1  1  
ATOM 3041   H HZ2  . LYS B 1 41  ? -23.834 -9.822  -3.709  1.00 63.21 ? 41  LYS B HZ2  1  
ATOM 3042   H HZ3  . LYS B 1 41  ? -22.280 -10.168 -3.151  1.00 64.41 ? 41  LYS B HZ3  1  
ATOM 3043   N N    . LEU B 1 42  ? -17.715 -11.103 -1.712  1.00 64.21 ? 42  LEU B N    1  
ATOM 3044   C CA   . LEU B 1 42  ? -17.143 -10.379 -2.850  1.00 65.23 ? 42  LEU B CA   1  
ATOM 3045   C C    . LEU B 1 42  ? -18.231 -10.317 -3.938  1.00 14.51 ? 42  LEU B C    1  
ATOM 3046   O O    . LEU B 1 42  ? -19.028 -11.251 -4.087  1.00 13.44 ? 42  LEU B O    1  
ATOM 3047   C CB   . LEU B 1 42  ? -15.829 -11.078 -3.315  1.00 5.31  ? 42  LEU B CB   1  
ATOM 3048   C CG   . LEU B 1 42  ? -14.910 -10.338 -4.363  1.00 60.31 ? 42  LEU B CG   1  
ATOM 3049   C CD1  . LEU B 1 42  ? -13.482 -10.914 -4.319  1.00 55.21 ? 42  LEU B CD1  1  
ATOM 3050   C CD2  . LEU B 1 42  ? -15.454 -10.413 -5.817  1.00 23.41 ? 42  LEU B CD2  1  
ATOM 3051   H H    . LEU B 1 42  ? -17.592 -12.075 -1.657  1.00 54.12 ? 42  LEU B H    1  
ATOM 3052   H HA   . LEU B 1 42  ? -16.906 -9.359  -2.528  1.00 53.22 ? 42  LEU B HA   1  
ATOM 3053   H HB2  . LEU B 1 42  ? -15.235 -11.254 -2.423  1.00 44.41 ? 42  LEU B HB2  1  
ATOM 3054   H HB3  . LEU B 1 42  ? -16.092 -12.048 -3.721  1.00 12.52 ? 42  LEU B HB3  1  
ATOM 3055   H HG   . LEU B 1 42  ? -14.841 -9.292  -4.091  1.00 11.02 ? 42  LEU B HG   1  
ATOM 3056   H HD11 . LEU B 1 42  ? -12.850 -10.383 -5.023  1.00 22.13 ? 42  LEU B HD11 1  
ATOM 3057   H HD12 . LEU B 1 42  ? -13.496 -11.965 -4.581  1.00 14.33 ? 42  LEU B HD12 1  
ATOM 3058   H HD13 . LEU B 1 42  ? -13.075 -10.801 -3.325  1.00 22.23 ? 42  LEU B HD13 1  
ATOM 3059   H HD21 . LEU B 1 42  ? -14.779 -9.898  -6.486  1.00 4.32  ? 42  LEU B HD21 1  
ATOM 3060   H HD22 . LEU B 1 42  ? -16.423 -9.939  -5.862  1.00 62.41 ? 42  LEU B HD22 1  
ATOM 3061   H HD23 . LEU B 1 42  ? -15.548 -11.448 -6.124  1.00 11.44 ? 42  LEU B HD23 1  
ATOM 3062   N N    . ASP B 1 43  ? -18.272 -9.207  -4.658  1.00 41.13 ? 43  ASP B N    1  
ATOM 3063   C CA   . ASP B 1 43  ? -19.248 -8.954  -5.712  1.00 51.02 ? 43  ASP B CA   1  
ATOM 3064   C C    . ASP B 1 43  ? -18.489 -8.256  -6.842  1.00 65.04 ? 43  ASP B C    1  
ATOM 3065   O O    . ASP B 1 43  ? -17.948 -7.172  -6.646  1.00 41.35 ? 43  ASP B O    1  
ATOM 3066   C CB   . ASP B 1 43  ? -20.415 -8.081  -5.163  1.00 72.34 ? 43  ASP B CB   1  
ATOM 3067   C CG   . ASP B 1 43  ? -21.668 -8.099  -6.059  1.00 3.45  ? 43  ASP B CG   1  
ATOM 3068   O OD1  . ASP B 1 43  ? -22.707 -8.664  -5.646  1.00 15.51 ? 43  ASP B OD1  1  
ATOM 3069   O OD2  . ASP B 1 43  ? -21.611 -7.578  -7.186  1.00 21.22 ? 43  ASP B OD2  1  
ATOM 3070   H H    . ASP B 1 43  ? -17.604 -8.521  -4.484  1.00 31.44 ? 43  ASP B H    1  
ATOM 3071   H HA   . ASP B 1 43  ? -19.638 -9.908  -6.071  1.00 14.15 ? 43  ASP B HA   1  
ATOM 3072   H HB2  . ASP B 1 43  ? -20.687 -8.445  -4.175  1.00 24.05 ? 43  ASP B HB2  1  
ATOM 3073   H HB3  . ASP B 1 43  ? -20.077 -7.052  -5.060  1.00 22.33 ? 43  ASP B HB3  1  
ATOM 3074   N N    . LEU B 1 44  ? -18.416 -8.905  -8.002  1.00 60.10 ? 44  LEU B N    1  
ATOM 3075   C CA   . LEU B 1 44  ? -17.617 -8.427  -9.136  1.00 54.12 ? 44  LEU B CA   1  
ATOM 3076   C C    . LEU B 1 44  ? -18.555 -7.689  -10.107 1.00 42.21 ? 44  LEU B C    1  
ATOM 3077   O O    . LEU B 1 44  ? -19.594 -8.230  -10.510 1.00 10.31 ? 44  LEU B O    1  
ATOM 3078   C CB   . LEU B 1 44  ? -16.926 -9.640  -9.829  1.00 72.03 ? 44  LEU B CB   1  
ATOM 3079   C CG   . LEU B 1 44  ? -15.701 -9.288  -10.723 1.00 23.25 ? 44  LEU B CG   1  
ATOM 3080   C CD1  . LEU B 1 44  ? -14.569 -8.658  -9.874  1.00 52.33 ? 44  LEU B CD1  1  
ATOM 3081   C CD2  . LEU B 1 44  ? -15.203 -10.522 -11.516 1.00 73.11 ? 44  LEU B CD2  1  
ATOM 3082   H H    . LEU B 1 44  ? -18.926 -9.730  -8.109  1.00 51.15 ? 44  LEU B H    1  
ATOM 3083   H HA   . LEU B 1 44  ? -16.842 -7.735  -8.768  1.00 72.30 ? 44  LEU B HA   1  
ATOM 3084   H HB2  . LEU B 1 44  ? -16.596 -10.334 -9.058  1.00 10.02 ? 44  LEU B HB2  1  
ATOM 3085   H HB3  . LEU B 1 44  ? -17.662 -10.152 -10.441 1.00 34.20 ? 44  LEU B HB3  1  
ATOM 3086   H HG   . LEU B 1 44  ? -16.007 -8.539  -11.446 1.00 33.42 ? 44  LEU B HG   1  
ATOM 3087   H HD11 . LEU B 1 44  ? -14.245 -9.354  -9.110  1.00 63.33 ? 44  LEU B HD11 1  
ATOM 3088   H HD12 . LEU B 1 44  ? -14.928 -7.751  -9.402  1.00 73.42 ? 44  LEU B HD12 1  
ATOM 3089   H HD13 . LEU B 1 44  ? -13.733 -8.412  -10.511 1.00 54.55 ? 44  LEU B HD13 1  
ATOM 3090   H HD21 . LEU B 1 44  ? -14.867 -11.292 -10.834 1.00 63.40 ? 44  LEU B HD21 1  
ATOM 3091   H HD22 . LEU B 1 44  ? -14.384 -10.232 -12.161 1.00 62.11 ? 44  LEU B HD22 1  
ATOM 3092   H HD23 . LEU B 1 44  ? -16.009 -10.910 -12.127 1.00 40.34 ? 44  LEU B HD23 1  
ATOM 3093   N N    . ASP B 1 45  ? -18.181 -6.462  -10.466 1.00 53.11 ? 45  ASP B N    1  
ATOM 3094   C CA   . ASP B 1 45  ? -19.017 -5.545  -11.257 1.00 42.24 ? 45  ASP B CA   1  
ATOM 3095   C C    . ASP B 1 45  ? -18.189 -4.991  -12.427 1.00 64.34 ? 45  ASP B C    1  
ATOM 3096   O O    . ASP B 1 45  ? -16.949 -4.948  -12.357 1.00 5.41  ? 45  ASP B O    1  
ATOM 3097   C CB   . ASP B 1 45  ? -19.563 -4.409  -10.342 1.00 34.51 ? 45  ASP B CB   1  
ATOM 3098   C CG   . ASP B 1 45  ? -20.592 -3.500  -11.040 1.00 61.44 ? 45  ASP B CG   1  
ATOM 3099   O OD1  . ASP B 1 45  ? -20.324 -2.294  -11.244 1.00 64.01 ? 45  ASP B OD1  1  
ATOM 3100   O OD2  . ASP B 1 45  ? -21.671 -3.999  -11.411 1.00 22.11 ? 45  ASP B OD2  1  
ATOM 3101   H H    . ASP B 1 45  ? -17.296 -6.155  -10.199 1.00 21.13 ? 45  ASP B H    1  
ATOM 3102   H HA   . ASP B 1 45  ? -19.856 -6.109  -11.664 1.00 12.22 ? 45  ASP B HA   1  
ATOM 3103   H HB2  . ASP B 1 45  ? -20.043 -4.858  -9.475  1.00 62.51 ? 45  ASP B HB2  1  
ATOM 3104   H HB3  . ASP B 1 45  ? -18.731 -3.805  -9.992  1.00 14.31 ? 45  ASP B HB3  1  
ATOM 3105   N N    . THR B 1 46  ? -18.874 -4.559  -13.497 1.00 14.44 ? 46  THR B N    1  
ATOM 3106   C CA   . THR B 1 46  ? -18.229 -4.182  -14.764 1.00 2.30  ? 46  THR B CA   1  
ATOM 3107   C C    . THR B 1 46  ? -18.239 -2.655  -14.959 1.00 31.41 ? 46  THR B C    1  
ATOM 3108   O O    . THR B 1 46  ? -19.230 -1.980  -14.655 1.00 60.21 ? 46  THR B O    1  
ATOM 3109   C CB   . THR B 1 46  ? -18.956 -4.869  -15.975 1.00 24.42 ? 46  THR B CB   1  
ATOM 3110   O OG1  . THR B 1 46  ? -20.365 -4.544  -15.967 1.00 2.52  ? 46  THR B OG1  1  
ATOM 3111   C CG2  . THR B 1 46  ? -18.794 -6.403  -15.947 1.00 55.33 ? 46  THR B CG2  1  
ATOM 3112   H H    . THR B 1 46  ? -19.850 -4.493  -13.434 1.00 54.23 ? 46  THR B H    1  
ATOM 3113   H HA   . THR B 1 46  ? -17.196 -4.532  -14.748 1.00 73.14 ? 46  THR B HA   1  
ATOM 3114   H HB   . THR B 1 46  ? -18.523 -4.496  -16.899 1.00 11.43 ? 46  THR B HB   1  
ATOM 3115   H HG1  . THR B 1 46  ? -20.504 -3.694  -15.534 1.00 63.04 ? 46  THR B HG1  1  
ATOM 3116   H HG21 . THR B 1 46  ? -19.294 -6.839  -16.803 1.00 20.40 ? 46  THR B HG21 1  
ATOM 3117   H HG22 . THR B 1 46  ? -19.229 -6.803  -15.041 1.00 2.30  ? 46  THR B HG22 1  
ATOM 3118   H HG23 . THR B 1 46  ? -17.743 -6.661  -15.981 1.00 2.25  ? 46  THR B HG23 1  
ATOM 3119   N N    . ALA B 1 47  ? -17.111 -2.135  -15.459 1.00 65.21 ? 47  ALA B N    1  
ATOM 3120   C CA   . ALA B 1 47  ? -16.955 -0.739  -15.877 1.00 0.54  ? 47  ALA B CA   1  
ATOM 3121   C C    . ALA B 1 47  ? -15.932 -0.729  -17.018 1.00 52.23 ? 47  ALA B C    1  
ATOM 3122   O O    . ALA B 1 47  ? -14.875 -1.350  -16.893 1.00 63.51 ? 47  ALA B O    1  
ATOM 3123   C CB   . ALA B 1 47  ? -16.510 0.149   -14.693 1.00 74.20 ? 47  ALA B CB   1  
ATOM 3124   H H    . ALA B 1 47  ? -16.333 -2.728  -15.562 1.00 33.05 ? 47  ALA B H    1  
ATOM 3125   H HA   . ALA B 1 47  ? -17.913 -0.377  -16.249 1.00 1.42  ? 47  ALA B HA   1  
ATOM 3126   H HB1  . ALA B 1 47  ? -15.563 -0.201  -14.304 1.00 21.31 ? 47  ALA B HB1  1  
ATOM 3127   H HB2  . ALA B 1 47  ? -17.254 0.105   -13.908 1.00 1.43  ? 47  ALA B HB2  1  
ATOM 3128   H HB3  . ALA B 1 47  ? -16.407 1.176   -15.023 1.00 60.43 ? 47  ALA B HB3  1  
ATOM 3129   N N    . SER B 1 48  ? -16.271 -0.101  -18.148 1.00 53.30 ? 48  SER B N    1  
ATOM 3130   C CA   . SER B 1 48  ? -15.430 -0.149  -19.360 1.00 21.11 ? 48  SER B CA   1  
ATOM 3131   C C    . SER B 1 48  ? -15.483 1.177   -20.122 1.00 22.45 ? 48  SER B C    1  
ATOM 3132   O O    . SER B 1 48  ? -16.388 1.996   -19.889 1.00 50.11 ? 48  SER B O    1  
ATOM 3133   C CB   . SER B 1 48  ? -15.924 -1.290  -20.273 1.00 71.11 ? 48  SER B CB   1  
ATOM 3134   O OG   . SER B 1 48  ? -16.111 -2.497  -19.552 1.00 34.23 ? 48  SER B OG   1  
ATOM 3135   H H    . SER B 1 48  ? -17.105 0.409   -18.178 1.00 13.25 ? 48  SER B H    1  
ATOM 3136   H HA   . SER B 1 48  ? -14.401 -0.345  -19.068 1.00 44.13 ? 48  SER B HA   1  
ATOM 3137   H HB2  . SER B 1 48  ? -16.871 -1.018  -20.723 1.00 43.11 ? 48  SER B HB2  1  
ATOM 3138   H HB3  . SER B 1 48  ? -15.198 -1.470  -21.058 1.00 23.34 ? 48  SER B HB3  1  
ATOM 3139   H HG   . SER B 1 48  ? -16.581 -3.127  -20.104 1.00 3.34  ? 48  SER B HG   1  
ATOM 3140   N N    . SER B 1 49  ? -14.512 1.367   -21.036 1.00 53.50 ? 49  SER B N    1  
ATOM 3141   C CA   . SER B 1 49  ? -14.545 2.439   -22.042 1.00 30.03 ? 49  SER B CA   1  
ATOM 3142   C C    . SER B 1 49  ? -13.497 2.170   -23.133 1.00 63.15 ? 49  SER B C    1  
ATOM 3143   O O    . SER B 1 49  ? -12.380 1.757   -22.831 1.00 31.35 ? 49  SER B O    1  
ATOM 3144   C CB   . SER B 1 49  ? -14.296 3.818   -21.387 1.00 54.44 ? 49  SER B CB   1  
ATOM 3145   O OG   . SER B 1 49  ? -13.026 3.892   -20.742 1.00 51.00 ? 49  SER B OG   1  
ATOM 3146   H H    . SER B 1 49  ? -13.729 0.771   -21.018 1.00 50.11 ? 49  SER B H    1  
ATOM 3147   H HA   . SER B 1 49  ? -15.532 2.435   -22.499 1.00 71.44 ? 49  SER B HA   1  
ATOM 3148   H HB2  . SER B 1 49  ? -14.338 4.591   -22.143 1.00 33.35 ? 49  SER B HB2  1  
ATOM 3149   H HB3  . SER B 1 49  ? -15.065 4.008   -20.648 1.00 63.24 ? 49  SER B HB3  1  
ATOM 3150   H HG   . SER B 1 49  ? -12.824 3.045   -20.319 1.00 31.14 ? 49  SER B HG   1  
ATOM 3151   N N    . GLN B 1 50  ? -13.874 2.382   -24.405 1.00 52.14 ? 50  GLN B N    1  
ATOM 3152   C CA   . GLN B 1 50  ? -12.940 2.340   -25.539 1.00 13.32 ? 50  GLN B CA   1  
ATOM 3153   C C    . GLN B 1 50  ? -12.468 3.775   -25.822 1.00 13.04 ? 50  GLN B C    1  
ATOM 3154   O O    . GLN B 1 50  ? -13.262 4.605   -26.288 1.00 24.14 ? 50  GLN B O    1  
ATOM 3155   C CB   . GLN B 1 50  ? -13.621 1.708   -26.794 1.00 71.14 ? 50  GLN B CB   1  
ATOM 3156   C CG   . GLN B 1 50  ? -12.638 1.406   -27.945 1.00 25.43 ? 50  GLN B CG   1  
ATOM 3157   C CD   . GLN B 1 50  ? -13.244 0.679   -29.155 1.00 30.53 ? 50  GLN B CD   1  
ATOM 3158   O OE1  . GLN B 1 50  ? -14.196 -0.097  -29.034 1.00 64.43 ? 50  GLN B OE1  1  
ATOM 3159   N NE2  . GLN B 1 50  ? -12.674 0.912   -30.332 1.00 23.34 ? 50  GLN B NE2  1  
ATOM 3160   H H    . GLN B 1 50  ? -14.816 2.581   -24.586 1.00 34.11 ? 50  GLN B H    1  
ATOM 3161   H HA   . GLN B 1 50  ? -12.080 1.727   -25.259 1.00 3.13  ? 50  GLN B HA   1  
ATOM 3162   H HB2  . GLN B 1 50  ? -14.100 0.781   -26.498 1.00 74.41 ? 50  GLN B HB2  1  
ATOM 3163   H HB3  . GLN B 1 50  ? -14.385 2.386   -27.163 1.00 31.13 ? 50  GLN B HB3  1  
ATOM 3164   H HG2  . GLN B 1 50  ? -12.220 2.344   -28.287 1.00 41.43 ? 50  GLN B HG2  1  
ATOM 3165   H HG3  . GLN B 1 50  ? -11.832 0.792   -27.555 1.00 63.53 ? 50  GLN B HG3  1  
ATOM 3166   H HE21 . GLN B 1 50  ? -11.907 1.524   -30.363 1.00 34.20 ? 50  GLN B HE21 1  
ATOM 3167   H HE22 . GLN B 1 50  ? -13.035 0.458   -31.123 1.00 71.50 ? 50  GLN B HE22 1  
ATOM 3168   N N    . LEU B 1 51  ? -11.192 4.067   -25.504 1.00 73.42 ? 51  LEU B N    1  
ATOM 3169   C CA   . LEU B 1 51  ? -10.617 5.426   -25.630 1.00 73.12 ? 51  LEU B CA   1  
ATOM 3170   C C    . LEU B 1 51  ? -10.458 5.786   -27.108 1.00 31.43 ? 51  LEU B C    1  
ATOM 3171   O O    . LEU B 1 51  ? -10.953 6.812   -27.581 1.00 74.22 ? 51  LEU B O    1  
ATOM 3172   C CB   . LEU B 1 51  ? -9.240  5.511   -24.912 1.00 60.10 ? 51  LEU B CB   1  
ATOM 3173   C CG   . LEU B 1 51  ? -9.201  4.972   -23.454 1.00 73.21 ? 51  LEU B CG   1  
ATOM 3174   C CD1  . LEU B 1 51  ? -7.809  5.178   -22.818 1.00 41.32 ? 51  LEU B CD1  1  
ATOM 3175   C CD2  . LEU B 1 51  ? -10.336 5.569   -22.588 1.00 22.11 ? 51  LEU B CD2  1  
ATOM 3176   H H    . LEU B 1 51  ? -10.618 3.343   -25.180 1.00 64.35 ? 51  LEU B H    1  
ATOM 3177   H HA   . LEU B 1 51  ? -11.303 6.126   -25.162 1.00 20.54 ? 51  LEU B HA   1  
ATOM 3178   H HB2  . LEU B 1 51  ? -8.514  4.952   -25.499 1.00 24.25 ? 51  LEU B HB2  1  
ATOM 3179   H HB3  . LEU B 1 51  ? -8.929  6.550   -24.897 1.00 71.21 ? 51  LEU B HB3  1  
ATOM 3180   H HG   . LEU B 1 51  ? -9.365  3.900   -23.490 1.00 5.12  ? 51  LEU B HG   1  
ATOM 3181   H HD11 . LEU B 1 51  ? -7.481  6.200   -22.951 1.00 25.43 ? 51  LEU B HD11 1  
ATOM 3182   H HD12 . LEU B 1 51  ? -7.098  4.515   -23.290 1.00 52.00 ? 51  LEU B HD12 1  
ATOM 3183   H HD13 . LEU B 1 51  ? -7.849  4.950   -21.759 1.00 12.30 ? 51  LEU B HD13 1  
ATOM 3184   H HD21 . LEU B 1 51  ? -10.307 5.126   -21.600 1.00 43.30 ? 51  LEU B HD21 1  
ATOM 3185   H HD22 . LEU B 1 51  ? -11.295 5.352   -23.038 1.00 12.34 ? 51  LEU B HD22 1  
ATOM 3186   H HD23 . LEU B 1 51  ? -10.216 6.637   -22.500 1.00 74.53 ? 51  LEU B HD23 1  
ATOM 3187   N N    . ALA B 1 52  ? -9.775  4.894   -27.817 1.00 64.33 ? 52  ALA B N    1  
ATOM 3188   C CA   . ALA B 1 52  ? -9.520  4.995   -29.257 1.00 23.42 ? 52  ALA B CA   1  
ATOM 3189   C C    . ALA B 1 52  ? -9.690  3.616   -29.873 1.00 20.15 ? 52  ALA B C    1  
ATOM 3190   O O    . ALA B 1 52  ? -10.158 2.689   -29.213 1.00 51.23 ? 52  ALA B O    1  
ATOM 3191   C CB   . ALA B 1 52  ? -8.101  5.539   -29.511 1.00 62.35 ? 52  ALA B CB   1  
ATOM 3192   H H    . ALA B 1 52  ? -9.432  4.101   -27.348 1.00 0.55  ? 52  ALA B H    1  
ATOM 3193   H HA   . ALA B 1 52  ? -10.245 5.672   -29.706 1.00 34.51 ? 52  ALA B HA   1  
ATOM 3194   H HB1  . ALA B 1 52  ? -7.387  5.043   -28.858 1.00 53.35 ? 52  ALA B HB1  1  
ATOM 3195   H HB2  . ALA B 1 52  ? -8.087  6.592   -29.326 1.00 4.04  ? 52  ALA B HB2  1  
ATOM 3196   H HB3  . ALA B 1 52  ? -7.819  5.368   -30.542 1.00 73.31 ? 52  ALA B HB3  1  
ATOM 3197   N N    . ASP B 1 53  ? -9.305  3.480   -31.133 1.00 43.22 ? 53  ASP B N    1  
ATOM 3198   C CA   . ASP B 1 53  ? -9.272  2.165   -31.788 1.00 13.22 ? 53  ASP B CA   1  
ATOM 3199   C C    . ASP B 1 53  ? -7.918  1.527   -31.487 1.00 12.33 ? 53  ASP B C    1  
ATOM 3200   O O    . ASP B 1 53  ? -6.922  2.247   -31.312 1.00 20.31 ? 53  ASP B O    1  
ATOM 3201   C CB   . ASP B 1 53  ? -9.530  2.245   -33.303 1.00 10.34 ? 53  ASP B CB   1  
ATOM 3202   C CG   . ASP B 1 53  ? -9.897  0.861   -33.882 1.00 64.42 ? 53  ASP B CG   1  
ATOM 3203   O OD1  . ASP B 1 53  ? -11.078 0.476   -33.775 1.00 13.22 ? 53  ASP B OD1  1  
ATOM 3204   O OD2  . ASP B 1 53  ? -9.016  0.155   -34.406 1.00 63.14 ? 53  ASP B OD2  1  
ATOM 3205   H H    . ASP B 1 53  ? -8.991  4.276   -31.617 1.00 31.35 ? 53  ASP B H    1  
ATOM 3206   H HA   . ASP B 1 53  ? -10.052 1.550   -31.334 1.00 10.10 ? 53  ASP B HA   1  
ATOM 3207   H HB2  . ASP B 1 53  ? -10.358 2.927   -33.486 1.00 44.22 ? 53  ASP B HB2  1  
ATOM 3208   H HB3  . ASP B 1 53  ? -8.644  2.633   -33.810 1.00 51.41 ? 53  ASP B HB3  1  
ATOM 3209   N N    . ASP B 1 54  ? -7.918  0.188   -31.338 1.00 22.31 ? 54  ASP B N    1  
ATOM 3210   C CA   . ASP B 1 54  ? -6.752  -0.615  -30.893 1.00 54.04 ? 54  ASP B CA   1  
ATOM 3211   C C    . ASP B 1 54  ? -6.374  -0.328  -29.414 1.00 13.41 ? 54  ASP B C    1  
ATOM 3212   O O    . ASP B 1 54  ? -5.459  -0.953  -28.883 1.00 13.13 ? 54  ASP B O    1  
ATOM 3213   C CB   . ASP B 1 54  ? -5.508  -0.427  -31.810 1.00 64.02 ? 54  ASP B CB   1  
ATOM 3214   C CG   . ASP B 1 54  ? -5.811  -0.597  -33.311 1.00 31.02 ? 54  ASP B CG   1  
ATOM 3215   O OD1  . ASP B 1 54  ? -5.910  0.428   -34.024 1.00 15.02 ? 54  ASP B OD1  1  
ATOM 3216   O OD2  . ASP B 1 54  ? -5.907  -1.746  -33.789 1.00 62.41 ? 54  ASP B OD2  1  
ATOM 3217   H H    . ASP B 1 54  ? -8.736  -0.294  -31.572 1.00 33.03 ? 54  ASP B H    1  
ATOM 3218   H HA   . ASP B 1 54  ? -7.056  -1.651  -30.950 1.00 52.04 ? 54  ASP B HA   1  
ATOM 3219   H HB2  . ASP B 1 54  ? -5.099  0.566   -31.644 1.00 11.15 ? 54  ASP B HB2  1  
ATOM 3220   H HB3  . ASP B 1 54  ? -4.751  -1.152  -31.528 1.00 62.01 ? 54  ASP B HB3  1  
ATOM 3221   N N    . VAL B 1 55  ? -7.089  0.615   -28.759 1.00 74.40 ? 55  VAL B N    1  
ATOM 3222   C CA   . VAL B 1 55  ? -6.861  1.023   -27.364 1.00 2.25  ? 55  VAL B CA   1  
ATOM 3223   C C    . VAL B 1 55  ? -8.189  0.900   -26.612 1.00 23.31 ? 55  VAL B C    1  
ATOM 3224   O O    . VAL B 1 55  ? -9.159  1.603   -26.922 1.00 13.21 ? 55  VAL B O    1  
ATOM 3225   C CB   . VAL B 1 55  ? -6.332  2.513   -27.253 1.00 4.01  ? 55  VAL B CB   1  
ATOM 3226   C CG1  . VAL B 1 55  ? -6.383  3.027   -25.787 1.00 62.32 ? 55  VAL B CG1  1  
ATOM 3227   C CG2  . VAL B 1 55  ? -4.898  2.656   -27.827 1.00 53.03 ? 55  VAL B CG2  1  
ATOM 3228   H H    . VAL B 1 55  ? -7.827  1.042   -29.230 1.00 2.11  ? 55  VAL B H    1  
ATOM 3229   H HA   . VAL B 1 55  ? -6.127  0.355   -26.911 1.00 61.55 ? 55  VAL B HA   1  
ATOM 3230   H HB   . VAL B 1 55  ? -6.991  3.146   -27.844 1.00 23.41 ? 55  VAL B HB   1  
ATOM 3231   H HG11 . VAL B 1 55  ? -6.111  4.071   -25.749 1.00 35.02 ? 55  VAL B HG11 1  
ATOM 3232   H HG12 . VAL B 1 55  ? -5.695  2.461   -25.174 1.00 61.31 ? 55  VAL B HG12 1  
ATOM 3233   H HG13 . VAL B 1 55  ? -7.386  2.912   -25.389 1.00 44.33 ? 55  VAL B HG13 1  
ATOM 3234   H HG21 . VAL B 1 55  ? -4.204  2.117   -27.201 1.00 54.32 ? 55  VAL B HG21 1  
ATOM 3235   H HG22 . VAL B 1 55  ? -4.611  3.700   -27.853 1.00 64.45 ? 55  VAL B HG22 1  
ATOM 3236   H HG23 . VAL B 1 55  ? -4.856  2.254   -28.826 1.00 41.44 ? 55  VAL B HG23 1  
ATOM 3237   N N    . TYR B 1 56  ? -8.230  0.019   -25.617 1.00 31.43 ? 56  TYR B N    1  
ATOM 3238   C CA   . TYR B 1 56  ? -9.399  -0.144  -24.756 1.00 24.05 ? 56  TYR B CA   1  
ATOM 3239   C C    . TYR B 1 56  ? -8.938  -0.025  -23.307 1.00 12.41 ? 56  TYR B C    1  
ATOM 3240   O O    . TYR B 1 56  ? -7.883  -0.550  -22.933 1.00 22.25 ? 56  TYR B O    1  
ATOM 3241   C CB   . TYR B 1 56  ? -10.088 -1.511  -25.016 1.00 60.10 ? 56  TYR B CB   1  
ATOM 3242   C CG   . TYR B 1 56  ? -11.566 -1.577  -24.593 1.00 32.40 ? 56  TYR B CG   1  
ATOM 3243   C CD1  . TYR B 1 56  ? -12.582 -1.521  -25.548 1.00 52.44 ? 56  TYR B CD1  1  
ATOM 3244   C CD2  . TYR B 1 56  ? -11.946 -1.680  -23.251 1.00 4.54  ? 56  TYR B CD2  1  
ATOM 3245   C CE1  . TYR B 1 56  ? -13.911 -1.560  -25.185 1.00 52.12 ? 56  TYR B CE1  1  
ATOM 3246   C CE2  . TYR B 1 56  ? -13.276 -1.724  -22.887 1.00 74.02 ? 56  TYR B CE2  1  
ATOM 3247   C CZ   . TYR B 1 56  ? -14.253 -1.659  -23.857 1.00 1.35  ? 56  TYR B CZ   1  
ATOM 3248   O OH   . TYR B 1 56  ? -15.582 -1.690  -23.500 1.00 60.33 ? 56  TYR B OH   1  
ATOM 3249   H H    . TYR B 1 56  ? -7.443  -0.534  -25.443 1.00 10.42 ? 56  TYR B H    1  
ATOM 3250   H HA   . TYR B 1 56  ? -10.106 0.662   -24.971 1.00 52.32 ? 56  TYR B HA   1  
ATOM 3251   H HB2  . TYR B 1 56  ? -10.036 -1.727  -26.078 1.00 13.23 ? 56  TYR B HB2  1  
ATOM 3252   H HB3  . TYR B 1 56  ? -9.552  -2.293  -24.487 1.00 35.21 ? 56  TYR B HB3  1  
ATOM 3253   H HD1  . TYR B 1 56  ? -12.317 -1.443  -26.597 1.00 53.20 ? 56  TYR B HD1  1  
ATOM 3254   H HD2  . TYR B 1 56  ? -11.179 -1.731  -22.489 1.00 21.33 ? 56  TYR B HD2  1  
ATOM 3255   H HE1  . TYR B 1 56  ? -14.679 -1.514  -25.948 1.00 71.21 ? 56  TYR B HE1  1  
ATOM 3256   H HE2  . TYR B 1 56  ? -13.548 -1.802  -21.843 1.00 15.24 ? 56  TYR B HE2  1  
ATOM 3257   H HH   . TYR B 1 56  ? -16.057 -2.283  -24.091 1.00 32.35 ? 56  TYR B HH   1  
ATOM 3258   N N    . GLU B 1 57  ? -9.742  0.659   -22.513 1.00 45.02 ? 57  GLU B N    1  
ATOM 3259   C CA   . GLU B 1 57  ? -9.485  0.893   -21.103 1.00 40.43 ? 57  GLU B CA   1  
ATOM 3260   C C    . GLU B 1 57  ? -10.429 -0.018  -20.300 1.00 64.32 ? 57  GLU B C    1  
ATOM 3261   O O    . GLU B 1 57  ? -11.649 0.202   -20.257 1.00 10.24 ? 57  GLU B O    1  
ATOM 3262   C CB   . GLU B 1 57  ? -9.677  2.404   -20.813 1.00 14.43 ? 57  GLU B CB   1  
ATOM 3263   C CG   . GLU B 1 57  ? -9.182  2.894   -19.442 1.00 41.43 ? 57  GLU B CG   1  
ATOM 3264   C CD   . GLU B 1 57  ? -10.092 2.532   -18.265 1.00 43.52 ? 57  GLU B CD   1  
ATOM 3265   O OE1  . GLU B 1 57  ? -9.587  2.055   -17.225 1.00 43.54 ? 57  GLU B OE1  1  
ATOM 3266   O OE2  . GLU B 1 57  ? -11.322 2.751   -18.381 1.00 74.53 ? 57  GLU B OE2  1  
ATOM 3267   H H    . GLU B 1 57  ? -10.563 1.020   -22.892 1.00 25.22 ? 57  GLU B H    1  
ATOM 3268   H HA   . GLU B 1 57  ? -8.448  0.622   -20.885 1.00 3.40  ? 57  GLU B HA   1  
ATOM 3269   H HB2  . GLU B 1 57  ? -9.138  2.960   -21.572 1.00 21.22 ? 57  GLU B HB2  1  
ATOM 3270   H HB3  . GLU B 1 57  ? -10.731 2.654   -20.906 1.00 41.43 ? 57  GLU B HB3  1  
ATOM 3271   H HG2  . GLU B 1 57  ? -8.195  2.479   -19.269 1.00 41.44 ? 57  GLU B HG2  1  
ATOM 3272   H HG3  . GLU B 1 57  ? -9.093  3.976   -19.477 1.00 41.33 ? 57  GLU B HG3  1  
ATOM 3273   N N    . VAL B 1 58  ? -9.839  -1.072  -19.739 1.00 45.12 ? 58  VAL B N    1  
ATOM 3274   C CA   . VAL B 1 58  ? -10.533 -2.120  -18.986 1.00 13.35 ? 58  VAL B CA   1  
ATOM 3275   C C    . VAL B 1 58  ? -10.486 -1.801  -17.490 1.00 55.42 ? 58  VAL B C    1  
ATOM 3276   O O    . VAL B 1 58  ? -9.404  -1.607  -16.937 1.00 23.50 ? 58  VAL B O    1  
ATOM 3277   C CB   . VAL B 1 58  ? -9.845  -3.518  -19.257 1.00 15.44 ? 58  VAL B CB   1  
ATOM 3278   C CG1  . VAL B 1 58  ? -10.438 -4.650  -18.376 1.00 4.34  ? 58  VAL B CG1  1  
ATOM 3279   C CG2  . VAL B 1 58  ? -9.906  -3.879  -20.766 1.00 14.44 ? 58  VAL B CG2  1  
ATOM 3280   H H    . VAL B 1 58  ? -8.868  -1.144  -19.820 1.00 61.14 ? 58  VAL B H    1  
ATOM 3281   H HA   . VAL B 1 58  ? -11.569 -2.170  -19.318 1.00 62.14 ? 58  VAL B HA   1  
ATOM 3282   H HB   . VAL B 1 58  ? -8.795  -3.422  -18.989 1.00 64.11 ? 58  VAL B HB   1  
ATOM 3283   H HG11 . VAL B 1 58  ? -9.929  -5.583  -18.586 1.00 61.55 ? 58  VAL B HG11 1  
ATOM 3284   H HG12 . VAL B 1 58  ? -11.492 -4.765  -18.581 1.00 31.30 ? 58  VAL B HG12 1  
ATOM 3285   H HG13 . VAL B 1 58  ? -10.306 -4.404  -17.328 1.00 40.54 ? 58  VAL B HG13 1  
ATOM 3286   H HG21 . VAL B 1 58  ? -10.937 -3.978  -21.080 1.00 24.54 ? 58  VAL B HG21 1  
ATOM 3287   H HG22 . VAL B 1 58  ? -9.388  -4.813  -20.944 1.00 31.00 ? 58  VAL B HG22 1  
ATOM 3288   H HG23 . VAL B 1 58  ? -9.430  -3.097  -21.346 1.00 75.21 ? 58  VAL B HG23 1  
ATOM 3289   N N    . VAL B 1 59  ? -11.659 -1.735  -16.844 1.00 60.42 ? 59  VAL B N    1  
ATOM 3290   C CA   . VAL B 1 59  ? -11.763 -1.605  -15.381 1.00 1.02  ? 59  VAL B CA   1  
ATOM 3291   C C    . VAL B 1 59  ? -12.371 -2.891  -14.829 1.00 31.25 ? 59  VAL B C    1  
ATOM 3292   O O    . VAL B 1 59  ? -13.217 -3.519  -15.485 1.00 24.41 ? 59  VAL B O    1  
ATOM 3293   C CB   . VAL B 1 59  ? -12.670 -0.392  -14.930 1.00 54.20 ? 59  VAL B CB   1  
ATOM 3294   C CG1  . VAL B 1 59  ? -12.494 -0.069  -13.423 1.00 52.13 ? 59  VAL B CG1  1  
ATOM 3295   C CG2  . VAL B 1 59  ? -12.439 0.844   -15.821 1.00 31.45 ? 59  VAL B CG2  1  
ATOM 3296   H H    . VAL B 1 59  ? -12.491 -1.788  -17.366 1.00 71.51 ? 59  VAL B H    1  
ATOM 3297   H HA   . VAL B 1 59  ? -10.764 -1.470  -14.966 1.00 54.12 ? 59  VAL B HA   1  
ATOM 3298   H HB   . VAL B 1 59  ? -13.710 -0.690  -15.068 1.00 22.01 ? 59  VAL B HB   1  
ATOM 3299   H HG11 . VAL B 1 59  ? -11.521 0.369   -13.248 1.00 55.15 ? 59  VAL B HG11 1  
ATOM 3300   H HG12 . VAL B 1 59  ? -12.580 -0.981  -12.843 1.00 22.32 ? 59  VAL B HG12 1  
ATOM 3301   H HG13 . VAL B 1 59  ? -13.263 0.617   -13.104 1.00 41.02 ? 59  VAL B HG13 1  
ATOM 3302   H HG21 . VAL B 1 59  ? -11.388 1.106   -15.822 1.00 74.03 ? 59  VAL B HG21 1  
ATOM 3303   H HG22 . VAL B 1 59  ? -13.013 1.685   -15.448 1.00 63.41 ? 59  VAL B HG22 1  
ATOM 3304   H HG23 . VAL B 1 59  ? -12.750 0.628   -16.835 1.00 11.12 ? 59  VAL B HG23 1  
ATOM 3305   N N    . LEU B 1 60  ? -11.952 -3.275  -13.623 1.00 23.12 ? 60  LEU B N    1  
ATOM 3306   C CA   . LEU B 1 60  ? -12.591 -4.351  -12.875 1.00 65.03 ? 60  LEU B CA   1  
ATOM 3307   C C    . LEU B 1 60  ? -12.982 -3.811  -11.498 1.00 32.01 ? 60  LEU B C    1  
ATOM 3308   O O    . LEU B 1 60  ? -12.105 -3.474  -10.687 1.00 32.04 ? 60  LEU B O    1  
ATOM 3309   C CB   . LEU B 1 60  ? -11.660 -5.589  -12.751 1.00 63.53 ? 60  LEU B CB   1  
ATOM 3310   C CG   . LEU B 1 60  ? -12.376 -6.895  -12.280 1.00 40.11 ? 60  LEU B CG   1  
ATOM 3311   C CD1  . LEU B 1 60  ? -13.434 -7.359  -13.316 1.00 60.34 ? 60  LEU B CD1  1  
ATOM 3312   C CD2  . LEU B 1 60  ? -11.364 -8.021  -11.947 1.00 55.24 ? 60  LEU B CD2  1  
ATOM 3313   H H    . LEU B 1 60  ? -11.184 -2.815  -13.222 1.00 0.52  ? 60  LEU B H    1  
ATOM 3314   H HA   . LEU B 1 60  ? -13.498 -4.641  -13.404 1.00 31.03 ? 60  LEU B HA   1  
ATOM 3315   H HB2  . LEU B 1 60  ? -11.201 -5.774  -13.720 1.00 12.03 ? 60  LEU B HB2  1  
ATOM 3316   H HB3  . LEU B 1 60  ? -10.871 -5.356  -12.045 1.00 31.52 ? 60  LEU B HB3  1  
ATOM 3317   H HG   . LEU B 1 60  ? -12.916 -6.673  -11.366 1.00 70.42 ? 60  LEU B HG   1  
ATOM 3318   H HD11 . LEU B 1 60  ? -14.174 -6.580  -13.455 1.00 55.33 ? 60  LEU B HD11 1  
ATOM 3319   H HD12 . LEU B 1 60  ? -13.928 -8.251  -12.959 1.00 25.52 ? 60  LEU B HD12 1  
ATOM 3320   H HD13 . LEU B 1 60  ? -12.957 -7.571  -14.266 1.00 73.02 ? 60  LEU B HD13 1  
ATOM 3321   H HD21 . LEU B 1 60  ? -10.719 -7.702  -11.139 1.00 35.22 ? 60  LEU B HD21 1  
ATOM 3322   H HD22 . LEU B 1 60  ? -10.762 -8.248  -12.816 1.00 54.41 ? 60  LEU B HD22 1  
ATOM 3323   H HD23 . LEU B 1 60  ? -11.900 -8.913  -11.643 1.00 61.21 ? 60  LEU B HD23 1  
ATOM 3324   N N    . ARG B 1 61  ? -14.297 -3.683  -11.261 1.00 33.41 ? 61  ARG B N    1  
ATOM 3325   C CA   . ARG B 1 61  ? -14.831 -3.200  -9.989  1.00 63.33 ? 61  ARG B CA   1  
ATOM 3326   C C    . ARG B 1 61  ? -15.005 -4.380  -9.040  1.00 43.22 ? 61  ARG B C    1  
ATOM 3327   O O    . ARG B 1 61  ? -15.822 -5.272  -9.267  1.00 14.10 ? 61  ARG B O    1  
ATOM 3328   C CB   . ARG B 1 61  ? -16.170 -2.456  -10.195 1.00 24.05 ? 61  ARG B CB   1  
ATOM 3329   C CG   . ARG B 1 61  ? -16.759 -1.806  -8.916  1.00 72.35 ? 61  ARG B CG   1  
ATOM 3330   C CD   . ARG B 1 61  ? -18.086 -1.101  -9.200  1.00 2.51  ? 61  ARG B CD   1  
ATOM 3331   N NE   . ARG B 1 61  ? -18.560 -0.260  -8.092  1.00 23.52 ? 61  ARG B NE   1  
ATOM 3332   C CZ   . ARG B 1 61  ? -19.815 0.197   -7.971  1.00 20.00 ? 61  ARG B CZ   1  
ATOM 3333   N NH1  . ARG B 1 61  ? -20.742 -0.112  -8.884  1.00 42.42 ? 61  ARG B NH1  1  
ATOM 3334   N NH2  . ARG B 1 61  ? -20.135 0.953   -6.933  1.00 60.23 ? 61  ARG B NH2  1  
ATOM 3335   H H    . ARG B 1 61  ? -14.930 -3.938  -11.968 1.00 62.23 ? 61  ARG B H    1  
ATOM 3336   H HA   . ARG B 1 61  ? -14.106 -2.509  -9.560  1.00 64.44 ? 61  ARG B HA   1  
ATOM 3337   H HB2  . ARG B 1 61  ? -16.017 -1.673  -10.930 1.00 5.42  ? 61  ARG B HB2  1  
ATOM 3338   H HB3  . ARG B 1 61  ? -16.900 -3.157  -10.590 1.00 31.42 ? 61  ARG B HB3  1  
ATOM 3339   H HG2  . ARG B 1 61  ? -16.924 -2.575  -8.170  1.00 4.02  ? 61  ARG B HG2  1  
ATOM 3340   H HG3  . ARG B 1 61  ? -16.051 -1.084  -8.531  1.00 65.33 ? 61  ARG B HG3  1  
ATOM 3341   H HD2  . ARG B 1 61  ? -17.978 -0.476  -10.080 1.00 43.21 ? 61  ARG B HD2  1  
ATOM 3342   H HD3  . ARG B 1 61  ? -18.833 -1.861  -9.396  1.00 72.43 ? 61  ARG B HD3  1  
ATOM 3343   H HE   . ARG B 1 61  ? -17.905 -0.015  -7.403  1.00 52.55 ? 61  ARG B HE   1  
ATOM 3344   H HH11 . ARG B 1 61  ? -20.501 -0.684  -9.676  1.00 1.41  ? 61  ARG B HH11 1  
ATOM 3345   H HH12 . ARG B 1 61  ? -21.678 0.234   -8.789  1.00 54.22 ? 61  ARG B HH12 1  
ATOM 3346   H HH21 . ARG B 1 61  ? -19.435 1.181   -6.241  1.00 64.32 ? 61  ARG B HH21 1  
ATOM 3347   H HH22 . ARG B 1 61  ? -21.066 1.302   -6.827  1.00 33.33 ? 61  ARG B HH22 1  
ATOM 3348   N N    . VAL B 1 62  ? -14.192 -4.376  -8.000  1.00 44.31 ? 62  VAL B N    1  
ATOM 3349   C CA   . VAL B 1 62  ? -14.183 -5.391  -6.968  1.00 24.03 ? 62  VAL B CA   1  
ATOM 3350   C C    . VAL B 1 62  ? -14.849 -4.808  -5.726  1.00 24.52 ? 62  VAL B C    1  
ATOM 3351   O O    . VAL B 1 62  ? -14.261 -3.974  -5.029  1.00 44.13 ? 62  VAL B O    1  
ATOM 3352   C CB   . VAL B 1 62  ? -12.708 -5.820  -6.659  1.00 73.23 ? 62  VAL B CB   1  
ATOM 3353   C CG1  . VAL B 1 62  ? -12.658 -6.930  -5.579  1.00 45.52 ? 62  VAL B CG1  1  
ATOM 3354   C CG2  . VAL B 1 62  ? -11.964 -6.212  -7.963  1.00 61.54 ? 62  VAL B CG2  1  
ATOM 3355   H H    . VAL B 1 62  ? -13.552 -3.645  -7.924  1.00 55.11 ? 62  VAL B H    1  
ATOM 3356   H HA   . VAL B 1 62  ? -14.737 -6.267  -7.308  1.00 13.23 ? 62  VAL B HA   1  
ATOM 3357   H HB   . VAL B 1 62  ? -12.194 -4.948  -6.247  1.00 51.54 ? 62  VAL B HB   1  
ATOM 3358   H HG11 . VAL B 1 62  ? -12.943 -6.506  -4.621  1.00 2.43  ? 62  VAL B HG11 1  
ATOM 3359   H HG12 . VAL B 1 62  ? -11.656 -7.323  -5.499  1.00 51.31 ? 62  VAL B HG12 1  
ATOM 3360   H HG13 . VAL B 1 62  ? -13.327 -7.725  -5.807  1.00 33.02 ? 62  VAL B HG13 1  
ATOM 3361   H HG21 . VAL B 1 62  ? -12.308 -7.158  -8.313  1.00 11.24 ? 62  VAL B HG21 1  
ATOM 3362   H HG22 . VAL B 1 62  ? -10.898 -6.263  -7.785  1.00 71.44 ? 62  VAL B HG22 1  
ATOM 3363   H HG23 . VAL B 1 62  ? -12.164 -5.468  -8.724  1.00 22.34 ? 62  VAL B HG23 1  
ATOM 3364   N N    . THR B 1 63  ? -16.089 -5.226  -5.489  1.00 55.31 ? 63  THR B N    1  
ATOM 3365   C CA   . THR B 1 63  ? -16.862 -4.809  -4.331  1.00 1.32  ? 63  THR B CA   1  
ATOM 3366   C C    . THR B 1 63  ? -16.689 -5.861  -3.242  1.00 23.30 ? 63  THR B C    1  
ATOM 3367   O O    . THR B 1 63  ? -16.733 -7.065  -3.507  1.00 21.35 ? 63  THR B O    1  
ATOM 3368   C CB   . THR B 1 63  ? -18.380 -4.671  -4.674  1.00 54.25 ? 63  THR B CB   1  
ATOM 3369   O OG1  . THR B 1 63  ? -18.542 -3.836  -5.836  1.00 32.12 ? 63  THR B OG1  1  
ATOM 3370   C CG2  . THR B 1 63  ? -19.196 -4.101  -3.482  1.00 42.53 ? 63  THR B CG2  1  
ATOM 3371   H H    . THR B 1 63  ? -16.507 -5.838  -6.129  1.00 3.14  ? 63  THR B H    1  
ATOM 3372   H HA   . THR B 1 63  ? -16.486 -3.848  -3.984  1.00 21.21 ? 63  THR B HA   1  
ATOM 3373   H HB   . THR B 1 63  ? -18.767 -5.657  -4.917  1.00 44.13 ? 63  THR B HB   1  
ATOM 3374   H HG1  . THR B 1 63  ? -18.501 -2.913  -5.576  1.00 60.04 ? 63  THR B HG1  1  
ATOM 3375   H HG21 . THR B 1 63  ? -19.142 -3.021  -3.478  1.00 21.14 ? 63  THR B HG21 1  
ATOM 3376   H HG22 . THR B 1 63  ? -18.794 -4.476  -2.547  1.00 21.55 ? 63  THR B HG22 1  
ATOM 3377   H HG23 . THR B 1 63  ? -20.221 -4.414  -3.562  1.00 74.23 ? 63  THR B HG23 1  
ATOM 3378   N N    . VAL B 1 64  ? -16.486 -5.394  -2.023  1.00 10.35 ? 64  VAL B N    1  
ATOM 3379   C CA   . VAL B 1 64  ? -16.202 -6.234  -0.860  1.00 4.02  ? 64  VAL B CA   1  
ATOM 3380   C C    . VAL B 1 64  ? -17.171 -5.880  0.265   1.00 40.42 ? 64  VAL B C    1  
ATOM 3381   O O    . VAL B 1 64  ? -17.379 -4.708  0.592   1.00 25.53 ? 64  VAL B O    1  
ATOM 3382   C CB   . VAL B 1 64  ? -14.717 -6.046  -0.354  1.00 30.43 ? 64  VAL B CB   1  
ATOM 3383   C CG1  . VAL B 1 64  ? -14.418 -6.850  0.943   1.00 11.22 ? 64  VAL B CG1  1  
ATOM 3384   C CG2  . VAL B 1 64  ? -13.702 -6.375  -1.474  1.00 33.32 ? 64  VAL B CG2  1  
ATOM 3385   H H    . VAL B 1 64  ? -16.549 -4.429  -1.888  1.00 63.30 ? 64  VAL B H    1  
ATOM 3386   H HA   . VAL B 1 64  ? -16.349 -7.272  -1.147  1.00 20.13 ? 64  VAL B HA   1  
ATOM 3387   H HB   . VAL B 1 64  ? -14.592 -4.993  -0.111  1.00 30.11 ? 64  VAL B HB   1  
ATOM 3388   H HG11 . VAL B 1 64  ? -13.397 -6.698  1.239   1.00 13.02 ? 64  VAL B HG11 1  
ATOM 3389   H HG12 . VAL B 1 64  ? -14.590 -7.903  0.778   1.00 64.14 ? 64  VAL B HG12 1  
ATOM 3390   H HG13 . VAL B 1 64  ? -15.062 -6.505  1.740   1.00 25.33 ? 64  VAL B HG13 1  
ATOM 3391   H HG21 . VAL B 1 64  ? -13.609 -7.440  -1.610  1.00 1.13  ? 64  VAL B HG21 1  
ATOM 3392   H HG22 . VAL B 1 64  ? -12.734 -5.970  -1.214  1.00 44.14 ? 64  VAL B HG22 1  
ATOM 3393   H HG23 . VAL B 1 64  ? -14.026 -5.928  -2.404  1.00 33.34 ? 64  VAL B HG23 1  
ATOM 3394   N N    . THR B 1 65  ? -17.772 -6.915  0.821   1.00 61.02 ? 65  THR B N    1  
ATOM 3395   C CA   . THR B 1 65  ? -18.538 -6.852  2.046   1.00 60.14 ? 65  THR B CA   1  
ATOM 3396   C C    . THR B 1 65  ? -17.890 -7.824  3.024   1.00 32.24 ? 65  THR B C    1  
ATOM 3397   O O    . THR B 1 65  ? -17.442 -8.902  2.631   1.00 14.11 ? 65  THR B O    1  
ATOM 3398   C CB   . THR B 1 65  ? -20.040 -7.225  1.802   1.00 64.01 ? 65  THR B CB   1  
ATOM 3399   O OG1  . THR B 1 65  ? -20.645 -6.249  0.938   1.00 44.43 ? 65  THR B OG1  1  
ATOM 3400   C CG2  . THR B 1 65  ? -20.857 -7.345  3.109   1.00 13.23 ? 65  THR B CG2  1  
ATOM 3401   H H    . THR B 1 65  ? -17.677 -7.783  0.391   1.00 65.13 ? 65  THR B H    1  
ATOM 3402   H HA   . THR B 1 65  ? -18.474 -5.838  2.445   1.00 41.15 ? 65  THR B HA   1  
ATOM 3403   H HB   . THR B 1 65  ? -20.070 -8.181  1.292   1.00 2.41  ? 65  THR B HB   1  
ATOM 3404   H HG1  . THR B 1 65  ? -20.048 -6.055  0.205   1.00 23.20 ? 65  THR B HG1  1  
ATOM 3405   H HG21 . THR B 1 65  ? -20.865 -6.395  3.624   1.00 1.34  ? 65  THR B HG21 1  
ATOM 3406   H HG22 . THR B 1 65  ? -20.414 -8.095  3.753   1.00 12.51 ? 65  THR B HG22 1  
ATOM 3407   H HG23 . THR B 1 65  ? -21.870 -7.636  2.878   1.00 53.13 ? 65  THR B HG23 1  
ATOM 3408   N N    . ALA B 1 66  ? -17.805 -7.416  4.273   1.00 54.22 ? 66  ALA B N    1  
ATOM 3409   C CA   . ALA B 1 66  ? -17.244 -8.223  5.341   1.00 34.25 ? 66  ALA B CA   1  
ATOM 3410   C C    . ALA B 1 66  ? -18.072 -7.978  6.586   1.00 61.53 ? 66  ALA B C    1  
ATOM 3411   O O    . ALA B 1 66  ? -18.437 -6.837  6.881   1.00 63.25 ? 66  ALA B O    1  
ATOM 3412   C CB   . ALA B 1 66  ? -15.783 -7.854  5.543   1.00 34.32 ? 66  ALA B CB   1  
ATOM 3413   H H    . ALA B 1 66  ? -18.140 -6.521  4.497   1.00 63.31 ? 66  ALA B H    1  
ATOM 3414   H HA   . ALA B 1 66  ? -17.309 -9.277  5.063   1.00 4.01  ? 66  ALA B HA   1  
ATOM 3415   H HB1  . ALA B 1 66  ? -15.202 -8.194  4.695   1.00 42.23 ? 66  ALA B HB1  1  
ATOM 3416   H HB2  . ALA B 1 66  ? -15.398 -8.304  6.442   1.00 53.44 ? 66  ALA B HB2  1  
ATOM 3417   H HB3  . ALA B 1 66  ? -15.686 -6.777  5.622   1.00 10.14 ? 66  ALA B HB3  1  
ATOM 3418   N N    . SER B 1 67  ? -18.383 -9.050  7.303   1.00 31.45 ? 67  SER B N    1  
ATOM 3419   C CA   . SER B 1 67  ? -19.362 -9.025  8.387   1.00 51.12 ? 67  SER B CA   1  
ATOM 3420   C C    . SER B 1 67  ? -18.851 -9.862  9.551   1.00 52.41 ? 67  SER B C    1  
ATOM 3421   O O    . SER B 1 67  ? -18.176 -10.850 9.339   1.00 22.02 ? 67  SER B O    1  
ATOM 3422   C CB   . SER B 1 67  ? -20.705 -9.588  7.862   1.00 71.43 ? 67  SER B CB   1  
ATOM 3423   O OG   . SER B 1 67  ? -21.008 -9.077  6.574   1.00 41.41 ? 67  SER B OG   1  
ATOM 3424   H H    . SER B 1 67  ? -17.941 -9.902  7.097   1.00 61.35 ? 67  SER B H    1  
ATOM 3425   H HA   . SER B 1 67  ? -19.496 -7.996  8.725   1.00 74.21 ? 67  SER B HA   1  
ATOM 3426   H HB2  . SER B 1 67  ? -20.651 -10.667 7.793   1.00 54.45 ? 67  SER B HB2  1  
ATOM 3427   H HB3  . SER B 1 67  ? -21.506 -9.313  8.537   1.00 11.25 ? 67  SER B HB3  1  
ATOM 3428   H HG   . SER B 1 67  ? -20.370 -9.439  5.947   1.00 21.52 ? 67  SER B HG   1  
ATOM 3429   N N    . LEU B 1 68  ? -19.154 -9.451  10.773  1.00 34.21 ? 68  LEU B N    1  
ATOM 3430   C CA   . LEU B 1 68  ? -18.815 -10.220 11.969  1.00 40.12 ? 68  LEU B CA   1  
ATOM 3431   C C    . LEU B 1 68  ? -20.098 -10.718 12.636  1.00 2.22  ? 68  LEU B C    1  
ATOM 3432   O O    . LEU B 1 68  ? -20.874 -9.942  13.212  1.00 60.43 ? 68  LEU B O    1  
ATOM 3433   C CB   . LEU B 1 68  ? -17.936 -9.354  12.893  1.00 20.35 ? 68  LEU B CB   1  
ATOM 3434   C CG   . LEU B 1 68  ? -16.452 -9.202  12.423  1.00 72.15 ? 68  LEU B CG   1  
ATOM 3435   C CD1  . LEU B 1 68  ? -15.730 -8.039  13.143  1.00 4.34  ? 68  LEU B CD1  1  
ATOM 3436   C CD2  . LEU B 1 68  ? -15.697 -10.547 12.558  1.00 53.15 ? 68  LEU B CD2  1  
ATOM 3437   H H    . LEU B 1 68  ? -19.618 -8.592  10.885  1.00 43.40 ? 68  LEU B H    1  
ATOM 3438   H HA   . LEU B 1 68  ? -18.229 -11.095 11.662  1.00 54.43 ? 68  LEU B HA   1  
ATOM 3439   H HB2  . LEU B 1 68  ? -18.384 -8.368  12.955  1.00 35.34 ? 68  LEU B HB2  1  
ATOM 3440   H HB3  . LEU B 1 68  ? -17.936 -9.785  13.886  1.00 2.30  ? 68  LEU B HB3  1  
ATOM 3441   H HG   . LEU B 1 68  ? -16.458 -8.950  11.369  1.00 2.43  ? 68  LEU B HG   1  
ATOM 3442   H HD11 . LEU B 1 68  ? -16.094 -7.933  14.156  1.00 64.20 ? 68  LEU B HD11 1  
ATOM 3443   H HD12 . LEU B 1 68  ? -15.930 -7.131  12.616  1.00 21.34 ? 68  LEU B HD12 1  
ATOM 3444   H HD13 . LEU B 1 68  ? -14.666 -8.207  13.163  1.00 44.41 ? 68  LEU B HD13 1  
ATOM 3445   H HD21 . LEU B 1 68  ? -15.614 -10.829 13.601  1.00 1.21  ? 68  LEU B HD21 1  
ATOM 3446   H HD22 . LEU B 1 68  ? -14.723 -10.463 12.130  1.00 73.34 ? 68  LEU B HD22 1  
ATOM 3447   H HD23 . LEU B 1 68  ? -16.234 -11.317 12.024  1.00 62.15 ? 68  LEU B HD23 1  
ATOM 3448   N N    . GLY B 1 69  ? -20.299 -12.026 12.516  1.00 4.50  ? 69  GLY B N    1  
ATOM 3449   C CA   . GLY B 1 69  ? -21.484 -12.709 12.994  1.00 20.42 ? 69  GLY B CA   1  
ATOM 3450   C C    . GLY B 1 69  ? -22.748 -12.329 12.234  1.00 44.25 ? 69  GLY B C    1  
ATOM 3451   O O    . GLY B 1 69  ? -22.892 -12.639 11.045  1.00 43.44 ? 69  GLY B O    1  
ATOM 3452   H H    . GLY B 1 69  ? -19.589 -12.553 12.096  1.00 1.44  ? 69  GLY B H    1  
ATOM 3453   H HA2  . GLY B 1 69  ? -21.323 -13.777 12.890  1.00 20.12 ? 69  GLY B HA2  1  
ATOM 3454   H HA3  . GLY B 1 69  ? -21.619 -12.491 14.046  1.00 23.44 ? 69  GLY B HA3  1  
ATOM 3455   N N    . GLU B 1 70  ? -23.637 -11.611 12.932  1.00 34.05 ? 70  GLU B N    1  
ATOM 3456   C CA   . GLU B 1 70  ? -25.008 -11.302 12.467  1.00 25.51 ? 70  GLU B CA   1  
ATOM 3457   C C    . GLU B 1 70  ? -25.090 -9.850  11.956  1.00 42.34 ? 70  GLU B C    1  
ATOM 3458   O O    . GLU B 1 70  ? -26.161 -9.394  11.542  1.00 31.32 ? 70  GLU B O    1  
ATOM 3459   C CB   . GLU B 1 70  ? -26.080 -11.509 13.618  1.00 33.14 ? 70  GLU B CB   1  
ATOM 3460   C CG   . GLU B 1 70  ? -25.650 -12.360 14.842  1.00 44.40 ? 70  GLU B CG   1  
ATOM 3461   C CD   . GLU B 1 70  ? -24.607 -11.663 15.749  1.00 14.41 ? 70  GLU B CD   1  
ATOM 3462   O OE1  . GLU B 1 70  ? -24.883 -10.556 16.250  1.00 74.34 ? 70  GLU B OE1  1  
ATOM 3463   O OE2  . GLU B 1 70  ? -23.492 -12.193 15.927  1.00 54.12 ? 70  GLU B OE2  1  
ATOM 3464   H H    . GLU B 1 70  ? -23.349 -11.254 13.790  1.00 31.01 ? 70  GLU B H    1  
ATOM 3465   H HA   . GLU B 1 70  ? -25.246 -11.967 11.641  1.00 23.22 ? 70  GLU B HA   1  
ATOM 3466   H HB2  . GLU B 1 70  ? -26.389 -10.540 14.003  1.00 14.11 ? 70  GLU B HB2  1  
ATOM 3467   H HB3  . GLU B 1 70  ? -26.957 -11.981 13.183  1.00 41.31 ? 70  GLU B HB3  1  
ATOM 3468   H HG2  . GLU B 1 70  ? -26.529 -12.574 15.442  1.00 4.32  ? 70  GLU B HG2  1  
ATOM 3469   H HG3  . GLU B 1 70  ? -25.240 -13.297 14.480  1.00 21.13 ? 70  GLU B HG3  1  
ATOM 3470   N N    . GLU B 1 71  ? -23.955 -9.142  11.968  1.00 42.13 ? 71  GLU B N    1  
ATOM 3471   C CA   . GLU B 1 71  ? -23.882 -7.716  11.607  1.00 43.11 ? 71  GLU B CA   1  
ATOM 3472   C C    . GLU B 1 71  ? -22.713 -7.486  10.651  1.00 52.34 ? 71  GLU B C    1  
ATOM 3473   O O    . GLU B 1 71  ? -21.777 -8.292  10.609  1.00 21.34 ? 71  GLU B O    1  
ATOM 3474   C CB   . GLU B 1 71  ? -23.698 -6.851  12.881  1.00 34.13 ? 71  GLU B CB   1  
ATOM 3475   C CG   . GLU B 1 71  ? -22.386 -7.128  13.648  1.00 65.13 ? 71  GLU B CG   1  
ATOM 3476   C CD   . GLU B 1 71  ? -22.197 -6.243  14.881  1.00 35.32 ? 71  GLU B CD   1  
ATOM 3477   O OE1  . GLU B 1 71  ? -22.005 -5.032  14.708  1.00 62.32 ? 71  GLU B OE1  1  
ATOM 3478   O OE2  . GLU B 1 71  ? -22.222 -6.759  16.016  1.00 72.10 ? 71  GLU B OE2  1  
ATOM 3479   H H    . GLU B 1 71  ? -23.123 -9.595  12.224  1.00 24.31 ? 71  GLU B H    1  
ATOM 3480   H HA   . GLU B 1 71  ? -24.808 -7.431  11.109  1.00 2.11  ? 71  GLU B HA   1  
ATOM 3481   H HB2  . GLU B 1 71  ? -23.716 -5.801  12.599  1.00 55.23 ? 71  GLU B HB2  1  
ATOM 3482   H HB3  . GLU B 1 71  ? -24.530 -7.038  13.551  1.00 51.31 ? 71  GLU B HB3  1  
ATOM 3483   H HG2  . GLU B 1 71  ? -22.380 -8.172  13.955  1.00 54.53 ? 71  GLU B HG2  1  
ATOM 3484   H HG3  . GLU B 1 71  ? -21.548 -6.967  12.975  1.00 61.11 ? 71  GLU B HG3  1  
ATOM 3485   N N    . THR B 1 72  ? -22.772 -6.385  9.891   1.00 13.21 ? 72  THR B N    1  
ATOM 3486   C CA   . THR B 1 72  ? -21.687 -5.976  9.000   1.00 3.15  ? 72  THR B CA   1  
ATOM 3487   C C    . THR B 1 72  ? -20.528 -5.374  9.819   1.00 0.33  ? 72  THR B C    1  
ATOM 3488   O O    . THR B 1 72  ? -20.743 -4.609  10.763  1.00 12.43 ? 72  THR B O    1  
ATOM 3489   C CB   . THR B 1 72  ? -22.194 -4.966  7.921   1.00 2.42  ? 72  THR B CB   1  
ATOM 3490   O OG1  . THR B 1 72  ? -23.219 -5.604  7.130   1.00 72.40 ? 72  THR B OG1  1  
ATOM 3491   C CG2  . THR B 1 72  ? -21.058 -4.461  6.997   1.00 35.12 ? 72  THR B CG2  1  
ATOM 3492   H H    . THR B 1 72  ? -23.574 -5.822  9.937   1.00 41.35 ? 72  THR B H    1  
ATOM 3493   H HA   . THR B 1 72  ? -21.330 -6.869  8.483   1.00 44.03 ? 72  THR B HA   1  
ATOM 3494   H HB   . THR B 1 72  ? -22.637 -4.114  8.431   1.00 32.31 ? 72  THR B HB   1  
ATOM 3495   H HG1  . THR B 1 72  ? -23.728 -4.928  6.666   1.00 21.34 ? 72  THR B HG1  1  
ATOM 3496   H HG21 . THR B 1 72  ? -21.439 -3.710  6.323   1.00 61.43 ? 72  THR B HG21 1  
ATOM 3497   H HG22 . THR B 1 72  ? -20.658 -5.280  6.419   1.00 50.10 ? 72  THR B HG22 1  
ATOM 3498   H HG23 . THR B 1 72  ? -20.263 -4.028  7.594   1.00 65.20 ? 72  THR B HG23 1  
ATOM 3499   N N    . ALA B 1 73  ? -19.309 -5.748  9.437   1.00 52.12 ? 73  ALA B N    1  
ATOM 3500   C CA   . ALA B 1 73  ? -18.068 -5.299  10.071  1.00 61.21 ? 73  ALA B CA   1  
ATOM 3501   C C    . ALA B 1 73  ? -17.557 -4.073  9.311   1.00 15.12 ? 73  ALA B C    1  
ATOM 3502   O O    . ALA B 1 73  ? -17.495 -2.962  9.851   1.00 4.03  ? 73  ALA B O    1  
ATOM 3503   C CB   . ALA B 1 73  ? -17.047 -6.446  10.041  1.00 3.43  ? 73  ALA B CB   1  
ATOM 3504   H H    . ALA B 1 73  ? -19.237 -6.328  8.661   1.00 55.34 ? 73  ALA B H    1  
ATOM 3505   H HA   . ALA B 1 73  ? -18.261 -5.037  11.116  1.00 23.15 ? 73  ALA B HA   1  
ATOM 3506   H HB1  . ALA B 1 73  ? -16.133 -6.141  10.506  1.00 24.44 ? 73  ALA B HB1  1  
ATOM 3507   H HB2  . ALA B 1 73  ? -16.849 -6.740  9.019   1.00 73.22 ? 73  ALA B HB2  1  
ATOM 3508   H HB3  . ALA B 1 73  ? -17.442 -7.289  10.580  1.00 41.14 ? 73  ALA B HB3  1  
ATOM 3509   N N    . PHE B 1 74  ? -17.264 -4.296  8.016   1.00 0.13  ? 74  PHE B N    1  
ATOM 3510   C CA   . PHE B 1 74  ? -16.753 -3.268  7.108   1.00 63.41 ? 74  PHE B CA   1  
ATOM 3511   C C    . PHE B 1 74  ? -17.158 -3.571  5.663   1.00 24.33 ? 74  PHE B C    1  
ATOM 3512   O O    . PHE B 1 74  ? -17.597 -4.675  5.329   1.00 63.44 ? 74  PHE B O    1  
ATOM 3513   C CB   . PHE B 1 74  ? -15.208 -3.122  7.218   1.00 63.31 ? 74  PHE B CB   1  
ATOM 3514   C CG   . PHE B 1 74  ? -14.356 -4.309  6.718   1.00 71.21 ? 74  PHE B CG   1  
ATOM 3515   C CD1  . PHE B 1 74  ? -13.914 -4.380  5.392   1.00 50.52 ? 74  PHE B CD1  1  
ATOM 3516   C CD2  . PHE B 1 74  ? -13.958 -5.324  7.584   1.00 71.04 ? 74  PHE B CD2  1  
ATOM 3517   C CE1  . PHE B 1 74  ? -13.105 -5.410  4.962   1.00 20.22 ? 74  PHE B CE1  1  
ATOM 3518   C CE2  . PHE B 1 74  ? -13.150 -6.363  7.152   1.00 61.40 ? 74  PHE B CE2  1  
ATOM 3519   C CZ   . PHE B 1 74  ? -12.724 -6.404  5.842   1.00 1.15  ? 74  PHE B CZ   1  
ATOM 3520   H H    . PHE B 1 74  ? -17.424 -5.191  7.650   1.00 72.21 ? 74  PHE B H    1  
ATOM 3521   H HA   . PHE B 1 74  ? -17.212 -2.321  7.389   1.00 71.24 ? 74  PHE B HA   1  
ATOM 3522   H HB2  . PHE B 1 74  ? -14.900 -2.242  6.663   1.00 33.05 ? 74  PHE B HB2  1  
ATOM 3523   H HB3  . PHE B 1 74  ? -14.960 -2.956  8.261   1.00 3.24  ? 74  PHE B HB3  1  
ATOM 3524   H HD1  . PHE B 1 74  ? -14.211 -3.615  4.697   1.00 53.01 ? 74  PHE B HD1  1  
ATOM 3525   H HD2  . PHE B 1 74  ? -14.291 -5.301  8.614   1.00 31.01 ? 74  PHE B HD2  1  
ATOM 3526   H HE1  . PHE B 1 74  ? -12.773 -5.446  3.932   1.00 1.11  ? 74  PHE B HE1  1  
ATOM 3527   H HE2  . PHE B 1 74  ? -12.852 -7.141  7.843   1.00 12.51 ? 74  PHE B HE2  1  
ATOM 3528   H HZ   . PHE B 1 74  ? -12.089 -7.212  5.503   1.00 31.22 ? 74  PHE B HZ   1  
ATOM 3529   N N    . LEU B 1 75  ? -16.958 -2.567  4.821   1.00 73.12 ? 75  LEU B N    1  
ATOM 3530   C CA   . LEU B 1 75  ? -17.216 -2.596  3.383   1.00 4.30  ? 75  LEU B CA   1  
ATOM 3531   C C    . LEU B 1 75  ? -15.987 -1.982  2.723   1.00 15.41 ? 75  LEU B C    1  
ATOM 3532   O O    . LEU B 1 75  ? -15.448 -1.006  3.234   1.00 41.44 ? 75  LEU B O    1  
ATOM 3533   C CB   . LEU B 1 75  ? -18.494 -1.764  3.033   1.00 53.53 ? 75  LEU B CB   1  
ATOM 3534   C CG   . LEU B 1 75  ? -19.802 -2.201  3.765   1.00 23.03 ? 75  LEU B CG   1  
ATOM 3535   C CD1  . LEU B 1 75  ? -20.973 -1.241  3.489   1.00 54.03 ? 75  LEU B CD1  1  
ATOM 3536   C CD2  . LEU B 1 75  ? -20.178 -3.655  3.418   1.00 21.50 ? 75  LEU B CD2  1  
ATOM 3537   H H    . LEU B 1 75  ? -16.586 -1.739  5.189   1.00 51.33 ? 75  LEU B H    1  
ATOM 3538   H HA   . LEU B 1 75  ? -17.340 -3.627  3.055   1.00 62.34 ? 75  LEU B HA   1  
ATOM 3539   H HB2  . LEU B 1 75  ? -18.299 -0.721  3.281   1.00 25.01 ? 75  LEU B HB2  1  
ATOM 3540   H HB3  . LEU B 1 75  ? -18.666 -1.825  1.963   1.00 65.24 ? 75  LEU B HB3  1  
ATOM 3541   H HG   . LEU B 1 75  ? -19.616 -2.168  4.831   1.00 34.11 ? 75  LEU B HG   1  
ATOM 3542   H HD11 . LEU B 1 75  ? -21.212 -1.234  2.435   1.00 72.22 ? 75  LEU B HD11 1  
ATOM 3543   H HD12 . LEU B 1 75  ? -20.703 -0.242  3.802   1.00 12.25 ? 75  LEU B HD12 1  
ATOM 3544   H HD13 . LEU B 1 75  ? -21.842 -1.563  4.052   1.00 62.30 ? 75  LEU B HD13 1  
ATOM 3545   H HD21 . LEU B 1 75  ? -19.382 -4.320  3.728   1.00 63.51 ? 75  LEU B HD21 1  
ATOM 3546   H HD22 . LEU B 1 75  ? -20.331 -3.757  2.351   1.00 45.00 ? 75  LEU B HD22 1  
ATOM 3547   H HD23 . LEU B 1 75  ? -21.088 -3.931  3.937   1.00 73.10 ? 75  LEU B HD23 1  
ATOM 3548   N N    . CYS B 1 76  ? -15.529 -2.568  1.630   1.00 43.41 ? 76  CYS B N    1  
ATOM 3549   C CA   . CYS B 1 76  ? -14.415 -2.033  0.835   1.00 71.14 ? 76  CYS B CA   1  
ATOM 3550   C C    . CYS B 1 76  ? -14.774 -2.191  -0.640  1.00 40.21 ? 76  CYS B C    1  
ATOM 3551   O O    . CYS B 1 76  ? -15.652 -2.978  -0.973  1.00 74.42 ? 76  CYS B O    1  
ATOM 3552   C CB   . CYS B 1 76  ? -13.093 -2.762  1.179   1.00 55.25 ? 76  CYS B CB   1  
ATOM 3553   S SG   . CYS B 1 76  ? -11.633 -2.075  0.362   1.00 31.05 ? 76  CYS B SG   1  
ATOM 3554   H H    . CYS B 1 76  ? -15.959 -3.396  1.328   1.00 75.14 ? 76  CYS B H    1  
ATOM 3555   H HA   . CYS B 1 76  ? -14.305 -0.970  1.053   1.00 21.32 ? 76  CYS B HA   1  
ATOM 3556   H HB2  . CYS B 1 76  ? -12.922 -2.698  2.246   1.00 73.43 ? 76  CYS B HB2  1  
ATOM 3557   H HB3  . CYS B 1 76  ? -13.168 -3.806  0.897   1.00 51.21 ? 76  CYS B HB3  1  
ATOM 3558   H HG   . CYS B 1 76  ? -11.973 -1.736  -0.872  1.00 40.50 ? 76  CYS B HG   1  
ATOM 3559   N N    . GLU B 1 77  ? -14.134 -1.415  -1.510  1.00 22.41 ? 77  GLU B N    1  
ATOM 3560   C CA   . GLU B 1 77  ? -14.386 -1.467  -2.951  1.00 33.31 ? 77  GLU B CA   1  
ATOM 3561   C C    . GLU B 1 77  ? -13.274 -0.736  -3.672  1.00 73.02 ? 77  GLU B C    1  
ATOM 3562   O O    . GLU B 1 77  ? -12.849 0.343   -3.250  1.00 2.33  ? 77  GLU B O    1  
ATOM 3563   C CB   . GLU B 1 77  ? -15.771 -0.854  -3.291  1.00 2.53  ? 77  GLU B CB   1  
ATOM 3564   C CG   . GLU B 1 77  ? -16.160 -0.854  -4.786  1.00 72.24 ? 77  GLU B CG   1  
ATOM 3565   C CD   . GLU B 1 77  ? -17.545 -0.235  -5.007  1.00 0.24  ? 77  GLU B CD   1  
ATOM 3566   O OE1  . GLU B 1 77  ? -18.553 -0.961  -4.934  1.00 73.02 ? 77  GLU B OE1  1  
ATOM 3567   O OE2  . GLU B 1 77  ? -17.635 0.980   -5.246  1.00 10.24 ? 77  GLU B OE2  1  
ATOM 3568   H H    . GLU B 1 77  ? -13.469 -0.774  -1.178  1.00 32.33 ? 77  GLU B H    1  
ATOM 3569   H HA   . GLU B 1 77  ? -14.362 -2.512  -3.253  1.00 32.42 ? 77  GLU B HA   1  
ATOM 3570   H HB2  . GLU B 1 77  ? -16.529 -1.410  -2.747  1.00 50.13 ? 77  GLU B HB2  1  
ATOM 3571   H HB3  . GLU B 1 77  ? -15.789 0.173   -2.934  1.00 34.45 ? 77  GLU B HB3  1  
ATOM 3572   H HG2  . GLU B 1 77  ? -15.420 -0.282  -5.342  1.00 23.34 ? 77  GLU B HG2  1  
ATOM 3573   H HG3  . GLU B 1 77  ? -16.167 -1.876  -5.163  1.00 10.43 ? 77  GLU B HG3  1  
ATOM 3574   N N    . VAL B 1 78  ? -12.767 -1.361  -4.730  1.00 14.01 ? 78  VAL B N    1  
ATOM 3575   C CA   . VAL B 1 78  ? -11.719 -0.802  -5.574  1.00 51.24 ? 78  VAL B CA   1  
ATOM 3576   C C    . VAL B 1 78  ? -12.147 -0.931  -7.027  1.00 43.43 ? 78  VAL B C    1  
ATOM 3577   O O    . VAL B 1 78  ? -12.799 -1.906  -7.405  1.00 13.21 ? 78  VAL B O    1  
ATOM 3578   C CB   . VAL B 1 78  ? -10.346 -1.549  -5.370  1.00 30.13 ? 78  VAL B CB   1  
ATOM 3579   C CG1  . VAL B 1 78  ? -9.219  -0.899  -6.220  1.00 61.43 ? 78  VAL B CG1  1  
ATOM 3580   C CG2  . VAL B 1 78  ? -9.971  -1.599  -3.867  1.00 13.13 ? 78  VAL B CG2  1  
ATOM 3581   H H    . VAL B 1 78  ? -13.120 -2.247  -4.962  1.00 51.21 ? 78  VAL B H    1  
ATOM 3582   H HA   . VAL B 1 78  ? -11.587 0.254   -5.327  1.00 21.40 ? 78  VAL B HA   1  
ATOM 3583   H HB   . VAL B 1 78  ? -10.468 -2.576  -5.715  1.00 71.44 ? 78  VAL B HB   1  
ATOM 3584   H HG11 . VAL B 1 78  ? -8.371  -1.541  -6.253  1.00 45.20 ? 78  VAL B HG11 1  
ATOM 3585   H HG12 . VAL B 1 78  ? -8.932  0.049   -5.792  1.00 55.31 ? 78  VAL B HG12 1  
ATOM 3586   H HG13 . VAL B 1 78  ? -9.571  -0.736  -7.222  1.00 44.41 ? 78  VAL B HG13 1  
ATOM 3587   H HG21 . VAL B 1 78  ? -9.660  -0.622  -3.526  1.00 21.53 ? 78  VAL B HG21 1  
ATOM 3588   H HG22 . VAL B 1 78  ? -9.181  -2.308  -3.708  1.00 61.40 ? 78  VAL B HG22 1  
ATOM 3589   H HG23 . VAL B 1 78  ? -10.826 -1.915  -3.290  1.00 52.21 ? 78  VAL B HG23 1  
ATOM 3590   N N    . GLN B 1 79  ? -11.773 0.051   -7.834  1.00 60.52 ? 79  GLN B N    1  
ATOM 3591   C CA   . GLN B 1 79  ? -11.935 -0.006  -9.285  1.00 51.43 ? 79  GLN B CA   1  
ATOM 3592   C C    . GLN B 1 79  ? -10.568 0.141   -9.917  1.00 64.30 ? 79  GLN B C    1  
ATOM 3593   O O    . GLN B 1 79  ? -10.077 1.257   -10.094 1.00 11.40 ? 79  GLN B O    1  
ATOM 3594   C CB   . GLN B 1 79  ? -12.912 1.084   -9.802  1.00 64.11 ? 79  GLN B CB   1  
ATOM 3595   C CG   . GLN B 1 79  ? -14.384 0.857   -9.413  1.00 43.33 ? 79  GLN B CG   1  
ATOM 3596   C CD   . GLN B 1 79  ? -15.371 1.850   -10.039 1.00 23.32 ? 79  GLN B CD   1  
ATOM 3597   O OE1  . GLN B 1 79  ? -16.407 2.157   -9.454  1.00 24.34 ? 79  GLN B OE1  1  
ATOM 3598   N NE2  . GLN B 1 79  ? -15.080 2.332   -11.247 1.00 32.54 ? 79  GLN B NE2  1  
ATOM 3599   H H    . GLN B 1 79  ? -11.347 0.844   -7.436  1.00 72.45 ? 79  GLN B H    1  
ATOM 3600   H HA   . GLN B 1 79  ? -12.321 -0.988  -9.544  1.00 40.21 ? 79  GLN B HA   1  
ATOM 3601   H HB2  . GLN B 1 79  ? -12.601 2.046   -9.406  1.00 33.30 ? 79  GLN B HB2  1  
ATOM 3602   H HB3  . GLN B 1 79  ? -12.853 1.126   -10.886 1.00 63.30 ? 79  GLN B HB3  1  
ATOM 3603   H HG2  . GLN B 1 79  ? -14.674 -0.136  -9.724  1.00 72.13 ? 79  GLN B HG2  1  
ATOM 3604   H HG3  . GLN B 1 79  ? -14.466 0.924   -8.334  1.00 74.21 ? 79  GLN B HG3  1  
ATOM 3605   H HE21 . GLN B 1 79  ? -14.257 2.040   -11.680 1.00 41.32 ? 79  GLN B HE21 1  
ATOM 3606   H HE22 . GLN B 1 79  ? -15.697 2.985   -11.638 1.00 12.10 ? 79  GLN B HE22 1  
ATOM 3607   N N    . GLN B 1 80  ? -9.935  -0.998  -10.205 1.00 22.22 ? 80  GLN B N    1  
ATOM 3608   C CA   . GLN B 1 80  ? -8.617  -1.017  -10.812 1.00 21.31 ? 80  GLN B CA   1  
ATOM 3609   C C    . GLN B 1 80  ? -8.776  -0.974  -12.332 1.00 12.21 ? 80  GLN B C    1  
ATOM 3610   O O    . GLN B 1 80  ? -9.173  -1.972  -12.949 1.00 24.15 ? 80  GLN B O    1  
ATOM 3611   C CB   . GLN B 1 80  ? -7.815  -2.266  -10.367 1.00 4.20  ? 80  GLN B CB   1  
ATOM 3612   C CG   . GLN B 1 80  ? -6.308  -2.141  -10.637 1.00 3.32  ? 80  GLN B CG   1  
ATOM 3613   C CD   . GLN B 1 80  ? -5.635  -1.013  -9.830  1.00 74.41 ? 80  GLN B CD   1  
ATOM 3614   O OE1  . GLN B 1 80  ? -4.699  -0.372  -10.298 1.00 20.13 ? 80  GLN B OE1  1  
ATOM 3615   N NE2  . GLN B 1 80  ? -6.064  -0.810  -8.582  1.00 24.21 ? 80  GLN B NE2  1  
ATOM 3616   H H    . GLN B 1 80  ? -10.381 -1.852  -10.015 1.00 75.31 ? 80  GLN B H    1  
ATOM 3617   H HA   . GLN B 1 80  ? -8.078  -0.124  -10.484 1.00 5.04  ? 80  GLN B HA   1  
ATOM 3618   H HB2  . GLN B 1 80  ? -7.957  -2.413  -9.300  1.00 31.11 ? 80  GLN B HB2  1  
ATOM 3619   H HB3  . GLN B 1 80  ? -8.190  -3.143  -10.886 1.00 41.13 ? 80  GLN B HB3  1  
ATOM 3620   H HG2  . GLN B 1 80  ? -5.829  -3.076  -10.368 1.00 60.30 ? 80  GLN B HG2  1  
ATOM 3621   H HG3  . GLN B 1 80  ? -6.155  -1.959  -11.698 1.00 22.30 ? 80  GLN B HG3  1  
ATOM 3622   H HE21 . GLN B 1 80  ? -6.772  -1.387  -8.229  1.00 40.13 ? 80  GLN B HE21 1  
ATOM 3623   H HE22 . GLN B 1 80  ? -5.653  -0.083  -8.067  1.00 74.51 ? 80  GLN B HE22 1  
ATOM 3624   N N    . GLY B 1 81  ? -8.547  0.211   -12.900 1.00 40.42 ? 81  GLY B N    1  
ATOM 3625   C CA   . GLY B 1 81  ? -8.569  0.408   -14.335 1.00 41.31 ? 81  GLY B CA   1  
ATOM 3626   C C    . GLY B 1 81  ? -7.191  0.258   -14.930 1.00 3.03  ? 81  GLY B C    1  
ATOM 3627   O O    . GLY B 1 81  ? -6.179  0.443   -14.241 1.00 54.23 ? 81  GLY B O    1  
ATOM 3628   H H    . GLY B 1 81  ? -8.327  0.969   -12.324 1.00 31.30 ? 81  GLY B H    1  
ATOM 3629   H HA2  . GLY B 1 81  ? -9.246  -0.306  -14.800 1.00 10.52 ? 81  GLY B HA2  1  
ATOM 3630   H HA3  . GLY B 1 81  ? -8.928  1.405   -14.542 1.00 70.31 ? 81  GLY B HA3  1  
ATOM 3631   N N    . GLY B 1 82  ? -7.157  -0.060  -16.213 1.00 73.33 ? 82  GLY B N    1  
ATOM 3632   C CA   . GLY B 1 82  ? -5.925  -0.285  -16.927 1.00 71.00 ? 82  GLY B CA   1  
ATOM 3633   C C    . GLY B 1 82  ? -6.149  -0.118  -18.403 1.00 24.01 ? 82  GLY B C    1  
ATOM 3634   O O    . GLY B 1 82  ? -7.054  -0.737  -18.970 1.00 45.41 ? 82  GLY B O    1  
ATOM 3635   H H    . GLY B 1 82  ? -8.008  -0.136  -16.700 1.00 10.44 ? 82  GLY B H    1  
ATOM 3636   H HA2  . GLY B 1 82  ? -5.164  0.414   -16.582 1.00 5.12  ? 82  GLY B HA2  1  
ATOM 3637   H HA3  . GLY B 1 82  ? -5.585  -1.296  -16.737 1.00 20.34 ? 82  GLY B HA3  1  
ATOM 3638   N N    . ILE B 1 83  ? -5.341  0.735   -19.022 1.00 62.35 ? 83  ILE B N    1  
ATOM 3639   C CA   . ILE B 1 83  ? -5.368  0.950   -20.461 1.00 11.53 ? 83  ILE B CA   1  
ATOM 3640   C C    . ILE B 1 83  ? -4.472  -0.118  -21.108 1.00 62.21 ? 83  ILE B C    1  
ATOM 3641   O O    . ILE B 1 83  ? -3.337  -0.332  -20.662 1.00 42.24 ? 83  ILE B O    1  
ATOM 3642   C CB   . ILE B 1 83  ? -4.868  2.393   -20.835 1.00 13.42 ? 83  ILE B CB   1  
ATOM 3643   C CG1  . ILE B 1 83  ? -5.565  3.473   -19.942 1.00 44.55 ? 83  ILE B CG1  1  
ATOM 3644   C CG2  . ILE B 1 83  ? -5.101  2.663   -22.343 1.00 61.20 ? 83  ILE B CG2  1  
ATOM 3645   C CD1  . ILE B 1 83  ? -5.030  4.885   -20.091 1.00 21.33 ? 83  ILE B CD1  1  
ATOM 3646   H H    . ILE B 1 83  ? -4.697  1.233   -18.488 1.00 10.20 ? 83  ILE B H    1  
ATOM 3647   H HA   . ILE B 1 83  ? -6.396  0.833   -20.813 1.00 23.15 ? 83  ILE B HA   1  
ATOM 3648   H HB   . ILE B 1 83  ? -3.793  2.435   -20.654 1.00 22.41 ? 83  ILE B HB   1  
ATOM 3649   H HG12 . ILE B 1 83  ? -6.619  3.505   -20.173 1.00 64.32 ? 83  ILE B HG12 1  
ATOM 3650   H HG13 . ILE B 1 83  ? -5.450  3.197   -18.898 1.00 50.44 ? 83  ILE B HG13 1  
ATOM 3651   H HG21 . ILE B 1 83  ? -4.536  1.952   -22.935 1.00 71.10 ? 83  ILE B HG21 1  
ATOM 3652   H HG22 . ILE B 1 83  ? -4.781  3.659   -22.596 1.00 5.34  ? 83  ILE B HG22 1  
ATOM 3653   H HG23 . ILE B 1 83  ? -6.150  2.561   -22.577 1.00 32.11 ? 83  ILE B HG23 1  
ATOM 3654   H HD11 . ILE B 1 83  ? -5.499  5.523   -19.357 1.00 50.45 ? 83  ILE B HD11 1  
ATOM 3655   H HD12 . ILE B 1 83  ? -5.252  5.255   -21.081 1.00 1.14  ? 83  ILE B HD12 1  
ATOM 3656   H HD13 . ILE B 1 83  ? -3.959  4.889   -19.936 1.00 72.41 ? 83  ILE B HD13 1  
ATOM 3657   N N    . PHE B 1 84  ? -5.004  -0.801  -22.124 1.00 74.30 ? 84  PHE B N    1  
ATOM 3658   C CA   . PHE B 1 84  ? -4.306  -1.878  -22.847 1.00 4.22  ? 84  PHE B CA   1  
ATOM 3659   C C    . PHE B 1 84  ? -4.497  -1.652  -24.353 1.00 34.31 ? 84  PHE B C    1  
ATOM 3660   O O    . PHE B 1 84  ? -5.613  -1.356  -24.801 1.00 52.11 ? 84  PHE B O    1  
ATOM 3661   C CB   . PHE B 1 84  ? -4.861  -3.284  -22.450 1.00 53.24 ? 84  PHE B CB   1  
ATOM 3662   C CG   . PHE B 1 84  ? -4.769  -3.630  -20.952 1.00 1.34  ? 84  PHE B CG   1  
ATOM 3663   C CD1  . PHE B 1 84  ? -5.870  -3.463  -20.108 1.00 11.12 ? 84  PHE B CD1  1  
ATOM 3664   C CD2  . PHE B 1 84  ? -3.589  -4.131  -20.390 1.00 10.24 ? 84  PHE B CD2  1  
ATOM 3665   C CE1  . PHE B 1 84  ? -5.794  -3.785  -18.762 1.00 23.24 ? 84  PHE B CE1  1  
ATOM 3666   C CE2  . PHE B 1 84  ? -3.519  -4.452  -19.036 1.00 41.43 ? 84  PHE B CE2  1  
ATOM 3667   C CZ   . PHE B 1 84  ? -4.621  -4.280  -18.230 1.00 63.33 ? 84  PHE B CZ   1  
ATOM 3668   H H    . PHE B 1 84  ? -5.904  -0.553  -22.420 1.00 21.31 ? 84  PHE B H    1  
ATOM 3669   H HA   . PHE B 1 84  ? -3.243  -1.832  -22.611 1.00 23.43 ? 84  PHE B HA   1  
ATOM 3670   H HB2  . PHE B 1 84  ? -5.905  -3.343  -22.742 1.00 1.42  ? 84  PHE B HB2  1  
ATOM 3671   H HB3  . PHE B 1 84  ? -4.314  -4.046  -22.999 1.00 61.24 ? 84  PHE B HB3  1  
ATOM 3672   H HD1  . PHE B 1 84  ? -6.798  -3.077  -20.514 1.00 24.23 ? 84  PHE B HD1  1  
ATOM 3673   H HD2  . PHE B 1 84  ? -2.716  -4.267  -21.018 1.00 31.34 ? 84  PHE B HD2  1  
ATOM 3674   H HE1  . PHE B 1 84  ? -6.659  -3.648  -18.124 1.00 60.13 ? 84  PHE B HE1  1  
ATOM 3675   H HE2  . PHE B 1 84  ? -2.596  -4.846  -18.611 1.00 73.44 ? 84  PHE B HE2  1  
ATOM 3676   H HZ   . PHE B 1 84  ? -4.567  -4.531  -17.178 1.00 53.11 ? 84  PHE B HZ   1  
ATOM 3677   N N    . SER B 1 85  ? -3.409  -1.772  -25.120 1.00 43.04 ? 85  SER B N    1  
ATOM 3678   C CA   . SER B 1 85  ? -3.454  -1.734  -26.584 1.00 24.41 ? 85  SER B CA   1  
ATOM 3679   C C    . SER B 1 85  ? -3.575  -3.164  -27.119 1.00 54.51 ? 85  SER B C    1  
ATOM 3680   O O    . SER B 1 85  ? -2.643  -3.963  -26.990 1.00 35.21 ? 85  SER B O    1  
ATOM 3681   C CB   . SER B 1 85  ? -2.209  -1.024  -27.150 1.00 52.21 ? 85  SER B CB   1  
ATOM 3682   O OG   . SER B 1 85  ? -2.199  0.339   -26.763 1.00 11.44 ? 85  SER B OG   1  
ATOM 3683   H H    . SER B 1 85  ? -2.542  -1.898  -24.685 1.00 72.54 ? 85  SER B H    1  
ATOM 3684   H HA   . SER B 1 85  ? -4.338  -1.168  -26.883 1.00 73.11 ? 85  SER B HA   1  
ATOM 3685   H HB2  . SER B 1 85  ? -1.310  -1.497  -26.771 1.00 74.03 ? 85  SER B HB2  1  
ATOM 3686   H HB3  . SER B 1 85  ? -2.214  -1.075  -28.231 1.00 53.00 ? 85  SER B HB3  1  
ATOM 3687   H HG   . SER B 1 85  ? -2.836  0.474   -26.052 1.00 22.20 ? 85  SER B HG   1  
ATOM 3688   N N    . ILE B 1 86  ? -4.754  -3.474  -27.680 1.00 33.24 ? 86  ILE B N    1  
ATOM 3689   C CA   . ILE B 1 86  ? -5.095  -4.794  -28.234 1.00 74.44 ? 86  ILE B CA   1  
ATOM 3690   C C    . ILE B 1 86  ? -5.547  -4.626  -29.694 1.00 32.24 ? 86  ILE B C    1  
ATOM 3691   O O    . ILE B 1 86  ? -6.355  -3.743  -30.006 1.00 74.21 ? 86  ILE B O    1  
ATOM 3692   C CB   . ILE B 1 86  ? -6.186  -5.576  -27.385 1.00 52.02 ? 86  ILE B CB   1  
ATOM 3693   C CG1  . ILE B 1 86  ? -7.572  -4.844  -27.346 1.00 23.40 ? 86  ILE B CG1  1  
ATOM 3694   C CG2  . ILE B 1 86  ? -5.676  -5.858  -25.949 1.00 42.13 ? 86  ILE B CG2  1  
ATOM 3695   C CD1  . ILE B 1 86  ? -7.616  -3.536  -26.567 1.00 25.42 ? 86  ILE B CD1  1  
ATOM 3696   H H    . ILE B 1 86  ? -5.427  -2.764  -27.751 1.00 34.41 ? 86  ILE B H    1  
ATOM 3697   H HA   . ILE B 1 86  ? -4.188  -5.392  -28.233 1.00 44.10 ? 86  ILE B HA   1  
ATOM 3698   H HB   . ILE B 1 86  ? -6.326  -6.545  -27.864 1.00 52.44 ? 86  ILE B HB   1  
ATOM 3699   H HG12 . ILE B 1 86  ? -7.880  -4.619  -28.361 1.00 21.10 ? 86  ILE B HG12 1  
ATOM 3700   H HG13 . ILE B 1 86  ? -8.311  -5.507  -26.910 1.00 2.25  ? 86  ILE B HG13 1  
ATOM 3701   H HG21 . ILE B 1 86  ? -6.422  -6.414  -25.394 1.00 32.11 ? 86  ILE B HG21 1  
ATOM 3702   H HG22 . ILE B 1 86  ? -5.476  -4.924  -25.437 1.00 21.52 ? 86  ILE B HG22 1  
ATOM 3703   H HG23 . ILE B 1 86  ? -4.760  -6.438  -25.992 1.00 32.21 ? 86  ILE B HG23 1  
ATOM 3704   H HD11 . ILE B 1 86  ? -6.911  -2.835  -26.996 1.00 54.12 ? 86  ILE B HD11 1  
ATOM 3705   H HD12 . ILE B 1 86  ? -7.363  -3.717  -25.534 1.00 30.53 ? 86  ILE B HD12 1  
ATOM 3706   H HD13 . ILE B 1 86  ? -8.611  -3.119  -26.625 1.00 11.23 ? 86  ILE B HD13 1  
ATOM 3707   N N    . ALA B 1 87  ? -5.004  -5.467  -30.580 1.00 33.04 ? 87  ALA B N    1  
ATOM 3708   C CA   . ALA B 1 87  ? -5.209  -5.350  -32.034 1.00 23.05 ? 87  ALA B CA   1  
ATOM 3709   C C    . ALA B 1 87  ? -4.992  -6.699  -32.722 1.00 23.15 ? 87  ALA B C    1  
ATOM 3710   O O    . ALA B 1 87  ? -4.557  -7.663  -32.083 1.00 1.11  ? 87  ALA B O    1  
ATOM 3711   C CB   . ALA B 1 87  ? -4.247  -4.295  -32.598 1.00 53.03 ? 87  ALA B CB   1  
ATOM 3712   H H    . ALA B 1 87  ? -4.444  -6.198  -30.246 1.00 71.04 ? 87  ALA B H    1  
ATOM 3713   H HA   . ALA B 1 87  ? -6.230  -5.024  -32.220 1.00 62.12 ? 87  ALA B HA   1  
ATOM 3714   H HB1  . ALA B 1 87  ? -4.430  -3.343  -32.113 1.00 54.21 ? 87  ALA B HB1  1  
ATOM 3715   H HB2  . ALA B 1 87  ? -4.404  -4.185  -33.660 1.00 1.41  ? 87  ALA B HB2  1  
ATOM 3716   H HB3  . ALA B 1 87  ? -3.223  -4.595  -32.414 1.00 13.42 ? 87  ALA B HB3  1  
ATOM 3717   N N    . GLY B 1 88  ? -5.311  -6.746  -34.032 1.00 62.35 ? 88  GLY B N    1  
ATOM 3718   C CA   . GLY B 1 88  ? -5.117  -7.933  -34.870 1.00 3.40  ? 88  GLY B CA   1  
ATOM 3719   C C    . GLY B 1 88  ? -6.245  -8.950  -34.709 1.00 51.32 ? 88  GLY B C    1  
ATOM 3720   O O    . GLY B 1 88  ? -6.987  -9.235  -35.655 1.00 35.13 ? 88  GLY B O    1  
ATOM 3721   H H    . GLY B 1 88  ? -5.712  -5.949  -34.438 1.00 53.30 ? 88  GLY B H    1  
ATOM 3722   H HA2  . GLY B 1 88  ? -5.075  -7.612  -35.903 1.00 75.11 ? 88  GLY B HA2  1  
ATOM 3723   H HA3  . GLY B 1 88  ? -4.175  -8.406  -34.621 1.00 4.51  ? 88  GLY B HA3  1  
ATOM 3724   N N    . ILE B 1 89  ? -6.363  -9.487  -33.488 1.00 35.43 ? 89  ILE B N    1  
ATOM 3725   C CA   . ILE B 1 89  ? -7.363  -10.499 -33.117 1.00 44.44 ? 89  ILE B CA   1  
ATOM 3726   C C    . ILE B 1 89  ? -8.798  -9.927  -33.109 1.00 65.22 ? 89  ILE B C    1  
ATOM 3727   O O    . ILE B 1 89  ? -8.999  -8.716  -32.968 1.00 14.34 ? 89  ILE B O    1  
ATOM 3728   C CB   . ILE B 1 89  ? -6.970  -11.150 -31.717 1.00 31.41 ? 89  ILE B CB   1  
ATOM 3729   C CG1  . ILE B 1 89  ? -5.988  -12.350 -31.917 1.00 75.55 ? 89  ILE B CG1  1  
ATOM 3730   C CG2  . ILE B 1 89  ? -8.188  -11.581 -30.871 1.00 71.15 ? 89  ILE B CG2  1  
ATOM 3731   C CD1  . ILE B 1 89  ? -6.541  -13.482 -32.764 1.00 41.14 ? 89  ILE B CD1  1  
ATOM 3732   H H    . ILE B 1 89  ? -5.754  -9.173  -32.790 1.00 21.43 ? 89  ILE B H    1  
ATOM 3733   H HA   . ILE B 1 89  ? -7.324  -11.280 -33.874 1.00 40.33 ? 89  ILE B HA   1  
ATOM 3734   H HB   . ILE B 1 89  ? -6.450  -10.389 -31.143 1.00 34.34 ? 89  ILE B HB   1  
ATOM 3735   H HG12 . ILE B 1 89  ? -5.087  -11.997 -32.399 1.00 60.30 ? 89  ILE B HG12 1  
ATOM 3736   H HG13 . ILE B 1 89  ? -5.727  -12.761 -30.949 1.00 72.14 ? 89  ILE B HG13 1  
ATOM 3737   H HG21 . ILE B 1 89  ? -7.872  -11.996 -29.946 1.00 73.43 ? 89  ILE B HG21 1  
ATOM 3738   H HG22 . ILE B 1 89  ? -8.762  -12.323 -31.409 1.00 41.42 ? 89  ILE B HG22 1  
ATOM 3739   H HG23 . ILE B 1 89  ? -8.818  -10.726 -30.676 1.00 24.23 ? 89  ILE B HG23 1  
ATOM 3740   H HD11 . ILE B 1 89  ? -5.838  -14.299 -32.763 1.00 14.22 ? 89  ILE B HD11 1  
ATOM 3741   H HD12 . ILE B 1 89  ? -6.689  -13.140 -33.777 1.00 5.11  ? 89  ILE B HD12 1  
ATOM 3742   H HD13 . ILE B 1 89  ? -7.483  -13.821 -32.355 1.00 55.22 ? 89  ILE B HD13 1  
ATOM 3743   N N    . GLU B 1 90  ? -9.782  -10.844 -33.244 1.00 70.45 ? 90  GLU B N    1  
ATOM 3744   C CA   . GLU B 1 90  ? -11.207 -10.504 -33.268 1.00 63.05 ? 90  GLU B CA   1  
ATOM 3745   C C    . GLU B 1 90  ? -12.077 -11.749 -32.933 1.00 74.21 ? 90  GLU B C    1  
ATOM 3746   O O    . GLU B 1 90  ? -11.640 -12.894 -33.122 1.00 24.23 ? 90  GLU B O    1  
ATOM 3747   C CB   . GLU B 1 90  ? -11.555 -9.892  -34.661 1.00 2.15  ? 90  GLU B CB   1  
ATOM 3748   C CG   . GLU B 1 90  ? -13.007 -9.428  -34.871 1.00 72.33 ? 90  GLU B CG   1  
ATOM 3749   C CD   . GLU B 1 90  ? -13.485 -8.417  -33.817 1.00 2.31  ? 90  GLU B CD   1  
ATOM 3750   O OE1  . GLU B 1 90  ? -14.470 -8.710  -33.109 1.00 50.22 ? 90  GLU B OE1  1  
ATOM 3751   O OE2  . GLU B 1 90  ? -12.867 -7.343  -33.683 1.00 31.21 ? 90  GLU B OE2  1  
ATOM 3752   H H    . GLU B 1 90  ? -9.528  -11.787 -33.301 1.00 52.04 ? 90  GLU B H    1  
ATOM 3753   H HA   . GLU B 1 90  ? -11.366 -9.761  -32.492 1.00 3.43  ? 90  GLU B HA   1  
ATOM 3754   H HB2  . GLU B 1 90  ? -10.914 -9.031  -34.822 1.00 41.20 ? 90  GLU B HB2  1  
ATOM 3755   H HB3  . GLU B 1 90  ? -11.321 -10.628 -35.429 1.00 2.13  ? 90  GLU B HB3  1  
ATOM 3756   H HG2  . GLU B 1 90  ? -13.089 -8.969  -35.851 1.00 74.15 ? 90  GLU B HG2  1  
ATOM 3757   H HG3  . GLU B 1 90  ? -13.649 -10.303 -34.846 1.00 44.14 ? 90  GLU B HG3  1  
ATOM 3758   N N    . GLY B 1 91  ? -13.286 -11.491 -32.387 1.00 61.22 ? 91  GLY B N    1  
ATOM 3759   C CA   . GLY B 1 91  ? -14.284 -12.520 -32.060 1.00 25.13 ? 91  GLY B CA   1  
ATOM 3760   C C    . GLY B 1 91  ? -14.177 -13.016 -30.621 1.00 14.24 ? 91  GLY B C    1  
ATOM 3761   O O    . GLY B 1 91  ? -13.961 -12.215 -29.707 1.00 10.04 ? 91  GLY B O    1  
ATOM 3762   H H    . GLY B 1 91  ? -13.511 -10.556 -32.200 1.00 53.02 ? 91  GLY B H    1  
ATOM 3763   H HA2  . GLY B 1 91  ? -15.265 -12.091 -32.199 1.00 61.10 ? 91  GLY B HA2  1  
ATOM 3764   H HA3  . GLY B 1 91  ? -14.180 -13.361 -32.741 1.00 2.35  ? 91  GLY B HA3  1  
ATOM 3765   N N    . THR B 1 92  ? -14.282 -14.347 -30.431 1.00 42.32 ? 92  THR B N    1  
ATOM 3766   C CA   . THR B 1 92  ? -14.225 -14.991 -29.097 1.00 50.31 ? 92  THR B CA   1  
ATOM 3767   C C    . THR B 1 92  ? -12.818 -14.849 -28.475 1.00 75.24 ? 92  THR B C    1  
ATOM 3768   O O    . THR B 1 92  ? -12.656 -14.812 -27.248 1.00 50.10 ? 92  THR B O    1  
ATOM 3769   C CB   . THR B 1 92  ? -14.605 -16.506 -29.199 1.00 52.04 ? 92  THR B CB   1  
ATOM 3770   O OG1  . THR B 1 92  ? -15.825 -16.636 -29.942 1.00 50.52 ? 92  THR B OG1  1  
ATOM 3771   C CG2  . THR B 1 92  ? -14.785 -17.167 -27.811 1.00 32.02 ? 92  THR B CG2  1  
ATOM 3772   H H    . THR B 1 92  ? -14.411 -14.918 -31.218 1.00 22.11 ? 92  THR B H    1  
ATOM 3773   H HA   . THR B 1 92  ? -14.950 -14.496 -28.457 1.00 31.24 ? 92  THR B HA   1  
ATOM 3774   H HB   . THR B 1 92  ? -13.820 -17.030 -29.739 1.00 32.51 ? 92  THR B HB   1  
ATOM 3775   H HG1  . THR B 1 92  ? -15.842 -17.494 -30.380 1.00 22.12 ? 92  THR B HG1  1  
ATOM 3776   H HG21 . THR B 1 92  ? -15.037 -18.211 -27.933 1.00 10.33 ? 92  THR B HG21 1  
ATOM 3777   H HG22 . THR B 1 92  ? -15.578 -16.672 -27.269 1.00 42.51 ? 92  THR B HG22 1  
ATOM 3778   H HG23 . THR B 1 92  ? -13.864 -17.088 -27.244 1.00 10.12 ? 92  THR B HG23 1  
ATOM 3779   N N    . GLN B 1 93  ? -11.821 -14.745 -29.364 1.00 65.34 ? 93  GLN B N    1  
ATOM 3780   C CA   . GLN B 1 93  ? -10.400 -14.657 -29.007 1.00 0.44  ? 93  GLN B CA   1  
ATOM 3781   C C    . GLN B 1 93  ? -10.108 -13.361 -28.209 1.00 13.24 ? 93  GLN B C    1  
ATOM 3782   O O    . GLN B 1 93  ? -9.345  -13.381 -27.237 1.00 14.10 ? 93  GLN B O    1  
ATOM 3783   C CB   . GLN B 1 93  ? -9.553  -14.731 -30.305 1.00 64.15 ? 93  GLN B CB   1  
ATOM 3784   C CG   . GLN B 1 93  ? -9.816  -15.989 -31.165 1.00 25.25 ? 93  GLN B CG   1  
ATOM 3785   C CD   . GLN B 1 93  ? -9.029  -16.002 -32.478 1.00 72.32 ? 93  GLN B CD   1  
ATOM 3786   O OE1  . GLN B 1 93  ? -7.915  -16.522 -32.547 1.00 42.15 ? 93  GLN B OE1  1  
ATOM 3787   N NE2  . GLN B 1 93  ? -9.589  -15.403 -33.524 1.00 74.32 ? 93  GLN B NE2  1  
ATOM 3788   H H    . GLN B 1 93  ? -12.058 -14.726 -30.315 1.00 63.32 ? 93  GLN B H    1  
ATOM 3789   H HA   . GLN B 1 93  ? -10.162 -15.512 -28.383 1.00 3.13  ? 93  GLN B HA   1  
ATOM 3790   H HB2  . GLN B 1 93  ? -9.772  -13.856 -30.911 1.00 5.22  ? 93  GLN B HB2  1  
ATOM 3791   H HB3  . GLN B 1 93  ? -8.499  -14.709 -30.045 1.00 65.43 ? 93  GLN B HB3  1  
ATOM 3792   H HG2  . GLN B 1 93  ? -9.543  -16.865 -30.590 1.00 41.10 ? 93  GLN B HG2  1  
ATOM 3793   H HG3  . GLN B 1 93  ? -10.875 -16.035 -31.394 1.00 70.40 ? 93  GLN B HG3  1  
ATOM 3794   H HE21 . GLN B 1 93  ? -10.468 -14.979 -33.404 1.00 3.45  ? 93  GLN B HE21 1  
ATOM 3795   H HE22 . GLN B 1 93  ? -9.102  -15.411 -34.375 1.00 43.13 ? 93  GLN B HE22 1  
ATOM 3796   N N    . MET B 1 94  ? -10.747 -12.237 -28.615 1.00 3.01  ? 94  MET B N    1  
ATOM 3797   C CA   . MET B 1 94  ? -10.606 -10.938 -27.909 1.00 14.05 ? 94  MET B CA   1  
ATOM 3798   C C    . MET B 1 94  ? -11.645 -10.813 -26.781 1.00 0.22  ? 94  MET B C    1  
ATOM 3799   O O    . MET B 1 94  ? -11.402 -10.116 -25.795 1.00 42.51 ? 94  MET B O    1  
ATOM 3800   C CB   . MET B 1 94  ? -10.670 -9.727  -28.895 1.00 53.34 ? 94  MET B CB   1  
ATOM 3801   C CG   . MET B 1 94  ? -11.969 -9.561  -29.699 1.00 34.20 ? 94  MET B CG   1  
ATOM 3802   S SD   . MET B 1 94  ? -13.371 -9.048  -28.686 1.00 32.14 ? 94  MET B SD   1  
ATOM 3803   C CE   . MET B 1 94  ? -14.660 -8.885  -29.916 1.00 72.34 ? 94  MET B CE   1  
ATOM 3804   H H    . MET B 1 94  ? -11.335 -12.286 -29.398 1.00 22.55 ? 94  MET B H    1  
ATOM 3805   H HA   . MET B 1 94  ? -9.620  -10.934 -27.444 1.00 14.30 ? 94  MET B HA   1  
ATOM 3806   H HB2  . MET B 1 94  ? -10.515 -8.816  -28.332 1.00 30.32 ? 94  MET B HB2  1  
ATOM 3807   H HB3  . MET B 1 94  ? -9.851  -9.827  -29.602 1.00 21.53 ? 94  MET B HB3  1  
ATOM 3808   H HG2  . MET B 1 94  ? -11.813 -8.812  -30.467 1.00 13.55 ? 94  MET B HG2  1  
ATOM 3809   H HG3  . MET B 1 94  ? -12.212 -10.506 -30.170 1.00 5.13  ? 94  MET B HG3  1  
ATOM 3810   H HE1  . MET B 1 94  ? -15.583 -8.603  -29.432 1.00 4.22  ? 94  MET B HE1  1  
ATOM 3811   H HE2  . MET B 1 94  ? -14.796 -9.827  -30.430 1.00 63.55 ? 94  MET B HE2  1  
ATOM 3812   H HE3  . MET B 1 94  ? -14.382 -8.121  -30.631 1.00 22.31 ? 94  MET B HE3  1  
ATOM 3813   N N    . ALA B 1 95  ? -12.783 -11.526 -26.920 1.00 41.04 ? 95  ALA B N    1  
ATOM 3814   C CA   . ALA B 1 95  ? -13.832 -11.590 -25.875 1.00 1.41  ? 95  ALA B CA   1  
ATOM 3815   C C    . ALA B 1 95  ? -13.272 -12.190 -24.566 1.00 60.44 ? 95  ALA B C    1  
ATOM 3816   O O    . ALA B 1 95  ? -13.670 -11.796 -23.469 1.00 4.31  ? 95  ALA B O    1  
ATOM 3817   C CB   . ALA B 1 95  ? -15.040 -12.400 -26.379 1.00 31.12 ? 95  ALA B CB   1  
ATOM 3818   H H    . ALA B 1 95  ? -12.929 -12.010 -27.758 1.00 42.34 ? 95  ALA B H    1  
ATOM 3819   H HA   . ALA B 1 95  ? -14.166 -10.575 -25.681 1.00 31.13 ? 95  ALA B HA   1  
ATOM 3820   H HB1  . ALA B 1 95  ? -14.742 -13.426 -26.570 1.00 51.24 ? 95  ALA B HB1  1  
ATOM 3821   H HB2  . ALA B 1 95  ? -15.413 -11.965 -27.297 1.00 42.05 ? 95  ALA B HB2  1  
ATOM 3822   H HB3  . ALA B 1 95  ? -15.829 -12.389 -25.635 1.00 43.41 ? 95  ALA B HB3  1  
ATOM 3823   N N    . HIS B 1 96  ? -12.334 -13.144 -24.716 1.00 63.34 ? 96  HIS B N    1  
ATOM 3824   C CA   . HIS B 1 96  ? -11.605 -13.758 -23.590 1.00 35.35 ? 96  HIS B CA   1  
ATOM 3825   C C    . HIS B 1 96  ? -10.474 -12.831 -23.090 1.00 5.11  ? 96  HIS B C    1  
ATOM 3826   O O    . HIS B 1 96  ? -10.223 -12.751 -21.882 1.00 13.14 ? 96  HIS B O    1  
ATOM 3827   C CB   . HIS B 1 96  ? -11.028 -15.135 -24.025 1.00 53.10 ? 96  HIS B CB   1  
ATOM 3828   C CG   . HIS B 1 96  ? -10.098 -15.765 -23.014 1.00 55.31 ? 96  HIS B CG   1  
ATOM 3829   N ND1  . HIS B 1 96  ? -8.757  -15.962 -23.252 1.00 61.41 ? 96  HIS B ND1  1  
ATOM 3830   C CD2  . HIS B 1 96  ? -10.317 -16.213 -21.752 1.00 4.43  ? 96  HIS B CD2  1  
ATOM 3831   C CE1  . HIS B 1 96  ? -8.193  -16.487 -22.186 1.00 64.02 ? 96  HIS B CE1  1  
ATOM 3832   N NE2  . HIS B 1 96  ? -9.115  -16.651 -21.256 1.00 14.45 ? 96  HIS B NE2  1  
ATOM 3833   H H    . HIS B 1 96  ? -12.131 -13.454 -25.624 1.00 21.05 ? 96  HIS B H    1  
ATOM 3834   H HA   . HIS B 1 96  ? -12.315 -13.919 -22.776 1.00 41.40 ? 96  HIS B HA   1  
ATOM 3835   H HB2  . HIS B 1 96  ? -11.845 -15.824 -24.195 1.00 62.24 ? 96  HIS B HB2  1  
ATOM 3836   H HB3  . HIS B 1 96  ? -10.479 -15.012 -24.953 1.00 52.31 ? 96  HIS B HB3  1  
ATOM 3837   H HD1  . HIS B 1 96  ? -8.283  -15.741 -24.083 1.00 23.11 ? 96  HIS B HD1  1  
ATOM 3838   H HD2  . HIS B 1 96  ? -11.267 -16.225 -21.232 1.00 3.21  ? 96  HIS B HD2  1  
ATOM 3839   H HE1  . HIS B 1 96  ? -7.149  -16.739 -22.085 1.00 41.42 ? 96  HIS B HE1  1  
ATOM 3840   H HE2  . HIS B 1 96  ? -8.904  -16.697 -20.300 1.00 37.61 ? 96  HIS B HE2  1  
ATOM 3841   N N    . CYS B 1 97  ? -9.804  -12.137 -24.035 1.00 44.53 ? 97  CYS B N    1  
ATOM 3842   C CA   . CYS B 1 97  ? -8.640  -11.274 -23.734 1.00 10.45 ? 97  CYS B CA   1  
ATOM 3843   C C    . CYS B 1 97  ? -9.028  -10.106 -22.807 1.00 2.42  ? 97  CYS B C    1  
ATOM 3844   O O    . CYS B 1 97  ? -8.303  -9.786  -21.864 1.00 34.22 ? 97  CYS B O    1  
ATOM 3845   C CB   . CYS B 1 97  ? -8.011  -10.730 -25.034 1.00 25.11 ? 97  CYS B CB   1  
ATOM 3846   S SG   . CYS B 1 97  ? -6.573  -9.660  -24.781 1.00 31.00 ? 97  CYS B SG   1  
ATOM 3847   H H    . CYS B 1 97  ? -10.110 -12.202 -24.963 1.00 1.44  ? 97  CYS B H    1  
ATOM 3848   H HA   . CYS B 1 97  ? -7.904  -11.888 -23.227 1.00 74.15 ? 97  CYS B HA   1  
ATOM 3849   H HB2  . CYS B 1 97  ? -7.688  -11.561 -25.648 1.00 53.20 ? 97  CYS B HB2  1  
ATOM 3850   H HB3  . CYS B 1 97  ? -8.752  -10.160 -25.581 1.00 23.54 ? 97  CYS B HB3  1  
ATOM 3851   H HG   . CYS B 1 97  ? -6.716  -9.039  -23.616 1.00 50.04 ? 97  CYS B HG   1  
ATOM 3852   N N    . LEU B 1 98  ? -10.179 -9.476  -23.087 1.00 1.31  ? 98  LEU B N    1  
ATOM 3853   C CA   . LEU B 1 98  ? -10.716 -8.379  -22.255 1.00 11.10 ? 98  LEU B CA   1  
ATOM 3854   C C    . LEU B 1 98  ? -11.648 -8.923  -21.152 1.00 52.33 ? 98  LEU B C    1  
ATOM 3855   O O    . LEU B 1 98  ? -11.854 -8.257  -20.137 1.00 2.43  ? 98  LEU B O    1  
ATOM 3856   C CB   . LEU B 1 98  ? -11.484 -7.334  -23.114 1.00 34.42 ? 98  LEU B CB   1  
ATOM 3857   C CG   . LEU B 1 98  ? -10.643 -6.450  -24.101 1.00 34.25 ? 98  LEU B CG   1  
ATOM 3858   C CD1  . LEU B 1 98  ? -10.218 -7.219  -25.367 1.00 72.34 ? 98  LEU B CD1  1  
ATOM 3859   C CD2  . LEU B 1 98  ? -11.407 -5.159  -24.461 1.00 21.24 ? 98  LEU B CD2  1  
ATOM 3860   H H    . LEU B 1 98  ? -10.679 -9.748  -23.884 1.00 33.32 ? 98  LEU B H    1  
ATOM 3861   H HA   . LEU B 1 98  ? -9.876  -7.877  -21.775 1.00 13.52 ? 98  LEU B HA   1  
ATOM 3862   H HB2  . LEU B 1 98  ? -12.242 -7.861  -23.688 1.00 64.05 ? 98  LEU B HB2  1  
ATOM 3863   H HB3  . LEU B 1 98  ? -11.999 -6.665  -22.431 1.00 52.11 ? 98  LEU B HB3  1  
ATOM 3864   H HG   . LEU B 1 98  ? -9.731  -6.148  -23.599 1.00 53.44 ? 98  LEU B HG   1  
ATOM 3865   H HD11 . LEU B 1 98  ? -9.620  -8.074  -25.085 1.00 14.12 ? 98  LEU B HD11 1  
ATOM 3866   H HD12 . LEU B 1 98  ? -9.634  -6.574  -26.011 1.00 4.25  ? 98  LEU B HD12 1  
ATOM 3867   H HD13 . LEU B 1 98  ? -11.098 -7.558  -25.901 1.00 43.31 ? 98  LEU B HD13 1  
ATOM 3868   H HD21 . LEU B 1 98  ? -11.634 -4.608  -23.559 1.00 1.11  ? 98  LEU B HD21 1  
ATOM 3869   H HD22 . LEU B 1 98  ? -12.328 -5.400  -24.975 1.00 42.24 ? 98  LEU B HD22 1  
ATOM 3870   H HD23 . LEU B 1 98  ? -10.793 -4.540  -25.105 1.00 34.35 ? 98  LEU B HD23 1  
ATOM 3871   N N    . GLY B 1 99  ? -12.213 -10.124 -21.375 1.00 32.42 ? 99  GLY B N    1  
ATOM 3872   C CA   . GLY B 1 99  ? -13.205 -10.716 -20.463 1.00 73.44 ? 99  GLY B CA   1  
ATOM 3873   C C    . GLY B 1 99  ? -12.604 -11.442 -19.267 1.00 31.43 ? 99  GLY B C    1  
ATOM 3874   O O    . GLY B 1 99  ? -13.307 -11.698 -18.282 1.00 21.40 ? 99  GLY B O    1  
ATOM 3875   H H    . GLY B 1 99  ? -11.961 -10.616 -22.184 1.00 11.40 ? 99  GLY B H    1  
ATOM 3876   H HA2  . GLY B 1 99  ? -13.864 -9.940  -20.101 1.00 75.42 ? 99  GLY B HA2  1  
ATOM 3877   H HA3  . GLY B 1 99  ? -13.798 -11.424 -21.030 1.00 54.31 ? 99  GLY B HA3  1  
ATOM 3878   N N    . ALA B 1 100 ? -11.307 -11.781 -19.354 1.00 4.40  ? 100 ALA B N    1  
ATOM 3879   C CA   . ALA B 1 100 ? -10.601 -12.543 -18.304 1.00 44.15 ? 100 ALA B CA   1  
ATOM 3880   C C    . ALA B 1 100 ? -9.191  -11.988 -18.078 1.00 71.33 ? 100 ALA B C    1  
ATOM 3881   O O    . ALA B 1 100 ? -8.862  -11.570 -16.968 1.00 23.50 ? 100 ALA B O    1  
ATOM 3882   C CB   . ALA B 1 100 ? -10.539 -14.036 -18.676 1.00 15.31 ? 100 ALA B CB   1  
ATOM 3883   H H    . ALA B 1 100 ? -10.807 -11.507 -20.147 1.00 2.14  ? 100 ALA B H    1  
ATOM 3884   H HA   . ALA B 1 100 ? -11.164 -12.454 -17.374 1.00 4.51  ? 100 ALA B HA   1  
ATOM 3885   H HB1  . ALA B 1 100 ? -10.036 -14.589 -17.892 1.00 14.34 ? 100 ALA B HB1  1  
ATOM 3886   H HB2  . ALA B 1 100 ? -9.999  -14.164 -19.607 1.00 34.13 ? 100 ALA B HB2  1  
ATOM 3887   H HB3  . ALA B 1 100 ? -11.542 -14.422 -18.792 1.00 43.54 ? 100 ALA B HB3  1  
ATOM 3888   N N    . TYR B 1 101 ? -8.400  -11.925 -19.166 1.00 1.22  ? 101 TYR B N    1  
ATOM 3889   C CA   . TYR B 1 101 ? -6.940  -11.701 -19.096 1.00 50.25 ? 101 TYR B CA   1  
ATOM 3890   C C    . TYR B 1 101 ? -6.557  -10.294 -18.574 1.00 63.25 ? 101 TYR B C    1  
ATOM 3891   O O    . TYR B 1 101 ? -5.766  -10.175 -17.627 1.00 4.11  ? 101 TYR B O    1  
ATOM 3892   C CB   . TYR B 1 101 ? -6.310  -11.953 -20.486 1.00 32.14 ? 101 TYR B CB   1  
ATOM 3893   C CG   . TYR B 1 101 ? -4.784  -12.027 -20.455 1.00 75.43 ? 101 TYR B CG   1  
ATOM 3894   C CD1  . TYR B 1 101 ? -4.146  -13.177 -19.982 1.00 32.43 ? 101 TYR B CD1  1  
ATOM 3895   C CD2  . TYR B 1 101 ? -3.983  -10.959 -20.876 1.00 33.41 ? 101 TYR B CD2  1  
ATOM 3896   C CE1  . TYR B 1 101 ? -2.775  -13.259 -19.933 1.00 3.51  ? 101 TYR B CE1  1  
ATOM 3897   C CE2  . TYR B 1 101 ? -2.607  -11.044 -20.830 1.00 13.02 ? 101 TYR B CE2  1  
ATOM 3898   C CZ   . TYR B 1 101 ? -2.012  -12.193 -20.355 1.00 50.44 ? 101 TYR B CZ   1  
ATOM 3899   O OH   . TYR B 1 101 ? -0.649  -12.279 -20.305 1.00 11.43 ? 101 TYR B OH   1  
ATOM 3900   H H    . TYR B 1 101 ? -8.807  -12.050 -20.046 1.00 11.02 ? 101 TYR B H    1  
ATOM 3901   H HA   . TYR B 1 101 ? -6.545  -12.444 -18.405 1.00 45.34 ? 101 TYR B HA   1  
ATOM 3902   H HB2  . TYR B 1 101 ? -6.682  -12.893 -20.880 1.00 1.14  ? 101 TYR B HB2  1  
ATOM 3903   H HB3  . TYR B 1 101 ? -6.602  -11.157 -21.164 1.00 61.00 ? 101 TYR B HB3  1  
ATOM 3904   H HD1  . TYR B 1 101 ? -4.746  -14.018 -19.650 1.00 2.52  ? 101 TYR B HD1  1  
ATOM 3905   H HD2  . TYR B 1 101 ? -4.453  -10.056 -21.248 1.00 23.35 ? 101 TYR B HD2  1  
ATOM 3906   H HE1  . TYR B 1 101 ? -2.300  -14.160 -19.563 1.00 12.10 ? 101 TYR B HE1  1  
ATOM 3907   H HE2  . TYR B 1 101 ? -2.001  -10.210 -21.161 1.00 44.23 ? 101 TYR B HE2  1  
ATOM 3908   H HH   . TYR B 1 101 ? -0.365  -13.059 -20.780 1.00 34.31 ? 101 TYR B HH   1  
ATOM 3909   N N    . CYS B 1 102 ? -7.115  -9.241  -19.209 1.00 35.22 ? 102 CYS B N    1  
ATOM 3910   C CA   . CYS B 1 102 ? -6.857  -7.834  -18.825 1.00 11.42 ? 102 CYS B CA   1  
ATOM 3911   C C    . CYS B 1 102 ? -7.295  -7.553  -17.350 1.00 13.24 ? 102 CYS B C    1  
ATOM 3912   O O    . CYS B 1 102 ? -6.484  -7.023  -16.584 1.00 34.24 ? 102 CYS B O    1  
ATOM 3913   C CB   . CYS B 1 102 ? -7.546  -6.848  -19.803 1.00 24.31 ? 102 CYS B CB   1  
ATOM 3914   S SG   . CYS B 1 102 ? -6.936  -6.926  -21.504 1.00 53.22 ? 102 CYS B SG   1  
ATOM 3915   H H    . CYS B 1 102 ? -7.714  -9.417  -19.959 1.00 10.21 ? 102 CYS B H    1  
ATOM 3916   H HA   . CYS B 1 102 ? -5.778  -7.684  -18.896 1.00 4.13  ? 102 CYS B HA   1  
ATOM 3917   H HB2  . CYS B 1 102 ? -8.605  -7.060  -19.835 1.00 43.22 ? 102 CYS B HB2  1  
ATOM 3918   H HB3  . CYS B 1 102 ? -7.405  -5.828  -19.446 1.00 1.22  ? 102 CYS B HB3  1  
ATOM 3919   H HG   . CYS B 1 102 ? -5.664  -6.564  -21.491 1.00 64.21 ? 102 CYS B HG   1  
ATOM 3920   N N    . PRO B 1 103 ? -8.570  -7.927  -16.907 1.00 2.53  ? 103 PRO B N    1  
ATOM 3921   C CA   . PRO B 1 103 ? -8.984  -7.816  -15.479 1.00 73.10 ? 103 PRO B CA   1  
ATOM 3922   C C    . PRO B 1 103 ? -8.111  -8.662  -14.518 1.00 21.21 ? 103 PRO B C    1  
ATOM 3923   O O    . PRO B 1 103 ? -7.947  -8.295  -13.351 1.00 71.12 ? 103 PRO B O    1  
ATOM 3924   C CB   . PRO B 1 103 ? -10.451 -8.335  -15.477 1.00 34.54 ? 103 PRO B CB   1  
ATOM 3925   C CG   . PRO B 1 103 ? -10.922 -8.152  -16.880 1.00 61.10 ? 103 PRO B CG   1  
ATOM 3926   C CD   . PRO B 1 103 ? -9.712  -8.430  -17.734 1.00 41.03 ? 103 PRO B CD   1  
ATOM 3927   H HA   . PRO B 1 103 ? -8.965  -6.775  -15.155 1.00 2.01  ? 103 PRO B HA   1  
ATOM 3928   H HB2  . PRO B 1 103 ? -10.493 -9.388  -15.184 1.00 15.41 ? 103 PRO B HB2  1  
ATOM 3929   H HB3  . PRO B 1 103 ? -11.059 -7.748  -14.798 1.00 3.43  ? 103 PRO B HB3  1  
ATOM 3930   H HG2  . PRO B 1 103 ? -11.727 -8.850  -17.100 1.00 71.33 ? 103 PRO B HG2  1  
ATOM 3931   H HG3  . PRO B 1 103 ? -11.261 -7.131  -17.032 1.00 71.12 ? 103 PRO B HG3  1  
ATOM 3932   H HD2  . PRO B 1 103 ? -9.615  -9.494  -17.924 1.00 63.31 ? 103 PRO B HD2  1  
ATOM 3933   H HD3  . PRO B 1 103 ? -9.775  -7.889  -18.672 1.00 2.55  ? 103 PRO B HD3  1  
ATOM 3934   N N    . ASN B 1 104 ? -7.560  -9.788  -15.027 1.00 30.34 ? 104 ASN B N    1  
ATOM 3935   C CA   . ASN B 1 104 ? -6.690  -10.708 -14.241 1.00 43.03 ? 104 ASN B CA   1  
ATOM 3936   C C    . ASN B 1 104 ? -5.313  -10.061 -13.960 1.00 55.11 ? 104 ASN B C    1  
ATOM 3937   O O    . ASN B 1 104 ? -4.694  -10.335 -12.929 1.00 24.41 ? 104 ASN B O    1  
ATOM 3938   C CB   . ASN B 1 104 ? -6.521  -12.074 -14.978 1.00 24.42 ? 104 ASN B CB   1  
ATOM 3939   C CG   . ASN B 1 104 ? -5.758  -13.147 -14.182 1.00 35.11 ? 104 ASN B CG   1  
ATOM 3940   O OD1  . ASN B 1 104 ? -5.743  -13.151 -12.949 1.00 62.13 ? 104 ASN B OD1  1  
ATOM 3941   N ND2  . ASN B 1 104 ? -5.156  -14.095 -14.888 1.00 52.24 ? 104 ASN B ND2  1  
ATOM 3942   H H    . ASN B 1 104 ? -7.754  -10.016 -15.961 1.00 1.52  ? 104 ASN B H    1  
ATOM 3943   H HA   . ASN B 1 104 ? -7.188  -10.887 -13.289 1.00 40.23 ? 104 ASN B HA   1  
ATOM 3944   H HB2  . ASN B 1 104 ? -7.500  -12.473 -15.208 1.00 32.24 ? 104 ASN B HB2  1  
ATOM 3945   H HB3  . ASN B 1 104 ? -5.993  -11.901 -15.910 1.00 15.02 ? 104 ASN B HB3  1  
ATOM 3946   H HD21 . ASN B 1 104 ? -5.237  -14.063 -15.868 1.00 72.21 ? 104 ASN B HD21 1  
ATOM 3947   H HD22 . ASN B 1 104 ? -4.658  -14.784 -14.407 1.00 30.22 ? 104 ASN B HD22 1  
ATOM 3948   N N    . ILE B 1 105 ? -4.844  -9.198  -14.891 1.00 43.24 ? 105 ILE B N    1  
ATOM 3949   C CA   . ILE B 1 105 ? -3.630  -8.369  -14.683 1.00 30.23 ? 105 ILE B CA   1  
ATOM 3950   C C    . ILE B 1 105 ? -3.895  -7.335  -13.569 1.00 34.04 ? 105 ILE B C    1  
ATOM 3951   O O    . ILE B 1 105 ? -3.033  -7.080  -12.731 1.00 45.00 ? 105 ILE B O    1  
ATOM 3952   C CB   . ILE B 1 105 ? -3.179  -7.639  -16.017 1.00 34.15 ? 105 ILE B CB   1  
ATOM 3953   C CG1  . ILE B 1 105 ? -2.742  -8.696  -17.087 1.00 4.03  ? 105 ILE B CG1  1  
ATOM 3954   C CG2  . ILE B 1 105 ? -2.053  -6.588  -15.768 1.00 2.43  ? 105 ILE B CG2  1  
ATOM 3955   C CD1  . ILE B 1 105 ? -2.235  -8.114  -18.393 1.00 1.00  ? 105 ILE B CD1  1  
ATOM 3956   H H    . ILE B 1 105 ? -5.328  -9.117  -15.740 1.00 43.42 ? 105 ILE B H    1  
ATOM 3957   H HA   . ILE B 1 105 ? -2.825  -9.028  -14.363 1.00 65.30 ? 105 ILE B HA   1  
ATOM 3958   H HB   . ILE B 1 105 ? -4.042  -7.100  -16.402 1.00 43.12 ? 105 ILE B HB   1  
ATOM 3959   H HG12 . ILE B 1 105 ? -1.947  -9.305  -16.680 1.00 13.33 ? 105 ILE B HG12 1  
ATOM 3960   H HG13 . ILE B 1 105 ? -3.585  -9.334  -17.321 1.00 2.23  ? 105 ILE B HG13 1  
ATOM 3961   H HG21 . ILE B 1 105 ? -2.387  -5.852  -15.048 1.00 3.02  ? 105 ILE B HG21 1  
ATOM 3962   H HG22 . ILE B 1 105 ? -1.797  -6.085  -16.689 1.00 54.04 ? 105 ILE B HG22 1  
ATOM 3963   H HG23 . ILE B 1 105 ? -1.171  -7.076  -15.393 1.00 21.23 ? 105 ILE B HG23 1  
ATOM 3964   H HD11 . ILE B 1 105 ? -2.062  -8.915  -19.095 1.00 20.20 ? 105 ILE B HD11 1  
ATOM 3965   H HD12 . ILE B 1 105 ? -1.309  -7.584  -18.222 1.00 52.41 ? 105 ILE B HD12 1  
ATOM 3966   H HD13 . ILE B 1 105 ? -2.968  -7.434  -18.802 1.00 24.44 ? 105 ILE B HD13 1  
ATOM 3967   N N    . LEU B 1 106 ? -5.124  -6.803  -13.557 1.00 32.31 ? 106 LEU B N    1  
ATOM 3968   C CA   . LEU B 1 106 ? -5.547  -5.718  -12.646 1.00 12.23 ? 106 LEU B CA   1  
ATOM 3969   C C    . LEU B 1 106 ? -5.988  -6.254  -11.273 1.00 52.21 ? 106 LEU B C    1  
ATOM 3970   O O    . LEU B 1 106 ? -6.028  -5.494  -10.296 1.00 53.30 ? 106 LEU B O    1  
ATOM 3971   C CB   . LEU B 1 106 ? -6.703  -4.945  -13.318 1.00 2.32  ? 106 LEU B CB   1  
ATOM 3972   C CG   . LEU B 1 106 ? -6.366  -4.357  -14.719 1.00 11.42 ? 106 LEU B CG   1  
ATOM 3973   C CD1  . LEU B 1 106 ? -7.621  -3.814  -15.428 1.00 50.14 ? 106 LEU B CD1  1  
ATOM 3974   C CD2  . LEU B 1 106 ? -5.239  -3.303  -14.621 1.00 62.03 ? 106 LEU B CD2  1  
ATOM 3975   H H    . LEU B 1 106 ? -5.784  -7.156  -14.189 1.00 23.11 ? 106 LEU B H    1  
ATOM 3976   H HA   . LEU B 1 106 ? -4.707  -5.045  -12.508 1.00 14.13 ? 106 LEU B HA   1  
ATOM 3977   H HB2  . LEU B 1 106 ? -7.550  -5.622  -13.420 1.00 11.15 ? 106 LEU B HB2  1  
ATOM 3978   H HB3  . LEU B 1 106 ? -6.999  -4.130  -12.667 1.00 51.45 ? 106 LEU B HB3  1  
ATOM 3979   H HG   . LEU B 1 106 ? -5.989  -5.161  -15.341 1.00 60.20 ? 106 LEU B HG   1  
ATOM 3980   H HD11 . LEU B 1 106 ? -8.340  -4.611  -15.534 1.00 12.21 ? 106 LEU B HD11 1  
ATOM 3981   H HD12 . LEU B 1 106 ? -7.359  -3.443  -16.409 1.00 74.23 ? 106 LEU B HD12 1  
ATOM 3982   H HD13 . LEU B 1 106 ? -8.061  -3.019  -14.855 1.00 23.14 ? 106 LEU B HD13 1  
ATOM 3983   H HD21 . LEU B 1 106 ? -4.315  -3.790  -14.339 1.00 10.14 ? 106 LEU B HD21 1  
ATOM 3984   H HD22 . LEU B 1 106 ? -5.472  -2.561  -13.874 1.00 11.14 ? 106 LEU B HD22 1  
ATOM 3985   H HD23 . LEU B 1 106 ? -5.099  -2.814  -15.575 1.00 31.41 ? 106 LEU B HD23 1  
ATOM 3986   N N    . PHE B 1 107 ? -6.306  -7.566  -11.215 1.00 13.11 ? 107 PHE B N    1  
ATOM 3987   C CA   . PHE B 1 107 ? -6.800  -8.240  -9.996  1.00 73.52 ? 107 PHE B CA   1  
ATOM 3988   C C    . PHE B 1 107 ? -5.803  -8.112  -8.802  1.00 60.33 ? 107 PHE B C    1  
ATOM 3989   O O    . PHE B 1 107 ? -6.242  -7.727  -7.720  1.00 71.21 ? 107 PHE B O    1  
ATOM 3990   C CB   . PHE B 1 107 ? -7.164  -9.736  -10.281 1.00 51.13 ? 107 PHE B CB   1  
ATOM 3991   C CG   . PHE B 1 107 ? -7.703  -10.500 -9.061  1.00 61.22 ? 107 PHE B CG   1  
ATOM 3992   C CD1  . PHE B 1 107 ? -9.042  -10.385 -8.679  1.00 33.25 ? 107 PHE B CD1  1  
ATOM 3993   C CD2  . PHE B 1 107 ? -6.869  -11.327 -8.294  1.00 41.12 ? 107 PHE B CD2  1  
ATOM 3994   C CE1  . PHE B 1 107 ? -9.526  -11.062 -7.572  1.00 21.32 ? 107 PHE B CE1  1  
ATOM 3995   C CE2  . PHE B 1 107 ? -7.356  -12.003 -7.190  1.00 72.34 ? 107 PHE B CE2  1  
ATOM 3996   C CZ   . PHE B 1 107 ? -8.684  -11.872 -6.830  1.00 1.02  ? 107 PHE B CZ   1  
ATOM 3997   H H    . PHE B 1 107 ? -6.217  -8.098  -12.033 1.00 34.12 ? 107 PHE B H    1  
ATOM 3998   H HA   . PHE B 1 107 ? -7.719  -7.723  -9.719  1.00 30.53 ? 107 PHE B HA   1  
ATOM 3999   H HB2  . PHE B 1 107 ? -7.918  -9.775  -11.058 1.00 4.23  ? 107 PHE B HB2  1  
ATOM 4000   H HB3  . PHE B 1 107 ? -6.278  -10.251 -10.642 1.00 11.52 ? 107 PHE B HB3  1  
ATOM 4001   H HD1  . PHE B 1 107 ? -9.708  -9.755  -9.254  1.00 50.30 ? 107 PHE B HD1  1  
ATOM 4002   H HD2  . PHE B 1 107 ? -5.826  -11.433 -8.571  1.00 42.32 ? 107 PHE B HD2  1  
ATOM 4003   H HE1  . PHE B 1 107 ? -10.564 -10.961 -7.288  1.00 32.35 ? 107 PHE B HE1  1  
ATOM 4004   H HE2  . PHE B 1 107 ? -6.697  -12.636 -6.607  1.00 20.33 ? 107 PHE B HE2  1  
ATOM 4005   H HZ   . PHE B 1 107 ? -9.064  -12.400 -5.964  1.00 31.23 ? 107 PHE B HZ   1  
ATOM 4006   N N    . PRO B 1 108 ? -4.455  -8.430  -8.957  1.00 21.42 ? 108 PRO B N    1  
ATOM 4007   C CA   . PRO B 1 108 ? -3.461  -8.270  -7.850  1.00 60.11 ? 108 PRO B CA   1  
ATOM 4008   C C    . PRO B 1 108 ? -3.368  -6.823  -7.296  1.00 32.55 ? 108 PRO B C    1  
ATOM 4009   O O    . PRO B 1 108 ? -3.220  -6.626  -6.080  1.00 10.44 ? 108 PRO B O    1  
ATOM 4010   C CB   . PRO B 1 108 ? -2.118  -8.705  -8.501  1.00 5.41  ? 108 PRO B CB   1  
ATOM 4011   C CG   . PRO B 1 108 ? -2.517  -9.601  -9.630  1.00 74.43 ? 108 PRO B CG   1  
ATOM 4012   C CD   . PRO B 1 108 ? -3.796  -9.011  -10.165 1.00 72.32 ? 108 PRO B CD   1  
ATOM 4013   H HA   . PRO B 1 108 ? -3.699  -8.944  -7.032  1.00 42.21 ? 108 PRO B HA   1  
ATOM 4014   H HB2  . PRO B 1 108 ? -1.571  -7.834  -8.869  1.00 31.21 ? 108 PRO B HB2  1  
ATOM 4015   H HB3  . PRO B 1 108 ? -1.506  -9.245  -7.789  1.00 15.13 ? 108 PRO B HB3  1  
ATOM 4016   H HG2  . PRO B 1 108 ? -1.744  -9.611  -10.396 1.00 24.42 ? 108 PRO B HG2  1  
ATOM 4017   H HG3  . PRO B 1 108 ? -2.694  -10.610 -9.268  1.00 31.13 ? 108 PRO B HG3  1  
ATOM 4018   H HD2  . PRO B 1 108 ? -3.587  -8.238  -10.900 1.00 62.24 ? 108 PRO B HD2  1  
ATOM 4019   H HD3  . PRO B 1 108 ? -4.418  -9.783  -10.606 1.00 3.23  ? 108 PRO B HD3  1  
ATOM 4020   N N    . TYR B 1 109 ? -3.468  -5.827  -8.200  1.00 35.21 ? 109 TYR B N    1  
ATOM 4021   C CA   . TYR B 1 109 ? -3.382  -4.390  -7.841  1.00 21.35 ? 109 TYR B CA   1  
ATOM 4022   C C    . TYR B 1 109 ? -4.617  -3.962  -7.004  1.00 45.03 ? 109 TYR B C    1  
ATOM 4023   O O    . TYR B 1 109 ? -4.484  -3.239  -6.006  1.00 74.03 ? 109 TYR B O    1  
ATOM 4024   C CB   . TYR B 1 109 ? -3.279  -3.504  -9.112  1.00 65.20 ? 109 TYR B CB   1  
ATOM 4025   C CG   . TYR B 1 109 ? -2.055  -3.741  -10.024 1.00 2.23  ? 109 TYR B CG   1  
ATOM 4026   C CD1  . TYR B 1 109 ? -1.981  -4.863  -10.849 1.00 35.22 ? 109 TYR B CD1  1  
ATOM 4027   C CD2  . TYR B 1 109 ? -0.995  -2.820  -10.092 1.00 24.25 ? 109 TYR B CD2  1  
ATOM 4028   C CE1  . TYR B 1 109 ? -0.908  -5.065  -11.698 1.00 72.11 ? 109 TYR B CE1  1  
ATOM 4029   C CE2  . TYR B 1 109 ? 0.081   -3.026  -10.939 1.00 70.15 ? 109 TYR B CE2  1  
ATOM 4030   C CZ   . TYR B 1 109 ? 0.115   -4.151  -11.740 1.00 23.31 ? 109 TYR B CZ   1  
ATOM 4031   O OH   . TYR B 1 109 ? 1.165   -4.351  -12.608 1.00 22.23 ? 109 TYR B OH   1  
ATOM 4032   H H    . TYR B 1 109 ? -3.606  -6.065  -9.138  1.00 12.12 ? 109 TYR B H    1  
ATOM 4033   H HA   . TYR B 1 109 ? -2.486  -4.251  -7.242  1.00 25.24 ? 109 TYR B HA   1  
ATOM 4034   H HB2  . TYR B 1 109 ? -4.164  -3.667  -9.718  1.00 65.21 ? 109 TYR B HB2  1  
ATOM 4035   H HB3  . TYR B 1 109 ? -3.271  -2.459  -8.810  1.00 32.22 ? 109 TYR B HB3  1  
ATOM 4036   H HD1  . TYR B 1 109 ? -2.784  -5.589  -10.822 1.00 35.40 ? 109 TYR B HD1  1  
ATOM 4037   H HD2  . TYR B 1 109 ? -1.022  -1.937  -9.464  1.00 35.00 ? 109 TYR B HD2  1  
ATOM 4038   H HE1  . TYR B 1 109 ? -0.879  -5.946  -12.327 1.00 40.22 ? 109 TYR B HE1  1  
ATOM 4039   H HE2  . TYR B 1 109 ? 0.893   -2.304  -10.975 1.00 52.23 ? 109 TYR B HE2  1  
ATOM 4040   H HH   . TYR B 1 109 ? 1.894   -3.773  -12.367 1.00 53.14 ? 109 TYR B HH   1  
ATOM 4041   N N    . ALA B 1 110 ? -5.819  -4.423  -7.433  1.00 4.30  ? 110 ALA B N    1  
ATOM 4042   C CA   . ALA B 1 110 ? -7.091  -4.194  -6.697  1.00 73.24 ? 110 ALA B CA   1  
ATOM 4043   C C    . ALA B 1 110 ? -7.058  -4.906  -5.333  1.00 4.11  ? 110 ALA B C    1  
ATOM 4044   O O    . ALA B 1 110 ? -7.487  -4.355  -4.324  1.00 42.40 ? 110 ALA B O    1  
ATOM 4045   C CB   . ALA B 1 110 ? -8.302  -4.700  -7.513  1.00 20.53 ? 110 ALA B CB   1  
ATOM 4046   H H    . ALA B 1 110 ? -5.850  -4.936  -8.270  1.00 13.02 ? 110 ALA B H    1  
ATOM 4047   H HA   . ALA B 1 110 ? -7.203  -3.122  -6.544  1.00 32.51 ? 110 ALA B HA   1  
ATOM 4048   H HB1  . ALA B 1 110 ? -8.399  -4.136  -8.420  1.00 60.33 ? 110 ALA B HB1  1  
ATOM 4049   H HB2  . ALA B 1 110 ? -9.213  -4.595  -6.934  1.00 74.52 ? 110 ALA B HB2  1  
ATOM 4050   H HB3  . ALA B 1 110 ? -8.161  -5.735  -7.763  1.00 21.02 ? 110 ALA B HB3  1  
ATOM 4051   N N    . ARG B 1 111 ? -6.503  -6.126  -5.357  1.00 74.01 ? 111 ARG B N    1  
ATOM 4052   C CA   . ARG B 1 111 ? -6.411  -7.054  -4.204  1.00 12.42 ? 111 ARG B CA   1  
ATOM 4053   C C    . ARG B 1 111 ? -5.668  -6.408  -3.021  1.00 30.34 ? 111 ARG B C    1  
ATOM 4054   O O    . ARG B 1 111 ? -6.164  -6.418  -1.886  1.00 70.22 ? 111 ARG B O    1  
ATOM 4055   C CB   . ARG B 1 111 ? -5.673  -8.339  -4.670  1.00 35.21 ? 111 ARG B CB   1  
ATOM 4056   C CG   . ARG B 1 111 ? -5.579  -9.492  -3.651  1.00 75.11 ? 111 ARG B CG   1  
ATOM 4057   C CD   . ARG B 1 111 ? -4.737  -10.663 -4.198  1.00 43.20 ? 111 ARG B CD   1  
ATOM 4058   N NE   . ARG B 1 111 ? -4.765  -11.844 -3.315  1.00 2.51  ? 111 ARG B NE   1  
ATOM 4059   C CZ   . ARG B 1 111 ? -3.695  -12.574 -2.943  1.00 3.33  ? 111 ARG B CZ   1  
ATOM 4060   N NH1  . ARG B 1 111 ? -2.465  -12.250 -3.350  1.00 43.22 ? 111 ARG B NH1  1  
ATOM 4061   N NH2  . ARG B 1 111 ? -3.875  -13.648 -2.182  1.00 22.32 ? 111 ARG B NH2  1  
ATOM 4062   H H    . ARG B 1 111 ? -6.125  -6.424  -6.208  1.00 10.42 ? 111 ARG B H    1  
ATOM 4063   H HA   . ARG B 1 111 ? -7.419  -7.314  -3.899  1.00 14.24 ? 111 ARG B HA   1  
ATOM 4064   H HB2  . ARG B 1 111 ? -6.181  -8.718  -5.550  1.00 2.45  ? 111 ARG B HB2  1  
ATOM 4065   H HB3  . ARG B 1 111 ? -4.663  -8.062  -4.963  1.00 34.43 ? 111 ARG B HB3  1  
ATOM 4066   H HG2  . ARG B 1 111 ? -5.122  -9.122  -2.741  1.00 70.53 ? 111 ARG B HG2  1  
