data_5JTO
# 
_entry.id   5JTO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5JTO         
WWPDB D_1000221104 
BMRB  30083        
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
BMRB . 30083 unspecified 
PDB  . 5JTL  unspecified 
PDB  . 5JTM  unspecified 
PDB  . 5JTN  unspecified 
PDB  . 5JTQ  unspecified 
PDB  . 5JTP  unspecified 
PDB  . 5JTR  unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        5JTO 
_pdbx_database_status.recvd_initial_deposition_date   2016-05-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Huang, C.'       1 
'Saio, T.'        2 
'Rossi, P.'       3 
'Kalodimos, C.G.' 4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            537 
_citation.language                  ? 
_citation.page_first                202 
_citation.page_last                 206 
_citation.title                     'Structural basis for the antifolding activity of a molecular chaperone.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature18965 
_citation.pdbx_database_id_PubMed   27501151 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Huang, C.'       1 
primary 'Rossi, P.'       2 
primary 'Saio, T.'        3 
primary 'Kalodimos, C.G.' 4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protein-export protein SecB' 17287.266 4 ?       ? ?                  ? 
2 polymer man 'Alkaline phosphatase'        4325.987  4 3.1.3.1 ? 'residues 271-310' ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        APase 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQ
GGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA
;
;MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQ
GGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA
;
A,B,C,D ? 
2 'polypeptide(L)' no no ANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTP ANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTP E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLU n 
1 4   GLN n 
1 5   ASN n 
1 6   ASN n 
1 7   THR n 
1 8   GLU n 
1 9   MET n 
1 10  THR n 
1 11  PHE n 
1 12  GLN n 
1 13  ILE n 
1 14  GLN n 
1 15  ARG n 
1 16  ILE n 
1 17  TYR n 
1 18  THR n 
1 19  LYS n 
1 20  ASP n 
1 21  ILE n 
1 22  SER n 
1 23  PHE n 
1 24  GLU n 
1 25  ALA n 
1 26  PRO n 
1 27  ASN n 
1 28  ALA n 
1 29  PRO n 
1 30  HIS n 
1 31  VAL n 
1 32  PHE n 
1 33  GLN n 
1 34  LYS n 
1 35  ASP n 
1 36  TRP n 
1 37  GLN n 
1 38  PRO n 
1 39  GLU n 
1 40  VAL n 
1 41  LYS n 
1 42  LEU n 
1 43  ASP n 
1 44  LEU n 
1 45  ASP n 
1 46  THR n 
1 47  ALA n 
1 48  SER n 
1 49  SER n 
1 50  GLN n 
1 51  LEU n 
1 52  ALA n 
1 53  ASP n 
1 54  ASP n 
1 55  VAL n 
1 56  TYR n 
1 57  GLU n 
1 58  VAL n 
1 59  VAL n 
1 60  LEU n 
1 61  ARG n 
1 62  VAL n 
1 63  THR n 
1 64  VAL n 
1 65  THR n 
1 66  ALA n 
1 67  SER n 
1 68  LEU n 
1 69  GLY n 
1 70  GLU n 
1 71  GLU n 
1 72  THR n 
1 73  ALA n 
1 74  PHE n 
1 75  LEU n 
1 76  CYS n 
1 77  GLU n 
1 78  VAL n 
1 79  GLN n 
1 80  GLN n 
1 81  GLY n 
1 82  GLY n 
1 83  ILE n 
1 84  PHE n 
1 85  SER n 
1 86  ILE n 
1 87  ALA n 
1 88  GLY n 
1 89  ILE n 
1 90  GLU n 
1 91  GLY n 
1 92  THR n 
1 93  GLN n 
1 94  MET n 
1 95  ALA n 
1 96  HIS n 
1 97  CYS n 
1 98  LEU n 
1 99  GLY n 
1 100 ALA n 
1 101 TYR n 
1 102 CYS n 
1 103 PRO n 
1 104 ASN n 
1 105 ILE n 
1 106 LEU n 
1 107 PHE n 
1 108 PRO n 
1 109 TYR n 
1 110 ALA n 
1 111 ARG n 
1 112 GLU n 
1 113 CYS n 
1 114 ILE n 
1 115 THR n 
1 116 SER n 
1 117 MET n 
1 118 VAL n 
1 119 SER n 
1 120 ARG n 
1 121 GLY n 
1 122 THR n 
1 123 PHE n 
1 124 PRO n 
1 125 GLN n 
1 126 LEU n 
1 127 ASN n 
1 128 LEU n 
1 129 ALA n 
1 130 PRO n 
1 131 VAL n 
1 132 ASN n 
1 133 PHE n 
1 134 ASP n 
1 135 ALA n 
1 136 LEU n 
1 137 PHE n 
1 138 MET n 
1 139 ASN n 
1 140 TYR n 
1 141 LEU n 
1 142 GLN n 
1 143 GLN n 
1 144 GLN n 
1 145 ALA n 
1 146 GLY n 
1 147 GLU n 
1 148 GLY n 
1 149 THR n 
1 150 GLU n 
1 151 GLU n 
1 152 HIS n 
1 153 GLN n 
1 154 ASP n 
1 155 ALA n 
2 1   ALA n 
2 2   ASN n 
2 3   GLN n 
2 4   GLN n 
2 5   LYS n 
2 6   PRO n 
2 7   LEU n 
2 8   LEU n 
2 9   GLY n 
2 10  LEU n 
2 11  PHE n 
2 12  ALA n 
2 13  ASP n 
2 14  GLY n 
2 15  ASN n 
2 16  MET n 
2 17  PRO n 
2 18  VAL n 
2 19  ARG n 
2 20  TRP n 
2 21  LEU n 
2 22  GLY n 
2 23  PRO n 
2 24  LYS n 
2 25  ALA n 
2 26  THR n 
2 27  TYR n 
2 28  HIS n 
2 29  GLY n 
2 30  ASN n 
2 31  ILE n 
2 32  ASP n 
2 33  LYS n 
2 34  PRO n 
2 35  ALA n 
2 36  VAL n 
2 37  THR n 
2 38  CYS n 
2 39  THR n 
2 40  PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 155 ? ? 'secB, Z5036, ECs4487' ? ?   ? ? ? ? 'Escherichia coli O157:H7'      83334 ? ? ? ? ? ? 
? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 40  ? ? 'phoA, b0383, JW0374'  ? K12 ? ? ? ? 'Escherichia coli (strain K12)' 83333 ? ? ? ? ? ? 
? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP SECB_ECO57 P0AG88 ? 1 
;MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQ
GGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA
;
1   
2 UNP PPB_ECOLI  P00634 ? 2 ANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTP 271 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5JTO A 1 ? 155 ? P0AG88 1   ? 155 ? 1   155 
2 1 5JTO B 1 ? 155 ? P0AG88 1   ? 155 ? 1   155 
3 1 5JTO C 1 ? 155 ? P0AG88 1   ? 155 ? 1   155 
4 1 5JTO D 1 ? 155 ? P0AG88 1   ? 155 ? 1   155 
5 2 5JTO E 1 ? 40  ? P00634 271 ? 310 ? 271 310 
6 2 5JTO F 1 ? 40  ? P00634 271 ? 310 ? 271 310 
7 2 5JTO G 1 ? 40  ? P00634 271 ? 310 ? 271 310 
8 2 5JTO H 1 ? 40  ? P00634 271 ? 310 ? 271 310 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1 1 1 '2D 1H-15N HSQC'            1 isotropic 
2 1 1 '2D 1H-13C HSQC aliphatic'  1 isotropic 
3 1 1 '2D 1H-13C HSQC aromatic'   2 isotropic 
4 1 1 '3D 1H-13C NOESY aliphatic' 2 isotropic 
5 1 1 '3D 1H-13C NOESY aromatic'  2 isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            301 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         150 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  condition_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;300 uM [U-100% 13C; U-100% 15N] E.coli chaperone SecB, 300 uM [U-100% 13C; U-100% 15N] E.coli Alkaline Phosphatase (PhoA) binding site d, 150 mM potassium chloride, 50 mM sodium phosphate, 50 mM potassium phosphate, 90% H2O/10% D2O
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
_pdbx_nmr_sample_details.label            Sample_1 
_pdbx_nmr_sample_details.type             solution 
_pdbx_nmr_sample_details.details          
;1H,13C-ILVMAT methyl labelling otherwise uniformly deuterated, 12C and 15N
Specific labelling of aromatic residues
;
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 AvanceIII ? Bruker 700 ? 
2 INOVA     ? Varian 900 ? 
# 
_pdbx_nmr_refine.entry_id           5JTO 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      5JTO 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             5JTO 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 refinement                  CNS     ? 'Brunger, Adams, Clore, Gros, Nilges and Read'      
2 'structure calculation'     CYANA   ? 'Guntert, Mumenthaler and Wuthrich'                 
3 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific'                      
4 processing                  NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5JTO 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5JTO 
_struct.title                        'The structure of chaperone SecB in complex with unstructured proPhoA binding site d' 
_struct.pdbx_descriptor              'Protein-export protein SecB, Alkaline phosphatase (E.C.3.1.3.1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5JTO 
_struct_keywords.text            'Molecular chaperone, CHAPERONE-HYDROLASE complex' 
_struct_keywords.pdbx_keywords   CHAPERONE/HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 27  ? PHE A 32  ? ASN A 27  PHE A 32  1 ? 6  
HELX_P HELX_P2  AA2 GLU A 90  ? ALA A 100 ? GLU A 90  ALA A 100 1 ? 11 
HELX_P HELX_P3  AA3 ALA A 100 ? GLY A 121 ? ALA A 100 GLY A 121 1 ? 22 
HELX_P HELX_P4  AA4 ASN A 132 ? GLN A 142 ? ASN A 132 GLN A 142 1 ? 11 
HELX_P HELX_P5  AA5 HIS B 30  ? LYS B 34  ? HIS B 30  LYS B 34  5 ? 5  
HELX_P HELX_P6  AA6 GLU B 90  ? GLY B 99  ? GLU B 90  GLY B 99  1 ? 10 
HELX_P HELX_P7  AA7 ALA B 100 ? GLY B 121 ? ALA B 100 GLY B 121 1 ? 22 
HELX_P HELX_P8  AA8 ASN B 132 ? LEU B 141 ? ASN B 132 LEU B 141 1 ? 10 
HELX_P HELX_P9  AA9 PRO C 29  ? LYS C 34  ? PRO C 29  LYS C 34  5 ? 6  
HELX_P HELX_P10 AB1 GLU C 90  ? GLY C 99  ? GLU C 90  GLY C 99  1 ? 10 
HELX_P HELX_P11 AB2 ALA C 100 ? GLY C 121 ? ALA C 100 GLY C 121 1 ? 22 
HELX_P HELX_P12 AB3 PHE C 133 ? LEU C 141 ? PHE C 133 LEU C 141 1 ? 9  
HELX_P HELX_P13 AB4 ASN D 27  ? PHE D 32  ? ASN D 27  PHE D 32  1 ? 6  
HELX_P HELX_P14 AB5 GLN D 33  ? ASP D 35  ? GLN D 33  ASP D 35  5 ? 3  
HELX_P HELX_P15 AB6 GLU D 90  ? ALA D 100 ? GLU D 90  ALA D 100 1 ? 11 
HELX_P HELX_P16 AB7 ALA D 100 ? GLY D 121 ? ALA D 100 GLY D 121 1 ? 22 
HELX_P HELX_P17 AB8 ASN D 132 ? GLN D 142 ? ASN D 132 GLN D 142 1 ? 11 
HELX_P HELX_P18 AB9 GLY F 22  ? THR F 26  ? GLY F 292 THR F 296 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 7 ? 
AA3 ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA3 6 7 ? anti-parallel 
AA3 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU A 39 ? ALA A 52 ? GLU A 39 ALA A 52 
AA1 2 VAL A 55 ? LEU A 68 ? VAL A 55 LEU A 68 
AA1 3 GLU A 71 ? ALA A 87 ? GLU A 71 ALA A 87 
AA1 4 THR A 10 ? GLU A 24 ? THR A 10 GLU A 24 
AA1 5 ILE B 13 ? GLU B 24 ? ILE B 13 GLU B 24 
AA1 6 GLU B 71 ? SER B 85 ? GLU B 71 SER B 85 
AA1 7 VAL B 55 ? LEU B 68 ? VAL B 55 LEU B 68 
AA1 8 GLU B 39 ? ALA B 52 ? GLU B 39 ALA B 52 
AA2 1 GLU C 39 ? ALA C 52 ? GLU C 39 ALA C 52 
AA2 2 VAL C 55 ? SER C 67 ? VAL C 55 SER C 67 
AA2 3 THR C 72 ? ALA C 87 ? THR C 72 ALA C 87 
AA2 4 THR C 10 ? GLU C 24 ? THR C 10 GLU C 24 
AA2 5 ASP D 20 ? GLU D 24 ? ASP D 20 GLU D 24 
AA2 6 GLU D 71 ? ALA D 87 ? GLU D 71 ALA D 87 
AA2 7 THR D 10 ? THR D 18 ? THR D 10 THR D 18 
AA3 1 GLU C 39 ? ALA C 52 ? GLU C 39 ALA C 52 
AA3 2 VAL C 55 ? SER C 67 ? VAL C 55 SER C 67 
AA3 3 THR C 72 ? ALA C 87 ? THR C 72 ALA C 87 
AA3 4 THR C 10 ? GLU C 24 ? THR C 10 GLU C 24 
AA3 5 ASP D 20 ? GLU D 24 ? ASP D 20 GLU D 24 
AA3 6 GLU D 71 ? ALA D 87 ? GLU D 71 ALA D 87 
AA3 7 VAL D 55 ? LEU D 68 ? VAL D 55 LEU D 68 
AA3 8 GLU D 39 ? ALA D 52 ? GLU D 39 ALA D 52 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 47 ? N ALA A 47 O VAL A 59 ? O VAL A 59 
AA1 2 3 N LEU A 68 ? N LEU A 68 O GLU A 71 ? O GLU A 71 
AA1 3 4 O SER A 85 ? O SER A 85 N GLN A 12 ? N GLN A 12 
AA1 4 5 N PHE A 23 ? N PHE A 23 O ILE B 21 ? O ILE B 21 
AA1 5 6 N LYS B 19 ? N LYS B 19 O GLN B 79 ? O GLN B 79 
AA1 6 7 O GLY B 82 ? O GLY B 82 N VAL B 58 ? N VAL B 58 
AA1 7 8 O VAL B 59 ? O VAL B 59 N ALA B 47 ? N ALA B 47 
AA2 1 2 N ASP C 43 ? N ASP C 43 O THR C 63 ? O THR C 63 
AA2 2 3 N VAL C 62 ? N VAL C 62 O VAL C 78 ? O VAL C 78 
AA2 3 4 O ILE C 83 ? O ILE C 83 N ARG C 15 ? N ARG C 15 
AA2 4 5 N PHE C 23 ? N PHE C 23 O ILE D 21 ? O ILE D 21 
AA2 5 6 N GLU D 24 ? N GLU D 24 O LEU D 75 ? O LEU D 75 
AA2 6 7 O ALA D 87 ? O ALA D 87 N THR D 10 ? N THR D 10 
AA3 1 2 N ASP C 43 ? N ASP C 43 O THR C 63 ? O THR C 63 
AA3 2 3 N VAL C 62 ? N VAL C 62 O VAL C 78 ? O VAL C 78 
AA3 3 4 O ILE C 83 ? O ILE C 83 N ARG C 15 ? N ARG C 15 
AA3 4 5 N PHE C 23 ? N PHE C 23 O ILE D 21 ? O ILE D 21 
AA3 5 6 N GLU D 24 ? N GLU D 24 O LEU D 75 ? O LEU D 75 
AA3 6 7 O CYS D 76 ? O CYS D 76 N VAL D 64 ? N VAL D 64 
AA3 7 8 O VAL D 59 ? O VAL D 59 N ALA D 47 ? N ALA D 47 
# 
_atom_sites.entry_id                    5JTO 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . MET A 1 1   ? -36.366 -24.555 2.052   1.00 22.43 ? 1   MET A N    1  
ATOM 2      C CA   . MET A 1 1   ? -37.646 -23.870 2.312   1.00 61.45 ? 1   MET A CA   1  
ATOM 3      C C    . MET A 1 1   ? -38.349 -23.560 0.982   1.00 74.32 ? 1   MET A C    1  
ATOM 4      O O    . MET A 1 1   ? -39.380 -24.166 0.666   1.00 52.43 ? 1   MET A O    1  
ATOM 5      C CB   . MET A 1 1   ? -37.422 -22.583 3.160   1.00 44.33 ? 1   MET A CB   1  
ATOM 6      C CG   . MET A 1 1   ? -36.881 -22.850 4.573   1.00 34.52 ? 1   MET A CG   1  
ATOM 7      S SD   . MET A 1 1   ? -36.655 -21.345 5.547   1.00 44.23 ? 1   MET A SD   1  
ATOM 8      C CE   . MET A 1 1   ? -35.996 -22.007 7.084   1.00 72.21 ? 1   MET A CE   1  
ATOM 9      H H1   . MET A 1 1   ? -35.903 -24.811 2.940   1.00 37.99 ? 1   MET A H1   1  
ATOM 10     H H2   . MET A 1 1   ? -35.734 -23.938 1.512   1.00 37.99 ? 1   MET A H2   1  
ATOM 11     H H3   . MET A 1 1   ? -36.529 -25.422 1.500   1.00 37.99 ? 1   MET A H3   1  
ATOM 12     H HA   . MET A 1 1   ? -38.270 -24.555 2.874   1.00 52.21 ? 1   MET A HA   1  
ATOM 13     H HB2  . MET A 1 1   ? -36.716 -21.941 2.645   1.00 73.33 ? 1   MET A HB2  1  
ATOM 14     H HB3  . MET A 1 1   ? -38.364 -22.053 3.257   1.00 43.23 ? 1   MET A HB3  1  
ATOM 15     H HG2  . MET A 1 1   ? -37.574 -23.494 5.099   1.00 5.24  ? 1   MET A HG2  1  
ATOM 16     H HG3  . MET A 1 1   ? -35.924 -23.353 4.493   1.00 14.44 ? 1   MET A HG3  1  
ATOM 17     H HE1  . MET A 1 1   ? -35.815 -21.197 7.773   1.00 44.52 ? 1   MET A HE1  1  
ATOM 18     H HE2  . MET A 1 1   ? -35.069 -22.526 6.886   1.00 33.01 ? 1   MET A HE2  1  
ATOM 19     H HE3  . MET A 1 1   ? -36.709 -22.695 7.517   1.00 73.01 ? 1   MET A HE3  1  
ATOM 20     N N    . SER A 1 2   ? -37.765 -22.645 0.188   1.00 74.42 ? 2   SER A N    1  
ATOM 21     C CA   . SER A 1 2   ? -38.345 -22.201 -1.097  1.00 53.31 ? 2   SER A CA   1  
ATOM 22     C C    . SER A 1 2   ? -37.249 -21.508 -1.928  1.00 42.05 ? 2   SER A C    1  
ATOM 23     O O    . SER A 1 2   ? -37.451 -20.409 -2.457  1.00 52.13 ? 2   SER A O    1  
ATOM 24     C CB   . SER A 1 2   ? -39.558 -21.256 -0.834  1.00 4.33  ? 2   SER A CB   1  
ATOM 25     O OG   . SER A 1 2   ? -40.246 -20.907 -2.031  1.00 54.14 ? 2   SER A OG   1  
ATOM 26     H H    . SER A 1 2   ? -36.907 -22.257 0.466   1.00 1.14  ? 2   SER A H    1  
ATOM 27     H HA   . SER A 1 2   ? -38.683 -23.081 -1.640  1.00 55.30 ? 2   SER A HA   1  
ATOM 28     H HB2  . SER A 1 2   ? -40.256 -21.753 -0.178  1.00 53.32 ? 2   SER A HB2  1  
ATOM 29     H HB3  . SER A 1 2   ? -39.210 -20.348 -0.359  1.00 11.41 ? 2   SER A HB3  1  
ATOM 30     H HG   . SER A 1 2   ? -39.609 -20.645 -2.708  1.00 54.42 ? 2   SER A HG   1  
ATOM 31     N N    . GLU A 1 3   ? -36.094 -22.197 -2.051  1.00 3.21  ? 3   GLU A N    1  
ATOM 32     C CA   . GLU A 1 3   ? -34.867 -21.656 -2.684  1.00 4.41  ? 3   GLU A CA   1  
ATOM 33     C C    . GLU A 1 3   ? -35.135 -21.219 -4.137  1.00 33.41 ? 3   GLU A C    1  
ATOM 34     O O    . GLU A 1 3   ? -34.603 -20.196 -4.584  1.00 52.54 ? 3   GLU A O    1  
ATOM 35     C CB   . GLU A 1 3   ? -33.711 -22.700 -2.599  1.00 71.34 ? 3   GLU A CB   1  
ATOM 36     C CG   . GLU A 1 3   ? -33.109 -22.896 -1.181  1.00 65.52 ? 3   GLU A CG   1  
ATOM 37     C CD   . GLU A 1 3   ? -34.126 -23.393 -0.128  1.00 43.42 ? 3   GLU A CD   1  
ATOM 38     O OE1  . GLU A 1 3   ? -34.671 -22.569 0.648   1.00 43.21 ? 3   GLU A OE1  1  
ATOM 39     O OE2  . GLU A 1 3   ? -34.417 -24.605 -0.093  1.00 42.32 ? 3   GLU A OE2  1  
ATOM 40     H H    . GLU A 1 3   ? -36.067 -23.113 -1.710  1.00 3.24  ? 3   GLU A H    1  
ATOM 41     H HA   . GLU A 1 3   ? -34.582 -20.779 -2.112  1.00 65.14 ? 3   GLU A HA   1  
ATOM 42     H HB2  . GLU A 1 3   ? -34.086 -23.661 -2.938  1.00 44.51 ? 3   GLU A HB2  1  
ATOM 43     H HB3  . GLU A 1 3   ? -32.908 -22.394 -3.265  1.00 32.04 ? 3   GLU A HB3  1  
ATOM 44     H HG2  . GLU A 1 3   ? -32.302 -23.620 -1.248  1.00 21.44 ? 3   GLU A HG2  1  
ATOM 45     H HG3  . GLU A 1 3   ? -32.688 -21.953 -0.847  1.00 14.33 ? 3   GLU A HG3  1  
ATOM 46     N N    . GLN A 1 4   ? -35.961 -22.024 -4.843  1.00 0.00  ? 4   GLN A N    1  
ATOM 47     C CA   . GLN A 1 4   ? -36.601 -21.653 -6.124  1.00 23.35 ? 4   GLN A CA   1  
ATOM 48     C C    . GLN A 1 4   ? -35.532 -21.221 -7.159  1.00 10.20 ? 4   GLN A C    1  
ATOM 49     O O    . GLN A 1 4   ? -35.473 -20.052 -7.579  1.00 54.51 ? 4   GLN A O    1  
ATOM 50     C CB   . GLN A 1 4   ? -37.698 -20.553 -5.852  1.00 2.20  ? 4   GLN A CB   1  
ATOM 51     C CG   . GLN A 1 4   ? -38.898 -20.486 -6.829  1.00 14.14 ? 4   GLN A CG   1  
ATOM 52     C CD   . GLN A 1 4   ? -38.537 -20.118 -8.269  1.00 41.21 ? 4   GLN A CD   1  
ATOM 53     O OE1  . GLN A 1 4   ? -38.326 -20.988 -9.110  1.00 21.45 ? 4   GLN A OE1  1  
ATOM 54     N NE2  . GLN A 1 4   ? -38.418 -18.831 -8.545  1.00 31.05 ? 4   GLN A NE2  1  
ATOM 55     H H    . GLN A 1 4   ? -36.149 -22.913 -4.482  1.00 44.01 ? 4   GLN A H    1  
ATOM 56     H HA   . GLN A 1 4   ? -37.089 -22.548 -6.499  1.00 31.52 ? 4   GLN A HA   1  
ATOM 57     H HB2  . GLN A 1 4   ? -38.100 -20.720 -4.859  1.00 43.04 ? 4   GLN A HB2  1  
ATOM 58     H HB3  . GLN A 1 4   ? -37.220 -19.578 -5.847  1.00 71.23 ? 4   GLN A HB3  1  
ATOM 59     H HG2  . GLN A 1 4   ? -39.389 -21.454 -6.841  1.00 20.15 ? 4   GLN A HG2  1  
ATOM 60     H HG3  . GLN A 1 4   ? -39.600 -19.748 -6.452  1.00 52.53 ? 4   GLN A HG3  1  
ATOM 61     H HE21 . GLN A 1 4   ? -38.565 -18.185 -7.816  1.00 63.33 ? 4   GLN A HE21 1  
ATOM 62     H HE22 . GLN A 1 4   ? -38.180 -18.573 -9.457  1.00 3.54  ? 4   GLN A HE22 1  
ATOM 63     N N    . ASN A 1 5   ? -34.648 -22.171 -7.518  1.00 30.01 ? 5   ASN A N    1  
ATOM 64     C CA   . ASN A 1 5   ? -33.566 -21.923 -8.487  1.00 22.31 ? 5   ASN A CA   1  
ATOM 65     C C    . ASN A 1 5   ? -34.121 -22.000 -9.925  1.00 73.24 ? 5   ASN A C    1  
ATOM 66     O O    . ASN A 1 5   ? -34.045 -23.041 -10.595 1.00 62.55 ? 5   ASN A O    1  
ATOM 67     C CB   . ASN A 1 5   ? -32.380 -22.908 -8.281  1.00 44.31 ? 5   ASN A CB   1  
ATOM 68     C CG   . ASN A 1 5   ? -31.139 -22.534 -9.111  1.00 23.54 ? 5   ASN A CG   1  
ATOM 69     O OD1  . ASN A 1 5   ? -30.251 -21.828 -8.636  1.00 23.30 ? 5   ASN A OD1  1  
ATOM 70     N ND2  . ASN A 1 5   ? -31.083 -22.984 -10.354 1.00 11.12 ? 5   ASN A ND2  1  
ATOM 71     H H    . ASN A 1 5   ? -34.725 -23.062 -7.112  1.00 3.24  ? 5   ASN A H    1  
ATOM 72     H HA   . ASN A 1 5   ? -33.200 -20.912 -8.320  1.00 23.03 ? 5   ASN A HA   1  
ATOM 73     H HB2  . ASN A 1 5   ? -32.099 -22.911 -7.233  1.00 21.03 ? 5   ASN A HB2  1  
ATOM 74     H HB3  . ASN A 1 5   ? -32.695 -23.910 -8.555  1.00 63.11 ? 5   ASN A HB3  1  
ATOM 75     H HD21 . ASN A 1 5   ? -31.832 -23.532 -10.683 1.00 64.33 ? 5   ASN A HD21 1  
ATOM 76     H HD22 . ASN A 1 5   ? -30.304 -22.753 -10.894 1.00 12.44 ? 5   ASN A HD22 1  
ATOM 77     N N    . ASN A 1 6   ? -34.751 -20.899 -10.343 1.00 0.25  ? 6   ASN A N    1  
ATOM 78     C CA   . ASN A 1 6   ? -35.229 -20.695 -11.720 1.00 22.41 ? 6   ASN A CA   1  
ATOM 79     C C    . ASN A 1 6   ? -34.178 -19.860 -12.478 1.00 64.32 ? 6   ASN A C    1  
ATOM 80     O O    . ASN A 1 6   ? -33.339 -19.192 -11.859 1.00 41.24 ? 6   ASN A O    1  
ATOM 81     C CB   . ASN A 1 6   ? -36.605 -19.963 -11.652 1.00 11.24 ? 6   ASN A CB   1  
ATOM 82     C CG   . ASN A 1 6   ? -37.452 -19.999 -12.937 1.00 73.53 ? 6   ASN A CG   1  
ATOM 83     O OD1  . ASN A 1 6   ? -36.948 -20.001 -14.055 1.00 12.21 ? 6   ASN A OD1  1  
ATOM 84     N ND2  . ASN A 1 6   ? -38.762 -20.001 -12.777 1.00 23.51 ? 6   ASN A ND2  1  
ATOM 85     H H    . ASN A 1 6   ? -34.912 -20.183 -9.690  1.00 53.00 ? 6   ASN A H    1  
ATOM 86     H HA   . ASN A 1 6   ? -35.348 -21.663 -12.211 1.00 74.31 ? 6   ASN A HA   1  
ATOM 87     H HB2  . ASN A 1 6   ? -37.191 -20.408 -10.859 1.00 13.30 ? 6   ASN A HB2  1  
ATOM 88     H HB3  . ASN A 1 6   ? -36.438 -18.921 -11.399 1.00 61.44 ? 6   ASN A HB3  1  
ATOM 89     H HD21 . ASN A 1 6   ? -39.116 -19.977 -11.864 1.00 42.45 ? 6   ASN A HD21 1  
ATOM 90     H HD22 . ASN A 1 6   ? -39.326 -20.021 -13.579 1.00 5.43  ? 6   ASN A HD22 1  
ATOM 91     N N    . THR A 1 7   ? -34.245 -19.883 -13.819 1.00 32.12 ? 7   THR A N    1  
ATOM 92     C CA   . THR A 1 7   ? -33.397 -19.055 -14.703 1.00 34.03 ? 7   THR A CA   1  
ATOM 93     C C    . THR A 1 7   ? -33.815 -17.557 -14.687 1.00 52.31 ? 7   THR A C    1  
ATOM 94     O O    . THR A 1 7   ? -33.307 -16.753 -15.479 1.00 1.31  ? 7   THR A O    1  
ATOM 95     C CB   . THR A 1 7   ? -33.416 -19.622 -16.163 1.00 74.45 ? 7   THR A CB   1  
ATOM 96     O OG1  . THR A 1 7   ? -34.775 -19.773 -16.611 1.00 32.34 ? 7   THR A OG1  1  
ATOM 97     C CG2  . THR A 1 7   ? -32.700 -20.983 -16.257 1.00 23.20 ? 7   THR A CG2  1  
ATOM 98     H H    . THR A 1 7   ? -34.894 -20.483 -14.236 1.00 72.53 ? 7   THR A H    1  
ATOM 99     H HA   . THR A 1 7   ? -32.375 -19.117 -14.332 1.00 53.44 ? 7   THR A HA   1  
ATOM 100    H HB   . THR A 1 7   ? -32.909 -18.925 -16.821 1.00 31.21 ? 7   THR A HB   1  
ATOM 101    H HG1  . THR A 1 7   ? -35.176 -18.907 -16.724 1.00 25.31 ? 7   THR A HG1  1  
ATOM 102    H HG21 . THR A 1 7   ? -33.220 -21.718 -15.652 1.00 44.52 ? 7   THR A HG21 1  
ATOM 103    H HG22 . THR A 1 7   ? -31.680 -20.891 -15.906 1.00 51.05 ? 7   THR A HG22 1  
ATOM 104    H HG23 . THR A 1 7   ? -32.691 -21.313 -17.288 1.00 4.32  ? 7   THR A HG23 1  
ATOM 105    N N    . GLU A 1 8   ? -34.742 -17.197 -13.769 1.00 30.44 ? 8   GLU A N    1  