ATOM 4067   H HG3  . ARG B 1 111 ? -6.578  -9.848  -3.430  1.00 32.21 ? 111 ARG B HG3  1  
ATOM 4068   H HD2  . ARG B 1 111 ? -5.129  -10.954 -5.165  1.00 1.20  ? 111 ARG B HD2  1  
ATOM 4069   H HD3  . ARG B 1 111 ? -3.712  -10.329 -4.318  1.00 14.13 ? 111 ARG B HD3  1  
ATOM 4070   H HE   . ARG B 1 111 ? -5.647  -12.116 -2.979  1.00 40.25 ? 111 ARG B HE   1  
ATOM 4071   H HH11 . ARG B 1 111 ? -2.324  -11.455 -3.945  1.00 31.44 ? 111 ARG B HH11 1  
ATOM 4072   H HH12 . ARG B 1 111 ? -1.676  -12.799 -3.066  1.00 20.43 ? 111 ARG B HH12 1  
ATOM 4073   H HH21 . ARG B 1 111 ? -4.803  -13.912 -1.894  1.00 41.02 ? 111 ARG B HH21 1  
ATOM 4074   H HH22 . ARG B 1 111 ? -3.092  -14.202 -1.895  1.00 72.11 ? 111 ARG B HH22 1  
ATOM 4075   N N    . GLU B 1 112 ? -4.485  -5.828  -3.320  1.00 21.52 ? 112 GLU B N    1  
ATOM 4076   C CA   . GLU B 1 112 ? -3.638  -5.154  -2.313  1.00 1.02  ? 112 GLU B CA   1  
ATOM 4077   C C    . GLU B 1 112 ? -4.320  -3.863  -1.830  1.00 22.33 ? 112 GLU B C    1  
ATOM 4078   O O    . GLU B 1 112 ? -4.225  -3.515  -0.652  1.00 22.21 ? 112 GLU B O    1  
ATOM 4079   C CB   . GLU B 1 112 ? -2.216  -4.857  -2.893  1.00 15.41 ? 112 GLU B CB   1  
ATOM 4080   C CG   . GLU B 1 112 ? -1.125  -4.466  -1.840  1.00 15.33 ? 112 GLU B CG   1  
ATOM 4081   C CD   . GLU B 1 112 ? -0.982  -2.947  -1.554  1.00 34.32 ? 112 GLU B CD   1  
ATOM 4082   O OE1  . GLU B 1 112 ? -0.408  -2.221  -2.395  1.00 55.33 ? 112 GLU B OE1  1  
ATOM 4083   O OE2  . GLU B 1 112 ? -1.404  -2.468  -0.478  1.00 20.44 ? 112 GLU B OE2  1  
ATOM 4084   H H    . GLU B 1 112 ? -4.170  -5.856  -4.250  1.00 33.42 ? 112 GLU B H    1  
ATOM 4085   H HA   . GLU B 1 112 ? -3.531  -5.831  -1.469  1.00 51.15 ? 112 GLU B HA   1  
ATOM 4086   H HB2  . GLU B 1 112 ? -1.875  -5.742  -3.420  1.00 5.43  ? 112 GLU B HB2  1  
ATOM 4087   H HB3  . GLU B 1 112 ? -2.294  -4.052  -3.617  1.00 1.04  ? 112 GLU B HB3  1  
ATOM 4088   H HG2  . GLU B 1 112 ? -1.350  -4.971  -0.907  1.00 55.31 ? 112 GLU B HG2  1  
ATOM 4089   H HG3  . GLU B 1 112 ? -0.165  -4.832  -2.190  1.00 33.43 ? 112 GLU B HG3  1  
ATOM 4090   N N    . CYS B 1 113 ? -5.042  -3.184  -2.750  1.00 43.23 ? 113 CYS B N    1  
ATOM 4091   C CA   . CYS B 1 113 ? -5.736  -1.918  -2.451  1.00 5.44  ? 113 CYS B CA   1  
ATOM 4092   C C    . CYS B 1 113 ? -6.901  -2.138  -1.462  1.00 15.05 ? 113 CYS B C    1  
ATOM 4093   O O    . CYS B 1 113 ? -7.178  -1.271  -0.629  1.00 54.41 ? 113 CYS B O    1  
ATOM 4094   C CB   . CYS B 1 113 ? -6.239  -1.241  -3.748  1.00 52.14 ? 113 CYS B CB   1  
ATOM 4095   S SG   . CYS B 1 113 ? -6.669  0.497   -3.533  1.00 2.43  ? 113 CYS B SG   1  
ATOM 4096   H H    . CYS B 1 113 ? -5.107  -3.550  -3.658  1.00 25.34 ? 113 CYS B H    1  
ATOM 4097   H HA   . CYS B 1 113 ? -5.009  -1.259  -1.983  1.00 70.24 ? 113 CYS B HA   1  
ATOM 4098   H HB2  . CYS B 1 113 ? -5.469  -1.293  -4.503  1.00 40.54 ? 113 CYS B HB2  1  
ATOM 4099   H HB3  . CYS B 1 113 ? -7.131  -1.753  -4.113  1.00 33.40 ? 113 CYS B HB3  1  
ATOM 4100   H HG   . CYS B 1 113 ? -7.578  0.574   -2.570  1.00 75.11 ? 113 CYS B HG   1  
ATOM 4101   N N    . ILE B 1 114 ? -7.563  -3.316  -1.555  1.00 34.31 ? 114 ILE B N    1  
ATOM 4102   C CA   . ILE B 1 114 ? -8.631  -3.719  -0.607  1.00 41.12 ? 114 ILE B CA   1  
ATOM 4103   C C    . ILE B 1 114 ? -8.013  -3.956  0.758   1.00 23.13 ? 114 ILE B C    1  
ATOM 4104   O O    . ILE B 1 114 ? -8.386  -3.298  1.727   1.00 3.35  ? 114 ILE B O    1  
ATOM 4105   C CB   . ILE B 1 114 ? -9.405  -5.019  -1.063  1.00 33.53 ? 114 ILE B CB   1  
ATOM 4106   C CG1  . ILE B 1 114 ? -10.022 -4.764  -2.465  1.00 11.34 ? 114 ILE B CG1  1  
ATOM 4107   C CG2  . ILE B 1 114 ? -10.509 -5.440  -0.028  1.00 31.32 ? 114 ILE B CG2  1  
ATOM 4108   C CD1  . ILE B 1 114 ? -10.706 -5.928  -3.125  1.00 12.42 ? 114 ILE B CD1  1  
ATOM 4109   H H    . ILE B 1 114 ? -7.317  -3.934  -2.273  1.00 71.32 ? 114 ILE B H    1  
ATOM 4110   H HA   . ILE B 1 114 ? -9.348  -2.899  -0.538  1.00 64.33 ? 114 ILE B HA   1  
ATOM 4111   H HB   . ILE B 1 114 ? -8.689  -5.834  -1.138  1.00 65.52 ? 114 ILE B HB   1  
ATOM 4112   H HG12 . ILE B 1 114 ? -10.756 -3.974  -2.389  1.00 42.41 ? 114 ILE B HG12 1  
ATOM 4113   H HG13 . ILE B 1 114 ? -9.239  -4.433  -3.138  1.00 30.41 ? 114 ILE B HG13 1  
ATOM 4114   H HG21 . ILE B 1 114 ? -10.818 -6.456  -0.206  1.00 23.23 ? 114 ILE B HG21 1  
ATOM 4115   H HG22 . ILE B 1 114 ? -11.369 -4.794  -0.124  1.00 11.34 ? 114 ILE B HG22 1  
ATOM 4116   H HG23 . ILE B 1 114 ? -10.145 -5.367  0.976   1.00 73.50 ? 114 ILE B HG23 1  
ATOM 4117   H HD11 . ILE B 1 114 ? -11.617 -5.574  -3.586  1.00 11.31 ? 114 ILE B HD11 1  
ATOM 4118   H HD12 . ILE B 1 114 ? -10.952 -6.698  -2.410  1.00 41.03 ? 114 ILE B HD12 1  
ATOM 4119   H HD13 . ILE B 1 114 ? -10.076 -6.340  -3.896  1.00 32.31 ? 114 ILE B HD13 1  
ATOM 4120   N N    . THR B 1 115 ? -7.008  -4.859  0.791   1.00 63.10 ? 115 THR B N    1  
ATOM 4121   C CA   . THR B 1 115 ? -6.338  -5.278  2.027   1.00 51.33 ? 115 THR B CA   1  
ATOM 4122   C C    . THR B 1 115 ? -5.674  -4.072  2.749   1.00 41.23 ? 115 THR B C    1  
ATOM 4123   O O    . THR B 1 115 ? -5.536  -4.076  3.980   1.00 53.51 ? 115 THR B O    1  
ATOM 4124   C CB   . THR B 1 115 ? -5.283  -6.400  1.731   1.00 3.04  ? 115 THR B CB   1  
ATOM 4125   O OG1  . THR B 1 115 ? -5.897  -7.462  0.972   1.00 62.14 ? 115 THR B OG1  1  
ATOM 4126   C CG2  . THR B 1 115 ? -4.682  -6.991  3.021   1.00 54.54 ? 115 THR B CG2  1  
ATOM 4127   H H    . THR B 1 115 ? -6.707  -5.257  -0.057  1.00 51.01 ? 115 THR B H    1  
ATOM 4128   H HA   . THR B 1 115 ? -7.108  -5.696  2.672   1.00 72.23 ? 115 THR B HA   1  
ATOM 4129   H HB   . THR B 1 115 ? -4.481  -5.975  1.134   1.00 50.01 ? 115 THR B HB   1  
ATOM 4130   H HG1  . THR B 1 115 ? -6.803  -7.591  1.275   1.00 72.44 ? 115 THR B HG1  1  
ATOM 4131   H HG21 . THR B 1 115 ? -4.186  -6.213  3.586   1.00 40.33 ? 115 THR B HG21 1  
ATOM 4132   H HG22 . THR B 1 115 ? -3.963  -7.759  2.769   1.00 12.54 ? 115 THR B HG22 1  
ATOM 4133   H HG23 . THR B 1 115 ? -5.466  -7.428  3.626   1.00 64.45 ? 115 THR B HG23 1  
ATOM 4134   N N    . SER B 1 116 ? -5.311  -3.030  1.965   1.00 43.24 ? 116 SER B N    1  
ATOM 4135   C CA   . SER B 1 116 ? -4.780  -1.765  2.498   1.00 72.35 ? 116 SER B CA   1  
ATOM 4136   C C    . SER B 1 116 ? -5.864  -1.061  3.334   1.00 3.30  ? 116 SER B C    1  
ATOM 4137   O O    . SER B 1 116 ? -5.630  -0.726  4.490   1.00 60.41 ? 116 SER B O    1  
ATOM 4138   C CB   . SER B 1 116 ? -4.300  -0.836  1.355   1.00 34.01 ? 116 SER B CB   1  
ATOM 4139   O OG   . SER B 1 116 ? -3.679  0.341   1.860   1.00 40.24 ? 116 SER B OG   1  
ATOM 4140   H H    . SER B 1 116 ? -5.408  -3.121  0.995   1.00 54.44 ? 116 SER B H    1  
ATOM 4141   H HA   . SER B 1 116 ? -3.933  -2.004  3.137   1.00 11.12 ? 116 SER B HA   1  
ATOM 4142   H HB2  . SER B 1 116 ? -3.579  -1.361  0.743   1.00 5.22  ? 116 SER B HB2  1  
ATOM 4143   H HB3  . SER B 1 116 ? -5.145  -0.540  0.737   1.00 74.34 ? 116 SER B HB3  1  
ATOM 4144   H HG   . SER B 1 116 ? -2.763  0.141   2.096   1.00 74.23 ? 116 SER B HG   1  
ATOM 4145   N N    . MET B 1 117 ? -7.075  -0.916  2.746   1.00 73.31 ? 117 MET B N    1  
ATOM 4146   C CA   . MET B 1 117 ? -8.202  -0.188  3.381   1.00 20.23 ? 117 MET B CA   1  
ATOM 4147   C C    . MET B 1 117 ? -8.764  -0.977  4.579   1.00 73.52 ? 117 MET B C    1  
ATOM 4148   O O    . MET B 1 117 ? -9.233  -0.376  5.553   1.00 43.34 ? 117 MET B O    1  
ATOM 4149   C CB   . MET B 1 117 ? -9.323  0.135   2.348   1.00 61.41 ? 117 MET B CB   1  
ATOM 4150   C CG   . MET B 1 117 ? -8.810  0.845   1.085   1.00 33.25 ? 117 MET B CG   1  
ATOM 4151   S SD   . MET B 1 117 ? -7.663  2.191   1.462   1.00 32.14 ? 117 MET B SD   1  
ATOM 4152   C CE   . MET B 1 117 ? -6.928  2.508   -0.141  1.00 61.45 ? 117 MET B CE   1  
ATOM 4153   H H    . MET B 1 117 ? -7.217  -1.321  1.864   1.00 51.43 ? 117 MET B H    1  
ATOM 4154   H HA   . MET B 1 117 ? -7.802  0.754   3.755   1.00 65.12 ? 117 MET B HA   1  
ATOM 4155   H HB2  . MET B 1 117 ? -9.810  -0.789  2.049   1.00 34.51 ? 117 MET B HB2  1  
ATOM 4156   H HB3  . MET B 1 117 ? -10.061 0.776   2.819   1.00 23.53 ? 117 MET B HB3  1  
ATOM 4157   H HG2  . MET B 1 117 ? -8.297  0.123   0.468   1.00 14.21 ? 117 MET B HG2  1  
ATOM 4158   H HG3  . MET B 1 117 ? -9.651  1.251   0.530   1.00 5.22  ? 117 MET B HG3  1  
ATOM 4159   H HE1  . MET B 1 117 ? -7.654  2.981   -0.787  1.00 64.12 ? 117 MET B HE1  1  
ATOM 4160   H HE2  . MET B 1 117 ? -6.608  1.575   -0.582  1.00 14.53 ? 117 MET B HE2  1  
ATOM 4161   H HE3  . MET B 1 117 ? -6.073  3.154   -0.020  1.00 2.12  ? 117 MET B HE3  1  
ATOM 4162   N N    . VAL B 1 118 ? -8.688  -2.326  4.496   1.00 2.41  ? 118 VAL B N    1  
ATOM 4163   C CA   . VAL B 1 118 ? -9.016  -3.234  5.620   1.00 55.02 ? 118 VAL B CA   1  
ATOM 4164   C C    . VAL B 1 118 ? -8.074  -2.939  6.811   1.00 51.51 ? 118 VAL B C    1  
ATOM 4165   O O    . VAL B 1 118 ? -8.517  -2.777  7.956   1.00 43.22 ? 118 VAL B O    1  
ATOM 4166   C CB   . VAL B 1 118 ? -8.853  -4.762  5.230   1.00 3.01  ? 118 VAL B CB   1  
ATOM 4167   C CG1  . VAL B 1 118 ? -9.214  -5.688  6.422   1.00 33.15 ? 118 VAL B CG1  1  
ATOM 4168   C CG2  . VAL B 1 118 ? -9.655  -5.135  3.947   1.00 32.00 ? 118 VAL B CG2  1  
ATOM 4169   H H    . VAL B 1 118 ? -8.403  -2.720  3.649   1.00 62.51 ? 118 VAL B H    1  
ATOM 4170   H HA   . VAL B 1 118 ? -10.047 -3.053  5.916   1.00 62.04 ? 118 VAL B HA   1  
ATOM 4171   H HB   . VAL B 1 118 ? -7.797  -4.929  5.009   1.00 23.03 ? 118 VAL B HB   1  
ATOM 4172   H HG11 . VAL B 1 118 ? -10.283 -5.668  6.596   1.00 14.15 ? 118 VAL B HG11 1  
ATOM 4173   H HG12 . VAL B 1 118 ? -8.707  -5.350  7.317   1.00 22.44 ? 118 VAL B HG12 1  
ATOM 4174   H HG13 . VAL B 1 118 ? -8.902  -6.698  6.213   1.00 41.55 ? 118 VAL B HG13 1  
ATOM 4175   H HG21 . VAL B 1 118 ? -10.707 -4.932  4.071   1.00 62.44 ? 118 VAL B HG21 1  
ATOM 4176   H HG22 . VAL B 1 118 ? -9.525  -6.186  3.725   1.00 32.33 ? 118 VAL B HG22 1  
ATOM 4177   H HG23 . VAL B 1 118 ? -9.286  -4.558  3.114   1.00 54.33 ? 118 VAL B HG23 1  
ATOM 4178   N N    . SER B 1 119 ? -6.768  -2.850  6.484   1.00 51.15 ? 119 SER B N    1  
ATOM 4179   C CA   . SER B 1 119 ? -5.685  -2.619  7.456   1.00 23.54 ? 119 SER B CA   1  
ATOM 4180   C C    . SER B 1 119 ? -5.810  -1.230  8.109   1.00 75.41 ? 119 SER B C    1  
ATOM 4181   O O    . SER B 1 119 ? -5.494  -1.045  9.294   1.00 20.34 ? 119 SER B O    1  
ATOM 4182   C CB   . SER B 1 119 ? -4.316  -2.752  6.743   1.00 0.44  ? 119 SER B CB   1  
ATOM 4183   O OG   . SER B 1 119 ? -3.245  -2.728  7.662   1.00 23.32 ? 119 SER B OG   1  
ATOM 4184   H H    . SER B 1 119 ? -6.522  -2.950  5.541   1.00 65.33 ? 119 SER B H    1  
ATOM 4185   H HA   . SER B 1 119 ? -5.763  -3.390  8.218   1.00 2.04  ? 119 SER B HA   1  
ATOM 4186   H HB2  . SER B 1 119 ? -4.278  -3.692  6.212   1.00 51.02 ? 119 SER B HB2  1  
ATOM 4187   H HB3  . SER B 1 119 ? -4.186  -1.942  6.036   1.00 0.03  ? 119 SER B HB3  1  
ATOM 4188   H HG   . SER B 1 119 ? -3.053  -3.634  7.940   1.00 51.55 ? 119 SER B HG   1  
ATOM 4189   N N    . ARG B 1 120 ? -6.286  -0.264  7.303   1.00 14.44 ? 120 ARG B N    1  
ATOM 4190   C CA   . ARG B 1 120 ? -6.535  1.119   7.739   1.00 11.14 ? 120 ARG B CA   1  
ATOM 4191   C C    . ARG B 1 120 ? -7.741  1.173   8.673   1.00 5.12  ? 120 ARG B C    1  
ATOM 4192   O O    . ARG B 1 120 ? -7.774  1.995   9.579   1.00 53.50 ? 120 ARG B O    1  
ATOM 4193   C CB   . ARG B 1 120 ? -6.755  2.033   6.511   1.00 55.33 ? 120 ARG B CB   1  
ATOM 4194   C CG   . ARG B 1 120 ? -5.513  2.166   5.622   1.00 73.44 ? 120 ARG B CG   1  
ATOM 4195   C CD   . ARG B 1 120 ? -5.782  2.891   4.292   1.00 75.42 ? 120 ARG B CD   1  
ATOM 4196   N NE   . ARG B 1 120 ? -4.580  2.863   3.459   1.00 51.44 ? 120 ARG B NE   1  
ATOM 4197   C CZ   . ARG B 1 120 ? -3.546  3.699   3.586   1.00 45.10 ? 120 ARG B CZ   1  
ATOM 4198   N NH1  . ARG B 1 120 ? -3.540  4.646   4.513   1.00 43.41 ? 120 ARG B NH1  1  
ATOM 4199   N NH2  . ARG B 1 120 ? -2.488  3.523   2.845   1.00 64.14 ? 120 ARG B NH2  1  
ATOM 4200   H H    . ARG B 1 120 ? -6.486  -0.498  6.374   1.00 30.31 ? 120 ARG B H    1  
ATOM 4201   H HA   . ARG B 1 120 ? -5.652  1.462   8.280   1.00 51.33 ? 120 ARG B HA   1  
ATOM 4202   H HB2  . ARG B 1 120 ? -7.567  1.627   5.912   1.00 70.21 ? 120 ARG B HB2  1  
ATOM 4203   H HB3  . ARG B 1 120 ? -7.038  3.025   6.851   1.00 74.54 ? 120 ARG B HB3  1  
ATOM 4204   H HG2  . ARG B 1 120 ? -4.752  2.717   6.166   1.00 0.14  ? 120 ARG B HG2  1  
ATOM 4205   H HG3  . ARG B 1 120 ? -5.133  1.173   5.404   1.00 23.31 ? 120 ARG B HG3  1  
ATOM 4206   H HD2  . ARG B 1 120 ? -6.582  2.385   3.768   1.00 1.21  ? 120 ARG B HD2  1  
ATOM 4207   H HD3  . ARG B 1 120 ? -6.068  3.919   4.487   1.00 73.24 ? 120 ARG B HD3  1  
ATOM 4208   H HE   . ARG B 1 120 ? -4.538  2.172   2.761   1.00 12.41 ? 120 ARG B HE   1  
ATOM 4209   H HH11 . ARG B 1 120 ? -4.316  4.763   5.122   1.00 53.30 ? 120 ARG B HH11 1  
ATOM 4210   H HH12 . ARG B 1 120 ? -2.743  5.264   4.597   1.00 71.12 ? 120 ARG B HH12 1  
ATOM 4211   H HH21 . ARG B 1 120 ? -2.451  2.780   2.179   1.00 74.15 ? 120 ARG B HH21 1  
ATOM 4212   H HH22 . ARG B 1 120 ? -1.697  4.144   2.937   1.00 2.43  ? 120 ARG B HH22 1  
ATOM 4213   N N    . GLY B 1 121 ? -8.715  0.265   8.442   1.00 52.10 ? 121 GLY B N    1  
ATOM 4214   C CA   . GLY B 1 121 ? -9.876  0.115   9.312   1.00 52.34 ? 121 GLY B CA   1  
ATOM 4215   C C    . GLY B 1 121 ? -9.592  -0.776  10.528  1.00 52.45 ? 121 GLY B C    1  
ATOM 4216   O O    . GLY B 1 121 ? -10.508 -1.068  11.292  1.00 33.14 ? 121 GLY B O    1  
ATOM 4217   H H    . GLY B 1 121 ? -8.635  -0.321  7.660   1.00 52.20 ? 121 GLY B H    1  
ATOM 4218   H HA2  . GLY B 1 121 ? -10.194 1.093   9.659   1.00 30.51 ? 121 GLY B HA2  1  
ATOM 4219   H HA3  . GLY B 1 121 ? -10.681 -0.323  8.734   1.00 10.53 ? 121 GLY B HA3  1  
ATOM 4220   N N    . THR B 1 122 ? -8.305  -1.192  10.691  1.00 62.25 ? 122 THR B N    1  
ATOM 4221   C CA   . THR B 1 122 ? -7.794  -2.047  11.801  1.00 52.41 ? 122 THR B CA   1  
ATOM 4222   C C    . THR B 1 122 ? -8.574  -3.372  11.951  1.00 13.52 ? 122 THR B C    1  
ATOM 4223   O O    . THR B 1 122 ? -8.652  -3.948  13.043  1.00 41.31 ? 122 THR B O    1  
ATOM 4224   C CB   . THR B 1 122 ? -7.726  -1.280  13.179  1.00 54.11 ? 122 THR B CB   1  
ATOM 4225   O OG1  . THR B 1 122 ? -9.025  -0.839  13.595  1.00 30.35 ? 122 THR B OG1  1  
ATOM 4226   C CG2  . THR B 1 122 ? -6.791  -0.063  13.131  1.00 25.13 ? 122 THR B CG2  1  
ATOM 4227   H H    . THR B 1 122 ? -7.654  -0.904  10.022  1.00 21.42 ? 122 THR B H    1  
ATOM 4228   H HA   . THR B 1 122 ? -6.777  -2.315  11.529  1.00 61.04 ? 122 THR B HA   1  
ATOM 4229   H HB   . THR B 1 122 ? -7.349  -1.968  13.932  1.00 75.20 ? 122 THR B HB   1  
ATOM 4230   H HG1  . THR B 1 122 ? -9.703  -1.289  13.081  1.00 12.11 ? 122 THR B HG1  1  
ATOM 4231   H HG21 . THR B 1 122 ? -7.096  0.599   12.331  1.00 4.24  ? 122 THR B HG21 1  
ATOM 4232   H HG22 . THR B 1 122 ? -5.780  -0.377  12.967  1.00 55.21 ? 122 THR B HG22 1  
ATOM 4233   H HG23 . THR B 1 122 ? -6.847  0.471   14.071  1.00 21.42 ? 122 THR B HG23 1  
ATOM 4234   N N    . PHE B 1 123 ? -9.099  -3.870  10.832  1.00 23.42 ? 123 PHE B N    1  
ATOM 4235   C CA   . PHE B 1 123 ? -9.910  -5.093  10.798  1.00 33.15 ? 123 PHE B CA   1  
ATOM 4236   C C    . PHE B 1 123 ? -9.034  -6.341  10.550  1.00 74.14 ? 123 PHE B C    1  
ATOM 4237   O O    . PHE B 1 123 ? -7.895  -6.208  10.082  1.00 65.22 ? 123 PHE B O    1  
ATOM 4238   C CB   . PHE B 1 123 ? -11.020 -4.950  9.726   1.00 10.21 ? 123 PHE B CB   1  
ATOM 4239   C CG   . PHE B 1 123 ? -12.269 -4.235  10.237  1.00 52.41 ? 123 PHE B CG   1  
ATOM 4240   C CD1  . PHE B 1 123 ? -13.208 -4.930  11.005  1.00 34.04 ? 123 PHE B CD1  1  
ATOM 4241   C CD2  . PHE B 1 123 ? -12.523 -2.900  9.940   1.00 11.45 ? 123 PHE B CD2  1  
ATOM 4242   C CE1  . PHE B 1 123 ? -14.351 -4.313  11.453  1.00 41.43 ? 123 PHE B CE1  1  
ATOM 4243   C CE2  . PHE B 1 123 ? -13.669 -2.281  10.397  1.00 4.01  ? 123 PHE B CE2  1  
ATOM 4244   C CZ   . PHE B 1 123 ? -14.585 -2.991  11.151  1.00 52.44 ? 123 PHE B CZ   1  
ATOM 4245   H H    . PHE B 1 123 ? -8.919  -3.409  9.985   1.00 25.52 ? 123 PHE B H    1  
ATOM 4246   H HA   . PHE B 1 123 ? -10.382 -5.209  11.774  1.00 61.15 ? 123 PHE B HA   1  
ATOM 4247   H HB2  . PHE B 1 123 ? -10.634 -4.404  8.870   1.00 65.02 ? 123 PHE B HB2  1  
ATOM 4248   H HB3  . PHE B 1 123 ? -11.326 -5.937  9.387   1.00 61.23 ? 123 PHE B HB3  1  
ATOM 4249   H HD1  . PHE B 1 123 ? -13.032 -5.971  11.251  1.00 62.23 ? 123 PHE B HD1  1  
ATOM 4250   H HD2  . PHE B 1 123 ? -11.808 -2.341  9.349   1.00 12.04 ? 123 PHE B HD2  1  
ATOM 4251   H HE1  . PHE B 1 123 ? -15.069 -4.867  12.047  1.00 60.22 ? 123 PHE B HE1  1  
ATOM 4252   H HE2  . PHE B 1 123 ? -13.852 -1.243  10.161  1.00 62.12 ? 123 PHE B HE2  1  
ATOM 4253   H HZ   . PHE B 1 123 ? -15.493 -2.513  11.496  1.00 11.24 ? 123 PHE B HZ   1  
ATOM 4254   N N    . PRO B 1 124 ? -9.555  -7.577  10.907  1.00 45.21 ? 124 PRO B N    1  
ATOM 4255   C CA   . PRO B 1 124 ? -8.871  -8.872  10.637  1.00 1.30  ? 124 PRO B CA   1  
ATOM 4256   C C    . PRO B 1 124 ? -8.364  -9.047  9.185   1.00 62.03 ? 124 PRO B C    1  
ATOM 4257   O O    . PRO B 1 124 ? -8.874  -8.412  8.253   1.00 42.11 ? 124 PRO B O    1  
ATOM 4258   C CB   . PRO B 1 124 ? -9.971  -9.913  10.956  1.00 52.12 ? 124 PRO B CB   1  
ATOM 4259   C CG   . PRO B 1 124 ? -10.814 -9.268  12.013  1.00 0.21  ? 124 PRO B CG   1  
ATOM 4260   C CD   . PRO B 1 124 ? -10.837 -7.799  11.657  1.00 35.13 ? 124 PRO B CD   1  
ATOM 4261   H HA   . PRO B 1 124 ? -8.036  -9.009  11.319  1.00 1.44  ? 124 PRO B HA   1  
ATOM 4262   H HB2  . PRO B 1 124 ? -10.563 -10.129 10.065  1.00 73.44 ? 124 PRO B HB2  1  
ATOM 4263   H HB3  . PRO B 1 124 ? -9.531  -10.829 11.333  1.00 65.23 ? 124 PRO B HB3  1  
ATOM 4264   H HG2  . PRO B 1 124 ? -11.818 -9.689  11.997  1.00 1.01  ? 124 PRO B HG2  1  
ATOM 4265   H HG3  . PRO B 1 124 ? -10.368 -9.409  12.993  1.00 15.13 ? 124 PRO B HG3  1  
ATOM 4266   H HD2  . PRO B 1 124 ? -11.689 -7.572  11.023  1.00 41.02 ? 124 PRO B HD2  1  
ATOM 4267   H HD3  . PRO B 1 124 ? -10.869 -7.186  12.550  1.00 64.41 ? 124 PRO B HD3  1  
ATOM 4268   N N    . GLN B 1 125 ? -7.376  -9.952  9.032   1.00 41.21 ? 125 GLN B N    1  
ATOM 4269   C CA   . GLN B 1 125 ? -6.694  -10.223 7.759   1.00 11.53 ? 125 GLN B CA   1  
ATOM 4270   C C    . GLN B 1 125 ? -7.696  -10.659 6.670   1.00 50.24 ? 125 GLN B C    1  
ATOM 4271   O O    . GLN B 1 125 ? -8.335  -11.709 6.787   1.00 73.52 ? 125 GLN B O    1  
ATOM 4272   C CB   . GLN B 1 125 ? -5.599  -11.308 7.972   1.00 54.52 ? 125 GLN B CB   1  
ATOM 4273   C CG   . GLN B 1 125 ? -4.700  -11.580 6.745   1.00 44.12 ? 125 GLN B CG   1  
ATOM 4274   C CD   . GLN B 1 125 ? -3.872  -10.364 6.321   1.00 72.03 ? 125 GLN B CD   1  
ATOM 4275   O OE1  . GLN B 1 125 ? -2.765  -10.154 6.810   1.00 72.20 ? 125 GLN B OE1  1  
ATOM 4276   N NE2  . GLN B 1 125 ? -4.392  -9.557  5.399   1.00 2.21  ? 125 GLN B NE2  1  
ATOM 4277   H H    . GLN B 1 125 ? -7.102  -10.467 9.817   1.00 70.32 ? 125 GLN B H    1  
ATOM 4278   H HA   . GLN B 1 125 ? -6.210  -9.302  7.447   1.00 62.21 ? 125 GLN B HA   1  
ATOM 4279   H HB2  . GLN B 1 125 ? -4.960  -10.999 8.795   1.00 40.33 ? 125 GLN B HB2  1  
ATOM 4280   H HB3  . GLN B 1 125 ? -6.083  -12.240 8.253   1.00 42.55 ? 125 GLN B HB3  1  
ATOM 4281   H HG2  . GLN B 1 125 ? -4.022  -12.393 6.980   1.00 2.51  ? 125 GLN B HG2  1  
ATOM 4282   H HG3  . GLN B 1 125 ? -5.329  -11.881 5.914   1.00 43.25 ? 125 GLN B HG3  1  
ATOM 4283   H HE21 . GLN B 1 125 ? -5.272  -9.775  5.031   1.00 33.32 ? 125 GLN B HE21 1  
ATOM 4284   H HE22 . GLN B 1 125 ? -3.861  -8.780  5.115   1.00 12.11 ? 125 GLN B HE22 1  
ATOM 4285   N N    . LEU B 1 126 ? -7.838  -9.824  5.630   1.00 23.22 ? 126 LEU B N    1  
ATOM 4286   C CA   . LEU B 1 126 ? -8.768  -10.070 4.520   1.00 5.50  ? 126 LEU B CA   1  
ATOM 4287   C C    . LEU B 1 126 ? -7.949  -10.107 3.217   1.00 4.22  ? 126 LEU B C    1  
ATOM 4288   O O    . LEU B 1 126 ? -7.529  -9.061  2.709   1.00 62.13 ? 126 LEU B O    1  
ATOM 4289   C CB   . LEU B 1 126 ? -9.878  -8.963  4.484   1.00 31.44 ? 126 LEU B CB   1  
ATOM 4290   C CG   . LEU B 1 126 ? -11.281 -9.368  3.896   1.00 43.12 ? 126 LEU B CG   1  
ATOM 4291   C CD1  . LEU B 1 126 ? -11.208 -9.843  2.419   1.00 3.00  ? 126 LEU B CD1  1  
ATOM 4292   C CD2  . LEU B 1 126 ? -11.966 -10.424 4.803   1.00 22.30 ? 126 LEU B CD2  1  
ATOM 4293   H H    . LEU B 1 126 ? -7.300  -9.004  5.607   1.00 4.01  ? 126 LEU B H    1  
ATOM 4294   H HA   . LEU B 1 126 ? -9.243  -11.040 4.664   1.00 54.42 ? 126 LEU B HA   1  
ATOM 4295   H HB2  . LEU B 1 126 ? -10.034 -8.619  5.505   1.00 44.54 ? 126 LEU B HB2  1  
ATOM 4296   H HB3  . LEU B 1 126 ? -9.505  -8.117  3.916   1.00 13.13 ? 126 LEU B HB3  1  
ATOM 4297   H HG   . LEU B 1 126 ? -11.913 -8.487  3.905   1.00 5.25  ? 126 LEU B HG   1  
ATOM 4298   H HD11 . LEU B 1 126 ? -12.202 -10.073 2.056   1.00 3.32  ? 126 LEU B HD11 1  
ATOM 4299   H HD12 . LEU B 1 126 ? -10.589 -10.729 2.342   1.00 54.11 ? 126 LEU B HD12 1  
ATOM 4300   H HD13 . LEU B 1 126 ? -10.781 -9.059  1.806   1.00 70.53 ? 126 LEU B HD13 1  
ATOM 4301   H HD21 . LEU B 1 126 ? -11.370 -11.328 4.837   1.00 74.45 ? 126 LEU B HD21 1  
ATOM 4302   H HD22 . LEU B 1 126 ? -12.948 -10.659 4.416   1.00 51.12 ? 126 LEU B HD22 1  
ATOM 4303   H HD23 . LEU B 1 126 ? -12.071 -10.028 5.806   1.00 74.31 ? 126 LEU B HD23 1  
ATOM 4304   N N    . ASN B 1 127 ? -7.687  -11.322 2.714   1.00 11.13 ? 127 ASN B N    1  
ATOM 4305   C CA   . ASN B 1 127 ? -6.955  -11.546 1.453   1.00 42.10 ? 127 ASN B CA   1  
ATOM 4306   C C    . ASN B 1 127 ? -7.860  -12.290 0.471   1.00 5.23  ? 127 ASN B C    1  
ATOM 4307   O O    . ASN B 1 127 ? -8.517  -13.265 0.853   1.00 65.04 ? 127 ASN B O    1  
ATOM 4308   C CB   . ASN B 1 127 ? -5.647  -12.356 1.700   1.00 31.44 ? 127 ASN B CB   1  
ATOM 4309   C CG   . ASN B 1 127 ? -4.644  -11.667 2.638   1.00 71.43 ? 127 ASN B CG   1  
ATOM 4310   O OD1  . ASN B 1 127 ? -3.917  -12.327 3.384   1.00 41.44 ? 127 ASN B OD1  1  
ATOM 4311   N ND2  . ASN B 1 127 ? -4.576  -10.340 2.606   1.00 23.15 ? 127 ASN B ND2  1  
ATOM 4312   H H    . ASN B 1 127 ? -8.006  -12.108 3.206   1.00 40.21 ? 127 ASN B H    1  
ATOM 4313   H HA   . ASN B 1 127 ? -6.692  -10.577 1.029   1.00 52.25 ? 127 ASN B HA   1  
ATOM 4314   H HB2  . ASN B 1 127 ? -5.902  -13.318 2.132   1.00 13.40 ? 127 ASN B HB2  1  
ATOM 4315   H HB3  . ASN B 1 127 ? -5.150  -12.525 0.750   1.00 41.02 ? 127 ASN B HB3  1  
ATOM 4316   H HD21 . ASN B 1 127 ? -5.159  -9.851  1.989   1.00 1.41  ? 127 ASN B HD21 1  
ATOM 4317   H HD22 . ASN B 1 127 ? -3.943  -9.901  3.208   1.00 3.25  ? 127 ASN B HD22 1  
ATOM 4318   N N    . LEU B 1 128 ? -7.893  -11.816 -0.786  1.00 21.22 ? 128 LEU B N    1  
ATOM 4319   C CA   . LEU B 1 128 ? -8.689  -12.436 -1.857  1.00 13.21 ? 128 LEU B CA   1  
ATOM 4320   C C    . LEU B 1 128 ? -8.004  -13.725 -2.341  1.00 4.42  ? 128 LEU B C    1  
ATOM 4321   O O    . LEU B 1 128 ? -6.765  -13.801 -2.371  1.00 10.42 ? 128 LEU B O    1  
ATOM 4322   C CB   . LEU B 1 128 ? -8.914  -11.451 -3.041  1.00 21.41 ? 128 LEU B CB   1  
ATOM 4323   C CG   . LEU B 1 128 ? -9.844  -10.214 -2.762  1.00 14.45 ? 128 LEU B CG   1  
ATOM 4324   C CD1  . LEU B 1 128 ? -9.210  -9.186  -1.789  1.00 31.52 ? 128 LEU B CD1  1  
ATOM 4325   C CD2  . LEU B 1 128 ? -10.282 -9.548  -4.086  1.00 71.23 ? 128 LEU B CD2  1  
ATOM 4326   H H    . LEU B 1 128 ? -7.365  -11.021 -0.997  1.00 20.15 ? 128 LEU B H    1  
ATOM 4327   H HA   . LEU B 1 128 ? -9.657  -12.696 -1.436  1.00 11.03 ? 128 LEU B HA   1  
ATOM 4328   H HB2  . LEU B 1 128 ? -7.945  -11.084 -3.368  1.00 62.35 ? 128 LEU B HB2  1  
ATOM 4329   H HB3  . LEU B 1 128 ? -9.349  -12.014 -3.863  1.00 24.43 ? 128 LEU B HB3  1  
ATOM 4330   H HG   . LEU B 1 128 ? -10.745 -10.575 -2.280  1.00 73.11 ? 128 LEU B HG   1  
ATOM 4331   H HD11 . LEU B 1 128 ? -8.295  -8.790  -2.211  1.00 55.10 ? 128 LEU B HD11 1  
ATOM 4332   H HD12 . LEU B 1 128 ? -8.989  -9.669  -0.848  1.00 2.44  ? 128 LEU B HD12 1  
ATOM 4333   H HD13 . LEU B 1 128 ? -9.904  -8.374  -1.613  1.00 65.53 ? 128 LEU B HD13 1  
ATOM 4334   H HD21 . LEU B 1 128 ? -9.418  -9.198  -4.634  1.00 44.54 ? 128 LEU B HD21 1  
ATOM 4335   H HD22 . LEU B 1 128 ? -10.939 -8.713  -3.875  1.00 70.24 ? 128 LEU B HD22 1  
ATOM 4336   H HD23 . LEU B 1 128 ? -10.824 -10.271 -4.689  1.00 0.40  ? 128 LEU B HD23 1  
ATOM 4337   N N    . ALA B 1 129 ? -8.821  -14.722 -2.705  1.00 43.53 ? 129 ALA B N    1  
ATOM 4338   C CA   . ALA B 1 129 ? -8.342  -16.037 -3.151  1.00 50.53 ? 129 ALA B CA   1  
ATOM 4339   C C    . ALA B 1 129 ? -7.682  -15.945 -4.549  1.00 32.11 ? 129 ALA B C    1  
ATOM 4340   O O    . ALA B 1 129 ? -8.232  -15.284 -5.443  1.00 0.13  ? 129 ALA B O    1  
ATOM 4341   C CB   . ALA B 1 129 ? -9.501  -17.050 -3.159  1.00 31.41 ? 129 ALA B CB   1  
ATOM 4342   H H    . ALA B 1 129 ? -9.785  -14.568 -2.674  1.00 42.34 ? 129 ALA B H    1  
ATOM 4343   H HA   . ALA B 1 129 ? -7.604  -16.379 -2.428  1.00 63.41 ? 129 ALA B HA   1  
ATOM 4344   H HB1  . ALA B 1 129 ? -9.132  -18.029 -3.434  1.00 70.01 ? 129 ALA B HB1  1  
ATOM 4345   H HB2  . ALA B 1 129 ? -10.256 -16.738 -3.869  1.00 62.01 ? 129 ALA B HB2  1  
ATOM 4346   H HB3  . ALA B 1 129 ? -9.943  -17.101 -2.172  1.00 32.53 ? 129 ALA B HB3  1  
ATOM 4347   N N    . PRO B 1 130 ? -6.478  -16.580 -4.749  1.00 61.33 ? 130 PRO B N    1  
ATOM 4348   C CA   . PRO B 1 130 ? -5.805  -16.627 -6.062  1.00 71.42 ? 130 PRO B CA   1  
ATOM 4349   C C    . PRO B 1 130 ? -6.527  -17.574 -7.038  1.00 64.43 ? 130 PRO B C    1  
ATOM 4350   O O    . PRO B 1 130 ? -6.450  -18.804 -6.901  1.00 54.34 ? 130 PRO B O    1  
ATOM 4351   C CB   . PRO B 1 130 ? -4.378  -17.142 -5.733  1.00 41.41 ? 130 PRO B CB   1  
ATOM 4352   C CG   . PRO B 1 130 ? -4.274  -17.156 -4.230  1.00 15.51 ? 130 PRO B CG   1  
ATOM 4353   C CD   . PRO B 1 130 ? -5.678  -17.297 -3.721  1.00 11.01 ? 130 PRO B CD   1  
ATOM 4354   H HA   . PRO B 1 130 ? -5.740  -15.633 -6.503  1.00 61.32 ? 130 PRO B HA   1  
ATOM 4355   H HB2  . PRO B 1 130 ? -4.225  -18.146 -6.138  1.00 30.21 ? 130 PRO B HB2  1  
ATOM 4356   H HB3  . PRO B 1 130 ? -3.628  -16.478 -6.151  1.00 23.44 ? 130 PRO B HB3  1  
ATOM 4357   H HG2  . PRO B 1 130 ? -3.659  -17.995 -3.904  1.00 2.01  ? 130 PRO B HG2  1  
ATOM 4358   H HG3  . PRO B 1 130 ? -3.838  -16.226 -3.875  1.00 31.11 ? 130 PRO B HG3  1  
ATOM 4359   H HD2  . PRO B 1 130 ? -5.968  -18.342 -3.657  1.00 71.01 ? 130 PRO B HD2  1  
ATOM 4360   H HD3  . PRO B 1 130 ? -5.768  -16.824 -2.757  1.00 60.14 ? 130 PRO B HD3  1  
ATOM 4361   N N    . VAL B 1 131 ? -7.253  -16.995 -7.996  1.00 63.33 ? 131 VAL B N    1  
ATOM 4362   C CA   . VAL B 1 131 ? -7.966  -17.749 -9.035  1.00 60.24 ? 131 VAL B CA   1  
ATOM 4363   C C    . VAL B 1 131 ? -7.296  -17.511 -10.397 1.00 31.52 ? 131 VAL B C    1  
ATOM 4364   O O    . VAL B 1 131 ? -6.843  -16.394 -10.691 1.00 44.54 ? 131 VAL B O    1  
ATOM 4365   C CB   . VAL B 1 131 ? -9.493  -17.351 -9.089  1.00 24.13 ? 131 VAL B CB   1  
ATOM 4366   C CG1  . VAL B 1 131 ? -10.193 -17.662 -7.738  1.00 15.33 ? 131 VAL B CG1  1  
ATOM 4367   C CG2  . VAL B 1 131 ? -9.680  -15.863 -9.493  1.00 1.30  ? 131 VAL B CG2  1  
ATOM 4368   H H    . VAL B 1 131 ? -7.309  -16.018 -8.012  1.00 3.40  ? 131 VAL B H    1  
ATOM 4369   H HA   . VAL B 1 131 ? -7.903  -18.814 -8.798  1.00 53.33 ? 131 VAL B HA   1  
ATOM 4370   H HB   . VAL B 1 131 ? -9.971  -17.965 -9.851  1.00 74.23 ? 131 VAL B HB   1  
ATOM 4371   H HG11 . VAL B 1 131 ? -11.239 -17.389 -7.793  1.00 44.33 ? 131 VAL B HG11 1  
ATOM 4372   H HG12 . VAL B 1 131 ? -9.720  -17.100 -6.940  1.00 71.20 ? 131 VAL B HG12 1  
ATOM 4373   H HG13 . VAL B 1 131 ? -10.113 -18.720 -7.520  1.00 53.14 ? 131 VAL B HG13 1  
ATOM 4374   H HG21 . VAL B 1 131 ? -10.734 -15.622 -9.535  1.00 44.34 ? 131 VAL B HG21 1  
ATOM 4375   H HG22 . VAL B 1 131 ? -9.239  -15.689 -10.466 1.00 32.04 ? 131 VAL B HG22 1  
ATOM 4376   H HG23 . VAL B 1 131 ? -9.196  -15.222 -8.766  1.00 53.55 ? 131 VAL B HG23 1  
ATOM 4377   N N    . ASN B 1 132 ? -7.188  -18.575 -11.206 1.00 11.13 ? 132 ASN B N    1  
ATOM 4378   C CA   . ASN B 1 132 ? -6.786  -18.459 -12.613 1.00 32.52 ? 132 ASN B CA   1  
ATOM 4379   C C    . ASN B 1 132 ? -8.084  -18.324 -13.426 1.00 11.42 ? 132 ASN B C    1  
ATOM 4380   O O    . ASN B 1 132 ? -8.714  -19.323 -13.791 1.00 61.31 ? 132 ASN B O    1  
ATOM 4381   C CB   . ASN B 1 132 ? -5.929  -19.678 -13.060 1.00 33.21 ? 132 ASN B CB   1  
ATOM 4382   C CG   . ASN B 1 132 ? -5.284  -19.517 -14.453 1.00 32.24 ? 132 ASN B CG   1  
ATOM 4383   O OD1  . ASN B 1 132 ? -5.809  -18.841 -15.340 1.00 45.23 ? 132 ASN B OD1  1  
ATOM 4384   N ND2  . ASN B 1 132 ? -4.147  -20.158 -14.663 1.00 34.03 ? 132 ASN B ND2  1  
ATOM 4385   H H    . ASN B 1 132 ? -7.393  -19.462 -10.846 1.00 32.14 ? 132 ASN B H    1  
ATOM 4386   H HA   . ASN B 1 132 ? -6.195  -17.550 -12.731 1.00 12.24 ? 132 ASN B HA   1  
ATOM 4387   H HB2  . ASN B 1 132 ? -5.135  -19.833 -12.335 1.00 51.25 ? 132 ASN B HB2  1  
ATOM 4388   H HB3  . ASN B 1 132 ? -6.553  -20.563 -13.078 1.00 21.33 ? 132 ASN B HB3  1  
ATOM 4389   H HD21 . ASN B 1 132 ? -3.775  -20.696 -13.933 1.00 43.04 ? 132 ASN B HD21 1  
ATOM 4390   H HD22 . ASN B 1 132 ? -3.728  -20.072 -15.543 1.00 61.03 ? 132 ASN B HD22 1  
ATOM 4391   N N    . PHE B 1 133 ? -8.501  -17.064 -13.621 1.00 0.32  ? 133 PHE B N    1  
ATOM 4392   C CA   . PHE B 1 133 ? -9.803  -16.712 -14.214 1.00 34.44 ? 133 PHE B CA   1  
ATOM 4393   C C    . PHE B 1 133 ? -9.873  -17.127 -15.699 1.00 24.41 ? 133 PHE B C    1  
ATOM 4394   O O    . PHE B 1 133 ? -10.937 -17.498 -16.205 1.00 63.33 ? 133 PHE B O    1  
ATOM 4395   C CB   . PHE B 1 133 ? -10.059 -15.190 -14.029 1.00 34.34 ? 133 PHE B CB   1  
ATOM 4396   C CG   . PHE B 1 133 ? -11.537 -14.803 -14.045 1.00 44.35 ? 133 PHE B CG   1  
ATOM 4397   C CD1  . PHE B 1 133 ? -12.329 -15.001 -12.908 1.00 3.24  ? 133 PHE B CD1  1  
ATOM 4398   C CD2  . PHE B 1 133 ? -12.136 -14.252 -15.176 1.00 13.52 ? 133 PHE B CD2  1  
ATOM 4399   C CE1  . PHE B 1 133 ? -13.667 -14.663 -12.909 1.00 12.01 ? 133 PHE B CE1  1  
ATOM 4400   C CE2  . PHE B 1 133 ? -13.474 -13.914 -15.174 1.00 2.34  ? 133 PHE B CE2  1  
ATOM 4401   C CZ   . PHE B 1 133 ? -14.236 -14.119 -14.041 1.00 14.42 ? 133 PHE B CZ   1  
ATOM 4402   H H    . PHE B 1 133 ? -7.909  -16.334 -13.340 1.00 40.23 ? 133 PHE B H    1  
ATOM 4403   H HA   . PHE B 1 133 ? -10.566 -17.265 -13.670 1.00 53.54 ? 133 PHE B HA   1  
ATOM 4404   H HB2  . PHE B 1 133 ? -9.647  -14.877 -13.075 1.00 73.32 ? 133 PHE B HB2  1  
ATOM 4405   H HB3  . PHE B 1 133 ? -9.551  -14.639 -14.815 1.00 35.45 ? 133 PHE B HB3  1  
ATOM 4406   H HD1  . PHE B 1 133 ? -11.886 -15.429 -12.016 1.00 44.34 ? 133 PHE B HD1  1  
ATOM 4407   H HD2  . PHE B 1 133 ? -11.544 -14.091 -16.067 1.00 32.45 ? 133 PHE B HD2  1  
ATOM 4408   H HE1  . PHE B 1 133 ? -14.270 -14.823 -12.023 1.00 34.35 ? 133 PHE B HE1  1  
ATOM 4409   H HE2  . PHE B 1 133 ? -13.926 -13.486 -16.059 1.00 65.43 ? 133 PHE B HE2  1  
ATOM 4410   H HZ   . PHE B 1 133 ? -15.285 -13.852 -14.041 1.00 60.10 ? 133 PHE B HZ   1  
ATOM 4411   N N    . ASP B 1 134 ? -8.711  -17.080 -16.366 1.00 42.12 ? 134 ASP B N    1  
ATOM 4412   C CA   . ASP B 1 134 ? -8.545  -17.523 -17.759 1.00 33.23 ? 134 ASP B CA   1  
ATOM 4413   C C    . ASP B 1 134 ? -8.764  -19.041 -17.898 1.00 23.34 ? 134 ASP B C    1  
ATOM 4414   O O    . ASP B 1 134 ? -9.356  -19.491 -18.888 1.00 54.22 ? 134 ASP B O    1  
ATOM 4415   C CB   . ASP B 1 134 ? -7.139  -17.136 -18.273 1.00 53.41 ? 134 ASP B CB   1  
ATOM 4416   C CG   . ASP B 1 134 ? -6.954  -15.616 -18.387 1.00 1.22  ? 134 ASP B CG   1  
ATOM 4417   O OD1  . ASP B 1 134 ? -7.301  -15.058 -19.450 1.00 54.42 ? 134 ASP B OD1  1  
ATOM 4418   O OD2  . ASP B 1 134 ? -6.495  -14.980 -17.417 1.00 23.14 ? 134 ASP B OD2  1  
ATOM 4419   H H    . ASP B 1 134 ? -7.928  -16.715 -15.903 1.00 42.22 ? 134 ASP B H    1  
ATOM 4420   H HA   . ASP B 1 134 ? -9.291  -17.006 -18.361 1.00 40.34 ? 134 ASP B HA   1  
ATOM 4421   H HB2  . ASP B 1 134 ? -6.390  -17.531 -17.592 1.00 41.35 ? 134 ASP B HB2  1  
ATOM 4422   H HB3  . ASP B 1 134 ? -6.980  -17.577 -19.251 1.00 5.34  ? 134 ASP B HB3  1  
ATOM 4423   N N    . ALA B 1 135 ? -8.296  -19.813 -16.887 1.00 3.21  ? 135 ALA B N    1  
ATOM 4424   C CA   . ALA B 1 135 ? -8.420  -21.292 -16.858 1.00 11.34 ? 135 ALA B CA   1  
ATOM 4425   C C    . ALA B 1 135 ? -9.889  -21.737 -16.809 1.00 22.34 ? 135 ALA B C    1  
ATOM 4426   O O    . ALA B 1 135 ? -10.243 -22.779 -17.359 1.00 62.13 ? 135 ALA B O    1  
ATOM 4427   C CB   . ALA B 1 135 ? -7.657  -21.882 -15.661 1.00 71.52 ? 135 ALA B CB   1  
ATOM 4428   H H    . ALA B 1 135 ? -7.849  -19.370 -16.133 1.00 51.55 ? 135 ALA B H    1  
ATOM 4429   H HA   . ALA B 1 135 ? -7.965  -21.678 -17.768 1.00 42.44 ? 135 ALA B HA   1  
ATOM 4430   H HB1  . ALA B 1 135 ? -6.608  -21.624 -15.736 1.00 64.32 ? 135 ALA B HB1  1  
ATOM 4431   H HB2  . ALA B 1 135 ? -7.759  -22.958 -15.654 1.00 30.43 ? 135 ALA B HB2  1  
ATOM 4432   H HB3  . ALA B 1 135 ? -8.054  -21.478 -14.738 1.00 20.11 ? 135 ALA B HB3  1  
ATOM 4433   N N    . LEU B 1 136 ? -10.725 -20.918 -16.153 1.00 63.42 ? 136 LEU B N    1  
ATOM 4434   C CA   . LEU B 1 136 ? -12.178 -21.168 -16.008 1.00 20.31 ? 136 LEU B CA   1  
ATOM 4435   C C    . LEU B 1 136 ? -12.884 -21.238 -17.384 1.00 2.23  ? 136 LEU B C    1  
ATOM 4436   O O    . LEU B 1 136 ? -13.831 -22.014 -17.573 1.00 42.41 ? 136 LEU B O    1  
ATOM 4437   C CB   . LEU B 1 136 ? -12.803 -20.065 -15.114 1.00 1.43  ? 136 LEU B CB   1  
ATOM 4438   C CG   . LEU B 1 136 ? -12.226 -19.962 -13.661 1.00 75.12 ? 136 LEU B CG   1  
ATOM 4439   C CD1  . LEU B 1 136 ? -12.841 -18.772 -12.883 1.00 63.12 ? 136 LEU B CD1  1  
ATOM 4440   C CD2  . LEU B 1 136 ? -12.406 -21.296 -12.893 1.00 71.31 ? 136 LEU B CD2  1  
ATOM 4441   H H    . LEU B 1 136 ? -10.347 -20.115 -15.739 1.00 0.32  ? 136 LEU B H    1  
ATOM 4442   H HA   . LEU B 1 136 ? -12.294 -22.127 -15.511 1.00 12.02 ? 136 LEU B HA   1  
ATOM 4443   H HB2  . LEU B 1 136 ? -12.659 -19.108 -15.609 1.00 72.10 ? 136 LEU B HB2  1  
ATOM 4444   H HB3  . LEU B 1 136 ? -13.871 -20.247 -15.041 1.00 4.32  ? 136 LEU B HB3  1  
ATOM 4445   H HG   . LEU B 1 136 ? -11.161 -19.773 -13.730 1.00 34.41 ? 136 LEU B HG   1  
ATOM 4446   H HD11 . LEU B 1 136 ? -13.911 -18.908 -12.779 1.00 2.52  ? 136 LEU B HD11 1  
ATOM 4447   H HD12 . LEU B 1 136 ? -12.652 -17.851 -13.420 1.00 12.04 ? 136 LEU B HD12 1  
ATOM 4448   H HD13 . LEU B 1 136 ? -12.391 -18.703 -11.901 1.00 2.30  ? 136 LEU B HD13 1  
ATOM 4449   H HD21 . LEU B 1 136 ? -11.989 -21.207 -11.899 1.00 62.35 ? 136 LEU B HD21 1  
ATOM 4450   H HD22 . LEU B 1 136 ? -11.892 -22.090 -13.420 1.00 2.31  ? 136 LEU B HD22 1  
ATOM 4451   H HD23 . LEU B 1 136 ? -13.459 -21.542 -12.820 1.00 14.11 ? 136 LEU B HD23 1  
ATOM 4452   N N    . PHE B 1 137 ? -12.402 -20.414 -18.334 1.00 25.03 ? 137 PHE B N    1  
ATOM 4453   C CA   . PHE B 1 137 ? -12.866 -20.433 -19.741 1.00 41.34 ? 137 PHE B CA   1  
ATOM 4454   C C    . PHE B 1 137 ? -12.120 -21.518 -20.545 1.00 25.24 ? 137 PHE B C    1  
ATOM 4455   O O    . PHE B 1 137 ? -12.720 -22.210 -21.370 1.00 24.34 ? 137 PHE B O    1  
ATOM 4456   C CB   . PHE B 1 137 ? -12.649 -19.047 -20.402 1.00 41.34 ? 137 PHE B CB   1  
ATOM 4457   C CG   . PHE B 1 137 ? -13.452 -17.916 -19.751 1.00 71.14 ? 137 PHE B CG   1  
ATOM 4458   C CD1  . PHE B 1 137 ? -14.767 -17.653 -20.146 1.00 22.45 ? 137 PHE B CD1  1  
ATOM 4459   C CD2  . PHE B 1 137 ? -12.896 -17.116 -18.751 1.00 30.44 ? 137 PHE B CD2  1  
ATOM 4460   C CE1  . PHE B 1 137 ? -15.499 -16.634 -19.557 1.00 60.22 ? 137 PHE B CE1  1  
ATOM 4461   C CE2  . PHE B 1 137 ? -13.629 -16.099 -18.164 1.00 22.33 ? 137 PHE B CE2  1  
ATOM 4462   C CZ   . PHE B 1 137 ? -14.926 -15.853 -18.570 1.00 41.53 ? 137 PHE B CZ   1  
ATOM 4463   H H    . PHE B 1 137 ? -11.714 -19.764 -18.076 1.00 25.34 ? 137 PHE B H    1  
ATOM 4464   H HA   . PHE B 1 137 ? -13.931 -20.660 -19.745 1.00 63.12 ? 137 PHE B HA   1  
ATOM 4465   H HB2  . PHE B 1 137 ? -11.595 -18.789 -20.351 1.00 74.11 ? 137 PHE B HB2  1  
ATOM 4466   H HB3  . PHE B 1 137 ? -12.937 -19.101 -21.449 1.00 31.11 ? 137 PHE B HB3  1  
ATOM 4467   H HD1  . PHE B 1 137 ? -15.223 -18.260 -20.920 1.00 13.11 ? 137 PHE B HD1  1  
ATOM 4468   H HD2  . PHE B 1 137 ? -11.879 -17.302 -18.425 1.00 13.54 ? 137 PHE B HD2  1  
ATOM 4469   H HE1  . PHE B 1 137 ? -16.516 -16.444 -19.873 1.00 32.34 ? 137 PHE B HE1  1  
ATOM 4470   H HE2  . PHE B 1 137 ? -13.182 -15.488 -17.392 1.00 23.04 ? 137 PHE B HE2  1  
ATOM 4471   H HZ   . PHE B 1 137 ? -15.497 -15.056 -18.111 1.00 11.15 ? 137 PHE B HZ   1  
ATOM 4472   N N    . MET B 1 138 ? -10.809 -21.662 -20.268 1.00 34.02 ? 138 MET B N    1  
ATOM 4473   C CA   . MET B 1 138 ? -9.893  -22.569 -21.007 1.00 62.01 ? 138 MET B CA   1  
ATOM 4474   C C    . MET B 1 138 ? -10.318 -24.050 -20.879 1.00 44.25 ? 138 MET B C    1  
ATOM 4475   O O    . MET B 1 138 ? -10.238 -24.812 -21.853 1.00 23.32 ? 138 MET B O    1  
ATOM 4476   C CB   . MET B 1 138 ? -8.427  -22.340 -20.512 1.00 43.24 ? 138 MET B CB   1  
ATOM 4477   C CG   . MET B 1 138 ? -7.364  -23.336 -21.031 1.00 20.34 ? 138 MET B CG   1  
ATOM 4478   S SD   . MET B 1 138 ? -7.388  -24.908 -20.132 1.00 21.44 ? 138 MET B SD   1  
ATOM 4479   C CE   . MET B 1 138 ? -6.053  -25.807 -20.921 1.00 25.23 ? 138 MET B CE   1  
ATOM 4480   H H    . MET B 1 138 ? -10.438 -21.134 -19.530 1.00 31.23 ? 138 MET B H    1  
ATOM 4481   H HA   . MET B 1 138 ? -9.947  -22.290 -22.055 1.00 14.33 ? 138 MET B HA   1  
ATOM 4482   H HB2  . MET B 1 138 ? -8.121  -21.342 -20.806 1.00 75.40 ? 138 MET B HB2  1  
ATOM 4483   H HB3  . MET B 1 138 ? -8.420  -22.385 -19.428 1.00 4.10  ? 138 MET B HB3  1  
ATOM 4484   H HG2  . MET B 1 138 ? -7.549  -23.536 -22.078 1.00 31.24 ? 138 MET B HG2  1  
ATOM 4485   H HG3  . MET B 1 138 ? -6.379  -22.893 -20.923 1.00 2.20  ? 138 MET B HG3  1  
ATOM 4486   H HE1  . MET B 1 138 ? -5.128  -25.262 -20.802 1.00 51.43 ? 138 MET B HE1  1  
ATOM 4487   H HE2  . MET B 1 138 ? -6.269  -25.927 -21.972 1.00 61.40 ? 138 MET B HE2  1  
ATOM 4488   H HE3  . MET B 1 138 ? -5.957  -26.780 -20.461 1.00 62.13 ? 138 MET B HE3  1  
ATOM 4489   N N    . ASN B 1 139 ? -10.831 -24.424 -19.692 1.00 25.10 ? 139 ASN B N    1  
ATOM 4490   C CA   . ASN B 1 139 ? -11.252 -25.814 -19.389 1.00 14.33 ? 139 ASN B CA   1  
ATOM 4491   C C    . ASN B 1 139 ? -12.572 -26.143 -20.100 1.00 10.33 ? 139 ASN B C    1  
ATOM 4492   O O    . ASN B 1 139 ? -12.860 -27.314 -20.373 1.00 10.35 ? 139 ASN B O    1  
ATOM 4493   C CB   . ASN B 1 139 ? -11.394 -26.035 -17.849 1.00 14.41 ? 139 ASN B CB   1  
ATOM 4494   C CG   . ASN B 1 139 ? -10.058 -26.100 -17.079 1.00 45.45 ? 139 ASN B CG   1  
ATOM 4495   O OD1  . ASN B 1 139 ? -9.948  -26.806 -16.076 1.00 55.35 ? 139 ASN B OD1  1  
ATOM 4496   N ND2  . ASN B 1 139 ? -9.035  -25.367 -17.514 1.00 45.51 ? 139 ASN B ND2  1  
ATOM 4497   H H    . ASN B 1 139 ? -10.947 -23.742 -18.999 1.00 23.52 ? 139 ASN B H    1  
ATOM 4498   H HA   . ASN B 1 139 ? -10.486 -26.484 -19.768 1.00 51.30 ? 139 ASN B HA   1  
ATOM 4499   H HB2  . ASN B 1 139 ? -11.977 -25.227 -17.428 1.00 74.50 ? 139 ASN B HB2  1  
ATOM 4500   H HB3  . ASN B 1 139 ? -11.925 -26.967 -17.674 1.00 73.24 ? 139 ASN B HB3  1  
ATOM 4501   H HD21 . ASN B 1 139 ? -9.158  -24.810 -18.308 1.00 62.45 ? 139 ASN B HD21 1  
ATOM 4502   H HD22 . ASN B 1 139 ? -8.193  -25.419 -17.019 1.00 12.35 ? 139 ASN B HD22 1  
ATOM 4503   N N    . TYR B 1 140 ? -13.360 -25.096 -20.412 1.00 71.52 ? 140 TYR B N    1  
ATOM 4504   C CA   . TYR B 1 140 ? -14.602 -25.240 -21.184 1.00 65.34 ? 140 TYR B CA   1  
ATOM 4505   C C    . TYR B 1 140 ? -14.275 -25.459 -22.674 1.00 52.43 ? 140 TYR B C    1  
ATOM 4506   O O    . TYR B 1 140 ? -14.970 -26.204 -23.369 1.00 21.20 ? 140 TYR B O    1  
ATOM 4507   C CB   . TYR B 1 140 ? -15.516 -23.990 -21.011 1.00 22.45 ? 140 TYR B CB   1  
ATOM 4508   C CG   . TYR B 1 140 ? -16.841 -24.093 -21.791 1.00 24.42 ? 140 TYR B CG   1  
ATOM 4509   C CD1  . TYR B 1 140 ? -17.873 -24.919 -21.341 1.00 73.53 ? 140 TYR B CD1  1  
ATOM 4510   C CD2  . TYR B 1 140 ? -17.038 -23.407 -23.001 1.00 73.13 ? 140 TYR B CD2  1  
ATOM 4511   C CE1  . TYR B 1 140 ? -19.040 -25.058 -22.063 1.00 64.40 ? 140 TYR B CE1  1  
ATOM 4512   C CE2  . TYR B 1 140 ? -18.212 -23.540 -23.717 1.00 2.14  ? 140 TYR B CE2  1  
ATOM 4513   C CZ   . TYR B 1 140 ? -19.205 -24.369 -23.247 1.00 73.42 ? 140 TYR B CZ   1  
ATOM 4514   O OH   . TYR B 1 140 ? -20.363 -24.522 -23.969 1.00 13.31 ? 140 TYR B OH   1  
ATOM 4515   H H    . TYR B 1 140 ? -13.089 -24.201 -20.122 1.00 15.54 ? 140 TYR B H    1  
ATOM 4516   H HA   . TYR B 1 140 ? -15.129 -26.113 -20.808 1.00 51.42 ? 140 TYR B HA   1  
ATOM 4517   H HB2  . TYR B 1 140 ? -15.754 -23.867 -19.960 1.00 5.11  ? 140 TYR B HB2  1  
ATOM 4518   H HB3  . TYR B 1 140 ? -14.986 -23.103 -21.355 1.00 53.21 ? 140 TYR B HB3  1  
ATOM 4519   H HD1  . TYR B 1 140 ? -17.752 -25.461 -20.410 1.00 24.12 ? 140 TYR B HD1  1  
ATOM 4520   H HD2  . TYR B 1 140 ? -16.258 -22.755 -23.370 1.00 3.54  ? 140 TYR B HD2  1  
ATOM 4521   H HE1  . TYR B 1 140 ? -19.827 -25.704 -21.693 1.00 13.31 ? 140 TYR B HE1  1  
ATOM 4522   H HE2  . TYR B 1 140 ? -18.345 -23.002 -24.648 1.00 43.22 ? 140 TYR B HE2  1  
ATOM 4523   H HH   . TYR B 1 140 ? -21.112 -24.515 -23.368 1.00 15.01 ? 140 TYR B HH   1  
ATOM 4524   N N    . LEU B 1 141 ? -13.205 -24.802 -23.150 1.00 40.04 ? 141 LEU B N    1  
ATOM 4525   C CA   . LEU B 1 141 ? -12.845 -24.778 -24.585 1.00 54.43 ? 141 LEU B CA   1  
ATOM 4526   C C    . LEU B 1 141 ? -11.955 -25.968 -24.992 1.00 15.11 ? 141 LEU B C    1  
ATOM 4527   O O    . LEU B 1 141 ? -11.647 -26.124 -26.181 1.00 65.24 ? 141 LEU B O    1  
ATOM 4528   C CB   . LEU B 1 141 ? -12.151 -23.430 -24.927 1.00 51.42 ? 141 LEU B CB   1  
ATOM 4529   C CG   . LEU B 1 141 ? -12.985 -22.142 -24.618 1.00 64.43 ? 141 LEU B CG   1  
ATOM 4530   C CD1  . LEU B 1 141 ? -12.199 -20.859 -24.974 1.00 62.35 ? 141 LEU B CD1  1  
ATOM 4531   C CD2  . LEU B 1 141 ? -14.366 -22.176 -25.319 1.00 1.45  ? 141 LEU B CD2  1  
ATOM 4532   H H    . LEU B 1 141 ? -12.635 -24.317 -22.516 1.00 43.31 ? 141 LEU B H    1  
ATOM 4533   H HA   . LEU B 1 141 ? -13.764 -24.842 -25.160 1.00 10.22 ? 141 LEU B HA   1  
ATOM 4534   H HB2  . LEU B 1 141 ? -11.221 -23.378 -24.367 1.00 21.30 ? 141 LEU B HB2  1  
ATOM 4535   H HB3  . LEU B 1 141 ? -11.907 -23.430 -25.984 1.00 2.50  ? 141 LEU B HB3  1  
ATOM 4536   H HG   . LEU B 1 141 ? -13.171 -22.108 -23.552 1.00 64.31 ? 141 LEU B HG   1  
ATOM 4537   H HD11 . LEU B 1 141 ? -12.787 -19.987 -24.715 1.00 32.41 ? 141 LEU B HD11 1  
ATOM 4538   H HD12 . LEU B 1 141 ? -11.980 -20.838 -26.034 1.00 22.34 ? 141 LEU B HD12 1  
ATOM 4539   H HD13 . LEU B 1 141 ? -11.271 -20.837 -24.418 1.00 73.20 ? 141 LEU B HD13 1  
ATOM 4540   H HD21 . LEU B 1 141 ? -14.954 -21.325 -25.004 1.00 3.41  ? 141 LEU B HD21 1  
ATOM 4541   H HD22 . LEU B 1 141 ? -14.891 -23.083 -25.045 1.00 74.12 ? 141 LEU B HD22 1  
ATOM 4542   H HD23 . LEU B 1 141 ? -14.239 -22.151 -26.394 1.00 53.14 ? 141 LEU B HD23 1  
ATOM 4543   N N    . GLN B 1 142 ? -11.560 -26.815 -24.024 1.00 24.32 ? 142 GLN B N    1  
ATOM 4544   C CA   . GLN B 1 142 ? -10.692 -27.982 -24.290 1.00 1.11  ? 142 GLN B CA   1  
ATOM 4545   C C    . GLN B 1 142 ? -11.438 -29.293 -23.984 1.00 35.00 ? 142 GLN B C    1  
ATOM 4546   O O    . GLN B 1 142 ? -12.150 -29.388 -22.975 1.00 62.00 ? 142 GLN B O    1  
ATOM 4547   C CB   . GLN B 1 142 ? -9.396  -27.914 -23.432 1.00 72.02 ? 142 GLN B CB   1  
ATOM 4548   C CG   . GLN B 1 142 ? -8.362  -29.013 -23.778 1.00 10.12 ? 142 GLN B CG   1  
ATOM 4549   C CD   . GLN B 1 142 ? -7.143  -29.062 -22.855 1.00 34.04 ? 142 GLN B CD   1  
ATOM 4550   O OE1  . GLN B 1 142 ? -7.223  -28.750 -21.669 1.00 61.42 ? 142 GLN B OE1  1  
ATOM 4551   N NE2  . GLN B 1 142 ? -6.001  -29.449 -23.402 1.00 4.31  ? 142 GLN B NE2  1  
ATOM 4552   H H    . GLN B 1 142 ? -11.859 -26.656 -23.104 1.00 74.31 ? 142 GLN B H    1  
ATOM 4553   H HA   . GLN B 1 142 ? -10.415 -27.975 -25.343 1.00 24.31 ? 142 GLN B HA   1  
ATOM 4554   H HB2  . GLN B 1 142 ? -8.929  -26.947 -23.585 1.00 62.22 ? 142 GLN B HB2  1  
ATOM 4555   H HB3  . GLN B 1 142 ? -9.660  -28.007 -22.384 1.00 74.32 ? 142 GLN B HB3  1  
ATOM 4556   H HG2  . GLN B 1 142 ? -8.852  -29.980 -23.724 1.00 43.21 ? 142 GLN B HG2  1  
ATOM 4557   H HG3  . GLN B 1 142 ? -8.023  -28.854 -24.795 1.00 42.22 ? 142 GLN B HG3  1  
ATOM 4558   H HE21 . GLN B 1 142 ? -6.001  -29.681 -24.357 1.00 73.44 ? 142 GLN B HE21 1  
ATOM 4559   H HE22 . GLN B 1 142 ? -5.211  -29.498 -22.833 1.00 20.43 ? 142 GLN B HE22 1  
ATOM 4560   N N    . GLN B 1 143 ? -11.271 -30.290 -24.871 1.00 23.12 ? 143 GLN B N    1  
ATOM 4561   C CA   . GLN B 1 143 ? -11.686 -31.676 -24.621 1.00 54.22 ? 143 GLN B CA   1  
ATOM 4562   C C    . GLN B 1 143 ? -10.710 -32.302 -23.605 1.00 31.01 ? 143 GLN B C    1  
ATOM 4563   O O    . GLN B 1 143 ? -9.501  -32.367 -23.862 1.00 14.45 ? 143 GLN B O    1  
ATOM 4564   C CB   . GLN B 1 143 ? -11.695 -32.493 -25.949 1.00 42.40 ? 143 GLN B CB   1  
ATOM 4565   C CG   . GLN B 1 143 ? -12.000 -34.004 -25.777 1.00 32.54 ? 143 GLN B CG   1  
ATOM 4566   C CD   . GLN B 1 143 ? -11.916 -34.817 -27.076 1.00 23.01 ? 143 GLN B CD   1  
ATOM 4567   O OE1  . GLN B 1 143 ? -12.190 -34.315 -28.166 1.00 64.33 ? 143 GLN B OE1  1  
ATOM 4568   N NE2  . GLN B 1 143 ? -11.543 -36.083 -26.969 1.00 31.32 ? 143 GLN B NE2  1  
ATOM 4569   H H    . GLN B 1 143 ? -10.836 -30.085 -25.722 1.00 54.21 ? 143 GLN B H    1  
ATOM 4570   H HA   . GLN B 1 143 ? -12.692 -31.663 -24.202 1.00 50.35 ? 143 GLN B HA   1  
ATOM 4571   H HB2  . GLN B 1 143 ? -12.445 -32.068 -26.610 1.00 71.21 ? 143 GLN B HB2  1  
ATOM 4572   H HB3  . GLN B 1 143 ? -10.724 -32.393 -26.426 1.00 35.31 ? 143 GLN B HB3  1  
ATOM 4573   H HG2  . GLN B 1 143 ? -11.294 -34.418 -25.067 1.00 22.05 ? 143 GLN B HG2  1  
ATOM 4574   H HG3  . GLN B 1 143 ? -13.001 -34.110 -25.374 1.00 65.41 ? 143 GLN B HG3  1  
ATOM 4575   H HE21 . GLN B 1 143 ? -11.342 -36.436 -26.076 1.00 61.05 ? 143 GLN B HE21 1  
ATOM 4576   H HE22 . GLN B 1 143 ? -11.481 -36.614 -27.789 1.00 71.05 ? 143 GLN B HE22 1  
ATOM 4577   N N    . GLN B 1 144 ? -11.228 -32.704 -22.441 1.00 53.22 ? 144 GLN B N    1  
ATOM 4578   C CA   . GLN B 1 144 ? -10.429 -33.365 -21.396 1.00 42.43 ? 144 GLN B CA   1  
ATOM 4579   C C    . GLN B 1 144 ? -10.131 -34.828 -21.812 1.00 64.23 ? 144 GLN B C    1  
ATOM 4580   O O    . GLN B 1 144 ? -11.048 -35.589 -22.149 1.00 31.51 ? 144 GLN B O    1  
ATOM 4581   C CB   . GLN B 1 144 ? -11.168 -33.277 -20.027 1.00 12.04 ? 144 GLN B CB   1  
ATOM 4582   C CG   . GLN B 1 144 ? -12.572 -33.918 -20.006 1.00 44.43 ? 144 GLN B CG   1  
ATOM 4583   C CD   . GLN B 1 144 ? -13.340 -33.673 -18.708 1.00 2.52  ? 144 GLN B CD   1  
ATOM 4584   O OE1  . GLN B 1 144 ? -13.255 -34.456 -17.760 1.00 31.44 ? 144 GLN B OE1  1  
ATOM 4585   N NE2  . GLN B 1 144 ? -14.089 -32.582 -18.651 1.00 75.11 ? 144 GLN B NE2  1  
ATOM 4586   H H    . GLN B 1 144 ? -12.181 -32.547 -22.278 1.00 42.04 ? 144 GLN B H    1  
ATOM 4587   H HA   . GLN B 1 144 ? -9.484  -32.824 -21.313 1.00 3.41  ? 144 GLN B HA   1  
ATOM 4588   H HB2  . GLN B 1 144 ? -10.561 -33.755 -19.267 1.00 11.21 ? 144 GLN B HB2  1  
ATOM 4589   H HB3  . GLN B 1 144 ? -11.275 -32.228 -19.768 1.00 24.34 ? 144 GLN B HB3  1  
ATOM 4590   H HG2  . GLN B 1 144 ? -13.148 -33.515 -20.829 1.00 75.25 ? 144 GLN B HG2  1  
ATOM 4591   H HG3  . GLN B 1 144 ? -12.470 -34.988 -20.149 1.00 4.12  ? 144 GLN B HG3  1  
ATOM 4592   H HE21 . GLN B 1 144 ? -14.107 -31.989 -19.431 1.00 73.22 ? 144 GLN B HE21 1  
ATOM 4593   H HE22 . GLN B 1 144 ? -14.607 -32.421 -17.837 1.00 53.34 ? 144 GLN B HE22 1  
ATOM 4594   N N    . ALA B 1 145 ? -8.840  -35.189 -21.841 1.00 73.25 ? 145 ALA B N    1  
ATOM 4595   C CA   . ALA B 1 145 ? -8.380  -36.544 -22.201 1.00 1.13  ? 145 ALA B CA   1  
ATOM 4596   C C    . ALA B 1 145 ? -7.093  -36.871 -21.430 1.00 32.31 ? 145 ALA B C    1  
ATOM 4597   O O    . ALA B 1 145 ? -6.276  -35.978 -21.172 1.00 34.33 ? 145 ALA B O    1  
ATOM 4598   C CB   . ALA B 1 145 ? -8.160  -36.664 -23.724 1.00 53.02 ? 145 ALA B CB   1  
ATOM 4599   H H    . ALA B 1 145 ? -8.161  -34.517 -21.611 1.00 24.02 ? 145 ALA B H    1  
ATOM 4600   H HA   . ALA B 1 145 ? -9.152  -37.258 -21.911 1.00 10.43 ? 145 ALA B HA   1  
ATOM 4601   H HB1  . ALA B 1 145 ? -7.849  -37.672 -23.975 1.00 64.01 ? 145 ALA B HB1  1  
ATOM 4602   H HB2  . ALA B 1 145 ? -7.396  -35.966 -24.042 1.00 13.32 ? 145 ALA B HB2  1  
ATOM 4603   H HB3  . ALA B 1 145 ? -9.083  -36.439 -24.242 1.00 74.40 ? 145 ALA B HB3  1  
ATOM 4604   N N    . GLY B 1 146 ? -6.932  -38.150 -21.063 1.00 55.33 ? 146 GLY B N    1  
ATOM 4605   C CA   . GLY B 1 146 ? -5.748  -38.632 -20.352 1.00 60.14 ? 146 GLY B CA   1  
ATOM 4606   C C    . GLY B 1 146 ? -5.331  -40.011 -20.828 1.00 3.02  ? 146 GLY B C    1  
ATOM 4607   O O    . GLY B 1 146 ? -5.784  -40.466 -21.883 1.00 1.24  ? 146 GLY B O    1  
ATOM 4608   H H    . GLY B 1 146 ? -7.640  -38.791 -21.281 1.00 33.42 ? 146 GLY B H    1  
ATOM 4609   H HA2  . GLY B 1 146 ? -4.918  -37.951 -20.510 1.00 22.05 ? 146 GLY B HA2  1  
ATOM 4610   H HA3  . GLY B 1 146 ? -5.969  -38.670 -19.292 1.00 40.53 ? 146 GLY B HA3  1  
ATOM 4611   N N    . GLU B 1 147 ? -4.471  -40.682 -20.056 1.00 35.43 ? 147 GLU B N    1  
ATOM 4612   C CA   . GLU B 1 147 ? -4.030  -42.060 -20.336 1.00 3.41  ? 147 GLU B CA   1  
ATOM 4613   C C    . GLU B 1 147 ? -4.176  -42.918 -19.066 1.00 42.21 ? 147 GLU B C    1  
ATOM 4614   O O    . GLU B 1 147 ? -4.823  -42.489 -18.098 1.00 65.13 ? 147 GLU B O    1  
ATOM 4615   C CB   . GLU B 1 147 ? -2.577  -42.047 -20.928 1.00 41.15 ? 147 GLU B CB   1  
ATOM 4616   C CG   . GLU B 1 147 ? -1.530  -41.179 -20.178 1.00 22.11 ? 147 GLU B CG   1  
ATOM 4617   C CD   . GLU B 1 147 ? -1.164  -41.703 -18.781 1.00 3.11  ? 147 GLU B CD   1  
ATOM 4618   O OE1  . GLU B 1 147 ? -1.528  -41.067 -17.770 1.00 4.24  ? 147 GLU B OE1  1  
ATOM 4619   O OE2  . GLU B 1 147 ? -0.528  -42.777 -18.693 1.00 0.41  ? 147 GLU B OE2  1  
ATOM 4620   H H    . GLU B 1 147 ? -4.120  -40.242 -19.251 1.00 13.53 ? 147 GLU B H    1  
ATOM 4621   H HA   . GLU B 1 147 ? -4.701  -42.487 -21.082 1.00 34.11 ? 147 GLU B HA   1  
ATOM 4622   H HB2  . GLU B 1 147 ? -2.204  -43.066 -20.953 1.00 15.14 ? 147 GLU B HB2  1  
ATOM 4623   H HB3  . GLU B 1 147 ? -2.634  -41.687 -21.952 1.00 73.15 ? 147 GLU B HB3  1  
ATOM 4624   H HG2  . GLU B 1 147 ? -0.623  -41.140 -20.773 1.00 23.45 ? 147 GLU B HG2  1  
ATOM 4625   H HG3  . GLU B 1 147 ? -1.922  -40.169 -20.090 1.00 73.20 ? 147 GLU B HG3  1  
ATOM 4626   N N    . GLY B 1 148 ? -3.590  -44.125 -19.078 1.00 13.33 ? 148 GLY B N    1  
ATOM 4627   C CA   . GLY B 1 148 ? -3.700  -45.044 -17.947 1.00 51.20 ? 148 GLY B CA   1  
ATOM 4628   C C    . GLY B 1 148 ? -2.579  -46.061 -17.915 1.00 71.22 ? 148 GLY B C    1  
ATOM 4629   O O    . GLY B 1 148 ? -2.100  -46.490 -18.968 1.00 40.43 ? 148 GLY B O    1  
ATOM 4630   H H    . GLY B 1 148 ? -3.054  -44.385 -19.855 1.00 71.03 ? 148 GLY B H    1  
ATOM 4631   H HA2  . GLY B 1 148 ? -3.688  -44.477 -17.020 1.00 65.42 ? 148 GLY B HA2  1  
ATOM 4632   H HA3  . GLY B 1 148 ? -4.644  -45.570 -18.018 1.00 75.31 ? 148 GLY B HA3  1  
ATOM 4633   N N    . THR B 1 149 ? -2.154  -46.442 -16.702 1.00 51.10 ? 149 THR B N    1  
ATOM 4634   C CA   . THR B 1 149 ? -1.120  -47.464 -16.492 1.00 73.31 ? 149 THR B CA   1  
ATOM 4635   C C    . THR B 1 149 ? -1.650  -48.853 -16.925 1.00 13.12 ? 149 THR B C    1  
ATOM 4636   O O    . THR B 1 149 ? -2.794  -49.205 -16.624 1.00 52.54 ? 149 THR B O    1  
ATOM 4637   C CB   . THR B 1 149 ? -0.675  -47.493 -14.996 1.00 10.22 ? 149 THR B CB   1  
ATOM 4638   O OG1  . THR B 1 149 ? -0.367  -46.154 -14.566 1.00 63.21 ? 149 THR B OG1  1  
ATOM 4639   C CG2  . THR B 1 149 ? 0.550   -48.408 -14.770 1.00 51.34 ? 149 THR B CG2  1  
ATOM 4640   H H    . THR B 1 149 ? -2.552  -46.016 -15.911 1.00 2.03  ? 149 THR B H    1  
ATOM 4641   H HA   . THR B 1 149 ? -0.258  -47.197 -17.104 1.00 42.31 ? 149 THR B HA   1  
ATOM 4642   H HB   . THR B 1 149 ? -1.502  -47.860 -14.395 1.00 62.44 ? 149 THR B HB   1  
ATOM 4643   H HG1  . THR B 1 149 ? 0.584   -46.015 -14.597 1.00 25.21 ? 149 THR B HG1  1  
ATOM 4644   H HG21 . THR B 1 149 ? 0.314   -49.418 -15.083 1.00 60.14 ? 149 THR B HG21 1  
ATOM 4645   H HG22 . THR B 1 149 ? 0.811   -48.416 -13.720 1.00 43.14 ? 149 THR B HG22 1  
ATOM 4646   H HG23 . THR B 1 149 ? 1.392   -48.043 -15.344 1.00 72.41 ? 149 THR B HG23 1  
ATOM 4647   N N    . GLU B 1 150 ? -0.812  -49.618 -17.641 1.00 52.55 ? 150 GLU B N    1  
ATOM 4648   C CA   . GLU B 1 150 ? -1.181  -50.925 -18.227 1.00 65.32 ? 150 GLU B CA   1  
ATOM 4649   C C    . GLU B 1 150 ? -0.257  -52.032 -17.675 1.00 1.24  ? 150 GLU B C    1  
ATOM 4650   O O    . GLU B 1 150 ? 0.950   -51.811 -17.516 1.00 53.11 ? 150 GLU B O    1  
ATOM 4651   C CB   . GLU B 1 150 ? -1.079  -50.831 -19.775 1.00 71.42 ? 150 GLU B CB   1  
ATOM 4652   C CG   . GLU B 1 150 ? -2.030  -49.786 -20.399 1.00 62.43 ? 150 GLU B CG   1  
ATOM 4653   C CD   . GLU B 1 150 ? -1.808  -49.554 -21.903 1.00 13.35 ? 150 GLU B CD   1  
ATOM 4654   O OE1  . GLU B 1 150 ? -1.195  -48.535 -22.281 1.00 21.22 ? 150 GLU B OE1  1  
ATOM 4655   O OE2  . GLU B 1 150 ? -2.256  -50.383 -22.716 1.00 44.14 ? 150 GLU B OE2  1  
ATOM 4656   H H    . GLU B 1 150 ? 0.105   -49.300 -17.772 1.00 14.20 ? 150 GLU B H    1  
ATOM 4657   H HA   . GLU B 1 150 ? -2.210  -51.154 -17.952 1.00 11.11 ? 150 GLU B HA   1  
ATOM 4658   H HB2  . GLU B 1 150 ? -0.060  -50.568 -20.040 1.00 60.50 ? 150 GLU B HB2  1  
ATOM 4659   H HB3  . GLU B 1 150 ? -1.309  -51.802 -20.203 1.00 5.15  ? 150 GLU B HB3  1  
ATOM 4660   H HG2  . GLU B 1 150 ? -3.054  -50.116 -20.248 1.00 62.35 ? 150 GLU B HG2  1  
ATOM 4661   H HG3  . GLU B 1 150 ? -1.896  -48.845 -19.876 1.00 45.45 ? 150 GLU B HG3  1  
ATOM 4662   N N    . GLU B 1 151 ? -0.837  -53.219 -17.397 1.00 35.51 ? 151 GLU B N    1  
ATOM 4663   C CA   . GLU B 1 151 ? -0.118  -54.363 -16.788 1.00 31.11 ? 151 GLU B CA   1  
ATOM 4664   C C    . GLU B 1 151 ? -0.609  -55.698 -17.392 1.00 74.24 ? 151 GLU B C    1  
ATOM 4665   O O    . GLU B 1 151 ? -1.576  -55.729 -18.161 1.00 54.33 ? 151 GLU B O    1  
ATOM 4666   C CB   . GLU B 1 151 ? -0.327  -54.352 -15.245 1.00 63.14 ? 151 GLU B CB   1  
ATOM 4667   C CG   . GLU B 1 151 ? -1.800  -54.509 -14.793 1.00 24.12 ? 151 GLU B CG   1  
ATOM 4668   C CD   . GLU B 1 151 ? -1.976  -54.488 -13.265 1.00 5.15  ? 151 GLU B CD   1  
ATOM 4669   O OE1  . GLU B 1 151 ? -2.067  -55.568 -12.647 1.00 2.44  ? 151 GLU B OE1  1  
ATOM 4670   O OE2  . GLU B 1 151 ? -2.014  -53.388 -12.679 1.00 1.03  ? 151 GLU B OE2  1  
ATOM 4671   H H    . GLU B 1 151 ? -1.787  -53.334 -17.608 1.00 25.42 ? 151 GLU B H    1  
ATOM 4672   H HA   . GLU B 1 151 ? 0.942   -54.261 -17.006 1.00 74.22 ? 151 GLU B HA   1  
ATOM 4673   H HB2  . GLU B 1 151 ? 0.254   -55.156 -14.806 1.00 71.34 ? 151 GLU B HB2  1  
ATOM 4674   H HB3  . GLU B 1 151 ? 0.046   -53.409 -14.856 1.00 32.30 ? 151 GLU B HB3  1  
ATOM 4675   H HG2  . GLU B 1 151 ? -2.384  -53.699 -15.220 1.00 4.21  ? 151 GLU B HG2  1  
ATOM 4676   H HG3  . GLU B 1 151 ? -2.181  -55.449 -15.179 1.00 52.31 ? 151 GLU B HG3  1  
ATOM 4677   N N    . HIS B 1 152 ? 0.077   -56.793 -17.039 1.00 51.31 ? 152 HIS B N    1  
ATOM 4678   C CA   . HIS B 1 152 ? -0.304  -58.160 -17.439 1.00 61.22 ? 152 HIS B CA   1  
ATOM 4679   C C    . HIS B 1 152 ? 0.246   -59.157 -16.408 1.00 65.34 ? 152 HIS B C    1  
ATOM 4680   O O    . HIS B 1 152 ? 1.365   -58.980 -15.904 1.00 72.41 ? 152 HIS B O    1  
ATOM 4681   C CB   . HIS B 1 152 ? 0.205   -58.508 -18.871 1.00 5.43  ? 152 HIS B CB   1  
ATOM 4682   C CG   . HIS B 1 152 ? 1.706   -58.534 -19.030 1.00 50.34 ? 152 HIS B CG   1  
ATOM 4683   N ND1  . HIS B 1 152 ? 2.425   -59.701 -19.174 1.00 53.12 ? 152 HIS B ND1  1  
ATOM 4684   C CD2  . HIS B 1 152 ? 2.615   -57.530 -19.103 1.00 53.11 ? 152 HIS B CD2  1  
ATOM 4685   C CE1  . HIS B 1 152 ? 3.703   -59.415 -19.320 1.00 34.53 ? 152 HIS B CE1  1  
ATOM 4686   N NE2  . HIS B 1 152 ? 3.846   -58.106 -19.284 1.00 51.12 ? 152 HIS B NE2  1  
ATOM 4687   H H    . HIS B 1 152 ? 0.876   -56.682 -16.478 1.00 24.55 ? 152 HIS B H    1  
ATOM 4688   H HA   . HIS B 1 152 ? -1.392  -58.215 -17.431 1.00 13.04 ? 152 HIS B HA   1  
ATOM 4689   H HB2  . HIS B 1 152 ? -0.169  -59.486 -19.155 1.00 1.04  ? 152 HIS B HB2  1  
ATOM 4690   H HB3  . HIS B 1 152 ? -0.188  -57.775 -19.568 1.00 13.23 ? 152 HIS B HB3  1  
ATOM 4691   H HD1  . HIS B 1 152 ? 2.053   -60.610 -19.162 1.00 13.14 ? 152 HIS B HD1  1  
ATOM 4692   H HD2  . HIS B 1 152 ? 2.408   -56.469 -19.033 1.00 50.41 ? 152 HIS B HD2  1  
ATOM 4693   H HE1  . HIS B 1 152 ? 4.497   -60.132 -19.451 1.00 34.50 ? 152 HIS B HE1  1  
ATOM 4694   H HE2  . HIS B 1 152 ? 4.704   -57.647 -19.152 1.00 37.61 ? 152 HIS B HE2  1  
ATOM 4695   N N    . GLN B 1 153 ? -0.557  -60.182 -16.085 1.00 12.21 ? 153 GLN B N    1  
ATOM 4696   C CA   . GLN B 1 153 ? -0.185  -61.248 -15.137 1.00 42.02 ? 153 GLN B CA   1  
ATOM 4697   C C    . GLN B 1 153 ? -0.990  -62.515 -15.467 1.00 11.23 ? 153 GLN B C    1  
ATOM 4698   O O    . GLN B 1 153 ? -2.219  -62.454 -15.621 1.00 31.24 ? 153 GLN B O    1  
ATOM 4699   C CB   . GLN B 1 153 ? -0.458  -60.804 -13.672 1.00 33.01 ? 153 GLN B CB   1  
ATOM 4700   C CG   . GLN B 1 153 ? -0.004  -61.793 -12.582 1.00 42.34 ? 153 GLN B CG   1  
ATOM 4701   C CD   . GLN B 1 153 ? -0.455  -61.358 -11.184 1.00 2.20  ? 153 GLN B CD   1  
ATOM 4702   O OE1  . GLN B 1 153 ? 0.246   -60.632 -10.478 1.00 32.35 ? 153 GLN B OE1  1  
ATOM 4703   N NE2  . GLN B 1 153 ? -1.645  -61.779 -10.787 1.00 24.42 ? 153 GLN B NE2  1  
ATOM 4704   H H    . GLN B 1 153 ? -1.447  -60.224 -16.498 1.00 65.02 ? 153 GLN B H    1  
ATOM 4705   H HA   . GLN B 1 153 ? 0.877   -61.454 -15.257 1.00 21.23 ? 153 GLN B HA   1  
ATOM 4706   H HB2  . GLN B 1 153 ? 0.051   -59.863 -13.502 1.00 70.32 ? 153 GLN B HB2  1  
ATOM 4707   H HB3  . GLN B 1 153 ? -1.526  -60.635 -13.557 1.00 44.25 ? 153 GLN B HB3  1  
ATOM 4708   H HG2  . GLN B 1 153 ? -0.418  -62.772 -12.801 1.00 34.25 ? 153 GLN B HG2  1  
ATOM 4709   H HG3  . GLN B 1 153 ? 1.078   -61.857 -12.594 1.00 20.14 ? 153 GLN B HG3  1  
ATOM 4710   H HE21 . GLN B 1 153 ? -2.168  -62.333 -11.400 1.00 53.54 ? 153 GLN B HE21 1  
ATOM 4711   H HE22 . GLN B 1 153 ? -1.955  -61.518 -9.896  1.00 34.41 ? 153 GLN B HE22 1  
ATOM 4712   N N    . ASP B 1 154 ? -0.286  -63.646 -15.588 1.00 12.11 ? 154 ASP B N    1  
ATOM 4713   C CA   . ASP B 1 154 ? -0.881  -64.967 -15.839 1.00 35.15 ? 154 ASP B CA   1  
ATOM 4714   C C    . ASP B 1 154 ? -0.387  -65.946 -14.762 1.00 73.11 ? 154 ASP B C    1  
ATOM 4715   O O    . ASP B 1 154 ? 0.805   -66.274 -14.715 1.00 2.03  ? 154 ASP B O    1  
ATOM 4716   C CB   . ASP B 1 154 ? -0.503  -65.470 -17.261 1.00 42.22 ? 154 ASP B CB   1  
ATOM 4717   C CG   . ASP B 1 154 ? -1.006  -66.898 -17.550 1.00 24.22 ? 154 ASP B CG   1  
ATOM 4718   O OD1  . ASP B 1 154 ? -0.199  -67.858 -17.494 1.00 73.53 ? 154 ASP B OD1  1  
ATOM 4719   O OD2  . ASP B 1 154 ? -2.213  -67.073 -17.818 1.00 14.33 ? 154 ASP B OD2  1  
ATOM 4720   H H    . ASP B 1 154 ? 0.689   -63.594 -15.504 1.00 52.24 ? 154 ASP B H    1  
ATOM 4721   H HA   . ASP B 1 154 ? -1.968  -64.881 -15.771 1.00 34.43 ? 154 ASP B HA   1  
ATOM 4722   H HB2  . ASP B 1 154 ? -0.935  -64.798 -17.996 1.00 72.02 ? 154 ASP B HB2  1  
ATOM 4723   H HB3  . ASP B 1 154 ? 0.579   -65.445 -17.373 1.00 12.52 ? 154 ASP B HB3  1  
ATOM 4724   N N    . ALA B 1 155 ? -1.299  -66.362 -13.872 1.00 63.24 ? 155 ALA B N    1  
ATOM 4725   C CA   . ALA B 1 155 ? -1.015  -67.350 -12.816 1.00 34.04 ? 155 ALA B CA   1  
ATOM 4726   C C    . ALA B 1 155 ? -1.290  -68.774 -13.352 1.00 22.55 ? 155 ALA B C    1  
ATOM 4727   O O    . ALA B 1 155 ? -0.348  -69.585 -13.454 1.00 53.02 ? 155 ALA B O    1  
ATOM 4728   C CB   . ALA B 1 155 ? -1.860  -67.059 -11.561 1.00 23.24 ? 155 ALA B CB   1  
ATOM 4729   O OXT  . ALA B 1 155 ? -2.453  -69.063 -13.702 1.00 37.61 ? 155 ALA B OXT  1  
ATOM 4730   H H    . ALA B 1 155 ? -2.206  -65.998 -13.932 1.00 65.15 ? 155 ALA B H    1  
ATOM 4731   H HA   . ALA B 1 155 ? 0.038   -67.261 -12.541 1.00 13.02 ? 155 ALA B HA   1  
ATOM 4732   H HB1  . ALA B 1 155 ? -1.607  -67.763 -10.777 1.00 14.43 ? 155 ALA B HB1  1  
ATOM 4733   H HB2  . ALA B 1 155 ? -2.912  -67.156 -11.797 1.00 50.12 ? 155 ALA B HB2  1  
ATOM 4734   H HB3  . ALA B 1 155 ? -1.666  -66.052 -11.215 1.00 13.45 ? 155 ALA B HB3  1  
ATOM 4735   N N    . MET C 1 1   ? 3.206   19.144  30.653  1.00 34.30 ? 1   MET C N    1  
ATOM 4736   C CA   . MET C 1 1   ? 2.220   19.431  29.585  1.00 53.21 ? 1   MET C CA   1  
ATOM 4737   C C    . MET C 1 1   ? 1.230   20.486  30.110  1.00 3.25  ? 1   MET C C    1  
ATOM 4738   O O    . MET C 1 1   ? 0.243   20.155  30.785  1.00 3.55  ? 1   MET C O    1  
ATOM 4739   C CB   . MET C 1 1   ? 1.511   18.125  29.113  1.00 35.14 ? 1   MET C CB   1  
ATOM 4740   C CG   . MET C 1 1   ? 0.607   18.273  27.865  1.00 0.20  ? 1   MET C CG   1  
ATOM 4741   S SD   . MET C 1 1   ? -0.981  19.087  28.192  1.00 24.33 ? 1   MET C SD   1  
ATOM 4742   C CE   . MET C 1 1   ? -1.796  17.909  29.278  1.00 41.42 ? 1   MET C CE   1  
ATOM 4743   H H1   . MET C 1 1   ? 2.720   18.778  31.494  1.00 37.61 ? 1   MET C H1   1  
ATOM 4744   H H2   . MET C 1 1   ? 3.715   20.017  30.916  1.00 37.61 ? 1   MET C H2   1  
ATOM 4745   H H3   . MET C 1 1   ? 3.895   18.437  30.333  1.00 37.61 ? 1   MET C H3   1  
ATOM 4746   H HA   . MET C 1 1   ? 2.769   19.854  28.747  1.00 34.11 ? 1   MET C HA   1  
ATOM 4747   H HB2  . MET C 1 1   ? 2.269   17.381  28.892  1.00 21.03 ? 1   MET C HB2  1  
ATOM 4748   H HB3  . MET C 1 1   ? 0.899   17.750  29.926  1.00 42.31 ? 1   MET C HB3  1  
ATOM 4749   H HG2  . MET C 1 1   ? 1.135   18.859  27.123  1.00 60.12 ? 1   MET C HG2  1  
ATOM 4750   H HG3  . MET C 1 1   ? 0.410   17.289  27.454  1.00 24.13 ? 1   MET C HG3  1  
ATOM 4751   H HE1  . MET C 1 1   ? -2.779  18.277  29.532  1.00 1.20  ? 1   MET C HE1  1  
ATOM 4752   H HE2  . MET C 1 1   ? -1.215  17.787  30.180  1.00 70.41 ? 1   MET C HE2  1  
ATOM 4753   H HE3  . MET C 1 1   ? -1.888  16.956  28.776  1.00 72.01 ? 1   MET C HE3  1  
ATOM 4754   N N    . SER C 1 2   ? 1.587   21.752  29.859  1.00 24.12 ? 2   SER C N    1  
ATOM 4755   C CA   . SER C 1 2   ? 0.832   22.965  30.261  1.00 61.34 ? 2   SER C CA   1  
ATOM 4756   C C    . SER C 1 2   ? 1.464   24.218  29.598  1.00 45.34 ? 2   SER C C    1  
ATOM 4757   O O    . SER C 1 2   ? 1.079   25.361  29.891  1.00 41.14 ? 2   SER C O    1  
ATOM 4758   C CB   . SER C 1 2   ? 0.843   23.105  31.808  1.00 72.30 ? 2   SER C CB   1  
ATOM 4759   O OG   . SER C 1 2   ? 2.165   22.992  32.328  1.00 23.44 ? 2   SER C OG   1  
ATOM 4760   H H    . SER C 1 2   ? 2.433   21.889  29.386  1.00 5.44  ? 2   SER C H    1  
ATOM 4761   H HA   . SER C 1 2   ? -0.192  22.864  29.909  1.00 0.44  ? 2   SER C HA   1  
ATOM 4762   H HB2  . SER C 1 2   ? 0.437   24.065  32.096  1.00 41.22 ? 2   SER C HB2  1  
ATOM 4763   H HB3  . SER C 1 2   ? 0.237   22.319  32.245  1.00 62.21 ? 2   SER C HB3  1  
ATOM 4764   H HG   . SER C 1 2   ? 2.811   23.042  31.611  1.00 14.23 ? 2   SER C HG   1  
ATOM 4765   N N    . GLU C 1 3   ? 2.411   23.972  28.665  1.00 25.54 ? 3   GLU C N    1  
ATOM 4766   C CA   . GLU C 1 3   ? 3.285   25.000  28.078  1.00 62.01 ? 3   GLU C CA   1  
ATOM 4767   C C    . GLU C 1 3   ? 2.534   25.755  26.971  1.00 43.54 ? 3   GLU C C    1  
ATOM 4768   O O    . GLU C 1 3   ? 1.658   25.189  26.305  1.00 4.22  ? 3   GLU C O    1  
ATOM 4769   C CB   . GLU C 1 3   ? 4.597   24.364  27.501  1.00 30.21 ? 3   GLU C CB   1  
ATOM 4770   C CG   . GLU C 1 3   ? 5.497   23.599  28.515  1.00 64.43 ? 3   GLU C CG   1  
ATOM 4771   C CD   . GLU C 1 3   ? 4.866   22.305  29.064  1.00 64.44 ? 3   GLU C CD   1  
ATOM 4772   O OE1  . GLU C 1 3   ? 4.721   21.330  28.296  1.00 61.42 ? 3   GLU C OE1  1  
ATOM 4773   O OE2  . GLU C 1 3   ? 4.471   22.262  30.248  1.00 71.10 ? 3   GLU C OE2  1  
ATOM 4774   H H    . GLU C 1 3   ? 2.507   23.058  28.337  1.00 34.33 ? 3   GLU C H    1  
ATOM 4775   H HA   . GLU C 1 3   ? 3.555   25.703  28.862  1.00 35.31 ? 3   GLU C HA   1  
ATOM 4776   H HB2  . GLU C 1 3   ? 4.328   23.666  26.714  1.00 55.42 ? 3   GLU C HB2  1  
ATOM 4777   H HB3  . GLU C 1 3   ? 5.197   25.156  27.059  1.00 40.40 ? 3   GLU C HB3  1  
ATOM 4778   H HG2  . GLU C 1 3   ? 6.431   23.337  28.022  1.00 22.44 ? 3   GLU C HG2  1  
ATOM 4779   H HG3  . GLU C 1 3   ? 5.725   24.263  29.343  1.00 64.51 ? 3   GLU C HG3  1  
ATOM 4780   N N    . GLN C 1 4   ? 2.897   27.030  26.791  1.00 34.14 ? 4   GLN C N    1  
ATOM 4781   C CA   . GLN C 1 4   ? 2.298   27.923  25.788  1.00 70.14 ? 4   GLN C CA   1  
ATOM 4782   C C    . GLN C 1 4   ? 3.090   27.782  24.474  1.00 40.13 ? 4   GLN C C    1  
ATOM 4783   O O    . GLN C 1 4   ? 2.572   27.229  23.498  1.00 22.31 ? 4   GLN C O    1  
ATOM 4784   C CB   . GLN C 1 4   ? 2.289   29.398  26.301  1.00 62.23 ? 4   GLN C CB   1  
ATOM 4785   C CG   . GLN C 1 4   ? 1.527   29.630  27.635  1.00 31.23 ? 4   GLN C CG   1  
ATOM 4786   C CD   . GLN C 1 4   ? 2.246   29.091  28.885  1.00 40.41 ? 4   GLN C CD   1  
ATOM 4787   O OE1  . GLN C 1 4   ? 3.477   29.057  28.947  1.00 62.05 ? 4   GLN C OE1  1  
ATOM 4788   N NE2  . GLN C 1 4   ? 1.487   28.631  29.868  1.00 1.05  ? 4   GLN C NE2  1  
ATOM 4789   H H    . GLN C 1 4   ? 3.609   27.389  27.359  1.00 31.40 ? 4   GLN C H    1  
ATOM 4790   H HA   . GLN C 1 4   ? 1.266   27.607  25.617  1.00 35.22 ? 4   GLN C HA   1  
ATOM 4791   H HB2  . GLN C 1 4   ? 3.314   29.727  26.437  1.00 53.51 ? 4   GLN C HB2  1  
ATOM 4792   H HB3  . GLN C 1 4   ? 1.830   30.025  25.541  1.00 64.23 ? 4   GLN C HB3  1  
ATOM 4793   H HG2  . GLN C 1 4   ? 1.382   30.695  27.774  1.00 22.13 ? 4   GLN C HG2  1  
ATOM 4794   H HG3  . GLN C 1 4   ? 0.556   29.154  27.559  1.00 1.35  ? 4   GLN C HG3  1  
ATOM 4795   H HE21 . GLN C 1 4   ? 0.517   28.662  29.757  1.00 45.51 ? 4   GLN C HE21 1  
ATOM 4796   H HE22 . GLN C 1 4   ? 1.930   28.279  30.666  1.00 11.05 ? 4   GLN C HE22 1  
ATOM 4797   N N    . ASN C 1 5   ? 4.356   28.272  24.503  1.00 45.13 ? 5   ASN C N    1  
ATOM 4798   C CA   . ASN C 1 5   ? 5.365   28.127  23.417  1.00 2.23  ? 5   ASN C CA   1  
ATOM 4799   C C    . ASN C 1 5   ? 4.952   28.843  22.105  1.00 75.11 ? 5   ASN C C    1  
ATOM 4800   O O    . ASN C 1 5   ? 3.780   28.848  21.728  1.00 2.41  ? 5   ASN C O    1  
ATOM 4801   C CB   . ASN C 1 5   ? 5.678   26.624  23.141  1.00 11.43 ? 5   ASN C CB   1  
ATOM 4802   C CG   . ASN C 1 5   ? 6.843   26.405  22.162  1.00 64.21 ? 5   ASN C CG   1  
ATOM 4803   O OD1  . ASN C 1 5   ? 7.822   27.152  22.163  1.00 4.33  ? 5   ASN C OD1  1  
ATOM 4804   N ND2  . ASN C 1 5   ? 6.730   25.402  21.305  1.00 24.44 ? 5   ASN C ND2  1  
ATOM 4805   H H    . ASN C 1 5   ? 4.631   28.766  25.300  1.00 42.13 ? 5   ASN C H    1  
ATOM 4806   H HA   . ASN C 1 5   ? 6.270   28.599  23.788  1.00 33.53 ? 5   ASN C HA   1  
ATOM 4807   H HB2  . ASN C 1 5   ? 5.935   26.141  24.071  1.00 15.13 ? 5   ASN C HB2  1  
ATOM 4808   H HB3  . ASN C 1 5   ? 4.788   26.151  22.737  1.00 3.42  ? 5   ASN C HB3  1  
ATOM 4809   H HD21 . ASN C 1 5   ? 5.920   24.855  21.337  1.00 10.13 ? 5   ASN C HD21 1  
ATOM 4810   H HD22 . ASN C 1 5   ? 7.455   25.266  20.664  1.00 41.31 ? 5   ASN C HD22 1  
ATOM 4811   N N    . ASN C 1 6   ? 5.936   29.417  21.394  1.00 34.33 ? 6   ASN C N    1  
ATOM 4812   C CA   . ASN C 1 6   ? 5.711   30.045  20.079  1.00 40.12 ? 6   ASN C CA   1  
ATOM 4813   C C    . ASN C 1 6   ? 5.694   28.963  18.980  1.00 11.35 ? 6   ASN C C    1  
ATOM 4814   O O    . ASN C 1 6   ? 6.200   27.850  19.181  1.00 45.23 ? 6   ASN C O    1  
ATOM 4815   C CB   . ASN C 1 6   ? 6.804   31.111  19.769  1.00 22.34 ? 6   ASN C CB   1  
ATOM 4816   C CG   . ASN C 1 6   ? 8.226   30.537  19.595  1.00 15.42 ? 6   ASN C CG   1  
ATOM 4817   O OD1  . ASN C 1 6   ? 8.634   29.610  20.292  1.00 31.41 ? 6   ASN C OD1  1  
ATOM 4818   N ND2  . ASN C 1 6   ? 8.977   31.073  18.643  1.00 43.15 ? 6   ASN C ND2  1  
ATOM 4819   H H    . ASN C 1 6   ? 6.851   29.384  21.743  1.00 14.33 ? 6   ASN C H    1  
ATOM 4820   H HA   . ASN C 1 6   ? 4.736   30.535  20.098  1.00 42.15 ? 6   ASN C HA   1  
ATOM 4821   H HB2  . ASN C 1 6   ? 6.534   31.641  18.863  1.00 25.41 ? 6   ASN C HB2  1  
ATOM 4822   H HB3  . ASN C 1 6   ? 6.831   31.824  20.585  1.00 20.42 ? 6   ASN C HB3  1  
ATOM 4823   H HD21 . ASN C 1 6   ? 8.597   31.796  18.104  1.00 62.30 ? 6   ASN C HD21 1  
ATOM 4824   H HD22 . ASN C 1 6   ? 9.883   30.721  18.517  1.00 61.44 ? 6   ASN C HD22 1  
ATOM 4825   N N    . THR C 1 7   ? 5.095   29.293  17.830  1.00 63.44 ? 7   THR C N    1  
ATOM 4826   C CA   . THR C 1 7   ? 5.119   28.427  16.647  1.00 11.32 ? 7   THR C CA   1  
ATOM 4827   C C    . THR C 1 7   ? 6.245   28.899  15.710  1.00 24.24 ? 7   THR C C    1  
ATOM 4828   O O    . THR C 1 7   ? 7.313   28.276  15.651  1.00 63.32 ? 7   THR C O    1  
ATOM 4829   C CB   . THR C 1 7   ? 3.736   28.430  15.904  1.00 42.01 ? 7   THR C CB   1  
ATOM 4830   O OG1  . THR C 1 7   ? 2.698   28.125  16.841  1.00 43.31 ? 7   THR C OG1  1  
ATOM 4831   C CG2  . THR C 1 7   ? 3.686   27.409  14.746  1.00 21.21 ? 7   THR C CG2  1  
ATOM 4832   H H    . THR C 1 7   ? 4.634   30.152  17.771  1.00 13.22 ? 7   THR C H    1  
ATOM 4833   H HA   . THR C 1 7   ? 5.326   27.403  16.967  1.00 72.41 ? 7   THR C HA   1  
ATOM 4834   H HB   . THR C 1 7   ? 3.558   29.421  15.503  1.00 61.32 ? 7   THR C HB   1  
ATOM 4835   H HG1  . THR C 1 7   ? 3.037   27.507  17.497  1.00 33.31 ? 7   THR C HG1  1  
ATOM 4836   H HG21 . THR C 1 7   ? 4.452   27.645  14.016  1.00 0.54  ? 7   THR C HG21 1  
ATOM 4837   H HG22 . THR C 1 7   ? 2.717   27.449  14.267  1.00 71.32 ? 7   THR C HG22 1  
ATOM 4838   H HG23 . THR C 1 7   ? 3.852   26.412  15.129  1.00 42.02 ? 7   THR C HG23 1  
ATOM 4839   N N    . GLU C 1 8   ? 6.005   30.061  15.060  1.00 33.45 ? 8   GLU C N    1  
ATOM 4840   C CA   . GLU C 1 8   ? 6.841   30.610  13.985  1.00 3.23  ? 8   GLU C CA   1  
ATOM 4841   C C    . GLU C 1 8   ? 7.133   29.536  12.911  1.00 12.21 ? 8   GLU C C    1  
ATOM 4842   O O    . GLU C 1 8   ? 6.299   29.348  12.018  1.00 3.35  ? 8   GLU C O    1  
ATOM 4843   C CB   . GLU C 1 8   ? 8.124   31.289  14.547  1.00 21.53 ? 8   GLU C CB   1  
ATOM 4844   C CG   . GLU C 1 8   ? 8.936   32.084  13.501  1.00 62.04 ? 8   GLU C CG   1  
ATOM 4845   C CD   . GLU C 1 8   ? 10.040  32.946  14.135  1.00 41.34 ? 8   GLU C CD   1  
ATOM 4846   O OE1  . GLU C 1 8   ? 9.707   33.995  14.737  1.00 32.14 ? 8   GLU C OE1  1  
ATOM 4847   O OE2  . GLU C 1 8   ? 11.232  32.579  14.053  1.00 0.35  ? 8   GLU C OE2  1  
ATOM 4848   H H    . GLU C 1 8   ? 5.227   30.587  15.335  1.00 54.22 ? 8   GLU C H    1  
ATOM 4849   H HA   . GLU C 1 8   ? 6.239   31.379  13.515  1.00 35.32 ? 8   GLU C HA   1  
ATOM 4850   H HB2  . GLU C 1 8   ? 7.834   31.969  15.343  1.00 31.12 ? 8   GLU C HB2  1  
ATOM 4851   H HB3  . GLU C 1 8   ? 8.766   30.520  14.968  1.00 34.34 ? 8   GLU C HB3  1  
ATOM 4852   H HG2  . GLU C 1 8   ? 9.383   31.382  12.802  1.00 15.45 ? 8   GLU C HG2  1  
ATOM 4853   H HG3  . GLU C 1 8   ? 8.258   32.733  12.951  1.00 74.53 ? 8   GLU C HG3  1  
ATOM 4854   N N    . MET C 1 9   ? 8.284   28.827  13.070  1.00 53.13 ? 9   MET C N    1  
ATOM 4855   C CA   . MET C 1 9   ? 8.744   27.673  12.253  1.00 33.22 ? 9   MET C CA   1  
ATOM 4856   C C    . MET C 1 9   ? 8.341   27.724  10.751  1.00 3.33  ? 9   MET C C    1  
ATOM 4857   O O    . MET C 1 9   ? 7.178   27.509  10.394  1.00 33.51 ? 9   MET C O    1  
ATOM 4858   C CB   . MET C 1 9   ? 8.249   26.349  12.907  1.00 63.42 ? 9   MET C CB   1  
ATOM 4859   C CG   . MET C 1 9   ? 8.628   25.070  12.142  1.00 3.31  ? 9   MET C CG   1  
ATOM 4860   S SD   . MET C 1 9   ? 10.410  24.893  11.918  1.00 74.12 ? 9   MET C SD   1  
ATOM 4861   C CE   . MET C 1 9   ? 10.494  23.416  10.911  1.00 60.24 ? 9   MET C CE   1  
ATOM 4862   H H    . MET C 1 9   ? 8.863   29.091  13.808  1.00 64.22 ? 9   MET C H    1  
ATOM 4863   H HA   . MET C 1 9   ? 9.828   27.684  12.311  1.00 14.24 ? 9   MET C HA   1  
ATOM 4864   H HB2  . MET C 1 9   ? 8.665   26.277  13.905  1.00 61.45 ? 9   MET C HB2  1  
ATOM 4865   H HB3  . MET C 1 9   ? 7.165   26.386  12.991  1.00 14.42 ? 9   MET C HB3  1  
ATOM 4866   H HG2  . MET C 1 9   ? 8.263   24.207  12.688  1.00 0.13  ? 9   MET C HG2  1  
ATOM 4867   H HG3  . MET C 1 9   ? 8.159   25.095  11.166  1.00 32.41 ? 9   MET C HG3  1  
ATOM 4868   H HE1  . MET C 1 9   ? 9.997   23.589  9.967   1.00 14.50 ? 9   MET C HE1  1  
ATOM 4869   H HE2  . MET C 1 9   ? 10.014  22.599  11.427  1.00 35.24 ? 9   MET C HE2  1  
ATOM 4870   H HE3  . MET C 1 9   ? 11.530  23.166  10.730  1.00 12.53 ? 9   MET C HE3  1  
ATOM 4871   N N    . THR C 1 10  ? 9.334   27.913  9.874   1.00 70.10 ? 10  THR C N    1  
ATOM 4872   C CA   . THR C 1 10  ? 9.117   27.907  8.428   1.00 75.51 ? 10  THR C CA   1  
ATOM 4873   C C    . THR C 1 10  ? 9.199   26.457  7.944   1.00 1.13  ? 10  THR C C    1  
ATOM 4874   O O    . THR C 1 10  ? 10.292  25.920  7.706   1.00 42.32 ? 10  THR C O    1  
ATOM 4875   C CB   . THR C 1 10  ? 10.150  28.816  7.690   1.00 64.24 ? 10  THR C CB   1  
ATOM 4876   O OG1  . THR C 1 10  ? 10.191  30.104  8.334   1.00 70.51 ? 10  THR C OG1  1  
ATOM 4877   C CG2  . THR C 1 10  ? 9.800   29.000  6.199   1.00 62.15 ? 10  THR C CG2  1  
ATOM 4878   H H    . THR C 1 10  ? 10.241  28.046  10.211  1.00 41.12 ? 10  THR C H    1  
ATOM 4879   H HA   . THR C 1 10  ? 8.117   28.293  8.221   1.00 42.13 ? 10  THR C HA   1  
ATOM 4880   H HB   . THR C 1 10  ? 11.132  28.363  7.764   1.00 43.32 ? 10  THR C HB   1  
ATOM 4881   H HG1  . THR C 1 10  ? 9.465   30.169  8.964   1.00 44.34 ? 10  THR C HG1  1  
ATOM 4882   H HG21 . THR C 1 10  ? 9.799   28.038  5.702   1.00 24.24 ? 10  THR C HG21 1  
ATOM 4883   H HG22 . THR C 1 10  ? 10.534  29.641  5.732   1.00 53.34 ? 10  THR C HG22 1  
ATOM 4884   H HG23 . THR C 1 10  ? 8.821   29.453  6.107   1.00 70.22 ? 10  THR C HG23 1  
ATOM 4885   N N    . PHE C 1 11  ? 8.026   25.813  7.887   1.00 24.41 ? 11  PHE C N    1  
ATOM 4886   C CA   . PHE C 1 11  ? 7.903   24.389  7.583   1.00 60.13 ? 11  PHE C CA   1  
ATOM 4887   C C    . PHE C 1 11  ? 7.033   24.182  6.345   1.00 2.35  ? 11  PHE C C    1  
ATOM 4888   O O    . PHE C 1 11  ? 5.967   24.791  6.204   1.00 72.03 ? 11  PHE C O    1  
ATOM 4889   C CB   . PHE C 1 11  ? 7.292   23.635  8.797   1.00 53.31 ? 11  PHE C CB   1  
ATOM 4890   C CG   . PHE C 1 11  ? 7.311   22.096  8.708   1.00 70.44 ? 11  PHE C CG   1  
ATOM 4891   C CD1  . PHE C 1 11  ? 6.452   21.338  9.446   1.00 62.10 ? 11  PHE C CD1  1  
ATOM 4892   C CD2  . PHE C 1 11  ? 8.208   21.406  7.918   1.00 21.24 ? 11  PHE C CD2  1  
ATOM 4893   C CE1  . PHE C 1 11  ? 6.501   19.958  9.392   1.00 63.33 ? 11  PHE C CE1  1  
ATOM 4894   C CE2  . PHE C 1 11  ? 8.228   20.038  7.876   1.00 52.11 ? 11  PHE C CE2  1  
ATOM 4895   C CZ   . PHE C 1 11  ? 7.370   19.319  8.613   1.00 11.22 ? 11  PHE C CZ   1  
ATOM 4896   H H    . PHE C 1 11  ? 7.207   26.322  8.054   1.00 24.35 ? 11  PHE C H    1  
ATOM 4897   H HA   . PHE C 1 11  ? 8.895   23.984  7.389   1.00 0.32  ? 11  PHE C HA   1  
ATOM 4898   H HB2  . PHE C 1 11  ? 7.843   23.911  9.689   1.00 30.52 ? 11  PHE C HB2  1  
ATOM 4899   H HB3  . PHE C 1 11  ? 6.260   23.951  8.921   1.00 33.43 ? 11  PHE C HB3  1  
ATOM 4900   H HD1  . PHE C 1 11  ? 5.722   21.827  10.083  1.00 13.25 ? 11  PHE C HD1  1  
ATOM 4901   H HD2  . PHE C 1 11  ? 8.897   21.952  7.330   1.00 42.04 ? 11  PHE C HD2  1  
ATOM 4902   H HE1  . PHE C 1 11  ? 5.839   19.385  9.994   1.00 20.25 ? 11  PHE C HE1  1  
ATOM 4903   H HE2  . PHE C 1 11  ? 8.914   19.531  7.257   1.00 4.04  ? 11  PHE C HE2  1  
ATOM 4904   H HZ   . PHE C 1 11  ? 7.397   18.234  8.597   1.00 55.12 ? 11  PHE C HZ   1  
ATOM 4905   N N    . GLN C 1 12  ? 7.509   23.295  5.471   1.00 3.14  ? 12  GLN C N    1  
ATOM 4906   C CA   . GLN C 1 12  ? 6.804   22.864  4.273   1.00 50.04 ? 12  GLN C CA   1  
ATOM 4907   C C    . GLN C 1 12  ? 7.327   21.474  3.895   1.00 41.45 ? 12  GLN C C    1  
ATOM 4908   O O    . GLN C 1 12  ? 8.546   21.282  3.793   1.00 35.31 ? 12  GLN C O    1  
ATOM 4909   C CB   . GLN C 1 12  ? 7.053   23.873  3.121   1.00 12.44 ? 12  GLN C CB   1  
ATOM 4910   C CG   . GLN C 1 12  ? 6.192   23.636  1.872   1.00 70.43 ? 12  GLN C CG   1  
ATOM 4911   C CD   . GLN C 1 12  ? 6.580   24.551  0.710   1.00 70.12 ? 12  GLN C CD   1  
ATOM 4912   O OE1  . GLN C 1 12  ? 6.090   25.674  0.593   1.00 23.44 ? 12  GLN C OE1  1  
ATOM 4913   N NE2  . GLN C 1 12  ? 7.408   24.051  -0.191  1.00 74.24 ? 12  GLN C NE2  1  
ATOM 4914   H H    . GLN C 1 12  ? 8.400   22.918  5.639   1.00 4.13  ? 12  GLN C H    1  
ATOM 4915   H HA   . GLN C 1 12  ? 5.741   22.809  4.489   1.00 52.43 ? 12  GLN C HA   1  
ATOM 4916   H HB2  . GLN C 1 12  ? 6.844   24.874  3.489   1.00 43.34 ? 12  GLN C HB2  1  
ATOM 4917   H HB3  . GLN C 1 12  ? 8.101   23.829  2.832   1.00 11.42 ? 12  GLN C HB3  1  
ATOM 4918   H HG2  . GLN C 1 12  ? 6.304   22.602  1.558   1.00 33.51 ? 12  GLN C HG2  1  
ATOM 4919   H HG3  . GLN C 1 12  ? 5.151   23.812  2.123   1.00 4.51  ? 12  GLN C HG3  1  
ATOM 4920   H HE21 . GLN C 1 12  ? 7.717   23.130  -0.079  1.00 13.13 ? 12  GLN C HE21 1  
ATOM 4921   H HE22 . GLN C 1 12  ? 7.688   24.629  -0.934  1.00 62.35 ? 12  GLN C HE22 1  
ATOM 4922   N N    . ILE C 1 13  ? 6.419   20.499  3.732   1.00 34.12 ? 13  ILE C N    1  
ATOM 4923   C CA   . ILE C 1 13  ? 6.786   19.173  3.225   1.00 62.45 ? 13  ILE C CA   1  
ATOM 4924   C C    . ILE C 1 13  ? 7.072   19.294  1.727   1.00 13.34 ? 13  ILE C C    1  
ATOM 4925   O O    . ILE C 1 13  ? 6.205   19.710  0.950   1.00 55.21 ? 13  ILE C O    1  
ATOM 4926   C CB   . ILE C 1 13  ? 5.675   18.094  3.468   1.00 32.12 ? 13  ILE C CB   1  
ATOM 4927   C CG1  . ILE C 1 13  ? 5.399   17.921  4.994   1.00 71.42 ? 13  ILE C CG1  1  
ATOM 4928   C CG2  . ILE C 1 13  ? 6.081   16.735  2.818   1.00 52.45 ? 13  ILE C CG2  1  
ATOM 4929   C CD1  . ILE C 1 13  ? 4.168   17.085  5.318   1.00 63.43 ? 13  ILE C CD1  1  
ATOM 4930   H H    . ILE C 1 13  ? 5.484   20.685  3.936   1.00 54.41 ? 13  ILE C H    1  
ATOM 4931   H HA   . ILE C 1 13  ? 7.695   18.851  3.743   1.00 53.11 ? 13  ILE C HA   1  
ATOM 4932   H HB   . ILE C 1 13  ? 4.765   18.436  2.984   1.00 15.15 ? 13  ILE C HB   1  
ATOM 4933   H HG12 . ILE C 1 13  ? 6.244   17.433  5.454   1.00 54.41 ? 13  ILE C HG12 1  
ATOM 4934   H HG13 . ILE C 1 13  ? 5.275   18.898  5.459   1.00 45.04 ? 13  ILE C HG13 1  
ATOM 4935   H HG21 . ILE C 1 13  ? 5.403   15.957  3.125   1.00 65.53 ? 13  ILE C HG21 1  
ATOM 4936   H HG22 . ILE C 1 13  ? 7.083   16.463  3.123   1.00 72.14 ? 13  ILE C HG22 1  
ATOM 4937   H HG23 . ILE C 1 13  ? 6.050   16.814  1.740   1.00 32.12 ? 13  ILE C HG23 1  
ATOM 4938   H HD11 . ILE C 1 13  ? 4.157   16.855  6.371   1.00 20.43 ? 13  ILE C HD11 1  
ATOM 4939   H HD12 . ILE C 1 13  ? 4.180   16.164  4.752   1.00 3.45  ? 13  ILE C HD12 1  
ATOM 4940   H HD13 . ILE C 1 13  ? 3.283   17.645  5.077   1.00 31.40 ? 13  ILE C HD13 1  
ATOM 4941   N N    . GLN C 1 14  ? 8.298   18.948  1.356   1.00 0.04  ? 14  GLN C N    1  
ATOM 4942   C CA   . GLN C 1 14  ? 8.784   19.051  -0.018  1.00 1.54  ? 14  GLN C CA   1  
ATOM 4943   C C    . GLN C 1 14  ? 8.332   17.818  -0.819  1.00 3.13  ? 14  GLN C C    1  
ATOM 4944   O O    . GLN C 1 14  ? 7.849   17.952  -1.949  1.00 43.42 ? 14  GLN C O    1  
ATOM 4945   C CB   . GLN C 1 14  ? 10.331  19.176  -0.011  1.00 32.04 ? 14  GLN C CB   1  
ATOM 4946   C CG   . GLN C 1 14  ? 10.892  20.280  0.919   1.00 22.50 ? 14  GLN C CG   1  
ATOM 4947   C CD   . GLN C 1 14  ? 10.494  21.695  0.502   1.00 71.11 ? 14  GLN C CD   1  
ATOM 4948   O OE1  . GLN C 1 14  ? 11.182  22.341  -0.285  1.00 55.53 ? 14  GLN C OE1  1  
ATOM 4949   N NE2  . GLN C 1 14  ? 9.396   22.197  1.043   1.00 62.34 ? 14  GLN C NE2  1  
ATOM 4950   H H    . GLN C 1 14  ? 8.902   18.589  2.038   1.00 3.53  ? 14  GLN C H    1  
ATOM 4951   H HA   . GLN C 1 14  ? 8.360   19.946  -0.470  1.00 2.10  ? 14  GLN C HA   1  
ATOM 4952   H HB2  . GLN C 1 14  ? 10.750  18.230  0.309   1.00 34.52 ? 14  GLN C HB2  1  
ATOM 4953   H HB3  . GLN C 1 14  ? 10.673  19.376  -1.020  1.00 21.43 ? 14  GLN C HB3  1  
ATOM 4954   H HG2  . GLN C 1 14  ? 10.530  20.104  1.924   1.00 33.22 ? 14  GLN C HG2  1  
ATOM 4955   H HG3  . GLN C 1 14  ? 11.975  20.216  0.930   1.00 22.21 ? 14  GLN C HG3  1  
ATOM 4956   H HE21 . GLN C 1 14  ? 8.895   21.643  1.676   1.00 21.24 ? 14  GLN C HE21 1  
ATOM 4957   H HE22 . GLN C 1 14  ? 9.146   23.114  0.808   1.00 62.35 ? 14  GLN C HE22 1  
ATOM 4958   N N    . ARG C 1 15  ? 8.440   16.622  -0.183  1.00 75.32 ? 15  ARG C N    1  
ATOM 4959   C CA   . ARG C 1 15  ? 8.162   15.324  -0.840  1.00 52.33 ? 15  ARG C CA   1  
ATOM 4960   C C    . ARG C 1 15  ? 8.359   14.167  0.156   1.00 31.33 ? 15  ARG C C    1  
ATOM 4961   O O    . ARG C 1 15  ? 9.359   14.132  0.869   1.00 22.23 ? 15  ARG C O    1  
ATOM 4962   C CB   . ARG C 1 15  ? 9.096   15.123  -2.065  1.00 72.41 ? 15  ARG C CB   1  
ATOM 4963   C CG   . ARG C 1 15  ? 8.806   13.875  -2.929  1.00 61.00 ? 15  ARG C CG   1  
ATOM 4964   C CD   . ARG C 1 15  ? 9.685   13.852  -4.184  1.00 33.42 ? 15  ARG C CD   1  
ATOM 4965   N NE   . ARG C 1 15  ? 9.394   12.718  -5.075  1.00 23.20 ? 15  ARG C NE   1  
ATOM 4966   C CZ   . ARG C 1 15  ? 9.350   12.794  -6.414  1.00 22.12 ? 15  ARG C CZ   1  
ATOM 4967   N NH1  . ARG C 1 15  ? 9.544   13.948  -7.041  1.00 32.24 ? 15  ARG C NH1  1  
ATOM 4968   N NH2  . ARG C 1 15  ? 9.167   11.702  -7.127  1.00 62.23 ? 15  ARG C NH2  1  
ATOM 4969   H H    . ARG C 1 15  ? 8.694   16.616  0.767   1.00 13.31 ? 15  ARG C H    1  
ATOM 4970   H HA   . ARG C 1 15  ? 7.129   15.337  -1.177  1.00 13.22 ? 15  ARG C HA   1  
ATOM 4971   H HB2  . ARG C 1 15  ? 9.009   15.999  -2.702  1.00 12.12 ? 15  ARG C HB2  1  
ATOM 4972   H HB3  . ARG C 1 15  ? 10.123  15.065  -1.714  1.00 25.44 ? 15  ARG C HB3  1  
ATOM 4973   H HG2  . ARG C 1 15  ? 9.004   12.984  -2.343  1.00 3.50  ? 15  ARG C HG2  1  
ATOM 4974   H HG3  . ARG C 1 15  ? 7.764   13.884  -3.226  1.00 64.33 ? 15  ARG C HG3  1  
ATOM 4975   H HD2  . ARG C 1 15  ? 9.535   14.778  -4.732  1.00 61.24 ? 15  ARG C HD2  1  
ATOM 4976   H HD3  . ARG C 1 15  ? 10.724  13.790  -3.883  1.00 50.12 ? 15  ARG C HD3  1  
ATOM 4977   H HE   . ARG C 1 15  ? 9.235   11.844  -4.650  1.00 31.02 ? 15  ARG C HE   1  
ATOM 4978   H HH11 . ARG C 1 15  ? 9.741   14.783  -6.520  1.00 60.53 ? 15  ARG C HH11 1  
ATOM 4979   H HH12 . ARG C 1 15  ? 9.513   13.986  -8.040  1.00 24.23 ? 15  ARG C HH12 1  
ATOM 4980   H HH21 . ARG C 1 15  ? 9.049   10.813  -6.674  1.00 74.52 ? 15  ARG C HH21 1  
ATOM 4981   H HH22 . ARG C 1 15  ? 9.125   11.757  -8.126  1.00 22.23 ? 15  ARG C HH22 1  
ATOM 4982   N N    . ILE C 1 16  ? 7.404   13.226  0.187   1.00 35.45 ? 16  ILE C N    1  
ATOM 4983   C CA   . ILE C 1 16  ? 7.480   11.999  1.015   1.00 11.03 ? 16  ILE C CA   1  
ATOM 4984   C C    . ILE C 1 16  ? 7.481   10.779  0.092   1.00 50.24 ? 16  ILE C C    1  
ATOM 4985   O O    . ILE C 1 16  ? 6.850   10.814  -0.968  1.00 74.44 ? 16  ILE C O    1  
ATOM 4986   C CB   . ILE C 1 16  ? 6.276   11.920  2.013   1.00 44.52 ? 16  ILE C CB   1  
ATOM 4987   C CG1  . ILE C 1 16  ? 6.352   13.094  3.034   1.00 61.31 ? 16  ILE C CG1  1  
ATOM 4988   C CG2  . ILE C 1 16  ? 6.222   10.551  2.741   1.00 73.21 ? 16  ILE C CG2  1  
ATOM 4989   C CD1  . ILE C 1 16  ? 5.120   13.248  3.886   1.00 14.12 ? 16  ILE C CD1  1  
ATOM 4990   H H    . ILE C 1 16  ? 6.614   13.348  -0.380  1.00 70.54 ? 16  ILE C H    1  
ATOM 4991   H HA   . ILE C 1 16  ? 8.411   12.014  1.588   1.00 23.14 ? 16  ILE C HA   1  
ATOM 4992   H HB   . ILE C 1 16  ? 5.360   12.022  1.435   1.00 34.33 ? 16  ILE C HB   1  
ATOM 4993   H HG12 . ILE C 1 16  ? 7.191   12.945  3.700   1.00 45.15 ? 16  ILE C HG12 1  
ATOM 4994   H HG13 . ILE C 1 16  ? 6.492   14.026  2.499   1.00 10.41 ? 16  ILE C HG13 1  
ATOM 4995   H HG21 . ILE C 1 16  ? 5.319   10.474  3.313   1.00 24.24 ? 16  ILE C HG21 1  
ATOM 4996   H HG22 . ILE C 1 16  ? 7.071   10.449  3.401   1.00 52.03 ? 16  ILE C HG22 1  
ATOM 4997   H HG23 . ILE C 1 16  ? 6.242   9.747   2.018   1.00 32.31 ? 16  ILE C HG23 1  
ATOM 4998   H HD11 . ILE C 1 16  ? 5.269   14.037  4.600   1.00 64.24 ? 16  ILE C HD11 1  
ATOM 4999   H HD12 . ILE C 1 16  ? 4.910   12.325  4.409   1.00 12.02 ? 16  ILE C HD12 1  
ATOM 5000   H HD13 . ILE C 1 16  ? 4.291   13.500  3.254   1.00 40.35 ? 16  ILE C HD13 1  
ATOM 5001   N N    . TYR C 1 17  ? 8.206   9.718   0.489   1.00 32.24 ? 17  TYR C N    1  
ATOM 5002   C CA   . TYR C 1 17  ? 8.400   8.521   -0.337  1.00 2.14  ? 17  TYR C CA   1  
ATOM 5003   C C    . TYR C 1 17  ? 9.160   7.439   0.444   1.00 33.42 ? 17  TYR C C    1  
ATOM 5004   O O    . TYR C 1 17  ? 9.886   7.730   1.403   1.00 31.42 ? 17  TYR C O    1  
ATOM 5005   C CB   . TYR C 1 17  ? 9.192   8.891   -1.629  1.00 15.24 ? 17  TYR C CB   1  
ATOM 5006   C CG   . TYR C 1 17  ? 10.564  9.540   -1.352  1.00 23.10 ? 17  TYR C CG   1  
ATOM 5007   C CD1  . TYR C 1 17  ? 10.684  10.898  -0.989  1.00 71.12 ? 17  TYR C CD1  1  
ATOM 5008   C CD2  . TYR C 1 17  ? 11.734  8.797   -1.431  1.00 13.31 ? 17  TYR C CD2  1  
ATOM 5009   C CE1  . TYR C 1 17  ? 11.915  11.465  -0.720  1.00 74.30 ? 17  TYR C CE1  1  
ATOM 5010   C CE2  . TYR C 1 17  ? 12.947  9.368   -1.166  1.00 54.10 ? 17  TYR C CE2  1  
ATOM 5011   C CZ   . TYR C 1 17  ? 13.040  10.687  -0.811  1.00 45.23 ? 17  TYR C CZ   1  
ATOM 5012   O OH   . TYR C 1 17  ? 14.275  11.225  -0.571  1.00 33.55 ? 17  TYR C OH   1  
ATOM 5013   H H    . TYR C 1 17  ? 8.633   9.740   1.375   1.00 3.02  ? 17  TYR C H    1  
ATOM 5014   H HA   . TYR C 1 17  ? 7.410   8.133   -0.606  1.00 2.20  ? 17  TYR C HA   1  
ATOM 5015   H HB2  . TYR C 1 17  ? 9.346   7.999   -2.226  1.00 41.11 ? 17  TYR C HB2  1  
ATOM 5016   H HB3  . TYR C 1 17  ? 8.604   9.595   -2.212  1.00 25.32 ? 17  TYR C HB3  1  
ATOM 5017   H HD1  . TYR C 1 17  ? 9.792   11.504  -0.921  1.00 44.43 ? 17  TYR C HD1  1  
ATOM 5018   H HD2  . TYR C 1 17  ? 11.682  7.752   -1.709  1.00 71.42 ? 17  TYR C HD2  1  
ATOM 5019   H HE1  . TYR C 1 17  ? 11.987  12.510  -0.439  1.00 75.22 ? 17  TYR C HE1  1  
ATOM 5020   H HE2  . TYR C 1 17  ? 13.843  8.772   -1.233  1.00 5.23  ? 17  TYR C HE2  1  
ATOM 5021   H HH   . TYR C 1 17  ? 14.369  11.448  0.361   1.00 61.51 ? 17  TYR C HH   1  
ATOM 5022   N N    . THR C 1 18  ? 9.002   6.197   0.000   1.00 55.02 ? 18  THR C N    1  
ATOM 5023   C CA   . THR C 1 18  ? 9.746   5.059   0.523   1.00 63.45 ? 18  THR C CA   1  
ATOM 5024   C C    . THR C 1 18  ? 11.110  5.004   -0.186  1.00 24.53 ? 18  THR C C    1  
ATOM 5025   O O    . THR C 1 18  ? 11.159  4.847   -1.408  1.00 41.15 ? 18  THR C O    1  
ATOM 5026   C CB   . THR C 1 18  ? 8.936   3.737   0.288   1.00 21.11 ? 18  THR C CB   1  
ATOM 5027   O OG1  . THR C 1 18  ? 8.757   3.487   -1.122  1.00 34.40 ? 18  THR C OG1  1  
ATOM 5028   C CG2  . THR C 1 18  ? 7.544   3.804   0.946   1.00 71.20 ? 18  THR C CG2  1  
ATOM 5029   H H    . THR C 1 18  ? 8.363   6.036   -0.722  1.00 1.14  ? 18  THR C H    1  
ATOM 5030   H HA   . THR C 1 18  ? 9.894   5.191   1.595   1.00 13.23 ? 18  THR C HA   1  
ATOM 5031   H HB   . THR C 1 18  ? 9.483   2.907   0.722   1.00 21.32 ? 18  THR C HB   1  
ATOM 5032   H HG1  . THR C 1 18  ? 9.614   3.376   -1.546  1.00 31.21 ? 18  THR C HG1  1  
ATOM 5033   H HG21 . THR C 1 18  ? 6.939   2.984   0.607   1.00 11.33 ? 18  THR C HG21 1  
ATOM 5034   H HG22 . THR C 1 18  ? 7.057   4.727   0.675   1.00 61.23 ? 18  THR C HG22 1  
ATOM 5035   H HG23 . THR C 1 18  ? 7.642   3.754   2.024   1.00 62.25 ? 18  THR C HG23 1  
ATOM 5036   N N    . LYS C 1 19  ? 12.207  5.209   0.558   1.00 62.51 ? 19  LYS C N    1  
ATOM 5037   C CA   . LYS C 1 19  ? 13.558  5.067   -0.013  1.00 61.41 ? 19  LYS C CA   1  
ATOM 5038   C C    . LYS C 1 19  ? 13.886  3.589   -0.128  1.00 22.21 ? 19  LYS C C    1  
ATOM 5039   O O    . LYS C 1 19  ? 14.333  3.105   -1.165  1.00 54.02 ? 19  LYS C O    1  
ATOM 5040   C CB   . LYS C 1 19  ? 14.634  5.750   0.857   1.00 74.12 ? 19  LYS C CB   1  
ATOM 5041   C CG   . LYS C 1 19  ? 14.316  7.214   1.261   1.00 53.33 ? 19  LYS C CG   1  
ATOM 5042   C CD   . LYS C 1 19  ? 15.450  8.196   0.917   1.00 53.14 ? 19  LYS C CD   1  
ATOM 5043   C CE   . LYS C 1 19  ? 16.777  7.854   1.595   1.00 4.33  ? 19  LYS C CE   1  
ATOM 5044   N NZ   . LYS C 1 19  ? 17.827  8.807   1.198   1.00 22.21 ? 19  LYS C NZ   1  
ATOM 5045   H H    . LYS C 1 19  ? 12.105  5.451   1.503   1.00 4.10  ? 19  LYS C H    1  
ATOM 5046   H HA   . LYS C 1 19  ? 13.561  5.519   -1.005  1.00 71.12 ? 19  LYS C HA   1  
ATOM 5047   H HB2  . LYS C 1 19  ? 14.779  5.166   1.765   1.00 30.21 ? 19  LYS C HB2  1  
ATOM 5048   H HB3  . LYS C 1 19  ? 15.564  5.736   0.293   1.00 21.54 ? 19  LYS C HB3  1  
ATOM 5049   H HG2  . LYS C 1 19  ? 13.419  7.539   0.745   1.00 60.22 ? 19  LYS C HG2  1  
ATOM 5050   H HG3  . LYS C 1 19  ? 14.131  7.257   2.329   1.00 24.51 ? 19  LYS C HG3  1  
ATOM 5051   H HD2  . LYS C 1 19  ? 15.599  8.198   -0.159  1.00 45.31 ? 19  LYS C HD2  1  
ATOM 5052   H HD3  . LYS C 1 19  ? 15.150  9.194   1.223   1.00 23.14 ? 19  LYS C HD3  1  
ATOM 5053   H HE2  . LYS C 1 19  ? 16.651  7.896   2.670   1.00 61.25 ? 19  LYS C HE2  1  
ATOM 5054   H HE3  . LYS C 1 19  ? 17.080  6.855   1.306   1.00 12.21 ? 19  LYS C HE3  1  
ATOM 5055   H HZ1  . LYS C 1 19  ? 17.400  9.730   0.976   1.00 72.34 ? 19  LYS C HZ1  1  
ATOM 5056   H HZ2  . LYS C 1 19  ? 18.321  8.470   0.372   1.00 25.32 ? 19  LYS C HZ2  1  
ATOM 5057   H HZ3  . LYS C 1 19  ? 18.509  8.943   1.972   1.00 74.22 ? 19  LYS C HZ3  1  
ATOM 5058   N N    . ASP C 1 20  ? 13.612  2.880   0.964   1.00 63.15 ? 20  ASP C N    1  
ATOM 5059   C CA   . ASP C 1 20  ? 13.944  1.473   1.108   1.00 64.54 ? 20  ASP C CA   1  
ATOM 5060   C C    . ASP C 1 20  ? 12.744  0.720   1.677   1.00 60.11 ? 20  ASP C C    1  
ATOM 5061   O O    . ASP C 1 20  ? 12.042  1.215   2.563   1.00 35.35 ? 20  ASP C O    1  
ATOM 5062   C CB   . ASP C 1 20  ? 15.193  1.307   2.004   1.00 45.01 ? 20  ASP C CB   1  
ATOM 5063   C CG   . ASP C 1 20  ? 15.549  -0.163  2.295   1.00 64.34 ? 20  ASP C CG   1  
ATOM 5064   O OD1  . ASP C 1 20  ? 15.104  -0.696  3.337   1.00 1.44  ? 20  ASP C OD1  1  
ATOM 5065   O OD2  . ASP C 1 20  ? 16.269  -0.785  1.486   1.00 21.54 ? 20  ASP C OD2  1  
ATOM 5066   H H    . ASP C 1 20  ? 13.152  3.324   1.708   1.00 4.43  ? 20  ASP C H    1  
ATOM 5067   H HA   . ASP C 1 20  ? 14.173  1.076   0.120   1.00 43.24 ? 20  ASP C HA   1  
ATOM 5068   H HB2  . ASP C 1 20  ? 16.042  1.778   1.514   1.00 31.43 ? 20  ASP C HB2  1  
ATOM 5069   H HB3  . ASP C 1 20  ? 15.025  1.821   2.948   1.00 2.12  ? 20  ASP C HB3  1  
ATOM 5070   N N    . ILE C 1 21  ? 12.505  -0.460  1.107   1.00 4.00  ? 21  ILE C N    1  
ATOM 5071   C CA   . ILE C 1 21  ? 11.477  -1.413  1.532   1.00 62.03 ? 21  ILE C CA   1  
ATOM 5072   C C    . ILE C 1 21  ? 12.115  -2.802  1.503   1.00 52.34 ? 21  ILE C C    1  
ATOM 5073   O O    . ILE C 1 21  ? 12.941  -3.080  0.626   1.00 22.32 ? 21  ILE C O    1  
ATOM 5074   C CB   . ILE C 1 21  ? 10.229  -1.409  0.566   1.00 15.21 ? 21  ILE C CB   1  
ATOM 5075   C CG1  . ILE C 1 21  ? 9.619   0.023   0.449   1.00 35.52 ? 21  ILE C CG1  1  
ATOM 5076   C CG2  . ILE C 1 21  ? 9.167   -2.437  1.031   1.00 72.03 ? 21  ILE C CG2  1  
ATOM 5077   C CD1  . ILE C 1 21  ? 8.534   0.182   -0.598  1.00 13.42 ? 21  ILE C CD1  1  
ATOM 5078   H H    . ILE C 1 21  ? 13.071  -0.721  0.354   1.00 72.04 ? 21  ILE C H    1  
ATOM 5079   H HA   . ILE C 1 21  ? 11.151  -1.173  2.548   1.00 11.41 ? 21  ILE C HA   1  
ATOM 5080   H HB   . ILE C 1 21  ? 10.573  -1.717  -0.420  1.00 0.42  ? 21  ILE C HB   1  
ATOM 5081   H HG12 . ILE C 1 21  ? 9.193   0.313   1.399   1.00 30.44 ? 21  ILE C HG12 1  
ATOM 5082   H HG13 . ILE C 1 21  ? 10.409  0.724   0.199   1.00 62.42 ? 21  ILE C HG13 1  
ATOM 5083   H HG21 . ILE C 1 21  ? 8.407   -2.542  0.281   1.00 73.12 ? 21  ILE C HG21 1  
ATOM 5084   H HG22 . ILE C 1 21  ? 8.713   -2.111  1.956   1.00 72.12 ? 21  ILE C HG22 1  
ATOM 5085   H HG23 . ILE C 1 21  ? 9.634   -3.405  1.191   1.00 51.25 ? 21  ILE C HG23 1  
ATOM 5086   H HD11 . ILE C 1 21  ? 8.199   1.204   -0.597  1.00 14.00 ? 21  ILE C HD11 1  
ATOM 5087   H HD12 . ILE C 1 21  ? 7.702   -0.469  -0.375  1.00 35.12 ? 21  ILE C HD12 1  
ATOM 5088   H HD13 . ILE C 1 21  ? 8.930   -0.052  -1.572  1.00 25.54 ? 21  ILE C HD13 1  
ATOM 5089   N N    . SER C 1 22  ? 11.733  -3.665  2.447   1.00 1.12  ? 22  SER C N    1  
ATOM 5090   C CA   . SER C 1 22  ? 12.173  -5.056  2.462   1.00 2.03  ? 22  SER C CA   1  
ATOM 5091   C C    . SER C 1 22  ? 11.262  -5.904  3.350   1.00 62.31 ? 22  SER C C    1  
ATOM 5092   O O    . SER C 1 22  ? 10.676  -5.407  4.320   1.00 52.01 ? 22  SER C O    1  
ATOM 5093   C CB   . SER C 1 22  ? 13.641  -5.177  2.932   1.00 71.11 ? 22  SER C CB   1  