ATOM 106    C CA   . GLU A 1 8   ? -35.013 -15.794 -13.364 1.00 42.20 ? 8   GLU A CA   1  
ATOM 107    C C    . GLU A 1 8   ? -33.791 -15.205 -12.618 1.00 71.13 ? 8   GLU A C    1  
ATOM 108    O O    . GLU A 1 8   ? -32.757 -15.874 -12.493 1.00 5.00  ? 8   GLU A O    1  
ATOM 109    C CB   . GLU A 1 8   ? -36.259 -15.763 -12.436 1.00 41.40 ? 8   GLU A CB   1  
ATOM 110    C CG   . GLU A 1 8   ? -37.554 -16.297 -13.079 1.00 54.45 ? 8   GLU A CG   1  
ATOM 111    C CD   . GLU A 1 8   ? -38.705 -16.420 -12.067 1.00 25.12 ? 8   GLU A CD   1  
ATOM 112    O OE1  . GLU A 1 8   ? -39.728 -15.723 -12.198 1.00 0.04  ? 8   GLU A OE1  1  
ATOM 113    O OE2  . GLU A 1 8   ? -38.569 -17.207 -11.110 1.00 62.24 ? 8   GLU A OE2  1  
ATOM 114    H H    . GLU A 1 8   ? -35.278 -17.899 -13.356 1.00 11.02 ? 8   GLU A H    1  
ATOM 115    H HA   . GLU A 1 8   ? -35.209 -15.205 -14.254 1.00 70.12 ? 8   GLU A HA   1  
ATOM 116    H HB2  . GLU A 1 8   ? -36.049 -16.365 -11.556 1.00 63.04 ? 8   GLU A HB2  1  
ATOM 117    H HB3  . GLU A 1 8   ? -36.437 -14.741 -12.115 1.00 73.11 ? 8   GLU A HB3  1  
ATOM 118    H HG2  . GLU A 1 8   ? -37.847 -15.632 -13.888 1.00 14.35 ? 8   GLU A HG2  1  
ATOM 119    H HG3  . GLU A 1 8   ? -37.357 -17.280 -13.493 1.00 60.34 ? 8   GLU A HG3  1  
ATOM 120    N N    . MET A 1 9   ? -33.939 -13.964 -12.104 1.00 21.12 ? 9   MET A N    1  
ATOM 121    C CA   . MET A 1 9   ? -32.884 -13.230 -11.357 1.00 22.03 ? 9   MET A CA   1  
ATOM 122    C C    . MET A 1 9   ? -31.760 -12.733 -12.300 1.00 62.10 ? 9   MET A C    1  
ATOM 123    O O    . MET A 1 9   ? -31.431 -13.379 -13.303 1.00 60.12 ? 9   MET A O    1  
ATOM 124    C CB   . MET A 1 9   ? -32.296 -14.061 -10.161 1.00 4.33  ? 9   MET A CB   1  
ATOM 125    C CG   . MET A 1 9   ? -33.341 -14.549 -9.140  1.00 70.12 ? 9   MET A CG   1  
ATOM 126    S SD   . MET A 1 9   ? -32.619 -15.400 -7.714  1.00 15.42 ? 9   MET A SD   1  
ATOM 127    C CE   . MET A 1 9   ? -31.849 -16.830 -8.473  1.00 1.14  ? 9   MET A CE   1  
ATOM 128    H H    . MET A 1 9   ? -34.800 -13.511 -12.240 1.00 2.33  ? 9   MET A H    1  
ATOM 129    H HA   . MET A 1 9   ? -33.376 -12.355 -10.944 1.00 51.32 ? 9   MET A HA   1  
ATOM 130    H HB2  . MET A 1 9   ? -31.785 -14.932 -10.560 1.00 44.13 ? 9   MET A HB2  1  
ATOM 131    H HB3  . MET A 1 9   ? -31.572 -13.454 -9.634  1.00 64.25 ? 9   MET A HB3  1  
ATOM 132    H HG2  . MET A 1 9   ? -33.888 -13.692 -8.776  1.00 30.33 ? 9   MET A HG2  1  
ATOM 133    H HG3  . MET A 1 9   ? -34.029 -15.224 -9.634  1.00 52.32 ? 9   MET A HG3  1  
ATOM 134    H HE1  . MET A 1 9   ? -31.102 -16.507 -9.184  1.00 45.51 ? 9   MET A HE1  1  
ATOM 135    H HE2  . MET A 1 9   ? -32.598 -17.420 -8.980  1.00 75.44 ? 9   MET A HE2  1  
ATOM 136    H HE3  . MET A 1 9   ? -31.377 -17.430 -7.708  1.00 1.40  ? 9   MET A HE3  1  
ATOM 137    N N    . THR A 1 10  ? -31.198 -11.557 -11.986 1.00 52.24 ? 10  THR A N    1  
ATOM 138    C CA   . THR A 1 10  ? -30.104 -10.944 -12.756 1.00 73.32 ? 10  THR A CA   1  
ATOM 139    C C    . THR A 1 10  ? -29.128 -10.258 -11.785 1.00 34.05 ? 10  THR A C    1  
ATOM 140    O O    . THR A 1 10  ? -29.554 -9.700  -10.770 1.00 72.44 ? 10  THR A O    1  
ATOM 141    C CB   . THR A 1 10  ? -30.665 -9.910  -13.796 1.00 11.43 ? 10  THR A CB   1  
ATOM 142    O OG1  . THR A 1 10  ? -31.635 -10.561 -14.643 1.00 64.21 ? 10  THR A OG1  1  
ATOM 143    C CG2  . THR A 1 10  ? -29.562 -9.297  -14.684 1.00 11.53 ? 10  THR A CG2  1  
ATOM 144    H H    . THR A 1 10  ? -31.534 -11.072 -11.206 1.00 64.15 ? 10  THR A H    1  
ATOM 145    H HA   . THR A 1 10  ? -29.575 -11.730 -13.296 1.00 53.03 ? 10  THR A HA   1  
ATOM 146    H HB   . THR A 1 10  ? -31.170 -9.108  -13.259 1.00 33.21 ? 10  THR A HB   1  
ATOM 147    H HG1  . THR A 1 10  ? -31.439 -11.504 -14.695 1.00 74.14 ? 10  THR A HG1  1  
ATOM 148    H HG21 . THR A 1 10  ? -30.007 -8.621  -15.402 1.00 31.13 ? 10  THR A HG21 1  
ATOM 149    H HG22 . THR A 1 10  ? -29.040 -10.083 -15.214 1.00 21.24 ? 10  THR A HG22 1  
ATOM 150    H HG23 . THR A 1 10  ? -28.859 -8.751  -14.070 1.00 54.20 ? 10  THR A HG23 1  
ATOM 151    N N    . PHE A 1 11  ? -27.826 -10.347 -12.098 1.00 22.14 ? 11  PHE A N    1  
ATOM 152    C CA   . PHE A 1 11  ? -26.740 -9.784  -11.283 1.00 11.55 ? 11  PHE A CA   1  
ATOM 153    C C    . PHE A 1 11  ? -25.687 -9.128  -12.199 1.00 44.31 ? 11  PHE A C    1  
ATOM 154    O O    . PHE A 1 11  ? -25.268 -9.736  -13.187 1.00 60.14 ? 11  PHE A O    1  
ATOM 155    C CB   . PHE A 1 11  ? -26.108 -10.914 -10.425 1.00 43.11 ? 11  PHE A CB   1  
ATOM 156    C CG   . PHE A 1 11  ? -24.989 -10.472 -9.478  1.00 72.51 ? 11  PHE A CG   1  
ATOM 157    C CD1  . PHE A 1 11  ? -23.786 -11.166 -9.391  1.00 43.12 ? 11  PHE A CD1  1  
ATOM 158    C CD2  . PHE A 1 11  ? -25.137 -9.351  -8.671  1.00 22.55 ? 11  PHE A CD2  1  
ATOM 159    C CE1  . PHE A 1 11  ? -22.802 -10.758 -8.508  1.00 2.53  ? 11  PHE A CE1  1  
ATOM 160    C CE2  . PHE A 1 11  ? -24.137 -8.973  -7.805  1.00 1.44  ? 11  PHE A CE2  1  
ATOM 161    C CZ   . PHE A 1 11  ? -22.979 -9.663  -7.732  1.00 60.30 ? 11  PHE A CZ   1  
ATOM 162    H H    . PHE A 1 11  ? -27.586 -10.806 -12.927 1.00 65.23 ? 11  PHE A H    1  
ATOM 163    H HA   . PHE A 1 11  ? -27.161 -9.026  -10.622 1.00 75.25 ? 11  PHE A HA   1  
ATOM 164    H HB2  . PHE A 1 11  ? -26.884 -11.363 -9.809  1.00 74.30 ? 11  PHE A HB2  1  
ATOM 165    H HB3  . PHE A 1 11  ? -25.715 -11.683 -11.087 1.00 64.12 ? 11  PHE A HB3  1  
ATOM 166    H HD1  . PHE A 1 11  ? -23.630 -12.043 -10.008 1.00 21.44 ? 11  PHE A HD1  1  
ATOM 167    H HD2  . PHE A 1 11  ? -26.054 -8.779  -8.716  1.00 64.43 ? 11  PHE A HD2  1  
ATOM 168    H HE1  . PHE A 1 11  ? -21.896 -11.298 -8.424  1.00 71.43 ? 11  PHE A HE1  1  
ATOM 169    H HE2  . PHE A 1 11  ? -24.252 -8.118  -7.198  1.00 31.41 ? 11  PHE A HE2  1  
ATOM 170    H HZ   . PHE A 1 11  ? -22.200 -9.348  -7.045  1.00 22.14 ? 11  PHE A HZ   1  
ATOM 171    N N    . GLN A 1 12  ? -25.269 -7.890  -11.866 1.00 52.41 ? 12  GLN A N    1  
ATOM 172    C CA   . GLN A 1 12  ? -24.206 -7.170  -12.601 1.00 42.15 ? 12  GLN A CA   1  
ATOM 173    C C    . GLN A 1 12  ? -23.518 -6.164  -11.666 1.00 5.24  ? 12  GLN A C    1  
ATOM 174    O O    . GLN A 1 12  ? -24.117 -5.159  -11.282 1.00 24.30 ? 12  GLN A O    1  
ATOM 175    C CB   . GLN A 1 12  ? -24.787 -6.448  -13.861 1.00 70.33 ? 12  GLN A CB   1  
ATOM 176    C CG   . GLN A 1 12  ? -23.769 -5.639  -14.713 1.00 61.51 ? 12  GLN A CG   1  
ATOM 177    C CD   . GLN A 1 12  ? -22.549 -6.448  -15.193 1.00 71.41 ? 12  GLN A CD   1  
ATOM 178    O OE1  . GLN A 1 12  ? -22.599 -7.113  -16.230 1.00 55.41 ? 12  GLN A OE1  1  
ATOM 179    N NE2  . GLN A 1 12  ? -21.433 -6.351  -14.480 1.00 31.52 ? 12  GLN A NE2  1  
ATOM 180    H H    . GLN A 1 12  ? -25.701 -7.438  -11.108 1.00 20.13 ? 12  GLN A H    1  
ATOM 181    H HA   . GLN A 1 12  ? -23.470 -7.904  -12.923 1.00 3.11  ? 12  GLN A HA   1  
ATOM 182    H HB2  . GLN A 1 12  ? -25.240 -7.194  -14.503 1.00 34.31 ? 12  GLN A HB2  1  
ATOM 183    H HB3  . GLN A 1 12  ? -25.571 -5.766  -13.534 1.00 63.21 ? 12  GLN A HB3  1  
ATOM 184    H HG2  . GLN A 1 12  ? -24.282 -5.256  -15.589 1.00 1.02  ? 12  GLN A HG2  1  
ATOM 185    H HG3  . GLN A 1 12  ? -23.420 -4.799  -14.122 1.00 20.24 ? 12  GLN A HG3  1  
ATOM 186    H HE21 . GLN A 1 12  ? -21.433 -5.772  -13.689 1.00 34.42 ? 12  GLN A HE21 1  
ATOM 187    H HE22 . GLN A 1 12  ? -20.645 -6.850  -14.785 1.00 33.30 ? 12  GLN A HE22 1  
ATOM 188    N N    . ILE A 1 13  ? -22.263 -6.456  -11.290 1.00 71.02 ? 13  ILE A N    1  
ATOM 189    C CA   . ILE A 1 13  ? -21.450 -5.563  -10.446 1.00 4.22  ? 13  ILE A CA   1  
ATOM 190    C C    . ILE A 1 13  ? -20.964 -4.382  -11.283 1.00 23.22 ? 13  ILE A C    1  
ATOM 191    O O    . ILE A 1 13  ? -20.323 -4.597  -12.301 1.00 45.51 ? 13  ILE A O    1  
ATOM 192    C CB   . ILE A 1 13  ? -20.206 -6.311  -9.842  1.00 73.13 ? 13  ILE A CB   1  
ATOM 193    C CG1  . ILE A 1 13  ? -20.688 -7.582  -9.082  1.00 0.21  ? 13  ILE A CG1  1  
ATOM 194    C CG2  . ILE A 1 13  ? -19.386 -5.361  -8.918  1.00 41.20 ? 13  ILE A CG2  1  
ATOM 195    C CD1  . ILE A 1 13  ? -19.613 -8.412  -8.417  1.00 65.21 ? 13  ILE A CD1  1  
ATOM 196    H H    . ILE A 1 13  ? -21.865 -7.295  -11.601 1.00 1.13  ? 13  ILE A H    1  
ATOM 197    H HA   . ILE A 1 13  ? -22.073 -5.199  -9.625  1.00 11.52 ? 13  ILE A HA   1  
ATOM 198    H HB   . ILE A 1 13  ? -19.559 -6.621  -10.663 1.00 54.45 ? 13  ILE A HB   1  
ATOM 199    H HG12 . ILE A 1 13  ? -21.364 -7.278  -8.301  1.00 54.44 ? 13  ILE A HG12 1  
ATOM 200    H HG13 . ILE A 1 13  ? -21.235 -8.230  -9.757  1.00 1.02  ? 13  ILE A HG13 1  
ATOM 201    H HG21 . ILE A 1 13  ? -18.515 -5.875  -8.540  1.00 52.44 ? 13  ILE A HG21 1  
ATOM 202    H HG22 . ILE A 1 13  ? -19.996 -5.041  -8.083  1.00 32.04 ? 13  ILE A HG22 1  
ATOM 203    H HG23 . ILE A 1 13  ? -19.067 -4.491  -9.478  1.00 35.55 ? 13  ILE A HG23 1  
ATOM 204    H HD11 . ILE A 1 13  ? -19.090 -7.809  -7.690  1.00 14.24 ? 13  ILE A HD11 1  
ATOM 205    H HD12 . ILE A 1 13  ? -18.912 -8.783  -9.146  1.00 34.31 ? 13  ILE A HD12 1  
ATOM 206    H HD13 . ILE A 1 13  ? -20.088 -9.241  -7.913  1.00 53.11 ? 13  ILE A HD13 1  
ATOM 207    N N    . GLN A 1 14  ? -21.284 -3.154  -10.854 1.00 30.23 ? 14  GLN A N    1  
ATOM 208    C CA   . GLN A 1 14  ? -20.870 -1.931  -11.563 1.00 14.52 ? 14  GLN A CA   1  
ATOM 209    C C    . GLN A 1 14  ? -19.551 -1.387  -10.984 1.00 60.13 ? 14  GLN A C    1  
ATOM 210    O O    . GLN A 1 14  ? -18.699 -0.882  -11.730 1.00 42.24 ? 14  GLN A O    1  
ATOM 211    C CB   . GLN A 1 14  ? -22.009 -0.869  -11.495 1.00 70.40 ? 14  GLN A CB   1  
ATOM 212    C CG   . GLN A 1 14  ? -21.707 0.499   -12.168 1.00 11.01 ? 14  GLN A CG   1  
ATOM 213    C CD   . GLN A 1 14  ? -21.499 0.458   -13.700 1.00 31.03 ? 14  GLN A CD   1  
ATOM 214    O OE1  . GLN A 1 14  ? -21.051 -0.526  -14.269 1.00 43.00 ? 14  GLN A OE1  1  
ATOM 215    N NE2  . GLN A 1 14  ? -21.794 1.552   -14.377 1.00 34.41 ? 14  GLN A NE2  1  
ATOM 216    H H    . GLN A 1 14  ? -21.813 -3.064  -10.031 1.00 72.42 ? 14  GLN A H    1  
ATOM 217    H HA   . GLN A 1 14  ? -20.701 -2.185  -12.609 1.00 24.15 ? 14  GLN A HA   1  
ATOM 218    H HB2  . GLN A 1 14  ? -22.895 -1.283  -11.968 1.00 30.50 ? 14  GLN A HB2  1  
ATOM 219    H HB3  . GLN A 1 14  ? -22.242 -0.686  -10.450 1.00 34.53 ? 14  GLN A HB3  1  
ATOM 220    H HG2  . GLN A 1 14  ? -22.531 1.167   -11.953 1.00 45.20 ? 14  GLN A HG2  1  
ATOM 221    H HG3  . GLN A 1 14  ? -20.809 0.908   -11.717 1.00 54.52 ? 14  GLN A HG3  1  
ATOM 222    H HE21 . GLN A 1 14  ? -22.121 2.328   -13.882 1.00 2.52  ? 14  GLN A HE21 1  
ATOM 223    H HE22 . GLN A 1 14  ? -21.671 1.541   -15.347 1.00 25.35 ? 14  GLN A HE22 1  
ATOM 224    N N    . ARG A 1 15  ? -19.369 -1.529  -9.651  1.00 1.22  ? 15  ARG A N    1  
ATOM 225    C CA   . ARG A 1 15  ? -18.251 -0.878  -8.933  1.00 5.12  ? 15  ARG A CA   1  
ATOM 226    C C    . ARG A 1 15  ? -18.142 -1.430  -7.496  1.00 51.44 ? 15  ARG A C    1  
ATOM 227    O O    . ARG A 1 15  ? -19.161 -1.683  -6.860  1.00 14.54 ? 15  ARG A O    1  
ATOM 228    C CB   . ARG A 1 15  ? -18.477 0.673   -8.923  1.00 4.01  ? 15  ARG A CB   1  
ATOM 229    C CG   . ARG A 1 15  ? -17.285 1.526   -8.423  1.00 63.25 ? 15  ARG A CG   1  
ATOM 230    C CD   . ARG A 1 15  ? -17.554 3.044   -8.557  1.00 52.33 ? 15  ARG A CD   1  
ATOM 231    N NE   . ARG A 1 15  ? -16.404 3.862   -8.126  1.00 31.14 ? 15  ARG A NE   1  
ATOM 232    C CZ   . ARG A 1 15  ? -16.124 5.111   -8.557  1.00 21.22 ? 15  ARG A CZ   1  
ATOM 233    N NH1  . ARG A 1 15  ? -16.889 5.704   -9.449  1.00 13.43 ? 15  ARG A NH1  1  
ATOM 234    N NH2  . ARG A 1 15  ? -15.055 5.748   -8.100  1.00 41.22 ? 15  ARG A NH2  1  
ATOM 235    H H    . ARG A 1 15  ? -19.984 -2.114  -9.146  1.00 75.23 ? 15  ARG A H    1  
ATOM 236    H HA   . ARG A 1 15  ? -17.333 -1.105  -9.469  1.00 44.23 ? 15  ARG A HA   1  
ATOM 237    H HB2  . ARG A 1 15  ? -18.709 0.985   -9.933  1.00 25.31 ? 15  ARG A HB2  1  
ATOM 238    H HB3  . ARG A 1 15  ? -19.338 0.893   -8.296  1.00 34.43 ? 15  ARG A HB3  1  
ATOM 239    H HG2  . ARG A 1 15  ? -17.103 1.295   -7.380  1.00 4.22  ? 15  ARG A HG2  1  
ATOM 240    H HG3  . ARG A 1 15  ? -16.403 1.272   -9.002  1.00 40.25 ? 15  ARG A HG3  1  
ATOM 241    H HD2  . ARG A 1 15  ? -17.782 3.269   -9.595  1.00 63.51 ? 15  ARG A HD2  1  
ATOM 242    H HD3  . ARG A 1 15  ? -18.410 3.302   -7.943  1.00 12.24 ? 15  ARG A HD3  1  
ATOM 243    H HE   . ARG A 1 15  ? -15.803 3.454   -7.467  1.00 41.32 ? 15  ARG A HE   1  
ATOM 244    H HH11 . ARG A 1 15  ? -17.707 5.234   -9.820  1.00 33.12 ? 15  ARG A HH11 1  
ATOM 245    H HH12 . ARG A 1 15  ? -16.682 6.627   -9.773  1.00 43.15 ? 15  ARG A HH12 1  
ATOM 246    H HH21 . ARG A 1 15  ? -14.454 5.306   -7.424  1.00 2.32  ? 15  ARG A HH21 1  
ATOM 247    H HH22 . ARG A 1 15  ? -14.837 6.669   -8.418  1.00 61.24 ? 15  ARG A HH22 1  
ATOM 248    N N    . ILE A 1 16  ? -16.900 -1.642  -7.010  1.00 75.22 ? 16  ILE A N    1  
ATOM 249    C CA   . ILE A 1 16  ? -16.615 -2.035  -5.599  1.00 73.34 ? 16  ILE A CA   1  
ATOM 250    C C    . ILE A 1 16  ? -15.604 -1.028  -5.014  1.00 44.45 ? 16  ILE A C    1  
ATOM 251    O O    . ILE A 1 16  ? -14.708 -0.578  -5.740  1.00 62.34 ? 16  ILE A O    1  
ATOM 252    C CB   . ILE A 1 16  ? -16.069 -3.524  -5.438  1.00 50.32 ? 16  ILE A CB   1  
ATOM 253    C CG1  . ILE A 1 16  ? -14.590 -3.722  -5.966  1.00 11.01 ? 16  ILE A CG1  1  
ATOM 254    C CG2  . ILE A 1 16  ? -17.036 -4.542  -6.098  1.00 25.45 ? 16  ILE A CG2  1  
ATOM 255    C CD1  . ILE A 1 16  ? -14.375 -3.491  -7.460  1.00 64.31 ? 16  ILE A CD1  1  
ATOM 256    H H    . ILE A 1 16  ? -16.140 -1.507  -7.611  1.00 63.50 ? 16  ILE A H    1  
ATOM 257    H HA   . ILE A 1 16  ? -17.548 -1.950  -5.030  1.00 31.21 ? 16  ILE A HA   1  
ATOM 258    H HB   . ILE A 1 16  ? -16.075 -3.741  -4.369  1.00 13.40 ? 16  ILE A HB   1  
ATOM 259    H HG12 . ILE A 1 16  ? -13.936 -3.038  -5.443  1.00 14.45 ? 16  ILE A HG12 1  
ATOM 260    H HG13 . ILE A 1 16  ? -14.267 -4.735  -5.745  1.00 21.20 ? 16  ILE A HG13 1  
ATOM 261    H HG21 . ILE A 1 16  ? -18.020 -4.455  -5.651  1.00 33.34 ? 16  ILE A HG21 1  
ATOM 262    H HG22 . ILE A 1 16  ? -16.671 -5.550  -5.951  1.00 14.31 ? 16  ILE A HG22 1  
ATOM 263    H HG23 . ILE A 1 16  ? -17.111 -4.341  -7.159  1.00 71.51 ? 16  ILE A HG23 1  
ATOM 264    H HD11 . ILE A 1 16  ? -13.348 -3.696  -7.718  1.00 43.03 ? 16  ILE A HD11 1  
ATOM 265    H HD12 . ILE A 1 16  ? -14.609 -2.464  -7.706  1.00 13.31 ? 16  ILE A HD12 1  
ATOM 266    H HD13 . ILE A 1 16  ? -15.024 -4.148  -8.023  1.00 21.33 ? 16  ILE A HD13 1  
ATOM 267    N N    . TYR A 1 17  ? -15.774 -0.654  -3.725  1.00 51.34 ? 17  TYR A N    1  
ATOM 268    C CA   . TYR A 1 17  ? -14.969 0.415   -3.082  1.00 73.13 ? 17  TYR A CA   1  
ATOM 269    C C    . TYR A 1 17  ? -15.280 0.524   -1.582  1.00 1.24  ? 17  TYR A C    1  
ATOM 270    O O    . TYR A 1 17  ? -16.370 0.172   -1.135  1.00 54.34 ? 17  TYR A O    1  
ATOM 271    C CB   . TYR A 1 17  ? -15.231 1.800   -3.761  1.00 32.14 ? 17  TYR A CB   1  
ATOM 272    C CG   . TYR A 1 17  ? -16.705 2.266   -3.754  1.00 0.24  ? 17  TYR A CG   1  
ATOM 273    C CD1  . TYR A 1 17  ? -17.642 1.752   -4.664  1.00 63.13 ? 17  TYR A CD1  1  
ATOM 274    C CD2  . TYR A 1 17  ? -17.159 3.205   -2.835  1.00 51.12 ? 17  TYR A CD2  1  
ATOM 275    C CE1  . TYR A 1 17  ? -18.961 2.159   -4.647  1.00 52.31 ? 17  TYR A CE1  1  
ATOM 276    C CE2  . TYR A 1 17  ? -18.472 3.607   -2.823  1.00 41.31 ? 17  TYR A CE2  1  
ATOM 277    C CZ   . TYR A 1 17  ? -19.371 3.087   -3.720  1.00 32.42 ? 17  TYR A CZ   1  
ATOM 278    O OH   . TYR A 1 17  ? -20.677 3.521   -3.695  1.00 1.23  ? 17  TYR A OH   1  
ATOM 279    H H    . TYR A 1 17  ? -16.455 -1.114  -3.184  1.00 53.05 ? 17  TYR A H    1  
ATOM 280    H HA   . TYR A 1 17  ? -13.916 0.156   -3.195  1.00 12.55 ? 17  TYR A HA   1  
ATOM 281    H HB2  . TYR A 1 17  ? -14.633 2.557   -3.256  1.00 5.21  ? 17  TYR A HB2  1  
ATOM 282    H HB3  . TYR A 1 17  ? -14.897 1.748   -4.797  1.00 54.44 ? 17  TYR A HB3  1  
ATOM 283    H HD1  . TYR A 1 17  ? -17.317 1.021   -5.393  1.00 15.24 ? 17  TYR A HD1  1  
ATOM 284    H HD2  . TYR A 1 17  ? -16.461 3.628   -2.117  1.00 31.34 ? 17  TYR A HD2  1  
ATOM 285    H HE1  . TYR A 1 17  ? -19.664 1.749   -5.362  1.00 15.44 ? 17  TYR A HE1  1  
ATOM 286    H HE2  . TYR A 1 17  ? -18.796 4.331   -2.096  1.00 12.11 ? 17  TYR A HE2  1  
ATOM 287    H HH   . TYR A 1 17  ? -21.257 2.811   -3.394  1.00 70.34 ? 17  TYR A HH   1  
ATOM 288    N N    . THR A 1 18  ? -14.314 1.055   -0.824  1.00 41.14 ? 18  THR A N    1  
ATOM 289    C CA   . THR A 1 18  ? -14.503 1.405   0.584   1.00 14.44 ? 18  THR A CA   1  
ATOM 290    C C    . THR A 1 18  ? -15.265 2.739   0.686   1.00 22.41 ? 18  THR A C    1  
ATOM 291    O O    . THR A 1 18  ? -14.821 3.765   0.145   1.00 32.21 ? 18  THR A O    1  
ATOM 292    C CB   . THR A 1 18  ? -13.134 1.517   1.334   1.00 72.51 ? 18  THR A CB   1  
ATOM 293    O OG1  . THR A 1 18  ? -12.313 2.552   0.755   1.00 52.34 ? 18  THR A OG1  1  
ATOM 294    C CG2  . THR A 1 18  ? -12.355 0.193   1.290   1.00 51.24 ? 18  THR A CG2  1  
ATOM 295    H H    . THR A 1 18  ? -13.439 1.219   -1.230  1.00 54.25 ? 18  THR A H    1  
ATOM 296    H HA   . THR A 1 18  ? -15.088 0.616   1.060   1.00 11.34 ? 18  THR A HA   1  
ATOM 297    H HB   . THR A 1 18  ? -13.323 1.770   2.375   1.00 20.24 ? 18  THR A HB   1  
ATOM 298    H HG1  . THR A 1 18  ? -12.827 3.358   0.639   1.00 11.12 ? 18  THR A HG1  1  
ATOM 299    H HG21 . THR A 1 18  ? -12.987 -0.618  1.627   1.00 44.42 ? 18  THR A HG21 1  
ATOM 300    H HG22 . THR A 1 18  ? -11.487 0.261   1.933   1.00 51.14 ? 18  THR A HG22 1  
ATOM 301    H HG23 . THR A 1 18  ? -12.032 -0.008  0.278   1.00 55.55 ? 18  THR A HG23 1  
ATOM 302    N N    . LYS A 1 19  ? -16.424 2.714   1.353   1.00 5.21  ? 19  LYS A N    1  
ATOM 303    C CA   . LYS A 1 19  ? -17.212 3.932   1.625   1.00 41.12 ? 19  LYS A CA   1  
ATOM 304    C C    . LYS A 1 19  ? -16.739 4.586   2.913   1.00 73.23 ? 19  LYS A C    1  
ATOM 305    O O    . LYS A 1 19  ? -16.948 5.780   3.121   1.00 54.40 ? 19  LYS A O    1  
ATOM 306    C CB   . LYS A 1 19  ? -18.709 3.603   1.737   1.00 44.33 ? 19  LYS A CB   1  
ATOM 307    C CG   . LYS A 1 19  ? -19.255 2.830   0.530   1.00 72.13 ? 19  LYS A CG   1  
ATOM 308    C CD   . LYS A 1 19  ? -20.788 2.782   0.502   1.00 53.13 ? 19  LYS A CD   1  
ATOM 309    C CE   . LYS A 1 19  ? -21.423 4.174   0.353   1.00 32.41 ? 19  LYS A CE   1  
ATOM 310    N NZ   . LYS A 1 19  ? -22.899 4.110   0.422   1.00 62.14 ? 19  LYS A NZ   1  
ATOM 311    H H    . LYS A 1 19  ? -16.764 1.850   1.675   1.00 52.32 ? 19  LYS A H    1  
ATOM 312    H HA   . LYS A 1 19  ? -17.066 4.630   0.802   1.00 25.31 ? 19  LYS A HA   1  
ATOM 313    H HB2  . LYS A 1 19  ? -18.875 3.007   2.632   1.00 4.12  ? 19  LYS A HB2  1  
ATOM 314    H HB3  . LYS A 1 19  ? -19.265 4.533   1.832   1.00 63.42 ? 19  LYS A HB3  1  
ATOM 315    H HG2  . LYS A 1 19  ? -18.901 3.299   -0.381  1.00 42.00 ? 19  LYS A HG2  1  
ATOM 316    H HG3  . LYS A 1 19  ? -18.874 1.813   0.569   1.00 54.10 ? 19  LYS A HG3  1  
ATOM 317    H HD2  . LYS A 1 19  ? -21.102 2.167   -0.334  1.00 43.54 ? 19  LYS A HD2  1  
ATOM 318    H HD3  . LYS A 1 19  ? -21.145 2.331   1.423   1.00 75.44 ? 19  LYS A HD3  1  
ATOM 319    H HE2  . LYS A 1 19  ? -21.066 4.819   1.144   1.00 24.10 ? 19  LYS A HE2  1  
ATOM 320    H HE3  . LYS A 1 19  ? -21.141 4.596   -0.604  1.00 43.21 ? 19  LYS A HE3  1  
ATOM 321    H HZ1  . LYS A 1 19  ? -23.305 5.053   0.382   1.00 61.14 ? 19  LYS A HZ1  1  
ATOM 322    H HZ2  . LYS A 1 19  ? -23.200 3.653   1.303   1.00 13.10 ? 19  LYS A HZ2  1  
ATOM 323    H HZ3  . LYS A 1 19  ? -23.263 3.560   -0.381  1.00 13.14 ? 19  LYS A HZ3  1  
ATOM 324    N N    . ASP A 1 20  ? -16.153 3.766   3.793   1.00 11.12 ? 20  ASP A N    1  
ATOM 325    C CA   . ASP A 1 20  ? -15.561 4.225   5.046   1.00 10.12 ? 20  ASP A CA   1  
ATOM 326    C C    . ASP A 1 20  ? -14.415 3.285   5.450   1.00 52.45 ? 20  ASP A C    1  
ATOM 327    O O    . ASP A 1 20  ? -14.503 2.061   5.286   1.00 64.34 ? 20  ASP A O    1  
ATOM 328    C CB   . ASP A 1 20  ? -16.629 4.328   6.163   1.00 43.21 ? 20  ASP A CB   1  
ATOM 329    C CG   . ASP A 1 20  ? -16.056 4.763   7.528   1.00 22.52 ? 20  ASP A CG   1  
ATOM 330    O OD1  . ASP A 1 20  ? -15.922 3.905   8.427   1.00 75.21 ? 20  ASP A OD1  1  
ATOM 331    O OD2  . ASP A 1 20  ? -15.734 5.962   7.699   1.00 44.13 ? 20  ASP A OD2  1  
ATOM 332    H H    . ASP A 1 20  ? -16.111 2.807   3.582   1.00 11.33 ? 20  ASP A H    1  
ATOM 333    H HA   . ASP A 1 20  ? -15.144 5.213   4.866   1.00 13.42 ? 20  ASP A HA   1  
ATOM 334    H HB2  . ASP A 1 20  ? -17.377 5.052   5.861   1.00 24.13 ? 20  ASP A HB2  1  
ATOM 335    H HB3  . ASP A 1 20  ? -17.115 3.362   6.275   1.00 14.15 ? 20  ASP A HB3  1  
ATOM 336    N N    . ILE A 1 21  ? -13.340 3.896   5.942   1.00 63.11 ? 21  ILE A N    1  