ATOM 5094   O OG   . SER C 1 22  ? 14.111  -6.517  2.854   1.00 45.42 ? 22  SER C OG   1  
ATOM 5095   H H    . SER C 1 22  ? 11.145  -3.352  3.163   1.00 23.34 ? 22  SER C H    1  
ATOM 5096   H HA   . SER C 1 22  ? 12.094  -5.425  1.440   1.00 20.11 ? 22  SER C HA   1  
ATOM 5097   H HB2  . SER C 1 22  ? 14.272  -4.562  2.302   1.00 61.14 ? 22  SER C HB2  1  
ATOM 5098   H HB3  . SER C 1 22  ? 13.730  -4.836  3.957   1.00 22.23 ? 22  SER C HB3  1  
ATOM 5099   H HG   . SER C 1 22  ? 14.044  -6.828  1.943   1.00 3.41  ? 22  SER C HG   1  
ATOM 5100   N N    . PHE C 1 23  ? 11.160  -7.187  2.986   1.00 1.14  ? 23  PHE C N    1  
ATOM 5101   C CA   . PHE C 1 23  ? 10.428  -8.201  3.742   1.00 61.03 ? 23  PHE C CA   1  
ATOM 5102   C C    . PHE C 1 23  ? 11.070  -9.563  3.459   1.00 1.31  ? 23  PHE C C    1  
ATOM 5103   O O    . PHE C 1 23  ? 11.112  -9.980  2.312   1.00 31.33 ? 23  PHE C O    1  
ATOM 5104   C CB   . PHE C 1 23  ? 8.935   -8.213  3.339   1.00 40.12 ? 23  PHE C CB   1  
ATOM 5105   C CG   . PHE C 1 23  ? 8.101   -9.197  4.146   1.00 42.30 ? 23  PHE C CG   1  
ATOM 5106   C CD1  . PHE C 1 23  ? 7.843   -10.486 3.671   1.00 14.22 ? 23  PHE C CD1  1  
ATOM 5107   C CD2  . PHE C 1 23  ? 7.593   -8.835  5.393   1.00 44.12 ? 23  PHE C CD2  1  
ATOM 5108   C CE1  . PHE C 1 23  ? 7.105   -11.373 4.423   1.00 21.22 ? 23  PHE C CE1  1  
ATOM 5109   C CE2  . PHE C 1 23  ? 6.852   -9.720  6.138   1.00 30.32 ? 23  PHE C CE2  1  
ATOM 5110   C CZ   . PHE C 1 23  ? 6.608   -10.988 5.653   1.00 54.42 ? 23  PHE C CZ   1  
ATOM 5111   H H    . PHE C 1 23  ? 11.612  -7.471  2.163   1.00 30.40 ? 23  PHE C H    1  
ATOM 5112   H HA   . PHE C 1 23  ? 10.517  -7.972  4.806   1.00 41.20 ? 23  PHE C HA   1  
ATOM 5113   H HB2  . PHE C 1 23  ? 8.524   -7.220  3.489   1.00 24.24 ? 23  PHE C HB2  1  
ATOM 5114   H HB3  . PHE C 1 23  ? 8.843   -8.465  2.283   1.00 13.02 ? 23  PHE C HB3  1  
ATOM 5115   H HD1  . PHE C 1 23  ? 8.236   -10.789 2.701   1.00 74.51 ? 23  PHE C HD1  1  
ATOM 5116   H HD2  . PHE C 1 23  ? 7.784   -7.839  5.777   1.00 75.35 ? 23  PHE C HD2  1  
ATOM 5117   H HE1  . PHE C 1 23  ? 6.909   -12.370 4.049   1.00 74.43 ? 23  PHE C HE1  1  
ATOM 5118   H HE2  . PHE C 1 23  ? 6.457   -9.422  7.105   1.00 11.04 ? 23  PHE C HE2  1  
ATOM 5119   H HZ   . PHE C 1 23  ? 6.030   -11.684 6.243   1.00 74.11 ? 23  PHE C HZ   1  
ATOM 5120   N N    . GLU C 1 24  ? 11.545  -10.244 4.505   1.00 25.23 ? 24  GLU C N    1  
ATOM 5121   C CA   . GLU C 1 24  ? 12.255  -11.526 4.395   1.00 30.01 ? 24  GLU C CA   1  
ATOM 5122   C C    . GLU C 1 24  ? 11.540  -12.609 5.221   1.00 70.43 ? 24  GLU C C    1  
ATOM 5123   O O    . GLU C 1 24  ? 11.336  -12.448 6.424   1.00 21.21 ? 24  GLU C O    1  
ATOM 5124   C CB   . GLU C 1 24  ? 13.717  -11.360 4.892   1.00 74.11 ? 24  GLU C CB   1  
ATOM 5125   C CG   . GLU C 1 24  ? 14.554  -10.347 4.083   1.00 73.13 ? 24  GLU C CG   1  
ATOM 5126   C CD   . GLU C 1 24  ? 15.987  -10.183 4.619   1.00 35.25 ? 24  GLU C CD   1  
ATOM 5127   O OE1  . GLU C 1 24  ? 16.212  -9.319  5.493   1.00 54.31 ? 24  GLU C OE1  1  
ATOM 5128   O OE2  . GLU C 1 24  ? 16.892  -10.934 4.186   1.00 32.24 ? 24  GLU C OE2  1  
ATOM 5129   H H    . GLU C 1 24  ? 11.409  -9.874  5.391   1.00 51.01 ? 24  GLU C H    1  
ATOM 5130   H HA   . GLU C 1 24  ? 12.273  -11.831 3.348   1.00 5.33  ? 24  GLU C HA   1  
ATOM 5131   H HB2  . GLU C 1 24  ? 13.696  -11.032 5.929   1.00 71.21 ? 24  GLU C HB2  1  
ATOM 5132   H HB3  . GLU C 1 24  ? 14.216  -12.323 4.849   1.00 62.34 ? 24  GLU C HB3  1  
ATOM 5133   H HG2  . GLU C 1 24  ? 14.598  -10.677 3.048   1.00 3.43  ? 24  GLU C HG2  1  
ATOM 5134   H HG3  . GLU C 1 24  ? 14.056  -9.385  4.115   1.00 44.21 ? 24  GLU C HG3  1  
ATOM 5135   N N    . ALA C 1 25  ? 11.146  -13.692 4.545   1.00 13.03 ? 25  ALA C N    1  
ATOM 5136   C CA   . ALA C 1 25  ? 10.676  -14.931 5.164   1.00 1.52  ? 25  ALA C CA   1  
ATOM 5137   C C    . ALA C 1 25  ? 11.337  -16.112 4.415   1.00 65.40 ? 25  ALA C C    1  
ATOM 5138   O O    . ALA C 1 25  ? 10.761  -16.654 3.467   1.00 61.04 ? 25  ALA C O    1  
ATOM 5139   C CB   . ALA C 1 25  ? 9.133   -15.007 5.146   1.00 1.05  ? 25  ALA C CB   1  
ATOM 5140   H H    . ALA C 1 25  ? 11.171  -13.652 3.572   1.00 44.35 ? 25  ALA C H    1  
ATOM 5141   H HA   . ALA C 1 25  ? 11.006  -14.955 6.203   1.00 31.31 ? 25  ALA C HA   1  
ATOM 5142   H HB1  . ALA C 1 25  ? 8.721   -14.159 5.681   1.00 1.30  ? 25  ALA C HB1  1  
ATOM 5143   H HB2  . ALA C 1 25  ? 8.804   -15.921 5.622   1.00 44.42 ? 25  ALA C HB2  1  
ATOM 5144   H HB3  . ALA C 1 25  ? 8.774   -14.991 4.125   1.00 61.35 ? 25  ALA C HB3  1  
ATOM 5145   N N    . PRO C 1 26  ? 12.614  -16.481 4.781   1.00 13.45 ? 26  PRO C N    1  
ATOM 5146   C CA   . PRO C 1 26  ? 13.325  -17.633 4.159   1.00 52.22 ? 26  PRO C CA   1  
ATOM 5147   C C    . PRO C 1 26  ? 12.790  -18.984 4.679   1.00 33.53 ? 26  PRO C C    1  
ATOM 5148   O O    . PRO C 1 26  ? 13.063  -20.044 4.113   1.00 41.11 ? 26  PRO C O    1  
ATOM 5149   C CB   . PRO C 1 26  ? 14.794  -17.391 4.574   1.00 61.41 ? 26  PRO C CB   1  
ATOM 5150   C CG   . PRO C 1 26  ? 14.704  -16.685 5.896   1.00 74.55 ? 26  PRO C CG   1  
ATOM 5151   C CD   . PRO C 1 26  ? 13.467  -15.808 5.815   1.00 3.03  ? 26  PRO C CD   1  
ATOM 5152   H HA   . PRO C 1 26  ? 13.242  -17.615 3.076   1.00 41.30 ? 26  PRO C HA   1  
ATOM 5153   H HB2  . PRO C 1 26  ? 15.333  -18.333 4.658   1.00 55.21 ? 26  PRO C HB2  1  
ATOM 5154   H HB3  . PRO C 1 26  ? 15.286  -16.756 3.847   1.00 50.12 ? 26  PRO C HB3  1  
ATOM 5155   H HG2  . PRO C 1 26  ? 14.607  -17.416 6.697   1.00 64.45 ? 26  PRO C HG2  1  
ATOM 5156   H HG3  . PRO C 1 26  ? 15.588  -16.076 6.060   1.00 52.42 ? 26  PRO C HG3  1  
ATOM 5157   H HD2  . PRO C 1 26  ? 12.959  -15.776 6.774   1.00 62.40 ? 26  PRO C HD2  1  
ATOM 5158   H HD3  . PRO C 1 26  ? 13.726  -14.801 5.499   1.00 53.54 ? 26  PRO C HD3  1  
ATOM 5159   N N    . ASN C 1 27  ? 12.017  -18.901 5.770   1.00 11.20 ? 27  ASN C N    1  
ATOM 5160   C CA   . ASN C 1 27  ? 11.370  -20.042 6.430   1.00 4.03  ? 27  ASN C CA   1  
ATOM 5161   C C    . ASN C 1 27  ? 9.877   -20.076 6.069   1.00 2.34  ? 27  ASN C C    1  
ATOM 5162   O O    . ASN C 1 27  ? 9.121   -20.825 6.690   1.00 61.12 ? 27  ASN C O    1  
ATOM 5163   C CB   . ASN C 1 27  ? 11.554  -19.906 7.969   1.00 11.02 ? 27  ASN C CB   1  
ATOM 5164   C CG   . ASN C 1 27  ? 13.020  -19.967 8.421   1.00 61.11 ? 27  ASN C CG   1  
ATOM 5165   O OD1  . ASN C 1 27  ? 13.946  -19.741 7.643   1.00 14.42 ? 27  ASN C OD1  1  
ATOM 5166   N ND2  . ASN C 1 27  ? 13.249  -20.231 9.688   1.00 74.11 ? 27  ASN C ND2  1  
ATOM 5167   H H    . ASN C 1 27  ? 11.874  -18.019 6.159   1.00 21.43 ? 27  ASN C H    1  
ATOM 5168   H HA   . ASN C 1 27  ? 11.840  -20.966 6.093   1.00 21.05 ? 27  ASN C HA   1  
ATOM 5169   H HB2  . ASN C 1 27  ? 11.142  -18.959 8.295   1.00 22.22 ? 27  ASN C HB2  1  
ATOM 5170   H HB3  . ASN C 1 27  ? 11.013  -20.709 8.459   1.00 50.41 ? 27  ASN C HB3  1  
ATOM 5171   H HD21 . ASN C 1 27  ? 12.480  -20.374 10.273  1.00 21.11 ? 27  ASN C HD21 1  
ATOM 5172   H HD22 . ASN C 1 27  ? 14.176  -20.265 9.992   1.00 35.45 ? 27  ASN C HD22 1  
ATOM 5173   N N    . ALA C 1 28  ? 9.492   -19.294 5.012   1.00 1.05  ? 28  ALA C N    1  
ATOM 5174   C CA   . ALA C 1 28  ? 8.085   -19.027 4.630   1.00 45.41 ? 28  ALA C CA   1  
ATOM 5175   C C    . ALA C 1 28  ? 7.205   -20.311 4.558   1.00 30.14 ? 28  ALA C C    1  
ATOM 5176   O O    . ALA C 1 28  ? 6.192   -20.351 5.251   1.00 73.01 ? 28  ALA C O    1  
ATOM 5177   C CB   . ALA C 1 28  ? 8.009   -18.207 3.320   1.00 10.11 ? 28  ALA C CB   1  
ATOM 5178   H H    . ALA C 1 28  ? 10.195  -18.874 4.474   1.00 3.30  ? 28  ALA C H    1  
ATOM 5179   H HA   . ALA C 1 28  ? 7.681   -18.396 5.421   1.00 25.24 ? 28  ALA C HA   1  
ATOM 5180   H HB1  . ALA C 1 28  ? 6.986   -17.927 3.117   1.00 51.30 ? 28  ALA C HB1  1  
ATOM 5181   H HB2  . ALA C 1 28  ? 8.389   -18.794 2.494   1.00 33.04 ? 28  ALA C HB2  1  
ATOM 5182   H HB3  . ALA C 1 28  ? 8.604   -17.310 3.418   1.00 24.41 ? 28  ALA C HB3  1  
ATOM 5183   N N    . PRO C 1 29  ? 7.584   -21.403 3.789   1.00 13.20 ? 29  PRO C N    1  
ATOM 5184   C CA   . PRO C 1 29  ? 6.781   -22.660 3.756   1.00 72.12 ? 29  PRO C CA   1  
ATOM 5185   C C    . PRO C 1 29  ? 6.531   -23.249 5.163   1.00 20.22 ? 29  PRO C C    1  
ATOM 5186   O O    . PRO C 1 29  ? 5.383   -23.503 5.556   1.00 14.41 ? 29  PRO C O    1  
ATOM 5187   C CB   . PRO C 1 29  ? 7.651   -23.631 2.913   1.00 41.03 ? 29  PRO C CB   1  
ATOM 5188   C CG   . PRO C 1 29  ? 8.515   -22.747 2.075   1.00 21.30 ? 29  PRO C CG   1  
ATOM 5189   C CD   . PRO C 1 29  ? 8.782   -21.512 2.901   1.00 31.21 ? 29  PRO C CD   1  
ATOM 5190   H HA   . PRO C 1 29  ? 5.830   -22.497 3.259   1.00 31.24 ? 29  PRO C HA   1  
ATOM 5191   H HB2  . PRO C 1 29  ? 8.259   -24.266 3.562   1.00 43.54 ? 29  PRO C HB2  1  
ATOM 5192   H HB3  . PRO C 1 29  ? 7.025   -24.252 2.283   1.00 42.21 ? 29  PRO C HB3  1  
ATOM 5193   H HG2  . PRO C 1 29  ? 9.443   -23.256 1.831   1.00 3.51  ? 29  PRO C HG2  1  
ATOM 5194   H HG3  . PRO C 1 29  ? 7.994   -22.475 1.160   1.00 64.31 ? 29  PRO C HG3  1  
ATOM 5195   H HD2  . PRO C 1 29  ? 9.689   -21.630 3.488   1.00 1.20  ? 29  PRO C HD2  1  
ATOM 5196   H HD3  . PRO C 1 29  ? 8.864   -20.637 2.265   1.00 72.12 ? 29  PRO C HD3  1  
ATOM 5197   N N    . HIS C 1 30  ? 7.631   -23.386 5.923   1.00 61.44 ? 30  HIS C N    1  
ATOM 5198   C CA   . HIS C 1 30  ? 7.642   -24.067 7.226   1.00 25.45 ? 30  HIS C CA   1  
ATOM 5199   C C    . HIS C 1 30  ? 6.863   -23.283 8.298   1.00 41.13 ? 30  HIS C C    1  
ATOM 5200   O O    . HIS C 1 30  ? 6.224   -23.877 9.162   1.00 3.11  ? 30  HIS C O    1  
ATOM 5201   C CB   . HIS C 1 30  ? 9.108   -24.297 7.682   1.00 63.22 ? 30  HIS C CB   1  
ATOM 5202   C CG   . HIS C 1 30  ? 9.243   -25.157 8.910   1.00 52.32 ? 30  HIS C CG   1  
ATOM 5203   N ND1  . HIS C 1 30  ? 8.776   -26.451 8.960   1.00 3.03  ? 30  HIS C ND1  1  
ATOM 5204   C CD2  . HIS C 1 30  ? 9.779   -24.909 10.134  1.00 32.15 ? 30  HIS C CD2  1  
ATOM 5205   C CE1  . HIS C 1 30  ? 9.012   -26.957 10.151  1.00 55.44 ? 30  HIS C CE1  1  
ATOM 5206   N NE2  . HIS C 1 30  ? 9.620   -26.047 10.880  1.00 42.33 ? 30  HIS C NE2  1  
ATOM 5207   H H    . HIS C 1 30  ? 8.471   -22.997 5.595   1.00 0.21  ? 30  HIS C H    1  
ATOM 5208   H HA   . HIS C 1 30  ? 7.165   -25.037 7.092   1.00 71.02 ? 30  HIS C HA   1  
ATOM 5209   H HB2  . HIS C 1 30  ? 9.653   -24.785 6.884   1.00 31.14 ? 30  HIS C HB2  1  
ATOM 5210   H HB3  . HIS C 1 30  ? 9.575   -23.339 7.887   1.00 21.41 ? 30  HIS C HB3  1  
ATOM 5211   H HD1  . HIS C 1 30  ? 8.334   -26.931 8.226   1.00 1.24  ? 30  HIS C HD1  1  
ATOM 5212   H HD2  . HIS C 1 30  ? 10.234  -23.985 10.464  1.00 55.23 ? 30  HIS C HD2  1  
ATOM 5213   H HE1  . HIS C 1 30  ? 8.733   -27.947 10.478  1.00 62.22 ? 30  HIS C HE1  1  
ATOM 5214   H HE2  . HIS C 1 30  ? 9.943   -26.179 11.796  1.00 37.61 ? 30  HIS C HE2  1  
ATOM 5215   N N    . VAL C 1 31  ? 6.930   -21.952 8.233   1.00 32.14 ? 31  VAL C N    1  
ATOM 5216   C CA   . VAL C 1 31  ? 6.380   -21.073 9.281   1.00 33.42 ? 31  VAL C CA   1  
ATOM 5217   C C    . VAL C 1 31  ? 4.838   -20.906 9.192   1.00 61.15 ? 31  VAL C C    1  
ATOM 5218   O O    . VAL C 1 31  ? 4.184   -20.617 10.197  1.00 4.43  ? 31  VAL C O    1  
ATOM 5219   C CB   . VAL C 1 31  ? 7.091   -19.676 9.263   1.00 11.32 ? 31  VAL C CB   1  
ATOM 5220   C CG1  . VAL C 1 31  ? 6.750   -18.863 8.000   1.00 51.01 ? 31  VAL C CG1  1  
ATOM 5221   C CG2  . VAL C 1 31  ? 6.773   -18.884 10.528  1.00 14.40 ? 31  VAL C CG2  1  
ATOM 5222   H H    . VAL C 1 31  ? 7.364   -21.541 7.454   1.00 41.11 ? 31  VAL C H    1  
ATOM 5223   H HA   . VAL C 1 31  ? 6.610   -21.542 10.240  1.00 72.12 ? 31  VAL C HA   1  
ATOM 5224   H HB   . VAL C 1 31  ? 8.164   -19.856 9.251   1.00 71.41 ? 31  VAL C HB   1  
ATOM 5225   H HG11 . VAL C 1 31  ? 5.690   -18.642 7.984   1.00 35.53 ? 31  VAL C HG11 1  
ATOM 5226   H HG12 . VAL C 1 31  ? 7.004   -19.436 7.122   1.00 74.00 ? 31  VAL C HG12 1  
ATOM 5227   H HG13 . VAL C 1 31  ? 7.311   -17.935 7.993   1.00 42.45 ? 31  VAL C HG13 1  
ATOM 5228   H HG21 . VAL C 1 31  ? 7.341   -17.980 10.536  1.00 45.23 ? 31  VAL C HG21 1  
ATOM 5229   H HG22 . VAL C 1 31  ? 7.028   -19.466 11.402  1.00 34.50 ? 31  VAL C HG22 1  
ATOM 5230   H HG23 . VAL C 1 31  ? 5.716   -18.641 10.557  1.00 71.23 ? 31  VAL C HG23 1  
ATOM 5231   N N    . PHE C 1 32  ? 4.265   -21.094 7.987   1.00 21.55 ? 32  PHE C N    1  
ATOM 5232   C CA   . PHE C 1 32  ? 2.809   -20.896 7.759   1.00 44.03 ? 32  PHE C CA   1  
ATOM 5233   C C    . PHE C 1 32  ? 1.952   -21.933 8.497   1.00 33.53 ? 32  PHE C C    1  
ATOM 5234   O O    . PHE C 1 32  ? 0.810   -21.650 8.867   1.00 53.35 ? 32  PHE C O    1  
ATOM 5235   C CB   . PHE C 1 32  ? 2.474   -20.903 6.248   1.00 73.50 ? 32  PHE C CB   1  
ATOM 5236   C CG   . PHE C 1 32  ? 3.082   -19.740 5.466   1.00 1.23  ? 32  PHE C CG   1  
ATOM 5237   C CD1  . PHE C 1 32  ? 3.286   -18.490 6.067   1.00 50.41 ? 32  PHE C CD1  1  
ATOM 5238   C CD2  . PHE C 1 32  ? 3.436   -19.887 4.128   1.00 64.20 ? 32  PHE C CD2  1  
ATOM 5239   C CE1  . PHE C 1 32  ? 3.830   -17.445 5.356   1.00 75.14 ? 32  PHE C CE1  1  
ATOM 5240   C CE2  . PHE C 1 32  ? 3.980   -18.835 3.428   1.00 54.41 ? 32  PHE C CE2  1  
ATOM 5241   C CZ   . PHE C 1 32  ? 4.179   -17.617 4.039   1.00 20.41 ? 32  PHE C CZ   1  
ATOM 5242   H H    . PHE C 1 32  ? 4.835   -21.352 7.229   1.00 74.33 ? 32  PHE C H    1  
ATOM 5243   H HA   . PHE C 1 32  ? 2.559   -19.914 8.157   1.00 22.44 ? 32  PHE C HA   1  
ATOM 5244   H HB2  . PHE C 1 32  ? 2.834   -21.829 5.811   1.00 10.15 ? 32  PHE C HB2  1  
ATOM 5245   H HB3  . PHE C 1 32  ? 1.398   -20.852 6.118   1.00 40.23 ? 32  PHE C HB3  1  
ATOM 5246   H HD1  . PHE C 1 32  ? 3.020   -18.347 7.109   1.00 53.41 ? 32  PHE C HD1  1  
ATOM 5247   H HD2  . PHE C 1 32  ? 3.282   -20.841 3.636   1.00 52.52 ? 32  PHE C HD2  1  
ATOM 5248   H HE1  . PHE C 1 32  ? 3.984   -16.487 5.836   1.00 14.44 ? 32  PHE C HE1  1  
ATOM 5249   H HE2  . PHE C 1 32  ? 4.260   -18.965 2.394   1.00 31.12 ? 32  PHE C HE2  1  
ATOM 5250   H HZ   . PHE C 1 32  ? 4.607   -16.793 3.479   1.00 34.04 ? 32  PHE C HZ   1  
ATOM 5251   N N    . GLN C 1 33  ? 2.518   -23.126 8.715   1.00 12.34 ? 33  GLN C N    1  
ATOM 5252   C CA   . GLN C 1 33  ? 1.835   -24.227 9.433   1.00 73.43 ? 33  GLN C CA   1  
ATOM 5253   C C    . GLN C 1 33  ? 2.041   -24.129 10.963  1.00 42.42 ? 33  GLN C C    1  
ATOM 5254   O O    . GLN C 1 33  ? 1.585   -25.001 11.707  1.00 12.53 ? 33  GLN C O    1  
ATOM 5255   C CB   . GLN C 1 33  ? 2.331   -25.595 8.882   1.00 62.42 ? 33  GLN C CB   1  
ATOM 5256   C CG   . GLN C 1 33  ? 3.853   -25.796 8.940   1.00 22.32 ? 33  GLN C CG   1  
ATOM 5257   C CD   . GLN C 1 33  ? 4.315   -27.126 8.352   1.00 32.41 ? 33  GLN C CD   1  
ATOM 5258   O OE1  . GLN C 1 33  ? 4.589   -27.233 7.153   1.00 50.02 ? 33  GLN C OE1  1  
ATOM 5259   N NE2  . GLN C 1 33  ? 4.402   -28.150 9.184   1.00 34.13 ? 33  GLN C NE2  1  
ATOM 5260   H H    . GLN C 1 33  ? 3.426   -23.276 8.383   1.00 61.33 ? 33  GLN C H    1  
ATOM 5261   H HA   . GLN C 1 33  ? 0.769   -24.143 9.235   1.00 50.42 ? 33  GLN C HA   1  
ATOM 5262   H HB2  . GLN C 1 33  ? 1.860   -26.394 9.445   1.00 73.25 ? 33  GLN C HB2  1  
ATOM 5263   H HB3  . GLN C 1 33  ? 2.022   -25.680 7.846   1.00 52.41 ? 33  GLN C HB3  1  
ATOM 5264   H HG2  . GLN C 1 33  ? 4.328   -24.993 8.386   1.00 2.43  ? 33  GLN C HG2  1  
ATOM 5265   H HG3  . GLN C 1 33  ? 4.177   -25.739 9.977   1.00 4.35  ? 33  GLN C HG3  1  
ATOM 5266   H HE21 . GLN C 1 33  ? 4.166   -28.008 10.125  1.00 25.34 ? 33  GLN C HE21 1  
ATOM 5267   H HE22 . GLN C 1 33  ? 4.719   -29.008 8.830   1.00 1.11  ? 33  GLN C HE22 1  
ATOM 5268   N N    . LYS C 1 34  ? 2.691   -23.042 11.425  1.00 2.02  ? 34  LYS C N    1  
ATOM 5269   C CA   . LYS C 1 34  ? 2.937   -22.788 12.859  1.00 73.31 ? 34  LYS C CA   1  
ATOM 5270   C C    . LYS C 1 34  ? 1.760   -22.012 13.475  1.00 41.43 ? 34  LYS C C    1  
ATOM 5271   O O    . LYS C 1 34  ? 1.098   -21.223 12.782  1.00 50.40 ? 34  LYS C O    1  
ATOM 5272   C CB   . LYS C 1 34  ? 4.237   -21.951 13.045  1.00 41.24 ? 34  LYS C CB   1  
ATOM 5273   C CG   . LYS C 1 34  ? 4.670   -21.738 14.523  1.00 31.25 ? 34  LYS C CG   1  
ATOM 5274   C CD   . LYS C 1 34  ? 5.459   -22.922 15.133  1.00 43.11 ? 34  LYS C CD   1  
ATOM 5275   C CE   . LYS C 1 34  ? 6.969   -22.860 14.816  1.00 3.42  ? 34  LYS C CE   1  
ATOM 5276   N NZ   . LYS C 1 34  ? 7.264   -22.950 13.357  1.00 43.12 ? 34  LYS C NZ   1  
ATOM 5277   H H    . LYS C 1 34  ? 3.006   -22.377 10.780  1.00 51.42 ? 34  LYS C H    1  
ATOM 5278   H HA   . LYS C 1 34  ? 3.051   -23.741 13.371  1.00 73.35 ? 34  LYS C HA   1  
ATOM 5279   H HB2  . LYS C 1 34  ? 5.047   -22.447 12.522  1.00 0.32  ? 34  LYS C HB2  1  
ATOM 5280   H HB3  . LYS C 1 34  ? 4.091   -20.973 12.588  1.00 41.21 ? 34  LYS C HB3  1  
ATOM 5281   H HG2  . LYS C 1 34  ? 5.288   -20.852 14.577  1.00 43.33 ? 34  LYS C HG2  1  
ATOM 5282   H HG3  . LYS C 1 34  ? 3.777   -21.565 15.121  1.00 53.00 ? 34  LYS C HG3  1  
ATOM 5283   H HD2  . LYS C 1 34  ? 5.333   -22.907 16.210  1.00 30.42 ? 34  LYS C HD2  1  
ATOM 5284   H HD3  . LYS C 1 34  ? 5.056   -23.853 14.748  1.00 43.24 ? 34  LYS C HD3  1  
ATOM 5285   H HE2  . LYS C 1 34  ? 7.372   -21.929 15.192  1.00 21.10 ? 34  LYS C HE2  1  
ATOM 5286   H HE3  . LYS C 1 34  ? 7.463   -23.683 15.319  1.00 60.55 ? 34  LYS C HE3  1  
ATOM 5287   H HZ1  . LYS C 1 34  ? 8.161   -22.474 13.141  1.00 74.22 ? 34  LYS C HZ1  1  
ATOM 5288   H HZ2  . LYS C 1 34  ? 6.517   -22.502 12.803  1.00 65.45 ? 34  LYS C HZ2  1  
ATOM 5289   H HZ3  . LYS C 1 34  ? 7.341   -23.947 13.067  1.00 14.54 ? 34  LYS C HZ3  1  
ATOM 5290   N N    . ASP C 1 35  ? 1.523   -22.238 14.780  1.00 43.11 ? 35  ASP C N    1  
ATOM 5291   C CA   . ASP C 1 35  ? 0.626   -21.405 15.593  1.00 45.45 ? 35  ASP C CA   1  
ATOM 5292   C C    . ASP C 1 35  ? 1.169   -19.957 15.654  1.00 74.10 ? 35  ASP C C    1  
ATOM 5293   O O    . ASP C 1 35  ? 2.321   -19.736 16.050  1.00 4.23  ? 35  ASP C O    1  
ATOM 5294   C CB   . ASP C 1 35  ? 0.483   -21.985 17.024  1.00 61.14 ? 35  ASP C CB   1  
ATOM 5295   C CG   . ASP C 1 35  ? -0.462  -21.141 17.902  1.00 65.22 ? 35  ASP C CG   1  
ATOM 5296   O OD1  . ASP C 1 35  ? -1.696  -21.291 17.777  1.00 13.10 ? 35  ASP C OD1  1  
ATOM 5297   O OD2  . ASP C 1 35  ? 0.021   -20.302 18.692  1.00 34.32 ? 35  ASP C OD2  1  
ATOM 5298   H H    . ASP C 1 35  ? 1.967   -22.996 15.208  1.00 54.20 ? 35  ASP C H    1  
ATOM 5299   H HA   . ASP C 1 35  ? -0.351  -21.404 15.114  1.00 41.01 ? 35  ASP C HA   1  
ATOM 5300   H HB2  . ASP C 1 35  ? 0.093   -22.999 16.960  1.00 14.44 ? 35  ASP C HB2  1  
ATOM 5301   H HB3  . ASP C 1 35  ? 1.464   -22.027 17.494  1.00 14.13 ? 35  ASP C HB3  1  
ATOM 5302   N N    . TRP C 1 36  ? 0.331   -18.994 15.249  1.00 73.54 ? 36  TRP C N    1  
ATOM 5303   C CA   . TRP C 1 36  ? 0.714   -17.583 15.146  1.00 14.53 ? 36  TRP C CA   1  
ATOM 5304   C C    . TRP C 1 36  ? 0.713   -16.902 16.530  1.00 73.00 ? 36  TRP C C    1  
ATOM 5305   O O    . TRP C 1 36  ? -0.343  -16.504 17.044  1.00 64.33 ? 36  TRP C O    1  
ATOM 5306   C CB   . TRP C 1 36  ? -0.231  -16.852 14.160  1.00 21.42 ? 36  TRP C CB   1  
ATOM 5307   C CG   . TRP C 1 36  ? 0.135   -15.405 13.910  1.00 11.23 ? 36  TRP C CG   1  
ATOM 5308   C CD1  . TRP C 1 36  ? -0.598  -14.293 14.229  1.00 12.13 ? 36  TRP C CD1  1  
ATOM 5309   C CD2  . TRP C 1 36  ? 1.345   -14.923 13.306  1.00 74.32 ? 36  TRP C CD2  1  
ATOM 5310   N NE1  . TRP C 1 36  ? 0.063   -13.165 13.821  1.00 11.51 ? 36  TRP C NE1  1  
ATOM 5311   C CE2  . TRP C 1 36  ? 1.257   -13.522 13.260  1.00 72.34 ? 36  TRP C CE2  1  
ATOM 5312   C CE3  . TRP C 1 36  ? 2.490   -15.546 12.791  1.00 72.22 ? 36  TRP C CE3  1  
ATOM 5313   C CZ2  . TRP C 1 36  ? 2.264   -12.732 12.717  1.00 0.31  ? 36  TRP C CZ2  1  
ATOM 5314   C CZ3  . TRP C 1 36  ? 3.490   -14.762 12.263  1.00 4.14  ? 36  TRP C CZ3  1  
ATOM 5315   C CH2  . TRP C 1 36  ? 3.372   -13.369 12.228  1.00 44.32 ? 36  TRP C CH2  1  
ATOM 5316   H H    . TRP C 1 36  ? -0.584  -19.244 15.011  1.00 43.21 ? 36  TRP C H    1  
ATOM 5317   H HA   . TRP C 1 36  ? 1.724   -17.543 14.738  1.00 32.53 ? 36  TRP C HA   1  
ATOM 5318   H HB2  . TRP C 1 36  ? -0.214  -17.366 13.204  1.00 5.33  ? 36  TRP C HB2  1  
ATOM 5319   H HB3  . TRP C 1 36  ? -1.243  -16.884 14.548  1.00 71.22 ? 36  TRP C HB3  1  
ATOM 5320   H HD1  . TRP C 1 36  ? -1.568  -14.315 14.707  1.00 70.42 ? 36  TRP C HD1  1  
ATOM 5321   H HE1  . TRP C 1 36  ? -0.264  -12.247 13.923  1.00 52.42 ? 36  TRP C HE1  1  
ATOM 5322   H HE3  . TRP C 1 36  ? 2.601   -16.624 12.817  1.00 62.54 ? 36  TRP C HE3  1  
ATOM 5323   H HZ2  . TRP C 1 36  ? 2.185   -11.654 12.678  1.00 30.30 ? 36  TRP C HZ2  1  
ATOM 5324   H HZ3  . TRP C 1 36  ? 4.386   -15.225 11.867  1.00 4.33  ? 36  TRP C HZ3  1  
ATOM 5325   H HH2  . TRP C 1 36  ? 4.182   -12.798 11.808  1.00 34.41 ? 36  TRP C HH2  1  
ATOM 5326   N N    . GLN C 1 37  ? 1.905   -16.809 17.131  1.00 42.55 ? 37  GLN C N    1  
ATOM 5327   C CA   . GLN C 1 37  ? 2.130   -16.078 18.383  1.00 55.33 ? 37  GLN C CA   1  
ATOM 5328   C C    . GLN C 1 37  ? 3.609   -15.616 18.427  1.00 70.33 ? 37  GLN C C    1  
ATOM 5329   O O    . GLN C 1 37  ? 4.462   -16.284 19.030  1.00 22.13 ? 37  GLN C O    1  
ATOM 5330   C CB   . GLN C 1 37  ? 1.732   -16.959 19.599  1.00 64.52 ? 37  GLN C CB   1  
ATOM 5331   C CG   . GLN C 1 37  ? 1.803   -16.250 20.962  1.00 44.32 ? 37  GLN C CG   1  
ATOM 5332   C CD   . GLN C 1 37  ? 1.298   -17.127 22.106  1.00 31.12 ? 37  GLN C CD   1  
ATOM 5333   O OE1  . GLN C 1 37  ? 2.063   -17.870 22.723  1.00 63.31 ? 37  GLN C OE1  1  
ATOM 5334   N NE2  . GLN C 1 37  ? 0.001   -17.067 22.382  1.00 71.20 ? 37  GLN C NE2  1  
ATOM 5335   H H    . GLN C 1 37  ? 2.668   -17.264 16.718  1.00 24.54 ? 37  GLN C H    1  
ATOM 5336   H HA   . GLN C 1 37  ? 1.501   -15.189 18.370  1.00 60.54 ? 37  GLN C HA   1  
ATOM 5337   H HB2  . GLN C 1 37  ? 0.714   -17.300 19.450  1.00 63.23 ? 37  GLN C HB2  1  
ATOM 5338   H HB3  . GLN C 1 37  ? 2.383   -17.829 19.629  1.00 75.01 ? 37  GLN C HB3  1  
ATOM 5339   H HG2  . GLN C 1 37  ? 2.833   -15.976 21.162  1.00 60.41 ? 37  GLN C HG2  1  
ATOM 5340   H HG3  . GLN C 1 37  ? 1.201   -15.349 20.920  1.00 11.43 ? 37  GLN C HG3  1  
ATOM 5341   H HE21 . GLN C 1 37  ? -0.561  -16.473 21.839  1.00 43.33 ? 37  GLN C HE21 1  
ATOM 5342   H HE22 . GLN C 1 37  ? -0.344  -17.617 23.117  1.00 3.24  ? 37  GLN C HE22 1  
ATOM 5343   N N    . PRO C 1 38  ? 3.954   -14.510 17.679  1.00 61.42 ? 38  PRO C N    1  
ATOM 5344   C CA   . PRO C 1 38  ? 5.334   -14.014 17.572  1.00 40.52 ? 38  PRO C CA   1  
ATOM 5345   C C    . PRO C 1 38  ? 5.706   -12.971 18.643  1.00 30.43 ? 38  PRO C C    1  
ATOM 5346   O O    . PRO C 1 38  ? 4.866   -12.203 19.129  1.00 23.04 ? 38  PRO C O    1  
ATOM 5347   C CB   . PRO C 1 38  ? 5.367   -13.394 16.154  1.00 23.14 ? 38  PRO C CB   1  
ATOM 5348   C CG   . PRO C 1 38  ? 3.950   -12.963 15.868  1.00 11.30 ? 38  PRO C CG   1  
ATOM 5349   C CD   . PRO C 1 38  ? 3.032   -13.669 16.865  1.00 12.32 ? 38  PRO C CD   1  
ATOM 5350   H HA   . PRO C 1 38  ? 6.045   -14.838 17.611  1.00 71.42 ? 38  PRO C HA   1  
ATOM 5351   H HB2  . PRO C 1 38  ? 6.057   -12.548 16.120  1.00 71.14 ? 38  PRO C HB2  1  
ATOM 5352   H HB3  . PRO C 1 38  ? 5.684   -14.137 15.427  1.00 53.23 ? 38  PRO C HB3  1  
ATOM 5353   H HG2  . PRO C 1 38  ? 3.865   -11.883 15.971  1.00 60.20 ? 38  PRO C HG2  1  
ATOM 5354   H HG3  . PRO C 1 38  ? 3.681   -13.253 14.856  1.00 42.32 ? 38  PRO C HG3  1  
ATOM 5355   H HD2  . PRO C 1 38  ? 2.518   -12.948 17.490  1.00 20.33 ? 38  PRO C HD2  1  
ATOM 5356   H HD3  . PRO C 1 38  ? 2.306   -14.287 16.344  1.00 31.24 ? 38  PRO C HD3  1  
ATOM 5357   N N    . GLU C 1 39  ? 6.986   -12.981 18.984  1.00 53.35 ? 39  GLU C N    1  
ATOM 5358   C CA   . GLU C 1 39  ? 7.643   -11.949 19.771  1.00 42.44 ? 39  GLU C CA   1  
ATOM 5359   C C    . GLU C 1 39  ? 8.144   -10.876 18.793  1.00 33.22 ? 39  GLU C C    1  
ATOM 5360   O O    . GLU C 1 39  ? 9.121   -11.098 18.061  1.00 13.23 ? 39  GLU C O    1  
ATOM 5361   C CB   . GLU C 1 39  ? 8.819   -12.579 20.556  1.00 2.32  ? 39  GLU C CB   1  
ATOM 5362   C CG   . GLU C 1 39  ? 8.410   -13.774 21.443  1.00 75.43 ? 39  GLU C CG   1  
ATOM 5363   C CD   . GLU C 1 39  ? 9.598   -14.374 22.200  1.00 30.42 ? 39  GLU C CD   1  
ATOM 5364   O OE1  . GLU C 1 39  ? 9.857   -13.947 23.347  1.00 4.12  ? 39  GLU C OE1  1  
ATOM 5365   O OE2  . GLU C 1 39  ? 10.300  -15.246 21.641  1.00 41.23 ? 39  GLU C OE2  1  
ATOM 5366   H H    . GLU C 1 39  ? 7.522   -13.732 18.694  1.00 3.21  ? 39  GLU C H    1  
ATOM 5367   H HA   . GLU C 1 39  ? 6.930   -11.513 20.468  1.00 5.23  ? 39  GLU C HA   1  
ATOM 5368   H HB2  . GLU C 1 39  ? 9.567   -12.923 19.846  1.00 30.02 ? 39  GLU C HB2  1  
ATOM 5369   H HB3  . GLU C 1 39  ? 9.267   -11.822 21.184  1.00 62.30 ? 39  GLU C HB3  1  
ATOM 5370   H HG2  . GLU C 1 39  ? 7.660   -13.444 22.159  1.00 15.11 ? 39  GLU C HG2  1  
ATOM 5371   H HG3  . GLU C 1 39  ? 7.968   -14.542 20.812  1.00 21.44 ? 39  GLU C HG3  1  
ATOM 5372   N N    . VAL C 1 40  ? 7.415   -9.757  18.729  1.00 4.10  ? 40  VAL C N    1  
ATOM 5373   C CA   . VAL C 1 40  ? 7.703   -8.672  17.790  1.00 24.41 ? 40  VAL C CA   1  
ATOM 5374   C C    . VAL C 1 40  ? 8.832   -7.788  18.347  1.00 1.31  ? 40  VAL C C    1  
ATOM 5375   O O    . VAL C 1 40  ? 8.610   -6.983  19.253  1.00 72.21 ? 40  VAL C O    1  
ATOM 5376   C CB   . VAL C 1 40  ? 6.417   -7.814  17.479  1.00 14.23 ? 40  VAL C CB   1  
ATOM 5377   C CG1  . VAL C 1 40  ? 6.720   -6.701  16.445  1.00 62.04 ? 40  VAL C CG1  1  
ATOM 5378   C CG2  . VAL C 1 40  ? 5.249   -8.724  17.012  1.00 21.33 ? 40  VAL C CG2  1  
ATOM 5379   H H    . VAL C 1 40  ? 6.658   -9.655  19.343  1.00 5.42  ? 40  VAL C H    1  
ATOM 5380   H HA   . VAL C 1 40  ? 8.036   -9.120  16.855  1.00 3.44  ? 40  VAL C HA   1  
ATOM 5381   H HB   . VAL C 1 40  ? 6.107   -7.328  18.403  1.00 2.25  ? 40  VAL C HB   1  
ATOM 5382   H HG11 . VAL C 1 40  ? 5.825   -6.124  16.246  1.00 54.24 ? 40  VAL C HG11 1  
ATOM 5383   H HG12 . VAL C 1 40  ? 7.071   -7.143  15.522  1.00 24.34 ? 40  VAL C HG12 1  
ATOM 5384   H HG13 . VAL C 1 40  ? 7.487   -6.040  16.834  1.00 75.13 ? 40  VAL C HG13 1  
ATOM 5385   H HG21 . VAL C 1 40  ? 5.524   -9.237  16.099  1.00 71.34 ? 40  VAL C HG21 1  
ATOM 5386   H HG22 . VAL C 1 40  ? 4.363   -8.127  16.830  1.00 34.00 ? 40  VAL C HG22 1  
ATOM 5387   H HG23 . VAL C 1 40  ? 5.027   -9.457  17.779  1.00 61.05 ? 40  VAL C HG23 1  
ATOM 5388   N N    . LYS C 1 41  ? 10.051  -7.983  17.825  1.00 62.12 ? 41  LYS C N    1  
ATOM 5389   C CA   . LYS C 1 41  ? 11.223  -7.190  18.213  1.00 22.31 ? 41  LYS C CA   1  
ATOM 5390   C C    . LYS C 1 41  ? 11.320  -6.014  17.234  1.00 72.21 ? 41  LYS C C    1  
ATOM 5391   O O    . LYS C 1 41  ? 11.638  -6.207  16.061  1.00 12.24 ? 41  LYS C O    1  
ATOM 5392   C CB   . LYS C 1 41  ? 12.518  -8.081  18.188  1.00 24.32 ? 41  LYS C CB   1  
ATOM 5393   C CG   . LYS C 1 41  ? 13.779  -7.479  18.882  1.00 23.50 ? 41  LYS C CG   1  
ATOM 5394   C CD   . LYS C 1 41  ? 14.470  -6.336  18.087  1.00 64.42 ? 41  LYS C CD   1  
ATOM 5395   C CE   . LYS C 1 41  ? 15.622  -5.663  18.860  1.00 51.30 ? 41  LYS C CE   1  
ATOM 5396   N NZ   . LYS C 1 41  ? 16.052  -4.380  18.230  1.00 60.25 ? 41  LYS C NZ   1  
ATOM 5397   H H    . LYS C 1 41  ? 10.165  -8.680  17.143  1.00 52.04 ? 41  LYS C H    1  
ATOM 5398   H HA   . LYS C 1 41  ? 11.074  -6.812  19.225  1.00 55.45 ? 41  LYS C HA   1  
ATOM 5399   H HB2  . LYS C 1 41  ? 12.291  -9.021  18.675  1.00 32.41 ? 41  LYS C HB2  1  
ATOM 5400   H HB3  . LYS C 1 41  ? 12.772  -8.297  17.154  1.00 21.24 ? 41  LYS C HB3  1  
ATOM 5401   H HG2  . LYS C 1 41  ? 13.481  -7.088  19.844  1.00 31.12 ? 41  LYS C HG2  1  
ATOM 5402   H HG3  . LYS C 1 41  ? 14.500  -8.275  19.039  1.00 61.14 ? 41  LYS C HG3  1  
ATOM 5403   H HD2  . LYS C 1 41  ? 14.863  -6.738  17.160  1.00 2.23  ? 41  LYS C HD2  1  
ATOM 5404   H HD3  . LYS C 1 41  ? 13.728  -5.584  17.852  1.00 24.50 ? 41  LYS C HD3  1  
ATOM 5405   H HE2  . LYS C 1 41  ? 15.296  -5.454  19.871  1.00 31.03 ? 41  LYS C HE2  1  
ATOM 5406   H HE3  . LYS C 1 41  ? 16.471  -6.334  18.895  1.00 15.45 ? 41  LYS C HE3  1  
ATOM 5407   H HZ1  . LYS C 1 41  ? 15.257  -3.706  18.216  1.00 3.12  ? 41  LYS C HZ1  1  
ATOM 5408   H HZ2  . LYS C 1 41  ? 16.363  -4.543  17.254  1.00 5.53  ? 41  LYS C HZ2  1  
ATOM 5409   H HZ3  . LYS C 1 41  ? 16.833  -3.958  18.765  1.00 24.43 ? 41  LYS C HZ3  1  
ATOM 5410   N N    . LEU C 1 42  ? 11.048  -4.798  17.717  1.00 43.24 ? 42  LEU C N    1  
ATOM 5411   C CA   . LEU C 1 42  ? 11.124  -3.583  16.890  1.00 71.12 ? 42  LEU C CA   1  
ATOM 5412   C C    . LEU C 1 42  ? 12.566  -3.063  16.872  1.00 62.24 ? 42  LEU C C    1  
ATOM 5413   O O    . LEU C 1 42  ? 13.368  -3.397  17.749  1.00 73.42 ? 42  LEU C O    1  
ATOM 5414   C CB   . LEU C 1 42  ? 10.142  -2.485  17.426  1.00 33.44 ? 42  LEU C CB   1  
ATOM 5415   C CG   . LEU C 1 42  ? 10.301  -1.998  18.931  1.00 63.43 ? 42  LEU C CG   1  
ATOM 5416   C CD1  . LEU C 1 42  ? 11.520  -1.058  19.175  1.00 52.31 ? 42  LEU C CD1  1  
ATOM 5417   C CD2  . LEU C 1 42  ? 9.012   -1.317  19.427  1.00 32.22 ? 42  LEU C CD2  1  
ATOM 5418   H H    . LEU C 1 42  ? 10.803  -4.712  18.661  1.00 22.32 ? 42  LEU C H    1  
ATOM 5419   H HA   . LEU C 1 42  ? 10.832  -3.849  15.868  1.00 45.22 ? 42  LEU C HA   1  
ATOM 5420   H HB2  . LEU C 1 42  ? 10.229  -1.616  16.780  1.00 10.20 ? 42  LEU C HB2  1  
ATOM 5421   H HB3  . LEU C 1 42  ? 9.134   -2.875  17.307  1.00 53.31 ? 42  LEU C HB3  1  
ATOM 5422   H HG   . LEU C 1 42  ? 10.452  -2.869  19.554  1.00 11.34 ? 42  LEU C HG   1  
ATOM 5423   H HD11 . LEU C 1 42  ? 11.446  -0.183  18.542  1.00 64.12 ? 42  LEU C HD11 1  
ATOM 5424   H HD12 . LEU C 1 42  ? 12.434  -1.587  18.950  1.00 43.53 ? 42  LEU C HD12 1  
ATOM 5425   H HD13 . LEU C 1 42  ? 11.542  -0.748  20.212  1.00 14.41 ? 42  LEU C HD13 1  
ATOM 5426   H HD21 . LEU C 1 42  ? 8.181   -1.993  19.320  1.00 70.43 ? 42  LEU C HD21 1  
ATOM 5427   H HD22 . LEU C 1 42  ? 8.819   -0.419  18.853  1.00 32.34 ? 42  LEU C HD22 1  
ATOM 5428   H HD23 . LEU C 1 42  ? 9.117   -1.051  20.475  1.00 24.31 ? 42  LEU C HD23 1  
ATOM 5429   N N    . ASP C 1 43  ? 12.866  -2.222  15.894  1.00 32.41 ? 43  ASP C N    1  
ATOM 5430   C CA   . ASP C 1 43  ? 14.130  -1.497  15.826  1.00 54.52 ? 43  ASP C CA   1  
ATOM 5431   C C    . ASP C 1 43  ? 13.854  -0.145  15.176  1.00 12.30 ? 43  ASP C C    1  
ATOM 5432   O O    . ASP C 1 43  ? 13.143  -0.070  14.167  1.00 1.21  ? 43  ASP C O    1  
ATOM 5433   C CB   . ASP C 1 43  ? 15.207  -2.294  15.038  1.00 65.43 ? 43  ASP C CB   1  
ATOM 5434   C CG   . ASP C 1 43  ? 16.618  -1.708  15.221  1.00 1.24  ? 43  ASP C CG   1  
ATOM 5435   O OD1  . ASP C 1 43  ? 16.959  -0.712  14.548  1.00 30.21 ? 43  ASP C OD1  1  
ATOM 5436   O OD2  . ASP C 1 43  ? 17.385  -2.231  16.062  1.00 3.03  ? 43  ASP C OD2  1  
ATOM 5437   H H    . ASP C 1 43  ? 12.205  -2.072  15.183  1.00 14.31 ? 43  ASP C H    1  
ATOM 5438   H HA   . ASP C 1 43  ? 14.479  -1.333  16.848  1.00 71.34 ? 43  ASP C HA   1  
ATOM 5439   H HB2  . ASP C 1 43  ? 15.202  -3.327  15.380  1.00 63.15 ? 43  ASP C HB2  1  
ATOM 5440   H HB3  . ASP C 1 43  ? 14.961  -2.288  13.983  1.00 25.31 ? 43  ASP C HB3  1  
ATOM 5441   N N    . LEU C 1 44  ? 14.407  0.908   15.773  1.00 53.32 ? 44  LEU C N    1  
ATOM 5442   C CA   . LEU C 1 44  ? 14.204  2.286   15.331  1.00 65.44 ? 44  LEU C CA   1  
ATOM 5443   C C    . LEU C 1 44  ? 15.594  2.923   15.185  1.00 12.42 ? 44  LEU C C    1  
ATOM 5444   O O    . LEU C 1 44  ? 16.299  3.137   16.180  1.00 13.44 ? 44  LEU C O    1  
ATOM 5445   C CB   . LEU C 1 44  ? 13.301  3.030   16.374  1.00 74.01 ? 44  LEU C CB   1  
ATOM 5446   C CG   . LEU C 1 44  ? 12.549  4.318   15.889  1.00 62.33 ? 44  LEU C CG   1  
ATOM 5447   C CD1  . LEU C 1 44  ? 13.500  5.518   15.682  1.00 64.41 ? 44  LEU C CD1  1  
ATOM 5448   C CD2  . LEU C 1 44  ? 11.720  4.018   14.610  1.00 74.13 ? 44  LEU C CD2  1  
ATOM 5449   H H    . LEU C 1 44  ? 14.991  0.749   16.542  1.00 63.44 ? 44  LEU C H    1  
ATOM 5450   H HA   . LEU C 1 44  ? 13.697  2.280   14.357  1.00 65.43 ? 44  LEU C HA   1  
ATOM 5451   H HB2  . LEU C 1 44  ? 12.548  2.323   16.724  1.00 72.23 ? 44  LEU C HB2  1  
ATOM 5452   H HB3  . LEU C 1 44  ? 13.912  3.295   17.230  1.00 74.03 ? 44  LEU C HB3  1  
ATOM 5453   H HG   . LEU C 1 44  ? 11.845  4.612   16.660  1.00 62.30 ? 44  LEU C HG   1  
ATOM 5454   H HD11 . LEU C 1 44  ? 14.023  5.731   16.606  1.00 70.23 ? 44  LEU C HD11 1  
ATOM 5455   H HD12 . LEU C 1 44  ? 12.929  6.394   15.396  1.00 53.22 ? 44  LEU C HD12 1  
ATOM 5456   H HD13 . LEU C 1 44  ? 14.223  5.297   14.906  1.00 74.05 ? 44  LEU C HD13 1  
ATOM 5457   H HD21 . LEU C 1 44  ? 11.164  4.899   14.321  1.00 24.41 ? 44  LEU C HD21 1  
ATOM 5458   H HD22 . LEU C 1 44  ? 11.026  3.212   14.805  1.00 74.11 ? 44  LEU C HD22 1  
ATOM 5459   H HD23 . LEU C 1 44  ? 12.380  3.731   13.798  1.00 22.04 ? 44  LEU C HD23 1  
ATOM 5460   N N    . ASP C 1 45  ? 15.974  3.200   13.940  1.00 12.02 ? 45  ASP C N    1  
ATOM 5461   C CA   . ASP C 1 45  ? 17.282  3.765   13.587  1.00 34.33 ? 45  ASP C CA   1  
ATOM 5462   C C    . ASP C 1 45  ? 17.072  5.067   12.802  1.00 15.10 ? 45  ASP C C    1  
ATOM 5463   O O    . ASP C 1 45  ? 16.044  5.247   12.146  1.00 45.32 ? 45  ASP C O    1  
ATOM 5464   C CB   . ASP C 1 45  ? 18.092  2.712   12.786  1.00 71.31 ? 45  ASP C CB   1  
ATOM 5465   C CG   . ASP C 1 45  ? 19.407  3.251   12.203  1.00 55.40 ? 45  ASP C CG   1  
ATOM 5466   O OD1  . ASP C 1 45  ? 20.337  3.540   12.982  1.00 53.24 ? 45  ASP C OD1  1  
ATOM 5467   O OD2  . ASP C 1 45  ? 19.516  3.388   10.970  1.00 43.31 ? 45  ASP C OD2  1  
ATOM 5468   H H    . ASP C 1 45  ? 15.340  3.014   13.214  1.00 41.23 ? 45  ASP C H    1  
ATOM 5469   H HA   . ASP C 1 45  ? 17.818  4.000   14.506  1.00 52.24 ? 45  ASP C HA   1  
ATOM 5470   H HB2  . ASP C 1 45  ? 18.327  1.878   13.444  1.00 34.43 ? 45  ASP C HB2  1  
ATOM 5471   H HB3  . ASP C 1 45  ? 17.471  2.335   11.977  1.00 70.31 ? 45  ASP C HB3  1  
ATOM 5472   N N    . THR C 1 46  ? 18.050  5.976   12.887  1.00 41.43 ? 46  THR C N    1  
ATOM 5473   C CA   . THR C 1 46  ? 17.925  7.353   12.385  1.00 4.44  ? 46  THR C CA   1  
ATOM 5474   C C    . THR C 1 46  ? 18.948  7.641   11.266  1.00 51.34 ? 46  THR C C    1  
ATOM 5475   O O    . THR C 1 46  ? 20.126  7.311   11.411  1.00 12.34 ? 46  THR C O    1  
ATOM 5476   C CB   . THR C 1 46  ? 18.125  8.349   13.573  1.00 24.14 ? 46  THR C CB   1  
ATOM 5477   O OG1  . THR C 1 46  ? 19.390  8.119   14.230  1.00 63.24 ? 46  THR C OG1  1  
ATOM 5478   C CG2  . THR C 1 46  ? 16.992  8.238   14.613  1.00 42.34 ? 46  THR C CG2  1  
ATOM 5479   H H    . THR C 1 46  ? 18.895  5.711   13.309  1.00 0.01  ? 46  THR C H    1  
ATOM 5480   H HA   . THR C 1 46  ? 16.918  7.493   11.989  1.00 65.44 ? 46  THR C HA   1  
ATOM 5481   H HB   . THR C 1 46  ? 18.126  9.355   13.177  1.00 33.21 ? 46  THR C HB   1  
ATOM 5482   H HG1  . THR C 1 46  ? 20.069  7.908   13.576  1.00 44.11 ? 46  THR C HG1  1  
ATOM 5483   H HG21 . THR C 1 46  ? 16.965  7.235   15.023  1.00 3.31  ? 46  THR C HG21 1  
ATOM 5484   H HG22 . THR C 1 46  ? 16.041  8.455   14.144  1.00 42.15 ? 46  THR C HG22 1  
ATOM 5485   H HG23 . THR C 1 46  ? 17.160  8.947   15.413  1.00 30.11 ? 46  THR C HG23 1  
ATOM 5486   N N    . ALA C 1 47  ? 18.490  8.275   10.168  1.00 32.10 ? 47  ALA C N    1  
ATOM 5487   C CA   . ALA C 1 47  ? 19.349  8.635   9.018   1.00 51.20 ? 47  ALA C CA   1  
ATOM 5488   C C    . ALA C 1 47  ? 18.873  9.948   8.383   1.00 51.21 ? 47  ALA C C    1  
ATOM 5489   O O    . ALA C 1 47  ? 17.717  10.348  8.562   1.00 20.13 ? 47  ALA C O    1  
ATOM 5490   C CB   . ALA C 1 47  ? 19.356  7.506   7.979   1.00 45.34 ? 47  ALA C CB   1  
ATOM 5491   H H    . ALA C 1 47  ? 17.537  8.518   10.128  1.00 52.00 ? 47  ALA C H    1  
ATOM 5492   H HA   . ALA C 1 47  ? 20.367  8.774   9.378   1.00 72.23 ? 47  ALA C HA   1  
ATOM 5493   H HB1  . ALA C 1 47  ? 20.018  7.759   7.160   1.00 15.43 ? 47  ALA C HB1  1  
ATOM 5494   H HB2  . ALA C 1 47  ? 18.354  7.353   7.596   1.00 14.43 ? 47  ALA C HB2  1  
ATOM 5495   H HB3  . ALA C 1 47  ? 19.699  6.591   8.444   1.00 64.34 ? 47  ALA C HB3  1  
ATOM 5496   N N    . SER C 1 48  ? 19.766  10.599  7.622   1.00 4.13  ? 48  SER C N    1  
ATOM 5497   C CA   . SER C 1 48  ? 19.501  11.912  7.000   1.00 72.22 ? 48  SER C CA   1  
ATOM 5498   C C    . SER C 1 48  ? 20.459  12.176  5.826   1.00 1.53  ? 48  SER C C    1  
ATOM 5499   O O    . SER C 1 48  ? 21.424  11.430  5.617   1.00 5.32  ? 48  SER C O    1  
ATOM 5500   C CB   . SER C 1 48  ? 19.669  13.048  8.045   1.00 74.52 ? 48  SER C CB   1  
ATOM 5501   O OG   . SER C 1 48  ? 18.717  12.965  9.086   1.00 41.41 ? 48  SER C OG   1  
ATOM 5502   H H    . SER C 1 48  ? 20.638  10.181  7.463   1.00 61.23 ? 48  SER C H    1  
ATOM 5503   H HA   . SER C 1 48  ? 18.479  11.916  6.628   1.00 70.30 ? 48  SER C HA   1  
ATOM 5504   H HB2  . SER C 1 48  ? 20.657  12.995  8.485   1.00 51.32 ? 48  SER C HB2  1  
ATOM 5505   H HB3  . SER C 1 48  ? 19.553  14.012  7.559   1.00 12.41 ? 48  SER C HB3  1  
ATOM 5506   H HG   . SER C 1 48  ? 17.924  12.531  8.760   1.00 63.12 ? 48  SER C HG   1  
ATOM 5507   N N    . SER C 1 49  ? 20.169  13.260  5.080   1.00 51.22 ? 49  SER C N    1  
ATOM 5508   C CA   . SER C 1 49  ? 21.096  13.860  4.105   1.00 30.11 ? 49  SER C CA   1  
ATOM 5509   C C    . SER C 1 49  ? 20.753  15.350  3.942   1.00 34.42 ? 49  SER C C    1  
ATOM 5510   O O    . SER C 1 49  ? 19.570  15.722  3.951   1.00 3.22  ? 49  SER C O    1  
ATOM 5511   C CB   . SER C 1 49  ? 21.032  13.143  2.730   1.00 62.32 ? 49  SER C CB   1  
ATOM 5512   O OG   . SER C 1 49  ? 19.759  13.277  2.121   1.00 21.33 ? 49  SER C OG   1  
ATOM 5513   H H    . SER C 1 49  ? 19.285  13.674  5.188   1.00 71.21 ? 49  SER C H    1  
ATOM 5514   H HA   . SER C 1 49  ? 22.105  13.779  4.506   1.00 70.54 ? 49  SER C HA   1  
ATOM 5515   H HB2  . SER C 1 49  ? 21.775  13.563  2.065   1.00 23.02 ? 49  SER C HB2  1  
ATOM 5516   H HB3  . SER C 1 49  ? 21.238  12.090  2.865   1.00 35.14 ? 49  SER C HB3  1  
ATOM 5517   H HG   . SER C 1 49  ? 19.102  12.841  2.669   1.00 31.32 ? 49  SER C HG   1  
ATOM 5518   N N    . GLN C 1 50  ? 21.784  16.201  3.824   1.00 40.44 ? 50  GLN C N    1  
ATOM 5519   C CA   . GLN C 1 50  ? 21.607  17.624  3.519   1.00 4.22  ? 50  GLN C CA   1  
ATOM 5520   C C    . GLN C 1 50  ? 21.540  17.782  2.000   1.00 64.10 ? 50  GLN C C    1  
ATOM 5521   O O    . GLN C 1 50  ? 22.463  17.377  1.289   1.00 51.34 ? 50  GLN C O    1  
ATOM 5522   C CB   . GLN C 1 50  ? 22.761  18.484  4.099   1.00 22.44 ? 50  GLN C CB   1  
ATOM 5523   C CG   . GLN C 1 50  ? 22.641  19.987  3.751   1.00 30.21 ? 50  GLN C CG   1  
ATOM 5524   C CD   . GLN C 1 50  ? 23.715  20.873  4.376   1.00 63.14 ? 50  GLN C CD   1  
ATOM 5525   O OE1  . GLN C 1 50  ? 24.840  20.445  4.615   1.00 51.34 ? 50  GLN C OE1  1  
ATOM 5526   N NE2  . GLN C 1 50  ? 23.371  22.124  4.631   1.00 24.24 ? 50  GLN C NE2  1  
ATOM 5527   H H    . GLN C 1 50  ? 22.692  15.856  3.927   1.00 32.13 ? 50  GLN C H    1  
ATOM 5528   H HA   . GLN C 1 50  ? 20.664  17.957  3.961   1.00 71.24 ? 50  GLN C HA   1  
ATOM 5529   H HB2  . GLN C 1 50  ? 22.763  18.379  5.181   1.00 62.14 ? 50  GLN C HB2  1  
ATOM 5530   H HB3  . GLN C 1 50  ? 23.707  18.115  3.714   1.00 63.10 ? 50  GLN C HB3  1  
ATOM 5531   H HG2  . GLN C 1 50  ? 22.699  20.102  2.675   1.00 45.21 ? 50  GLN C HG2  1  
ATOM 5532   H HG3  . GLN C 1 50  ? 21.667  20.336  4.085   1.00 31.45 ? 50  GLN C HG3  1  
ATOM 5533   H HE21 . GLN C 1 50  ? 22.460  22.410  4.407   1.00 11.32 ? 50  GLN C HE21 1  
ATOM 5534   H HE22 . GLN C 1 50  ? 24.041  22.714  5.033   1.00 33.22 ? 50  GLN C HE22 1  
ATOM 5535   N N    . LEU C 1 51  ? 20.432  18.339  1.518   1.00 73.31 ? 51  LEU C N    1  
ATOM 5536   C CA   . LEU C 1 51  ? 20.188  18.551  0.080   1.00 34.32 ? 51  LEU C CA   1  
ATOM 5537   C C    . LEU C 1 51  ? 20.504  20.004  -0.295  1.00 43.11 ? 51  LEU C C    1  
ATOM 5538   O O    . LEU C 1 51  ? 20.918  20.289  -1.422  1.00 64.40 ? 51  LEU C O    1  
ATOM 5539   C CB   . LEU C 1 51  ? 18.723  18.186  -0.224  1.00 21.11 ? 51  LEU C CB   1  
ATOM 5540   C CG   . LEU C 1 51  ? 18.299  16.757  0.250   1.00 71.23 ? 51  LEU C CG   1  
ATOM 5541   C CD1  . LEU C 1 51  ? 16.803  16.530  0.040   1.00 12.33 ? 51  LEU C CD1  1  
ATOM 5542   C CD2  . LEU C 1 51  ? 19.146  15.649  -0.426  1.00 0.51  ? 51  LEU C CD2  1  
ATOM 5543   H H    . LEU C 1 51  ? 19.737  18.612  2.152   1.00 0.43  ? 51  LEU C H    1  
ATOM 5544   H HA   . LEU C 1 51  ? 20.842  17.892  -0.488  1.00 13.12 ? 51  LEU C HA   1  
ATOM 5545   H HB2  . LEU C 1 51  ? 18.078  18.917  0.264   1.00 51.25 ? 51  LEU C HB2  1  
ATOM 5546   H HB3  . LEU C 1 51  ? 18.561  18.252  -1.294  1.00 54.40 ? 51  LEU C HB3  1  
ATOM 5547   H HG   . LEU C 1 51  ? 18.478  16.687  1.317   1.00 21.13 ? 51  LEU C HG   1  
ATOM 5548   H HD11 . LEU C 1 51  ? 16.524  16.772  -0.978  1.00 12.12 ? 51  LEU C HD11 1  
ATOM 5549   H HD12 . LEU C 1 51  ? 16.247  17.158  0.719   1.00 41.50 ? 51  LEU C HD12 1  
ATOM 5550   H HD13 . LEU C 1 51  ? 16.555  15.494  0.238   1.00 4.22  ? 51  LEU C HD13 1  
ATOM 5551   H HD21 . LEU C 1 51  ? 19.015  15.683  -1.500  1.00 52.44 ? 51  LEU C HD21 1  
ATOM 5552   H HD22 . LEU C 1 51  ? 18.834  14.678  -0.060  1.00 64.40 ? 51  LEU C HD22 1  
ATOM 5553   H HD23 . LEU C 1 51  ? 20.191  15.793  -0.185  1.00 0.23  ? 51  LEU C HD23 1  
ATOM 5554   N N    . ALA C 1 52  ? 20.303  20.900  0.682   1.00 2.32  ? 52  ALA C N    1  
ATOM 5555   C CA   . ALA C 1 52  ? 20.623  22.330  0.577   1.00 61.02 ? 52  ALA C CA   1  
ATOM 5556   C C    . ALA C 1 52  ? 20.572  22.971  1.966   1.00 23.23 ? 52  ALA C C    1  
ATOM 5557   O O    . ALA C 1 52  ? 20.402  22.283  2.988   1.00 52.51 ? 52  ALA C O    1  
ATOM 5558   C CB   . ALA C 1 52  ? 19.654  23.050  -0.389  1.00 54.22 ? 52  ALA C CB   1  
ATOM 5559   H H    . ALA C 1 52  ? 19.919  20.579  1.527   1.00 23.33 ? 52  ALA C H    1  
ATOM 5560   H HA   . ALA C 1 52  ? 21.634  22.427  0.192   1.00 4.04  ? 52  ALA C HA   1  
ATOM 5561   H HB1  . ALA C 1 52  ? 19.774  24.123  -0.305  1.00 52.50 ? 52  ALA C HB1  1  
ATOM 5562   H HB2  . ALA C 1 52  ? 18.633  22.783  -0.155  1.00 45.43 ? 52  ALA C HB2  1  
ATOM 5563   H HB3  . ALA C 1 52  ? 19.876  22.754  -1.398  1.00 64.52 ? 52  ALA C HB3  1  
ATOM 5564   N N    . ASP C 1 53  ? 20.731  24.296  1.984   1.00 42.33 ? 53  ASP C N    1  
ATOM 5565   C CA   . ASP C 1 53  ? 20.543  25.109  3.194   1.00 70.43 ? 53  ASP C CA   1  
ATOM 5566   C C    . ASP C 1 53  ? 19.040  25.154  3.518   1.00 3.54  ? 53  ASP C C    1  
ATOM 5567   O O    . ASP C 1 53  ? 18.232  25.477  2.638   1.00 43.11 ? 53  ASP C O    1  
ATOM 5568   C CB   . ASP C 1 53  ? 21.103  26.547  3.000   1.00 22.20 ? 53  ASP C CB   1  
ATOM 5569   C CG   . ASP C 1 53  ? 22.631  26.585  2.832   1.00 13.31 ? 53  ASP C CG   1  
ATOM 5570   O OD1  . ASP C 1 53  ? 23.126  26.455  1.698   1.00 10.02 ? 53  ASP C OD1  1  
ATOM 5571   O OD2  . ASP C 1 53  ? 23.350  26.742  3.837   1.00 31.25 ? 53  ASP C OD2  1  
ATOM 5572   H H    . ASP C 1 53  ? 20.962  24.742  1.140   1.00 25.30 ? 53  ASP C H    1  
ATOM 5573   H HA   . ASP C 1 53  ? 21.073  24.627  4.012   1.00 64.42 ? 53  ASP C HA   1  
ATOM 5574   H HB2  . ASP C 1 53  ? 20.649  26.990  2.118   1.00 5.44  ? 53  ASP C HB2  1  
ATOM 5575   H HB3  . ASP C 1 53  ? 20.835  27.156  3.860   1.00 63.12 ? 53  ASP C HB3  1  
ATOM 5576   N N    . ASP C 1 54  ? 18.684  24.757  4.759   1.00 72.50 ? 54  ASP C N    1  
ATOM 5577   C CA   . ASP C 1 54  ? 17.287  24.740  5.281   1.00 21.15 ? 54  ASP C CA   1  
ATOM 5578   C C    . ASP C 1 54  ? 16.399  23.661  4.613   1.00 34.33 ? 54  ASP C C    1  
ATOM 5579   O O    . ASP C 1 54  ? 15.203  23.566  4.917   1.00 10.41 ? 54  ASP C O    1  
ATOM 5580   C CB   . ASP C 1 54  ? 16.623  26.144  5.208   1.00 1.32  ? 54  ASP C CB   1  
ATOM 5581   C CG   . ASP C 1 54  ? 17.391  27.206  6.012   1.00 74.32 ? 54  ASP C CG   1  
ATOM 5582   O OD1  . ASP C 1 54  ? 18.340  27.813  5.467   1.00 31.12 ? 54  ASP C OD1  1  
ATOM 5583   O OD2  . ASP C 1 54  ? 17.056  27.440  7.188   1.00 25.40 ? 54  ASP C OD2  1  
ATOM 5584   H H    . ASP C 1 54  ? 19.398  24.471  5.367   1.00 24.35 ? 54  ASP C H    1  
ATOM 5585   H HA   . ASP C 1 54  ? 17.368  24.467  6.327   1.00 71.34 ? 54  ASP C HA   1  
ATOM 5586   H HB2  . ASP C 1 54  ? 16.570  26.457  4.170   1.00 4.31  ? 54  ASP C HB2  1  
ATOM 5587   H HB3  . ASP C 1 54  ? 15.609  26.079  5.599   1.00 20.22 ? 54  ASP C HB3  1  
ATOM 5588   N N    . VAL C 1 55  ? 16.996  22.841  3.725   1.00 41.31 ? 55  VAL C N    1  
ATOM 5589   C CA   . VAL C 1 55  ? 16.330  21.684  3.099   1.00 15.15 ? 55  VAL C CA   1  
ATOM 5590   C C    . VAL C 1 55  ? 17.086  20.420  3.522   1.00 0.22  ? 55  VAL C C    1  
ATOM 5591   O O    . VAL C 1 55  ? 18.239  20.199  3.114   1.00 24.11 ? 55  VAL C O    1  
ATOM 5592   C CB   . VAL C 1 55  ? 16.284  21.782  1.527   1.00 44.42 ? 55  VAL C CB   1  
ATOM 5593   C CG1  . VAL C 1 55  ? 15.663  20.497  0.910   1.00 3.32  ? 55  VAL C CG1  1  
ATOM 5594   C CG2  . VAL C 1 55  ? 15.515  23.052  1.073   1.00 32.11 ? 55  VAL C CG2  1  
ATOM 5595   H H    . VAL C 1 55  ? 17.929  23.008  3.494   1.00 34.53 ? 55  VAL C H    1  
ATOM 5596   H HA   . VAL C 1 55  ? 15.305  21.627  3.469   1.00 74.11 ? 55  VAL C HA   1  
ATOM 5597   H HB   . VAL C 1 55  ? 17.307  21.863  1.164   1.00 72.25 ? 55  VAL C HB   1  
ATOM 5598   H HG11 . VAL C 1 55  ? 14.616  20.431  1.172   1.00 54.52 ? 55  VAL C HG11 1  
ATOM 5599   H HG12 . VAL C 1 55  ? 16.176  19.623  1.295   1.00 63.24 ? 55  VAL C HG12 1  
ATOM 5600   H HG13 . VAL C 1 55  ? 15.766  20.508  -0.162  1.00 10.14 ? 55  VAL C HG13 1  
ATOM 5601   H HG21 . VAL C 1 55  ? 14.471  22.965  1.345   1.00 3.22  ? 55  VAL C HG21 1  
ATOM 5602   H HG22 . VAL C 1 55  ? 15.596  23.171  0.000   1.00 34.23 ? 55  VAL C HG22 1  
ATOM 5603   H HG23 . VAL C 1 55  ? 15.935  23.924  1.559   1.00 11.22 ? 55  VAL C HG23 1  
ATOM 5604   N N    . TYR C 1 56  ? 16.433  19.604  4.354   1.00 23.34 ? 56  TYR C N    1  
ATOM 5605   C CA   . TYR C 1 56  ? 17.043  18.422  4.976   1.00 61.22 ? 56  TYR C CA   1  
ATOM 5606   C C    . TYR C 1 56  ? 16.092  17.238  4.863   1.00 41.11 ? 56  TYR C C    1  
ATOM 5607   O O    . TYR C 1 56  ? 14.876  17.376  5.053   1.00 75.12 ? 56  TYR C O    1  
ATOM 5608   C CB   . TYR C 1 56  ? 17.391  18.693  6.465   1.00 62.31 ? 56  TYR C CB   1  
ATOM 5609   C CG   . TYR C 1 56  ? 18.454  19.785  6.664   1.00 14.22 ? 56  TYR C CG   1  
ATOM 5610   C CD1  . TYR C 1 56  ? 18.096  21.125  6.848   1.00 11.35 ? 56  TYR C CD1  1  
ATOM 5611   C CD2  . TYR C 1 56  ? 19.815  19.474  6.655   1.00 53.21 ? 56  TYR C CD2  1  
ATOM 5612   C CE1  . TYR C 1 56  ? 19.054  22.103  7.021   1.00 71.44 ? 56  TYR C CE1  1  
ATOM 5613   C CE2  . TYR C 1 56  ? 20.769  20.454  6.827   1.00 15.11 ? 56  TYR C CE2  1  
ATOM 5614   C CZ   . TYR C 1 56  ? 20.383  21.763  7.009   1.00 42.22 ? 56  TYR C CZ   1  
ATOM 5615   O OH   . TYR C 1 56  ? 21.334  22.733  7.201   1.00 12.32 ? 56  TYR C OH   1  
ATOM 5616   H H    . TYR C 1 56  ? 15.486  19.786  4.534   1.00 61.13 ? 56  TYR C H    1  
ATOM 5617   H HA   . TYR C 1 56  ? 17.961  18.185  4.439   1.00 20.22 ? 56  TYR C HA   1  
ATOM 5618   H HB2  . TYR C 1 56  ? 16.493  18.997  6.991   1.00 23.01 ? 56  TYR C HB2  1  
ATOM 5619   H HB3  . TYR C 1 56  ? 17.762  17.778  6.921   1.00 42.53 ? 56  TYR C HB3  1  
ATOM 5620   H HD1  . TYR C 1 56  ? 17.048  21.395  6.860   1.00 75.40 ? 56  TYR C HD1  1  
ATOM 5621   H HD2  . TYR C 1 56  ? 20.123  18.444  6.510   1.00 21.34 ? 56  TYR C HD2  1  
ATOM 5622   H HE1  . TYR C 1 56  ? 18.755  23.133  7.163   1.00 35.24 ? 56  TYR C HE1  1  
ATOM 5623   H HE2  . TYR C 1 56  ? 21.818  20.192  6.815   1.00 60.51 ? 56  TYR C HE2  1  
ATOM 5624   H HH   . TYR C 1 56  ? 22.089  22.565  6.628   1.00 60.42 ? 56  TYR C HH   1  
ATOM 5625   N N    . GLU C 1 57  ? 16.666  16.089  4.533   1.00 35.14 ? 57  GLU C N    1  
ATOM 5626   C CA   . GLU C 1 57  ? 15.956  14.827  4.449   1.00 61.14 ? 57  GLU C CA   1  
ATOM 5627   C C    . GLU C 1 57  ? 15.920  14.158  5.833   1.00 31.53 ? 57  GLU C C    1  
ATOM 5628   O O    . GLU C 1 57  ? 16.968  13.909  6.434   1.00 61.01 ? 57  GLU C O    1  
ATOM 5629   C CB   . GLU C 1 57  ? 16.667  13.911  3.437   1.00 3.45  ? 57  GLU C CB   1  
ATOM 5630   C CG   . GLU C 1 57  ? 16.050  12.511  3.320   1.00 1.12  ? 57  GLU C CG   1  
ATOM 5631   C CD   . GLU C 1 57  ? 16.849  11.607  2.391   1.00 33.13 ? 57  GLU C CD   1  
ATOM 5632   O OE1  . GLU C 1 57  ? 16.451  11.425  1.233   1.00 43.11 ? 57  GLU C OE1  1  
ATOM 5633   O OE2  . GLU C 1 57  ? 17.902  11.086  2.820   1.00 65.44 ? 57  GLU C OE2  1  
ATOM 5634   H H    . GLU C 1 57  ? 17.623  16.088  4.338   1.00 74.40 ? 57  GLU C H    1  
ATOM 5635   H HA   . GLU C 1 57  ? 14.940  15.016  4.100   1.00 65.24 ? 57  GLU C HA   1  
ATOM 5636   H HB2  . GLU C 1 57  ? 16.634  14.382  2.457   1.00 74.23 ? 57  GLU C HB2  1  
ATOM 5637   H HB3  . GLU C 1 57  ? 17.710  13.803  3.730   1.00 73.44 ? 57  GLU C HB3  1  
ATOM 5638   H HG2  . GLU C 1 57  ? 16.019  12.059  4.308   1.00 30.15 ? 57  GLU C HG2  1  
ATOM 5639   H HG3  . GLU C 1 57  ? 15.033  12.602  2.949   1.00 60.21 ? 57  GLU C HG3  1  
ATOM 5640   N N    . VAL C 1 58  ? 14.710  13.913  6.333   1.00 54.04 ? 58  VAL C N    1  
ATOM 5641   C CA   . VAL C 1 58  ? 14.470  13.082  7.516   1.00 53.22 ? 58  VAL C CA   1  
ATOM 5642   C C    . VAL C 1 58  ? 14.113  11.669  7.033   1.00 35.05 ? 58  VAL C C    1  
ATOM 5643   O O    . VAL C 1 58  ? 13.126  11.483  6.323   1.00 43.44 ? 58  VAL C O    1  
ATOM 5644   C CB   . VAL C 1 58  ? 13.309  13.679  8.407   1.00 55.03 ? 58  VAL C CB   1  
ATOM 5645   C CG1  . VAL C 1 58  ? 12.849  12.697  9.519   1.00 64.31 ? 58  VAL C CG1  1  
ATOM 5646   C CG2  . VAL C 1 58  ? 13.730  15.048  9.006   1.00 12.02 ? 58  VAL C CG2  1  
ATOM 5647   H H    . VAL C 1 58  ? 13.936  14.308  5.886   1.00 41.12 ? 58  VAL C H    1  
ATOM 5648   H HA   . VAL C 1 58  ? 15.383  13.042  8.115   1.00 22.11 ? 58  VAL C HA   1  
ATOM 5649   H HB   . VAL C 1 58  ? 12.453  13.855  7.759   1.00 71.33 ? 58  VAL C HB   1  
ATOM 5650   H HG11 . VAL C 1 58  ? 13.682  12.456  10.165  1.00 12.53 ? 58  VAL C HG11 1  
ATOM 5651   H HG12 . VAL C 1 58  ? 12.476  11.785  9.069   1.00 32.41 ? 58  VAL C HG12 1  
ATOM 5652   H HG13 . VAL C 1 58  ? 12.058  13.147  10.106  1.00 74.25 ? 58  VAL C HG13 1  
ATOM 5653   H HG21 . VAL C 1 58  ? 12.911  15.466  9.581   1.00 41.31 ? 58  VAL C HG21 1  
ATOM 5654   H HG22 . VAL C 1 58  ? 13.985  15.733  8.207   1.00 43.50 ? 58  VAL C HG22 1  
ATOM 5655   H HG23 . VAL C 1 58  ? 14.589  14.917  9.651   1.00 15.24 ? 58  VAL C HG23 1  
ATOM 5656   N N    . VAL C 1 59  ? 14.973  10.699  7.356   1.00 72.52 ? 59  VAL C N    1  
ATOM 5657   C CA   . VAL C 1 59  ? 14.706  9.269   7.140   1.00 13.05 ? 59  VAL C CA   1  
ATOM 5658   C C    . VAL C 1 59  ? 14.579  8.611   8.511   1.00 24.30 ? 59  VAL C C    1  
ATOM 5659   O O    . VAL C 1 59  ? 15.388  8.884   9.414   1.00 10.42 ? 59  VAL C O    1  
ATOM 5660   C CB   . VAL C 1 59  ? 15.857  8.542   6.343   1.00 52.13 ? 59  VAL C CB   1  
ATOM 5661   C CG1  . VAL C 1 59  ? 15.543  7.037   6.137   1.00 12.14 ? 59  VAL C CG1  1  
ATOM 5662   C CG2  . VAL C 1 59  ? 16.148  9.239   4.996   1.00 12.15 ? 59  VAL C CG2  1  
ATOM 5663   H H    . VAL C 1 59  ? 15.824  10.950  7.770   1.00 44.33 ? 59  VAL C H    1  
ATOM 5664   H HA   . VAL C 1 59  ? 13.771  9.157   6.592   1.00 64.23 ? 59  VAL C HA   1  
ATOM 5665   H HB   . VAL C 1 59  ? 16.763  8.606   6.943   1.00 4.44  ? 59  VAL C HB   1  
ATOM 5666   H HG11 . VAL C 1 59  ? 16.389  6.545   5.683   1.00 73.03 ? 59  VAL C HG11 1  
ATOM 5667   H HG12 . VAL C 1 59  ? 14.678  6.925   5.497   1.00 65.10 ? 59  VAL C HG12 1  
ATOM 5668   H HG13 . VAL C 1 59  ? 15.336  6.573   7.095   1.00 44.10 ? 59  VAL C HG13 1  
ATOM 5669   H HG21 . VAL C 1 59  ? 17.067  8.851   4.578   1.00 70.33 ? 59  VAL C HG21 1  
ATOM 5670   H HG22 . VAL C 1 59  ? 16.255  10.304  5.146   1.00 71.20 ? 59  VAL C HG22 1  
ATOM 5671   H HG23 . VAL C 1 59  ? 15.346  9.057   4.289   1.00 24.11 ? 59  VAL C HG23 1  
ATOM 5672   N N    . LEU C 1 60  ? 13.579  7.744   8.670   1.00 51.22 ? 60  LEU C N    1  
ATOM 5673   C CA   . LEU C 1 60  ? 13.438  6.937   9.876   1.00 53.00 ? 60  LEU C CA   1  
ATOM 5674   C C    . LEU C 1 60  ? 13.323  5.466   9.469   1.00 12.41 ? 60  LEU C C    1  
ATOM 5675   O O    . LEU C 1 60  ? 12.405  5.088   8.724   1.00 70.13 ? 60  LEU C O    1  
ATOM 5676   C CB   . LEU C 1 60  ? 12.216  7.390   10.730  1.00 70.33 ? 60  LEU C CB   1  
ATOM 5677   C CG   . LEU C 1 60  ? 12.330  7.060   12.253  1.00 22.41 ? 60  LEU C CG   1  
ATOM 5678   C CD1  . LEU C 1 60  ? 13.478  7.875   12.906  1.00 42.44 ? 60  LEU C CD1  1  
ATOM 5679   C CD2  . LEU C 1 60  ? 10.987  7.267   12.994  1.00 4.35  ? 60  LEU C CD2  1  
ATOM 5680   H H    . LEU C 1 60  ? 12.919  7.643   7.951   1.00 41.21 ? 60  LEU C H    1  
ATOM 5681   H HA   . LEU C 1 60  ? 14.346  7.059   10.469  1.00 53.33 ? 60  LEU C HA   1  
ATOM 5682   H HB2  . LEU C 1 60  ? 12.097  8.466   10.619  1.00 32.43 ? 60  LEU C HB2  1  
ATOM 5683   H HB3  . LEU C 1 60  ? 11.321  6.915   10.340  1.00 3.02  ? 60  LEU C HB3  1  
ATOM 5684   H HG   . LEU C 1 60  ? 12.596  6.013   12.355  1.00 34.00 ? 60  LEU C HG   1  
ATOM 5685   H HD11 . LEU C 1 60  ? 14.418  7.629   12.424  1.00 51.45 ? 60  LEU C HD11 1  
ATOM 5686   H HD12 . LEU C 1 60  ? 13.550  7.629   13.955  1.00 55.34 ? 60  LEU C HD12 1  
ATOM 5687   H HD13 . LEU C 1 60  ? 13.290  8.936   12.799  1.00 33.23 ? 60  LEU C HD13 1  
ATOM 5688   H HD21 . LEU C 1 60  ? 10.700  8.307   12.957  1.00 1.42  ? 60  LEU C HD21 1  
ATOM 5689   H HD22 . LEU C 1 60  ? 11.089  6.961   14.027  1.00 64.24 ? 60  LEU C HD22 1  
ATOM 5690   H HD23 . LEU C 1 60  ? 10.218  6.667   12.524  1.00 0.30  ? 60  LEU C HD23 1  
ATOM 5691   N N    . ARG C 1 61  ? 14.292  4.663   9.925   1.00 33.31 ? 61  ARG C N    1  
ATOM 5692   C CA   . ARG C 1 61  ? 14.312  3.222   9.703   1.00 13.14 ? 61  ARG C CA   1  
ATOM 5693   C C    . ARG C 1 61  ? 13.412  2.544   10.729  1.00 20.10 ? 61  ARG C C    1  
ATOM 5694   O O    . ARG C 1 61  ? 13.660  2.621   11.938  1.00 71.44 ? 61  ARG C O    1  
ATOM 5695   C CB   . ARG C 1 61  ? 15.751  2.662   9.817   1.00 41.00 ? 61  ARG C CB   1  
ATOM 5696   C CG   . ARG C 1 61  ? 15.852  1.131   9.603   1.00 24.13 ? 61  ARG C CG   1  
ATOM 5697   C CD   . ARG C 1 61  ? 17.265  0.577   9.840   1.00 23.42 ? 61  ARG C CD   1  
ATOM 5698   N NE   . ARG C 1 61  ? 18.285  1.266   9.032   1.00 54.34 ? 61  ARG C NE   1  
ATOM 5699   C CZ   . ARG C 1 61  ? 19.181  0.675   8.227   1.00 25.34 ? 61  ARG C CZ   1  
ATOM 5700   N NH1  . ARG C 1 61  ? 19.215  -0.646  8.086   1.00 42.12 ? 61  ARG C NH1  1  
ATOM 5701   N NH2  . ARG C 1 61  ? 20.038  1.424   7.554   1.00 41.12 ? 61  ARG C NH2  1  
ATOM 5702   H H    . ARG C 1 61  ? 15.019  5.064   10.438  1.00 13.54 ? 61  ARG C H    1  
ATOM 5703   H HA   . ARG C 1 61  ? 13.930  3.027   8.703   1.00 14.42 ? 61  ARG C HA   1  
ATOM 5704   H HB2  . ARG C 1 61  ? 16.372  3.151   9.074   1.00 71.12 ? 61  ARG C HB2  1  
ATOM 5705   H HB3  . ARG C 1 61  ? 16.140  2.898   10.802  1.00 2.13  ? 61  ARG C HB3  1  
ATOM 5706   H HG2  . ARG C 1 61  ? 15.169  0.635   10.285  1.00 63.14 ? 61  ARG C HG2  1  
ATOM 5707   H HG3  . ARG C 1 61  ? 15.554  0.902   8.586   1.00 31.02 ? 61  ARG C HG3  1  
ATOM 5708   H HD2  . ARG C 1 61  ? 17.518  0.692   10.885  1.00 5.31  ? 61  ARG C HD2  1  
ATOM 5709   H HD3  . ARG C 1 61  ? 17.267  -0.481  9.593   1.00 62.30 ? 61  ARG C HD3  1  
ATOM 5710   H HE   . ARG C 1 61  ? 18.311  2.241   9.105   1.00 64.14 ? 61  ARG C HE   1  
ATOM 5711   H HH11 . ARG C 1 61  ? 18.561  -1.226  8.583   1.00 3.00  ? 61  ARG C HH11 1  
ATOM 5712   H HH12 . ARG C 1 61  ? 19.891  -1.071  7.482   1.00 24.21 ? 61  ARG C HH12 1  
ATOM 5713   H HH21 . ARG C 1 61  ? 20.010  2.422   7.645   1.00 11.10 ? 61  ARG C HH21 1  
ATOM 5714   H HH22 . ARG C 1 61  ? 20.714  0.997   6.949   1.00 2.33  ? 61  ARG C HH22 1  
ATOM 5715   N N    . VAL C 1 62  ? 12.356  1.924   10.224  1.00 14.32 ? 62  VAL C N    1  
ATOM 5716   C CA   . VAL C 1 62  ? 11.426  1.137   11.012  1.00 45.23 ? 62  VAL C CA   1  
ATOM 5717   C C    . VAL C 1 62  ? 11.619  -0.331  10.623  1.00 20.21 ? 62  VAL C C    1  
ATOM 5718   O O    . VAL C 1 62  ? 11.381  -0.708  9.469   1.00 44.25 ? 62  VAL C O    1  
ATOM 5719   C CB   . VAL C 1 62  ? 9.948   1.572   10.744  1.00 42.41 ? 62  VAL C CB   1  
ATOM 5720   C CG1  . VAL C 1 62  ? 8.989   0.847   11.711  1.00 4.12  ? 62  VAL C CG1  1  
ATOM 5721   C CG2  . VAL C 1 62  ? 9.801   3.114   10.813  1.00 12.34 ? 62  VAL C CG2  1  
ATOM 5722   H H    . VAL C 1 62  ? 12.194  1.998   9.261   1.00 2.21  ? 62  VAL C H    1  
ATOM 5723   H HA   . VAL C 1 62  ? 11.644  1.269   12.074  1.00 15.14 ? 62  VAL C HA   1  
ATOM 5724   H HB   . VAL C 1 62  ? 9.684   1.262   9.730   1.00 22.40 ? 62  VAL C HB   1  
ATOM 5725   H HG11 . VAL C 1 62  ? 7.976   0.985   11.386  1.00 14.20 ? 62  VAL C HG11 1  
ATOM 5726   H HG12 . VAL C 1 62  ? 9.087   1.229   12.691  1.00 31.43 ? 62  VAL C HG12 1  
ATOM 5727   H HG13 . VAL C 1 62  ? 9.208   -0.214  11.720  1.00 30.41 ? 62  VAL C HG13 1  
ATOM 5728   H HG21 . VAL C 1 62  ? 9.900   3.447   11.826  1.00 54.44 ? 62  VAL C HG21 1  
ATOM 5729   H HG22 . VAL C 1 62  ? 8.834   3.414   10.429  1.00 30.13 ? 62  VAL C HG22 1  
ATOM 5730   H HG23 . VAL C 1 62  ? 10.580  3.575   10.218  1.00 45.22 ? 62  VAL C HG23 1  
ATOM 5731   N N    . THR C 1 63  ? 12.050  -1.144  11.582  1.00 41.03 ? 63  THR C N    1  
ATOM 5732   C CA   . THR C 1 63  ? 12.396  -2.543  11.342  1.00 63.14 ? 63  THR C CA   1  
ATOM 5733   C C    . THR C 1 63  ? 11.669  -3.424  12.353  1.00 62.24 ? 63  THR C C    1  
ATOM 5734   O O    . THR C 1 63  ? 11.894  -3.336  13.559  1.00 51.10 ? 63  THR C O    1  
ATOM 5735   C CB   . THR C 1 63  ? 13.939  -2.789  11.421  1.00 30.23 ? 63  THR C CB   1  
ATOM 5736   O OG1  . THR C 1 63  ? 14.633  -1.814  10.625  1.00 43.15 ? 63  THR C OG1  1  
ATOM 5737   C CG2  . THR C 1 63  ? 14.313  -4.210  10.947  1.00 54.30 ? 63  THR C CG2  1  
ATOM 5738   H H    . THR C 1 63  ? 12.112  -0.792  12.491  1.00 12.41 ? 63  THR C H    1  
ATOM 5739   H HA   . THR C 1 63  ? 12.053  -2.813  10.338  1.00 42.43 ? 63  THR C HA   1  
ATOM 5740   H HB   . THR C 1 63  ? 14.256  -2.674  12.449  1.00 63.15 ? 63  THR C HB   1  
ATOM 5741   H HG1  . THR C 1 63  ? 15.381  -2.227  10.180  1.00 22.14 ? 63  THR C HG1  1  
ATOM 5742   H HG21 . THR C 1 63  ? 15.377  -4.345  11.016  1.00 74.15 ? 63  THR C HG21 1  
ATOM 5743   H HG22 . THR C 1 63  ? 14.004  -4.346  9.920   1.00 51.13 ? 63  THR C HG22 1  
ATOM 5744   H HG23 . THR C 1 63  ? 13.820  -4.948  11.569  1.00 35.25 ? 63  THR C HG23 1  
ATOM 5745   N N    . VAL C 1 64  ? 10.784  -4.254  11.828  1.00 60.01 ? 64  VAL C N    1  
ATOM 5746   C CA   . VAL C 1 64  ? 9.933   -5.150  12.591  1.00 33.12 ? 64  VAL C CA   1  
ATOM 5747   C C    . VAL C 1 64  ? 10.414  -6.590  12.402  1.00 33.33 ? 64  VAL C C    1  
ATOM 5748   O O    . VAL C 1 64  ? 10.403  -7.119  11.284  1.00 12.53 ? 64  VAL C O    1  
ATOM 5749   C CB   . VAL C 1 64  ? 8.441   -5.014  12.129  1.00 33.21 ? 64  VAL C CB   1  
ATOM 5750   C CG1  . VAL C 1 64  ? 7.529   -6.004  12.887  1.00 74.14 ? 64  VAL C CG1  1  
ATOM 5751   C CG2  . VAL C 1 64  ? 7.961   -3.548  12.279  1.00 33.33 ? 64  VAL C CG2  1  
ATOM 5752   H H    . VAL C 1 64  ? 10.709  -4.273  10.861  1.00 33.11 ? 64  VAL C H    1  
ATOM 5753   H HA   . VAL C 1 64  ? 9.989   -4.879  13.648  1.00 22.44 ? 64  VAL C HA   1  
ATOM 5754   H HB   . VAL C 1 64  ? 8.394   -5.269  11.071  1.00 52.12 ? 64  VAL C HB   1  
ATOM 5755   H HG11 . VAL C 1 64  ? 7.852   -7.017  12.688  1.00 60.55 ? 64  VAL C HG11 1  
ATOM 5756   H HG12 . VAL C 1 64  ? 6.503   -5.889  12.566  1.00 54.21 ? 64  VAL C HG12 1  
ATOM 5757   H HG13 . VAL C 1 64  ? 7.596   -5.823  13.947  1.00 33.44 ? 64  VAL C HG13 1  
ATOM 5758   H HG21 . VAL C 1 64  ? 7.962   -3.262  13.322  1.00 71.03 ? 64  VAL C HG21 1  
ATOM 5759   H HG22 . VAL C 1 64  ? 6.969   -3.443  11.877  1.00 63.43 ? 64  VAL C HG22 1  
ATOM 5760   H HG23 . VAL C 1 64  ? 8.624   -2.893  11.728  1.00 44.03 ? 64  VAL C HG23 1  
ATOM 5761   N N    . THR C 1 65  ? 10.860  -7.191  13.499  1.00 13.10 ? 65  THR C N    1  
ATOM 5762   C CA   . THR C 1 65  ? 11.199  -8.608  13.565  1.00 11.05 ? 65  THR C CA   1  
ATOM 5763   C C    . THR C 1 65  ? 10.026  -9.341  14.224  1.00 22.52 ? 65  THR C C    1  
ATOM 5764   O O    . THR C 1 65  ? 9.360   -8.786  15.099  1.00 41.42 ? 65  THR C O    1  
ATOM 5765   C CB   . THR C 1 65  ? 12.505  -8.852  14.399  1.00 54.53 ? 65  THR C CB   1  
ATOM 5766   O OG1  . THR C 1 65  ? 13.481  -7.856  14.065  1.00 33.43 ? 65  THR C OG1  1  
ATOM 5767   C CG2  . THR C 1 65  ? 13.096  -10.258 14.161  1.00 33.34 ? 65  THR C CG2  1  
ATOM 5768   H H    . THR C 1 65  ? 10.951  -6.660  14.306  1.00 71.21 ? 65  THR C H    1  
ATOM 5769   H HA   . THR C 1 65  ? 11.350  -8.975  12.552  1.00 72.23 ? 65  THR C HA   1  
ATOM 5770   H HB   . THR C 1 65  ? 12.274  -8.746  15.457  1.00 44.44 ? 65  THR C HB   1  
ATOM 5771   H HG1  . THR C 1 65  ? 13.185  -7.001  14.400  1.00 24.03 ? 65  THR C HG1  1  
ATOM 5772   H HG21 . THR C 1 65  ? 13.340  -10.376 13.115  1.00 63.13 ? 65  THR C HG21 1  
ATOM 5773   H HG22 . THR C 1 65  ? 12.371  -11.011 14.446  1.00 10.22 ? 65  THR C HG22 1  
ATOM 5774   H HG23 . THR C 1 65  ? 13.992  -10.386 14.755  1.00 52.44 ? 65  THR C HG23 1  
ATOM 5775   N N    . ALA C 1 66  ? 9.779   -10.568 13.792  1.00 62.31 ? 66  ALA C N    1  
ATOM 5776   C CA   . ALA C 1 66  ? 8.763   -11.441 14.369  1.00 50.21 ? 66  ALA C CA   1  
ATOM 5777   C C    . ALA C 1 66  ? 9.390   -12.818 14.537  1.00 43.01 ? 66  ALA C C    1  
ATOM 5778   O O    . ALA C 1 66  ? 9.877   -13.383 13.554  1.00 40.04 ? 66  ALA C O    1  
ATOM 5779   C CB   . ALA C 1 66  ? 7.530   -11.487 13.450  1.00 13.21 ? 66  ALA C CB   1  
ATOM 5780   H H    . ALA C 1 66  ? 10.312  -10.912 13.042  1.00 62.45 ? 66  ALA C H    1  
ATOM 5781   H HA   . ALA C 1 66  ? 8.462   -11.055 15.344  1.00 1.23  ? 66  ALA C HA   1  
ATOM 5782   H HB1  . ALA C 1 66  ? 6.746   -12.053 13.911  1.00 55.34 ? 66  ALA C HB1  1  
ATOM 5783   H HB2  . ALA C 1 66  ? 7.788   -11.953 12.511  1.00 42.21 ? 66  ALA C HB2  1  
ATOM 5784   H HB3  . ALA C 1 66  ? 7.178   -10.479 13.262  1.00 42.44 ? 66  ALA C HB3  1  
ATOM 5785   N N    . SER C 1 67  ? 9.459   -13.332 15.778  1.00 5.33  ? 67  SER C N    1  
ATOM 5786   C CA   . SER C 1 67  ? 10.004  -14.677 16.045  1.00 23.52 ? 67  SER C CA   1  
ATOM 5787   C C    . SER C 1 67  ? 9.073   -15.453 16.982  1.00 51.25 ? 67  SER C C    1  
ATOM 5788   O O    . SER C 1 67  ? 8.790   -15.008 18.085  1.00 42.55 ? 67  SER C O    1  
ATOM 5789   C CB   . SER C 1 67  ? 11.417  -14.555 16.667  1.00 24.45 ? 67  SER C CB   1  
ATOM 5790   O OG   . SER C 1 67  ? 12.292  -13.843 15.805  1.00 35.43 ? 67  SER C OG   1  
ATOM 5791   H H    . SER C 1 67  ? 9.159   -12.784 16.542  1.00 31.04 ? 67  SER C H    1  
ATOM 5792   H HA   . SER C 1 67  ? 10.080  -15.214 15.095  1.00 60.33 ? 67  SER C HA   1  
ATOM 5793   H HB2  . SER C 1 67  ? 11.361  -14.021 17.606  1.00 73.31 ? 67  SER C HB2  1  
ATOM 5794   H HB3  . SER C 1 67  ? 11.827  -15.542 16.842  1.00 55.10 ? 67  SER C HB3  1  
ATOM 5795   H HG   . SER C 1 67  ? 11.889  -13.763 14.934  1.00 21.30 ? 67  SER C HG   1  
ATOM 5796   N N    . LEU C 1 68  ? 8.662   -16.647 16.547  1.00 21.41 ? 68  LEU C N    1  
ATOM 5797   C CA   . LEU C 1 68  ? 7.758   -17.547 17.292  1.00 1.10  ? 68  LEU C CA   1  
ATOM 5798   C C    . LEU C 1 68  ? 8.584   -18.436 18.263  1.00 44.54 ? 68  LEU C C    1  
ATOM 5799   O O    . LEU C 1 68  ? 8.286   -19.623 18.439  1.00 44.04 ? 68  LEU C O    1  
ATOM 5800   C CB   . LEU C 1 68  ? 7.004   -18.418 16.241  1.00 54.03 ? 68  LEU C CB   1  
ATOM 5801   C CG   . LEU C 1 68  ? 6.326   -17.638 15.056  1.00 43.00 ? 68  LEU C CG   1  
ATOM 5802   C CD1  . LEU C 1 68  ? 6.152   -18.545 13.837  1.00 13.34 ? 68  LEU C CD1  1  
ATOM 5803   C CD2  . LEU C 1 68  ? 4.974   -17.022 15.459  1.00 32.20 ? 68  LEU C CD2  1  
ATOM 5804   H H    . LEU C 1 68  ? 8.981   -16.948 15.672  1.00 42.31 ? 68  LEU C H    1  
ATOM 5805   H HA   . LEU C 1 68  ? 7.046   -16.957 17.857  1.00 3.04  ? 68  LEU C HA   1  
ATOM 5806   H HB2  . LEU C 1 68  ? 7.719   -19.125 15.822  1.00 70.34 ? 68  LEU C HB2  1  
ATOM 5807   H HB3  . LEU C 1 68  ? 6.240   -18.990 16.756  1.00 52.22 ? 68  LEU C HB3  1  
ATOM 5808   H HG   . LEU C 1 68  ? 6.977   -16.824 14.755  1.00 72.11 ? 68  LEU C HG   1  
ATOM 5809   H HD11 . LEU C 1 68  ? 5.555   -19.405 14.099  1.00 35.41 ? 68  LEU C HD11 1  
ATOM 5810   H HD12 . LEU C 1 68  ? 7.120   -18.874 13.495  1.00 60.32 ? 68  LEU C HD12 1  
ATOM 5811   H HD13 . LEU C 1 68  ? 5.671   -18.012 13.035  1.00 22.53 ? 68  LEU C HD13 1  
ATOM 5812   H HD21 . LEU C 1 68  ? 4.592   -16.423 14.645  1.00 71.11 ? 68  LEU C HD21 1  
ATOM 5813   H HD22 . LEU C 1 68  ? 5.104   -16.390 16.322  1.00 74.23 ? 68  LEU C HD22 1  
ATOM 5814   H HD23 . LEU C 1 68  ? 4.261   -17.803 15.691  1.00 55.44 ? 68  LEU C HD23 1  
ATOM 5815   N N    . GLY C 1 69  ? 9.594   -17.825 18.923  1.00 5.42  ? 69  GLY C N    1  
ATOM 5816   C CA   . GLY C 1 69  ? 10.602  -18.542 19.700  1.00 65.22 ? 69  GLY C CA   1  
ATOM 5817   C C    . GLY C 1 69  ? 11.924  -18.574 18.942  1.00 71.22 ? 69  GLY C C    1  
ATOM 5818   O O    . GLY C 1 69  ? 12.520  -17.518 18.695  1.00 34.10 ? 69  GLY C O    1  
ATOM 5819   H H    . GLY C 1 69  ? 9.652   -16.849 18.885  1.00 22.43 ? 69  GLY C H    1  
ATOM 5820   H HA2  . GLY C 1 69  ? 10.744  -18.027 20.643  1.00 11.32 ? 69  GLY C HA2  1  
ATOM 5821   H HA3  . GLY C 1 69  ? 10.272  -19.555 19.903  1.00 71.12 ? 69  GLY C HA3  1  
ATOM 5822   N N    . GLU C 1 70  ? 12.354  -19.780 18.531  1.00 14.32 ? 70  GLU C N    1  
ATOM 5823   C CA   . GLU C 1 70  ? 13.589  -19.977 17.734  1.00 2.30  ? 70  GLU C CA   1  
ATOM 5824   C C    . GLU C 1 70  ? 13.269  -19.861 16.234  1.00 3.04  ? 70  GLU C C    1  
ATOM 5825   O O    . GLU C 1 70  ? 14.136  -19.499 15.432  1.00 14.34 ? 70  GLU C O    1  
ATOM 5826   C CB   . GLU C 1 70  ? 14.219  -21.363 18.036  1.00 25.24 ? 70  GLU C CB   1  
ATOM 5827   C CG   . GLU C 1 70  ? 13.284  -22.564 17.774  1.00 70.51 ? 70  GLU C CG   1  
ATOM 5828   C CD   . GLU C 1 70  ? 13.979  -23.917 17.952  1.00 53.52 ? 70  GLU C CD   1  
ATOM 5829   O OE1  . GLU C 1 70  ? 14.565  -24.424 16.975  1.00 55.44 ? 70  GLU C OE1  1  
ATOM 5830   O OE2  . GLU C 1 70  ? 13.956  -24.473 19.070  1.00 20.10 ? 70  GLU C OE2  1  
ATOM 5831   H H    . GLU C 1 70  ? 11.828  -20.566 18.778  1.00 35.33 ? 70  GLU C H    1  
ATOM 5832   H HA   . GLU C 1 70  ? 14.299  -19.196 18.002  1.00 24.44 ? 70  GLU C HA   1  
ATOM 5833   H HB2  . GLU C 1 70  ? 15.107  -21.482 17.421  1.00 44.23 ? 70  GLU C HB2  1  
ATOM 5834   H HB3  . GLU C 1 70  ? 14.520  -21.388 19.077  1.00 11.33 ? 70  GLU C HB3  1  
ATOM 5835   H HG2  . GLU C 1 70  ? 12.440  -22.505 18.456  1.00 71.11 ? 70  GLU C HG2  1  
ATOM 5836   H HG3  . GLU C 1 70  ? 12.906  -22.495 16.757  1.00 60.23 ? 70  GLU C HG3  1  
ATOM 5837   N N    . GLU C 1 71  ? 12.018  -20.197 15.871  1.00 64.33 ? 71  GLU C N    1  
ATOM 5838   C CA   . GLU C 1 71  ? 11.484  -19.975 14.524  1.00 62.14 ? 71  GLU C CA   1  
ATOM 5839   C C    . GLU C 1 71  ? 11.391  -18.469 14.269  1.00 54.21 ? 71  GLU C C    1  
ATOM 5840   O O    . GLU C 1 71  ? 10.683  -17.774 15.006  1.00 54.33 ? 71  GLU C O    1  
ATOM 5841   C CB   . GLU C 1 71  ? 10.061  -20.594 14.391  1.00 3.12  ? 71  GLU C CB   1  
ATOM 5842   C CG   . GLU C 1 71  ? 9.349   -20.337 13.029  1.00 22.33 ? 71  GLU C CG   1  
ATOM 5843   C CD   . GLU C 1 71  ? 9.837   -21.220 11.863  1.00 52.23 ? 71  GLU C CD   1  
ATOM 5844   O OE1  . GLU C 1 71  ? 9.058   -22.078 11.385  1.00 53.23 ? 71  GLU C OE1  1  
ATOM 5845   O OE2  . GLU C 1 71  ? 10.987  -21.067 11.433  1.00 62.33 ? 71  GLU C OE2  1  
ATOM 5846   H H    . GLU C 1 71  ? 11.432  -20.599 16.543  1.00 54.55 ? 71  GLU C H    1  
ATOM 5847   H HA   . GLU C 1 71  ? 12.149  -20.437 13.803  1.00 23.40 ? 71  GLU C HA   1  
ATOM 5848   H HB2  . GLU C 1 71  ? 10.129  -21.665 14.540  1.00 54.23 ? 71  GLU C HB2  1  
ATOM 5849   H HB3  . GLU C 1 71  ? 9.434   -20.183 15.180  1.00 73.31 ? 71  GLU C HB3  1  
ATOM 5850   H HG2  . GLU C 1 71  ? 8.284   -20.506 13.167  1.00 61.55 ? 71  GLU C HG2  1  
ATOM 5851   H HG3  . GLU C 1 71  ? 9.491   -19.295 12.757  1.00 63.52 ? 71  GLU C HG3  1  
ATOM 5852   N N    . THR C 1 72  ? 12.116  -17.953 13.275  1.00 1.34  ? 72  THR C N    1  
ATOM 5853   C CA   . THR C 1 72  ? 11.883  -16.594 12.802  1.00 50.30 ? 72  THR C CA   1  
ATOM 5854   C C    . THR C 1 72  ? 10.689  -16.623 11.844  1.00 1.34  ? 72  THR C C    1  
ATOM 5855   O O    . THR C 1 72  ? 10.703  -17.361 10.847  1.00 53.32 ? 72  THR C O    1  
ATOM 5856   C CB   . THR C 1 72  ? 13.118  -15.975 12.088  1.00 2.20  ? 72  THR C CB   1  
ATOM 5857   O OG1  . THR C 1 72  ? 14.275  -16.089 12.937  1.00 53.22 ? 72  THR C OG1  1  
ATOM 5858   C CG2  . THR C 1 72  ? 12.869  -14.488 11.731  1.00 64.30 ? 72  THR C CG2  1  
ATOM 5859   H H    . THR C 1 72  ? 12.810  -18.494 12.850  1.00 54.42 ? 72  THR C H    1  
ATOM 5860   H HA   . THR C 1 72  ? 11.640  -15.967 13.665  1.00 23.51 ? 72  THR C HA   1  
ATOM 5861   H HB   . THR C 1 72  ? 13.309  -16.526 11.172  1.00 33.24 ? 72  THR C HB   1  
ATOM 5862   H HG1  . THR C 1 72  ? 14.433  -15.252 13.387  1.00 51.43 ? 72  THR C HG1  1  
ATOM 5863   H HG21 . THR C 1 72  ? 12.038  -14.409 11.039  1.00 74.01 ? 72  THR C HG21 1  
ATOM 5864   H HG22 . THR C 1 72  ? 13.743  -14.071 11.276  1.00 2.03  ? 72  THR C HG22 1  
ATOM 5865   H HG23 . THR C 1 72  ? 12.637  -13.929 12.628  1.00 32.21 ? 72  THR C HG23 1  
ATOM 5866   N N    . ALA C 1 73  ? 9.657   -15.841 12.178  1.00 63.23 ? 73  ALA C N    1  
ATOM 5867   C CA   . ALA C 1 73  ? 8.456   -15.708 11.348  1.00 35.13 ? 73  ALA C CA   1  
ATOM 5868   C C    . ALA C 1 73  ? 8.811   -14.890 10.118  1.00 64.33 ? 73  ALA C C    1  
ATOM 5869   O O    . ALA C 1 73  ? 8.709   -15.369 8.982   1.00 12.45 ? 73  ALA C O    1  
ATOM 5870   C CB   . ALA C 1 73  ? 7.294   -15.071 12.129  1.00 3.01  ? 73  ALA C CB   1  
ATOM 5871   H H    . ALA C 1 73  ? 9.732   -15.308 12.987  1.00 64.22 ? 73  ALA C H    1  
ATOM 5872   H HA   . ALA C 1 73  ? 8.155   -16.698 11.037  1.00 60.45 ? 73  ALA C HA   1  
ATOM 5873   H HB1  . ALA C 1 73  ? 6.448   -14.922 11.476  1.00 24.32 ? 73  ALA C HB1  1  
ATOM 5874   H HB2  . ALA C 1 73  ? 7.599   -14.120 12.543  1.00 32.12 ? 73  ALA C HB2  1  
ATOM 5875   H HB3  . ALA C 1 73  ? 6.998   -15.723 12.929  1.00 73.40 ? 73  ALA C HB3  1  
ATOM 5876   N N    . PHE C 1 74  ? 9.295   -13.667 10.373  1.00 3.31  ? 74  PHE C N    1  
ATOM 5877   C CA   . PHE C 1 74  ? 9.734   -12.761 9.321   1.00 73.30 ? 74  PHE C CA   1  
ATOM 5878   C C    . PHE C 1 74  ? 10.615  -11.639 9.872   1.00 65.04 ? 74  PHE C C    1  
ATOM 5879   O O    . PHE C 1 74  ? 10.757  -11.450 11.088  1.00 44.11 ? 74  PHE C O    1  
ATOM 5880   C CB   . PHE C 1 74  ? 8.516   -12.174 8.544   1.00 13.34 ? 74  PHE C CB   1  
ATOM 5881   C CG   . PHE C 1 74  ? 7.496   -11.357 9.365   1.00 71.32 ? 74  PHE C CG   1  
ATOM 5882   C CD1  . PHE C 1 74  ? 7.763   -10.040 9.774   1.00 35.50 ? 74  PHE C CD1  1  
ATOM 5883   C CD2  . PHE C 1 74  ? 6.243   -11.884 9.668   1.00 44.42 ? 74  PHE C CD2  1  
ATOM 5884   C CE1  . PHE C 1 74  ? 6.816   -9.292  10.446  1.00 74.43 ? 74  PHE C CE1  1  
ATOM 5885   C CE2  . PHE C 1 74  ? 5.303   -11.136 10.349  1.00 51.34 ? 74  PHE C CE2  1  
ATOM 5886   C CZ   . PHE C 1 74  ? 5.584   -9.843  10.732  1.00 53.30 ? 74  PHE C CZ   1  
ATOM 5887   H H    . PHE C 1 74  ? 9.363   -13.370 11.306  1.00 0.12  ? 74  PHE C H    1  
ATOM 5888   H HA   . PHE C 1 74  ? 10.339  -13.336 8.626   1.00 25.03 ? 74  PHE C HA   1  
ATOM 5889   H HB2  . PHE C 1 74  ? 8.882   -11.529 7.752   1.00 65.05 ? 74  PHE C HB2  1  
ATOM 5890   H HB3  . PHE C 1 74  ? 7.983   -12.999 8.079   1.00 24.01 ? 74  PHE C HB3  1  
ATOM 5891   H HD1  . PHE C 1 74  ? 8.725   -9.610  9.563   1.00 3.01  ? 74  PHE C HD1  1  
ATOM 5892   H HD2  . PHE C 1 74  ? 6.013   -12.909 9.389   1.00 54.04 ? 74  PHE C HD2  1  
ATOM 5893   H HE1  . PHE C 1 74  ? 7.042   -8.278  10.758  1.00 72.41 ? 74  PHE C HE1  1  
ATOM 5894   H HE2  . PHE C 1 74  ? 4.335   -11.562 10.572  1.00 21.12 ? 74  PHE C HE2  1  
ATOM 5895   H HZ   . PHE C 1 74  ? 4.836   -9.262  11.254  1.00 23.10 ? 74  PHE C HZ   1  
ATOM 5896   N N    . LEU C 1 75  ? 11.190  -10.912 8.925   1.00 72.12 ? 75  LEU C N    1  
ATOM 5897   C CA   . LEU C 1 75  ? 11.852  -9.635  9.129   1.00 72.21 ? 75  LEU C CA   1  
ATOM 5898   C C    . LEU C 1 75  ? 11.218  -8.661  8.116   1.00 54.34 ? 75  LEU C C    1  
ATOM 5899   O O    . LEU C 1 75  ? 10.806  -9.074  7.034   1.00 54.33 ? 75  LEU C O    1  
ATOM 5900   C CB   . LEU C 1 75  ? 13.397  -9.798  8.929   1.00 22.13 ? 75  LEU C CB   1  
ATOM 5901   C CG   . LEU C 1 75  ? 14.324  -8.624  9.421   1.00 64.34 ? 75  LEU C CG   1  
ATOM 5902   C CD1  . LEU C 1 75  ? 14.354  -7.418  8.444   1.00 3.00  ? 75  LEU C CD1  1  
ATOM 5903   C CD2  . LEU C 1 75  ? 13.926  -8.175  10.852  1.00 22.03 ? 75  LEU C CD2  1  
ATOM 5904   H H    . LEU C 1 75  ? 11.165  -11.259 8.013   1.00 74.43 ? 75  LEU C H    1  
ATOM 5905   H HA   . LEU C 1 75  ? 11.649  -9.288  10.140  1.00 75.22 ? 75  LEU C HA   1  
ATOM 5906   H HB2  . LEU C 1 75  ? 13.700  -10.699 9.457   1.00 11.40 ? 75  LEU C HB2  1  
ATOM 5907   H HB3  . LEU C 1 75  ? 13.588  -9.964  7.873   1.00 2.33  ? 75  LEU C HB3  1  
ATOM 5908   H HG   . LEU C 1 75  ? 15.341  -8.997  9.479   1.00 44.42 ? 75  LEU C HG   1  
ATOM 5909   H HD11 . LEU C 1 75  ? 14.657  -7.754  7.463   1.00 73.20 ? 75  LEU C HD11 1  
ATOM 5910   H HD12 . LEU C 1 75  ? 15.068  -6.682  8.796   1.00 30.44 ? 75  LEU C HD12 1  
ATOM 5911   H HD13 . LEU C 1 75  ? 13.376  -6.963  8.382   1.00 31.45 ? 75  LEU C HD13 1  
ATOM 5912   H HD21 . LEU C 1 75  ? 14.600  -7.408  11.201  1.00 45.20 ? 75  LEU C HD21 1  
ATOM 5913   H HD22 . LEU C 1 75  ? 13.975  -9.019  11.528  1.00 3.43  ? 75  LEU C HD22 1  
ATOM 5914   H HD23 . LEU C 1 75  ? 12.913  -7.783  10.850  1.00 2.33  ? 75  LEU C HD23 1  
ATOM 5915   N N    . CYS C 1 76  ? 11.098  -7.394  8.488   1.00 2.11  ? 76  CYS C N    1  
ATOM 5916   C CA   . CYS C 1 76  ? 10.568  -6.344  7.608   1.00 41.52 ? 76  CYS C CA   1  
ATOM 5917   C C    . CYS C 1 76  ? 11.277  -5.041  7.951   1.00 35.44 ? 76  CYS C C    1  
ATOM 5918   O O    . CYS C 1 76  ? 11.383  -4.702  9.121   1.00 65.23 ? 76  CYS C O    1  
ATOM 5919   C CB   . CYS C 1 76  ? 9.034   -6.198  7.774   1.00 44.22 ? 76  CYS C CB   1  
ATOM 5920   S SG   . CYS C 1 76  ? 8.277   -5.028  6.623   1.00 3.11  ? 76  CYS C SG   1  
ATOM 5921   H H    . CYS C 1 76  ? 11.388  -7.143  9.390   1.00 24.00 ? 76  CYS C H    1  
ATOM 5922   H HA   . CYS C 1 76  ? 10.794  -6.609  6.574   1.00 72.20 ? 76  CYS C HA   1  
ATOM 5923   H HB2  . CYS C 1 76  ? 8.566   -7.159  7.611   1.00 5.51  ? 76  CYS C HB2  1  
ATOM 5924   H HB3  . CYS C 1 76  ? 8.804   -5.864  8.782   1.00 60.35 ? 76  CYS C HB3  1  
ATOM 5925   H HG   . CYS C 1 76  ? 9.053   -4.950  5.552   1.00 61.14 ? 76  CYS C HG   1  
ATOM 5926   N N    . GLU C 1 77  ? 11.800  -4.339  6.943   1.00 72.34 ? 77  GLU C N    1  
ATOM 5927   C CA   . GLU C 1 77  ? 12.453  -3.039  7.135   1.00 11.24 ? 77  GLU C CA   1  
ATOM 5928   C C    . GLU C 1 77  ? 11.994  -2.075  6.046   1.00 51.52 ? 77  GLU C C    1  
ATOM 5929   O O    . GLU C 1 77  ? 12.191  -2.338  4.857   1.00 21.25 ? 77  GLU C O    1  
ATOM 5930   C CB   . GLU C 1 77  ? 13.998  -3.174  7.119   1.00 24.51 ? 77  GLU C CB   1  
ATOM 5931   C CG   . GLU C 1 77  ? 14.745  -1.832  7.309   1.00 30.30 ? 77  GLU C CG   1  
ATOM 5932   C CD   . GLU C 1 77  ? 16.271  -1.984  7.378   1.00 40.30 ? 77  GLU C CD   1  
ATOM 5933   O OE1  . GLU C 1 77  ? 16.960  -1.676  6.386   1.00 21.23 ? 77  GLU C OE1  1  
ATOM 5934   O OE2  . GLU C 1 77  ? 16.787  -2.412  8.434   1.00 42.43 ? 77  GLU C OE2  1  
ATOM 5935   H H    . GLU C 1 77  ? 11.745  -4.704  6.036   1.00 54.40 ? 77  GLU C H    1  
ATOM 5936   H HA   . GLU C 1 77  ? 12.149  -2.642  8.105   1.00 63.10 ? 77  GLU C HA   1  
ATOM 5937   H HB2  . GLU C 1 77  ? 14.294  -3.850  7.916   1.00 24.32 ? 77  GLU C HB2  1  
ATOM 5938   H HB3  . GLU C 1 77  ? 14.305  -3.606  6.171   1.00 70.52 ? 77  GLU C HB3  1  
ATOM 5939   H HG2  . GLU C 1 77  ? 14.493  -1.179  6.478   1.00 0.20  ? 77  GLU C HG2  1  
ATOM 5940   H HG3  . GLU C 1 77  ? 14.399  -1.367  8.228   1.00 21.43 ? 77  GLU C HG3  1  
ATOM 5941   N N    . VAL C 1 78  ? 11.336  -0.989  6.466   1.00 63.54 ? 78  VAL C N    1  
ATOM 5942   C CA   . VAL C 1 78  ? 10.989  0.136   5.596   1.00 25.02 ? 78  VAL C CA   1  
ATOM 5943   C C    . VAL C 1 78  ? 11.654  1.402   6.151   1.00 70.44 ? 78  VAL C C    1  
ATOM 5944   O O    . VAL C 1 78  ? 11.432  1.784   7.307   1.00 0.32  ? 78  VAL C O    1  
ATOM 5945   C CB   . VAL C 1 78  ? 9.433   0.360   5.471   1.00 32.04 ? 78  VAL C CB   1  
ATOM 5946   C CG1  . VAL C 1 78  ? 9.097   1.585   4.548   1.00 4.32  ? 78  VAL C CG1  1  
ATOM 5947   C CG2  . VAL C 1 78  ? 8.731   -0.937  4.984   1.00 4.13  ? 78  VAL C CG2  1  
ATOM 5948   H H    . VAL C 1 78  ? 11.086  -0.939  7.412   1.00 70.10 ? 78  VAL C H    1  
ATOM 5949   H HA   . VAL C 1 78  ? 11.384  -0.066  4.595   1.00 51.33 ? 78  VAL C HA   1  
ATOM 5950   H HB   . VAL C 1 78  ? 9.053   0.579   6.469   1.00 31.33 ? 78  VAL C HB   1  
ATOM 5951   H HG11 . VAL C 1 78  ? 8.585   1.260   3.655   1.00 13.13 ? 78  VAL C HG11 1  
ATOM 5952   H HG12 . VAL C 1 78  ? 10.001  2.094   4.253   1.00 10.31 ? 78  VAL C HG12 1  
ATOM 5953   H HG13 . VAL C 1 78  ? 8.473   2.284   5.080   1.00 52.23 ? 78  VAL C HG13 1  
ATOM 5954   H HG21 . VAL C 1 78  ? 7.661   -0.777  4.938   1.00 1.33  ? 78  VAL C HG21 1  
ATOM 5955   H HG22 . VAL C 1 78  ? 8.936   -1.747  5.673   1.00 73.14 ? 78  VAL C HG22 1  
ATOM 5956   H HG23 . VAL C 1 78  ? 9.090   -1.205  4.006   1.00 34.41 ? 78  VAL C HG23 1  
ATOM 5957   N N    . GLN C 1 79  ? 12.470  2.035   5.312   1.00 31.03 ? 79  GLN C N    1  
ATOM 5958   C CA   . GLN C 1 79  ? 13.156  3.292   5.616   1.00 32.04 ? 79  GLN C CA   1  
ATOM 5959   C C    . GLN C 1 79  ? 12.423  4.419   4.888   1.00 70.44 ? 79  GLN C C    1  
ATOM 5960   O O    . GLN C 1 79  ? 12.644  4.659   3.688   1.00 64.10 ? 79  GLN C O    1  
ATOM 5961   C CB   . GLN C 1 79  ? 14.651  3.200   5.204   1.00 65.15 ? 79  GLN C CB   1  
ATOM 5962   C CG   . GLN C 1 79  ? 15.473  2.218   6.061   1.00 21.51 ? 79  GLN C CG   1  
ATOM 5963   C CD   . GLN C 1 79  ? 16.923  2.054   5.594   1.00 11.54 ? 79  GLN C CD   1  
ATOM 5964   O OE1  . GLN C 1 79  ? 17.799  2.839   5.951   1.00 43.15 ? 79  GLN C OE1  1  
ATOM 5965   N NE2  . GLN C 1 79  ? 17.198  1.006   4.839   1.00 32.02 ? 79  GLN C NE2  1  
ATOM 5966   H H    . GLN C 1 79  ? 12.597  1.644   4.426   1.00 1.25  ? 79  GLN C H    1  
ATOM 5967   H HA   . GLN C 1 79  ? 13.095  3.471   6.690   1.00 70.01 ? 79  GLN C HA   1  
ATOM 5968   H HB2  . GLN C 1 79  ? 14.708  2.883   4.170   1.00 42.54 ? 79  GLN C HB2  1  
ATOM 5969   H HB3  . GLN C 1 79  ? 15.104  4.184   5.288   1.00 62.15 ? 79  GLN C HB3  1  
ATOM 5970   H HG2  . GLN C 1 79  ? 15.484  2.575   7.084   1.00 4.55  ? 79  GLN C HG2  1  
ATOM 5971   H HG3  . GLN C 1 79  ? 14.987  1.247   6.038   1.00 1.21  ? 79  GLN C HG3  1  
ATOM 5972   H HE21 . GLN C 1 79  ? 16.464  0.388   4.619   1.00 20.23 ? 79  GLN C HE21 1  
ATOM 5973   H HE22 . GLN C 1 79  ? 18.121  0.874   4.542   1.00 44.51 ? 79  GLN C HE22 1  
ATOM 5974   N N    . GLN C 1 80  ? 11.493  5.054   5.618   1.00 50.22 ? 80  GLN C N    1  
ATOM 5975   C CA   . GLN C 1 80  ? 10.637  6.107   5.080   1.00 23.44 ? 80  GLN C CA   1  
ATOM 5976   C C    . GLN C 1 80  ? 11.408  7.431   5.046   1.00 21.23 ? 80  GLN C C    1  
ATOM 5977   O O    . GLN C 1 80  ? 11.802  7.951   6.096   1.00 14.32 ? 80  GLN C O    1  
ATOM 5978   C CB   . GLN C 1 80  ? 9.344   6.245   5.932   1.00 65.10 ? 80  GLN C CB   1  
ATOM 5979   C CG   . GLN C 1 80  ? 8.306   7.219   5.339   1.00 25.44 ? 80  GLN C CG   1  
ATOM 5980   C CD   . GLN C 1 80  ? 7.757   6.788   3.981   1.00 1.32  ? 80  GLN C CD   1  
ATOM 5981   O OE1  . GLN C 1 80  ? 7.461   7.616   3.128   1.00 43.35 ? 80  GLN C OE1  1  
ATOM 5982   N NE2  . GLN C 1 80  ? 7.537   5.492   3.796   1.00 11.42 ? 80  GLN C NE2  1  
ATOM 5983   H H    . GLN C 1 80  ? 11.397  4.812   6.566   1.00 32.21 ? 80  GLN C H    1  
ATOM 5984   H HA   . GLN C 1 80  ? 10.355  5.827   4.066   1.00 22.21 ? 80  GLN C HA   1  
ATOM 5985   H HB2  . GLN C 1 80  ? 8.879   5.266   6.014   1.00 11.40 ? 80  GLN C HB2  1  
ATOM 5986   H HB3  . GLN C 1 80  ? 9.602   6.581   6.931   1.00 22.21 ? 80  GLN C HB3  1  
ATOM 5987   H HG2  . GLN C 1 80  ? 7.468   7.289   6.025   1.00 30.32 ? 80  GLN C HG2  1  
ATOM 5988   H HG3  . GLN C 1 80  ? 8.754   8.205   5.239   1.00 2.10  ? 80  GLN C HG3  1  
ATOM 5989   H HE21 . GLN C 1 80  ? 7.728   4.874   4.529   1.00 5.53  ? 80  GLN C HE21 1  
ATOM 5990   H HE22 . GLN C 1 80  ? 7.172   5.216   2.938   1.00 42.51 ? 80  GLN C HE22 1  
ATOM 5991   N N    . GLY C 1 81  ? 11.647  7.936   3.828   1.00 3.44  ? 81  GLY C N    1  
ATOM 5992   C CA   . GLY C 1 81  ? 12.306  9.217   3.622   1.00 23.43 ? 81  GLY C CA   1  
ATOM 5993   C C    . GLY C 1 81  ? 11.300  10.326  3.391   1.00 70.34 ? 81  GLY C C    1  
ATOM 5994   O O    . GLY C 1 81  ? 10.242  10.108  2.784   1.00 33.34 ? 81  GLY C O    1  
ATOM 5995   H H    . GLY C 1 81  ? 11.342  7.433   3.047   1.00 14.41 ? 81  GLY C H    1  
ATOM 5996   H HA2  . GLY C 1 81  ? 12.924  9.460   4.486   1.00 73.11 ? 81  GLY C HA2  1  
ATOM 5997   H HA3  . GLY C 1 81  ? 12.944  9.142   2.755   1.00 1.12  ? 81  GLY C HA3  1  
ATOM 5998   N N    . GLY C 1 82  ? 11.637  11.516  3.867   1.00 23.33 ? 82  GLY C N    1  
ATOM 5999   C CA   . GLY C 1 82  ? 10.770  12.674  3.751   1.00 65.32 ? 82  GLY C CA   1  
ATOM 6000   C C    . GLY C 1 82  ? 11.576  13.942  3.784   1.00 75.21 ? 82  GLY C C    1  
ATOM 6001   O O    . GLY C 1 82  ? 12.292  14.199  4.754   1.00 35.52 ? 82  GLY C O    1  
ATOM 6002   H H    . GLY C 1 82  ? 12.503  11.611  4.321   1.00 2.22  ? 82  GLY C H    1  
ATOM 6003   H HA2  . GLY C 1 82  ? 10.201  12.621  2.823   1.00 50.05 ? 82  GLY C HA2  1  
ATOM 6004   H HA3  . GLY C 1 82  ? 10.079  12.680  4.584   1.00 55.34 ? 82  GLY C HA3  1  
ATOM 6005   N N    . ILE C 1 83  ? 11.491  14.721  2.712   1.00 3.42  ? 83  ILE C N    1  
ATOM 6006   C CA   . ILE C 1 83  ? 12.189  15.994  2.598   1.00 73.42 ? 83  ILE C CA   1  
ATOM 6007   C C    . ILE C 1 83  ? 11.322  17.079  3.252   1.00 44.22 ? 83  ILE C C    1  
ATOM 6008   O O    . ILE C 1 83  ? 10.138  17.211  2.911   1.00 51.32 ? 83  ILE C O    1  
ATOM 6009   C CB   . ILE C 1 83  ? 12.467  16.374  1.098   1.00 45.42 ? 83  ILE C CB   1  
ATOM 6010   C CG1  . ILE C 1 83  ? 12.899  15.132  0.245   1.00 1.34  ? 83  ILE C CG1  1  
ATOM 6011   C CG2  . ILE C 1 83  ? 13.513  17.509  1.015   1.00 32.32 ? 83  ILE C CG2  1  
ATOM 6012   C CD1  . ILE C 1 83  ? 14.086  14.349  0.775   1.00 61.25 ? 83  ILE C CD1  1  
ATOM 6013   H H    . ILE C 1 83  ? 10.934  14.429  1.968   1.00 11.52 ? 83  ILE C H    1  
ATOM 6014   H HA   . ILE C 1 83  ? 13.144  15.915  3.123   1.00 52.33 ? 83  ILE C HA   1  
ATOM 6015   H HB   . ILE C 1 83  ? 11.539  16.763  0.677   1.00 61.00 ? 83  ILE C HB   1  
ATOM 6016   H HG12 . ILE C 1 83  ? 12.066  14.442  0.188   1.00 53.43 ? 83  ILE C HG12 1  
ATOM 6017   H HG13 . ILE C 1 83  ? 13.142  15.456  -0.760  1.00 21.42 ? 83  ILE C HG13 1  
ATOM 6018   H HG21 . ILE C 1 83  ? 13.154  18.381  1.550   1.00 11.30 ? 83  ILE C HG21 1  
ATOM 6019   H HG22 . ILE C 1 83  ? 13.682  17.777  -0.016  1.00 73.14 ? 83  ILE C HG22 1  
ATOM 6020   H HG23 . ILE C 1 83  ? 14.450  17.183  1.455   1.00 11.00 ? 83  ILE C HG23 1  
ATOM 6021   H HD11 . ILE C 1 83  ? 14.426  13.662  0.017   1.00 52.21 ? 83  ILE C HD11 1  
ATOM 6022   H HD12 . ILE C 1 83  ? 13.791  13.794  1.654   1.00 63.21 ? 83  ILE C HD12 1  
ATOM 6023   H HD13 . ILE C 1 83  ? 14.890  15.024  1.031   1.00 14.34 ? 83  ILE C HD13 1  
ATOM 6024   N N    . PHE C 1 84  ? 11.905  17.836  4.189   1.00 34.02 ? 84  PHE C N    1  
ATOM 6025   C CA   . PHE C 1 84  ? 11.190  18.874  4.953   1.00 51.44 ? 84  PHE C CA   1  
ATOM 6026   C C    . PHE C 1 84  ? 12.012  20.178  4.962   1.00 35.43 ? 84  PHE C C    1  
ATOM 6027   O O    . PHE C 1 84  ? 13.251  20.144  4.908   1.00 53.44 ? 84  PHE C O    1  
ATOM 6028   C CB   . PHE C 1 84  ? 10.916  18.384  6.410   1.00 61.23 ? 84  PHE C CB   1  
ATOM 6029   C CG   . PHE C 1 84  ? 10.116  17.074  6.509   1.00 15.13 ? 84  PHE C CG   1  
ATOM 6030   C CD1  . PHE C 1 84  ? 10.712  15.895  6.942   1.00 44.03 ? 84  PHE C CD1  1  
ATOM 6031   C CD2  . PHE C 1 84  ? 8.762   17.029  6.171   1.00 12.22 ? 84  PHE C CD2  1  
ATOM 6032   C CE1  . PHE C 1 84  ? 9.984   14.723  7.042   1.00 21.12 ? 84  PHE C CE1  1  
ATOM 6033   C CE2  . PHE C 1 84  ? 8.036   15.853  6.271   1.00 63.32 ? 84  PHE C CE2  1  
ATOM 6034   C CZ   . PHE C 1 84  ? 8.649   14.706  6.704   1.00 54.43 ? 84  PHE C CZ   1  
ATOM 6035   H H    . PHE C 1 84  ? 12.860  17.700  4.370   1.00 33.05 ? 84  PHE C H    1  
ATOM 6036   H HA   . PHE C 1 84  ? 10.236  19.069  4.462   1.00 62.42 ? 84  PHE C HA   1  
ATOM 6037   H HB2  . PHE C 1 84  ? 11.861  18.246  6.922   1.00 64.23 ? 84  PHE C HB2  1  
ATOM 6038   H HB3  . PHE C 1 84  ? 10.339  19.148  6.947   1.00 35.33 ? 84  PHE C HB3  1  
ATOM 6039   H HD1  . PHE C 1 84  ? 11.761  15.899  7.211   1.00 24.44 ? 84  PHE C HD1  1  
ATOM 6040   H HD2  . PHE C 1 84  ? 8.270   17.932  5.825   1.00 74.31 ? 84  PHE C HD2  1  
ATOM 6041   H HE1  . PHE C 1 84  ? 10.465  13.815  7.381   1.00 1.43  ? 84  PHE C HE1  1  
ATOM 6042   H HE2  . PHE C 1 84  ? 6.981   15.837  6.009   1.00 33.44 ? 84  PHE C HE2  1  
ATOM 6043   H HZ   . PHE C 1 84  ? 8.081   13.788  6.783   1.00 10.31 ? 84  PHE C HZ   1  
ATOM 6044   N N    . SER C 1 85  ? 11.305  21.319  4.980   1.00 62.20 ? 85  SER C N    1  
ATOM 6045   C CA   . SER C 1 85  ? 11.900  22.653  5.182   1.00 3.23  ? 85  SER C CA   1  
ATOM 6046   C C    . SER C 1 85  ? 11.981  22.952  6.688   1.00 61.21 ? 85  SER C C    1  
ATOM 6047   O O    . SER C 1 85  ? 10.963  22.884  7.381   1.00 3.51  ? 85  SER C O    1  
ATOM 6048   C CB   . SER C 1 85  ? 11.042  23.731  4.476   1.00 51.30 ? 85  SER C CB   1  
ATOM 6049   O OG   . SER C 1 85  ? 10.915  23.458  3.096   1.00 50.14 ? 85  SER C OG   1  
ATOM 6050   H H    . SER C 1 85  ? 10.342  21.264  4.841   1.00 62.12 ? 85  SER C H    1  
ATOM 6051   H HA   . SER C 1 85  ? 12.900  22.659  4.752   1.00 44.41 ? 85  SER C HA   1  
ATOM 6052   H HB2  . SER C 1 85  ? 10.049  23.754  4.911   1.00 31.15 ? 85  SER C HB2  1  
ATOM 6053   H HB3  . SER C 1 85  ? 11.503  24.703  4.592   1.00 12.34 ? 85  SER C HB3  1  
ATOM 6054   H HG   . SER C 1 85  ? 11.789  23.432  2.696   1.00 75.43 ? 85  SER C HG   1  
ATOM 6055   N N    . ILE C 1 86  ? 13.193  23.254  7.197   1.00 32.13 ? 86  ILE C N    1  
ATOM 6056   C CA   . ILE C 1 86  ? 13.401  23.608  8.616   1.00 3.01  ? 86  ILE C CA   1  
ATOM 6057   C C    . ILE C 1 86  ? 14.034  25.000  8.713   1.00 74.24 ? 86  ILE C C    1  
ATOM 6058   O O    . ILE C 1 86  ? 15.115  25.225  8.163   1.00 22.12 ? 86  ILE C O    1  
ATOM 6059   C CB   . ILE C 1 86  ? 14.301  22.571  9.413   1.00 54.41 ? 86  ILE C CB   1  
ATOM 6060   C CG1  . ILE C 1 86  ? 13.766  21.095  9.288   1.00 41.41 ? 86  ILE C CG1  1  
ATOM 6061   C CG2  . ILE C 1 86  ? 14.425  22.990  10.913  1.00 2.32  ? 86  ILE C CG2  1  
ATOM 6062   C CD1  . ILE C 1 86  ? 14.200  20.349  8.029   1.00 53.42 ? 86  ILE C CD1  1  
ATOM 6063   H H    . ILE C 1 86  ? 13.968  23.249  6.598   1.00 2.30  ? 86  ILE C H    1  
ATOM 6064   H HA   . ILE C 1 86  ? 12.425  23.638  9.102   1.00 61.54 ? 86  ILE C HA   1  
ATOM 6065   H HB   . ILE C 1 86  ? 15.303  22.613  8.988   1.00 63.34 ? 86  ILE C HB   1  
ATOM 6066   H HG12 . ILE C 1 86  ? 14.114  20.513  10.128  1.00 63.44 ? 86  ILE C HG12 1  
ATOM 6067   H HG13 . ILE C 1 86  ? 12.684  21.106  9.302   1.00 54.11 ? 86  ILE C HG13 1  
ATOM 6068   H HG21 . ILE C 1 86  ? 13.444  23.013  11.369  1.00 13.33 ? 86  ILE C HG21 1  
ATOM 6069   H HG22 . ILE C 1 86  ? 14.871  23.976  10.986  1.00 44.53 ? 86  ILE C HG22 1  
ATOM 6070   H HG23 . ILE C 1 86  ? 15.050  22.283  11.444  1.00 62.40 ? 86  ILE C HG23 1  
ATOM 6071   H HD11 . ILE C 1 86  ? 13.775  19.356  8.033   1.00 52.33 ? 86  ILE C HD11 1  
ATOM 6072   H HD12 . ILE C 1 86  ? 15.279  20.276  8.004   1.00 1.32  ? 86  ILE C HD12 1  
ATOM 6073   H HD13 . ILE C 1 86  ? 13.857  20.882  7.151   1.00 71.41 ? 86  ILE C HD13 1  
ATOM 6074   N N    . ALA C 1 87  ? 13.334  25.917  9.404   1.00 51.34 ? 87  ALA C N    1  
ATOM 6075   C CA   . ALA C 1 87  ? 13.828  27.264  9.727   1.00 22.24 ? 87  ALA C CA   1  
ATOM 6076   C C    . ALA C 1 87  ? 12.973  27.881  10.856  1.00 44.44 ? 87  ALA C C    1  
ATOM 6077   O O    . ALA C 1 87  ? 11.920  27.342  11.212  1.00 53.22 ? 87  ALA C O    1  
ATOM 6078   C CB   . ALA C 1 87  ? 13.838  28.158  8.470   1.00 10.32 ? 87  ALA C CB   1  
ATOM 6079   H H    . ALA C 1 87  ? 12.434  25.673  9.711   1.00 24.13 ? 87  ALA C H    1  
ATOM 6080   H HA   . ALA C 1 87  ? 14.850  27.166  10.085  1.00 54.40 ? 87  ALA C HA   1  
ATOM 6081   H HB1  . ALA C 1 87  ? 14.470  27.709  7.711   1.00 35.51 ? 87  ALA C HB1  1  
ATOM 6082   H HB2  . ALA C 1 87  ? 14.226  29.138  8.715   1.00 54.41 ? 87  ALA C HB2  1  
ATOM 6083   H HB3  . ALA C 1 87  ? 12.834  28.257  8.079   1.00 3.14  ? 87  ALA C HB3  1  
ATOM 6084   N N    . GLY C 1 88  ? 13.452  28.997  11.430  1.00 1.34  ? 88  GLY C N    1  
ATOM 6085   C CA   . GLY C 1 88  ? 12.709  29.763  12.443  1.00 74.23 ? 88  GLY C CA   1  
ATOM 6086   C C    . GLY C 1 88  ? 13.120  29.405  13.870  1.00 52.11 ? 88  GLY C C    1  
ATOM 6087   O O    . GLY C 1 88  ? 13.621  30.257  14.614  1.00 3.24  ? 88  GLY C O    1  
ATOM 6088   H H    . GLY C 1 88  ? 14.349  29.300  11.179  1.00 54.24 ? 88  GLY C H    1  
ATOM 6089   H HA2  . GLY C 1 88  ? 12.901  30.814  12.276  1.00 64.20 ? 88  GLY C HA2  1  
ATOM 6090   H HA3  . GLY C 1 88  ? 11.643  29.592  12.331  1.00 65.40 ? 88  GLY C HA3  1  
ATOM 6091   N N    . ILE C 1 89  ? 12.929  28.131  14.237  1.00 40.21 ? 89  ILE C N    1  
ATOM 6092   C CA   . ILE C 1 89  ? 13.242  27.610  15.588  1.00 23.00 ? 89  ILE C CA   1  
ATOM 6093   C C    . ILE C 1 89  ? 14.637  26.959  15.602  1.00 14.51 ? 89  ILE C C    1  
ATOM 6094   O O    . ILE C 1 89  ? 15.099  26.433  14.578  1.00 12.30 ? 89  ILE C O    1  
ATOM 6095   C CB   . ILE C 1 89  ? 12.140  26.587  16.063  1.00 74.40 ? 89  ILE C CB   1  
ATOM 6096   C CG1  . ILE C 1 89  ? 12.022  25.377  15.067  1.00 13.43 ? 89  ILE C CG1  1  
ATOM 6097   C CG2  . ILE C 1 89  ? 10.777  27.308  16.247  1.00 11.23 ? 89  ILE C CG2  1  
ATOM 6098   C CD1  . ILE C 1 89  ? 10.959  24.345  15.418  1.00 3.23  ? 89  ILE C CD1  1  
ATOM 6099   H H    . ILE C 1 89  ? 12.575  27.507  13.569  1.00 43.35 ? 89  ILE C H    1  
ATOM 6100   H HA   . ILE C 1 89  ? 13.253  28.445  16.295  1.00 42.11 ? 89  ILE C HA   1  
ATOM 6101   H HB   . ILE C 1 89  ? 12.438  26.208  17.040  1.00 31.42 ? 89  ILE C HB   1  
ATOM 6102   H HG12 . ILE C 1 89  ? 11.793  25.747  14.078  1.00 71.13 ? 89  ILE C HG12 1  
ATOM 6103   H HG13 . ILE C 1 89  ? 12.974  24.859  15.029  1.00 53.10 ? 89  ILE C HG13 1  
ATOM 6104   H HG21 . ILE C 1 89  ? 10.033  26.608  16.605  1.00 50.21 ? 89  ILE C HG21 1  
ATOM 6105   H HG22 . ILE C 1 89  ? 10.448  27.719  15.300  1.00 11.00 ? 89  ILE C HG22 1  
ATOM 6106   H HG23 . ILE C 1 89  ? 10.881  28.114  16.965  1.00 73.21 ? 89  ILE C HG23 1  
ATOM 6107   H HD11 . ILE C 1 89  ? 11.055  23.495  14.757  1.00 23.04 ? 89  ILE C HD11 1  
ATOM 6108   H HD12 . ILE C 1 89  ? 9.977   24.778  15.301  1.00 52.44 ? 89  ILE C HD12 1  
ATOM 6109   H HD13 . ILE C 1 89  ? 11.091  24.016  16.440  1.00 43.10 ? 89  ILE C HD13 1  
ATOM 6110   N N    . GLU C 1 90  ? 15.293  26.996  16.773  1.00 25.34 ? 90  GLU C N    1  
ATOM 6111   C CA   . GLU C 1 90  ? 16.665  26.486  16.959  1.00 33.32 ? 90  GLU C CA   1  
ATOM 6112   C C    . GLU C 1 90  ? 16.819  25.932  18.384  1.00 11.32 ? 90  GLU C C    1  
ATOM 6113   O O    . GLU C 1 90  ? 16.222  26.457  19.326  1.00 53.04 ? 90  GLU C O    1  
ATOM 6114   C CB   . GLU C 1 90  ? 17.698  27.619  16.687  1.00 45.10 ? 90  GLU C CB   1  
ATOM 6115   C CG   . GLU C 1 90  ? 19.187  27.220  16.836  1.00 0.34  ? 90  GLU C CG   1  
ATOM 6116   C CD   . GLU C 1 90  ? 19.613  26.065  15.916  1.00 75.41 ? 90  GLU C CD   1  
ATOM 6117   O OE1  . GLU C 1 90  ? 19.776  26.290  14.698  1.00 75.42 ? 90  GLU C OE1  1  
ATOM 6118   O OE2  . GLU C 1 90  ? 19.778  24.931  16.412  1.00 13.42 ? 90  GLU C OE2  1  
ATOM 6119   H H    . GLU C 1 90  ? 14.830  27.376  17.555  1.00 25.24 ? 90  GLU C H    1  