ATOM 337    C CA   . ILE A 1 21  ? -12.149 3.229   6.464   1.00 23.54 ? 21  ILE A CA   1  
ATOM 338    C C    . ILE A 1 21  ? -11.842 3.869   7.812   1.00 21.01 ? 21  ILE A C    1  
ATOM 339    O O    . ILE A 1 21  ? -11.924 5.100   7.952   1.00 54.11 ? 21  ILE A O    1  
ATOM 340    C CB   . ILE A 1 21  ? -10.883 3.410   5.532   1.00 61.53 ? 21  ILE A CB   1  
ATOM 341    C CG1  . ILE A 1 21  ? -11.112 2.756   4.132   1.00 60.04 ? 21  ILE A CG1  1  
ATOM 342    C CG2  . ILE A 1 21  ? -9.594  2.857   6.211   1.00 75.41 ? 21  ILE A CG2  1  
ATOM 343    C CD1  . ILE A 1 21  ? -9.983  2.958   3.134   1.00 74.23 ? 21  ILE A CD1  1  
ATOM 344    H H    . ILE A 1 21  ? -13.359 4.874   5.985   1.00 51.33 ? 21  ILE A H    1  
ATOM 345    H HA   . ILE A 1 21  ? -12.353 2.163   6.597   1.00 62.51 ? 21  ILE A HA   1  
ATOM 346    H HB   . ILE A 1 21  ? -10.735 4.483   5.387   1.00 3.11  ? 21  ILE A HB   1  
ATOM 347    H HG12 . ILE A 1 21  ? -11.254 1.689   4.246   1.00 24.32 ? 21  ILE A HG12 1  
ATOM 348    H HG13 . ILE A 1 21  ? -12.008 3.177   3.689   1.00 45.24 ? 21  ILE A HG13 1  
ATOM 349    H HG21 . ILE A 1 21  ? -8.725  3.220   5.694   1.00 10.32 ? 21  ILE A HG21 1  
ATOM 350    H HG22 . ILE A 1 21  ? -9.593  1.775   6.187   1.00 64.31 ? 21  ILE A HG22 1  
ATOM 351    H HG23 . ILE A 1 21  ? -9.547  3.185   7.242   1.00 10.11 ? 21  ILE A HG23 1  
ATOM 352    H HD11 . ILE A 1 21  ? -10.211 2.419   2.228   1.00 14.43 ? 21  ILE A HD11 1  
ATOM 353    H HD12 . ILE A 1 21  ? -9.054  2.590   3.546   1.00 51.15 ? 21  ILE A HD12 1  
ATOM 354    H HD13 . ILE A 1 21  ? -9.887  4.008   2.906   1.00 31.22 ? 21  ILE A HD13 1  
ATOM 355    N N    . SER A 1 22  ? -11.457 3.042   8.774   1.00 4.24  ? 22  SER A N    1  
ATOM 356    C CA   . SER A 1 22  ? -11.009 3.493   10.077  1.00 65.50 ? 22  SER A CA   1  
ATOM 357    C C    . SER A 1 22  ? -9.953  2.513   10.585  1.00 22.40 ? 22  SER A C    1  
ATOM 358    O O    . SER A 1 22  ? -10.161 1.297   10.569  1.00 30.13 ? 22  SER A O    1  
ATOM 359    C CB   . SER A 1 22  ? -12.202 3.604   11.064  1.00 40.31 ? 22  SER A CB   1  
ATOM 360    O OG   . SER A 1 22  ? -11.790 4.125   12.323  1.00 62.34 ? 22  SER A OG   1  
ATOM 361    H H    . SER A 1 22  ? -11.458 2.079   8.588   1.00 74.31 ? 22  SER A H    1  
ATOM 362    H HA   . SER A 1 22  ? -10.547 4.476   9.945   1.00 63.43 ? 22  SER A HA   1  
ATOM 363    H HB2  . SER A 1 22  ? -12.951 4.266   10.651  1.00 23.25 ? 22  SER A HB2  1  
ATOM 364    H HB3  . SER A 1 22  ? -12.645 2.625   11.223  1.00 30.31 ? 22  SER A HB3  1  
ATOM 365    H HG   . SER A 1 22  ? -11.551 5.054   12.223  1.00 24.51 ? 22  SER A HG   1  
ATOM 366    N N    . PHE A 1 23  ? -8.802  3.049   10.972  1.00 50.01 ? 23  PHE A N    1  
ATOM 367    C CA   . PHE A 1 23  ? -7.717  2.291   11.586  1.00 0.22  ? 23  PHE A CA   1  
ATOM 368    C C    . PHE A 1 23  ? -7.210  3.105   12.764  1.00 15.21 ? 23  PHE A C    1  
ATOM 369    O O    . PHE A 1 23  ? -6.687  4.189   12.578  1.00 51.54 ? 23  PHE A O    1  
ATOM 370    C CB   . PHE A 1 23  ? -6.581  2.009   10.566  1.00 53.20 ? 23  PHE A CB   1  
ATOM 371    C CG   . PHE A 1 23  ? -5.343  1.321   11.162  1.00 2.42  ? 23  PHE A CG   1  
ATOM 372    C CD1  . PHE A 1 23  ? -5.356  -0.044  11.426  1.00 54.43 ? 23  PHE A CD1  1  
ATOM 373    C CD2  . PHE A 1 23  ? -4.176  2.037   11.458  1.00 64.00 ? 23  PHE A CD2  1  
ATOM 374    C CE1  . PHE A 1 23  ? -4.254  -0.680  11.963  1.00 31.44 ? 23  PHE A CE1  1  
ATOM 375    C CE2  . PHE A 1 23  ? -3.072  1.400   11.998  1.00 31.10 ? 23  PHE A CE2  1  
ATOM 376    C CZ   . PHE A 1 23  ? -3.111  0.040   12.249  1.00 63.42 ? 23  PHE A CZ   1  
ATOM 377    H H    . PHE A 1 23  ? -8.678  4.012   10.849  1.00 12.02 ? 23  PHE A H    1  
ATOM 378    H HA   . PHE A 1 23  ? -8.116  1.340   11.948  1.00 30.11 ? 23  PHE A HA   1  
ATOM 379    H HB2  . PHE A 1 23  ? -6.972  1.370   9.783   1.00 15.13 ? 23  PHE A HB2  1  
ATOM 380    H HB3  . PHE A 1 23  ? -6.270  2.940   10.110  1.00 23.34 ? 23  PHE A HB3  1  
ATOM 381    H HD1  . PHE A 1 23  ? -6.249  -0.615  11.201  1.00 50.54 ? 23  PHE A HD1  1  
ATOM 382    H HD2  . PHE A 1 23  ? -4.141  3.104   11.264  1.00 5.43  ? 23  PHE A HD2  1  
ATOM 383    H HE1  . PHE A 1 23  ? -4.288  -1.747  12.157  1.00 35.02 ? 23  PHE A HE1  1  
ATOM 384    H HE2  . PHE A 1 23  ? -2.179  1.965   12.223  1.00 74.03 ? 23  PHE A HE2  1  
ATOM 385    H HZ   . PHE A 1 23  ? -2.248  -0.458  12.670  1.00 42.34 ? 23  PHE A HZ   1  
ATOM 386    N N    . GLU A 1 24  ? -7.411  2.601   13.977  1.00 11.02 ? 24  GLU A N    1  
ATOM 387    C CA   . GLU A 1 24  ? -6.921  3.247   15.201  1.00 50.13 ? 24  GLU A CA   1  
ATOM 388    C C    . GLU A 1 24  ? -5.957  2.307   15.897  1.00 24.15 ? 24  GLU A C    1  
ATOM 389    O O    . GLU A 1 24  ? -6.279  1.146   16.099  1.00 54.33 ? 24  GLU A O    1  
ATOM 390    C CB   . GLU A 1 24  ? -8.092  3.589   16.153  1.00 21.15 ? 24  GLU A CB   1  
ATOM 391    C CG   . GLU A 1 24  ? -9.079  4.629   15.598  1.00 52.12 ? 24  GLU A CG   1  
ATOM 392    C CD   . GLU A 1 24  ? -10.190 4.991   16.591  1.00 41.10 ? 24  GLU A CD   1  
ATOM 393    O OE1  . GLU A 1 24  ? -11.366 4.622   16.367  1.00 63.03 ? 24  GLU A OE1  1  
ATOM 394    O OE2  . GLU A 1 24  ? -9.888  5.641   17.614  1.00 11.40 ? 24  GLU A OE2  1  
ATOM 395    H H    . GLU A 1 24  ? -7.914  1.762   14.059  1.00 50.50 ? 24  GLU A H    1  
ATOM 396    H HA   . GLU A 1 24  ? -6.395  4.172   14.932  1.00 72.25 ? 24  GLU A HA   1  
ATOM 397    H HB2  . GLU A 1 24  ? -8.646  2.678   16.375  1.00 65.23 ? 24  GLU A HB2  1  
ATOM 398    H HB3  . GLU A 1 24  ? -7.684  3.975   17.082  1.00 62.10 ? 24  GLU A HB3  1  
ATOM 399    H HG2  . GLU A 1 24  ? -8.531  5.534   15.345  1.00 12.25 ? 24  GLU A HG2  1  
ATOM 400    H HG3  . GLU A 1 24  ? -9.522  4.231   14.695  1.00 2.13  ? 24  GLU A HG3  1  
ATOM 401    N N    . ALA A 1 25  ? -4.781  2.817   16.257  1.00 62.23 ? 25  ALA A N    1  
ATOM 402    C CA   . ALA A 1 25  ? -3.787  2.087   17.047  1.00 12.01 ? 25  ALA A CA   1  
ATOM 403    C C    . ALA A 1 25  ? -3.531  2.906   18.328  1.00 44.11 ? 25  ALA A C    1  
ATOM 404    O O    . ALA A 1 25  ? -2.545  3.654   18.411  1.00 21.34 ? 25  ALA A O    1  
ATOM 405    C CB   . ALA A 1 25  ? -2.510  1.814   16.217  1.00 21.02 ? 25  ALA A CB   1  
ATOM 406    H H    . ALA A 1 25  ? -4.582  3.739   16.001  1.00 35.54 ? 25  ALA A H    1  
ATOM 407    H HA   . ALA A 1 25  ? -4.212  1.121   17.335  1.00 35.50 ? 25  ALA A HA   1  
ATOM 408    H HB1  . ALA A 1 25  ? -2.780  1.491   15.218  1.00 53.24 ? 25  ALA A HB1  1  
ATOM 409    H HB2  . ALA A 1 25  ? -1.930  1.035   16.690  1.00 3.33  ? 25  ALA A HB2  1  
ATOM 410    H HB3  . ALA A 1 25  ? -1.900  2.707   16.159  1.00 33.32 ? 25  ALA A HB3  1  
ATOM 411    N N    . PRO A 1 26  ? -4.474  2.809   19.336  1.00 22.05 ? 26  PRO A N    1  
ATOM 412    C CA   . PRO A 1 26  ? -4.570  3.769   20.472  1.00 31.12 ? 26  PRO A CA   1  
ATOM 413    C C    . PRO A 1 26  ? -3.281  3.863   21.296  1.00 45.41 ? 26  PRO A C    1  
ATOM 414    O O    . PRO A 1 26  ? -2.802  4.959   21.599  1.00 13.53 ? 26  PRO A O    1  
ATOM 415    C CB   . PRO A 1 26  ? -5.744  3.209   21.328  1.00 53.33 ? 26  PRO A CB   1  
ATOM 416    C CG   . PRO A 1 26  ? -6.532  2.359   20.384  1.00 62.31 ? 26  PRO A CG   1  
ATOM 417    C CD   . PRO A 1 26  ? -5.509  1.741   19.462  1.00 13.15 ? 26  PRO A CD   1  
ATOM 418    H HA   . PRO A 1 26  ? -4.834  4.763   20.112  1.00 34.34 ? 26  PRO A HA   1  
ATOM 419    H HB2  . PRO A 1 26  ? -5.365  2.612   22.163  1.00 2.12  ? 26  PRO A HB2  1  
ATOM 420    H HB3  . PRO A 1 26  ? -6.357  4.017   21.708  1.00 53.41 ? 26  PRO A HB3  1  
ATOM 421    H HG2  . PRO A 1 26  ? -7.071  1.590   20.933  1.00 5.51  ? 26  PRO A HG2  1  
ATOM 422    H HG3  . PRO A 1 26  ? -7.230  2.967   19.814  1.00 13.34 ? 26  PRO A HG3  1  
ATOM 423    H HD2  . PRO A 1 26  ? -5.085  0.841   19.902  1.00 71.34 ? 26  PRO A HD2  1  
ATOM 424    H HD3  . PRO A 1 26  ? -5.953  1.514   18.499  1.00 33.41 ? 26  PRO A HD3  1  
ATOM 425    N N    . ASN A 1 27  ? -2.719  2.691   21.638  1.00 74.03 ? 27  ASN A N    1  
ATOM 426    C CA   . ASN A 1 27  ? -1.479  2.593   22.421  1.00 43.33 ? 27  ASN A CA   1  
ATOM 427    C C    . ASN A 1 27  ? -0.436  1.849   21.596  1.00 54.44 ? 27  ASN A C    1  
ATOM 428    O O    . ASN A 1 27  ? 0.300   1.027   22.134  1.00 1.41  ? 27  ASN A O    1  
ATOM 429    C CB   . ASN A 1 27  ? -1.711  1.858   23.768  1.00 14.45 ? 27  ASN A CB   1  
ATOM 430    C CG   . ASN A 1 27  ? -3.061  2.152   24.400  1.00 1.42  ? 27  ASN A CG   1  
ATOM 431    O OD1  . ASN A 1 27  ? -3.229  3.134   25.117  1.00 20.22 ? 27  ASN A OD1  1  
ATOM 432    N ND2  . ASN A 1 27  ? -4.021  1.267   24.153  1.00 63.32 ? 27  ASN A ND2  1  
ATOM 433    H H    . ASN A 1 27  ? -3.154  1.861   21.351  1.00 14.35 ? 27  ASN A H    1  
ATOM 434    H HA   . ASN A 1 27  ? -1.101  3.600   22.622  1.00 72.44 ? 27  ASN A HA   1  
ATOM 435    H HB2  . ASN A 1 27  ? -1.636  0.786   23.612  1.00 15.33 ? 27  ASN A HB2  1  
ATOM 436    H HB3  . ASN A 1 27  ? -0.929  2.141   24.471  1.00 62.32 ? 27  ASN A HB3  1  
ATOM 437    H HD21 . ASN A 1 27  ? -3.794  0.481   23.588  1.00 14.03 ? 27  ASN A HD21 1  
ATOM 438    H HD22 . ASN A 1 27  ? -4.900  1.420   24.544  1.00 64.01 ? 27  ASN A HD22 1  
ATOM 439    N N    . ALA A 1 28  ? -0.379  2.177   20.287  1.00 61.44 ? 28  ALA A N    1  
ATOM 440    C CA   . ALA A 1 28  ? 0.632   1.636   19.349  1.00 20.31 ? 28  ALA A CA   1  
ATOM 441    C C    . ALA A 1 28  ? 2.073   1.667   19.948  1.00 12.31 ? 28  ALA A C    1  
ATOM 442    O O    . ALA A 1 28  ? 2.682   0.606   20.070  1.00 34.31 ? 28  ALA A O    1  
ATOM 443    C CB   . ALA A 1 28  ? 0.574   2.358   17.991  1.00 40.14 ? 28  ALA A CB   1  
ATOM 444    H H    . ALA A 1 28  ? -1.060  2.790   19.933  1.00 54.35 ? 28  ALA A H    1  
ATOM 445    H HA   . ALA A 1 28  ? 0.356   0.601   19.168  1.00 34.00 ? 28  ALA A HA   1  
ATOM 446    H HB1  . ALA A 1 28  ? 1.236   1.867   17.286  1.00 53.45 ? 28  ALA A HB1  1  
ATOM 447    H HB2  . ALA A 1 28  ? 0.884   3.388   18.109  1.00 74.12 ? 28  ALA A HB2  1  
ATOM 448    H HB3  . ALA A 1 28  ? -0.432  2.334   17.609  1.00 1.35  ? 28  ALA A HB3  1  
ATOM 449    N N    . PRO A 1 29  ? 2.604   2.855   20.456  1.00 12.42 ? 29  PRO A N    1  
ATOM 450    C CA   . PRO A 1 29  ? 3.992   2.934   20.985  1.00 25.30 ? 29  PRO A CA   1  
ATOM 451    C C    . PRO A 1 29  ? 4.218   2.051   22.241  1.00 70.23 ? 29  PRO A C    1  
ATOM 452    O O    . PRO A 1 29  ? 5.351   1.656   22.548  1.00 72.41 ? 29  PRO A O    1  
ATOM 453    C CB   . PRO A 1 29  ? 4.177   4.438   21.346  1.00 63.41 ? 29  PRO A CB   1  
ATOM 454    C CG   . PRO A 1 29  ? 3.014   5.173   20.746  1.00 31.14 ? 29  PRO A CG   1  
ATOM 455    C CD   . PRO A 1 29  ? 1.906   4.169   20.605  1.00 41.31 ? 29  PRO A CD   1  
ATOM 456    H HA   . PRO A 1 29  ? 4.712   2.648   20.221  1.00 54.41 ? 29  PRO A HA   1  
ATOM 457    H HB2  . PRO A 1 29  ? 4.194   4.572   22.431  1.00 63.31 ? 29  PRO A HB2  1  
ATOM 458    H HB3  . PRO A 1 29  ? 5.109   4.811   20.936  1.00 70.44 ? 29  PRO A HB3  1  
ATOM 459    H HG2  . PRO A 1 29  ? 2.708   5.984   21.403  1.00 2.04  ? 29  PRO A HG2  1  
ATOM 460    H HG3  . PRO A 1 29  ? 3.275   5.577   19.768  1.00 55.42 ? 29  PRO A HG3  1  
ATOM 461    H HD2  . PRO A 1 29  ? 1.274   4.168   21.494  1.00 41.02 ? 29  PRO A HD2  1  
ATOM 462    H HD3  . PRO A 1 29  ? 1.307   4.384   19.730  1.00 12.14 ? 29  PRO A HD3  1  
ATOM 463    N N    . HIS A 1 30  ? 3.115   1.759   22.957  1.00 63.31 ? 30  HIS A N    1  
ATOM 464    C CA   . HIS A 1 30  ? 3.141   1.038   24.247  1.00 32.24 ? 30  HIS A CA   1  
ATOM 465    C C    . HIS A 1 30  ? 2.897   -0.472  24.051  1.00 24.43 ? 30  HIS A C    1  
ATOM 466    O O    . HIS A 1 30  ? 3.190   -1.266  24.936  1.00 54.42 ? 30  HIS A O    1  
ATOM 467    C CB   . HIS A 1 30  ? 2.048   1.593   25.195  1.00 65.32 ? 30  HIS A CB   1  
ATOM 468    C CG   . HIS A 1 30  ? 2.090   3.078   25.437  1.00 13.04 ? 30  HIS A CG   1  
ATOM 469    N ND1  . HIS A 1 30  ? 2.439   3.630   26.647  1.00 60.42 ? 30  HIS A ND1  1  
ATOM 470    C CD2  . HIS A 1 30  ? 1.788   4.125   24.630  1.00 2.52  ? 30  HIS A CD2  1  
ATOM 471    C CE1  . HIS A 1 30  ? 2.351   4.939   26.574  1.00 1.34  ? 30  HIS A CE1  1  
ATOM 472    N NE2  . HIS A 1 30  ? 1.959   5.266   25.364  1.00 65.41 ? 30  HIS A NE2  1  
ATOM 473    H H    . HIS A 1 30  ? 2.246   2.023   22.595  1.00 40.11 ? 30  HIS A H    1  
ATOM 474    H HA   . HIS A 1 30  ? 4.118   1.183   24.707  1.00 31.35 ? 30  HIS A HA   1  
ATOM 475    H HB2  . HIS A 1 30  ? 1.071   1.363   24.786  1.00 53.23 ? 30  HIS A HB2  1  
ATOM 476    H HB3  . HIS A 1 30  ? 2.137   1.101   26.162  1.00 64.12 ? 30  HIS A HB3  1  
ATOM 477    H HD1  . HIS A 1 30  ? 2.699   3.133   27.443  1.00 52.22 ? 30  HIS A HD1  1  
ATOM 478    H HD2  . HIS A 1 30  ? 1.468   4.070   23.594  1.00 10.33 ? 30  HIS A HD2  1  
ATOM 479    H HE1  . HIS A 1 30  ? 2.563   5.628   27.374  1.00 52.41 ? 30  HIS A HE1  1  
ATOM 480    H HE2  . HIS A 1 30  ? 1.616   6.154   25.113  1.00 37.99 ? 30  HIS A HE2  1  
ATOM 481    N N    . VAL A 1 31  ? 2.275   -0.832  22.929  1.00 43.21 ? 31  VAL A N    1  
ATOM 482    C CA   . VAL A 1 31  ? 1.835   -2.215  22.633  1.00 50.24 ? 31  VAL A CA   1  
ATOM 483    C C    . VAL A 1 31  ? 2.990   -3.103  22.111  1.00 51.14 ? 31  VAL A C    1  
ATOM 484    O O    . VAL A 1 31  ? 3.023   -4.316  22.368  1.00 23.32 ? 31  VAL A O    1  
ATOM 485    C CB   . VAL A 1 31  ? 0.576   -2.171  21.653  1.00 53.21 ? 31  VAL A CB   1  
ATOM 486    C CG1  . VAL A 1 31  ? 0.745   -3.040  20.371  1.00 63.54 ? 31  VAL A CG1  1  
ATOM 487    C CG2  . VAL A 1 31  ? -0.725  -2.526  22.420  1.00 13.10 ? 31  VAL A CG2  1  
ATOM 488    H H    . VAL A 1 31  ? 2.091   -0.143  22.260  1.00 0.01  ? 31  VAL A H    1  
ATOM 489    H HA   . VAL A 1 31  ? 1.510   -2.648  23.580  1.00 51.51 ? 31  VAL A HA   1  
ATOM 490    H HB   . VAL A 1 31  ? 0.454   -1.134  21.312  1.00 72.22 ? 31  VAL A HB   1  
ATOM 491    H HG11 . VAL A 1 31  ? 0.729   -4.091  20.630  1.00 64.31 ? 31  VAL A HG11 1  
ATOM 492    H HG12 . VAL A 1 31  ? 1.693   -2.809  19.898  1.00 15.43 ? 31  VAL A HG12 1  
ATOM 493    H HG13 . VAL A 1 31  ? -0.048  -2.826  19.679  1.00 51.13 ? 31  VAL A HG13 1  
ATOM 494    H HG21 . VAL A 1 31  ? -0.801  -1.916  23.314  1.00 24.32 ? 31  VAL A HG21 1  
ATOM 495    H HG22 . VAL A 1 31  ? -0.732  -3.567  22.694  1.00 62.31 ? 31  VAL A HG22 1  
ATOM 496    H HG23 . VAL A 1 31  ? -1.576  -2.326  21.793  1.00 4.34  ? 31  VAL A HG23 1  
ATOM 497    N N    . PHE A 1 32  ? 3.932   -2.481  21.380  1.00 33.12 ? 32  PHE A N    1  
ATOM 498    C CA   . PHE A 1 32  ? 5.081   -3.189  20.746  1.00 52.43 ? 32  PHE A CA   1  
ATOM 499    C C    . PHE A 1 32  ? 6.167   -3.617  21.772  1.00 31.00 ? 32  PHE A C    1  
ATOM 500    O O    . PHE A 1 32  ? 7.203   -4.169  21.386  1.00 34.41 ? 32  PHE A O    1  
ATOM 501    C CB   . PHE A 1 32  ? 5.702   -2.301  19.629  1.00 15.42 ? 32  PHE A CB   1  
ATOM 502    C CG   . PHE A 1 32  ? 4.724   -1.929  18.505  1.00 42.51 ? 32  PHE A CG   1  
ATOM 503    C CD1  . PHE A 1 32  ? 3.974   -2.911  17.847  1.00 74.51 ? 32  PHE A CD1  1  
ATOM 504    C CD2  . PHE A 1 32  ? 4.559   -0.602  18.101  1.00 43.20 ? 32  PHE A CD2  1  
ATOM 505    C CE1  . PHE A 1 32  ? 3.091   -2.573  16.832  1.00 31.13 ? 32  PHE A CE1  1  
ATOM 506    C CE2  . PHE A 1 32  ? 3.677   -0.267  17.087  1.00 3.54  ? 32  PHE A CE2  1  
ATOM 507    C CZ   . PHE A 1 32  ? 2.944   -1.252  16.454  1.00 31.00 ? 32  PHE A CZ   1  
ATOM 508    H H    . PHE A 1 32  ? 3.841   -1.515  21.248  1.00 11.01 ? 32  PHE A H    1  
ATOM 509    H HA   . PHE A 1 32  ? 4.693   -4.091  20.285  1.00 60.43 ? 32  PHE A HA   1  
ATOM 510    H HB2  . PHE A 1 32  ? 6.077   -1.386  20.079  1.00 32.21 ? 32  PHE A HB2  1  
ATOM 511    H HB3  . PHE A 1 32  ? 6.540   -2.825  19.178  1.00 22.13 ? 32  PHE A HB3  1  
ATOM 512    H HD1  . PHE A 1 32  ? 4.085   -3.950  18.136  1.00 4.22  ? 32  PHE A HD1  1  
ATOM 513    H HD2  . PHE A 1 32  ? 5.132   0.177   18.590  1.00 43.21 ? 32  PHE A HD2  1  
ATOM 514    H HE1  . PHE A 1 32  ? 2.519   -3.344  16.332  1.00 5.34  ? 32  PHE A HE1  1  
ATOM 515    H HE2  . PHE A 1 32  ? 3.563   0.768   16.790  1.00 73.04 ? 32  PHE A HE2  1  
ATOM 516    H HZ   . PHE A 1 32  ? 2.256   -0.988  15.661  1.00 42.55 ? 32  PHE A HZ   1  
ATOM 517    N N    . GLN A 1 33  ? 5.963   -3.282  23.058  1.00 1.30  ? 33  GLN A N    1  
ATOM 518    C CA   . GLN A 1 33  ? 6.789   -3.785  24.191  1.00 44.41 ? 33  GLN A CA   1  
ATOM 519    C C    . GLN A 1 33  ? 6.043   -4.855  25.032  1.00 64.12 ? 33  GLN A C    1  
ATOM 520    O O    . GLN A 1 33  ? 6.648   -5.501  25.893  1.00 32.40 ? 33  GLN A O    1  
ATOM 521    C CB   . GLN A 1 33  ? 7.233   -2.595  25.085  1.00 20.44 ? 33  GLN A CB   1  
ATOM 522    C CG   . GLN A 1 33  ? 6.067   -1.697  25.534  1.00 62.45 ? 33  GLN A CG   1  
ATOM 523    C CD   . GLN A 1 33  ? 6.437   -0.551  26.468  1.00 14.13 ? 33  GLN A CD   1  
ATOM 524    O OE1  . GLN A 1 33  ? 7.546   -0.030  26.424  1.00 5.20  ? 33  GLN A OE1  1  
ATOM 525    N NE2  . GLN A 1 33  ? 5.492   -0.133  27.305  1.00 10.35 ? 33  GLN A NE2  1  
ATOM 526    H H    . GLN A 1 33  ? 5.220   -2.680  23.261  1.00 41.13 ? 33  GLN A H    1  
ATOM 527    H HA   . GLN A 1 33  ? 7.680   -4.255  23.777  1.00 45.34 ? 33  GLN A HA   1  
ATOM 528    H HB2  . GLN A 1 33  ? 7.736   -2.978  25.971  1.00 43.14 ? 33  GLN A HB2  1  
ATOM 529    H HB3  . GLN A 1 33  ? 7.939   -1.984  24.530  1.00 12.33 ? 33  GLN A HB3  1  
ATOM 530    H HG2  . GLN A 1 33  ? 5.613   -1.262  24.651  1.00 4.53  ? 33  GLN A HG2  1  
ATOM 531    H HG3  . GLN A 1 33  ? 5.327   -2.321  26.023  1.00 1.10  ? 33  GLN A HG3  1  
ATOM 532    H HE21 . GLN A 1 33  ? 4.618   -0.578  27.276  1.00 64.24 ? 33  GLN A HE21 1  
ATOM 533    H HE22 . GLN A 1 33  ? 5.703   0.608   27.911  1.00 51.12 ? 33  GLN A HE22 1  
ATOM 534    N N    . LYS A 1 34  ? 4.724   -5.010  24.795  1.00 3.04  ? 34  LYS A N    1  
ATOM 535    C CA   . LYS A 1 34  ? 3.831   -5.856  25.639  1.00 63.04 ? 34  LYS A CA   1  
ATOM 536    C C    . LYS A 1 34  ? 3.924   -7.362  25.318  1.00 42.21 ? 34  LYS A C    1  
ATOM 537    O O    . LYS A 1 34  ? 4.566   -7.766  24.349  1.00 3.44  ? 34  LYS A O    1  
ATOM 538    C CB   . LYS A 1 34  ? 2.353   -5.366  25.521  1.00 1.33  ? 34  LYS A CB   1  
ATOM 539    C CG   . LYS A 1 34  ? 2.090   -4.018  26.210  1.00 3.33  ? 34  LYS A CG   1  
ATOM 540    C CD   . LYS A 1 34  ? 2.296   -4.093  27.738  1.00 61.53 ? 34  LYS A CD   1  
ATOM 541    C CE   . LYS A 1 34  ? 2.257   -2.714  28.404  1.00 73.44 ? 34  LYS A CE   1  
ATOM 542    N NZ   . LYS A 1 34  ? 0.984   -2.005  28.169  1.00 25.41 ? 34  LYS A NZ   1  
ATOM 543    H H    . LYS A 1 34  ? 4.335   -4.557  24.021  1.00 52.02 ? 34  LYS A H    1  
ATOM 544    H HA   . LYS A 1 34  ? 4.147   -5.723  26.670  1.00 22.42 ? 34  LYS A HA   1  
ATOM 545    H HB2  . LYS A 1 34  ? 2.101   -5.265  24.471  1.00 3.33  ? 34  LYS A HB2  1  
ATOM 546    H HB3  . LYS A 1 34  ? 1.688   -6.105  25.960  1.00 31.41 ? 34  LYS A HB3  1  
ATOM 547    H HG2  . LYS A 1 34  ? 2.775   -3.286  25.798  1.00 25.25 ? 34  LYS A HG2  1  
ATOM 548    H HG3  . LYS A 1 34  ? 1.070   -3.703  26.004  1.00 63.01 ? 34  LYS A HG3  1  
ATOM 549    H HD2  . LYS A 1 34  ? 1.519   -4.715  28.173  1.00 50.12 ? 34  LYS A HD2  1  
ATOM 550    H HD3  . LYS A 1 34  ? 3.262   -4.548  27.942  1.00 41.53 ? 34  LYS A HD3  1  
ATOM 551    H HE2  . LYS A 1 34  ? 2.390   -2.839  29.465  1.00 62.34 ? 34  LYS A HE2  1  
ATOM 552    H HE3  . LYS A 1 34  ? 3.067   -2.108  28.013  1.00 61.12 ? 34  LYS A HE3  1  
ATOM 553    H HZ1  . LYS A 1 34  ? 1.007   -1.056  28.593  1.00 4.22  ? 34  LYS A HZ1  1  
ATOM 554    H HZ2  . LYS A 1 34  ? 0.190   -2.532  28.580  1.00 51.02 ? 34  LYS A HZ2  1  
ATOM 555    H HZ3  . LYS A 1 34  ? 0.823   -1.902  27.148  1.00 21.11 ? 34  LYS A HZ3  1  
ATOM 556    N N    . ASP A 1 35  ? 3.272   -8.168  26.194  1.00 64.21 ? 35  ASP A N    1  
ATOM 557    C CA   . ASP A 1 35  ? 3.108   -9.634  26.034  1.00 44.33 ? 35  ASP A CA   1  
ATOM 558    C C    . ASP A 1 35  ? 2.330   -9.937  24.752  1.00 5.43  ? 35  ASP A C    1  
ATOM 559    O O    . ASP A 1 35  ? 1.277   -9.340  24.519  1.00 4.54  ? 35  ASP A O    1  
ATOM 560    C CB   . ASP A 1 35  ? 2.336   -10.242 27.241  1.00 3.40  ? 35  ASP A CB   1  
ATOM 561    C CG   . ASP A 1 35  ? 3.056   -10.076 28.585  1.00 44.54 ? 35  ASP A CG   1  
ATOM 562    O OD1  . ASP A 1 35  ? 3.238   -8.925  29.033  1.00 65.23 ? 35  ASP A OD1  1  
ATOM 563    O OD2  . ASP A 1 35  ? 3.428   -11.092 29.216  1.00 1.01  ? 35  ASP A OD2  1  
ATOM 564    H H    . ASP A 1 35  ? 2.882   -7.753  26.992  1.00 74.24 ? 35  ASP A H    1  
ATOM 565    H HA   . ASP A 1 35  ? 4.095   -10.083 25.979  1.00 34.21 ? 35  ASP A HA   1  
ATOM 566    H HB2  . ASP A 1 35  ? 1.365   -9.763  27.321  1.00 12.50 ? 35  ASP A HB2  1  
ATOM 567    H HB3  . ASP A 1 35  ? 2.178   -11.304 27.060  1.00 75.54 ? 35  ASP A HB3  1  
ATOM 568    N N    . TRP A 1 36  ? 2.819   -10.910 23.974  1.00 24.04 ? 36  TRP A N    1  
ATOM 569    C CA   . TRP A 1 36  ? 2.343   -11.179 22.609  1.00 32.25 ? 36  TRP A CA   1  
ATOM 570    C C    . TRP A 1 36  ? 1.104   -12.106 22.610  1.00 54.44 ? 36  TRP A C    1  
ATOM 571    O O    . TRP A 1 36  ? 1.128   -13.210 22.046  1.00 31.52 ? 36  TRP A O    1  
ATOM 572    C CB   . TRP A 1 36  ? 3.517   -11.797 21.790  1.00 51.44 ? 36  TRP A CB   1  
ATOM 573    C CG   . TRP A 1 36  ? 4.834   -11.056 21.948  1.00 11.30 ? 36  TRP A CG   1  
ATOM 574    C CD1  . TRP A 1 36  ? 6.006   -11.556 22.452  1.00 42.43 ? 36  TRP A CD1  1  
ATOM 575    C CD2  . TRP A 1 36  ? 5.094   -9.673  21.649  1.00 73.34 ? 36  TRP A CD2  1  
ATOM 576    N NE1  . TRP A 1 36  ? 6.971   -10.585 22.448  1.00 12.13 ? 36  TRP A NE1  1  
ATOM 577    C CE2  . TRP A 1 36  ? 6.439   -9.426  21.958  1.00 41.04 ? 36  TRP A CE2  1  
ATOM 578    C CE3  . TRP A 1 36  ? 4.328   -8.629  21.130  1.00 72.41 ? 36  TRP A CE3  1  
ATOM 579    C CZ2  . TRP A 1 36  ? 7.030   -8.178  21.779  1.00 64.51 ? 36  TRP A CZ2  1  
ATOM 580    C CZ3  . TRP A 1 36  ? 4.909   -7.391  20.952  1.00 42.45 ? 36  TRP A CZ3  1  
ATOM 581    C CH2  . TRP A 1 36  ? 6.254   -7.180  21.267  1.00 71.33 ? 36  TRP A CH2  1  
ATOM 582    H H    . TRP A 1 36  ? 3.540   -11.468 24.333  1.00 71.45 ? 36  TRP A H    1  
ATOM 583    H HA   . TRP A 1 36  ? 2.061   -10.234 22.149  1.00 34.44 ? 36  TRP A HA   1  
ATOM 584    H HB2  . TRP A 1 36  ? 3.670   -12.827 22.101  1.00 42.42 ? 36  TRP A HB2  1  
ATOM 585    H HB3  . TRP A 1 36  ? 3.260   -11.789 20.737  1.00 25.32 ? 36  TRP A HB3  1  
ATOM 586    H HD1  . TRP A 1 36  ? 6.143   -12.576 22.787  1.00 11.55 ? 36  TRP A HD1  1  
ATOM 587    H HE1  . TRP A 1 36  ? 7.897   -10.701 22.748  1.00 61.24 ? 36  TRP A HE1  1  
ATOM 588    H HE3  . TRP A 1 36  ? 3.285   -8.777  20.881  1.00 24.54 ? 36  TRP A HE3  1  
ATOM 589    H HZ2  . TRP A 1 36  ? 8.074   -8.000  22.016  1.00 63.22 ? 36  TRP A HZ2  1  
ATOM 590    H HZ3  . TRP A 1 36  ? 4.323   -6.571  20.550  1.00 2.45  ? 36  TRP A HZ3  1  
ATOM 591    H HH2  . TRP A 1 36  ? 6.672   -6.197  21.108  1.00 64.32 ? 36  TRP A HH2  1  
ATOM 592    N N    . GLN A 1 37  ? 0.010   -11.620 23.229  1.00 53.23 ? 37  GLN A N    1  
ATOM 593    C CA   . GLN A 1 37  ? -1.296  -12.306 23.263  1.00 30.24 ? 37  GLN A CA   1  
ATOM 594    C C    . GLN A 1 37  ? -2.446  -11.257 23.256  1.00 25.14 ? 37  GLN A C    1  
ATOM 595    O O    . GLN A 1 37  ? -2.984  -10.925 24.315  1.00 1.52  ? 37  GLN A O    1  
ATOM 596    C CB   . GLN A 1 37  ? -1.428  -13.263 24.505  1.00 60.41 ? 37  GLN A CB   1  
ATOM 597    C CG   . GLN A 1 37  ? -0.557  -14.539 24.469  1.00 23.34 ? 37  GLN A CG   1  
ATOM 598    C CD   . GLN A 1 37  ? -0.849  -15.505 25.625  1.00 15.14 ? 37  GLN A CD   1  
ATOM 599    O OE1  . GLN A 1 37  ? -0.224  -15.442 26.682  1.00 73.11 ? 37  GLN A OE1  1  
ATOM 600    N NE2  . GLN A 1 37  ? -1.816  -16.387 25.429  1.00 5.15  ? 37  GLN A NE2  1  
ATOM 601    H H    . GLN A 1 37  ? 0.081   -10.759 23.680  1.00 73.15 ? 37  GLN A H    1  
ATOM 602    H HA   . GLN A 1 37  ? -1.386  -12.902 22.357  1.00 1.35  ? 37  GLN A HA   1  
ATOM 603    H HB2  . GLN A 1 37  ? -1.165  -12.705 25.395  1.00 54.05 ? 37  GLN A HB2  1  
ATOM 604    H HB3  . GLN A 1 37  ? -2.467  -13.572 24.594  1.00 62.15 ? 37  GLN A HB3  1  
ATOM 605    H HG2  . GLN A 1 37  ? -0.733  -15.053 23.530  1.00 34.02 ? 37  GLN A HG2  1  
ATOM 606    H HG3  . GLN A 1 37  ? 0.489   -14.252 24.514  1.00 52.01 ? 37  GLN A HG3  1  
ATOM 607    H HE21 . GLN A 1 37  ? -2.285  -16.374 24.565  1.00 23.33 ? 37  GLN A HE21 1  
ATOM 608    H HE22 . GLN A 1 37  ? -2.037  -17.005 26.157  1.00 43.15 ? 37  GLN A HE22 1  
ATOM 609    N N    . PRO A 1 38  ? -2.766  -10.632 22.072  1.00 2.41  ? 38  PRO A N    1  
ATOM 610    C CA   . PRO A 1 38  ? -4.037  -9.900  21.877  1.00 14.33 ? 38  PRO A CA   1  
ATOM 611    C C    . PRO A 1 38  ? -5.237  -10.848 21.674  1.00 70.44 ? 38  PRO A C    1  
ATOM 612    O O    . PRO A 1 38  ? -5.092  -11.949 21.132  1.00 73.03 ? 38  PRO A O    1  
ATOM 613    C CB   . PRO A 1 38  ? -3.780  -9.057  20.599  1.00 34.22 ? 38  PRO A CB   1  
ATOM 614    C CG   . PRO A 1 38  ? -2.752  -9.829  19.838  1.00 65.31 ? 38  PRO A CG   1  
ATOM 615    C CD   . PRO A 1 38  ? -1.878  -10.487 20.889  1.00 51.01 ? 38  PRO A CD   1  
ATOM 616    H HA   . PRO A 1 38  ? -4.238  -9.237  22.715  1.00 21.31 ? 38  PRO A HA   1  
ATOM 617    H HB2  . PRO A 1 38  ? -4.694  -8.938  20.018  1.00 50.44 ? 38  PRO A HB2  1  
ATOM 618    H HB3  . PRO A 1 38  ? -3.391  -8.082  20.864  1.00 61.12 ? 38  PRO A HB3  1  
ATOM 619    H HG2  . PRO A 1 38  ? -3.237  -10.580 19.217  1.00 2.22  ? 38  PRO A HG2  1  
ATOM 620    H HG3  . PRO A 1 38  ? -2.157  -9.165  19.219  1.00 12.51 ? 38  PRO A HG3  1  
ATOM 621    H HD2  . PRO A 1 38  ? -1.534  -11.454 20.547  1.00 13.34 ? 38  PRO A HD2  1  
ATOM 622    H HD3  . PRO A 1 38  ? -1.027  -9.855  21.128  1.00 33.14 ? 38  PRO A HD3  1  
ATOM 623    N N    . GLU A 1 39  ? -6.415  -10.401 22.114  1.00 60.32 ? 39  GLU A N    1  
ATOM 624    C CA   . GLU A 1 39  ? -7.689  -11.086 21.864  1.00 54.53 ? 39  GLU A CA   1  
ATOM 625    C C    . GLU A 1 39  ? -8.355  -10.408 20.658  1.00 75.42 ? 39  GLU A C    1  
ATOM 626    O O    . GLU A 1 39  ? -8.875  -9.289  20.778  1.00 74.52 ? 39  GLU A O    1  
ATOM 627    C CB   . GLU A 1 39  ? -8.576  -11.006 23.135  1.00 25.51 ? 39  GLU A CB   1  
ATOM 628    C CG   . GLU A 1 39  ? -9.952  -11.697 23.024  1.00 23.12 ? 39  GLU A CG   1  
ATOM 629    C CD   . GLU A 1 39  ? -10.743 -11.669 24.343  1.00 45.52 ? 39  GLU A CD   1  
ATOM 630    O OE1  . GLU A 1 39  ? -10.907 -12.730 24.988  1.00 14.50 ? 39  GLU A OE1  1  
ATOM 631    O OE2  . GLU A 1 39  ? -11.181 -10.575 24.755  1.00 4.43  ? 39  GLU A OE2  1  
ATOM 632    H H    . GLU A 1 39  ? -6.433  -9.575  22.642  1.00 12.21 ? 39  GLU A H    1  
ATOM 633    H HA   . GLU A 1 39  ? -7.490  -12.133 21.629  1.00 45.40 ? 39  GLU A HA   1  
ATOM 634    H HB2  . GLU A 1 39  ? -8.036  -11.462 23.957  1.00 0.13  ? 39  GLU A HB2  1  
ATOM 635    H HB3  . GLU A 1 39  ? -8.741  -9.958  23.378  1.00 71.55 ? 39  GLU A HB3  1  
ATOM 636    H HG2  . GLU A 1 39  ? -10.535 -11.191 22.260  1.00 0.51  ? 39  GLU A HG2  1  
ATOM 637    H HG3  . GLU A 1 39  ? -9.799  -12.726 22.719  1.00 51.24 ? 39  GLU A HG3  1  
ATOM 638    N N    . VAL A 1 40  ? -8.266  -11.053 19.477  1.00 33.14 ? 40  VAL A N    1  
ATOM 639    C CA   . VAL A 1 40  ? -8.764  -10.476 18.222  1.00 70.40 ? 40  VAL A CA   1  
ATOM 640    C C    . VAL A 1 40  ? -10.268 -10.772 18.074  1.00 33.44 ? 40  VAL A C    1  
ATOM 641    O O    . VAL A 1 40  ? -10.664 -11.868 17.663  1.00 42.34 ? 40  VAL A O    1  
ATOM 642    C CB   . VAL A 1 40  ? -7.952  -10.977 16.968  1.00 2.15  ? 40  VAL A CB   1  
ATOM 643    C CG1  . VAL A 1 40  ? -8.440  -10.280 15.671  1.00 44.34 ? 40  VAL A CG1  1  
ATOM 644    C CG2  . VAL A 1 40  ? -6.430  -10.770 17.183  1.00 72.41 ? 40  VAL A CG2  1  
ATOM 645    H H    . VAL A 1 40  ? -7.868  -11.947 19.456  1.00 64.51 ? 40  VAL A H    1  
ATOM 646    H HA   . VAL A 1 40  ? -8.632  -9.394  18.284  1.00 24.13 ? 40  VAL A HA   1  
ATOM 647    H HB   . VAL A 1 40  ? -8.129  -12.048 16.854  1.00 40.34 ? 40  VAL A HB   1  
ATOM 648    H HG11 . VAL A 1 40  ? -9.491  -10.490 15.516  1.00 11.20 ? 40  VAL A HG11 1  
ATOM 649    H HG12 . VAL A 1 40  ? -7.880  -10.648 14.820  1.00 53.42 ? 40  VAL A HG12 1  
ATOM 650    H HG13 . VAL A 1 40  ? -8.299  -9.208  15.752  1.00 21.11 ? 40  VAL A HG13 1  
ATOM 651    H HG21 . VAL A 1 40  ? -6.108  -11.312 18.063  1.00 72.31 ? 40  VAL A HG21 1  
ATOM 652    H HG22 . VAL A 1 40  ? -6.213  -9.717  17.315  1.00 34.24 ? 40  VAL A HG22 1  
ATOM 653    H HG23 . VAL A 1 40  ? -5.883  -11.139 16.322  1.00 22.41 ? 40  VAL A HG23 1  
ATOM 654    N N    . LYS A 1 41  ? -11.083 -9.796  18.495  1.00 53.22 ? 41  LYS A N    1  
ATOM 655    C CA   . LYS A 1 41  ? -12.540 -9.833  18.364  1.00 62.13 ? 41  LYS A CA   1  
ATOM 656    C C    . LYS A 1 41  ? -12.945 -9.314  16.981  1.00 34.42 ? 41  LYS A C    1  
ATOM 657    O O    . LYS A 1 41  ? -12.641 -8.163  16.634  1.00 62.32 ? 41  LYS A O    1  
ATOM 658    C CB   . LYS A 1 41  ? -13.189 -8.970  19.477  1.00 52.31 ? 41  LYS A CB   1  
ATOM 659    C CG   . LYS A 1 41  ? -14.739 -8.993  19.491  1.00 52.02 ? 41  LYS A CG   1  
ATOM 660    C CD   . LYS A 1 41  ? -15.345 -8.179  20.664  1.00 70.41 ? 41  LYS A CD   1  
ATOM 661    C CE   . LYS A 1 41  ? -16.877 -8.290  20.724  1.00 3.53  ? 41  LYS A CE   1  
ATOM 662    N NZ   . LYS A 1 41  ? -17.523 -7.708  19.525  1.00 43.10 ? 41  LYS A NZ   1  
ATOM 663    H H    . LYS A 1 41  ? -10.679 -9.014  18.922  1.00 55.13 ? 41  LYS A H    1  
ATOM 664    H HA   . LYS A 1 41  ? -12.871 -10.865 18.478  1.00 3.33  ? 41  LYS A HA   1  
ATOM 665    H HB2  . LYS A 1 41  ? -12.835 -9.329  20.436  1.00 44.33 ? 41  LYS A HB2  1  
ATOM 666    H HB3  . LYS A 1 41  ? -12.862 -7.940  19.354  1.00 33.44 ? 41  LYS A HB3  1  
ATOM 667    H HG2  . LYS A 1 41  ? -15.105 -8.583  18.554  1.00 1.11  ? 41  LYS A HG2  1  
ATOM 668    H HG3  . LYS A 1 41  ? -15.067 -10.024 19.574  1.00 4.44  ? 41  LYS A HG3  1  
ATOM 669    H HD2  . LYS A 1 41  ? -14.935 -8.548  21.601  1.00 74.01 ? 41  LYS A HD2  1  
ATOM 670    H HD3  . LYS A 1 41  ? -15.073 -7.132  20.550  1.00 32.32 ? 41  LYS A HD3  1  
ATOM 671    H HE2  . LYS A 1 41  ? -17.157 -9.333  20.792  1.00 54.31 ? 41  LYS A HE2  1  
ATOM 672    H HE3  . LYS A 1 41  ? -17.238 -7.769  21.601  1.00 24.21 ? 41  LYS A HE3  1  
ATOM 673    H HZ1  . LYS A 1 41  ? -17.319 -6.691  19.461  1.00 34.04 ? 41  LYS A HZ1  1  
ATOM 674    H HZ2  . LYS A 1 41  ? -18.553 -7.841  19.568  1.00 5.24  ? 41  LYS A HZ2  1  
ATOM 675    H HZ3  . LYS A 1 41  ? -17.167 -8.168  18.662  1.00 13.53 ? 41  LYS A HZ3  1  
ATOM 676    N N    . LEU A 1 42  ? -13.615 -10.165 16.199  1.00 33.45 ? 42  LEU A N    1  
ATOM 677    C CA   . LEU A 1 42  ? -14.120 -9.786  14.872  1.00 2.52  ? 42  LEU A CA   1  
ATOM 678    C C    . LEU A 1 42  ? -15.609 -9.400  14.981  1.00 13.52 ? 42  LEU A C    1  
ATOM 679    O O    . LEU A 1 42  ? -16.359 -9.940  15.814  1.00 20.05 ? 42  LEU A O    1  
ATOM 680    C CB   . LEU A 1 42  ? -13.896 -10.925 13.816  1.00 72.41 ? 42  LEU A CB   1  
ATOM 681    C CG   . LEU A 1 42  ? -14.890 -12.150 13.808  1.00 52.33 ? 42  LEU A CG   1  
ATOM 682    C CD1  . LEU A 1 42  ? -14.615 -13.097 12.611  1.00 71.34 ? 42  LEU A CD1  1  
ATOM 683    C CD2  . LEU A 1 42  ? -14.879 -12.936 15.140  1.00 41.23 ? 42  LEU A CD2  1  
ATOM 684    H H    . LEU A 1 42  ? -13.777 -11.072 16.526  1.00 52.51 ? 42  LEU A H    1  
ATOM 685    H HA   . LEU A 1 42  ? -13.564 -8.898  14.544  1.00 65.22 ? 42  LEU A HA   1  
ATOM 686    H HB2  . LEU A 1 42  ? -13.930 -10.467 12.835  1.00 34.43 ? 42  LEU A HB2  1  
ATOM 687    H HB3  . LEU A 1 42  ? -12.890 -11.312 13.959  1.00 41.11 ? 42  LEU A HB3  1  
ATOM 688    H HG   . LEU A 1 42  ? -15.893 -11.764 13.674  1.00 74.43 ? 42  LEU A HG   1  
ATOM 689    H HD11 . LEU A 1 42  ? -15.327 -13.913 12.621  1.00 4.40  ? 42  LEU A HD11 1  
ATOM 690    H HD12 . LEU A 1 42  ? -13.612 -13.500 12.674  1.00 32.25 ? 42  LEU A HD12 1  
ATOM 691    H HD13 . LEU A 1 42  ? -14.721 -12.550 11.682  1.00 70.14 ? 42  LEU A HD13 1  
ATOM 692    H HD21 . LEU A 1 42  ? -15.157 -12.276 15.952  1.00 31.31 ? 42  LEU A HD21 1  
ATOM 693    H HD22 . LEU A 1 42  ? -13.889 -13.334 15.329  1.00 64.34 ? 42  LEU A HD22 1  
ATOM 694    H HD23 . LEU A 1 42  ? -15.588 -13.752 15.089  1.00 31.43 ? 42  LEU A HD23 1  
ATOM 695    N N    . ASP A 1 43  ? -16.009 -8.434  14.153  1.00 44.23 ? 43  ASP A N    1  
ATOM 696    C CA   . ASP A 1 43  ? -17.386 -7.927  14.072  1.00 63.03 ? 43  ASP A CA   1  
ATOM 697    C C    . ASP A 1 43  ? -17.757 -7.760  12.596  1.00 73.51 ? 43  ASP A C    1  
ATOM 698    O O    . ASP A 1 43  ? -16.898 -7.464  11.759  1.00 22.31 ? 43  ASP A O    1  
ATOM 699    C CB   . ASP A 1 43  ? -17.537 -6.573  14.829  1.00 4.13  ? 43  ASP A CB   1  
ATOM 700    C CG   . ASP A 1 43  ? -17.406 -6.693  16.359  1.00 52.12 ? 43  ASP A CG   1  
ATOM 701    O OD1  . ASP A 1 43  ? -18.437 -6.853  17.048  1.00 73.31 ? 43  ASP A OD1  1  
ATOM 702    O OD2  . ASP A 1 43  ? -16.273 -6.650  16.888  1.00 2.50  ? 43  ASP A OD2  1  
ATOM 703    H H    . ASP A 1 43  ? -15.341 -8.035  13.560  1.00 64.14 ? 43  ASP A H    1  
ATOM 704    H HA   . ASP A 1 43  ? -18.055 -8.667  14.514  1.00 72.12 ? 43  ASP A HA   1  
ATOM 705    H HB2  . ASP A 1 43  ? -16.774 -5.886  14.471  1.00 65.10 ? 43  ASP A HB2  1  
ATOM 706    H HB3  . ASP A 1 43  ? -18.509 -6.146  14.601  1.00 75.31 ? 43  ASP A HB3  1  
ATOM 707    N N    . LEU A 1 44  ? -19.035 -7.983  12.279  1.00 41.34 ? 44  LEU A N    1  
ATOM 708    C CA   . LEU A 1 44  ? -19.559 -7.856  10.918  1.00 53.15 ? 44  LEU A CA   1  
ATOM 709    C C    . LEU A 1 44  ? -20.952 -7.231  11.012  1.00 33.40 ? 44  LEU A C    1  
ATOM 710    O O    . LEU A 1 44  ? -21.824 -7.737  11.735  1.00 41.00 ? 44  LEU A O    1  
ATOM 711    C CB   . LEU A 1 44  ? -19.554 -9.252  10.211  1.00 70.21 ? 44  LEU A CB   1  
ATOM 712    C CG   . LEU A 1 44  ? -19.565 -9.253  8.637   1.00 1.03  ? 44  LEU A CG   1  
ATOM 713    C CD1  . LEU A 1 44  ? -19.199 -10.646 8.082   1.00 30.00 ? 44  LEU A CD1  1  
ATOM 714    C CD2  . LEU A 1 44  ? -20.914 -8.776  8.045   1.00 65.22 ? 44  LEU A CD2  1  
ATOM 715    H H    . LEU A 1 44  ? -19.655 -8.239  12.993  1.00 23.34 ? 44  LEU A H    1  
ATOM 716    H HA   . LEU A 1 44  ? -18.908 -7.178  10.358  1.00 10.55 ? 44  LEU A HA   1  
ATOM 717    H HB2  . LEU A 1 44  ? -18.655 -9.770  10.533  1.00 44.11 ? 44  LEU A HB2  1  
ATOM 718    H HB3  . LEU A 1 44  ? -20.407 -9.830  10.562  1.00 42.43 ? 44  LEU A HB3  1  
ATOM 719    H HG   . LEU A 1 44  ? -18.802 -8.566  8.288   1.00 25.04 ? 44  LEU A HG   1  
ATOM 720    H HD11 . LEU A 1 44  ? -19.193 -10.616 7.002   1.00 23.42 ? 44  LEU A HD11 1  
ATOM 721    H HD12 . LEU A 1 44  ? -19.921 -11.382 8.415   1.00 71.32 ? 44  LEU A HD12 1  
ATOM 722    H HD13 . LEU A 1 44  ? -18.214 -10.929 8.432   1.00 71.04 ? 44  LEU A HD13 1  
ATOM 723    H HD21 . LEU A 1 44  ? -21.116 -7.764  8.371   1.00 22.13 ? 44  LEU A HD21 1  
ATOM 724    H HD22 . LEU A 1 44  ? -21.716 -9.423  8.378   1.00 21.51 ? 44  LEU A HD22 1  
ATOM 725    H HD23 . LEU A 1 44  ? -20.865 -8.795  6.965   1.00 11.11 ? 44  LEU A HD23 1  
ATOM 726    N N    . ASP A 1 45  ? -21.148 -6.127  10.288  1.00 61.22 ? 45  ASP A N    1  
ATOM 727    C CA   . ASP A 1 45  ? -22.426 -5.411  10.229  1.00 21.23 ? 45  ASP A CA   1  
ATOM 728    C C    . ASP A 1 45  ? -22.937 -5.478  8.807   1.00 50.14 ? 45  ASP A C    1  
ATOM 729    O O    . ASP A 1 45  ? -22.191 -5.223  7.849   1.00 4.41  ? 45  ASP A O    1  
ATOM 730    C CB   . ASP A 1 45  ? -22.287 -3.930  10.659  1.00 40.51 ? 45  ASP A CB   1  
ATOM 731    C CG   . ASP A 1 45  ? -21.949 -3.776  12.143  1.00 52.40 ? 45  ASP A CG   1  
ATOM 732    O OD1  . ASP A 1 45  ? -20.774 -3.985  12.518  1.00 24.43 ? 45  ASP A OD1  1  
ATOM 733    O OD2  . ASP A 1 45  ? -22.846 -3.424  12.946  1.00 71.42 ? 45  ASP A OD2  1  
ATOM 734    H H    . ASP A 1 45  ? -20.396 -5.775  9.768   1.00 34.43 ? 45  ASP A H    1  
ATOM 735    H HA   . ASP A 1 45  ? -23.137 -5.909  10.893  1.00 0.30  ? 45  ASP A HA   1  
ATOM 736    H HB2  . ASP A 1 45  ? -21.502 -3.461  10.073  1.00 71.22 ? 45  ASP A HB2  1  
ATOM 737    H HB3  . ASP A 1 45  ? -23.218 -3.406  10.458  1.00 50.34 ? 45  ASP A HB3  1  
ATOM 738    N N    . THR A 1 46  ? -24.206 -5.836  8.689   1.00 61.13 ? 46  THR A N    1  
ATOM 739    C CA   . THR A 1 46  ? -24.875 -6.054  7.420   1.00 53.21 ? 46  THR A CA   1  
ATOM 740    C C    . THR A 1 46  ? -25.821 -4.878  7.143   1.00 44.44 ? 46  THR A C    1  
ATOM 741    O O    . THR A 1 46  ? -26.663 -4.536  7.989   1.00 52.02 ? 46  THR A O    1  
ATOM 742    C CB   . THR A 1 46  ? -25.673 -7.392  7.480   1.00 43.00 ? 46  THR A CB   1  
ATOM 743    O OG1  . THR A 1 46  ? -26.615 -7.349  8.556   1.00 41.44 ? 46  THR A OG1  1  
ATOM 744    C CG2  . THR A 1 46  ? -24.754 -8.621  7.663   1.00 14.44 ? 46  THR A CG2  1  
ATOM 745    H H    . THR A 1 46  ? -24.728 -5.972  9.512   1.00 51.34 ? 46  THR A H    1  
ATOM 746    H HA   . THR A 1 46  ? -24.131 -6.124  6.624   1.00 13.41 ? 46  THR A HA   1  
ATOM 747    H HB   . THR A 1 46  ? -26.222 -7.507  6.550   1.00 72.44 ? 46  THR A HB   1  
ATOM 748    H HG1  . THR A 1 46  ? -27.279 -8.031  8.417   1.00 3.33  ? 46  THR A HG1  1  
ATOM 749    H HG21 . THR A 1 46  ? -24.175 -8.518  8.572   1.00 23.22 ? 46  THR A HG21 1  
ATOM 750    H HG22 . THR A 1 46  ? -24.079 -8.703  6.819   1.00 72.53 ? 46  THR A HG22 1  
ATOM 751    H HG23 . THR A 1 46  ? -25.354 -9.519  7.725   1.00 3.13  ? 46  THR A HG23 1  
ATOM 752    N N    . ALA A 1 47  ? -25.652 -4.240  5.978   1.00 51.22 ? 47  ALA A N    1  
ATOM 753    C CA   . ALA A 1 47  ? -26.472 -3.098  5.560   1.00 32.52 ? 47  ALA A CA   1  
ATOM 754    C C    . ALA A 1 47  ? -26.554 -3.065  4.036   1.00 74.34 ? 47  ALA A C    1  
ATOM 755    O O    . ALA A 1 47  ? -25.528 -3.098  3.359   1.00 62.14 ? 47  ALA A O    1  
ATOM 756    C CB   . ALA A 1 47  ? -25.886 -1.777  6.102   1.00 72.41 ? 47  ALA A CB   1  
ATOM 757    H H    . ALA A 1 47  ? -24.946 -4.551  5.370   1.00 31.33 ? 47  ALA A H    1  
ATOM 758    H HA   . ALA A 1 47  ? -27.476 -3.221  5.969   1.00 22.20 ? 47  ALA A HA   1  
ATOM 759    H HB1  . ALA A 1 47  ? -26.515 -0.945  5.807   1.00 73.22 ? 47  ALA A HB1  1  
ATOM 760    H HB2  . ALA A 1 47  ? -24.889 -1.628  5.706   1.00 5.54  ? 47  ALA A HB2  1  
ATOM 761    H HB3  . ALA A 1 47  ? -25.835 -1.818  7.182   1.00 60.31 ? 47  ALA A HB3  1  
ATOM 762    N N    . SER A 1 48  ? -27.776 -3.033  3.507   1.00 30.22 ? 48  SER A N    1  
ATOM 763    C CA   . SER A 1 48  ? -28.037 -2.862  2.072   1.00 0.23  ? 48  SER A CA   1  
ATOM 764    C C    . SER A 1 48  ? -28.667 -1.477  1.833   1.00 73.34 ? 48  SER A C    1  
ATOM 765    O O    . SER A 1 48  ? -29.186 -0.846  2.768   1.00 54.44 ? 48  SER A O    1  
ATOM 766    C CB   . SER A 1 48  ? -28.943 -4.011  1.570   1.00 4.53  ? 48  SER A CB   1  
ATOM 767    O OG   . SER A 1 48  ? -30.026 -4.232  2.461   1.00 73.22 ? 48  SER A OG   1  
ATOM 768    H H    . SER A 1 48  ? -28.549 -3.119  4.108   1.00 3.35  ? 48  SER A H    1  
ATOM 769    H HA   . SER A 1 48  ? -27.086 -2.903  1.537   1.00 42.31 ? 48  SER A HA   1  
ATOM 770    H HB2  . SER A 1 48  ? -29.341 -3.771  0.593   1.00 52.43 ? 48  SER A HB2  1  
ATOM 771    H HB3  . SER A 1 48  ? -28.366 -4.934  1.501   1.00 74.10 ? 48  SER A HB3  1  
ATOM 772    H HG   . SER A 1 48  ? -30.233 -5.172  2.492   1.00 14.24 ? 48  SER A HG   1  
ATOM 773    N N    . SER A 1 49  ? -28.635 -1.023  0.575   1.00 4.12  ? 49  SER A N    1  
ATOM 774    C CA   . SER A 1 49  ? -29.046 0.335   0.192   1.00 44.02 ? 49  SER A CA   1  
ATOM 775    C C    . SER A 1 49  ? -29.634 0.316   -1.222  1.00 13.11 ? 49  SER A C    1  
ATOM 776    O O    . SER A 1 49  ? -29.324 -0.570  -2.018  1.00 1.23  ? 49  SER A O    1  
ATOM 777    C CB   . SER A 1 49  ? -27.825 1.294   0.261   1.00 3.25  ? 49  SER A CB   1  
ATOM 778    O OG   . SER A 1 49  ? -28.162 2.618   -0.135  1.00 31.12 ? 49  SER A OG   1  
ATOM 779    H H    . SER A 1 49  ? -28.328 -1.628  -0.132  1.00 71.35 ? 49  SER A H    1  
ATOM 780    H HA   . SER A 1 49  ? -29.810 0.677   0.887   1.00 65.45 ? 49  SER A HA   1  
ATOM 781    H HB2  . SER A 1 49  ? -27.452 1.331   1.276   1.00 3.23  ? 49  SER A HB2  1  
ATOM 782    H HB3  . SER A 1 49  ? -27.035 0.931   -0.389  1.00 62.30 ? 49  SER A HB3  1  
ATOM 783    H HG   . SER A 1 49  ? -27.368 3.077   -0.426  1.00 21.11 ? 49  SER A HG   1  
ATOM 784    N N    . GLN A 1 50  ? -30.517 1.279   -1.505  1.00 0.20  ? 50  GLN A N    1  
ATOM 785    C CA   . GLN A 1 50  ? -31.056 1.514   -2.851  1.00 53.13 ? 50  GLN A CA   1  
ATOM 786    C C    . GLN A 1 50  ? -30.381 2.766   -3.424  1.00 3.55  ? 50  GLN A C    1  
ATOM 787    O O    . GLN A 1 50  ? -30.514 3.858   -2.860  1.00 60.11 ? 50  GLN A O    1  
ATOM 788    C CB   . GLN A 1 50  ? -32.590 1.724   -2.789  1.00 34.10 ? 50  GLN A CB   1  
ATOM 789    C CG   . GLN A 1 50  ? -33.268 1.867   -4.170  1.00 12.45 ? 50  GLN A CG   1  
ATOM 790    C CD   . GLN A 1 50  ? -34.739 2.289   -4.101  1.00 62.43 ? 50  GLN A CD   1  
ATOM 791    O OE1  . GLN A 1 50  ? -35.455 1.993   -3.146  1.00 72.14 ? 50  GLN A OE1  1  
ATOM 792    N NE2  . GLN A 1 50  ? -35.194 2.990   -5.114  1.00 52.52 ? 50  GLN A NE2  1  
ATOM 793    H H    . GLN A 1 50  ? -30.818 1.861   -0.779  1.00 0.11  ? 50  GLN A H    1  
ATOM 794    H HA   . GLN A 1 50  ? -30.835 0.651   -3.487  1.00 35.02 ? 50  GLN A HA   1  
ATOM 795    H HB2  . GLN A 1 50  ? -33.034 0.876   -2.276  1.00 41.13 ? 50  GLN A HB2  1  
ATOM 796    H HB3  . GLN A 1 50  ? -32.799 2.620   -2.209  1.00 51.32 ? 50  GLN A HB3  1  
ATOM 797    H HG2  . GLN A 1 50  ? -32.725 2.612   -4.746  1.00 75.31 ? 50  GLN A HG2  1  
ATOM 798    H HG3  . GLN A 1 50  ? -33.207 0.916   -4.691  1.00 42.13 ? 50  GLN A HG3  1  