ATOM 6120   H HA   . GLU C 1 90  ? 16.828  25.676  16.249  1.00 22.05 ? 90  GLU C HA   1  
ATOM 6121   H HB2  . GLU C 1 90  ? 17.552  27.983  15.676  1.00 74.22 ? 90  GLU C HB2  1  
ATOM 6122   H HB3  . GLU C 1 90  ? 17.498  28.438  17.373  1.00 63.44 ? 90  GLU C HB3  1  
ATOM 6123   H HG2  . GLU C 1 90  ? 19.804  28.085  16.613  1.00 43.01 ? 90  GLU C HG2  1  
ATOM 6124   H HG3  . GLU C 1 90  ? 19.360  26.935  17.869  1.00 33.51 ? 90  GLU C HG3  1  
ATOM 6125   N N    . GLY C 1 91  ? 17.642  24.885  18.526  1.00 41.21 ? 91  GLY C N    1  
ATOM 6126   C CA   . GLY C 1 91  ? 17.845  24.207  19.798  1.00 14.24 ? 91  GLY C CA   1  
ATOM 6127   C C    . GLY C 1 91  ? 16.879  23.046  19.976  1.00 5.12  ? 91  GLY C C    1  
ATOM 6128   O O    . GLY C 1 91  ? 16.598  22.330  19.011  1.00 74.45 ? 91  GLY C O    1  
ATOM 6129   H H    . GLY C 1 91  ? 18.128  24.563  17.736  1.00 54.01 ? 91  GLY C H    1  
ATOM 6130   H HA2  . GLY C 1 91  ? 18.856  23.824  19.822  1.00 70.04 ? 91  GLY C HA2  1  
ATOM 6131   H HA3  . GLY C 1 91  ? 17.724  24.910  20.619  1.00 3.00  ? 91  GLY C HA3  1  
ATOM 6132   N N    . THR C 1 92  ? 16.345  22.888  21.195  1.00 40.31 ? 92  THR C N    1  
ATOM 6133   C CA   . THR C 1 92  ? 15.477  21.755  21.574  1.00 53.44 ? 92  THR C CA   1  
ATOM 6134   C C    . THR C 1 92  ? 14.096  21.772  20.869  1.00 10.01 ? 92  THR C C    1  
ATOM 6135   O O    . THR C 1 92  ? 13.448  20.725  20.763  1.00 34.32 ? 92  THR C O    1  
ATOM 6136   C CB   . THR C 1 92  ? 15.300  21.712  23.125  1.00 64.45 ? 92  THR C CB   1  
ATOM 6137   O OG1  . THR C 1 92  ? 15.051  23.048  23.608  1.00 35.43 ? 92  THR C OG1  1  
ATOM 6138   C CG2  . THR C 1 92  ? 16.543  21.115  23.828  1.00 32.04 ? 92  THR C CG2  1  
ATOM 6139   H H    . THR C 1 92  ? 16.547  23.558  21.883  1.00 22.23 ? 92  THR C H    1  
ATOM 6140   H HA   . THR C 1 92  ? 15.990  20.842  21.273  1.00 42.53 ? 92  THR C HA   1  
ATOM 6141   H HB   . THR C 1 92  ? 14.439  21.093  23.369  1.00 44.12 ? 92  THR C HB   1  
ATOM 6142   H HG1  . THR C 1 92  ? 14.845  23.020  24.552  1.00 54.50 ? 92  THR C HG1  1  
ATOM 6143   H HG21 . THR C 1 92  ? 17.420  21.704  23.591  1.00 1.12  ? 92  THR C HG21 1  
ATOM 6144   H HG22 . THR C 1 92  ? 16.695  20.096  23.496  1.00 11.12 ? 92  THR C HG22 1  
ATOM 6145   H HG23 . THR C 1 92  ? 16.390  21.118  24.901  1.00 53.43 ? 92  THR C HG23 1  
ATOM 6146   N N    . GLN C 1 93  ? 13.655  22.947  20.380  1.00 24.41 ? 93  GLN C N    1  
ATOM 6147   C CA   . GLN C 1 93  ? 12.377  23.073  19.633  1.00 23.35 ? 93  GLN C CA   1  
ATOM 6148   C C    . GLN C 1 93  ? 12.572  22.554  18.200  1.00 4.03  ? 93  GLN C C    1  
ATOM 6149   O O    . GLN C 1 93  ? 11.703  21.867  17.647  1.00 51.34 ? 93  GLN C O    1  
ATOM 6150   C CB   . GLN C 1 93  ? 11.855  24.541  19.616  1.00 31.34 ? 93  GLN C CB   1  
ATOM 6151   C CG   . GLN C 1 93  ? 11.754  25.200  21.017  1.00 41.15 ? 93  GLN C CG   1  
ATOM 6152   C CD   . GLN C 1 93  ? 13.083  25.764  21.524  1.00 5.11  ? 93  GLN C CD   1  
ATOM 6153   O OE1  . GLN C 1 93  ? 13.393  25.697  22.710  1.00 13.51 ? 93  GLN C OE1  1  
ATOM 6154   N NE2  . GLN C 1 93  ? 13.854  26.367  20.624  1.00 51.41 ? 93  GLN C NE2  1  
ATOM 6155   H H    . GLN C 1 93  ? 14.198  23.748  20.529  1.00 71.35 ? 93  GLN C H    1  
ATOM 6156   H HA   . GLN C 1 93  ? 11.638  22.446  20.131  1.00 53.23 ? 93  GLN C HA   1  
ATOM 6157   H HB2  . GLN C 1 93  ? 12.521  25.141  19.002  1.00 40.45 ? 93  GLN C HB2  1  
ATOM 6158   H HB3  . GLN C 1 93  ? 10.872  24.557  19.161  1.00 32.30 ? 93  GLN C HB3  1  
ATOM 6159   H HG2  . GLN C 1 93  ? 11.044  26.017  20.972  1.00 52.54 ? 93  GLN C HG2  1  
ATOM 6160   H HG3  . GLN C 1 93  ? 11.398  24.463  21.728  1.00 64.22 ? 93  GLN C HG3  1  
ATOM 6161   H HE21 . GLN C 1 93  ? 13.537  26.420  19.701  1.00 33.33 ? 93  GLN C HE21 1  
ATOM 6162   H HE22 . GLN C 1 93  ? 14.696  26.763  20.920  1.00 50.41 ? 93  GLN C HE22 1  
ATOM 6163   N N    . MET C 1 94  ? 13.735  22.896  17.619  1.00 30.00 ? 94  MET C N    1  
ATOM 6164   C CA   . MET C 1 94  ? 14.184  22.379  16.310  1.00 22.15 ? 94  MET C CA   1  
ATOM 6165   C C    . MET C 1 94  ? 14.439  20.862  16.398  1.00 24.32 ? 94  MET C C    1  
ATOM 6166   O O    . MET C 1 94  ? 14.122  20.115  15.470  1.00 54.12 ? 94  MET C O    1  
ATOM 6167   C CB   . MET C 1 94  ? 15.448  23.170  15.864  1.00 62.43 ? 94  MET C CB   1  
ATOM 6168   C CG   . MET C 1 94  ? 16.132  22.700  14.564  1.00 24.20 ? 94  MET C CG   1  
ATOM 6169   S SD   . MET C 1 94  ? 17.228  21.287  14.812  1.00 23.01 ? 94  MET C SD   1  
ATOM 6170   C CE   . MET C 1 94  ? 18.438  21.942  15.956  1.00 55.44 ? 94  MET C CE   1  
ATOM 6171   H H    . MET C 1 94  ? 14.319  23.524  18.091  1.00 1.23  ? 94  MET C H    1  
ATOM 6172   H HA   . MET C 1 94  ? 13.387  22.560  15.592  1.00 21.13 ? 94  MET C HA   1  
ATOM 6173   H HB2  . MET C 1 94  ? 15.165  24.210  15.732  1.00 52.33 ? 94  MET C HB2  1  
ATOM 6174   H HB3  . MET C 1 94  ? 16.181  23.125  16.664  1.00 43.35 ? 94  MET C HB3  1  
ATOM 6175   H HG2  . MET C 1 94  ? 15.373  22.419  13.847  1.00 23.13 ? 94  MET C HG2  1  
ATOM 6176   H HG3  . MET C 1 94  ? 16.715  23.514  14.155  1.00 71.44 ? 94  MET C HG3  1  
ATOM 6177   H HE1  . MET C 1 94  ? 17.948  22.245  16.870  1.00 3.31  ? 94  MET C HE1  1  
ATOM 6178   H HE2  . MET C 1 94  ? 18.934  22.795  15.512  1.00 64.22 ? 94  MET C HE2  1  
ATOM 6179   H HE3  . MET C 1 94  ? 19.169  21.179  16.180  1.00 74.21 ? 94  MET C HE3  1  
ATOM 6180   N N    . ALA C 1 95  ? 14.958  20.428  17.561  1.00 2.11  ? 95  ALA C N    1  
ATOM 6181   C CA   . ALA C 1 95  ? 15.199  19.006  17.878  1.00 14.41 ? 95  ALA C CA   1  
ATOM 6182   C C    . ALA C 1 95  ? 13.884  18.234  18.019  1.00 12.13 ? 95  ALA C C    1  
ATOM 6183   O O    . ALA C 1 95  ? 13.812  17.052  17.695  1.00 14.50 ? 95  ALA C O    1  
ATOM 6184   C CB   . ALA C 1 95  ? 16.010  18.889  19.170  1.00 40.52 ? 95  ALA C CB   1  
ATOM 6185   H H    . ALA C 1 95  ? 15.193  21.095  18.234  1.00 63.13 ? 95  ALA C H    1  
ATOM 6186   H HA   . ALA C 1 95  ? 15.783  18.575  17.069  1.00 25.10 ? 95  ALA C HA   1  
ATOM 6187   H HB1  . ALA C 1 95  ? 16.891  19.503  19.097  1.00 44.24 ? 95  ALA C HB1  1  
ATOM 6188   H HB2  . ALA C 1 95  ? 16.307  17.859  19.326  1.00 14.34 ? 95  ALA C HB2  1  
ATOM 6189   H HB3  . ALA C 1 95  ? 15.415  19.221  20.012  1.00 34.40 ? 95  ALA C HB3  1  
ATOM 6190   N N    . HIS C 1 96  ? 12.859  18.921  18.553  1.00 73.01 ? 96  HIS C N    1  
ATOM 6191   C CA   . HIS C 1 96  ? 11.490  18.382  18.636  1.00 50.40 ? 96  HIS C CA   1  
ATOM 6192   C C    . HIS C 1 96  ? 10.906  18.195  17.226  1.00 34.23 ? 96  HIS C C    1  
ATOM 6193   O O    . HIS C 1 96  ? 10.231  17.196  16.962  1.00 13.12 ? 96  HIS C O    1  
ATOM 6194   C CB   . HIS C 1 96  ? 10.576  19.318  19.474  1.00 13.01 ? 96  HIS C CB   1  
ATOM 6195   C CG   . HIS C 1 96  ? 9.116   18.927  19.452  1.00 71.03 ? 96  HIS C CG   1  
ATOM 6196   N ND1  . HIS C 1 96  ? 8.204   19.481  18.575  1.00 42.31 ? 96  HIS C ND1  1  
ATOM 6197   C CD2  . HIS C 1 96  ? 8.426   18.000  20.162  1.00 11.43 ? 96  HIS C CD2  1  
ATOM 6198   C CE1  . HIS C 1 96  ? 7.032   18.909  18.742  1.00 31.32 ? 96  HIS C CE1  1  
ATOM 6199   N NE2  . HIS C 1 96  ? 7.133   18.006  19.696  1.00 55.45 ? 96  HIS C NE2  1  
ATOM 6200   H H    . HIS C 1 96  ? 13.038  19.813  18.916  1.00 63.15 ? 96  HIS C H    1  
ATOM 6201   H HA   . HIS C 1 96  ? 11.545  17.413  19.129  1.00 72.32 ? 96  HIS C HA   1  
ATOM 6202   H HB2  . HIS C 1 96  ? 10.907  19.307  20.503  1.00 52.32 ? 96  HIS C HB2  1  
ATOM 6203   H HB3  . HIS C 1 96  ? 10.658  20.332  19.092  1.00 10.04 ? 96  HIS C HB3  1  
ATOM 6204   H HD1  . HIS C 1 96  ? 8.390   20.188  17.921  1.00 15.31 ? 96  HIS C HD1  1  
ATOM 6205   H HD2  . HIS C 1 96  ? 8.819   17.373  20.950  1.00 41.51 ? 96  HIS C HD2  1  
ATOM 6206   H HE1  . HIS C 1 96  ? 6.141   19.123  18.174  1.00 31.13 ? 96  HIS C HE1  1  
ATOM 6207   H HE2  . HIS C 1 96  ? 6.513   17.254  19.789  1.00 37.61 ? 96  HIS C HE2  1  
ATOM 6208   N N    . CYS C 1 97  ? 11.167  19.179  16.335  1.00 71.21 ? 97  CYS C N    1  
ATOM 6209   C CA   . CYS C 1 97  ? 10.667  19.151  14.948  1.00 45.04 ? 97  CYS C CA   1  
ATOM 6210   C C    . CYS C 1 97  ? 11.261  17.957  14.189  1.00 64.23 ? 97  CYS C C    1  
ATOM 6211   O O    . CYS C 1 97  ? 10.537  17.219  13.545  1.00 73.53 ? 97  CYS C O    1  
ATOM 6212   C CB   . CYS C 1 97  ? 10.963  20.474  14.198  1.00 3.31  ? 97  CYS C CB   1  
ATOM 6213   S SG   . CYS C 1 97  ? 10.454  20.487  12.447  1.00 3.25  ? 97  CYS C SG   1  
ATOM 6214   H H    . CYS C 1 97  ? 11.725  19.934  16.620  1.00 52.43 ? 97  CYS C H    1  
ATOM 6215   H HA   . CYS C 1 97  ? 9.589   19.024  15.001  1.00 73.04 ? 97  CYS C HA   1  
ATOM 6216   H HB2  . CYS C 1 97  ? 10.441  21.285  14.690  1.00 61.40 ? 97  CYS C HB2  1  
ATOM 6217   H HB3  . CYS C 1 97  ? 12.027  20.673  14.232  1.00 50.11 ? 97  CYS C HB3  1  
ATOM 6218   H HG   . CYS C 1 97  ? 9.181   20.095  12.340  1.00 21.43 ? 97  CYS C HG   1  
ATOM 6219   N N    . LEU C 1 98  ? 12.572  17.748  14.338  1.00 72.50 ? 98  LEU C N    1  
ATOM 6220   C CA   . LEU C 1 98  ? 13.312  16.705  13.600  1.00 21.21 ? 98  LEU C CA   1  
ATOM 6221   C C    . LEU C 1 98  ? 13.154  15.313  14.236  1.00 2.13  ? 98  LEU C C    1  
ATOM 6222   O O    . LEU C 1 98  ? 12.825  14.352  13.553  1.00 42.25 ? 98  LEU C O    1  
ATOM 6223   C CB   . LEU C 1 98  ? 14.802  17.085  13.556  1.00 11.51 ? 98  LEU C CB   1  
ATOM 6224   C CG   . LEU C 1 98  ? 15.141  18.390  12.792  1.00 14.13 ? 98  LEU C CG   1  
ATOM 6225   C CD1  . LEU C 1 98  ? 16.584  18.809  13.067  1.00 64.42 ? 98  LEU C CD1  1  
ATOM 6226   C CD2  . LEU C 1 98  ? 14.876  18.237  11.277  1.00 25.14 ? 98  LEU C CD2  1  
ATOM 6227   H H    . LEU C 1 98  ? 13.070  18.320  14.961  1.00 54.44 ? 98  LEU C H    1  
ATOM 6228   H HA   . LEU C 1 98  ? 12.929  16.675  12.581  1.00 1.32  ? 98  LEU C HA   1  
ATOM 6229   H HB2  . LEU C 1 98  ? 15.151  17.186  14.584  1.00 14.21 ? 98  LEU C HB2  1  
ATOM 6230   H HB3  . LEU C 1 98  ? 15.356  16.269  13.097  1.00 72.13 ? 98  LEU C HB3  1  
ATOM 6231   H HG   . LEU C 1 98  ? 14.501  19.185  13.157  1.00 64.34 ? 98  LEU C HG   1  
ATOM 6232   H HD11 . LEU C 1 98  ? 17.269  18.064  12.679  1.00 14.24 ? 98  LEU C HD11 1  
ATOM 6233   H HD12 . LEU C 1 98  ? 16.737  18.907  14.134  1.00 31.32 ? 98  LEU C HD12 1  
ATOM 6234   H HD13 . LEU C 1 98  ? 16.786  19.760  12.598  1.00 14.41 ? 98  LEU C HD13 1  
ATOM 6235   H HD21 . LEU C 1 98  ? 15.147  19.157  10.769  1.00 62.43 ? 98  LEU C HD21 1  
ATOM 6236   H HD22 . LEU C 1 98  ? 13.827  18.039  11.111  1.00 51.51 ? 98  LEU C HD22 1  
ATOM 6237   H HD23 . LEU C 1 98  ? 15.464  17.420  10.877  1.00 63.52 ? 98  LEU C HD23 1  
ATOM 6238   N N    . GLY C 1 99  ? 13.422  15.224  15.544  1.00 33.12 ? 99  GLY C N    1  
ATOM 6239   C CA   . GLY C 1 99  ? 13.542  13.940  16.255  1.00 23.05 ? 99  GLY C CA   1  
ATOM 6240   C C    . GLY C 1 99  ? 12.232  13.367  16.778  1.00 60.11 ? 99  GLY C C    1  
ATOM 6241   O O    . GLY C 1 99  ? 12.250  12.400  17.552  1.00 1.45  ? 99  GLY C O    1  
ATOM 6242   H H    . GLY C 1 99  ? 13.559  16.051  16.044  1.00 50.33 ? 99  GLY C H    1  
ATOM 6243   H HA2  . GLY C 1 99  ? 14.000  13.207  15.600  1.00 53.23 ? 99  GLY C HA2  1  
ATOM 6244   H HA3  . GLY C 1 99  ? 14.207  14.095  17.096  1.00 73.25 ? 99  GLY C HA3  1  
ATOM 6245   N N    . ALA C 1 100 ? 11.093  13.945  16.354  1.00 14.11 ? 100 ALA C N    1  
ATOM 6246   C CA   . ALA C 1 100 ? 9.758   13.520  16.825  1.00 35.43 ? 100 ALA C CA   1  
ATOM 6247   C C    . ALA C 1 100 ? 8.683   13.831  15.772  1.00 2.13  ? 100 ALA C C    1  
ATOM 6248   O O    . ALA C 1 100 ? 8.073   12.934  15.195  1.00 51.40 ? 100 ALA C O    1  
ATOM 6249   C CB   . ALA C 1 100 ? 9.421   14.212  18.164  1.00 30.31 ? 100 ALA C CB   1  
ATOM 6250   H H    . ALA C 1 100 ? 11.152  14.669  15.702  1.00 42.13 ? 100 ALA C H    1  
ATOM 6251   H HA   . ALA C 1 100 ? 9.777   12.444  16.997  1.00 64.31 ? 100 ALA C HA   1  
ATOM 6252   H HB1  . ALA C 1 100 ? 8.481   13.833  18.546  1.00 54.42 ? 100 ALA C HB1  1  
ATOM 6253   H HB2  . ALA C 1 100 ? 9.338   15.285  18.018  1.00 34.10 ? 100 ALA C HB2  1  
ATOM 6254   H HB3  . ALA C 1 100 ? 10.204  14.010  18.883  1.00 14.23 ? 100 ALA C HB3  1  
ATOM 6255   N N    . TYR C 1 101 ? 8.551   15.125  15.493  1.00 22.51 ? 101 TYR C N    1  
ATOM 6256   C CA   . TYR C 1 101 ? 7.423   15.733  14.763  1.00 0.32  ? 101 TYR C CA   1  
ATOM 6257   C C    . TYR C 1 101 ? 7.458   15.475  13.228  1.00 25.44 ? 101 TYR C C    1  
ATOM 6258   O O    . TYR C 1 101 ? 6.407   15.271  12.602  1.00 55.10 ? 101 TYR C O    1  
ATOM 6259   C CB   . TYR C 1 101 ? 7.465   17.240  15.131  1.00 24.30 ? 101 TYR C CB   1  
ATOM 6260   C CG   . TYR C 1 101 ? 6.645   18.200  14.278  1.00 21.10 ? 101 TYR C CG   1  
ATOM 6261   C CD1  . TYR C 1 101 ? 5.293   18.458  14.532  1.00 43.32 ? 101 TYR C CD1  1  
ATOM 6262   C CD2  . TYR C 1 101 ? 7.260   18.900  13.246  1.00 63.54 ? 101 TYR C CD2  1  
ATOM 6263   C CE1  . TYR C 1 101 ? 4.595   19.377  13.773  1.00 61.24 ? 101 TYR C CE1  1  
ATOM 6264   C CE2  . TYR C 1 101 ? 6.576   19.797  12.496  1.00 53.31 ? 101 TYR C CE2  1  
ATOM 6265   C CZ   . TYR C 1 101 ? 5.244   20.043  12.756  1.00 53.05 ? 101 TYR C CZ   1  
ATOM 6266   O OH   . TYR C 1 101 ? 4.565   20.965  11.984  1.00 40.40 ? 101 TYR C OH   1  
ATOM 6267   H H    . TYR C 1 101 ? 9.257   15.728  15.803  1.00 4.32  ? 101 TYR C H    1  
ATOM 6268   H HA   . TYR C 1 101 ? 6.504   15.310  15.160  1.00 13.10 ? 101 TYR C HA   1  
ATOM 6269   H HB2  . TYR C 1 101 ? 7.131   17.355  16.157  1.00 23.43 ? 101 TYR C HB2  1  
ATOM 6270   H HB3  . TYR C 1 101 ? 8.503   17.567  15.088  1.00 22.43 ? 101 TYR C HB3  1  
ATOM 6271   H HD1  . TYR C 1 101 ? 4.791   17.923  15.331  1.00 34.34 ? 101 TYR C HD1  1  
ATOM 6272   H HD2  . TYR C 1 101 ? 8.304   18.707  13.018  1.00 72.45 ? 101 TYR C HD2  1  
ATOM 6273   H HE1  . TYR C 1 101 ? 3.548   19.568  13.976  1.00 24.20 ? 101 TYR C HE1  1  
ATOM 6274   H HE2  . TYR C 1 101 ? 7.095   20.320  11.672  1.00 52.24 ? 101 TYR C HE2  1  
ATOM 6275   H HH   . TYR C 1 101 ? 4.828   20.858  11.059  1.00 74.40 ? 101 TYR C HH   1  
ATOM 6276   N N    . CYS C 1 102 ? 8.662   15.478  12.631  1.00 21.10 ? 102 CYS C N    1  
ATOM 6277   C CA   . CYS C 1 102 ? 8.849   15.261  11.173  1.00 10.25 ? 102 CYS C CA   1  
ATOM 6278   C C    . CYS C 1 102 ? 8.735   13.757  10.787  1.00 33.40 ? 102 CYS C C    1  
ATOM 6279   O O    . CYS C 1 102 ? 8.088   13.443  9.789   1.00 73.43 ? 102 CYS C O    1  
ATOM 6280   C CB   . CYS C 1 102 ? 10.186  15.863  10.672  1.00 15.14 ? 102 CYS C CB   1  
ATOM 6281   S SG   . CYS C 1 102 ? 10.244  17.672  10.707  1.00 54.44 ? 102 CYS C SG   1  
ATOM 6282   H H    . CYS C 1 102 ? 9.453   15.616  13.186  1.00 2.50  ? 102 CYS C H    1  
ATOM 6283   H HA   . CYS C 1 102 ? 8.038   15.794  10.673  1.00 71.43 ? 102 CYS C HA   1  
ATOM 6284   H HB2  . CYS C 1 102 ? 10.997  15.504  11.290  1.00 44.53 ? 102 CYS C HB2  1  
ATOM 6285   H HB3  . CYS C 1 102 ? 10.360  15.558  9.648   1.00 63.34 ? 102 CYS C HB3  1  
ATOM 6286   H HG   . CYS C 1 102 ? 9.065   18.124  10.317  1.00 60.45 ? 102 CYS C HG   1  
ATOM 6287   N N    . PRO C 1 103 ? 9.356   12.780  11.547  1.00 51.12 ? 103 PRO C N    1  
ATOM 6288   C CA   . PRO C 1 103 ? 9.135   11.338  11.297  1.00 52.23 ? 103 PRO C CA   1  
ATOM 6289   C C    . PRO C 1 103 ? 7.758   10.855  11.815  1.00 23.34 ? 103 PRO C C    1  
ATOM 6290   O O    . PRO C 1 103 ? 7.367   9.720   11.540  1.00 20.52 ? 103 PRO C O    1  
ATOM 6291   C CB   . PRO C 1 103 ? 10.307  10.669  12.041  1.00 73.05 ? 103 PRO C CB   1  
ATOM 6292   C CG   . PRO C 1 103 ? 10.611  11.589  13.176  1.00 42.32 ? 103 PRO C CG   1  
ATOM 6293   C CD   . PRO C 1 103 ? 10.343  12.977  12.642  1.00 51.30 ? 103 PRO C CD   1  
ATOM 6294   H HA   . PRO C 1 103 ? 9.205   11.110  10.231  1.00 2.21  ? 103 PRO C HA   1  
ATOM 6295   H HB2  . PRO C 1 103 ? 10.022  9.678   12.395  1.00 21.53 ? 103 PRO C HB2  1  
ATOM 6296   H HB3  . PRO C 1 103 ? 11.167  10.585  11.387  1.00 41.21 ? 103 PRO C HB3  1  
ATOM 6297   H HG2  . PRO C 1 103 ? 9.962   11.367  14.021  1.00 20.10 ? 103 PRO C HG2  1  
ATOM 6298   H HG3  . PRO C 1 103 ? 11.650  11.495  13.473  1.00 75.24 ? 103 PRO C HG3  1  
ATOM 6299   H HD2  . PRO C 1 103 ? 9.932   13.612  13.420  1.00 40.24 ? 103 PRO C HD2  1  
ATOM 6300   H HD3  . PRO C 1 103 ? 11.256  13.419  12.251  1.00 61.11 ? 103 PRO C HD3  1  
ATOM 6301   N N    . ASN C 1 104 ? 7.049   11.723  12.579  1.00 72.05 ? 104 ASN C N    1  
ATOM 6302   C CA   . ASN C 1 104 ? 5.622   11.518  12.950  1.00 32.34 ? 104 ASN C CA   1  
ATOM 6303   C C    . ASN C 1 104 ? 4.758   11.647  11.683  1.00 34.31 ? 104 ASN C C    1  
ATOM 6304   O O    . ASN C 1 104 ? 3.785   10.906  11.498  1.00 4.02  ? 104 ASN C O    1  
ATOM 6305   C CB   . ASN C 1 104 ? 5.182   12.558  14.029  1.00 62.01 ? 104 ASN C CB   1  
ATOM 6306   C CG   . ASN C 1 104 ? 3.811   12.304  14.689  1.00 21.32 ? 104 ASN C CG   1  
ATOM 6307   O OD1  . ASN C 1 104 ? 2.874   11.780  14.084  1.00 13.50 ? 104 ASN C OD1  1  
ATOM 6308   N ND2  . ASN C 1 104 ? 3.687   12.686  15.952  1.00 33.54 ? 104 ASN C ND2  1  
ATOM 6309   H H    . ASN C 1 104 ? 7.507   12.520  12.923  1.00 22.21 ? 104 ASN C H    1  
ATOM 6310   H HA   . ASN C 1 104 ? 5.521   10.514  13.352  1.00 54.42 ? 104 ASN C HA   1  
ATOM 6311   H HB2  . ASN C 1 104 ? 5.928   12.572  14.812  1.00 31.11 ? 104 ASN C HB2  1  
ATOM 6312   H HB3  . ASN C 1 104 ? 5.155   13.543  13.574  1.00 74.04 ? 104 ASN C HB3  1  
ATOM 6313   H HD21 . ASN C 1 104 ? 4.466   13.096  16.391  1.00 41.10 ? 104 ASN C HD21 1  
ATOM 6314   H HD22 . ASN C 1 104 ? 2.827   12.549  16.393  1.00 72.31 ? 104 ASN C HD22 1  
ATOM 6315   N N    . ILE C 1 105 ? 5.157   12.594  10.800  1.00 61.04 ? 105 ILE C N    1  
ATOM 6316   C CA   . ILE C 1 105 ? 4.565   12.744  9.456   1.00 5.13  ? 105 ILE C CA   1  
ATOM 6317   C C    . ILE C 1 105 ? 4.758   11.433  8.662   1.00 34.31 ? 105 ILE C C    1  
ATOM 6318   O O    . ILE C 1 105 ? 3.829   10.932  8.032   1.00 13.14 ? 105 ILE C O    1  
ATOM 6319   C CB   . ILE C 1 105 ? 5.220   13.937  8.644   1.00 21.42 ? 105 ILE C CB   1  
ATOM 6320   C CG1  . ILE C 1 105 ? 5.159   15.295  9.423   1.00 43.43 ? 105 ILE C CG1  1  
ATOM 6321   C CG2  . ILE C 1 105 ? 4.585   14.081  7.245   1.00 70.25 ? 105 ILE C CG2  1  
ATOM 6322   C CD1  . ILE C 1 105 ? 3.771   15.704  9.878   1.00 13.14 ? 105 ILE C CD1  1  
ATOM 6323   H H    . ILE C 1 105 ? 5.872   13.206  11.066  1.00 3.45  ? 105 ILE C H    1  
ATOM 6324   H HA   . ILE C 1 105 ? 3.502   12.942  9.574   1.00 2.40  ? 105 ILE C HA   1  
ATOM 6325   H HB   . ILE C 1 105 ? 6.269   13.684  8.491   1.00 74.32 ? 105 ILE C HB   1  
ATOM 6326   H HG12 . ILE C 1 105 ? 5.780   15.225  10.306  1.00 74.52 ? 105 ILE C HG12 1  
ATOM 6327   H HG13 . ILE C 1 105 ? 5.545   16.094  8.787   1.00 35.10 ? 105 ILE C HG13 1  
ATOM 6328   H HG21 . ILE C 1 105 ? 4.694   13.151  6.695   1.00 51.01 ? 105 ILE C HG21 1  
ATOM 6329   H HG22 . ILE C 1 105 ? 5.080   14.869  6.699   1.00 22.13 ? 105 ILE C HG22 1  
ATOM 6330   H HG23 . ILE C 1 105 ? 3.537   14.323  7.334   1.00 45.44 ? 105 ILE C HG23 1  
ATOM 6331   H HD11 . ILE C 1 105 ? 3.791   16.708  10.250  1.00 61.41 ? 105 ILE C HD11 1  
ATOM 6332   H HD12 . ILE C 1 105 ? 3.435   15.039  10.661  1.00 22.33 ? 105 ILE C HD12 1  
ATOM 6333   H HD13 . ILE C 1 105 ? 3.086   15.649  9.045   1.00 43.21 ? 105 ILE C HD13 1  
ATOM 6334   N N    . LEU C 1 106 ? 5.977   10.874  8.773   1.00 71.32 ? 106 LEU C N    1  
ATOM 6335   C CA   . LEU C 1 106 ? 6.427   9.697   8.001   1.00 34.32 ? 106 LEU C CA   1  
ATOM 6336   C C    . LEU C 1 106 ? 5.952   8.365   8.608   1.00 5.04  ? 106 LEU C C    1  
ATOM 6337   O O    . LEU C 1 106 ? 5.997   7.328   7.929   1.00 52.50 ? 106 LEU C O    1  
ATOM 6338   C CB   . LEU C 1 106 ? 7.970   9.704   7.928   1.00 62.23 ? 106 LEU C CB   1  
ATOM 6339   C CG   . LEU C 1 106 ? 8.611   10.961  7.276   1.00 75.21 ? 106 LEU C CG   1  
ATOM 6340   C CD1  . LEU C 1 106 ? 10.149  10.847  7.242   1.00 24.03 ? 106 LEU C CD1  1  
ATOM 6341   C CD2  . LEU C 1 106 ? 8.013   11.231  5.874   1.00 13.35 ? 106 LEU C CD2  1  
ATOM 6342   H H    . LEU C 1 106 ? 6.607   11.275  9.403   1.00 45.33 ? 106 LEU C H    1  
ATOM 6343   H HA   . LEU C 1 106 ? 6.030   9.783   6.994   1.00 62.35 ? 106 LEU C HA   1  
ATOM 6344   H HB2  . LEU C 1 106 ? 8.358   9.609   8.940   1.00 75.42 ? 106 LEU C HB2  1  
ATOM 6345   H HB3  . LEU C 1 106 ? 8.288   8.835   7.366   1.00 12.21 ? 106 LEU C HB3  1  
ATOM 6346   H HG   . LEU C 1 106 ? 8.376   11.823  7.894   1.00 62.42 ? 106 LEU C HG   1  
ATOM 6347   H HD11 . LEU C 1 106 ? 10.440  9.944   6.726   1.00 43.11 ? 106 LEU C HD11 1  
ATOM 6348   H HD12 . LEU C 1 106 ? 10.533  10.815  8.252   1.00 0.45  ? 106 LEU C HD12 1  
ATOM 6349   H HD13 . LEU C 1 106 ? 10.572  11.703  6.732   1.00 14.43 ? 106 LEU C HD13 1  
ATOM 6350   H HD21 . LEU C 1 106 ? 8.191   10.397  5.214   1.00 35.12 ? 106 LEU C HD21 1  
ATOM 6351   H HD22 . LEU C 1 106 ? 8.459   12.120  5.451   1.00 22.14 ? 106 LEU C HD22 1  
ATOM 6352   H HD23 . LEU C 1 106 ? 6.950   11.383  5.963   1.00 2.50  ? 106 LEU C HD23 1  
ATOM 6353   N N    . PHE C 1 107 ? 5.509   8.413   9.882   1.00 62.22 ? 107 PHE C N    1  
ATOM 6354   C CA   . PHE C 1 107 ? 5.106   7.221   10.658  1.00 21.14 ? 107 PHE C CA   1  
ATOM 6355   C C    . PHE C 1 107 ? 4.012   6.378   9.937   1.00 11.32 ? 107 PHE C C    1  
ATOM 6356   O O    . PHE C 1 107 ? 4.230   5.180   9.746   1.00 54.02 ? 107 PHE C O    1  
ATOM 6357   C CB   . PHE C 1 107 ? 4.661   7.611   12.108  1.00 3.03  ? 107 PHE C CB   1  
ATOM 6358   C CG   . PHE C 1 107 ? 4.154   6.430   12.948  1.00 74.30 ? 107 PHE C CG   1  
ATOM 6359   C CD1  . PHE C 1 107 ? 2.782   6.194   13.114  1.00 71.42 ? 107 PHE C CD1  1  
ATOM 6360   C CD2  . PHE C 1 107 ? 5.049   5.549   13.557  1.00 51.41 ? 107 PHE C CD2  1  
ATOM 6361   C CE1  . PHE C 1 107 ? 2.331   5.112   13.845  1.00 31.24 ? 107 PHE C CE1  1  
ATOM 6362   C CE2  . PHE C 1 107 ? 4.591   4.471   14.293  1.00 11.32 ? 107 PHE C CE2  1  
ATOM 6363   C CZ   . PHE C 1 107 ? 3.234   4.256   14.439  1.00 74.22 ? 107 PHE C CZ   1  
ATOM 6364   H H    . PHE C 1 107 ? 5.464   9.287   10.322  1.00 64.05 ? 107 PHE C H    1  
ATOM 6365   H HA   . PHE C 1 107 ? 5.999   6.602   10.742  1.00 0.02  ? 107 PHE C HA   1  
ATOM 6366   H HB2  . PHE C 1 107 ? 5.501   8.056   12.629  1.00 0.02  ? 107 PHE C HB2  1  
ATOM 6367   H HB3  . PHE C 1 107 ? 3.869   8.352   12.046  1.00 45.33 ? 107 PHE C HB3  1  
ATOM 6368   H HD1  . PHE C 1 107 ? 2.067   6.865   12.651  1.00 13.30 ? 107 PHE C HD1  1  
ATOM 6369   H HD2  . PHE C 1 107 ? 6.113   5.711   13.448  1.00 41.24 ? 107 PHE C HD2  1  
ATOM 6370   H HE1  . PHE C 1 107 ? 1.266   4.944   13.962  1.00 54.42 ? 107 PHE C HE1  1  
ATOM 6371   H HE2  . PHE C 1 107 ? 5.296   3.797   14.758  1.00 53.54 ? 107 PHE C HE2  1  
ATOM 6372   H HZ   . PHE C 1 107 ? 2.878   3.408   15.012  1.00 15.20 ? 107 PHE C HZ   1  
ATOM 6373   N N    . PRO C 1 108 ? 2.829   6.966   9.511   1.00 62.42 ? 108 PRO C N    1  
ATOM 6374   C CA   . PRO C 1 108 ? 1.743   6.175   8.863   1.00 11.33 ? 108 PRO C CA   1  
ATOM 6375   C C    . PRO C 1 108 ? 2.158   5.552   7.501   1.00 52.42 ? 108 PRO C C    1  
ATOM 6376   O O    . PRO C 1 108 ? 1.666   4.475   7.142   1.00 33.25 ? 108 PRO C O    1  
ATOM 6377   C CB   . PRO C 1 108 ? 0.590   7.199   8.702   1.00 63.25 ? 108 PRO C CB   1  
ATOM 6378   C CG   . PRO C 1 108 ? 1.259   8.542   8.711   1.00 64.11 ? 108 PRO C CG   1  
ATOM 6379   C CD   . PRO C 1 108 ? 2.431   8.403   9.642   1.00 22.53 ? 108 PRO C CD   1  
ATOM 6380   H HA   . PRO C 1 108 ? 1.417   5.372   9.518   1.00 35.01 ? 108 PRO C HA   1  
ATOM 6381   H HB2  . PRO C 1 108 ? 0.051   7.032   7.770   1.00 42.13 ? 108 PRO C HB2  1  
ATOM 6382   H HB3  . PRO C 1 108 ? -0.097  7.121   9.534   1.00 44.01 ? 108 PRO C HB3  1  
ATOM 6383   H HG2  . PRO C 1 108 ? 1.594   8.798   7.707   1.00 33.54 ? 108 PRO C HG2  1  
ATOM 6384   H HG3  . PRO C 1 108 ? 0.577   9.302   9.077   1.00 41.22 ? 108 PRO C HG3  1  
ATOM 6385   H HD2  . PRO C 1 108 ? 3.241   9.060   9.333   1.00 33.50 ? 108 PRO C HD2  1  
ATOM 6386   H HD3  . PRO C 1 108 ? 2.142   8.626   10.664  1.00 61.21 ? 108 PRO C HD3  1  
ATOM 6387   N N    . TYR C 1 109 ? 3.070   6.228   6.769   1.00 3.20  ? 109 TYR C N    1  
ATOM 6388   C CA   . TYR C 1 109 ? 3.591   5.743   5.467   1.00 44.10 ? 109 TYR C CA   1  
ATOM 6389   C C    . TYR C 1 109 ? 4.447   4.476   5.665   1.00 52.42 ? 109 TYR C C    1  
ATOM 6390   O O    . TYR C 1 109 ? 4.263   3.467   4.970   1.00 33.40 ? 109 TYR C O    1  
ATOM 6391   C CB   . TYR C 1 109 ? 4.458   6.824   4.773   1.00 12.43 ? 109 TYR C CB   1  
ATOM 6392   C CG   . TYR C 1 109 ? 3.763   8.152   4.445   1.00 21.32 ? 109 TYR C CG   1  
ATOM 6393   C CD1  . TYR C 1 109 ? 3.644   9.154   5.406   1.00 33.04 ? 109 TYR C CD1  1  
ATOM 6394   C CD2  . TYR C 1 109 ? 3.253   8.420   3.165   1.00 30.43 ? 109 TYR C CD2  1  
ATOM 6395   C CE1  . TYR C 1 109 ? 3.051   10.364  5.112   1.00 30.30 ? 109 TYR C CE1  1  
ATOM 6396   C CE2  . TYR C 1 109 ? 2.653   9.633   2.874   1.00 25.14 ? 109 TYR C CE2  1  
ATOM 6397   C CZ   . TYR C 1 109 ? 2.553   10.598  3.855   1.00 23.40 ? 109 TYR C CZ   1  
ATOM 6398   O OH   . TYR C 1 109 ? 1.986   11.821  3.574   1.00 54.35 ? 109 TYR C OH   1  
ATOM 6399   H H    . TYR C 1 109 ? 3.400   7.081   7.115   1.00 50.34 ? 109 TYR C H    1  
ATOM 6400   H HA   . TYR C 1 109 ? 2.743   5.506   4.831   1.00 34.33 ? 109 TYR C HA   1  
ATOM 6401   H HB2  . TYR C 1 109 ? 5.304   7.053   5.416   1.00 60.12 ? 109 TYR C HB2  1  
ATOM 6402   H HB3  . TYR C 1 109 ? 4.849   6.415   3.844   1.00 1.53  ? 109 TYR C HB3  1  
ATOM 6403   H HD1  . TYR C 1 109 ? 4.029   8.977   6.404   1.00 2.43  ? 109 TYR C HD1  1  
ATOM 6404   H HD2  . TYR C 1 109 ? 3.331   7.661   2.395   1.00 5.42  ? 109 TYR C HD2  1  
ATOM 6405   H HE1  . TYR C 1 109 ? 2.978   11.124  5.874   1.00 13.44 ? 109 TYR C HE1  1  
ATOM 6406   H HE2  . TYR C 1 109 ? 2.261   9.820   1.882   1.00 63.31 ? 109 TYR C HE2  1  
ATOM 6407   H HH   . TYR C 1 109 ? 1.498   11.771  2.750   1.00 51.52 ? 109 TYR C HH   1  
ATOM 6408   N N    . ALA C 1 110 ? 5.397   4.567   6.623   1.00 31.41 ? 110 ALA C N    1  
ATOM 6409   C CA   . ALA C 1 110 ? 6.270   3.441   7.022   1.00 73.20 ? 110 ALA C CA   1  
ATOM 6410   C C    . ALA C 1 110 ? 5.422   2.269   7.548   1.00 3.01  ? 110 ALA C C    1  
ATOM 6411   O O    . ALA C 1 110 ? 5.646   1.115   7.189   1.00 53.51 ? 110 ALA C O    1  
ATOM 6412   C CB   . ALA C 1 110 ? 7.271   3.905   8.102   1.00 62.44 ? 110 ALA C CB   1  
ATOM 6413   H H    . ALA C 1 110 ? 5.511   5.427   7.081   1.00 50.41 ? 110 ALA C H    1  
ATOM 6414   H HA   . ALA C 1 110 ? 6.832   3.121   6.147   1.00 35.32 ? 110 ALA C HA   1  
ATOM 6415   H HB1  . ALA C 1 110 ? 7.951   4.625   7.684   1.00 33.02 ? 110 ALA C HB1  1  
ATOM 6416   H HB2  . ALA C 1 110 ? 7.837   3.061   8.481   1.00 32.22 ? 110 ALA C HB2  1  
ATOM 6417   H HB3  . ALA C 1 110 ? 6.738   4.369   8.919   1.00 12.01 ? 110 ALA C HB3  1  
ATOM 6418   N N    . ARG C 1 111 ? 4.418   2.633   8.362   1.00 70.43 ? 111 ARG C N    1  
ATOM 6419   C CA   . ARG C 1 111 ? 3.485   1.702   9.033   1.00 43.55 ? 111 ARG C CA   1  
ATOM 6420   C C    . ARG C 1 111 ? 2.723   0.838   8.011   1.00 20.44 ? 111 ARG C C    1  
ATOM 6421   O O    . ARG C 1 111 ? 2.733   -0.394  8.109   1.00 5.22  ? 111 ARG C O    1  
ATOM 6422   C CB   . ARG C 1 111 ? 2.476   2.529   9.881   1.00 13.41 ? 111 ARG C CB   1  
ATOM 6423   C CG   . ARG C 1 111 ? 1.453   1.720   10.711  1.00 54.11 ? 111 ARG C CG   1  
ATOM 6424   C CD   . ARG C 1 111 ? 0.365   2.623   11.329  1.00 24.03 ? 111 ARG C CD   1  
ATOM 6425   N NE   . ARG C 1 111 ? -0.529  1.885   12.241  1.00 70.01 ? 111 ARG C NE   1  
ATOM 6426   C CZ   . ARG C 1 111 ? -1.839  2.135   12.436  1.00 21.10 ? 111 ARG C CZ   1  
ATOM 6427   N NH1  . ARG C 1 111 ? -2.456  3.115   11.771  1.00 15.32 ? 111 ARG C NH1  1  
ATOM 6428   N NH2  . ARG C 1 111 ? -2.513  1.424   13.335  1.00 2.42  ? 111 ARG C NH2  1  
ATOM 6429   H H    . ARG C 1 111 ? 4.295   3.590   8.519   1.00 31.31 ? 111 ARG C H    1  
ATOM 6430   H HA   . ARG C 1 111 ? 4.072   1.062   9.690   1.00 1.04  ? 111 ARG C HA   1  
ATOM 6431   H HB2  . ARG C 1 111 ? 3.039   3.154   10.565  1.00 51.40 ? 111 ARG C HB2  1  
ATOM 6432   H HB3  . ARG C 1 111 ? 1.925   3.182   9.207   1.00 1.51  ? 111 ARG C HB3  1  
ATOM 6433   H HG2  . ARG C 1 111 ? 0.977   0.988   10.070  1.00 50.10 ? 111 ARG C HG2  1  
ATOM 6434   H HG3  . ARG C 1 111 ? 1.977   1.207   11.507  1.00 1.12  ? 111 ARG C HG3  1  
ATOM 6435   H HD2  . ARG C 1 111 ? 0.844   3.418   11.890  1.00 32.21 ? 111 ARG C HD2  1  
ATOM 6436   H HD3  . ARG C 1 111 ? -0.222  3.060   10.527  1.00 14.04 ? 111 ARG C HD3  1  
ATOM 6437   H HE   . ARG C 1 111 ? -0.119  1.152   12.753  1.00 61.33 ? 111 ARG C HE   1  
ATOM 6438   H HH11 . ARG C 1 111 ? -1.948  3.672   11.111  1.00 65.34 ? 111 ARG C HH11 1  
ATOM 6439   H HH12 . ARG C 1 111 ? -3.431  3.293   11.923  1.00 23.33 ? 111 ARG C HH12 1  
ATOM 6440   H HH21 . ARG C 1 111 ? -2.048  0.705   13.858  1.00 61.12 ? 111 ARG C HH21 1  
ATOM 6441   H HH22 . ARG C 1 111 ? -3.488  1.599   13.493  1.00 71.42 ? 111 ARG C HH22 1  
ATOM 6442   N N    . GLU C 1 112 ? 2.086   1.510   7.019   1.00 43.34 ? 112 GLU C N    1  
ATOM 6443   C CA   . GLU C 1 112 ? 1.258   0.838   5.991   1.00 23.44 ? 112 GLU C CA   1  
ATOM 6444   C C    . GLU C 1 112 ? 2.141   -0.032  5.092   1.00 1.51  ? 112 GLU C C    1  
ATOM 6445   O O    . GLU C 1 112 ? 1.738   -1.126  4.712   1.00 40.51 ? 112 GLU C O    1  
ATOM 6446   C CB   . GLU C 1 112 ? 0.442   1.867   5.135   1.00 4.43  ? 112 GLU C CB   1  
ATOM 6447   C CG   . GLU C 1 112 ? -0.696  1.249   4.241   1.00 72.24 ? 112 GLU C CG   1  
ATOM 6448   C CD   . GLU C 1 112 ? -0.310  0.945   2.762   1.00 22.23 ? 112 GLU C CD   1  
ATOM 6449   O OE1  . GLU C 1 112 ? 0.026   -0.210  2.433   1.00 15.32 ? 112 GLU C OE1  1  
ATOM 6450   O OE2  . GLU C 1 112 ? -0.380  1.857   1.907   1.00 23.35 ? 112 GLU C OE2  1  
ATOM 6451   H H    . GLU C 1 112 ? 2.181   2.485   6.978   1.00 3.13  ? 112 GLU C H    1  
ATOM 6452   H HA   . GLU C 1 112 ? 0.554   0.196   6.514   1.00 12.24 ? 112 GLU C HA   1  
ATOM 6453   H HB2  . GLU C 1 112 ? -0.010  2.584   5.814   1.00 31.25 ? 112 GLU C HB2  1  
ATOM 6454   H HB3  . GLU C 1 112 ? 1.128   2.410   4.491   1.00 54.41 ? 112 GLU C HB3  1  
ATOM 6455   H HG2  . GLU C 1 112 ? -1.031  0.326   4.701   1.00 32.41 ? 112 GLU C HG2  1  
ATOM 6456   H HG3  . GLU C 1 112 ? -1.538  1.934   4.235   1.00 12.24 ? 112 GLU C HG3  1  
ATOM 6457   N N    . CYS C 1 113 ? 3.365   0.453   4.792   1.00 43.50 ? 113 CYS C N    1  
ATOM 6458   C CA   . CYS C 1 113 ? 4.309   -0.258  3.909   1.00 61.34 ? 113 CYS C CA   1  
ATOM 6459   C C    . CYS C 1 113 ? 4.818   -1.565  4.556   1.00 31.14 ? 113 CYS C C    1  
ATOM 6460   O O    . CYS C 1 113 ? 5.085   -2.549  3.853   1.00 41.10 ? 113 CYS C O    1  
ATOM 6461   C CB   . CYS C 1 113 ? 5.491   0.658   3.523   1.00 63.15 ? 113 CYS C CB   1  
ATOM 6462   S SG   . CYS C 1 113 ? 6.563   -0.038  2.247   1.00 24.14 ? 113 CYS C SG   1  
ATOM 6463   H H    . CYS C 1 113 ? 3.638   1.316   5.179   1.00 63.32 ? 113 CYS C H    1  
ATOM 6464   H HA   . CYS C 1 113 ? 3.767   -0.514  3.001   1.00 13.43 ? 113 CYS C HA   1  
ATOM 6465   H HB2  . CYS C 1 113 ? 5.106   1.594   3.145   1.00 15.34 ? 113 CYS C HB2  1  
ATOM 6466   H HB3  . CYS C 1 113 ? 6.107   0.855   4.396   1.00 62.52 ? 113 CYS C HB3  1  
ATOM 6467   H HG   . CYS C 1 113 ? 6.561   -1.360  2.383   1.00 60.24 ? 113 CYS C HG   1  
ATOM 6468   N N    . ILE C 1 114 ? 4.945   -1.562  5.900   1.00 51.52 ? 114 ILE C N    1  
ATOM 6469   C CA   . ILE C 1 114 ? 5.327   -2.761  6.679   1.00 2.14  ? 114 ILE C CA   1  
ATOM 6470   C C    . ILE C 1 114 ? 4.162   -3.762  6.719   1.00 1.11  ? 114 ILE C C    1  
ATOM 6471   O O    . ILE C 1 114 ? 4.335   -4.919  6.346   1.00 21.00 ? 114 ILE C O    1  
ATOM 6472   C CB   . ILE C 1 114 ? 5.783   -2.400  8.145   1.00 42.11 ? 114 ILE C CB   1  
ATOM 6473   C CG1  . ILE C 1 114 ? 7.083   -1.543  8.103   1.00 33.20 ? 114 ILE C CG1  1  
ATOM 6474   C CG2  . ILE C 1 114 ? 5.989   -3.672  9.028   1.00 64.41 ? 114 ILE C CG2  1  
ATOM 6475   C CD1  . ILE C 1 114 ? 7.552   -1.052  9.450   1.00 65.55 ? 114 ILE C CD1  1  
ATOM 6476   H H    . ILE C 1 114 ? 4.778   -0.724  6.382   1.00 54.32 ? 114 ILE C H    1  
ATOM 6477   H HA   . ILE C 1 114 ? 6.172   -3.227  6.171   1.00 70.14 ? 114 ILE C HA   1  
ATOM 6478   H HB   . ILE C 1 114 ? 4.994   -1.807  8.604   1.00 60.43 ? 114 ILE C HB   1  
ATOM 6479   H HG12 . ILE C 1 114 ? 7.885   -2.137  7.682   1.00 34.31 ? 114 ILE C HG12 1  
ATOM 6480   H HG13 . ILE C 1 114 ? 6.930   -0.677  7.469   1.00 54.30 ? 114 ILE C HG13 1  
ATOM 6481   H HG21 . ILE C 1 114 ? 6.723   -4.319  8.568   1.00 35.04 ? 114 ILE C HG21 1  
ATOM 6482   H HG22 . ILE C 1 114 ? 5.057   -4.211  9.128   1.00 1.32  ? 114 ILE C HG22 1  
ATOM 6483   H HG23 . ILE C 1 114 ? 6.335   -3.388  10.014  1.00 13.35 ? 114 ILE C HG23 1  
ATOM 6484   H HD11 . ILE C 1 114 ? 8.397   -0.392  9.324   1.00 53.43 ? 114 ILE C HD11 1  
ATOM 6485   H HD12 . ILE C 1 114 ? 7.850   -1.894  10.057  1.00 50.33 ? 114 ILE C HD12 1  
ATOM 6486   H HD13 . ILE C 1 114 ? 6.766   -0.508  9.956   1.00 42.44 ? 114 ILE C HD13 1  
ATOM 6487   N N    . THR C 1 115 ? 2.968   -3.288  7.138   1.00 72.13 ? 115 THR C N    1  
ATOM 6488   C CA   . THR C 1 115 ? 1.777   -4.143  7.318   1.00 1.04  ? 115 THR C CA   1  
ATOM 6489   C C    . THR C 1 115 ? 1.296   -4.735  5.963   1.00 51.13 ? 115 THR C C    1  
ATOM 6490   O O    . THR C 1 115 ? 0.740   -5.848  5.917   1.00 33.32 ? 115 THR C O    1  
ATOM 6491   C CB   . THR C 1 115 ? 0.617   -3.351  8.021   1.00 65.43 ? 115 THR C CB   1  
ATOM 6492   O OG1  . THR C 1 115 ? 1.130   -2.649  9.173   1.00 11.31 ? 115 THR C OG1  1  
ATOM 6493   C CG2  . THR C 1 115 ? -0.525  -4.285  8.473   1.00 0.11  ? 115 THR C CG2  1  
ATOM 6494   H H    . THR C 1 115 ? 2.886   -2.330  7.334   1.00 75.14 ? 115 THR C H    1  
ATOM 6495   H HA   . THR C 1 115 ? 2.070   -4.964  7.969   1.00 10.42 ? 115 THR C HA   1  
ATOM 6496   H HB   . THR C 1 115 ? 0.218   -2.620  7.324   1.00 55.24 ? 115 THR C HB   1  
ATOM 6497   H HG1  . THR C 1 115 ? 1.675   -3.246  9.698   1.00 3.45  ? 115 THR C HG1  1  
ATOM 6498   H HG21 . THR C 1 115 ? -1.317  -3.702  8.929   1.00 34.41 ? 115 THR C HG21 1  
ATOM 6499   H HG22 . THR C 1 115 ? -0.151  -5.000  9.193   1.00 71.50 ? 115 THR C HG22 1  
ATOM 6500   H HG23 . THR C 1 115 ? -0.922  -4.817  7.617   1.00 35.31 ? 115 THR C HG23 1  
ATOM 6501   N N    . SER C 1 116 ? 1.551   -3.985  4.865   1.00 63.45 ? 116 SER C N    1  
ATOM 6502   C CA   . SER C 1 116 ? 1.292   -4.449  3.489   1.00 12.42 ? 116 SER C CA   1  
ATOM 6503   C C    . SER C 1 116 ? 2.222   -5.629  3.174   1.00 53.30 ? 116 SER C C    1  
ATOM 6504   O O    . SER C 1 116 ? 1.760   -6.681  2.749   1.00 2.23  ? 116 SER C O    1  
ATOM 6505   C CB   . SER C 1 116 ? 1.510   -3.304  2.464   1.00 64.45 ? 116 SER C CB   1  
ATOM 6506   O OG   . SER C 1 116 ? 1.235   -3.719  1.128   1.00 41.21 ? 116 SER C OG   1  
ATOM 6507   H H    . SER C 1 116 ? 1.939   -3.097  4.989   1.00 40.23 ? 116 SER C H    1  
ATOM 6508   H HA   . SER C 1 116 ? 0.257   -4.780  3.436   1.00 20.40 ? 116 SER C HA   1  
ATOM 6509   H HB2  . SER C 1 116 ? 0.847   -2.483  2.704   1.00 34.40 ? 116 SER C HB2  1  
ATOM 6510   H HB3  . SER C 1 116 ? 2.535   -2.956  2.517   1.00 74.15 ? 116 SER C HB3  1  
ATOM 6511   H HG   . SER C 1 116 ? 0.328   -3.473  0.894   1.00 20.12 ? 116 SER C HG   1  
ATOM 6512   N N    . MET C 1 117 ? 3.534   -5.436  3.456   1.00 70.45 ? 117 MET C N    1  
ATOM 6513   C CA   . MET C 1 117 ? 4.592   -6.456  3.241   1.00 51.24 ? 117 MET C CA   1  
ATOM 6514   C C    . MET C 1 117 ? 4.336   -7.745  4.044   1.00 23.53 ? 117 MET C C    1  
ATOM 6515   O O    . MET C 1 117 ? 4.617   -8.846  3.557   1.00 51.54 ? 117 MET C O    1  
ATOM 6516   C CB   . MET C 1 117 ? 6.000   -5.861  3.567   1.00 1.44  ? 117 MET C CB   1  
ATOM 6517   C CG   . MET C 1 117 ? 6.742   -5.306  2.349   1.00 72.20 ? 117 MET C CG   1  
ATOM 6518   S SD   . MET C 1 117 ? 5.710   -4.267  1.285   1.00 32.31 ? 117 MET C SD   1  
ATOM 6519   C CE   . MET C 1 117 ? 6.520   -4.500  -0.295  1.00 71.04 ? 117 MET C CE   1  
ATOM 6520   H H    . MET C 1 117 ? 3.804   -4.568  3.825   1.00 20.21 ? 117 MET C H    1  
ATOM 6521   H HA   . MET C 1 117 ? 4.562   -6.715  2.183   1.00 61.35 ? 117 MET C HA   1  
ATOM 6522   H HB2  . MET C 1 117 ? 5.894   -5.061  4.291   1.00 4.12  ? 117 MET C HB2  1  
ATOM 6523   H HB3  . MET C 1 117 ? 6.625   -6.637  4.005   1.00 43.14 ? 117 MET C HB3  1  
ATOM 6524   H HG2  . MET C 1 117 ? 7.582   -4.712  2.689   1.00 52.12 ? 117 MET C HG2  1  
ATOM 6525   H HG3  . MET C 1 117 ? 7.117   -6.138  1.765   1.00 21.02 ? 117 MET C HG3  1  
ATOM 6526   H HE1  . MET C 1 117 ? 7.555   -4.761  -0.133  1.00 41.11 ? 117 MET C HE1  1  
ATOM 6527   H HE2  . MET C 1 117 ? 6.473   -3.603  -0.876  1.00 71.44 ? 117 MET C HE2  1  
ATOM 6528   H HE3  . MET C 1 117 ? 6.051   -5.308  -0.830  1.00 21.21 ? 117 MET C HE3  1  
ATOM 6529   N N    . VAL C 1 118 ? 3.811   -7.589  5.272   1.00 10.34 ? 118 VAL C N    1  
ATOM 6530   C CA   . VAL C 1 118 ? 3.401   -8.723  6.128   1.00 40.00 ? 118 VAL C CA   1  
ATOM 6531   C C    . VAL C 1 118 ? 2.298   -9.540  5.429   1.00 31.03 ? 118 VAL C C    1  
ATOM 6532   O O    . VAL C 1 118 ? 2.397   -10.763 5.306   1.00 64.11 ? 118 VAL C O    1  
ATOM 6533   C CB   . VAL C 1 118 ? 2.902   -8.225  7.543   1.00 32.21 ? 118 VAL C CB   1  
ATOM 6534   C CG1  . VAL C 1 118 ? 2.346   -9.386  8.407   1.00 75.24 ? 118 VAL C CG1  1  
ATOM 6535   C CG2  . VAL C 1 118 ? 4.034   -7.474  8.289   1.00 34.22 ? 118 VAL C CG2  1  
ATOM 6536   H H    . VAL C 1 118 ? 3.699   -6.683  5.617   1.00 61.35 ? 118 VAL C H    1  
ATOM 6537   H HA   . VAL C 1 118 ? 4.272   -9.358  6.275   1.00 41.54 ? 118 VAL C HA   1  
ATOM 6538   H HB   . VAL C 1 118 ? 2.090   -7.520  7.377   1.00 14.32 ? 118 VAL C HB   1  
ATOM 6539   H HG11 . VAL C 1 118 ? 1.771   -8.993  9.223   1.00 50.12 ? 118 VAL C HG11 1  
ATOM 6540   H HG12 . VAL C 1 118 ? 3.161   -9.979  8.801   1.00 63.31 ? 118 VAL C HG12 1  
ATOM 6541   H HG13 . VAL C 1 118 ? 1.713   -10.022 7.809   1.00 22.44 ? 118 VAL C HG13 1  
ATOM 6542   H HG21 . VAL C 1 118 ? 4.328   -6.601  7.724   1.00 5.25  ? 118 VAL C HG21 1  
ATOM 6543   H HG22 . VAL C 1 118 ? 4.891   -8.126  8.407   1.00 35.04 ? 118 VAL C HG22 1  
ATOM 6544   H HG23 . VAL C 1 118 ? 3.690   -7.166  9.267   1.00 71.24 ? 118 VAL C HG23 1  
ATOM 6545   N N    . SER C 1 119 ? 1.282   -8.820  4.924   1.00 22.23 ? 119 SER C N    1  
ATOM 6546   C CA   . SER C 1 119 ? 0.125   -9.419  4.243   1.00 74.05 ? 119 SER C CA   1  
ATOM 6547   C C    . SER C 1 119 ? 0.507   -9.961  2.835   1.00 21.41 ? 119 SER C C    1  
ATOM 6548   O O    . SER C 1 119 ? -0.179  -10.839 2.295   1.00 24.20 ? 119 SER C O    1  
ATOM 6549   C CB   . SER C 1 119 ? -1.011  -8.374  4.146   1.00 23.21 ? 119 SER C CB   1  
ATOM 6550   O OG   . SER C 1 119 ? -2.195  -8.939  3.613   1.00 2.34  ? 119 SER C OG   1  
ATOM 6551   H H    . SER C 1 119 ? 1.312   -7.844  5.019   1.00 12.22 ? 119 SER C H    1  
ATOM 6552   H HA   . SER C 1 119 ? -0.220  -10.249 4.857   1.00 34.42 ? 119 SER C HA   1  
ATOM 6553   H HB2  . SER C 1 119 ? -1.232  -7.992  5.135   1.00 50.20 ? 119 SER C HB2  1  
ATOM 6554   H HB3  . SER C 1 119 ? -0.701  -7.553  3.510   1.00 73.43 ? 119 SER C HB3  1  
ATOM 6555   H HG   . SER C 1 119 ? -2.006  -9.820  3.268   1.00 4.44  ? 119 SER C HG   1  
ATOM 6556   N N    . ARG C 1 120 ? 1.608   -9.430  2.261   1.00 1.13  ? 120 ARG C N    1  
ATOM 6557   C CA   . ARG C 1 120 ? 2.189   -9.913  0.985   1.00 54.42 ? 120 ARG C CA   1  
ATOM 6558   C C    . ARG C 1 120 ? 2.901   -11.252 1.215   1.00 72.35 ? 120 ARG C C    1  
ATOM 6559   O O    . ARG C 1 120 ? 2.888   -12.129 0.350   1.00 4.14  ? 120 ARG C O    1  
ATOM 6560   C CB   . ARG C 1 120 ? 3.184   -8.873  0.401   1.00 34.10 ? 120 ARG C CB   1  
ATOM 6561   C CG   . ARG C 1 120 ? 2.525   -7.592  -0.155  1.00 30.14 ? 120 ARG C CG   1  
ATOM 6562   C CD   . ARG C 1 120 ? 3.555   -6.516  -0.550  1.00 65.31 ? 120 ARG C CD   1  
ATOM 6563   N NE   . ARG C 1 120 ? 2.917   -5.321  -1.120  1.00 1.24  ? 120 ARG C NE   1  
ATOM 6564   C CZ   . ARG C 1 120 ? 2.457   -5.220  -2.375  1.00 11.32 ? 120 ARG C CZ   1  
ATOM 6565   N NH1  . ARG C 1 120 ? 2.532   -6.239  -3.224  1.00 72.11 ? 120 ARG C NH1  1  
ATOM 6566   N NH2  . ARG C 1 120 ? 1.915   -4.090  -2.781  1.00 2.14  ? 120 ARG C NH2  1  
ATOM 6567   H H    . ARG C 1 120 ? 2.057   -8.694  2.722   1.00 71.23 ? 120 ARG C H    1  
ATOM 6568   H HA   . ARG C 1 120 ? 1.375   -10.063 0.278   1.00 31.52 ? 120 ARG C HA   1  
ATOM 6569   H HB2  . ARG C 1 120 ? 3.878   -8.585  1.185   1.00 72.24 ? 120 ARG C HB2  1  
ATOM 6570   H HB3  . ARG C 1 120 ? 3.749   -9.335  -0.403  1.00 51.52 ? 120 ARG C HB3  1  
ATOM 6571   H HG2  . ARG C 1 120 ? 1.941   -7.851  -1.031  1.00 71.01 ? 120 ARG C HG2  1  
ATOM 6572   H HG3  . ARG C 1 120 ? 1.864   -7.182  0.600   1.00 73.24 ? 120 ARG C HG3  1  
ATOM 6573   H HD2  . ARG C 1 120 ? 4.099   -6.215  0.336   1.00 3.32  ? 120 ARG C HD2  1  
ATOM 6574   H HD3  . ARG C 1 120 ? 4.259   -6.926  -1.270  1.00 4.24  ? 120 ARG C HD3  1  
ATOM 6575   H HE   . ARG C 1 120 ? 2.808   -4.549  -0.521  1.00 63.23 ? 120 ARG C HE   1  
ATOM 6576   H HH11 . ARG C 1 120 ? 2.936   -7.104  -2.938  1.00 72.15 ? 120 ARG C HH11 1  
ATOM 6577   H HH12 . ARG C 1 120 ? 2.170   -6.145  -4.163  1.00 53.41 ? 120 ARG C HH12 1  
ATOM 6578   H HH21 . ARG C 1 120 ? 1.844   -3.312  -2.159  1.00 31.21 ? 120 ARG C HH21 1  
ATOM 6579   H HH22 . ARG C 1 120 ? 1.559   -4.010  -3.723  1.00 34.34 ? 120 ARG C HH22 1  
ATOM 6580   N N    . GLY C 1 121 ? 3.515   -11.385 2.410   1.00 75.41 ? 121 GLY C N    1  
ATOM 6581   C CA   . GLY C 1 121 ? 4.088   -12.644 2.871   1.00 71.31 ? 121 GLY C CA   1  
ATOM 6582   C C    . GLY C 1 121 ? 3.043   -13.546 3.521   1.00 75.21 ? 121 GLY C C    1  
ATOM 6583   O O    . GLY C 1 121 ? 3.394   -14.572 4.093   1.00 21.01 ? 121 GLY C O    1  
ATOM 6584   H H    . GLY C 1 121 ? 3.574   -10.601 2.997   1.00 73.43 ? 121 GLY C H    1  
ATOM 6585   H HA2  . GLY C 1 121 ? 4.536   -13.169 2.034   1.00 30.30 ? 121 GLY C HA2  1  
ATOM 6586   H HA3  . GLY C 1 121 ? 4.862   -12.424 3.595   1.00 71.12 ? 121 GLY C HA3  1  
ATOM 6587   N N    . THR C 1 122 ? 1.755   -13.129 3.427   1.00 21.20 ? 122 THR C N    1  
ATOM 6588   C CA   . THR C 1 122 ? 0.554   -13.872 3.879   1.00 21.20 ? 122 THR C CA   1  
ATOM 6589   C C    . THR C 1 122 ? 0.559   -14.185 5.393   1.00 72.13 ? 122 THR C C    1  
ATOM 6590   O O    . THR C 1 122 ? -0.090  -15.138 5.843   1.00 52.13 ? 122 THR C O    1  
ATOM 6591   C CB   . THR C 1 122 ? 0.287   -15.174 3.034   1.00 30.43 ? 122 THR C CB   1  
ATOM 6592   O OG1  . THR C 1 122 ? 1.345   -16.131 3.205   1.00 65.12 ? 122 THR C OG1  1  
ATOM 6593   C CG2  . THR C 1 122 ? 0.128   -14.877 1.536   1.00 53.54 ? 122 THR C CG2  1  
ATOM 6594   H H    . THR C 1 122 ? 1.600   -12.255 3.027   1.00 43.42 ? 122 THR C H    1  
ATOM 6595   H HA   . THR C 1 122 ? -0.285  -13.204 3.705   1.00 32.33 ? 122 THR C HA   1  
ATOM 6596   H HB   . THR C 1 122 ? -0.634  -15.625 3.387   1.00 44.42 ? 122 THR C HB   1  
ATOM 6597   H HG1  . THR C 1 122 ? 2.181   -15.746 2.921   1.00 60.14 ? 122 THR C HG1  1  
ATOM 6598   H HG21 . THR C 1 122 ? -0.007  -15.807 0.995   1.00 40.55 ? 122 THR C HG21 1  
ATOM 6599   H HG22 . THR C 1 122 ? 1.015   -14.381 1.168   1.00 3.44  ? 122 THR C HG22 1  
ATOM 6600   H HG23 . THR C 1 122 ? -0.727  -14.245 1.367   1.00 44.41 ? 122 THR C HG23 1  
ATOM 6601   N N    . PHE C 1 123 ? 1.256   -13.351 6.180   1.00 32.24 ? 123 PHE C N    1  
ATOM 6602   C CA   . PHE C 1 123 ? 1.200   -13.411 7.644   1.00 43.23 ? 123 PHE C CA   1  
ATOM 6603   C C    . PHE C 1 123 ? 0.037   -12.515 8.119   1.00 34.24 ? 123 PHE C C    1  
ATOM 6604   O O    . PHE C 1 123 ? -0.231  -11.485 7.481   1.00 21.20 ? 123 PHE C O    1  
ATOM 6605   C CB   . PHE C 1 123 ? 2.532   -12.938 8.270   1.00 2.43  ? 123 PHE C CB   1  
ATOM 6606   C CG   . PHE C 1 123 ? 3.739   -13.817 7.959   1.00 32.43 ? 123 PHE C CG   1  
ATOM 6607   C CD1  . PHE C 1 123 ? 4.102   -14.862 8.807   1.00 52.31 ? 123 PHE C CD1  1  
ATOM 6608   C CD2  . PHE C 1 123 ? 4.526   -13.584 6.835   1.00 63.33 ? 123 PHE C CD2  1  
ATOM 6609   C CE1  . PHE C 1 123 ? 5.207   -15.641 8.541   1.00 62.44 ? 123 PHE C CE1  1  
ATOM 6610   C CE2  . PHE C 1 123 ? 5.631   -14.366 6.566   1.00 13.21 ? 123 PHE C CE2  1  
ATOM 6611   C CZ   . PHE C 1 123 ? 5.971   -15.393 7.418   1.00 62.32 ? 123 PHE C CZ   1  
ATOM 6612   H H    . PHE C 1 123 ? 1.798   -12.650 5.767   1.00 24.10 ? 123 PHE C H    1  
ATOM 6613   H HA   . PHE C 1 123 ? 1.008   -14.441 7.943   1.00 11.11 ? 123 PHE C HA   1  
ATOM 6614   H HB2  . PHE C 1 123 ? 2.751   -11.937 7.915   1.00 41.33 ? 123 PHE C HB2  1  
ATOM 6615   H HB3  . PHE C 1 123 ? 2.420   -12.897 9.350   1.00 62.12 ? 123 PHE C HB3  1  
ATOM 6616   H HD1  . PHE C 1 123 ? 3.504   -15.064 9.686   1.00 63.31 ? 123 PHE C HD1  1  
ATOM 6617   H HD2  . PHE C 1 123 ? 4.265   -12.776 6.161   1.00 30.14 ? 123 PHE C HD2  1  
ATOM 6618   H HE1  . PHE C 1 123 ? 5.478   -16.447 9.215   1.00 63.24 ? 123 PHE C HE1  1  
ATOM 6619   H HE2  . PHE C 1 123 ? 6.230   -14.171 5.685   1.00 51.20 ? 123 PHE C HE2  1  
ATOM 6620   H HZ   . PHE C 1 123 ? 6.840   -16.004 7.207   1.00 51.35 ? 123 PHE C HZ   1  
ATOM 6621   N N    . PRO C 1 124 ? -0.686  -12.902 9.219   1.00 71.12 ? 124 PRO C N    1  
ATOM 6622   C CA   . PRO C 1 124 ? -1.781  -12.081 9.802   1.00 22.12 ? 124 PRO C CA   1  
ATOM 6623   C C    . PRO C 1 124 ? -1.348  -10.635 10.157  1.00 33.35 ? 124 PRO C C    1  
ATOM 6624   O O    . PRO C 1 124 ? -0.169  -10.376 10.433  1.00 52.55 ? 124 PRO C O    1  
ATOM 6625   C CB   . PRO C 1 124 ? -2.194  -12.882 11.064  1.00 5.02  ? 124 PRO C CB   1  
ATOM 6626   C CG   . PRO C 1 124 ? -1.808  -14.297 10.747  1.00 1.31  ? 124 PRO C CG   1  
ATOM 6627   C CD   . PRO C 1 124 ? -0.525  -14.186 9.956   1.00 1.52  ? 124 PRO C CD   1  
ATOM 6628   H HA   . PRO C 1 124 ? -2.622  -12.032 9.114   1.00 13.02 ? 124 PRO C HA   1  
ATOM 6629   H HB2  . PRO C 1 124 ? -1.659  -12.517 11.943  1.00 71.11 ? 124 PRO C HB2  1  
ATOM 6630   H HB3  . PRO C 1 124 ? -3.262  -12.810 11.229  1.00 52.11 ? 124 PRO C HB3  1  
ATOM 6631   H HG2  . PRO C 1 124 ? -1.651  -14.856 11.666  1.00 21.31 ? 124 PRO C HG2  1  
ATOM 6632   H HG3  . PRO C 1 124 ? -2.576  -14.775 10.146  1.00 42.42 ? 124 PRO C HG3  1  
ATOM 6633   H HD2  . PRO C 1 124 ? 0.337   -14.143 10.618  1.00 33.54 ? 124 PRO C HD2  1  
ATOM 6634   H HD3  . PRO C 1 124 ? -0.424  -15.017 9.267   1.00 31.43 ? 124 PRO C HD3  1  
ATOM 6635   N N    . GLN C 1 125 ? -2.344  -9.730  10.161  1.00 24.45 ? 125 GLN C N    1  
ATOM 6636   C CA   . GLN C 1 125 ? -2.159  -8.269  10.293  1.00 2.12  ? 125 GLN C CA   1  
ATOM 6637   C C    . GLN C 1 125 ? -1.354  -7.864  11.542  1.00 3.10  ? 125 GLN C C    1  
ATOM 6638   O O    . GLN C 1 125 ? -1.716  -8.213  12.672  1.00 25.40 ? 125 GLN C O    1  
ATOM 6639   C CB   . GLN C 1 125 ? -3.548  -7.573  10.302  1.00 12.13 ? 125 GLN C CB   1  
ATOM 6640   C CG   . GLN C 1 125 ? -4.286  -7.635  8.952   1.00 13.45 ? 125 GLN C CG   1  
ATOM 6641   C CD   . GLN C 1 125 ? -3.653  -6.738  7.885   1.00 13.42 ? 125 GLN C CD   1  
ATOM 6642   O OE1  . GLN C 1 125 ? -4.028  -5.589  7.746   1.00 52.03 ? 125 GLN C OE1  1  
ATOM 6643   N NE2  . GLN C 1 125 ? -2.677  -7.234  7.138   1.00 33.41 ? 125 GLN C NE2  1  
ATOM 6644   H H    . GLN C 1 125 ? -3.258  -10.064 10.073  1.00 60.25 ? 125 GLN C H    1  
ATOM 6645   H HA   . GLN C 1 125 ? -1.621  -7.938  9.410   1.00 63.43 ? 125 GLN C HA   1  
ATOM 6646   H HB2  . GLN C 1 125 ? -4.169  -8.051  11.053  1.00 70.22 ? 125 GLN C HB2  1  
ATOM 6647   H HB3  . GLN C 1 125 ? -3.425  -6.529  10.575  1.00 75.12 ? 125 GLN C HB3  1  
ATOM 6648   H HG2  . GLN C 1 125 ? -4.280  -8.659  8.595   1.00 23.21 ? 125 GLN C HG2  1  
ATOM 6649   H HG3  . GLN C 1 125 ? -5.314  -7.326  9.097   1.00 71.53 ? 125 GLN C HG3  1  
ATOM 6650   H HE21 . GLN C 1 125 ? -2.393  -8.163  7.288   1.00 21.43 ? 125 GLN C HE21 1  
ATOM 6651   H HE22 . GLN C 1 125 ? -2.272  -6.642  6.468   1.00 4.24  ? 125 GLN C HE22 1  
ATOM 6652   N N    . LEU C 1 126 ? -0.266  -7.114  11.308  1.00 72.21 ? 126 LEU C N    1  
ATOM 6653   C CA   . LEU C 1 126 ? 0.587   -6.562  12.363  1.00 24.42 ? 126 LEU C CA   1  
ATOM 6654   C C    . LEU C 1 126 ? 0.732   -5.044  12.128  1.00 1.44  ? 126 LEU C C    1  
ATOM 6655   O O    . LEU C 1 126 ? 1.604   -4.596  11.369  1.00 32.45 ? 126 LEU C O    1  
ATOM 6656   C CB   . LEU C 1 126 ? 1.964   -7.284  12.377  1.00 60.51 ? 126 LEU C CB   1  
ATOM 6657   C CG   . LEU C 1 126 ? 2.935   -6.889  13.537  1.00 52.51 ? 126 LEU C CG   1  
ATOM 6658   C CD1  . LEU C 1 126 ? 2.298   -7.140  14.928  1.00 23.42 ? 126 LEU C CD1  1  
ATOM 6659   C CD2  . LEU C 1 126 ? 4.287   -7.621  13.394  1.00 24.12 ? 126 LEU C CD2  1  
ATOM 6660   H H    . LEU C 1 126 ? -0.030  -6.919  10.379  1.00 63.20 ? 126 LEU C H    1  
ATOM 6661   H HA   . LEU C 1 126 ? 0.099   -6.717  13.325  1.00 30.12 ? 126 LEU C HA   1  
ATOM 6662   H HB2  . LEU C 1 126 ? 1.782   -8.355  12.434  1.00 2.34  ? 126 LEU C HB2  1  
ATOM 6663   H HB3  . LEU C 1 126 ? 2.461   -7.081  11.433  1.00 42.24 ? 126 LEU C HB3  1  
ATOM 6664   H HG   . LEU C 1 126 ? 3.134   -5.826  13.469  1.00 73.20 ? 126 LEU C HG   1  
ATOM 6665   H HD11 . LEU C 1 126 ? 2.051   -8.188  15.040  1.00 55.34 ? 126 LEU C HD11 1  
ATOM 6666   H HD12 . LEU C 1 126 ? 1.398   -6.548  15.028  1.00 42.11 ? 126 LEU C HD12 1  
ATOM 6667   H HD13 . LEU C 1 126 ? 2.995   -6.851  15.705  1.00 2.54  ? 126 LEU C HD13 1  
ATOM 6668   H HD21 . LEU C 1 126 ? 4.953   -7.318  14.192  1.00 53.23 ? 126 LEU C HD21 1  
ATOM 6669   H HD22 . LEU C 1 126 ? 4.740   -7.363  12.444  1.00 32.15 ? 126 LEU C HD22 1  
ATOM 6670   H HD23 . LEU C 1 126 ? 4.138   -8.692  13.438  1.00 74.14 ? 126 LEU C HD23 1  
ATOM 6671   N N    . ASN C 1 127 ? -0.187  -4.273  12.735  1.00 34.54 ? 127 ASN C N    1  
ATOM 6672   C CA   . ASN C 1 127 ? -0.232  -2.801  12.629  1.00 63.12 ? 127 ASN C CA   1  
ATOM 6673   C C    . ASN C 1 127 ? 0.563   -2.178  13.786  1.00 14.21 ? 127 ASN C C    1  
ATOM 6674   O O    . ASN C 1 127 ? 0.381   -2.572  14.944  1.00 54.40 ? 127 ASN C O    1  
ATOM 6675   C CB   . ASN C 1 127 ? -1.701  -2.291  12.665  1.00 24.25 ? 127 ASN C CB   1  
ATOM 6676   C CG   . ASN C 1 127 ? -2.567  -2.859  11.534  1.00 4.10  ? 127 ASN C CG   1  
ATOM 6677   O OD1  . ASN C 1 127 ? -3.129  -3.948  11.650  1.00 4.21  ? 127 ASN C OD1  1  
ATOM 6678   N ND2  . ASN C 1 127 ? -2.695  -2.118  10.443  1.00 44.21 ? 127 ASN C ND2  1  
ATOM 6679   H H    . ASN C 1 127 ? -0.866  -4.714  13.284  1.00 30.44 ? 127 ASN C H    1  
ATOM 6680   H HA   . ASN C 1 127 ? 0.222   -2.511  11.683  1.00 40.15 ? 127 ASN C HA   1  
ATOM 6681   H HB2  . ASN C 1 127 ? -2.153  -2.570  13.609  1.00 35.14 ? 127 ASN C HB2  1  
ATOM 6682   H HB3  . ASN C 1 127 ? -1.704  -1.209  12.586  1.00 52.33 ? 127 ASN C HB3  1  
ATOM 6683   H HD21 . ASN C 1 127 ? -2.236  -1.260  10.407  1.00 54.50 ? 127 ASN C HD21 1  
ATOM 6684   H HD22 . ASN C 1 127 ? -3.253  -2.465  9.714   1.00 44.52 ? 127 ASN C HD22 1  
ATOM 6685   N N    . LEU C 1 128 ? 1.451   -1.224  13.460  1.00 63.44 ? 128 LEU C N    1  
ATOM 6686   C CA   . LEU C 1 128 ? 2.283   -0.518  14.458  1.00 64.51 ? 128 LEU C CA   1  
ATOM 6687   C C    . LEU C 1 128 ? 1.392   0.452   15.284  1.00 41.23 ? 128 LEU C C    1  
ATOM 6688   O O    . LEU C 1 128 ? 0.565   1.172   14.716  1.00 34.42 ? 128 LEU C O    1  
ATOM 6689   C CB   . LEU C 1 128 ? 3.456   0.239   13.739  1.00 1.23  ? 128 LEU C CB   1  
ATOM 6690   C CG   . LEU C 1 128 ? 4.844   0.268   14.474  1.00 32.31 ? 128 LEU C CG   1  
ATOM 6691   C CD1  . LEU C 1 128 ? 5.906   0.980   13.612  1.00 4.24  ? 128 LEU C CD1  1  
ATOM 6692   C CD2  . LEU C 1 128 ? 4.766   0.896   15.889  1.00 34.14 ? 128 LEU C CD2  1  
ATOM 6693   H H    . LEU C 1 128 ? 1.562   -0.993  12.515  1.00 71.15 ? 128 LEU C H    1  
ATOM 6694   H HA   . LEU C 1 128 ? 2.704   -1.267  15.123  1.00 4.54  ? 128 LEU C HA   1  
ATOM 6695   H HB2  . LEU C 1 128 ? 3.610   -0.231  12.769  1.00 24.41 ? 128 LEU C HB2  1  
ATOM 6696   H HB3  . LEU C 1 128 ? 3.149   1.265   13.553  1.00 22.45 ? 128 LEU C HB3  1  
ATOM 6697   H HG   . LEU C 1 128 ? 5.180   -0.756  14.596  1.00 41.44 ? 128 LEU C HG   1  
ATOM 6698   H HD11 . LEU C 1 128 ? 6.005   0.467   12.664  1.00 4.22  ? 128 LEU C HD11 1  
ATOM 6699   H HD12 . LEU C 1 128 ? 6.861   0.963   14.121  1.00 73.14 ? 128 LEU C HD12 1  
ATOM 6700   H HD13 . LEU C 1 128 ? 5.613   2.008   13.434  1.00 43.13 ? 128 LEU C HD13 1  
ATOM 6701   H HD21 . LEU C 1 128 ? 4.414   1.918   15.823  1.00 60.42 ? 128 LEU C HD21 1  
ATOM 6702   H HD22 . LEU C 1 128 ? 5.746   0.883   16.348  1.00 1.40  ? 128 LEU C HD22 1  
ATOM 6703   H HD23 . LEU C 1 128 ? 4.084   0.322   16.502  1.00 50.14 ? 128 LEU C HD23 1  
ATOM 6704   N N    . ALA C 1 129 ? 1.565   0.438   16.618  1.00 44.14 ? 129 ALA C N    1  
ATOM 6705   C CA   . ALA C 1 129 ? 0.788   1.285   17.545  1.00 45.33 ? 129 ALA C CA   1  
ATOM 6706   C C    . ALA C 1 129 ? 1.328   2.746   17.551  1.00 61.01 ? 129 ALA C C    1  
ATOM 6707   O O    . ALA C 1 129 ? 2.524   2.951   17.310  1.00 43.44 ? 129 ALA C O    1  
ATOM 6708   C CB   . ALA C 1 129 ? 0.819   0.672   18.958  1.00 4.02  ? 129 ALA C CB   1  
ATOM 6709   H H    . ALA C 1 129 ? 2.242   -0.162  16.993  1.00 41.21 ? 129 ALA C H    1  
ATOM 6710   H HA   . ALA C 1 129 ? -0.245  1.294   17.205  1.00 61.43 ? 129 ALA C HA   1  
ATOM 6711   H HB1  . ALA C 1 129 ? 0.090   1.163   19.590  1.00 70.11 ? 129 ALA C HB1  1  
ATOM 6712   H HB2  . ALA C 1 129 ? 1.796   0.802   19.387  1.00 63.00 ? 129 ALA C HB2  1  
ATOM 6713   H HB3  . ALA C 1 129 ? 0.590   -0.386  18.906  1.00 31.00 ? 129 ALA C HB3  1  
ATOM 6714   N N    . PRO C 1 130 ? 0.458   3.778   17.829  1.00 31.33 ? 130 PRO C N    1  
ATOM 6715   C CA   . PRO C 1 130 ? 0.868   5.205   17.812  1.00 60.21 ? 130 PRO C CA   1  
ATOM 6716   C C    . PRO C 1 130 ? 1.835   5.548   18.971  1.00 43.21 ? 130 PRO C C    1  
ATOM 6717   O O    . PRO C 1 130 ? 1.448   5.531   20.147  1.00 24.43 ? 130 PRO C O    1  
ATOM 6718   C CB   . PRO C 1 130 ? -0.479  5.975   17.933  1.00 53.10 ? 130 PRO C CB   1  
ATOM 6719   C CG   . PRO C 1 130 ? -1.428  5.015   18.589  1.00 1.01  ? 130 PRO C CG   1  
ATOM 6720   C CD   . PRO C 1 130 ? -0.982  3.623   18.185  1.00 22.12 ? 130 PRO C CD   1  
ATOM 6721   H HA   . PRO C 1 130 ? 1.343   5.460   16.866  1.00 75.24 ? 130 PRO C HA   1  
ATOM 6722   H HB2  . PRO C 1 130 ? -0.356  6.879   18.528  1.00 73.42 ? 130 PRO C HB2  1  
ATOM 6723   H HB3  . PRO C 1 130 ? -0.848  6.242   16.954  1.00 3.30  ? 130 PRO C HB3  1  
ATOM 6724   H HG2  . PRO C 1 130 ? -1.381  5.134   19.670  1.00 50.10 ? 130 PRO C HG2  1  
ATOM 6725   H HG3  . PRO C 1 130 ? -2.441  5.197   18.244  1.00 74.33 ? 130 PRO C HG3  1  
ATOM 6726   H HD2  . PRO C 1 130 ? -1.097  2.931   19.011  1.00 73.22 ? 130 PRO C HD2  1  
ATOM 6727   H HD3  . PRO C 1 130 ? -1.539  3.266   17.332  1.00 41.35 ? 130 PRO C HD3  1  
ATOM 6728   N N    . VAL C 1 131 ? 3.107   5.823   18.625  1.00 50.04 ? 131 VAL C N    1  
ATOM 6729   C CA   . VAL C 1 131 ? 4.149   6.189   19.601  1.00 25.45 ? 131 VAL C CA   1  
ATOM 6730   C C    . VAL C 1 131 ? 4.437   7.697   19.507  1.00 42.21 ? 131 VAL C C    1  
ATOM 6731   O O    . VAL C 1 131 ? 4.971   8.176   18.498  1.00 33.32 ? 131 VAL C O    1  
ATOM 6732   C CB   . VAL C 1 131 ? 5.476   5.375   19.376  1.00 60.42 ? 131 VAL C CB   1  
ATOM 6733   C CG1  . VAL C 1 131 ? 6.515   5.682   20.489  1.00 14.30 ? 131 VAL C CG1  1  
ATOM 6734   C CG2  . VAL C 1 131 ? 5.176   3.858   19.263  1.00 10.23 ? 131 VAL C CG2  1  
ATOM 6735   H H    . VAL C 1 131 ? 3.352   5.778   17.680  1.00 32.54 ? 131 VAL C H    1  
ATOM 6736   H HA   . VAL C 1 131 ? 3.780   5.959   20.602  1.00 12.10 ? 131 VAL C HA   1  
ATOM 6737   H HB   . VAL C 1 131 ? 5.908   5.697   18.430  1.00 55.52 ? 131 VAL C HB   1  
ATOM 6738   H HG11 . VAL C 1 131 ? 6.112   5.408   21.457  1.00 3.12  ? 131 VAL C HG11 1  
ATOM 6739   H HG12 . VAL C 1 131 ? 6.747   6.742   20.491  1.00 55.41 ? 131 VAL C HG12 1  
ATOM 6740   H HG13 . VAL C 1 131 ? 7.425   5.125   20.310  1.00 73.31 ? 131 VAL C HG13 1  
ATOM 6741   H HG21 . VAL C 1 131 ? 4.719   3.502   20.177  1.00 1.32  ? 131 VAL C HG21 1  
ATOM 6742   H HG22 . VAL C 1 131 ? 6.097   3.312   19.091  1.00 13.22 ? 131 VAL C HG22 1  
ATOM 6743   H HG23 . VAL C 1 131 ? 4.502   3.681   18.434  1.00 31.52 ? 131 VAL C HG23 1  
ATOM 6744   N N    . ASN C 1 132 ? 4.060   8.430   20.561  1.00 34.14 ? 132 ASN C N    1  
ATOM 6745   C CA   . ASN C 1 132 ? 4.277   9.878   20.666  1.00 50.21 ? 132 ASN C CA   1  
ATOM 6746   C C    . ASN C 1 132 ? 5.682   10.172  21.221  1.00 60.24 ? 132 ASN C C    1  
ATOM 6747   O O    . ASN C 1 132 ? 5.859   10.258  22.440  1.00 43.14 ? 132 ASN C O    1  
ATOM 6748   C CB   . ASN C 1 132 ? 3.205   10.517  21.592  1.00 42.22 ? 132 ASN C CB   1  
ATOM 6749   C CG   . ASN C 1 132 ? 1.797   10.520  21.008  1.00 73.24 ? 132 ASN C CG   1  
ATOM 6750   O OD1  . ASN C 1 132 ? 1.056   9.545   21.123  1.00 43.11 ? 132 ASN C OD1  1  
ATOM 6751   N ND2  . ASN C 1 132 ? 1.404   11.634  20.412  1.00 23.00 ? 132 ASN C ND2  1  
ATOM 6752   H H    . ASN C 1 132 ? 3.609   7.976   21.302  1.00 53.24 ? 132 ASN C H    1  
ATOM 6753   H HA   . ASN C 1 132 ? 4.190   10.316  19.674  1.00 62.01 ? 132 ASN C HA   1  
ATOM 6754   H HB2  . ASN C 1 132 ? 3.178   9.971   22.527  1.00 41.43 ? 132 ASN C HB2  1  
ATOM 6755   H HB3  . ASN C 1 132 ? 3.487   11.544  21.805  1.00 61.14 ? 132 ASN C HB3  1  
ATOM 6756   H HD21 . ASN C 1 132 ? 2.029   12.384  20.365  1.00 40.12 ? 132 ASN C HD21 1  
ATOM 6757   H HD22 . ASN C 1 132 ? 0.502   11.663  20.055  1.00 21.25 ? 132 ASN C HD22 1  
ATOM 6758   N N    . PHE C 1 133 ? 6.678   10.297  20.319  1.00 61.54 ? 133 PHE C N    1  
ATOM 6759   C CA   . PHE C 1 133 ? 8.031   10.793  20.681  1.00 13.34 ? 133 PHE C CA   1  
ATOM 6760   C C    . PHE C 1 133 ? 7.923   12.216  21.264  1.00 55.01 ? 133 PHE C C    1  
ATOM 6761   O O    . PHE C 1 133 ? 8.623   12.570  22.214  1.00 63.22 ? 133 PHE C O    1  
ATOM 6762   C CB   . PHE C 1 133 ? 8.973   10.827  19.448  1.00 42.40 ? 133 PHE C CB   1  
ATOM 6763   C CG   . PHE C 1 133 ? 9.353   9.465   18.869  1.00 71.13 ? 133 PHE C CG   1  
ATOM 6764   C CD1  . PHE C 1 133 ? 8.504   8.794   17.983  1.00 4.52  ? 133 PHE C CD1  1  
ATOM 6765   C CD2  . PHE C 1 133 ? 10.581  8.872   19.181  1.00 24.22 ? 133 PHE C CD2  1  
ATOM 6766   C CE1  . PHE C 1 133 ? 8.867   7.573   17.442  1.00 2.44  ? 133 PHE C CE1  1  
ATOM 6767   C CE2  . PHE C 1 133 ? 10.937  7.652   18.641  1.00 43.33 ? 133 PHE C CE2  1  
ATOM 6768   C CZ   . PHE C 1 133 ? 10.086  7.007   17.767  1.00 14.42 ? 133 PHE C CZ   1  
ATOM 6769   H H    . PHE C 1 133 ? 6.501   10.043  19.388  1.00 11.31 ? 133 PHE C H    1  
ATOM 6770   H HA   . PHE C 1 133 ? 8.444   10.128  21.435  1.00 43.01 ? 133 PHE C HA   1  
ATOM 6771   H HB2  . PHE C 1 133 ? 8.494   11.398  18.658  1.00 41.42 ? 133 PHE C HB2  1  
ATOM 6772   H HB3  . PHE C 1 133 ? 9.892   11.341  19.722  1.00 3.12  ? 133 PHE C HB3  1  
ATOM 6773   H HD1  . PHE C 1 133 ? 7.548   9.233   17.725  1.00 14.22 ? 133 PHE C HD1  1  
ATOM 6774   H HD2  . PHE C 1 133 ? 11.255  9.372   19.868  1.00 5.44  ? 133 PHE C HD2  1  
ATOM 6775   H HE1  . PHE C 1 133 ? 8.200   7.063   16.758  1.00 63.44 ? 133 PHE C HE1  1  
ATOM 6776   H HE2  . PHE C 1 133 ? 11.890  7.206   18.893  1.00 73.14 ? 133 PHE C HE2  1  
ATOM 6777   H HZ   . PHE C 1 133 ? 10.370  6.052   17.341  1.00 1.11  ? 133 PHE C HZ   1  
ATOM 6778   N N    . ASP C 1 134 ? 7.007   12.989  20.659  1.00 75.20 ? 134 ASP C N    1  
ATOM 6779   C CA   . ASP C 1 134 ? 6.688   14.377  21.030  1.00 2.21  ? 134 ASP C CA   1  
ATOM 6780   C C    . ASP C 1 134 ? 6.306   14.486  22.515  1.00 44.21 ? 134 ASP C C    1  
ATOM 6781   O O    . ASP C 1 134 ? 6.873   15.298  23.248  1.00 12.34 ? 134 ASP C O    1  
ATOM 6782   C CB   . ASP C 1 134 ? 5.510   14.885  20.156  1.00 23.40 ? 134 ASP C CB   1  
ATOM 6783   C CG   . ASP C 1 134 ? 5.788   14.781  18.648  1.00 65.23 ? 134 ASP C CG   1  
ATOM 6784   O OD1  . ASP C 1 134 ? 5.650   13.673  18.088  1.00 70.53 ? 134 ASP C OD1  1  
ATOM 6785   O OD2  . ASP C 1 134 ? 6.162   15.800  18.035  1.00 44.15 ? 134 ASP C OD2  1  
ATOM 6786   H H    . ASP C 1 134 ? 6.522   12.602  19.900  1.00 54.54 ? 134 ASP C H    1  
ATOM 6787   H HA   . ASP C 1 134 ? 7.566   14.987  20.834  1.00 23.14 ? 134 ASP C HA   1  
ATOM 6788   H HB2  . ASP C 1 134 ? 4.619   14.305  20.382  1.00 45.53 ? 134 ASP C HB2  1  
ATOM 6789   H HB3  . ASP C 1 134 ? 5.312   15.922  20.401  1.00 33.11 ? 134 ASP C HB3  1  
ATOM 6790   N N    . ALA C 1 135 ? 5.355   13.626  22.933  1.00 25.34 ? 135 ALA C N    1  
ATOM 6791   C CA   . ALA C 1 135 ? 4.812   13.603  24.307  1.00 64.51 ? 135 ALA C CA   1  
ATOM 6792   C C    . ALA C 1 135 ? 5.852   13.074  25.308  1.00 42.32 ? 135 ALA C C    1  
ATOM 6793   O O    . ALA C 1 135 ? 5.868   13.474  26.476  1.00 13.22 ? 135 ALA C O    1  
ATOM 6794   C CB   . ALA C 1 135 ? 3.525   12.765  24.341  1.00 50.33 ? 135 ALA C CB   1  
ATOM 6795   H H    . ALA C 1 135 ? 5.011   12.976  22.291  1.00 34.52 ? 135 ALA C H    1  
ATOM 6796   H HA   . ALA C 1 135 ? 4.555   14.626  24.579  1.00 21.04 ? 135 ALA C HA   1  
ATOM 6797   H HB1  . ALA C 1 135 ? 2.791   13.227  23.708  1.00 23.15 ? 135 ALA C HB1  1  
ATOM 6798   H HB2  . ALA C 1 135 ? 3.140   12.709  25.352  1.00 61.34 ? 135 ALA C HB2  1  
ATOM 6799   H HB3  . ALA C 1 135 ? 3.718   11.765  23.969  1.00 34.34 ? 135 ALA C HB3  1  
ATOM 6800   N N    . LEU C 1 136 ? 6.718   12.178  24.823  1.00 60.34 ? 136 LEU C N    1  
ATOM 6801   C CA   . LEU C 1 136 ? 7.876   11.669  25.594  1.00 33.45 ? 136 LEU C CA   1  
ATOM 6802   C C    . LEU C 1 136 ? 8.934   12.781  25.835  1.00 11.14 ? 136 LEU C C    1  
ATOM 6803   O O    . LEU C 1 136 ? 9.612   12.787  26.866  1.00 53.53 ? 136 LEU C O    1  
ATOM 6804   C CB   . LEU C 1 136 ? 8.512   10.447  24.881  1.00 71.31 ? 136 LEU C CB   1  
ATOM 6805   C CG   . LEU C 1 136 ? 7.655   9.142   24.812  1.00 53.32 ? 136 LEU C CG   1  
ATOM 6806   C CD1  . LEU C 1 136 ? 8.359   8.053   23.958  1.00 32.12 ? 136 LEU C CD1  1  
ATOM 6807   C CD2  . LEU C 1 136 ? 7.309   8.623   26.231  1.00 42.51 ? 136 LEU C CD2  1  
ATOM 6808   H H    . LEU C 1 136 ? 6.560   11.833  23.917  1.00 70.53 ? 136 LEU C H    1  
ATOM 6809   H HA   . LEU C 1 136 ? 7.501   11.345  26.561  1.00 54.34 ? 136 LEU C HA   1  
ATOM 6810   H HB2  . LEU C 1 136 ? 8.752   10.747  23.865  1.00 45.44 ? 136 LEU C HB2  1  
ATOM 6811   H HB3  . LEU C 1 136 ? 9.444   10.208  25.385  1.00 2.21  ? 136 LEU C HB3  1  
ATOM 6812   H HG   . LEU C 1 136 ? 6.719   9.372   24.316  1.00 32.30 ? 136 LEU C HG   1  
ATOM 6813   H HD11 . LEU C 1 136 ? 9.310   7.785   24.405  1.00 75.01 ? 136 LEU C HD11 1  
ATOM 6814   H HD12 . LEU C 1 136 ? 8.532   8.433   22.959  1.00 72.33 ? 136 LEU C HD12 1  
ATOM 6815   H HD13 . LEU C 1 136 ? 7.732   7.174   23.895  1.00 44.31 ? 136 LEU C HD13 1  
ATOM 6816   H HD21 . LEU C 1 136 ? 6.706   7.729   26.156  1.00 23.14 ? 136 LEU C HD21 1  
ATOM 6817   H HD22 . LEU C 1 136 ? 6.751   9.379   26.767  1.00 30.41 ? 136 LEU C HD22 1  
ATOM 6818   H HD23 . LEU C 1 136 ? 8.218   8.399   26.776  1.00 70.11 ? 136 LEU C HD23 1  
ATOM 6819   N N    . PHE C 1 137 ? 9.072   13.712  24.871  1.00 43.35 ? 137 PHE C N    1  
ATOM 6820   C CA   . PHE C 1 137 ? 9.936   14.911  25.022  1.00 41.00 ? 137 PHE C CA   1  
ATOM 6821   C C    . PHE C 1 137 ? 9.242   15.987  25.891  1.00 1.44  ? 137 PHE C C    1  
ATOM 6822   O O    . PHE C 1 137 ? 9.907   16.818  26.508  1.00 73.41 ? 137 PHE C O    1  
ATOM 6823   C CB   . PHE C 1 137 ? 10.317  15.502  23.629  1.00 20.20 ? 137 PHE C CB   1  
ATOM 6824   C CG   . PHE C 1 137 ? 11.400  14.727  22.854  1.00 20.21 ? 137 PHE C CG   1  
ATOM 6825   C CD1  . PHE C 1 137 ? 12.648  14.476  23.432  1.00 31.22 ? 137 PHE C CD1  1  
ATOM 6826   C CD2  . PHE C 1 137 ? 11.194  14.297  21.540  1.00 14.10 ? 137 PHE C CD2  1  
ATOM 6827   C CE1  . PHE C 1 137 ? 13.647  13.822  22.730  1.00 44.33 ? 137 PHE C CE1  1  
ATOM 6828   C CE2  . PHE C 1 137 ? 12.192  13.635  20.841  1.00 73.55 ? 137 PHE C CE2  1  
ATOM 6829   C CZ   . PHE C 1 137 ? 13.420  13.402  21.436  1.00 2.04  ? 137 PHE C CZ   1  
ATOM 6830   H H    . PHE C 1 137 ? 8.579   13.592  24.033  1.00 55.41 ? 137 PHE C H    1  
ATOM 6831   H HA   . PHE C 1 137 ? 10.855  14.605  25.544  1.00 11.03 ? 137 PHE C HA   1  
ATOM 6832   H HB2  . PHE C 1 137 ? 9.425   15.542  23.013  1.00 21.21 ? 137 PHE C HB2  1  
ATOM 6833   H HB3  . PHE C 1 137 ? 10.682  16.517  23.761  1.00 41.43 ? 137 PHE C HB3  1  
ATOM 6834   H HD1  . PHE C 1 137 ? 12.835  14.795  24.450  1.00 61.42 ? 137 PHE C HD1  1  
ATOM 6835   H HD2  . PHE C 1 137 ? 10.235  14.472  21.068  1.00 13.23 ? 137 PHE C HD2  1  
ATOM 6836   H HE1  . PHE C 1 137 ? 14.606  13.639  23.197  1.00 71.51 ? 137 PHE C HE1  1  
ATOM 6837   H HE2  . PHE C 1 137 ? 12.015  13.305  19.824  1.00 74.43 ? 137 PHE C HE2  1  
ATOM 6838   H HZ   . PHE C 1 137 ? 14.203  12.894  20.886  1.00 64.04 ? 137 PHE C HZ   1  
ATOM 6839   N N    . MET C 1 138 ? 7.901   15.966  25.925  1.00 4.55  ? 138 MET C N    1  
ATOM 6840   C CA   . MET C 1 138 ? 7.109   16.825  26.835  1.00 32.43 ? 138 MET C CA   1  
ATOM 6841   C C    . MET C 1 138 ? 7.331   16.403  28.297  1.00 71.42 ? 138 MET C C    1  
ATOM 6842   O O    . MET C 1 138 ? 7.191   17.223  29.208  1.00 12.13 ? 138 MET C O    1  
ATOM 6843   C CB   . MET C 1 138 ? 5.599   16.783  26.476  1.00 34.22 ? 138 MET C CB   1  
ATOM 6844   C CG   . MET C 1 138 ? 5.253   17.399  25.117  1.00 52.31 ? 138 MET C CG   1  
ATOM 6845   S SD   . MET C 1 138 ? 3.507   17.205  24.696  1.00 13.15 ? 138 MET C SD   1  
ATOM 6846   C CE   . MET C 1 138 ? 3.466   17.895  23.042  1.00 63.33 ? 138 MET C CE   1  
ATOM 6847   H H    . MET C 1 138 ? 7.427   15.359  25.320  1.00 11.11 ? 138 MET C H    1  
ATOM 6848   H HA   . MET C 1 138 ? 7.467   17.846  26.715  1.00 3.44  ? 138 MET C HA   1  
ATOM 6849   H HB2  . MET C 1 138 ? 5.271   15.750  26.466  1.00 21.44 ? 138 MET C HB2  1  
ATOM 6850   H HB3  . MET C 1 138 ? 5.036   17.314  27.237  1.00 33.53 ? 138 MET C HB3  1  
ATOM 6851   H HG2  . MET C 1 138 ? 5.488   18.457  25.135  1.00 33.44 ? 138 MET C HG2  1  
ATOM 6852   H HG3  . MET C 1 138 ? 5.847   16.917  24.350  1.00 12.02 ? 138 MET C HG3  1  
ATOM 6853   H HE1  . MET C 1 138 ? 4.121   17.326  22.397  1.00 34.13 ? 138 MET C HE1  1  
ATOM 6854   H HE2  . MET C 1 138 ? 3.794   18.924  23.071  1.00 71.23 ? 138 MET C HE2  1  
ATOM 6855   H HE3  . MET C 1 138 ? 2.458   17.850  22.659  1.00 51.10 ? 138 MET C HE3  1  
ATOM 6856   N N    . ASN C 1 139 ? 7.649   15.105  28.501  1.00 10.31 ? 139 ASN C N    1  
ATOM 6857   C CA   . ASN C 1 139 ? 7.901   14.531  29.833  1.00 23.45 ? 139 ASN C CA   1  
ATOM 6858   C C    . ASN C 1 139 ? 9.070   15.221  30.553  1.00 4.30  ? 139 ASN C C    1  
ATOM 6859   O O    . ASN C 1 139 ? 8.943   15.529  31.746  1.00 64.13 ? 139 ASN C O    1  
ATOM 6860   C CB   . ASN C 1 139 ? 8.146   12.997  29.760  1.00 64.15 ? 139 ASN C CB   1  
ATOM 6861   C CG   . ASN C 1 139 ? 6.894   12.190  29.398  1.00 73.12 ? 139 ASN C CG   1  
ATOM 6862   O OD1  . ASN C 1 139 ? 5.765   12.595  29.687  1.00 55.44 ? 139 ASN C OD1  1  
ATOM 6863   N ND2  . ASN C 1 139 ? 7.085   11.021  28.801  1.00 10.33 ? 139 ASN C ND2  1  
ATOM 6864   H H    . ASN C 1 139 ? 7.711   14.517  27.722  1.00 25.51 ? 139 ASN C H    1  
ATOM 6865   H HA   . ASN C 1 139 ? 7.002   14.702  30.421  1.00 64.14 ? 139 ASN C HA   1  
ATOM 6866   H HB2  . ASN C 1 139 ? 8.905   12.796  29.016  1.00 21.32 ? 139 ASN C HB2  1  
ATOM 6867   H HB3  . ASN C 1 139 ? 8.502   12.640  30.723  1.00 42.04 ? 139 ASN C HB3  1  
ATOM 6868   H HD21 . ASN C 1 139 ? 8.006   10.736  28.626  1.00 44.04 ? 139 ASN C HD21 1  
ATOM 6869   H HD22 . ASN C 1 139 ? 6.298   10.492  28.554  1.00 74.33 ? 139 ASN C HD22 1  
ATOM 6870   N N    . TYR C 1 140 ? 10.214  15.483  29.861  1.00 20.44 ? 140 TYR C N    1  
ATOM 6871   C CA   . TYR C 1 140 ? 11.370  16.112  30.557  1.00 42.35 ? 140 TYR C CA   1  
ATOM 6872   C C    . TYR C 1 140 ? 11.074  17.610  30.861  1.00 34.40 ? 140 TYR C C    1  
ATOM 6873   O O    . TYR C 1 140 ? 9.928   18.048  30.720  1.00 14.43 ? 140 TYR C O    1  
ATOM 6874   C CB   . TYR C 1 140 ? 12.703  15.878  29.744  1.00 3.22  ? 140 TYR C CB   1  
ATOM 6875   C CG   . TYR C 1 140 ? 12.954  16.697  28.447  1.00 41.43 ? 140 TYR C CG   1  
ATOM 6876   C CD1  . TYR C 1 140 ? 12.788  16.128  27.182  1.00 21.40 ? 140 TYR C CD1  1  
ATOM 6877   C CD2  . TYR C 1 140 ? 13.414  18.022  28.490  1.00 22.25 ? 140 TYR C CD2  1  
ATOM 6878   C CE1  . TYR C 1 140 ? 13.055  16.850  26.029  1.00 60.35 ? 140 TYR C CE1  1  
ATOM 6879   C CE2  . TYR C 1 140 ? 13.672  18.742  27.340  1.00 22.12 ? 140 TYR C CE2  1  
ATOM 6880   C CZ   . TYR C 1 140 ? 13.492  18.151  26.112  1.00 33.35 ? 140 TYR C CZ   1  
ATOM 6881   O OH   . TYR C 1 140 ? 13.760  18.865  24.959  1.00 61.23 ? 140 TYR C OH   1  
ATOM 6882   H H    . TYR C 1 140 ? 10.265  15.279  28.903  1.00 44.12 ? 140 TYR C H    1  
ATOM 6883   H HA   . TYR C 1 140 ? 11.473  15.606  31.514  1.00 63.40 ? 140 TYR C HA   1  
ATOM 6884   H HB2  . TYR C 1 140 ? 13.539  16.073  30.399  1.00 43.25 ? 140 TYR C HB2  1  
ATOM 6885   H HB3  . TYR C 1 140 ? 12.738  14.824  29.462  1.00 1.32  ? 140 TYR C HB3  1  
ATOM 6886   H HD1  . TYR C 1 140 ? 12.434  15.106  27.102  1.00 1.32  ? 140 TYR C HD1  1  
ATOM 6887   H HD2  . TYR C 1 140 ? 13.557  18.491  29.456  1.00 11.21 ? 140 TYR C HD2  1  
ATOM 6888   H HE1  . TYR C 1 140 ? 12.918  16.389  25.064  1.00 13.13 ? 140 TYR C HE1  1  
ATOM 6889   H HE2  . TYR C 1 140 ? 14.016  19.768  27.408  1.00 71.23 ? 140 TYR C HE2  1  
ATOM 6890   H HH   . TYR C 1 140 ? 14.579  19.355  25.072  1.00 63.54 ? 140 TYR C HH   1  
ATOM 6891   N N    . LEU C 1 141 ? 12.113  18.399  31.218  1.00 25.24 ? 141 LEU C N    1  
ATOM 6892   C CA   . LEU C 1 141 ? 12.007  19.860  31.514  1.00 54.20 ? 141 LEU C CA   1  
ATOM 6893   C C    . LEU C 1 141 ? 11.128  20.196  32.779  1.00 11.23 ? 141 LEU C C    1  
ATOM 6894   O O    . LEU C 1 141 ? 11.247  21.290  33.344  1.00 63.24 ? 141 LEU C O    1  
ATOM 6895   C CB   . LEU C 1 141 ? 11.493  20.635  30.254  1.00 42.42 ? 141 LEU C CB   1  
ATOM 6896   C CG   . LEU C 1 141 ? 11.491  22.194  30.335  1.00 41.03 ? 141 LEU C CG   1  
ATOM 6897   C CD1  . LEU C 1 141 ? 12.926  22.749  30.498  1.00 53.51 ? 141 LEU C CD1  1  
ATOM 6898   C CD2  . LEU C 1 141 ? 10.769  22.812  29.113  1.00 2.53  ? 141 LEU C CD2  1  
ATOM 6899   H H    . LEU C 1 141 ? 12.994  17.979  31.309  1.00 62.11 ? 141 LEU C H    1  
ATOM 6900   H HA   . LEU C 1 141 ? 13.016  20.196  31.724  1.00 5.42  ? 141 LEU C HA   1  
ATOM 6901   H HB2  . LEU C 1 141 ? 12.109  20.343  29.407  1.00 10.42 ? 141 LEU C HB2  1  
ATOM 6902   H HB3  . LEU C 1 141 ? 10.479  20.303  30.051  1.00 12.24 ? 141 LEU C HB3  1  
ATOM 6903   H HG   . LEU C 1 141 ? 10.935  22.489  31.219  1.00 30.31 ? 141 LEU C HG   1  
ATOM 6904   H HD11 . LEU C 1 141 ? 13.537  22.449  29.655  1.00 24.42 ? 141 LEU C HD11 1  
ATOM 6905   H HD12 . LEU C 1 141 ? 13.362  22.363  31.410  1.00 71.15 ? 141 LEU C HD12 1  
ATOM 6906   H HD13 . LEU C 1 141 ? 12.897  23.829  30.553  1.00 41.31 ? 141 LEU C HD13 1  
ATOM 6907   H HD21 . LEU C 1 141 ? 11.287  22.546  28.201  1.00 62.24 ? 141 LEU C HD21 1  
ATOM 6908   H HD22 . LEU C 1 141 ? 10.745  23.890  29.209  1.00 25.22 ? 141 LEU C HD22 1  
ATOM 6909   H HD23 . LEU C 1 141 ? 9.752   22.443  29.067  1.00 2.33  ? 141 LEU C HD23 1  
ATOM 6910   N N    . GLN C 1 142 ? 10.291  19.249  33.243  1.00 53.21 ? 142 GLN C N    1  
ATOM 6911   C CA   . GLN C 1 142 ? 9.218   19.507  34.236  1.00 50.43 ? 142 GLN C CA   1  
ATOM 6912   C C    . GLN C 1 142 ? 8.849   18.213  34.975  1.00 14.21 ? 142 GLN C C    1  
ATOM 6913   O O    . GLN C 1 142 ? 9.494   17.177  34.789  1.00 61.22 ? 142 GLN C O    1  
ATOM 6914   C CB   . GLN C 1 142 ? 7.961   20.084  33.510  1.00 3.10  ? 142 GLN C CB   1  
ATOM 6915   C CG   . GLN C 1 142 ? 7.440   19.201  32.353  1.00 70.14 ? 142 GLN C CG   1  
ATOM 6916   C CD   . GLN C 1 142 ? 6.188   19.742  31.671  1.00 20.23 ? 142 GLN C CD   1  
ATOM 6917   O OE1  . GLN C 1 142 ? 5.304   20.314  32.311  1.00 62.43 ? 142 GLN C OE1  1  
ATOM 6918   N NE2  . GLN C 1 142 ? 6.113   19.581  30.355  1.00 33.44 ? 142 GLN C NE2  1  
ATOM 6919   H H    . GLN C 1 142 ? 10.405  18.334  32.932  1.00 60.04 ? 142 GLN C H    1  
ATOM 6920   H HA   . GLN C 1 142 ? 9.578   20.233  34.963  1.00 53.25 ? 142 GLN C HA   1  
ATOM 6921   H HB2  . GLN C 1 142 ? 7.159   20.214  34.234  1.00 0.44  ? 142 GLN C HB2  1  
ATOM 6922   H HB3  . GLN C 1 142 ? 8.216   21.057  33.106  1.00 63.03 ? 142 GLN C HB3  1  
ATOM 6923   H HG2  . GLN C 1 142 ? 8.225   19.110  31.611  1.00 11.44 ? 142 GLN C HG2  1  
ATOM 6924   H HG3  . GLN C 1 142 ? 7.215   18.214  32.741  1.00 73.24 ? 142 GLN C HG3  1  
ATOM 6925   H HE21 . GLN C 1 142 ? 6.852   19.122  29.905  1.00 12.52 ? 142 GLN C HE21 1  
ATOM 6926   H HE22 . GLN C 1 142 ? 5.346   19.963  29.881  1.00 60.30 ? 142 GLN C HE22 1  
ATOM 6927   N N    . GLN C 1 143 ? 7.807   18.296  35.818  1.00 41.52 ? 143 GLN C N    1  
ATOM 6928   C CA   . GLN C 1 143 ? 7.237   17.136  36.522  1.00 12.02 ? 143 GLN C CA   1  
ATOM 6929   C C    . GLN C 1 143 ? 6.105   16.515  35.671  1.00 55.24 ? 143 GLN C C    1  
ATOM 6930   O O    . GLN C 1 143 ? 5.401   17.229  34.940  1.00 0.14  ? 143 GLN C O    1  
ATOM 6931   C CB   . GLN C 1 143 ? 6.717   17.579  37.917  1.00 41.34 ? 143 GLN C CB   1  
ATOM 6932   C CG   . GLN C 1 143 ? 5.584   18.621  37.876  1.00 52.23 ? 143 GLN C CG   1  
ATOM 6933   C CD   . GLN C 1 143 ? 5.230   19.209  39.241  1.00 44.12 ? 143 GLN C CD   1  
ATOM 6934   O OE1  . GLN C 1 143 ? 4.366   18.691  39.953  1.00 33.54 ? 143 GLN C OE1  1  
ATOM 6935   N NE2  . GLN C 1 143 ? 5.900   20.286  39.620  1.00 52.31 ? 143 GLN C NE2  1  
ATOM 6936   H H    . GLN C 1 143 ? 7.396   19.177  35.965  1.00 40.05 ? 143 GLN C H    1  
ATOM 6937   H HA   . GLN C 1 143 ? 8.025   16.395  36.656  1.00 24.12 ? 143 GLN C HA   1  
ATOM 6938   H HB2  . GLN C 1 143 ? 6.365   16.706  38.454  1.00 74.55 ? 143 GLN C HB2  1  
ATOM 6939   H HB3  . GLN C 1 143 ? 7.550   18.006  38.467  1.00 61.24 ? 143 GLN C HB3  1  
ATOM 6940   H HG2  . GLN C 1 143 ? 5.875   19.430  37.219  1.00 31.13 ? 143 GLN C HG2  1  
ATOM 6941   H HG3  . GLN C 1 143 ? 4.697   18.152  37.467  1.00 52.14 ? 143 GLN C HG3  1  
ATOM 6942   H HE21 . GLN C 1 143 ? 6.582   20.649  39.013  1.00 42.43 ? 143 GLN C HE21 1  
ATOM 6943   H HE22 . GLN C 1 143 ? 5.685   20.681  40.491  1.00 3.42  ? 143 GLN C HE22 1  
ATOM 6944   N N    . GLN C 1 144 ? 5.944   15.182  35.766  1.00 14.54 ? 144 GLN C N    1  
ATOM 6945   C CA   . GLN C 1 144 ? 4.962   14.419  34.959  1.00 74.53 ? 144 GLN C CA   1  
ATOM 6946   C C    . GLN C 1 144 ? 4.025   13.662  35.907  1.00 61.15 ? 144 GLN C C    1  
ATOM 6947   O O    . GLN C 1 144 ? 4.470   12.754  36.620  1.00 52.31 ? 144 GLN C O    1  
ATOM 6948   C CB   . GLN C 1 144 ? 5.654   13.398  33.979  1.00 54.53 ? 144 GLN C CB   1  
ATOM 6949   C CG   . GLN C 1 144 ? 7.063   13.787  33.486  1.00 23.31 ? 144 GLN C CG   1  
ATOM 6950   C CD   . GLN C 1 144 ? 8.173   13.585  34.535  1.00 72.32 ? 144 GLN C CD   1  
ATOM 6951   O OE1  . GLN C 1 144 ? 8.102   12.686  35.373  1.00 45.01 ? 144 GLN C OE1  1  
ATOM 6952   N NE2  . GLN C 1 144 ? 9.182   14.436  34.519  1.00 53.43 ? 144 GLN C NE2  1  
ATOM 6953   H H    . GLN C 1 144 ? 6.502   14.690  36.404  1.00 11.12 ? 144 GLN C H    1  
ATOM 6954   H HA   . GLN C 1 144 ? 4.375   15.128  34.372  1.00 41.13 ? 144 GLN C HA   1  
ATOM 6955   H HB2  . GLN C 1 144 ? 5.735   12.432  34.467  1.00 43.12 ? 144 GLN C HB2  1  
ATOM 6956   H HB3  . GLN C 1 144 ? 5.017   13.277  33.107  1.00 41.44 ? 144 GLN C HB3  1  
ATOM 6957   H HG2  . GLN C 1 144 ? 7.311   13.182  32.621  1.00 31.41 ? 144 GLN C HG2  1  
ATOM 6958   H HG3  . GLN C 1 144 ? 7.049   14.830  33.189  1.00 35.41 ? 144 GLN C HG3  1  
ATOM 6959   H HE21 . GLN C 1 144 ? 9.177   15.155  33.848  1.00 70.52 ? 144 GLN C HE21 1  
ATOM 6960   H HE22 . GLN C 1 144 ? 9.894   14.320  35.182  1.00 54.22 ? 144 GLN C HE22 1  
ATOM 6961   N N    . ALA C 1 145 ? 2.756   14.053  35.929  1.00 21.05 ? 145 ALA C N    1  
ATOM 6962   C CA   . ALA C 1 145 ? 1.701   13.356  36.671  1.00 31.43 ? 145 ALA C CA   1  
ATOM 6963   C C    . ALA C 1 145 ? 0.666   12.820  35.675  1.00 62.10 ? 145 ALA C C    1  
ATOM 6964   O O    . ALA C 1 145 ? 0.850   12.935  34.450  1.00 30.41 ? 145 ALA C O    1  
ATOM 6965   C CB   . ALA C 1 145 ? 1.069   14.304  37.708  1.00 24.44 ? 145 ALA C CB   1  
ATOM 6966   H H    . ALA C 1 145 ? 2.506   14.843  35.408  1.00 1.02  ? 145 ALA C H    1  
ATOM 6967   H HA   . ALA C 1 145 ? 2.138   12.509  37.200  1.00 62.05 ? 145 ALA C HA   1  
ATOM 6968   H HB1  . ALA C 1 145 ? 1.830   14.646  38.397  1.00 40.21 ? 145 ALA C HB1  1  
ATOM 6969   H HB2  . ALA C 1 145 ? 0.297   13.783  38.263  1.00 31.32 ? 145 ALA C HB2  1  
ATOM 6970   H HB3  . ALA C 1 145 ? 0.632   15.159  37.207  1.00 72.31 ? 145 ALA C HB3  1  
ATOM 6971   N N    . GLY C 1 146 ? -0.409  12.226  36.198  1.00 24.13 ? 146 GLY C N    1  
ATOM 6972   C CA   . GLY C 1 146 ? -1.461  11.679  35.362  1.00 72.11 ? 146 GLY C CA   1  
ATOM 6973   C C    . GLY C 1 146 ? -2.697  11.342  36.168  1.00 61.23 ? 146 GLY C C    1  
ATOM 6974   O O    . GLY C 1 146 ? -2.617  10.571  37.131  1.00 1.31  ? 146 GLY C O    1  
ATOM 6975   H H    . GLY C 1 146 ? -0.488  12.161  37.171  1.00 40.02 ? 146 GLY C H    1  
ATOM 6976   H HA2  . GLY C 1 146 ? -1.717  12.400  34.589  1.00 61.14 ? 146 GLY C HA2  1  
ATOM 6977   H HA3  . GLY C 1 146 ? -1.099  10.777  34.885  1.00 12.54 ? 146 GLY C HA3  1  
ATOM 6978   N N    . GLU C 1 147 ? -3.826  11.950  35.794  1.00 22.11 ? 147 GLU C N    1  
ATOM 6979   C CA   . GLU C 1 147 ? -5.138  11.674  36.379  1.00 2.43  ? 147 GLU C CA   1  
ATOM 6980   C C    . GLU C 1 147 ? -5.699  10.341  35.824  1.00 42.32 ? 147 GLU C C    1  
ATOM 6981   O O    . GLU C 1 147 ? -5.354  9.929   34.708  1.00 64.40 ? 147 GLU C O    1  
ATOM 6982   C CB   . GLU C 1 147 ? -6.089  12.852  36.055  1.00 73.44 ? 147 GLU C CB   1  
ATOM 6983   C CG   . GLU C 1 147 ? -7.501  12.743  36.646  1.00 15.33 ? 147 GLU C CG   1  
ATOM 6984   C CD   . GLU C 1 147 ? -7.534  12.716  38.182  1.00 65.42 ? 147 GLU C CD   1  
ATOM 6985   O OE1  . GLU C 1 147 ? -7.565  11.621  38.775  1.00 14.53 ? 147 GLU C OE1  1  
ATOM 6986   O OE2  . GLU C 1 147 ? -7.541  13.796  38.802  1.00 15.24 ? 147 GLU C OE2  1  
ATOM 6987   H H    . GLU C 1 147 ? -3.774  12.620  35.076  1.00 53.24 ? 147 GLU C H    1  
ATOM 6988   H HA   . GLU C 1 147 ? -5.022  11.593  37.459  1.00 73.21 ? 147 GLU C HA   1  
ATOM 6989   H HB2  . GLU C 1 147 ? -5.642  13.770  36.425  1.00 70.42 ? 147 GLU C HB2  1  
ATOM 6990   H HB3  . GLU C 1 147 ? -6.178  12.932  34.974  1.00 33.02 ? 147 GLU C HB3  1  
ATOM 6991   H HG2  . GLU C 1 147 ? -8.084  13.592  36.304  1.00 24.53 ? 147 GLU C HG2  1  
ATOM 6992   H HG3  . GLU C 1 147 ? -7.963  11.836  36.266  1.00 44.22 ? 147 GLU C HG3  1  
ATOM 6993   N N    . GLY C 1 148 ? -6.532  9.661   36.629  1.00 31.25 ? 148 GLY C N    1  
ATOM 6994   C CA   . GLY C 1 148 ? -7.170  8.403   36.234  1.00 14.32 ? 148 GLY C CA   1  
ATOM 6995   C C    . GLY C 1 148 ? -8.567  8.612   35.666  1.00 33.45 ? 148 GLY C C    1  
ATOM 6996   O O    . GLY C 1 148 ? -9.146  9.704   35.800  1.00 34.41 ? 148 GLY C O    1  
ATOM 6997   H H    . GLY C 1 148 ? -6.736  10.035  37.511  1.00 70.52 ? 148 GLY C H    1  
ATOM 6998   H HA2  . GLY C 1 148 ? -6.559  7.894   35.494  1.00 43.31 ? 148 GLY C HA2  1  
ATOM 6999   H HA3  . GLY C 1 148 ? -7.246  7.768   37.107  1.00 13.11 ? 148 GLY C HA3  1  
ATOM 7000   N N    . THR C 1 149 ? -9.102  7.554   35.034  1.00 41.20 ? 149 THR C N    1  
ATOM 7001   C CA   . THR C 1 149 ? -10.454 7.551   34.466  1.00 3.12  ? 149 THR C CA   1  
ATOM 7002   C C    . THR C 1 149 ? -11.508 7.640   35.601  1.00 31.22 ? 149 THR C C    1  
ATOM 7003   O O    . THR C 1 149 ? -11.612 6.748   36.455  1.00 4.22  ? 149 THR C O    1  
ATOM 7004   C CB   . THR C 1 149 ? -10.696 6.296   33.537  1.00 33.40 ? 149 THR C CB   1  
ATOM 7005   O OG1  . THR C 1 149 ? -12.062 6.248   33.087  1.00 33.14 ? 149 THR C OG1  1  
ATOM 7006   C CG2  . THR C 1 149 ? -10.336 4.963   34.217  1.00 25.05 ? 149 THR C CG2  1  
ATOM 7007   H H    . THR C 1 149 ? -8.562  6.742   34.955  1.00 24.30 ? 149 THR C H    1  
ATOM 7008   H HA   . THR C 1 149 ? -10.542 8.441   33.841  1.00 41.22 ? 149 THR C HA   1  
ATOM 7009   H HB   . THR C 1 149 ? -10.065 6.406   32.660  1.00 73.45 ? 149 THR C HB   1  
ATOM 7010   H HG1  . THR C 1 149 ? -12.380 7.146   32.934  1.00 4.13  ? 149 THR C HG1  1  
ATOM 7011   H HG21 . THR C 1 149 ? -9.294  4.974   34.515  1.00 64.23 ? 149 THR C HG21 1  
ATOM 7012   H HG22 . THR C 1 149 ? -10.496 4.145   33.526  1.00 32.10 ? 149 THR C HG22 1  
ATOM 7013   H HG23 . THR C 1 149 ? -10.955 4.816   35.091  1.00 51.32 ? 149 THR C HG23 1  
ATOM 7014   N N    . GLU C 1 150 ? -12.245 8.757   35.605  1.00 74.24 ? 150 GLU C N    1  
ATOM 7015   C CA   . GLU C 1 150 ? -13.233 9.096   36.645  1.00 30.44 ? 150 GLU C CA   1  
ATOM 7016   C C    . GLU C 1 150 ? -14.563 8.343   36.435  1.00 10.33 ? 150 GLU C C    1  
ATOM 7017   O O    . GLU C 1 150 ? -15.285 8.087   37.410  1.00 60.02 ? 150 GLU C O    1  
ATOM 7018   C CB   . GLU C 1 150 ? -13.445 10.636  36.665  1.00 23.43 ? 150 GLU C CB   1  
ATOM 7019   C CG   . GLU C 1 150 ? -13.868 11.261  35.314  1.00 14.22 ? 150 GLU C CG   1  
ATOM 7020   C CD   . GLU C 1 150 ? -13.764 12.790  35.296  1.00 1.11  ? 150 GLU C CD   1  
ATOM 7021   O OE1  . GLU C 1 150 ? -14.709 13.462  35.760  1.00 34.53 ? 150 GLU C OE1  1  
ATOM 7022   O OE2  . GLU C 1 150 ? -12.721 13.327  34.860  1.00 32.42 ? 150 GLU C OE2  1  
ATOM 7023   H H    . GLU C 1 150 ? -12.130 9.383   34.857  1.00 62.40 ? 150 GLU C H    1  
ATOM 7024   H HA   . GLU C 1 150 ? -12.820 8.795   37.607  1.00 12.43 ? 150 GLU C HA   1  
ATOM 7025   H HB2  . GLU C 1 150 ? -14.205 10.877  37.403  1.00 61.21 ? 150 GLU C HB2  1  
ATOM 7026   H HB3  . GLU C 1 150 ? -12.516 11.103  36.977  1.00 65.05 ? 150 GLU C HB3  1  
ATOM 7027   H HG2  . GLU C 1 150 ? -13.235 10.854  34.531  1.00 34.10 ? 150 GLU C HG2  1  
ATOM 7028   H HG3  . GLU C 1 150 ? -14.896 10.977  35.109  1.00 22.50 ? 150 GLU C HG3  1  
ATOM 7029   N N    . GLU C 1 151 ? -14.864 7.993   35.159  1.00 43.11 ? 151 GLU C N    1  
ATOM 7030   C CA   . GLU C 1 151 ? -16.082 7.257   34.765  1.00 13.04 ? 151 GLU C CA   1  
ATOM 7031   C C    . GLU C 1 151 ? -17.351 8.053   35.151  1.00 30.51 ? 151 GLU C C    1  
ATOM 7032   O O    . GLU C 1 151 ? -17.911 7.866   36.244  1.00 1.20  ? 151 GLU C O    1  
ATOM 7033   C CB   . GLU C 1 151 ? -16.090 5.819   35.363  1.00 22.21 ? 151 GLU C CB   1  
ATOM 7034   C CG   . GLU C 1 151 ? -17.333 4.977   35.002  1.00 73.20 ? 151 GLU C CG   1  
ATOM 7035   C CD   . GLU C 1 151 ? -17.368 3.614   35.694  1.00 44.42 ? 151 GLU C CD   1  
ATOM 7036   O OE1  . GLU C 1 151 ? -17.830 3.536   36.847  1.00 34.52 ? 151 GLU C OE1  1  
ATOM 7037   O OE2  . GLU C 1 151 ? -16.919 2.615   35.097  1.00 71.11 ? 151 GLU C OE2  1  
ATOM 7038   H H    . GLU C 1 151 ? -14.238 8.255   34.448  1.00 35.50 ? 151 GLU C H    1  
ATOM 7039   H HA   . GLU C 1 151 ? -16.056 7.173   33.682  1.00 13.33 ? 151 GLU C HA   1  
ATOM 7040   H HB2  . GLU C 1 151 ? -15.209 5.294   35.010  1.00 11.12 ? 151 GLU C HB2  1  
ATOM 7041   H HB3  . GLU C 1 151 ? -16.032 5.895   36.445  1.00 63.12 ? 151 GLU C HB3  1  
ATOM 7042   H HG2  . GLU C 1 151 ? -18.224 5.534   35.280  1.00 62.11 ? 151 GLU C HG2  1  
ATOM 7043   H HG3  . GLU C 1 151 ? -17.347 4.829   33.926  1.00 42.55 ? 151 GLU C HG3  1  
ATOM 7044   N N    . HIS C 1 152 ? -17.768 8.992   34.284  1.00 44.24 ? 152 HIS C N    1  
ATOM 7045   C CA   . HIS C 1 152 ? -18.938 9.855   34.551  1.00 11.55 ? 152 HIS C CA   1  
ATOM 7046   C C    . HIS C 1 152 ? -19.785 10.057  33.286  1.00 75.23 ? 152 HIS C C    1  
ATOM 7047   O O    . HIS C 1 152 ? -19.318 10.623  32.293  1.00 71.51 ? 152 HIS C O    1  
ATOM 7048   C CB   . HIS C 1 152 ? -18.507 11.234  35.135  1.00 32.15 ? 152 HIS C CB   1  
ATOM 7049   C CG   . HIS C 1 152 ? -18.028 11.190  36.567  1.00 15.54 ? 152 HIS C CG   1  
ATOM 7050   N ND1  . HIS C 1 152 ? -16.823 11.708  36.977  1.00 60.04 ? 152 HIS C ND1  1  
ATOM 7051   C CD2  . HIS C 1 152 ? -18.623 10.716  37.688  1.00 52.45 ? 152 HIS C CD2  1  
ATOM 7052   C CE1  . HIS C 1 152 ? -16.693 11.551  38.277  1.00 20.11 ? 152 HIS C CE1  1  
ATOM 7053   N NE2  . HIS C 1 152 ? -17.768 10.955  38.730  1.00 64.22 ? 152 HIS C NE2  1  
ATOM 7054   H H    . HIS C 1 152 ? -17.275 9.111   33.438  1.00 63.51 ? 152 HIS C H    1  
ATOM 7055   H HA   . HIS C 1 152 ? -19.561 9.350   35.293  1.00 53.33 ? 152 HIS C HA   1  
ATOM 7056   H HB2  . HIS C 1 152 ? -17.707 11.639  34.533  1.00 12.04 ? 152 HIS C HB2  1  
ATOM 7057   H HB3  . HIS C 1 152 ? -19.349 11.919  35.100  1.00 14.33 ? 152 HIS C HB3  1  
ATOM 7058   H HD1  . HIS C 1 152 ? -16.162 12.132  36.397  1.00 1.51  ? 152 HIS C HD1  1  
ATOM 7059   H HD2  . HIS C 1 152 ? -19.592 10.234  37.750  1.00 52.11 ? 152 HIS C HD2  1  
ATOM 7060   H HE1  . HIS C 1 152 ? -15.847 11.863  38.871  1.00 53.25 ? 152 HIS C HE1  1  
ATOM 7061   H HE2  . HIS C 1 152 ? -17.942 10.737  39.673  1.00 37.61 ? 152 HIS C HE2  1  
ATOM 7062   N N    . GLN C 1 153 ? -21.033 9.555   33.342  1.00 12.12 ? 153 GLN C N    1  
ATOM 7063   C CA   . GLN C 1 153 ? -22.107 9.876   32.384  1.00 72.24 ? 153 GLN C CA   1  
ATOM 7064   C C    . GLN C 1 153 ? -23.379 10.237  33.175  1.00 64.30 ? 153 GLN C C    1  
ATOM 7065   O O    . GLN C 1 153 ? -23.733 9.542   34.136  1.00 55.54 ? 153 GLN C O    1  
ATOM 7066   C CB   . GLN C 1 153 ? -22.423 8.685   31.430  1.00 24.54 ? 153 GLN C CB   1  
ATOM 7067   C CG   . GLN C 1 153 ? -21.295 8.297   30.457  1.00 74.40 ? 153 GLN C CG   1  
ATOM 7068   C CD   . GLN C 1 153 ? -21.722 7.215   29.456  1.00 22.42 ? 153 GLN C CD   1  
ATOM 7069   O OE1  . GLN C 1 153 ? -22.193 7.519   28.360  1.00 42.15 ? 153 GLN C OE1  1  
ATOM 7070   N NE2  . GLN C 1 153 ? -21.606 5.950   29.837  1.00 2.21  ? 153 GLN C NE2  1  
ATOM 7071   H H    . GLN C 1 153 ? -21.242 8.927   34.064  1.00 1.54  ? 153 GLN C H    1  
ATOM 7072   H HA   . GLN C 1 153 ? -21.802 10.736  31.794  1.00 42.33 ? 153 GLN C HA   1  
ATOM 7073   H HB2  . GLN C 1 153 ? -22.657 7.815   32.034  1.00 25.35 ? 153 GLN C HB2  1  
ATOM 7074   H HB3  . GLN C 1 153 ? -23.300 8.937   30.843  1.00 12.22 ? 153 GLN C HB3  1  
ATOM 7075   H HG2  . GLN C 1 153 ? -20.991 9.179   29.902  1.00 5.00  ? 153 GLN C HG2  1  
ATOM 7076   H HG3  . GLN C 1 153 ? -20.450 7.931   31.030  1.00 75.35 ? 153 GLN C HG3  1  
ATOM 7077   H HE21 . GLN C 1 153 ? -21.261 5.764   30.739  1.00 41.21 ? 153 GLN C HE21 1  
ATOM 7078   H HE22 . GLN C 1 153 ? -21.870 5.253   29.206  1.00 31.21 ? 153 GLN C HE22 1  
ATOM 7079   N N    . ASP C 1 154 ? -24.060 11.315  32.761  1.00 14.50 ? 154 ASP C N    1  
ATOM 7080   C CA   . ASP C 1 154 ? -25.344 11.755  33.346  1.00 62.23 ? 154 ASP C CA   1  
ATOM 7081   C C    . ASP C 1 154 ? -26.257 12.289  32.232  1.00 35.20 ? 154 ASP C C    1  
ATOM 7082   O O    . ASP C 1 154 ? -25.779 12.658  31.149  1.00 53.43 ? 154 ASP C O    1  
ATOM 7083   C CB   . ASP C 1 154 ? -25.120 12.824  34.459  1.00 64.00 ? 154 ASP C CB   1  
ATOM 7084   C CG   . ASP C 1 154 ? -24.380 14.081  33.972  1.00 54.42 ? 154 ASP C CG   1  
ATOM 7085   O OD1  . ASP C 1 154 ? -25.034 15.099  33.663  1.00 24.43 ? 154 ASP C OD1  1  
ATOM 7086   O OD2  . ASP C 1 154 ? -23.134 14.046  33.881  1.00 30.35 ? 154 ASP C OD2  1  
ATOM 7087   H H    . ASP C 1 154 ? -23.687 11.848  32.025  1.00 34.34 ? 154 ASP C H    1  
ATOM 7088   H HA   . ASP C 1 154 ? -25.826 10.886  33.787  1.00 63.12 ? 154 ASP C HA   1  
ATOM 7089   H HB2  . ASP C 1 154 ? -26.082 13.120  34.868  1.00 61.22 ? 154 ASP C HB2  1  
ATOM 7090   H HB3  . ASP C 1 154 ? -24.541 12.370  35.260  1.00 43.01 ? 154 ASP C HB3  1  
ATOM 7091   N N    . ALA C 1 155 ? -27.564 12.318  32.503  1.00 51.13 ? 155 ALA C N    1  
ATOM 7092   C CA   . ALA C 1 155 ? -28.582 12.738  31.531  1.00 44.14 ? 155 ALA C CA   1  
ATOM 7093   C C    . ALA C 1 155 ? -29.741 13.434  32.285  1.00 61.50 ? 155 ALA C C    1  
ATOM 7094   O O    . ALA C 1 155 ? -29.656 14.656  32.509  1.00 50.51 ? 155 ALA C O    1  
ATOM 7095   C CB   . ALA C 1 155 ? -29.052 11.522  30.694  1.00 31.34 ? 155 ALA C CB   1  
ATOM 7096   O OXT  . ALA C 1 155 ? -30.710 12.757  32.683  1.00 37.61 ? 155 ALA C OXT  1  
ATOM 7097   H H    . ALA C 1 155 ? -27.862 12.055  33.399  1.00 21.53 ? 155 ALA C H    1  
ATOM 7098   H HA   . ALA C 1 155 ? -28.128 13.459  30.847  1.00 14.54 ? 155 ALA C HA   1  
ATOM 7099   H HB1  . ALA C 1 155 ? -28.202 11.075  30.197  1.00 24.24 ? 155 ALA C HB1  1  
ATOM 7100   H HB2  . ALA C 1 155 ? -29.770 11.842  29.950  1.00 4.10  ? 155 ALA C HB2  1  
ATOM 7101   H HB3  . ALA C 1 155 ? -29.513 10.787  31.342  1.00 61.33 ? 155 ALA C HB3  1  
ATOM 7102   N N    . MET D 1 1   ? 0.748   -19.848 -19.569 1.00 10.22 ? 1   MET D N    1  
ATOM 7103   C CA   . MET D 1 1   ? -0.647  -19.969 -19.100 1.00 70.55 ? 1   MET D CA   1  
ATOM 7104   C C    . MET D 1 1   ? -1.178  -21.394 -19.313 1.00 45.33 ? 1   MET D C    1  
ATOM 7105   O O    . MET D 1 1   ? -2.101  -21.815 -18.616 1.00 52.45 ? 1   MET D O    1  
ATOM 7106   C CB   . MET D 1 1   ? -1.581  -18.958 -19.824 1.00 72.41 ? 1   MET D CB   1  
ATOM 7107   C CG   . MET D 1 1   ? -1.196  -17.482 -19.656 1.00 1.41  ? 1   MET D CG   1  
ATOM 7108   S SD   . MET D 1 1   ? 0.340   -17.062 -20.510 1.00 70.01 ? 1   MET D SD   1  
ATOM 7109   C CE   . MET D 1 1   ? 0.554   -15.340 -20.050 1.00 31.15 ? 1   MET D CE   1  
ATOM 7110   H H1   . MET D 1 1   ? 0.798   -20.031 -20.586 1.00 37.61 ? 1   MET D H1   1  
ATOM 7111   H H2   . MET D 1 1   ? 1.355   -20.538 -19.077 1.00 37.61 ? 1   MET D H2   1  
ATOM 7112   H H3   . MET D 1 1   ? 1.110   -18.895 -19.380 1.00 37.61 ? 1   MET D H3   1  
ATOM 7113   H HA   . MET D 1 1   ? -0.649  -19.752 -18.037 1.00 43.53 ? 1   MET D HA   1  
ATOM 7114   H HB2  . MET D 1 1   ? -1.583  -19.183 -20.885 1.00 12.43 ? 1   MET D HB2  1  
ATOM 7115   H HB3  . MET D 1 1   ? -2.590  -19.087 -19.443 1.00 14.45 ? 1   MET D HB3  1  
ATOM 7116   H HG2  . MET D 1 1   ? -1.991  -16.863 -20.055 1.00 34.11 ? 1   MET D HG2  1  
ATOM 7117   H HG3  . MET D 1 1   ? -1.078  -17.270 -18.600 1.00 41.22 ? 1   MET D HG3  1  
ATOM 7118   H HE1  . MET D 1 1   ? 1.438   -14.946 -20.528 1.00 41.02 ? 1   MET D HE1  1  
ATOM 7119   H HE2  . MET D 1 1   ? 0.664   -15.264 -18.977 1.00 75.24 ? 1   MET D HE2  1  
ATOM 7120   H HE3  . MET D 1 1   ? -0.310  -14.771 -20.365 1.00 41.43 ? 1   MET D HE3  1  
ATOM 7121   N N    . SER D 1 2   ? -0.604  -22.133 -20.279 1.00 25.30 ? 2   SER D N    1  
ATOM 7122   C CA   . SER D 1 2   ? -1.093  -23.474 -20.661 1.00 52.50 ? 2   SER D CA   1  
ATOM 7123   C C    . SER D 1 2   ? 0.086   -24.388 -21.028 1.00 64.00 ? 2   SER D C    1  
ATOM 7124   O O    . SER D 1 2   ? 1.231   -23.925 -21.124 1.00 2.23  ? 2   SER D O    1  
ATOM 7125   C CB   . SER D 1 2   ? -2.080  -23.364 -21.859 1.00 45.23 ? 2   SER D CB   1  
ATOM 7126   O OG   . SER D 1 2   ? -3.171  -22.496 -21.568 1.00 55.52 ? 2   SER D OG   1  
ATOM 7127   H H    . SER D 1 2   ? 0.187   -21.781 -20.746 1.00 5.12  ? 2   SER D H    1  
ATOM 7128   H HA   . SER D 1 2   ? -1.612  -23.908 -19.811 1.00 62.04 ? 2   SER D HA   1  
ATOM 7129   H HB2  . SER D 1 2   ? -1.559  -22.975 -22.725 1.00 51.40 ? 2   SER D HB2  1  
ATOM 7130   H HB3  . SER D 1 2   ? -2.478  -24.344 -22.096 1.00 64.03 ? 2   SER D HB3  1  
ATOM 7131   H HG   . SER D 1 2   ? -2.988  -21.623 -21.926 1.00 71.31 ? 2   SER D HG   1  
ATOM 7132   N N    . GLU D 1 3   ? -0.221  -25.691 -21.204 1.00 20.31 ? 3   GLU D N    1  
ATOM 7133   C CA   . GLU D 1 3   ? 0.721   -26.709 -21.705 1.00 33.22 ? 3   GLU D CA   1  
ATOM 7134   C C    . GLU D 1 3   ? -0.055  -27.944 -22.201 1.00 51.25 ? 3   GLU D C    1  
ATOM 7135   O O    . GLU D 1 3   ? -1.299  -27.925 -22.243 1.00 52.42 ? 3   GLU D O    1  
ATOM 7136   C CB   . GLU D 1 3   ? 1.787   -27.075 -20.627 1.00 2.42  ? 3   GLU D CB   1  
ATOM 7137   C CG   . GLU D 1 3   ? 1.247   -27.605 -19.280 1.00 2.25  ? 3   GLU D CG   1  
ATOM 7138   C CD   . GLU D 1 3   ? 2.363   -27.789 -18.224 1.00 20.40 ? 3   GLU D CD   1  
ATOM 7139   O OE1  . GLU D 1 3   ? 2.768   -28.939 -17.942 1.00 12.40 ? 3   GLU D OE1  1  
ATOM 7140   O OE2  . GLU D 1 3   ? 2.875   -26.765 -17.712 1.00 10.44 ? 3   GLU D OE2  1  
ATOM 7141   H H    . GLU D 1 3   ? -1.127  -25.986 -20.980 1.00 25.40 ? 3   GLU D H    1  
ATOM 7142   H HA   . GLU D 1 3   ? 1.230   -26.281 -22.567 1.00 65.41 ? 3   GLU D HA   1  
ATOM 7143   H HB2  . GLU D 1 3   ? 2.457   -27.819 -21.039 1.00 20.12 ? 3   GLU D HB2  1  
ATOM 7144   H HB3  . GLU D 1 3   ? 2.366   -26.179 -20.422 1.00 3.13  ? 3   GLU D HB3  1  
ATOM 7145   H HG2  . GLU D 1 3   ? 0.514   -26.901 -18.896 1.00 61.10 ? 3   GLU D HG2  1  