ATOM 799    H HE21 . GLN A 1 50  ? -34.580 3.204   -5.842  1.00 44.53 ? 50  GLN A HE21 1  
ATOM 800    H HE22 . GLN A 1 50  ? -36.135 3.262   -5.098  1.00 4.11  ? 50  GLN A HE22 1  
ATOM 801    N N    . LEU A 1 51  ? -29.624 2.604   -4.510  1.00 22.34 ? 51  LEU A N    1  
ATOM 802    C CA   . LEU A 1 51  ? -29.001 3.739   -5.226  1.00 51.34 ? 51  LEU A CA   1  
ATOM 803    C C    . LEU A 1 51  ? -29.879 4.155   -6.412  1.00 65.25 ? 51  LEU A C    1  
ATOM 804    O O    . LEU A 1 51  ? -29.986 5.341   -6.741  1.00 20.11 ? 51  LEU A O    1  
ATOM 805    C CB   . LEU A 1 51  ? -27.585 3.350   -5.703  1.00 3.44  ? 51  LEU A CB   1  
ATOM 806    C CG   . LEU A 1 51  ? -26.605 2.855   -4.593  1.00 62.32 ? 51  LEU A CG   1  
ATOM 807    C CD1  . LEU A 1 51  ? -25.223 2.531   -5.199  1.00 35.30 ? 51  LEU A CD1  1  
ATOM 808    C CD2  . LEU A 1 51  ? -26.503 3.864   -3.415  1.00 65.34 ? 51  LEU A CD2  1  
ATOM 809    H H    . LEU A 1 51  ? -29.465 1.694   -4.838  1.00 11.41 ? 51  LEU A H    1  
ATOM 810    H HA   . LEU A 1 51  ? -28.924 4.581   -4.540  1.00 64.50 ? 51  LEU A HA   1  
ATOM 811    H HB2  . LEU A 1 51  ? -27.681 2.563   -6.449  1.00 53.40 ? 51  LEU A HB2  1  
ATOM 812    H HB3  . LEU A 1 51  ? -27.139 4.215   -6.185  1.00 30.21 ? 51  LEU A HB3  1  
ATOM 813    H HG   . LEU A 1 51  ? -26.992 1.927   -4.184  1.00 32.41 ? 51  LEU A HG   1  
ATOM 814    H HD11 . LEU A 1 51  ? -24.849 3.382   -5.754  1.00 33.12 ? 51  LEU A HD11 1  
ATOM 815    H HD12 . LEU A 1 51  ? -25.313 1.684   -5.866  1.00 31.43 ? 51  LEU A HD12 1  
ATOM 816    H HD13 . LEU A 1 51  ? -24.523 2.281   -4.410  1.00 73.14 ? 51  LEU A HD13 1  
ATOM 817    H HD21 . LEU A 1 51  ? -27.480 4.006   -2.971  1.00 5.40  ? 51  LEU A HD21 1  
ATOM 818    H HD22 . LEU A 1 51  ? -26.134 4.815   -3.773  1.00 53.42 ? 51  LEU A HD22 1  
ATOM 819    H HD23 . LEU A 1 51  ? -25.826 3.479   -2.662  1.00 45.54 ? 51  LEU A HD23 1  
ATOM 820    N N    . ALA A 1 52  ? -30.502 3.149   -7.040  1.00 44.11 ? 52  ALA A N    1  
ATOM 821    C CA   . ALA A 1 52  ? -31.427 3.336   -8.169  1.00 4.41  ? 52  ALA A CA   1  
ATOM 822    C C    . ALA A 1 52  ? -32.415 2.170   -8.223  1.00 61.14 ? 52  ALA A C    1  
ATOM 823    O O    . ALA A 1 52  ? -32.368 1.266   -7.374  1.00 73.00 ? 52  ALA A O    1  
ATOM 824    C CB   . ALA A 1 52  ? -30.651 3.460   -9.498  1.00 64.43 ? 52  ALA A CB   1  
ATOM 825    H H    . ALA A 1 52  ? -30.341 2.235   -6.724  1.00 2.10  ? 52  ALA A H    1  
ATOM 826    H HA   . ALA A 1 52  ? -31.985 4.252   -8.009  1.00 61.02 ? 52  ALA A HA   1  
ATOM 827    H HB1  . ALA A 1 52  ? -30.198 2.511   -9.749  1.00 44.41 ? 52  ALA A HB1  1  
ATOM 828    H HB2  . ALA A 1 52  ? -29.876 4.194   -9.399  1.00 21.30 ? 52  ALA A HB2  1  
ATOM 829    H HB3  . ALA A 1 52  ? -31.324 3.757   -10.294 1.00 25.12 ? 52  ALA A HB3  1  
ATOM 830    N N    . ASP A 1 53  ? -33.306 2.207   -9.224  1.00 71.42 ? 53  ASP A N    1  
ATOM 831    C CA   . ASP A 1 53  ? -34.226 1.096   -9.516  1.00 11.54 ? 53  ASP A CA   1  
ATOM 832    C C    . ASP A 1 53  ? -33.406 -0.104  -9.989  1.00 53.40 ? 53  ASP A C    1  
ATOM 833    O O    . ASP A 1 53  ? -32.616 0.025   -10.933 1.00 53.33 ? 53  ASP A O    1  
ATOM 834    C CB   . ASP A 1 53  ? -35.274 1.495   -10.591 1.00 42.14 ? 53  ASP A CB   1  
ATOM 835    C CG   . ASP A 1 53  ? -36.181 2.646   -10.134 1.00 5.04  ? 53  ASP A CG   1  
ATOM 836    O OD1  . ASP A 1 53  ? -35.735 3.816   -10.171 1.00 71.05 ? 53  ASP A OD1  1  
ATOM 837    O OD2  . ASP A 1 53  ? -37.336 2.390   -9.719  1.00 33.45 ? 53  ASP A OD2  1  
ATOM 838    H H    . ASP A 1 53  ? -33.337 3.007   -9.793  1.00 2.01  ? 53  ASP A H    1  
ATOM 839    H HA   . ASP A 1 53  ? -34.742 0.841   -8.595  1.00 44.22 ? 53  ASP A HA   1  
ATOM 840    H HB2  . ASP A 1 53  ? -34.761 1.795   -11.497 1.00 63.13 ? 53  ASP A HB2  1  
ATOM 841    H HB3  . ASP A 1 53  ? -35.895 0.631   -10.819 1.00 42.45 ? 53  ASP A HB3  1  
ATOM 842    N N    . ASP A 1 54  ? -33.539 -1.236  -9.272  1.00 4.44  ? 54  ASP A N    1  
ATOM 843    C CA   . ASP A 1 54  ? -32.824 -2.504  -9.560  1.00 43.11 ? 54  ASP A CA   1  
ATOM 844    C C    . ASP A 1 54  ? -31.302 -2.392  -9.322  1.00 12.41 ? 54  ASP A C    1  
ATOM 845    O O    . ASP A 1 54  ? -30.552 -3.312  -9.650  1.00 44.32 ? 54  ASP A O    1  
ATOM 846    C CB   . ASP A 1 54  ? -33.121 -3.043  -10.995 1.00 0.13  ? 54  ASP A CB   1  
ATOM 847    C CG   . ASP A 1 54  ? -34.621 -3.216  -11.270 1.00 32.45 ? 54  ASP A CG   1  
ATOM 848    O OD1  . ASP A 1 54  ? -35.239 -4.116  -10.670 1.00 1.23  ? 54  ASP A OD1  1  
ATOM 849    O OD2  . ASP A 1 54  ? -35.185 -2.450  -12.087 1.00 53.10 ? 54  ASP A OD2  1  
ATOM 850    H H    . ASP A 1 54  ? -34.143 -1.218  -8.502  1.00 21.32 ? 54  ASP A H    1  
ATOM 851    H HA   . ASP A 1 54  ? -33.199 -3.225  -8.848  1.00 74.22 ? 54  ASP A HA   1  
ATOM 852    H HB2  . ASP A 1 54  ? -32.703 -2.356  -11.722 1.00 31.13 ? 54  ASP A HB2  1  
ATOM 853    H HB3  . ASP A 1 54  ? -32.640 -4.008  -11.118 1.00 64.24 ? 54  ASP A HB3  1  
ATOM 854    N N    . VAL A 1 55  ? -30.854 -1.262  -8.739  1.00 64.33 ? 55  VAL A N    1  
ATOM 855    C CA   . VAL A 1 55  ? -29.462 -1.052  -8.341  1.00 45.21 ? 55  VAL A CA   1  
ATOM 856    C C    . VAL A 1 55  ? -29.416 -0.970  -6.814  1.00 1.43  ? 55  VAL A C    1  
ATOM 857    O O    . VAL A 1 55  ? -29.840 0.030   -6.207  1.00 72.05 ? 55  VAL A O    1  
ATOM 858    C CB   . VAL A 1 55  ? -28.841 0.247   -8.966  1.00 53.34 ? 55  VAL A CB   1  
ATOM 859    C CG1  . VAL A 1 55  ? -27.376 0.429   -8.506  1.00 4.44  ? 55  VAL A CG1  1  
ATOM 860    C CG2  . VAL A 1 55  ? -28.958 0.244   -10.512 1.00 54.25 ? 55  VAL A CG2  1  
ATOM 861    H H    . VAL A 1 55  ? -31.494 -0.548  -8.556  1.00 74.03 ? 55  VAL A H    1  
ATOM 862    H HA   . VAL A 1 55  ? -28.868 -1.910  -8.671  1.00 64.11 ? 55  VAL A HA   1  
ATOM 863    H HB   . VAL A 1 55  ? -29.409 1.100   -8.593  1.00 74.04 ? 55  VAL A HB   1  
ATOM 864    H HG11 . VAL A 1 55  ? -26.996 1.371   -8.856  1.00 13.35 ? 55  VAL A HG11 1  
ATOM 865    H HG12 . VAL A 1 55  ? -26.763 -0.370  -8.901  1.00 24.13 ? 55  VAL A HG12 1  
ATOM 866    H HG13 . VAL A 1 55  ? -27.326 0.411   -7.424  1.00 60.21 ? 55  VAL A HG13 1  
ATOM 867    H HG21 . VAL A 1 55  ? -29.996 0.128   -10.799 1.00 52.24 ? 55  VAL A HG21 1  
ATOM 868    H HG22 . VAL A 1 55  ? -28.384 -0.564  -10.923 1.00 20.30 ? 55  VAL A HG22 1  
ATOM 869    H HG23 . VAL A 1 55  ? -28.586 1.178   -10.908 1.00 1.10  ? 55  VAL A HG23 1  
ATOM 870    N N    . TYR A 1 56  ? -28.911 -2.038  -6.216  1.00 50.31 ? 56  TYR A N    1  
ATOM 871    C CA   . TYR A 1 56  ? -28.838 -2.211  -4.770  1.00 63.14 ? 56  TYR A CA   1  
ATOM 872    C C    . TYR A 1 56  ? -27.377 -2.326  -4.369  1.00 33.50 ? 56  TYR A C    1  
ATOM 873    O O    . TYR A 1 56  ? -26.640 -3.168  -4.888  1.00 71.12 ? 56  TYR A O    1  
ATOM 874    C CB   . TYR A 1 56  ? -29.620 -3.474  -4.327  1.00 30.12 ? 56  TYR A CB   1  
ATOM 875    C CG   . TYR A 1 56  ? -31.144 -3.352  -4.467  1.00 62.34 ? 56  TYR A CG   1  
ATOM 876    C CD1  . TYR A 1 56  ? -31.771 -3.460  -5.711  1.00 45.53 ? 56  TYR A CD1  1  
ATOM 877    C CD2  . TYR A 1 56  ? -31.954 -3.120  -3.354  1.00 24.30 ? 56  TYR A CD2  1  
ATOM 878    C CE1  . TYR A 1 56  ? -33.138 -3.340  -5.838  1.00 63.34 ? 56  TYR A CE1  1  
ATOM 879    C CE2  . TYR A 1 56  ? -33.320 -3.005  -3.479  1.00 5.24  ? 56  TYR A CE2  1  
ATOM 880    C CZ   . TYR A 1 56  ? -33.911 -3.114  -4.720  1.00 3.04  ? 56  TYR A CZ   1  
ATOM 881    O OH   . TYR A 1 56  ? -35.281 -2.989  -4.839  1.00 33.14 ? 56  TYR A OH   1  
ATOM 882    H H    . TYR A 1 56  ? -28.532 -2.734  -6.782  1.00 30.23 ? 56  TYR A H    1  
ATOM 883    H HA   . TYR A 1 56  ? -29.276 -1.335  -4.284  1.00 20.14 ? 56  TYR A HA   1  
ATOM 884    H HB2  . TYR A 1 56  ? -29.300 -4.320  -4.928  1.00 14.22 ? 56  TYR A HB2  1  
ATOM 885    H HB3  . TYR A 1 56  ? -29.394 -3.689  -3.285  1.00 4.13  ? 56  TYR A HB3  1  
ATOM 886    H HD1  . TYR A 1 56  ? -31.163 -3.639  -6.593  1.00 65.23 ? 56  TYR A HD1  1  
ATOM 887    H HD2  . TYR A 1 56  ? -31.496 -3.031  -2.377  1.00 63.14 ? 56  TYR A HD2  1  
ATOM 888    H HE1  . TYR A 1 56  ? -33.598 -3.429  -6.813  1.00 62.22 ? 56  TYR A HE1  1  
ATOM 889    H HE2  . TYR A 1 56  ? -33.927 -2.829  -2.601  1.00 3.24  ? 56  TYR A HE2  1  
ATOM 890    H HH   . TYR A 1 56  ? -35.611 -3.641  -5.467  1.00 13.14 ? 56  TYR A HH   1  
ATOM 891    N N    . GLU A 1 57  ? -26.976 -1.473  -3.449  1.00 12.33 ? 57  GLU A N    1  
ATOM 892    C CA   . GLU A 1 57  ? -25.644 -1.476  -2.880  1.00 52.22 ? 57  GLU A CA   1  
ATOM 893    C C    . GLU A 1 57  ? -25.634 -2.344  -1.619  1.00 11.25 ? 57  GLU A C    1  
ATOM 894    O O    . GLU A 1 57  ? -26.649 -2.464  -0.925  1.00 42.40 ? 57  GLU A O    1  
ATOM 895    C CB   . GLU A 1 57  ? -25.256 -0.037  -2.544  1.00 43.14 ? 57  GLU A CB   1  
ATOM 896    C CG   . GLU A 1 57  ? -23.839 0.141   -1.976  1.00 12.12 ? 57  GLU A CG   1  
ATOM 897    C CD   . GLU A 1 57  ? -23.642 1.542   -1.438  1.00 43.32 ? 57  GLU A CD   1  
ATOM 898    O OE1  . GLU A 1 57  ? -24.219 1.837   -0.369  1.00 35.13 ? 57  GLU A OE1  1  
ATOM 899    O OE2  . GLU A 1 57  ? -22.956 2.365   -2.081  1.00 24.43 ? 57  GLU A OE2  1  
ATOM 900    H H    . GLU A 1 57  ? -27.611 -0.801  -3.133  1.00 32.13 ? 57  GLU A H    1  
ATOM 901    H HA   . GLU A 1 57  ? -24.939 -1.878  -3.613  1.00 52.35 ? 57  GLU A HA   1  
ATOM 902    H HB2  . GLU A 1 57  ? -25.333 0.558   -3.450  1.00 62.32 ? 57  GLU A HB2  1  
ATOM 903    H HB3  . GLU A 1 57  ? -25.971 0.356   -1.823  1.00 1.30  ? 57  GLU A HB3  1  
ATOM 904    H HG2  . GLU A 1 57  ? -23.681 -0.573  -1.166  1.00 13.11 ? 57  GLU A HG2  1  
ATOM 905    H HG3  . GLU A 1 57  ? -23.117 -0.056  -2.763  1.00 34.25 ? 57  GLU A HG3  1  
ATOM 906    N N    . VAL A 1 58  ? -24.496 -2.962  -1.352  1.00 22.42 ? 58  VAL A N    1  
ATOM 907    C CA   . VAL A 1 58  ? -24.264 -3.778  -0.166  1.00 74.13 ? 58  VAL A CA   1  
ATOM 908    C C    . VAL A 1 58  ? -22.992 -3.259  0.511   1.00 73.14 ? 58  VAL A C    1  
ATOM 909    O O    . VAL A 1 58  ? -21.992 -3.022  -0.161  1.00 34.32 ? 58  VAL A O    1  
ATOM 910    C CB   . VAL A 1 58  ? -24.144 -5.290  -0.585  1.00 73.22 ? 58  VAL A CB   1  
ATOM 911    C CG1  . VAL A 1 58  ? -23.586 -6.176  0.533   1.00 4.24  ? 58  VAL A CG1  1  
ATOM 912    C CG2  . VAL A 1 58  ? -25.509 -5.823  -1.089  1.00 61.01 ? 58  VAL A CG2  1  
ATOM 913    H H    . VAL A 1 58  ? -23.760 -2.869  -1.991  1.00 22.45 ? 58  VAL A H    1  
ATOM 914    H HA   . VAL A 1 58  ? -25.109 -3.666  0.522   1.00 22.41 ? 58  VAL A HA   1  
ATOM 915    H HB   . VAL A 1 58  ? -23.447 -5.349  -1.416  1.00 43.32 ? 58  VAL A HB   1  
ATOM 916    H HG11 . VAL A 1 58  ? -23.550 -7.209  0.205   1.00 34.24 ? 58  VAL A HG11 1  
ATOM 917    H HG12 . VAL A 1 58  ? -24.215 -6.101  1.408   1.00 63.12 ? 58  VAL A HG12 1  
ATOM 918    H HG13 . VAL A 1 58  ? -22.586 -5.851  0.788   1.00 44.34 ? 58  VAL A HG13 1  
ATOM 919    H HG21 . VAL A 1 58  ? -25.847 -5.223  -1.928  1.00 13.32 ? 58  VAL A HG21 1  
ATOM 920    H HG22 . VAL A 1 58  ? -26.247 -5.764  -0.296  1.00 52.44 ? 58  VAL A HG22 1  
ATOM 921    H HG23 . VAL A 1 58  ? -25.411 -6.852  -1.409  1.00 14.45 ? 58  VAL A HG23 1  
ATOM 922    N N    . VAL A 1 59  ? -23.069 -3.010  1.823   1.00 72.32 ? 59  VAL A N    1  
ATOM 923    C CA   . VAL A 1 59  ? -21.937 -2.549  2.636   1.00 3.22  ? 59  VAL A CA   1  
ATOM 924    C C    . VAL A 1 59  ? -21.767 -3.511  3.822   1.00 75.10 ? 59  VAL A C    1  
ATOM 925    O O    . VAL A 1 59  ? -22.745 -3.841  4.512   1.00 3.24  ? 59  VAL A O    1  
ATOM 926    C CB   . VAL A 1 59  ? -22.125 -1.076  3.183   1.00 70.15 ? 59  VAL A CB   1  
ATOM 927    C CG1  . VAL A 1 59  ? -20.899 -0.644  4.028   1.00 20.45 ? 59  VAL A CG1  1  
ATOM 928    C CG2  . VAL A 1 59  ? -22.396 -0.054  2.043   1.00 63.03 ? 59  VAL A CG2  1  
ATOM 929    H H    . VAL A 1 59  ? -23.921 -3.154  2.269   1.00 51.20 ? 59  VAL A H    1  
ATOM 930    H HA   . VAL A 1 59  ? -21.029 -2.578  2.024   1.00 30.24 ? 59  VAL A HA   1  
ATOM 931    H HB   . VAL A 1 59  ? -22.993 -1.072  3.842   1.00 31.53 ? 59  VAL A HB   1  
ATOM 932    H HG11 . VAL A 1 59  ? -20.764 -1.330  4.854   1.00 15.31 ? 59  VAL A HG11 1  
ATOM 933    H HG12 . VAL A 1 59  ? -21.055 0.346   4.421   1.00 4.11  ? 59  VAL A HG12 1  
ATOM 934    H HG13 . VAL A 1 59  ? -20.005 -0.646  3.415   1.00 13.45 ? 59  VAL A HG13 1  
ATOM 935    H HG21 . VAL A 1 59  ? -21.655 -0.166  1.261   1.00 53.14 ? 59  VAL A HG21 1  
ATOM 936    H HG22 . VAL A 1 59  ? -22.342 0.953   2.436   1.00 51.12 ? 59  VAL A HG22 1  
ATOM 937    H HG23 . VAL A 1 59  ? -23.382 -0.203  1.624   1.00 40.52 ? 59  VAL A HG23 1  
ATOM 938    N N    . LEU A 1 60  ? -20.519 -3.962  4.037   1.00 33.24 ? 60  LEU A N    1  
ATOM 939    C CA   . LEU A 1 60  ? -20.144 -4.829  5.165   1.00 63.21 ? 60  LEU A CA   1  
ATOM 940    C C    . LEU A 1 60  ? -19.104 -4.093  5.992   1.00 24.13 ? 60  LEU A C    1  
ATOM 941    O O    . LEU A 1 60  ? -18.001 -3.818  5.500   1.00 25.21 ? 60  LEU A O    1  
ATOM 942    C CB   . LEU A 1 60  ? -19.555 -6.206  4.714   1.00 73.40 ? 60  LEU A CB   1  
ATOM 943    C CG   . LEU A 1 60  ? -20.497 -7.152  3.902   1.00 52.13 ? 60  LEU A CG   1  
ATOM 944    C CD1  . LEU A 1 60  ? -21.873 -7.330  4.597   1.00 73.23 ? 60  LEU A CD1  1  
ATOM 945    C CD2  . LEU A 1 60  ? -20.640 -6.681  2.439   1.00 4.13  ? 60  LEU A CD2  1  
ATOM 946    H H    . LEU A 1 60  ? -19.812 -3.673  3.422   1.00 74.44 ? 60  LEU A H    1  
ATOM 947    H HA   . LEU A 1 60  ? -21.027 -5.009  5.780   1.00 32.03 ? 60  LEU A HA   1  
ATOM 948    H HB2  . LEU A 1 60  ? -18.665 -6.015  4.118   1.00 54.13 ? 60  LEU A HB2  1  
ATOM 949    H HB3  . LEU A 1 60  ? -19.237 -6.742  5.607   1.00 54.11 ? 60  LEU A HB3  1  
ATOM 950    H HG   . LEU A 1 60  ? -20.039 -8.136  3.871   1.00 52.02 ? 60  LEU A HG   1  
ATOM 951    H HD11 . LEU A 1 60  ? -21.728 -7.729  5.592   1.00 31.40 ? 60  LEU A HD11 1  
ATOM 952    H HD12 . LEU A 1 60  ? -22.483 -8.020  4.030   1.00 51.52 ? 60  LEU A HD12 1  
ATOM 953    H HD13 . LEU A 1 60  ? -22.384 -6.377  4.664   1.00 4.35  ? 60  LEU A HD13 1  
ATOM 954    H HD21 . LEU A 1 60  ? -21.067 -5.685  2.408   1.00 63.55 ? 60  LEU A HD21 1  
ATOM 955    H HD22 . LEU A 1 60  ? -21.287 -7.359  1.899   1.00 5.40  ? 60  LEU A HD22 1  
ATOM 956    H HD23 . LEU A 1 60  ? -19.669 -6.668  1.961   1.00 62.14 ? 60  LEU A HD23 1  
ATOM 957    N N    . ARG A 1 61  ? -19.462 -3.756  7.231   1.00 22.24 ? 61  ARG A N    1  
ATOM 958    C CA   . ARG A 1 61  ? -18.521 -3.189  8.184   1.00 34.05 ? 61  ARG A CA   1  
ATOM 959    C C    . ARG A 1 61  ? -17.795 -4.348  8.864   1.00 31.44 ? 61  ARG A C    1  
ATOM 960    O O    . ARG A 1 61  ? -18.365 -5.006  9.740   1.00 12.31 ? 61  ARG A O    1  
ATOM 961    C CB   . ARG A 1 61  ? -19.262 -2.294  9.214   1.00 3.04  ? 61  ARG A CB   1  
ATOM 962    C CG   . ARG A 1 61  ? -18.324 -1.519  10.165  1.00 2.30  ? 61  ARG A CG   1  
ATOM 963    C CD   . ARG A 1 61  ? -19.063 -0.526  11.088  1.00 13.44 ? 61  ARG A CD   1  
ATOM 964    N NE   . ARG A 1 61  ? -19.857 -1.202  12.120  1.00 75.11 ? 61  ARG A NE   1  
ATOM 965    C CZ   . ARG A 1 61  ? -20.071 -0.758  13.375  1.00 10.54 ? 61  ARG A CZ   1  
ATOM 966    N NH1  . ARG A 1 61  ? -19.543 0.385   13.803  1.00 44.40 ? 61  ARG A NH1  1  
ATOM 967    N NH2  . ARG A 1 61  ? -20.807 -1.480  14.202  1.00 3.04  ? 61  ARG A NH2  1  
ATOM 968    H H    . ARG A 1 61  ? -20.390 -3.909  7.515   1.00 32.32 ? 61  ARG A H    1  
ATOM 969    H HA   . ARG A 1 61  ? -17.798 -2.579  7.640   1.00 51.23 ? 61  ARG A HA   1  
ATOM 970    H HB2  . ARG A 1 61  ? -19.872 -1.576  8.672   1.00 61.20 ? 61  ARG A HB2  1  
ATOM 971    H HB3  . ARG A 1 61  ? -19.922 -2.916  9.814   1.00 71.40 ? 61  ARG A HB3  1  
ATOM 972    H HG2  . ARG A 1 61  ? -17.790 -2.231  10.787  1.00 14.41 ? 61  ARG A HG2  1  
ATOM 973    H HG3  . ARG A 1 61  ? -17.601 -0.969  9.568   1.00 33.32 ? 61  ARG A HG3  1  
ATOM 974    H HD2  . ARG A 1 61  ? -18.326 0.108   11.569  1.00 52.45 ? 61  ARG A HD2  1  
ATOM 975    H HD3  . ARG A 1 61  ? -19.722 0.095   10.491  1.00 72.21 ? 61  ARG A HD3  1  
ATOM 976    H HE   . ARG A 1 61  ? -20.239 -2.063  11.870  1.00 51.05 ? 61  ARG A HE   1  
ATOM 977    H HH11 . ARG A 1 61  ? -18.971 0.937   13.189  1.00 43.42 ? 61  ARG A HH11 1  
ATOM 978    H HH12 . ARG A 1 61  ? -19.712 0.702   14.738  1.00 62.42 ? 61  ARG A HH12 1  
ATOM 979    H HH21 . ARG A 1 61  ? -21.203 -2.353  13.895  1.00 53.11 ? 61  ARG A HH21 1  
ATOM 980    H HH22 . ARG A 1 61  ? -20.975 -1.163  15.141  1.00 71.32 ? 61  ARG A HH22 1  
ATOM 981    N N    . VAL A 1 62  ? -16.565 -4.634  8.411   1.00 23.41 ? 62  VAL A N    1  
ATOM 982    C CA   . VAL A 1 62  ? -15.714 -5.647  9.041   1.00 35.31 ? 62  VAL A CA   1  
ATOM 983    C C    . VAL A 1 62  ? -14.815 -4.931  10.048  1.00 13.52 ? 62  VAL A C    1  
ATOM 984    O O    . VAL A 1 62  ? -13.930 -4.161  9.654   1.00 44.41 ? 62  VAL A O    1  
ATOM 985    C CB   . VAL A 1 62  ? -14.807 -6.440  8.021   1.00 42.21 ? 62  VAL A CB   1  
ATOM 986    C CG1  . VAL A 1 62  ? -14.168 -7.706  8.700   1.00 34.21 ? 62  VAL A CG1  1  
ATOM 987    C CG2  . VAL A 1 62  ? -15.563 -6.790  6.714   1.00 42.02 ? 62  VAL A CG2  1  
ATOM 988    H H    . VAL A 1 62  ? -16.225 -4.152  7.629   1.00 41.30 ? 62  VAL A H    1  
ATOM 989    H HA   . VAL A 1 62  ? -16.353 -6.363  9.565   1.00 25.52 ? 62  VAL A HA   1  
ATOM 990    H HB   . VAL A 1 62  ? -13.981 -5.776  7.734   1.00 31.33 ? 62  VAL A HB   1  
ATOM 991    H HG11 . VAL A 1 62  ? -13.098 -7.714  8.534   1.00 62.34 ? 62  VAL A HG11 1  
ATOM 992    H HG12 . VAL A 1 62  ? -14.592 -8.611  8.297   1.00 33.20 ? 62  VAL A HG12 1  
ATOM 993    H HG13 . VAL A 1 62  ? -14.342 -7.690  9.764   1.00 34.11 ? 62  VAL A HG13 1  
ATOM 994    H HG21 . VAL A 1 62  ? -14.891 -7.310  6.041   1.00 71.11 ? 62  VAL A HG21 1  
ATOM 995    H HG22 . VAL A 1 62  ? -15.901 -5.883  6.235   1.00 52.42 ? 62  VAL A HG22 1  
ATOM 996    H HG23 . VAL A 1 62  ? -16.401 -7.410  6.913   1.00 54.51 ? 62  VAL A HG23 1  
ATOM 997    N N    . THR A 1 63  ? -15.063 -5.162  11.326  1.00 42.04 ? 63  THR A N    1  
ATOM 998    C CA   . THR A 1 63  ? -14.312 -4.539  12.406  1.00 22.04 ? 63  THR A CA   1  
ATOM 999    C C    . THR A 1 63  ? -13.435 -5.597  13.076  1.00 72.54 ? 63  THR A C    1  
ATOM 1000   O O    . THR A 1 63  ? -13.909 -6.660  13.472  1.00 21.43 ? 63  THR A O    1  
ATOM 1001   C CB   . THR A 1 63  ? -15.252 -3.874  13.457  1.00 22.25 ? 63  THR A CB   1  
ATOM 1002   O OG1  . THR A 1 63  ? -16.174 -2.990  12.791  1.00 62.22 ? 63  THR A OG1  1  
ATOM 1003   C CG2  . THR A 1 63  ? -14.453 -3.086  14.515  1.00 13.23 ? 63  THR A CG2  1  
ATOM 1004   H H    . THR A 1 63  ? -15.766 -5.799  11.552  1.00 20.14 ? 63  THR A H    1  
ATOM 1005   H HA   . THR A 1 63  ? -13.671 -3.759  11.977  1.00 55.11 ? 63  THR A HA   1  
ATOM 1006   H HB   . THR A 1 63  ? -15.822 -4.651  13.960  1.00 32.42 ? 63  THR A HB   1  
ATOM 1007   H HG1  . THR A 1 63  ? -15.946 -2.078  12.990  1.00 60.12 ? 63  THR A HG1  1  
ATOM 1008   H HG21 . THR A 1 63  ? -13.793 -3.756  15.055  1.00 52.41 ? 63  THR A HG21 1  
ATOM 1009   H HG22 . THR A 1 63  ? -15.124 -2.618  15.212  1.00 42.11 ? 63  THR A HG22 1  
ATOM 1010   H HG23 . THR A 1 63  ? -13.858 -2.318  14.030  1.00 60.23 ? 63  THR A HG23 1  
ATOM 1011   N N    . VAL A 1 64  ? -12.154 -5.290  13.169  1.00 15.12 ? 64  VAL A N    1  
ATOM 1012   C CA   . VAL A 1 64  ? -11.144 -6.143  13.781  1.00 63.01 ? 64  VAL A CA   1  
ATOM 1013   C C    . VAL A 1 64  ? -10.610 -5.396  14.994  1.00 3.02  ? 64  VAL A C    1  
ATOM 1014   O O    . VAL A 1 64  ? -10.161 -4.262  14.860  1.00 21.00 ? 64  VAL A O    1  
ATOM 1015   C CB   . VAL A 1 64  ? -9.968  -6.440  12.780  1.00 40.42 ? 64  VAL A CB   1  
ATOM 1016   C CG1  . VAL A 1 64  ? -8.835  -7.230  13.471  1.00 24.44 ? 64  VAL A CG1  1  
ATOM 1017   C CG2  . VAL A 1 64  ? -10.472 -7.149  11.491  1.00 54.22 ? 64  VAL A CG2  1  
ATOM 1018   H H    . VAL A 1 64  ? -11.871 -4.423  12.828  1.00 41.15 ? 64  VAL A H    1  
ATOM 1019   H HA   . VAL A 1 64  ? -11.602 -7.088  14.093  1.00 51.11 ? 64  VAL A HA   1  
ATOM 1020   H HB   . VAL A 1 64  ? -9.547  -5.478  12.474  1.00 51.45 ? 64  VAL A HB   1  
ATOM 1021   H HG11 . VAL A 1 64  ? -8.388  -6.622  14.249  1.00 15.14 ? 64  VAL A HG11 1  
ATOM 1022   H HG12 . VAL A 1 64  ? -8.074  -7.486  12.749  1.00 45.22 ? 64  VAL A HG12 1  
ATOM 1023   H HG13 . VAL A 1 64  ? -9.228  -8.135  13.916  1.00 53.02 ? 64  VAL A HG13 1  
ATOM 1024   H HG21 . VAL A 1 64  ? -10.841 -8.140  11.709  1.00 70.24 ? 64  VAL A HG21 1  
ATOM 1025   H HG22 . VAL A 1 64  ? -9.663  -7.222  10.777  1.00 44.23 ? 64  VAL A HG22 1  
ATOM 1026   H HG23 . VAL A 1 64  ? -11.271 -6.567  11.054  1.00 42.52 ? 64  VAL A HG23 1  
ATOM 1027   N N    . THR A 1 65  ? -10.671 -6.010  16.169  1.00 25.05 ? 65  THR A N    1  
ATOM 1028   C CA   . THR A 1 65  ? -10.210 -5.373  17.406  1.00 3.52  ? 65  THR A CA   1  
ATOM 1029   C C    . THR A 1 65  ? -9.221  -6.294  18.110  1.00 21.23 ? 65  THR A C    1  
ATOM 1030   O O    . THR A 1 65  ? -9.518  -7.465  18.315  1.00 15.22 ? 65  THR A O    1  
ATOM 1031   C CB   . THR A 1 65  ? -11.411 -5.050  18.360  1.00 34.32 ? 65  THR A CB   1  
ATOM 1032   O OG1  . THR A 1 65  ? -12.536 -4.592  17.588  1.00 12.22 ? 65  THR A OG1  1  
ATOM 1033   C CG2  . THR A 1 65  ? -11.032 -3.975  19.401  1.00 42.44 ? 65  THR A CG2  1  
ATOM 1034   H H    . THR A 1 65  ? -11.036 -6.919  16.213  1.00 45.15 ? 65  THR A H    1  
ATOM 1035   H HA   . THR A 1 65  ? -9.707  -4.439  17.145  1.00 70.15 ? 65  THR A HA   1  
ATOM 1036   H HB   . THR A 1 65  ? -11.708 -5.954  18.888  1.00 25.11 ? 65  THR A HB   1  
ATOM 1037   H HG1  . THR A 1 65  ? -12.902 -5.335  17.094  1.00 62.34 ? 65  THR A HG1  1  
ATOM 1038   H HG21 . THR A 1 65  ? -11.904 -3.694  19.969  1.00 73.11 ? 65  THR A HG21 1  
ATOM 1039   H HG22 . THR A 1 65  ? -10.638 -3.096  18.901  1.00 10.15 ? 65  THR A HG22 1  
ATOM 1040   H HG23 . THR A 1 65  ? -10.281 -4.366  20.076  1.00 13.02 ? 65  THR A HG23 1  
ATOM 1041   N N    . ALA A 1 66  ? -8.063  -5.755  18.484  1.00 53.03 ? 66  ALA A N    1  
ATOM 1042   C CA   . ALA A 1 66  ? -6.999  -6.509  19.162  1.00 63.24 ? 66  ALA A CA   1  
ATOM 1043   C C    . ALA A 1 66  ? -6.598  -5.761  20.433  1.00 34.11 ? 66  ALA A C    1  
ATOM 1044   O O    . ALA A 1 66  ? -6.273  -4.582  20.354  1.00 14.00 ? 66  ALA A O    1  
ATOM 1045   C CB   . ALA A 1 66  ? -5.793  -6.684  18.220  1.00 72.22 ? 66  ALA A CB   1  
ATOM 1046   H H    . ALA A 1 66  ? -7.922  -4.799  18.313  1.00 63.43 ? 66  ALA A H    1  
ATOM 1047   H HA   . ALA A 1 66  ? -7.376  -7.502  19.428  1.00 25.51 ? 66  ALA A HA   1  
ATOM 1048   H HB1  . ALA A 1 66  ? -6.061  -7.339  17.399  1.00 14.32 ? 66  ALA A HB1  1  
ATOM 1049   H HB2  . ALA A 1 66  ? -4.964  -7.113  18.760  1.00 74.25 ? 66  ALA A HB2  1  
ATOM 1050   H HB3  . ALA A 1 66  ? -5.492  -5.721  17.817  1.00 70.55 ? 66  ALA A HB3  1  
ATOM 1051   N N    . SER A 1 67  ? -6.664  -6.437  21.598  1.00 22.24 ? 67  SER A N    1  
ATOM 1052   C CA   . SER A 1 67  ? -6.207  -5.876  22.891  1.00 22.23 ? 67  SER A CA   1  
ATOM 1053   C C    . SER A 1 67  ? -5.358  -6.913  23.641  1.00 13.25 ? 67  SER A C    1  
ATOM 1054   O O    . SER A 1 67  ? -5.807  -8.039  23.858  1.00 54.22 ? 67  SER A O    1  
ATOM 1055   C CB   . SER A 1 67  ? -7.418  -5.434  23.756  1.00 14.14 ? 67  SER A CB   1  
ATOM 1056   O OG   . SER A 1 67  ? -8.174  -4.432  23.099  1.00 34.22 ? 67  SER A OG   1  
ATOM 1057   H H    . SER A 1 67  ? -7.049  -7.344  21.594  1.00 12.41 ? 67  SER A H    1  
ATOM 1058   H HA   . SER A 1 67  ? -5.585  -4.999  22.688  1.00 54.42 ? 67  SER A HA   1  
ATOM 1059   H HB2  . SER A 1 67  ? -8.066  -6.282  23.949  1.00 73.13 ? 67  SER A HB2  1  
ATOM 1060   H HB3  . SER A 1 67  ? -7.067  -5.034  24.701  1.00 50.31 ? 67  SER A HB3  1  
ATOM 1061   H HG   . SER A 1 67  ? -8.597  -4.811  22.329  1.00 35.53 ? 67  SER A HG   1  
ATOM 1062   N N    . LEU A 1 68  ? -4.143  -6.504  24.059  1.00 63.54 ? 68  LEU A N    1  
ATOM 1063   C CA   . LEU A 1 68  ? -3.169  -7.358  24.759  1.00 12.44 ? 68  LEU A CA   1  
ATOM 1064   C C    . LEU A 1 68  ? -3.481  -7.281  26.263  1.00 70.04 ? 68  LEU A C    1  
ATOM 1065   O O    . LEU A 1 68  ? -2.903  -6.470  27.007  1.00 14.12 ? 68  LEU A O    1  
ATOM 1066   C CB   . LEU A 1 68  ? -1.688  -6.909  24.440  1.00 54.30 ? 68  LEU A CB   1  
ATOM 1067   C CG   . LEU A 1 68  ? -1.208  -7.063  22.944  1.00 11.30 ? 68  LEU A CG   1  
ATOM 1068   C CD1  . LEU A 1 68  ? -1.964  -6.131  21.992  1.00 23.33 ? 68  LEU A CD1  1  
ATOM 1069   C CD2  . LEU A 1 68  ? 0.316   -6.844  22.790  1.00 22.22 ? 68  LEU A CD2  1  
ATOM 1070   H H    . LEU A 1 68  ? -3.882  -5.583  23.874  1.00 72.04 ? 68  LEU A H    1  
ATOM 1071   H HA   . LEU A 1 68  ? -3.306  -8.388  24.421  1.00 52.14 ? 68  LEU A HA   1  
ATOM 1072   H HB2  . LEU A 1 68  ? -1.580  -5.864  24.724  1.00 33.11 ? 68  LEU A HB2  1  
ATOM 1073   H HB3  . LEU A 1 68  ? -1.019  -7.491  25.067  1.00 55.43 ? 68  LEU A HB3  1  
ATOM 1074   H HG   . LEU A 1 68  ? -1.417  -8.077  22.619  1.00 71.21 ? 68  LEU A HG   1  
ATOM 1075   H HD11 . LEU A 1 68  ? -1.606  -6.269  20.978  1.00 64.31 ? 68  LEU A HD11 1  
ATOM 1076   H HD12 . LEU A 1 68  ? -1.816  -5.098  22.282  1.00 62.41 ? 68  LEU A HD12 1  
ATOM 1077   H HD13 . LEU A 1 68  ? -3.021  -6.361  22.023  1.00 2.34  ? 68  LEU A HD13 1  
ATOM 1078   H HD21 . LEU A 1 68  ? 0.614   -7.057  21.769  1.00 15.20 ? 68  LEU A HD21 1  
ATOM 1079   H HD22 . LEU A 1 68  ? 0.849   -7.508  23.456  1.00 5.13  ? 68  LEU A HD22 1  
ATOM 1080   H HD23 . LEU A 1 68  ? 0.571   -5.818  23.031  1.00 34.14 ? 68  LEU A HD23 1  
ATOM 1081   N N    . GLY A 1 69  ? -4.497  -8.075  26.659  1.00 35.22 ? 69  GLY A N    1  
ATOM 1082   C CA   . GLY A 1 69  ? -5.028  -8.093  28.017  1.00 2.51  ? 69  GLY A CA   1  
ATOM 1083   C C    . GLY A 1 69  ? -5.971  -6.920  28.258  1.00 11.53 ? 69  GLY A C    1  
ATOM 1084   O O    . GLY A 1 69  ? -7.194  -7.045  28.111  1.00 1.05  ? 69  GLY A O    1  
ATOM 1085   H H    . GLY A 1 69  ? -4.911  -8.653  25.990  1.00 34.51 ? 69  GLY A H    1  
ATOM 1086   H HA2  . GLY A 1 69  ? -5.571  -9.021  28.163  1.00 11.01 ? 69  GLY A HA2  1  
ATOM 1087   H HA3  . GLY A 1 69  ? -4.214  -8.054  28.735  1.00 64.22 ? 69  GLY A HA3  1  
ATOM 1088   N N    . GLU A 1 70  ? -5.375  -5.769  28.591  1.00 23.41 ? 70  GLU A N    1  
ATOM 1089   C CA   . GLU A 1 70  ? -6.099  -4.533  28.953  1.00 22.32 ? 70  GLU A CA   1  
ATOM 1090   C C    . GLU A 1 70  ? -5.866  -3.415  27.917  1.00 5.04  ? 70  GLU A C    1  
ATOM 1091   O O    . GLU A 1 70  ? -6.672  -2.489  27.814  1.00 3.21  ? 70  GLU A O    1  
ATOM 1092   C CB   . GLU A 1 70  ? -5.633  -4.059  30.355  1.00 10.54 ? 70  GLU A CB   1  
ATOM 1093   C CG   . GLU A 1 70  ? -4.108  -3.871  30.470  1.00 42.53 ? 70  GLU A CG   1  
ATOM 1094   C CD   . GLU A 1 70  ? -3.668  -3.344  31.837  1.00 2.31  ? 70  GLU A CD   1  
ATOM 1095   O OE1  . GLU A 1 70  ? -3.518  -4.152  32.777  1.00 72.43 ? 70  GLU A OE1  1  
ATOM 1096   O OE2  . GLU A 1 70  ? -3.479  -2.118  31.980  1.00 53.32 ? 70  GLU A OE2  1  
ATOM 1097   H H    . GLU A 1 70  ? -4.393  -5.746  28.584  1.00 22.41 ? 70  GLU A H    1  
ATOM 1098   H HA   . GLU A 1 70  ? -7.166  -4.748  28.993  1.00 71.21 ? 70  GLU A HA   1  
ATOM 1099   H HB2  . GLU A 1 70  ? -6.117  -3.113  30.594  1.00 42.20 ? 70  GLU A HB2  1  
ATOM 1100   H HB3  . GLU A 1 70  ? -5.941  -4.794  31.091  1.00 61.43 ? 70  GLU A HB3  1  
ATOM 1101   H HG2  . GLU A 1 70  ? -3.624  -4.826  30.287  1.00 22.23 ? 70  GLU A HG2  1  
ATOM 1102   H HG3  . GLU A 1 70  ? -3.787  -3.173  29.702  1.00 4.45  ? 70  GLU A HG3  1  
ATOM 1103   N N    . GLU A 1 71  ? -4.770  -3.511  27.146  1.00 13.52 ? 71  GLU A N    1  
ATOM 1104   C CA   . GLU A 1 71  ? -4.299  -2.400  26.292  1.00 73.23 ? 71  GLU A CA   1  
ATOM 1105   C C    . GLU A 1 71  ? -4.486  -2.728  24.796  1.00 4.30  ? 71  GLU A C    1  
ATOM 1106   O O    . GLU A 1 71  ? -3.897  -3.689  24.303  1.00 42.43 ? 71  GLU A O    1  
ATOM 1107   C CB   . GLU A 1 71  ? -2.808  -2.113  26.607  1.00 33.20 ? 71  GLU A CB   1  
ATOM 1108   C CG   . GLU A 1 71  ? -2.236  -0.953  25.788  1.00 62.13 ? 71  GLU A CG   1  
ATOM 1109   C CD   . GLU A 1 71  ? -0.780  -0.634  26.097  1.00 70.52 ? 71  GLU A CD   1  
ATOM 1110   O OE1  . GLU A 1 71  ? -0.510  0.222   26.968  1.00 22.25 ? 71  GLU A OE1  1  
ATOM 1111   O OE2  . GLU A 1 71  ? 0.106   -1.261  25.494  1.00 34.12 ? 71  GLU A OE2  1  
ATOM 1112   H H    . GLU A 1 71  ? -4.272  -4.356  27.134  1.00 54.23 ? 71  GLU A H    1  
ATOM 1113   H HA   . GLU A 1 71  ? -4.880  -1.506  26.532  1.00 21.30 ? 71  GLU A HA   1  
ATOM 1114   H HB2  . GLU A 1 71  ? -2.717  -1.874  27.663  1.00 5.03  ? 71  GLU A HB2  1  
ATOM 1115   H HB3  . GLU A 1 71  ? -2.218  -3.003  26.406  1.00 3.31  ? 71  GLU A HB3  1  
ATOM 1116   H HG2  . GLU A 1 71  ? -2.319  -1.200  24.731  1.00 75.13 ? 71  GLU A HG2  1  
ATOM 1117   H HG3  . GLU A 1 71  ? -2.836  -0.065  25.973  1.00 53.00 ? 71  GLU A HG3  1  
ATOM 1118   N N    . THR A 1 72  ? -5.291  -1.907  24.082  1.00 5.34  ? 72  THR A N    1  
ATOM 1119   C CA   . THR A 1 72  ? -5.590  -2.114  22.652  1.00 63.43 ? 72  THR A CA   1  
ATOM 1120   C C    . THR A 1 72  ? -4.372  -1.833  21.739  1.00 4.13  ? 72  THR A C    1  
ATOM 1121   O O    . THR A 1 72  ? -3.700  -0.801  21.874  1.00 5.22  ? 72  THR A O    1  
ATOM 1122   C CB   . THR A 1 72  ? -6.792  -1.224  22.186  1.00 63.13 ? 72  THR A CB   1  
ATOM 1123   O OG1  . THR A 1 72  ? -7.901  -1.409  23.081  1.00 51.21 ? 72  THR A OG1  1  
ATOM 1124   C CG2  . THR A 1 72  ? -7.238  -1.561  20.742  1.00 31.55 ? 72  THR A CG2  1  
ATOM 1125   H H    . THR A 1 72  ? -5.712  -1.153  24.536  1.00 73.12 ? 72  THR A H    1  
ATOM 1126   H HA   . THR A 1 72  ? -5.889  -3.155  22.536  1.00 23.22 ? 72  THR A HA   1  
ATOM 1127   H HB   . THR A 1 72  ? -6.495  -0.179  22.222  1.00 22.22 ? 72  THR A HB   1  
ATOM 1128   H HG1  . THR A 1 72  ? -8.095  -2.350  23.171  1.00 2.21  ? 72  THR A HG1  1  
ATOM 1129   H HG21 . THR A 1 72  ? -8.034  -0.912  20.442  1.00 65.44 ? 72  THR A HG21 1  
ATOM 1130   H HG22 . THR A 1 72  ? -7.581  -2.587  20.696  1.00 54.20 ? 72  THR A HG22 1  
ATOM 1131   H HG23 . THR A 1 72  ? -6.403  -1.434  20.063  1.00 73.22 ? 72  THR A HG23 1  
ATOM 1132   N N    . ALA A 1 73  ? -4.136  -2.772  20.803  1.00 4.11  ? 73  ALA A N    1  
ATOM 1133   C CA   . ALA A 1 73  ? -3.105  -2.677  19.756  1.00 41.22 ? 73  ALA A CA   1  
ATOM 1134   C C    . ALA A 1 73  ? -3.608  -1.828  18.611  1.00 54.31 ? 73  ALA A C    1  
ATOM 1135   O O    . ALA A 1 73  ? -3.076  -0.750  18.339  1.00 45.54 ? 73  ALA A O    1  
ATOM 1136   C CB   . ALA A 1 73  ? -2.737  -4.077  19.238  1.00 44.21 ? 73  ALA A CB   1  
ATOM 1137   H H    . ALA A 1 73  ? -4.703  -3.561  20.811  1.00 12.32 ? 73  ALA A H    1  
ATOM 1138   H HA   . ALA A 1 73  ? -2.210  -2.222  20.180  1.00 73.01 ? 73  ALA A HA   1  
ATOM 1139   H HB1  . ALA A 1 73  ? -2.383  -4.672  20.054  1.00 3.53  ? 73  ALA A HB1  1  
ATOM 1140   H HB2  . ALA A 1 73  ? -1.959  -4.008  18.487  1.00 74.54 ? 73  ALA A HB2  1  
ATOM 1141   H HB3  . ALA A 1 73  ? -3.609  -4.551  18.808  1.00 31.04 ? 73  ALA A HB3  1  
ATOM 1142   N N    . PHE A 1 74  ? -4.671  -2.331  17.965  1.00 73.31 ? 74  PHE A N    1  
ATOM 1143   C CA   . PHE A 1 74  ? -5.252  -1.694  16.784  1.00 43.31 ? 74  PHE A CA   1  
ATOM 1144   C C    . PHE A 1 74  ? -6.743  -2.042  16.650  1.00 52.00 ? 74  PHE A C    1  
ATOM 1145   O O    . PHE A 1 74  ? -7.274  -2.928  17.346  1.00 73.14 ? 74  PHE A O    1  
ATOM 1146   C CB   . PHE A 1 74  ? -4.470  -2.078  15.488  1.00 24.23 ? 74  PHE A CB   1  
ATOM 1147   C CG   . PHE A 1 74  ? -4.682  -3.519  15.005  1.00 34.45 ? 74  PHE A CG   1  
ATOM 1148   C CD1  . PHE A 1 74  ? -3.984  -4.578  15.572  1.00 32.54 ? 74  PHE A CD1  1  
ATOM 1149   C CD2  . PHE A 1 74  ? -5.599  -3.806  13.989  1.00 12.02 ? 74  PHE A CD2  1  
ATOM 1150   C CE1  . PHE A 1 74  ? -4.195  -5.872  15.141  1.00 14.13 ? 74  PHE A CE1  1  
ATOM 1151   C CE2  . PHE A 1 74  ? -5.805  -5.101  13.560  1.00 14.11 ? 74  PHE A CE2  1  
ATOM 1152   C CZ   . PHE A 1 74  ? -5.103  -6.136  14.137  1.00 12.25 ? 74  PHE A CZ   1  
ATOM 1153   H H    . PHE A 1 74  ? -5.084  -3.159  18.309  1.00 13.00 ? 74  PHE A H    1  
ATOM 1154   H HA   . PHE A 1 74  ? -5.180  -0.616  16.923  1.00 60.03 ? 74  PHE A HA   1  
ATOM 1155   H HB2  . PHE A 1 74  ? -4.764  -1.408  14.685  1.00 33.44 ? 74  PHE A HB2  1  
ATOM 1156   H HB3  . PHE A 1 74  ? -3.409  -1.942  15.666  1.00 12.34 ? 74  PHE A HB3  1  
ATOM 1157   H HD1  . PHE A 1 74  ? -3.267  -4.383  16.361  1.00 74.13 ? 74  PHE A HD1  1  
ATOM 1158   H HD2  . PHE A 1 74  ? -6.154  -2.995  13.529  1.00 21.13 ? 74  PHE A HD2  1  
ATOM 1159   H HE1  . PHE A 1 74  ? -3.644  -6.683  15.597  1.00 31.22 ? 74  PHE A HE1  1  
ATOM 1160   H HE2  . PHE A 1 74  ? -6.518  -5.302  12.773  1.00 75.44 ? 74  PHE A HE2  1  
ATOM 1161   H HZ   . PHE A 1 74  ? -5.262  -7.152  13.805  1.00 74.35 ? 74  PHE A HZ   1  
ATOM 1162   N N    . LEU A 1 75  ? -7.382  -1.310  15.737  1.00 1.53  ? 75  LEU A N    1  
ATOM 1163   C CA   . LEU A 1 75  ? -8.790  -1.431  15.403  1.00 62.04 ? 75  LEU A CA   1  
ATOM 1164   C C    . LEU A 1 75  ? -8.925  -1.189  13.890  1.00 0.44  ? 75  LEU A C    1  
ATOM 1165   O O    . LEU A 1 75  ? -8.746  -0.062  13.433  1.00 5.14  ? 75  LEU A O    1  
ATOM 1166   C CB   . LEU A 1 75  ? -9.593  -0.378  16.223  1.00 22.24 ? 75  LEU A CB   1  
ATOM 1167   C CG   . LEU A 1 75  ? -11.129 -0.307  15.972  1.00 0.22  ? 75  LEU A CG   1  
ATOM 1168   C CD1  . LEU A 1 75  ? -11.817 -1.646  16.308  1.00 42.43 ? 75  LEU A CD1  1  
ATOM 1169   C CD2  . LEU A 1 75  ? -11.758 0.873   16.755  1.00 62.42 ? 75  LEU A CD2  1  
ATOM 1170   H H    . LEU A 1 75  ? -6.864  -0.635  15.251  1.00 1.43  ? 75  LEU A H    1  
ATOM 1171   H HA   . LEU A 1 75  ? -9.134  -2.434  15.650  1.00 33.14 ? 75  LEU A HA   1  
ATOM 1172   H HB2  . LEU A 1 75  ? -9.433  -0.585  17.277  1.00 35.21 ? 75  LEU A HB2  1  
ATOM 1173   H HB3  . LEU A 1 75  ? -9.170  0.602   16.012  1.00 62.45 ? 75  LEU A HB3  1  
ATOM 1174   H HG   . LEU A 1 75  ? -11.300 -0.123  14.917  1.00 24.22 ? 75  LEU A HG   1  
ATOM 1175   H HD11 . LEU A 1 75  ? -12.880 -1.567  16.130  1.00 53.23 ? 75  LEU A HD11 1  
ATOM 1176   H HD12 . LEU A 1 75  ? -11.656 -1.906  17.342  1.00 30.42 ? 75  LEU A HD12 1  
ATOM 1177   H HD13 . LEU A 1 75  ? -11.415 -2.427  15.677  1.00 10.05 ? 75  LEU A HD13 1  
ATOM 1178   H HD21 . LEU A 1 75  ? -11.588 0.748   17.818  1.00 22.00 ? 75  LEU A HD21 1  
ATOM 1179   H HD22 . LEU A 1 75  ? -12.820 0.915   16.567  1.00 64.21 ? 75  LEU A HD22 1  
ATOM 1180   H HD23 . LEU A 1 75  ? -11.309 1.804   16.430  1.00 52.54 ? 75  LEU A HD23 1  
ATOM 1181   N N    . CYS A 1 76  ? -9.188  -2.250  13.115  1.00 41.12 ? 76  CYS A N    1  
ATOM 1182   C CA   . CYS A 1 76  ? -9.385  -2.153  11.654  1.00 64.03 ? 76  CYS A CA   1  
ATOM 1183   C C    . CYS A 1 76  ? -10.868 -2.311  11.300  1.00 11.20 ? 76  CYS A C    1  
ATOM 1184   O O    . CYS A 1 76  ? -11.378 -3.428  11.205  1.00 62.22 ? 76  CYS A O    1  
ATOM 1185   C CB   . CYS A 1 76  ? -8.549  -3.231  10.934  1.00 40.34 ? 76  CYS A CB   1  
ATOM 1186   S SG   . CYS A 1 76  ? -6.775  -2.990  11.052  1.00 54.51 ? 76  CYS A SG   1  
ATOM 1187   H H    . CYS A 1 76  ? -9.237  -3.131  13.533  1.00 14.33 ? 76  CYS A H    1  
ATOM 1188   H HA   . CYS A 1 76  ? -9.044  -1.173  11.321  1.00 73.55 ? 76  CYS A HA   1  
ATOM 1189   H HB2  . CYS A 1 76  ? -8.771  -4.205  11.353  1.00 54.52 ? 76  CYS A HB2  1  
ATOM 1190   H HB3  . CYS A 1 76  ? -8.804  -3.242  9.879   1.00 50.41 ? 76  CYS A HB3  1  
ATOM 1191   H HG   . CYS A 1 76  ? -6.564  -2.125  12.024  1.00 11.43 ? 76  CYS A HG   1  
ATOM 1192   N N    . GLU A 1 77  ? -11.546 -1.181  11.103  1.00 34.43 ? 77  GLU A N    1  
ATOM 1193   C CA   . GLU A 1 77  ? -12.963 -1.133  10.740  1.00 52.34 ? 77  GLU A CA   1  
ATOM 1194   C C    . GLU A 1 77  ? -13.088 -0.602  9.310   1.00 34.13 ? 77  GLU A C    1  
ATOM 1195   O O    . GLU A 1 77  ? -12.735 0.543   9.032   1.00 42.25 ? 77  GLU A O    1  
ATOM 1196   C CB   . GLU A 1 77  ? -13.734 -0.238  11.743  1.00 33.31 ? 77  GLU A CB   1  
ATOM 1197   C CG   . GLU A 1 77  ? -15.211 -0.029  11.378  1.00 73.41 ? 77  GLU A CG   1  
ATOM 1198   C CD   . GLU A 1 77  ? -15.999 0.712   12.459  1.00 71.40 ? 77  GLU A CD   1  
ATOM 1199   O OE1  . GLU A 1 77  ? -16.008 1.957   12.459  1.00 71.14 ? 77  GLU A OE1  1  
ATOM 1200   O OE2  . GLU A 1 77  ? -16.613 0.046   13.321  1.00 60.43 ? 77  GLU A OE2  1  
ATOM 1201   H H    . GLU A 1 77  ? -11.067 -0.337  11.186  1.00 24.21 ? 77  GLU A H    1  
ATOM 1202   H HA   . GLU A 1 77  ? -13.370 -2.148  10.777  1.00 10.32 ? 77  GLU A HA   1  
ATOM 1203   H HB2  . GLU A 1 77  ? -13.682 -0.698  12.726  1.00 51.02 ? 77  GLU A HB2  1  
ATOM 1204   H HB3  . GLU A 1 77  ? -13.251 0.735   11.792  1.00 34.10 ? 77  GLU A HB3  1  
ATOM 1205   H HG2  . GLU A 1 77  ? -15.261 0.538   10.453  1.00 40.24 ? 77  GLU A HG2  1  
ATOM 1206   H HG3  . GLU A 1 77  ? -15.671 -1.002  11.207  1.00 71.34 ? 77  GLU A HG3  1  
ATOM 1207   N N    . VAL A 1 78  ? -13.586 -1.451  8.406   1.00 41.10 ? 78  VAL A N    1  
ATOM 1208   C CA   . VAL A 1 78  ? -13.646 -1.165  6.969   1.00 35.43 ? 78  VAL A CA   1  
ATOM 1209   C C    . VAL A 1 78  ? -15.052 -1.466  6.452   1.00 22.31 ? 78  VAL A C    1  
ATOM 1210   O O    . VAL A 1 78  ? -15.471 -2.628  6.398   1.00 13.11 ? 78  VAL A O    1  
ATOM 1211   C CB   . VAL A 1 78  ? -12.550 -2.007  6.193   1.00 20.15 ? 78  VAL A CB   1  
ATOM 1212   C CG1  . VAL A 1 78  ? -12.722 -1.911  4.653   1.00 71.12 ? 78  VAL A CG1  1  
ATOM 1213   C CG2  . VAL A 1 78  ? -11.125 -1.566  6.644   1.00 3.11  ? 78  VAL A CG2  1  
ATOM 1214   H H    . VAL A 1 78  ? -13.937 -2.308  8.722   1.00 23.32 ? 78  VAL A H    1  
ATOM 1215   H HA   . VAL A 1 78  ? -13.432 -0.102  6.812   1.00 52.02 ? 78  VAL A HA   1  
ATOM 1216   H HB   . VAL A 1 78  ? -12.672 -3.053  6.470   1.00 72.11 ? 78  VAL A HB   1  
ATOM 1217   H HG11 . VAL A 1 78  ? -13.633 -2.414  4.355   1.00 63.23 ? 78  VAL A HG11 1  
ATOM 1218   H HG12 . VAL A 1 78  ? -11.885 -2.380  4.156   1.00 52.02 ? 78  VAL A HG12 1  
ATOM 1219   H HG13 . VAL A 1 78  ? -12.783 -0.877  4.351   1.00 25.00 ? 78  VAL A HG13 1  
ATOM 1220   H HG21 . VAL A 1 78  ? -10.892 -0.584  6.253   1.00 42.12 ? 78  VAL A HG21 1  
ATOM 1221   H HG22 . VAL A 1 78  ? -10.380 -2.265  6.326   1.00 34.43 ? 78  VAL A HG22 1  
ATOM 1222   H HG23 . VAL A 1 78  ? -11.089 -1.531  7.719   1.00 32.51 ? 78  VAL A HG23 1  
ATOM 1223   N N    . GLN A 1 79  ? -15.781 -0.397  6.104   1.00 72.11 ? 79  GLN A N    1  
ATOM 1224   C CA   . GLN A 1 79  ? -17.086 -0.492  5.463   1.00 74.02 ? 79  GLN A CA   1  
ATOM 1225   C C    . GLN A 1 79  ? -16.883 -0.629  3.950   1.00 73.13 ? 79  GLN A C    1  
ATOM 1226   O O    . GLN A 1 79  ? -16.830 0.370   3.214   1.00 11.20 ? 79  GLN A O    1  
ATOM 1227   C CB   . GLN A 1 79  ? -17.971 0.730   5.834   1.00 51.53 ? 79  GLN A CB   1  
ATOM 1228   C CG   . GLN A 1 79  ? -18.339 0.799   7.327   1.00 32.33 ? 79  GLN A CG   1  
ATOM 1229   C CD   . GLN A 1 79  ? -19.420 1.832   7.645   1.00 24.54 ? 79  GLN A CD   1  
ATOM 1230   O OE1  . GLN A 1 79  ? -20.610 1.533   7.564   1.00 60.33 ? 79  GLN A OE1  1  
ATOM 1231   N NE2  . GLN A 1 79  ? -19.021 3.028   8.039   1.00 51.44 ? 79  GLN A NE2  1  
ATOM 1232   H H    . GLN A 1 79  ? -15.416 0.495   6.288   1.00 40.24 ? 79  GLN A H    1  
ATOM 1233   H HA   . GLN A 1 79  ? -17.573 -1.396  5.829   1.00 50.50 ? 79  GLN A HA   1  
ATOM 1234   H HB2  . GLN A 1 79  ? -17.441 1.641   5.571   1.00 74.31 ? 79  GLN A HB2  1  
ATOM 1235   H HB3  . GLN A 1 79  ? -18.890 0.687   5.259   1.00 1.34  ? 79  GLN A HB3  1  
ATOM 1236   H HG2  . GLN A 1 79  ? -18.697 -0.176  7.643   1.00 20.52 ? 79  GLN A HG2  1  
ATOM 1237   H HG3  . GLN A 1 79  ? -17.444 1.038   7.895   1.00 22.11 ? 79  GLN A HG3  1  
ATOM 1238   H HE21 . GLN A 1 79  ? -18.056 3.192   8.112   1.00 25.04 ? 79  GLN A HE21 1  
ATOM 1239   H HE22 . GLN A 1 79  ? -19.701 3.702   8.243   1.00 32.10 ? 79  GLN A HE22 1  
ATOM 1240   N N    . GLN A 1 80  ? -16.701 -1.889  3.517   1.00 44.45 ? 80  GLN A N    1  
ATOM 1241   C CA   . GLN A 1 80  ? -16.519 -2.236  2.112   1.00 5.11  ? 80  GLN A CA   1  
ATOM 1242   C C    . GLN A 1 80  ? -17.890 -2.228  1.416   1.00 22.41 ? 80  GLN A C    1  
ATOM 1243   O O    . GLN A 1 80  ? -18.714 -3.121  1.645   1.00 32.32 ? 80  GLN A O    1  
ATOM 1244   C CB   . GLN A 1 80  ? -15.833 -3.627  1.977   1.00 61.32 ? 80  GLN A CB   1  
ATOM 1245   C CG   . GLN A 1 80  ? -15.461 -4.007  0.527   1.00 31.13 ? 80  GLN A CG   1  
ATOM 1246   C CD   . GLN A 1 80  ? -14.312 -3.180  -0.060  1.00 21.01 ? 80  GLN A CD   1  
ATOM 1247   O OE1  . GLN A 1 80  ? -14.305 -2.865  -1.249  1.00 42.41 ? 80  GLN A OE1  1  
ATOM 1248   N NE2  . GLN A 1 80  ? -13.288 -2.901  0.746   1.00 72.44 ? 80  GLN A NE2  1  
ATOM 1249   H H    . GLN A 1 80  ? -16.701 -2.615  4.182   1.00 43.34 ? 80  GLN A H    1  
ATOM 1250   H HA   . GLN A 1 80  ? -15.875 -1.482  1.657   1.00 41.32 ? 80  GLN A HA   1  
ATOM 1251   H HB2  . GLN A 1 80  ? -14.922 -3.622  2.567   1.00 65.53 ? 80  GLN A HB2  1  
ATOM 1252   H HB3  . GLN A 1 80  ? -16.489 -4.394  2.379   1.00 31.03 ? 80  GLN A HB3  1  
ATOM 1253   H HG2  . GLN A 1 80  ? -15.165 -5.050  0.506   1.00 64.52 ? 80  GLN A HG2  1  
ATOM 1254   H HG3  . GLN A 1 80  ? -16.337 -3.882  -0.101  1.00 11.32 ? 80  GLN A HG3  1  
ATOM 1255   H HE21 . GLN A 1 80  ? -13.310 -3.237  1.670   1.00 55.01 ? 80  GLN A HE21 1  
ATOM 1256   H HE22 . GLN A 1 80  ? -12.551 -2.375  0.380   1.00 32.12 ? 80  GLN A HE22 1  
ATOM 1257   N N    . GLY A 1 81  ? -18.138 -1.173  0.629   1.00 62.22 ? 81  GLY A N    1  
ATOM 1258   C CA   . GLY A 1 81  ? -19.347 -1.058  -0.180  1.00 44.22 ? 81  GLY A CA   1  
ATOM 1259   C C    . GLY A 1 81  ? -19.169 -1.663  -1.565  1.00 60.15 ? 81  GLY A C    1  
ATOM 1260   O O    . GLY A 1 81  ? -18.040 -1.858  -2.033  1.00 13.33 ? 81  GLY A O    1  
ATOM 1261   H H    . GLY A 1 81  ? -17.472 -0.458  0.583   1.00 62.12 ? 81  GLY A H    1  