ATOM 7146   H HG3  . GLU D 1 3   ? 0.758   -28.557 -19.452 1.00 25.41 ? 3   GLU D HG3  1  
ATOM 7147   N N    . GLN D 1 4   ? 0.691   -29.001 -22.584 1.00 12.11 ? 4   GLN D N    1  
ATOM 7148   C CA   . GLN D 1 4   ? 0.139   -30.226 -23.192 1.00 52.15 ? 4   GLN D CA   1  
ATOM 7149   C C    . GLN D 1 4   ? -0.651  -31.045 -22.148 1.00 4.32  ? 4   GLN D C    1  
ATOM 7150   O O    . GLN D 1 4   ? -0.107  -31.936 -21.481 1.00 33.44 ? 4   GLN D O    1  
ATOM 7151   C CB   . GLN D 1 4   ? 1.276   -31.088 -23.844 1.00 31.31 ? 4   GLN D CB   1  
ATOM 7152   C CG   . GLN D 1 4   ? 1.967   -30.458 -25.085 1.00 63.43 ? 4   GLN D CG   1  
ATOM 7153   C CD   . GLN D 1 4   ? 2.823   -29.210 -24.810 1.00 41.24 ? 4   GLN D CD   1  
ATOM 7154   O OE1  . GLN D 1 4   ? 3.396   -29.043 -23.730 1.00 32.43 ? 4   GLN D OE1  1  
ATOM 7155   N NE2  . GLN D 1 4   ? 2.915   -28.326 -25.791 1.00 62.02 ? 4   GLN D NE2  1  
ATOM 7156   H H    . GLN D 1 4   ? 1.657   -28.958 -22.441 1.00 72.22 ? 4   GLN D H    1  
ATOM 7157   H HA   . GLN D 1 4   ? -0.548  -29.922 -23.977 1.00 23.11 ? 4   GLN D HA   1  
ATOM 7158   H HB2  . GLN D 1 4   ? 2.038   -31.280 -23.096 1.00 73.41 ? 4   GLN D HB2  1  
ATOM 7159   H HB3  . GLN D 1 4   ? 0.853   -32.043 -24.148 1.00 1.42  ? 4   GLN D HB3  1  
ATOM 7160   H HG2  . GLN D 1 4   ? 2.620   -31.203 -25.529 1.00 30.33 ? 4   GLN D HG2  1  
ATOM 7161   H HG3  . GLN D 1 4   ? 1.201   -30.202 -25.806 1.00 65.55 ? 4   GLN D HG3  1  
ATOM 7162   H HE21 . GLN D 1 4   ? 2.446   -28.514 -26.631 1.00 2.24  ? 4   GLN D HE21 1  
ATOM 7163   H HE22 . GLN D 1 4   ? 3.446   -27.523 -25.639 1.00 21.05 ? 4   GLN D HE22 1  
ATOM 7164   N N    . ASN D 1 5   ? -1.934  -30.686 -21.982 1.00 32.13 ? 5   ASN D N    1  
ATOM 7165   C CA   . ASN D 1 5   ? -2.866  -31.403 -21.100 1.00 63.22 ? 5   ASN D CA   1  
ATOM 7166   C C    . ASN D 1 5   ? -3.487  -32.582 -21.876 1.00 62.40 ? 5   ASN D C    1  
ATOM 7167   O O    . ASN D 1 5   ? -4.535  -32.447 -22.520 1.00 13.33 ? 5   ASN D O    1  
ATOM 7168   C CB   . ASN D 1 5   ? -3.955  -30.436 -20.546 1.00 3.03  ? 5   ASN D CB   1  
ATOM 7169   C CG   . ASN D 1 5   ? -4.927  -31.097 -19.550 1.00 40.13 ? 5   ASN D CG   1  
ATOM 7170   O OD1  . ASN D 1 5   ? -4.565  -32.031 -18.832 1.00 63.10 ? 5   ASN D OD1  1  
ATOM 7171   N ND2  . ASN D 1 5   ? -6.163  -30.616 -19.496 1.00 51.31 ? 5   ASN D ND2  1  
ATOM 7172   H H    . ASN D 1 5   ? -2.262  -29.905 -22.474 1.00 62.44 ? 5   ASN D H    1  
ATOM 7173   H HA   . ASN D 1 5   ? -2.299  -31.801 -20.261 1.00 73.51 ? 5   ASN D HA   1  
ATOM 7174   H HB2  . ASN D 1 5   ? -3.469  -29.614 -20.037 1.00 11.35 ? 5   ASN D HB2  1  
ATOM 7175   H HB3  . ASN D 1 5   ? -4.527  -30.038 -21.378 1.00 42.33 ? 5   ASN D HB3  1  
ATOM 7176   H HD21 . ASN D 1 5   ? -6.398  -29.868 -20.087 1.00 44.01 ? 5   ASN D HD21 1  
ATOM 7177   H HD22 . ASN D 1 5   ? -6.795  -31.031 -18.873 1.00 2.42  ? 5   ASN D HD22 1  
ATOM 7178   N N    . ASN D 1 6   ? -2.765  -33.711 -21.872 1.00 13.41 ? 6   ASN D N    1  
ATOM 7179   C CA   . ASN D 1 6   ? -3.203  -34.984 -22.495 1.00 13.34 ? 6   ASN D CA   1  
ATOM 7180   C C    . ASN D 1 6   ? -3.082  -36.133 -21.471 1.00 75.14 ? 6   ASN D C    1  
ATOM 7181   O O    . ASN D 1 6   ? -3.023  -37.314 -21.831 1.00 61.45 ? 6   ASN D O    1  
ATOM 7182   C CB   . ASN D 1 6   ? -2.357  -35.286 -23.767 1.00 74.41 ? 6   ASN D CB   1  
ATOM 7183   C CG   . ASN D 1 6   ? -0.869  -35.535 -23.479 1.00 43.44 ? 6   ASN D CG   1  
ATOM 7184   O OD1  . ASN D 1 6   ? -0.268  -34.878 -22.630 1.00 23.44 ? 6   ASN D OD1  1  
ATOM 7185   N ND2  . ASN D 1 6   ? -0.269  -36.499 -24.167 1.00 45.41 ? 6   ASN D ND2  1  
ATOM 7186   H H    . ASN D 1 6   ? -1.884  -33.692 -21.440 1.00 33.14 ? 6   ASN D H    1  
ATOM 7187   H HA   . ASN D 1 6   ? -4.253  -34.891 -22.775 1.00 44.22 ? 6   ASN D HA   1  
ATOM 7188   H HB2  . ASN D 1 6   ? -2.764  -36.161 -24.261 1.00 22.22 ? 6   ASN D HB2  1  
ATOM 7189   H HB3  . ASN D 1 6   ? -2.430  -34.444 -24.443 1.00 54.32 ? 6   ASN D HB3  1  
ATOM 7190   H HD21 . ASN D 1 6   ? -0.798  -37.004 -24.823 1.00 55.31 ? 6   ASN D HD21 1  
ATOM 7191   H HD22 . ASN D 1 6   ? 0.676   -36.679 -23.983 1.00 61.44 ? 6   ASN D HD22 1  
ATOM 7192   N N    . THR D 1 7   ? -3.103  -35.764 -20.186 1.00 55.25 ? 7   THR D N    1  
ATOM 7193   C CA   . THR D 1 7   ? -2.885  -36.677 -19.062 1.00 41.22 ? 7   THR D CA   1  
ATOM 7194   C C    . THR D 1 7   ? -3.814  -36.260 -17.901 1.00 73.43 ? 7   THR D C    1  
ATOM 7195   O O    . THR D 1 7   ? -4.687  -35.397 -18.083 1.00 64.30 ? 7   THR D O    1  
ATOM 7196   C CB   . THR D 1 7   ? -1.361  -36.674 -18.653 1.00 60.24 ? 7   THR D CB   1  
ATOM 7197   O OG1  . THR D 1 7   ? -1.107  -37.641 -17.620 1.00 53.44 ? 7   THR D OG1  1  
ATOM 7198   C CG2  . THR D 1 7   ? -0.876  -35.276 -18.202 1.00 53.12 ? 7   THR D CG2  1  
ATOM 7199   H H    . THR D 1 7   ? -3.296  -34.824 -19.979 1.00 51.20 ? 7   THR D H    1  
ATOM 7200   H HA   . THR D 1 7   ? -3.160  -37.684 -19.370 1.00 15.44 ? 7   THR D HA   1  
ATOM 7201   H HB   . THR D 1 7   ? -0.784  -36.964 -19.525 1.00 53.42 ? 7   THR D HB   1  
ATOM 7202   H HG1  . THR D 1 7   ? -0.295  -37.411 -17.149 1.00 63.24 ? 7   THR D HG1  1  
ATOM 7203   H HG21 . THR D 1 7   ? -1.440  -34.956 -17.335 1.00 15.03 ? 7   THR D HG21 1  
ATOM 7204   H HG22 . THR D 1 7   ? -1.022  -34.562 -19.003 1.00 4.45  ? 7   THR D HG22 1  
ATOM 7205   H HG23 . THR D 1 7   ? 0.177   -35.315 -17.949 1.00 64.31 ? 7   THR D HG23 1  
ATOM 7206   N N    . GLU D 1 8   ? -3.627  -36.863 -16.715 1.00 14.51 ? 8   GLU D N    1  
ATOM 7207   C CA   . GLU D 1 8   ? -4.407  -36.537 -15.498 1.00 33.14 ? 8   GLU D CA   1  
ATOM 7208   C C    . GLU D 1 8   ? -3.834  -35.301 -14.763 1.00 22.41 ? 8   GLU D C    1  
ATOM 7209   O O    . GLU D 1 8   ? -4.014  -35.182 -13.541 1.00 44.41 ? 8   GLU D O    1  
ATOM 7210   C CB   . GLU D 1 8   ? -4.408  -37.763 -14.554 1.00 51.42 ? 8   GLU D CB   1  
ATOM 7211   C CG   . GLU D 1 8   ? -4.974  -39.053 -15.168 1.00 35.21 ? 8   GLU D CG   1  
ATOM 7212   C CD   . GLU D 1 8   ? -4.948  -40.206 -14.164 1.00 3.11  ? 8   GLU D CD   1  
ATOM 7213   O OE1  . GLU D 1 8   ? -3.973  -40.982 -14.145 1.00 53.01 ? 8   GLU D OE1  1  
ATOM 7214   O OE2  . GLU D 1 8   ? -5.882  -40.306 -13.345 1.00 32.03 ? 8   GLU D OE2  1  
ATOM 7215   H H    . GLU D 1 8   ? -2.939  -37.559 -16.649 1.00 62.44 ? 8   GLU D H    1  
ATOM 7216   H HA   . GLU D 1 8   ? -5.430  -36.319 -15.791 1.00 54.22 ? 8   GLU D HA   1  
ATOM 7217   H HB2  . GLU D 1 8   ? -3.389  -37.961 -14.238 1.00 64.11 ? 8   GLU D HB2  1  
ATOM 7218   H HB3  . GLU D 1 8   ? -4.999  -37.526 -13.674 1.00 63.04 ? 8   GLU D HB3  1  
ATOM 7219   H HG2  . GLU D 1 8   ? -6.000  -38.874 -15.482 1.00 65.54 ? 8   GLU D HG2  1  
ATOM 7220   H HG3  . GLU D 1 8   ? -4.382  -39.320 -16.038 1.00 12.43 ? 8   GLU D HG3  1  
ATOM 7221   N N    . MET D 1 9   ? -3.124  -34.423 -15.522 1.00 22.44 ? 9   MET D N    1  
ATOM 7222   C CA   . MET D 1 9   ? -2.548  -33.135 -15.058 1.00 22.13 ? 9   MET D CA   1  
ATOM 7223   C C    . MET D 1 9   ? -3.361  -32.475 -13.924 1.00 70.03 ? 9   MET D C    1  
ATOM 7224   O O    . MET D 1 9   ? -4.560  -32.205 -14.072 1.00 50.13 ? 9   MET D O    1  
ATOM 7225   C CB   . MET D 1 9   ? -2.407  -32.151 -16.260 1.00 43.44 ? 9   MET D CB   1  
ATOM 7226   C CG   . MET D 1 9   ? -1.883  -30.746 -15.896 1.00 75.11 ? 9   MET D CG   1  
ATOM 7227   S SD   . MET D 1 9   ? -0.279  -30.813 -15.074 1.00 64.34 ? 9   MET D SD   1  
ATOM 7228   C CE   . MET D 1 9   ? 0.075   -29.081 -14.770 1.00 33.42 ? 9   MET D CE   1  
ATOM 7229   H H    . MET D 1 9   ? -2.983  -34.655 -16.454 1.00 12.24 ? 9   MET D H    1  
ATOM 7230   H HA   . MET D 1 9   ? -1.552  -33.361 -14.683 1.00 1.22  ? 9   MET D HA   1  
ATOM 7231   H HB2  . MET D 1 9   ? -1.722  -32.582 -16.982 1.00 5.13  ? 9   MET D HB2  1  
ATOM 7232   H HB3  . MET D 1 9   ? -3.378  -32.038 -16.734 1.00 23.44 ? 9   MET D HB3  1  
ATOM 7233   H HG2  . MET D 1 9   ? -1.784  -30.155 -16.802 1.00 52.10 ? 9   MET D HG2  1  
ATOM 7234   H HG3  . MET D 1 9   ? -2.592  -30.265 -15.234 1.00 45.21 ? 9   MET D HG3  1  
ATOM 7235   H HE1  . MET D 1 9   ? -0.680  -28.664 -14.118 1.00 63.13 ? 9   MET D HE1  1  
ATOM 7236   H HE2  . MET D 1 9   ? 0.082   -28.542 -15.706 1.00 22.12 ? 9   MET D HE2  1  
ATOM 7237   H HE3  . MET D 1 9   ? 1.044   -28.993 -14.297 1.00 13.24 ? 9   MET D HE3  1  
ATOM 7238   N N    . THR D 1 10  ? -2.685  -32.214 -12.809 1.00 72.23 ? 10  THR D N    1  
ATOM 7239   C CA   . THR D 1 10  ? -3.269  -31.599 -11.624 1.00 15.12 ? 10  THR D CA   1  
ATOM 7240   C C    . THR D 1 10  ? -2.461  -30.353 -11.292 1.00 40.00 ? 10  THR D C    1  
ATOM 7241   O O    . THR D 1 10  ? -1.230  -30.342 -11.450 1.00 60.43 ? 10  THR D O    1  
ATOM 7242   C CB   . THR D 1 10  ? -3.275  -32.585 -10.408 1.00 65.24 ? 10  THR D CB   1  
ATOM 7243   O OG1  . THR D 1 10  ? -3.978  -33.791 -10.765 1.00 35.33 ? 10  THR D OG1  1  
ATOM 7244   C CG2  . THR D 1 10  ? -3.927  -31.965 -9.154  1.00 5.24  ? 10  THR D CG2  1  
ATOM 7245   H H    . THR D 1 10  ? -1.732  -32.431 -12.786 1.00 63.04 ? 10  THR D H    1  
ATOM 7246   H HA   . THR D 1 10  ? -4.300  -31.315 -11.842 1.00 23.40 ? 10  THR D HA   1  
ATOM 7247   H HB   . THR D 1 10  ? -2.248  -32.848 -10.170 1.00 73.22 ? 10  THR D HB   1  
ATOM 7248   H HG1  . THR D 1 10  ? -4.218  -33.760 -11.703 1.00 40.02 ? 10  THR D HG1  1  
ATOM 7249   H HG21 . THR D 1 10  ? -3.385  -31.070 -8.862  1.00 64.43 ? 10  THR D HG21 1  
ATOM 7250   H HG22 . THR D 1 10  ? -3.897  -32.670 -8.345  1.00 54.22 ? 10  THR D HG22 1  
ATOM 7251   H HG23 . THR D 1 10  ? -4.956  -31.705 -9.364  1.00 65.33 ? 10  THR D HG23 1  
ATOM 7252   N N    . PHE D 1 11  ? -3.166  -29.314 -10.849 1.00 5.04  ? 11  PHE D N    1  
ATOM 7253   C CA   . PHE D 1 11  ? -2.576  -28.022 -10.532 1.00 5.32  ? 11  PHE D CA   1  
ATOM 7254   C C    . PHE D 1 11  ? -3.600  -27.232 -9.711  1.00 52.52 ? 11  PHE D C    1  
ATOM 7255   O O    . PHE D 1 11  ? -4.473  -26.555 -10.263 1.00 44.54 ? 11  PHE D O    1  
ATOM 7256   C CB   . PHE D 1 11  ? -2.168  -27.265 -11.830 1.00 31.42 ? 11  PHE D CB   1  
ATOM 7257   C CG   . PHE D 1 11  ? -1.210  -26.092 -11.614 1.00 35.03 ? 11  PHE D CG   1  
ATOM 7258   C CD1  . PHE D 1 11  ? -1.669  -24.845 -11.174 1.00 31.52 ? 11  PHE D CD1  1  
ATOM 7259   C CD2  . PHE D 1 11  ? 0.152   -26.231 -11.883 1.00 63.41 ? 11  PHE D CD2  1  
ATOM 7260   C CE1  . PHE D 1 11  ? -0.795  -23.785 -11.015 1.00 23.43 ? 11  PHE D CE1  1  
ATOM 7261   C CE2  . PHE D 1 11  ? 1.021   -25.174 -11.718 1.00 10.12 ? 11  PHE D CE2  1  
ATOM 7262   C CZ   . PHE D 1 11  ? 0.549   -23.952 -11.289 1.00 3.52  ? 11  PHE D CZ   1  
ATOM 7263   H H    . PHE D 1 11  ? -4.131  -29.433 -10.710 1.00 20.41 ? 11  PHE D H    1  
ATOM 7264   H HA   . PHE D 1 11  ? -1.690  -28.196 -9.919  1.00 14.45 ? 11  PHE D HA   1  
ATOM 7265   H HB2  . PHE D 1 11  ? -1.687  -27.970 -12.502 1.00 54.24 ? 11  PHE D HB2  1  
ATOM 7266   H HB3  . PHE D 1 11  ? -3.059  -26.888 -12.322 1.00 43.25 ? 11  PHE D HB3  1  
ATOM 7267   H HD1  . PHE D 1 11  ? -2.721  -24.711 -10.957 1.00 52.20 ? 11  PHE D HD1  1  
ATOM 7268   H HD2  . PHE D 1 11  ? 0.533   -27.189 -12.220 1.00 25.10 ? 11  PHE D HD2  1  
ATOM 7269   H HE1  . PHE D 1 11  ? -1.162  -22.827 -10.672 1.00 43.14 ? 11  PHE D HE1  1  
ATOM 7270   H HE2  . PHE D 1 11  ? 2.073   -25.302 -11.933 1.00 25.52 ? 11  PHE D HE2  1  
ATOM 7271   H HZ   . PHE D 1 11  ? 1.231   -23.126 -11.175 1.00 20.42 ? 11  PHE D HZ   1  
ATOM 7272   N N    . GLN D 1 12  ? -3.520  -27.381 -8.391  1.00 71.52 ? 12  GLN D N    1  
ATOM 7273   C CA   . GLN D 1 12  ? -4.375  -26.665 -7.442  1.00 2.24  ? 12  GLN D CA   1  
ATOM 7274   C C    . GLN D 1 12  ? -3.482  -25.717 -6.663  1.00 2.21  ? 12  GLN D C    1  
ATOM 7275   O O    . GLN D 1 12  ? -2.564  -26.169 -5.970  1.00 64.23 ? 12  GLN D O    1  
ATOM 7276   C CB   . GLN D 1 12  ? -5.073  -27.658 -6.478  1.00 35.11 ? 12  GLN D CB   1  
ATOM 7277   C CG   . GLN D 1 12  ? -5.998  -28.672 -7.169  1.00 22.04 ? 12  GLN D CG   1  
ATOM 7278   C CD   . GLN D 1 12  ? -6.612  -29.666 -6.189  1.00 24.03 ? 12  GLN D CD   1  
ATOM 7279   O OE1  . GLN D 1 12  ? -7.675  -29.433 -5.622  1.00 4.15  ? 12  GLN D OE1  1  
ATOM 7280   N NE2  . GLN D 1 12  ? -5.933  -30.775 -5.960  1.00 43.30 ? 12  GLN D NE2  1  
ATOM 7281   H H    . GLN D 1 12  ? -2.848  -27.992 -8.031  1.00 31.20 ? 12  GLN D H    1  
ATOM 7282   H HA   . GLN D 1 12  ? -5.129  -26.098 -7.987  1.00 62.14 ? 12  GLN D HA   1  
ATOM 7283   H HB2  . GLN D 1 12  ? -4.311  -28.210 -5.933  1.00 61.15 ? 12  GLN D HB2  1  
ATOM 7284   H HB3  . GLN D 1 12  ? -5.664  -27.094 -5.763  1.00 1.14  ? 12  GLN D HB3  1  
ATOM 7285   H HG2  . GLN D 1 12  ? -6.799  -28.134 -7.667  1.00 24.01 ? 12  GLN D HG2  1  
ATOM 7286   H HG3  . GLN D 1 12  ? -5.425  -29.217 -7.911  1.00 14.25 ? 12  GLN D HG3  1  
ATOM 7287   H HE21 . GLN D 1 12  ? -5.077  -30.902 -6.424  1.00 74.33 ? 12  GLN D HE21 1  
ATOM 7288   H HE22 . GLN D 1 12  ? -6.314  -31.429 -5.340  1.00 22.33 ? 12  GLN D HE22 1  
ATOM 7289   N N    . ILE D 1 13  ? -3.719  -24.409 -6.810  1.00 61.34 ? 13  ILE D N    1  
ATOM 7290   C CA   . ILE D 1 13  ? -2.928  -23.408 -6.109  1.00 52.51 ? 13  ILE D CA   1  
ATOM 7291   C C    . ILE D 1 13  ? -3.233  -23.480 -4.608  1.00 14.21 ? 13  ILE D C    1  
ATOM 7292   O O    . ILE D 1 13  ? -4.396  -23.363 -4.197  1.00 25.35 ? 13  ILE D O    1  
ATOM 7293   C CB   . ILE D 1 13  ? -3.190  -21.949 -6.608  1.00 30.30 ? 13  ILE D CB   1  
ATOM 7294   C CG1  . ILE D 1 13  ? -2.955  -21.814 -8.151  1.00 25.14 ? 13  ILE D CG1  1  
ATOM 7295   C CG2  . ILE D 1 13  ? -2.301  -20.968 -5.818  1.00 54.24 ? 13  ILE D CG2  1  
ATOM 7296   C CD1  . ILE D 1 13  ? -2.985  -20.383 -8.682  1.00 21.33 ? 13  ILE D CD1  1  
ATOM 7297   H H    . ILE D 1 13  ? -4.451  -24.117 -7.390  1.00 44.14 ? 13  ILE D H    1  
ATOM 7298   H HA   . ILE D 1 13  ? -1.874  -23.641 -6.278  1.00 3.14  ? 13  ILE D HA   1  
ATOM 7299   H HB   . ILE D 1 13  ? -4.227  -21.700 -6.391  1.00 43.54 ? 13  ILE D HB   1  
ATOM 7300   H HG12 . ILE D 1 13  ? -1.991  -22.228 -8.406  1.00 51.51 ? 13  ILE D HG12 1  
ATOM 7301   H HG13 . ILE D 1 13  ? -3.723  -22.369 -8.677  1.00 31.20 ? 13  ILE D HG13 1  
ATOM 7302   H HG21 . ILE D 1 13  ? -2.502  -19.957 -6.131  1.00 34.14 ? 13  ILE D HG21 1  
ATOM 7303   H HG22 . ILE D 1 13  ? -1.256  -21.190 -5.998  1.00 62.03 ? 13  ILE D HG22 1  
ATOM 7304   H HG23 . ILE D 1 13  ? -2.500  -21.051 -4.755  1.00 2.11  ? 13  ILE D HG23 1  
ATOM 7305   H HD11 . ILE D 1 13  ? -2.036  -19.907 -8.482  1.00 34.41 ? 13  ILE D HD11 1  
ATOM 7306   H HD12 . ILE D 1 13  ? -3.769  -19.821 -8.189  1.00 4.40  ? 13  ILE D HD12 1  
ATOM 7307   H HD13 . ILE D 1 13  ? -3.165  -20.396 -9.746  1.00 1.25  ? 13  ILE D HD13 1  
ATOM 7308   N N    . GLN D 1 14  ? -2.184  -23.684 -3.814  1.00 1.13  ? 14  GLN D N    1  
ATOM 7309   C CA   . GLN D 1 14  ? -2.275  -23.680 -2.355  1.00 25.45 ? 14  GLN D CA   1  
ATOM 7310   C C    . GLN D 1 14  ? -2.215  -22.236 -1.837  1.00 31.04 ? 14  GLN D C    1  
ATOM 7311   O O    . GLN D 1 14  ? -3.061  -21.828 -1.028  1.00 45.43 ? 14  GLN D O    1  
ATOM 7312   C CB   . GLN D 1 14  ? -1.117  -24.515 -1.751  1.00 13.02 ? 14  GLN D CB   1  
ATOM 7313   C CG   . GLN D 1 14  ? -1.150  -26.036 -2.048  1.00 5.11  ? 14  GLN D CG   1  
ATOM 7314   C CD   . GLN D 1 14  ? -2.151  -26.822 -1.184  1.00 53.02 ? 14  GLN D CD   1  
ATOM 7315   O OE1  . GLN D 1 14  ? -3.196  -26.311 -0.785  1.00 15.35 ? 14  GLN D OE1  1  
ATOM 7316   N NE2  . GLN D 1 14  ? -1.827  -28.075 -0.879  1.00 30.24 ? 14  GLN D NE2  1  
ATOM 7317   H H    . GLN D 1 14  ? -1.308  -23.832 -4.227  1.00 73.52 ? 14  GLN D H    1  
ATOM 7318   H HA   . GLN D 1 14  ? -3.224  -24.127 -2.063  1.00 53.02 ? 14  GLN D HA   1  
ATOM 7319   H HB2  . GLN D 1 14  ? -0.180  -24.124 -2.136  1.00 21.44 ? 14  GLN D HB2  1  
ATOM 7320   H HB3  . GLN D 1 14  ? -1.113  -24.385 -0.673  1.00 10.21 ? 14  GLN D HB3  1  
ATOM 7321   H HG2  . GLN D 1 14  ? -1.418  -26.181 -3.087  1.00 15.33 ? 14  GLN D HG2  1  
ATOM 7322   H HG3  . GLN D 1 14  ? -0.157  -26.443 -1.885  1.00 44.14 ? 14  GLN D HG3  1  
ATOM 7323   H HE21 . GLN D 1 14  ? -0.985  -28.433 -1.228  1.00 32.04 ? 14  GLN D HE21 1  
ATOM 7324   H HE22 . GLN D 1 14  ? -2.443  -28.588 -0.316  1.00 0.32  ? 14  GLN D HE22 1  
ATOM 7325   N N    . ARG D 1 15  ? -1.245  -21.439 -2.364  1.00 34.51 ? 15  ARG D N    1  
ATOM 7326   C CA   . ARG D 1 15  ? -0.864  -20.154 -1.728  1.00 61.50 ? 15  ARG D CA   1  
ATOM 7327   C C    . ARG D 1 15  ? 0.230   -19.420 -2.534  1.00 30.34 ? 15  ARG D C    1  
ATOM 7328   O O    . ARG D 1 15  ? 1.129   -20.060 -3.061  1.00 75.20 ? 15  ARG D O    1  
ATOM 7329   C CB   . ARG D 1 15  ? -0.353  -20.480 -0.291  1.00 12.53 ? 15  ARG D CB   1  
ATOM 7330   C CG   . ARG D 1 15  ? -0.186  -19.310 0.689   1.00 52.43 ? 15  ARG D CG   1  
ATOM 7331   C CD   . ARG D 1 15  ? 0.176   -19.835 2.092   1.00 24.33 ? 15  ARG D CD   1  
ATOM 7332   N NE   . ARG D 1 15  ? 0.311   -18.766 3.091   1.00 62.10 ? 15  ARG D NE   1  
ATOM 7333   C CZ   . ARG D 1 15  ? -0.137  -18.828 4.359   1.00 2.12  ? 15  ARG D CZ   1  
ATOM 7334   N NH1  . ARG D 1 15  ? -0.745  -19.912 4.815   1.00 33.51 ? 15  ARG D NH1  1  
ATOM 7335   N NH2  . ARG D 1 15  ? 0.101   -17.830 5.190   1.00 30.43 ? 15  ARG D NH2  1  
ATOM 7336   H H    . ARG D 1 15  ? -0.786  -21.719 -3.186  1.00 13.30 ? 15  ARG D H    1  
ATOM 7337   H HA   . ARG D 1 15  ? -1.746  -19.530 -1.678  1.00 4.45  ? 15  ARG D HA   1  
ATOM 7338   H HB2  . ARG D 1 15  ? -1.053  -21.176 0.160   1.00 32.31 ? 15  ARG D HB2  1  
ATOM 7339   H HB3  . ARG D 1 15  ? 0.607   -20.991 -0.375  1.00 61.54 ? 15  ARG D HB3  1  
ATOM 7340   H HG2  . ARG D 1 15  ? 0.604   -18.657 0.334   1.00 23.31 ? 15  ARG D HG2  1  
ATOM 7341   H HG3  . ARG D 1 15  ? -1.115  -18.757 0.745   1.00 53.34 ? 15  ARG D HG3  1  
ATOM 7342   H HD2  . ARG D 1 15  ? -0.595  -20.527 2.416   1.00 22.45 ? 15  ARG D HD2  1  
ATOM 7343   H HD3  . ARG D 1 15  ? 1.123   -20.368 2.034   1.00 41.23 ? 15  ARG D HD3  1  
ATOM 7344   H HE   . ARG D 1 15  ? 0.758   -17.949 2.795   1.00 22.40 ? 15  ARG D HE   1  
ATOM 7345   H HH11 . ARG D 1 15  ? -0.899  -20.698 4.211   1.00 61.34 ? 15  ARG D HH11 1  
ATOM 7346   H HH12 . ARG D 1 15  ? -1.071  -19.948 5.765   1.00 55.24 ? 15  ARG D HH12 1  
ATOM 7347   H HH21 . ARG D 1 15  ? 0.598   -17.016 4.874   1.00 75.43 ? 15  ARG D HH21 1  
ATOM 7348   H HH22 . ARG D 1 15  ? -0.226  -17.872 6.138   1.00 32.44 ? 15  ARG D HH22 1  
ATOM 7349   N N    . ILE D 1 16  ? 0.124   -18.072 -2.627  1.00 32.21 ? 16  ILE D N    1  
ATOM 7350   C CA   . ILE D 1 16  ? 1.172   -17.190 -3.217  1.00 51.13 ? 16  ILE D CA   1  
ATOM 7351   C C    . ILE D 1 16  ? 1.562   -16.170 -2.155  1.00 40.51 ? 16  ILE D C    1  
ATOM 7352   O O    . ILE D 1 16  ? 0.688   -15.677 -1.430  1.00 63.12 ? 16  ILE D O    1  
ATOM 7353   C CB   . ILE D 1 16  ? 0.732   -16.381 -4.512  1.00 34.13 ? 16  ILE D CB   1  
ATOM 7354   C CG1  . ILE D 1 16  ? 0.302   -17.319 -5.677  1.00 53.33 ? 16  ILE D CG1  1  
ATOM 7355   C CG2  . ILE D 1 16  ? 1.851   -15.419 -4.989  1.00 40.41 ? 16  ILE D CG2  1  
ATOM 7356   C CD1  . ILE D 1 16  ? -1.054  -17.922 -5.490  1.00 52.23 ? 16  ILE D CD1  1  
ATOM 7357   H H    . ILE D 1 16  ? -0.680  -17.646 -2.262  1.00 72.32 ? 16  ILE D H    1  
ATOM 7358   H HA   . ILE D 1 16  ? 2.044   -17.800 -3.465  1.00 11.44 ? 16  ILE D HA   1  
ATOM 7359   H HB   . ILE D 1 16  ? -0.124  -15.764 -4.235  1.00 40.13 ? 16  ILE D HB   1  
ATOM 7360   H HG12 . ILE D 1 16  ? 0.279   -16.767 -6.606  1.00 4.34  ? 16  ILE D HG12 1  
ATOM 7361   H HG13 . ILE D 1 16  ? 1.012   -18.133 -5.767  1.00 53.15 ? 16  ILE D HG13 1  
ATOM 7362   H HG21 . ILE D 1 16  ? 1.468   -14.756 -5.740  1.00 44.42 ? 16  ILE D HG21 1  
ATOM 7363   H HG22 . ILE D 1 16  ? 2.677   -15.983 -5.397  1.00 32.02 ? 16  ILE D HG22 1  
ATOM 7364   H HG23 . ILE D 1 16  ? 2.208   -14.825 -4.154  1.00 5.34  ? 16  ILE D HG23 1  
ATOM 7365   H HD11 . ILE D 1 16  ? -1.310  -18.516 -6.343  1.00 44.33 ? 16  ILE D HD11 1  
ATOM 7366   H HD12 . ILE D 1 16  ? -1.798  -17.142 -5.355  1.00 12.22 ? 16  ILE D HD12 1  
ATOM 7367   H HD13 . ILE D 1 16  ? -1.054  -18.558 -4.618  1.00 75.41 ? 16  ILE D HD13 1  
ATOM 7368   N N    . TYR D 1 17  ? 2.857   -15.844 -2.094  1.00 32.24 ? 17  TYR D N    1  
ATOM 7369   C CA   . TYR D 1 17  ? 3.422   -14.962 -1.080  1.00 72.51 ? 17  TYR D CA   1  
ATOM 7370   C C    . TYR D 1 17  ? 4.824   -14.498 -1.471  1.00 51.23 ? 17  TYR D C    1  
ATOM 7371   O O    . TYR D 1 17  ? 5.402   -14.947 -2.470  1.00 44.31 ? 17  TYR D O    1  
ATOM 7372   C CB   . TYR D 1 17  ? 3.459   -15.692 0.298   1.00 61.32 ? 17  TYR D CB   1  
ATOM 7373   C CG   . TYR D 1 17  ? 4.077   -17.104 0.222   1.00 62.04 ? 17  TYR D CG   1  
ATOM 7374   C CD1  . TYR D 1 17  ? 3.272   -18.224 -0.010  1.00 33.52 ? 17  TYR D CD1  1  
ATOM 7375   C CD2  . TYR D 1 17  ? 5.454   -17.318 0.351   1.00 61.53 ? 17  TYR D CD2  1  
ATOM 7376   C CE1  . TYR D 1 17  ? 3.806   -19.488 -0.109  1.00 50.32 ? 17  TYR D CE1  1  
ATOM 7377   C CE2  . TYR D 1 17  ? 5.988   -18.589 0.256   1.00 42.14 ? 17  TYR D CE2  1  
ATOM 7378   C CZ   . TYR D 1 17  ? 5.161   -19.667 0.028   1.00 33.21 ? 17  TYR D CZ   1  
ATOM 7379   O OH   . TYR D 1 17  ? 5.690   -20.930 -0.073  1.00 72.31 ? 17  TYR D OH   1  
ATOM 7380   H H    . TYR D 1 17  ? 3.463   -16.207 -2.773  1.00 5.31  ? 17  TYR D H    1  
ATOM 7381   H HA   . TYR D 1 17  ? 2.787   -14.078 -1.021  1.00 64.14 ? 17  TYR D HA   1  
ATOM 7382   H HB2  . TYR D 1 17  ? 4.031   -15.104 1.008   1.00 33.43 ? 17  TYR D HB2  1  
ATOM 7383   H HB3  . TYR D 1 17  ? 2.440   -15.788 0.674   1.00 13.12 ? 17  TYR D HB3  1  
ATOM 7384   H HD1  . TYR D 1 17  ? 2.203   -18.089 -0.115  1.00 74.44 ? 17  TYR D HD1  1  
ATOM 7385   H HD2  . TYR D 1 17  ? 6.106   -16.470 0.532   1.00 44.23 ? 17  TYR D HD2  1  
ATOM 7386   H HE1  . TYR D 1 17  ? 3.159   -20.335 -0.290  1.00 64.22 ? 17  TYR D HE1  1  
ATOM 7387   H HE2  . TYR D 1 17  ? 7.055   -18.734 0.365   1.00 43.03 ? 17  TYR D HE2  1  
ATOM 7388   H HH   . TYR D 1 17  ? 6.565   -20.955 0.345   1.00 24.50 ? 17  TYR D HH   1  
ATOM 7389   N N    . THR D 1 18  ? 5.358   -13.598 -0.649  1.00 3.42  ? 18  THR D N    1  
ATOM 7390   C CA   . THR D 1 18  ? 6.679   -13.027 -0.828  1.00 52.32 ? 18  THR D CA   1  
ATOM 7391   C C    . THR D 1 18  ? 7.629   -13.577 0.246   1.00 14.53 ? 18  THR D C    1  
ATOM 7392   O O    . THR D 1 18  ? 7.384   -13.422 1.450   1.00 71.21 ? 18  THR D O    1  
ATOM 7393   C CB   . THR D 1 18  ? 6.589   -11.476 -0.754  1.00 2.35  ? 18  THR D CB   1  
ATOM 7394   O OG1  . THR D 1 18  ? 6.119   -11.049 0.546   1.00 64.14 ? 18  THR D OG1  1  
ATOM 7395   C CG2  . THR D 1 18  ? 5.628   -10.913 -1.823  1.00 62.34 ? 18  THR D CG2  1  
ATOM 7396   H H    . THR D 1 18  ? 4.827   -13.292 0.114   1.00 30.12 ? 18  THR D H    1  
ATOM 7397   H HA   . THR D 1 18  ? 7.055   -13.299 -1.817  1.00 13.11 ? 18  THR D HA   1  
ATOM 7398   H HB   . THR D 1 18  ? 7.576   -11.060 -0.924  1.00 11.30 ? 18  THR D HB   1  
ATOM 7399   H HG1  . THR D 1 18  ? 6.643   -11.466 1.237   1.00 2.21  ? 18  THR D HG1  1  
ATOM 7400   H HG21 . THR D 1 18  ? 5.693   -9.842  -1.843  1.00 43.14 ? 18  THR D HG21 1  
ATOM 7401   H HG22 . THR D 1 18  ? 4.620   -11.182 -1.570  1.00 31.04 ? 18  THR D HG22 1  
ATOM 7402   H HG23 . THR D 1 18  ? 5.877   -11.306 -2.801  1.00 2.31  ? 18  THR D HG23 1  
ATOM 7403   N N    . LYS D 1 19  ? 8.684   -14.251 -0.205  1.00 61.04 ? 19  LYS D N    1  
ATOM 7404   C CA   . LYS D 1 19  ? 9.734   -14.799 0.675   1.00 14.14 ? 19  LYS D CA   1  
ATOM 7405   C C    . LYS D 1 19  ? 10.868  -13.795 0.827   1.00 71.30 ? 19  LYS D C    1  
ATOM 7406   O O    . LYS D 1 19  ? 11.699  -13.907 1.730   1.00 31.00 ? 19  LYS D O    1  
ATOM 7407   C CB   . LYS D 1 19  ? 10.284  -16.097 0.078   1.00 61.22 ? 19  LYS D CB   1  
ATOM 7408   C CG   . LYS D 1 19  ? 9.192   -17.070 -0.377  1.00 63.22 ? 19  LYS D CG   1  
ATOM 7409   C CD   . LYS D 1 19  ? 9.775   -18.370 -0.921  1.00 71.23 ? 19  LYS D CD   1  
ATOM 7410   C CE   . LYS D 1 19  ? 10.563  -19.156 0.135   1.00 63.42 ? 19  LYS D CE   1  
ATOM 7411   N NZ   . LYS D 1 19  ? 11.045  -20.441 -0.414  1.00 42.01 ? 19  LYS D NZ   1  
ATOM 7412   H H    . LYS D 1 19  ? 8.765   -14.392 -1.173  1.00 63.34 ? 19  LYS D H    1  
ATOM 7413   H HA   . LYS D 1 19  ? 9.302   -15.008 1.654   1.00 4.42  ? 19  LYS D HA   1  
ATOM 7414   H HB2  . LYS D 1 19  ? 10.911  -15.861 -0.777  1.00 75.02 ? 19  LYS D HB2  1  
ATOM 7415   H HB3  . LYS D 1 19  ? 10.888  -16.595 0.832   1.00 10.03 ? 19  LYS D HB3  1  
ATOM 7416   H HG2  . LYS D 1 19  ? 8.545   -17.298 0.466   1.00 42.34 ? 19  LYS D HG2  1  
ATOM 7417   H HG3  . LYS D 1 19  ? 8.603   -16.594 -1.156  1.00 23.35 ? 19  LYS D HG3  1  
ATOM 7418   H HD2  . LYS D 1 19  ? 8.962   -18.994 -1.281  1.00 72.22 ? 19  LYS D HD2  1  
ATOM 7419   H HD3  . LYS D 1 19  ? 10.435  -18.142 -1.754  1.00 51.04 ? 19  LYS D HD3  1  
ATOM 7420   H HE2  . LYS D 1 19  ? 11.414  -18.573 0.458   1.00 33.02 ? 19  LYS D HE2  1  
ATOM 7421   H HE3  . LYS D 1 19  ? 9.921   -19.360 0.984   1.00 53.55 ? 19  LYS D HE3  1  
ATOM 7422   H HZ1  . LYS D 1 19  ? 11.954  -20.315 -0.893  1.00 62.43 ? 19  LYS D HZ1  1  
ATOM 7423   H HZ2  . LYS D 1 19  ? 10.360  -20.804 -1.104  1.00 53.25 ? 19  LYS D HZ2  1  
ATOM 7424   H HZ3  . LYS D 1 19  ? 11.140  -21.144 0.343   1.00 13.40 ? 19  LYS D HZ3  1  
ATOM 7425   N N    . ASP D 1 20  ? 10.912  -12.856 -0.116  1.00 55.53 ? 20  ASP D N    1  
ATOM 7426   C CA   . ASP D 1 20  ? 11.865  -11.763 -0.125  1.00 31.13 ? 20  ASP D CA   1  
ATOM 7427   C C    . ASP D 1 20  ? 11.305  -10.634 -0.980  1.00 53.20 ? 20  ASP D C    1  
ATOM 7428   O O    . ASP D 1 20  ? 10.766  -10.865 -2.067  1.00 32.22 ? 20  ASP D O    1  
ATOM 7429   C CB   . ASP D 1 20  ? 13.244  -12.228 -0.643  1.00 54.13 ? 20  ASP D CB   1  
ATOM 7430   C CG   . ASP D 1 20  ? 14.230  -11.074 -0.909  1.00 14.05 ? 20  ASP D CG   1  
ATOM 7431   O OD1  . ASP D 1 20  ? 14.583  -10.840 -2.090  1.00 65.20 ? 20  ASP D OD1  1  
ATOM 7432   O OD2  . ASP D 1 20  ? 14.653  -10.403 0.060   1.00 34.12 ? 20  ASP D OD2  1  
ATOM 7433   H H    . ASP D 1 20  ? 10.269  -12.906 -0.853  1.00 23.13 ? 20  ASP D H    1  
ATOM 7434   H HA   . ASP D 1 20  ? 11.972  -11.409 0.903   1.00 21.15 ? 20  ASP D HA   1  
ATOM 7435   H HB2  . ASP D 1 20  ? 13.688  -12.894 0.091   1.00 1.40  ? 20  ASP D HB2  1  
ATOM 7436   H HB3  . ASP D 1 20  ? 13.101  -12.788 -1.562  1.00 50.34 ? 20  ASP D HB3  1  
ATOM 7437   N N    . ILE D 1 21  ? 11.386  -9.427  -0.438  1.00 61.43 ? 21  ILE D N    1  
ATOM 7438   C CA   . ILE D 1 21  ? 11.045  -8.183  -1.120  1.00 55.42 ? 21  ILE D CA   1  
ATOM 7439   C C    . ILE D 1 21  ? 12.191  -7.212  -0.878  1.00 13.21 ? 21  ILE D C    1  
ATOM 7440   O O    . ILE D 1 21  ? 12.819  -7.245  0.191   1.00 42.03 ? 21  ILE D O    1  
ATOM 7441   C CB   . ILE D 1 21  ? 9.706   -7.539  -0.586  1.00 23.42 ? 21  ILE D CB   1  
ATOM 7442   C CG1  . ILE D 1 21  ? 8.508   -8.519  -0.731  1.00 41.32 ? 21  ILE D CG1  1  
ATOM 7443   C CG2  . ILE D 1 21  ? 9.408   -6.214  -1.312  1.00 20.45 ? 21  ILE D CG2  1  
ATOM 7444   C CD1  . ILE D 1 21  ? 7.177   -8.019  -0.173  1.00 51.12 ? 21  ILE D CD1  1  
ATOM 7445   H H    . ILE D 1 21  ? 11.715  -9.362  0.482   1.00 45.25 ? 21  ILE D H    1  
ATOM 7446   H HA   . ILE D 1 21  ? 10.949  -8.373  -2.194  1.00 3.14  ? 21  ILE D HA   1  
ATOM 7447   H HB   . ILE D 1 21  ? 9.833   -7.308  0.469   1.00 64.23 ? 21  ILE D HB   1  
ATOM 7448   H HG12 . ILE D 1 21  ? 8.353   -8.740  -1.778  1.00 54.51 ? 21  ILE D HG12 1  
ATOM 7449   H HG13 . ILE D 1 21  ? 8.746   -9.443  -0.216  1.00 40.21 ? 21  ILE D HG13 1  
ATOM 7450   H HG21 . ILE D 1 21  ? 8.469   -5.828  -0.989  1.00 51.53 ? 21  ILE D HG21 1  
ATOM 7451   H HG22 . ILE D 1 21  ? 9.376   -6.375  -2.381  1.00 3.25  ? 21  ILE D HG22 1  
ATOM 7452   H HG23 . ILE D 1 21  ? 10.171  -5.482  -1.089  1.00 20.24 ? 21  ILE D HG23 1  
ATOM 7453   H HD11 . ILE D 1 21  ? 6.448   -7.989  -0.959  1.00 5.13  ? 21  ILE D HD11 1  
ATOM 7454   H HD12 . ILE D 1 21  ? 7.280   -7.038  0.242   1.00 20.53 ? 21  ILE D HD12 1  
ATOM 7455   H HD13 . ILE D 1 21  ? 6.836   -8.688  0.593   1.00 21.52 ? 21  ILE D HD13 1  
ATOM 7456   N N    . SER D 1 22  ? 12.441  -6.344  -1.856  1.00 31.44 ? 22  SER D N    1  
ATOM 7457   C CA   . SER D 1 22  ? 13.408  -5.273  -1.727  1.00 54.31 ? 22  SER D CA   1  
ATOM 7458   C C    . SER D 1 22  ? 13.072  -4.138  -2.704  1.00 50.12 ? 22  SER D C    1  
ATOM 7459   O O    . SER D 1 22  ? 12.562  -4.370  -3.808  1.00 42.13 ? 22  SER D O    1  
ATOM 7460   C CB   . SER D 1 22  ? 14.852  -5.797  -1.940  1.00 24.53 ? 22  SER D CB   1  
ATOM 7461   O OG   . SER D 1 22  ? 15.815  -4.771  -1.757  1.00 33.20 ? 22  SER D OG   1  
ATOM 7462   H H    . SER D 1 22  ? 11.947  -6.433  -2.704  1.00 11.23 ? 22  SER D H    1  
ATOM 7463   H HA   . SER D 1 22  ? 13.317  -4.885  -0.711  1.00 24.04 ? 22  SER D HA   1  
ATOM 7464   H HB2  . SER D 1 22  ? 15.058  -6.584  -1.223  1.00 44.43 ? 22  SER D HB2  1  
ATOM 7465   H HB3  . SER D 1 22  ? 14.952  -6.197  -2.941  1.00 32.11 ? 22  SER D HB3  1  
ATOM 7466   H HG   . SER D 1 22  ? 15.743  -4.419  -0.863  1.00 31.11 ? 22  SER D HG   1  
ATOM 7467   N N    . PHE D 1 23  ? 13.337  -2.923  -2.235  1.00 53.11 ? 23  PHE D N    1  
ATOM 7468   C CA   . PHE D 1 23  ? 13.246  -1.681  -2.991  1.00 61.10 ? 23  PHE D CA   1  
ATOM 7469   C C    . PHE D 1 23  ? 14.330  -0.769  -2.405  1.00 63.24 ? 23  PHE D C    1  
ATOM 7470   O O    . PHE D 1 23  ? 14.339  -0.547  -1.202  1.00 21.51 ? 23  PHE D O    1  
ATOM 7471   C CB   . PHE D 1 23  ? 11.829  -1.043  -2.863  1.00 0.24  ? 23  PHE D CB   1  
ATOM 7472   C CG   . PHE D 1 23  ? 11.677  0.278   -3.617  1.00 41.21 ? 23  PHE D CG   1  
ATOM 7473   C CD1  . PHE D 1 23  ? 11.400  0.293   -4.984  1.00 1.44  ? 23  PHE D CD1  1  
ATOM 7474   C CD2  . PHE D 1 23  ? 11.829  1.504   -2.961  1.00 34.33 ? 23  PHE D CD2  1  
ATOM 7475   C CE1  . PHE D 1 23  ? 11.280  1.487   -5.668  1.00 62.32 ? 23  PHE D CE1  1  
ATOM 7476   C CE2  . PHE D 1 23  ? 11.707  2.692   -3.650  1.00 35.53 ? 23  PHE D CE2  1  
ATOM 7477   C CZ   . PHE D 1 23  ? 11.435  2.686   -4.999  1.00 14.45 ? 23  PHE D CZ   1  
ATOM 7478   H H    . PHE D 1 23  ? 13.628  -2.853  -1.302  1.00 43.45 ? 23  PHE D H    1  
ATOM 7479   H HA   . PHE D 1 23  ? 13.468  -1.889  -4.040  1.00 1.35  ? 23  PHE D HA   1  
ATOM 7480   H HB2  . PHE D 1 23  ? 11.097  -1.740  -3.256  1.00 23.54 ? 23  PHE D HB2  1  
ATOM 7481   H HB3  . PHE D 1 23  ? 11.599  -0.864  -1.812  1.00 3.51  ? 23  PHE D HB3  1  
ATOM 7482   H HD1  . PHE D 1 23  ? 11.277  -0.645  -5.514  1.00 13.30 ? 23  PHE D HD1  1  
ATOM 7483   H HD2  . PHE D 1 23  ? 12.044  1.519   -1.899  1.00 34.34 ? 23  PHE D HD2  1  
ATOM 7484   H HE1  . PHE D 1 23  ? 11.069  1.484   -6.730  1.00 72.12 ? 23  PHE D HE1  1  
ATOM 7485   H HE2  . PHE D 1 23  ? 11.830  3.634   -3.129  1.00 31.14 ? 23  PHE D HE2  1  
ATOM 7486   H HZ   . PHE D 1 23  ? 11.344  3.622   -5.536  1.00 23.51 ? 23  PHE D HZ   1  
ATOM 7487   N N    . GLU D 1 24  ? 15.271  -0.300  -3.234  1.00 71.30 ? 24  GLU D N    1  
ATOM 7488   C CA   . GLU D 1 24  ? 16.412  0.517   -2.777  1.00 74.21 ? 24  GLU D CA   1  
ATOM 7489   C C    . GLU D 1 24  ? 16.581  1.729   -3.693  1.00 73.24 ? 24  GLU D C    1  
ATOM 7490   O O    . GLU D 1 24  ? 16.987  1.581   -4.844  1.00 61.32 ? 24  GLU D O    1  
ATOM 7491   C CB   . GLU D 1 24  ? 17.727  -0.310  -2.779  1.00 3.42  ? 24  GLU D CB   1  
ATOM 7492   C CG   . GLU D 1 24  ? 17.750  -1.509  -1.819  1.00 42.32 ? 24  GLU D CG   1  
ATOM 7493   C CD   . GLU D 1 24  ? 19.099  -2.236  -1.838  1.00 5.24  ? 24  GLU D CD   1  
ATOM 7494   O OE1  . GLU D 1 24  ? 19.257  -3.208  -2.606  1.00 14.21 ? 24  GLU D OE1  1  
ATOM 7495   O OE2  . GLU D 1 24  ? 20.021  -1.814  -1.110  1.00 0.44  ? 24  GLU D OE2  1  
ATOM 7496   H H    . GLU D 1 24  ? 15.197  -0.505  -4.186  1.00 31.25 ? 24  GLU D H    1  
ATOM 7497   H HA   . GLU D 1 24  ? 16.214  0.863   -1.762  1.00 65.51 ? 24  GLU D HA   1  
ATOM 7498   H HB2  . GLU D 1 24  ? 17.901  -0.685  -3.784  1.00 62.01 ? 24  GLU D HB2  1  
ATOM 7499   H HB3  . GLU D 1 24  ? 18.552  0.347   -2.513  1.00 73.12 ? 24  GLU D HB3  1  
ATOM 7500   H HG2  . GLU D 1 24  ? 17.548  -1.158  -0.810  1.00 1.43  ? 24  GLU D HG2  1  
ATOM 7501   H HG3  . GLU D 1 24  ? 16.968  -2.203  -2.109  1.00 34.31 ? 24  GLU D HG3  1  
ATOM 7502   N N    . ALA D 1 25  ? 16.295  2.917   -3.168  1.00 35.41 ? 25  ALA D N    1  
ATOM 7503   C CA   . ALA D 1 25  ? 16.493  4.188   -3.866  1.00 11.53 ? 25  ALA D CA   1  
ATOM 7504   C C    . ALA D 1 25  ? 17.603  4.963   -3.127  1.00 1.14  ? 25  ALA D C    1  
ATOM 7505   O O    . ALA D 1 25  ? 17.318  5.699   -2.173  1.00 54.34 ? 25  ALA D O    1  
ATOM 7506   C CB   . ALA D 1 25  ? 15.163  4.966   -3.942  1.00 3.53  ? 25  ALA D CB   1  
ATOM 7507   H H    . ALA D 1 25  ? 15.942  2.943   -2.259  1.00 12.13 ? 25  ALA D H    1  
ATOM 7508   H HA   . ALA D 1 25  ? 16.824  3.985   -4.884  1.00 44.24 ? 25  ALA D HA   1  
ATOM 7509   H HB1  . ALA D 1 25  ? 14.432  4.383   -4.478  1.00 43.23 ? 25  ALA D HB1  1  
ATOM 7510   H HB2  . ALA D 1 25  ? 15.311  5.904   -4.458  1.00 64.31 ? 25  ALA D HB2  1  
ATOM 7511   H HB3  . ALA D 1 25  ? 14.789  5.162   -2.947  1.00 24.25 ? 25  ALA D HB3  1  
ATOM 7512   N N    . PRO D 1 26  ? 18.913  4.737   -3.503  1.00 20.00 ? 26  PRO D N    1  
ATOM 7513   C CA   . PRO D 1 26  ? 20.072  5.334   -2.790  1.00 22.42 ? 26  PRO D CA   1  
ATOM 7514   C C    . PRO D 1 26  ? 20.230  6.836   -3.098  1.00 63.03 ? 26  PRO D C    1  
ATOM 7515   O O    . PRO D 1 26  ? 20.516  7.649   -2.214  1.00 61.55 ? 26  PRO D O    1  
ATOM 7516   C CB   . PRO D 1 26  ? 21.293  4.501   -3.310  1.00 34.33 ? 26  PRO D CB   1  
ATOM 7517   C CG   . PRO D 1 26  ? 20.709  3.382   -4.143  1.00 2.34  ? 26  PRO D CG   1  
ATOM 7518   C CD   . PRO D 1 26  ? 19.377  3.888   -4.638  1.00 64.50 ? 26  PRO D CD   1  
ATOM 7519   H HA   . PRO D 1 26  ? 19.974  5.201   -1.715  1.00 22.21 ? 26  PRO D HA   1  
ATOM 7520   H HB2  . PRO D 1 26  ? 21.958  5.125   -3.911  1.00 61.41 ? 26  PRO D HB2  1  
ATOM 7521   H HB3  . PRO D 1 26  ? 21.848  4.090   -2.474  1.00 0.52  ? 26  PRO D HB3  1  
ATOM 7522   H HG2  . PRO D 1 26  ? 21.368  3.152   -4.977  1.00 70.15 ? 26  PRO D HG2  1  
ATOM 7523   H HG3  . PRO D 1 26  ? 20.565  2.495   -3.533  1.00 43.44 ? 26  PRO D HG3  1  
ATOM 7524   H HD2  . PRO D 1 26  ? 19.495  4.475   -5.545  1.00 23.14 ? 26  PRO D HD2  1  
ATOM 7525   H HD3  . PRO D 1 26  ? 18.696  3.062   -4.812  1.00 34.13 ? 26  PRO D HD3  1  
ATOM 7526   N N    . ASN D 1 27  ? 20.001  7.174   -4.374  1.00 1.14  ? 27  ASN D N    1  
ATOM 7527   C CA   . ASN D 1 27  ? 20.164  8.537   -4.909  1.00 15.13 ? 27  ASN D CA   1  
ATOM 7528   C C    . ASN D 1 27  ? 18.837  9.321   -4.840  1.00 72.43 ? 27  ASN D C    1  
ATOM 7529   O O    . ASN D 1 27  ? 18.795  10.460  -5.279  1.00 24.41 ? 27  ASN D O    1  
ATOM 7530   C CB   . ASN D 1 27  ? 20.653  8.453   -6.384  1.00 30.23 ? 27  ASN D CB   1  
ATOM 7531   C CG   . ASN D 1 27  ? 21.891  7.571   -6.570  1.00 60.01 ? 27  ASN D CG   1  
ATOM 7532   O OD1  . ASN D 1 27  ? 22.738  7.472   -5.683  1.00 72.23 ? 27  ASN D OD1  1  
ATOM 7533   N ND2  . ASN D 1 27  ? 22.018  6.925   -7.716  1.00 63.43 ? 27  ASN D ND2  1  
ATOM 7534   H H    . ASN D 1 27  ? 19.706  6.474   -4.989  1.00 43.24 ? 27  ASN D H    1  
ATOM 7535   H HA   . ASN D 1 27  ? 20.916  9.053   -4.317  1.00 64.31 ? 27  ASN D HA   1  
ATOM 7536   H HB2  . ASN D 1 27  ? 19.857  8.062   -7.007  1.00 64.24 ? 27  ASN D HB2  1  
ATOM 7537   H HB3  . ASN D 1 27  ? 20.910  9.456   -6.734  1.00 70.30 ? 27  ASN D HB3  1  
ATOM 7538   H HD21 . ASN D 1 27  ? 21.320  7.034   -8.397  1.00 53.33 ? 27  ASN D HD21 1  
ATOM 7539   H HD22 . ASN D 1 27  ? 22.807  6.363   -7.837  1.00 43.03 ? 27  ASN D HD22 1  
ATOM 7540   N N    . ALA D 1 28  ? 17.801  8.690   -4.218  1.00 11.12 ? 28  ALA D N    1  
ATOM 7541   C CA   . ALA D 1 28  ? 16.362  9.058   -4.297  1.00 63.01 ? 28  ALA D CA   1  
ATOM 7542   C C    . ALA D 1 28  ? 16.042  10.569  -4.515  1.00 42.41 ? 28  ALA D C    1  
ATOM 7543   O O    . ALA D 1 28  ? 15.600  10.909  -5.609  1.00 45.14 ? 28  ALA D O    1  
ATOM 7544   C CB   . ALA D 1 28  ? 15.596  8.460   -3.103  1.00 11.40 ? 28  ALA D CB   1  
ATOM 7545   H H    . ALA D 1 28  ? 18.016  7.905   -3.690  1.00 44.03 ? 28  ALA D H    1  
ATOM 7546   H HA   . ALA D 1 28  ? 15.994  8.541   -5.180  1.00 61.14 ? 28  ALA D HA   1  
ATOM 7547   H HB1  . ALA D 1 28  ? 14.532  8.538   -3.267  1.00 13.40 ? 28  ALA D HB1  1  
ATOM 7548   H HB2  . ALA D 1 28  ? 15.847  8.990   -2.199  1.00 21.31 ? 28  ALA D HB2  1  
ATOM 7549   H HB3  . ALA D 1 28  ? 15.854  7.417   -2.991  1.00 31.22 ? 28  ALA D HB3  1  
ATOM 7550   N N    . PRO D 1 29  ? 16.296  11.529  -3.565  1.00 35.11 ? 29  PRO D N    1  
ATOM 7551   C CA   . PRO D 1 29  ? 15.831  12.922  -3.766  1.00 2.23  ? 29  PRO D CA   1  
ATOM 7552   C C    . PRO D 1 29  ? 16.679  13.702  -4.795  1.00 14.34 ? 29  PRO D C    1  
ATOM 7553   O O    . PRO D 1 29  ? 16.191  14.646  -5.442  1.00 73.33 ? 29  PRO D O    1  
ATOM 7554   C CB   . PRO D 1 29  ? 15.909  13.515  -2.348  1.00 51.42 ? 29  PRO D CB   1  
ATOM 7555   C CG   . PRO D 1 29  ? 17.067  12.804  -1.710  1.00 54.22 ? 29  PRO D CG   1  
ATOM 7556   C CD   . PRO D 1 29  ? 17.048  11.391  -2.273  1.00 5.13  ? 29  PRO D CD   1  
ATOM 7557   H HA   . PRO D 1 29  ? 14.808  12.921  -4.118  1.00 64.24 ? 29  PRO D HA   1  
ATOM 7558   H HB2  . PRO D 1 29  ? 16.068  14.594  -2.380  1.00 61.42 ? 29  PRO D HB2  1  
ATOM 7559   H HB3  . PRO D 1 29  ? 14.996  13.291  -1.808  1.00 70.31 ? 29  PRO D HB3  1  
ATOM 7560   H HG2  . PRO D 1 29  ? 17.997  13.306  -1.963  1.00 33.14 ? 29  PRO D HG2  1  
ATOM 7561   H HG3  . PRO D 1 29  ? 16.941  12.780  -0.633  1.00 2.32  ? 29  PRO D HG3  1  
ATOM 7562   H HD2  . PRO D 1 29  ? 18.059  11.031  -2.440  1.00 3.34  ? 29  PRO D HD2  1  
ATOM 7563   H HD3  . PRO D 1 29  ? 16.520  10.718  -1.602  1.00 4.32  ? 29  PRO D HD3  1  
ATOM 7564   N N    . HIS D 1 30  ? 17.924  13.254  -4.970  1.00 41.13 ? 30  HIS D N    1  
ATOM 7565   C CA   . HIS D 1 30  ? 18.850  13.783  -5.975  1.00 43.14 ? 30  HIS D CA   1  
ATOM 7566   C C    . HIS D 1 30  ? 18.417  13.310  -7.375  1.00 1.21  ? 30  HIS D C    1  
ATOM 7567   O O    . HIS D 1 30  ? 18.464  14.070  -8.349  1.00 43.52 ? 30  HIS D O    1  
ATOM 7568   C CB   . HIS D 1 30  ? 20.292  13.308  -5.634  1.00 35.03 ? 30  HIS D CB   1  
ATOM 7569   C CG   . HIS D 1 30  ? 21.317  13.435  -6.735  1.00 2.13  ? 30  HIS D CG   1  
ATOM 7570   N ND1  . HIS D 1 30  ? 22.301  12.495  -6.937  1.00 25.21 ? 30  HIS D ND1  1  
ATOM 7571   C CD2  . HIS D 1 30  ? 21.520  14.387  -7.680  1.00 34.02 ? 30  HIS D CD2  1  
ATOM 7572   C CE1  . HIS D 1 30  ? 23.056  12.863  -7.946  1.00 0.42  ? 30  HIS D CE1  1  
ATOM 7573   N NE2  . HIS D 1 30  ? 22.606  14.004  -8.412  1.00 25.40 ? 30  HIS D NE2  1  
ATOM 7574   H H    . HIS D 1 30  ? 18.225  12.503  -4.416  1.00 31.14 ? 30  HIS D H    1  
ATOM 7575   H HA   . HIS D 1 30  ? 18.815  14.870  -5.939  1.00 33.33 ? 30  HIS D HA   1  
ATOM 7576   H HB2  . HIS D 1 30  ? 20.660  13.880  -4.795  1.00 74.34 ? 30  HIS D HB2  1  
ATOM 7577   H HB3  . HIS D 1 30  ? 20.252  12.267  -5.343  1.00 63.14 ? 30  HIS D HB3  1  
ATOM 7578   H HD1  . HIS D 1 30  ? 22.423  11.671  -6.421  1.00 33.22 ? 30  HIS D HD1  1  
ATOM 7579   H HD2  . HIS D 1 30  ? 20.894  15.248  -7.865  1.00 14.11 ? 30  HIS D HD2  1  
ATOM 7580   H HE1  . HIS D 1 30  ? 23.884  12.301  -8.344  1.00 73.13 ? 30  HIS D HE1  1  
ATOM 7581   H HE2  . HIS D 1 30  ? 23.034  14.537  -9.113  1.00 37.61 ? 30  HIS D HE2  1  
ATOM 7582   N N    . VAL D 1 31  ? 17.971  12.056  -7.452  1.00 74.51 ? 31  VAL D N    1  
ATOM 7583   C CA   . VAL D 1 31  ? 17.656  11.398  -8.722  1.00 35.04 ? 31  VAL D CA   1  
ATOM 7584   C C    . VAL D 1 31  ? 16.225  11.779  -9.190  1.00 64.32 ? 31  VAL D C    1  
ATOM 7585   O O    . VAL D 1 31  ? 15.881  11.576  -10.349 1.00 12.00 ? 31  VAL D O    1  
ATOM 7586   C CB   . VAL D 1 31  ? 17.822  9.827   -8.601  1.00 14.11 ? 31  VAL D CB   1  
ATOM 7587   C CG1  . VAL D 1 31  ? 16.636  9.166   -7.852  1.00 55.14 ? 31  VAL D CG1  1  
ATOM 7588   C CG2  . VAL D 1 31  ? 18.093  9.166   -9.962  1.00 14.23 ? 31  VAL D CG2  1  
ATOM 7589   H H    . VAL D 1 31  ? 17.816  11.565  -6.619  1.00 31.21 ? 31  VAL D H    1  
ATOM 7590   H HA   . VAL D 1 31  ? 18.373  11.764  -9.463  1.00 55.15 ? 31  VAL D HA   1  
ATOM 7591   H HB   . VAL D 1 31  ? 18.709  9.653   -7.991  1.00 55.33 ? 31  VAL D HB   1  
ATOM 7592   H HG11 . VAL D 1 31  ? 16.724  9.381   -6.804  1.00 54.31 ? 31  VAL D HG11 1  
ATOM 7593   H HG12 . VAL D 1 31  ? 16.632  8.096   -7.993  1.00 31.33 ? 31  VAL D HG12 1  
ATOM 7594   H HG13 . VAL D 1 31  ? 15.700  9.582   -8.189  1.00 0.42  ? 31  VAL D HG13 1  
ATOM 7595   H HG21 . VAL D 1 31  ? 17.284  9.391   -10.646 1.00 14.13 ? 31  VAL D HG21 1  
ATOM 7596   H HG22 . VAL D 1 31  ? 18.160  8.089   -9.841  1.00 32.23 ? 31  VAL D HG22 1  
ATOM 7597   H HG23 . VAL D 1 31  ? 19.022  9.532   -10.375 1.00 34.22 ? 31  VAL D HG23 1  
ATOM 7598   N N    . PHE D 1 32  ? 15.394  12.333  -8.263  1.00 42.41 ? 32  PHE D N    1  
ATOM 7599   C CA   . PHE D 1 32  ? 14.024  12.809  -8.599  1.00 3.33  ? 32  PHE D CA   1  
ATOM 7600   C C    . PHE D 1 32  ? 14.058  14.055  -9.496  1.00 54.33 ? 32  PHE D C    1  
ATOM 7601   O O    . PHE D 1 32  ? 13.081  14.348  -10.198 1.00 4.12  ? 32  PHE D O    1  
ATOM 7602   C CB   . PHE D 1 32  ? 13.170  13.117  -7.340  1.00 53.51 ? 32  PHE D CB   1  
ATOM 7603   C CG   . PHE D 1 32  ? 12.804  11.900  -6.496  1.00 10.01 ? 32  PHE D CG   1  
ATOM 7604   C CD1  . PHE D 1 32  ? 12.539  10.659  -7.082  1.00 12.34 ? 32  PHE D CD1  1  
ATOM 7605   C CD2  . PHE D 1 32  ? 12.722  11.999  -5.111  1.00 32.24 ? 32  PHE D CD2  1  
ATOM 7606   C CE1  . PHE D 1 32  ? 12.218  9.567   -6.301  1.00 21.11 ? 32  PHE D CE1  1  
ATOM 7607   C CE2  . PHE D 1 32  ? 12.399  10.909  -4.344  1.00 61.25 ? 32  PHE D CE2  1  
ATOM 7608   C CZ   . PHE D 1 32  ? 12.151  9.692   -4.933  1.00 61.33 ? 32  PHE D CZ   1  
ATOM 7609   H H    . PHE D 1 32  ? 15.703  12.402  -7.336  1.00 72.41 ? 32  PHE D H    1  
ATOM 7610   H HA   . PHE D 1 32  ? 13.549  12.000  -9.148  1.00 65.44 ? 32  PHE D HA   1  
ATOM 7611   H HB2  . PHE D 1 32  ? 13.718  13.811  -6.710  1.00 70.50 ? 32  PHE D HB2  1  
ATOM 7612   H HB3  . PHE D 1 32  ? 12.240  13.588  -7.643  1.00 25.04 ? 32  PHE D HB3  1  
ATOM 7613   H HD1  . PHE D 1 32  ? 12.596  10.551  -8.159  1.00 22.24 ? 32  PHE D HD1  1  
ATOM 7614   H HD2  . PHE D 1 32  ? 12.915  12.953  -4.634  1.00 54.22 ? 32  PHE D HD2  1  
ATOM 7615   H HE1  . PHE D 1 32  ? 12.013  8.612   -6.766  1.00 52.44 ? 32  PHE D HE1  1  
ATOM 7616   H HE2  . PHE D 1 32  ? 12.346  11.005  -3.269  1.00 71.42 ? 32  PHE D HE2  1  
ATOM 7617   H HZ   . PHE D 1 32  ? 11.914  8.832   -4.315  1.00 52.15 ? 32  PHE D HZ   1  
ATOM 7618   N N    . GLN D 1 33  ? 15.191  14.785  -9.447  1.00 75.45 ? 33  GLN D N    1  
ATOM 7619   C CA   . GLN D 1 33  ? 15.475  15.921  -10.357 1.00 3.31  ? 33  GLN D CA   1  
ATOM 7620   C C    . GLN D 1 33  ? 15.418  15.447  -11.827 1.00 2.42  ? 33  GLN D C    1  
ATOM 7621   O O    . GLN D 1 33  ? 15.122  16.220  -12.743 1.00 31.21 ? 33  GLN D O    1  
ATOM 7622   C CB   . GLN D 1 33  ? 16.874  16.516  -10.031 1.00 20.42 ? 33  GLN D CB   1  
ATOM 7623   C CG   . GLN D 1 33  ? 17.051  16.954  -8.556  1.00 43.12 ? 33  GLN D CG   1  
ATOM 7624   C CD   . GLN D 1 33  ? 18.490  17.341  -8.192  1.00 31.24 ? 33  GLN D CD   1  
ATOM 7625   O OE1  . GLN D 1 33  ? 19.247  17.852  -9.020  1.00 72.24 ? 33  GLN D OE1  1  
ATOM 7626   N NE2  . GLN D 1 33  ? 18.888  17.082  -6.954  1.00 34.22 ? 33  GLN D NE2  1  
ATOM 7627   H H    . GLN D 1 33  ? 15.863  14.545  -8.775  1.00 75.22 ? 33  GLN D H    1  
ATOM 7628   H HA   . GLN D 1 33  ? 14.716  16.680  -10.199 1.00 61.51 ? 33  GLN D HA   1  
ATOM 7629   H HB2  . GLN D 1 33  ? 17.632  15.771  -10.257 1.00 52.21 ? 33  GLN D HB2  1  
ATOM 7630   H HB3  . GLN D 1 33  ? 17.044  17.382  -10.663 1.00 73.15 ? 33  GLN D HB3  1  
ATOM 7631   H HG2  . GLN D 1 33  ? 16.410  17.808  -8.366  1.00 31.02 ? 33  GLN D HG2  1  
ATOM 7632   H HG3  . GLN D 1 33  ? 16.739  16.133  -7.917  1.00 51.35 ? 33  GLN D HG3  1  
ATOM 7633   H HE21 . GLN D 1 33  ? 18.255  16.654  -6.340  1.00 42.22 ? 33  GLN D HE21 1  
ATOM 7634   H HE22 . GLN D 1 33  ? 19.803  17.325  -6.705  1.00 11.05 ? 33  GLN D HE22 1  
ATOM 7635   N N    . LYS D 1 34  ? 15.702  14.149  -12.009 1.00 30.30 ? 34  LYS D N    1  
ATOM 7636   C CA   . LYS D 1 34  ? 15.572  13.436  -13.279 1.00 32.41 ? 34  LYS D CA   1  
ATOM 7637   C C    . LYS D 1 34  ? 14.144  12.876  -13.401 1.00 31.13 ? 34  LYS D C    1  
ATOM 7638   O O    . LYS D 1 34  ? 13.915  11.668  -13.271 1.00 65.23 ? 34  LYS D O    1  
ATOM 7639   C CB   . LYS D 1 34  ? 16.631  12.307  -13.318 1.00 42.04 ? 34  LYS D CB   1  
ATOM 7640   C CG   . LYS D 1 34  ? 18.066  12.799  -13.045 1.00 31.51 ? 34  LYS D CG   1  
ATOM 7641   C CD   . LYS D 1 34  ? 19.109  11.683  -13.186 1.00 5.14  ? 34  LYS D CD   1  
ATOM 7642   C CE   . LYS D 1 34  ? 20.522  12.145  -12.826 1.00 32.43 ? 34  LYS D CE   1  
ATOM 7643   N NZ   . LYS D 1 34  ? 21.532  11.153  -13.262 1.00 41.33 ? 34  LYS D NZ   1  
ATOM 7644   H H    . LYS D 1 34  ? 16.012  13.637  -11.234 1.00 44.24 ? 34  LYS D H    1  
ATOM 7645   H HA   . LYS D 1 34  ? 15.755  14.129  -14.096 1.00 32.10 ? 34  LYS D HA   1  
ATOM 7646   H HB2  . LYS D 1 34  ? 16.377  11.565  -12.563 1.00 50.24 ? 34  LYS D HB2  1  
ATOM 7647   H HB3  . LYS D 1 34  ? 16.606  11.823  -14.287 1.00 33.42 ? 34  LYS D HB3  1  
ATOM 7648   H HG2  . LYS D 1 34  ? 18.302  13.591  -13.748 1.00 12.11 ? 34  LYS D HG2  1  
ATOM 7649   H HG3  . LYS D 1 34  ? 18.106  13.197  -12.037 1.00 52.40 ? 34  LYS D HG3  1  
ATOM 7650   H HD2  . LYS D 1 34  ? 18.838  10.860  -12.533 1.00 52.41 ? 34  LYS D HD2  1  
ATOM 7651   H HD3  . LYS D 1 34  ? 19.107  11.332  -14.213 1.00 52.51 ? 34  LYS D HD3  1  
ATOM 7652   H HE2  . LYS D 1 34  ? 20.731  13.090  -13.315 1.00 1.43  ? 34  LYS D HE2  1  
ATOM 7653   H HE3  . LYS D 1 34  ? 20.598  12.273  -11.753 1.00 54.31 ? 34  LYS D HE3  1  
ATOM 7654   H HZ1  . LYS D 1 34  ? 21.684  11.226  -14.287 1.00 23.24 ? 34  LYS D HZ1  1  
ATOM 7655   H HZ2  . LYS D 1 34  ? 21.207  10.192  -13.043 1.00 34.42 ? 34  LYS D HZ2  1  
ATOM 7656   H HZ3  . LYS D 1 34  ? 22.440  11.320  -12.775 1.00 71.52 ? 34  LYS D HZ3  1  
ATOM 7657   N N    . ASP D 1 35  ? 13.178  13.784  -13.599 1.00 3.14  ? 35  ASP D N    1  
ATOM 7658   C CA   . ASP D 1 35  ? 11.756  13.425  -13.701 1.00 73.40 ? 35  ASP D CA   1  
ATOM 7659   C C    . ASP D 1 35  ? 11.455  12.891  -15.114 1.00 42.30 ? 35  ASP D C    1  
ATOM 7660   O O    . ASP D 1 35  ? 11.149  13.664  -16.030 1.00 2.00  ? 35  ASP D O    1  
ATOM 7661   C CB   . ASP D 1 35  ? 10.854  14.639  -13.352 1.00 34.45 ? 35  ASP D CB   1  
ATOM 7662   C CG   . ASP D 1 35  ? 9.346   14.303  -13.393 1.00 40.24 ? 35  ASP D CG   1  
ATOM 7663   O OD1  . ASP D 1 35  ? 8.646   14.717  -14.345 1.00 63.51 ? 35  ASP D OD1  1  
ATOM 7664   O OD2  . ASP D 1 35  ? 8.858   13.617  -12.471 1.00 4.13  ? 35  ASP D OD2  1  
ATOM 7665   H H    . ASP D 1 35  ? 13.433  14.727  -13.683 1.00 31.54 ? 35  ASP D H    1  
ATOM 7666   H HA   . ASP D 1 35  ? 11.559  12.634  -12.976 1.00 4.14  ? 35  ASP D HA   1  
ATOM 7667   H HB2  . ASP D 1 35  ? 11.099  14.989  -12.353 1.00 1.55  ? 35  ASP D HB2  1  
ATOM 7668   H HB3  . ASP D 1 35  ? 11.057  15.444  -14.055 1.00 70.44 ? 35  ASP D HB3  1  
ATOM 7669   N N    . TRP D 1 36  ? 11.647  11.578  -15.284 1.00 44.21 ? 36  TRP D N    1  
ATOM 7670   C CA   . TRP D 1 36  ? 11.274  10.835  -16.498 1.00 51.53 ? 36  TRP D CA   1  
ATOM 7671   C C    . TRP D 1 36  ? 11.252  9.332   -16.181 1.00 42.24 ? 36  TRP D C    1  
ATOM 7672   O O    . TRP D 1 36  ? 11.603  8.923   -15.067 1.00 33.03 ? 36  TRP D O    1  
ATOM 7673   C CB   . TRP D 1 36  ? 12.219  11.165  -17.704 1.00 13.25 ? 36  TRP D CB   1  
ATOM 7674   C CG   . TRP D 1 36  ? 13.699  10.850  -17.511 1.00 1.44  ? 36  TRP D CG   1  
ATOM 7675   C CD1  . TRP D 1 36  ? 14.294  9.624   -17.555 1.00 42.41 ? 36  TRP D CD1  1  
ATOM 7676   C CD2  . TRP D 1 36  ? 14.772  11.788  -17.301 1.00 33.14 ? 36  TRP D CD2  1  
ATOM 7677   N NE1  . TRP D 1 36  ? 15.643  9.738   -17.351 1.00 61.15 ? 36  TRP D NE1  1  
ATOM 7678   C CE2  . TRP D 1 36  ? 15.965  11.050  -17.200 1.00 74.33 ? 36  TRP D CE2  1  
ATOM 7679   C CE3  . TRP D 1 36  ? 14.837  13.175  -17.179 1.00 74.41 ? 36  TRP D CE3  1  
ATOM 7680   C CZ2  . TRP D 1 36  ? 17.201  11.647  -16.988 1.00 63.11 ? 36  TRP D CZ2  1  
ATOM 7681   C CZ3  . TRP D 1 36  ? 16.067  13.774  -16.973 1.00 42.14 ? 36  TRP D CZ3  1  
ATOM 7682   C CH2  . TRP D 1 36  ? 17.237  13.010  -16.879 1.00 51.33 ? 36  TRP D CH2  1  
ATOM 7683   H H    . TRP D 1 36  ? 12.075  11.078  -14.552 1.00 33.42 ? 36  TRP D H    1  
ATOM 7684   H HA   . TRP D 1 36  ? 10.260  11.129  -16.758 1.00 12.33 ? 36  TRP D HA   1  
ATOM 7685   H HB2  . TRP D 1 36  ? 11.883  10.611  -18.570 1.00 41.31 ? 36  TRP D HB2  1  
ATOM 7686   H HB3  . TRP D 1 36  ? 12.129  12.224  -17.928 1.00 25.13 ? 36  TRP D HB3  1  
ATOM 7687   H HD1  . TRP D 1 36  ? 13.761  8.697   -17.704 1.00 72.41 ? 36  TRP D HD1  1  
ATOM 7688   H HE1  . TRP D 1 36  ? 16.273  8.996   -17.326 1.00 31.12 ? 36  TRP D HE1  1  
ATOM 7689   H HE3  . TRP D 1 36  ? 13.942  13.784  -17.248 1.00 3.35  ? 36  TRP D HE3  1  
ATOM 7690   H HZ2  . TRP D 1 36  ? 18.111  11.067  -16.918 1.00 14.32 ? 36  TRP D HZ2  1  
ATOM 7691   H HZ3  . TRP D 1 36  ? 16.131  14.852  -16.882 1.00 64.02 ? 36  TRP D HZ3  1  
ATOM 7692   H HH2  . TRP D 1 36  ? 18.179  13.519  -16.719 1.00 14.32 ? 36  TRP D HH2  1  
ATOM 7693   N N    . GLN D 1 37  ? 10.823  8.524   -17.163 1.00 10.02 ? 37  GLN D N    1  
ATOM 7694   C CA   . GLN D 1 37  ? 10.733  7.055   -17.033 1.00 25.53 ? 37  GLN D CA   1  
ATOM 7695   C C    . GLN D 1 37  ? 12.160  6.453   -16.943 1.00 24.21 ? 37  GLN D C    1  
ATOM 7696   O O    . GLN D 1 37  ? 12.936  6.600   -17.896 1.00 14.32 ? 37  GLN D O    1  
ATOM 7697   C CB   . GLN D 1 37  ? 9.957   6.458   -18.246 1.00 42.42 ? 37  GLN D CB   1  
ATOM 7698   C CG   . GLN D 1 37  ? 9.648   4.942   -18.167 1.00 62.13 ? 37  GLN D CG   1  
ATOM 7699   C CD   . GLN D 1 37  ? 8.576   4.571   -17.137 1.00 43.24 ? 37  GLN D CD   1  
ATOM 7700   O OE1  . GLN D 1 37  ? 7.385   4.594   -17.439 1.00 74.11 ? 37  GLN D OE1  1  
ATOM 7701   N NE2  . GLN D 1 37  ? 8.984   4.174   -15.939 1.00 33.42 ? 37  GLN D NE2  1  
ATOM 7702   H H    . GLN D 1 37  ? 10.562  8.931   -18.015 1.00 62.25 ? 37  GLN D H    1  
ATOM 7703   H HA   . GLN D 1 37  ? 10.187  6.837   -16.121 1.00 4.03  ? 37  GLN D HA   1  
ATOM 7704   H HB2  . GLN D 1 37  ? 9.013   6.984   -18.347 1.00 1.34  ? 37  GLN D HB2  1  
ATOM 7705   H HB3  . GLN D 1 37  ? 10.537  6.638   -19.150 1.00 2.34  ? 37  GLN D HB3  1  
ATOM 7706   H HG2  . GLN D 1 37  ? 9.315   4.598   -19.140 1.00 61.41 ? 37  GLN D HG2  1  
ATOM 7707   H HG3  . GLN D 1 37  ? 10.565  4.420   -17.914 1.00 11.43 ? 37  GLN D HG3  1  
ATOM 7708   H HE21 . GLN D 1 37  ? 9.943   4.128   -15.769 1.00 15.20 ? 37  GLN D HE21 1  
ATOM 7709   H HE22 . GLN D 1 37  ? 8.299   3.942   -15.272 1.00 35.32 ? 37  GLN D HE22 1  
ATOM 7710   N N    . PRO D 1 38  ? 12.542  5.806   -15.787 1.00 44.01 ? 38  PRO D N    1  
ATOM 7711   C CA   . PRO D 1 38  ? 13.888  5.197   -15.614 1.00 3.30  ? 38  PRO D CA   1  
ATOM 7712   C C    . PRO D 1 38  ? 14.150  4.049   -16.605 1.00 62.43 ? 38  PRO D C    1  
ATOM 7713   O O    . PRO D 1 38  ? 13.202  3.391   -17.051 1.00 62.32 ? 38  PRO D O    1  
ATOM 7714   C CB   . PRO D 1 38  ? 13.871  4.669   -14.144 1.00 11.51 ? 38  PRO D CB   1  
ATOM 7715   C CG   . PRO D 1 38  ? 12.739  5.402   -13.478 1.00 45.11 ? 38  PRO D CG   1  
ATOM 7716   C CD   . PRO D 1 38  ? 11.711  5.631   -14.561 1.00 2.05  ? 38  PRO D CD   1  
ATOM 7717   H HA   . PRO D 1 38  ? 14.666  5.946   -15.722 1.00 10.25 ? 38  PRO D HA   1  
ATOM 7718   H HB2  . PRO D 1 38  ? 13.703  3.590   -14.120 1.00 53.21 ? 38  PRO D HB2  1  
ATOM 7719   H HB3  . PRO D 1 38  ? 14.809  4.899   -13.648 1.00 33.40 ? 38  PRO D HB3  1  
ATOM 7720   H HG2  . PRO D 1 38  ? 12.326  4.802   -12.670 1.00 1.35  ? 38  PRO D HG2  1  
ATOM 7721   H HG3  . PRO D 1 38  ? 13.087  6.355   -13.088 1.00 14.42 ? 38  PRO D HG3  1  
ATOM 7722   H HD2  . PRO D 1 38  ? 11.052  4.772   -14.659 1.00 62.34 ? 38  PRO D HD2  1  
ATOM 7723   H HD3  . PRO D 1 38  ? 11.130  6.524   -14.353 1.00 41.20 ? 38  PRO D HD3  1  
ATOM 7724   N N    . GLU D 1 39  ? 15.434  3.825   -16.950 1.00 32.23 ? 39  GLU D N    1  
ATOM 7725   C CA   . GLU D 1 39  ? 15.841  2.660   -17.754 1.00 4.24  ? 39  GLU D CA   1  
ATOM 7726   C C    . GLU D 1 39  ? 15.751  1.427   -16.850 1.00 41.25 ? 39  GLU D C    1  
ATOM 7727   O O    . GLU D 1 39  ? 16.506  1.317   -15.881 1.00 55.45 ? 39  GLU D O    1  
ATOM 7728   C CB   . GLU D 1 39  ? 17.290  2.818   -18.308 1.00 72.34 ? 39  GLU D CB   1  
ATOM 7729   C CG   . GLU D 1 39  ? 17.602  4.174   -18.975 1.00 74.55 ? 39  GLU D CG   1  
ATOM 7730   C CD   . GLU D 1 39  ? 16.604  4.581   -20.076 1.00 2.43  ? 39  GLU D CD   1  
ATOM 7731   O OE1  . GLU D 1 39  ? 15.691  5.389   -19.801 1.00 33.00 ? 39  GLU D OE1  1  
ATOM 7732   O OE2  . GLU D 1 39  ? 16.727  4.098   -21.219 1.00 24.44 ? 39  GLU D OE2  1  
ATOM 7733   H H    . GLU D 1 39  ? 16.118  4.453   -16.652 1.00 73.25 ? 39  GLU D H    1  
ATOM 7734   H HA   . GLU D 1 39  ? 15.144  2.559   -18.587 1.00 54.33 ? 39  GLU D HA   1  
ATOM 7735   H HB2  . GLU D 1 39  ? 17.993  2.683   -17.492 1.00 40.22 ? 39  GLU D HB2  1  
ATOM 7736   H HB3  . GLU D 1 39  ? 17.469  2.037   -19.040 1.00 31.11 ? 39  GLU D HB3  1  
ATOM 7737   H HG2  . GLU D 1 39  ? 17.604  4.938   -18.205 1.00 12.33 ? 39  GLU D HG2  1  
ATOM 7738   H HG3  . GLU D 1 39  ? 18.599  4.123   -19.407 1.00 21.22 ? 39  GLU D HG3  1  
ATOM 7739   N N    . VAL D 1 40  ? 14.817  0.531   -17.166 1.00 70.52 ? 40  VAL D N    1  
ATOM 7740   C CA   . VAL D 1 40  ? 14.476  -0.625  -16.329 1.00 32.14 ? 40  VAL D CA   1  
ATOM 7741   C C    . VAL D 1 40  ? 15.037  -1.906  -16.961 1.00 4.35  ? 40  VAL D C    1  
ATOM 7742   O O    . VAL D 1 40  ? 14.959  -2.096  -18.174 1.00 73.25 ? 40  VAL D O    1  
ATOM 7743   C CB   . VAL D 1 40  ? 12.916  -0.735  -16.134 1.00 53.03 ? 40  VAL D CB   1  
ATOM 7744   C CG1  . VAL D 1 40  ? 12.524  -1.970  -15.286 1.00 33.53 ? 40  VAL D CG1  1  
ATOM 7745   C CG2  . VAL D 1 40  ? 12.354  0.573   -15.516 1.00 61.40 ? 40  VAL D CG2  1  
ATOM 7746   H H    . VAL D 1 40  ? 14.343  0.639   -18.013 1.00 44.14 ? 40  VAL D H    1  
ATOM 7747   H HA   . VAL D 1 40  ? 14.932  -0.488  -15.346 1.00 72.22 ? 40  VAL D HA   1  
ATOM 7748   H HB   . VAL D 1 40  ? 12.463  -0.856  -17.118 1.00 72.44 ? 40  VAL D HB   1  
ATOM 7749   H HG11 . VAL D 1 40  ? 12.960  -1.890  -14.300 1.00 43.32 ? 40  VAL D HG11 1  
ATOM 7750   H HG12 . VAL D 1 40  ? 12.891  -2.872  -15.762 1.00 4.33  ? 40  VAL D HG12 1  
ATOM 7751   H HG13 . VAL D 1 40  ? 11.447  -2.031  -15.200 1.00 62.42 ? 40  VAL D HG13 1  
ATOM 7752   H HG21 . VAL D 1 40  ? 12.823  0.761   -14.559 1.00 51.22 ? 40  VAL D HG21 1  
ATOM 7753   H HG22 . VAL D 1 40  ? 11.285  0.486   -15.377 1.00 22.23 ? 40  VAL D HG22 1  
ATOM 7754   H HG23 . VAL D 1 40  ? 12.555  1.405   -16.181 1.00 20.52 ? 40  VAL D HG23 1  
ATOM 7755   N N    . LYS D 1 41  ? 15.594  -2.770  -16.114 1.00 53.41 ? 41  LYS D N    1  
ATOM 7756   C CA   . LYS D 1 41  ? 16.234  -4.024  -16.508 1.00 22.14 ? 41  LYS D CA   1  
ATOM 7757   C C    . LYS D 1 41  ? 15.631  -5.149  -15.670 1.00 62.34 ? 41  LYS D C    1  
ATOM 7758   O O    . LYS D 1 41  ? 15.601  -5.055  -14.446 1.00 61.21 ? 41  LYS D O    1  
ATOM 7759   C CB   . LYS D 1 41  ? 17.778  -3.890  -16.304 1.00 4.34  ? 41  LYS D CB   1  
ATOM 7760   C CG   . LYS D 1 41  ? 18.623  -5.195  -16.450 1.00 21.13 ? 41  LYS D CG   1  
ATOM 7761   C CD   . LYS D 1 41  ? 18.895  -5.906  -15.092 1.00 14.55 ? 41  LYS D CD   1  
ATOM 7762   C CE   . LYS D 1 41  ? 19.829  -7.112  -15.225 1.00 5.35  ? 41  LYS D CE   1  
ATOM 7763   N NZ   . LYS D 1 41  ? 19.273  -8.135  -16.138 1.00 34.44 ? 41  LYS D NZ   1  
ATOM 7764   H H    . LYS D 1 41  ? 15.570  -2.553  -15.159 1.00 23.11 ? 41  LYS D H    1  
ATOM 7765   H HA   . LYS D 1 41  ? 16.028  -4.210  -17.561 1.00 55.33 ? 41  LYS D HA   1  
ATOM 7766   H HB2  . LYS D 1 41  ? 18.146  -3.172  -17.028 1.00 53.34 ? 41  LYS D HB2  1  
ATOM 7767   H HB3  . LYS D 1 41  ? 17.958  -3.477  -15.314 1.00 52.31 ? 41  LYS D HB3  1  
ATOM 7768   H HG2  . LYS D 1 41  ? 18.096  -5.884  -17.099 1.00 30.50 ? 41  LYS D HG2  1  
ATOM 7769   H HG3  . LYS D 1 41  ? 19.575  -4.948  -16.906 1.00 54.34 ? 41  LYS D HG3  1  
ATOM 7770   H HD2  . LYS D 1 41  ? 19.345  -5.198  -14.408 1.00 31.40 ? 41  LYS D HD2  1  
ATOM 7771   H HD3  . LYS D 1 41  ? 17.949  -6.242  -14.677 1.00 61.43 ? 41  LYS D HD3  1  
ATOM 7772   H HE2  . LYS D 1 41  ? 20.785  -6.787  -15.612 1.00 64.15 ? 41  LYS D HE2  1  
ATOM 7773   H HE3  . LYS D 1 41  ? 19.972  -7.560  -14.248 1.00 73.35 ? 41  LYS D HE3  1  
ATOM 7774   H HZ1  . LYS D 1 41  ? 19.854  -8.998  -16.112 1.00 73.45 ? 41  LYS D HZ1  1  
ATOM 7775   H HZ2  . LYS D 1 41  ? 19.255  -7.776  -17.110 1.00 44.12 ? 41  LYS D HZ2  1  
ATOM 7776   H HZ3  . LYS D 1 41  ? 18.304  -8.380  -15.857 1.00 45.22 ? 41  LYS D HZ3  1  
ATOM 7777   N N    . LEU D 1 42  ? 15.141  -6.198  -16.333 1.00 4.20  ? 42  LEU D N    1  
ATOM 7778   C CA   . LEU D 1 42  ? 14.592  -7.384  -15.664 1.00 23.21 ? 42  LEU D CA   1  
ATOM 7779   C C    . LEU D 1 42  ? 15.679  -8.472  -15.597 1.00 1.44  ? 42  LEU D C    1  
ATOM 7780   O O    . LEU D 1 42  ? 16.492  -8.602  -16.524 1.00 63.13 ? 42  LEU D O    1  
ATOM 7781   C CB   . LEU D 1 42  ? 13.351  -7.913  -16.426 1.00 60.13 ? 42  LEU D CB   1  
ATOM 7782   C CG   . LEU D 1 42  ? 12.677  -9.198  -15.840 1.00 42.12 ? 42  LEU D CG   1  
ATOM 7783   C CD1  . LEU D 1 42  ? 12.280  -9.013  -14.363 1.00 4.24  ? 42  LEU D CD1  1  
ATOM 7784   C CD2  . LEU D 1 42  ? 11.466  -9.629  -16.685 1.00 4.25  ? 42  LEU D CD2  1  
ATOM 7785   H H    . LEU D 1 42  ? 15.154  -6.178  -17.312 1.00 44.23 ? 42  LEU D H    1  
ATOM 7786   H HA   . LEU D 1 42  ? 14.286  -7.101  -14.647 1.00 43.41 ? 42  LEU D HA   1  
ATOM 7787   H HB2  . LEU D 1 42  ? 12.609  -7.119  -16.453 1.00 24.02 ? 42  LEU D HB2  1  
ATOM 7788   H HB3  . LEU D 1 42  ? 13.648  -8.124  -17.451 1.00 54.03 ? 42  LEU D HB3  1  
ATOM 7789   H HG   . LEU D 1 42  ? 13.397  -10.007 -15.873 1.00 23.31 ? 42  LEU D HG   1  
ATOM 7790   H HD11 . LEU D 1 42  ? 11.583  -8.190  -14.264 1.00 44.03 ? 42  LEU D HD11 1  
ATOM 7791   H HD12 . LEU D 1 42  ? 13.162  -8.808  -13.773 1.00 35.41 ? 42  LEU D HD12 1  
ATOM 7792   H HD13 . LEU D 1 42  ? 11.818  -9.920  -13.995 1.00 22.24 ? 42  LEU D HD13 1  
ATOM 7793   H HD21 . LEU D 1 42  ? 11.786  -9.820  -17.701 1.00 1.13  ? 42  LEU D HD21 1  
ATOM 7794   H HD22 . LEU D 1 42  ? 10.718  -8.846  -16.690 1.00 52.44 ? 42  LEU D HD22 1  
ATOM 7795   H HD23 . LEU D 1 42  ? 11.038  -10.532 -16.274 1.00 70.12 ? 42  LEU D HD23 1  
ATOM 7796   N N    . ASP D 1 43  ? 15.689  -9.232  -14.495 1.00 72.00 ? 43  ASP D N    1  
ATOM 7797   C CA   . ASP D 1 43  ? 16.612  -10.361 -14.294 1.00 2.31  ? 43  ASP D CA   1  
ATOM 7798   C C    . ASP D 1 43  ? 15.882  -11.477 -13.526 1.00 63.02 ? 43  ASP D C    1  
ATOM 7799   O O    . ASP D 1 43  ? 14.940  -11.196 -12.777 1.00 63.01 ? 43  ASP D O    1  
ATOM 7800   C CB   . ASP D 1 43  ? 17.874  -9.897  -13.519 1.00 31.34 ? 43  ASP D CB   1  
ATOM 7801   C CG   . ASP D 1 43  ? 19.057  -10.857 -13.701 1.00 50.24 ? 43  ASP D CG   1  
ATOM 7802   O OD1  . ASP D 1 43  ? 19.880  -10.611 -14.603 1.00 75.32 ? 43  ASP D OD1  1  
ATOM 7803   O OD2  . ASP D 1 43  ? 19.153  -11.866 -12.972 1.00 73.21 ? 43  ASP D OD2  1  
ATOM 7804   H H    . ASP D 1 43  ? 15.042  -9.030  -13.785 1.00 11.40 ? 43  ASP D H    1  
ATOM 7805   H HA   . ASP D 1 43  ? 16.905  -10.741 -15.269 1.00 52.21 ? 43  ASP D HA   1  
ATOM 7806   H HB2  . ASP D 1 43  ? 18.166  -8.911  -13.875 1.00 63.13 ? 43  ASP D HB2  1  
ATOM 7807   H HB3  . ASP D 1 43  ? 17.644  -9.817  -12.460 1.00 53.43 ? 43  ASP D HB3  1  
ATOM 7808   N N    . LEU D 1 44  ? 16.327  -12.736 -13.712 1.00 65.34 ? 44  LEU D N    1  
ATOM 7809   C CA   . LEU D 1 44  ? 15.687  -13.925 -13.105 1.00 45.20 ? 44  LEU D CA   1  
ATOM 7810   C C    . LEU D 1 44  ? 16.734  -14.853 -12.469 1.00 61.33 ? 44  LEU D C    1  
ATOM 7811   O O    . LEU D 1 44  ? 17.855  -14.981 -12.970 1.00 4.22  ? 44  LEU D O    1  
ATOM 7812   C CB   . LEU D 1 44  ? 14.874  -14.721 -14.166 1.00 4.22  ? 44  LEU D CB   1  
ATOM 7813   C CG   . LEU D 1 44  ? 13.657  -13.983 -14.811 1.00 74.11 ? 44  LEU D CG   1  
ATOM 7814   C CD1  . LEU D 1 44  ? 13.010  -14.844 -15.919 1.00 31.22 ? 44  LEU D CD1  1  
ATOM 7815   C CD2  . LEU D 1 44  ? 12.619  -13.559 -13.736 1.00 4.21  ? 44  LEU D CD2  1  
ATOM 7816   H H    . LEU D 1 44  ? 17.131  -12.873 -14.256 1.00 10.44 ? 44  LEU D H    1  
ATOM 7817   H HA   . LEU D 1 44  ? 15.007  -13.588 -12.326 1.00 2.21  ? 44  LEU D HA   1  
ATOM 7818   H HB2  . LEU D 1 44  ? 15.557  -15.006 -14.964 1.00 52.10 ? 44  LEU D HB2  1  
ATOM 7819   H HB3  . LEU D 1 44  ? 14.506  -15.633 -13.705 1.00 53.23 ? 44  LEU D HB3  1  
ATOM 7820   H HG   . LEU D 1 44  ? 14.019  -13.077 -15.285 1.00 51.31 ? 44  LEU D HG   1  
ATOM 7821   H HD11 . LEU D 1 44  ? 13.748  -15.082 -16.674 1.00 63.22 ? 44  LEU D HD11 1  
ATOM 7822   H HD12 . LEU D 1 44  ? 12.203  -14.294 -16.382 1.00 23.14 ? 44  LEU D HD12 1  
ATOM 7823   H HD13 . LEU D 1 44  ? 12.619  -15.763 -15.498 1.00 44.03 ? 44  LEU D HD13 1  
ATOM 7824   H HD21 . LEU D 1 44  ? 13.091  -12.902 -13.015 1.00 74.51 ? 44  LEU D HD21 1  
ATOM 7825   H HD22 . LEU D 1 44  ? 12.236  -14.432 -13.225 1.00 31.51 ? 44  LEU D HD22 1  
ATOM 7826   H HD23 . LEU D 1 44  ? 11.800  -13.033 -14.209 1.00 75.11 ? 44  LEU D HD23 1  
ATOM 7827   N N    . ASP D 1 45  ? 16.326  -15.500 -11.371 1.00 53.33 ? 45  ASP D N    1  
ATOM 7828   C CA   . ASP D 1 45  ? 17.064  -16.598 -10.713 1.00 35.52 ? 45  ASP D CA   1  
ATOM 7829   C C    . ASP D 1 45  ? 16.061  -17.709 -10.363 1.00 72.24 ? 45  ASP D C    1  
ATOM 7830   O O    . ASP D 1 45  ? 14.857  -17.443 -10.185 1.00 1.11  ? 45  ASP D O    1  
ATOM 7831   C CB   . ASP D 1 45  ? 17.829  -16.077 -9.452  1.00 5.23  ? 45  ASP D CB   1  
ATOM 7832   C CG   . ASP D 1 45  ? 18.302  -17.172 -8.463  1.00 75.30 ? 45  ASP D CG   1  
ATOM 7833   O OD1  . ASP D 1 45  ? 17.725  -17.289 -7.354  1.00 52.21 ? 45  ASP D OD1  1  
ATOM 7834   O OD2  . ASP D 1 45  ? 19.241  -17.918 -8.794  1.00 22.42 ? 45  ASP D OD2  1  
ATOM 7835   H H    . ASP D 1 45  ? 15.471  -15.226 -10.973 1.00 73.13 ? 45  ASP D H    1  
ATOM 7836   H HA   . ASP D 1 45  ? 17.782  -16.998 -11.423 1.00 12.12 ? 45  ASP D HA   1  
ATOM 7837   H HB2  . ASP D 1 45  ? 18.705  -15.529 -9.783  1.00 55.51 ? 45  ASP D HB2  1  
ATOM 7838   H HB3  . ASP D 1 45  ? 17.192  -15.385 -8.922  1.00 12.54 ? 45  ASP D HB3  1  
ATOM 7839   N N    . THR D 1 46  ? 16.573  -18.936 -10.251 1.00 41.22 ? 46  THR D N    1  
ATOM 7840   C CA   . THR D 1 46  ? 15.774  -20.134 -9.995  1.00 70.23 ? 46  THR D CA   1  
ATOM 7841   C C    . THR D 1 46  ? 15.900  -20.505 -8.512  1.00 62.43 ? 46  THR D C    1  
ATOM 7842   O O    . THR D 1 46  ? 16.989  -20.430 -7.942  1.00 53.30 ? 46  THR D O    1  
ATOM 7843   C CB   . THR D 1 46  ? 16.311  -21.317 -10.873 1.00 32.44 ? 46  THR D CB   1  
ATOM 7844   O OG1  . THR D 1 46  ? 16.183  -20.990 -12.269 1.00 71.00 ? 46  THR D OG1  1  
ATOM 7845   C CG2  . THR D 1 46  ? 15.611  -22.660 -10.588 1.00 42.40 ? 46  THR D CG2  1  
ATOM 7846   H H    . THR D 1 46  ? 17.541  -19.039 -10.325 1.00 31.15 ? 46  THR D H    1  
ATOM 7847   H HA   . THR D 1 46  ? 14.733  -19.945 -10.255 1.00 72.41 ? 46  THR D HA   1  
ATOM 7848   H HB   . THR D 1 46  ? 17.372  -21.437 -10.660 1.00 45.24 ? 46  THR D HB   1  
ATOM 7849   H HG1  . THR D 1 46  ? 16.948  -21.337 -12.742 1.00 13.54 ? 46  THR D HG1  1  
ATOM 7850   H HG21 . THR D 1 46  ? 15.753  -22.936 -9.549  1.00 23.43 ? 46  THR D HG21 1  
ATOM 7851   H HG22 . THR D 1 46  ? 16.028  -23.434 -11.220 1.00 32.44 ? 46  THR D HG22 1  
ATOM 7852   H HG23 . THR D 1 46  ? 14.556  -22.568 -10.790 1.00 10.53 ? 46  THR D HG23 1  
ATOM 7853   N N    . ALA D 1 47  ? 14.782  -20.933 -7.922  1.00 43.25 ? 47  ALA D N    1  
ATOM 7854   C CA   . ALA D 1 47  ? 14.716  -21.426 -6.541  1.00 22.24 ? 47  ALA D CA   1  
ATOM 7855   C C    . ALA D 1 47  ? 13.372  -22.115 -6.345  1.00 53.01 ? 47  ALA D C    1  
ATOM 7856   O O    . ALA D 1 47  ? 12.368  -21.663 -6.877  1.00 41.25 ? 47  ALA D O    1  
ATOM 7857   C CB   . ALA D 1 47  ? 14.905  -20.297 -5.512  1.00 23.11 ? 47  ALA D CB   1  
ATOM 7858   H H    . ALA D 1 47  ? 13.947  -20.912 -8.442  1.00 54.41 ? 47  ALA D H    1  
ATOM 7859   H HA   . ALA D 1 47  ? 15.514  -22.155 -6.407  1.00 32.33 ? 47  ALA D HA   1  
ATOM 7860   H HB1  . ALA D 1 47  ? 14.245  -19.470 -5.745  1.00 4.24  ? 47  ALA D HB1  1  
ATOM 7861   H HB2  . ALA D 1 47  ? 15.925  -19.961 -5.538  1.00 60.11 ? 47  ALA D HB2  1  
ATOM 7862   H HB3  . ALA D 1 47  ? 14.685  -20.662 -4.517  1.00 71.54 ? 47  ALA D HB3  1  
ATOM 7863   N N    . SER D 1 48  ? 13.366  -23.203 -5.585  1.00 60.24 ? 48  SER D N    1  
ATOM 7864   C CA   . SER D 1 48  ? 12.153  -24.021 -5.360  1.00 22.45 ? 48  SER D CA   1  
ATOM 7865   C C    . SER D 1 48  ? 12.446  -25.148 -4.373  1.00 20.22 ? 48  SER D C    1  
ATOM 7866   O O    . SER D 1 48  ? 13.606  -25.498 -4.172  1.00 61.22 ? 48  SER D O    1  
ATOM 7867   C CB   . SER D 1 48  ? 11.647  -24.603 -6.700  1.00 72.40 ? 48  SER D CB   1  
ATOM 7868   O OG   . SER D 1 48  ? 12.691  -25.250 -7.410  1.00 60.02 ? 48  SER D OG   1  
ATOM 7869   H H    . SER D 1 48  ? 14.208  -23.473 -5.161  1.00 33.04 ? 48  SER D H    1  
ATOM 7870   H HA   . SER D 1 48  ? 11.385  -23.376 -4.938  1.00 31.11 ? 48  SER D HA   1  
ATOM 7871   H HB2  . SER D 1 48  ? 10.858  -25.321 -6.517  1.00 51.12 ? 48  SER D HB2  1  
ATOM 7872   H HB3  . SER D 1 48  ? 11.258  -23.802 -7.316  1.00 0.21  ? 48  SER D HB3  1  
ATOM 7873   H HG   . SER D 1 48  ? 12.823  -26.133 -7.046  1.00 35.55 ? 48  SER D HG   1  
ATOM 7874   N N    . SER D 1 49  ? 11.387  -25.740 -3.796  1.00 1.21  ? 49  SER D N    1  
ATOM 7875   C CA   . SER D 1 49  ? 11.523  -26.823 -2.810  1.00 33.44 ? 49  SER D CA   1  
ATOM 7876   C C    . SER D 1 49  ? 10.276  -27.722 -2.806  1.00 75.54 ? 49  SER D C    1  
ATOM 7877   O O    . SER D 1 49  ? 9.170   -27.261 -3.115  1.00 55.43 ? 49  SER D O    1  
ATOM 7878   C CB   . SER D 1 49  ? 11.769  -26.218 -1.406  1.00 64.42 ? 49  SER D CB   1  
ATOM 7879   O OG   . SER D 1 49  ? 10.713  -25.355 -1.016  1.00 73.53 ? 49  SER D OG   1  
ATOM 7880   H H    . SER D 1 49  ? 10.484  -25.443 -4.045  1.00 35.20 ? 49  SER D H    1  
ATOM 7881   H HA   . SER D 1 49  ? 12.384  -27.430 -3.088  1.00 4.34  ? 49  SER D HA   1  
ATOM 7882   H HB2  . SER D 1 49  ? 11.853  -27.010 -0.673  1.00 13.44 ? 49  SER D HB2  1  
ATOM 7883   H HB3  . SER D 1 49  ? 12.690  -25.648 -1.416  1.00 0.44  ? 49  SER D HB3  1  
ATOM 7884   H HG   . SER D 1 49  ? 10.576  -24.683 -1.698  1.00 42.35 ? 49  SER D HG   1  
ATOM 7885   N N    . GLN D 1 50  ? 10.470  -29.012 -2.473  1.00 32.42 ? 50  GLN D N    1  
ATOM 7886   C CA   . GLN D 1 50  ? 9.371   -29.974 -2.291  1.00 73.12 ? 50  GLN D CA   1  
ATOM 7887   C C    . GLN D 1 50  ? 8.896   -29.910 -0.830  1.00 72.32 ? 50  GLN D C    1  
ATOM 7888   O O    . GLN D 1 50  ? 9.685   -30.156 0.093   1.00 30.40 ? 50  GLN D O    1  
ATOM 7889   C CB   . GLN D 1 50  ? 9.828   -31.413 -2.653  1.00 32.43 ? 50  GLN D CB   1  
ATOM 7890   C CG   . GLN D 1 50  ? 8.713   -32.476 -2.508  1.00 70.20 ? 50  GLN D CG   1  
ATOM 7891   C CD   . GLN D 1 50  ? 9.152   -33.901 -2.853  1.00 52.45 ? 50  GLN D CD   1  
ATOM 7892   O OE1  . GLN D 1 50  ? 10.318  -34.269 -2.702  1.00 43.53 ? 50  GLN D OE1  1  
ATOM 7893   N NE2  . GLN D 1 50  ? 8.212   -34.722 -3.290  1.00 70.21 ? 50  GLN D NE2  1  
ATOM 7894   H H    . GLN D 1 50  ? 11.388  -29.323 -2.330  1.00 62.12 ? 50  GLN D H    1  
ATOM 7895   H HA   . GLN D 1 50  ? 8.551   -29.688 -2.951  1.00 10.51 ? 50  GLN D HA   1  
ATOM 7896   H HB2  . GLN D 1 50  ? 10.179  -31.419 -3.681  1.00 32.32 ? 50  GLN D HB2  1  
ATOM 7897   H HB3  . GLN D 1 50  ? 10.654  -31.692 -2.006  1.00 14.35 ? 50  GLN D HB3  1  
ATOM 7898   H HG2  . GLN D 1 50  ? 8.359   -32.474 -1.484  1.00 53.11 ? 50  GLN D HG2  1  
ATOM 7899   H HG3  . GLN D 1 50  ? 7.892   -32.199 -3.162  1.00 44.31 ? 50  GLN D HG3  1  
ATOM 7900   H HE21 . GLN D 1 50  ? 7.298   -34.381 -3.366  1.00 33.43 ? 50  GLN D HE21 1  
ATOM 7901   H HE22 . GLN D 1 50  ? 8.470   -35.636 -3.521  1.00 65.51 ? 50  GLN D HE22 1  
ATOM 7902   N N    . LEU D 1 51  ? 7.618   -29.564 -0.625  1.00 54.22 ? 51  LEU D N    1  
ATOM 7903   C CA   . LEU D 1 51  ? 7.049   -29.363 0.726   1.00 2.00  ? 51  LEU D CA   1  
ATOM 7904   C C    . LEU D 1 51  ? 6.367   -30.639 1.235   1.00 21.03 ? 51  LEU D C    1  
ATOM 7905   O O    . LEU D 1 51  ? 6.353   -30.906 2.445   1.00 73.13 ? 51  LEU D O    1  
ATOM 7906   C CB   . LEU D 1 51  ? 6.051   -28.178 0.716   1.00 22.31 ? 51  LEU D CB   1  
ATOM 7907   C CG   . LEU D 1 51  ? 6.583   -26.837 0.109   1.00 11.03 ? 51  LEU D CG   1  
ATOM 7908   C CD1  . LEU D 1 51  ? 5.597   -25.685 0.369   1.00 44.41 ? 51  LEU D CD1  1  
ATOM 7909   C CD2  . LEU D 1 51  ? 8.006   -26.484 0.616   1.00 62.41 ? 51  LEU D CD2  1  
ATOM 7910   H H    . LEU D 1 51  ? 7.039   -29.437 -1.404  1.00 4.01  ? 51  LEU D H    1  
ATOM 7911   H HA   . LEU D 1 51  ? 7.864   -29.119 1.404   1.00 31.41 ? 51  LEU D HA   1  
ATOM 7912   H HB2  . LEU D 1 51  ? 5.170   -28.479 0.152   1.00 30.32 ? 51  LEU D HB2  1  
ATOM 7913   H HB3  . LEU D 1 51  ? 5.743   -27.988 1.740   1.00 31.43 ? 51  LEU D HB3  1  
ATOM 7914   H HG   . LEU D 1 51  ? 6.650   -26.953 -0.967  1.00 12.12 ? 51  LEU D HG   1  
ATOM 7915   H HD11 . LEU D 1 51  ? 5.968   -24.775 -0.087  1.00 55.42 ? 51  LEU D HD11 1  
ATOM 7916   H HD12 . LEU D 1 51  ? 5.480   -25.527 1.434   1.00 22.12 ? 51  LEU D HD12 1  
ATOM 7917   H HD13 . LEU D 1 51  ? 4.635   -25.928 -0.062  1.00 35.12 ? 51  LEU D HD13 1  
ATOM 7918   H HD21 . LEU D 1 51  ? 8.696   -27.271 0.339   1.00 71.12 ? 51  LEU D HD21 1  
ATOM 7919   H HD22 . LEU D 1 51  ? 8.002   -26.374 1.690   1.00 53.02 ? 51  LEU D HD22 1  
ATOM 7920   H HD23 . LEU D 1 51  ? 8.333   -25.555 0.164   1.00 73.13 ? 51  LEU D HD23 1  
ATOM 7921   N N    . ALA D 1 52  ? 5.806   -31.412 0.295   1.00 22.02 ? 52  ALA D N    1  
ATOM 7922   C CA   . ALA D 1 52  ? 5.085   -32.659 0.587   1.00 74.33 ? 52  ALA D CA   1  
ATOM 7923   C C    . ALA D 1 52  ? 4.975   -33.525 -0.671  1.00 71.50 ? 52  ALA D C    1  
ATOM 7924   O O    . ALA D 1 52  ? 5.522   -33.189 -1.735  1.00 3.23  ? 52  ALA D O    1  
ATOM 7925   C CB   . ALA D 1 52  ? 3.689   -32.359 1.175   1.00 50.33 ? 52  ALA D CB   1  
ATOM 7926   H H    . ALA D 1 52  ? 5.890   -31.136 -0.641  1.00 75.51 ? 52  ALA D H    1  
ATOM 7927   H HA   . ALA D 1 52  ? 5.654   -33.215 1.327   1.00 61.25 ? 52  ALA D HA   1  
ATOM 7928   H HB1  . ALA D 1 52  ? 3.117   -33.275 1.253   1.00 40.31 ? 52  ALA D HB1  1  
ATOM 7929   H HB2  . ALA D 1 52  ? 3.159   -31.660 0.542   1.00 50.00 ? 52  ALA D HB2  1  
ATOM 7930   H HB3  . ALA D 1 52  ? 3.801   -31.937 2.156   1.00 73.21 ? 52  ALA D HB3  1  
ATOM 7931   N N    . ASP D 1 53  ? 4.253   -34.644 -0.521  1.00 75.44 ? 53  ASP D N    1  
ATOM 7932   C CA   . ASP D 1 53  ? 4.000   -35.607 -1.607  1.00 14.30 ? 53  ASP D CA   1  
ATOM 7933   C C    . ASP D 1 53  ? 3.110   -34.953 -2.670  1.00 33.01 ? 53  ASP D C    1  
ATOM 7934   O O    . ASP D 1 53  ? 1.944   -34.650 -2.394  1.00 1.41  ? 53  ASP D O    1  
ATOM 7935   C CB   . ASP D 1 53  ? 3.323   -36.890 -1.060  1.00 52.44 ? 53  ASP D CB   1  
ATOM 7936   C CG   . ASP D 1 53  ? 4.180   -37.610 -0.014  1.00 23.33 ? 53  ASP D CG   1  
ATOM 7937   O OD1  . ASP D 1 53  ? 4.144   -37.212 1.168   1.00 71.32 ? 53  ASP D OD1  1  
ATOM 7938   O OD2  . ASP D 1 53  ? 4.910   -38.560 -0.368  1.00 73.52 ? 53  ASP D OD2  1  
ATOM 7939   H H    . ASP D 1 53  ? 3.870   -34.822 0.368   1.00 42.12 ? 53  ASP D H    1  
ATOM 7940   H HA   . ASP D 1 53  ? 4.955   -35.873 -2.050  1.00 61.23 ? 53  ASP D HA   1  
ATOM 7941   H HB2  . ASP D 1 53  ? 2.368   -36.629 -0.608  1.00 32.33 ? 53  ASP D HB2  1  
ATOM 7942   H HB3  . ASP D 1 53  ? 3.132   -37.573 -1.886  1.00 22.14 ? 53  ASP D HB3  1  
ATOM 7943   N N    . ASP D 1 54  ? 3.705   -34.674 -3.849  1.00 33.20 ? 54  ASP D N    1  
ATOM 7944   C CA   . ASP D 1 54  ? 3.034   -34.009 -4.996  1.00 64.20 ? 54  ASP D CA   1  
ATOM 7945   C C    . ASP D 1 54  ? 2.657   -32.530 -4.695  1.00 24.42 ? 54  ASP D C    1  
ATOM 7946   O O    . ASP D 1 54  ? 1.989   -31.883 -5.501  1.00 25.24 ? 54  ASP D O    1  
ATOM 7947   C CB   . ASP D 1 54  ? 1.789   -34.813 -5.489  1.00 21.12 ? 54  ASP D CB   1  
ATOM 7948   C CG   . ASP D 1 54  ? 2.137   -36.185 -6.084  1.00 31.52 ? 54  ASP D CG   1  
ATOM 7949   O OD1  . ASP D 1 54  ? 2.448   -36.259 -7.292  1.00 61.40 ? 54  ASP D OD1  1  
ATOM 7950   O OD2  . ASP D 1 54  ? 2.103   -37.191 -5.347  1.00 13.32 ? 54  ASP D OD2  1  
ATOM 7951   H H    . ASP D 1 54  ? 4.644   -34.937 -3.960  1.00 62.44 ? 54  ASP D H    1  
ATOM 7952   H HA   . ASP D 1 54  ? 3.760   -33.993 -5.798  1.00 23.51 ? 54  ASP D HA   1  
ATOM 7953   H HB2  . ASP D 1 54  ? 1.113   -34.955 -4.654  1.00 74.42 ? 54  ASP D HB2  1  
ATOM 7954   H HB3  . ASP D 1 54  ? 1.270   -34.231 -6.247  1.00 31.50 ? 54  ASP D HB3  1  
ATOM 7955   N N    . VAL D 1 55  ? 3.093   -32.001 -3.540  1.00 12.11 ? 55  VAL D N    1  
ATOM 7956   C CA   . VAL D 1 55  ? 2.899   -30.588 -3.170  1.00 11.51 ? 55  VAL D CA   1  
ATOM 7957   C C    . VAL D 1 55  ? 4.275   -29.913 -3.198  1.00 72.42 ? 55  VAL D C    1  
ATOM 7958   O O    . VAL D 1 55  ? 5.191   -30.314 -2.467  1.00 15.45 ? 55  VAL D O    1  
ATOM 7959   C CB   . VAL D 1 55  ? 2.230   -30.426 -1.757  1.00 73.25 ? 55  VAL D CB   1  
ATOM 7960   C CG1  . VAL D 1 55  ? 2.042   -28.931 -1.394  1.00 25.22 ? 55  VAL D CG1  1  
ATOM 7961   C CG2  . VAL D 1 55  ? 0.887   -31.196 -1.684  1.00 24.12 ? 55  VAL D CG2  1  
ATOM 7962   H H    . VAL D 1 55  ? 3.589   -32.572 -2.923  1.00 2.12  ? 55  VAL D H    1  
ATOM 7963   H HA   . VAL D 1 55  ? 2.252   -30.116 -3.915  1.00 70.12 ? 55  VAL D HA   1  
ATOM 7964   H HB   . VAL D 1 55  ? 2.899   -30.860 -1.019  1.00 0.31  ? 55  VAL D HB   1  
ATOM 7965   H HG11 . VAL D 1 55  ? 3.004   -28.429 -1.400  1.00 4.22  ? 55  VAL D HG11 1  
ATOM 7966   H HG12 . VAL D 1 55  ? 1.607   -28.842 -0.411  1.00 11.05 ? 55  VAL D HG12 1  
ATOM 7967   H HG13 . VAL D 1 55  ? 1.390   -28.456 -2.116  1.00 45.11 ? 55  VAL D HG13 1  
ATOM 7968   H HG21 . VAL D 1 55  ? 0.437   -31.063 -0.709  1.00 72.03 ? 55  VAL D HG21 1  
ATOM 7969   H HG22 . VAL D 1 55  ? 1.061   -32.252 -1.852  1.00 10.33 ? 55  VAL D HG22 1  
ATOM 7970   H HG23 . VAL D 1 55  ? 0.212   -30.824 -2.440  1.00 51.04 ? 55  VAL D HG23 1  
ATOM 7971   N N    . TYR D 1 56  ? 4.411   -28.887 -4.036  1.00 45.32 ? 56  TYR D N    1  
ATOM 7972   C CA   . TYR D 1 56  ? 5.713   -28.337 -4.415  1.00 73.41 ? 56  TYR D CA   1  
ATOM 7973   C C    . TYR D 1 56  ? 5.632   -26.806 -4.500  1.00 11.53 ? 56  TYR D C    1  
ATOM 7974   O O    . TYR D 1 56  ? 4.717   -26.264 -5.123  1.00 70.43 ? 56  TYR D O    1  
ATOM 7975   C CB   . TYR D 1 56  ? 6.131   -28.954 -5.780  1.00 23.24 ? 56  TYR D CB   1  
ATOM 7976   C CG   . TYR D 1 56  ? 7.569   -28.646 -6.207  1.00 31.41 ? 56  TYR D CG   1  
ATOM 7977   C CD1  . TYR D 1 56  ? 8.612   -29.523 -5.909  1.00 52.02 ? 56  TYR D CD1  1  
ATOM 7978   C CD2  . TYR D 1 56  ? 7.886   -27.467 -6.883  1.00 33.02 ? 56  TYR D CD2  1  
ATOM 7979   C CE1  . TYR D 1 56  ? 9.907   -29.231 -6.262  1.00 22.41 ? 56  TYR D CE1  1  
ATOM 7980   C CE2  . TYR D 1 56  ? 9.178   -27.179 -7.241  1.00 11.15 ? 56  TYR D CE2  1  
ATOM 7981   C CZ   . TYR D 1 56  ? 10.181  -28.059 -6.927  1.00 64.05 ? 56  TYR D CZ   1  
ATOM 7982   O OH   . TYR D 1 56  ? 11.467  -27.758 -7.269  1.00 51.43 ? 56  TYR D OH   1  
ATOM 7983   H H    . TYR D 1 56  ? 3.603   -28.476 -4.409  1.00 12.40 ? 56  TYR D H    1  
ATOM 7984   H HA   . TYR D 1 56  ? 6.447   -28.616 -3.659  1.00 52.33 ? 56  TYR D HA   1  
ATOM 7985   H HB2  . TYR D 1 56  ? 6.027   -30.032 -5.723  1.00 74.21 ? 56  TYR D HB2  1  
ATOM 7986   H HB3  . TYR D 1 56  ? 5.464   -28.591 -6.556  1.00 53.43 ? 56  TYR D HB3  1  
ATOM 7987   H HD1  . TYR D 1 56  ? 8.394   -30.447 -5.388  1.00 74.41 ? 56  TYR D HD1  1  
ATOM 7988   H HD2  . TYR D 1 56  ? 7.093   -26.773 -7.136  1.00 12.31 ? 56  TYR D HD2  1  
ATOM 7989   H HE1  . TYR D 1 56  ? 10.704  -29.924 -6.022  1.00 3.42  ? 56  TYR D HE1  1  
ATOM 7990   H HE2  . TYR D 1 56  ? 9.402   -26.258 -7.766  1.00 4.33  ? 56  TYR D HE2  1  
ATOM 7991   H HH   . TYR D 1 56  ? 11.771  -28.390 -7.921  1.00 22.14 ? 56  TYR D HH   1  
ATOM 7992   N N    . GLU D 1 57  ? 6.601   -26.130 -3.870  1.00 51.31 ? 57  GLU D N    1  
ATOM 7993   C CA   . GLU D 1 57  ? 6.743   -24.670 -3.920  1.00 64.23 ? 57  GLU D CA   1  
ATOM 7994   C C    . GLU D 1 57  ? 7.692   -24.259 -5.062  1.00 63.11 ? 57  GLU D C    1  
ATOM 7995   O O    . GLU D 1 57  ? 8.777   -24.822 -5.206  1.00 4.14  ? 57  GLU D O    1  
ATOM 7996   C CB   . GLU D 1 57  ? 7.318   -24.143 -2.595  1.00 73.11 ? 57  GLU D CB   1  
ATOM 7997   C CG   . GLU D 1 57  ? 7.559   -22.615 -2.593  1.00 44.43 ? 57  GLU D CG   1  
ATOM 7998   C CD   . GLU D 1 57  ? 8.605   -22.171 -1.583  1.00 1.03  ? 57  GLU D CD   1  
ATOM 7999   O OE1  . GLU D 1 57  ? 9.755   -22.663 -1.648  1.00 10.24 ? 57  GLU D OE1  1  
ATOM 8000   O OE2  . GLU D 1 57  ? 8.321   -21.293 -0.760  1.00 22.13 ? 57  GLU D OE2  1  
ATOM 8001   H H    . GLU D 1 57  ? 7.258   -26.635 -3.351  1.00 71.35 ? 57  GLU D H    1  
ATOM 8002   H HA   . GLU D 1 57  ? 5.758   -24.229 -4.078  1.00 14.53 ? 57  GLU D HA   1  
ATOM 8003   H HB2  . GLU D 1 57  ? 6.629   -24.386 -1.794  1.00 22.01 ? 57  GLU D HB2  1  
ATOM 8004   H HB3  . GLU D 1 57  ? 8.264   -24.645 -2.397  1.00 4.40  ? 57  GLU D HB3  1  
ATOM 8005   H HG2  . GLU D 1 57  ? 7.896   -22.308 -3.576  1.00 54.54 ? 57  GLU D HG2  1  
ATOM 8006   H HG3  . GLU D 1 57  ? 6.619   -22.115 -2.381  1.00 43.12 ? 57  GLU D HG3  1  
ATOM 8007   N N    . VAL D 1 58  ? 7.280   -23.240 -5.820  1.00 72.52 ? 58  VAL D N    1  
ATOM 8008   C CA   . VAL D 1 58  ? 8.043   -22.646 -6.928  1.00 63.31 ? 58  VAL D CA   1  
ATOM 8009   C C    . VAL D 1 58  ? 8.341   -21.180 -6.580  1.00 43.14 ? 58  VAL D C    1  
ATOM 8010   O O    . VAL D 1 58  ? 7.427   -20.450 -6.206  1.00 11.52 ? 58  VAL D O    1  
ATOM 8011   C CB   . VAL D 1 58  ? 7.198   -22.732 -8.250  1.00 50.33 ? 58  VAL D CB   1  
ATOM 8012   C CG1  . VAL D 1 58  ? 7.904   -22.050 -9.442  1.00 2.11  ? 58  VAL D CG1  1  
ATOM 8013   C CG2  . VAL D 1 58  ? 6.847   -24.204 -8.564  1.00 35.22 ? 58  VAL D CG2  1  
ATOM 8014   H H    . VAL D 1 58  ? 6.410   -22.851 -5.620  1.00 31.24 ? 58  VAL D H    1  
ATOM 8015   H HA   . VAL D 1 58  ? 8.978   -23.194 -7.065  1.00 75.24 ? 58  VAL D HA   1  
ATOM 8016   H HB   . VAL D 1 58  ? 6.261   -22.203 -8.080  1.00 11.13 ? 58  VAL D HB   1  
ATOM 8017   H HG11 . VAL D 1 58  ? 8.107   -21.013 -9.199  1.00 73.43 ? 58  VAL D HG11 1  
ATOM 8018   H HG12 . VAL D 1 58  ? 7.270   -22.088 -10.317 1.00 13.21 ? 58  VAL D HG12 1  
ATOM 8019   H HG13 . VAL D 1 58  ? 8.836   -22.555 -9.653  1.00 72.24 ? 58  VAL D HG13 1  
ATOM 8020   H HG21 . VAL D 1 58  ? 7.754   -24.770 -8.738  1.00 63.13 ? 58  VAL D HG21 1  
ATOM 8021   H HG22 . VAL D 1 58  ? 6.222   -24.255 -9.445  1.00 51.13 ? 58  VAL D HG22 1  
ATOM 8022   H HG23 . VAL D 1 58  ? 6.312   -24.638 -7.728  1.00 61.05 ? 58  VAL D HG23 1  
ATOM 8023   N N    . VAL D 1 59  ? 9.614   -20.760 -6.678  1.00 43.23 ? 59  VAL D N    1  
ATOM 8024   C CA   . VAL D 1 59  ? 10.044  -19.377 -6.361  1.00 32.54 ? 59  VAL D CA   1  
ATOM 8025   C C    . VAL D 1 59  ? 10.795  -18.786 -7.557  1.00 61.34 ? 59  VAL D C    1  
ATOM 8026   O O    . VAL D 1 59  ? 11.697  -19.420 -8.112  1.00 32.33 ? 59  VAL D O    1  
ATOM 8027   C CB   . VAL D 1 59  ? 10.996  -19.311 -5.106  1.00 64.13 ? 59  VAL D CB   1  
ATOM 8028   C CG1  . VAL D 1 59  ? 11.300  -17.843 -4.708  1.00 64.20 ? 59  VAL D CG1  1  
ATOM 8029   C CG2  . VAL D 1 59  ? 10.430  -20.120 -3.920  1.00 20.42 ? 59  VAL D CG2  1  
ATOM 8030   H H    . VAL D 1 59  ? 10.296  -21.395 -6.985  1.00 45.34 ? 59  VAL D H    1  
ATOM 8031   H HA   . VAL D 1 59  ? 9.159   -18.774 -6.156  1.00 33.51 ? 59  VAL D HA   1  
ATOM 8032   H HB   . VAL D 1 59  ? 11.945  -19.773 -5.386  1.00 13.21 ? 59  VAL D HB   1  
ATOM 8033   H HG11 . VAL D 1 59  ? 12.066  -17.821 -3.950  1.00 21.11 ? 59  VAL D HG11 1  
ATOM 8034   H HG12 . VAL D 1 59  ? 10.405  -17.371 -4.327  1.00 3.32  ? 59  VAL D HG12 1  
ATOM 8035   H HG13 . VAL D 1 59  ? 11.647  -17.294 -5.577  1.00 22.32 ? 59  VAL D HG13 1  
ATOM 8036   H HG21 . VAL D 1 59  ? 11.134  -20.109 -3.102  1.00 24.14 ? 59  VAL D HG21 1  
ATOM 8037   H HG22 . VAL D 1 59  ? 10.255  -21.145 -4.221  1.00 24.25 ? 59  VAL D HG22 1  
ATOM 8038   H HG23 . VAL D 1 59  ? 9.500   -19.685 -3.582  1.00 44.21 ? 59  VAL D HG23 1  
ATOM 8039   N N    . LEU D 1 60  ? 10.419  -17.573 -7.962  1.00 25.54 ? 60  LEU D N    1  
ATOM 8040   C CA   . LEU D 1 60  ? 11.141  -16.816 -8.991  1.00 3.15  ? 60  LEU D CA   1  
ATOM 8041   C C    . LEU D 1 60  ? 11.676  -15.530 -8.379  1.00 1.30  ? 60  LEU D C    1  
ATOM 8042   O O    . LEU D 1 60  ? 10.901  -14.714 -7.855  1.00 45.33 ? 60  LEU D O    1  
ATOM 8043   C CB   . LEU D 1 60  ? 10.237  -16.514 -10.228 1.00 30.03 ? 60  LEU D CB   1  
ATOM 8044   C CG   . LEU D 1 60  ? 10.130  -17.652 -11.298 1.00 2.22  ? 60  LEU D CG   1  
ATOM 8045   C CD1  . LEU D 1 60  ? 11.511  -17.969 -11.928 1.00 25.14 ? 60  LEU D CD1  1  
ATOM 8046   C CD2  . LEU D 1 60  ? 9.469   -18.929 -10.717 1.00 3.34  ? 60  LEU D CD2  1  
ATOM 8047   H H    . LEU D 1 60  ? 9.628   -17.166 -7.552  1.00 30.12 ? 60  LEU D H    1  
ATOM 8048   H HA   . LEU D 1 60  ? 11.989  -17.418 -9.319  1.00 44.25 ? 60  LEU D HA   1  
ATOM 8049   H HB2  . LEU D 1 60  ? 9.237   -16.287 -9.870  1.00 1.30  ? 60  LEU D HB2  1  
ATOM 8050   H HB3  . LEU D 1 60  ? 10.616  -15.625 -10.728 1.00 5.15  ? 60  LEU D HB3  1  
ATOM 8051   H HG   . LEU D 1 60  ? 9.492   -17.302 -12.104 1.00 74.12 ? 60  LEU D HG   1  
ATOM 8052   H HD11 . LEU D 1 60  ? 11.404  -18.741 -12.680 1.00 43.55 ? 60  LEU D HD11 1  
ATOM 8053   H HD12 . LEU D 1 60  ? 12.199  -18.310 -11.164 1.00 41.21 ? 60  LEU D HD12 1  
ATOM 8054   H HD13 . LEU D 1 60  ? 11.912  -17.077 -12.393 1.00 12.24 ? 60  LEU D HD13 1  
ATOM 8055   H HD21 . LEU D 1 60  ? 8.494   -18.683 -10.313 1.00 24.42 ? 60  LEU D HD21 1  
ATOM 8056   H HD22 . LEU D 1 60  ? 10.086  -19.345 -9.933  1.00 72.52 ? 60  LEU D HD22 1  
ATOM 8057   H HD23 . LEU D 1 60  ? 9.348   -19.664 -11.502 1.00 3.14  ? 60  LEU D HD23 1  
ATOM 8058   N N    . ARG D 1 61  ? 13.004  -15.367 -8.438  1.00 32.33 ? 61  ARG D N    1  
ATOM 8059   C CA   . ARG D 1 61  ? 13.665  -14.133 -8.044  1.00 61.14 ? 61  ARG D CA   1  
ATOM 8060   C C    . ARG D 1 61  ? 13.600  -13.177 -9.233  1.00 61.20 ? 61  ARG D C    1  
ATOM 8061   O O    . ARG D 1 61  ? 14.384  -13.285 -10.180 1.00 20.14 ? 61  ARG D O    1  
ATOM 8062   C CB   . ARG D 1 61  ? 15.133  -14.387 -7.629  1.00 12.31 ? 61  ARG D CB   1  
ATOM 8063   C CG   . ARG D 1 61  ? 15.892  -13.120 -7.153  1.00 0.43  ? 61  ARG D CG   1  
ATOM 8064   C CD   . ARG D 1 61  ? 17.399  -13.353 -6.948  1.00 24.12 ? 61  ARG D CD   1  
ATOM 8065   N NE   . ARG D 1 61  ? 17.671  -14.507 -6.080  1.00 24.13 ? 61  ARG D NE   1  
ATOM 8066   C CZ   . ARG D 1 61  ? 17.966  -14.459 -4.773  1.00 31.30 ? 61  ARG D CZ   1  
ATOM 8067   N NH1  . ARG D 1 61  ? 18.014  -13.300 -4.112  1.00 0.02  ? 61  ARG D NH1  1  
ATOM 8068   N NH2  . ARG D 1 61  ? 18.162  -15.597 -4.124  1.00 51.43 ? 61  ARG D NH2  1  
ATOM 8069   H H    . ARG D 1 61  ? 13.552  -16.109 -8.773  1.00 21.24 ? 61  ARG D H    1  
ATOM 8070   H HA   . ARG D 1 61  ? 13.123  -13.703 -7.205  1.00 61.13 ? 61  ARG D HA   1  
ATOM 8071   H HB2  . ARG D 1 61  ? 15.145  -15.116 -6.822  1.00 25.02 ? 61  ARG D HB2  1  
ATOM 8072   H HB3  . ARG D 1 61  ? 15.659  -14.805 -8.474  1.00 1.11  ? 61  ARG D HB3  1  
ATOM 8073   H HG2  . ARG D 1 61  ? 15.762  -12.336 -7.891  1.00 44.21 ? 61  ARG D HG2  1  
ATOM 8074   H HG3  . ARG D 1 61  ? 15.461  -12.788 -6.214  1.00 24.05 ? 61  ARG D HG3  1  
ATOM 8075   H HD2  . ARG D 1 61  ? 17.856  -13.536 -7.913  1.00 4.43  ? 61  ARG D HD2  1  
ATOM 8076   H HD3  . ARG D 1 61  ? 17.840  -12.462 -6.513  1.00 74.33 ? 61  ARG D HD3  1  
ATOM 8077   H HE   . ARG D 1 61  ? 17.634  -15.389 -6.508  1.00 20.21 ? 61  ARG D HE   1  
ATOM 8078   H HH11 . ARG D 1 61  ? 17.839  -12.434 -4.593  1.00 43.33 ? 61  ARG D HH11 1  
ATOM 8079   H HH12 . ARG D 1 61  ? 18.231  -13.287 -3.130  1.00 65.34 ? 61  ARG D HH12 1  
ATOM 8080   H HH21 . ARG D 1 61  ? 18.101  -16.472 -4.613  1.00 0.34  ? 61  ARG D HH21 1  
ATOM 8081   H HH22 . ARG D 1 61  ? 18.381  -15.594 -3.147  1.00 25.52 ? 61  ARG D HH22 1  
ATOM 8082   N N    . VAL D 1 62  ? 12.601  -12.305 -9.195  1.00 71.23 ? 62  VAL D N    1  
ATOM 8083   C CA   . VAL D 1 62  ? 12.399  -11.261 -10.188 1.00 60.34 ? 62  VAL D CA   1  
ATOM 8084   C C    . VAL D 1 62  ? 13.145  -10.017 -9.722  1.00 2.44  ? 62  VAL D C    1  
ATOM 8085   O O    . VAL D 1 62  ? 12.977  -9.585  -8.584  1.00 4.40  ? 62  VAL D O    1  
ATOM 8086   C CB   . VAL D 1 62  ? 10.869  -10.947 -10.362 1.00 51.42 ? 62  VAL D CB   1  
ATOM 8087   C CG1  . VAL D 1 62  ? 10.642  -9.754  -11.328 1.00 71.31 ? 62  VAL D CG1  1  
ATOM 8088   C CG2  . VAL D 1 62  ? 10.118  -12.227 -10.821 1.00 62.42 ? 62  VAL D CG2  1  
ATOM 8089   H H    . VAL D 1 62  ? 11.967  -12.363 -8.453  1.00 61.14 ? 62  VAL D H    1  
ATOM 8090   H HA   . VAL D 1 62  ? 12.798  -11.594 -11.147 1.00 32.34 ? 62  VAL D HA   1  
ATOM 8091   H HB   . VAL D 1 62  ? 10.473  -10.662 -9.388  1.00 60.32 ? 62  VAL D HB   1  
ATOM 8092   H HG11 . VAL D 1 62  ? 9.682   -9.306  -11.157 1.00 53.24 ? 62  VAL D HG11 1  
ATOM 8093   H HG12 . VAL D 1 62  ? 10.704  -10.087 -12.352 1.00 74.34 ? 62  VAL D HG12 1  
ATOM 8094   H HG13 . VAL D 1 62  ? 11.394  -9.007  -11.157 1.00 41.42 ? 62  VAL D HG13 1  
ATOM 8095   H HG21 . VAL D 1 62  ? 10.611  -12.648 -11.684 1.00 11.11 ? 62  VAL D HG21 1  
ATOM 8096   H HG22 . VAL D 1 62  ? 9.094   -11.985 -11.080 1.00 52.12 ? 62  VAL D HG22 1  
ATOM 8097   H HG23 . VAL D 1 62  ? 10.115  -12.958 -10.020 1.00 70.23 ? 62  VAL D HG23 1  
ATOM 8098   N N    . THR D 1 63  ? 13.975  -9.459  -10.596 1.00 22.23 ? 63  THR D N    1  
ATOM 8099   C CA   . THR D 1 63  ? 14.810  -8.308  -10.267 1.00 30.15 ? 63  THR D CA   1  
ATOM 8100   C C    . THR D 1 63  ? 14.571  -7.189  -11.275 1.00 23.25 ? 63  THR D C    1  
ATOM 8101   O O    . THR D 1 63  ? 14.454  -7.438  -12.472 1.00 41.23 ? 63  THR D O    1  
ATOM 8102   C CB   . THR D 1 63  ? 16.320  -8.700  -10.267 1.00 60.44 ? 63  THR D CB   1  
ATOM 8103   O OG1  . THR D 1 63  ? 16.522  -9.842  -9.421  1.00 51.41 ? 63  THR D OG1  1  
ATOM 8104   C CG2  . THR D 1 63  ? 17.229  -7.542  -9.809  1.00 1.33  ? 63  THR D CG2  1  
ATOM 8105   H H    . THR D 1 63  ? 14.026  -9.834  -11.497 1.00 34.52 ? 63  THR D H    1  
ATOM 8106   H HA   . THR D 1 63  ? 14.534  -7.956  -9.273  1.00 54.34 ? 63  THR D HA   1  
ATOM 8107   H HB   . THR D 1 63  ? 16.602  -8.977  -11.277 1.00 12.25 ? 63  THR D HB   1  
ATOM 8108   H HG1  . THR D 1 63  ? 16.463  -9.574  -8.499  1.00 70.35 ? 63  THR D HG1  1  
ATOM 8109   H HG21 . THR D 1 63  ? 18.258  -7.790  -10.010 1.00 11.40 ? 63  THR D HG21 1  
ATOM 8110   H HG22 . THR D 1 63  ? 17.104  -7.373  -8.748  1.00 64.32 ? 63  THR D HG22 1  
ATOM 8111   H HG23 . THR D 1 63  ? 16.973  -6.635  -10.346 1.00 14.55 ? 63  THR D HG23 1  
ATOM 8112   N N    . VAL D 1 64  ? 14.522  -5.960  -10.764 1.00 50.20 ? 64  VAL D N    1  
ATOM 8113   C CA   . VAL D 1 64  ? 14.315  -4.746  -11.550 1.00 74.34 ? 64  VAL D CA   1  
ATOM 8114   C C    . VAL D 1 64  ? 15.419  -3.738  -11.193 1.00 2.24  ? 64  VAL D C    1  
ATOM 8115   O O    . VAL D 1 64  ? 15.399  -3.126  -10.125 1.00 14.51 ? 64  VAL D O    1  
ATOM 8116   C CB   . VAL D 1 64  ? 12.861  -4.158  -11.304 1.00 74.51 ? 64  VAL D CB   1  
ATOM 8117   C CG1  . VAL D 1 64  ? 12.726  -2.670  -11.745 1.00 24.52 ? 64  VAL D CG1  1  
ATOM 8118   C CG2  . VAL D 1 64  ? 11.787  -5.070  -11.973 1.00 71.54 ? 64  VAL D CG2  1  
ATOM 8119   H H    . VAL D 1 64  ? 14.640  -5.861  -9.799  1.00 44.34 ? 64  VAL D H    1  
ATOM 8120   H HA   . VAL D 1 64  ? 14.411  -5.004  -12.601 1.00 41.13 ? 64  VAL D HA   1  
ATOM 8121   H HB   . VAL D 1 64  ? 12.679  -4.185  -10.230 1.00 72.44 ? 64  VAL D HB   1  
ATOM 8122   H HG11 . VAL D 1 64  ? 13.270  -2.038  -11.050 1.00 1.43  ? 64  VAL D HG11 1  
ATOM 8123   H HG12 . VAL D 1 64  ? 11.688  -2.373  -11.750 1.00 60.54 ? 64  VAL D HG12 1  
ATOM 8124   H HG13 . VAL D 1 64  ? 13.143  -2.534  -12.733 1.00 42.04 ? 64  VAL D HG13 1  
ATOM 8125   H HG21 . VAL D 1 64  ? 10.805  -4.665  -11.812 1.00 52.45 ? 64  VAL D HG21 1  
ATOM 8126   H HG22 . VAL D 1 64  ? 11.821  -6.064  -11.540 1.00 32.22 ? 64  VAL D HG22 1  
ATOM 8127   H HG23 . VAL D 1 64  ? 11.962  -5.142  -13.029 1.00 50.02 ? 64  VAL D HG23 1  
ATOM 8128   N N    . THR D 1 65  ? 16.419  -3.629  -12.075 1.00 72.34 ? 65  THR D N    1  
ATOM 8129   C CA   . THR D 1 65  ? 17.470  -2.624  -11.968 1.00 52.21 ? 65  THR D CA   1  
ATOM 8130   C C    . THR D 1 65  ? 17.057  -1.398  -12.795 1.00 53.25 ? 65  THR D C    1  
ATOM 8131   O O    . THR D 1 65  ? 16.969  -1.468  -14.021 1.00 50.14 ? 65  THR D O    1  
ATOM 8132   C CB   . THR D 1 65  ? 18.837  -3.173  -12.483 1.00 12.21 ? 65  THR D CB   1  
ATOM 8133   O OG1  . THR D 1 65  ? 19.102  -4.460  -11.891 1.00 2.24  ? 65  THR D OG1  1  
ATOM 8134   C CG2  . THR D 1 65  ? 19.991  -2.205  -12.162 1.00 35.44 ? 65  THR D CG2  1  
ATOM 8135   H H    . THR D 1 65  ? 16.453  -4.254  -12.826 1.00 0.43  ? 65  THR D H    1  
ATOM 8136   H HA   . THR D 1 65  ? 17.583  -2.343  -10.917 1.00 52.42 ? 65  THR D HA   1  
ATOM 8137   H HB   . THR D 1 65  ? 18.780  -3.304  -13.560 1.00 62.20 ? 65  THR D HB   1  
ATOM 8138   H HG1  . THR D 1 65  ? 18.624  -4.533  -11.058 1.00 63.31 ? 65  THR D HG1  1  
ATOM 8139   H HG21 . THR D 1 65  ? 20.908  -2.591  -12.565 1.00 53.20 ? 65  THR D HG21 1  
ATOM 8140   H HG22 . THR D 1 65  ? 20.090  -2.096  -11.091 1.00 2.41  ? 65  THR D HG22 1  
ATOM 8141   H HG23 . THR D 1 65  ? 19.788  -1.236  -12.602 1.00 52.33 ? 65  THR D HG23 1  
ATOM 8142   N N    . ALA D 1 66  ? 16.790  -0.297  -12.108 1.00 62.11 ? 66  ALA D N    1  
ATOM 8143   C CA   . ALA D 1 66  ? 16.311  0.947   -12.720 1.00 30.41 ? 66  ALA D CA   1  
ATOM 8144   C C    . ALA D 1 66  ? 17.350  2.036   -12.516 1.00 2.21  ? 66  ALA D C    1  
ATOM 8145   O O    . ALA D 1 66  ? 17.964  2.118   -11.440 1.00 3.51  ? 66  ALA D O    1  
ATOM 8146   C CB   . ALA D 1 66  ? 14.970  1.353   -12.114 1.00 40.11 ? 66  ALA D CB   1  
ATOM 8147   H H    . ALA D 1 66  ? 16.956  -0.308  -11.142 1.00 41.42 ? 66  ALA D H    1  
ATOM 8148   H HA   . ALA D 1 66  ? 16.165  0.785   -13.789 1.00 4.03  ? 66  ALA D HA   1  
ATOM 8149   H HB1  . ALA D 1 66  ? 14.225  0.626   -12.365 1.00 5.50  ? 66  ALA D HB1  1  
ATOM 8150   H HB2  . ALA D 1 66  ? 14.662  2.319   -12.494 1.00 71.41 ? 66  ALA D HB2  1  
ATOM 8151   H HB3  . ALA D 1 66  ? 15.053  1.401   -11.038 1.00 22.25 ? 66  ALA D HB3  1  
ATOM 8152   N N    . SER D 1 67  ? 17.540  2.876   -13.542 1.00 12.20 ? 67  SER D N    1  
ATOM 8153   C CA   . SER D 1 67  ? 18.540  3.942   -13.513 1.00 4.34  ? 67  SER D CA   1  
ATOM 8154   C C    . SER D 1 67  ? 18.087  5.154   -14.346 1.00 73.22 ? 67  SER D C    1  
ATOM 8155   O O    . SER D 1 67  ? 17.717  5.018   -15.515 1.00 13.21 ? 67  SER D O    1  
ATOM 8156   C CB   . SER D 1 67  ? 19.899  3.388   -14.011 1.00 32.51 ? 67  SER D CB   1  
ATOM 8157   O OG   . SER D 1 67  ? 19.783  2.815   -15.302 1.00 74.41 ? 67  SER D OG   1  
ATOM 8158   H H    . SER D 1 67  ? 17.006  2.758   -14.357 1.00 41.44 ? 67  SER D H    1  
ATOM 8159   H HA   . SER D 1 67  ? 18.645  4.268   -12.475 1.00 65.13 ? 67  SER D HA   1  
ATOM 8160   H HB2  . SER D 1 67  ? 20.628  4.186   -14.053 1.00 74.35 ? 67  SER D HB2  1  
ATOM 8161   H HB3  . SER D 1 67  ? 20.248  2.627   -13.324 1.00 60.13 ? 67  SER D HB3  1  
ATOM 8162   H HG   . SER D 1 67  ? 19.597  1.870   -15.221 1.00 74.45 ? 67  SER D HG   1  
ATOM 8163   N N    . LEU D 1 68  ? 18.111  6.331   -13.706 1.00 10.40 ? 68  LEU D N    1  
ATOM 8164   C CA   . LEU D 1 68  ? 17.798  7.624   -14.332 1.00 51.52 ? 68  LEU D CA   1  
ATOM 8165   C C    . LEU D 1 68  ? 19.100  8.278   -14.809 1.00 53.21 ? 68  LEU D C    1  
ATOM 8166   O O    . LEU D 1 68  ? 19.980  8.595   -13.986 1.00 64.52 ? 68  LEU D O    1  
ATOM 8167   C CB   . LEU D 1 68  ? 17.045  8.518   -13.312 1.00 43.11 ? 68  LEU D CB   1  
ATOM 8168   C CG   . LEU D 1 68  ? 15.548  8.134   -13.072 1.00 14.43 ? 68  LEU D CG   1  
ATOM 8169   C CD1  . LEU D 1 68  ? 15.003  8.693   -11.743 1.00 73.22 ? 68  LEU D CD1  1  
ATOM 8170   C CD2  . LEU D 1 68  ? 14.676  8.579   -14.254 1.00 3.55  ? 68  LEU D CD2  1  
ATOM 8171   H H    . LEU D 1 68  ? 18.377  6.336   -12.761 1.00 20.21 ? 68  LEU D H    1  
ATOM 8172   H HA   . LEU D 1 68  ? 17.150  7.447   -15.189 1.00 42.11 ? 68  LEU D HA   1  
ATOM 8173   H HB2  . LEU D 1 68  ? 17.574  8.457   -12.366 1.00 74.43 ? 68  LEU D HB2  1  
ATOM 8174   H HB3  . LEU D 1 68  ? 17.084  9.549   -13.648 1.00 22.13 ? 68  LEU D HB3  1  
ATOM 8175   H HG   . LEU D 1 68  ? 15.475  7.056   -13.010 1.00 13.44 ? 68  LEU D HG   1  
ATOM 8176   H HD11 . LEU D 1 68  ? 15.096  9.759   -11.725 1.00 15.23 ? 68  LEU D HD11 1  
ATOM 8177   H HD12 . LEU D 1 68  ? 15.576  8.283   -10.929 1.00 43.34 ? 68  LEU D HD12 1  
ATOM 8178   H HD13 . LEU D 1 68  ? 13.965  8.414   -11.623 1.00 42.00 ? 68  LEU D HD13 1  
ATOM 8179   H HD21 . LEU D 1 68  ? 14.718  9.658   -14.362 1.00 61.43 ? 68  LEU D HD21 1  
ATOM 8180   H HD22 . LEU D 1 68  ? 13.652  8.276   -14.084 1.00 22.42 ? 68  LEU D HD22 1  
ATOM 8181   H HD23 . LEU D 1 68  ? 15.034  8.115   -15.161 1.00 21.31 ? 68  LEU D HD23 1  
ATOM 8182   N N    . GLY D 1 69  ? 19.228  8.445   -16.137 1.00 40.01 ? 69  GLY D N    1  
ATOM 8183   C CA   . GLY D 1 69  ? 20.444  8.972   -16.738 1.00 72.43 ? 69  GLY D CA   1  
ATOM 8184   C C    . GLY D 1 69  ? 21.566  7.945   -16.718 1.00 64.52 ? 69  GLY D C    1  
ATOM 8185   O O    . GLY D 1 69  ? 21.477  6.917   -17.395 1.00 52.44 ? 69  GLY D O    1  
ATOM 8186   H H    . GLY D 1 69  ? 18.479  8.195   -16.719 1.00 24.32 ? 69  GLY D H    1  
ATOM 8187   H HA2  . GLY D 1 69  ? 20.228  9.240   -17.766 1.00 74.53 ? 69  GLY D HA2  1  
ATOM 8188   H HA3  . GLY D 1 69  ? 20.756  9.864   -16.208 1.00 4.42  ? 69  GLY D HA3  1  
ATOM 8189   N N    . GLU D 1 70  ? 22.606  8.212   -15.913 1.00 32.50 ? 70  GLU D N    1  
ATOM 8190   C CA   . GLU D 1 70  ? 23.802  7.348   -15.803 1.00 64.21 ? 70  GLU D CA   1  
ATOM 8191   C C    . GLU D 1 70  ? 24.009  6.879   -14.348 1.00 13.24 ? 70  GLU D C    1  
ATOM 8192   O O    . GLU D 1 70  ? 25.059  6.321   -14.018 1.00 64.14 ? 70  GLU D O    1  
ATOM 8193   C CB   . GLU D 1 70  ? 25.075  8.090   -16.338 1.00 62.43 ? 70  GLU D CB   1  
ATOM 8194   C CG   . GLU D 1 70  ? 25.598  9.268   -15.479 1.00 31.52 ? 70  GLU D CG   1  
ATOM 8195   C CD   . GLU D 1 70  ? 24.586  10.408  -15.302 1.00 22.54 ? 70  GLU D CD   1  
ATOM 8196   O OE1  . GLU D 1 70  ? 24.315  11.135  -16.282 1.00 64.12 ? 70  GLU D OE1  1  
ATOM 8197   O OE2  . GLU D 1 70  ? 24.037  10.562  -14.194 1.00 72.05 ? 70  GLU D OE2  1  
ATOM 8198   H H    . GLU D 1 70  ? 22.564  9.015   -15.356 1.00 24.02 ? 70  GLU D H    1  
ATOM 8199   H HA   . GLU D 1 70  ? 23.638  6.461   -16.413 1.00 15.30 ? 70  GLU D HA   1  
ATOM 8200   H HB2  . GLU D 1 70  ? 25.879  7.367   -16.429 1.00 42.21 ? 70  GLU D HB2  1  
ATOM 8201   H HB3  . GLU D 1 70  ? 24.858  8.471   -17.329 1.00 54.13 ? 70  GLU D HB3  1  
ATOM 8202   H HG2  . GLU D 1 70  ? 25.869  8.883   -14.504 1.00 54.10 ? 70  GLU D HG2  1  
ATOM 8203   H HG3  . GLU D 1 70  ? 26.490  9.671   -15.945 1.00 21.42 ? 70  GLU D HG3  1  
ATOM 8204   N N    . GLU D 1 71  ? 22.995  7.085   -13.482 1.00 24.14 ? 71  GLU D N    1  
ATOM 8205   C CA   . GLU D 1 71  ? 23.062  6.687   -12.058 1.00 2.35  ? 71  GLU D CA   1  
ATOM 8206   C C    . GLU D 1 71  ? 21.798  5.924   -11.670 1.00 54.33 ? 71  GLU D C    1  
ATOM 8207   O O    . GLU D 1 71  ? 20.786  5.987   -12.380 1.00 73.50 ? 71  GLU D O    1  
ATOM 8208   C CB   . GLU D 1 71  ? 23.237  7.927   -11.139 1.00 34.01 ? 71  GLU D CB   1  
ATOM 8209   C CG   . GLU D 1 71  ? 21.985  8.824   -11.026 1.00 43.41 ? 71  GLU D CG   1  
ATOM 8210   C CD   . GLU D 1 71  ? 22.213  10.071  -10.164 1.00 4.15  ? 71  GLU D CD   1  
ATOM 8211   O OE1  . GLU D 1 71  ? 21.747  10.112  -9.010  1.00 12.11 ? 71  GLU D OE1  1  
ATOM 8212   O OE2  . GLU D 1 71  ? 22.879  11.010  -10.646 1.00 1.41  ? 71  GLU D OE2  1  
ATOM 8213   H H    . GLU D 1 71  ? 22.167  7.494   -13.812 1.00 40.01 ? 71  GLU D H    1  
ATOM 8214   H HA   . GLU D 1 71  ? 23.913  6.022   -11.923 1.00 43.21 ? 71  GLU D HA   1  
ATOM 8215   H HB2  . GLU D 1 71  ? 23.503  7.589   -10.141 1.00 5.14  ? 71  GLU D HB2  1  
ATOM 8216   H HB3  . GLU D 1 71  ? 24.053  8.531   -11.525 1.00 43.11 ? 71  GLU D HB3  1  
ATOM 8217   H HG2  . GLU D 1 71  ? 21.693  9.140   -12.024 1.00 52.21 ? 71  GLU D HG2  1  
ATOM 8218   H HG3  . GLU D 1 71  ? 21.175  8.237   -10.599 1.00 73.22 ? 71  GLU D HG3  1  
ATOM 8219   N N    . THR D 1 72  ? 21.862  5.249   -10.518 1.00 54.22 ? 72  THR D N    1  
ATOM 8220   C CA   . THR D 1 72  ? 20.787  4.395   -10.016 1.00 30.23 ? 72  THR D CA   1  
ATOM 8221   C C    . THR D 1 72  ? 19.520  5.206   -9.668  1.00 42.33 ? 72  THR D C    1  
ATOM 8222   O O    . THR D 1 72  ? 19.593  6.234   -8.987  1.00 53.34 ? 72  THR D O    1  
ATOM 8223   C CB   . THR D 1 72  ? 21.270  3.608   -8.757  1.00 71.25 ? 72  THR D CB   1  
ATOM 8224   O OG1  . THR D 1 72  ? 22.521  2.954   -9.055  1.00 13.12 ? 72  THR D OG1  1  
ATOM 8225   C CG2  . THR D 1 72  ? 20.233  2.564   -8.300  1.00 4.21  ? 72  THR D CG2  1  
ATOM 8226   H H    . THR D 1 72  ? 22.677  5.325   -9.981  1.00 55.11 ? 72  THR D H    1  
ATOM 8227   H HA   . THR D 1 72  ? 20.551  3.674   -10.796 1.00 14.54 ? 72  THR D HA   1  
ATOM 8228   H HB   . THR D 1 72  ? 21.439  4.312   -7.945  1.00 2.23  ? 72  THR D HB   1  
ATOM 8229   H HG1  . THR D 1 72  ? 22.642  2.202   -8.463  1.00 32.24 ? 72  THR D HG1  1  
ATOM 8230   H HG21 . THR D 1 72  ? 19.371  3.046   -7.870  1.00 12.12 ? 72  THR D HG21 1  
ATOM 8231   H HG22 . THR D 1 72  ? 20.670  1.901   -7.566  1.00 72.04 ? 72  THR D HG22 1  
ATOM 8232   H HG23 . THR D 1 72  ? 19.915  1.988   -9.152  1.00 13.44 ? 72  THR D HG23 1  
ATOM 8233   N N    . ALA D 1 73  ? 18.368  4.734   -10.158 1.00 10.03 ? 73  ALA D N    1  
ATOM 8234   C CA   . ALA D 1 73  ? 17.059  5.270   -9.779  1.00 33.52 ? 73  ALA D CA   1  
ATOM 8235   C C    . ALA D 1 73  ? 16.555  4.469   -8.577  1.00 51.24 ? 73  ALA D C    1  
ATOM 8236   O O    . ALA D 1 73  ? 16.519  4.977   -7.451  1.00 11.12 ? 73  ALA D O    1  
ATOM 8237   C CB   . ALA D 1 73  ? 16.082  5.206   -10.963 1.00 44.40 ? 73  ALA D CB   1  
ATOM 8238   H H    . ALA D 1 73  ? 18.401  3.977   -10.769 1.00 71.15 ? 73  ALA D H    1  
ATOM 8239   H HA   . ALA D 1 73  ? 17.180  6.316   -9.490  1.00 31.33 ? 73  ALA D HA   1  
ATOM 8240   H HB1  . ALA D 1 73  ? 15.170  5.719   -10.715 1.00 45.24 ? 73  ALA D HB1  1  
ATOM 8241   H HB2  . ALA D 1 73  ? 15.859  4.173   -11.211 1.00 14.22 ? 73  ALA D HB2  1  
ATOM 8242   H HB3  . ALA D 1 73  ? 16.526  5.688   -11.821 1.00 61.31 ? 73  ALA D HB3  1  
ATOM 8243   N N    . PHE D 1 74  ? 16.232  3.179   -8.824  1.00 2.33  ? 74  PHE D N    1  
ATOM 8244   C CA   . PHE D 1 74  ? 15.825  2.243   -7.765  1.00 41.34 ? 74  PHE D CA   1  
ATOM 8245   C C    . PHE D 1 74  ? 16.201  0.796   -8.133  1.00 21.31 ? 74  PHE D C    1  
ATOM 8246   O O    . PHE D 1 74  ? 16.313  0.447   -9.307  1.00 71.30 ? 74  PHE D O    1  
ATOM 8247   C CB   . PHE D 1 74  ? 14.306  2.366   -7.461  1.00 4.12  ? 74  PHE D CB   1  
ATOM 8248   C CG   . PHE D 1 74  ? 13.369  2.098   -8.651  1.00 21.31 ? 74  PHE D CG   1  
ATOM 8249   C CD1  . PHE D 1 74  ? 12.815  0.830   -8.867  1.00 70.14 ? 74  PHE D CD1  1  
ATOM 8250   C CD2  . PHE D 1 74  ? 13.035  3.117   -9.547  1.00 2.02  ? 74  PHE D CD2  1  
ATOM 8251   C CE1  . PHE D 1 74  ? 11.965  0.597   -9.932  1.00 24.50 ? 74  PHE D CE1  1  
ATOM 8252   C CE2  . PHE D 1 74  ? 12.182  2.881   -10.612 1.00 71.32 ? 74  PHE D CE2  1  
ATOM 8253   C CZ   . PHE D 1 74  ? 11.647  1.624   -10.804 1.00 5.14  ? 74  PHE D CZ   1  
ATOM 8254   H H    . PHE D 1 74  ? 16.263  2.844   -9.754  1.00 35.53 ? 74  PHE D H    1  
ATOM 8255   H HA   . PHE D 1 74  ? 16.380  2.509   -6.867  1.00 32.31 ? 74  PHE D HA   1  
ATOM 8256   H HB2  . PHE D 1 74  ? 14.047  1.669   -6.669  1.00 32.12 ? 74  PHE D HB2  1  
ATOM 8257   H HB3  . PHE D 1 74  ? 14.108  3.371   -7.100  1.00 34.21 ? 74  PHE D HB3  1  
ATOM 8258   H HD1  . PHE D 1 74  ? 13.056  0.022   -8.188  1.00 40.54 ? 74  PHE D HD1  1  
ATOM 8259   H HD2  . PHE D 1 74  ? 13.454  4.109   -9.407  1.00 64.33 ? 74  PHE D HD2  1  
ATOM 8260   H HE1  . PHE D 1 74  ? 11.548  -0.390  -10.086 1.00 42.21 ? 74  PHE D HE1  1  
ATOM 8261   H HE2  . PHE D 1 74  ? 11.932  3.684   -11.293 1.00 4.24  ? 74  PHE D HE2  1  
ATOM 8262   H HZ   . PHE D 1 74  ? 10.982  1.439   -11.638 1.00 13.21 ? 74  PHE D HZ   1  
ATOM 8263   N N    . LEU D 1 75  ? 16.397  -0.028  -7.096  1.00 11.34 ? 75  LEU D N    1  
ATOM 8264   C CA   . LEU D 1 75  ? 16.717  -1.456  -7.214  1.00 42.30 ? 75  LEU D CA   1  
ATOM 8265   C C    . LEU D 1 75  ? 15.585  -2.219  -6.531  1.00 33.44 ? 75  LEU D C    1  
ATOM 8266   O O    . LEU D 1 75  ? 15.449  -2.155  -5.312  1.00 44.45 ? 75  LEU D O    1  
ATOM 8267   C CB   . LEU D 1 75  ? 18.073  -1.772  -6.516  1.00 45.14 ? 75  LEU D CB   1  
ATOM 8268   C CG   . LEU D 1 75  ? 19.280  -0.869  -6.914  1.00 54.44 ? 75  LEU D CG   1  
ATOM 8269   C CD1  . LEU D 1 75  ? 20.557  -1.281  -6.150  1.00 14.11 ? 75  LEU D CD1  1  
ATOM 8270   C CD2  . LEU D 1 75  ? 19.509  -0.849  -8.448  1.00 12.01 ? 75  LEU D CD2  1  
ATOM 8271   H H    . LEU D 1 75  ? 16.307  0.340   -6.199  1.00 33.25 ? 75  LEU D H    1  
ATOM 8272   H HA   . LEU D 1 75  ? 16.773  -1.732  -8.267  1.00 14.32 ? 75  LEU D HA   1  
ATOM 8273   H HB2  . LEU D 1 75  ? 17.931  -1.682  -5.439  1.00 74.12 ? 75  LEU D HB2  1  
ATOM 8274   H HB3  . LEU D 1 75  ? 18.336  -2.802  -6.731  1.00 34.23 ? 75  LEU D HB3  1  
ATOM 8275   H HG   . LEU D 1 75  ? 19.052  0.147   -6.612  1.00 30.41 ? 75  LEU D HG   1  
ATOM 8276   H HD11 . LEU D 1 75  ? 20.815  -2.308  -6.379  1.00 44.22 ? 75  LEU D HD11 1  
ATOM 8277   H HD12 . LEU D 1 75  ? 20.390  -1.185  -5.085  1.00 72.42 ? 75  LEU D HD12 1  
ATOM 8278   H HD13 . LEU D 1 75  ? 21.378  -0.635  -6.435  1.00 12.22 ? 75  LEU D HD13 1  
ATOM 8279   H HD21 . LEU D 1 75  ? 19.753  -1.829  -8.800  1.00 25.33 ? 75  LEU D HD21 1  
ATOM 8280   H HD22 . LEU D 1 75  ? 20.319  -0.173  -8.685  1.00 32.34 ? 75  LEU D HD22 1  
ATOM 8281   H HD23 . LEU D 1 75  ? 18.610  -0.502  -8.943  1.00 23.43 ? 75  LEU D HD23 1  
ATOM 8282   N N    . CYS D 1 76  ? 14.774  -2.924  -7.307  1.00 31.02 ? 76  CYS D N    1  
ATOM 8283   C CA   . CYS D 1 76  ? 13.542  -3.539  -6.818  1.00 41.02 ? 76  CYS D CA   1  
ATOM 8284   C C    . CYS D 1 76  ? 13.534  -5.037  -7.155  1.00 14.13 ? 76  CYS D C    1  
ATOM 8285   O O    . CYS D 1 76  ? 13.338  -5.417  -8.306  1.00 42.03 ? 76  CYS D O    1  
ATOM 8286   C CB   . CYS D 1 76  ? 12.335  -2.818  -7.452  1.00 54.24 ? 76  CYS D CB   1  
ATOM 8287   S SG   . CYS D 1 76  ? 10.760  -3.385  -6.822  1.00 33.43 ? 76  CYS D SG   1  
ATOM 8288   H H    . CYS D 1 76  ? 15.013  -3.043  -8.242  1.00 11.44 ? 76  CYS D H    1  
ATOM 8289   H HA   . CYS D 1 76  ? 13.490  -3.419  -5.736  1.00 50.44 ? 76  CYS D HA   1  
ATOM 8290   H HB2  . CYS D 1 76  ? 12.401  -1.755  -7.251  1.00 61.54 ? 76  CYS D HB2  1  
ATOM 8291   H HB3  . CYS D 1 76  ? 12.337  -2.974  -8.526  1.00 1.01  ? 76  CYS D HB3  1  
ATOM 8292   H HG   . CYS D 1 76  ? 11.019  -4.270  -5.869  1.00 25.35 ? 76  CYS D HG   1  
ATOM 8293   N N    . GLU D 1 77  ? 13.750  -5.886  -6.138  1.00 42.31 ? 77  GLU D N    1  
ATOM 8294   C CA   . GLU D 1 77  ? 13.825  -7.349  -6.303  1.00 70.21 ? 77  GLU D CA   1  
ATOM 8295   C C    . GLU D 1 77  ? 12.782  -8.022  -5.412  1.00 61.31 ? 77  GLU D C    1  
ATOM 8296   O O    . GLU D 1 77  ? 12.695  -7.714  -4.224  1.00 3.13  ? 77  GLU D O    1  
ATOM 8297   C CB   . GLU D 1 77  ? 15.245  -7.855  -5.940  1.00 65.23 ? 77  GLU D CB   1  
ATOM 8298   C CG   . GLU D 1 77  ? 15.441  -9.383  -6.074  1.00 32.33 ? 77  GLU D CG   1  
ATOM 8299   C CD   . GLU D 1 77  ? 16.890  -9.834  -5.821  1.00 70.43 ? 77  GLU D CD   1  
ATOM 8300   O OE1  . GLU D 1 77  ? 17.764  -9.520  -6.656  1.00 13.43 ? 77  GLU D OE1  1  
ATOM 8301   O OE2  . GLU D 1 77  ? 17.159  -10.516 -4.810  1.00 3.42  ? 77  GLU D OE2  1  
ATOM 8302   H H    . GLU D 1 77  ? 13.849  -5.518  -5.234  1.00 73.24 ? 77  GLU D H    1  
ATOM 8303   H HA   . GLU D 1 77  ? 13.619  -7.596  -7.344  1.00 72.14 ? 77  GLU D HA   1  
ATOM 8304   H HB2  . GLU D 1 77  ? 15.961  -7.362  -6.591  1.00 21.03 ? 77  GLU D HB2  1  
ATOM 8305   H HB3  . GLU D 1 77  ? 15.468  -7.571  -4.915  1.00 35.23 ? 77  GLU D HB3  1  
ATOM 8306   H HG2  . GLU D 1 77  ? 14.786  -9.877  -5.363  1.00 41.32 ? 77  GLU D HG2  1  
ATOM 8307   H HG3  . GLU D 1 77  ? 15.152  -9.684  -7.078  1.00 71.31 ? 77  GLU D HG3  1  
ATOM 8308   N N    . VAL D 1 78  ? 11.973  -8.918  -5.999  1.00 24.21 ? 78  VAL D N    1  
ATOM 8309   C CA   . VAL D 1 78  ? 10.996  -9.729  -5.263  1.00 21.35 ? 78  VAL D CA   1  
ATOM 8310   C C    . VAL D 1 78  ? 11.203  -11.212 -5.592  1.00 23.14 ? 78  VAL D C    1  
ATOM 8311   O O    . VAL D 1 78  ? 11.110  -11.609 -6.761  1.00 61.34 ? 78  VAL D O    1  
ATOM 8312   C CB   . VAL D 1 78  ? 9.502   -9.335  -5.600  1.00 74.42 ? 78  VAL D CB   1  
ATOM 8313   C CG1  . VAL D 1 78  ? 8.512   -10.098 -4.680  1.00 70.25 ? 78  VAL D CG1  1  
ATOM 8314   C CG2  . VAL D 1 78  ? 9.288   -7.798  -5.551  1.00 71.04 ? 78  VAL D CG2  1  
ATOM 8315   H H    . VAL D 1 78  ? 12.032  -9.034  -6.964  1.00 43.34 ? 78  VAL D H    1  
ATOM 8316   H HA   . VAL D 1 78  ? 11.155  -9.576  -4.193  1.00 1.43  ? 78  VAL D HA   1  
ATOM 8317   H HB   . VAL D 1 78  ? 9.298   -9.658  -6.624  1.00 34.51 ? 78  VAL D HB   1  
ATOM 8318   H HG11 . VAL D 1 78  ? 8.496   -11.148 -4.955  1.00 42.53 ? 78  VAL D HG11 1  
ATOM 8319   H HG12 . VAL D 1 78  ? 7.515   -9.691  -4.783  1.00 74.12 ? 78  VAL D HG12 1  
ATOM 8320   H HG13 . VAL D 1 78  ? 8.832   -10.012 -3.652  1.00 74.11 ? 78  VAL D HG13 1  
ATOM 8321   H HG21 . VAL D 1 78  ? 8.238   -7.567  -5.464  1.00 73.44 ? 78  VAL D HG21 1  
ATOM 8322   H HG22 . VAL D 1 78  ? 9.666   -7.352  -6.463  1.00 24.11 ? 78  VAL D HG22 1  
ATOM 8323   H HG23 . VAL D 1 78  ? 9.815   -7.377  -4.720  1.00 3.04  ? 78  VAL D HG23 1  
ATOM 8324   N N    . GLN D 1 79  ? 11.473  -12.025 -4.559  1.00 43.31 ? 79  GLN D N    1  
ATOM 8325   C CA   . GLN D 1 79  ? 11.422  -13.482 -4.668  1.00 23.24 ? 79  GLN D CA   1  
ATOM 8326   C C    . GLN D 1 79  ? 9.987   -13.931 -4.386  1.00 22.41 ? 79  GLN D C    1  
ATOM 8327   O O    . GLN D 1 79  ? 9.599   -14.187 -3.234  1.00 3.20  ? 79  GLN D O    1  
ATOM 8328   C CB   . GLN D 1 79  ? 12.434  -14.168 -3.715  1.00 32.01 ? 79  GLN D CB   1  
ATOM 8329   C CG   . GLN D 1 79  ? 13.905  -13.941 -4.097  1.00 33.23 ? 79  GLN D CG   1  
ATOM 8330   C CD   . GLN D 1 79  ? 14.875  -14.791 -3.278  1.00 20.40 ? 79  GLN D CD   1  
ATOM 8331   O OE1  . GLN D 1 79  ? 15.153  -15.934 -3.631  1.00 44.10 ? 79  GLN D OE1  1  
ATOM 8332   N NE2  . GLN D 1 79  ? 15.438  -14.225 -2.222  1.00 53.23 ? 79  GLN D NE2  1  
ATOM 8333   H H    . GLN D 1 79  ? 11.722  -11.627 -3.699  1.00 25.10 ? 79  GLN D H    1  
ATOM 8334   H HA   . GLN D 1 79  ? 11.670  -13.751 -5.691  1.00 11.33 ? 79  GLN D HA   1  
ATOM 8335   H HB2  . GLN D 1 79  ? 12.280  -13.788 -2.710  1.00 14.14 ? 79  GLN D HB2  1  
ATOM 8336   H HB3  . GLN D 1 79  ? 12.246  -15.238 -3.710  1.00 62.21 ? 79  GLN D HB3  1  
ATOM 8337   H HG2  . GLN D 1 79  ? 14.037  -14.186 -5.144  1.00 0.23  ? 79  GLN D HG2  1  
ATOM 8338   H HG3  . GLN D 1 79  ? 14.148  -12.892 -3.954  1.00 40.44 ? 79  GLN D HG3  1  
ATOM 8339   H HE21 . GLN D 1 79  ? 15.216  -13.292 -2.022  1.00 23.53 ? 79  GLN D HE21 1  
ATOM 8340   H HE22 . GLN D 1 79  ? 16.047  -14.765 -1.678  1.00 53.23 ? 79  GLN D HE22 1  
ATOM 8341   N N    . GLN D 1 80  ? 9.196   -13.939 -5.467  1.00 34.24 ? 80  GLN D N    1  
ATOM 8342   C CA   . GLN D 1 80  ? 7.785   -14.297 -5.436  1.00 42.25 ? 80  GLN D CA   1  
ATOM 8343   C C    . GLN D 1 80  ? 7.664   -15.830 -5.464  1.00 24.31 ? 80  GLN D C    1  
ATOM 8344   O O    . GLN D 1 80  ? 8.009   -16.461 -6.467  1.00 13.21 ? 80  GLN D O    1  
ATOM 8345   C CB   . GLN D 1 80  ? 7.049   -13.648 -6.648  1.00 41.00 ? 80  GLN D CB   1  
ATOM 8346   C CG   . GLN D 1 80  ? 5.516   -13.698 -6.539  1.00 41.22 ? 80  GLN D CG   1  
ATOM 8347   C CD   . GLN D 1 80  ? 4.952   -12.775 -5.440  1.00 44.42 ? 80  GLN D CD   1  
ATOM 8348   O OE1  . GLN D 1 80  ? 3.969   -13.095 -4.784  1.00 10.32 ? 80  GLN D OE1  1  
ATOM 8349   N NE2  . GLN D 1 80  ? 5.534   -11.588 -5.274  1.00 73.42 ? 80  GLN D NE2  1  
ATOM 8350   H H    . GLN D 1 80  ? 9.595   -13.704 -6.333  1.00 62.11 ? 80  GLN D H    1  
ATOM 8351   H HA   . GLN D 1 80  ? 7.354   -13.912 -4.513  1.00 43.00 ? 80  GLN D HA   1  
ATOM 8352   H HB2  . GLN D 1 80  ? 7.346   -12.606 -6.719  1.00 43.10 ? 80  GLN D HB2  1  
ATOM 8353   H HB3  . GLN D 1 80  ? 7.348   -14.148 -7.564  1.00 74.02 ? 80  GLN D HB3  1  
ATOM 8354   H HG2  . GLN D 1 80  ? 5.087   -13.390 -7.488  1.00 71.34 ? 80  GLN D HG2  1  
ATOM 8355   H HG3  . GLN D 1 80  ? 5.213   -14.720 -6.332  1.00 12.53 ? 80  GLN D HG3  1  
ATOM 8356   H HE21 . GLN D 1 80  ? 6.285   -11.348 -5.853  1.00 34.22 ? 80  GLN D HE21 1  
ATOM 8357   H HE22 . GLN D 1 80  ? 5.178   -10.998 -4.579  1.00 42.41 ? 80  GLN D HE22 1  
ATOM 8358   N N    . GLY D 1 81  ? 7.226   -16.411 -4.337  1.00 0.31  ? 81  GLY D N    1  
ATOM 8359   C CA   . GLY D 1 81  ? 7.069   -17.860 -4.199  1.00 73.13 ? 81  GLY D CA   1  
ATOM 8360   C C    . GLY D 1 81  ? 5.608   -18.264 -4.110  1.00 54.20 ? 81  GLY D C    1  
ATOM 8361   O O    . GLY D 1 81  ? 4.767   -17.481 -3.655  1.00 33.22 ? 81  GLY D O    1  
ATOM 8362   H H    . GLY D 1 81  ? 6.979   -15.838 -3.584  1.00 24.20 ? 81  GLY D H    1  
ATOM 8363   H HA2  . GLY D 1 81  ? 7.529   -18.372 -5.048  1.00 3.24  ? 81  GLY D HA2  1  
ATOM 8364   H HA3  . GLY D 1 81  ? 7.572   -18.176 -3.295  1.00 44.01 ? 81  GLY D HA3  1  
ATOM 8365   N N    . GLY D 1 82  ? 5.311   -19.496 -4.529  1.00 23.23 ? 82  GLY D N    1  
ATOM 8366   C CA   . GLY D 1 82  ? 3.949   -20.002 -4.562  1.00 73.51 ? 82  GLY D CA   1  
ATOM 8367   C C    . GLY D 1 82  ? 3.915   -21.515 -4.495  1.00 31.35 ? 82  GLY D C    1  
ATOM 8368   O O    . GLY D 1 82  ? 4.618   -22.186 -5.250  1.00 61.04 ? 82  GLY D O    1  
ATOM 8369   H H    . GLY D 1 82  ? 6.039   -20.084 -4.813  1.00 51.04 ? 82  GLY D H    1  
ATOM 8370   H HA2  . GLY D 1 82  ? 3.383   -19.588 -3.730  1.00 52.32 ? 82  GLY D HA2  1  
ATOM 8371   H HA3  . GLY D 1 82  ? 3.483   -19.687 -5.488  1.00 45.10 ? 82  GLY D HA3  1  
ATOM 8372   N N    . ILE D 1 83  ? 3.081   -22.043 -3.597  1.00 23.30 ? 83  ILE D N    1  
ATOM 8373   C CA   . ILE D 1 83  ? 2.902   -23.484 -3.399  1.00 23.02 ? 83  ILE D CA   1  
ATOM 8374   C C    . ILE D 1 83  ? 1.786   -23.982 -4.334  1.00 74.32 ? 83  ILE D C    1  
ATOM 8375   O O    . ILE D 1 83  ? 0.735   -23.327 -4.444  1.00 73.43 ? 83  ILE D O    1  
ATOM 8376   C CB   . ILE D 1 83  ? 2.478   -23.803 -1.921  1.00 11.50 ? 83  ILE D CB   1  
ATOM 8377   C CG1  . ILE D 1 83  ? 3.382   -23.055 -0.891  1.00 55.35 ? 83  ILE D CG1  1  
ATOM 8378   C CG2  . ILE D 1 83  ? 2.483   -25.337 -1.675  1.00 75.31 ? 83  ILE D CG2  1  
ATOM 8379   C CD1  . ILE D 1 83  ? 2.854   -23.048 0.539   1.00 24.33 ? 83  ILE D CD1  1  
ATOM 8380   H H    . ILE D 1 83  ? 2.558   -21.434 -3.043  1.00 3.04  ? 83  ILE D H    1  
ATOM 8381   H HA   . ILE D 1 83  ? 3.838   -23.995 -3.621  1.00 63.22 ? 83  ILE D HA   1  
ATOM 8382   H HB   . ILE D 1 83  ? 1.453   -23.453 -1.788  1.00 74.22 ? 83  ILE D HB   1  
ATOM 8383   H HG12 . ILE D 1 83  ? 4.364   -23.506 -0.873  1.00 3.20  ? 83  ILE D HG12 1  
ATOM 8384   H HG13 . ILE D 1 83  ? 3.485   -22.018 -1.196  1.00 20.14 ? 83  ILE D HG13 1  
ATOM 8385   H HG21 . ILE D 1 83  ? 1.857   -25.570 -0.830  1.00 71.50 ? 83  ILE D HG21 1  
ATOM 8386   H HG22 . ILE D 1 83  ? 3.489   -25.681 -1.479  1.00 21.42 ? 83  ILE D HG22 1  
ATOM 8387   H HG23 . ILE D 1 83  ? 2.098   -25.855 -2.547  1.00 30.55 ? 83  ILE D HG23 1  
ATOM 8388   H HD11 . ILE D 1 83  ? 2.681   -24.057 0.874   1.00 14.02 ? 83  ILE D HD11 1  
ATOM 8389   H HD12 . ILE D 1 83  ? 1.929   -22.491 0.578   1.00 64.25 ? 83  ILE D HD12 1  
ATOM 8390   H HD13 . ILE D 1 83  ? 3.581   -22.575 1.183   1.00 71.33 ? 83  ILE D HD13 1  
ATOM 8391   N N    . PHE D 1 84  ? 2.009   -25.138 -4.989  1.00 54.05 ? 84  PHE D N    1  
ATOM 8392   C CA   . PHE D 1 84  ? 1.032   -25.751 -5.906  1.00 51.11 ? 84  PHE D CA   1  
ATOM 8393   C C    . PHE D 1 84  ? 0.973   -27.276 -5.682  1.00 20.21 ? 84  PHE D C    1  
ATOM 8394   O O    . PHE D 1 84  ? 2.013   -27.948 -5.657  1.00 11.11 ? 84  PHE D O    1  
ATOM 8395   C CB   . PHE D 1 84  ? 1.405   -25.458 -7.396  1.00 32.41 ? 84  PHE D CB   1  
ATOM 8396   C CG   . PHE D 1 84  ? 1.694   -23.983 -7.703  1.00 50.33 ? 84  PHE D CG   1  
ATOM 8397   C CD1  . PHE D 1 84  ? 2.998   -23.535 -7.943  1.00 2.04  ? 84  PHE D CD1  1  
ATOM 8398   C CD2  . PHE D 1 84  ? 0.664   -23.044 -7.733  1.00 73.41 ? 84  PHE D CD2  1  
ATOM 8399   C CE1  . PHE D 1 84  ? 3.253   -22.198 -8.202  1.00 74.23 ? 84  PHE D CE1  1  
ATOM 8400   C CE2  . PHE D 1 84  ? 0.923   -21.709 -7.994  1.00 13.22 ? 84  PHE D CE2  1  
ATOM 8401   C CZ   . PHE D 1 84  ? 2.216   -21.287 -8.230  1.00 41.13 ? 84  PHE D CZ   1  
ATOM 8402   H H    . PHE D 1 84  ? 2.863   -25.589 -4.857  1.00 63.41 ? 84  PHE D H    1  
ATOM 8403   H HA   . PHE D 1 84  ? 0.055   -25.328 -5.687  1.00 0.22  ? 84  PHE D HA   1  
ATOM 8404   H HB2  . PHE D 1 84  ? 2.286   -26.037 -7.661  1.00 32.11 ? 84  PHE D HB2  1  
ATOM 8405   H HB3  . PHE D 1 84  ? 0.586   -25.776 -8.034  1.00 45.14 ? 84  PHE D HB3  1  
ATOM 8406   H HD1  . PHE D 1 84  ? 3.817   -24.243 -7.926  1.00 61.23 ? 84  PHE D HD1  1  
ATOM 8407   H HD2  . PHE D 1 84  ? -0.356  -23.366 -7.547  1.00 24.01 ? 84  PHE D HD2  1  
ATOM 8408   H HE1  . PHE D 1 84  ? 4.268   -21.866 -8.383  1.00 31.41 ? 84  PHE D HE1  1  
ATOM 8409   H HE2  . PHE D 1 84  ? 0.109   -20.995 -8.014  1.00 43.52 ? 84  PHE D HE2  1  
ATOM 8410   H HZ   . PHE D 1 84  ? 2.417   -20.242 -8.433  1.00 53.11 ? 84  PHE D HZ   1  
ATOM 8411   N N    . SER D 1 85  ? -0.248  -27.797 -5.491  1.00 24.02 ? 85  SER D N    1  
ATOM 8412   C CA   . SER D 1 85  ? -0.529  -29.238 -5.507  1.00 33.32 ? 85  SER D CA   1  
ATOM 8413   C C    . SER D 1 85  ? -0.600  -29.728 -6.971  1.00 0.32  ? 85  SER D C    1  
ATOM 8414   O O    . SER D 1 85  ? -1.620  -29.562 -7.652  1.00 24.32 ? 85  SER D O    1  
ATOM 8415   C CB   . SER D 1 85  ? -1.852  -29.522 -4.773  1.00 20.00 ? 85  SER D CB   1  
ATOM 8416   O OG   . SER D 1 85  ? -1.796  -29.072 -3.438  1.00 2.40  ? 85  SER D OG   1  
ATOM 8417   H H    . SER D 1 85  ? -0.990  -27.186 -5.318  1.00 5.23  ? 85  SER D H    1  
ATOM 8418   H HA   . SER D 1 85  ? 0.280   -29.754 -4.985  1.00 15.13 ? 85  SER D HA   1  
ATOM 8419   H HB2  . SER D 1 85  ? -2.664  -29.007 -5.270  1.00 32.12 ? 85  SER D HB2  1  
ATOM 8420   H HB3  . SER D 1 85  ? -2.049  -30.585 -4.770  1.00 33.05 ? 85  SER D HB3  1  
ATOM 8421   H HG   . SER D 1 85  ? -2.664  -29.180 -3.029  1.00 3.21  ? 85  SER D HG   1  
ATOM 8422   N N    . ILE D 1 86  ? 0.507   -30.300 -7.440  1.00 24.32 ? 86  ILE D N    1  
ATOM 8423   C CA   . ILE D 1 86  ? 0.684   -30.757 -8.833  1.00 32.20 ? 86  ILE D CA   1  
ATOM 8424   C C    . ILE D 1 86  ? 0.852   -32.285 -8.876  1.00 45.32 ? 86  ILE D C    1  
ATOM 8425   O O    . ILE D 1 86  ? 1.533   -32.855 -8.026  1.00 12.21 ? 86  ILE D O    1  
ATOM 8426   C CB   . ILE D 1 86  ? 1.930   -30.047 -9.481  1.00 12.02 ? 86  ILE D CB   1  
ATOM 8427   C CG1  . ILE D 1 86  ? 3.197   -30.246 -8.580  1.00 62.43 ? 86  ILE D CG1  1  
ATOM 8428   C CG2  . ILE D 1 86  ? 1.643   -28.546 -9.726  1.00 72.30 ? 86  ILE D CG2  1  
ATOM 8429   C CD1  . ILE D 1 86  ? 4.423   -29.491 -9.024  1.00 21.12 ? 86  ILE D CD1  1  
ATOM 8430   H H    . ILE D 1 86  ? 1.250   -30.436 -6.814  1.00 32.11 ? 86  ILE D H    1  
ATOM 8431   H HA   . ILE D 1 86  ? -0.203  -30.484 -9.407  1.00 4.22  ? 86  ILE D HA   1  
ATOM 8432   H HB   . ILE D 1 86  ? 2.114   -30.505 -10.451 1.00 63.31 ? 86  ILE D HB   1  
ATOM 8433   H HG12 . ILE D 1 86  ? 2.975   -29.923 -7.573  1.00 30.14 ? 86  ILE D HG12 1  
ATOM 8434   H HG13 . ILE D 1 86  ? 3.454   -31.298 -8.558  1.00 62.53 ? 86  ILE D HG13 1  
ATOM 8435   H HG21 . ILE D 1 86  ? 0.775   -28.439 -10.366 1.00 15.54 ? 86  ILE D HG21 1  
ATOM 8436   H HG22 . ILE D 1 86  ? 2.494   -28.080 -10.205 1.00 41.04 ? 86  ILE D HG22 1  
ATOM 8437   H HG23 . ILE D 1 86  ? 1.452   -28.051 -8.782  1.00 64.10 ? 86  ILE D HG23 1  
ATOM 8438   H HD11 . ILE D 1 86  ? 5.253   -29.754 -8.384  1.00 33.42 ? 86  ILE D HD11 1  
ATOM 8439   H HD12 . ILE D 1 86  ? 4.243   -28.429 -8.957  1.00 32.33 ? 86  ILE D HD12 1  
ATOM 8440   H HD13 . ILE D 1 86  ? 4.665   -29.754 -10.046 1.00 32.32 ? 86  ILE D HD13 1  
ATOM 8441   N N    . ALA D 1 87  ? 0.234   -32.940 -9.868  1.00 60.31 ? 87  ALA D N    1  
ATOM 8442   C CA   . ALA D 1 87  ? 0.254   -34.417 -9.992  1.00 1.31  ? 87  ALA D CA   1  
ATOM 8443   C C    . ALA D 1 87  ? -0.171  -34.858 -11.400 1.00 2.33  ? 87  ALA D C    1  
ATOM 8444   O O    . ALA D 1 87  ? -0.664  -34.045 -12.189 1.00 24.21 ? 87  ALA D O    1  
ATOM 8445   C CB   . ALA D 1 87  ? -0.650  -35.072 -8.923  1.00 2.01  ? 87  ALA D CB   1  
ATOM 8446   H H    . ALA D 1 87  ? -0.251  -32.420 -10.543 1.00 64.43 ? 87  ALA D H    1  
ATOM 8447   H HA   . ALA D 1 87  ? 1.274   -34.752 -9.826  1.00 73.40 ? 87  ALA D HA   1  
ATOM 8448   H HB1  . ALA D 1 87  ? -0.582  -36.150 -8.995  1.00 10.34 ? 87  ALA D HB1  1  
ATOM 8449   H HB2  . ALA D 1 87  ? -1.679  -34.768 -9.072  1.00 52.51 ? 87  ALA D HB2  1  
ATOM 8450   H HB3  . ALA D 1 87  ? -0.328  -34.760 -7.938  1.00 50.51 ? 87  ALA D HB3  1  
ATOM 8451   N N    . GLY D 1 88  ? 0.051   -36.152 -11.705 1.00 21.44 ? 88  GLY D N    1  
ATOM 8452   C CA   . GLY D 1 88  ? -0.367  -36.748 -12.982 1.00 65.02 ? 88  GLY D CA   1  
ATOM 8453   C C    . GLY D 1 88  ? 0.538   -36.371 -14.148 1.00 40.14 ? 88  GLY D C    1  
ATOM 8454   O O    . GLY D 1 88  ? 0.154   -36.509 -15.308 1.00 44.15 ? 88  GLY D O    1  
ATOM 8455   H H    . GLY D 1 88  ? 0.522   -36.712 -11.052 1.00 51.22 ? 88  GLY D H    1  
ATOM 8456   H HA2  . GLY D 1 88  ? -0.360  -37.824 -12.875 1.00 5.01  ? 88  GLY D HA2  1  
ATOM 8457   H HA3  . GLY D 1 88  ? -1.380  -36.432 -13.208 1.00 25.42 ? 88  GLY D HA3  1  
ATOM 8458   N N    . ILE D 1 89  ? 1.744   -35.882 -13.823 1.00 42.11 ? 89  ILE D N    1  
ATOM 8459   C CA   . ILE D 1 89  ? 2.746   -35.436 -14.806 1.00 71.12 ? 89  ILE D CA   1  
ATOM 8460   C C    . ILE D 1 89  ? 3.933   -36.421 -14.789 1.00 33.44 ? 89  ILE D C    1  
ATOM 8461   O O    . ILE D 1 89  ? 4.286   -36.957 -13.729 1.00 23.32 ? 89  ILE D O    1  
ATOM 8462   C CB   . ILE D 1 89  ? 3.282   -33.981 -14.480 1.00 73.21 ? 89  ILE D CB   1  
ATOM 8463   C CG1  . ILE D 1 89  ? 2.135   -33.033 -14.004 1.00 35.33 ? 89  ILE D CG1  1  
ATOM 8464   C CG2  . ILE D 1 89  ? 4.005   -33.378 -15.713 1.00 44.23 ? 89  ILE D CG2  1  
ATOM 8465   C CD1  . ILE D 1 89  ? 2.602   -31.681 -13.480 1.00 12.43 ? 89  ILE D CD1  1  
ATOM 8466   H H    . ILE D 1 89  ? 1.977   -35.826 -12.877 1.00 72.34 ? 89  ILE D H    1  
ATOM 8467   H HA   . ILE D 1 89  ? 2.292   -35.429 -15.799 1.00 62.02 ? 89  ILE D HA   1  
ATOM 8468   H HB   . ILE D 1 89  ? 4.016   -34.062 -13.678 1.00 52.52 ? 89  ILE D HB   1  
ATOM 8469   H HG12 . ILE D 1 89  ? 1.455   -32.846 -14.824 1.00 71.23 ? 89  ILE D HG12 1  
ATOM 8470   H HG13 . ILE D 1 89  ? 1.586   -33.516 -13.203 1.00 71.21 ? 89  ILE D HG13 1  
ATOM 8471   H HG21 . ILE D 1 89  ? 4.802   -34.041 -16.031 1.00 24.51 ? 89  ILE D HG21 1  
ATOM 8472   H HG22 . ILE D 1 89  ? 4.432   -32.419 -15.460 1.00 51.12 ? 89  ILE D HG22 1  
ATOM 8473   H HG23 . ILE D 1 89  ? 3.304   -33.250 -16.528 1.00 74.54 ? 89  ILE D HG23 1  
ATOM 8474   H HD11 . ILE D 1 89  ? 1.743   -31.104 -13.166 1.00 51.25 ? 89  ILE D HD11 1  
ATOM 8475   H HD12 . ILE D 1 89  ? 3.122   -31.146 -14.262 1.00 65.50 ? 89  ILE D HD12 1  
ATOM 8476   H HD13 . ILE D 1 89  ? 3.264   -31.823 -12.637 1.00 54.21 ? 89  ILE D HD13 1  
ATOM 8477   N N    . GLU D 1 90  ? 4.560   -36.622 -15.949 1.00 73.04 ? 90  GLU D N    1  
ATOM 8478   C CA   . GLU D 1 90  ? 5.736   -37.494 -16.101 1.00 3.41  ? 90  GLU D CA   1  
ATOM 8479   C C    . GLU D 1 90  ? 6.768   -36.833 -17.027 1.00 52.12 ? 90  GLU D C    1  
ATOM 8480   O O    . GLU D 1 90  ? 6.463   -35.836 -17.704 1.00 71.42 ? 90  GLU D O    1  
ATOM 8481   C CB   . GLU D 1 90  ? 5.305   -38.915 -16.599 1.00 2.31  ? 90  GLU D CB   1  
ATOM 8482   C CG   . GLU D 1 90  ? 4.446   -38.976 -17.896 1.00 64.03 ? 90  GLU D CG   1  
ATOM 8483   C CD   . GLU D 1 90  ? 5.220   -38.703 -19.206 1.00 41.54 ? 90  GLU D CD   1  
ATOM 8484   O OE1  . GLU D 1 90  ? 6.101   -39.509 -19.563 1.00 41.22 ? 90  GLU D OE1  1  
ATOM 8485   O OE2  . GLU D 1 90  ? 4.951   -37.691 -19.884 1.00 43.41 ? 90  GLU D OE2  1  
ATOM 8486   H H    . GLU D 1 90  ? 4.228   -36.152 -16.738 1.00 21.41 ? 90  GLU D H    1  
ATOM 8487   H HA   . GLU D 1 90  ? 6.203   -37.599 -15.122 1.00 10.41 ? 90  GLU D HA   1  
ATOM 8488   H HB2  . GLU D 1 90  ? 6.197   -39.510 -16.763 1.00 13.33 ? 90  GLU D HB2  1  
ATOM 8489   H HB3  . GLU D 1 90  ? 4.734   -39.384 -15.802 1.00 43.22 ? 90  GLU D HB3  1  
ATOM 8490   H HG2  . GLU D 1 90  ? 4.004   -39.965 -17.967 1.00 42.34 ? 90  GLU D HG2  1  
ATOM 8491   H HG3  . GLU D 1 90  ? 3.642   -38.253 -17.803 1.00 64.15 ? 90  GLU D HG3  1  
ATOM 8492   N N    . GLY D 1 91  ? 7.994   -37.378 -16.998 1.00 4.34  ? 91  GLY D N    1  
ATOM 8493   C CA   . GLY D 1 91  ? 9.081   -36.986 -17.895 1.00 2.04  ? 91  GLY D CA   1  
ATOM 8494   C C    . GLY D 1 91  ? 9.481   -35.511 -17.823 1.00 30.12 ? 91  GLY D C    1  
ATOM 8495   O O    . GLY D 1 91  ? 9.471   -34.907 -16.745 1.00 20.40 ? 91  GLY D O    1  
ATOM 8496   H H    . GLY D 1 91  ? 8.172   -38.075 -16.333 1.00 53.24 ? 91  GLY D H    1  
ATOM 8497   H HA2  . GLY D 1 91  ? 9.950   -37.581 -17.646 1.00 54.44 ? 91  GLY D HA2  1  
ATOM 8498   H HA3  . GLY D 1 91  ? 8.790   -37.228 -18.912 1.00 30.31 ? 91  GLY D HA3  1  
ATOM 8499   N N    . THR D 1 92  ? 9.807   -34.935 -18.996 1.00 73.35 ? 92  THR D N    1  
ATOM 8500   C CA   . THR D 1 92  ? 10.363  -33.571 -19.119 1.00 33.20 ? 92  THR D CA   1  
ATOM 8501   C C    . THR D 1 92  ? 9.270   -32.488 -18.934 1.00 71.34 ? 92  THR D C    1  
ATOM 8502   O O    . THR D 1 92  ? 9.580   -31.317 -18.673 1.00 24.44 ? 92  THR D O    1  
ATOM 8503   C CB   . THR D 1 92  ? 11.089  -33.412 -20.504 1.00 52.52 ? 92  THR D CB   1  
ATOM 8504   O OG1  . THR D 1 92  ? 11.989  -34.518 -20.696 1.00 61.10 ? 92  THR D OG1  1  
ATOM 8505   C CG2  . THR D 1 92  ? 11.899  -32.104 -20.618 1.00 74.13 ? 92  THR D CG2  1  
ATOM 8506   H H    . THR D 1 92  ? 9.670   -35.453 -19.818 1.00 24.33 ? 92  THR D H    1  
ATOM 8507   H HA   . THR D 1 92  ? 11.108  -33.448 -18.337 1.00 15.21 ? 92  THR D HA   1  
ATOM 8508   H HB   . THR D 1 92  ? 10.344  -33.433 -21.295 1.00 60.31 ? 92  THR D HB   1  
ATOM 8509   H HG1  . THR D 1 92  ? 12.228  -34.893 -19.838 1.00 64.10 ? 92  THR D HG1  1  
ATOM 8510   H HG21 . THR D 1 92  ? 11.238  -31.252 -20.513 1.00 30.11 ? 92  THR D HG21 1  
ATOM 8511   H HG22 . THR D 1 92  ? 12.387  -32.058 -21.583 1.00 2.22  ? 92  THR D HG22 1  
ATOM 8512   H HG23 . THR D 1 92  ? 12.649  -32.070 -19.838 1.00 74.24 ? 92  THR D HG23 1  
ATOM 8513   N N    . GLN D 1 93  ? 7.983   -32.893 -19.034 1.00 53.53 ? 93  GLN D N    1  
ATOM 8514   C CA   . GLN D 1 93  ? 6.840   -31.978 -18.820 1.00 44.24 ? 93  GLN D CA   1  
ATOM 8515   C C    . GLN D 1 93  ? 6.755   -31.543 -17.335 1.00 54.44 ? 93  GLN D C    1  
ATOM 8516   O O    . GLN D 1 93  ? 6.182   -30.500 -17.021 1.00 52.25 ? 93  GLN D O    1  
ATOM 8517   C CB   . GLN D 1 93  ? 5.499   -32.618 -19.279 1.00 14.01 ? 93  GLN D CB   1  
ATOM 8518   C CG   . GLN D 1 93  ? 4.352   -31.594 -19.462 1.00 22.44 ? 93  GLN D CG   1  
ATOM 8519   C CD   . GLN D 1 93  ? 2.986   -32.235 -19.712 1.00 41.34 ? 93  GLN D CD   1  
ATOM 8520   O OE1  . GLN D 1 93  ? 2.623   -32.532 -20.851 1.00 14.22 ? 93  GLN D OE1  1  
ATOM 8521   N NE2  . GLN D 1 93  ? 2.207   -32.431 -18.654 1.00 1.03  ? 93  GLN D NE2  1  
ATOM 8522   H H    . GLN D 1 93  ? 7.802   -33.827 -19.265 1.00 73.22 ? 93  GLN D H    1  
ATOM 8523   H HA   . GLN D 1 93  ? 7.025   -31.091 -19.422 1.00 54.23 ? 93  GLN D HA   1  
ATOM 8524   H HB2  . GLN D 1 93  ? 5.658   -33.124 -20.227 1.00 45.40 ? 93  GLN D HB2  1  
ATOM 8525   H HB3  . GLN D 1 93  ? 5.188   -33.357 -18.545 1.00 60.45 ? 93  GLN D HB3  1  
ATOM 8526   H HG2  . GLN D 1 93  ? 4.289   -30.983 -18.569 1.00 65.51 ? 93  GLN D HG2  1  
ATOM 8527   H HG3  . GLN D 1 93  ? 4.590   -30.950 -20.302 1.00 13.22 ? 93  GLN D HG3  1  
ATOM 8528   H HE21 . GLN D 1 93  ? 2.543   -32.158 -17.774 1.00 3.11  ? 93  GLN D HE21 1  
ATOM 8529   H HE22 . GLN D 1 93  ? 1.324   -32.825 -18.798 1.00 62.23 ? 93  GLN D HE22 1  
ATOM 8530   N N    . MET D 1 94  ? 7.351   -32.354 -16.431 1.00 12.53 ? 94  MET D N    1  
ATOM 8531   C CA   . MET D 1 94  ? 7.494   -32.009 -14.993 1.00 33.24 ? 94  MET D CA   1  
ATOM 8532   C C    . MET D 1 94  ? 8.395   -30.771 -14.824 1.00 53.40 ? 94  MET D C    1  
ATOM 8533   O O    . MET D 1 94  ? 8.160   -29.930 -13.949 1.00 54.10 ? 94  MET D O    1  
ATOM 8534   C CB   . MET D 1 94  ? 8.071   -33.218 -14.203 1.00 21.12 ? 94  MET D CB   1  
ATOM 8535   C CG   . MET D 1 94  ? 7.173   -34.461 -14.226 1.00 2.31  ? 94  MET D CG   1  
ATOM 8536   S SD   . MET D 1 94  ? 7.937   -35.921 -13.494 1.00 22.42 ? 94  MET D SD   1  
ATOM 8537   C CE   . MET D 1 94  ? 8.110   -35.448 -11.777 1.00 13.34 ? 94  MET D CE   1  
ATOM 8538   H H    . MET D 1 94  ? 7.704   -33.218 -16.741 1.00 72.10 ? 94  MET D H    1  
ATOM 8539   H HA   . MET D 1 94  ? 6.503   -31.776 -14.608 1.00 63.32 ? 94  MET D HA   1  
ATOM 8540   H HB2  . MET D 1 94  ? 9.030   -33.491 -14.629 1.00 65.54 ? 94  MET D HB2  1  
ATOM 8541   H HB3  . MET D 1 94  ? 8.222   -32.931 -13.168 1.00 33.22 ? 94  MET D HB3  1  
ATOM 8542   H HG2  . MET D 1 94  ? 6.260   -34.247 -13.682 1.00 43.42 ? 94  MET D HG2  1  
ATOM 8543   H HG3  . MET D 1 94  ? 6.920   -34.692 -15.254 1.00 73.31 ? 94  MET D HG3  1  
ATOM 8544   H HE1  . MET D 1 94  ? 7.139   -35.218 -11.364 1.00 33.43 ? 94  MET D HE1  1  
ATOM 8545   H HE2  . MET D 1 94  ? 8.751   -34.577 -11.699 1.00 34.10 ? 94  MET D HE2  1  
ATOM 8546   H HE3  . MET D 1 94  ? 8.551   -36.263 -11.222 1.00 62.54 ? 94  MET D HE3  1  
ATOM 8547   N N    . ALA D 1 95  ? 9.417   -30.675 -15.696 1.00 2.55  ? 95  ALA D N    1  
ATOM 8548   C CA   . ALA D 1 95  ? 10.329  -29.519 -15.759 1.00 13.23 ? 95  ALA D CA   1  
ATOM 8549   C C    . ALA D 1 95  ? 9.646   -28.315 -16.440 1.00 25.41 ? 95  ALA D C    1  
ATOM 8550   O O    . ALA D 1 95  ? 10.001  -27.165 -16.171 1.00 63.21 ? 95  ALA D O    1  
ATOM 8551   C CB   . ALA D 1 95  ? 11.628  -29.908 -16.488 1.00 72.32 ? 95  ALA D CB   1  
ATOM 8552   H H    . ALA D 1 95  ? 9.559   -31.411 -16.326 1.00 72.40 ? 95  ALA D H    1  
ATOM 8553   H HA   . ALA D 1 95  ? 10.588  -29.242 -14.741 1.00 1.25  ? 95  ALA D HA   1  
ATOM 8554   H HB1  . ALA D 1 95  ? 12.312  -29.068 -16.497 1.00 40.43 ? 95  ALA D HB1  1  
ATOM 8555   H HB2  . ALA D 1 95  ? 11.404  -30.199 -17.506 1.00 14.52 ? 95  ALA D HB2  1  
ATOM 8556   H HB3  . ALA D 1 95  ? 12.094  -30.740 -15.977 1.00 55.54 ? 95  ALA D HB3  1  
ATOM 8557   N N    . HIS D 1 96  ? 8.653   -28.595 -17.321 1.00 64.43 ? 96  HIS D N    1  
ATOM 8558   C CA   . HIS D 1 96  ? 7.879   -27.544 -18.017 1.00 24.24 ? 96  HIS D CA   1  
ATOM 8559   C C    . HIS D 1 96  ? 6.871   -26.887 -17.063 1.00 74.45 ? 96  HIS D C    1  
ATOM 8560   O O    . HIS D 1 96  ? 6.673   -25.674 -17.117 1.00 23.42 ? 96  HIS D O    1  
ATOM 8561   C CB   . HIS D 1 96  ? 7.113   -28.099 -19.244 1.00 33.14 ? 96  HIS D CB   1  
ATOM 8562   C CG   . HIS D 1 96  ? 6.427   -27.014 -20.045 1.00 14.53 ? 96  HIS D CG   1  
ATOM 8563   N ND1  . HIS D 1 96  ? 5.162   -26.553 -19.753 1.00 54.32 ? 96  HIS D ND1  1  
ATOM 8564   C CD2  . HIS D 1 96  ? 6.869   -26.244 -21.074 1.00 52.44 ? 96  HIS D CD2  1  
ATOM 8565   C CE1  . HIS D 1 96  ? 4.860   -25.558 -20.558 1.00 40.24 ? 96  HIS D CE1  1  
ATOM 8566   N NE2  . HIS D 1 96  ? 5.874   -25.346 -21.366 1.00 21.03 ? 96  HIS D NE2  1  
ATOM 8567   H H    . HIS D 1 96  ? 8.442   -29.535 -17.505 1.00 4.54  ? 96  HIS D H    1  
ATOM 8568   H HA   . HIS D 1 96  ? 8.586   -26.789 -18.360 1.00 50.32 ? 96  HIS D HA   1  
ATOM 8569   H HB2  . HIS D 1 96  ? 7.804   -28.616 -19.895 1.00 63.35 ? 96  HIS D HB2  1  
ATOM 8570   H HB3  . HIS D 1 96  ? 6.354   -28.801 -18.911 1.00 41.44 ? 96  HIS D HB3  1  
ATOM 8571   H HD1  . HIS D 1 96  ? 4.571   -26.903 -19.044 1.00 22.42 ? 96  HIS D HD1  1  
ATOM 8572   H HD2  . HIS D 1 96  ? 7.825   -26.326 -21.577 1.00 73.32 ? 96  HIS D HD2  1  
ATOM 8573   H HE1  . HIS D 1 96  ? 3.931   -25.005 -20.554 1.00 22.51 ? 96  HIS D HE1  1  
ATOM 8574   H HE2  . HIS D 1 96  ? 5.982   -24.546 -21.921 1.00 37.61 ? 96  HIS D HE2  1  
ATOM 8575   N N    . CYS D 1 97  ? 6.228   -27.714 -16.215 1.00 70.23 ? 97  CYS D N    1  
ATOM 8576   C CA   . CYS D 1 97  ? 5.214   -27.256 -15.245 1.00 42.44 ? 97  CYS D CA   1  
ATOM 8577   C C    . CYS D 1 97  ? 5.807   -26.171 -14.338 1.00 2.21  ? 97  CYS D C    1  
ATOM 8578   O O    . CYS D 1 97  ? 5.230   -25.097 -14.163 1.00 42.40 ? 97  CYS D O    1  
ATOM 8579   C CB   . CYS D 1 97  ? 4.703   -28.443 -14.392 1.00 13.14 ? 97  CYS D CB   1  
ATOM 8580   S SG   . CYS D 1 97  ? 3.360   -28.011 -13.256 1.00 71.13 ? 97  CYS D SG   1  
ATOM 8581   H H    . CYS D 1 97  ? 6.440   -28.667 -16.246 1.00 52.11 ? 97  CYS D H    1  
ATOM 8582   H HA   . CYS D 1 97  ? 4.382   -26.839 -15.804 1.00 53.44 ? 97  CYS D HA   1  
ATOM 8583   H HB2  . CYS D 1 97  ? 4.332   -29.222 -15.048 1.00 43.05 ? 97  CYS D HB2  1  
ATOM 8584   H HB3  . CYS D 1 97  ? 5.522   -28.843 -13.796 1.00 34.11 ? 97  CYS D HB3  1  
ATOM 8585   H HG   . CYS D 1 97  ? 2.350   -27.547 -13.980 1.00 61.20 ? 97  CYS D HG   1  
ATOM 8586   N N    . LEU D 1 98  ? 7.015   -26.460 -13.839 1.00 4.12  ? 98  LEU D N    1  
ATOM 8587   C CA   . LEU D 1 98  ? 7.744   -25.602 -12.890 1.00 3.12  ? 98  LEU D CA   1  
ATOM 8588   C C    . LEU D 1 98  ? 8.586   -24.543 -13.618 1.00 63.41 ? 98  LEU D C    1  
ATOM 8589   O O    . LEU D 1 98  ? 8.952   -23.526 -13.027 1.00 31.43 ? 98  LEU D O    1  
ATOM 8590   C CB   . LEU D 1 98  ? 8.638   -26.502 -12.002 1.00 25.32 ? 98  LEU D CB   1  
ATOM 8591   C CG   . LEU D 1 98  ? 7.897   -27.707 -11.344 1.00 31.23 ? 98  LEU D CG   1  
ATOM 8592   C CD1  . LEU D 1 98  ? 8.849   -28.582 -10.521 1.00 23.20 ? 98  LEU D CD1  1  
ATOM 8593   C CD2  . LEU D 1 98  ? 6.699   -27.237 -10.503 1.00 62.11 ? 98  LEU D CD2  1  
ATOM 8594   H H    . LEU D 1 98  ? 7.437   -27.302 -14.116 1.00 30.02 ? 98  LEU D H    1  
ATOM 8595   H HA   . LEU D 1 98  ? 7.017   -25.098 -12.258 1.00 31.04 ? 98  LEU D HA   1  
ATOM 8596   H HB2  . LEU D 1 98  ? 9.452   -26.890 -12.611 1.00 42.14 ? 98  LEU D HB2  1  
ATOM 8597   H HB3  . LEU D 1 98  ? 9.067   -25.894 -11.212 1.00 34.21 ? 98  LEU D HB3  1  
ATOM 8598   H HG   . LEU D 1 98  ? 7.504   -28.335 -12.135 1.00 4.24  ? 98  LEU D HG   1  
ATOM 8599   H HD11 . LEU D 1 98  ? 8.308   -29.440 -10.141 1.00 24.24 ? 98  LEU D HD11 1  
ATOM 8600   H HD12 . LEU D 1 98  ? 9.256   -28.017 -9.693  1.00 32.54 ? 98  LEU D HD12 1  
ATOM 8601   H HD13 . LEU D 1 98  ? 9.659   -28.928 -11.149 1.00 15.23 ? 98  LEU D HD13 1  
ATOM 8602   H HD21 . LEU D 1 98  ? 6.196   -28.093 -10.083 1.00 44.21 ? 98  LEU D HD21 1  
ATOM 8603   H HD22 . LEU D 1 98  ? 6.003   -26.694 -11.130 1.00 32.02 ? 98  LEU D HD22 1  
ATOM 8604   H HD23 . LEU D 1 98  ? 7.037   -26.594 -9.702  1.00 32.30 ? 98  LEU D HD23 1  
ATOM 8605   N N    . GLY D 1 99  ? 8.881   -24.796 -14.906 1.00 31.32 ? 99  GLY D N    1  
ATOM 8606   C CA   . GLY D 1 99  ? 9.723   -23.908 -15.718 1.00 0.23  ? 99  GLY D CA   1  
ATOM 8607   C C    . GLY D 1 99  ? 8.942   -22.992 -16.646 1.00 44.30 ? 99  GLY D C    1  
ATOM 8608   O O    . GLY D 1 99  ? 9.551   -22.225 -17.396 1.00 4.02  ? 99  GLY D O    1  
ATOM 8609   H H    . GLY D 1 99  ? 8.526   -25.612 -15.315 1.00 41.54 ? 99  GLY D H    1  
ATOM 8610   H HA2  . GLY D 1 99  ? 10.339  -23.297 -15.069 1.00 53.14 ? 99  GLY D HA2  1  
ATOM 8611   H HA3  . GLY D 1 99  ? 10.377  -24.527 -16.319 1.00 1.21  ? 99  GLY D HA3  1  
ATOM 8612   N N    . ALA D 1 100 ? 7.596   -23.058 -16.601 1.00 12.43 ? 100 ALA D N    1  
ATOM 8613   C CA   . ALA D 1 100 ? 6.731   -22.243 -17.479 1.00 23.45 ? 100 ALA D CA   1  
ATOM 8614   C C    . ALA D 1 100 ? 5.425   -21.836 -16.773 1.00 43.33 ? 100 ALA D C    1  
ATOM 8615   O O    . ALA D 1 100 ? 5.241   -20.663 -16.457 1.00 2.24  ? 100 ALA D O    1  
ATOM 8616   C CB   . ALA D 1 100 ? 6.447   -22.981 -18.793 1.00 24.41 ? 100 ALA D CB   1  
ATOM 8617   H H    . ALA D 1 100 ? 7.176   -23.671 -15.964 1.00 15.11 ? 100 ALA D H    1  
ATOM 8618   H HA   . ALA D 1 100 ? 7.271   -21.332 -17.730 1.00 5.24  ? 100 ALA D HA   1  
ATOM 8619   H HB1  . ALA D 1 100 ? 5.827   -22.366 -19.433 1.00 31.52 ? 100 ALA D HB1  1  
ATOM 8620   H HB2  . ALA D 1 100 ? 5.934   -23.914 -18.589 1.00 72.15 ? 100 ALA D HB2  1  
ATOM 8621   H HB3  . ALA D 1 100 ? 7.379   -23.193 -19.299 1.00 35.32 ? 100 ALA D HB3  1  
ATOM 8622   N N    . TYR D 1 101 ? 4.537   -22.806 -16.487 1.00 50.13 ? 101 TYR D N    1  
ATOM 8623   C CA   . TYR D 1 101 ? 3.175   -22.493 -15.995 1.00 25.03 ? 101 TYR D CA   1  
ATOM 8624   C C    . TYR D 1 101 ? 3.172   -21.960 -14.535 1.00 21.13 ? 101 TYR D C    1  
ATOM 8625   O O    . TYR D 1 101 ? 2.411   -21.036 -14.213 1.00 52.21 ? 101 TYR D O    1  
ATOM 8626   C CB   . TYR D 1 101 ? 2.246   -23.724 -16.151 1.00 73.24 ? 101 TYR D CB   1  
ATOM 8627   C CG   . TYR D 1 101 ? 0.783   -23.484 -15.725 1.00 12.25 ? 101 TYR D CG   1  
ATOM 8628   C CD1  . TYR D 1 101 ? 0.121   -22.282 -16.022 1.00 75.22 ? 101 TYR D CD1  1  
ATOM 8629   C CD2  . TYR D 1 101 ? 0.067   -24.449 -15.026 1.00 45.15 ? 101 TYR D CD2  1  
ATOM 8630   C CE1  . TYR D 1 101 ? -1.185  -22.065 -15.624 1.00 61.12 ? 101 TYR D CE1  1  
ATOM 8631   C CE2  . TYR D 1 101 ? -1.238  -24.233 -14.638 1.00 14.21 ? 101 TYR D CE2  1  
ATOM 8632   C CZ   . TYR D 1 101 ? -1.860  -23.044 -14.934 1.00 20.42 ? 101 TYR D CZ   1  
ATOM 8633   O OH   . TYR D 1 101 ? -3.158  -22.830 -14.520 1.00 52.14 ? 101 TYR D OH   1  
ATOM 8634   H H    . TYR D 1 101 ? 4.793   -23.743 -16.617 1.00 34.42 ? 101 TYR D H    1  
ATOM 8635   H HA   . TYR D 1 101 ? 2.788   -21.702 -16.637 1.00 62.32 ? 101 TYR D HA   1  
ATOM 8636   H HB2  . TYR D 1 101 ? 2.235   -24.027 -17.190 1.00 35.01 ? 101 TYR D HB2  1  
ATOM 8637   H HB3  . TYR D 1 101 ? 2.645   -24.540 -15.556 1.00 13.23 ? 101 TYR D HB3  1  
ATOM 8638   H HD1  . TYR D 1 101 ? 0.652   -21.508 -16.564 1.00 1.31  ? 101 TYR D HD1  1  
ATOM 8639   H HD2  . TYR D 1 101 ? 0.549   -25.386 -14.777 1.00 23.20 ? 101 TYR D HD2  1  
ATOM 8640   H HE1  . TYR D 1 101 ? -1.674  -21.129 -15.865 1.00 72.13 ? 101 TYR D HE1  1  
ATOM 8641   H HE2  . TYR D 1 101 ? -1.768  -25.002 -14.093 1.00 20.23 ? 101 TYR D HE2  1  
ATOM 8642   H HH   . TYR D 1 101 ? -3.665  -22.438 -15.236 1.00 53.02 ? 101 TYR D HH   1  
ATOM 8643   N N    . CYS D 1 102 ? 4.030   -22.519 -13.673 1.00 24.43 ? 102 CYS D N    1  
ATOM 8644   C CA   . CYS D 1 102 ? 4.118   -22.097 -12.260 1.00 35.32 ? 102 CYS D CA   1  
ATOM 8645   C C    . CYS D 1 102 ? 4.698   -20.645 -12.127 1.00 63.33 ? 102 CYS D C    1  
ATOM 8646   O O    . CYS D 1 102 ? 4.090   -19.824 -11.430 1.00 3.13  ? 102 CYS D O    1  
ATOM 8647   C CB   . CYS D 1 102 ? 4.927   -23.116 -11.431 1.00 43.42 ? 102 CYS D CB   1  
ATOM 8648   S SG   . CYS D 1 102 ? 4.231   -24.780 -11.378 1.00 2.30  ? 102 CYS D SG   1  
ATOM 8649   H H    . CYS D 1 102 ? 4.615   -23.227 -13.992 1.00 71.31 ? 102 CYS D H    1  
ATOM 8650   H HA   . CYS D 1 102 ? 3.096   -22.090 -11.873 1.00 13.11 ? 102 CYS D HA   1  
ATOM 8651   H HB2  . CYS D 1 102 ? 5.923   -23.204 -11.841 1.00 24.12 ? 102 CYS D HB2  1  
ATOM 8652   H HB3  . CYS D 1 102 ? 5.004   -22.769 -10.406 1.00 53.00 ? 102 CYS D HB3  1  
ATOM 8653   H HG   . CYS D 1 102 ? 3.747   -25.062 -12.579 1.00 31.31 ? 102 CYS D HG   1  
ATOM 8654   N N    . PRO D 1 103 ? 5.876   -20.281 -12.792 1.00 41.42 ? 103 PRO D N    1  
ATOM 8655   C CA   . PRO D 1 103 ? 6.358   -18.867 -12.863 1.00 33.54 ? 103 PRO D CA   1  
ATOM 8656   C C    . PRO D 1 103 ? 5.342   -17.913 -13.522 1.00 20.22 ? 103 PRO D C    1  
ATOM 8657   O O    . PRO D 1 103 ? 5.307   -16.722 -13.199 1.00 44.31 ? 103 PRO D O    1  
ATOM 8658   C CB   . PRO D 1 103 ? 7.663   -18.941 -13.720 1.00 34.24 ? 103 PRO D CB   1  
ATOM 8659   C CG   . PRO D 1 103 ? 7.670   -20.300 -14.341 1.00 51.14 ? 103 PRO D CG   1  
ATOM 8660   C CD   . PRO D 1 103 ? 6.864   -21.191 -13.429 1.00 32.01 ? 103 PRO D CD   1  
ATOM 8661   H HA   . PRO D 1 103 ? 6.596   -18.491 -11.861 1.00 60.43 ? 103 PRO D HA   1  
ATOM 8662   H HB2  . PRO D 1 103 ? 7.682   -18.160 -14.482 1.00 44.41 ? 103 PRO D HB2  1  
ATOM 8663   H HB3  . PRO D 1 103 ? 8.528   -18.827 -13.082 1.00 64.44 ? 103 PRO D HB3  1  
ATOM 8664   H HG2  . PRO D 1 103 ? 7.212   -20.252 -15.328 1.00 74.51 ? 103 PRO D HG2  1  
ATOM 8665   H HG3  . PRO D 1 103 ? 8.684   -20.674 -14.430 1.00 1.10  ? 103 PRO D HG3  1  
ATOM 8666   H HD2  . PRO D 1 103 ? 6.362   -21.965 -14.005 1.00 61.53 ? 103 PRO D HD2  1  
ATOM 8667   H HD3  . PRO D 1 103 ? 7.500   -21.644 -12.676 1.00 73.15 ? 103 PRO D HD3  1  
ATOM 8668   N N    . ASN D 1 104 ? 4.528   -18.460 -14.445 1.00 54.23 ? 104 ASN D N    1  
ATOM 8669   C CA   . ASN D 1 104 ? 3.482   -17.706 -15.164 1.00 31.42 ? 104 ASN D CA   1  
ATOM 8670   C C    . ASN D 1 104 ? 2.412   -17.189 -14.179 1.00 44.50 ? 104 ASN D C    1  
ATOM 8671   O O    . ASN D 1 104 ? 1.869   -16.094 -14.357 1.00 24.23 ? 104 ASN D O    1  
ATOM 8672   C CB   . ASN D 1 104 ? 2.829   -18.610 -16.241 1.00 10.41 ? 104 ASN D CB   1  
ATOM 8673   C CG   . ASN D 1 104 ? 1.998   -17.837 -17.254 1.00 32.23 ? 104 ASN D CG   1  
ATOM 8674   O OD1  . ASN D 1 104 ? 0.815   -17.574 -17.045 1.00 32.40 ? 104 ASN D OD1  1  
ATOM 8675   N ND2  . ASN D 1 104 ? 2.598   -17.515 -18.388 1.00 0.25  ? 104 ASN D ND2  1  
ATOM 8676   H H    . ASN D 1 104 ? 4.643   -19.410 -14.661 1.00 20.32 ? 104 ASN D H    1  
ATOM 8677   H HA   . ASN D 1 104 ? 3.960   -16.858 -15.650 1.00 53.24 ? 104 ASN D HA   1  
ATOM 8678   H HB2  . ASN D 1 104 ? 3.609   -19.143 -16.774 1.00 71.12 ? 104 ASN D HB2  1  
ATOM 8679   H HB3  . ASN D 1 104 ? 2.190   -19.341 -15.755 1.00 64.13 ? 104 ASN D HB3  1  
ATOM 8680   H HD21 . ASN D 1 104 ? 3.533   -17.793 -18.512 1.00 64.12 ? 104 ASN D HD21 1  
ATOM 8681   H HD22 . ASN D 1 104 ? 2.098   -17.015 -19.053 1.00 13.00 ? 104 ASN D HD22 1  
ATOM 8682   N N    . ILE D 1 105 ? 2.126   -18.007 -13.142 1.00 30.24 ? 105 ILE D N    1  
ATOM 8683   C CA   . ILE D 1 105 ? 1.207   -17.643 -12.040 1.00 74.54 ? 105 ILE D CA   1  
ATOM 8684   C C    . ILE D 1 105 ? 1.829   -16.528 -11.167 1.00 42.12 ? 105 ILE D C    1  
ATOM 8685   O O    . ILE D 1 105 ? 1.137   -15.601 -10.739 1.00 24.32 ? 105 ILE D O    1  
ATOM 8686   C CB   . ILE D 1 105 ? 0.867   -18.905 -11.141 1.00 30.25 ? 105 ILE D CB   1  
ATOM 8687   C CG1  . ILE D 1 105 ? 0.142   -20.015 -11.981 1.00 72.22 ? 105 ILE D CG1  1  
ATOM 8688   C CG2  . ILE D 1 105 ? 0.048   -18.528 -9.873  1.00 45.31 ? 105 ILE D CG2  1  
ATOM 8689   C CD1  . ILE D 1 105 ? -1.190  -19.607 -12.610 1.00 53.43 ? 105 ILE D CD1  1  
ATOM 8690   H H    . ILE D 1 105 ? 2.548   -18.891 -13.121 1.00 34.22 ? 105 ILE D H    1  
ATOM 8691   H HA   . ILE D 1 105 ? 0.283   -17.276 -12.478 1.00 0.51  ? 105 ILE D HA   1  
ATOM 8692   H HB   . ILE D 1 105 ? 1.815   -19.314 -10.792 1.00 32.45 ? 105 ILE D HB   1  
ATOM 8693   H HG12 . ILE D 1 105 ? 0.792   -20.325 -12.786 1.00 15.10 ? 105 ILE D HG12 1  
ATOM 8694   H HG13 . ILE D 1 105 ? -0.046  -20.872 -11.344 1.00 52.44 ? 105 ILE D HG13 1  
ATOM 8695   H HG21 . ILE D 1 105 ? 0.619   -17.838 -9.258  1.00 31.32 ? 105 ILE D HG21 1  
ATOM 8696   H HG22 . ILE D 1 105 ? -0.165  -19.419 -9.296  1.00 1.44  ? 105 ILE D HG22 1  
ATOM 8697   H HG23 . ILE D 1 105 ? -0.886  -18.062 -10.162 1.00 15.14 ? 105 ILE D HG23 1  
ATOM 8698   H HD11 . ILE D 1 105 ? -1.554  -20.413 -13.229 1.00 31.55 ? 105 ILE D HD11 1  
ATOM 8699   H HD12 . ILE D 1 105 ? -1.055  -18.724 -13.218 1.00 54.22 ? 105 ILE D HD12 1  
ATOM 8700   H HD13 . ILE D 1 105 ? -1.915  -19.401 -11.834 1.00 63.13 ? 105 ILE D HD13 1  
ATOM 8701   N N    . LEU D 1 106 ? 3.151   -16.617 -10.958 1.00 21.45 ? 106 LEU D N    1  
ATOM 8702   C CA   . LEU D 1 106 ? 3.894   -15.733 -10.031 1.00 45.30 ? 106 LEU D CA   1  
ATOM 8703   C C    . LEU D 1 106 ? 4.245   -14.371 -10.665 1.00 72.40 ? 106 LEU D C    1  
ATOM 8704   O O    . LEU D 1 106 ? 4.487   -13.403 -9.941  1.00 42.02 ? 106 LEU D O    1  
ATOM 8705   C CB   . LEU D 1 106 ? 5.185   -16.450 -9.569  1.00 73.13 ? 106 LEU D CB   1  
ATOM 8706   C CG   . LEU D 1 106 ? 4.983   -17.823 -8.853  1.00 53.03 ? 106 LEU D CG   1  
ATOM 8707   C CD1  . LEU D 1 106 ? 6.337   -18.467 -8.502  1.00 11.51 ? 106 LEU D CD1  1  
ATOM 8708   C CD2  . LEU D 1 106 ? 4.077   -17.683 -7.605  1.00 61.23 ? 106 LEU D CD2  1  
ATOM 8709   H H    . LEU D 1 106 ? 3.652   -17.304 -11.445 1.00 31.55 ? 106 LEU D H    1  
ATOM 8710   H HA   . LEU D 1 106 ? 3.265   -15.559 -9.163  1.00 73.51 ? 106 LEU D HA   1  
ATOM 8711   H HB2  . LEU D 1 106 ? 5.810   -16.610 -10.446 1.00 4.21  ? 106 LEU D HB2  1  
ATOM 8712   H HB3  . LEU D 1 106 ? 5.718   -15.790 -8.894  1.00 21.43 ? 106 LEU D HB3  1  
ATOM 8713   H HG   . LEU D 1 106 ? 4.483   -18.497 -9.540  1.00 52.03 ? 106 LEU D HG   1  
ATOM 8714   H HD11 . LEU D 1 106 ? 6.906   -17.808 -7.867  1.00 12.04 ? 106 LEU D HD11 1  
ATOM 8715   H HD12 . LEU D 1 106 ? 6.898   -18.643 -9.401  1.00 32.42 ? 106 LEU D HD12 1  
ATOM 8716   H HD13 . LEU D 1 106 ? 6.181   -19.409 -7.993  1.00 72.00 ? 106 LEU D HD13 1  
ATOM 8717   H HD21 . LEU D 1 106 ? 3.099   -17.344 -7.905  1.00 14.22 ? 106 LEU D HD21 1  
ATOM 8718   H HD22 . LEU D 1 106 ? 4.499   -16.969 -6.916  1.00 3.04  ? 106 LEU D HD22 1  
ATOM 8719   H HD23 . LEU D 1 106 ? 3.981   -18.643 -7.112  1.00 14.23 ? 106 LEU D HD23 1  
ATOM 8720   N N    . PHE D 1 107 ? 4.266   -14.315 -12.013 1.00 44.22 ? 107 PHE D N    1  
ATOM 8721   C CA   . PHE D 1 107 ? 4.665   -13.107 -12.781 1.00 34.14 ? 107 PHE D CA   1  
ATOM 8722   C C    . PHE D 1 107 ? 3.725   -11.882 -12.531 1.00 33.42 ? 107 PHE D C    1  
ATOM 8723   O O    . PHE D 1 107 ? 4.240   -10.778 -12.324 1.00 31.42 ? 107 PHE D O    1  
ATOM 8724   C CB   . PHE D 1 107 ? 4.784   -13.431 -14.304 1.00 60.32 ? 107 PHE D CB   1  
ATOM 8725   C CG   . PHE D 1 107 ? 5.176   -12.236 -15.189 1.00 5.43  ? 107 PHE D CG   1  
ATOM 8726   C CD1  . PHE D 1 107 ? 6.427   -11.625 -15.057 1.00 14.13 ? 107 PHE D CD1  1  
ATOM 8727   C CD2  . PHE D 1 107 ? 4.300   -11.733 -16.157 1.00 62.11 ? 107 PHE D CD2  1  
ATOM 8728   C CE1  . PHE D 1 107 ? 6.782   -10.549 -15.856 1.00 52.11 ? 107 PHE D CE1  1  
ATOM 8729   C CE2  . PHE D 1 107 ? 4.658   -10.659 -16.952 1.00 44.52 ? 107 PHE D CE2  1  
ATOM 8730   C CZ   . PHE D 1 107 ? 5.898   -10.070 -16.804 1.00 24.13 ? 107 PHE D CZ   1  
ATOM 8731   H H    . PHE D 1 107 ? 4.014   -15.119 -12.514 1.00 74.14 ? 107 PHE D H    1  
ATOM 8732   H HA   . PHE D 1 107 ? 5.658   -12.837 -12.422 1.00 15.22 ? 107 PHE D HA   1  
ATOM 8733   H HB2  . PHE D 1 107 ? 5.533   -14.201 -14.443 1.00 11.41 ? 107 PHE D HB2  1  
ATOM 8734   H HB3  . PHE D 1 107 ? 3.831   -13.818 -14.653 1.00 42.32 ? 107 PHE D HB3  1  
ATOM 8735   H HD1  . PHE D 1 107 ? 7.125   -11.996 -14.318 1.00 24.04 ? 107 PHE D HD1  1  
ATOM 8736   H HD2  . PHE D 1 107 ? 3.324   -12.190 -16.280 1.00 5.12  ? 107 PHE D HD2  1  
ATOM 8737   H HE1  . PHE D 1 107 ? 7.752   -10.087 -15.740 1.00 41.45 ? 107 PHE D HE1  1  
ATOM 8738   H HE2  . PHE D 1 107 ? 3.965   -10.281 -17.695 1.00 14.24 ? 107 PHE D HE2  1  
ATOM 8739   H HZ   . PHE D 1 107 ? 6.175   -9.229  -17.428 1.00 53.20 ? 107 PHE D HZ   1  
ATOM 8740   N N    . PRO D 1 108 ? 2.342   -12.024 -12.561 1.00 34.23 ? 108 PRO D N    1  
ATOM 8741   C CA   . PRO D 1 108 ? 1.415   -10.906 -12.205 1.00 21.05 ? 108 PRO D CA   1  
ATOM 8742   C C    . PRO D 1 108 ? 1.669   -10.328 -10.793 1.00 2.34  ? 108 PRO D C    1  
ATOM 8743   O O    . PRO D 1 108 ? 1.612   -9.109  -10.596 1.00 30.23 ? 108 PRO D O    1  
ATOM 8744   C CB   . PRO D 1 108 ? 0.007   -11.557 -12.293 1.00 25.13 ? 108 PRO D CB   1  
ATOM 8745   C CG   . PRO D 1 108 ? 0.182   -12.692 -13.255 1.00 70.23 ? 108 PRO D CG   1  
ATOM 8746   C CD   . PRO D 1 108 ? 1.570   -13.224 -12.995 1.00 2.23  ? 108 PRO D CD   1  
ATOM 8747   H HA   . PRO D 1 108 ? 1.490   -10.102 -12.934 1.00 50.20 ? 108 PRO D HA   1  
ATOM 8748   H HB2  . PRO D 1 108 ? -0.310  -11.919 -11.312 1.00 22.42 ? 108 PRO D HB2  1  
ATOM 8749   H HB3  . PRO D 1 108 ? -0.718  -10.848 -12.672 1.00 14.24 ? 108 PRO D HB3  1  
ATOM 8750   H HG2  . PRO D 1 108 ? -0.566  -13.459 -13.071 1.00 12.51 ? 108 PRO D HG2  1  
ATOM 8751   H HG3  . PRO D 1 108 ? 0.106   -12.334 -14.278 1.00 14.45 ? 108 PRO D HG3  1  
ATOM 8752   H HD2  . PRO D 1 108 ? 1.555   -13.974 -12.210 1.00 60.33 ? 108 PRO D HD2  1  
ATOM 8753   H HD3  . PRO D 1 108 ? 1.996   -13.643 -13.900 1.00 63.33 ? 108 PRO D HD3  1  
ATOM 8754   N N    . TYR D 1 109 ? 1.972   -11.225 -9.834  1.00 65.54 ? 109 TYR D N    1  
ATOM 8755   C CA   . TYR D 1 109 ? 2.225   -10.860 -8.422  1.00 62.11 ? 109 TYR D CA   1  
ATOM 8756   C C    . TYR D 1 109 ? 3.600   -10.185 -8.245  1.00 42.14 ? 109 TYR D C    1  
ATOM 8757   O O    . TYR D 1 109 ? 3.744   -9.271  -7.424  1.00 30.41 ? 109 TYR D O    1  
ATOM 8758   C CB   . TYR D 1 109 ? 2.138   -12.115 -7.522  1.00 12.11 ? 109 TYR D CB   1  
ATOM 8759   C CG   . TYR D 1 109 ? 0.747   -12.760 -7.453  1.00 25.31 ? 109 TYR D CG   1  
ATOM 8760   C CD1  . TYR D 1 109 ? 0.419   -13.868 -8.239  1.00 11.21 ? 109 TYR D CD1  1  
ATOM 8761   C CD2  . TYR D 1 109 ? -0.235  -12.263 -6.591  1.00 53.34 ? 109 TYR D CD2  1  
ATOM 8762   C CE1  . TYR D 1 109 ? -0.831  -14.454 -8.166  1.00 11.52 ? 109 TYR D CE1  1  
ATOM 8763   C CE2  . TYR D 1 109 ? -1.483  -12.847 -6.516  1.00 32.12 ? 109 TYR D CE2  1  
ATOM 8764   C CZ   . TYR D 1 109 ? -1.777  -13.940 -7.303  1.00 62.40 ? 109 TYR D CZ   1  
ATOM 8765   O OH   . TYR D 1 109 ? -3.022  -14.520 -7.228  1.00 22.50 ? 109 TYR D OH   1  
ATOM 8766   H H    . TYR D 1 109 ? 2.029   -12.170 -10.086 1.00 2.13  ? 109 TYR D H    1  
ATOM 8767   H HA   . TYR D 1 109 ? 1.451   -10.159 -8.117  1.00 40.44 ? 109 TYR D HA   1  
ATOM 8768   H HB2  . TYR D 1 109 ? 2.838   -12.860 -7.888  1.00 53.51 ? 109 TYR D HB2  1  
ATOM 8769   H HB3  . TYR D 1 109 ? 2.429   -11.847 -6.509  1.00 62.40 ? 109 TYR D HB3  1  
ATOM 8770   H HD1  . TYR D 1 109 ? 1.164   -14.274 -8.915  1.00 43.20 ? 109 TYR D HD1  1  
ATOM 8771   H HD2  . TYR D 1 109 ? -0.007  -11.402 -5.971  1.00 11.52 ? 109 TYR D HD2  1  
ATOM 8772   H HE1  . TYR D 1 109 ? -1.062  -15.313 -8.784  1.00 74.43 ? 109 TYR D HE1  1  
ATOM 8773   H HE2  . TYR D 1 109 ? -2.224  -12.447 -5.839  1.00 4.22  ? 109 TYR D HE2  1  
ATOM 8774   H HH   . TYR D 1 109 ? -3.697  -13.851 -7.361  1.00 2.34  ? 109 TYR D HH   1  
ATOM 8775   N N    . ALA D 1 110 ? 4.604   -10.658 -9.011  1.00 40.11 ? 110 ALA D N    1  
ATOM 8776   C CA   . ALA D 1 110 ? 5.960   -10.074 -9.007  1.00 53.11 ? 110 ALA D CA   1  
ATOM 8777   C C    . ALA D 1 110 ? 5.906   -8.642  -9.548  1.00 54.34 ? 110 ALA D C    1  
ATOM 8778   O O    . ALA D 1 110 ? 6.416   -7.710  -8.915  1.00 21.21 ? 110 ALA D O    1  
ATOM 8779   C CB   . ALA D 1 110 ? 6.929   -10.919 -9.848  1.00 1.14  ? 110 ALA D CB   1  
ATOM 8780   H H    . ALA D 1 110 ? 4.425   -11.417 -9.599  1.00 63.44 ? 110 ALA D H    1  
ATOM 8781   H HA   . ALA D 1 110 ? 6.322   -10.061 -7.981  1.00 51.12 ? 110 ALA D HA   1  
ATOM 8782   H HB1  . ALA D 1 110 ? 7.898   -10.438 -9.884  1.00 22.13 ? 110 ALA D HB1  1  
ATOM 8783   H HB2  . ALA D 1 110 ? 6.547   -11.028 -10.855 1.00 23.23 ? 110 ALA D HB2  1  
ATOM 8784   H HB3  . ALA D 1 110 ? 7.048   -11.893 -9.408  1.00 21.53 ? 110 ALA D HB3  1  
ATOM 8785   N N    . ARG D 1 111 ? 5.235   -8.498  -10.714 1.00 54.24 ? 111 ARG D N    1  
ATOM 8786   C CA   . ARG D 1 111 ? 5.046   -7.205  -11.394 1.00 35.42 ? 111 ARG D CA   1  
ATOM 8787   C C    . ARG D 1 111 ? 4.312   -6.221  -10.473 1.00 64.15 ? 111 ARG D C    1  
ATOM 8788   O O    . ARG D 1 111 ? 4.741   -5.082  -10.339 1.00 1.14  ? 111 ARG D O    1  
ATOM 8789   C CB   . ARG D 1 111 ? 4.261   -7.377  -12.736 1.00 43.14 ? 111 ARG D CB   1  
ATOM 8790   C CG   . ARG D 1 111 ? 3.848   -6.042  -13.419 1.00 32.11 ? 111 ARG D CG   1  
ATOM 8791   C CD   . ARG D 1 111 ? 3.141   -6.232  -14.776 1.00 43.13 ? 111 ARG D CD   1  
ATOM 8792   N NE   . ARG D 1 111 ? 1.884   -7.013  -14.691 1.00 1.21  ? 111 ARG D NE   1  
ATOM 8793   C CZ   . ARG D 1 111 ? 1.567   -8.050  -15.491 1.00 1.23  ? 111 ARG D CZ   1  
ATOM 8794   N NH1  . ARG D 1 111 ? 2.375   -8.426  -16.481 1.00 74.13 ? 111 ARG D NH1  1  
ATOM 8795   N NH2  . ARG D 1 111 ? 0.434   -8.711  -15.296 1.00 33.24 ? 111 ARG D NH2  1  
ATOM 8796   H H    . ARG D 1 111 ? 4.852   -9.297  -11.126 1.00 23.33 ? 111 ARG D H    1  
ATOM 8797   H HA   . ARG D 1 111 ? 6.039   -6.812  -11.611 1.00 3.20  ? 111 ARG D HA   1  
ATOM 8798   H HB2  . ARG D 1 111 ? 4.881   -7.936  -13.429 1.00 43.12 ? 111 ARG D HB2  1  
ATOM 8799   H HB3  . ARG D 1 111 ? 3.360   -7.952  -12.544 1.00 22.20 ? 111 ARG D HB3  1  
ATOM 8800   H HG2  . ARG D 1 111 ? 3.173   -5.510  -12.757 1.00 30.20 ? 111 ARG D HG2  1  
ATOM 8801   H HG3  . ARG D 1 111 ? 4.739   -5.437  -13.569 1.00 73.35 ? 111 ARG D HG3  1  
ATOM 8802   H HD2  . ARG D 1 111 ? 2.900   -5.254  -15.177 1.00 3.03  ? 111 ARG D HD2  1  
ATOM 8803   H HD3  . ARG D 1 111 ? 3.827   -6.726  -15.457 1.00 13.14 ? 111 ARG D HD3  1  
ATOM 8804   H HE   . ARG D 1 111 ? 1.226   -6.723  -14.016 1.00 4.12  ? 111 ARG D HE   1  
ATOM 8805   H HH11 . ARG D 1 111 ? 3.247   -7.944  -16.632 1.00 13.22 ? 111 ARG D HH11 1  
ATOM 8806   H HH12 . ARG D 1 111 ? 2.126   -9.192  -17.074 1.00 1.43  ? 111 ARG D HH12 1  
ATOM 8807   H HH21 . ARG D 1 111 ? -0.176  -8.453  -14.541 1.00 22.24 ? 111 ARG D HH21 1  
ATOM 8808   H HH22 . ARG D 1 111 ? 0.191   -9.479  -15.891 1.00 10.52 ? 111 ARG D HH22 1  
ATOM 8809   N N    . GLU D 1 112 ? 3.232   -6.699  -9.820  1.00 34.24 ? 112 GLU D N    1  
ATOM 8810   C CA   . GLU D 1 112 ? 2.390   -5.873  -8.928  1.00 65.23 ? 112 GLU D CA   1  
ATOM 8811   C C    . GLU D 1 112 ? 3.210   -5.330  -7.750  1.00 42.35 ? 112 GLU D C    1  
ATOM 8812   O O    . GLU D 1 112 ? 3.208   -4.123  -7.505  1.00 13.23 ? 112 GLU D O    1  
ATOM 8813   C CB   . GLU D 1 112 ? 1.168   -6.698  -8.421  1.00 14.50 ? 112 GLU D CB   1  
ATOM 8814   C CG   . GLU D 1 112 ? 0.178   -5.961  -7.460  1.00 35.23 ? 112 GLU D CG   1  
ATOM 8815   C CD   . GLU D 1 112 ? 0.610   -5.950  -5.972  1.00 23.42 ? 112 GLU D CD   1  
ATOM 8816   O OE1  . GLU D 1 112 ? 0.701   -7.043  -5.371  1.00 13.43 ? 112 GLU D OE1  1  
ATOM 8817   O OE2  . GLU D 1 112 ? 0.887   -4.860  -5.414  1.00 41.31 ? 112 GLU D OE2  1  
ATOM 8818   H H    . GLU D 1 112 ? 2.996   -7.646  -9.935  1.00 54.34 ? 112 GLU D H    1  
ATOM 8819   H HA   . GLU D 1 112 ? 2.020   -5.033  -9.516  1.00 3.43  ? 112 GLU D HA   1  
ATOM 8820   H HB2  . GLU D 1 112 ? 0.609   -7.030  -9.288  1.00 33.32 ? 112 GLU D HB2  1  
ATOM 8821   H HB3  . GLU D 1 112 ? 1.540   -7.581  -7.909  1.00 14.50 ? 112 GLU D HB3  1  
ATOM 8822   H HG2  . GLU D 1 112 ? 0.061   -4.938  -7.802  1.00 4.41  ? 112 GLU D HG2  1  
ATOM 8823   H HG3  . GLU D 1 112 ? -0.787  -6.451  -7.523  1.00 33.44 ? 112 GLU D HG3  1  
ATOM 8824   N N    . CYS D 1 113 ? 3.906   -6.246  -7.032  1.00 45.40 ? 113 CYS D N    1  
ATOM 8825   C CA   . CYS D 1 113 ? 4.688   -5.907  -5.825  1.00 65.42 ? 113 CYS D CA   1  
ATOM 8826   C C    . CYS D 1 113 ? 5.732   -4.819  -6.134  1.00 63.52 ? 113 CYS D C    1  
ATOM 8827   O O    . CYS D 1 113 ? 5.873   -3.847  -5.380  1.00 31.41 ? 113 CYS D O    1  
ATOM 8828   C CB   . CYS D 1 113 ? 5.375   -7.164  -5.241  1.00 64.40 ? 113 CYS D CB   1  
ATOM 8829   S SG   . CYS D 1 113 ? 6.240   -6.881  -3.672  1.00 64.44 ? 113 CYS D SG   1  
ATOM 8830   H H    . CYS D 1 113 ? 3.878   -7.182  -7.322  1.00 4.51  ? 113 CYS D H    1  
ATOM 8831   H HA   . CYS D 1 113 ? 3.990   -5.522  -5.088  1.00 4.30  ? 113 CYS D HA   1  
ATOM 8832   H HB2  . CYS D 1 113 ? 4.630   -7.927  -5.061  1.00 41.02 ? 113 CYS D HB2  1  
ATOM 8833   H HB3  . CYS D 1 113 ? 6.101   -7.543  -5.950  1.00 34.55 ? 113 CYS D HB3  1  
ATOM 8834   H HG   . CYS D 1 113 ? 6.463   -5.578  -3.554  1.00 33.31 ? 113 CYS D HG   1  
ATOM 8835   N N    . ILE D 1 114 ? 6.426   -4.996  -7.274  1.00 31.45 ? 114 ILE D N    1  
ATOM 8836   C CA   . ILE D 1 114 ? 7.405   -4.025  -7.811  1.00 70.12 ? 114 ILE D CA   1  
ATOM 8837   C C    . ILE D 1 114 ? 6.724   -2.683  -8.122  1.00 2.42  ? 114 ILE D C    1  
ATOM 8838   O O    . ILE D 1 114 ? 7.102   -1.661  -7.553  1.00 20.14 ? 114 ILE D O    1  
ATOM 8839   C CB   . ILE D 1 114 ? 8.115   -4.619  -9.094  1.00 5.35  ? 114 ILE D CB   1  
ATOM 8840   C CG1  . ILE D 1 114 ? 9.053   -5.800  -8.672  1.00 64.51 ? 114 ILE D CG1  1  
ATOM 8841   C CG2  . ILE D 1 114 ? 8.899   -3.543  -9.910  1.00 54.13 ? 114 ILE D CG2  1  
ATOM 8842   C CD1  . ILE D 1 114 ? 9.468   -6.724  -9.790  1.00 12.04 ? 114 ILE D CD1  1  
ATOM 8843   H H    . ILE D 1 114 ? 6.271   -5.819  -7.783  1.00 14.32 ? 114 ILE D H    1  
ATOM 8844   H HA   . ILE D 1 114 ? 8.164   -3.864  -7.048  1.00 11.11 ? 114 ILE D HA   1  
ATOM 8845   H HB   . ILE D 1 114 ? 7.338   -5.012  -9.744  1.00 2.21  ? 114 ILE D HB   1  
ATOM 8846   H HG12 . ILE D 1 114 ? 9.957   -5.404  -8.232  1.00 64.40 ? 114 ILE D HG12 1  
ATOM 8847   H HG13 . ILE D 1 114 ? 8.547   -6.409  -7.931  1.00 5.51  ? 114 ILE D HG13 1  
ATOM 8848   H HG21 . ILE D 1 114 ? 9.286   -3.981  -10.817 1.00 64.22 ? 114 ILE D HG21 1  
ATOM 8849   H HG22 . ILE D 1 114 ? 9.723   -3.163  -9.324  1.00 35.20 ? 114 ILE D HG22 1  
ATOM 8850   H HG23 . ILE D 1 114 ? 8.246   -2.724  -10.172 1.00 71.35 ? 114 ILE D HG23 1  
ATOM 8851   H HD11 . ILE D 1 114 ? 10.327  -7.291  -9.486  1.00 33.52 ? 114 ILE D HD11 1  
ATOM 8852   H HD12 . ILE D 1 114 ? 9.705   -6.160  -10.683 1.00 44.20 ? 114 ILE D HD12 1  
ATOM 8853   H HD13 . ILE D 1 114 ? 8.661   -7.403  -9.991  1.00 11.20 ? 114 ILE D HD13 1  
ATOM 8854   N N    . THR D 1 115 ? 5.665   -2.731  -8.959  1.00 12.35 ? 115 THR D N    1  
ATOM 8855   C CA   . THR D 1 115 ? 4.961   -1.536  -9.478  1.00 61.32 ? 115 THR D CA   1  
ATOM 8856   C C    . THR D 1 115 ? 4.394   -0.665  -8.326  1.00 41.51 ? 115 THR D C    1  
ATOM 8857   O O    . THR D 1 115 ? 4.416   0.578   -8.389  1.00 64.54 ? 115 THR D O    1  
ATOM 8858   C CB   . THR D 1 115 ? 3.804   -1.964  -10.458 1.00 33.41 ? 115 THR D CB   1  
ATOM 8859   O OG1  . THR D 1 115 ? 4.340   -2.709  -11.568 1.00 12.34 ? 115 THR D OG1  1  
ATOM 8860   C CG2  . THR D 1 115 ? 3.015   -0.767  -11.008 1.00 15.23 ? 115 THR D CG2  1  
ATOM 8861   H H    . THR D 1 115 ? 5.328   -3.608  -9.221  1.00 52.52 ? 115 THR D H    1  
ATOM 8862   H HA   . THR D 1 115 ? 5.689   -0.956  -10.041 1.00 15.30 ? 115 THR D HA   1  
ATOM 8863   H HB   . THR D 1 115 ? 3.118   -2.613  -9.918  1.00 11.31 ? 115 THR D HB   1  
ATOM 8864   H HG1  . THR D 1 115 ? 5.131   -3.177  -11.291 1.00 74.20 ? 115 THR D HG1  1  
ATOM 8865   H HG21 . THR D 1 115 ? 2.267   -1.112  -11.708 1.00 34.41 ? 115 THR D HG21 1  
ATOM 8866   H HG22 . THR D 1 115 ? 3.682   -0.093  -11.516 1.00 3.30  ? 115 THR D HG22 1  
ATOM 8867   H HG23 . THR D 1 115 ? 2.528   -0.242  -10.196 1.00 41.44 ? 115 THR D HG23 1  
ATOM 8868   N N    . SER D 1 116 ? 3.929   -1.347  -7.262  1.00 62.42 ? 116 SER D N    1  
ATOM 8869   C CA   . SER D 1 116 ? 3.398   -0.705  -6.049  1.00 70.31 ? 116 SER D CA   1  
ATOM 8870   C C    . SER D 1 116 ? 4.534   0.014   -5.300  1.00 74.32 ? 116 SER D C    1  
ATOM 8871   O O    . SER D 1 116 ? 4.374   1.152   -4.882  1.00 61.21 ? 116 SER D O    1  
ATOM 8872   C CB   . SER D 1 116 ? 2.714   -1.760  -5.137  1.00 71.42 ? 116 SER D CB   1  
ATOM 8873   O OG   . SER D 1 116 ? 2.154   -1.179  -3.958  1.00 40.43 ? 116 SER D OG   1  
ATOM 8874   H H    . SER D 1 116 ? 3.959   -2.322  -7.291  1.00 63.23 ? 116 SER D H    1  
ATOM 8875   H HA   . SER D 1 116 ? 2.657   0.034   -6.358  1.00 33.41 ? 116 SER D HA   1  
ATOM 8876   H HB2  . SER D 1 116 ? 1.918   -2.245  -5.687  1.00 12.25 ? 116 SER D HB2  1  
ATOM 8877   H HB3  . SER D 1 116 ? 3.440   -2.510  -4.839  1.00 1.40  ? 116 SER D HB3  1  
ATOM 8878   H HG   . SER D 1 116 ? 1.228   -1.451  -3.873  1.00 54.04 ? 116 SER D HG   1  
ATOM 8879   N N    . MET D 1 117 ? 5.701   -0.651  -5.180  1.00 33.23 ? 117 MET D N    1  
ATOM 8880   C CA   . MET D 1 117 ? 6.882   -0.081  -4.487  1.00 3.34  ? 117 MET D CA   1  
ATOM 8881   C C    . MET D 1 117 ? 7.508   1.078   -5.282  1.00 52.10 ? 117 MET D C    1  
ATOM 8882   O O    . MET D 1 117 ? 8.117   1.973   -4.689  1.00 12.03 ? 117 MET D O    1  
ATOM 8883   C CB   . MET D 1 117 ? 7.935   -1.178  -4.200  1.00 71.43 ? 117 MET D CB   1  
ATOM 8884   C CG   . MET D 1 117 ? 7.494   -2.207  -3.153  1.00 43.31 ? 117 MET D CG   1  
ATOM 8885   S SD   . MET D 1 117 ? 8.792   -3.390  -2.753  1.00 53.44 ? 117 MET D SD   1  
ATOM 8886   C CE   . MET D 1 117 ? 8.977   -4.261  -4.306  1.00 21.45 ? 117 MET D CE   1  
ATOM 8887   H H    . MET D 1 117 ? 5.777   -1.548  -5.575  1.00 21.20 ? 117 MET D H    1  
ATOM 8888   H HA   . MET D 1 117 ? 6.534   0.316   -3.536  1.00 12.31 ? 117 MET D HA   1  
ATOM 8889   H HB2  . MET D 1 117 ? 8.156   -1.705  -5.122  1.00 10.13 ? 117 MET D HB2  1  
ATOM 8890   H HB3  . MET D 1 117 ? 8.848   -0.712  -3.844  1.00 32.12 ? 117 MET D HB3  1  
ATOM 8891   H HG2  . MET D 1 117 ? 7.215   -1.690  -2.244  1.00 54.44 ? 117 MET D HG2  1  
ATOM 8892   H HG3  . MET D 1 117 ? 6.635   -2.750  -3.528  1.00 31.43 ? 117 MET D HG3  1  
ATOM 8893   H HE1  . MET D 1 117 ? 9.767   -4.991  -4.217  1.00 5.00  ? 117 MET D HE1  1  
ATOM 8894   H HE2  . MET D 1 117 ? 9.223   -3.561  -5.091  1.00 21.23 ? 117 MET D HE2  1  
ATOM 8895   H HE3  . MET D 1 117 ? 8.053   -4.764  -4.550  1.00 14.45 ? 117 MET D HE3  1  
ATOM 8896   N N    . VAL D 1 118 ? 7.341   1.050   -6.619  1.00 35.42 ? 118 VAL D N    1  
ATOM 8897   C CA   . VAL D 1 118 ? 7.768   2.143   -7.511  1.00 35.14 ? 118 VAL D CA   1  
ATOM 8898   C C    . VAL D 1 118 ? 6.956   3.411   -7.195  1.00 25.34 ? 118 VAL D C    1  
ATOM 8899   O O    . VAL D 1 118 ? 7.524   4.487   -6.991  1.00 2.35  ? 118 VAL D O    1  
ATOM 8900   C CB   . VAL D 1 118 ? 7.583   1.764   -9.035  1.00 42.12 ? 118 VAL D CB   1  
ATOM 8901   C CG1  . VAL D 1 118 ? 7.934   2.953   -9.965  1.00 61.21 ? 118 VAL D CG1  1  
ATOM 8902   C CG2  . VAL D 1 118 ? 8.413   0.511   -9.406  1.00 43.15 ? 118 VAL D CG2  1  
ATOM 8903   H H    . VAL D 1 118 ? 6.909   0.269   -7.017  1.00 74.34 ? 118 VAL D H    1  
ATOM 8904   H HA   . VAL D 1 118 ? 8.825   2.335   -7.326  1.00 43.21 ? 118 VAL D HA   1  
ATOM 8905   H HB   . VAL D 1 118 ? 6.534   1.522   -9.190  1.00 71.42 ? 118 VAL D HB   1  
ATOM 8906   H HG11 . VAL D 1 118 ? 9.000   3.138   -9.944  1.00 71.33 ? 118 VAL D HG11 1  
ATOM 8907   H HG12 . VAL D 1 118 ? 7.418   3.844   -9.631  1.00 54.51 ? 118 VAL D HG12 1  
ATOM 8908   H HG13 . VAL D 1 118 ? 7.626   2.739   -10.971 1.00 15.23 ? 118 VAL D HG13 1  
ATOM 8909   H HG21 . VAL D 1 118 ? 9.469   0.730   -9.311  1.00 14.13 ? 118 VAL D HG21 1  
ATOM 8910   H HG22 . VAL D 1 118 ? 8.202   0.208   -10.423 1.00 22.51 ? 118 VAL D HG22 1  
ATOM 8911   H HG23 . VAL D 1 118 ? 8.163   -0.302  -8.741  1.00 44.41 ? 118 VAL D HG23 1  
ATOM 8912   N N    . SER D 1 119 ? 5.617   3.249   -7.124  1.00 43.21 ? 119 SER D N    1  
ATOM 8913   C CA   . SER D 1 119 ? 4.687   4.365   -6.879  1.00 50.02 ? 119 SER D CA   1  
ATOM 8914   C C    . SER D 1 119 ? 4.834   4.899   -5.434  1.00 53.13 ? 119 SER D C    1  
ATOM 8915   O O    . SER D 1 119 ? 4.678   6.103   -5.187  1.00 11.11 ? 119 SER D O    1  
ATOM 8916   C CB   . SER D 1 119 ? 3.229   3.924   -7.164  1.00 24.20 ? 119 SER D CB   1  
ATOM 8917   O OG   . SER D 1 119 ? 2.810   2.883   -6.301  1.00 51.12 ? 119 SER D OG   1  
ATOM 8918   H H    . SER D 1 119 ? 5.245   2.348   -7.239  1.00 44.43 ? 119 SER D H    1  
ATOM 8919   H HA   . SER D 1 119 ? 4.952   5.159   -7.575  1.00 43.23 ? 119 SER D HA   1  
ATOM 8920   H HB2  . SER D 1 119 ? 2.560   4.764   -7.039  1.00 63.45 ? 119 SER D HB2  1  
ATOM 8921   H HB3  . SER D 1 119 ? 3.156   3.562   -8.182  1.00 14.00 ? 119 SER D HB3  1  
ATOM 8922   H HG   . SER D 1 119 ? 2.651   3.239   -5.423  1.00 4.21  ? 119 SER D HG   1  
ATOM 8923   N N    . ARG D 1 120 ? 5.166   3.983   -4.494  1.00 0.13  ? 120 ARG D N    1  
ATOM 8924   C CA   . ARG D 1 120 ? 5.458   4.318   -3.077  1.00 31.03 ? 120 ARG D CA   1  
ATOM 8925   C C    . ARG D 1 120 ? 6.777   5.112   -2.977  1.00 24.24 ? 120 ARG D C    1  
ATOM 8926   O O    . ARG D 1 120 ? 6.893   6.042   -2.171  1.00 34.42 ? 120 ARG D O    1  
ATOM 8927   C CB   . ARG D 1 120 ? 5.539   3.024   -2.213  1.00 25.31 ? 120 ARG D CB   1  
ATOM 8928   C CG   . ARG D 1 120 ? 4.197   2.275   -2.036  1.00 71.34 ? 120 ARG D CG   1  
ATOM 8929   C CD   . ARG D 1 120 ? 4.346   0.919   -1.313  1.00 52.13 ? 120 ARG D CD   1  
ATOM 8930   N NE   . ARG D 1 120 ? 3.067   0.171   -1.275  1.00 3.44  ? 120 ARG D NE   1  
ATOM 8931   C CZ   . ARG D 1 120 ? 2.269   0.015   -0.197  1.00 22.33 ? 120 ARG D CZ   1  
ATOM 8932   N NH1  . ARG D 1 120 ? 2.586   0.551   0.978   1.00 50.20 ? 120 ARG D NH1  1  
ATOM 8933   N NH2  . ARG D 1 120 ? 1.153   -0.695  -0.297  1.00 44.12 ? 120 ARG D NH2  1  
ATOM 8934   H H    . ARG D 1 120 ? 5.221   3.044   -4.769  1.00 50.34 ? 120 ARG D H    1  
ATOM 8935   H HA   . ARG D 1 120 ? 4.646   4.939   -2.708  1.00 2.35  ? 120 ARG D HA   1  
ATOM 8936   H HB2  . ARG D 1 120 ? 6.248   2.344   -2.677  1.00 64.45 ? 120 ARG D HB2  1  
ATOM 8937   H HB3  . ARG D 1 120 ? 5.911   3.283   -1.227  1.00 4.33  ? 120 ARG D HB3  1  
ATOM 8938   H HG2  . ARG D 1 120 ? 3.522   2.898   -1.462  1.00 45.22 ? 120 ARG D HG2  1  
ATOM 8939   H HG3  . ARG D 1 120 ? 3.765   2.101   -3.015  1.00 32.32 ? 120 ARG D HG3  1  
ATOM 8940   H HD2  . ARG D 1 120 ? 5.077   0.320   -1.846  1.00 34.54 ? 120 ARG D HD2  1  
ATOM 8941   H HD3  . ARG D 1 120 ? 4.700   1.088   -0.300  1.00 71.45 ? 120 ARG D HD3  1  
ATOM 8942   H HE   . ARG D 1 120 ? 2.773   -0.229  -2.127  1.00 35.10 ? 120 ARG D HE   1  
ATOM 8943   H HH11 . ARG D 1 120 ? 3.424   1.083   1.080   1.00 14.53 ? 120 ARG D HH11 1  
ATOM 8944   H HH12 . ARG D 1 120 ? 1.974   0.419   1.770   1.00 21.51 ? 120 ARG D HH12 1  
ATOM 8945   H HH21 . ARG D 1 120 ? 0.886   -1.113  -1.174  1.00 42.00 ? 120 ARG D HH21 1  
ATOM 8946   H HH22 . ARG D 1 120 ? 0.559   -0.811  0.508   1.00 62.12 ? 120 ARG D HH22 1  
ATOM 8947   N N    . GLY D 1 121 ? 7.759   4.729   -3.825  1.00 31.20 ? 121 GLY D N    1  
ATOM 8948   C CA   . GLY D 1 121 ? 9.036   5.440   -3.947  1.00 34.44 ? 121 GLY D CA   1  
ATOM 8949   C C    . GLY D 1 121 ? 8.933   6.663   -4.858  1.00 63.11 ? 121 GLY D C    1  
ATOM 8950   O O    . GLY D 1 121 ? 9.927   7.347   -5.095  1.00 22.35 ? 121 GLY D O    1  
ATOM 8951   H H    . GLY D 1 121 ? 7.605   3.945   -4.391  1.00 23.22 ? 121 GLY D H    1  
ATOM 8952   H HA2  . GLY D 1 121 ? 9.371   5.757   -2.966  1.00 54.20 ? 121 GLY D HA2  1  
ATOM 8953   H HA3  . GLY D 1 121 ? 9.770   4.757   -4.360  1.00 72.35 ? 121 GLY D HA3  1  
ATOM 8954   N N    . THR D 1 122 ? 7.703   6.897   -5.375  1.00 74.15 ? 122 THR D N    1  
ATOM 8955   C CA   . THR D 1 122 ? 7.285   8.077   -6.161  1.00 23.23 ? 122 THR D CA   1  
ATOM 8956   C C    . THR D 1 122 ? 8.044   8.213   -7.502  1.00 43.43 ? 122 THR D C    1  
ATOM 8957   O O    . THR D 1 122 ? 8.150   9.309   -8.061  1.00 41.13 ? 122 THR D O    1  
ATOM 8958   C CB   . THR D 1 122 ? 7.313   9.421   -5.324  1.00 54.00 ? 122 THR D CB   1  
ATOM 8959   O OG1  . THR D 1 122 ? 8.660   9.834   -5.016  1.00 32.32 ? 122 THR D OG1  1  
ATOM 8960   C CG2  . THR D 1 122 ? 6.524   9.294   -4.005  1.00 62.40 ? 122 THR D CG2  1  
ATOM 8961   H H    . THR D 1 122 ? 7.025   6.213   -5.222  1.00 62.44 ? 122 THR D H    1  
ATOM 8962   H HA   . THR D 1 122 ? 6.245   7.893   -6.420  1.00 23.54 ? 122 THR D HA   1  
ATOM 8963   H HB   . THR D 1 122 ? 6.849   10.201  -5.919  1.00 22.15 ? 122 THR D HB   1  
ATOM 8964   H HG1  . THR D 1 122 ? 9.109   9.139   -4.519  1.00 53.33 ? 122 THR D HG1  1  
ATOM 8965   H HG21 . THR D 1 122 ? 6.980   8.543   -3.377  1.00 50.10 ? 122 THR D HG21 1  
ATOM 8966   H HG22 . THR D 1 122 ? 5.502   9.012   -4.198  1.00 54.52 ? 122 THR D HG22 1  
ATOM 8967   H HG23 . THR D 1 122 ? 6.538   10.242  -3.486  1.00 71.41 ? 122 THR D HG23 1  
ATOM 8968   N N    . PHE D 1 123 ? 8.513   7.076   -8.044  1.00 53.32 ? 123 PHE D N    1  
ATOM 8969   C CA   . PHE D 1 123 ? 9.101   7.010   -9.394  1.00 14.42 ? 123 PHE D CA   1  
ATOM 8970   C C    . PHE D 1 123 ? 7.977   6.775   -10.428 1.00 52.31 ? 123 PHE D C    1  
ATOM 8971   O O    . PHE D 1 123 ? 6.931   6.211   -10.069 1.00 25.54 ? 123 PHE D O    1  
ATOM 8972   C CB   . PHE D 1 123 ? 10.151  5.872   -9.476  1.00 64.43 ? 123 PHE D CB   1  
ATOM 8973   C CG   . PHE D 1 123 ? 11.414  6.117   -8.654  1.00 4.00  ? 123 PHE D CG   1  
ATOM 8974   C CD1  . PHE D 1 123 ? 12.499  6.803   -9.204  1.00 43.44 ? 123 PHE D CD1  1  
ATOM 8975   C CD2  . PHE D 1 123 ? 11.524  5.655   -7.341  1.00 74.33 ? 123 PHE D CD2  1  
ATOM 8976   C CE1  . PHE D 1 123 ? 13.649  7.019   -8.470  1.00 12.24 ? 123 PHE D CE1  1  
ATOM 8977   C CE2  . PHE D 1 123 ? 12.675  5.872   -6.608  1.00 3.42  ? 123 PHE D CE2  1  
ATOM 8978   C CZ   . PHE D 1 123 ? 13.736  6.554   -7.172  1.00 45.32 ? 123 PHE D CZ   1  
ATOM 8979   H H    . PHE D 1 123 ? 8.440   6.245   -7.531  1.00 1.34  ? 123 PHE D H    1  
ATOM 8980   H HA   . PHE D 1 123 ? 9.587   7.959   -9.607  1.00 20.20 ? 123 PHE D HA   1  
ATOM 8981   H HB2  . PHE D 1 123 ? 9.699   4.945   -9.136  1.00 1.24  ? 123 PHE D HB2  1  
ATOM 8982   H HB3  . PHE D 1 123 ? 10.451  5.742   -10.513 1.00 13.10 ? 123 PHE D HB3  1  
ATOM 8983   H HD1  . PHE D 1 123 ? 12.436  7.172   -10.221 1.00 32.24 ? 123 PHE D HD1  1  
ATOM 8984   H HD2  . PHE D 1 123 ? 10.696  5.118   -6.894  1.00 72.22 ? 123 PHE D HD2  1  
ATOM 8985   H HE1  . PHE D 1 123 ? 14.481  7.553   -8.911  1.00 44.05 ? 123 PHE D HE1  1  
ATOM 8986   H HE2  . PHE D 1 123 ? 12.745  5.509   -5.591  1.00 1.21  ? 123 PHE D HE2  1  
ATOM 8987   H HZ   . PHE D 1 123 ? 14.637  6.725   -6.595  1.00 62.10 ? 123 PHE D HZ   1  
ATOM 8988   N N    . PRO D 1 124 ? 8.157   7.229   -11.715 1.00 0.02  ? 124 PRO D N    1  
ATOM 8989   C CA   . PRO D 1 124 ? 7.205   6.931   -12.818 1.00 51.51 ? 124 PRO D CA   1  
ATOM 8990   C C    . PRO D 1 124 ? 6.925   5.420   -12.959 1.00 30.41 ? 124 PRO D C    1  
ATOM 8991   O O    . PRO D 1 124 ? 7.864   4.616   -13.095 1.00 54.12 ? 124 PRO D O    1  
ATOM 8992   C CB   . PRO D 1 124 ? 7.918   7.506   -14.070 1.00 20.33 ? 124 PRO D CB   1  
ATOM 8993   C CG   . PRO D 1 124 ? 8.769   8.611   -13.521 1.00 41.05 ? 124 PRO D CG   1  
ATOM 8994   C CD   . PRO D 1 124 ? 9.272   8.097   -12.190 1.00 3.43  ? 124 PRO D CD   1  
ATOM 8995   H HA   . PRO D 1 124 ? 6.265   7.456   -12.663 1.00 1.02  ? 124 PRO D HA   1  
ATOM 8996   H HB2  . PRO D 1 124 ? 8.529   6.739   -14.551 1.00 74.53 ? 124 PRO D HB2  1  
ATOM 8997   H HB3  . PRO D 1 124 ? 7.197   7.900   -14.776 1.00 73.02 ? 124 PRO D HB3  1  
ATOM 8998   H HG2  . PRO D 1 124 ? 9.596   8.814   -14.197 1.00 40.13 ? 124 PRO D HG2  1  
ATOM 8999   H HG3  . PRO D 1 124 ? 8.180   9.511   -13.376 1.00 10.01 ? 124 PRO D HG3  1  
ATOM 9000   H HD2  . PRO D 1 124 ? 10.183  7.518   -12.319 1.00 61.32 ? 124 PRO D HD2  1  
ATOM 9001   H HD3  . PRO D 1 124 ? 9.446   8.916   -11.501 1.00 32.24 ? 124 PRO D HD3  1  
ATOM 9002   N N    . GLN D 1 125 ? 5.626   5.070   -12.898 1.00 22.23 ? 125 GLN D N    1  
ATOM 9003   C CA   . GLN D 1 125 ? 5.132   3.681   -12.890 1.00 25.41 ? 125 GLN D CA   1  
ATOM 9004   C C    . GLN D 1 125 ? 5.640   2.873   -14.103 1.00 61.13 ? 125 GLN D C    1  
ATOM 9005   O O    . GLN D 1 125 ? 5.796   3.416   -15.201 1.00 52.31 ? 125 GLN D O    1  
ATOM 9006   C CB   . GLN D 1 125 ? 3.578   3.684   -12.853 1.00 2.53  ? 125 GLN D CB   1  
ATOM 9007   C CG   . GLN D 1 125 ? 2.941   2.285   -12.921 1.00 12.24 ? 125 GLN D CG   1  
ATOM 9008   C CD   . GLN D 1 125 ? 1.421   2.307   -12.954 1.00 35.24 ? 125 GLN D CD   1  
ATOM 9009   O OE1  . GLN D 1 125 ? 0.818   2.384   -14.027 1.00 34.25 ? 125 GLN D OE1  1  
ATOM 9010   N NE2  . GLN D 1 125 ? 0.794   2.224   -11.785 1.00 70.01 ? 125 GLN D NE2  1  
ATOM 9011   H H    . GLN D 1 125 ? 4.965   5.789   -12.853 1.00 44.45 ? 125 GLN D H    1  
ATOM 9012   H HA   . GLN D 1 125 ? 5.498   3.214   -11.981 1.00 52.55 ? 125 GLN D HA   1  
ATOM 9013   H HB2  . GLN D 1 125 ? 3.255   4.158   -11.931 1.00 31.34 ? 125 GLN D HB2  1  
ATOM 9014   H HB3  . GLN D 1 125 ? 3.209   4.270   -13.688 1.00 41.40 ? 125 GLN D HB3  1  
ATOM 9015   H HG2  . GLN D 1 125 ? 3.293   1.787   -13.817 1.00 25.24 ? 125 GLN D HG2  1  
ATOM 9016   H HG3  . GLN D 1 125 ? 3.264   1.716   -12.058 1.00 54.34 ? 125 GLN D HG3  1  
ATOM 9017   H HE21 . GLN D 1 125 ? 1.335   2.160   -10.971 1.00 55.23 ? 125 GLN D HE21 1  
ATOM 9018   H HE22 . GLN D 1 125 ? -0.188  2.211   -11.787 1.00 11.54 ? 125 GLN D HE22 1  
ATOM 9019   N N    . LEU D 1 126 ? 5.866   1.567   -13.892 1.00 51.31 ? 126 LEU D N    1  
ATOM 9020   C CA   . LEU D 1 126 ? 6.376   0.664   -14.924 1.00 73.24 ? 126 LEU D CA   1  
ATOM 9021   C C    . LEU D 1 126 ? 5.699   -0.702  -14.741 1.00 41.15 ? 126 LEU D C    1  
ATOM 9022   O O    . LEU D 1 126 ? 5.859   -1.346  -13.696 1.00 71.41 ? 126 LEU D O    1  
ATOM 9023   C CB   . LEU D 1 126 ? 7.936   0.583   -14.830 1.00 22.45 ? 126 LEU D CB   1  
ATOM 9024   C CG   . LEU D 1 126 ? 8.713   -0.101  -16.020 1.00 42.04 ? 126 LEU D CG   1  
ATOM 9025   C CD1  . LEU D 1 126 ? 8.603   -1.649  -16.014 1.00 22.32 ? 126 LEU D CD1  1  
ATOM 9026   C CD2  . LEU D 1 126 ? 8.286   0.496   -17.389 1.00 4.41  ? 126 LEU D CD2  1  
ATOM 9027   H H    . LEU D 1 126 ? 5.659   1.188   -13.007 1.00 74.42 ? 126 LEU D H    1  
ATOM 9028   H HA   . LEU D 1 126 ? 6.103   1.064   -15.900 1.00 52.20 ? 126 LEU D HA   1  
ATOM 9029   H HB2  . LEU D 1 126 ? 8.308   1.602   -14.738 1.00 62.13 ? 126 LEU D HB2  1  
ATOM 9030   H HB3  . LEU D 1 126 ? 8.193   0.063   -13.914 1.00 30.32 ? 126 LEU D HB3  1  
ATOM 9031   H HG   . LEU D 1 126 ? 9.767   0.124   -15.898 1.00 45.00 ? 126 LEU D HG   1  
ATOM 9032   H HD11 . LEU D 1 126 ? 8.951   -2.035  -15.066 1.00 40.50 ? 126 LEU D HD11 1  
ATOM 9033   H HD12 . LEU D 1 126 ? 9.216   -2.061  -16.805 1.00 2.03  ? 126 LEU D HD12 1  
ATOM 9034   H HD13 . LEU D 1 126 ? 7.573   -1.951  -16.168 1.00 2.23  ? 126 LEU D HD13 1  
ATOM 9035   H HD21 . LEU D 1 126 ? 7.237   0.289   -17.572 1.00 3.22  ? 126 LEU D HD21 1  
ATOM 9036   H HD22 . LEU D 1 126 ? 8.878   0.060   -18.180 1.00 32.40 ? 126 LEU D HD22 1  
ATOM 9037   H HD23 . LEU D 1 126 ? 8.441   1.568   -17.383 1.00 44.33 ? 126 LEU D HD23 1  
ATOM 9038   N N    . ASN D 1 127 ? 4.927   -1.125  -15.755 1.00 74.10 ? 127 ASN D N    1  
ATOM 9039   C CA   . ASN D 1 127 ? 4.257   -2.436  -15.778 1.00 42.33 ? 127 ASN D CA   1  
ATOM 9040   C C    . ASN D 1 127 ? 4.941   -3.311  -16.835 1.00 64.02 ? 127 ASN D C    1  
ATOM 9041   O O    . ASN D 1 127 ? 4.967   -2.950  -18.017 1.00 54.31 ? 127 ASN D O    1  
ATOM 9042   C CB   . ASN D 1 127 ? 2.742   -2.292  -16.094 1.00 21.10 ? 127 ASN D CB   1  
ATOM 9043   C CG   . ASN D 1 127 ? 2.008   -1.382  -15.104 1.00 73.52 ? 127 ASN D CG   1  
ATOM 9044   O OD1  . ASN D 1 127 ? 1.580   -1.820  -14.036 1.00 51.14 ? 127 ASN D OD1  1  
ATOM 9045   N ND2  . ASN D 1 127 ? 1.835   -0.116  -15.457 1.00 40.12 ? 127 ASN D ND2  1  
ATOM 9046   H H    . ASN D 1 127 ? 4.814   -0.537  -16.526 1.00 10.43 ? 127 ASN D H    1  
ATOM 9047   H HA   . ASN D 1 127 ? 4.367   -2.903  -14.799 1.00 31.40 ? 127 ASN D HA   1  
ATOM 9048   H HB2  . ASN D 1 127 ? 2.620   -1.882  -17.092 1.00 65.23 ? 127 ASN D HB2  1  
ATOM 9049   H HB3  . ASN D 1 127 ? 2.277   -3.272  -16.065 1.00 73.34 ? 127 ASN D HB3  1  
ATOM 9050   H HD21 . ASN D 1 127 ? 2.185   0.174   -16.323 1.00 30.41 ? 127 ASN D HD21 1  
ATOM 9051   H HD22 . ASN D 1 127 ? 1.366   0.475   -14.835 1.00 22.53 ? 127 ASN D HD22 1  
ATOM 9052   N N    . LEU D 1 128 ? 5.514   -4.444  -16.389 1.00 5.40  ? 128 LEU D N    1  
ATOM 9053   C CA   . LEU D 1 128 ? 6.229   -5.398  -17.257 1.00 64.35 ? 128 LEU D CA   1  
ATOM 9054   C C    . LEU D 1 128 ? 5.250   -6.071  -18.237 1.00 35.04 ? 128 LEU D C    1  
ATOM 9055   O O    . LEU D 1 128 ? 4.214   -6.610  -17.816 1.00 60.24 ? 128 LEU D O    1  
ATOM 9056   C CB   . LEU D 1 128 ? 6.978   -6.478  -16.417 1.00 51.12 ? 128 LEU D CB   1  
ATOM 9057   C CG   . LEU D 1 128 ? 8.196   -5.987  -15.554 1.00 15.12 ? 128 LEU D CG   1  
ATOM 9058   C CD1  . LEU D 1 128 ? 7.769   -5.143  -14.328 1.00 14.04 ? 128 LEU D CD1  1  
ATOM 9059   C CD2  . LEU D 1 128 ? 9.092   -7.177  -15.141 1.00 72.22 ? 128 LEU D CD2  1  
ATOM 9060   H H    . LEU D 1 128 ? 5.451   -4.645  -15.435 1.00 2.22  ? 128 LEU D H    1  
ATOM 9061   H HA   . LEU D 1 128 ? 6.964   -4.833  -17.826 1.00 13.20 ? 128 LEU D HA   1  
ATOM 9062   H HB2  . LEU D 1 128 ? 6.258   -6.951  -15.755 1.00 63.33 ? 128 LEU D HB2  1  
ATOM 9063   H HB3  . LEU D 1 128 ? 7.342   -7.238  -17.105 1.00 51.42 ? 128 LEU D HB3  1  
ATOM 9064   H HG   . LEU D 1 128 ? 8.805   -5.340  -16.174 1.00 43.21 ? 128 LEU D HG   1  
ATOM 9065   H HD11 . LEU D 1 128 ? 8.646   -4.818  -13.783 1.00 44.45 ? 128 LEU D HD11 1  
ATOM 9066   H HD12 . LEU D 1 128 ? 7.137   -5.730  -13.674 1.00 65.22 ? 128 LEU D HD12 1  
ATOM 9067   H HD13 . LEU D 1 128 ? 7.221   -4.273  -14.666 1.00 5.30  ? 128 LEU D HD13 1  
ATOM 9068   H HD21 . LEU D 1 128 ? 9.944   -6.817  -14.578 1.00 65.50 ? 128 LEU D HD21 1  
ATOM 9069   H HD22 . LEU D 1 128 ? 9.450   -7.685  -16.031 1.00 33.01 ? 128 LEU D HD22 1  
ATOM 9070   H HD23 . LEU D 1 128 ? 8.529   -7.875  -14.534 1.00 72.14 ? 128 LEU D HD23 1  
ATOM 9071   N N    . ALA D 1 129 ? 5.597   -6.029  -19.532 1.00 35.24 ? 129 ALA D N    1  
ATOM 9072   C CA   . ALA D 1 129 ? 4.767   -6.585  -20.608 1.00 31.11 ? 129 ALA D CA   1  
ATOM 9073   C C    . ALA D 1 129 ? 4.708   -8.133  -20.519 1.00 63.42 ? 129 ALA D C    1  
ATOM 9074   O O    . ALA D 1 129 ? 5.747   -8.777  -20.313 1.00 31.52 ? 129 ALA D O    1  
ATOM 9075   C CB   . ALA D 1 129 ? 5.296   -6.127  -21.981 1.00 51.04 ? 129 ALA D CB   1  
ATOM 9076   H H    . ALA D 1 129 ? 6.452   -5.615  -19.771 1.00 63.25 ? 129 ALA D H    1  
ATOM 9077   H HA   . ALA D 1 129 ? 3.763   -6.181  -20.484 1.00 11.31 ? 129 ALA D HA   1  
ATOM 9078   H HB1  . ALA D 1 129 ? 4.651   -6.499  -22.767 1.00 20.13 ? 129 ALA D HB1  1  
ATOM 9079   H HB2  . ALA D 1 129 ? 6.299   -6.504  -22.133 1.00 4.22  ? 129 ALA D HB2  1  
ATOM 9080   H HB3  . ALA D 1 129 ? 5.316   -5.044  -22.021 1.00 74.11 ? 129 ALA D HB3  1  
ATOM 9081   N N    . PRO D 1 130 ? 3.484   -8.749  -20.642 1.00 11.02 ? 130 PRO D N    1  
ATOM 9082   C CA   . PRO D 1 130 ? 3.311   -10.219 -20.564 1.00 61.21 ? 130 PRO D CA   1  
ATOM 9083   C C    . PRO D 1 130 ? 3.930   -10.951 -21.781 1.00 22.51 ? 130 PRO D C    1  
ATOM 9084   O O    . PRO D 1 130 ? 3.682   -10.573 -22.933 1.00 72.42 ? 130 PRO D O    1  
ATOM 9085   C CB   . PRO D 1 130 ? 1.765   -10.402 -20.511 1.00 30.32 ? 130 PRO D CB   1  
ATOM 9086   C CG   . PRO D 1 130 ? 1.199   -9.033  -20.245 1.00 14.42 ? 130 PRO D CG   1  
ATOM 9087   C CD   . PRO D 1 130 ? 2.179   -8.069  -20.862 1.00 50.31 ? 130 PRO D CD   1  
ATOM 9088   H HA   . PRO D 1 130 ? 3.751   -10.607 -19.647 1.00 52.41 ? 130 PRO D HA   1  
ATOM 9089   H HB2  . PRO D 1 130 ? 1.391   -10.794 -21.459 1.00 43.00 ? 130 PRO D HB2  1  
ATOM 9090   H HB3  . PRO D 1 130 ? 1.490   -11.081 -19.711 1.00 33.23 ? 130 PRO D HB3  1  
ATOM 9091   H HG2  . PRO D 1 130 ? 0.219   -8.936  -20.707 1.00 50.14 ? 130 PRO D HG2  1  
ATOM 9092   H HG3  . PRO D 1 130 ? 1.120   -8.853  -19.175 1.00 11.24 ? 130 PRO D HG3  1  
ATOM 9093   H HD2  . PRO D 1 130 ? 1.982   -7.940  -21.923 1.00 42.13 ? 130 PRO D HD2  1  
ATOM 9094   H HD3  . PRO D 1 130 ? 2.145   -7.112  -20.355 1.00 31.50 ? 130 PRO D HD3  1  
ATOM 9095   N N    . VAL D 1 131 ? 4.740   -11.989 -21.509 1.00 12.03 ? 131 VAL D N    1  
ATOM 9096   C CA   . VAL D 1 131 ? 5.373   -12.835 -22.544 1.00 73.43 ? 131 VAL D CA   1  
ATOM 9097   C C    . VAL D 1 131 ? 4.851   -14.281 -22.431 1.00 40.23 ? 131 VAL D C    1  
ATOM 9098   O O    . VAL D 1 131 ? 4.619   -14.777 -21.318 1.00 32.20 ? 131 VAL D O    1  
ATOM 9099   C CB   . VAL D 1 131 ? 6.953   -12.812 -22.425 1.00 54.41 ? 131 VAL D CB   1  
ATOM 9100   C CG1  . VAL D 1 131 ? 7.515   -11.398 -22.715 1.00 31.21 ? 131 VAL D CG1  1  
ATOM 9101   C CG2  . VAL D 1 131 ? 7.430   -13.325 -21.040 1.00 33.33 ? 131 VAL D CG2  1  
ATOM 9102   H H    . VAL D 1 131 ? 4.915   -12.203 -20.571 1.00 51.33 ? 131 VAL D H    1  
ATOM 9103   H HA   . VAL D 1 131 ? 5.101   -12.444 -23.525 1.00 4.25  ? 131 VAL D HA   1  
ATOM 9104   H HB   . VAL D 1 131 ? 7.355   -13.481 -23.184 1.00 31.21 ? 131 VAL D HB   1  
ATOM 9105   H HG11 . VAL D 1 131 ? 8.595   -11.405 -22.631 1.00 2.40  ? 131 VAL D HG11 1  
ATOM 9106   H HG12 . VAL D 1 131 ? 7.108   -10.687 -22.007 1.00 2.13  ? 131 VAL D HG12 1  
ATOM 9107   H HG13 . VAL D 1 131 ? 7.240   -11.095 -23.718 1.00 61.42 ? 131 VAL D HG13 1  
ATOM 9108   H HG21 . VAL D 1 131 ? 7.093   -14.344 -20.894 1.00 13.02 ? 131 VAL D HG21 1  
ATOM 9109   H HG22 . VAL D 1 131 ? 7.020   -12.701 -20.256 1.00 42.22 ? 131 VAL D HG22 1  
ATOM 9110   H HG23 . VAL D 1 131 ? 8.512   -13.298 -20.987 1.00 70.31 ? 131 VAL D HG23 1  
ATOM 9111   N N    . ASN D 1 132 ? 4.642   -14.946 -23.585 1.00 21.11 ? 132 ASN D N    1  
ATOM 9112   C CA   . ASN D 1 132 ? 4.273   -16.376 -23.624 1.00 61.01 ? 132 ASN D CA   1  
ATOM 9113   C C    . ASN D 1 132 ? 5.560   -17.212 -23.759 1.00 10.34 ? 132 ASN D C    1  
ATOM 9114   O O    . ASN D 1 132 ? 5.894   -17.739 -24.830 1.00 14.04 ? 132 ASN D O    1  
ATOM 9115   C CB   . ASN D 1 132 ? 3.263   -16.680 -24.768 1.00 23.52 ? 132 ASN D CB   1  
ATOM 9116   C CG   . ASN D 1 132 ? 2.733   -18.125 -24.743 1.00 42.14 ? 132 ASN D CG   1  
ATOM 9117   O OD1  . ASN D 1 132 ? 2.605   -18.743 -23.683 1.00 60.10 ? 132 ASN D OD1  1  
ATOM 9118   N ND2  . ASN D 1 132 ? 2.437   -18.683 -25.905 1.00 75.25 ? 132 ASN D ND2  1  
ATOM 9119   H H    . ASN D 1 132 ? 4.742   -14.464 -24.433 1.00 75.34 ? 132 ASN D H    1  
ATOM 9120   H HA   . ASN D 1 132 ? 3.802   -16.628 -22.673 1.00 33.34 ? 132 ASN D HA   1  
ATOM 9121   H HB2  . ASN D 1 132 ? 2.414   -16.016 -24.676 1.00 15.51 ? 132 ASN D HB2  1  
ATOM 9122   H HB3  . ASN D 1 132 ? 3.746   -16.500 -25.723 1.00 34.02 ? 132 ASN D HB3  1  
ATOM 9123   H HD21 . ASN D 1 132 ? 2.570   -18.154 -26.721 1.00 32.21 ? 132 ASN D HD21 1  
ATOM 9124   H HD22 . ASN D 1 132 ? 2.109   -19.603 -25.905 1.00 30.40 ? 132 ASN D HD22 1  
ATOM 9125   N N    . PHE D 1 133 ? 6.308   -17.255 -22.652 1.00 54.13 ? 133 PHE D N    1  
ATOM 9126   C CA   . PHE D 1 133 ? 7.564   -18.014 -22.543 1.00 14.44 ? 133 PHE D CA   1  
ATOM 9127   C C    . PHE D 1 133 ? 7.280   -19.524 -22.461 1.00 72.23 ? 133 PHE D C    1  
ATOM 9128   O O    . PHE D 1 133 ? 8.138   -20.334 -22.820 1.00 22.12 ? 133 PHE D O    1  
ATOM 9129   C CB   . PHE D 1 133 ? 8.394   -17.516 -21.328 1.00 34.12 ? 133 PHE D CB   1  
ATOM 9130   C CG   . PHE D 1 133 ? 7.764   -17.728 -19.944 1.00 13.44 ? 133 PHE D CG   1  
ATOM 9131   C CD1  . PHE D 1 133 ? 6.590   -17.063 -19.577 1.00 11.13 ? 133 PHE D CD1  1  
ATOM 9132   C CD2  . PHE D 1 133 ? 8.353   -18.579 -19.007 1.00 5.44  ? 133 PHE D CD2  1  
ATOM 9133   C CE1  . PHE D 1 133 ? 6.026   -17.247 -18.333 1.00 21.30 ? 133 PHE D CE1  1  
ATOM 9134   C CE2  . PHE D 1 133 ? 7.787   -18.757 -17.762 1.00 34.34 ? 133 PHE D CE2  1  
ATOM 9135   C CZ   . PHE D 1 133 ? 6.624   -18.092 -17.427 1.00 72.11 ? 133 PHE D CZ   1  
ATOM 9136   H H    . PHE D 1 133 ? 6.001   -16.751 -21.875 1.00 51.24 ? 133 PHE D H    1  
ATOM 9137   H HA   . PHE D 1 133 ? 8.136   -17.828 -23.450 1.00 21.40 ? 133 PHE D HA   1  
ATOM 9138   H HB2  . PHE D 1 133 ? 9.357   -18.016 -21.338 1.00 44.42 ? 133 PHE D HB2  1  
ATOM 9139   H HB3  . PHE D 1 133 ? 8.570   -16.452 -21.447 1.00 12.22 ? 133 PHE D HB3  1  
ATOM 9140   H HD1  . PHE D 1 133 ? 6.115   -16.397 -20.287 1.00 21.41 ? 133 PHE D HD1  1  
ATOM 9141   H HD2  . PHE D 1 133 ? 9.266   -19.103 -19.262 1.00 72.35 ? 133 PHE D HD2  1  
ATOM 9142   H HE1  . PHE D 1 133 ? 5.116   -16.725 -18.067 1.00 61.45 ? 133 PHE D HE1  1  
ATOM 9143   H HE2  . PHE D 1 133 ? 8.252   -19.422 -17.045 1.00 13.25 ? 133 PHE D HE2  1  
ATOM 9144   H HZ   . PHE D 1 133 ? 6.179   -18.239 -16.449 1.00 73.02 ? 133 PHE D HZ   1  
ATOM 9145   N N    . ASP D 1 134 ? 6.049   -19.866 -22.011 1.00 75.34 ? 134 ASP D N    1  
ATOM 9146   C CA   . ASP D 1 134 ? 5.524   -21.246 -21.963 1.00 11.43 ? 134 ASP D CA   1  
ATOM 9147   C C    . ASP D 1 134 ? 5.751   -21.968 -23.296 1.00 1.22  ? 134 ASP D C    1  
ATOM 9148   O O    . ASP D 1 134 ? 6.321   -23.065 -23.326 1.00 65.41 ? 134 ASP D O    1  
ATOM 9149   C CB   . ASP D 1 134 ? 4.002   -21.241 -21.643 1.00 10.15 ? 134 ASP D CB   1  
ATOM 9150   C CG   . ASP D 1 134 ? 3.656   -20.588 -20.297 1.00 63.04 ? 134 ASP D CG   1  
ATOM 9151   O OD1  . ASP D 1 134 ? 3.240   -21.301 -19.355 1.00 13.33 ? 134 ASP D OD1  1  
ATOM 9152   O OD2  . ASP D 1 134 ? 3.775   -19.349 -20.190 1.00 11.50 ? 134 ASP D OD2  1  
ATOM 9153   H H    . ASP D 1 134 ? 5.469   -19.149 -21.678 1.00 41.01 ? 134 ASP D H    1  
ATOM 9154   H HA   . ASP D 1 134 ? 6.046   -21.775 -21.179 1.00 34.44 ? 134 ASP D HA   1  
ATOM 9155   H HB2  . ASP D 1 134 ? 3.478   -20.698 -22.426 1.00 31.41 ? 134 ASP D HB2  1  
ATOM 9156   H HB3  . ASP D 1 134 ? 3.639   -22.265 -21.639 1.00 61.11 ? 134 ASP D HB3  1  
ATOM 9157   N N    . ALA D 1 135 ? 5.326   -21.303 -24.389 1.00 32.44 ? 135 ALA D N    1  
ATOM 9158   C CA   . ALA D 1 135 ? 5.388   -21.848 -25.755 1.00 75.51 ? 135 ALA D CA   1  
ATOM 9159   C C    . ALA D 1 135 ? 6.838   -22.094 -26.190 1.00 14.42 ? 135 ALA D C    1  
ATOM 9160   O O    . ALA D 1 135 ? 7.159   -23.173 -26.695 1.00 73.32 ? 135 ALA D O    1  
ATOM 9161   C CB   . ALA D 1 135 ? 4.696   -20.896 -26.740 1.00 54.00 ? 135 ALA D CB   1  
ATOM 9162   H H    . ALA D 1 135 ? 4.966   -20.397 -24.267 1.00 41.31 ? 135 ALA D H    1  
ATOM 9163   H HA   . ALA D 1 135 ? 4.845   -22.793 -25.760 1.00 72.34 ? 135 ALA D HA   1  
ATOM 9164   H HB1  . ALA D 1 135 ? 3.667   -20.756 -26.444 1.00 3.50  ? 135 ALA D HB1  1  
ATOM 9165   H HB2  . ALA D 1 135 ? 4.727   -21.311 -27.740 1.00 23.13 ? 135 ALA D HB2  1  
ATOM 9166   H HB3  . ALA D 1 135 ? 5.196   -19.937 -26.734 1.00 10.11 ? 135 ALA D HB3  1  
ATOM 9167   N N    . LEU D 1 136 ? 7.702   -21.086 -25.941 1.00 23.35 ? 136 LEU D N    1  
ATOM 9168   C CA   . LEU D 1 136 ? 9.138   -21.129 -26.300 1.00 24.51 ? 136 LEU D CA   1  
ATOM 9169   C C    . LEU D 1 136 ? 9.842   -22.336 -25.640 1.00 75.13 ? 136 LEU D C    1  
ATOM 9170   O O    . LEU D 1 136 ? 10.673  -23.013 -26.274 1.00 12.55 ? 136 LEU D O    1  
ATOM 9171   C CB   . LEU D 1 136 ? 9.841   -19.801 -25.897 1.00 13.22 ? 136 LEU D CB   1  
ATOM 9172   C CG   . LEU D 1 136 ? 11.349  -19.681 -26.303 1.00 3.01  ? 136 LEU D CG   1  
ATOM 9173   C CD1  . LEU D 1 136 ? 11.535  -19.792 -27.839 1.00 1.40  ? 136 LEU D CD1  1  
ATOM 9174   C CD2  . LEU D 1 136 ? 11.978  -18.383 -25.744 1.00 45.43 ? 136 LEU D CD2  1  
ATOM 9175   H H    . LEU D 1 136 ? 7.356   -20.281 -25.502 1.00 43.22 ? 136 LEU D H    1  
ATOM 9176   H HA   . LEU D 1 136 ? 9.196   -21.239 -27.379 1.00 41.35 ? 136 LEU D HA   1  
ATOM 9177   H HB2  . LEU D 1 136 ? 9.296   -18.980 -26.351 1.00 21.15 ? 136 LEU D HB2  1  
ATOM 9178   H HB3  . LEU D 1 136 ? 9.767   -19.695 -24.819 1.00 32.43 ? 136 LEU D HB3  1  
ATOM 9179   H HG   . LEU D 1 136 ? 11.887  -20.513 -25.862 1.00 23.33 ? 136 LEU D HG   1  
ATOM 9180   H HD11 . LEU D 1 136 ? 11.156  -20.747 -28.183 1.00 44.40 ? 136 LEU D HD11 1  
ATOM 9181   H HD12 . LEU D 1 136 ? 12.586  -19.725 -28.086 1.00 51.42 ? 136 LEU D HD12 1  
ATOM 9182   H HD13 . LEU D 1 136 ? 10.999  -18.995 -28.339 1.00 53.45 ? 136 LEU D HD13 1  
ATOM 9183   H HD21 . LEU D 1 136 ? 11.896  -18.379 -24.665 1.00 64.52 ? 136 LEU D HD21 1  
ATOM 9184   H HD22 . LEU D 1 136 ? 11.466  -17.518 -26.144 1.00 64.53 ? 136 LEU D HD22 1  
ATOM 9185   H HD23 . LEU D 1 136 ? 13.024  -18.337 -26.018 1.00 35.32 ? 136 LEU D HD23 1  
ATOM 9186   N N    . PHE D 1 137 ? 9.475   -22.600 -24.366 1.00 61.42 ? 137 PHE D N    1  
ATOM 9187   C CA   . PHE D 1 137 ? 9.934   -23.787 -23.625 1.00 40.51 ? 137 PHE D CA   1  
ATOM 9188   C C    . PHE D 1 137 ? 9.494   -25.079 -24.335 1.00 63.34 ? 137 PHE D C    1  
ATOM 9189   O O    . PHE D 1 137 ? 10.320  -25.953 -24.575 1.00 14.25 ? 137 PHE D O    1  
ATOM 9190   C CB   . PHE D 1 137 ? 9.428   -23.772 -22.145 1.00 33.23 ? 137 PHE D CB   1  
ATOM 9191   C CG   . PHE D 1 137 ? 10.373  -23.055 -21.181 1.00 13.32 ? 137 PHE D CG   1  
ATOM 9192   C CD1  . PHE D 1 137 ? 10.251  -21.691 -20.918 1.00 23.54 ? 137 PHE D CD1  1  
ATOM 9193   C CD2  . PHE D 1 137 ? 11.402  -23.760 -20.547 1.00 72.11 ? 137 PHE D CD2  1  
ATOM 9194   C CE1  . PHE D 1 137 ? 11.126  -21.055 -20.061 1.00 52.44 ? 137 PHE D CE1  1  
ATOM 9195   C CE2  . PHE D 1 137 ? 12.272  -23.122 -19.688 1.00 23.35 ? 137 PHE D CE2  1  
ATOM 9196   C CZ   . PHE D 1 137 ? 12.131  -21.773 -19.445 1.00 42.12 ? 137 PHE D CZ   1  
ATOM 9197   H H    . PHE D 1 137 ? 8.878   -21.968 -23.916 1.00 74.04 ? 137 PHE D H    1  
ATOM 9198   H HA   . PHE D 1 137 ? 11.023  -23.755 -23.622 1.00 34.01 ? 137 PHE D HA   1  