ATOM 1262   H HA2  . GLY A 1 81  ? -20.175 -1.551  0.325   1.00 51.43 ? 81  GLY A HA2  1  
ATOM 1263   H HA3  . GLY A 1 81  ? -19.588 -0.010  -0.289  1.00 32.21 ? 81  GLY A HA3  1  
ATOM 1264   N N    . GLY A 1 82  ? -20.293 -1.978  -2.214  1.00 20.42 ? 82  GLY A N    1  
ATOM 1265   C CA   . GLY A 1 82  ? -20.285 -2.540  -3.554  1.00 40.40 ? 82  GLY A CA   1  
ATOM 1266   C C    . GLY A 1 82  ? -21.613 -2.331  -4.239  1.00 43.33 ? 82  GLY A C    1  
ATOM 1267   O O    . GLY A 1 82  ? -22.655 -2.719  -3.707  1.00 45.43 ? 82  GLY A O    1  
ATOM 1268   H H    . GLY A 1 82  ? -21.151 -1.840  -1.761  1.00 34.11 ? 82  GLY A H    1  
ATOM 1269   H HA2  . GLY A 1 82  ? -19.493 -2.078  -4.140  1.00 30.43 ? 82  GLY A HA2  1  
ATOM 1270   H HA3  . GLY A 1 82  ? -20.092 -3.604  -3.488  1.00 3.14  ? 82  GLY A HA3  1  
ATOM 1271   N N    . ILE A 1 83  ? -21.578 -1.685  -5.404  1.00 70.23 ? 83  ILE A N    1  
ATOM 1272   C CA   . ILE A 1 83  ? -22.760 -1.458  -6.233  1.00 5.01  ? 83  ILE A CA   1  
ATOM 1273   C C    . ILE A 1 83  ? -23.044 -2.713  -7.075  1.00 25.34 ? 83  ILE A C    1  
ATOM 1274   O O    . ILE A 1 83  ? -22.179 -3.170  -7.844  1.00 34.10 ? 83  ILE A O    1  
ATOM 1275   C CB   . ILE A 1 83  ? -22.563 -0.220  -7.180  1.00 22.11 ? 83  ILE A CB   1  
ATOM 1276   C CG1  . ILE A 1 83  ? -22.110 1.037   -6.360  1.00 4.43  ? 83  ILE A CG1  1  
ATOM 1277   C CG2  . ILE A 1 83  ? -23.862 0.052   -7.980  1.00 13.43 ? 83  ILE A CG2  1  
ATOM 1278   C CD1  . ILE A 1 83  ? -21.852 2.287   -7.189  1.00 63.31 ? 83  ILE A CD1  1  
ATOM 1279   H H    . ILE A 1 83  ? -20.721 -1.345  -5.714  1.00 33.34 ? 83  ILE A H    1  
ATOM 1280   H HA   . ILE A 1 83  ? -23.606 -1.264  -5.570  1.00 13.20 ? 83  ILE A HA   1  
ATOM 1281   H HB   . ILE A 1 83  ? -21.778 -0.466  -7.895  1.00 0.32  ? 83  ILE A HB   1  
ATOM 1282   H HG12 . ILE A 1 83  ? -22.869 1.286   -5.633  1.00 2.02  ? 83  ILE A HG12 1  
ATOM 1283   H HG13 . ILE A 1 83  ? -21.190 0.806   -5.835  1.00 21.21 ? 83  ILE A HG13 1  
ATOM 1284   H HG21 . ILE A 1 83  ? -24.131 -0.824  -8.556  1.00 12.13 ? 83  ILE A HG21 1  
ATOM 1285   H HG22 . ILE A 1 83  ? -23.714 0.873   -8.649  1.00 13.33 ? 83  ILE A HG22 1  
ATOM 1286   H HG23 . ILE A 1 83  ? -24.671 0.292   -7.300  1.00 75.23 ? 83  ILE A HG23 1  
ATOM 1287   H HD11 . ILE A 1 83  ? -21.540 3.087   -6.536  1.00 75.11 ? 83  ILE A HD11 1  
ATOM 1288   H HD12 . ILE A 1 83  ? -22.759 2.577   -7.701  1.00 74.33 ? 83  ILE A HD12 1  
ATOM 1289   H HD13 . ILE A 1 83  ? -21.074 2.090   -7.913  1.00 72.33 ? 83  ILE A HD13 1  
ATOM 1290   N N    . PHE A 1 84  ? -24.267 -3.248  -6.931  1.00 43.20 ? 84  PHE A N    1  
ATOM 1291   C CA   . PHE A 1 84  ? -24.706 -4.485  -7.602  1.00 32.22 ? 84  PHE A CA   1  
ATOM 1292   C C    . PHE A 1 84  ? -26.106 -4.249  -8.189  1.00 34.33 ? 84  PHE A C    1  
ATOM 1293   O O    . PHE A 1 84  ? -27.051 -3.958  -7.456  1.00 41.42 ? 84  PHE A O    1  
ATOM 1294   C CB   . PHE A 1 84  ? -24.755 -5.685  -6.600  1.00 43.04 ? 84  PHE A CB   1  
ATOM 1295   C CG   . PHE A 1 84  ? -23.500 -5.879  -5.739  1.00 3.22  ? 84  PHE A CG   1  
ATOM 1296   C CD1  . PHE A 1 84  ? -23.536 -5.754  -4.354  1.00 61.22 ? 84  PHE A CD1  1  
ATOM 1297   C CD2  . PHE A 1 84  ? -22.288 -6.211  -6.327  1.00 11.03 ? 84  PHE A CD2  1  
ATOM 1298   C CE1  . PHE A 1 84  ? -22.397 -5.964  -3.596  1.00 51.41 ? 84  PHE A CE1  1  
ATOM 1299   C CE2  . PHE A 1 84  ? -21.150 -6.411  -5.571  1.00 10.31 ? 84  PHE A CE2  1  
ATOM 1300   C CZ   . PHE A 1 84  ? -21.206 -6.290  -4.207  1.00 0.12  ? 84  PHE A CZ   1  
ATOM 1301   H H    . PHE A 1 84  ? -24.913 -2.773  -6.366  1.00 43.34 ? 84  PHE A H    1  
ATOM 1302   H HA   . PHE A 1 84  ? -24.010 -4.719  -8.411  1.00 71.24 ? 84  PHE A HA   1  
ATOM 1303   H HB2  . PHE A 1 84  ? -25.607 -5.568  -5.937  1.00 4.30  ? 84  PHE A HB2  1  
ATOM 1304   H HB3  . PHE A 1 84  ? -24.890 -6.612  -7.171  1.00 53.40 ? 84  PHE A HB3  1  
ATOM 1305   H HD1  . PHE A 1 84  ? -24.464 -5.484  -3.867  1.00 52.52 ? 84  PHE A HD1  1  
ATOM 1306   H HD2  . PHE A 1 84  ? -22.237 -6.310  -7.404  1.00 72.41 ? 84  PHE A HD2  1  
ATOM 1307   H HE1  . PHE A 1 84  ? -22.438 -5.864  -2.521  1.00 32.34 ? 84  PHE A HE1  1  
ATOM 1308   H HE2  . PHE A 1 84  ? -20.215 -6.667  -6.056  1.00 72.30 ? 84  PHE A HE2  1  
ATOM 1309   H HZ   . PHE A 1 84  ? -20.319 -6.455  -3.612  1.00 62.14 ? 84  PHE A HZ   1  
ATOM 1310   N N    . SER A 1 85  ? -26.233 -4.363  -9.506  1.00 22.24 ? 85  SER A N    1  
ATOM 1311   C CA   . SER A 1 85  ? -27.524 -4.278  -10.187 1.00 12.35 ? 85  SER A CA   1  
ATOM 1312   C C    . SER A 1 85  ? -28.205 -5.658  -10.132 1.00 63.53 ? 85  SER A C    1  
ATOM 1313   O O    . SER A 1 85  ? -27.828 -6.575  -10.876 1.00 72.41 ? 85  SER A O    1  
ATOM 1314   C CB   . SER A 1 85  ? -27.327 -3.801  -11.641 1.00 1.22  ? 85  SER A CB   1  
ATOM 1315   O OG   . SER A 1 85  ? -28.570 -3.602  -12.305 1.00 45.25 ? 85  SER A OG   1  
ATOM 1316   H H    . SER A 1 85  ? -25.436 -4.498  -10.039 1.00 21.22 ? 85  SER A H    1  
ATOM 1317   H HA   . SER A 1 85  ? -28.143 -3.546  -9.663  1.00 23.51 ? 85  SER A HA   1  
ATOM 1318   H HB2  . SER A 1 85  ? -26.789 -2.863  -11.638 1.00 24.22 ? 85  SER A HB2  1  
ATOM 1319   H HB3  . SER A 1 85  ? -26.751 -4.536  -12.191 1.00 10.34 ? 85  SER A HB3  1  
ATOM 1320   H HG   . SER A 1 85  ? -29.295 -3.693  -11.676 1.00 33.21 ? 85  SER A HG   1  
ATOM 1321   N N    . ILE A 1 86  ? -29.164 -5.808  -9.198  1.00 30.43 ? 86  ILE A N    1  
ATOM 1322   C CA   . ILE A 1 86  ? -29.915 -7.060  -9.003  1.00 41.22 ? 86  ILE A CA   1  
ATOM 1323   C C    . ILE A 1 86  ? -31.419 -6.843  -9.279  1.00 30.15 ? 86  ILE A C    1  
ATOM 1324   O O    . ILE A 1 86  ? -31.991 -5.809  -8.916  1.00 11.40 ? 86  ILE A O    1  
ATOM 1325   C CB   . ILE A 1 86  ? -29.713 -7.673  -7.555  1.00 51.01 ? 86  ILE A CB   1  
ATOM 1326   C CG1  . ILE A 1 86  ? -30.169 -6.682  -6.433  1.00 24.30 ? 86  ILE A CG1  1  
ATOM 1327   C CG2  . ILE A 1 86  ? -28.245 -8.117  -7.332  1.00 12.52 ? 86  ILE A CG2  1  
ATOM 1328   C CD1  . ILE A 1 86  ? -30.085 -7.236  -5.013  1.00 13.23 ? 86  ILE A CD1  1  
ATOM 1329   H H    . ILE A 1 86  ? -29.382 -5.040  -8.629  1.00 24.41 ? 86  ILE A H    1  
ATOM 1330   H HA   . ILE A 1 86  ? -29.544 -7.789  -9.726  1.00 2.45  ? 86  ILE A HA   1  
ATOM 1331   H HB   . ILE A 1 86  ? -30.329 -8.569  -7.493  1.00 41.14 ? 86  ILE A HB   1  
ATOM 1332   H HG12 . ILE A 1 86  ? -29.553 -5.792  -6.466  1.00 72.14 ? 86  ILE A HG12 1  
ATOM 1333   H HG13 . ILE A 1 86  ? -31.199 -6.396  -6.606  1.00 64.22 ? 86  ILE A HG13 1  
ATOM 1334   H HG21 . ILE A 1 86  ? -27.959 -8.836  -8.090  1.00 43.15 ? 86  ILE A HG21 1  
ATOM 1335   H HG22 . ILE A 1 86  ? -28.144 -8.577  -6.357  1.00 12.13 ? 86  ILE A HG22 1  
ATOM 1336   H HG23 . ILE A 1 86  ? -27.586 -7.259  -7.389  1.00 65.43 ? 86  ILE A HG23 1  
ATOM 1337   H HD11 . ILE A 1 86  ? -29.057 -7.469  -4.771  1.00 32.24 ? 86  ILE A HD11 1  
ATOM 1338   H HD12 . ILE A 1 86  ? -30.685 -8.131  -4.933  1.00 41.33 ? 86  ILE A HD12 1  
ATOM 1339   H HD13 . ILE A 1 86  ? -30.455 -6.495  -4.318  1.00 14.40 ? 86  ILE A HD13 1  
ATOM 1340   N N    . ALA A 1 87  ? -32.032 -7.845  -9.927  1.00 60.44 ? 87  ALA A N    1  
ATOM 1341   C CA   . ALA A 1 87  ? -33.481 -7.890  -10.219 1.00 63.22 ? 87  ALA A CA   1  
ATOM 1342   C C    . ALA A 1 87  ? -33.956 -9.348  -10.234 1.00 32.44 ? 87  ALA A C    1  
ATOM 1343   O O    . ALA A 1 87  ? -33.130 -10.260 -10.242 1.00 12.10 ? 87  ALA A O    1  
ATOM 1344   C CB   . ALA A 1 87  ? -33.806 -7.192  -11.551 1.00 5.03  ? 87  ALA A CB   1  
ATOM 1345   H H    . ALA A 1 87  ? -31.483 -8.605  -10.219 1.00 52.52 ? 87  ALA A H    1  
ATOM 1346   H HA   . ALA A 1 87  ? -34.005 -7.367  -9.422  1.00 23.24 ? 87  ALA A HA   1  
ATOM 1347   H HB1  . ALA A 1 87  ? -33.426 -6.182  -11.529 1.00 61.52 ? 87  ALA A HB1  1  
ATOM 1348   H HB2  . ALA A 1 87  ? -34.881 -7.160  -11.694 1.00 33.33 ? 87  ALA A HB2  1  
ATOM 1349   H HB3  . ALA A 1 87  ? -33.352 -7.726  -12.377 1.00 23.21 ? 87  ALA A HB3  1  
ATOM 1350   N N    . GLY A 1 88  ? -35.289 -9.556  -10.193 1.00 61.11 ? 88  GLY A N    1  
ATOM 1351   C CA   . GLY A 1 88  ? -35.879 -10.901 -10.277 1.00 64.44 ? 88  GLY A CA   1  
ATOM 1352   C C    . GLY A 1 88  ? -35.804 -11.695 -8.979  1.00 10.35 ? 88  GLY A C    1  
ATOM 1353   O O    . GLY A 1 88  ? -36.119 -12.892 -8.965  1.00 14.21 ? 88  GLY A O    1  
ATOM 1354   H H    . GLY A 1 88  ? -35.883 -8.783  -10.106 1.00 3.31  ? 88  GLY A H    1  
ATOM 1355   H HA2  . GLY A 1 88  ? -36.919 -10.794 -10.551 1.00 22.30 ? 88  GLY A HA2  1  
ATOM 1356   H HA3  . GLY A 1 88  ? -35.378 -11.460 -11.061 1.00 20.35 ? 88  GLY A HA3  1  
ATOM 1357   N N    . ILE A 1 89  ? -35.411 -11.028 -7.877  1.00 25.42 ? 89  ILE A N    1  
ATOM 1358   C CA   . ILE A 1 89  ? -35.135 -11.689 -6.587  1.00 25.24 ? 89  ILE A CA   1  
ATOM 1359   C C    . ILE A 1 89  ? -36.233 -11.310 -5.567  1.00 32.42 ? 89  ILE A C    1  
ATOM 1360   O O    . ILE A 1 89  ? -36.611 -10.141 -5.456  1.00 24.13 ? 89  ILE A O    1  
ATOM 1361   C CB   . ILE A 1 89  ? -33.691 -11.314 -6.009  1.00 13.54 ? 89  ILE A CB   1  
ATOM 1362   C CG1  . ILE A 1 89  ? -33.536 -9.800  -5.562  1.00 42.23 ? 89  ILE A CG1  1  
ATOM 1363   C CG2  . ILE A 1 89  ? -32.571 -11.687 -7.008  1.00 15.25 ? 89  ILE A CG2  1  
ATOM 1364   C CD1  . ILE A 1 89  ? -33.553 -8.745  -6.660  1.00 51.42 ? 89  ILE A CD1  1  
ATOM 1365   H H    . ILE A 1 89  ? -35.326 -10.060 -7.931  1.00 2.44  ? 89  ILE A H    1  
ATOM 1366   H HA   . ILE A 1 89  ? -35.162 -12.772 -6.742  1.00 34.31 ? 89  ILE A HA   1  
ATOM 1367   H HB   . ILE A 1 89  ? -33.541 -11.939 -5.127  1.00 72.11 ? 89  ILE A HB   1  
ATOM 1368   H HG12 . ILE A 1 89  ? -34.333 -9.553  -4.877  1.00 25.44 ? 89  ILE A HG12 1  
ATOM 1369   H HG13 . ILE A 1 89  ? -32.595 -9.694  -5.032  1.00 32.12 ? 89  ILE A HG13 1  
ATOM 1370   H HG21 . ILE A 1 89  ? -31.606 -11.427 -6.593  1.00 32.41 ? 89  ILE A HG21 1  
ATOM 1371   H HG22 . ILE A 1 89  ? -32.714 -11.150 -7.938  1.00 64.34 ? 89  ILE A HG22 1  
ATOM 1372   H HG23 . ILE A 1 89  ? -32.598 -12.750 -7.206  1.00 11.32 ? 89  ILE A HG23 1  
ATOM 1373   H HD11 . ILE A 1 89  ? -33.475 -7.761  -6.219  1.00 13.31 ? 89  ILE A HD11 1  
ATOM 1374   H HD12 . ILE A 1 89  ? -34.473 -8.813  -7.225  1.00 32.43 ? 89  ILE A HD12 1  
ATOM 1375   H HD13 . ILE A 1 89  ? -32.713 -8.902  -7.327  1.00 73.21 ? 89  ILE A HD13 1  
ATOM 1376   N N    . GLU A 1 90  ? -36.748 -12.326 -4.840  1.00 41.43 ? 90  GLU A N    1  
ATOM 1377   C CA   . GLU A 1 90  ? -37.761 -12.164 -3.759  1.00 23.33 ? 90  GLU A CA   1  
ATOM 1378   C C    . GLU A 1 90  ? -37.498 -13.227 -2.676  1.00 44.41 ? 90  GLU A C    1  
ATOM 1379   O O    . GLU A 1 90  ? -36.689 -14.128 -2.897  1.00 4.33  ? 90  GLU A O    1  
ATOM 1380   C CB   . GLU A 1 90  ? -39.217 -12.341 -4.315  1.00 74.32 ? 90  GLU A CB   1  
ATOM 1381   C CG   . GLU A 1 90  ? -39.673 -11.272 -5.335  1.00 74.34 ? 90  GLU A CG   1  
ATOM 1382   C CD   . GLU A 1 90  ? -41.082 -11.505 -5.907  1.00 53.33 ? 90  GLU A CD   1  
ATOM 1383   O OE1  . GLU A 1 90  ? -41.245 -12.418 -6.742  1.00 44.10 ? 90  GLU A OE1  1  
ATOM 1384   O OE2  . GLU A 1 90  ? -42.025 -10.765 -5.554  1.00 73.04 ? 90  GLU A OE2  1  
ATOM 1385   H H    . GLU A 1 90  ? -36.437 -13.235 -5.034  1.00 11.13 ? 90  GLU A H    1  
ATOM 1386   H HA   . GLU A 1 90  ? -37.651 -11.175 -3.318  1.00 42.11 ? 90  GLU A HA   1  
ATOM 1387   H HB2  . GLU A 1 90  ? -39.284 -13.313 -4.794  1.00 72.15 ? 90  GLU A HB2  1  
ATOM 1388   H HB3  . GLU A 1 90  ? -39.912 -12.326 -3.480  1.00 14.01 ? 90  GLU A HB3  1  
ATOM 1389   H HG2  . GLU A 1 90  ? -39.648 -10.305 -4.847  1.00 4.40  ? 90  GLU A HG2  1  
ATOM 1390   H HG3  . GLU A 1 90  ? -38.966 -11.255 -6.158  1.00 11.41 ? 90  GLU A HG3  1  
ATOM 1391   N N    . GLY A 1 91  ? -38.210 -13.127 -1.531  1.00 43.34 ? 91  GLY A N    1  
ATOM 1392   C CA   . GLY A 1 91  ? -38.158 -14.128 -0.448  1.00 11.54 ? 91  GLY A CA   1  
ATOM 1393   C C    . GLY A 1 91  ? -36.753 -14.533 0.005   1.00 11.14 ? 91  GLY A C    1  
ATOM 1394   O O    . GLY A 1 91  ? -35.911 -13.675 0.283   1.00 24.55 ? 91  GLY A O    1  
ATOM 1395   H H    . GLY A 1 91  ? -38.798 -12.352 -1.419  1.00 23.53 ? 91  GLY A H    1  
ATOM 1396   H HA2  . GLY A 1 91  ? -38.682 -13.725 0.407   1.00 60.32 ? 91  GLY A HA2  1  
ATOM 1397   H HA3  . GLY A 1 91  ? -38.691 -15.011 -0.780  1.00 61.43 ? 91  GLY A HA3  1  
ATOM 1398   N N    . THR A 1 92  ? -36.505 -15.854 0.054   1.00 10.24 ? 92  THR A N    1  
ATOM 1399   C CA   . THR A 1 92  ? -35.209 -16.422 0.461   1.00 12.13 ? 92  THR A CA   1  
ATOM 1400   C C    . THR A 1 92  ? -34.150 -16.303 -0.658  1.00 21.22 ? 92  THR A C    1  
ATOM 1401   O O    . THR A 1 92  ? -32.960 -16.470 -0.393  1.00 5.33  ? 92  THR A O    1  
ATOM 1402   C CB   . THR A 1 92  ? -35.353 -17.910 0.927   1.00 72.24 ? 92  THR A CB   1  
ATOM 1403   O OG1  . THR A 1 92  ? -34.087 -18.412 1.381   1.00 2.31  ? 92  THR A OG1  1  
ATOM 1404   C CG2  . THR A 1 92  ? -35.880 -18.814 -0.190  1.00 12.15 ? 92  THR A CG2  1  
ATOM 1405   H H    . THR A 1 92  ? -37.231 -16.472 -0.179  1.00 22.31 ? 92  THR A H    1  
ATOM 1406   H HA   . THR A 1 92  ? -34.857 -15.847 1.317   1.00 14.14 ? 92  THR A HA   1  
ATOM 1407   H HB   . THR A 1 92  ? -36.053 -17.944 1.757   1.00 64.33 ? 92  THR A HB   1  
ATOM 1408   H HG1  . THR A 1 92  ? -33.518 -18.556 0.617   1.00 62.11 ? 92  THR A HG1  1  
ATOM 1409   H HG21 . THR A 1 92  ? -36.849 -18.459 -0.523  1.00 21.50 ? 92  THR A HG21 1  
ATOM 1410   H HG22 . THR A 1 92  ? -35.981 -19.829 0.172   1.00 51.21 ? 92  THR A HG22 1  
ATOM 1411   H HG23 . THR A 1 92  ? -35.191 -18.803 -1.026  1.00 13.12 ? 92  THR A HG23 1  
ATOM 1412   N N    . GLN A 1 93  ? -34.589 -16.018 -1.903  1.00 70.45 ? 93  GLN A N    1  
ATOM 1413   C CA   . GLN A 1 93  ? -33.677 -15.822 -3.050  1.00 71.43 ? 93  GLN A CA   1  
ATOM 1414   C C    . GLN A 1 93  ? -32.857 -14.532 -2.845  1.00 64.01 ? 93  GLN A C    1  
ATOM 1415   O O    . GLN A 1 93  ? -31.638 -14.530 -3.038  1.00 41.31 ? 93  GLN A O    1  
ATOM 1416   C CB   . GLN A 1 93  ? -34.464 -15.757 -4.388  1.00 25.42 ? 93  GLN A CB   1  
ATOM 1417   C CG   . GLN A 1 93  ? -35.408 -16.956 -4.643  1.00 63.22 ? 93  GLN A CG   1  
ATOM 1418   C CD   . GLN A 1 93  ? -36.256 -16.822 -5.926  1.00 54.11 ? 93  GLN A CD   1  
ATOM 1419   O OE1  . GLN A 1 93  ? -37.400 -17.269 -5.980  1.00 44.44 ? 93  GLN A OE1  1  
ATOM 1420   N NE2  . GLN A 1 93  ? -35.691 -16.242 -6.983  1.00 41.04 ? 93  GLN A NE2  1  
ATOM 1421   H H    . GLN A 1 93  ? -35.554 -15.933 -2.051  1.00 2.04  ? 93  GLN A H    1  
ATOM 1422   H HA   . GLN A 1 93  ? -32.998 -16.670 -3.084  1.00 3.34  ? 93  GLN A HA   1  
ATOM 1423   H HB2  . GLN A 1 93  ? -35.062 -14.853 -4.395  1.00 40.33 ? 93  GLN A HB2  1  
ATOM 1424   H HB3  . GLN A 1 93  ? -33.755 -15.706 -5.210  1.00 52.32 ? 93  GLN A HB3  1  
ATOM 1425   H HG2  . GLN A 1 93  ? -34.811 -17.859 -4.729  1.00 30.13 ? 93  GLN A HG2  1  
ATOM 1426   H HG3  . GLN A 1 93  ? -36.070 -17.058 -3.788  1.00 61.03 ? 93  GLN A HG3  1  
ATOM 1427   H HE21 . GLN A 1 93  ? -34.766 -15.926 -6.908  1.00 42.02 ? 93  GLN A HE21 1  
ATOM 1428   H HE22 . GLN A 1 93  ? -36.225 -16.158 -7.796  1.00 62.22 ? 93  GLN A HE22 1  
ATOM 1429   N N    . MET A 1 94  ? -33.546 -13.441 -2.427  1.00 21.14 ? 94  MET A N    1  
ATOM 1430   C CA   . MET A 1 94  ? -32.885 -12.150 -2.103  1.00 14.54 ? 94  MET A CA   1  
ATOM 1431   C C    . MET A 1 94  ? -32.224 -12.213 -0.716  1.00 10.42 ? 94  MET A C    1  
ATOM 1432   O O    . MET A 1 94  ? -31.226 -11.535 -0.470  1.00 14.10 ? 94  MET A O    1  
ATOM 1433   C CB   . MET A 1 94  ? -33.878 -10.949 -2.208  1.00 33.25 ? 94  MET A CB   1  
ATOM 1434   C CG   . MET A 1 94  ? -35.059 -10.922 -1.227  1.00 34.13 ? 94  MET A CG   1  
ATOM 1435   S SD   . MET A 1 94  ? -34.595 -10.466 0.458   1.00 2.20  ? 94  MET A SD   1  
ATOM 1436   C CE   . MET A 1 94  ? -36.212 -10.306 1.213   1.00 45.11 ? 94  MET A CE   1  
ATOM 1437   H H    . MET A 1 94  ? -34.522 -13.512 -2.332  1.00 53.34 ? 94  MET A H    1  
ATOM 1438   H HA   . MET A 1 94  ? -32.092 -11.999 -2.838  1.00 4.24  ? 94  MET A HA   1  
ATOM 1439   H HB2  . MET A 1 94  ? -33.323 -10.029 -2.071  1.00 42.15 ? 94  MET A HB2  1  
ATOM 1440   H HB3  . MET A 1 94  ? -34.284 -10.942 -3.215  1.00 63.30 ? 94  MET A HB3  1  
ATOM 1441   H HG2  . MET A 1 94  ? -35.792 -10.204 -1.581  1.00 15.10 ? 94  MET A HG2  1  
ATOM 1442   H HG3  . MET A 1 94  ? -35.514 -11.905 -1.204  1.00 55.12 ? 94  MET A HG3  1  
ATOM 1443   H HE1  . MET A 1 94  ? -36.701 -11.269 1.226   1.00 4.54  ? 94  MET A HE1  1  
ATOM 1444   H HE2  . MET A 1 94  ? -36.811 -9.608  0.636   1.00 41.30 ? 94  MET A HE2  1  
ATOM 1445   H HE3  . MET A 1 94  ? -36.105 -9.940  2.223   1.00 61.13 ? 94  MET A HE3  1  
ATOM 1446   N N    . ALA A 1 95  ? -32.784 -13.059 0.170   1.00 1.31  ? 95  ALA A N    1  
ATOM 1447   C CA   . ALA A 1 95  ? -32.251 -13.279 1.528   1.00 63.22 ? 95  ALA A CA   1  
ATOM 1448   C C    . ALA A 1 95  ? -30.900 -14.011 1.497   1.00 62.25 ? 95  ALA A C    1  
ATOM 1449   O O    . ALA A 1 95  ? -30.060 -13.809 2.371   1.00 54.35 ? 95  ALA A O    1  
ATOM 1450   C CB   . ALA A 1 95  ? -33.262 -14.053 2.380   1.00 54.14 ? 95  ALA A CB   1  
ATOM 1451   H H    . ALA A 1 95  ? -33.593 -13.539 -0.096  1.00 43.44 ? 95  ALA A H    1  
ATOM 1452   H HA   . ALA A 1 95  ? -32.107 -12.307 1.990   1.00 43.01 ? 95  ALA A HA   1  
ATOM 1453   H HB1  . ALA A 1 95  ? -32.904 -14.134 3.400   1.00 61.41 ? 95  ALA A HB1  1  
ATOM 1454   H HB2  . ALA A 1 95  ? -33.403 -15.045 1.973   1.00 3.11  ? 95  ALA A HB2  1  
ATOM 1455   H HB3  . ALA A 1 95  ? -34.212 -13.532 2.378   1.00 24.41 ? 95  ALA A HB3  1  
ATOM 1456   N N    . HIS A 1 96  ? -30.721 -14.884 0.494   1.00 1.21  ? 96  HIS A N    1  
ATOM 1457   C CA   . HIS A 1 96  ? -29.460 -15.614 0.275   1.00 14.05 ? 96  HIS A CA   1  
ATOM 1458   C C    . HIS A 1 96  ? -28.504 -14.776 -0.598  1.00 10.43 ? 96  HIS A C    1  
ATOM 1459   O O    . HIS A 1 96  ? -27.285 -14.848 -0.428  1.00 61.43 ? 96  HIS A O    1  
ATOM 1460   C CB   . HIS A 1 96  ? -29.735 -16.985 -0.391  1.00 21.33 ? 96  HIS A CB   1  
ATOM 1461   C CG   . HIS A 1 96  ? -28.489 -17.813 -0.618  1.00 20.40 ? 96  HIS A CG   1  
ATOM 1462   N ND1  . HIS A 1 96  ? -27.749 -17.759 -1.783  1.00 60.24 ? 96  HIS A ND1  1  
ATOM 1463   C CD2  . HIS A 1 96  ? -27.815 -18.653 0.204   1.00 30.15 ? 96  HIS A CD2  1  
ATOM 1464   C CE1  . HIS A 1 96  ? -26.683 -18.518 -1.663  1.00 3.32  ? 96  HIS A CE1  1  
ATOM 1465   N NE2  . HIS A 1 96  ? -26.700 -19.069 -0.471  1.00 4.42  ? 96  HIS A NE2  1  
ATOM 1466   H H    . HIS A 1 96  ? -31.464 -15.043 -0.121  1.00 41.42 ? 96  HIS A H    1  
ATOM 1467   H HA   . HIS A 1 96  ? -28.989 -15.783 1.247   1.00 42.44 ? 96  HIS A HA   1  
ATOM 1468   H HB2  . HIS A 1 96  ? -30.403 -17.557 0.241   1.00 13.13 ? 96  HIS A HB2  1  
ATOM 1469   H HB3  . HIS A 1 96  ? -30.214 -16.828 -1.352  1.00 23.14 ? 96  HIS A HB3  1  
ATOM 1470   H HD1  . HIS A 1 96  ? -27.989 -17.258 -2.593  1.00 11.41 ? 96  HIS A HD1  1  
ATOM 1471   H HD2  . HIS A 1 96  ? -28.094 -18.931 1.209   1.00 74.33 ? 96  HIS A HD2  1  
ATOM 1472   H HE1  . HIS A 1 96  ? -25.913 -18.650 -2.412  1.00 12.14 ? 96  HIS A HE1  1  
ATOM 1473   H HE2  . HIS A 1 96  ? -26.096 -19.781 -0.181  1.00 37.99 ? 96  HIS A HE2  1  
ATOM 1474   N N    . CYS A 1 97  ? -29.074 -14.001 -1.543  1.00 62.15 ? 97  CYS A N    1  
ATOM 1475   C CA   . CYS A 1 97  ? -28.292 -13.122 -2.444  1.00 55.00 ? 97  CYS A CA   1  
ATOM 1476   C C    . CYS A 1 97  ? -27.534 -12.067 -1.633  1.00 70.44 ? 97  CYS A C    1  
ATOM 1477   O O    . CYS A 1 97  ? -26.343 -11.833 -1.847  1.00 22.12 ? 97  CYS A O    1  
ATOM 1478   C CB   . CYS A 1 97  ? -29.211 -12.436 -3.481  1.00 1.03  ? 97  CYS A CB   1  
ATOM 1479   S SG   . CYS A 1 97  ? -28.362 -11.346 -4.655  1.00 61.43 ? 97  CYS A SG   1  
ATOM 1480   H H    . CYS A 1 97  ? -30.050 -14.017 -1.637  1.00 3.01  ? 97  CYS A H    1  
ATOM 1481   H HA   . CYS A 1 97  ? -27.577 -13.745 -2.970  1.00 33.32 ? 97  CYS A HA   1  
ATOM 1482   H HB2  . CYS A 1 97  ? -29.716 -13.195 -4.060  1.00 54.21 ? 97  CYS A HB2  1  
ATOM 1483   H HB3  . CYS A 1 97  ? -29.956 -11.841 -2.962  1.00 71.40 ? 97  CYS A HB3  1  
ATOM 1484   H HG   . CYS A 1 97  ? -27.281 -10.851 -4.066  1.00 63.41 ? 97  CYS A HG   1  
ATOM 1485   N N    . LEU A 1 98  ? -28.245 -11.451 -0.684  1.00 52.34 ? 98  LEU A N    1  
ATOM 1486   C CA   . LEU A 1 98  ? -27.685 -10.432 0.210   1.00 1.11  ? 98  LEU A CA   1  
ATOM 1487   C C    . LEU A 1 98  ? -27.086 -11.071 1.475   1.00 21.40 ? 98  LEU A C    1  
ATOM 1488   O O    . LEU A 1 98  ? -26.144 -10.538 2.020   1.00 2.45  ? 98  LEU A O    1  
ATOM 1489   C CB   . LEU A 1 98  ? -28.774 -9.394  0.594   1.00 22.34 ? 98  LEU A CB   1  
ATOM 1490   C CG   . LEU A 1 98  ? -29.418 -8.596  -0.582  1.00 21.55 ? 98  LEU A CG   1  
ATOM 1491   C CD1  . LEU A 1 98  ? -30.433 -7.559  -0.048  1.00 23.31 ? 98  LEU A CD1  1  
ATOM 1492   C CD2  . LEU A 1 98  ? -28.336 -7.930  -1.463  1.00 53.42 ? 98  LEU A CD2  1  