ATOM 9199   H HB2  . PHE D 1 137 ? 8.461   -23.278 -22.099 1.00 43.45 ? 137 PHE D HB2  1  
ATOM 9200   H HB3  . PHE D 1 137 ? 9.302   -24.792 -21.789 1.00 71.45 ? 137 PHE D HB3  1  
ATOM 9201   H HD1  . PHE D 1 137 ? 9.463   -21.126 -21.395 1.00 74.52 ? 137 PHE D HD1  1  
ATOM 9202   H HD2  . PHE D 1 137 ? 11.517  -24.820 -20.737 1.00 33.35 ? 137 PHE D HD2  1  
ATOM 9203   H HE1  . PHE D 1 137 ? 11.019  -19.995 -19.866 1.00 14.13 ? 137 PHE D HE1  1  
ATOM 9204   H HE2  . PHE D 1 137 ? 13.062  -23.681 -19.201 1.00 52.44 ? 137 PHE D HE2  1  
ATOM 9205   H HZ   . PHE D 1 137 ? 12.816  -21.272 -18.773 1.00 72.15 ? 137 PHE D HZ   1  
ATOM 9206   N N    . MET D 1 138 ? 8.202   -25.154 -24.722 1.00 35.24 ? 138 MET D N    1  
ATOM 9207   C CA   . MET D 1 138 ? 7.619   -26.378 -25.325 1.00 73.44 ? 138 MET D CA   1  
ATOM 9208   C C    . MET D 1 138 ? 8.379   -26.771 -26.602 1.00 13.11 ? 138 MET D C    1  
ATOM 9209   O O    . MET D 1 138 ? 8.788   -27.922 -26.736 1.00 74.42 ? 138 MET D O    1  
ATOM 9210   C CB   . MET D 1 138 ? 6.117   -26.186 -25.684 1.00 1.11  ? 138 MET D CB   1  
ATOM 9211   C CG   . MET D 1 138 ? 5.224   -25.779 -24.524 1.00 10.13 ? 138 MET D CG   1  
ATOM 9212   S SD   . MET D 1 138 ? 3.570   -25.313 -25.073 1.00 13.14 ? 138 MET D SD   1  
ATOM 9213   C CE   . MET D 1 138 ? 3.009   -24.343 -23.681 1.00 35.20 ? 138 MET D CE   1  
ATOM 9214   H H    . MET D 1 138 ? 7.634   -24.358 -24.621 1.00 44.45 ? 138 MET D H    1  
ATOM 9215   H HA   . MET D 1 138 ? 7.723   -27.177 -24.582 1.00 72.14 ? 138 MET D HA   1  
ATOM 9216   H HB2  . MET D 1 138 ? 6.034   -25.413 -26.444 1.00 35.34 ? 138 MET D HB2  1  
ATOM 9217   H HB3  . MET D 1 138 ? 5.731   -27.111 -26.096 1.00 34.13 ? 138 MET D HB3  1  
ATOM 9218   H HG2  . MET D 1 138 ? 5.140   -26.607 -23.829 1.00 51.31 ? 138 MET D HG2  1  
ATOM 9219   H HG3  . MET D 1 138 ? 5.672   -24.936 -24.016 1.00 20.05 ? 138 MET D HG3  1  
ATOM 9220   H HE1  . MET D 1 138 ? 3.739   -23.572 -23.467 1.00 40.14 ? 138 MET D HE1  1  
ATOM 9221   H HE2  . MET D 1 138 ? 2.892   -24.980 -22.817 1.00 70.30 ? 138 MET D HE2  1  
ATOM 9222   H HE3  . MET D 1 138 ? 2.068   -23.881 -23.918 1.00 13.41 ? 138 MET D HE3  1  
ATOM 9223   N N    . ASN D 1 139 ? 8.594   -25.771 -27.500 1.00 52.03 ? 139 ASN D N    1  
ATOM 9224   C CA   . ASN D 1 139 ? 9.285   -25.968 -28.800 1.00 10.41 ? 139 ASN D CA   1  
ATOM 9225   C C    . ASN D 1 139 ? 10.667  -26.622 -28.613 1.00 73.44 ? 139 ASN D C    1  
ATOM 9226   O O    . ASN D 1 139 ? 11.050  -27.517 -29.375 1.00 21.54 ? 139 ASN D O    1  
ATOM 9227   C CB   . ASN D 1 139 ? 9.452   -24.624 -29.577 1.00 34.12 ? 139 ASN D CB   1  
ATOM 9228   C CG   . ASN D 1 139 ? 8.128   -24.024 -30.065 1.00 41.03 ? 139 ASN D CG   1  
ATOM 9229   O OD1  . ASN D 1 139 ? 7.524   -23.177 -29.409 1.00 33.44 ? 139 ASN D OD1  1  
ATOM 9230   N ND2  . ASN D 1 139 ? 7.667   -24.457 -31.228 1.00 4.01  ? 139 ASN D ND2  1  
ATOM 9231   H H    . ASN D 1 139 ? 8.276   -24.872 -27.276 1.00 72.43 ? 139 ASN D H    1  
ATOM 9232   H HA   . ASN D 1 139 ? 8.666   -26.637 -29.393 1.00 65.44 ? 139 ASN D HA   1  
ATOM 9233   H HB2  . ASN D 1 139 ? 9.932   -23.900 -28.932 1.00 55.14 ? 139 ASN D HB2  1  
ATOM 9234   H HB3  . ASN D 1 139 ? 10.091  -24.786 -30.442 1.00 22.43 ? 139 ASN D HB3  1  
ATOM 9235   H HD21 . ASN D 1 139 ? 8.187   -25.132 -31.711 1.00 73.22 ? 139 ASN D HD21 1  
ATOM 9236   H HD22 . ASN D 1 139 ? 6.819   -24.091 -31.557 1.00 72.42 ? 139 ASN D HD22 1  
ATOM 9237   N N    . TYR D 1 140 ? 11.385  -26.187 -27.571 1.00 41.44 ? 140 TYR D N    1  
ATOM 9238   C CA   . TYR D 1 140 ? 12.747  -26.660 -27.284 1.00 74.31 ? 140 TYR D CA   1  
ATOM 9239   C C    . TYR D 1 140 ? 12.726  -28.071 -26.646 1.00 14.14 ? 140 TYR D C    1  
ATOM 9240   O O    . TYR D 1 140 ? 13.501  -28.955 -27.033 1.00 14.14 ? 140 TYR D O    1  
ATOM 9241   C CB   . TYR D 1 140 ? 13.463  -25.640 -26.358 1.00 55.00 ? 140 TYR D CB   1  
ATOM 9242   C CG   . TYR D 1 140 ? 14.956  -25.930 -26.160 1.00 42.23 ? 140 TYR D CG   1  
ATOM 9243   C CD1  . TYR D 1 140 ? 15.845  -25.827 -27.235 1.00 44.43 ? 140 TYR D CD1  1  
ATOM 9244   C CD2  . TYR D 1 140 ? 15.476  -26.325 -24.923 1.00 20.12 ? 140 TYR D CD2  1  
ATOM 9245   C CE1  . TYR D 1 140 ? 17.188  -26.105 -27.086 1.00 22.44 ? 140 TYR D CE1  1  
ATOM 9246   C CE2  . TYR D 1 140 ? 16.820  -26.596 -24.773 1.00 42.42 ? 140 TYR D CE2  1  
ATOM 9247   C CZ   . TYR D 1 140 ? 17.668  -26.489 -25.859 1.00 3.54  ? 140 TYR D CZ   1  
ATOM 9248   O OH   . TYR D 1 140 ? 19.006  -26.781 -25.713 1.00 22.22 ? 140 TYR D OH   1  
ATOM 9249   H H    . TYR D 1 140 ? 10.983  -25.525 -26.968 1.00 70.03 ? 140 TYR D H    1  
ATOM 9250   H HA   . TYR D 1 140 ? 13.284  -26.711 -28.230 1.00 43.41 ? 140 TYR D HA   1  
ATOM 9251   H HB2  . TYR D 1 140 ? 13.374  -24.649 -26.792 1.00 13.14 ? 140 TYR D HB2  1  
ATOM 9252   H HB3  . TYR D 1 140 ? 12.977  -25.637 -25.386 1.00 33.13 ? 140 TYR D HB3  1  
ATOM 9253   H HD1  . TYR D 1 140 ? 15.470  -25.520 -28.204 1.00 72.51 ? 140 TYR D HD1  1  
ATOM 9254   H HD2  . TYR D 1 140 ? 14.811  -26.410 -24.071 1.00 30.34 ? 140 TYR D HD2  1  
ATOM 9255   H HE1  . TYR D 1 140 ? 17.854  -26.017 -27.934 1.00 3.12  ? 140 TYR D HE1  1  
ATOM 9256   H HE2  . TYR D 1 140 ? 17.207  -26.901 -23.808 1.00 72.34 ? 140 TYR D HE2  1  
ATOM 9257   H HH   . TYR D 1 140 ? 19.094  -27.650 -25.299 1.00 35.14 ? 140 TYR D HH   1  
ATOM 9258   N N    . LEU D 1 141 ? 11.800  -28.261 -25.688 1.00 44.51 ? 141 LEU D N    1  
ATOM 9259   C CA   . LEU D 1 141 ? 11.667  -29.506 -24.885 1.00 72.12 ? 141 LEU D CA   1  
ATOM 9260   C C    . LEU D 1 141 ? 11.264  -30.703 -25.757 1.00 2.44  ? 141 LEU D C    1  
ATOM 9261   O O    . LEU D 1 141 ? 11.822  -31.800 -25.621 1.00 3.11  ? 141 LEU D O    1  
ATOM 9262   C CB   . LEU D 1 141 ? 10.622  -29.296 -23.739 1.00 54.34 ? 141 LEU D CB   1  
ATOM 9263   C CG   . LEU D 1 141 ? 11.146  -28.680 -22.391 1.00 24.10 ? 141 LEU D CG   1  
ATOM 9264   C CD1  . LEU D 1 141 ? 12.116  -27.491 -22.605 1.00 60.10 ? 141 LEU D CD1  1  
ATOM 9265   C CD2  . LEU D 1 141 ? 9.958   -28.278 -21.488 1.00 34.35 ? 141 LEU D CD2  1  
ATOM 9266   H H    . LEU D 1 141 ? 11.166  -27.536 -25.517 1.00 22.12 ? 141 LEU D H    1  
ATOM 9267   H HA   . LEU D 1 141 ? 12.635  -29.712 -24.440 1.00 34.52 ? 141 LEU D HA   1  
ATOM 9268   H HB2  . LEU D 1 141 ? 9.834   -28.652 -24.119 1.00 21.35 ? 141 LEU D HB2  1  
ATOM 9269   H HB3  . LEU D 1 141 ? 10.169  -30.258 -23.500 1.00 1.43  ? 141 LEU D HB3  1  
ATOM 9270   H HG   . LEU D 1 141 ? 11.703  -29.441 -21.862 1.00 71.13 ? 141 LEU D HG   1  
ATOM 9271   H HD11 . LEU D 1 141 ? 12.153  -26.882 -21.719 1.00 52.44 ? 141 LEU D HD11 1  
ATOM 9272   H HD12 . LEU D 1 141 ? 11.785  -26.886 -23.435 1.00 41.33 ? 141 LEU D HD12 1  
ATOM 9273   H HD13 . LEU D 1 141 ? 13.106  -27.872 -22.818 1.00 42.10 ? 141 LEU D HD13 1  
ATOM 9274   H HD21 . LEU D 1 141 ? 9.246   -29.093 -21.432 1.00 4.00  ? 141 LEU D HD21 1  
ATOM 9275   H HD22 . LEU D 1 141 ? 9.461   -27.405 -21.893 1.00 44.11 ? 141 LEU D HD22 1  
ATOM 9276   H HD23 . LEU D 1 141 ? 10.317  -28.054 -20.493 1.00 15.33 ? 141 LEU D HD23 1  
ATOM 9277   N N    . GLN D 1 142 ? 10.314  -30.462 -26.677 1.00 70.51 ? 142 GLN D N    1  
ATOM 9278   C CA   . GLN D 1 142 ? 9.684   -31.525 -27.493 1.00 11.24 ? 142 GLN D CA   1  
ATOM 9279   C C    . GLN D 1 142 ? 10.621  -32.021 -28.612 1.00 62.31 ? 142 GLN D C    1  
ATOM 9280   O O    . GLN D 1 142 ? 10.264  -32.940 -29.358 1.00 63.23 ? 142 GLN D O    1  
ATOM 9281   C CB   . GLN D 1 142 ? 8.370   -30.970 -28.113 1.00 23.43 ? 142 GLN D CB   1  
ATOM 9282   C CG   . GLN D 1 142 ? 8.591   -29.861 -29.170 1.00 14.11 ? 142 GLN D CG   1  
ATOM 9283   C CD   . GLN D 1 142 ? 7.333   -29.078 -29.539 1.00 5.34  ? 142 GLN D CD   1  
ATOM 9284   O OE1  . GLN D 1 142 ? 6.426   -28.912 -28.725 1.00 51.31 ? 142 GLN D OE1  1  
ATOM 9285   N NE2  . GLN D 1 142 ? 7.280   -28.570 -30.761 1.00 64.44 ? 142 GLN D NE2  1  
ATOM 9286   H H    . GLN D 1 142 ? 10.029  -29.538 -26.818 1.00 50.50 ? 142 GLN D H    1  
ATOM 9287   H HA   . GLN D 1 142 ? 9.443   -32.360 -26.840 1.00 24.22 ? 142 GLN D HA   1  
ATOM 9288   H HB2  . GLN D 1 142 ? 7.831   -31.789 -28.583 1.00 50.25 ? 142 GLN D HB2  1  
ATOM 9289   H HB3  . GLN D 1 142 ? 7.752   -30.569 -27.317 1.00 44.31 ? 142 GLN D HB3  1  
ATOM 9290   H HG2  . GLN D 1 142 ? 9.318   -29.152 -28.785 1.00 2.45  ? 142 GLN D HG2  1  
ATOM 9291   H HG3  . GLN D 1 142 ? 8.993   -30.318 -30.066 1.00 24.03 ? 142 GLN D HG3  1  
ATOM 9292   H HE21 . GLN D 1 142 ? 8.042   -28.720 -31.361 1.00 31.52 ? 142 GLN D HE21 1  
ATOM 9293   H HE22 . GLN D 1 142 ? 6.485   -28.059 -31.015 1.00 23.43 ? 142 GLN D HE22 1  
ATOM 9294   N N    . GLN D 1 143 ? 11.826  -31.418 -28.711 1.00 1.11  ? 143 GLN D N    1  
ATOM 9295   C CA   . GLN D 1 143 ? 12.843  -31.795 -29.705 1.00 43.35 ? 143 GLN D CA   1  
ATOM 9296   C C    . GLN D 1 143 ? 14.191  -32.031 -28.997 1.00 71.42 ? 143 GLN D C    1  
ATOM 9297   O O    . GLN D 1 143 ? 15.247  -31.630 -29.499 1.00 3.43  ? 143 GLN D O    1  
ATOM 9298   C CB   . GLN D 1 143 ? 12.966  -30.668 -30.784 1.00 53.55 ? 143 GLN D CB   1  
ATOM 9299   C CG   . GLN D 1 143 ? 11.662  -30.362 -31.546 1.00 73.11 ? 143 GLN D CG   1  
ATOM 9300   C CD   . GLN D 1 143 ? 11.812  -29.271 -32.606 1.00 24.51 ? 143 GLN D CD   1  
ATOM 9301   O OE1  . GLN D 1 143 ? 12.132  -29.548 -33.761 1.00 30.44 ? 143 GLN D OE1  1  
ATOM 9302   N NE2  . GLN D 1 143 ? 11.584  -28.022 -32.228 1.00 60.12 ? 143 GLN D NE2  1  
ATOM 9303   H H    . GLN D 1 143 ? 12.038  -30.690 -28.093 1.00 14.21 ? 143 GLN D H    1  
ATOM 9304   H HA   . GLN D 1 143 ? 12.541  -32.722 -30.187 1.00 2.55  ? 143 GLN D HA   1  
ATOM 9305   H HB2  . GLN D 1 143 ? 13.297  -29.754 -30.301 1.00 41.02 ? 143 GLN D HB2  1  
ATOM 9306   H HB3  . GLN D 1 143 ? 13.717  -30.964 -31.509 1.00 4.34  ? 143 GLN D HB3  1  
ATOM 9307   H HG2  . GLN D 1 143 ? 11.322  -31.268 -32.033 1.00 42.02 ? 143 GLN D HG2  1  
ATOM 9308   H HG3  . GLN D 1 143 ? 10.912  -30.050 -30.827 1.00 32.23 ? 143 GLN D HG3  1  
ATOM 9309   H HE21 . GLN D 1 143 ? 11.336  -27.859 -31.296 1.00 12.42 ? 143 GLN D HE21 1  
ATOM 9310   H HE22 . GLN D 1 143 ? 11.667  -27.314 -32.897 1.00 50.44 ? 143 GLN D HE22 1  
ATOM 9311   N N    . GLN D 1 144 ? 14.132  -32.739 -27.847 1.00 52.03 ? 144 GLN D N    1  
ATOM 9312   C CA   . GLN D 1 144 ? 15.318  -33.223 -27.110 1.00 31.54 ? 144 GLN D CA   1  
ATOM 9313   C C    . GLN D 1 144 ? 14.891  -34.055 -25.888 1.00 64.34 ? 144 GLN D C    1  
ATOM 9314   O O    . GLN D 1 144 ? 13.795  -33.866 -25.340 1.00 11.00 ? 144 GLN D O    1  
ATOM 9315   C CB   . GLN D 1 144 ? 16.260  -32.064 -26.639 1.00 34.52 ? 144 GLN D CB   1  
ATOM 9316   C CG   . GLN D 1 144 ? 15.682  -31.126 -25.554 1.00 35.03 ? 144 GLN D CG   1  
ATOM 9317   C CD   . GLN D 1 144 ? 16.712  -30.142 -24.993 1.00 23.20 ? 144 GLN D CD   1  
ATOM 9318   O OE1  . GLN D 1 144 ? 17.644  -29.729 -25.685 1.00 3.24  ? 144 GLN D OE1  1  
ATOM 9319   N NE2  . GLN D 1 144 ? 16.561  -29.774 -23.730 1.00 31.05 ? 144 GLN D NE2  1  
ATOM 9320   H H    . GLN D 1 144 ? 13.248  -32.939 -27.471 1.00 23.32 ? 144 GLN D H    1  
ATOM 9321   H HA   . GLN D 1 144 ? 15.870  -33.870 -27.786 1.00 12.24 ? 144 GLN D HA   1  
ATOM 9322   H HB2  . GLN D 1 144 ? 17.176  -32.500 -26.255 1.00 15.04 ? 144 GLN D HB2  1  
ATOM 9323   H HB3  . GLN D 1 144 ? 16.513  -31.460 -27.507 1.00 11.54 ? 144 GLN D HB3  1  
ATOM 9324   H HG2  . GLN D 1 144 ? 14.865  -30.557 -25.982 1.00 22.11 ? 144 GLN D HG2  1  
ATOM 9325   H HG3  . GLN D 1 144 ? 15.299  -31.731 -24.738 1.00 31.42 ? 144 GLN D HG3  1  
ATOM 9326   H HE21 . GLN D 1 144 ? 15.812  -30.147 -23.225 1.00 34.15 ? 144 GLN D HE21 1  
ATOM 9327   H HE22 . GLN D 1 144 ? 17.210  -29.140 -23.352 1.00 1.43  ? 144 GLN D HE22 1  
ATOM 9328   N N    . ALA D 1 145 ? 15.771  -34.978 -25.470 1.00 12.13 ? 145 ALA D N    1  
ATOM 9329   C CA   . ALA D 1 145 ? 15.613  -35.742 -24.215 1.00 73.33 ? 145 ALA D CA   1  
ATOM 9330   C C    . ALA D 1 145 ? 16.467  -35.118 -23.091 1.00 40.31 ? 145 ALA D C    1  
ATOM 9331   O O    . ALA D 1 145 ? 16.582  -35.694 -22.001 1.00 3.02  ? 145 ALA D O    1  
ATOM 9332   C CB   . ALA D 1 145 ? 15.986  -37.218 -24.443 1.00 64.32 ? 145 ALA D CB   1  
ATOM 9333   H H    . ALA D 1 145 ? 16.559  -35.158 -26.028 1.00 53.22 ? 145 ALA D H    1  
ATOM 9334   H HA   . ALA D 1 145 ? 14.568  -35.702 -23.913 1.00 64.41 ? 145 ALA D HA   1  
ATOM 9335   H HB1  . ALA D 1 145 ? 17.027  -37.292 -24.732 1.00 30.55 ? 145 ALA D HB1  1  
ATOM 9336   H HB2  . ALA D 1 145 ? 15.369  -37.631 -25.231 1.00 72.44 ? 145 ALA D HB2  1  
ATOM 9337   H HB3  . ALA D 1 145 ? 15.825  -37.781 -23.533 1.00 60.33 ? 145 ALA D HB3  1  
ATOM 9338   N N    . GLY D 1 146 ? 17.048  -33.929 -23.371 1.00 61.42 ? 146 GLY D N    1  
ATOM 9339   C CA   . GLY D 1 146 ? 17.899  -33.205 -22.428 1.00 41.34 ? 146 GLY D CA   1  
ATOM 9340   C C    . GLY D 1 146 ? 17.108  -32.567 -21.296 1.00 15.04 ? 146 GLY D C    1  
ATOM 9341   O O    . GLY D 1 146 ? 16.814  -31.365 -21.322 1.00 50.34 ? 146 GLY D O    1  
ATOM 9342   H H    . GLY D 1 146 ? 16.894  -33.535 -24.250 1.00 13.03 ? 146 GLY D H    1  
ATOM 9343   H HA2  . GLY D 1 146 ? 18.638  -33.884 -22.014 1.00 21.33 ? 146 GLY D HA2  1  
ATOM 9344   H HA3  . GLY D 1 146 ? 18.420  -32.430 -22.974 1.00 60.23 ? 146 GLY D HA3  1  
ATOM 9345   N N    . GLU D 1 147 ? 16.746  -33.400 -20.316 1.00 62.32 ? 147 GLU D N    1  
ATOM 9346   C CA   . GLU D 1 147 ? 16.014  -32.990 -19.119 1.00 1.41  ? 147 GLU D CA   1  
ATOM 9347   C C    . GLU D 1 147 ? 17.037  -32.569 -18.041 1.00 41.32 ? 147 GLU D C    1  
ATOM 9348   O O    . GLU D 1 147 ? 17.498  -33.393 -17.237 1.00 3.33  ? 147 GLU D O    1  
ATOM 9349   C CB   . GLU D 1 147 ? 15.123  -34.164 -18.639 1.00 32.23 ? 147 GLU D CB   1  
ATOM 9350   C CG   . GLU D 1 147 ? 14.219  -33.837 -17.436 1.00 20.31 ? 147 GLU D CG   1  
ATOM 9351   C CD   . GLU D 1 147 ? 13.630  -35.098 -16.803 1.00 71.10 ? 147 GLU D CD   1  
ATOM 9352   O OE1  . GLU D 1 147 ? 14.233  -35.619 -15.844 1.00 3.31  ? 147 GLU D OE1  1  
ATOM 9353   O OE2  . GLU D 1 147 ? 12.607  -35.605 -17.293 1.00 30.34 ? 147 GLU D OE2  1  
ATOM 9354   H H    . GLU D 1 147 ? 17.000  -34.341 -20.395 1.00 72.35 ? 147 GLU D H    1  
ATOM 9355   H HA   . GLU D 1 147 ? 15.378  -32.139 -19.364 1.00 21.52 ? 147 GLU D HA   1  
ATOM 9356   H HB2  . GLU D 1 147 ? 14.489  -34.479 -19.465 1.00 13.42 ? 147 GLU D HB2  1  
ATOM 9357   H HB3  . GLU D 1 147 ? 15.766  -34.996 -18.369 1.00 61.14 ? 147 GLU D HB3  1  
ATOM 9358   H HG2  . GLU D 1 147 ? 14.807  -33.307 -16.690 1.00 2.50  ? 147 GLU D HG2  1  
ATOM 9359   H HG3  . GLU D 1 147 ? 13.411  -33.190 -17.766 1.00 72.34 ? 147 GLU D HG3  1  
ATOM 9360   N N    . GLY D 1 148 ? 17.462  -31.302 -18.113 1.00 33.54 ? 148 GLY D N    1  
ATOM 9361   C CA   . GLY D 1 148 ? 18.407  -30.725 -17.158 1.00 34.32 ? 148 GLY D CA   1  
ATOM 9362   C C    . GLY D 1 148 ? 17.698  -30.012 -16.017 1.00 35.22 ? 148 GLY D C    1  
ATOM 9363   O O    . GLY D 1 148 ? 16.508  -29.692 -16.128 1.00 13.34 ? 148 GLY D O    1  
ATOM 9364   H H    . GLY D 1 148 ? 17.123  -30.742 -18.837 1.00 44.10 ? 148 GLY D H    1  
ATOM 9365   H HA2  . GLY D 1 148 ? 19.049  -31.503 -16.755 1.00 14.54 ? 148 GLY D HA2  1  
ATOM 9366   H HA3  . GLY D 1 148 ? 19.025  -30.009 -17.683 1.00 62.43 ? 148 GLY D HA3  1  
ATOM 9367   N N    . THR D 1 149 ? 18.432  -29.771 -14.922 1.00 74.31 ? 149 THR D N    1  
ATOM 9368   C CA   . THR D 1 149 ? 17.920  -29.061 -13.739 1.00 4.32  ? 149 THR D CA   1  
ATOM 9369   C C    . THR D 1 149 ? 19.079  -28.615 -12.839 1.00 61.12 ? 149 THR D C    1  
ATOM 9370   O O    . THR D 1 149 ? 20.154  -29.228 -12.846 1.00 30.22 ? 149 THR D O    1  
ATOM 9371   C CB   . THR D 1 149 ? 16.925  -29.938 -12.906 1.00 35.01 ? 149 THR D CB   1  
ATOM 9372   O OG1  . THR D 1 149 ? 16.442  -29.204 -11.765 1.00 44.03 ? 149 THR D OG1  1  
ATOM 9373   C CG2  . THR D 1 149 ? 17.545  -31.270 -12.427 1.00 3.52  ? 149 THR D CG2  1  
ATOM 9374   H H    . THR D 1 149 ? 19.359  -30.092 -14.900 1.00 72.04 ? 149 THR D H    1  
ATOM 9375   H HA   . THR D 1 149 ? 17.392  -28.174 -14.085 1.00 11.51 ? 149 THR D HA   1  
ATOM 9376   H HB   . THR D 1 149 ? 16.075  -30.169 -13.541 1.00 45.42 ? 149 THR D HB   1  
ATOM 9377   H HG1  . THR D 1 149 ? 16.259  -28.291 -12.019 1.00 13.52 ? 149 THR D HG1  1  
ATOM 9378   H HG21 . THR D 1 149 ? 17.868  -31.854 -13.280 1.00 33.14 ? 149 THR D HG21 1  
ATOM 9379   H HG22 . THR D 1 149 ? 16.806  -31.833 -11.873 1.00 15.54 ? 149 THR D HG22 1  
ATOM 9380   H HG23 . THR D 1 149 ? 18.394  -31.071 -11.786 1.00 53.41 ? 149 THR D HG23 1  
ATOM 9381   N N    . GLU D 1 150 ? 18.855  -27.537 -12.073 1.00 34.42 ? 150 GLU D N    1  
ATOM 9382   C CA   . GLU D 1 150 ? 19.816  -27.048 -11.076 1.00 45.23 ? 150 GLU D CA   1  
ATOM 9383   C C    . GLU D 1 150 ? 19.230  -27.228 -9.668  1.00 5.41  ? 150 GLU D C    1  
ATOM 9384   O O    . GLU D 1 150 ? 18.014  -27.084 -9.460  1.00 20.10 ? 150 GLU D O    1  
ATOM 9385   C CB   . GLU D 1 150 ? 20.177  -25.560 -11.335 1.00 74.22 ? 150 GLU D CB   1  
ATOM 9386   C CG   . GLU D 1 150 ? 18.992  -24.577 -11.218 1.00 21.21 ? 150 GLU D CG   1  
ATOM 9387   C CD   . GLU D 1 150 ? 19.403  -23.107 -11.362 1.00 34.25 ? 150 GLU D CD   1  
ATOM 9388   O OE1  . GLU D 1 150 ? 19.069  -22.477 -12.388 1.00 63.40 ? 150 GLU D OE1  1  
ATOM 9389   O OE2  . GLU D 1 150 ? 20.066  -22.576 -10.441 1.00 3.32  ? 150 GLU D OE2  1  
ATOM 9390   H H    . GLU D 1 150 ? 18.003  -27.057 -12.173 1.00 43.45 ? 150 GLU D H    1  
ATOM 9391   H HA   . GLU D 1 150 ? 20.725  -27.645 -11.151 1.00 40.42 ? 150 GLU D HA   1  
ATOM 9392   H HB2  . GLU D 1 150 ? 20.944  -25.259 -10.626 1.00 25.12 ? 150 GLU D HB2  1  
ATOM 9393   H HB3  . GLU D 1 150 ? 20.588  -25.476 -12.335 1.00 4.25  ? 150 GLU D HB3  1  
ATOM 9394   H HG2  . GLU D 1 150 ? 18.265  -24.819 -11.987 1.00 55.12 ? 150 GLU D HG2  1  
ATOM 9395   H HG3  . GLU D 1 150 ? 18.524  -24.712 -10.246 1.00 74.00 ? 150 GLU D HG3  1  
ATOM 9396   N N    . GLU D 1 151 ? 20.100  -27.574 -8.713  1.00 64.32 ? 151 GLU D N    1  
ATOM 9397   C CA   . GLU D 1 151 ? 19.742  -27.662 -7.295  1.00 13.11 ? 151 GLU D CA   1  
ATOM 9398   C C    . GLU D 1 151 ? 20.061  -26.288 -6.673  1.00 5.23  ? 151 GLU D C    1  
ATOM 9399   O O    . GLU D 1 151 ? 21.233  -25.971 -6.425  1.00 21.03 ? 151 GLU D O    1  
ATOM 9400   C CB   . GLU D 1 151 ? 20.529  -28.839 -6.622  1.00 60.34 ? 151 GLU D CB   1  
ATOM 9401   C CG   . GLU D 1 151 ? 19.900  -29.419 -5.330  1.00 60.51 ? 151 GLU D CG   1  
ATOM 9402   C CD   . GLU D 1 151 ? 19.935  -28.465 -4.121  1.00 1.20  ? 151 GLU D CD   1  
ATOM 9403   O OE1  . GLU D 1 151 ? 21.024  -28.277 -3.543  1.00 44.01 ? 151 GLU D OE1  1  
ATOM 9404   O OE2  . GLU D 1 151 ? 18.884  -27.918 -3.735  1.00 73.44 ? 151 GLU D OE2  1  
ATOM 9405   H H    . GLU D 1 151 ? 21.025  -27.773 -8.972  1.00 32.45 ? 151 GLU D H    1  
ATOM 9406   H HA   . GLU D 1 151 ? 18.672  -27.856 -7.214  1.00 1.11  ? 151 GLU D HA   1  
ATOM 9407   H HB2  . GLU D 1 151 ? 20.611  -29.650 -7.337  1.00 60.02 ? 151 GLU D HB2  1  
ATOM 9408   H HB3  . GLU D 1 151 ? 21.532  -28.502 -6.383  1.00 53.23 ? 151 GLU D HB3  1  
ATOM 9409   H HG2  . GLU D 1 151 ? 18.870  -29.683 -5.545  1.00 71.04 ? 151 GLU D HG2  1  
ATOM 9410   H HG3  . GLU D 1 151 ? 20.432  -30.328 -5.064  1.00 32.31 ? 151 GLU D HG3  1  
ATOM 9411   N N    . HIS D 1 152 ? 19.025  -25.448 -6.514  1.00 32.12 ? 152 HIS D N    1  
ATOM 9412   C CA   . HIS D 1 152 ? 19.168  -24.069 -6.018  1.00 42.22 ? 152 HIS D CA   1  
ATOM 9413   C C    . HIS D 1 152 ? 17.924  -23.721 -5.192  1.00 3.45  ? 152 HIS D C    1  
ATOM 9414   O O    . HIS D 1 152 ? 16.818  -23.692 -5.735  1.00 50.33 ? 152 HIS D O    1  
ATOM 9415   C CB   . HIS D 1 152 ? 19.330  -23.083 -7.214  1.00 52.14 ? 152 HIS D CB   1  
ATOM 9416   C CG   . HIS D 1 152 ? 19.861  -21.716 -6.839  1.00 22.22 ? 152 HIS D CG   1  
ATOM 9417   N ND1  . HIS D 1 152 ? 19.086  -20.721 -6.281  1.00 13.34 ? 152 HIS D ND1  1  
ATOM 9418   C CD2  . HIS D 1 152 ? 21.107  -21.189 -6.948  1.00 52.22 ? 152 HIS D CD2  1  
ATOM 9419   C CE1  . HIS D 1 152 ? 19.830  -19.658 -6.055  1.00 52.14 ? 152 HIS D CE1  1  
ATOM 9420   N NE2  . HIS D 1 152 ? 21.056  -19.914 -6.450  1.00 0.12  ? 152 HIS D NE2  1  
ATOM 9421   H H    . HIS D 1 152 ? 18.124  -25.772 -6.738  1.00 21.12 ? 152 HIS D H    1  
ATOM 9422   H HA   . HIS D 1 152 ? 20.050  -24.019 -5.383  1.00 41.31 ? 152 HIS D HA   1  
ATOM 9423   H HB2  . HIS D 1 152 ? 20.019  -23.515 -7.931  1.00 52.40 ? 152 HIS D HB2  1  
ATOM 9424   H HB3  . HIS D 1 152 ? 18.372  -22.950 -7.703  1.00 32.41 ? 152 HIS D HB3  1  
ATOM 9425   H HD1  . HIS D 1 152 ? 18.123  -20.770 -6.113  1.00 65.25 ? 152 HIS D HD1  1  
ATOM 9426   H HD2  . HIS D 1 152 ? 21.982  -21.687 -7.342  1.00 61.42 ? 152 HIS D HD2  1  
ATOM 9427   H HE1  . HIS D 1 152 ? 19.489  -18.728 -5.626  1.00 62.34 ? 152 HIS D HE1  1  
ATOM 9428   H HE2  . HIS D 1 152 ? 21.765  -19.238 -6.554  1.00 37.61 ? 152 HIS D HE2  1  
ATOM 9429   N N    . GLN D 1 153 ? 18.100  -23.497 -3.875  1.00 42.43 ? 153 GLN D N    1  
ATOM 9430   C CA   . GLN D 1 153 ? 16.979  -23.210 -2.943  1.00 24.52 ? 153 GLN D CA   1  
ATOM 9431   C C    . GLN D 1 153 ? 17.257  -21.968 -2.085  1.00 73.32 ? 153 GLN D C    1  
ATOM 9432   O O    . GLN D 1 153 ? 16.638  -21.791 -1.024  1.00 40.53 ? 153 GLN D O    1  
ATOM 9433   C CB   . GLN D 1 153 ? 16.698  -24.442 -2.036  1.00 42.53 ? 153 GLN D CB   1  
ATOM 9434   C CG   . GLN D 1 153 ? 16.393  -25.746 -2.800  1.00 54.40 ? 153 GLN D CG   1  
ATOM 9435   C CD   . GLN D 1 153 ? 15.664  -26.788 -1.961  1.00 73.43 ? 153 GLN D CD   1  
ATOM 9436   O OE1  . GLN D 1 153 ? 15.819  -26.854 -0.741  1.00 54.34 ? 153 GLN D OE1  1  
ATOM 9437   N NE2  . GLN D 1 153 ? 14.852  -27.613 -2.607  1.00 64.32 ? 153 GLN D NE2  1  
ATOM 9438   H H    . GLN D 1 153 ? 19.011  -23.538 -3.511  1.00 13.40 ? 153 GLN D H    1  
ATOM 9439   H HA   . GLN D 1 153 ? 16.092  -23.006 -3.533  1.00 32.23 ? 153 GLN D HA   1  
ATOM 9440   H HB2  . GLN D 1 153 ? 17.562  -24.615 -1.400  1.00 41.01 ? 153 GLN D HB2  1  
ATOM 9441   H HB3  . GLN D 1 153 ? 15.849  -24.213 -1.401  1.00 71.51 ? 153 GLN D HB3  1  
ATOM 9442   H HG2  . GLN D 1 153 ? 15.777  -25.507 -3.659  1.00 71.52 ? 153 GLN D HG2  1  
ATOM 9443   H HG3  . GLN D 1 153 ? 17.324  -26.177 -3.147  1.00 65.00 ? 153 GLN D HG3  1  
ATOM 9444   H HE21 . GLN D 1 153 ? 14.766  -27.510 -3.582  1.00 42.23 ? 153 GLN D HE21 1  
ATOM 9445   H HE22 . GLN D 1 153 ? 14.373  -28.287 -2.089  1.00 33.23 ? 153 GLN D HE22 1  
ATOM 9446   N N    . ASP D 1 154 ? 18.173  -21.101 -2.553  1.00 13.13 ? 154 ASP D N    1  
ATOM 9447   C CA   . ASP D 1 154 ? 18.457  -19.815 -1.897  1.00 1.11  ? 154 ASP D CA   1  
ATOM 9448   C C    . ASP D 1 154 ? 17.248  -18.862 -2.092  1.00 45.55 ? 154 ASP D C    1  
ATOM 9449   O O    . ASP D 1 154 ? 17.164  -18.140 -3.092  1.00 2.22  ? 154 ASP D O    1  
ATOM 9450   C CB   . ASP D 1 154 ? 19.773  -19.196 -2.452  1.00 2.13  ? 154 ASP D CB   1  
ATOM 9451   C CG   . ASP D 1 154 ? 20.274  -17.994 -1.628  1.00 32.23 ? 154 ASP D CG   1  
ATOM 9452   O OD1  . ASP D 1 154 ? 21.050  -18.199 -0.670  1.00 55.23 ? 154 ASP D OD1  1  
ATOM 9453   O OD2  . ASP D 1 154 ? 19.891  -16.845 -1.928  1.00 64.13 ? 154 ASP D OD2  1  
ATOM 9454   H H    . ASP D 1 154 ? 18.679  -21.338 -3.355  1.00 74.30 ? 154 ASP D H    1  
ATOM 9455   H HA   . ASP D 1 154 ? 18.585  -20.006 -0.834  1.00 23.34 ? 154 ASP D HA   1  
ATOM 9456   H HB2  . ASP D 1 154 ? 20.548  -19.959 -2.458  1.00 53.04 ? 154 ASP D HB2  1  
ATOM 9457   H HB3  . ASP D 1 154 ? 19.606  -18.876 -3.478  1.00 62.15 ? 154 ASP D HB3  1  
ATOM 9458   N N    . ALA D 1 155 ? 16.292  -18.954 -1.145  1.00 74.14 ? 155 ALA D N    1  
ATOM 9459   C CA   . ALA D 1 155 ? 15.034  -18.188 -1.148  1.00 62.52 ? 155 ALA D CA   1  
ATOM 9460   C C    . ALA D 1 155 ? 14.458  -18.138 0.291   1.00 2.31  ? 155 ALA D C    1  
ATOM 9461   O O    . ALA D 1 155 ? 13.885  -19.159 0.750   1.00 42.32 ? 155 ALA D O    1  
ATOM 9462   C CB   . ALA D 1 155 ? 14.017  -18.808 -2.133  1.00 21.24 ? 155 ALA D CB   1  
ATOM 9463   O OXT  . ALA D 1 155 ? 14.600  -17.098 0.965   1.00 37.61 ? 155 ALA D OXT  1  
ATOM 9464   H H    . ALA D 1 155 ? 16.441  -19.577 -0.407  1.00 53.01 ? 155 ALA D H    1  
ATOM 9465   H HA   . ALA D 1 155 ? 15.258  -17.174 -1.484  1.00 24.12 ? 155 ALA D HA   1  
ATOM 9466   H HB1  . ALA D 1 155 ? 13.108  -18.219 -2.141  1.00 73.22 ? 155 ALA D HB1  1  
ATOM 9467   H HB2  . ALA D 1 155 ? 13.784  -19.819 -1.828  1.00 52.23 ? 155 ALA D HB2  1  
ATOM 9468   H HB3  . ALA D 1 155 ? 14.439  -18.825 -3.129  1.00 4.34  ? 155 ALA D HB3  1  
ATOM 9469   N N    . MET E 2 1   ? 10.940  37.257  -3.017  1.00 51.24 ? 1   MET E N    1  
ATOM 9470   C CA   . MET E 2 1   ? 10.531  36.128  -3.875  1.00 44.23 ? 1   MET E CA   1  
ATOM 9471   C C    . MET E 2 1   ? 10.383  34.852  -3.032  1.00 70.13 ? 1   MET E C    1  
ATOM 9472   O O    . MET E 2 1   ? 11.361  34.128  -2.816  1.00 22.22 ? 1   MET E O    1  
ATOM 9473   C CB   . MET E 2 1   ? 11.552  35.925  -5.027  1.00 42.23 ? 1   MET E CB   1  
ATOM 9474   C CG   . MET E 2 1   ? 11.704  37.125  -5.966  1.00 21.34 ? 1   MET E CG   1  
ATOM 9475   S SD   . MET E 2 1   ? 12.898  36.809  -7.284  1.00 50.40 ? 1   MET E SD   1  
ATOM 9476   C CE   . MET E 2 1   ? 12.839  38.345  -8.203  1.00 42.14 ? 1   MET E CE   1  
ATOM 9477   H H1   . MET E 2 1   ? 10.984  38.138  -3.570  1.00 37.61 ? 1   MET E H1   1  
ATOM 9478   H H2   . MET E 2 1   ? 11.879  37.073  -2.609  1.00 37.61 ? 1   MET E H2   1  
ATOM 9479   H H3   . MET E 2 1   ? 10.262  37.380  -2.244  1.00 37.61 ? 1   MET E H3   1  
ATOM 9480   H HA   . MET E 2 1   ? 9.564   36.377  -4.302  1.00 54.45 ? 1   MET E HA   1  
ATOM 9481   H HB2  . MET E 2 1   ? 12.526  35.712  -4.600  1.00 11.21 ? 1   MET E HB2  1  
ATOM 9482   H HB3  . MET E 2 1   ? 11.247  35.071  -5.622  1.00 4.14  ? 1   MET E HB3  1  
ATOM 9483   H HG2  . MET E 2 1   ? 10.744  37.346  -6.415  1.00 44.14 ? 1   MET E HG2  1  
ATOM 9484   H HG3  . MET E 2 1   ? 12.038  37.981  -5.393  1.00 72.33 ? 1   MET E HG3  1  
ATOM 9485   H HE1  . MET E 2 1   ? 13.120  39.165  -7.557  1.00 31.03 ? 1   MET E HE1  1  
ATOM 9486   H HE2  . MET E 2 1   ? 11.837  38.507  -8.576  1.00 50.54 ? 1   MET E HE2  1  
ATOM 9487   H HE3  . MET E 2 1   ? 13.527  38.289  -9.031  1.00 62.12 ? 1   MET E HE3  1  
ATOM 9488   N N    . LYS E 2 2   ? 9.159   34.611  -2.510  1.00 34.31 ? 2   LYS E N    1  
ATOM 9489   C CA   . LYS E 2 2   ? 8.803   33.368  -1.785  1.00 42.34 ? 2   LYS E CA   1  
ATOM 9490   C C    . LYS E 2 2   ? 7.368   32.941  -2.140  1.00 4.40  ? 2   LYS E C    1  
ATOM 9491   O O    . LYS E 2 2   ? 6.529   33.775  -2.509  1.00 44.00 ? 2   LYS E O    1  
ATOM 9492   C CB   . LYS E 2 2   ? 8.924   33.511  -0.236  1.00 31.05 ? 2   LYS E CB   1  
ATOM 9493   C CG   . LYS E 2 2   ? 10.348  33.807  0.298   1.00 72.34 ? 2   LYS E CG   1  
ATOM 9494   C CD   . LYS E 2 2   ? 10.492  33.523  1.810   1.00 25.24 ? 2   LYS E CD   1  
ATOM 9495   C CE   . LYS E 2 2   ? 10.381  32.022  2.140   1.00 41.20 ? 2   LYS E CE   1  
ATOM 9496   N NZ   . LYS E 2 2   ? 10.502  31.754  3.594   1.00 35.45 ? 2   LYS E NZ   1  
ATOM 9497   H H    . LYS E 2 2   ? 8.458   35.290  -2.629  1.00 41.05 ? 2   LYS E H    1  
ATOM 9498   H HA   . LYS E 2 2   ? 9.480   32.582  -2.118  1.00 34.02 ? 2   LYS E HA   1  
ATOM 9499   H HB2  . LYS E 2 2   ? 8.271   34.314  0.090   1.00 72.23 ? 2   LYS E HB2  1  
ATOM 9500   H HB3  . LYS E 2 2   ? 8.579   32.589  0.222   1.00 14.02 ? 2   LYS E HB3  1  
ATOM 9501   H HG2  . LYS E 2 2   ? 11.064  33.194  -0.242  1.00 2.21  ? 2   LYS E HG2  1  
ATOM 9502   H HG3  . LYS E 2 2   ? 10.576  34.852  0.112   1.00 54.01 ? 2   LYS E HG3  1  
ATOM 9503   H HD2  . LYS E 2 2   ? 11.459  33.881  2.147   1.00 33.40 ? 2   LYS E HD2  1  
ATOM 9504   H HD3  . LYS E 2 2   ? 9.714   34.058  2.347   1.00 23.32 ? 2   LYS E HD3  1  
ATOM 9505   H HE2  . LYS E 2 2   ? 9.420   31.657  1.801   1.00 35.32 ? 2   LYS E HE2  1  
ATOM 9506   H HE3  . LYS E 2 2   ? 11.167  31.486  1.621   1.00 11.51 ? 2   LYS E HE3  1  
ATOM 9507   H HZ1  . LYS E 2 2   ? 9.693   32.171  4.102   1.00 24.43 ? 2   LYS E HZ1  1  
ATOM 9508   H HZ2  . LYS E 2 2   ? 11.378  32.171  3.963   1.00 42.43 ? 2   LYS E HZ2  1  
ATOM 9509   H HZ3  . LYS E 2 2   ? 10.518  30.728  3.769   1.00 63.21 ? 2   LYS E HZ3  1  
ATOM 9510   N N    . GLN E 2 3   ? 7.103   31.634  -2.012  1.00 13.13 ? 3   GLN E N    1  
ATOM 9511   C CA   . GLN E 2 3   ? 5.760   31.043  -2.165  1.00 62.42 ? 3   GLN E CA   1  
ATOM 9512   C C    . GLN E 2 3   ? 5.500   30.057  -1.013  1.00 5.44  ? 3   GLN E C    1  
ATOM 9513   O O    . GLN E 2 3   ? 6.381   29.821  -0.175  1.00 53.53 ? 3   GLN E O    1  
ATOM 9514   C CB   . GLN E 2 3   ? 5.630   30.323  -3.538  1.00 13.31 ? 3   GLN E CB   1  
ATOM 9515   C CG   . GLN E 2 3   ? 6.588   29.121  -3.733  1.00 23.24 ? 3   GLN E CG   1  
ATOM 9516   C CD   . GLN E 2 3   ? 6.365   28.354  -5.041  1.00 24.34 ? 3   GLN E CD   1  
ATOM 9517   O OE1  . GLN E 2 3   ? 5.936   28.914  -6.047  1.00 2.42  ? 3   GLN E OE1  1  
ATOM 9518   N NE2  . GLN E 2 3   ? 6.656   27.065  -5.039  1.00 72.01 ? 3   GLN E NE2  1  
ATOM 9519   H H    . GLN E 2 3   ? 7.847   31.029  -1.804  1.00 20.42 ? 3   GLN E H    1  
ATOM 9520   H HA   . GLN E 2 3   ? 5.020   31.838  -2.105  1.00 62.33 ? 3   GLN E HA   1  
ATOM 9521   H HB2  . GLN E 2 3   ? 4.611   29.966  -3.646  1.00 23.20 ? 3   GLN E HB2  1  
ATOM 9522   H HB3  . GLN E 2 3   ? 5.824   31.044  -4.325  1.00 71.24 ? 3   GLN E HB3  1  
ATOM 9523   H HG2  . GLN E 2 3   ? 7.608   29.484  -3.730  1.00 44.33 ? 3   GLN E HG2  1  
ATOM 9524   H HG3  . GLN E 2 3   ? 6.457   28.437  -2.902  1.00 64.34 ? 3   GLN E HG3  1  
ATOM 9525   H HE21 . GLN E 2 3   ? 7.003   26.667  -4.217  1.00 21.15 ? 3   GLN E HE21 1  
ATOM 9526   H HE22 . GLN E 2 3   ? 6.513   26.562  -5.870  1.00 14.41 ? 3   GLN E HE22 1  
ATOM 9527   N N    . SER E 2 4   ? 4.292   29.471  -0.992  1.00 31.15 ? 4   SER E N    1  
ATOM 9528   C CA   . SER E 2 4   ? 3.898   28.475  0.019   1.00 74.34 ? 4   SER E CA   1  
ATOM 9529   C C    . SER E 2 4   ? 3.002   27.402  -0.623  1.00 53.24 ? 4   SER E C    1  
ATOM 9530   O O    . SER E 2 4   ? 2.117   27.721  -1.428  1.00 65.51 ? 4   SER E O    1  
ATOM 9531   C CB   . SER E 2 4   ? 3.180   29.169  1.208   1.00 44.34 ? 4   SER E CB   1  
ATOM 9532   O OG   . SER E 2 4   ? 2.088   29.967  0.770   1.00 15.51 ? 4   SER E OG   1  
ATOM 9533   H H    . SER E 2 4   ? 3.641   29.712  -1.683  1.00 2.32  ? 4   SER E H    1  
ATOM 9534   H HA   . SER E 2 4   ? 4.799   27.991  0.389   1.00 53.45 ? 4   SER E HA   1  
ATOM 9535   H HB2  . SER E 2 4   ? 2.805   28.424  1.899   1.00 72.43 ? 4   SER E HB2  1  
ATOM 9536   H HB3  . SER E 2 4   ? 3.882   29.809  1.728   1.00 25.30 ? 4   SER E HB3  1  
ATOM 9537   H HG   . SER E 2 4   ? 2.410   30.843  0.522   1.00 71.21 ? 4   SER E HG   1  
ATOM 9538   N N    . THR E 2 5   ? 3.261   26.129  -0.279  1.00 43.10 ? 5   THR E N    1  
ATOM 9539   C CA   . THR E 2 5   ? 2.435   24.987  -0.705  1.00 45.42 ? 5   THR E CA   1  
ATOM 9540   C C    . THR E 2 5   ? 1.124   24.965  0.111   1.00 22.54 ? 5   THR E C    1  
ATOM 9541   O O    . THR E 2 5   ? 1.079   25.476  1.243   1.00 25.31 ? 5   THR E O    1  
ATOM 9542   C CB   . THR E 2 5   ? 3.235   23.643  -0.546  1.00 60.22 ? 5   THR E CB   1  
ATOM 9543   O OG1  . THR E 2 5   ? 4.422   23.713  -1.354  1.00 74.20 ? 5   THR E OG1  1  
ATOM 9544   C CG2  . THR E 2 5   ? 2.435   22.387  -0.953  1.00 72.50 ? 5   THR E CG2  1  
ATOM 9545   H H    . THR E 2 5   ? 4.034   25.953  0.295   1.00 42.13 ? 5   THR E H    1  
ATOM 9546   H HA   . THR E 2 5   ? 2.197   25.119  -1.760  1.00 32.10 ? 5   THR E HA   1  
ATOM 9547   H HB   . THR E 2 5   ? 3.536   23.543  0.494   1.00 4.23  ? 5   THR E HB   1  
ATOM 9548   H HG1  . THR E 2 5   ? 4.850   24.563  -1.221  1.00 2.54  ? 5   THR E HG1  1  
ATOM 9549   H HG21 . THR E 2 5   ? 3.044   21.504  -0.808  1.00 51.11 ? 5   THR E HG21 1  
ATOM 9550   H HG22 . THR E 2 5   ? 2.149   22.456  -1.993  1.00 45.23 ? 5   THR E HG22 1  
ATOM 9551   H HG23 . THR E 2 5   ? 1.544   22.309  -0.342  1.00 35.41 ? 5   THR E HG23 1  
ATOM 9552   N N    . ILE E 2 6   ? 0.080   24.391  -0.503  1.00 55.21 ? 6   ILE E N    1  
ATOM 9553   C CA   . ILE E 2 6   ? -1.285  24.312  0.035   1.00 62.33 ? 6   ILE E CA   1  
ATOM 9554   C C    . ILE E 2 6   ? -1.332  23.720  1.476   1.00 34.35 ? 6   ILE E C    1  
ATOM 9555   O O    . ILE E 2 6   ? -0.698  22.695  1.771   1.00 53.42 ? 6   ILE E O    1  
ATOM 9556   C CB   . ILE E 2 6   ? -2.183  23.477  -0.951  1.00 2.52  ? 6   ILE E CB   1  
ATOM 9557   C CG1  . ILE E 2 6   ? -3.658  23.434  -0.464  1.00 3.11  ? 6   ILE E CG1  1  
ATOM 9558   C CG2  . ILE E 2 6   ? -1.613  22.044  -1.185  1.00 14.31 ? 6   ILE E CG2  1  
ATOM 9559   C CD1  . ILE E 2 6   ? -4.590  22.662  -1.364  1.00 34.53 ? 6   ILE E CD1  1  
ATOM 9560   H H    . ILE E 2 6   ? 0.238   23.991  -1.380  1.00 62.51 ? 6   ILE E H    1  
ATOM 9561   H HA   . ILE E 2 6   ? -1.675  25.330  0.061   1.00 14.13 ? 6   ILE E HA   1  
ATOM 9562   H HB   . ILE E 2 6   ? -2.157  23.986  -1.913  1.00 73.21 ? 6   ILE E HB   1  
ATOM 9563   H HG12 . ILE E 2 6   ? -3.702  22.972  0.513   1.00 40.13 ? 6   ILE E HG12 1  
ATOM 9564   H HG13 . ILE E 2 6   ? -4.043  24.444  -0.388  1.00 63.32 ? 6   ILE E HG13 1  
ATOM 9565   H HG21 . ILE E 2 6   ? -1.621  21.491  -0.254  1.00 60.13 ? 6   ILE E HG21 1  
ATOM 9566   H HG22 . ILE E 2 6   ? -0.594  22.109  -1.547  1.00 32.10 ? 6   ILE E HG22 1  
ATOM 9567   H HG23 . ILE E 2 6   ? -2.214  21.521  -1.918  1.00 61.11 ? 6   ILE E HG23 1  
ATOM 9568   H HD11 . ILE E 2 6   ? -4.289  21.624  -1.399  1.00 62.51 ? 6   ILE E HD11 1  
ATOM 9569   H HD12 . ILE E 2 6   ? -4.566  23.078  -2.362  1.00 44.13 ? 6   ILE E HD12 1  
ATOM 9570   H HD13 . ILE E 2 6   ? -5.598  22.725  -0.978  1.00 42.35 ? 6   ILE E HD13 1  
ATOM 9571   N N    . ALA E 2 7   ? -2.087  24.400  2.358   1.00 33.10 ? 7   ALA E N    1  
ATOM 9572   C CA   . ALA E 2 7   ? -2.194  24.058  3.789   1.00 74.21 ? 7   ALA E CA   1  
ATOM 9573   C C    . ALA E 2 7   ? -3.593  24.411  4.325   1.00 61.42 ? 7   ALA E C    1  
ATOM 9574   O O    . ALA E 2 7   ? -4.334  25.183  3.699   1.00 4.33  ? 7   ALA E O    1  
ATOM 9575   C CB   . ALA E 2 7   ? -1.103  24.793  4.594   1.00 51.44 ? 7   ALA E CB   1  
ATOM 9576   H H    . ALA E 2 7   ? -2.602  25.168  2.031   1.00 1.25  ? 7   ALA E H    1  
ATOM 9577   H HA   . ALA E 2 7   ? -2.041  22.986  3.903   1.00 41.32 ? 7   ALA E HA   1  
ATOM 9578   H HB1  . ALA E 2 7   ? -1.244  25.863  4.512   1.00 32.42 ? 7   ALA E HB1  1  
ATOM 9579   H HB2  . ALA E 2 7   ? -0.128  24.534  4.199   1.00 71.43 ? 7   ALA E HB2  1  
ATOM 9580   H HB3  . ALA E 2 7   ? -1.149  24.502  5.636   1.00 73.24 ? 7   ALA E HB3  1  
ATOM 9581   N N    . LEU E 2 8   ? -3.943  23.829  5.486   1.00 64.30 ? 8   LEU E N    1  
ATOM 9582   C CA   . LEU E 2 8   ? -5.192  24.142  6.215   1.00 64.11 ? 8   LEU E CA   1  
ATOM 9583   C C    . LEU E 2 8   ? -5.030  25.425  7.056   1.00 5.41  ? 8   LEU E C    1  
ATOM 9584   O O    . LEU E 2 8   ? -3.964  26.053  7.074   1.00 75.20 ? 8   LEU E O    1  
ATOM 9585   C CB   . LEU E 2 8   ? -5.604  22.950  7.141   1.00 43.35 ? 8   LEU E CB   1  
ATOM 9586   C CG   . LEU E 2 8   ? -6.086  21.649  6.431   1.00 2.42  ? 8   LEU E CG   1  
ATOM 9587   C CD1  . LEU E 2 8   ? -6.428  20.546  7.456   1.00 41.35 ? 8   LEU E CD1  1  
ATOM 9588   C CD2  . LEU E 2 8   ? -7.284  21.930  5.500   1.00 23.22 ? 8   LEU E CD2  1  
ATOM 9589   H H    . LEU E 2 8   ? -3.331  23.174  5.875   1.00 64.10 ? 8   LEU E H    1  
ATOM 9590   H HA   . LEU E 2 8   ? -5.978  24.307  5.487   1.00 75.32 ? 8   LEU E HA   1  
ATOM 9591   H HB2  . LEU E 2 8   ? -4.749  22.699  7.765   1.00 14.11 ? 8   LEU E HB2  1  
ATOM 9592   H HB3  . LEU E 2 8   ? -6.403  23.287  7.797   1.00 55.54 ? 8   LEU E HB3  1  
ATOM 9593   H HG   . LEU E 2 8   ? -5.279  21.271  5.815   1.00 14.53 ? 8   LEU E HG   1  
ATOM 9594   H HD11 . LEU E 2 8   ? -6.746  19.652  6.936   1.00 32.01 ? 8   LEU E HD11 1  
ATOM 9595   H HD12 . LEU E 2 8   ? -7.223  20.880  8.111   1.00 63.12 ? 8   LEU E HD12 1  
ATOM 9596   H HD13 . LEU E 2 8   ? -5.551  20.318  8.047   1.00 54.35 ? 8   LEU E HD13 1  
ATOM 9597   H HD21 . LEU E 2 8   ? -6.999  22.659  4.753   1.00 30.54 ? 8   LEU E HD21 1  
ATOM 9598   H HD22 . LEU E 2 8   ? -8.119  22.314  6.071   1.00 32.44 ? 8   LEU E HD22 1  
ATOM 9599   H HD23 . LEU E 2 8   ? -7.582  21.016  5.002   1.00 1.52  ? 8   LEU E HD23 1  
ATOM 9600   N N    . ALA E 2 9   ? -6.108  25.783  7.755   1.00 11.33 ? 9   ALA E N    1  
ATOM 9601   C CA   . ALA E 2 9   ? -6.143  26.900  8.713   1.00 74.13 ? 9   ALA E CA   1  
ATOM 9602   C C    . ALA E 2 9   ? -6.884  26.444  9.975   1.00 14.42 ? 9   ALA E C    1  
ATOM 9603   O O    . ALA E 2 9   ? -7.417  25.323  10.002  1.00 44.31 ? 9   ALA E O    1  
ATOM 9604   C CB   . ALA E 2 9   ? -6.823  28.128  8.074   1.00 63.52 ? 9   ALA E CB   1  
ATOM 9605   H H    . ALA E 2 9   ? -6.930  25.263  7.633   1.00 65.42 ? 9   ALA E H    1  
ATOM 9606   H HA   . ALA E 2 9   ? -5.123  27.169  8.983   1.00 15.25 ? 9   ALA E HA   1  
ATOM 9607   H HB1  . ALA E 2 9   ? -6.835  28.949  8.781   1.00 53.05 ? 9   ALA E HB1  1  
ATOM 9608   H HB2  . ALA E 2 9   ? -7.839  27.882  7.795   1.00 51.14 ? 9   ALA E HB2  1  
ATOM 9609   H HB3  . ALA E 2 9   ? -6.275  28.430  7.190   1.00 43.53 ? 9   ALA E HB3  1  
ATOM 9610   N N    . LEU E 2 10  ? -6.922  27.314  11.005  1.00 13.14 ? 10  LEU E N    1  
ATOM 9611   C CA   . LEU E 2 10  ? -7.646  27.045  12.265  1.00 11.41 ? 10  LEU E CA   1  
ATOM 9612   C C    . LEU E 2 10  ? -9.120  26.733  11.985  1.00 72.21 ? 10  LEU E C    1  
ATOM 9613   O O    . LEU E 2 10  ? -9.777  27.477  11.245  1.00 31.30 ? 10  LEU E O    1  
ATOM 9614   C CB   . LEU E 2 10  ? -7.537  28.256  13.235  1.00 45.41 ? 10  LEU E CB   1  
ATOM 9615   C CG   . LEU E 2 10  ? -6.120  28.538  13.820  1.00 21.44 ? 10  LEU E CG   1  
ATOM 9616   C CD1  . LEU E 2 10  ? -6.118  29.816  14.697  1.00 63.12 ? 10  LEU E CD1  1  
ATOM 9617   C CD2  . LEU E 2 10  ? -5.596  27.309  14.601  1.00 35.10 ? 10  LEU E CD2  1  
ATOM 9618   H H    . LEU E 2 10  ? -6.454  28.169  10.911  1.00 73.40 ? 10  LEU E H    1  
ATOM 9619   H HA   . LEU E 2 10  ? -7.183  26.179  12.731  1.00 13.25 ? 10  LEU E HA   1  
ATOM 9620   H HB2  . LEU E 2 10  ? -7.866  29.141  12.701  1.00 34.04 ? 10  LEU E HB2  1  
ATOM 9621   H HB3  . LEU E 2 10  ? -8.218  28.095  14.068  1.00 72.42 ? 10  LEU E HB3  1  
ATOM 9622   H HG   . LEU E 2 10  ? -5.436  28.716  12.999  1.00 30.35 ? 10  LEU E HG   1  
ATOM 9623   H HD11 . LEU E 2 10  ? -5.116  30.008  15.057  1.00 31.32 ? 10  LEU E HD11 1  
ATOM 9624   H HD12 . LEU E 2 10  ? -6.783  29.689  15.542  1.00 24.54 ? 10  LEU E HD12 1  
ATOM 9625   H HD13 . LEU E 2 10  ? -6.450  30.660  14.106  1.00 25.11 ? 10  LEU E HD13 1  
ATOM 9626   H HD21 . LEU E 2 10  ? -6.255  27.086  15.432  1.00 65.33 ? 10  LEU E HD21 1  
ATOM 9627   H HD22 . LEU E 2 10  ? -4.603  27.514  14.978  1.00 43.01 ? 10  LEU E HD22 1  
ATOM 9628   H HD23 . LEU E 2 10  ? -5.548  26.452  13.941  1.00 2.41  ? 10  LEU E HD23 1  
ATOM 9629   N N    . LEU E 2 11  ? -9.605  25.617  12.566  1.00 51.42 ? 11  LEU E N    1  
ATOM 9630   C CA   . LEU E 2 11  ? -10.997 25.168  12.429  1.00 71.22 ? 11  LEU E CA   1  
ATOM 9631   C C    . LEU E 2 11  ? -11.941 26.231  13.045  1.00 4.41  ? 11  LEU E C    1  
ATOM 9632   O O    . LEU E 2 11  ? -11.941 26.400  14.272  1.00 21.45 ? 11  LEU E O    1  
ATOM 9633   C CB   . LEU E 2 11  ? -11.181 23.779  13.114  1.00 40.34 ? 11  LEU E CB   1  
ATOM 9634   C CG   . LEU E 2 11  ? -10.224 22.641  12.619  1.00 13.22 ? 11  LEU E CG   1  
ATOM 9635   C CD1  . LEU E 2 11  ? -10.432 21.337  13.426  1.00 22.03 ? 11  LEU E CD1  1  
ATOM 9636   C CD2  . LEU E 2 11  ? -10.372 22.398  11.095  1.00 13.53 ? 11  LEU E CD2  1  
ATOM 9637   H H    . LEU E 2 11  ? -8.996  25.080  13.110  1.00 74.34 ? 11  LEU E H    1  
ATOM 9638   H HA   . LEU E 2 11  ? -11.207 25.065  11.368  1.00 13.14 ? 11  LEU E HA   1  
ATOM 9639   H HB2  . LEU E 2 11  ? -11.031 23.905  14.181  1.00 74.15 ? 11  LEU E HB2  1  
ATOM 9640   H HB3  . LEU E 2 11  ? -12.203 23.450  12.955  1.00 41.33 ? 11  LEU E HB3  1  
ATOM 9641   H HG   . LEU E 2 11  ? -9.202  22.955  12.794  1.00 45.11 ? 11  LEU E HG   1  
ATOM 9642   H HD11 . LEU E 2 11  ? -10.243 21.529  14.475  1.00 24.53 ? 11  LEU E HD11 1  
ATOM 9643   H HD12 . LEU E 2 11  ? -9.747  20.578  13.079  1.00 65.15 ? 11  LEU E HD12 1  
ATOM 9644   H HD13 . LEU E 2 11  ? -11.450 20.984  13.306  1.00 52.40 ? 11  LEU E HD13 1  
ATOM 9645   H HD21 . LEU E 2 11  ? -10.128 23.307  10.559  1.00 3.03  ? 11  LEU E HD21 1  
ATOM 9646   H HD22 . LEU E 2 11  ? -11.389 22.109  10.860  1.00 21.23 ? 11  LEU E HD22 1  
ATOM 9647   H HD23 . LEU E 2 11  ? -9.697  21.613  10.783  1.00 22.50 ? 11  LEU E HD23 1  
ATOM 9648   N N    . PRO E 2 12  ? -12.729 26.989  12.198  1.00 15.13 ? 12  PRO E N    1  
ATOM 9649   C CA   . PRO E 2 12  ? -13.543 28.147  12.644  1.00 24.53 ? 12  PRO E CA   1  
ATOM 9650   C C    . PRO E 2 12  ? -14.847 27.699  13.340  1.00 24.04 ? 12  PRO E C    1  
ATOM 9651   O O    . PRO E 2 12  ? -15.958 27.906  12.828  1.00 22.01 ? 12  PRO E O    1  
ATOM 9652   C CB   . PRO E 2 12  ? -13.808 28.938  11.313  1.00 43.42 ? 12  PRO E CB   1  
ATOM 9653   C CG   . PRO E 2 12  ? -13.054 28.197  10.236  1.00 72.14 ? 12  PRO E CG   1  
ATOM 9654   C CD   . PRO E 2 12  ? -12.904 26.782  10.740  1.00 10.42 ? 12  PRO E CD   1  
ATOM 9655   H HA   . PRO E 2 12  ? -12.983 28.774  13.334  1.00 63.33 ? 12  PRO E HA   1  
ATOM 9656   H HB2  . PRO E 2 12  ? -14.876 28.962  11.089  1.00 64.45 ? 12  PRO E HB2  1  
ATOM 9657   H HB3  . PRO E 2 12  ? -13.439 29.955  11.398  1.00 10.12 ? 12  PRO E HB3  1  
ATOM 9658   H HG2  . PRO E 2 12  ? -13.614 28.214  9.306   1.00 11.35 ? 12  PRO E HG2  1  
ATOM 9659   H HG3  . PRO E 2 12  ? -12.074 28.642  10.085  1.00 32.35 ? 12  PRO E HG3  1  
ATOM 9660   H HD2  . PRO E 2 12  ? -13.795 26.196  10.532  1.00 64.13 ? 12  PRO E HD2  1  
ATOM 9661   H HD3  . PRO E 2 12  ? -12.032 26.309  10.303  1.00 55.42 ? 12  PRO E HD3  1  
ATOM 9662   N N    . LEU E 2 13  ? -14.670 27.095  14.518  1.00 2.33  ? 13  LEU E N    1  
ATOM 9663   C CA   . LEU E 2 13  ? -15.747 26.517  15.328  1.00 24.11 ? 13  LEU E CA   1  
ATOM 9664   C C    . LEU E 2 13  ? -15.122 26.023  16.637  1.00 41.12 ? 13  LEU E C    1  
ATOM 9665   O O    . LEU E 2 13  ? -15.604 26.362  17.726  1.00 22.30 ? 13  LEU E O    1  
ATOM 9666   C CB   . LEU E 2 13  ? -16.480 25.349  14.571  1.00 62.31 ? 13  LEU E CB   1  
ATOM 9667   C CG   . LEU E 2 13  ? -17.902 24.914  15.104  1.00 41.11 ? 13  LEU E CG   1  
ATOM 9668   C CD1  . LEU E 2 13  ? -18.687 24.146  14.016  1.00 65.24 ? 13  LEU E CD1  1  
ATOM 9669   C CD2  . LEU E 2 13  ? -17.828 24.072  16.408  1.00 14.54 ? 13  LEU E CD2  1  
ATOM 9670   H H    . LEU E 2 13  ? -13.759 27.063  14.880  1.00 11.35 ? 13  LEU E H    1  
ATOM 9671   H HA   . LEU E 2 13  ? -16.459 27.308  15.547  1.00 41.44 ? 13  LEU E HA   1  
ATOM 9672   H HB2  . LEU E 2 13  ? -16.595 25.664  13.537  1.00 2.22  ? 13  LEU E HB2  1  
ATOM 9673   H HB3  . LEU E 2 13  ? -15.834 24.478  14.572  1.00 3.43  ? 13  LEU E HB3  1  
ATOM 9674   H HG   . LEU E 2 13  ? -18.475 25.806  15.329  1.00 3.23  ? 13  LEU E HG   1  
ATOM 9675   H HD11 . LEU E 2 13  ? -18.169 23.228  13.760  1.00 55.54 ? 13  LEU E HD11 1  
ATOM 9676   H HD12 . LEU E 2 13  ? -18.776 24.762  13.132  1.00 42.44 ? 13  LEU E HD12 1  
ATOM 9677   H HD13 . LEU E 2 13  ? -19.678 23.908  14.379  1.00 10.42 ? 13  LEU E HD13 1  
ATOM 9678   H HD21 . LEU E 2 13  ? -18.826 23.808  16.730  1.00 0.33  ? 13  LEU E HD21 1  
ATOM 9679   H HD22 . LEU E 2 13  ? -17.351 24.654  17.187  1.00 12.03 ? 13  LEU E HD22 1  
ATOM 9680   H HD23 . LEU E 2 13  ? -17.254 23.170  16.236  1.00 53.35 ? 13  LEU E HD23 1  
ATOM 9681   N N    . LEU E 2 14  ? -14.015 25.246  16.490  1.00 4.41  ? 14  LEU E N    1  
ATOM 9682   C CA   . LEU E 2 14  ? -13.368 24.502  17.590  1.00 13.25 ? 14  LEU E CA   1  
ATOM 9683   C C    . LEU E 2 14  ? -14.381 23.503  18.186  1.00 24.45 ? 14  LEU E C    1  
ATOM 9684   O O    . LEU E 2 14  ? -15.156 23.848  19.089  1.00 53.12 ? 14  LEU E O    1  
ATOM 9685   C CB   . LEU E 2 14  ? -12.772 25.458  18.672  1.00 73.04 ? 14  LEU E CB   1  
ATOM 9686   C CG   . LEU E 2 14  ? -12.138 24.783  19.937  1.00 74.15 ? 14  LEU E CG   1  
ATOM 9687   C CD1  . LEU E 2 14  ? -10.957 23.861  19.567  1.00 33.22 ? 14  LEU E CD1  1  
ATOM 9688   C CD2  . LEU E 2 14  ? -11.724 25.846  20.981  1.00 63.31 ? 14  LEU E CD2  1  
ATOM 9689   H H    . LEU E 2 14  ? -13.623 25.173  15.597  1.00 32.44 ? 14  LEU E H    1  
ATOM 9690   H HA   . LEU E 2 14  ? -12.555 23.936  17.141  1.00 20.51 ? 14  LEU E HA   1  
ATOM 9691   H HB2  . LEU E 2 14  ? -12.013 26.071  18.196  1.00 74.44 ? 14  LEU E HB2  1  
ATOM 9692   H HB3  . LEU E 2 14  ? -13.570 26.116  19.004  1.00 35.02 ? 14  LEU E HB3  1  
ATOM 9693   H HG   . LEU E 2 14  ? -12.889 24.154  20.400  1.00 23.02 ? 14  LEU E HG   1  
ATOM 9694   H HD11 . LEU E 2 14  ? -10.165 24.437  19.102  1.00 4.43  ? 14  LEU E HD11 1  
ATOM 9695   H HD12 . LEU E 2 14  ? -11.293 23.098  18.876  1.00 72.33 ? 14  LEU E HD12 1  
ATOM 9696   H HD13 . LEU E 2 14  ? -10.575 23.381  20.458  1.00 31.43 ? 14  LEU E HD13 1  
ATOM 9697   H HD21 . LEU E 2 14  ? -12.591 26.434  21.259  1.00 63.42 ? 14  LEU E HD21 1  
ATOM 9698   H HD22 . LEU E 2 14  ? -10.968 26.499  20.564  1.00 10.31 ? 14  LEU E HD22 1  
ATOM 9699   H HD23 . LEU E 2 14  ? -11.331 25.359  21.864  1.00 72.23 ? 14  LEU E HD23 1  
ATOM 9700   N N    . PHE E 2 15  ? -14.408 22.285  17.619  1.00 50.22 ? 15  PHE E N    1  
ATOM 9701   C CA   . PHE E 2 15  ? -15.416 21.278  17.971  1.00 2.10  ? 15  PHE E CA   1  
ATOM 9702   C C    . PHE E 2 15  ? -15.199 20.775  19.409  1.00 14.32 ? 15  PHE E C    1  
ATOM 9703   O O    . PHE E 2 15  ? -14.062 20.547  19.826  1.00 40.21 ? 15  PHE E O    1  
ATOM 9704   C CB   . PHE E 2 15  ? -15.430 20.112  16.943  1.00 74.10 ? 15  PHE E CB   1  
ATOM 9705   C CG   . PHE E 2 15  ? -14.162 19.241  16.865  1.00 32.24 ? 15  PHE E CG   1  
ATOM 9706   C CD1  . PHE E 2 15  ? -14.051 18.066  17.618  1.00 51.03 ? 15  PHE E CD1  1  
ATOM 9707   C CD2  . PHE E 2 15  ? -13.097 19.577  16.020  1.00 64.02 ? 15  PHE E CD2  1  
ATOM 9708   C CE1  . PHE E 2 15  ? -12.929 17.266  17.535  1.00 32.13 ? 15  PHE E CE1  1  
ATOM 9709   C CE2  . PHE E 2 15  ? -11.973 18.773  15.941  1.00 31.21 ? 15  PHE E CE2  1  
ATOM 9710   C CZ   . PHE E 2 15  ? -11.891 17.619  16.698  1.00 52.13 ? 15  PHE E CZ   1  
ATOM 9711   H H    . PHE E 2 15  ? -13.720 22.054  16.964  1.00 75.22 ? 15  PHE E H    1  
ATOM 9712   H HA   . PHE E 2 15  ? -16.385 21.776  17.927  1.00 52.44 ? 15  PHE E HA   1  
ATOM 9713   H HB2  . PHE E 2 15  ? -16.264 19.458  17.173  1.00 13.54 ? 15  PHE E HB2  1  
ATOM 9714   H HB3  . PHE E 2 15  ? -15.602 20.531  15.955  1.00 40.33 ? 15  PHE E HB3  1  
ATOM 9715   H HD1  . PHE E 2 15  ? -14.861 17.782  18.278  1.00 73.04 ? 15  PHE E HD1  1  
ATOM 9716   H HD2  . PHE E 2 15  ? -13.150 20.478  15.422  1.00 12.22 ? 15  PHE E HD2  1  
ATOM 9717   H HE1  . PHE E 2 15  ? -12.861 16.362  18.126  1.00 32.02 ? 15  PHE E HE1  1  
ATOM 9718   H HE2  . PHE E 2 15  ? -11.156 19.048  15.287  1.00 43.13 ? 15  PHE E HE2  1  
ATOM 9719   H HZ   . PHE E 2 15  ? -11.011 16.991  16.633  1.00 54.12 ? 15  PHE E HZ   1  
ATOM 9720   N N    . THR E 2 16  ? -16.304 20.651  20.162  1.00 41.42 ? 16  THR E N    1  
ATOM 9721   C CA   . THR E 2 16  ? -16.305 20.185  21.562  1.00 31.44 ? 16  THR E CA   1  
ATOM 9722   C C    . THR E 2 16  ? -17.412 19.113  21.744  1.00 22.13 ? 16  THR E C    1  
ATOM 9723   O O    . THR E 2 16  ? -18.528 19.423  22.174  1.00 51.31 ? 16  THR E O    1  
ATOM 9724   C CB   . THR E 2 16  ? -16.470 21.392  22.564  1.00 41.41 ? 16  THR E CB   1  
ATOM 9725   O OG1  . THR E 2 16  ? -17.479 22.293  22.080  1.00 75.43 ? 16  THR E OG1  1  
ATOM 9726   C CG2  . THR E 2 16  ? -15.153 22.174  22.768  1.00 31.44 ? 16  THR E CG2  1  
ATOM 9727   H H    . THR E 2 16  ? -17.170 20.880  19.755  1.00 21.04 ? 16  THR E H    1  
ATOM 9728   H HA   . THR E 2 16  ? -15.350 19.706  21.764  1.00 13.33 ? 16  THR E HA   1  
ATOM 9729   H HB   . THR E 2 16  ? -16.791 21.006  23.529  1.00 45.41 ? 16  THR E HB   1  
ATOM 9730   H HG1  . THR E 2 16  ? -17.079 22.914  21.463  1.00 64.22 ? 16  THR E HG1  1  
ATOM 9731   H HG21 . THR E 2 16  ? -14.394 21.517  23.177  1.00 63.23 ? 16  THR E HG21 1  
ATOM 9732   H HG22 . THR E 2 16  ? -15.315 22.996  23.454  1.00 71.01 ? 16  THR E HG22 1  
ATOM 9733   H HG23 . THR E 2 16  ? -14.809 22.567  21.819  1.00 4.15  ? 16  THR E HG23 1  
ATOM 9734   N N    . PRO E 2 17  ? -17.119 17.824  21.363  1.00 42.52 ? 17  PRO E N    1  
ATOM 9735   C CA   . PRO E 2 17  ? -18.115 16.721  21.409  1.00 21.22 ? 17  PRO E CA   1  
ATOM 9736   C C    . PRO E 2 17  ? -18.318 16.151  22.828  1.00 61.11 ? 17  PRO E C    1  
ATOM 9737   O O    . PRO E 2 17  ? -19.368 15.571  23.133  1.00 71.53 ? 17  PRO E O    1  
ATOM 9738   C CB   . PRO E 2 17  ? -17.482 15.671  20.473  1.00 41.42 ? 17  PRO E CB   1  
ATOM 9739   C CG   . PRO E 2 17  ? -16.005 15.860  20.630  1.00 13.52 ? 17  PRO E CG   1  
ATOM 9740   C CD   . PRO E 2 17  ? -15.800 17.345  20.840  1.00 20.44 ? 17  PRO E CD   1  
ATOM 9741   H HA   . PRO E 2 17  ? -19.074 17.036  21.009  1.00 50.31 ? 17  PRO E HA   1  
ATOM 9742   H HB2  . PRO E 2 17  ? -17.790 14.666  20.757  1.00 22.22 ? 17  PRO E HB2  1  
ATOM 9743   H HB3  . PRO E 2 17  ? -17.775 15.864  19.448  1.00 54.35 ? 17  PRO E HB3  1  
ATOM 9744   H HG2  . PRO E 2 17  ? -15.651 15.297  21.493  1.00 43.14 ? 17  PRO E HG2  1  
ATOM 9745   H HG3  . PRO E 2 17  ? -15.484 15.530  19.737  1.00 33.53 ? 17  PRO E HG3  1  
ATOM 9746   H HD2  . PRO E 2 17  ? -15.010 17.524  21.562  1.00 62.15 ? 17  PRO E HD2  1  
ATOM 9747   H HD3  . PRO E 2 17  ? -15.560 17.836  19.901  1.00 2.33  ? 17  PRO E HD3  1  
ATOM 9748   N N    . VAL E 2 18  ? -17.298 16.328  23.677  1.00 1.13  ? 18  VAL E N    1  
ATOM 9749   C CA   . VAL E 2 18  ? -17.276 15.795  25.042  1.00 62.34 ? 18  VAL E CA   1  
ATOM 9750   C C    . VAL E 2 18  ? -18.041 16.743  25.968  1.00 23.53 ? 18  VAL E C    1  
ATOM 9751   O O    . VAL E 2 18  ? -17.995 17.966  25.786  1.00 71.31 ? 18  VAL E O    1  
ATOM 9752   C CB   . VAL E 2 18  ? -15.796 15.615  25.543  1.00 25.32 ? 18  VAL E CB   1  
ATOM 9753   C CG1  . VAL E 2 18  ? -15.721 15.059  26.986  1.00 45.42 ? 18  VAL E CG1  1  
ATOM 9754   C CG2  . VAL E 2 18  ? -14.995 14.732  24.558  1.00 53.04 ? 18  VAL E CG2  1  
ATOM 9755   H H    . VAL E 2 18  ? -16.539 16.866  23.383  1.00 2.15  ? 18  VAL E H    1  
ATOM 9756   H HA   . VAL E 2 18  ? -17.761 14.818  25.038  1.00 53.44 ? 18  VAL E HA   1  
ATOM 9757   H HB   . VAL E 2 18  ? -15.330 16.597  25.551  1.00 43.31 ? 18  VAL E HB   1  
ATOM 9758   H HG11 . VAL E 2 18  ? -14.686 14.960  27.291  1.00 1.33  ? 18  VAL E HG11 1  
ATOM 9759   H HG12 . VAL E 2 18  ? -16.199 14.092  27.031  1.00 10.35 ? 18  VAL E HG12 1  
ATOM 9760   H HG13 . VAL E 2 18  ? -16.227 15.736  27.664  1.00 24.12 ? 18  VAL E HG13 1  
ATOM 9761   H HG21 . VAL E 2 18  ? -15.006 15.183  23.573  1.00 63.33 ? 18  VAL E HG21 1  
ATOM 9762   H HG22 . VAL E 2 18  ? -15.438 13.748  24.504  1.00 2.34  ? 18  VAL E HG22 1  
ATOM 9763   H HG23 . VAL E 2 18  ? -13.968 14.642  24.895  1.00 32.41 ? 18  VAL E HG23 1  
ATOM 9764   N N    . THR E 2 19  ? -18.744 16.160  26.944  1.00 53.14 ? 19  THR E N    1  
ATOM 9765   C CA   . THR E 2 19  ? -19.477 16.897  27.972  1.00 40.12 ? 19  THR E CA   1  
ATOM 9766   C C    . THR E 2 19  ? -18.499 17.628  28.917  1.00 43.11 ? 19  THR E C    1  
ATOM 9767   O O    . THR E 2 19  ? -17.351 17.197  29.088  1.00 40.15 ? 19  THR E O    1  
ATOM 9768   C CB   . THR E 2 19  ? -20.399 15.915  28.769  1.00 61.43 ? 19  THR E CB   1  
ATOM 9769   O OG1  . THR E 2 19  ? -19.628 14.797  29.248  1.00 4.45  ? 19  THR E OG1  1  
ATOM 9770   C CG2  . THR E 2 19  ? -21.560 15.394  27.896  1.00 63.55 ? 19  THR E CG2  1  
ATOM 9771   H H    . THR E 2 19  ? -18.754 15.184  26.989  1.00 71.20 ? 19  THR E H    1  
ATOM 9772   H HA   . THR E 2 19  ? -20.106 17.634  27.475  1.00 52.44 ? 19  THR E HA   1  
ATOM 9773   H HB   . THR E 2 19  ? -20.817 16.437  29.625  1.00 22.22 ? 19  THR E HB   1  
ATOM 9774   H HG1  . THR E 2 19  ? -20.207 14.186  29.717  1.00 54.44 ? 19  THR E HG1  1  
ATOM 9775   H HG21 . THR E 2 19  ? -22.151 16.229  27.540  1.00 73.35 ? 19  THR E HG21 1  
ATOM 9776   H HG22 . THR E 2 19  ? -22.192 14.738  28.481  1.00 61.12 ? 19  THR E HG22 1  
ATOM 9777   H HG23 . THR E 2 19  ? -21.165 14.848  27.050  1.00 35.13 ? 19  THR E HG23 1  
ATOM 9778   N N    . LYS E 2 20  ? -18.973 18.754  29.485  1.00 64.02 ? 20  LYS E N    1  
ATOM 9779   C CA   . LYS E 2 20  ? -18.211 19.611  30.422  1.00 71.05 ? 20  LYS E CA   1  
ATOM 9780   C C    . LYS E 2 20  ? -17.027 20.338  29.739  1.00 2.23  ? 20  LYS E C    1  
ATOM 9781   O O    . LYS E 2 20  ? -16.166 20.895  30.420  1.00 2.21  ? 20  LYS E O    1  
ATOM 9782   C CB   . LYS E 2 20  ? -17.749 18.806  31.680  1.00 73.24 ? 20  LYS E CB   1  
ATOM 9783   C CG   . LYS E 2 20  ? -18.907 18.178  32.494  1.00 71.24 ? 20  LYS E CG   1  
ATOM 9784   C CD   . LYS E 2 20  ? -19.860 19.228  33.147  1.00 20.55 ? 20  LYS E CD   1  
ATOM 9785   C CE   . LYS E 2 20  ? -19.374 19.742  34.522  1.00 5.53  ? 20  LYS E CE   1  
ATOM 9786   N NZ   . LYS E 2 20  ? -18.026 20.373  34.481  1.00 45.21 ? 20  LYS E NZ   1  
ATOM 9787   H H    . LYS E 2 20  ? -19.890 19.022  29.268  1.00 42.42 ? 20  LYS E H    1  
ATOM 9788   H HA   . LYS E 2 20  ? -18.899 20.379  30.753  1.00 21.25 ? 20  LYS E HA   1  
ATOM 9789   H HB2  . LYS E 2 20  ? -17.089 18.007  31.358  1.00 23.54 ? 20  LYS E HB2  1  
ATOM 9790   H HB3  . LYS E 2 20  ? -17.190 19.464  32.338  1.00 23.21 ? 20  LYS E HB3  1  
ATOM 9791   H HG2  . LYS E 2 20  ? -19.488 17.551  31.829  1.00 55.21 ? 20  LYS E HG2  1  
ATOM 9792   H HG3  . LYS E 2 20  ? -18.486 17.553  33.275  1.00 24.20 ? 20  LYS E HG3  1  
ATOM 9793   H HD2  . LYS E 2 20  ? -19.961 20.077  32.483  1.00 4.24  ? 20  LYS E HD2  1  
ATOM 9794   H HD3  . LYS E 2 20  ? -20.840 18.775  33.277  1.00 10.21 ? 20  LYS E HD3  1  
ATOM 9795   H HE2  . LYS E 2 20  ? -20.078 20.474  34.891  1.00 74.13 ? 20  LYS E HE2  1  
ATOM 9796   H HE3  . LYS E 2 20  ? -19.343 18.907  35.214  1.00 20.42 ? 20  LYS E HE3  1  
ATOM 9797   H HZ1  . LYS E 2 20  ? -18.003 21.129  33.775  1.00 63.11 ? 20  LYS E HZ1  1  
ATOM 9798   H HZ2  . LYS E 2 20  ? -17.305 19.664  34.239  1.00 50.30 ? 20  LYS E HZ2  1  
ATOM 9799   H HZ3  . LYS E 2 20  ? -17.791 20.776  35.409  1.00 13.45 ? 20  LYS E HZ3  1  
ATOM 9800   N N    . ALA E 2 21  ? -17.024 20.391  28.393  1.00 3.24  ? 21  ALA E N    1  
ATOM 9801   C CA   . ALA E 2 21  ? -15.984 21.099  27.612  1.00 5.22  ? 21  ALA E CA   1  
ATOM 9802   C C    . ALA E 2 21  ? -16.414 22.561  27.359  1.00 53.12 ? 21  ALA E C    1  
ATOM 9803   O O    . ALA E 2 21  ? -16.377 23.045  26.218  1.00 13.24 ? 21  ALA E O    1  
ATOM 9804   C CB   . ALA E 2 21  ? -15.707 20.339  26.294  1.00 52.14 ? 21  ALA E CB   1  
ATOM 9805   H H    . ALA E 2 21  ? -17.750 19.952  27.905  1.00 62.10 ? 21  ALA E H    1  
ATOM 9806   H HA   . ALA E 2 21  ? -15.063 21.111  28.194  1.00 3.41  ? 21  ALA E HA   1  
ATOM 9807   H HB1  . ALA E 2 21  ? -15.407 19.322  26.515  1.00 14.32 ? 21  ALA E HB1  1  
ATOM 9808   H HB2  . ALA E 2 21  ? -14.914 20.830  25.744  1.00 41.43 ? 21  ALA E HB2  1  
ATOM 9809   H HB3  . ALA E 2 21  ? -16.603 20.321  25.686  1.00 22.32 ? 21  ALA E HB3  1  
ATOM 9810   N N    . ARG E 2 22  ? -16.798 23.253  28.457  1.00 33.43 ? 22  ARG E N    1  
ATOM 9811   C CA   . ARG E 2 22  ? -17.272 24.653  28.433  1.00 2.35  ? 22  ARG E CA   1  
ATOM 9812   C C    . ARG E 2 22  ? -16.180 25.585  27.876  1.00 3.35  ? 22  ARG E C    1  
ATOM 9813   O O    . ARG E 2 22  ? -15.038 25.553  28.342  1.00 12.12 ? 22  ARG E O    1  
ATOM 9814   C CB   . ARG E 2 22  ? -17.667 25.109  29.871  1.00 2.41  ? 22  ARG E CB   1  
ATOM 9815   C CG   . ARG E 2 22  ? -18.300 26.524  29.974  1.00 4.03  ? 22  ARG E CG   1  
ATOM 9816   C CD   . ARG E 2 22  ? -19.694 26.610  29.324  1.00 41.24 ? 22  ARG E CD   1  
ATOM 9817   N NE   . ARG E 2 22  ? -20.280 27.965  29.433  1.00 73.13 ? 22  ARG E NE   1  
ATOM 9818   C CZ   . ARG E 2 22  ? -21.472 28.265  29.985  1.00 4.12  ? 22  ARG E CZ   1  
ATOM 9819   N NH1  . ARG E 2 22  ? -22.244 27.321  30.508  1.00 53.20 ? 22  ARG E NH1  1  
ATOM 9820   N NH2  . ARG E 2 22  ? -21.883 29.521  30.011  1.00 33.02 ? 22  ARG E NH2  1  
ATOM 9821   H H    . ARG E 2 22  ? -16.753 22.802  29.324  1.00 23.54 ? 22  ARG E H    1  
ATOM 9822   H HA   . ARG E 2 22  ? -18.149 24.697  27.794  1.00 73.40 ? 22  ARG E HA   1  
ATOM 9823   H HB2  . ARG E 2 22  ? -18.380 24.398  30.274  1.00 54.20 ? 22  ARG E HB2  1  
ATOM 9824   H HB3  . ARG E 2 22  ? -16.781 25.086  30.499  1.00 23.40 ? 22  ARG E HB3  1  
ATOM 9825   H HG2  . ARG E 2 22  ? -18.393 26.792  31.021  1.00 33.15 ? 22  ARG E HG2  1  
ATOM 9826   H HG3  . ARG E 2 22  ? -17.643 27.236  29.488  1.00 12.22 ? 22  ARG E HG3  1  
ATOM 9827   H HD2  . ARG E 2 22  ? -19.608 26.358  28.275  1.00 10.43 ? 22  ARG E HD2  1  
ATOM 9828   H HD3  . ARG E 2 22  ? -20.354 25.895  29.807  1.00 63.34 ? 22  ARG E HD3  1  
ATOM 9829   H HE   . ARG E 2 22  ? -19.738 28.704  29.075  1.00 73.31 ? 22  ARG E HE   1  
ATOM 9830   H HH11 . ARG E 2 22  ? -21.947 26.365  30.495  1.00 50.21 ? 22  ARG E HH11 1  
ATOM 9831   H HH12 . ARG E 2 22  ? -23.130 27.559  30.912  1.00 34.23 ? 22  ARG E HH12 1  
ATOM 9832   H HH21 . ARG E 2 22  ? -21.307 30.247  29.626  1.00 4.04  ? 22  ARG E HH21 1  
ATOM 9833   H HH22 . ARG E 2 22  ? -22.769 29.756  30.419  1.00 64.30 ? 22  ARG E HH22 1  
ATOM 9834   N N    . THR E 2 23  ? -16.535 26.406  26.882  1.00 1.02  ? 23  THR E N    1  
ATOM 9835   C CA   . THR E 2 23  ? -15.614 27.379  26.275  1.00 23.44 ? 23  THR E CA   1  
ATOM 9836   C C    . THR E 2 23  ? -16.117 28.826  26.523  1.00 64.21 ? 23  THR E C    1  
ATOM 9837   O O    . THR E 2 23  ? -16.797 29.398  25.669  1.00 63.25 ? 23  THR E O    1  
ATOM 9838   C CB   . THR E 2 23  ? -15.425 27.078  24.744  1.00 35.42 ? 23  THR E CB   1  
ATOM 9839   O OG1  . THR E 2 23  ? -16.709 26.928  24.111  1.00 2.15  ? 23  THR E OG1  1  
ATOM 9840   C CG2  . THR E 2 23  ? -14.588 25.806  24.501  1.00 21.04 ? 23  THR E CG2  1  
ATOM 9841   H H    . THR E 2 23  ? -17.448 26.353  26.531  1.00 72.24 ? 23  THR E H    1  
ATOM 9842   H HA   . THR E 2 23  ? -14.642 27.283  26.755  1.00 32.04 ? 23  THR E HA   1  
ATOM 9843   H HB   . THR E 2 23  ? -14.913 27.918  24.283  1.00 62.43 ? 23  THR E HB   1  
ATOM 9844   H HG1  . THR E 2 23  ? -16.588 26.816  23.160  1.00 74.41 ? 23  THR E HG1  1  
ATOM 9845   H HG21 . THR E 2 23  ? -15.089 24.947  24.929  1.00 74.11 ? 23  THR E HG21 1  
ATOM 9846   H HG22 . THR E 2 23  ? -13.613 25.915  24.962  1.00 4.20  ? 23  THR E HG22 1  
ATOM 9847   H HG23 . THR E 2 23  ? -14.459 25.651  23.437  1.00 71.24 ? 23  THR E HG23 1  
ATOM 9848   N N    . PRO E 2 24  ? -15.827 29.439  27.723  1.00 20.30 ? 24  PRO E N    1  
ATOM 9849   C CA   . PRO E 2 24  ? -16.249 30.820  28.033  1.00 41.21 ? 24  PRO E CA   1  
ATOM 9850   C C    . PRO E 2 24  ? -15.370 31.862  27.302  1.00 25.42 ? 24  PRO E C    1  
ATOM 9851   O O    . PRO E 2 24  ? -14.202 32.065  27.658  1.00 31.31 ? 24  PRO E O    1  
ATOM 9852   C CB   . PRO E 2 24  ? -16.115 30.913  29.586  1.00 5.12  ? 24  PRO E CB   1  
ATOM 9853   C CG   . PRO E 2 24  ? -15.753 29.523  30.050  1.00 11.32 ? 24  PRO E CG   1  
ATOM 9854   C CD   . PRO E 2 24  ? -15.085 28.862  28.873  1.00 44.31 ? 24  PRO E CD   1  
ATOM 9855   H HA   . PRO E 2 24  ? -17.289 30.975  27.751  1.00 21.34 ? 24  PRO E HA   1  
ATOM 9856   H HB2  . PRO E 2 24  ? -15.338 31.628  29.861  1.00 31.41 ? 24  PRO E HB2  1  
ATOM 9857   H HB3  . PRO E 2 24  ? -17.055 31.220  30.028  1.00 60.04 ? 24  PRO E HB3  1  
ATOM 9858   H HG2  . PRO E 2 24  ? -15.075 29.573  30.899  1.00 2.14  ? 24  PRO E HG2  1  
ATOM 9859   H HG3  . PRO E 2 24  ? -16.648 28.972  30.325  1.00 12.11 ? 24  PRO E HG3  1  
ATOM 9860   H HD2  . PRO E 2 24  ? -14.030 29.122  28.827  1.00 31.23 ? 24  PRO E HD2  1  
ATOM 9861   H HD3  . PRO E 2 24  ? -15.204 27.787  28.918  1.00 43.40 ? 24  PRO E HD3  1  
ATOM 9862   N N    . GLU E 2 25  ? -15.934 32.469  26.251  1.00 21.31 ? 25  GLU E N    1  
ATOM 9863   C CA   . GLU E 2 25  ? -15.284 33.540  25.483  1.00 4.30  ? 25  GLU E CA   1  
ATOM 9864   C C    . GLU E 2 25  ? -15.443 34.884  26.239  1.00 53.42 ? 25  GLU E C    1  
ATOM 9865   O O    . GLU E 2 25  ? -16.583 35.389  26.342  1.00 62.11 ? 25  GLU E O    1  
ATOM 9866   C CB   . GLU E 2 25  ? -15.898 33.634  24.062  1.00 54.44 ? 25  GLU E CB   1  
ATOM 9867   C CG   . GLU E 2 25  ? -15.278 34.742  23.183  1.00 62.04 ? 25  GLU E CG   1  
ATOM 9868   C CD   . GLU E 2 25  ? -15.987 34.905  21.838  1.00 22.33 ? 25  GLU E CD   1  
ATOM 9869   O OE1  . GLU E 2 25  ? -15.427 34.510  20.794  1.00 21.54 ? 25  GLU E OE1  1  
ATOM 9870   O OE2  . GLU E 2 25  ? -17.128 35.419  21.820  1.00 45.31 ? 25  GLU E OE2  1  
ATOM 9871   O OXT  . GLU E 2 25  ? -14.443 35.414  26.756  1.00 37.61 ? 25  GLU E OXT  1  
ATOM 9872   H H    . GLU E 2 25  ? -16.832 32.197  25.987  1.00 64.24 ? 25  GLU E H    1  
ATOM 9873   H HA   . GLU E 2 25  ? -14.226 33.295  25.392  1.00 33.30 ? 25  GLU E HA   1  
ATOM 9874   H HB2  . GLU E 2 25  ? -15.760 32.682  23.559  1.00 3.32  ? 25  GLU E HB2  1  
ATOM 9875   H HB3  . GLU E 2 25  ? -16.962 33.825  24.154  1.00 15.53 ? 25  GLU E HB3  1  
ATOM 9876   H HG2  . GLU E 2 25  ? -15.334 35.685  23.720  1.00 43.34 ? 25  GLU E HG2  1  
ATOM 9877   H HG3  . GLU E 2 25  ? -14.232 34.507  23.012  1.00 20.14 ? 25  GLU E HG3  1  
ATOM 9878   N N    . MET F 2 1   ? -23.480 -8.260  5.883   1.00 35.32 ? 1   MET F N    1  
ATOM 9879   C CA   . MET F 2 1   ? -24.347 -9.393  6.278   1.00 2.34  ? 1   MET F CA   1  
ATOM 9880   C C    . MET F 2 1   ? -24.650 -10.265 5.056   1.00 0.32  ? 1   MET F C    1  
ATOM 9881   O O    . MET F 2 1   ? -25.237 -9.768  4.090   1.00 42.15 ? 1   MET F O    1  
ATOM 9882   C CB   . MET F 2 1   ? -25.661 -8.859  6.902   1.00 71.24 ? 1   MET F CB   1  
ATOM 9883   C CG   . MET F 2 1   ? -25.460 -8.045  8.184   1.00 23.51 ? 1   MET F CG   1  
ATOM 9884   S SD   . MET F 2 1   ? -26.957 -7.201  8.731   1.00 42.12 ? 1   MET F SD   1  
ATOM 9885   C CE   . MET F 2 1   ? -27.192 -5.994  7.416   1.00 23.42 ? 1   MET F CE   1  
ATOM 9886   H H1   . MET F 2 1   ? -23.285 -7.650  6.700   1.00 37.61 ? 1   MET F H1   1  
ATOM 9887   H H2   . MET F 2 1   ? -23.947 -7.698  5.150   1.00 37.61 ? 1   MET F H2   1  
ATOM 9888   H H3   . MET F 2 1   ? -22.581 -8.615  5.509   1.00 37.61 ? 1   MET F H3   1  
ATOM 9889   H HA   . MET F 2 1   ? -23.810 -9.979  7.017   1.00 52.10 ? 1   MET F HA   1  
ATOM 9890   H HB2  . MET F 2 1   ? -26.159 -8.227  6.177   1.00 13.23 ? 1   MET F HB2  1  
ATOM 9891   H HB3  . MET F 2 1   ? -26.309 -9.697  7.134   1.00 50.13 ? 1   MET F HB3  1  
ATOM 9892   H HG2  . MET F 2 1   ? -25.138 -8.708  8.976   1.00 60.42 ? 1   MET F HG2  1  
ATOM 9893   H HG3  . MET F 2 1   ? -24.688 -7.301  8.014   1.00 4.33  ? 1   MET F HG3  1  
ATOM 9894   H HE1  . MET F 2 1   ? -28.055 -5.386  7.640   1.00 62.11 ? 1   MET F HE1  1  
ATOM 9895   H HE2  . MET F 2 1   ? -27.347 -6.503  6.475   1.00 12.33 ? 1   MET F HE2  1  
ATOM 9896   H HE3  . MET F 2 1   ? -26.316 -5.363  7.344   1.00 70.33 ? 1   MET F HE3  1  
ATOM 9897   N N    . LYS F 2 2   ? -24.229 -11.550 5.107   1.00 3.31  ? 2   LYS F N    1  
ATOM 9898   C CA   . LYS F 2 2   ? -24.510 -12.547 4.053   1.00 52.50 ? 2   LYS F CA   1  
ATOM 9899   C C    . LYS F 2 2   ? -23.952 -13.911 4.504   1.00 33.43 ? 2   LYS F C    1  
ATOM 9900   O O    . LYS F 2 2   ? -24.710 -14.883 4.613   1.00 43.11 ? 2   LYS F O    1  
ATOM 9901   C CB   . LYS F 2 2   ? -23.901 -12.123 2.666   1.00 51.55 ? 2   LYS F CB   1  
ATOM 9902   C CG   . LYS F 2 2   ? -24.588 -12.706 1.386   1.00 72.41 ? 2   LYS F CG   1  
ATOM 9903   C CD   . LYS F 2 2   ? -24.394 -14.241 1.139   1.00 13.11 ? 2   LYS F CD   1  
ATOM 9904   C CE   . LYS F 2 2   ? -25.594 -15.104 1.597   1.00 70.20 ? 2   LYS F CE   1  
ATOM 9905   N NZ   . LYS F 2 2   ? -26.874 -14.666 0.983   1.00 54.31 ? 2   LYS F NZ   1  
ATOM 9906   H H    . LYS F 2 2   ? -23.726 -11.843 5.899   1.00 72.11 ? 2   LYS F H    1  
ATOM 9907   H HA   . LYS F 2 2   ? -25.591 -12.624 3.960   1.00 21.51 ? 2   LYS F HA   1  
ATOM 9908   H HB2  . LYS F 2 2   ? -23.958 -11.041 2.595   1.00 42.20 ? 2   LYS F HB2  1  
ATOM 9909   H HB3  . LYS F 2 2   ? -22.850 -12.397 2.639   1.00 0.54  ? 2   LYS F HB3  1  
ATOM 9910   H HG2  . LYS F 2 2   ? -25.649 -12.500 1.449   1.00 32.33 ? 2   LYS F HG2  1  
ATOM 9911   H HG3  . LYS F 2 2   ? -24.193 -12.170 0.530   1.00 4.11  ? 2   LYS F HG3  1  
ATOM 9912   H HD2  . LYS F 2 2   ? -24.248 -14.409 0.079   1.00 12.12 ? 2   LYS F HD2  1  
ATOM 9913   H HD3  . LYS F 2 2   ? -23.505 -14.575 1.667   1.00 25.53 ? 2   LYS F HD3  1  
ATOM 9914   H HE2  . LYS F 2 2   ? -25.418 -16.135 1.318   1.00 11.32 ? 2   LYS F HE2  1  
ATOM 9915   H HE3  . LYS F 2 2   ? -25.683 -15.038 2.673   1.00 71.03 ? 2   LYS F HE3  1  
ATOM 9916   H HZ1  . LYS F 2 2   ? -27.654 -15.274 1.312   1.00 65.14 ? 2   LYS F HZ1  1  
ATOM 9917   H HZ2  . LYS F 2 2   ? -26.817 -14.733 -0.050  1.00 21.23 ? 2   LYS F HZ2  1  
ATOM 9918   H HZ3  . LYS F 2 2   ? -27.083 -13.682 1.246   1.00 41.24 ? 2   LYS F HZ3  1  
ATOM 9919   N N    . GLN F 2 3   ? -22.630 -13.921 4.803   1.00 60.32 ? 3   GLN F N    1  
ATOM 9920   C CA   . GLN F 2 3   ? -21.819 -15.129 5.111   1.00 71.13 ? 3   GLN F CA   1  
ATOM 9921   C C    . GLN F 2 3   ? -21.391 -15.844 3.815   1.00 54.54 ? 3   GLN F C    1  
ATOM 9922   O O    . GLN F 2 3   ? -22.221 -16.460 3.135   1.00 23.41 ? 3   GLN F O    1  
ATOM 9923   C CB   . GLN F 2 3   ? -22.514 -16.124 6.093   1.00 3.24  ? 3   GLN F CB   1  
ATOM 9924   C CG   . GLN F 2 3   ? -21.657 -17.343 6.501   1.00 12.24 ? 3   GLN F CG   1  
ATOM 9925   C CD   . GLN F 2 3   ? -22.426 -18.345 7.363   1.00 65.21 ? 3   GLN F CD   1  
ATOM 9926   O OE1  . GLN F 2 3   ? -23.053 -19.270 6.847   1.00 32.34 ? 3   GLN F OE1  1  
ATOM 9927   N NE2  . GLN F 2 3   ? -22.392 -18.167 8.678   1.00 24.42 ? 3   GLN F NE2  1  
ATOM 9928   H H    . GLN F 2 3   ? -22.165 -13.058 4.809   1.00 11.42 ? 3   GLN F H    1  
ATOM 9929   H HA   . GLN F 2 3   ? -20.922 -14.756 5.596   1.00 40.22 ? 3   GLN F HA   1  
ATOM 9930   H HB2  . GLN F 2 3   ? -22.788 -15.582 6.991   1.00 44.32 ? 3   GLN F HB2  1  
ATOM 9931   H HB3  . GLN F 2 3   ? -23.423 -16.486 5.622   1.00 5.23  ? 3   GLN F HB3  1  
ATOM 9932   H HG2  . GLN F 2 3   ? -21.317 -17.848 5.605   1.00 3.35  ? 3   GLN F HG2  1  
ATOM 9933   H HG3  . GLN F 2 3   ? -20.795 -16.991 7.059   1.00 62.03 ? 3   GLN F HG3  1  
ATOM 9934   H HE21 . GLN F 2 3   ? -21.884 -17.406 9.032   1.00 74.11 ? 3   GLN F HE21 1  
ATOM 9935   H HE22 . GLN F 2 3   ? -22.889 -18.795 9.243   1.00 2.43  ? 3   GLN F HE22 1  
ATOM 9936   N N    . SER F 2 4   ? -20.097 -15.711 3.482   1.00 3.43  ? 4   SER F N    1  
ATOM 9937   C CA   . SER F 2 4   ? -19.443 -16.393 2.353   1.00 22.53 ? 4   SER F CA   1  
ATOM 9938   C C    . SER F 2 4   ? -17.910 -16.247 2.521   1.00 73.11 ? 4   SER F C    1  
ATOM 9939   O O    . SER F 2 4   ? -17.434 -15.743 3.552   1.00 32.45 ? 4   SER F O    1  
ATOM 9940   C CB   . SER F 2 4   ? -19.945 -15.806 0.992   1.00 61.34 ? 4   SER F CB   1  
ATOM 9941   O OG   . SER F 2 4   ? -19.410 -16.505 -0.123  1.00 22.34 ? 4   SER F OG   1  
ATOM 9942   H H    . SER F 2 4   ? -19.544 -15.111 4.029   1.00 23.01 ? 4   SER F H    1  
ATOM 9943   H HA   . SER F 2 4   ? -19.695 -17.448 2.409   1.00 52.44 ? 4   SER F HA   1  
ATOM 9944   H HB2  . SER F 2 4   ? -21.024 -15.877 0.948   1.00 53.33 ? 4   SER F HB2  1  
ATOM 9945   H HB3  . SER F 2 4   ? -19.658 -14.765 0.918   1.00 73.20 ? 4   SER F HB3  1  
ATOM 9946   H HG   . SER F 2 4   ? -20.111 -16.685 -0.760  1.00 3.14  ? 4   SER F HG   1  
ATOM 9947   N N    . THR F 2 5   ? -17.149 -16.720 1.528   1.00 70.42 ? 5   THR F N    1  
ATOM 9948   C CA   . THR F 2 5   ? -15.687 -16.591 1.486   1.00 22.21 ? 5   THR F CA   1  
ATOM 9949   C C    . THR F 2 5   ? -15.263 -16.272 0.047   1.00 30.35 ? 5   THR F C    1  
ATOM 9950   O O    . THR F 2 5   ? -15.328 -17.144 -0.831  1.00 5.53  ? 5   THR F O    1  
ATOM 9951   C CB   . THR F 2 5   ? -14.977 -17.896 1.990   1.00 41.41 ? 5   THR F CB   1  
ATOM 9952   O OG1  . THR F 2 5   ? -15.517 -18.283 3.264   1.00 31.13 ? 5   THR F OG1  1  
ATOM 9953   C CG2  . THR F 2 5   ? -13.450 -17.710 2.124   1.00 63.43 ? 5   THR F CG2  1  
ATOM 9954   H H    . THR F 2 5   ? -17.595 -17.181 0.784   1.00 13.21 ? 5   THR F H    1  
ATOM 9955   H HA   . THR F 2 5   ? -15.394 -15.764 2.137   1.00 13.12 ? 5   THR F HA   1  
ATOM 9956   H HB   . THR F 2 5   ? -15.171 -18.695 1.281   1.00 14.53 ? 5   THR F HB   1  
ATOM 9957   H HG1  . THR F 2 5   ? -15.691 -17.495 3.794   1.00 51.34 ? 5   THR F HG1  1  
ATOM 9958   H HG21 . THR F 2 5   ? -13.238 -16.920 2.837   1.00 54.43 ? 5   THR F HG21 1  
ATOM 9959   H HG22 . THR F 2 5   ? -13.027 -17.440 1.165   1.00 30.31 ? 5   THR F HG22 1  
ATOM 9960   H HG23 . THR F 2 5   ? -12.996 -18.632 2.464   1.00 31.42 ? 5   THR F HG23 1  
ATOM 9961   N N    . ILE F 2 6   ? -14.842 -15.002 -0.172  1.00 21.34 ? 6   ILE F N    1  
ATOM 9962   C CA   . ILE F 2 6   ? -14.453 -14.454 -1.496  1.00 32.34 ? 6   ILE F CA   1  
ATOM 9963   C C    . ILE F 2 6   ? -15.664 -14.619 -2.478  1.00 23.24 ? 6   ILE F C    1  
ATOM 9964   O O    . ILE F 2 6   ? -16.815 -14.532 -2.020  1.00 75.33 ? 6   ILE F O    1  
ATOM 9965   C CB   . ILE F 2 6   ? -13.083 -15.116 -2.006  1.00 13.23 ? 6   ILE F CB   1  
ATOM 9966   C CG1  . ILE F 2 6   ? -12.069 -15.323 -0.818  1.00 12.22 ? 6   ILE F CG1  1  
ATOM 9967   C CG2  . ILE F 2 6   ? -12.403 -14.267 -3.114  1.00 35.51 ? 6   ILE F CG2  1  
ATOM 9968   C CD1  . ILE F 2 6   ? -11.662 -14.053 -0.079  1.00 75.11 ? 6   ILE F CD1  1  
ATOM 9969   H H    . ILE F 2 6   ? -14.796 -14.405 0.601   1.00 62.11 ? 6   ILE F H    1  
ATOM 9970   H HA   . ILE F 2 6   ? -14.283 -13.388 -1.352  1.00 63.03 ? 6   ILE F HA   1  
ATOM 9971   H HB   . ILE F 2 6   ? -13.322 -16.085 -2.431  1.00 75.40 ? 6   ILE F HB   1  
ATOM 9972   H HG12 . ILE F 2 6   ? -12.517 -15.985 -0.088  1.00 64.01 ? 6   ILE F HG12 1  
ATOM 9973   H HG13 . ILE F 2 6   ? -11.167 -15.789 -1.194  1.00 20.34 ? 6   ILE F HG13 1  
ATOM 9974   H HG21 . ILE F 2 6   ? -12.148 -13.287 -2.727  1.00 23.55 ? 6   ILE F HG21 1  
ATOM 9975   H HG22 . ILE F 2 6   ? -13.081 -14.148 -3.952  1.00 52.14 ? 6   ILE F HG22 1  
ATOM 9976   H HG23 . ILE F 2 6   ? -11.504 -14.762 -3.457  1.00 42.41 ? 6   ILE F HG23 1  
ATOM 9977   H HD11 . ILE F 2 6   ? -10.933 -14.301 0.679   1.00 42.34 ? 6   ILE F HD11 1  
ATOM 9978   H HD12 . ILE F 2 6   ? -12.528 -13.610 0.391   1.00 13.01 ? 6   ILE F HD12 1  
ATOM 9979   H HD13 . ILE F 2 6   ? -11.228 -13.350 -0.776  1.00 3.45  ? 6   ILE F HD13 1  
ATOM 9980   N N    . ALA F 2 7   ? -15.434 -14.800 -3.800  1.00 53.15 ? 7   ALA F N    1  
ATOM 9981   C CA   . ALA F 2 7   ? -16.511 -15.071 -4.780  1.00 52.42 ? 7   ALA F CA   1  
ATOM 9982   C C    . ALA F 2 7   ? -15.892 -15.486 -6.131  1.00 14.22 ? 7   ALA F C    1  
ATOM 9983   O O    . ALA F 2 7   ? -15.563 -16.664 -6.321  1.00 43.24 ? 7   ALA F O    1  
ATOM 9984   C CB   . ALA F 2 7   ? -17.451 -13.858 -4.946  1.00 2.23  ? 7   ALA F CB   1  
ATOM 9985   H H    . ALA F 2 7   ? -14.523 -14.767 -4.129  1.00 55.31 ? 7   ALA F H    1  
ATOM 9986   H HA   . ALA F 2 7   ? -17.105 -15.902 -4.400  1.00 71.53 ? 7   ALA F HA   1  
ATOM 9987   H HB1  . ALA F 2 7   ? -18.235 -14.093 -5.652  1.00 14.44 ? 7   ALA F HB1  1  
ATOM 9988   H HB2  . ALA F 2 7   ? -16.882 -13.004 -5.306  1.00 1.11  ? 7   ALA F HB2  1  
ATOM 9989   H HB3  . ALA F 2 7   ? -17.891 -13.607 -3.989  1.00 34.55 ? 7   ALA F HB3  1  
ATOM 9990   N N    . LEU F 2 8   ? -15.667 -14.480 -7.023  1.00 45.04 ? 8   LEU F N    1  
ATOM 9991   C CA   . LEU F 2 8   ? -15.199 -14.669 -8.416  1.00 42.55 ? 8   LEU F CA   1  
ATOM 9992   C C    . LEU F 2 8   ? -16.135 -15.590 -9.233  1.00 62.44 ? 8   LEU F C    1  
ATOM 9993   O O    . LEU F 2 8   ? -16.185 -16.807 -9.021  1.00 45.32 ? 8   LEU F O    1  
ATOM 9994   C CB   . LEU F 2 8   ? -13.719 -15.155 -8.482  1.00 1.14  ? 8   LEU F CB   1  
ATOM 9995   C CG   . LEU F 2 8   ? -12.624 -14.056 -8.258  1.00 13.14 ? 8   LEU F CG   1  
ATOM 9996   C CD1  . LEU F 2 8   ? -12.742 -12.922 -9.310  1.00 62.33 ? 8   LEU F CD1  1  
ATOM 9997   C CD2  . LEU F 2 8   ? -12.641 -13.497 -6.816  1.00 64.11 ? 8   LEU F CD2  1  
ATOM 9998   H H    . LEU F 2 8   ? -15.801 -13.566 -6.718  1.00 22.40 ? 8   LEU F H    1  
ATOM 9999   H HA   . LEU F 2 8   ? -15.240 -13.682 -8.869  1.00 5.13  ? 8   LEU F HA   1  
ATOM 10000  H HB2  . LEU F 2 8   ? -13.586 -15.930 -7.732  1.00 33.01 ? 8   LEU F HB2  1  
ATOM 10001  H HB3  . LEU F 2 8   ? -13.545 -15.605 -9.455  1.00 31.45 ? 8   LEU F HB3  1  
ATOM 10002  H HG   . LEU F 2 8   ? -11.655 -14.516 -8.410  1.00 14.44 ? 8   LEU F HG   1  
ATOM 10003  H HD11 . LEU F 2 8   ? -11.940 -12.211 -9.171  1.00 60.53 ? 8   LEU F HD11 1  
ATOM 10004  H HD12 . LEU F 2 8   ? -13.692 -12.413 -9.204  1.00 1.15  ? 8   LEU F HD12 1  
ATOM 10005  H HD13 . LEU F 2 8   ? -12.675 -13.341 -10.308 1.00 61.10 ? 8   LEU F HD13 1  
ATOM 10006  H HD21 . LEU F 2 8   ? -12.495 -14.307 -6.112  1.00 4.42  ? 8   LEU F HD21 1  
ATOM 10007  H HD22 . LEU F 2 8   ? -13.592 -13.019 -6.614  1.00 71.34 ? 8   LEU F HD22 1  
ATOM 10008  H HD23 . LEU F 2 8   ? -11.846 -12.774 -6.694  1.00 73.32 ? 8   LEU F HD23 1  
ATOM 10009  N N    . ALA F 2 9   ? -16.866 -14.986 -10.175 1.00 33.10 ? 9   ALA F N    1  
ATOM 10010  C CA   . ALA F 2 9   ? -17.782 -15.691 -11.081 1.00 0.02  ? 9   ALA F CA   1  
ATOM 10011  C C    . ALA F 2 9   ? -17.483 -15.259 -12.516 1.00 0.32  ? 9   ALA F C    1  
ATOM 10012  O O    . ALA F 2 9   ? -17.159 -14.085 -12.747 1.00 64.14 ? 9   ALA F O    1  
ATOM 10013  C CB   . ALA F 2 9   ? -19.252 -15.394 -10.711 1.00 0.02  ? 9   ALA F CB   1  
ATOM 10014  H H    . ALA F 2 9   ? -16.776 -14.016 -10.284 1.00 24.44 ? 9   ALA F H    1  
ATOM 10015  H HA   . ALA F 2 9   ? -17.615 -16.763 -10.991 1.00 43.41 ? 9   ALA F HA   1  
ATOM 10016  H HB1  . ALA F 2 9   ? -19.916 -15.927 -11.381 1.00 40.54 ? 9   ALA F HB1  1  
ATOM 10017  H HB2  . ALA F 2 9   ? -19.446 -14.332 -10.786 1.00 32.21 ? 9   ALA F HB2  1  
ATOM 10018  H HB3  . ALA F 2 9   ? -19.442 -15.719 -9.695  1.00 63.45 ? 9   ALA F HB3  1  
ATOM 10019  N N    . LEU F 2 10  ? -17.572 -16.214 -13.466 1.00 40.25 ? 10  LEU F N    1  
ATOM 10020  C CA   . LEU F 2 10  ? -17.440 -15.933 -14.905 1.00 63.10 ? 10  LEU F CA   1  
ATOM 10021  C C    . LEU F 2 10  ? -18.567 -14.978 -15.301 1.00 62.25 ? 10  LEU F C    1  
ATOM 10022  O O    . LEU F 2 10  ? -19.740 -15.345 -15.167 1.00 55.31 ? 10  LEU F O    1  
ATOM 10023  C CB   . LEU F 2 10  ? -17.501 -17.230 -15.773 1.00 50.41 ? 10  LEU F CB   1  
ATOM 10024  C CG   . LEU F 2 10  ? -16.314 -18.251 -15.631 1.00 33.30 ? 10  LEU F CG   1  
ATOM 10025  C CD1  . LEU F 2 10  ? -16.324 -18.988 -14.272 1.00 54.43 ? 10  LEU F CD1  1  
ATOM 10026  C CD2  . LEU F 2 10  ? -16.306 -19.250 -16.814 1.00 51.20 ? 10  LEU F CD2  1  
ATOM 10027  H H    . LEU F 2 10  ? -17.757 -17.130 -13.185 1.00 34.05 ? 10  LEU F H    1  
ATOM 10028  H HA   . LEU F 2 10  ? -16.479 -15.447 -15.068 1.00 13.43 ? 10  LEU F HA   1  
ATOM 10029  H HB2  . LEU F 2 10  ? -18.424 -17.751 -15.539 1.00 4.32  ? 10  LEU F HB2  1  
ATOM 10030  H HB3  . LEU F 2 10  ? -17.550 -16.927 -16.817 1.00 22.42 ? 10  LEU F HB3  1  
ATOM 10031  H HG   . LEU F 2 10  ? -15.383 -17.699 -15.677 1.00 30.33 ? 10  LEU F HG   1  
ATOM 10032  H HD11 . LEU F 2 10  ? -17.246 -19.542 -14.157 1.00 2.45  ? 10  LEU F HD11 1  
ATOM 10033  H HD12 . LEU F 2 10  ? -16.238 -18.266 -13.472 1.00 3.25  ? 10  LEU F HD12 1  
ATOM 10034  H HD13 . LEU F 2 10  ? -15.485 -19.670 -14.221 1.00 12.41 ? 10  LEU F HD13 1  
ATOM 10035  H HD21 . LEU F 2 10  ? -15.460 -19.920 -16.724 1.00 71.41 ? 10  LEU F HD21 1  
ATOM 10036  H HD22 . LEU F 2 10  ? -16.224 -18.704 -17.744 1.00 42.51 ? 10  LEU F HD22 1  
ATOM 10037  H HD23 . LEU F 2 10  ? -17.223 -19.827 -16.818 1.00 61.14 ? 10  LEU F HD23 1  
ATOM 10038  N N    . LEU F 2 11  ? -18.183 -13.769 -15.750 1.00 64.44 ? 11  LEU F N    1  
ATOM 10039  C CA   . LEU F 2 11  ? -19.102 -12.646 -16.030 1.00 53.23 ? 11  LEU F CA   1  
ATOM 10040  C C    . LEU F 2 11  ? -20.330 -13.110 -16.867 1.00 33.54 ? 11  LEU F C    1  
ATOM 10041  O O    . LEU F 2 11  ? -20.168 -13.464 -18.039 1.00 31.23 ? 11  LEU F O    1  
ATOM 10042  C CB   . LEU F 2 11  ? -18.340 -11.485 -16.757 1.00 72.20 ? 11  LEU F CB   1  
ATOM 10043  C CG   . LEU F 2 11  ? -17.388 -10.573 -15.889 1.00 42.40 ? 11  LEU F CG   1  
ATOM 10044  C CD1  . LEU F 2 11  ? -16.259 -11.364 -15.189 1.00 33.01 ? 11  LEU F CD1  1  
ATOM 10045  C CD2  . LEU F 2 11  ? -16.804 -9.421  -16.745 1.00 10.13 ? 11  LEU F CD2  1  
ATOM 10046  H H    . LEU F 2 11  ? -17.226 -13.629 -15.902 1.00 44.01 ? 11  LEU F H    1  
ATOM 10047  H HA   . LEU F 2 11  ? -19.449 -12.282 -15.072 1.00 11.30 ? 11  LEU F HA   1  
ATOM 10048  H HB2  . LEU F 2 11  ? -17.746 -11.922 -17.556 1.00 55.20 ? 11  LEU F HB2  1  
ATOM 10049  H HB3  . LEU F 2 11  ? -19.081 -10.838 -17.218 1.00 40.25 ? 11  LEU F HB3  1  
ATOM 10050  H HG   . LEU F 2 11  ? -17.978 -10.119 -15.106 1.00 22.34 ? 11  LEU F HG   1  
ATOM 10051  H HD11 . LEU F 2 11  ? -16.695 -12.111 -14.539 1.00 44.34 ? 11  LEU F HD11 1  
ATOM 10052  H HD12 . LEU F 2 11  ? -15.649 -10.692 -14.595 1.00 34.40 ? 11  LEU F HD12 1  
ATOM 10053  H HD13 . LEU F 2 11  ? -15.637 -11.854 -15.928 1.00 23.22 ? 11  LEU F HD13 1  
ATOM 10054  H HD21 . LEU F 2 11  ? -16.214 -9.825  -17.559 1.00 23.22 ? 11  LEU F HD21 1  
ATOM 10055  H HD22 . LEU F 2 11  ? -16.177 -8.786  -16.131 1.00 71.32 ? 11  LEU F HD22 1  
ATOM 10056  H HD23 . LEU F 2 11  ? -17.613 -8.830  -17.150 1.00 14.23 ? 11  LEU F HD23 1  
ATOM 10057  N N    . PRO F 2 12  ? -21.566 -13.169 -16.250 1.00 63.25 ? 12  PRO F N    1  
ATOM 10058  C CA   . PRO F 2 12  ? -22.798 -13.629 -16.952 1.00 2.21  ? 12  PRO F CA   1  
ATOM 10059  C C    . PRO F 2 12  ? -23.261 -12.623 -18.029 1.00 10.02 ? 12  PRO F C    1  
ATOM 10060  O O    . PRO F 2 12  ? -23.858 -13.006 -19.036 1.00 2.54  ? 12  PRO F O    1  
ATOM 10061  C CB   . PRO F 2 12  ? -23.829 -13.778 -15.801 1.00 23.14 ? 12  PRO F CB   1  
ATOM 10062  C CG   . PRO F 2 12  ? -23.364 -12.825 -14.740 1.00 10.42 ? 12  PRO F CG   1  
ATOM 10063  C CD   . PRO F 2 12  ? -21.852 -12.818 -14.823 1.00 25.54 ? 12  PRO F CD   1  
ATOM 10064  H HA   . PRO F 2 12  ? -22.638 -14.594 -17.424 1.00 21.01 ? 12  PRO F HA   1  
ATOM 10065  H HB2  . PRO F 2 12  ? -24.834 -13.536 -16.145 1.00 11.21 ? 12  PRO F HB2  1  
ATOM 10066  H HB3  . PRO F 2 12  ? -23.813 -14.793 -15.419 1.00 73.54 ? 12  PRO F HB3  1  
ATOM 10067  H HG2  . PRO F 2 12  ? -23.764 -11.833 -14.935 1.00 54.55 ? 12  PRO F HG2  1  
ATOM 10068  H HG3  . PRO F 2 12  ? -23.682 -13.164 -13.760 1.00 12.32 ? 12  PRO F HG3  1  
ATOM 10069  H HD2  . PRO F 2 12  ? -21.461 -11.836 -14.584 1.00 23.34 ? 12  PRO F HD2  1  
ATOM 10070  H HD3  . PRO F 2 12  ? -21.425 -13.558 -14.152 1.00 11.11 ? 12  PRO F HD3  1  
ATOM 10071  N N    . LEU F 2 13  ? -22.945 -11.333 -17.800 1.00 34.51 ? 13  LEU F N    1  
ATOM 10072  C CA   . LEU F 2 13  ? -23.181 -10.241 -18.766 1.00 43.21 ? 13  LEU F CA   1  
ATOM 10073  C C    . LEU F 2 13  ? -22.041 -10.200 -19.803 1.00 75.00 ? 13  LEU F C    1  
ATOM 10074  O O    . LEU F 2 13  ? -22.123 -9.454  -20.783 1.00 0.22  ? 13  LEU F O    1  
ATOM 10075  C CB   . LEU F 2 13  ? -23.265 -8.860  -18.030 1.00 21.43 ? 13  LEU F CB   1  
ATOM 10076  C CG   . LEU F 2 13  ? -24.546 -8.576  -17.165 1.00 33.22 ? 13  LEU F CG   1  
ATOM 10077  C CD1  . LEU F 2 13  ? -24.690 -9.541  -15.970 1.00 33.24 ? 13  LEU F CD1  1  
ATOM 10078  C CD2  . LEU F 2 13  ? -24.576 -7.101  -16.696 1.00 52.21 ? 13  LEU F CD2  1  
ATOM 10079  H H    . LEU F 2 13  ? -22.518 -11.108 -16.951 1.00 11.44 ? 13  LEU F H    1  
ATOM 10080  H HA   . LEU F 2 13  ? -24.120 -10.429 -19.279 1.00 30.24 ? 13  LEU F HA   1  
ATOM 10081  H HB2  . LEU F 2 13  ? -22.394 -8.768  -17.387 1.00 3.42  ? 13  LEU F HB2  1  
ATOM 10082  H HB3  . LEU F 2 13  ? -23.199 -8.078  -18.784 1.00 4.52  ? 13  LEU F HB3  1  
ATOM 10083  H HG   . LEU F 2 13  ? -25.417 -8.724  -17.790 1.00 44.53 ? 13  LEU F HG   1  
ATOM 10084  H HD11 . LEU F 2 13  ? -23.839 -9.443  -15.307 1.00 12.44 ? 13  LEU F HD11 1  
ATOM 10085  H HD12 . LEU F 2 13  ? -24.742 -10.558 -16.333 1.00 31.33 ? 13  LEU F HD12 1  
ATOM 10086  H HD13 . LEU F 2 13  ? -25.597 -9.315  -15.426 1.00 35.21 ? 13  LEU F HD13 1  
ATOM 10087  H HD21 . LEU F 2 13  ? -24.561 -6.448  -17.557 1.00 64.23 ? 13  LEU F HD21 1  
ATOM 10088  H HD22 . LEU F 2 13  ? -23.716 -6.891  -16.072 1.00 25.41 ? 13  LEU F HD22 1  
ATOM 10089  H HD23 . LEU F 2 13  ? -25.481 -6.918  -16.129 1.00 21.22 ? 13  LEU F HD23 1  
ATOM 10090  N N    . LEU F 2 14  ? -20.984 -11.017 -19.555 1.00 25.14 ? 14  LEU F N    1  
ATOM 10091  C CA   . LEU F 2 14  ? -19.696 -10.965 -20.269 1.00 62.41 ? 14  LEU F CA   1  
ATOM 10092  C C    . LEU F 2 14  ? -19.024 -9.595  -20.054 1.00 20.32 ? 14  LEU F C    1  
ATOM 10093  O O    . LEU F 2 14  ? -19.418 -8.825  -19.162 1.00 30.05 ? 14  LEU F O    1  
ATOM 10094  C CB   . LEU F 2 14  ? -19.866 -11.328 -21.781 1.00 45.02 ? 14  LEU F CB   1  
ATOM 10095  C CG   . LEU F 2 14  ? -20.425 -12.761 -22.079 1.00 53.11 ? 14  LEU F CG   1  
ATOM 10096  C CD1  . LEU F 2 14  ? -20.616 -12.995 -23.598 1.00 4.35  ? 14  LEU F CD1  1  
ATOM 10097  C CD2  . LEU F 2 14  ? -19.532 -13.860 -21.441 1.00 63.12 ? 14  LEU F CD2  1  
ATOM 10098  H H    . LEU F 2 14  ? -21.083 -11.691 -18.859 1.00 60.04 ? 14  LEU F H    1  
ATOM 10099  H HA   . LEU F 2 14  ? -19.060 -11.712 -19.806 1.00 3.21  ? 14  LEU F HA   1  
ATOM 10100  H HB2  . LEU F 2 14  ? -20.538 -10.600 -22.224 1.00 63.21 ? 14  LEU F HB2  1  
ATOM 10101  H HB3  . LEU F 2 14  ? -18.901 -11.233 -22.267 1.00 4.44  ? 14  LEU F HB3  1  
ATOM 10102  H HG   . LEU F 2 14  ? -21.406 -12.844 -21.626 1.00 12.13 ? 14  LEU F HG   1  
ATOM 10103  H HD11 . LEU F 2 14  ? -19.664 -12.917 -24.110 1.00 32.00 ? 14  LEU F HD11 1  
ATOM 10104  H HD12 . LEU F 2 14  ? -21.295 -12.251 -23.996 1.00 55.15 ? 14  LEU F HD12 1  
ATOM 10105  H HD13 . LEU F 2 14  ? -21.035 -13.977 -23.769 1.00 40.53 ? 14  LEU F HD13 1  
ATOM 10106  H HD21 . LEU F 2 14  ? -18.527 -13.797 -21.837 1.00 61.41 ? 14  LEU F HD21 1  
ATOM 10107  H HD22 . LEU F 2 14  ? -19.942 -14.837 -21.656 1.00 53.54 ? 14  LEU F HD22 1  
ATOM 10108  H HD23 . LEU F 2 14  ? -19.502 -13.722 -20.367 1.00 21.42 ? 14  LEU F HD23 1  
ATOM 10109  N N    . PHE F 2 15  ? -17.977 -9.318  -20.821 1.00 1.32  ? 15  PHE F N    1  
ATOM 10110  C CA   . PHE F 2 15  ? -17.314 -8.013  -20.817 1.00 43.35 ? 15  PHE F CA   1  
ATOM 10111  C C    . PHE F 2 15  ? -17.565 -7.341  -22.170 1.00 34.42 ? 15  PHE F C    1  
ATOM 10112  O O    . PHE F 2 15  ? -17.548 -8.019  -23.206 1.00 42.15 ? 15  PHE F O    1  
ATOM 10113  C CB   . PHE F 2 15  ? -15.800 -8.191  -20.549 1.00 33.42 ? 15  PHE F CB   1  
ATOM 10114  C CG   . PHE F 2 15  ? -15.046 -6.882  -20.304 1.00 5.42  ? 15  PHE F CG   1  
ATOM 10115  C CD1  . PHE F 2 15  ? -15.066 -6.280  -19.043 1.00 65.15 ? 15  PHE F CD1  1  
ATOM 10116  C CD2  . PHE F 2 15  ? -14.332 -6.248  -21.326 1.00 64.05 ? 15  PHE F CD2  1  
ATOM 10117  C CE1  . PHE F 2 15  ? -14.401 -5.090  -18.814 1.00 40.53 ? 15  PHE F CE1  1  
ATOM 10118  C CE2  . PHE F 2 15  ? -13.668 -5.058  -21.092 1.00 11.55 ? 15  PHE F CE2  1  
ATOM 10119  C CZ   . PHE F 2 15  ? -13.704 -4.481  -19.840 1.00 44.31 ? 15  PHE F CZ   1  
ATOM 10120  H H    . PHE F 2 15  ? -17.633 -10.011 -21.422 1.00 2.40  ? 15  PHE F H    1  
ATOM 10121  H HA   . PHE F 2 15  ? -17.745 -7.397  -20.025 1.00 73.44 ? 15  PHE F HA   1  
ATOM 10122  H HB2  . PHE F 2 15  ? -15.674 -8.818  -19.671 1.00 44.41 ? 15  PHE F HB2  1  
ATOM 10123  H HB3  . PHE F 2 15  ? -15.345 -8.697  -21.395 1.00 54.51 ? 15  PHE F HB3  1  
ATOM 10124  H HD1  . PHE F 2 15  ? -15.610 -6.754  -18.233 1.00 23.42 ? 15  PHE F HD1  1  
ATOM 10125  H HD2  . PHE F 2 15  ? -14.292 -6.698  -22.317 1.00 31.43 ? 15  PHE F HD2  1  
ATOM 10126  H HE1  . PHE F 2 15  ? -14.426 -4.635  -17.833 1.00 13.13 ? 15  PHE F HE1  1  
ATOM 10127  H HE2  . PHE F 2 15  ? -13.121 -4.577  -21.893 1.00 73.02 ? 15  PHE F HE2  1  
ATOM 10128  H HZ   . PHE F 2 15  ? -13.182 -3.549  -19.660 1.00 42.45 ? 15  PHE F HZ   1  
ATOM 10129  N N    . THR F 2 16  ? -17.819 -6.023  -22.144 1.00 54.01 ? 16  THR F N    1  
ATOM 10130  C CA   . THR F 2 16  ? -17.987 -5.207  -23.350 1.00 23.11 ? 16  THR F CA   1  
ATOM 10131  C C    . THR F 2 16  ? -16.637 -5.140  -24.109 1.00 12.34 ? 16  THR F C    1  
ATOM 10132  O O    . THR F 2 16  ? -15.693 -4.513  -23.627 1.00 53.14 ? 16  THR F O    1  
ATOM 10133  C CB   . THR F 2 16  ? -18.492 -3.775  -22.974 1.00 43.14 ? 16  THR F CB   1  
ATOM 10134  O OG1  . THR F 2 16  ? -17.655 -3.235  -21.945 1.00 61.23 ? 16  THR F OG1  1  
ATOM 10135  C CG2  . THR F 2 16  ? -19.955 -3.783  -22.484 1.00 64.43 ? 16  THR F CG2  1  
ATOM 10136  H H    . THR F 2 16  ? -17.887 -5.579  -21.276 1.00 62.50 ? 16  THR F H    1  
ATOM 10137  H HA   . THR F 2 16  ? -18.734 -5.683  -23.981 1.00 44.22 ? 16  THR F HA   1  
ATOM 10138  H HB   . THR F 2 16  ? -18.423 -3.131  -23.848 1.00 42.33 ? 16  THR F HB   1  
ATOM 10139  H HG1  . THR F 2 16  ? -16.773 -3.073  -22.302 1.00 32.22 ? 16  THR F HG1  1  
ATOM 10140  H HG21 . THR F 2 16  ? -20.261 -2.776  -22.231 1.00 11.14 ? 16  THR F HG21 1  
ATOM 10141  H HG22 . THR F 2 16  ? -20.043 -4.411  -21.606 1.00 11.45 ? 16  THR F HG22 1  
ATOM 10142  H HG23 . THR F 2 16  ? -20.599 -4.167  -23.263 1.00 33.41 ? 16  THR F HG23 1  
ATOM 10143  N N    . PRO F 2 17  ? -16.517 -5.821  -25.285 1.00 43.14 ? 17  PRO F N    1  
ATOM 10144  C CA   . PRO F 2 17  ? -15.227 -6.001  -25.977 1.00 73.43 ? 17  PRO F CA   1  
ATOM 10145  C C    . PRO F 2 17  ? -14.889 -4.814  -26.905 1.00 33.40 ? 17  PRO F C    1  
ATOM 10146  O O    . PRO F 2 17  ? -15.557 -3.774  -26.863 1.00 64.10 ? 17  PRO F O    1  
ATOM 10147  C CB   . PRO F 2 17  ? -15.495 -7.301  -26.757 1.00 70.23 ? 17  PRO F CB   1  
ATOM 10148  C CG   . PRO F 2 17  ? -16.931 -7.190  -27.182 1.00 70.32 ? 17  PRO F CG   1  
ATOM 10149  C CD   . PRO F 2 17  ? -17.636 -6.445  -26.060 1.00 3.32  ? 17  PRO F CD   1  
ATOM 10150  H HA   . PRO F 2 17  ? -14.409 -6.152  -25.280 1.00 3.31  ? 17  PRO F HA   1  
ATOM 10151  H HB2  . PRO F 2 17  ? -14.827 -7.379  -27.615 1.00 73.22 ? 17  PRO F HB2  1  
ATOM 10152  H HB3  . PRO F 2 17  ? -15.362 -8.163  -26.113 1.00 41.43 ? 17  PRO F HB3  1  
ATOM 10153  H HG2  . PRO F 2 17  ? -16.998 -6.637  -28.117 1.00 13.44 ? 17  PRO F HG2  1  
ATOM 10154  H HG3  . PRO F 2 17  ? -17.365 -8.177  -27.308 1.00 24.22 ? 17  PRO F HG3  1  
ATOM 10155  H HD2  . PRO F 2 17  ? -18.298 -5.684  -26.457 1.00 4.01  ? 17  PRO F HD2  1  
ATOM 10156  H HD3  . PRO F 2 17  ? -18.196 -7.134  -25.434 1.00 5.43  ? 17  PRO F HD3  1  
ATOM 10157  N N    . VAL F 2 18  ? -13.848 -4.973  -27.732 1.00 51.32 ? 18  VAL F N    1  
ATOM 10158  C CA   . VAL F 2 18  ? -13.452 -3.945  -28.709 1.00 11.23 ? 18  VAL F CA   1  
ATOM 10159  C C    . VAL F 2 18  ? -14.329 -4.065  -29.959 1.00 11.25 ? 18  VAL F C    1  
ATOM 10160  O O    . VAL F 2 18  ? -14.589 -5.179  -30.433 1.00 21.00 ? 18  VAL F O    1  
ATOM 10161  C CB   . VAL F 2 18  ? -11.942 -4.067  -29.128 1.00 60.10 ? 18  VAL F CB   1  
ATOM 10162  C CG1  . VAL F 2 18  ? -11.509 -2.904  -30.064 1.00 11.35 ? 18  VAL F CG1  1  
ATOM 10163  C CG2  . VAL F 2 18  ? -11.038 -4.151  -27.888 1.00 70.22 ? 18  VAL F CG2  1  
ATOM 10164  H H    . VAL F 2 18  ? -13.342 -5.810  -27.696 1.00 51.22 ? 18  VAL F H    1  
ATOM 10165  H HA   . VAL F 2 18  ? -13.604 -2.964  -28.256 1.00 44.31 ? 18  VAL F HA   1  
ATOM 10166  H HB   . VAL F 2 18  ? -11.822 -4.997  -29.684 1.00 44.35 ? 18  VAL F HB   1  
ATOM 10167  H HG11 . VAL F 2 18  ? -10.470 -3.027  -30.344 1.00 4.55  ? 18  VAL F HG11 1  
ATOM 10168  H HG12 . VAL F 2 18  ? -11.634 -1.956  -29.558 1.00 30.13 ? 18  VAL F HG12 1  
ATOM 10169  H HG13 . VAL F 2 18  ? -12.121 -2.913  -30.958 1.00 51.11 ? 18  VAL F HG13 1  
ATOM 10170  H HG21 . VAL F 2 18  ? -11.305 -5.021  -27.298 1.00 34.11 ? 18  VAL F HG21 1  
ATOM 10171  H HG22 . VAL F 2 18  ? -11.156 -3.262  -27.280 1.00 74.21 ? 18  VAL F HG22 1  
ATOM 10172  H HG23 . VAL F 2 18  ? -10.003 -4.238  -28.192 1.00 33.41 ? 18  VAL F HG23 1  
ATOM 10173  N N    . THR F 2 19  ? -14.795 -2.918  -30.462 1.00 13.31 ? 19  THR F N    1  
ATOM 10174  C CA   . THR F 2 19  ? -15.472 -2.833  -31.751 1.00 61.22 ? 19  THR F CA   1  
ATOM 10175  C C    . THR F 2 19  ? -14.403 -2.846  -32.854 1.00 43.51 ? 19  THR F C    1  
ATOM 10176  O O    . THR F 2 19  ? -13.685 -1.853  -33.006 1.00 71.23 ? 19  THR F O    1  
ATOM 10177  C CB   . THR F 2 19  ? -16.321 -1.521  -31.841 1.00 40.10 ? 19  THR F CB   1  
ATOM 10178  O OG1  . THR F 2 19  ? -17.207 -1.446  -30.711 1.00 64.23 ? 19  THR F OG1  1  
ATOM 10179  C CG2  . THR F 2 19  ? -17.136 -1.435  -33.152 1.00 22.02 ? 19  THR F CG2  1  
ATOM 10180  H H    . THR F 2 19  ? -14.666 -2.094  -29.949 1.00 52.12 ? 19  THR F H    1  
ATOM 10181  H HA   . THR F 2 19  ? -16.135 -3.692  -31.859 1.00 32.15 ? 19  THR F HA   1  
ATOM 10182  H HB   . THR F 2 19  ? -15.645 -0.669  -31.796 1.00 14.24 ? 19  THR F HB   1  
ATOM 10183  H HG1  . THR F 2 19  ? -16.703 -1.197  -29.925 1.00 2.43  ? 19  THR F HG1  1  
ATOM 10184  H HG21 . THR F 2 19  ? -16.466 -1.466  -34.005 1.00 13.50 ? 19  THR F HG21 1  
ATOM 10185  H HG22 . THR F 2 19  ? -17.694 -0.508  -33.178 1.00 3.52  ? 19  THR F HG22 1  
ATOM 10186  H HG23 . THR F 2 19  ? -17.827 -2.266  -33.213 1.00 60.13 ? 19  THR F HG23 1  
ATOM 10187  N N    . LYS F 2 20  ? -14.258 -4.002  -33.537 1.00 43.20 ? 20  LYS F N    1  
ATOM 10188  C CA   . LYS F 2 20  ? -13.339 -4.186  -34.681 1.00 15.31 ? 20  LYS F CA   1  
ATOM 10189  C C    . LYS F 2 20  ? -11.882 -3.825  -34.298 1.00 3.43  ? 20  LYS F C    1  
ATOM 10190  O O    . LYS F 2 20  ? -11.410 -2.720  -34.587 1.00 15.25 ? 20  LYS F O    1  
ATOM 10191  C CB   . LYS F 2 20  ? -13.829 -3.382  -35.923 1.00 24.15 ? 20  LYS F CB   1  
ATOM 10192  C CG   . LYS F 2 20  ? -15.212 -3.820  -36.458 1.00 62.44 ? 20  LYS F CG   1  
ATOM 10193  C CD   . LYS F 2 20  ? -15.745 -2.881  -37.566 1.00 50.22 ? 20  LYS F CD   1  
ATOM 10194  C CE   . LYS F 2 20  ? -17.118 -3.313  -38.105 1.00 63.20 ? 20  LYS F CE   1  
ATOM 10195  N NZ   . LYS F 2 20  ? -17.690 -2.291  -39.021 1.00 50.34 ? 20  LYS F NZ   1  
ATOM 10196  H H    . LYS F 2 20  ? -14.779 -4.774  -33.244 1.00 15.43 ? 20  LYS F H    1  
ATOM 10197  H HA   . LYS F 2 20  ? -13.368 -5.243  -34.929 1.00 60.22 ? 20  LYS F HA   1  
ATOM 10198  H HB2  . LYS F 2 20  ? -13.883 -2.332  -35.653 1.00 5.42  ? 20  LYS F HB2  1  
ATOM 10199  H HB3  . LYS F 2 20  ? -13.104 -3.495  -36.723 1.00 3.51  ? 20  LYS F HB3  1  
ATOM 10200  H HG2  . LYS F 2 20  ? -15.130 -4.825  -36.858 1.00 24.20 ? 20  LYS F HG2  1  
ATOM 10201  H HG3  . LYS F 2 20  ? -15.919 -3.825  -35.634 1.00 31.42 ? 20  LYS F HG3  1  
ATOM 10202  H HD2  . LYS F 2 20  ? -15.833 -1.878  -37.163 1.00 23.44 ? 20  LYS F HD2  1  
ATOM 10203  H HD3  . LYS F 2 20  ? -15.036 -2.866  -38.390 1.00 2.21  ? 20  LYS F HD3  1  
ATOM 10204  H HE2  . LYS F 2 20  ? -17.017 -4.248  -38.643 1.00 74.52 ? 20  LYS F HE2  1  
ATOM 10205  H HE3  . LYS F 2 20  ? -17.799 -3.451  -37.274 1.00 41.25 ? 20  LYS F HE3  1  
ATOM 10206  H HZ1  . LYS F 2 20  ? -17.909 -1.423  -38.490 1.00 43.31 ? 20  LYS F HZ1  1  
ATOM 10207  H HZ2  . LYS F 2 20  ? -18.566 -2.645  -39.457 1.00 34.45 ? 20  LYS F HZ2  1  
ATOM 10208  H HZ3  . LYS F 2 20  ? -17.009 -2.058  -39.772 1.00 11.42 ? 20  LYS F HZ3  1  
ATOM 10209  N N    . ALA F 2 21  ? -11.197 -4.765  -33.615 1.00 32.33 ? 21  ALA F N    1  
ATOM 10210  C CA   . ALA F 2 21  ? -9.796  -4.594  -33.160 1.00 1.04  ? 21  ALA F CA   1  
ATOM 10211  C C    . ALA F 2 21  ? -8.813  -4.896  -34.312 1.00 34.11 ? 21  ALA F C    1  
ATOM 10212  O O    . ALA F 2 21  ? -7.889  -5.706  -34.173 1.00 44.41 ? 21  ALA F O    1  
ATOM 10213  C CB   . ALA F 2 21  ? -9.533  -5.500  -31.931 1.00 73.14 ? 21  ALA F CB   1  
ATOM 10214  H H    . ALA F 2 21  ? -11.650 -5.610  -33.412 1.00 71.31 ? 21  ALA F H    1  
ATOM 10215  H HA   . ALA F 2 21  ? -9.659  -3.561  -32.852 1.00 31.24 ? 21  ALA F HA   1  
ATOM 10216  H HB1  . ALA F 2 21  ? -10.231 -5.255  -31.141 1.00 44.31 ? 21  ALA F HB1  1  
ATOM 10217  H HB2  . ALA F 2 21  ? -8.523  -5.350  -31.567 1.00 30.53 ? 21  ALA F HB2  1  
ATOM 10218  H HB3  . ALA F 2 21  ? -9.659  -6.541  -32.206 1.00 63.42 ? 21  ALA F HB3  1  
ATOM 10219  N N    . ARG F 2 22  ? -9.029  -4.227  -35.460 1.00 13.24 ? 22  ARG F N    1  
ATOM 10220  C CA   . ARG F 2 22  ? -8.251  -4.438  -36.695 1.00 13.44 ? 22  ARG F CA   1  
ATOM 10221  C C    . ARG F 2 22  ? -8.054  -3.096  -37.422 1.00 12.44 ? 22  ARG F C    1  
ATOM 10222  O O    . ARG F 2 22  ? -6.918  -2.662  -37.650 1.00 44.13 ? 22  ARG F O    1  
ATOM 10223  C CB   . ARG F 2 22  ? -8.952  -5.450  -37.655 1.00 13.10 ? 22  ARG F CB   1  
ATOM 10224  C CG   . ARG F 2 22  ? -9.145  -6.877  -37.094 1.00 11.23 ? 22  ARG F CG   1  
ATOM 10225  C CD   . ARG F 2 22  ? -9.688  -7.848  -38.147 1.00 63.53 ? 22  ARG F CD   1  
ATOM 10226  N NE   . ARG F 2 22  ? -9.987  -9.174  -37.584 1.00 2.20  ? 22  ARG F NE   1  
ATOM 10227  C CZ   . ARG F 2 22  ? -10.398 -10.237 -38.296 1.00 12.11 ? 22  ARG F CZ   1  
ATOM 10228  N NH1  . ARG F 2 22  ? -10.550 -10.155 -39.616 1.00 10.25 ? 22  ARG F NH1  1  
ATOM 10229  N NH2  . ARG F 2 22  ? -10.685 -11.371 -37.675 1.00 24.13 ? 22  ARG F NH2  1  
ATOM 10230  H H    . ARG F 2 22  ? -9.724  -3.540  -35.465 1.00 31.43 ? 22  ARG F H    1  
ATOM 10231  H HA   . ARG F 2 22  ? -7.273  -4.832  -36.422 1.00 64.23 ? 22  ARG F HA   1  
ATOM 10232  H HB2  . ARG F 2 22  ? -9.930  -5.058  -37.915 1.00 75.00 ? 22  ARG F HB2  1  
ATOM 10233  H HB3  . ARG F 2 22  ? -8.364  -5.526  -38.566 1.00 53.04 ? 22  ARG F HB3  1  
ATOM 10234  H HG2  . ARG F 2 22  ? -8.190  -7.246  -36.734 1.00 40.42 ? 22  ARG F HG2  1  
ATOM 10235  H HG3  . ARG F 2 22  ? -9.840  -6.833  -36.262 1.00 24.12 ? 22  ARG F HG3  1  
ATOM 10236  H HD2  . ARG F 2 22  ? -10.598 -7.439  -38.572 1.00 12.10 ? 22  ARG F HD2  1  
ATOM 10237  H HD3  . ARG F 2 22  ? -8.949  -7.962  -38.934 1.00 72.10 ? 22  ARG F HD3  1  
ATOM 10238  H HE   . ARG F 2 22  ? -9.868  -9.275  -36.615 1.00 4.03  ? 22  ARG F HE   1  
ATOM 10239  H HH11 . ARG F 2 22  ? -10.357 -9.298  -40.096 1.00 5.54  ? 22  ARG F HH11 1  
ATOM 10240  H HH12 . ARG F 2 22  ? -10.859 -10.956 -40.140 1.00 74.42 ? 22  ARG F HH12 1  
ATOM 10241  H HH21 . ARG F 2 22  ? -10.597 -11.438 -36.682 1.00 73.10 ? 22  ARG F HH21 1  
ATOM 10242  H HH22 . ARG F 2 22  ? -10.994 -12.168 -38.201 1.00 74.23 ? 22  ARG F HH22 1  
ATOM 10243  N N    . THR F 2 23  ? -9.174  -2.446  -37.791 1.00 40.52 ? 23  THR F N    1  
ATOM 10244  C CA   . THR F 2 23  ? -9.163  -1.227  -38.619 1.00 31.43 ? 23  THR F CA   1  
ATOM 10245  C C    . THR F 2 23  ? -9.755  -0.033  -37.835 1.00 11.14 ? 23  THR F C    1  
ATOM 10246  O O    . THR F 2 23  ? -10.937 -0.063  -37.480 1.00 54.23 ? 23  THR F O    1  
ATOM 10247  C CB   . THR F 2 23  ? -9.966  -1.441  -39.956 1.00 24.01 ? 23  THR F CB   1  
ATOM 10248  O OG1  . THR F 2 23  ? -11.311 -1.869  -39.673 1.00 54.21 ? 23  THR F OG1  1  
ATOM 10249  C CG2  . THR F 2 23  ? -9.289  -2.476  -40.873 1.00 65.14 ? 23  THR F CG2  1  
ATOM 10250  H H    . THR F 2 23  ? -10.038 -2.784  -37.478 1.00 24.04 ? 23  THR F H    1  
ATOM 10251  H HA   . THR F 2 23  ? -8.133  -0.995  -38.886 1.00 70.42 ? 23  THR F HA   1  
ATOM 10252  H HB   . THR F 2 23  ? -10.014 -0.494  -40.489 1.00 52.53 ? 23  THR F HB   1  
ATOM 10253  H HG1  . THR F 2 23  ? -11.749 -1.207  -39.120 1.00 71.22 ? 23  THR F HG1  1  
ATOM 10254  H HG21 . THR F 2 23  ? -9.246  -3.434  -40.373 1.00 43.20 ? 23  THR F HG21 1  
ATOM 10255  H HG22 . THR F 2 23  ? -8.282  -2.153  -41.110 1.00 74.42 ? 23  THR F HG22 1  
ATOM 10256  H HG23 . THR F 2 23  ? -9.852  -2.578  -41.793 1.00 70.33 ? 23  THR F HG23 1  
ATOM 10257  N N    . PRO F 2 24  ? -8.926  1.007   -37.496 1.00 61.13 ? 24  PRO F N    1  
ATOM 10258  C CA   . PRO F 2 24  ? -9.430  2.323   -37.032 1.00 71.32 ? 24  PRO F CA   1  
ATOM 10259  C C    . PRO F 2 24  ? -10.291 3.022   -38.107 1.00 30.30 ? 24  PRO F C    1  
ATOM 10260  O O    . PRO F 2 24  ? -9.800  3.853   -38.886 1.00 24.11 ? 24  PRO F O    1  
ATOM 10261  C CB   . PRO F 2 24  ? -8.130  3.116   -36.689 1.00 33.45 ? 24  PRO F CB   1  
ATOM 10262  C CG   . PRO F 2 24  ? -7.027  2.388   -37.399 1.00 34.04 ? 24  PRO F CG   1  
ATOM 10263  C CD   . PRO F 2 24  ? -7.444  0.940   -37.431 1.00 64.43 ? 24  PRO F CD   1  
ATOM 10264  H HA   . PRO F 2 24  ? -10.031 2.210   -36.131 1.00 4.33  ? 24  PRO F HA   1  
ATOM 10265  H HB2  . PRO F 2 24  ? -8.205  4.148   -37.031 1.00 2.22  ? 24  PRO F HB2  1  
ATOM 10266  H HB3  . PRO F 2 24  ? -7.953  3.105   -35.619 1.00 34.42 ? 24  PRO F HB3  1  
ATOM 10267  H HG2  . PRO F 2 24  ? -6.916  2.778   -38.409 1.00 43.43 ? 24  PRO F HG2  1  
ATOM 10268  H HG3  . PRO F 2 24  ? -6.091  2.495   -36.859 1.00 1.33  ? 24  PRO F HG3  1  
ATOM 10269  H HD2  . PRO F 2 24  ? -7.036  0.443   -38.305 1.00 34.44 ? 24  PRO F HD2  1  
ATOM 10270  H HD3  . PRO F 2 24  ? -7.127  0.427   -36.529 1.00 4.14  ? 24  PRO F HD3  1  
ATOM 10271  N N    . GLU F 2 25  ? -11.575 2.631   -38.166 1.00 31.45 ? 25  GLU F N    1  
ATOM 10272  C CA   . GLU F 2 25  ? -12.535 3.124   -39.161 1.00 51.52 ? 25  GLU F CA   1  
ATOM 10273  C C    . GLU F 2 25  ? -13.828 3.570   -38.428 1.00 43.51 ? 25  GLU F C    1  
ATOM 10274  O O    . GLU F 2 25  ? -14.636 2.698   -38.029 1.00 64.32 ? 25  GLU F O    1  
ATOM 10275  C CB   . GLU F 2 25  ? -12.807 2.019   -40.227 1.00 74.10 ? 25  GLU F CB   1  
ATOM 10276  C CG   . GLU F 2 25  ? -13.739 2.452   -41.375 1.00 64.52 ? 25  GLU F CG   1  
ATOM 10277  C CD   . GLU F 2 25  ? -13.918 1.363   -42.442 1.00 25.11 ? 25  GLU F CD   1  
ATOM 10278  O OE1  . GLU F 2 25  ? -14.814 0.502   -42.293 1.00 21.03 ? 25  GLU F OE1  1  
ATOM 10279  O OE2  . GLU F 2 25  ? -13.156 1.356   -43.434 1.00 65.03 ? 25  GLU F OE2  1  
ATOM 10280  O OXT  . GLU F 2 25  ? -14.013 4.791   -38.225 1.00 37.61 ? 25  GLU F OXT  1  
ATOM 10281  H H    . GLU F 2 25  ? -11.892 1.978   -37.506 1.00 34.43 ? 25  GLU F H    1  
ATOM 10282  H HA   . GLU F 2 25  ? -12.098 3.990   -39.663 1.00 14.15 ? 25  GLU F HA   1  
ATOM 10283  H HB2  . GLU F 2 25  ? -11.859 1.716   -40.658 1.00 44.31 ? 25  GLU F HB2  1  
ATOM 10284  H HB3  . GLU F 2 25  ? -13.250 1.162   -39.732 1.00 15.31 ? 25  GLU F HB3  1  
ATOM 10285  H HG2  . GLU F 2 25  ? -14.712 2.700   -40.959 1.00 0.41  ? 25  GLU F HG2  1  
ATOM 10286  H HG3  . GLU F 2 25  ? -13.329 3.340   -41.843 1.00 45.51 ? 25  GLU F HG3  1  
ATOM 10287  N N    . MET G 2 1   ? 7.004   0.281   32.702  1.00 61.42 ? 1   MET G N    1  
ATOM 10288  C CA   . MET G 2 1   ? 6.053   -0.674  32.087  1.00 23.12 ? 1   MET G CA   1  
ATOM 10289  C C    . MET G 2 1   ? 5.138   0.063   31.092  1.00 72.53 ? 1   MET G C    1  
ATOM 10290  O O    . MET G 2 1   ? 4.735   1.207   31.344  1.00 40.21 ? 1   MET G O    1  
ATOM 10291  C CB   . MET G 2 1   ? 5.224   -1.400  33.186  1.00 54.12 ? 1   MET G CB   1  
ATOM 10292  C CG   . MET G 2 1   ? 4.289   -0.498  34.019  1.00 5.15  ? 1   MET G CG   1  
ATOM 10293  S SD   . MET G 2 1   ? 5.152   0.838   34.879  1.00 21.02 ? 1   MET G SD   1  
ATOM 10294  C CE   . MET G 2 1   ? 3.781   1.765   35.573  1.00 3.23  ? 1   MET G CE   1  
ATOM 10295  H H1   . MET G 2 1   ? 7.623   -0.209  33.375  1.00 37.61 ? 1   MET G H1   1  
ATOM 10296  H H2   . MET G 2 1   ? 6.484   1.024   33.206  1.00 37.61 ? 1   MET G H2   1  
ATOM 10297  H H3   . MET G 2 1   ? 7.586   0.725   31.969  1.00 37.61 ? 1   MET G H3   1  
ATOM 10298  H HA   . MET G 2 1   ? 6.638   -1.408  31.545  1.00 5.03  ? 1   MET G HA   1  
ATOM 10299  H HB2  . MET G 2 1   ? 4.620   -2.166  32.714  1.00 35.34 ? 1   MET G HB2  1  
ATOM 10300  H HB3  . MET G 2 1   ? 5.913   -1.884  33.868  1.00 72.32 ? 1   MET G HB3  1  
ATOM 10301  H HG2  . MET G 2 1   ? 3.551   -0.060  33.360  1.00 11.13 ? 1   MET G HG2  1  
ATOM 10302  H HG3  . MET G 2 1   ? 3.784   -1.109  34.758  1.00 52.32 ? 1   MET G HG3  1  
ATOM 10303  H HE1  . MET G 2 1   ? 4.166   2.601   36.137  1.00 50.01 ? 1   MET G HE1  1  
ATOM 10304  H HE2  . MET G 2 1   ? 3.205   1.125   36.225  1.00 14.12 ? 1   MET G HE2  1  
ATOM 10305  H HE3  . MET G 2 1   ? 3.150   2.129   34.776  1.00 70.15 ? 1   MET G HE3  1  
ATOM 10306  N N    . LYS G 2 2   ? 4.834   -0.584  29.945  1.00 43.10 ? 2   LYS G N    1  
ATOM 10307  C CA   . LYS G 2 2   ? 3.916   -0.037  28.922  1.00 15.41 ? 2   LYS G CA   1  
ATOM 10308  C C    . LYS G 2 2   ? 2.847   -1.088  28.590  1.00 3.44  ? 2   LYS G C    1  
ATOM 10309  O O    . LYS G 2 2   ? 3.178   -2.173  28.094  1.00 52.35 ? 2   LYS G O    1  
ATOM 10310  C CB   . LYS G 2 2   ? 4.670   0.355   27.615  1.00 53.42 ? 2   LYS G CB   1  
ATOM 10311  C CG   . LYS G 2 2   ? 5.870   1.307   27.800  1.00 53.33 ? 2   LYS G CG   1  
ATOM 10312  C CD   . LYS G 2 2   ? 6.475   1.766   26.449  1.00 62.42 ? 2   LYS G CD   1  
ATOM 10313  C CE   . LYS G 2 2   ? 7.841   2.452   26.605  1.00 32.23 ? 2   LYS G CE   1  
ATOM 10314  N NZ   . LYS G 2 2   ? 8.872   1.510   27.128  1.00 10.44 ? 2   LYS G NZ   1  
ATOM 10315  H H    . LYS G 2 2   ? 5.238   -1.464  29.781  1.00 62.50 ? 2   LYS G H    1  
ATOM 10316  H HA   . LYS G 2 2   ? 3.429   0.848   29.330  1.00 11.41 ? 2   LYS G HA   1  
ATOM 10317  H HB2  . LYS G 2 2   ? 5.036   -0.551  27.140  1.00 42.43 ? 2   LYS G HB2  1  
ATOM 10318  H HB3  . LYS G 2 2   ? 3.964   0.830   26.941  1.00 43.04 ? 2   LYS G HB3  1  
ATOM 10319  H HG2  . LYS G 2 2   ? 5.543   2.183   28.353  1.00 71.42 ? 2   LYS G HG2  1  
ATOM 10320  H HG3  . LYS G 2 2   ? 6.633   0.794   28.375  1.00 23.11 ? 2   LYS G HG3  1  
ATOM 10321  H HD2  . LYS G 2 2   ? 6.598   0.902   25.805  1.00 3.02  ? 2   LYS G HD2  1  
ATOM 10322  H HD3  . LYS G 2 2   ? 5.787   2.460   25.978  1.00 71.12 ? 2   LYS G HD3  1  
ATOM 10323  H HE2  . LYS G 2 2   ? 8.164   2.819   25.640  1.00 75.43 ? 2   LYS G HE2  1  
ATOM 10324  H HE3  . LYS G 2 2   ? 7.748   3.284   27.292  1.00 73.21 ? 2   LYS G HE3  1  
ATOM 10325  H HZ1  . LYS G 2 2   ? 9.788   1.992   27.211  1.00 12.14 ? 2   LYS G HZ1  1  
ATOM 10326  H HZ2  . LYS G 2 2   ? 8.978   0.700   26.480  1.00 21.12 ? 2   LYS G HZ2  1  
ATOM 10327  H HZ3  . LYS G 2 2   ? 8.593   1.153   28.061  1.00 10.10 ? 2   LYS G HZ3  1  
ATOM 10328  N N    . GLN G 2 3   ? 1.574   -0.769  28.855  1.00 61.21 ? 3   GLN G N    1  
ATOM 10329  C CA   . GLN G 2 3   ? 0.441   -1.654  28.532  1.00 44.41 ? 3   GLN G CA   1  
ATOM 10330  C C    . GLN G 2 3   ? -0.039  -1.347  27.095  1.00 14.14 ? 3   GLN G C    1  
ATOM 10331  O O    . GLN G 2 3   ? -1.166  -0.897  26.863  1.00 33.31 ? 3   GLN G O    1  
ATOM 10332  C CB   . GLN G 2 3   ? -0.688  -1.472  29.586  1.00 20.23 ? 3   GLN G CB   1  
ATOM 10333  C CG   . GLN G 2 3   ? -1.830  -2.500  29.494  1.00 1.44  ? 3   GLN G CG   1  
ATOM 10334  C CD   . GLN G 2 3   ? -2.905  -2.294  30.558  1.00 73.33 ? 3   GLN G CD   1  
ATOM 10335  O OE1  . GLN G 2 3   ? -3.882  -1.575  30.346  1.00 41.25 ? 3   GLN G OE1  1  
ATOM 10336  N NE2  . GLN G 2 3   ? -2.720  -2.896  31.721  1.00 22.12 ? 3   GLN G NE2  1  
ATOM 10337  H H    . GLN G 2 3   ? 1.385   0.094   29.277  1.00 74.21 ? 3   GLN G H    1  
ATOM 10338  H HA   . GLN G 2 3   ? 0.792   -2.687  28.566  1.00 3.41  ? 3   GLN G HA   1  
ATOM 10339  H HB2  . GLN G 2 3   ? -0.248  -1.544  30.576  1.00 52.40 ? 3   GLN G HB2  1  
ATOM 10340  H HB3  . GLN G 2 3   ? -1.112  -0.478  29.473  1.00 61.03 ? 3   GLN G HB3  1  
ATOM 10341  H HG2  . GLN G 2 3   ? -2.291  -2.421  28.516  1.00 71.42 ? 3   GLN G HG2  1  
ATOM 10342  H HG3  . GLN G 2 3   ? -1.411  -3.496  29.606  1.00 41.14 ? 3   GLN G HG3  1  
ATOM 10343  H HE21 . GLN G 2 3   ? -1.910  -3.434  31.841  1.00 32.53 ? 3   GLN G HE21 1  
ATOM 10344  H HE22 . GLN G 2 3   ? -3.398  -2.778  32.415  1.00 40.41 ? 3   GLN G HE22 1  
ATOM 10345  N N    . SER G 2 4   ? 0.863   -1.561  26.133  1.00 11.41 ? 4   SER G N    1  
ATOM 10346  C CA   . SER G 2 4   ? 0.635   -1.249  24.711  1.00 14.12 ? 4   SER G CA   1  
ATOM 10347  C C    . SER G 2 4   ? 1.473   -2.189  23.839  1.00 34.53 ? 4   SER G C    1  
ATOM 10348  O O    . SER G 2 4   ? 2.489   -2.732  24.307  1.00 24.03 ? 4   SER G O    1  
ATOM 10349  C CB   . SER G 2 4   ? 0.997   0.234   24.405  1.00 13.41 ? 4   SER G CB   1  
ATOM 10350  O OG   . SER G 2 4   ? 0.215   1.143   25.176  1.00 72.11 ? 4   SER G OG   1  
ATOM 10351  H H    . SER G 2 4   ? 1.724   -1.960  26.385  1.00 1.31  ? 4   SER G H    1  
ATOM 10352  H HA   . SER G 2 4   ? -0.416  -1.415  24.488  1.00 24.14 ? 4   SER G HA   1  
ATOM 10353  H HB2  . SER G 2 4   ? 2.040   0.407   24.633  1.00 51.00 ? 4   SER G HB2  1  
ATOM 10354  H HB3  . SER G 2 4   ? 0.824   0.439   23.354  1.00 52.40 ? 4   SER G HB3  1  
ATOM 10355  H HG   . SER G 2 4   ? -0.520  0.675   25.578  1.00 1.32  ? 4   SER G HG   1  
ATOM 10356  N N    . THR G 2 5   ? 1.040   -2.365  22.574  1.00 62.53 ? 5   THR G N    1  
ATOM 10357  C CA   . THR G 2 5   ? 1.738   -3.201  21.591  1.00 55.23 ? 5   THR G CA   1  
ATOM 10358  C C    . THR G 2 5   ? 3.138   -2.618  21.309  1.00 52.25 ? 5   THR G C    1  
ATOM 10359  O O    . THR G 2 5   ? 3.242   -1.524  20.742  1.00 1.03  ? 5   THR G O    1  
ATOM 10360  C CB   . THR G 2 5   ? 0.933   -3.306  20.248  1.00 24.12 ? 5   THR G CB   1  
ATOM 10361  O OG1  . THR G 2 5   ? -0.418  -3.695  20.525  1.00 51.44 ? 5   THR G OG1  1  
ATOM 10362  C CG2  . THR G 2 5   ? 1.568   -4.320  19.265  1.00 70.22 ? 5   THR G CG2  1  
ATOM 10363  H H    . THR G 2 5   ? 0.221   -1.909  22.293  1.00 71.23 ? 5   THR G H    1  
ATOM 10364  H HA   . THR G 2 5   ? 1.831   -4.206  22.015  1.00 13.25 ? 5   THR G HA   1  
ATOM 10365  H HB   . THR G 2 5   ? 0.916   -2.329  19.776  1.00 73.53 ? 5   THR G HB   1  
ATOM 10366  H HG1  . THR G 2 5   ? -0.416  -4.453  21.121  1.00 64.02 ? 5   THR G HG1  1  
ATOM 10367  H HG21 . THR G 2 5   ? 0.994   -4.354  18.348  1.00 15.43 ? 5   THR G HG21 1  
ATOM 10368  H HG22 . THR G 2 5   ? 1.581   -5.305  19.713  1.00 12.40 ? 5   THR G HG22 1  
ATOM 10369  H HG23 . THR G 2 5   ? 2.585   -4.021  19.038  1.00 75.34 ? 5   THR G HG23 1  
ATOM 10370  N N    . ILE G 2 6   ? 4.170   -3.362  21.763  1.00 20.12 ? 6   ILE G N    1  
ATOM 10371  C CA   . ILE G 2 6   ? 5.619   -3.075  21.605  1.00 21.33 ? 6   ILE G CA   1  
ATOM 10372  C C    . ILE G 2 6   ? 6.043   -1.644  22.057  1.00 61.33 ? 6   ILE G C    1  
ATOM 10373  O O    . ILE G 2 6   ? 6.662   -1.503  23.120  1.00 75.03 ? 6   ILE G O    1  
ATOM 10374  C CB   . ILE G 2 6   ? 6.210   -3.493  20.185  1.00 72.12 ? 6   ILE G CB   1  
ATOM 10375  C CG1  . ILE G 2 6   ? 5.506   -2.789  18.966  1.00 62.24 ? 6   ILE G CG1  1  
ATOM 10376  C CG2  . ILE G 2 6   ? 6.157   -5.033  20.025  1.00 53.40 ? 6   ILE G CG2  1  
ATOM 10377  C CD1  . ILE G 2 6   ? 6.100   -3.081  17.597  1.00 13.22 ? 6   ILE G CD1  1  
ATOM 10378  H H    . ILE G 2 6   ? 3.941   -4.168  22.266  1.00 73.51 ? 6   ILE G H    1  
ATOM 10379  H HA   . ILE G 2 6   ? 6.089   -3.750  22.322  1.00 2.13  ? 6   ILE G HA   1  
ATOM 10380  H HB   . ILE G 2 6   ? 7.264   -3.216  20.179  1.00 61.51 ? 6   ILE G HB   1  
ATOM 10381  H HG12 . ILE G 2 6   ? 4.467   -3.087  18.937  1.00 22.24 ? 6   ILE G HG12 1  
ATOM 10382  H HG13 . ILE G 2 6   ? 5.548   -1.714  19.118  1.00 71.21 ? 6   ILE G HG13 1  
ATOM 10383  H HG21 . ILE G 2 6   ? 6.608   -5.321  19.082  1.00 64.24 ? 6   ILE G HG21 1  
ATOM 10384  H HG22 . ILE G 2 6   ? 5.130   -5.371  20.042  1.00 4.10  ? 6   ILE G HG22 1  
ATOM 10385  H HG23 . ILE G 2 6   ? 6.702   -5.508  20.834  1.00 71.11 ? 6   ILE G HG23 1  
ATOM 10386  H HD11 . ILE G 2 6   ? 6.040   -4.139  17.395  1.00 1.31  ? 6   ILE G HD11 1  
ATOM 10387  H HD12 . ILE G 2 6   ? 7.132   -2.764  17.575  1.00 34.24 ? 6   ILE G HD12 1  
ATOM 10388  H HD13 . ILE G 2 6   ? 5.543   -2.540  16.846  1.00 23.05 ? 6   ILE G HD13 1  
ATOM 10389  N N    . ALA G 2 7   ? 5.691   -0.605  21.263  1.00 13.31 ? 7   ALA G N    1  
ATOM 10390  C CA   . ALA G 2 7   ? 5.961   0.826   21.555  1.00 43.15 ? 7   ALA G CA   1  
ATOM 10391  C C    . ALA G 2 7   ? 7.476   1.172   21.505  1.00 50.51 ? 7   ALA G C    1  
ATOM 10392  O O    . ALA G 2 7   ? 8.294   0.569   22.204  1.00 20.53 ? 7   ALA G O    1  
ATOM 10393  C CB   . ALA G 2 7   ? 5.316   1.277   22.885  1.00 50.33 ? 7   ALA G CB   1  
ATOM 10394  H H    . ALA G 2 7   ? 5.207   -0.810  20.442  1.00 55.41 ? 7   ALA G H    1  
ATOM 10395  H HA   . ALA G 2 7   ? 5.469   1.386   20.765  1.00 30.43 ? 7   ALA G HA   1  
ATOM 10396  H HB1  . ALA G 2 7   ? 5.781   0.761   23.718  1.00 1.23  ? 7   ALA G HB1  1  
ATOM 10397  H HB2  . ALA G 2 7   ? 4.260   1.044   22.871  1.00 53.32 ? 7   ALA G HB2  1  
ATOM 10398  H HB3  . ALA G 2 7   ? 5.443   2.344   23.010  1.00 42.21 ? 7   ALA G HB3  1  
ATOM 10399  N N    . LEU G 2 8   ? 7.828   2.155   20.658  1.00 41.22 ? 8   LEU G N    1  
ATOM 10400  C CA   . LEU G 2 8   ? 9.215   2.631   20.467  1.00 21.34 ? 8   LEU G CA   1  
ATOM 10401  C C    . LEU G 2 8   ? 9.695   3.439   21.701  1.00 54.40 ? 8   LEU G C    1  
ATOM 10402  O O    . LEU G 2 8   ? 8.923   3.694   22.634  1.00 24.20 ? 8   LEU G O    1  
ATOM 10403  C CB   . LEU G 2 8   ? 9.274   3.506   19.179  1.00 62.24 ? 8   LEU G CB   1  
ATOM 10404  C CG   . LEU G 2 8   ? 8.780   2.821   17.855  1.00 31.04 ? 8   LEU G CG   1  
ATOM 10405  C CD1  . LEU G 2 8   ? 8.522   3.859   16.737  1.00 42.32 ? 8   LEU G CD1  1  
ATOM 10406  C CD2  . LEU G 2 8   ? 9.763   1.730   17.378  1.00 42.15 ? 8   LEU G CD2  1  
ATOM 10407  H H    . LEU G 2 8   ? 7.125   2.591   20.148  1.00 2.23  ? 8   LEU G H    1  
ATOM 10408  H HA   . LEU G 2 8   ? 9.858   1.766   20.340  1.00 73.01 ? 8   LEU G HA   1  
ATOM 10409  H HB2  . LEU G 2 8   ? 8.665   4.388   19.354  1.00 52.03 ? 8   LEU G HB2  1  
ATOM 10410  H HB3  . LEU G 2 8   ? 10.299  3.834   19.033  1.00 1.33  ? 8   LEU G HB3  1  
ATOM 10411  H HG   . LEU G 2 8   ? 7.833   2.334   18.054  1.00 51.12 ? 8   LEU G HG   1  
ATOM 10412  H HD11 . LEU G 2 8   ? 7.780   4.572   17.071  1.00 52.12 ? 8   LEU G HD11 1  
ATOM 10413  H HD12 . LEU G 2 8   ? 8.155   3.359   15.850  1.00 31.31 ? 8   LEU G HD12 1  
ATOM 10414  H HD13 . LEU G 2 8   ? 9.440   4.384   16.497  1.00 73.13 ? 8   LEU G HD13 1  
ATOM 10415  H HD21 . LEU G 2 8   ? 10.731  2.170   17.169  1.00 44.13 ? 8   LEU G HD21 1  
ATOM 10416  H HD22 . LEU G 2 8   ? 9.382   1.260   16.484  1.00 55.40 ? 8   LEU G HD22 1  
ATOM 10417  H HD23 . LEU G 2 8   ? 9.872   0.982   18.151  1.00 41.35 ? 8   LEU G HD23 1  
ATOM 10418  N N    . ALA G 2 9   ? 10.974  3.831   21.690  1.00 70.13 ? 9   ALA G N    1  
ATOM 10419  C CA   . ALA G 2 9   ? 11.600  4.631   22.767  1.00 4.10  ? 9   ALA G CA   1  
ATOM 10420  C C    . ALA G 2 9   ? 12.221  5.908   22.184  1.00 62.45 ? 9   ALA G C    1  
ATOM 10421  O O    . ALA G 2 9   ? 12.326  6.047   20.959  1.00 15.53 ? 9   ALA G O    1  
ATOM 10422  C CB   . ALA G 2 9   ? 12.668  3.790   23.494  1.00 0.15  ? 9   ALA G CB   1  
ATOM 10423  H H    . ALA G 2 9   ? 11.528  3.585   20.920  1.00 62.43 ? 9   ALA G H    1  
ATOM 10424  H HA   . ALA G 2 9   ? 10.837  4.915   23.491  1.00 1.31  ? 9   ALA G HA   1  
ATOM 10425  H HB1  . ALA G 2 9   ? 13.448  3.503   22.799  1.00 64.11 ? 9   ALA G HB1  1  
ATOM 10426  H HB2  . ALA G 2 9   ? 12.212  2.897   23.902  1.00 34.43 ? 9   ALA G HB2  1  
ATOM 10427  H HB3  . ALA G 2 9   ? 13.103  4.365   24.303  1.00 63.31 ? 9   ALA G HB3  1  
ATOM 10428  N N    . LEU G 2 10  ? 12.634  6.831   23.077  1.00 1.34  ? 10  LEU G N    1  
ATOM 10429  C CA   . LEU G 2 10  ? 13.355  8.058   22.693  1.00 53.30 ? 10  LEU G CA   1  
ATOM 10430  C C    . LEU G 2 10  ? 14.762  7.733   22.179  1.00 31.41 ? 10  LEU G C    1  
ATOM 10431  O O    . LEU G 2 10  ? 15.308  6.647   22.422  1.00 51.23 ? 10  LEU G O    1  
ATOM 10432  C CB   . LEU G 2 10  ? 13.437  9.069   23.877  1.00 61.01 ? 10  LEU G CB   1  
ATOM 10433  C CG   . LEU G 2 10  ? 12.118  9.819   24.231  1.00 23.33 ? 10  LEU G CG   1  
ATOM 10434  C CD1  . LEU G 2 10  ? 12.332  10.798  25.410  1.00 64.43 ? 10  LEU G CD1  1  
ATOM 10435  C CD2  . LEU G 2 10  ? 11.544  10.548  22.986  1.00 31.02 ? 10  LEU G CD2  1  
ATOM 10436  H H    . LEU G 2 10  ? 12.456  6.674   24.026  1.00 5.20  ? 10  LEU G H    1  
ATOM 10437  H HA   . LEU G 2 10  ? 12.800  8.519   21.881  1.00 11.22 ? 10  LEU G HA   1  
ATOM 10438  H HB2  . LEU G 2 10  ? 13.770  8.527   24.758  1.00 41.33 ? 10  LEU G HB2  1  
ATOM 10439  H HB3  . LEU G 2 10  ? 14.192  9.816   23.643  1.00 14.41 ? 10  LEU G HB3  1  
ATOM 10440  H HG   . LEU G 2 10  ? 11.380  9.091   24.550  1.00 33.22 ? 10  LEU G HG   1  
ATOM 10441  H HD11 . LEU G 2 10  ? 13.062  11.552  25.140  1.00 4.32  ? 10  LEU G HD11 1  
ATOM 10442  H HD12 . LEU G 2 10  ? 12.691  10.251  26.274  1.00 61.31 ? 10  LEU G HD12 1  
ATOM 10443  H HD13 . LEU G 2 10  ? 11.396  11.277  25.664  1.00 44.45 ? 10  LEU G HD13 1  
ATOM 10444  H HD21 . LEU G 2 10  ? 11.325  9.826   22.209  1.00 62.13 ? 10  LEU G HD21 1  
ATOM 10445  H HD22 . LEU G 2 10  ? 12.262  11.265  22.612  1.00 43.42 ? 10  LEU G HD22 1  
ATOM 10446  H HD23 . LEU G 2 10  ? 10.632  11.065  23.254  1.00 41.44 ? 10  LEU G HD23 1  
ATOM 10447  N N    . LEU G 2 11  ? 15.333  8.714   21.486  1.00 55.15 ? 11  LEU G N    1  
ATOM 10448  C CA   . LEU G 2 11  ? 16.629  8.599   20.818  1.00 35.31 ? 11  LEU G CA   1  
ATOM 10449  C C    . LEU G 2 11  ? 17.729  9.199   21.725  1.00 63.22 ? 11  LEU G C    1  
ATOM 10450  O O    . LEU G 2 11  ? 17.493  10.256  22.321  1.00 14.12 ? 11  LEU G O    1  
ATOM 10451  C CB   . LEU G 2 11  ? 16.541  9.348   19.463  1.00 31.30 ? 11  LEU G CB   1  
ATOM 10452  C CG   . LEU G 2 11  ? 15.355  8.915   18.545  1.00 20.41 ? 11  LEU G CG   1  
ATOM 10453  C CD1  . LEU G 2 11  ? 15.180  9.875   17.349  1.00 13.21 ? 11  LEU G CD1  1  
ATOM 10454  C CD2  . LEU G 2 11  ? 15.521  7.445   18.093  1.00 50.24 ? 11  LEU G CD2  1  
ATOM 10455  H H    . LEU G 2 11  ? 14.863  9.571   21.427  1.00 50.14 ? 11  LEU G H    1  
ATOM 10456  H HA   . LEU G 2 11  ? 16.837  7.549   20.632  1.00 42.15 ? 11  LEU G HA   1  
ATOM 10457  H HB2  . LEU G 2 11  ? 16.449  10.413  19.663  1.00 11.31 ? 11  LEU G HB2  1  
ATOM 10458  H HB3  . LEU G 2 11  ? 17.467  9.189   18.918  1.00 74.33 ? 11  LEU G HB3  1  
ATOM 10459  H HG   . LEU G 2 11  ? 14.441  8.971   19.123  1.00 41.44 ? 11  LEU G HG   1  
ATOM 10460  H HD11 . LEU G 2 11  ? 14.351  9.546   16.735  1.00 20.44 ? 11  LEU G HD11 1  
ATOM 10461  H HD12 . LEU G 2 11  ? 16.082  9.895   16.751  1.00 41.11 ? 11  LEU G HD12 1  
ATOM 10462  H HD13 . LEU G 2 11  ? 14.974  10.872  17.716  1.00 72.03 ? 11  LEU G HD13 1  
ATOM 10463  H HD21 . LEU G 2 11  ? 15.549  6.801   18.962  1.00 2.22  ? 11  LEU G HD21 1  
ATOM 10464  H HD22 . LEU G 2 11  ? 16.440  7.328   17.532  1.00 13.22 ? 11  LEU G HD22 1  
ATOM 10465  H HD23 . LEU G 2 11  ? 14.684  7.158   17.468  1.00 63.30 ? 11  LEU G HD23 1  
ATOM 10466  N N    . PRO G 2 12  ? 18.933  8.534   21.855  1.00 34.42 ? 12  PRO G N    1  
ATOM 10467  C CA   . PRO G 2 12  ? 20.063  9.038   22.700  1.00 61.44 ? 12  PRO G CA   1  
ATOM 10468  C C    . PRO G 2 12  ? 20.513  10.452  22.260  1.00 10.12 ? 12  PRO G C    1  
ATOM 10469  O O    . PRO G 2 12  ? 20.705  11.353  23.084  1.00 51.12 ? 12  PRO G O    1  
ATOM 10470  C CB   . PRO G 2 12  ? 21.185  7.973   22.485  1.00 14.24 ? 12  PRO G CB   1  
ATOM 10471  C CG   . PRO G 2 12  ? 20.795  7.232   21.235  1.00 15.05 ? 12  PRO G CG   1  
ATOM 10472  C CD   . PRO G 2 12  ? 19.284  7.246   21.198  1.00 23.34 ? 12  PRO G CD   1  
ATOM 10473  H HA   . PRO G 2 12  ? 19.785  9.070   23.748  1.00 41.11 ? 12  PRO G HA   1  
ATOM 10474  H HB2  . PRO G 2 12  ? 22.159  8.450   22.372  1.00 62.24 ? 12  PRO G HB2  1  
ATOM 10475  H HB3  . PRO G 2 12  ? 21.216  7.289   23.326  1.00 75.14 ? 12  PRO G HB3  1  
ATOM 10476  H HG2  . PRO G 2 12  ? 21.202  7.741   20.363  1.00 3.43  ? 12  PRO G HG2  1  
ATOM 10477  H HG3  . PRO G 2 12  ? 21.159  6.210   21.268  1.00 42.00 ? 12  PRO G HG3  1  
ATOM 10478  H HD2  . PRO G 2 12  ? 18.930  7.223   20.172  1.00 4.13  ? 12  PRO G HD2  1  
ATOM 10479  H HD3  . PRO G 2 12  ? 18.873  6.409   21.752  1.00 72.45 ? 12  PRO G HD3  1  
ATOM 10480  N N    . LEU G 2 13  ? 20.681  10.613  20.940  1.00 73.52 ? 13  LEU G N    1  
ATOM 10481  C CA   . LEU G 2 13  ? 20.855  11.916  20.285  1.00 50.50 ? 13  LEU G CA   1  
ATOM 10482  C C    . LEU G 2 13  ? 19.479  12.338  19.760  1.00 14.42 ? 13  LEU G C    1  
ATOM 10483  O O    . LEU G 2 13  ? 18.747  11.501  19.236  1.00 64.23 ? 13  LEU G O    1  
ATOM 10484  C CB   . LEU G 2 13  ? 21.877  11.834  19.110  1.00 30.53 ? 13  LEU G CB   1  
ATOM 10485  C CG   . LEU G 2 13  ? 23.379  11.548  19.477  1.00 42.02 ? 13  LEU G CG   1  
ATOM 10486  C CD1  . LEU G 2 13  ? 23.596  10.135  20.078  1.00 3.23  ? 13  LEU G CD1  1  
ATOM 10487  C CD2  . LEU G 2 13  ? 24.293  11.775  18.248  1.00 72.13 ? 13  LEU G CD2  1  
ATOM 10488  H H    . LEU G 2 13  ? 20.663  9.816   20.374  1.00 54.43 ? 13  LEU G H    1  
ATOM 10489  H HA   . LEU G 2 13  ? 21.203  12.642  21.018  1.00 73.34 ? 13  LEU G HA   1  
ATOM 10490  H HB2  . LEU G 2 13  ? 21.542  11.058  18.426  1.00 24.23 ? 13  LEU G HB2  1  
ATOM 10491  H HB3  . LEU G 2 13  ? 21.841  12.780  18.577  1.00 62.33 ? 13  LEU G HB3  1  
ATOM 10492  H HG   . LEU G 2 13  ? 23.685  12.258  20.234  1.00 52.04 ? 13  LEU G HG   1  
ATOM 10493  H HD11 . LEU G 2 13  ? 24.636  10.006  20.342  1.00 70.44 ? 13  LEU G HD11 1  
ATOM 10494  H HD12 . LEU G 2 13  ? 23.312  9.378   19.360  1.00 41.02 ? 13  LEU G HD12 1  
ATOM 10495  H HD13 . LEU G 2 13  ? 22.988  10.025  20.968  1.00 45.42 ? 13  LEU G HD13 1  
ATOM 10496  H HD21 . LEU G 2 13  ? 24.017  11.098  17.449  1.00 61.25 ? 13  LEU G HD21 1  
ATOM 10497  H HD22 . LEU G 2 13  ? 25.325  11.600  18.522  1.00 14.14 ? 13  LEU G HD22 1  
ATOM 10498  H HD23 . LEU G 2 13  ? 24.190  12.795  17.905  1.00 15.55 ? 13  LEU G HD23 1  
ATOM 10499  N N    . LEU G 2 14  ? 19.157  13.635  19.840  1.00 10.43 ? 14  LEU G N    1  
ATOM 10500  C CA   . LEU G 2 14  ? 17.799  14.150  19.535  1.00 2.14  ? 14  LEU G CA   1  
ATOM 10501  C C    . LEU G 2 14  ? 17.494  14.189  18.017  1.00 5.15  ? 14  LEU G C    1  
ATOM 10502  O O    . LEU G 2 14  ? 16.459  14.732  17.630  1.00 20.30 ? 14  LEU G O    1  
ATOM 10503  C CB   . LEU G 2 14  ? 17.591  15.561  20.169  1.00 10.35 ? 14  LEU G CB   1  
ATOM 10504  C CG   . LEU G 2 14  ? 17.581  15.643  21.742  1.00 15.14 ? 14  LEU G CG   1  
ATOM 10505  C CD1  . LEU G 2 14  ? 18.994  15.469  22.350  1.00 25.35 ? 14  LEU G CD1  1  
ATOM 10506  C CD2  . LEU G 2 14  ? 16.913  16.955  22.225  1.00 52.44 ? 14  LEU G CD2  1  
ATOM 10507  H H    . LEU G 2 14  ? 19.848  14.272  20.112  1.00 42.43 ? 14  LEU G H    1  
ATOM 10508  H HA   . LEU G 2 14  ? 17.088  13.470  19.990  1.00 52.31 ? 14  LEU G HA   1  
ATOM 10509  H HB2  . LEU G 2 14  ? 18.372  16.218  19.798  1.00 42.00 ? 14  LEU G HB2  1  
ATOM 10510  H HB3  . LEU G 2 14  ? 16.640  15.947  19.811  1.00 35.01 ? 14  LEU G HB3  1  
ATOM 10511  H HG   . LEU G 2 14  ? 16.979  14.826  22.121  1.00 2.24  ? 14  LEU G HG   1  
ATOM 10512  H HD11 . LEU G 2 14  ? 19.653  16.246  21.983  1.00 31.44 ? 14  LEU G HD11 1  
ATOM 10513  H HD12 . LEU G 2 14  ? 19.390  14.503  22.066  1.00 3.14  ? 14  LEU G HD12 1  
ATOM 10514  H HD13 . LEU G 2 14  ? 18.940  15.523  23.429  1.00 43.30 ? 14  LEU G HD13 1  
ATOM 10515  H HD21 . LEU G 2 14  ? 16.887  16.979  23.307  1.00 71.13 ? 14  LEU G HD21 1  
ATOM 10516  H HD22 . LEU G 2 14  ? 15.901  17.002  21.848  1.00 31.10 ? 14  LEU G HD22 1  
ATOM 10517  H HD23 . LEU G 2 14  ? 17.470  17.810  21.859  1.00 2.02  ? 14  LEU G HD23 1  
ATOM 10518  N N    . PHE G 2 15  ? 18.395  13.593  17.190  1.00 40.35 ? 15  PHE G N    1  
ATOM 10519  C CA   . PHE G 2 15  ? 18.261  13.516  15.722  1.00 32.44 ? 15  PHE G CA   1  
ATOM 10520  C C    . PHE G 2 15  ? 18.165  14.928  15.114  1.00 63.42 ? 15  PHE G C    1  
ATOM 10521  O O    . PHE G 2 15  ? 17.081  15.504  15.031  1.00 22.34 ? 15  PHE G O    1  
ATOM 10522  C CB   . PHE G 2 15  ? 17.052  12.617  15.311  1.00 75.24 ? 15  PHE G CB   1  
ATOM 10523  C CG   . PHE G 2 15  ? 16.814  12.523  13.800  1.00 2.43  ? 15  PHE G CG   1  
ATOM 10524  C CD1  . PHE G 2 15  ? 17.604  11.707  13.006  1.00 3.51  ? 15  PHE G CD1  1  
ATOM 10525  C CD2  . PHE G 2 15  ? 15.804  13.254  13.181  1.00 61.02 ? 15  PHE G CD2  1  
ATOM 10526  C CE1  . PHE G 2 15  ? 17.392  11.618  11.646  1.00 30.23 ? 15  PHE G CE1  1  
ATOM 10527  C CE2  . PHE G 2 15  ? 15.592  13.170  11.825  1.00 31.35 ? 15  PHE G CE2  1  
ATOM 10528  C CZ   . PHE G 2 15  ? 16.384  12.350  11.054  1.00 30.10 ? 15  PHE G CZ   1  
ATOM 10529  H H    . PHE G 2 15  ? 19.180  13.183  17.591  1.00 53.02 ? 15  PHE G H    1  
ATOM 10530  H HA   . PHE G 2 15  ? 19.170  13.050  15.356  1.00 54.11 ? 15  PHE G HA   1  
ATOM 10531  H HB2  . PHE G 2 15  ? 17.220  11.613  15.684  1.00 31.12 ? 15  PHE G HB2  1  
ATOM 10532  H HB3  . PHE G 2 15  ? 16.150  13.006  15.775  1.00 15.30 ? 15  PHE G HB3  1  
ATOM 10533  H HD1  . PHE G 2 15  ? 18.393  11.126  13.463  1.00 62.13 ? 15  PHE G HD1  1  
ATOM 10534  H HD2  . PHE G 2 15  ? 15.180  13.902  13.780  1.00 75.31 ? 15  PHE G HD2  1  
ATOM 10535  H HE1  . PHE G 2 15  ? 18.019  10.976  11.042  1.00 43.52 ? 15  PHE G HE1  1  
ATOM 10536  H HE2  . PHE G 2 15  ? 14.799  13.746  11.361  1.00 44.22 ? 15  PHE G HE2  1  
ATOM 10537  H HZ   . PHE G 2 15  ? 16.218  12.279  9.986   1.00 23.14 ? 15  PHE G HZ   1  
ATOM 10538  N N    . THR G 2 16  ? 19.316  15.498  14.727  1.00 22.04 ? 16  THR G N    1  
ATOM 10539  C CA   . THR G 2 16  ? 19.386  16.877  14.226  1.00 4.24  ? 16  THR G CA   1  
ATOM 10540  C C    . THR G 2 16  ? 20.390  17.006  13.056  1.00 4.32  ? 16  THR G C    1  
ATOM 10541  O O    . THR G 2 16  ? 21.577  17.275  13.278  1.00 75.11 ? 16  THR G O    1  
ATOM 10542  C CB   . THR G 2 16  ? 19.721  17.870  15.398  1.00 43.44 ? 16  THR G CB   1  
ATOM 10543  O OG1  . THR G 2 16  ? 20.757  17.309  16.228  1.00 43.34 ? 16  THR G OG1  1  
ATOM 10544  C CG2  . THR G 2 16  ? 18.491  18.184  16.275  1.00 12.41 ? 16  THR G CG2  1  
ATOM 10545  H H    . THR G 2 16  ? 20.145  14.980  14.781  1.00 25.24 ? 16  THR G H    1  
ATOM 10546  H HA   . THR G 2 16  ? 18.406  17.143  13.837  1.00 53.03 ? 16  THR G HA   1  
ATOM 10547  H HB   . THR G 2 16  ? 20.089  18.803  14.978  1.00 3.41  ? 16  THR G HB   1  
ATOM 10548  H HG1  . THR G 2 16  ? 20.363  16.705  16.865  1.00 24.43 ? 16  THR G HG1  1  
ATOM 10549  H HG21 . THR G 2 16  ? 18.771  18.870  17.062  1.00 51.20 ? 16  THR G HG21 1  
ATOM 10550  H HG22 . THR G 2 16  ? 18.112  17.272  16.720  1.00 22.22 ? 16  THR G HG22 1  
ATOM 10551  H HG23 . THR G 2 16  ? 17.713  18.634  15.671  1.00 43.21 ? 16  THR G HG23 1  
ATOM 10552  N N    . PRO G 2 17  ? 19.927  16.762  11.778  1.00 43.12 ? 17  PRO G N    1  
ATOM 10553  C CA   . PRO G 2 17  ? 20.749  17.013  10.562  1.00 42.43 ? 17  PRO G CA   1  
ATOM 10554  C C    . PRO G 2 17  ? 20.939  18.515  10.255  1.00 34.24 ? 17  PRO G C    1  
ATOM 10555  O O    . PRO G 2 17  ? 21.866  18.881  9.525   1.00 32.35 ? 17  PRO G O    1  
ATOM 10556  C CB   . PRO G 2 17  ? 19.938  16.325  9.438   1.00 45.21 ? 17  PRO G CB   1  
ATOM 10557  C CG   . PRO G 2 17  ? 18.516  16.335  9.921   1.00 35.12 ? 17  PRO G CG   1  
ATOM 10558  C CD   . PRO G 2 17  ? 18.600  16.160  11.421  1.00 71.50 ? 17  PRO G CD   1  
ATOM 10559  H HA   . PRO G 2 17  ? 21.725  16.544  10.646  1.00 22.55 ? 17  PRO G HA   1  
ATOM 10560  H HB2  . PRO G 2 17  ? 20.043  16.862  8.495   1.00 45.43 ? 17  PRO G HB2  1  
ATOM 10561  H HB3  . PRO G 2 17  ? 20.278  15.306  9.311   1.00 62.02 ? 17  PRO G HB3  1  
ATOM 10562  H HG2  . PRO G 2 17  ? 18.045  17.284  9.668   1.00 53.53 ? 17  PRO G HG2  1  
ATOM 10563  H HG3  . PRO G 2 17  ? 17.960  15.515  9.478   1.00 70.30 ? 17  PRO G HG3  1  
ATOM 10564  H HD2  . PRO G 2 17  ? 17.788  16.688  11.912  1.00 30.22 ? 17  PRO G HD2  1  
ATOM 10565  H HD3  . PRO G 2 17  ? 18.575  15.109  11.690  1.00 50.12 ? 17  PRO G HD3  1  
ATOM 10566  N N    . VAL G 2 18  ? 20.042  19.363  10.798  1.00 32.12 ? 18  VAL G N    1  
ATOM 10567  C CA   . VAL G 2 18  ? 20.056  20.819  10.549  1.00 5.41  ? 18  VAL G CA   1  
ATOM 10568  C C    . VAL G 2 18  ? 21.322  21.458  11.135  1.00 13.40 ? 18  VAL G C    1  
ATOM 10569  O O    . VAL G 2 18  ? 22.161  21.974  10.390  1.00 64.42 ? 18  VAL G O    1  
ATOM 10570  C CB   . VAL G 2 18  ? 18.757  21.511  11.098  1.00 31.31 ? 18  VAL G CB   1  
ATOM 10571  C CG1  . VAL G 2 18  ? 18.790  23.051  10.914  1.00 21.23 ? 18  VAL G CG1  1  
ATOM 10572  C CG2  . VAL G 2 18  ? 17.511  20.902  10.420  1.00 4.43  ? 18  VAL G CG2  1  
ATOM 10573  H H    . VAL G 2 18  ? 19.348  18.998  11.383  1.00 74.11 ? 18  VAL G H    1  
ATOM 10574  H HA   . VAL G 2 18  ? 20.072  20.954  9.470   1.00 3.43  ? 18  VAL G HA   1  
ATOM 10575  H HB   . VAL G 2 18  ? 18.688  21.306  12.163  1.00 62.44 ? 18  VAL G HB   1  
ATOM 10576  H HG11 . VAL G 2 18  ? 18.899  23.293  9.865   1.00 14.44 ? 18  VAL G HG11 1  
ATOM 10577  H HG12 . VAL G 2 18  ? 19.624  23.467  11.465  1.00 42.44 ? 18  VAL G HG12 1  
ATOM 10578  H HG13 . VAL G 2 18  ? 17.869  23.484  11.288  1.00 73.44 ? 18  VAL G HG13 1  
ATOM 10579  H HG21 . VAL G 2 18  ? 17.499  19.829  10.575  1.00 11.14 ? 18  VAL G HG21 1  
ATOM 10580  H HG22 . VAL G 2 18  ? 17.531  21.107  9.359   1.00 44.54 ? 18  VAL G HG22 1  
ATOM 10581  H HG23 . VAL G 2 18  ? 16.613  21.329  10.848  1.00 33.32 ? 18  VAL G HG23 1  
ATOM 10582  N N    . THR G 2 19  ? 21.454  21.407  12.469  1.00 72.34 ? 19  THR G N    1  
ATOM 10583  C CA   . THR G 2 19  ? 22.675  21.809  13.177  1.00 10.14 ? 19  THR G CA   1  
ATOM 10584  C C    . THR G 2 19  ? 23.162  20.603  14.008  1.00 12.04 ? 19  THR G C    1  
ATOM 10585  O O    . THR G 2 19  ? 23.750  19.678  13.427  1.00 22.13 ? 19  THR G O    1  
ATOM 10586  C CB   . THR G 2 19  ? 22.449  23.105  14.039  1.00 15.31 ? 19  THR G CB   1  
ATOM 10587  O OG1  . THR G 2 19  ? 21.298  22.929  14.872  1.00 44.41 ? 19  THR G OG1  1  
ATOM 10588  C CG2  . THR G 2 19  ? 22.264  24.366  13.168  1.00 32.43 ? 19  THR G CG2  1  
ATOM 10589  H H    . THR G 2 19  ? 20.703  21.079  13.003  1.00 2.22  ? 19  THR G H    1  
ATOM 10590  H HA   . THR G 2 19  ? 23.445  22.032  12.437  1.00 50.11 ? 19  THR G HA   1  
ATOM 10591  H HB   . THR G 2 19  ? 23.313  23.251  14.680  1.00 41.41 ? 19  THR G HB   1  
ATOM 10592  H HG1  . THR G 2 19  ? 20.927  23.792  15.091  1.00 55.23 ? 19  THR G HG1  1  
ATOM 10593  H HG21 . THR G 2 19  ? 22.121  25.233  13.803  1.00 3.43  ? 19  THR G HG21 1  
ATOM 10594  H HG22 . THR G 2 19  ? 21.397  24.247  12.532  1.00 61.22 ? 19  THR G HG22 1  
ATOM 10595  H HG23 . THR G 2 19  ? 23.141  24.519  12.550  1.00 74.32 ? 19  THR G HG23 1  
ATOM 10596  N N    . LYS G 2 20  ? 22.838  20.571  15.320  1.00 3.24  ? 20  LYS G N    1  
ATOM 10597  C CA   . LYS G 2 20  ? 23.207  19.484  16.237  1.00 15.31 ? 20  LYS G CA   1  
ATOM 10598  C C    . LYS G 2 20  ? 22.726  19.877  17.643  1.00 62.50 ? 20  LYS G C    1  
ATOM 10599  O O    . LYS G 2 20  ? 23.468  20.494  18.401  1.00 64.30 ? 20  LYS G O    1  
ATOM 10600  C CB   . LYS G 2 20  ? 24.746  19.214  16.229  1.00 42.41 ? 20  LYS G CB   1  
ATOM 10601  C CG   . LYS G 2 20  ? 25.193  17.917  16.931  1.00 12.33 ? 20  LYS G CG   1  
ATOM 10602  C CD   . LYS G 2 20  ? 26.709  17.696  16.774  1.00 20.03 ? 20  LYS G CD   1  
ATOM 10603  C CE   . LYS G 2 20  ? 27.180  16.331  17.279  1.00 24.31 ? 20  LYS G CE   1  
ATOM 10604  N NZ   . LYS G 2 20  ? 28.630  16.133  17.019  1.00 51.12 ? 20  LYS G NZ   1  
ATOM 10605  H H    . LYS G 2 20  ? 22.323  21.312  15.692  1.00 62.23 ? 20  LYS G H    1  
ATOM 10606  H HA   . LYS G 2 20  ? 22.681  18.583  15.919  1.00 22.41 ? 20  LYS G HA   1  
ATOM 10607  H HB2  . LYS G 2 20  ? 25.072  19.161  15.195  1.00 65.10 ? 20  LYS G HB2  1  
ATOM 10608  H HB3  . LYS G 2 20  ? 25.253  20.052  16.699  1.00 42.15 ? 20  LYS G HB3  1  
ATOM 10609  H HG2  . LYS G 2 20  ? 24.947  17.982  17.987  1.00 22.34 ? 20  LYS G HG2  1  
ATOM 10610  H HG3  . LYS G 2 20  ? 24.665  17.076  16.491  1.00 43.20 ? 20  LYS G HG3  1  
ATOM 10611  H HD2  . LYS G 2 20  ? 26.970  17.780  15.725  1.00 4.44  ? 20  LYS G HD2  1  
ATOM 10612  H HD3  . LYS G 2 20  ? 27.234  18.473  17.327  1.00 33.53 ? 20  LYS G HD3  1  
ATOM 10613  H HE2  . LYS G 2 20  ? 27.003  16.262  18.346  1.00 42.14 ? 20  LYS G HE2  1  
ATOM 10614  H HE3  . LYS G 2 20  ? 26.626  15.552  16.773  1.00 52.23 ? 20  LYS G HE3  1  
ATOM 10615  H HZ1  . LYS G 2 20  ? 28.834  16.273  16.008  1.00 73.21 ? 20  LYS G HZ1  1  
ATOM 10616  H HZ2  . LYS G 2 20  ? 28.922  15.177  17.290  1.00 31.15 ? 20  LYS G HZ2  1  
ATOM 10617  H HZ3  . LYS G 2 20  ? 29.187  16.817  17.566  1.00 24.55 ? 20  LYS G HZ3  1  
ATOM 10618  N N    . ALA G 2 21  ? 21.452  19.597  17.953  1.00 62.14 ? 21  ALA G N    1  
ATOM 10619  C CA   . ALA G 2 21  ? 20.859  19.915  19.261  1.00 15.11 ? 21  ALA G CA   1  
ATOM 10620  C C    . ALA G 2 21  ? 21.017  18.723  20.214  1.00 31.02 ? 21  ALA G C    1  
ATOM 10621  O O    . ALA G 2 21  ? 20.520  17.618  19.940  1.00 32.34 ? 21  ALA G O    1  
ATOM 10622  C CB   . ALA G 2 21  ? 19.388  20.312  19.117  1.00 4.22  ? 21  ALA G CB   1  
ATOM 10623  H H    . ALA G 2 21  ? 20.897  19.154  17.285  1.00 22.31 ? 21  ALA G H    1  
ATOM 10624  H HA   . ALA G 2 21  ? 21.391  20.777  19.676  1.00 33.24 ? 21  ALA G HA   1  
ATOM 10625  H HB1  . ALA G 2 21  ? 18.969  20.557  20.087  1.00 44.30 ? 21  ALA G HB1  1  
ATOM 10626  H HB2  . ALA G 2 21  ? 18.825  19.493  18.684  1.00 22.25 ? 21  ALA G HB2  1  
ATOM 10627  H HB3  . ALA G 2 21  ? 19.304  21.175  18.469  1.00 24.43 ? 21  ALA G HB3  1  
ATOM 10628  N N    . ARG G 2 22  ? 21.726  18.978  21.314  1.00 13.35 ? 22  ARG G N    1  
ATOM 10629  C CA   . ARG G 2 22  ? 22.035  18.007  22.372  1.00 40.04 ? 22  ARG G CA   1  
ATOM 10630  C C    . ARG G 2 22  ? 22.703  18.782  23.535  1.00 25.14 ? 22  ARG G C    1  
ATOM 10631  O O    . ARG G 2 22  ? 22.945  19.991  23.424  1.00 62.41 ? 22  ARG G O    1  
ATOM 10632  C CB   . ARG G 2 22  ? 22.979  16.878  21.822  1.00 1.41  ? 22  ARG G CB   1  
ATOM 10633  C CG   . ARG G 2 22  ? 23.213  15.688  22.783  1.00 14.54 ? 22  ARG G CG   1  
ATOM 10634  C CD   . ARG G 2 22  ? 24.301  14.709  22.303  1.00 51.15 ? 22  ARG G CD   1  
ATOM 10635  N NE   . ARG G 2 22  ? 24.611  13.700  23.336  1.00 33.44 ? 22  ARG G NE   1  
ATOM 10636  C CZ   . ARG G 2 22  ? 25.464  13.873  24.368  1.00 73.54 ? 22  ARG G CZ   1  
ATOM 10637  N NH1  . ARG G 2 22  ? 26.124  15.008  24.534  1.00 64.42 ? 22  ARG G NH1  1  
ATOM 10638  N NH2  . ARG G 2 22  ? 25.639  12.901  25.247  1.00 43.13 ? 22  ARG G NH2  1  
ATOM 10639  H H    . ARG G 2 22  ? 22.057  19.895  21.431  1.00 72.12 ? 22  ARG G H    1  
ATOM 10640  H HA   . ARG G 2 22  ? 21.102  17.574  22.723  1.00 42.54 ? 22  ARG G HA   1  
ATOM 10641  H HB2  . ARG G 2 22  ? 22.546  16.490  20.905  1.00 4.42  ? 22  ARG G HB2  1  
ATOM 10642  H HB3  . ARG G 2 22  ? 23.942  17.318  21.578  1.00 75.21 ? 22  ARG G HB3  1  
ATOM 10643  H HG2  . ARG G 2 22  ? 23.508  16.078  23.752  1.00 21.02 ? 22  ARG G HG2  1  
ATOM 10644  H HG3  . ARG G 2 22  ? 22.281  15.145  22.898  1.00 65.12 ? 22  ARG G HG3  1  
ATOM 10645  H HD2  . ARG G 2 22  ? 23.945  14.196  21.418  1.00 23.40 ? 22  ARG G HD2  1  
ATOM 10646  H HD3  . ARG G 2 22  ? 25.203  15.260  22.058  1.00 53.44 ? 22  ARG G HD3  1  
ATOM 10647  H HE   . ARG G 2 22  ? 24.143  12.839  23.265  1.00 23.51 ? 22  ARG G HE   1  
ATOM 10648  H HH11 . ARG G 2 22  ? 25.996  15.769  23.894  1.00 24.02 ? 22  ARG G HH11 1  
ATOM 10649  H HH12 . ARG G 2 22  ? 26.756  15.112  25.308  1.00 13.33 ? 22  ARG G HH12 1  
ATOM 10650  H HH21 . ARG G 2 22  ? 25.138  12.037  25.153  1.00 62.21 ? 22  ARG G HH21 1  
ATOM 10651  H HH22 . ARG G 2 22  ? 26.277  13.026  26.014  1.00 4.11  ? 22  ARG G HH22 1  
ATOM 10652  N N    . THR G 2 23  ? 22.956  18.112  24.659  1.00 50.53 ? 23  THR G N    1  
ATOM 10653  C CA   . THR G 2 23  ? 23.858  18.626  25.694  1.00 64.13 ? 23  THR G CA   1  
ATOM 10654  C C    . THR G 2 23  ? 25.321  18.569  25.168  1.00 50.23 ? 23  THR G C    1  
ATOM 10655  O O    . THR G 2 23  ? 25.654  17.661  24.402  1.00 64.21 ? 23  THR G O    1  
ATOM 10656  C CB   . THR G 2 23  ? 23.707  17.797  27.013  1.00 3.41  ? 23  THR G CB   1  
ATOM 10657  O OG1  . THR G 2 23  ? 23.877  16.401  26.723  1.00 14.24 ? 23  THR G OG1  1  
ATOM 10658  C CG2  . THR G 2 23  ? 22.330  18.019  27.671  1.00 22.15 ? 23  THR G CG2  1  
ATOM 10659  H H    . THR G 2 23  ? 22.530  17.243  24.803  1.00 14.41 ? 23  THR G H    1  
ATOM 10660  H HA   . THR G 2 23  ? 23.591  19.663  25.898  1.00 54.20 ? 23  THR G HA   1  
ATOM 10661  H HB   . THR G 2 23  ? 24.478  18.102  27.713  1.00 2.34  ? 23  THR G HB   1  
ATOM 10662  H HG1  . THR G 2 23  ? 24.603  16.053  27.248  1.00 41.54 ? 23  THR G HG1  1  
ATOM 10663  H HG21 . THR G 2 23  ? 22.267  17.447  28.589  1.00 4.45  ? 23  THR G HG21 1  
ATOM 10664  H HG22 . THR G 2 23  ? 21.546  17.697  26.998  1.00 13.34 ? 23  THR G HG22 1  
ATOM 10665  H HG23 . THR G 2 23  ? 22.197  19.069  27.897  1.00 22.35 ? 23  THR G HG23 1  
ATOM 10666  N N    . PRO G 2 24  ? 26.208  19.554  25.524  1.00 31.43 ? 24  PRO G N    1  
ATOM 10667  C CA   . PRO G 2 24  ? 27.649  19.533  25.116  1.00 50.04 ? 24  PRO G CA   1  
ATOM 10668  C C    . PRO G 2 24  ? 28.479  18.456  25.860  1.00 43.54 ? 24  PRO G C    1  
ATOM 10669  O O    . PRO G 2 24  ? 29.679  18.309  25.611  1.00 30.43 ? 24  PRO G O    1  
ATOM 10670  C CB   . PRO G 2 24  ? 28.122  20.967  25.461  1.00 72.00 ? 24  PRO G CB   1  
ATOM 10671  C CG   . PRO G 2 24  ? 27.229  21.396  26.583  1.00 22.40 ? 24  PRO G CG   1  
ATOM 10672  C CD   . PRO G 2 24  ? 25.878  20.776  26.304  1.00 22.15 ? 24  PRO G CD   1  
ATOM 10673  H HA   . PRO G 2 24  ? 27.751  19.366  24.049  1.00 52.12 ? 24  PRO G HA   1  
ATOM 10674  H HB2  . PRO G 2 24  ? 29.170  20.970  25.762  1.00 31.53 ? 24  PRO G HB2  1  
ATOM 10675  H HB3  . PRO G 2 24  ? 27.989  21.621  24.608  1.00 52.31 ? 24  PRO G HB3  1  
ATOM 10676  H HG2  . PRO G 2 24  ? 27.627  21.034  27.528  1.00 31.45 ? 24  PRO G HG2  1  
ATOM 10677  H HG3  . PRO G 2 24  ? 27.144  22.478  26.610  1.00 32.23 ? 24  PRO G HG3  1  
ATOM 10678  H HD2  . PRO G 2 24  ? 25.376  20.517  27.230  1.00 33.33 ? 24  PRO G HD2  1  
ATOM 10679  H HD3  . PRO G 2 24  ? 25.255  21.445  25.717  1.00 71.51 ? 24  PRO G HD3  1  
ATOM 10680  N N    . GLU G 2 25  ? 27.819  17.711  26.759  1.00 1.02  ? 25  GLU G N    1  
ATOM 10681  C CA   . GLU G 2 25  ? 28.427  16.663  27.575  1.00 54.51 ? 25  GLU G CA   1  
ATOM 10682  C C    . GLU G 2 25  ? 27.470  15.438  27.606  1.00 64.15 ? 25  GLU G C    1  
ATOM 10683  O O    . GLU G 2 25  ? 26.374  15.535  28.191  1.00 34.32 ? 25  GLU G O    1  
ATOM 10684  C CB   . GLU G 2 25  ? 28.753  17.253  28.983  1.00 63.52 ? 25  GLU G CB   1  
ATOM 10685  C CG   . GLU G 2 25  ? 27.610  18.059  29.650  1.00 33.03 ? 25  GLU G CG   1  
ATOM 10686  C CD   . GLU G 2 25  ? 28.064  18.823  30.899  1.00 10.23 ? 25  GLU G CD   1  
ATOM 10687  O OE1  . GLU G 2 25  ? 28.415  18.174  31.904  1.00 41.15 ? 25  GLU G OE1  1  
ATOM 10688  O OE2  . GLU G 2 25  ? 28.085  20.069  30.880  1.00 64.54 ? 25  GLU G OE2  1  
ATOM 10689  O OXT  . GLU G 2 25  ? 27.788  14.401  26.988  1.00 37.61 ? 25  GLU G OXT  1  
ATOM 10690  H H    . GLU G 2 25  ? 26.868  17.878  26.886  1.00 30.12 ? 25  GLU G H    1  
ATOM 10691  H HA   . GLU G 2 25  ? 29.365  16.361  27.099  1.00 71.33 ? 25  GLU G HA   1  
ATOM 10692  H HB2  . GLU G 2 25  ? 29.031  16.442  29.650  1.00 64.13 ? 25  GLU G HB2  1  
ATOM 10693  H HB3  . GLU G 2 25  ? 29.607  17.912  28.880  1.00 62.40 ? 25  GLU G HB3  1  
ATOM 10694  H HG2  . GLU G 2 25  ? 27.212  18.762  28.922  1.00 42.30 ? 25  GLU G HG2  1  
ATOM 10695  H HG3  . GLU G 2 25  ? 26.817  17.372  29.931  1.00 3.12  ? 25  GLU G HG3  1  
ATOM 10696  N N    . MET H 2 1   ? 19.657  -16.749 -21.698 1.00 14.45 ? 1   MET H N    1  
ATOM 10697  C CA   . MET H 2 1   ? 18.344  -16.069 -21.633 1.00 61.32 ? 1   MET H CA   1  
ATOM 10698  C C    . MET H 2 1   ? 18.232  -15.026 -22.743 1.00 54.43 ? 1   MET H C    1  
ATOM 10699  O O    . MET H 2 1   ? 19.206  -14.731 -23.446 1.00 62.23 ? 1   MET H O    1  
ATOM 10700  C CB   . MET H 2 1   ? 18.152  -15.355 -20.266 1.00 20.21 ? 1   MET H CB   1  
ATOM 10701  C CG   . MET H 2 1   ? 18.268  -16.243 -19.038 1.00 44.14 ? 1   MET H CG   1  
ATOM 10702  S SD   . MET H 2 1   ? 17.981  -15.340 -17.499 1.00 43.01 ? 1   MET H SD   1  
ATOM 10703  C CE   . MET H 2 1   ? 16.314  -14.721 -17.741 1.00 1.11  ? 1   MET H CE   1  
ATOM 10704  H H1   . MET H 2 1   ? 19.711  -17.503 -20.987 1.00 37.61 ? 1   MET H H1   1  
ATOM 10705  H H2   . MET H 2 1   ? 20.419  -16.065 -21.524 1.00 37.61 ? 1   MET H H2   1  
ATOM 10706  H H3   . MET H 2 1   ? 19.793  -17.163 -22.639 1.00 37.61 ? 1   MET H H3   1  
ATOM 10707  H HA   . MET H 2 1   ? 17.570  -16.816 -21.765 1.00 3.22  ? 1   MET H HA   1  
ATOM 10708  H HB2  . MET H 2 1   ? 18.894  -14.574 -20.172 1.00 71.34 ? 1   MET H HB2  1  
ATOM 10709  H HB3  . MET H 2 1   ? 17.169  -14.894 -20.251 1.00 52.25 ? 1   MET H HB3  1  
ATOM 10710  H HG2  . MET H 2 1   ? 17.542  -17.046 -19.107 1.00 52.34 ? 1   MET H HG2  1  
ATOM 10711  H HG3  . MET H 2 1   ? 19.263  -16.671 -19.003 1.00 44.34 ? 1   MET H HG3  1  
ATOM 10712  H HE1  . MET H 2 1   ? 16.006  -14.170 -16.867 1.00 25.04 ? 1   MET H HE1  1  
ATOM 10713  H HE2  . MET H 2 1   ? 15.640  -15.551 -17.899 1.00 34.24 ? 1   MET H HE2  1  
ATOM 10714  H HE3  . MET H 2 1   ? 16.292  -14.070 -18.604 1.00 11.14 ? 1   MET H HE3  1  
ATOM 10715  N N    . LYS H 2 2   ? 17.027  -14.464 -22.869 1.00 63.53 ? 2   LYS H N    1  
ATOM 10716  C CA   . LYS H 2 2   ? 16.762  -13.270 -23.668 1.00 32.40 ? 2   LYS H CA   1  
ATOM 10717  C C    . LYS H 2 2   ? 16.027  -12.287 -22.738 1.00 12.22 ? 2   LYS H C    1  
ATOM 10718  O O    . LYS H 2 2   ? 14.821  -12.044 -22.874 1.00 31.12 ? 2   LYS H O    1  
ATOM 10719  C CB   . LYS H 2 2   ? 15.951  -13.643 -24.943 1.00 51.12 ? 2   LYS H CB   1  
ATOM 10720  C CG   . LYS H 2 2   ? 15.888  -12.536 -26.017 1.00 51.11 ? 2   LYS H CG   1  
ATOM 10721  C CD   . LYS H 2 2   ? 15.181  -13.011 -27.304 1.00 35.02 ? 2   LYS H CD   1  
ATOM 10722  C CE   . LYS H 2 2   ? 15.184  -11.949 -28.412 1.00 34.23 ? 2   LYS H CE   1  
ATOM 10723  N NZ   . LYS H 2 2   ? 14.512  -12.450 -29.633 1.00 11.22 ? 2   LYS H NZ   1  
ATOM 10724  H H    . LYS H 2 2   ? 16.275  -14.870 -22.393 1.00 53.54 ? 2   LYS H H    1  
ATOM 10725  H HA   . LYS H 2 2   ? 17.712  -12.823 -23.964 1.00 64.22 ? 2   LYS H HA   1  
ATOM 10726  H HB2  . LYS H 2 2   ? 16.400  -14.523 -25.393 1.00 22.13 ? 2   LYS H HB2  1  
ATOM 10727  H HB3  . LYS H 2 2   ? 14.936  -13.891 -24.650 1.00 35.33 ? 2   LYS H HB3  1  
ATOM 10728  H HG2  . LYS H 2 2   ? 15.349  -11.684 -25.613 1.00 65.15 ? 2   LYS H HG2  1  
ATOM 10729  H HG3  . LYS H 2 2   ? 16.899  -12.230 -26.263 1.00 1.14  ? 2   LYS H HG3  1  
ATOM 10730  H HD2  . LYS H 2 2   ? 15.684  -13.898 -27.676 1.00 21.34 ? 2   LYS H HD2  1  
ATOM 10731  H HD3  . LYS H 2 2   ? 14.153  -13.264 -27.067 1.00 44.11 ? 2   LYS H HD3  1  
ATOM 10732  H HE2  . LYS H 2 2   ? 14.663  -11.065 -28.066 1.00 0.44  ? 2   LYS H HE2  1  
ATOM 10733  H HE3  . LYS H 2 2   ? 16.208  -11.689 -28.658 1.00 51.02 ? 2   LYS H HE3  1  
ATOM 10734  H HZ1  . LYS H 2 2   ? 14.995  -13.301 -29.985 1.00 12.42 ? 2   LYS H HZ1  1  
ATOM 10735  H HZ2  . LYS H 2 2   ? 14.528  -11.727 -30.379 1.00 24.01 ? 2   LYS H HZ2  1  
ATOM 10736  H HZ3  . LYS H 2 2   ? 13.523  -12.692 -29.424 1.00 42.41 ? 2   LYS H HZ3  1  
ATOM 10737  N N    . GLN H 2 3   ? 16.798  -11.784 -21.749 1.00 41.31 ? 3   GLN H N    1  
ATOM 10738  C CA   . GLN H 2 3   ? 16.292  -10.981 -20.609 1.00 24.22 ? 3   GLN H CA   1  
ATOM 10739  C C    . GLN H 2 3   ? 15.548  -9.727  -21.088 1.00 21.22 ? 3   GLN H C    1  
ATOM 10740  O O    . GLN H 2 3   ? 14.549  -9.313  -20.483 1.00 34.31 ? 3   GLN H O    1  
ATOM 10741  C CB   . GLN H 2 3   ? 17.474  -10.559 -19.688 1.00 24.35 ? 3   GLN H CB   1  
ATOM 10742  C CG   . GLN H 2 3   ? 18.333  -11.733 -19.162 1.00 32.11 ? 3   GLN H CG   1  
ATOM 10743  C CD   . GLN H 2 3   ? 19.537  -11.289 -18.322 1.00 24.35 ? 3   GLN H CD   1  
ATOM 10744  O OE1  . GLN H 2 3   ? 19.506  -10.259 -17.662 1.00 34.20 ? 3   GLN H OE1  1  
ATOM 10745  N NE2  . GLN H 2 3   ? 20.612  -12.060 -18.344 1.00 71.30 ? 3   GLN H NE2  1  
ATOM 10746  H H    . GLN H 2 3   ? 17.759  -11.954 -21.795 1.00 64.05 ? 3   GLN H H    1  
ATOM 10747  H HA   . GLN H 2 3   ? 15.609  -11.606 -20.041 1.00 54.02 ? 3   GLN H HA   1  
ATOM 10748  H HB2  . GLN H 2 3   ? 18.124  -9.884  -20.239 1.00 24.03 ? 3   GLN H HB2  1  
ATOM 10749  H HB3  . GLN H 2 3   ? 17.074  -10.024 -18.831 1.00 32.41 ? 3   GLN H HB3  1  
ATOM 10750  H HG2  . GLN H 2 3   ? 17.713  -12.376 -18.546 1.00 22.11 ? 3   GLN H HG2  1  
ATOM 10751  H HG3  . GLN H 2 3   ? 18.694  -12.302 -20.012 1.00 64.45 ? 3   GLN H HG3  1  
ATOM 10752  H HE21 . GLN H 2 3   ? 20.593  -12.876 -18.889 1.00 4.11  ? 3   GLN H HE21 1  
ATOM 10753  H HE22 . GLN H 2 3   ? 21.383  -11.784 -17.808 1.00 23.42 ? 3   GLN H HE22 1  
ATOM 10754  N N    . SER H 2 4   ? 16.093  -9.122  -22.168 1.00 71.24 ? 4   SER H N    1  
ATOM 10755  C CA   . SER H 2 4   ? 15.540  -7.920  -22.810 1.00 21.22 ? 4   SER H CA   1  
ATOM 10756  C C    . SER H 2 4   ? 15.533  -6.739  -21.820 1.00 13.03 ? 4   SER H C    1  
ATOM 10757  O O    . SER H 2 4   ? 16.262  -6.760  -20.814 1.00 54.31 ? 4   SER H O    1  
ATOM 10758  C CB   . SER H 2 4   ? 14.122  -8.216  -23.372 1.00 22.43 ? 4   SER H CB   1  
ATOM 10759  O OG   . SER H 2 4   ? 14.143  -9.368  -24.193 1.00 53.43 ? 4   SER H OG   1  
ATOM 10760  H H    . SER H 2 4   ? 16.910  -9.505  -22.540 1.00 70.44 ? 4   SER H H    1  
ATOM 10761  H HA   . SER H 2 4   ? 16.199  -7.668  -23.631 1.00 4.14  ? 4   SER H HA   1  
ATOM 10762  H HB2  . SER H 2 4   ? 13.435  -8.395  -22.556 1.00 63.12 ? 4   SER H HB2  1  
ATOM 10763  H HB3  . SER H 2 4   ? 13.775  -7.375  -23.959 1.00 52.42 ? 4   SER H HB3  1  
ATOM 10764  H HG   . SER H 2 4   ? 14.156  -10.149 -23.626 1.00 73.13 ? 4   SER H HG   1  
ATOM 10765  N N    . THR H 2 5   ? 14.760  -5.696  -22.137 1.00 15.41 ? 5   THR H N    1  
ATOM 10766  C CA   . THR H 2 5   ? 14.465  -4.624  -21.191 1.00 64.13 ? 5   THR H CA   1  
ATOM 10767  C C    . THR H 2 5   ? 13.666  -5.193  -19.995 1.00 52.22 ? 5   THR H C    1  
ATOM 10768  O O    . THR H 2 5   ? 14.112  -5.126  -18.849 1.00 54.21 ? 5   THR H O    1  
ATOM 10769  C CB   . THR H 2 5   ? 13.677  -3.479  -21.901 1.00 41.34 ? 5   THR H CB   1  
ATOM 10770  O OG1  . THR H 2 5   ? 14.480  -2.936  -22.962 1.00 70.32 ? 5   THR H OG1  1  
ATOM 10771  C CG2  . THR H 2 5   ? 13.275  -2.354  -20.942 1.00 51.35 ? 5   THR H CG2  1  
ATOM 10772  H H    . THR H 2 5   ? 14.392  -5.636  -23.043 1.00 35.23 ? 5   THR H H    1  
ATOM 10773  H HA   . THR H 2 5   ? 15.410  -4.222  -20.831 1.00 34.23 ? 5   THR H HA   1  
ATOM 10774  H HB   . THR H 2 5   ? 12.776  -3.900  -22.336 1.00 45.41 ? 5   THR H HB   1  
ATOM 10775  H HG1  . THR H 2 5   ? 15.292  -2.565  -22.595 1.00 44.53 ? 5   THR H HG1  1  
ATOM 10776  H HG21 . THR H 2 5   ? 12.635  -2.745  -20.164 1.00 64.50 ? 5   THR H HG21 1  
ATOM 10777  H HG22 . THR H 2 5   ? 12.745  -1.584  -21.488 1.00 14.52 ? 5   THR H HG22 1  
ATOM 10778  H HG23 . THR H 2 5   ? 14.161  -1.923  -20.493 1.00 62.33 ? 5   THR H HG23 1  
ATOM 10779  N N    . ILE H 2 6   ? 12.497  -5.795  -20.308 1.00 33.43 ? 6   ILE H N    1  
ATOM 10780  C CA   . ILE H 2 6   ? 11.589  -6.413  -19.321 1.00 13.11 ? 6   ILE H CA   1  
ATOM 10781  C C    . ILE H 2 6   ? 10.840  -7.604  -19.970 1.00 4.32  ? 6   ILE H C    1  
ATOM 10782  O O    . ILE H 2 6   ? 9.728   -7.451  -20.494 1.00 11.51 ? 6   ILE H O    1  
ATOM 10783  C CB   . ILE H 2 6   ? 10.568  -5.364  -18.690 1.00 1.34  ? 6   ILE H CB   1  
ATOM 10784  C CG1  . ILE H 2 6   ? 9.963   -4.426  -19.798 1.00 32.23 ? 6   ILE H CG1  1  
ATOM 10785  C CG2  . ILE H 2 6   ? 11.222  -4.542  -17.547 1.00 43.32 ? 6   ILE H CG2  1  
ATOM 10786  C CD1  . ILE H 2 6   ? 8.951   -3.401  -19.307 1.00 34.24 ? 6   ILE H CD1  1  
ATOM 10787  H H    . ILE H 2 6   ? 12.239  -5.834  -21.251 1.00 21.33 ? 6   ILE H H    1  
ATOM 10788  H HA   . ILE H 2 6   ? 12.201  -6.813  -18.514 1.00 44.51 ? 6   ILE H HA   1  
ATOM 10789  H HB   . ILE H 2 6   ? 9.752   -5.927  -18.239 1.00 24.03 ? 6   ILE H HB   1  
ATOM 10790  H HG12 . ILE H 2 6   ? 10.765  -3.881  -20.274 1.00 71.22 ? 6   ILE H HG12 1  
ATOM 10791  H HG13 . ILE H 2 6   ? 9.470   -5.039  -20.547 1.00 60.53 ? 6   ILE H HG13 1  
ATOM 10792  H HG21 . ILE H 2 6   ? 11.599  -5.210  -16.782 1.00 72.54 ? 6   ILE H HG21 1  
ATOM 10793  H HG22 . ILE H 2 6   ? 10.491  -3.877  -17.104 1.00 21.33 ? 6   ILE H HG22 1  
ATOM 10794  H HG23 . ILE H 2 6   ? 12.042  -3.953  -17.942 1.00 71.20 ? 6   ILE H HG23 1  
ATOM 10795  H HD11 . ILE H 2 6   ? 9.430   -2.716  -18.623 1.00 24.43 ? 6   ILE H HD11 1  
ATOM 10796  H HD12 . ILE H 2 6   ? 8.138   -3.905  -18.802 1.00 3.03  ? 6   ILE H HD12 1  
ATOM 10797  H HD13 . ILE H 2 6   ? 8.560   -2.853  -20.151 1.00 3.33  ? 6   ILE H HD13 1  
ATOM 10798  N N    . ALA H 2 7   ? 11.489  -8.785  -19.969 1.00 25.31 ? 7   ALA H N    1  
ATOM 10799  C CA   . ALA H 2 7   ? 10.911  -10.026 -20.525 1.00 0.13  ? 7   ALA H CA   1  
ATOM 10800  C C    . ALA H 2 7   ? 11.540  -11.262 -19.862 1.00 11.04 ? 7   ALA H C    1  
ATOM 10801  O O    . ALA H 2 7   ? 12.740  -11.270 -19.562 1.00 12.05 ? 7   ALA H O    1  
ATOM 10802  C CB   . ALA H 2 7   ? 11.100  -10.069 -22.052 1.00 41.21 ? 7   ALA H CB   1  
ATOM 10803  H H    . ALA H 2 7   ? 12.395  -8.826  -19.585 1.00 74.14 ? 7   ALA H H    1  
ATOM 10804  H HA   . ALA H 2 7   ? 9.844   -10.026 -20.315 1.00 42.14 ? 7   ALA H HA   1  
ATOM 10805  H HB1  . ALA H 2 7   ? 12.155  -10.089 -22.289 1.00 40.34 ? 7   ALA H HB1  1  
ATOM 10806  H HB2  . ALA H 2 7   ? 10.657  -9.183  -22.493 1.00 2.45  ? 7   ALA H HB2  1  
ATOM 10807  H HB3  . ALA H 2 7   ? 10.619  -10.947 -22.460 1.00 30.23 ? 7   ALA H HB3  1  
ATOM 10808  N N    . LEU H 2 8   ? 10.707  -12.293 -19.615 1.00 51.23 ? 8   LEU H N    1  
ATOM 10809  C CA   . LEU H 2 8   ? 11.161  -13.571 -19.039 1.00 20.14 ? 8   LEU H CA   1  
ATOM 10810  C C    . LEU H 2 8   ? 11.890  -14.383 -20.128 1.00 2.02  ? 8   LEU H C    1  
ATOM 10811  O O    . LEU H 2 8   ? 13.065  -14.737 -19.973 1.00 60.33 ? 8   LEU H O    1  
ATOM 10812  C CB   . LEU H 2 8   ? 9.958   -14.375 -18.460 1.00 52.50 ? 8   LEU H CB   1  
ATOM 10813  C CG   . LEU H 2 8   ? 9.039   -13.617 -17.440 1.00 71.31 ? 8   LEU H CG   1  
ATOM 10814  C CD1  . LEU H 2 8   ? 7.894   -14.522 -16.940 1.00 41.44 ? 8   LEU H CD1  1  
ATOM 10815  C CD2  . LEU H 2 8   ? 9.842   -13.030 -16.258 1.00 35.32 ? 8   LEU H CD2  1  
ATOM 10816  H H    . LEU H 2 8   ? 9.762   -12.186 -19.834 1.00 31.12 ? 8   LEU H H    1  
ATOM 10817  H HA   . LEU H 2 8   ? 11.853  -13.348 -18.228 1.00 45.53 ? 8   LEU H HA   1  
ATOM 10818  H HB2  . LEU H 2 8   ? 9.337   -14.700 -19.291 1.00 10.41 ? 8   LEU H HB2  1  
ATOM 10819  H HB3  . LEU H 2 8   ? 10.345  -15.261 -17.968 1.00 54.34 ? 8   LEU H HB3  1  
ATOM 10820  H HG   . LEU H 2 8   ? 8.578   -12.784 -17.956 1.00 22.34 ? 8   LEU H HG   1  
ATOM 10821  H HD11 . LEU H 2 8   ? 7.259   -13.970 -16.260 1.00 21.54 ? 8   LEU H HD11 1  
ATOM 10822  H HD12 . LEU H 2 8   ? 8.299   -15.387 -16.428 1.00 50.23 ? 8   LEU H HD12 1  
ATOM 10823  H HD13 . LEU H 2 8   ? 7.304   -14.854 -17.784 1.00 32.14 ? 8   LEU H HD13 1  
ATOM 10824  H HD21 . LEU H 2 8   ? 10.342  -13.824 -15.714 1.00 40.42 ? 8   LEU H HD21 1  
ATOM 10825  H HD22 . LEU H 2 8   ? 9.175   -12.504 -15.591 1.00 43.42 ? 8   LEU H HD22 1  
ATOM 10826  H HD23 . LEU H 2 8   ? 10.583  -12.335 -16.633 1.00 41.51 ? 8   LEU H HD23 1  
ATOM 10827  N N    . ALA H 2 9   ? 11.144  -14.639 -21.234 1.00 63.41 ? 9   ALA H N    1  
ATOM 10828  C CA   . ALA H 2 9   ? 11.621  -15.328 -22.458 1.00 30.14 ? 9   ALA H CA   1  
ATOM 10829  C C    . ALA H 2 9   ? 12.010  -16.801 -22.195 1.00 64.22 ? 9   ALA H C    1  
ATOM 10830  O O    . ALA H 2 9   ? 11.281  -17.723 -22.568 1.00 63.15 ? 9   ALA H O    1  
ATOM 10831  C CB   . ALA H 2 9   ? 12.764  -14.546 -23.139 1.00 31.34 ? 9   ALA H CB   1  
ATOM 10832  H H    . ALA H 2 9   ? 10.213  -14.344 -21.224 1.00 23.31 ? 9   ALA H H    1  
ATOM 10833  H HA   . ALA H 2 9   ? 10.781  -15.329 -23.145 1.00 53.02 ? 9   ALA H HA   1  
ATOM 10834  H HB1  . ALA H 2 9   ? 13.018  -15.012 -24.084 1.00 50.34 ? 9   ALA H HB1  1  
ATOM 10835  H HB2  . ALA H 2 9   ? 13.637  -14.542 -22.500 1.00 14.35 ? 9   ALA H HB2  1  
ATOM 10836  H HB3  . ALA H 2 9   ? 12.453  -13.525 -23.317 1.00 41.23 ? 9   ALA H HB3  1  
ATOM 10837  N N    . LEU H 2 10  ? 13.156  -17.003 -21.545 1.00 72.31 ? 10  LEU H N    1  
ATOM 10838  C CA   . LEU H 2 10  ? 13.690  -18.335 -21.230 1.00 3.21  ? 10  LEU H CA   1  
ATOM 10839  C C    . LEU H 2 10  ? 14.559  -18.202 -19.967 1.00 61.11 ? 10  LEU H C    1  
ATOM 10840  O O    . LEU H 2 10  ? 15.344  -17.255 -19.856 1.00 13.33 ? 10  LEU H O    1  
ATOM 10841  C CB   . LEU H 2 10  ? 14.499  -18.901 -22.455 1.00 72.13 ? 10  LEU H CB   1  
ATOM 10842  C CG   . LEU H 2 10  ? 14.472  -20.459 -22.677 1.00 3.42  ? 10  LEU H CG   1  
ATOM 10843  C CD1  . LEU H 2 10  ? 15.054  -20.833 -24.062 1.00 63.34 ? 10  LEU H CD1  1  
ATOM 10844  C CD2  . LEU H 2 10  ? 15.196  -21.231 -21.545 1.00 32.31 ? 10  LEU H CD2  1  
ATOM 10845  H H    . LEU H 2 10  ? 13.666  -16.219 -21.252 1.00 54.40 ? 10  LEU H H    1  
ATOM 10846  H HA   . LEU H 2 10  ? 12.853  -18.996 -21.015 1.00 41.24 ? 10  LEU H HA   1  
ATOM 10847  H HB2  . LEU H 2 10  ? 14.099  -18.437 -23.352 1.00 62.13 ? 10  LEU H HB2  1  
ATOM 10848  H HB3  . LEU H 2 10  ? 15.535  -18.589 -22.364 1.00 71.21 ? 10  LEU H HB3  1  
ATOM 10849  H HG   . LEU H 2 10  ? 13.439  -20.785 -22.676 1.00 15.01 ? 10  LEU H HG   1  
ATOM 10850  H HD11 . LEU H 2 10  ? 14.992  -21.903 -24.205 1.00 31.02 ? 10  LEU H HD11 1  
ATOM 10851  H HD12 . LEU H 2 10  ? 16.092  -20.526 -24.127 1.00 34.23 ? 10  LEU H HD12 1  
ATOM 10852  H HD13 . LEU H 2 10  ? 14.487  -20.337 -24.838 1.00 43.52 ? 10  LEU H HD13 1  
ATOM 10853  H HD21 . LEU H 2 10  ? 15.133  -22.293 -21.731 1.00 0.52  ? 10  LEU H HD21 1  
ATOM 10854  H HD22 . LEU H 2 10  ? 14.718  -21.013 -20.597 1.00 10.21 ? 10  LEU H HD22 1  
ATOM 10855  H HD23 . LEU H 2 10  ? 16.235  -20.932 -21.494 1.00 54.32 ? 10  LEU H HD23 1  
ATOM 10856  N N    . LEU H 2 11  ? 14.381  -19.137 -19.019 1.00 75.24 ? 11  LEU H N    1  
ATOM 10857  C CA   . LEU H 2 11  ? 15.128  -19.177 -17.745 1.00 34.33 ? 11  LEU H CA   1  
ATOM 10858  C C    . LEU H 2 11  ? 16.629  -19.491 -17.984 1.00 21.41 ? 11  LEU H C    1  
ATOM 10859  O O    . LEU H 2 11  ? 16.962  -20.149 -18.976 1.00 22.03 ? 11  LEU H O    1  
ATOM 10860  C CB   . LEU H 2 11  ? 14.478  -20.233 -16.805 1.00 3.23  ? 11  LEU H CB   1  
ATOM 10861  C CG   . LEU H 2 11  ? 13.014  -19.919 -16.354 1.00 11.35 ? 11  LEU H CG   1  
ATOM 10862  C CD1  . LEU H 2 11  ? 12.412  -21.088 -15.550 1.00 14.23 ? 11  LEU H CD1  1  
ATOM 10863  C CD2  . LEU H 2 11  ? 12.944  -18.592 -15.562 1.00 25.45 ? 11  LEU H CD2  1  
ATOM 10864  H H    . LEU H 2 11  ? 13.720  -19.834 -19.187 1.00 53.23 ? 11  LEU H H    1  
ATOM 10865  H HA   . LEU H 2 11  ? 15.045  -18.197 -17.284 1.00 31.52 ? 11  LEU H HA   1  
ATOM 10866  H HB2  . LEU H 2 11  ? 14.483  -21.191 -17.319 1.00 31.44 ? 11  LEU H HB2  1  
ATOM 10867  H HB3  . LEU H 2 11  ? 15.091  -20.327 -15.915 1.00 54.34 ? 11  LEU H HB3  1  
ATOM 10868  H HG   . LEU H 2 11  ? 12.401  -19.800 -17.241 1.00 13.23 ? 11  LEU H HG   1  
ATOM 10869  H HD11 . LEU H 2 11  ? 12.992  -21.258 -14.650 1.00 22.32 ? 11  LEU H HD11 1  
ATOM 10870  H HD12 . LEU H 2 11  ? 12.423  -21.987 -16.154 1.00 50.33 ? 11  LEU H HD12 1  
ATOM 10871  H HD13 . LEU H 2 11  ? 11.391  -20.860 -15.280 1.00 23.31 ? 11  LEU H HD13 1  
ATOM 10872  H HD21 . LEU H 2 11  ? 13.291  -17.778 -16.188 1.00 51.54 ? 11  LEU H HD21 1  
ATOM 10873  H HD22 . LEU H 2 11  ? 13.566  -18.651 -14.679 1.00 14.14 ? 11  LEU H HD22 1  
ATOM 10874  H HD23 . LEU H 2 11  ? 11.921  -18.397 -15.267 1.00 0.41  ? 11  LEU H HD23 1  
ATOM 10875  N N    . PRO H 2 12  ? 17.560  -19.030 -17.070 1.00 74.33 ? 12  PRO H N    1  
ATOM 10876  C CA   . PRO H 2 12  ? 19.041  -19.203 -17.247 1.00 20.55 ? 12  PRO H CA   1  
ATOM 10877  C C    . PRO H 2 12  ? 19.463  -20.680 -17.343 1.00 32.31 ? 12  PRO H C    1  
ATOM 10878  O O    . PRO H 2 12  ? 20.451  -21.025 -18.005 1.00 33.11 ? 12  PRO H O    1  
ATOM 10879  C CB   . PRO H 2 12  ? 19.638  -18.505 -15.992 1.00 72.41 ? 12  PRO H CB   1  
ATOM 10880  C CG   . PRO H 2 12  ? 18.519  -18.465 -14.989 1.00 12.43 ? 12  PRO H CG   1  
ATOM 10881  C CD   . PRO H 2 12  ? 17.252  -18.311 -15.796 1.00 3.43  ? 12  PRO H CD   1  
ATOM 10882  H HA   . PRO H 2 12  ? 19.381  -18.691 -18.140 1.00 24.14 ? 12  PRO H HA   1  
ATOM 10883  H HB2  . PRO H 2 12  ? 20.496  -19.060 -15.610 1.00 2.21  ? 12  PRO H HB2  1  
ATOM 10884  H HB3  . PRO H 2 12  ? 19.948  -17.496 -16.242 1.00 1.42  ? 12  PRO H HB3  1  
ATOM 10885  H HG2  . PRO H 2 12  ? 18.501  -19.391 -14.420 1.00 33.14 ? 12  PRO H HG2  1  
ATOM 10886  H HG3  . PRO H 2 12  ? 18.640  -17.621 -14.319 1.00 14.11 ? 12  PRO H HG3  1  
ATOM 10887  H HD2  . PRO H 2 12  ? 16.417  -18.775 -15.281 1.00 63.43 ? 12  PRO H HD2  1  
ATOM 10888  H HD3  . PRO H 2 12  ? 17.036  -17.265 -15.986 1.00 4.33  ? 12  PRO H HD3  1  
ATOM 10889  N N    . LEU H 2 13  ? 18.664  -21.528 -16.707 1.00 2.51  ? 13  LEU H N    1  
ATOM 10890  C CA   . LEU H 2 13  ? 18.813  -22.983 -16.718 1.00 40.01 ? 13  LEU H CA   1  
ATOM 10891  C C    . LEU H 2 13  ? 17.398  -23.565 -16.509 1.00 34.43 ? 13  LEU H C    1  
ATOM 10892  O O    . LEU H 2 13  ? 16.548  -22.892 -15.896 1.00 61.12 ? 13  LEU H O    1  
ATOM 10893  C CB   . LEU H 2 13  ? 19.836  -23.407 -15.601 1.00 71.32 ? 13  LEU H CB   1  
ATOM 10894  C CG   . LEU H 2 13  ? 20.468  -24.848 -15.652 1.00 52.34 ? 13  LEU H CG   1  
ATOM 10895  C CD1  . LEU H 2 13  ? 19.495  -25.951 -15.195 1.00 12.44 ? 13  LEU H CD1  1  
ATOM 10896  C CD2  . LEU H 2 13  ? 21.037  -25.159 -17.052 1.00 2.03  ? 13  LEU H CD2  1  
ATOM 10897  H H    . LEU H 2 13  ? 17.917  -21.153 -16.193 1.00 3.41  ? 13  LEU H H    1  
ATOM 10898  H HA   . LEU H 2 13  ? 19.185  -23.289 -17.691 1.00 14.22 ? 13  LEU H HA   1  
ATOM 10899  H HB2  . LEU H 2 13  ? 20.660  -22.695 -15.630 1.00 64.00 ? 13  LEU H HB2  1  
ATOM 10900  H HB3  . LEU H 2 13  ? 19.351  -23.287 -14.639 1.00 24.42 ? 13  LEU H HB3  1  
ATOM 10901  H HG   . LEU H 2 13  ? 21.304  -24.876 -14.963 1.00 75.51 ? 13  LEU H HG   1  
ATOM 10902  H HD11 . LEU H 2 13  ? 18.643  -25.998 -15.863 1.00 55.44 ? 13  LEU H HD11 1  
ATOM 10903  H HD12 . LEU H 2 13  ? 19.149  -25.735 -14.194 1.00 45.54 ? 13  LEU H HD12 1  
ATOM 10904  H HD13 . LEU H 2 13  ? 20.001  -26.909 -15.191 1.00 33.02 ? 13  LEU H HD13 1  
ATOM 10905  H HD21 . LEU H 2 13  ? 21.507  -26.133 -17.048 1.00 43.40 ? 13  LEU H HD21 1  
ATOM 10906  H HD22 . LEU H 2 13  ? 21.772  -24.413 -17.319 1.00 14.21 ? 13  LEU H HD22 1  
ATOM 10907  H HD23 . LEU H 2 13  ? 20.238  -25.151 -17.786 1.00 51.32 ? 13  LEU H HD23 1  
ATOM 10908  N N    . LEU H 2 14  ? 17.134  -24.773 -17.061 1.00 24.43 ? 14  LEU H N    1  
ATOM 10909  C CA   . LEU H 2 14  ? 15.848  -25.481 -16.874 1.00 64.43 ? 14  LEU H CA   1  
ATOM 10910  C C    . LEU H 2 14  ? 15.557  -25.619 -15.371 1.00 30.12 ? 14  LEU H C    1  
ATOM 10911  O O    . LEU H 2 14  ? 16.354  -26.227 -14.650 1.00 10.20 ? 14  LEU H O    1  
ATOM 10912  C CB   . LEU H 2 14  ? 15.875  -26.877 -17.551 1.00 34.23 ? 14  LEU H CB   1  
ATOM 10913  C CG   . LEU H 2 14  ? 16.099  -26.896 -19.096 1.00 0.01  ? 14  LEU H CG   1  
ATOM 10914  C CD1  . LEU H 2 14  ? 16.179  -28.348 -19.631 1.00 42.11 ? 14  LEU H CD1  1  
ATOM 10915  C CD2  . LEU H 2 14  ? 15.006  -26.078 -19.828 1.00 0.05  ? 14  LEU H CD2  1  
ATOM 10916  H H    . LEU H 2 14  ? 17.827  -25.200 -17.598 1.00 75.21 ? 14  LEU H H    1  
ATOM 10917  H HA   . LEU H 2 14  ? 15.070  -24.878 -17.336 1.00 21.35 ? 14  LEU H HA   1  
ATOM 10918  H HB2  . LEU H 2 14  ? 16.668  -27.455 -17.088 1.00 41.13 ? 14  LEU H HB2  1  
ATOM 10919  H HB3  . LEU H 2 14  ? 14.932  -27.376 -17.342 1.00 35.52 ? 14  LEU H HB3  1  
ATOM 10920  H HG   . LEU H 2 14  ? 17.052  -26.426 -19.311 1.00 32.34 ? 14  LEU H HG   1  
ATOM 10921  H HD11 . LEU H 2 14  ? 16.986  -28.873 -19.132 1.00 52.41 ? 14  LEU H HD11 1  
ATOM 10922  H HD12 . LEU H 2 14  ? 16.372  -28.338 -20.694 1.00 22.53 ? 14  LEU H HD12 1  
ATOM 10923  H HD13 . LEU H 2 14  ? 15.247  -28.867 -19.441 1.00 65.52 ? 14  LEU H HD13 1  
ATOM 10924  H HD21 . LEU H 2 14  ? 15.034  -25.051 -19.486 1.00 21.14 ? 14  LEU H HD21 1  
ATOM 10925  H HD22 . LEU H 2 14  ? 14.028  -26.495 -19.621 1.00 30.34 ? 14  LEU H HD22 1  
ATOM 10926  H HD23 . LEU H 2 14  ? 15.187  -26.101 -20.893 1.00 51.03 ? 14  LEU H HD23 1  
ATOM 10927  N N    . PHE H 2 15  ? 14.415  -25.043 -14.950 1.00 1.55  ? 15  PHE H N    1  
ATOM 10928  C CA   . PHE H 2 15  ? 14.078  -24.754 -13.545 1.00 12.23 ? 15  PHE H CA   1  
ATOM 10929  C C    . PHE H 2 15  ? 14.309  -25.981 -12.618 1.00 4.23  ? 15  PHE H C    1  
ATOM 10930  O O    . PHE H 2 15  ? 15.423  -26.163 -12.102 1.00 34.13 ? 15  PHE H O    1  
ATOM 10931  C CB   . PHE H 2 15  ? 12.609  -24.227 -13.497 1.00 25.13 ? 15  PHE H CB   1  
ATOM 10932  C CG   . PHE H 2 15  ? 12.193  -23.525 -12.207 1.00 53.30 ? 15  PHE H CG   1  
ATOM 10933  C CD1  . PHE H 2 15  ? 12.427  -22.161 -12.029 1.00 11.53 ? 15  PHE H CD1  1  
ATOM 10934  C CD2  . PHE H 2 15  ? 11.567  -24.222 -11.180 1.00 53.04 ? 15  PHE H CD2  1  
ATOM 10935  C CE1  . PHE H 2 15  ? 12.054  -21.527 -10.863 1.00 42.25 ? 15  PHE H CE1  1  
ATOM 10936  C CE2  . PHE H 2 15  ? 11.194  -23.587 -10.021 1.00 4.21  ? 15  PHE H CE2  1  
ATOM 10937  C CZ   . PHE H 2 15  ? 11.440  -22.240 -9.859  1.00 24.13 ? 15  PHE H CZ   1  
ATOM 10938  H H    . PHE H 2 15  ? 13.760  -24.792 -15.628 1.00 63.04 ? 15  PHE H H    1  
ATOM 10939  H HA   . PHE H 2 15  ? 14.737  -23.953 -13.221 1.00 4.33  ? 15  PHE H HA   1  
ATOM 10940  H HB2  . PHE H 2 15  ? 12.463  -23.525 -14.307 1.00 2.23  ? 15  PHE H HB2  1  
ATOM 10941  H HB3  . PHE H 2 15  ? 11.935  -25.063 -13.655 1.00 32.42 ? 15  PHE H HB3  1  
ATOM 10942  H HD1  . PHE H 2 15  ? 12.910  -21.597 -12.815 1.00 24.44 ? 15  PHE H HD1  1  
ATOM 10943  H HD2  . PHE H 2 15  ? 11.367  -25.281 -11.300 1.00 1.24  ? 15  PHE H HD2  1  
ATOM 10944  H HE1  . PHE H 2 15  ? 12.242  -20.470 -10.738 1.00 42.32 ? 15  PHE H HE1  1  
ATOM 10945  H HE2  . PHE H 2 15  ? 10.709  -24.146 -9.229  1.00 34.24 ? 15  PHE H HE2  1  
ATOM 10946  H HZ   . PHE H 2 15  ? 11.148  -21.743 -8.942  1.00 33.12 ? 15  PHE H HZ   1  
ATOM 10947  N N    . THR H 2 16  ? 13.278  -26.830 -12.464 1.00 53.24 ? 16  THR H N    1  
ATOM 10948  C CA   . THR H 2 16  ? 13.337  -28.072 -11.675 1.00 34.44 ? 16  THR H CA   1  
ATOM 10949  C C    . THR H 2 16  ? 12.242  -29.043 -12.173 1.00 34.13 ? 16  THR H C    1  
ATOM 10950  O O    . THR H 2 16  ? 11.251  -28.602 -12.766 1.00 34.22 ? 16  THR H O    1  
ATOM 10951  C CB   . THR H 2 16  ? 13.133  -27.832 -10.125 1.00 21.03 ? 16  THR H CB   1  
ATOM 10952  O OG1  . THR H 2 16  ? 11.979  -27.005 -9.909  1.00 73.32 ? 16  THR H OG1  1  
ATOM 10953  C CG2  . THR H 2 16  ? 14.365  -27.213 -9.422  1.00 73.23 ? 16  THR H CG2  1  
ATOM 10954  H H    . THR H 2 16  ? 12.427  -26.615 -12.895 1.00 43.43 ? 16  THR H H    1  
ATOM 10955  H HA   . THR H 2 16  ? 14.306  -28.532 -11.833 1.00 61.54 ? 16  THR H HA   1  
ATOM 10956  H HB   . THR H 2 16  ? 12.935  -28.794 -9.656  1.00 1.53  ? 16  THR H HB   1  
ATOM 10957  H HG1  . THR H 2 16  ? 12.196  -26.305 -9.278  1.00 34.31 ? 16  THR H HG1  1  
ATOM 10958  H HG21 . THR H 2 16  ? 15.221  -27.866 -9.543  1.00 4.14  ? 16  THR H HG21 1  
ATOM 10959  H HG22 . THR H 2 16  ? 14.160  -27.086 -8.368  1.00 14.44 ? 16  THR H HG22 1  
ATOM 10960  H HG23 . THR H 2 16  ? 14.587  -26.249 -9.860  1.00 53.41 ? 16  THR H HG23 1  
ATOM 10961  N N    . PRO H 2 17  ? 12.422  -30.385 -11.977 1.00 33.03 ? 17  PRO H N    1  
ATOM 10962  C CA   . PRO H 2 17  ? 11.328  -31.358 -12.074 1.00 35.45 ? 17  PRO H CA   1  
ATOM 10963  C C    . PRO H 2 17  ? 10.671  -31.543 -10.690 1.00 70.22 ? 17  PRO H C    1  
ATOM 10964  O O    . PRO H 2 17  ? 11.202  -31.077 -9.678  1.00 64.30 ? 17  PRO H O    1  
ATOM 10965  C CB   . PRO H 2 17  ? 12.069  -32.622 -12.552 1.00 42.55 ? 17  PRO H CB   1  
ATOM 10966  C CG   . PRO H 2 17  ? 13.410  -32.551 -11.871 1.00 54.44 ? 17  PRO H CG   1  
ATOM 10967  C CD   . PRO H 2 17  ? 13.707  -31.070 -11.658 1.00 75.12 ? 17  PRO H CD   1  
ATOM 10968  H HA   . PRO H 2 17  ? 10.577  -31.063 -12.803 1.00 35.52 ? 17  PRO H HA   1  
ATOM 10969  H HB2  . PRO H 2 17  ? 11.520  -33.518 -12.265 1.00 21.01 ? 17  PRO H HB2  1  
ATOM 10970  H HB3  . PRO H 2 17  ? 12.196  -32.599 -13.628 1.00 12.53 ? 17  PRO H HB3  1  
ATOM 10971  H HG2  . PRO H 2 17  ? 13.366  -33.074 -10.917 1.00 23.04 ? 17  PRO H HG2  1  
ATOM 10972  H HG3  . PRO H 2 17  ? 14.176  -32.999 -12.496 1.00 53.54 ? 17  PRO H HG3  1  
ATOM 10973  H HD2  . PRO H 2 17  ? 13.993  -30.879 -10.629 1.00 4.22  ? 17  PRO H HD2  1  
ATOM 10974  H HD3  . PRO H 2 17  ? 14.492  -30.738 -12.326 1.00 34.23 ? 17  PRO H HD3  1  
ATOM 10975  N N    . VAL H 2 18  ? 9.513   -32.201 -10.637 1.00 21.41 ? 18  VAL H N    1  
ATOM 10976  C CA   . VAL H 2 18  ? 8.821   -32.460 -9.350  1.00 64.35 ? 18  VAL H CA   1  
ATOM 10977  C C    . VAL H 2 18  ? 9.457   -33.694 -8.648  1.00 22.41 ? 18  VAL H C    1  
ATOM 10978  O O    . VAL H 2 18  ? 9.185   -33.955 -7.474  1.00 50.05 ? 18  VAL H O    1  
ATOM 10979  C CB   . VAL H 2 18  ? 7.268   -32.679 -9.551  1.00 5.13  ? 18  VAL H CB   1  
ATOM 10980  C CG1  . VAL H 2 18  ? 6.498   -32.543 -8.209  1.00 61.24 ? 18  VAL H CG1  1  
ATOM 10981  C CG2  . VAL H 2 18  ? 6.694   -31.727 -10.635 1.00 74.25 ? 18  VAL H CG2  1  
ATOM 10982  H H    . VAL H 2 18  ? 9.110   -32.517 -11.469 1.00 23.15 ? 18  VAL H H    1  
ATOM 10983  H HA   . VAL H 2 18  ? 8.964   -31.586 -8.714  1.00 43.23 ? 18  VAL H HA   1  
ATOM 10984  H HB   . VAL H 2 18  ? 7.119   -33.698 -9.905  1.00 13.14 ? 18  VAL H HB   1  
ATOM 10985  H HG11 . VAL H 2 18  ? 5.442   -32.709 -8.373  1.00 2.53  ? 18  VAL H HG11 1  
ATOM 10986  H HG12 . VAL H 2 18  ? 6.642   -31.552 -7.799  1.00 14.23 ? 18  VAL H HG12 1  
ATOM 10987  H HG13 . VAL H 2 18  ? 6.867   -33.276 -7.500  1.00 14.32 ? 18  VAL H HG13 1  
ATOM 10988  H HG21 . VAL H 2 18  ? 6.820   -30.696 -10.323 1.00 0.13  ? 18  VAL H HG21 1  
ATOM 10989  H HG22 . VAL H 2 18  ? 5.640   -31.927 -10.782 1.00 72.13 ? 18  VAL H HG22 1  
ATOM 10990  H HG23 . VAL H 2 18  ? 7.216   -31.882 -11.571 1.00 24.11 ? 18  VAL H HG23 1  
ATOM 10991  N N    . THR H 2 19  ? 10.344  -34.398 -9.393  1.00 13.31 ? 19  THR H N    1  
ATOM 10992  C CA   . THR H 2 19  ? 10.931  -35.698 -9.024  1.00 41.21 ? 19  THR H CA   1  
ATOM 10993  C C    . THR H 2 19  ? 11.660  -35.643 -7.660  1.00 34.22 ? 19  THR H C    1  
ATOM 10994  O O    . THR H 2 19  ? 11.201  -36.241 -6.684  1.00 33.22 ? 19  THR H O    1  
ATOM 10995  C CB   . THR H 2 19  ? 11.909  -36.170 -10.155 1.00 53.03 ? 19  THR H CB   1  
ATOM 10996  O OG1  . THR H 2 19  ? 11.311  -35.900 -11.430 1.00 51.13 ? 19  THR H OG1  1  
ATOM 10997  C CG2  . THR H 2 19  ? 12.245  -37.671 -10.056 1.00 1.21  ? 19  THR H CG2  1  
ATOM 10998  H H    . THR H 2 19  ? 10.619  -34.018 -10.248 1.00 44.05 ? 19  THR H H    1  
ATOM 10999  H HA   . THR H 2 19  ? 10.117  -36.413 -8.964  1.00 13.03 ? 19  THR H HA   1  
ATOM 11000  H HB   . THR H 2 19  ? 12.833  -35.601 -10.086 1.00 54.44 ? 19  THR H HB   1  
ATOM 11001  H HG1  . THR H 2 19  ? 11.672  -36.498 -12.090 1.00 4.24  ? 19  THR H HG1  1  
ATOM 11002  H HG21 . THR H 2 19  ? 11.341  -38.257 -10.165 1.00 1.42  ? 19  THR H HG21 1  
ATOM 11003  H HG22 . THR H 2 19  ? 12.694  -37.885 -9.095  1.00 25.43 ? 19  THR H HG22 1  
ATOM 11004  H HG23 . THR H 2 19  ? 12.942  -37.942 -10.841 1.00 23.42 ? 19  THR H HG23 1  
ATOM 11005  N N    . LYS H 2 20  ? 12.790  -34.916 -7.611  1.00 65.10 ? 20  LYS H N    1  
ATOM 11006  C CA   . LYS H 2 20  ? 13.539  -34.663 -6.364  1.00 72.14 ? 20  LYS H CA   1  
ATOM 11007  C C    . LYS H 2 20  ? 13.643  -33.149 -6.173  1.00 43.15 ? 20  LYS H C    1  
ATOM 11008  O O    . LYS H 2 20  ? 13.109  -32.591 -5.207  1.00 23.15 ? 20  LYS H O    1  
ATOM 11009  C CB   . LYS H 2 20  ? 14.967  -35.283 -6.410  1.00 53.31 ? 20  LYS H CB   1  
ATOM 11010  C CG   . LYS H 2 20  ? 15.017  -36.818 -6.554  1.00 53.41 ? 20  LYS H CG   1  
ATOM 11011  C CD   . LYS H 2 20  ? 16.469  -37.365 -6.506  1.00 0.51  ? 20  LYS H CD   1  
ATOM 11012  C CE   . LYS H 2 20  ? 16.541  -38.886 -6.720  1.00 23.11 ? 20  LYS H CE   1  
ATOM 11013  N NZ   . LYS H 2 20  ? 16.035  -39.279 -8.060  1.00 74.45 ? 20  LYS H NZ   1  
ATOM 11014  H H    . LYS H 2 20  ? 13.123  -34.518 -8.437  1.00 74.45 ? 20  LYS H H    1  
ATOM 11015  H HA   . LYS H 2 20  ? 12.988  -35.096 -5.528  1.00 61.14 ? 20  LYS H HA   1  
ATOM 11016  H HB2  . LYS H 2 20  ? 15.503  -34.852 -7.250  1.00 21.13 ? 20  LYS H HB2  1  
ATOM 11017  H HB3  . LYS H 2 20  ? 15.490  -35.014 -5.498  1.00 63.41 ? 20  LYS H HB3  1  
ATOM 11018  H HG2  . LYS H 2 20  ? 14.445  -37.267 -5.746  1.00 65.33 ? 20  LYS H HG2  1  
ATOM 11019  H HG3  . LYS H 2 20  ? 14.567  -37.093 -7.501  1.00 12.24 ? 20  LYS H HG3  1  
ATOM 11020  H HD2  . LYS H 2 20  ? 17.051  -36.880 -7.283  1.00 30.54 ? 20  LYS H HD2  1  
ATOM 11021  H HD3  . LYS H 2 20  ? 16.900  -37.125 -5.540  1.00 22.31 ? 20  LYS H HD3  1  
ATOM 11022  H HE2  . LYS H 2 20  ? 17.570  -39.208 -6.630  1.00 34.14 ? 20  LYS H HE2  1  
ATOM 11023  H HE3  . LYS H 2 20  ? 15.945  -39.381 -5.964  1.00 5.14  ? 20  LYS H HE3  1  
ATOM 11024  H HZ1  . LYS H 2 20  ? 16.593  -38.811 -8.805  1.00 72.22 ? 20  LYS H HZ1  1  
ATOM 11025  H HZ2  . LYS H 2 20  ? 15.041  -38.995 -8.163  1.00 64.31 ? 20  LYS H HZ2  1  
ATOM 11026  H HZ3  . LYS H 2 20  ? 16.102  -40.307 -8.187  1.00 21.20 ? 20  LYS H HZ3  1  
ATOM 11027  N N    . ALA H 2 21  ? 14.369  -32.511 -7.132  1.00 72.34 ? 21  ALA H N    1  
ATOM 11028  C CA   . ALA H 2 21  ? 14.572  -31.046 -7.198  1.00 53.42 ? 21  ALA H CA   1  
ATOM 11029  C C    . ALA H 2 21  ? 15.381  -30.500 -6.000  1.00 42.14 ? 21  ALA H C    1  
ATOM 11030  O O    . ALA H 2 21  ? 15.436  -29.284 -5.773  1.00 42.24 ? 21  ALA H O    1  
ATOM 11031  C CB   . ALA H 2 21  ? 13.219  -30.348 -7.341  1.00 51.34 ? 21  ALA H CB   1  
ATOM 11032  H H    . ALA H 2 21  ? 14.784  -33.055 -7.828  1.00 0.30  ? 21  ALA H H    1  
ATOM 11033  H HA   . ALA H 2 21  ? 15.138  -30.849 -8.100  1.00 72.34 ? 21  ALA H HA   1  
ATOM 11034  H HB1  . ALA H 2 21  ? 12.687  -30.755 -8.195  1.00 24.03 ? 21  ALA H HB1  1  
ATOM 11035  H HB2  . ALA H 2 21  ? 13.362  -29.284 -7.488  1.00 41.44 ? 21  ALA H HB2  1  
ATOM 11036  H HB3  . ALA H 2 21  ? 12.628  -30.509 -6.451  1.00 30.32 ? 21  ALA H HB3  1  
ATOM 11037  N N    . ARG H 2 22  ? 16.031  -31.422 -5.274  1.00 31.11 ? 22  ARG H N    1  
ATOM 11038  C CA   . ARG H 2 22  ? 16.810  -31.117 -4.072  1.00 75.43 ? 22  ARG H CA   1  
ATOM 11039  C C    . ARG H 2 22  ? 17.722  -32.305 -3.742  1.00 4.43  ? 22  ARG H C    1  
ATOM 11040  O O    . ARG H 2 22  ? 17.493  -33.432 -4.213  1.00 23.02 ? 22  ARG H O    1  
ATOM 11041  C CB   . ARG H 2 22  ? 15.874  -30.818 -2.859  1.00 32.33 ? 22  ARG H CB   1  
ATOM 11042  C CG   . ARG H 2 22  ? 16.608  -30.259 -1.620  1.00 43.31 ? 22  ARG H CG   1  
ATOM 11043  C CD   . ARG H 2 22  ? 15.717  -30.117 -0.380  1.00 61.32 ? 22  ARG H CD   1  
ATOM 11044  N NE   . ARG H 2 22  ? 16.415  -29.386 0.692   1.00 41.00 ? 22  ARG H NE   1  
ATOM 11045  C CZ   . ARG H 2 22  ? 17.263  -29.926 1.572   1.00 43.51 ? 22  ARG H CZ   1  
ATOM 11046  N NH1  . ARG H 2 22  ? 17.553  -31.217 1.540   1.00 44.22 ? 22  ARG H NH1  1  
ATOM 11047  N NH2  . ARG H 2 22  ? 17.845  -29.155 2.474   1.00 51.54 ? 22  ARG H NH2  1  
ATOM 11048  H H    . ARG H 2 22  ? 15.987  -32.354 -5.565  1.00 11.30 ? 22  ARG H H    1  
ATOM 11049  H HA   . ARG H 2 22  ? 17.427  -30.246 -4.276  1.00 53.42 ? 22  ARG H HA   1  
ATOM 11050  H HB2  . ARG H 2 22  ? 15.131  -30.090 -3.171  1.00 1.34  ? 22  ARG H HB2  1  
ATOM 11051  H HB3  . ARG H 2 22  ? 15.359  -31.731 -2.576  1.00 50.35 ? 22  ARG H HB3  1  
ATOM 11052  H HG2  . ARG H 2 22  ? 17.434  -30.919 -1.375  1.00 51.11 ? 22  ARG H HG2  1  
ATOM 11053  H HG3  . ARG H 2 22  ? 17.010  -29.283 -1.874  1.00 23.34 ? 22  ARG H HG3  1  
ATOM 11054  H HD2  . ARG H 2 22  ? 14.826  -29.563 -0.648  1.00 64.32 ? 22  ARG H HD2  1  
ATOM 11055  H HD3  . ARG H 2 22  ? 15.434  -31.100 -0.021  1.00 62.43 ? 22  ARG H HD3  1  
ATOM 11056  H HE   . ARG H 2 22  ? 16.248  -28.419 0.744   1.00 72.31 ? 22  ARG H HE   1  
ATOM 11057  H HH11 . ARG H 2 22  ? 17.129  -31.816 0.852   1.00 22.52 ? 22  ARG H HH11 1  
ATOM 11058  H HH12 . ARG H 2 22  ? 18.186  -31.608 2.209   1.00 33.24 ? 22  ARG H HH12 1  
ATOM 11059  H HH21 . ARG H 2 22  ? 17.649  -28.172 2.497   1.00 51.03 ? 22  ARG H HH21 1  
ATOM 11060  H HH22 . ARG H 2 22  ? 18.481  -29.549 3.139   1.00 43.30 ? 22  ARG H HH22 1  
ATOM 11061  N N    . THR H 2 23  ? 18.766  -32.031 -2.953  1.00 23.41 ? 23  THR H N    1  
ATOM 11062  C CA   . THR H 2 23  ? 19.557  -33.062 -2.290  1.00 12.24 ? 23  THR H CA   1  
ATOM 11063  C C    . THR H 2 23  ? 18.643  -33.837 -1.297  1.00 70.15 ? 23  THR H C    1  
ATOM 11064  O O    . THR H 2 23  ? 17.958  -33.205 -0.485  1.00 40.03 ? 23  THR H O    1  
ATOM 11065  C CB   . THR H 2 23  ? 20.769  -32.411 -1.557  1.00 11.40 ? 23  THR H CB   1  
ATOM 11066  O OG1  . THR H 2 23  ? 20.304  -31.422 -0.622  1.00 5.31  ? 23  THR H OG1  1  
ATOM 11067  C CG2  . THR H 2 23  ? 21.735  -31.744 -2.556  1.00 4.10  ? 23  THR H CG2  1  
ATOM 11068  H H    . THR H 2 23  ? 19.006  -31.094 -2.806  1.00 31.15 ? 23  THR H H    1  
ATOM 11069  H HA   . THR H 2 23  ? 19.930  -33.744 -3.051  1.00 20.21 ? 23  THR H HA   1  
ATOM 11070  H HB   . THR H 2 23  ? 21.309  -33.182 -1.016  1.00 74.42 ? 23  THR H HB   1  
ATOM 11071  H HG1  . THR H 2 23  ? 20.148  -30.590 -1.080  1.00 11.35 ? 23  THR H HG1  1  
ATOM 11072  H HG21 . THR H 2 23  ? 22.574  -31.318 -2.020  1.00 11.14 ? 23  THR H HG21 1  
ATOM 11073  H HG22 . THR H 2 23  ? 21.222  -30.957 -3.094  1.00 71.11 ? 23  THR H HG22 1  
ATOM 11074  H HG23 . THR H 2 23  ? 22.100  -32.480 -3.261  1.00 52.00 ? 23  THR H HG23 1  
ATOM 11075  N N    . PRO H 2 24  ? 18.616  -35.209 -1.358  1.00 11.55 ? 24  PRO H N    1  
ATOM 11076  C CA   . PRO H 2 24  ? 17.565  -36.046 -0.687  1.00 0.32  ? 24  PRO H CA   1  
ATOM 11077  C C    . PRO H 2 24  ? 17.554  -35.995 0.866   1.00 21.44 ? 24  PRO H C    1  
ATOM 11078  O O    . PRO H 2 24  ? 16.689  -36.613 1.498   1.00 74.32 ? 24  PRO H O    1  
ATOM 11079  C CB   . PRO H 2 24  ? 17.879  -37.489 -1.198  1.00 51.42 ? 24  PRO H CB   1  
ATOM 11080  C CG   . PRO H 2 24  ? 18.787  -37.304 -2.384  1.00 2.22  ? 24  PRO H CG   1  
ATOM 11081  C CD   . PRO H 2 24  ? 19.592  -36.066 -2.082  1.00 35.23 ? 24  PRO H CD   1  
ATOM 11082  H HA   . PRO H 2 24  ? 16.580  -35.756 -1.038  1.00 32.31 ? 24  PRO H HA   1  
ATOM 11083  H HB2  . PRO H 2 24  ? 18.374  -38.072 -0.421  1.00 61.42 ? 24  PRO H HB2  1  
ATOM 11084  H HB3  . PRO H 2 24  ? 16.966  -37.989 -1.500  1.00 20.33 ? 24  PRO H HB3  1  
ATOM 11085  H HG2  . PRO H 2 24  ? 19.437  -38.169 -2.497  1.00 25.31 ? 24  PRO H HG2  1  
ATOM 11086  H HG3  . PRO H 2 24  ? 18.205  -37.157 -3.290  1.00 23.12 ? 24  PRO H HG3  1  
ATOM 11087  H HD2  . PRO H 2 24  ? 20.445  -36.300 -1.449  1.00 33.34 ? 24  PRO H HD2  1  
ATOM 11088  H HD3  . PRO H 2 24  ? 19.924  -35.591 -2.998  1.00 12.12 ? 24  PRO H HD3  1  
ATOM 11089  N N    . GLU H 2 25  ? 18.512  -35.273 1.467   1.00 5.53  ? 25  GLU H N    1  
ATOM 11090  C CA   . GLU H 2 25  ? 18.661  -35.168 2.930   1.00 3.10  ? 25  GLU H CA   1  
ATOM 11091  C C    . GLU H 2 25  ? 18.277  -33.740 3.393   1.00 3.22  ? 25  GLU H C    1  
ATOM 11092  O O    . GLU H 2 25  ? 17.091  -33.507 3.697   1.00 4.13  ? 25  GLU H O    1  
ATOM 11093  C CB   . GLU H 2 25  ? 20.122  -35.539 3.303   1.00 42.50 ? 25  GLU H CB   1  
ATOM 11094  C CG   . GLU H 2 25  ? 20.525  -36.964 2.876   1.00 12.35 ? 25  GLU H CG   1  
ATOM 11095  C CD   . GLU H 2 25  ? 22.023  -37.233 3.042   1.00 12.25 ? 25  GLU H CD   1  
ATOM 11096  O OE1  . GLU H 2 25  ? 22.423  -37.917 4.007   1.00 2.14  ? 25  GLU H OE1  1  
ATOM 11097  O OE2  . GLU H 2 25  ? 22.810  -36.756 2.200   1.00 70.03 ? 25  GLU H OE2  1  
ATOM 11098  O OXT  . GLU H 2 25  ? 19.149  -32.845 3.411   1.00 37.61 ? 25  GLU H OXT  1  
ATOM 11099  H H    . GLU H 2 25  ? 19.143  -34.784 0.907   1.00 32.21 ? 25  GLU H H    1  
ATOM 11100  H HA   . GLU H 2 25  ? 17.991  -35.886 3.403   1.00 3.22  ? 25  GLU H HA   1  
ATOM 11101  H HB2  . GLU H 2 25  ? 20.789  -34.834 2.820   1.00 53.11 ? 25  GLU H HB2  1  
ATOM 11102  H HB3  . GLU H 2 25  ? 20.247  -35.455 4.377   1.00 72.44 ? 25  GLU H HB3  1  
ATOM 11103  H HG2  . GLU H 2 25  ? 19.963  -37.679 3.472   1.00 15.23 ? 25  GLU H HG2  1  
ATOM 11104  H HG3  . GLU H 2 25  ? 20.260  -37.103 1.832   1.00 52.45 ? 25  GLU H HG3  1  
ATOM 11105  N N    . MET A 1 1   ? 6.266   33.598  28.611  1.00 54.00 ? 1   MET A N    2  
ATOM 11106  C CA   . MET A 1 1   ? 6.051   33.887  27.167  1.00 63.51 ? 1   MET A CA   2  
ATOM 11107  C C    . MET A 1 1   ? 6.243   32.614  26.341  1.00 73.41 ? 1   MET A C    2  
ATOM 11108  O O    . MET A 1 1   ? 6.746   31.611  26.864  1.00 1.41  ? 1   MET A O    2  
ATOM 11109  C CB   . MET A 1 1   ? 6.993   35.017  26.675  1.00 10.31 ? 1   MET A CB   2  
ATOM 11110  C CG   . MET A 1 1   ? 6.714   36.377  27.321  1.00 22.43 ? 1   MET A CG   2  
ATOM 11111  S SD   . MET A 1 1   ? 4.996   36.894  27.104  1.00 1.33  ? 1   MET A SD   2  
ATOM 11112  C CE   . MET A 1 1   ? 5.006   38.519  27.861  1.00 21.22 ? 1   MET A CE   2  
ATOM 11113  H H1   . MET A 1 1   ? 7.219   33.207  28.756  1.00 37.77 ? 1   MET A H1   2  
ATOM 11114  H H2   . MET A 1 1   ? 5.568   32.903  28.939  1.00 37.77 ? 1   MET A H2   2  
ATOM 11115  H H3   . MET A 1 1   ? 6.168   34.461  29.179  1.00 37.77 ? 1   MET A H3   2  
ATOM 11116  H HA   . MET A 1 1   ? 5.020   34.212  27.051  1.00 62.30 ? 1   MET A HA   2  
ATOM 11117  H HB2  . MET A 1 1   ? 8.017   34.738  26.890  1.00 12.44 ? 1   MET A HB2  2  
ATOM 11118  H HB3  . MET A 1 1   ? 6.883   35.128  25.596  1.00 45.15 ? 1   MET A HB3  2  
ATOM 11119  H HG2  . MET A 1 1   ? 6.922   36.311  28.382  1.00 65.24 ? 1   MET A HG2  2  
ATOM 11120  H HG3  . MET A 1 1   ? 7.362   37.122  26.874  1.00 10.10 ? 1   MET A HG3  2  
ATOM 11121  H HE1  . MET A 1 1   ? 5.718   39.150  27.349  1.00 31.35 ? 1   MET A HE1  2  
ATOM 11122  H HE2  . MET A 1 1   ? 5.283   38.433  28.902  1.00 24.32 ? 1   MET A HE2  2  
ATOM 11123  H HE3  . MET A 1 1   ? 4.021   38.957  27.786  1.00 73.53 ? 1   MET A HE3  2  
ATOM 11124  N N    . SER A 1 2   ? 5.856   32.685  25.045  1.00 40.41 ? 2   SER A N    2  
ATOM 11125  C CA   . SER A 1 2   ? 5.731   31.521  24.134  1.00 14.43 ? 2   SER A CA   2  
ATOM 11126  C C    . SER A 1 2   ? 4.632   30.577  24.654  1.00 33.04 ? 2   SER A C    2  
ATOM 11127  O O    . SER A 1 2   ? 3.502   30.600  24.160  1.00 13.31 ? 2   SER A O    2  
ATOM 11128  C CB   . SER A 1 2   ? 7.079   30.773  23.923  1.00 50.44 ? 2   SER A CB   2  
ATOM 11129  O OG   . SER A 1 2   ? 8.071   31.657  23.454  1.00 62.42 ? 2   SER A OG   2  
ATOM 11130  H H    . SER A 1 2   ? 5.631   33.567  24.686  1.00 12.02 ? 2   SER A H    2  
ATOM 11131  H HA   . SER A 1 2   ? 5.406   31.912  23.173  1.00 13.15 ? 2   SER A HA   2  
ATOM 11132  H HB2  . SER A 1 2   ? 7.413   30.344  24.861  1.00 42.13 ? 2   SER A HB2  2  
ATOM 11133  H HB3  . SER A 1 2   ? 6.946   29.982  23.194  1.00 62.13 ? 2   SER A HB3  2  
ATOM 11134  H HG   . SER A 1 2   ? 8.111   31.610  22.489  1.00 64.01 ? 2   SER A HG   2  
ATOM 11135  N N    . GLU A 1 3   ? 4.975   29.790  25.689  1.00 33.14 ? 3   GLU A N    2  
ATOM 11136  C CA   . GLU A 1 3   ? 4.035   28.915  26.411  1.00 23.44 ? 3   GLU A CA   2  
ATOM 11137  C C    . GLU A 1 3   ? 3.323   29.680  27.551  1.00 44.20 ? 3   GLU A C    2  
ATOM 11138  O O    . GLU A 1 3   ? 3.725   30.793  27.936  1.00 62.41 ? 3   GLU A O    2  
ATOM 11139  C CB   . GLU A 1 3   ? 4.787   27.657  26.982  1.00 60.15 ? 3   GLU A CB   2  
ATOM 11140  C CG   . GLU A 1 3   ? 4.716   26.393  26.092  1.00 24.11 ? 3   GLU A CG   2  
ATOM 11141  C CD   . GLU A 1 3   ? 3.271   25.893  25.836  1.00 75.22 ? 3   GLU A CD   2  
ATOM 11142  O OE1  . GLU A 1 3   ? 2.975   25.452  24.705  1.00 43.14 ? 3   GLU A OE1  2  
ATOM 11143  O OE2  . GLU A 1 3   ? 2.425   25.953  26.768  1.00 71.41 ? 3   GLU A OE2  2  
ATOM 11144  H H    . GLU A 1 3   ? 5.906   29.807  25.993  1.00 61.55 ? 3   GLU A H    2  
ATOM 11145  H HA   . GLU A 1 3   ? 3.277   28.583  25.703  1.00 53.33 ? 3   GLU A HA   2  
ATOM 11146  H HB2  . GLU A 1 3   ? 5.833   27.905  27.123  1.00 23.23 ? 3   GLU A HB2  2  
ATOM 11147  H HB3  . GLU A 1 3   ? 4.372   27.395  27.953  1.00 3.45  ? 3   GLU A HB3  2  
ATOM 11148  H HG2  . GLU A 1 3   ? 5.190   26.614  25.141  1.00 52.41 ? 3   GLU A HG2  2  
ATOM 11149  H HG3  . GLU A 1 3   ? 5.272   25.596  26.578  1.00 40.15 ? 3   GLU A HG3  2  
ATOM 11150  N N    . GLN A 1 4   ? 2.255   29.051  28.060  1.00 31.13 ? 4   GLN A N    2  
ATOM 11151  C CA   . GLN A 1 4   ? 1.513   29.497  29.265  1.00 24.21 ? 4   GLN A CA   2  
ATOM 11152  C C    . GLN A 1 4   ? 0.944   28.266  30.020  1.00 71.14 ? 4   GLN A C    2  
ATOM 11153  O O    . GLN A 1 4   ? 0.365   28.395  31.106  1.00 25.11 ? 4   GLN A O    2  
ATOM 11154  C CB   . GLN A 1 4   ? 0.372   30.479  28.854  1.00 41.10 ? 4   GLN A CB   2  
ATOM 11155  C CG   . GLN A 1 4   ? -0.799  29.822  28.090  1.00 2.33  ? 4   GLN A CG   2  
ATOM 11156  C CD   . GLN A 1 4   ? -1.835  30.816  27.556  1.00 14.34 ? 4   GLN A CD   2  
ATOM 11157  O OE1  . GLN A 1 4   ? -2.034  31.894  28.111  1.00 43.53 ? 4   GLN A OE1  2  
ATOM 11158  N NE2  . GLN A 1 4   ? -2.522  30.448  26.487  1.00 51.34 ? 4   GLN A NE2  2  
ATOM 11159  H H    . GLN A 1 4   ? 1.936   28.248  27.593  1.00 31.54 ? 4   GLN A H    2  
ATOM 11160  H HA   . GLN A 1 4   ? 2.204   30.013  29.928  1.00 43.45 ? 4   GLN A HA   2  
ATOM 11161  H HB2  . GLN A 1 4   ? -0.024  30.949  29.751  1.00 21.15 ? 4   GLN A HB2  2  
ATOM 11162  H HB3  . GLN A 1 4   ? 0.796   31.255  28.225  1.00 3.01  ? 4   GLN A HB3  2  
ATOM 11163  H HG2  . GLN A 1 4   ? -0.394  29.262  27.257  1.00 23.33 ? 4   GLN A HG2  2  
ATOM 11164  H HG3  . GLN A 1 4   ? -1.302  29.133  28.761  1.00 51.44 ? 4   GLN A HG3  2  
ATOM 11165  H HE21 . GLN A 1 4   ? -2.339  29.565  26.095  1.00 3.45  ? 4   GLN A HE21 2  
ATOM 11166  H HE22 . GLN A 1 4   ? -3.188  31.069  26.135  1.00 42.12 ? 4   GLN A HE22 2  
ATOM 11167  N N    . ASN A 1 5   ? 1.141   27.069  29.430  1.00 53.22 ? 5   ASN A N    2  
ATOM 11168  C CA   . ASN A 1 5   ? 0.609   25.781  29.927  1.00 73.34 ? 5   ASN A CA   2  
ATOM 11169  C C    . ASN A 1 5   ? 1.781   24.876  30.354  1.00 75.42 ? 5   ASN A C    2  
ATOM 11170  O O    . ASN A 1 5   ? 2.930   25.121  29.960  1.00 33.44 ? 5   ASN A O    2  
ATOM 11171  C CB   . ASN A 1 5   ? -0.223  25.119  28.792  1.00 13.24 ? 5   ASN A CB   2  
ATOM 11172  C CG   . ASN A 1 5   ? -0.874  23.784  29.155  1.00 54.54 ? 5   ASN A CG   2  
ATOM 11173  O OD1  . ASN A 1 5   ? -1.262  23.552  30.295  1.00 23.35 ? 5   ASN A OD1  2  
ATOM 11174  N ND2  . ASN A 1 5   ? -1.000  22.893  28.184  1.00 43.54 ? 5   ASN A ND2  2  
ATOM 11175  H H    . ASN A 1 5   ? 1.701   27.040  28.624  1.00 34.13 ? 5   ASN A H    2  
ATOM 11176  H HA   . ASN A 1 5   ? -0.034  25.967  30.789  1.00 52.14 ? 5   ASN A HA   2  
ATOM 11177  H HB2  . ASN A 1 5   ? -1.017  25.796  28.499  1.00 51.01 ? 5   ASN A HB2  2  
ATOM 11178  H HB3  . ASN A 1 5   ? 0.424   24.962  27.931  1.00 41.14 ? 5   ASN A HB3  2  
ATOM 11179  H HD21 . ASN A 1 5   ? -0.668  23.132  27.291  1.00 21.32 ? 5   ASN A HD21 2  
ATOM 11180  H HD22 . ASN A 1 5   ? -1.433  22.039  28.395  1.00 23.21 ? 5   ASN A HD22 2  
ATOM 11181  N N    . ASN A 1 6   ? 1.500   23.849  31.182  1.00 33.35 ? 6   ASN A N    2  
ATOM 11182  C CA   . ASN A 1 6   ? 2.509   22.874  31.637  1.00 40.11 ? 6   ASN A CA   2  
ATOM 11183  C C    . ASN A 1 6   ? 2.036   21.430  31.325  1.00 3.45  ? 6   ASN A C    2  
ATOM 11184  O O    . ASN A 1 6   ? 2.348   20.903  30.251  1.00 2.24  ? 6   ASN A O    2  
ATOM 11185  C CB   . ASN A 1 6   ? 2.831   23.097  33.143  1.00 14.14 ? 6   ASN A CB   2  
ATOM 11186  C CG   . ASN A 1 6   ? 3.866   22.109  33.698  1.00 72.54 ? 6   ASN A CG   2  
ATOM 11187  O OD1  . ASN A 1 6   ? 5.075   22.318  33.572  1.00 61.02 ? 6   ASN A OD1  2  
ATOM 11188  N ND2  . ASN A 1 6   ? 3.400   21.047  34.336  1.00 2.40  ? 6   ASN A ND2  2  
ATOM 11189  H H    . ASN A 1 6   ? 0.577   23.741  31.495  1.00 53.34 ? 6   ASN A H    2  
ATOM 11190  H HA   . ASN A 1 6   ? 3.424   23.049  31.069  1.00 71.00 ? 6   ASN A HA   2  
ATOM 11191  H HB2  . ASN A 1 6   ? 3.214   24.102  33.276  1.00 30.21 ? 6   ASN A HB2  2  
ATOM 11192  H HB3  . ASN A 1 6   ? 1.913   23.002  33.718  1.00 33.50 ? 6   ASN A HB3  2  
ATOM 11193  H HD21 . ASN A 1 6   ? 2.431   20.951  34.425  1.00 30.44 ? 6   ASN A HD21 2  
ATOM 11194  H HD22 . ASN A 1 6   ? 4.043   20.392  34.682  1.00 54.41 ? 6   ASN A HD22 2  
ATOM 11195  N N    . THR A 1 7   ? 1.233   20.815  32.228  1.00 0.34  ? 7   THR A N    2  
ATOM 11196  C CA   . THR A 1 7   ? 0.828   19.389  32.118  1.00 74.31 ? 7   THR A CA   2  
ATOM 11197  C C    . THR A 1 7   ? -0.462  19.131  32.938  1.00 32.34 ? 7   THR A C    2  
ATOM 11198  O O    . THR A 1 7   ? -0.435  19.146  34.172  1.00 25.11 ? 7   THR A O    2  
ATOM 11199  C CB   . THR A 1 7   ? 1.965   18.409  32.623  1.00 44.54 ? 7   THR A CB   2  
ATOM 11200  O OG1  . THR A 1 7   ? 3.210   18.681  31.952  1.00 61.33 ? 7   THR A OG1  2  
ATOM 11201  C CG2  . THR A 1 7   ? 1.598   16.925  32.403  1.00 24.23 ? 7   THR A CG2  2  
ATOM 11202  H H    . THR A 1 7   ? 0.886   21.335  32.983  1.00 71.34 ? 7   THR A H    2  
ATOM 11203  H HA   . THR A 1 7   ? 0.629   19.171  31.067  1.00 61.55 ? 7   THR A HA   2  
ATOM 11204  H HB   . THR A 1 7   ? 2.114   18.575  33.687  1.00 22.22 ? 7   THR A HB   2  
ATOM 11205  H HG1  . THR A 1 7   ? 3.033   18.965  31.050  1.00 44.03 ? 7   THR A HG1  2  
ATOM 11206  H HG21 . THR A 1 7   ? 2.391   16.292  32.783  1.00 12.21 ? 7   THR A HG21 2  
ATOM 11207  H HG22 . THR A 1 7   ? 1.467   16.733  31.346  1.00 30.45 ? 7   THR A HG22 2  
ATOM 11208  H HG23 . THR A 1 7   ? 0.678   16.695  32.925  1.00 43.11 ? 7   THR A HG23 2  
ATOM 11209  N N    . GLU A 1 8   ? -1.582  18.903  32.233  1.00 73.05 ? 8   GLU A N    2  
ATOM 11210  C CA   . GLU A 1 8   ? -2.893  18.547  32.826  1.00 65.15 ? 8   GLU A CA   2  
ATOM 11211  C C    . GLU A 1 8   ? -3.547  17.435  31.997  1.00 65.02 ? 8   GLU A C    2  
ATOM 11212  O O    . GLU A 1 8   ? -3.128  17.178  30.858  1.00 13.12 ? 8   GLU A O    2  
ATOM 11213  C CB   . GLU A 1 8   ? -3.824  19.794  32.904  1.00 65.14 ? 8   GLU A CB   2  
ATOM 11214  C CG   . GLU A 1 8   ? -3.494  20.776  34.046  1.00 34.13 ? 8   GLU A CG   2  
ATOM 11215  C CD   . GLU A 1 8   ? -3.749  20.178  35.444  1.00 30.21 ? 8   GLU A CD   2  
ATOM 11216  O OE1  . GLU A 1 8   ? -4.923  19.896  35.773  1.00 3.05  ? 8   GLU A OE1  2  
ATOM 11217  O OE2  . GLU A 1 8   ? -2.788  19.993  36.223  1.00 51.51 ? 8   GLU A OE2  2  
ATOM 11218  H H    . GLU A 1 8   ? -1.530  18.966  31.256  1.00 21.34 ? 8   GLU A H    2  
ATOM 11219  H HA   . GLU A 1 8   ? -2.725  18.164  33.832  1.00 5.22  ? 8   GLU A HA   2  
ATOM 11220  H HB2  . GLU A 1 8   ? -3.763  20.335  31.966  1.00 61.52 ? 8   GLU A HB2  2  
ATOM 11221  H HB3  . GLU A 1 8   ? -4.853  19.467  33.038  1.00 72.31 ? 8   GLU A HB3  2  
ATOM 11222  H HG2  . GLU A 1 8   ? -2.447  21.061  33.965  1.00 11.51 ? 8   GLU A HG2  2  
ATOM 11223  H HG3  . GLU A 1 8   ? -4.103  21.666  33.933  1.00 32.02 ? 8   GLU A HG3  2  
ATOM 11224  N N    . MET A 1 9   ? -4.558  16.772  32.607  1.00 41.44 ? 9   MET A N    2  
ATOM 11225  C CA   . MET A 1 9   ? -5.344  15.671  31.991  1.00 11.35 ? 9   MET A CA   2  
ATOM 11226  C C    . MET A 1 9   ? -4.467  14.388  31.835  1.00 61.42 ? 9   MET A C    2  
ATOM 11227  O O    . MET A 1 9   ? -3.259  14.402  32.113  1.00 15.44 ? 9   MET A O    2  
ATOM 11228  C CB   . MET A 1 9   ? -6.002  16.166  30.642  1.00 4.10  ? 9   MET A CB   2  
ATOM 11229  C CG   . MET A 1 9   ? -6.897  15.161  29.887  1.00 1.12  ? 9   MET A CG   2  
ATOM 11230  S SD   . MET A 1 9   ? -7.785  15.901  28.495  1.00 12.21 ? 9   MET A SD   2  
ATOM 11231  C CE   . MET A 1 9   ? -8.952  16.958  29.342  1.00 34.22 ? 9   MET A CE   2  
ATOM 11232  H H    . MET A 1 9   ? -4.780  17.032  33.527  1.00 35.24 ? 9   MET A H    2  
ATOM 11233  H HA   . MET A 1 9   ? -6.139  15.437  32.695  1.00 50.35 ? 9   MET A HA   2  
ATOM 11234  H HB2  . MET A 1 9   ? -6.609  17.039  30.857  1.00 72.33 ? 9   MET A HB2  2  
ATOM 11235  H HB3  . MET A 1 9   ? -5.204  16.476  29.969  1.00 25.13 ? 9   MET A HB3  2  
ATOM 11236  H HG2  . MET A 1 9   ? -6.277  14.363  29.502  1.00 12.01 ? 9   MET A HG2  2  
ATOM 11237  H HG3  . MET A 1 9   ? -7.620  14.749  30.576  1.00 14.41 ? 9   MET A HG3  2  
ATOM 11238  H HE1  . MET A 1 9   ? -9.566  17.469  28.614  1.00 2.32  ? 9   MET A HE1  2  
ATOM 11239  H HE2  . MET A 1 9   ? -8.416  17.686  29.932  1.00 72.51 ? 9   MET A HE2  2  
ATOM 11240  H HE3  . MET A 1 9   ? -9.584  16.363  29.988  1.00 14.41 ? 9   MET A HE3  2  
ATOM 11241  N N    . THR A 1 10  ? -5.085  13.269  31.433  1.00 75.42 ? 10  THR A N    2  
ATOM 11242  C CA   . THR A 1 10  ? -4.389  12.007  31.145  1.00 23.23 ? 10  THR A CA   2  
ATOM 11243  C C    . THR A 1 10  ? -4.977  11.425  29.852  1.00 74.33 ? 10  THR A C    2  
ATOM 11244  O O    . THR A 1 10  ? -6.163  11.080  29.787  1.00 64.35 ? 10  THR A O    2  
ATOM 11245  C CB   . THR A 1 10  ? -4.546  10.997  32.331  1.00 75.44 ? 10  THR A CB   2  
ATOM 11246  O OG1  . THR A 1 10  ? -4.063  11.608  33.542  1.00 71.15 ? 10  THR A OG1  2  
ATOM 11247  C CG2  . THR A 1 10  ? -3.775  9.685   32.090  1.00 72.32 ? 10  THR A CG2  2  
ATOM 11248  H H    . THR A 1 10  ? -6.059  13.275  31.362  1.00 1.31  ? 10  THR A H    2  
ATOM 11249  H HA   . THR A 1 10  ? -3.327  12.210  31.001  1.00 43.22 ? 10  THR A HA   2  
ATOM 11250  H HB   . THR A 1 10  ? -5.600  10.765  32.457  1.00 23.42 ? 10  THR A HB   2  
ATOM 11251  H HG1  . THR