ATOM 1493   H H    . LEU A 1 98  ? -29.189 -11.687 -0.582  1.00 41.20 ? 98  LEU A H    1  
ATOM 1494   H HA   . LEU A 1 98  ? -26.885 -9.912  -0.323  1.00 44.22 ? 98  LEU A HA   1  
ATOM 1495   H HB2  . LEU A 1 98  ? -29.568 -9.916  1.125   1.00 71.24 ? 98  LEU A HB2  1  
ATOM 1496   H HB3  . LEU A 1 98  ? -28.331 -8.670  1.280   1.00 45.32 ? 98  LEU A HB3  1  
ATOM 1497   H HG   . LEU A 1 98  ? -29.968 -9.288  -1.213  1.00 52.14 ? 98  LEU A HG   1  
ATOM 1498   H HD11 . LEU A 1 98  ? -30.884 -7.026  -0.874  1.00 32.10 ? 98  LEU A HD11 1  
ATOM 1499   H HD12 . LEU A 1 98  ? -29.932 -6.849  0.602   1.00 42.24 ? 98  LEU A HD12 1  
ATOM 1500   H HD13 . LEU A 1 98  ? -31.209 -8.065  0.512   1.00 43.00 ? 98  LEU A HD13 1  
ATOM 1501   H HD21 . LEU A 1 98  ? -28.803 -7.329  -2.232  1.00 22.33 ? 98  LEU A HD21 1  
ATOM 1502   H HD22 . LEU A 1 98  ? -27.731 -8.693  -1.933  1.00 4.03  ? 98  LEU A HD22 1  
ATOM 1503   H HD23 . LEU A 1 98  ? -27.697 -7.299  -0.848  1.00 11.41 ? 98  LEU A HD23 1  
ATOM 1504   N N    . GLY A 1 99  ? -27.633 -12.214 1.926   1.00 64.02 ? 99  GLY A N    1  
ATOM 1505   C CA   . GLY A 1 99  ? -27.204 -12.844 3.196   1.00 14.13 ? 99  GLY A CA   1  
ATOM 1506   C C    . GLY A 1 99  ? -26.020 -13.806 3.069   1.00 25.35 ? 99  GLY A C    1  
ATOM 1507   O O    . GLY A 1 99  ? -25.556 -14.341 4.084   1.00 62.33 ? 99  GLY A O    1  
ATOM 1508   H H    . GLY A 1 99  ? -28.344 -12.632 1.403   1.00 71.13 ? 99  GLY A H    1  
ATOM 1509   H HA2  . GLY A 1 99  ? -26.942 -12.071 3.909   1.00 0.44  ? 99  GLY A HA2  1  
ATOM 1510   H HA3  . GLY A 1 99  ? -28.047 -13.396 3.596   1.00 70.43 ? 99  GLY A HA3  1  
ATOM 1511   N N    . ALA A 1 100 ? -25.526 -14.044 1.831   1.00 2.34  ? 100 ALA A N    1  
ATOM 1512   C CA   . ALA A 1 100 ? -24.447 -15.035 1.582   1.00 71.34 ? 100 ALA A CA   1  
ATOM 1513   C C    . ALA A 1 100 ? -23.555 -14.637 0.394   1.00 40.52 ? 100 ALA A C    1  
ATOM 1514   O O    . ALA A 1 100 ? -22.347 -14.422 0.553   1.00 40.13 ? 100 ALA A O    1  
ATOM 1515   C CB   . ALA A 1 100 ? -25.055 -16.435 1.354   1.00 51.40 ? 100 ALA A CB   1  
ATOM 1516   H H    . ALA A 1 100 ? -25.890 -13.539 1.074   1.00 31.34 ? 100 ALA A H    1  
ATOM 1517   H HA   . ALA A 1 100 ? -23.819 -15.089 2.473   1.00 22.51 ? 100 ALA A HA   1  
ATOM 1518   H HB1  . ALA A 1 100 ? -25.792 -16.633 2.112   1.00 20.53 ? 100 ALA A HB1  1  
ATOM 1519   H HB2  . ALA A 1 100 ? -24.282 -17.188 1.410   1.00 11.23 ? 100 ALA A HB2  1  
ATOM 1520   H HB3  . ALA A 1 100 ? -25.529 -16.483 0.379   1.00 15.41 ? 100 ALA A HB3  1  
ATOM 1521   N N    . TYR A 1 101 ? -24.182 -14.520 -0.788  1.00 23.13 ? 101 TYR A N    1  
ATOM 1522   C CA   . TYR A 1 101 ? -23.470 -14.399 -2.084  1.00 74.13 ? 101 TYR A CA   1  
ATOM 1523   C C    . TYR A 1 101 ? -22.715 -13.041 -2.244  1.00 54.34 ? 101 TYR A C    1  
ATOM 1524   O O    . TYR A 1 101 ? -21.479 -12.996 -2.219  1.00 43.42 ? 101 TYR A O    1  
ATOM 1525   C CB   . TYR A 1 101 ? -24.479 -14.628 -3.246  1.00 60.44 ? 101 TYR A CB   1  
ATOM 1526   C CG   . TYR A 1 101 ? -23.835 -14.637 -4.640  1.00 51.41 ? 101 TYR A CG   1  
ATOM 1527   C CD1  . TYR A 1 101 ? -23.256 -15.799 -5.164  1.00 34.44 ? 101 TYR A CD1  1  
ATOM 1528   C CD2  . TYR A 1 101 ? -23.785 -13.482 -5.423  1.00 10.12 ? 101 TYR A CD2  1  
ATOM 1529   C CE1  . TYR A 1 101 ? -22.656 -15.802 -6.412  1.00 43.14 ? 101 TYR A CE1  1  
ATOM 1530   C CE2  . TYR A 1 101 ? -23.197 -13.485 -6.653  1.00 23.04 ? 101 TYR A CE2  1  
ATOM 1531   C CZ   . TYR A 1 101 ? -22.631 -14.638 -7.153  1.00 54.34 ? 101 TYR A CZ   1  
ATOM 1532   O OH   . TYR A 1 101 ? -22.026 -14.617 -8.391  1.00 72.32 ? 101 TYR A OH   1  
ATOM 1533   H H    . TYR A 1 101 ? -25.164 -14.530 -0.791  1.00 3.11  ? 101 TYR A H    1  
ATOM 1534   H HA   . TYR A 1 101 ? -22.736 -15.199 -2.116  1.00 35.41 ? 101 TYR A HA   1  
ATOM 1535   H HB2  . TYR A 1 101 ? -24.976 -15.582 -3.100  1.00 13.41 ? 101 TYR A HB2  1  
ATOM 1536   H HB3  . TYR A 1 101 ? -25.231 -13.847 -3.226  1.00 1.11  ? 101 TYR A HB3  1  
ATOM 1537   H HD1  . TYR A 1 101 ? -23.284 -16.710 -4.581  1.00 51.13 ? 101 TYR A HD1  1  
ATOM 1538   H HD2  . TYR A 1 101 ? -24.219 -12.567 -5.050  1.00 24.33 ? 101 TYR A HD2  1  
ATOM 1539   H HE1  . TYR A 1 101 ? -22.214 -16.714 -6.802  1.00 33.32 ? 101 TYR A HE1  1  
ATOM 1540   H HE2  . TYR A 1 101 ? -23.184 -12.571 -7.228  1.00 62.13 ? 101 TYR A HE2  1  
ATOM 1541   H HH   . TYR A 1 101 ? -22.391 -15.321 -8.937  1.00 51.40 ? 101 TYR A HH   1  
ATOM 1542   N N    . CYS A 1 102 ? -23.481 -11.949 -2.411  1.00 64.33 ? 102 CYS A N    1  
ATOM 1543   C CA   . CYS A 1 102 ? -22.950 -10.591 -2.689  1.00 42.24 ? 102 CYS A CA   1  
ATOM 1544   C C    . CYS A 1 102 ? -22.067 -9.981  -1.546  1.00 43.30 ? 102 CYS A C    1  
ATOM 1545   O O    . CYS A 1 102 ? -21.145 -9.221  -1.860  1.00 5.14  ? 102 CYS A O    1  
ATOM 1546   C CB   . CYS A 1 102 ? -24.112 -9.654  -3.079  1.00 15.10 ? 102 CYS A CB   1  
ATOM 1547   S SG   . CYS A 1 102 ? -24.995 -10.198 -4.564  1.00 14.33 ? 102 CYS A SG   1  
ATOM 1548   H H    . CYS A 1 102 ? -24.449 -12.058 -2.360  1.00 53.10 ? 102 CYS A H    1  
ATOM 1549   H HA   . CYS A 1 102 ? -22.314 -10.694 -3.565  1.00 54.43 ? 102 CYS A HA   1  
ATOM 1550   H HB2  . CYS A 1 102 ? -24.830 -9.612  -2.266  1.00 3.34  ? 102 CYS A HB2  1  
ATOM 1551   H HB3  . CYS A 1 102 ? -23.734 -8.658  -3.271  1.00 44.13 ? 102 CYS A HB3  1  
ATOM 1552   H HG   . CYS A 1 102 ? -24.092 -10.505 -5.496  1.00 53.10 ? 102 CYS A HG   1  
ATOM 1553   N N    . PRO A 1 103 ? -22.316 -10.257 -0.214  1.00 41.33 ? 103 PRO A N    1  
ATOM 1554   C CA   . PRO A 1 103 ? -21.348 -9.887  0.859   1.00 50.25 ? 103 PRO A CA   1  
ATOM 1555   C C    . PRO A 1 103 ? -19.983 -10.607 0.717   1.00 41.55 ? 103 PRO A C    1  
ATOM 1556   O O    . PRO A 1 103 ? -18.938 -10.026 1.037   1.00 12.22 ? 103 PRO A O    1  
ATOM 1557   C CB   . PRO A 1 103 ? -22.075 -10.295 2.172   1.00 23.21 ? 103 PRO A CB   1  
ATOM 1558   C CG   . PRO A 1 103 ? -23.089 -11.299 1.743   1.00 4.34  ? 103 PRO A CG   1  
ATOM 1559   C CD   . PRO A 1 103 ? -23.547 -10.845 0.378   1.00 25.20 ? 103 PRO A CD   1  
ATOM 1560   H HA   . PRO A 1 103 ? -21.174 -8.814  0.864   1.00 44.31 ? 103 PRO A HA   1  
ATOM 1561   H HB2  . PRO A 1 103 ? -21.376 -10.715 2.893   1.00 75.41 ? 103 PRO A HB2  1  
ATOM 1562   H HB3  . PRO A 1 103 ? -22.568 -9.432  2.610   1.00 3.43  ? 103 PRO A HB3  1  
ATOM 1563   H HG2  . PRO A 1 103 ? -22.634 -12.288 1.681   1.00 60.21 ? 103 PRO A HG2  1  
ATOM 1564   H HG3  . PRO A 1 103 ? -23.927 -11.319 2.431   1.00 53.21 ? 103 PRO A HG3  1  
ATOM 1565   H HD2  . PRO A 1 103 ? -23.897 -11.689 -0.207  1.00 55.41 ? 103 PRO A HD2  1  
ATOM 1566   H HD3  . PRO A 1 103 ? -24.328 -10.096 0.458   1.00 15.11 ? 103 PRO A HD3  1  
ATOM 1567   N N    . ASN A 1 104 ? -20.012 -11.859 0.211   1.00 13.41 ? 104 ASN A N    1  
ATOM 1568   C CA   . ASN A 1 104 ? -18.795 -12.678 0.003   1.00 72.34 ? 104 ASN A CA   1  
ATOM 1569   C C    . ASN A 1 104 ? -17.991 -12.181 -1.227  1.00 23.23 ? 104 ASN A C    1  
ATOM 1570   O O    . ASN A 1 104 ? -16.830 -12.553 -1.401  1.00 61.40 ? 104 ASN A O    1  
ATOM 1571   C CB   . ASN A 1 104 ? -19.176 -14.178 -0.154  1.00 31.15 ? 104 ASN A CB   1  
ATOM 1572   C CG   . ASN A 1 104 ? -17.982 -15.145 -0.081  1.00 73.43 ? 104 ASN A CG   1  
ATOM 1573   O OD1  . ASN A 1 104 ? -16.989 -14.883 0.606   1.00 13.51 ? 104 ASN A OD1  1  
ATOM 1574   N ND2  . ASN A 1 104 ? -18.079 -16.276 -0.766  1.00 73.41 ? 104 ASN A ND2  1  
ATOM 1575   H H    . ASN A 1 104 ? -20.881 -12.246 -0.029  1.00 14.30 ? 104 ASN A H    1  
ATOM 1576   H HA   . ASN A 1 104 ? -18.169 -12.568 0.887   1.00 31.31 ? 104 ASN A HA   1  
ATOM 1577   H HB2  . ASN A 1 104 ? -19.869 -14.451 0.632   1.00 72.52 ? 104 ASN A HB2  1  
ATOM 1578   H HB3  . ASN A 1 104 ? -19.674 -14.314 -1.112  1.00 33.01 ? 104 ASN A HB3  1  
ATOM 1579   H HD21 . ASN A 1 104 ? -18.901 -16.440 -1.273  1.00 63.40 ? 104 ASN A HD21 1  
ATOM 1580   H HD22 . ASN A 1 104 ? -17.320 -16.891 -0.749  1.00 43.02 ? 104 ASN A HD22 1  
ATOM 1581   N N    . ILE A 1 105 ? -18.629 -11.360 -2.090  1.00 22.53 ? 105 ILE A N    1  
ATOM 1582   C CA   . ILE A 1 105 ? -17.933 -10.644 -3.185  1.00 3.12  ? 105 ILE A CA   1  
ATOM 1583   C C    . ILE A 1 105 ? -16.986 -9.579  -2.586  1.00 32.42 ? 105 ILE A C    1  
ATOM 1584   O O    . ILE A 1 105 ? -15.843 -9.403  -3.035  1.00 54.14 ? 105 ILE A O    1  
ATOM 1585   C CB   . ILE A 1 105 ? -18.959 -9.947  -4.170  1.00 44.45 ? 105 ILE A CB   1  
ATOM 1586   C CG1  . ILE A 1 105 ? -19.867 -10.996 -4.903  1.00 24.12 ? 105 ILE A CG1  1  
ATOM 1587   C CG2  . ILE A 1 105 ? -18.254 -9.002  -5.186  1.00 24.44 ? 105 ILE A CG2  1  
ATOM 1588   C CD1  . ILE A 1 105 ? -19.155 -11.946 -5.865  1.00 4.24  ? 105 ILE A CD1  1  
ATOM 1589   H H    . ILE A 1 105 ? -19.596 -11.237 -1.986  1.00 54.31 ? 105 ILE A H    1  
ATOM 1590   H HA   . ILE A 1 105 ? -17.346 -11.368 -3.747  1.00 11.50 ? 105 ILE A HA   1  
ATOM 1591   H HB   . ILE A 1 105 ? -19.606 -9.320  -3.558  1.00 5.21  ? 105 ILE A HB   1  
ATOM 1592   H HG12 . ILE A 1 105 ? -20.366 -11.607 -4.162  1.00 31.42 ? 105 ILE A HG12 1  
ATOM 1593   H HG13 . ILE A 1 105 ? -20.622 -10.465 -5.471  1.00 1.31  ? 105 ILE A HG13 1  
ATOM 1594   H HG21 . ILE A 1 105 ? -17.390 -9.492  -5.610  1.00 1.43  ? 105 ILE A HG21 1  
ATOM 1595   H HG22 . ILE A 1 105 ? -17.939 -8.095  -4.697  1.00 0.32  ? 105 ILE A HG22 1  
ATOM 1596   H HG23 . ILE A 1 105 ? -18.941 -8.744  -5.978  1.00 52.51 ? 105 ILE A HG23 1  
ATOM 1597   H HD11 . ILE A 1 105 ? -19.882 -12.611 -6.311  1.00 54.43 ? 105 ILE A HD11 1  
ATOM 1598   H HD12 . ILE A 1 105 ? -18.422 -12.533 -5.328  1.00 33.53 ? 105 ILE A HD12 1  
ATOM 1599   H HD13 . ILE A 1 105 ? -18.664 -11.382 -6.645  1.00 50.52 ? 105 ILE A HD13 1  
ATOM 1600   N N    . LEU A 1 106 ? -17.482 -8.897  -1.545  1.00 2.23  ? 106 LEU A N    1  
ATOM 1601   C CA   . LEU A 1 106 ? -16.798 -7.761  -0.915  1.00 21.32 ? 106 LEU A CA   1  
ATOM 1602   C C    . LEU A 1 106 ? -15.871 -8.199  0.230   1.00 64.35 ? 106 LEU A C    1  
ATOM 1603   O O    . LEU A 1 106 ? -15.009 -7.424  0.645   1.00 65.14 ? 106 LEU A O    1  
ATOM 1604   C CB   . LEU A 1 106 ? -17.854 -6.766  -0.384  1.00 12.25 ? 106 LEU A CB   1  
ATOM 1605   C CG   . LEU A 1 106 ? -18.746 -6.098  -1.469  1.00 50.45 ? 106 LEU A CG   1  
ATOM 1606   C CD1  . LEU A 1 106 ? -19.848 -5.231  -0.830  1.00 0.45  ? 106 LEU A CD1  1  
ATOM 1607   C CD2  . LEU A 1 106 ? -17.886 -5.285  -2.467  1.00 73.50 ? 106 LEU A CD2  1  
ATOM 1608   H H    . LEU A 1 106 ? -18.349 -9.174  -1.180  1.00 42.50 ? 106 LEU A H    1  
ATOM 1609   H HA   . LEU A 1 106 ? -16.197 -7.264  -1.677  1.00 43.54 ? 106 LEU A HA   1  
ATOM 1610   H HB2  . LEU A 1 106 ? -18.497 -7.299  0.313   1.00 52.35 ? 106 LEU A HB2  1  
ATOM 1611   H HB3  . LEU A 1 106 ? -17.344 -5.980  0.164   1.00 52.02 ? 106 LEU A HB3  1  
ATOM 1612   H HG   . LEU A 1 106 ? -19.245 -6.879  -2.036  1.00 25.52 ? 106 LEU A HG   1  
ATOM 1613   H HD11 . LEU A 1 106 ? -20.472 -5.846  -0.196  1.00 2.54  ? 106 LEU A HD11 1  
ATOM 1614   H HD12 . LEU A 1 106 ? -20.466 -4.791  -1.604  1.00 1.25  ? 106 LEU A HD12 1  
ATOM 1615   H HD13 . LEU A 1 106 ? -19.405 -4.439  -0.236  1.00 33.25 ? 106 LEU A HD13 1  
ATOM 1616   H HD21 . LEU A 1 106 ? -18.525 -4.826  -3.212  1.00 64.11 ? 106 LEU A HD21 1  
ATOM 1617   H HD22 . LEU A 1 106 ? -17.187 -5.942  -2.964  1.00 61.21 ? 106 LEU A HD22 1  
ATOM 1618   H HD23 . LEU A 1 106 ? -17.339 -4.512  -1.940  1.00 60.11 ? 106 LEU A HD23 1  
ATOM 1619   N N    . PHE A 1 107 ? -16.075 -9.427  0.742   1.00 64.43 ? 107 PHE A N    1  
ATOM 1620   C CA   . PHE A 1 107 ? -15.287 -9.978  1.869   1.00 72.43 ? 107 PHE A CA   1  
ATOM 1621   C C    . PHE A 1 107 ? -13.754 -10.055 1.568   1.00 42.21 ? 107 PHE A C    1  
ATOM 1622   O O    . PHE A 1 107 ? -12.972 -9.684  2.438   1.00 13.10 ? 107 PHE A O    1  
ATOM 1623   C CB   . PHE A 1 107 ? -15.849 -11.359 2.328   1.00 1.44  ? 107 PHE A CB   1  
ATOM 1624   C CG   . PHE A 1 107 ? -15.168 -11.934 3.579   1.00 71.54 ? 107 PHE A CG   1  
ATOM 1625   C CD1  . PHE A 1 107 ? -15.312 -11.305 4.820   1.00 72.11 ? 107 PHE A CD1  1  
ATOM 1626   C CD2  . PHE A 1 107 ? -14.363 -13.073 3.510   1.00 20.24 ? 107 PHE A CD2  1  
ATOM 1627   C CE1  . PHE A 1 107 ? -14.703 -11.818 5.952   1.00 10.15 ? 107 PHE A CE1  1  
ATOM 1628   C CE2  . PHE A 1 107 ? -13.757 -13.586 4.643   1.00 13.43 ? 107 PHE A CE2  1  
ATOM 1629   C CZ   . PHE A 1 107 ? -13.909 -12.948 5.860   1.00 1.11  ? 107 PHE A CZ   1  
ATOM 1630   H H    . PHE A 1 107 ? -16.794 -9.977  0.360   1.00 24.21 ? 107 PHE A H    1  
ATOM 1631   H HA   . PHE A 1 107 ? -15.418 -9.281  2.691   1.00 21.51 ? 107 PHE A HA   1  
ATOM 1632   H HB2  . PHE A 1 107 ? -16.904 -11.254 2.549   1.00 73.22 ? 107 PHE A HB2  1  
ATOM 1633   H HB3  . PHE A 1 107 ? -15.738 -12.075 1.517   1.00 32.42 ? 107 PHE A HB3  1  
ATOM 1634   H HD1  . PHE A 1 107 ? -15.931 -10.418 4.900   1.00 61.00 ? 107 PHE A HD1  1  
ATOM 1635   H HD2  . PHE A 1 107 ? -14.235 -13.576 2.558   1.00 11.33 ? 107 PHE A HD2  1  
ATOM 1636   H HE1  . PHE A 1 107 ? -14.827 -11.320 6.905   1.00 13.42 ? 107 PHE A HE1  1  
ATOM 1637   H HE2  . PHE A 1 107 ? -13.138 -14.472 4.569   1.00 12.53 ? 107 PHE A HE2  1  
ATOM 1638   H HZ   . PHE A 1 107 ? -13.428 -13.346 6.742   1.00 53.12 ? 107 PHE A HZ   1  
ATOM 1639   N N    . PRO A 1 108 ? -13.281 -10.548 0.364   1.00 11.31 ? 108 PRO A N    1  
ATOM 1640   C CA   . PRO A 1 108 ? -11.831 -10.526 0.010   1.00 73.32 ? 108 PRO A CA   1  
ATOM 1641   C C    . PRO A 1 108 ? -11.240 -9.092  -0.095  1.00 24.21 ? 108 PRO A C    1  
ATOM 1642   O O    . PRO A 1 108 ? -10.053 -8.885  0.186   1.00 71.21 ? 108 PRO A O    1  
ATOM 1643   C CB   . PRO A 1 108 ? -11.773 -11.259 -1.361  1.00 63.44 ? 108 PRO A CB   1  
ATOM 1644   C CG   . PRO A 1 108 ? -13.042 -12.052 -1.428  1.00 61.13 ? 108 PRO A CG   1  
ATOM 1645   C CD   . PRO A 1 108 ? -14.068 -11.219 -0.706  1.00 10.34 ? 108 PRO A CD   1  
ATOM 1646   H HA   . PRO A 1 108 ? -11.252 -11.088 0.743   1.00 73.42 ? 108 PRO A HA   1  
ATOM 1647   H HB2  . PRO A 1 108 ? -11.718 -10.539 -2.182  1.00 51.33 ? 108 PRO A HB2  1  
ATOM 1648   H HB3  . PRO A 1 108 ? -10.914 -11.921 -1.403  1.00 1.30  ? 108 PRO A HB3  1  
ATOM 1649   H HG2  . PRO A 1 108 ? -13.335 -12.207 -2.462  1.00 64.11 ? 108 PRO A HG2  1  
ATOM 1650   H HG3  . PRO A 1 108 ? -12.921 -13.007 -0.925  1.00 64.43 ? 108 PRO A HG3  1  
ATOM 1651   H HD2  . PRO A 1 108 ? -14.515 -10.483 -1.373  1.00 15.24 ? 108 PRO A HD2  1  
ATOM 1652   H HD3  . PRO A 1 108 ? -14.840 -11.848 -0.278  1.00 21.44 ? 108 PRO A HD3  1  
ATOM 1653   N N    . TYR A 1 109 ? -12.082 -8.123  -0.507  1.00 23.00 ? 109 TYR A N    1  
ATOM 1654   C CA   . TYR A 1 109 ? -11.685 -6.697  -0.639  1.00 23.14 ? 109 TYR A CA   1  
ATOM 1655   C C    . TYR A 1 109 ? -11.608 -5.990  0.734   1.00 12.15 ? 109 TYR A C    1  
ATOM 1656   O O    . TYR A 1 109 ? -10.753 -5.121  0.936   1.00 34.43 ? 109 TYR A O    1  
ATOM 1657   C CB   . TYR A 1 109 ? -12.659 -5.947  -1.582  1.00 63.02 ? 109 TYR A CB   1  
ATOM 1658   C CG   . TYR A 1 109 ? -12.513 -6.311  -3.068  1.00 22.15 ? 109 TYR A CG   1  
ATOM 1659   C CD1  . TYR A 1 109 ? -13.351 -7.250  -3.678  1.00 42.21 ? 109 TYR A CD1  1  
ATOM 1660   C CD2  . TYR A 1 109 ? -11.530 -5.705  -3.860  1.00 72.23 ? 109 TYR A CD2  1  
ATOM 1661   C CE1  . TYR A 1 109 ? -13.213 -7.569  -5.017  1.00 10.01 ? 109 TYR A CE1  1  
ATOM 1662   C CE2  . TYR A 1 109 ? -11.389 -6.023  -5.198  1.00 44.31 ? 109 TYR A CE2  1  
ATOM 1663   C CZ   . TYR A 1 109 ? -12.233 -6.952  -5.774  1.00 62.11 ? 109 TYR A CZ   1  
ATOM 1664   O OH   . TYR A 1 109 ? -12.100 -7.261  -7.110  1.00 63.20 ? 109 TYR A OH   1  
ATOM 1665   H H    . TYR A 1 109 ? -13.001 -8.374  -0.738  1.00 11.42 ? 109 TYR A H    1  
ATOM 1666   H HA   . TYR A 1 109 ? -10.688 -6.676  -1.084  1.00 72.05 ? 109 TYR A HA   1  
ATOM 1667   H HB2  . TYR A 1 109 ? -13.681 -6.162  -1.279  1.00 70.22 ? 109 TYR A HB2  1  
ATOM 1668   H HB3  . TYR A 1 109 ? -12.499 -4.876  -1.489  1.00 55.34 ? 109 TYR A HB3  1  
ATOM 1669   H HD1  . TYR A 1 109 ? -14.119 -7.733  -3.086  1.00 22.10 ? 109 TYR A HD1  1  
ATOM 1670   H HD2  . TYR A 1 109 ? -10.865 -4.977  -3.413  1.00 72.53 ? 109 TYR A HD2  1  
ATOM 1671   H HE1  . TYR A 1 109 ? -13.872 -8.299  -5.468  1.00 53.52 ? 109 TYR A HE1  1  
ATOM 1672   H HE2  . TYR A 1 109 ? -10.620 -5.539  -5.789  1.00 63.53 ? 109 TYR A HE2  1  
ATOM 1673   H HH   . TYR A 1 109 ? -12.965 -7.262  -7.527  1.00 55.34 ? 109 TYR A HH   1  
ATOM 1674   N N    . ALA A 1 110 ? -12.527 -6.347  1.661   1.00 63.15 ? 110 ALA A N    1  
ATOM 1675   C CA   . ALA A 1 110 ? -12.495 -5.851  3.059   1.00 11.31 ? 110 ALA A CA   1  
ATOM 1676   C C    . ALA A 1 110 ? -11.284 -6.452  3.777   1.00 31.14 ? 110 ALA A C    1  
ATOM 1677   O O    . ALA A 1 110 ? -10.587 -5.756  4.511   1.00 40.31 ? 110 ALA A O    1  
ATOM 1678   C CB   . ALA A 1 110 ? -13.778 -6.218  3.825   1.00 52.22 ? 110 ALA A CB   1  
ATOM 1679   H H    . ALA A 1 110 ? -13.230 -6.972  1.401   1.00 75.42 ? 110 ALA A H    1  
ATOM 1680   H HA   . ALA A 1 110 ? -12.403 -4.767  3.038   1.00 63.51 ? 110 ALA A HA   1  
ATOM 1681   H HB1  . ALA A 1 110 ? -13.640 -6.014  4.879   1.00 13.41 ? 110 ALA A HB1  1  
ATOM 1682   H HB2  . ALA A 1 110 ? -14.002 -7.266  3.694   1.00 31.15 ? 110 ALA A HB2  1  
ATOM 1683   H HB3  . ALA A 1 110 ? -14.614 -5.633  3.486   1.00 61.04 ? 110 ALA A HB3  1  
ATOM 1684   N N    . ARG A 1 111 ? -11.073 -7.765  3.532   1.00 72.15 ? 111 ARG A N    1  
ATOM 1685   C CA   . ARG A 1 111 ? -9.923  -8.541  4.042   1.00 4.02  ? 111 ARG A CA   1  
ATOM 1686   C C    . ARG A 1 111 ? -8.613  -7.829  3.686   1.00 41.01 ? 111 ARG A C    1  
ATOM 1687   O O    . ARG A 1 111 ? -7.803  -7.557  4.565   1.00 43.33 ? 111 ARG A O    1  
ATOM 1688   C CB   . ARG A 1 111 ? -9.930  -9.980  3.435   1.00 33.44 ? 111 ARG A CB   1  
ATOM 1689   C CG   . ARG A 1 111 ? -8.651  -10.825 3.683   1.00 60.53 ? 111 ARG A CG   1  
ATOM 1690   C CD   . ARG A 1 111 ? -8.613  -12.117 2.833   1.00 53.55 ? 111 ARG A CD   1  
ATOM 1691   N NE   . ARG A 1 111 ? -9.666  -13.069 3.228   1.00 11.11 ? 111 ARG A NE   1  
ATOM 1692   C CZ   . ARG A 1 111 ? -10.329 -13.902 2.405   1.00 2.42  ? 111 ARG A CZ   1  
ATOM 1693   N NH1  . ARG A 1 111 ? -10.082 -13.921 1.097   1.00 15.31 ? 111 ARG A NH1  1  
ATOM 1694   N NH2  . ARG A 1 111 ? -11.210 -14.749 2.916   1.00 41.34 ? 111 ARG A NH2  1  
ATOM 1695   H H    . ARG A 1 111 ? -11.722 -8.228  2.971   1.00 4.13  ? 111 ARG A H    1  
ATOM 1696   H HA   . ARG A 1 111 ? -10.019 -8.606  5.125   1.00 54.52 ? 111 ARG A HA   1  
ATOM 1697   H HB2  . ARG A 1 111 ? -10.776 -10.523 3.846   1.00 11.31 ? 111 ARG A HB2  1  
ATOM 1698   H HB3  . ARG A 1 111 ? -10.073 -9.896  2.362   1.00 72.11 ? 111 ARG A HB3  1  
ATOM 1699   H HG2  . ARG A 1 111 ? -7.784  -10.224 3.436   1.00 4.13  ? 111 ARG A HG2  1  
ATOM 1700   H HG3  . ARG A 1 111 ? -8.602  -11.093 4.734   1.00 34.33 ? 111 ARG A HG3  1  
ATOM 1701   H HD2  . ARG A 1 111 ? -8.740  -11.851 1.791   1.00 71.50 ? 111 ARG A HD2  1  
ATOM 1702   H HD3  . ARG A 1 111 ? -7.647  -12.595 2.959   1.00 55.22 ? 111 ARG A HD3  1  
ATOM 1703   H HE   . ARG A 1 111 ? -9.878  -13.101 4.183   1.00 31.24 ? 111 ARG A HE   1  
ATOM 1704   H HH11 . ARG A 1 111 ? -9.388  -13.317 0.702   1.00 74.32 ? 111 ARG A HH11 1  
ATOM 1705   H HH12 . ARG A 1 111 ? -10.588 -14.545 0.503   1.00 22.51 ? 111 ARG A HH12 1  
ATOM 1706   H HH21 . ARG A 1 111 ? -11.377 -14.764 3.908   1.00 51.11 ? 111 ARG A HH21 1  
ATOM 1707   H HH22 . ARG A 1 111 ? -11.717 -15.374 2.320   1.00 54.43 ? 111 ARG A HH22 1  
ATOM 1708   N N    . GLU A 1 112 ? -8.466  -7.500  2.386   1.00 75.15 ? 112 GLU A N    1  
ATOM 1709   C CA   . GLU A 1 112 ? -7.258  -6.857  1.835   1.00 62.41 ? 112 GLU A CA   1  
ATOM 1710   C C    . GLU A 1 112 ? -7.048  -5.471  2.465   1.00 24.05 ? 112 GLU A C    1  
ATOM 1711   O O    . GLU A 1 112 ? -5.941  -5.160  2.914   1.00 72.35 ? 112 GLU A O    1  
ATOM 1712   C CB   . GLU A 1 112 ? -7.386  -6.775  0.283   1.00 74.21 ? 112 GLU A CB   1  
ATOM 1713   C CG   . GLU A 1 112 ? -6.157  -6.216  -0.497  1.00 55.31 ? 112 GLU A CG   1  
ATOM 1714   C CD   . GLU A 1 112 ? -6.096  -4.678  -0.570  1.00 70.13 ? 112 GLU A CD   1  
ATOM 1715   O OE1  . GLU A 1 112 ? -6.922  -4.076  -1.301  1.00 44.34 ? 112 GLU A OE1  1  
ATOM 1716   O OE2  . GLU A 1 112 ? -5.232  -4.060  0.101   1.00 44.31 ? 112 GLU A OE2  1  
ATOM 1717   H H    . GLU A 1 112 ? -9.209  -7.687  1.773   1.00 5.25  ? 112 GLU A H    1  
ATOM 1718   H HA   . GLU A 1 112 ? -6.404  -7.487  2.080   1.00 73.20 ? 112 GLU A HA   1  
ATOM 1719   H HB2  . GLU A 1 112 ? -7.582  -7.776  -0.087  1.00 2.43  ? 112 GLU A HB2  1  
ATOM 1720   H HB3  . GLU A 1 112 ? -8.249  -6.159  0.038   1.00 21.41 ? 112 GLU A HB3  1  
ATOM 1721   H HG2  . GLU A 1 112 ? -5.248  -6.582  -0.031  1.00 25.12 ? 112 GLU A HG2  1  
ATOM 1722   H HG3  . GLU A 1 112 ? -6.190  -6.601  -1.513  1.00 40.15 ? 112 GLU A HG3  1  
ATOM 1723   N N    . CYS A 1 113 ? -8.125  -4.657  2.493   1.00 70.43 ? 113 CYS A N    1  
ATOM 1724   C CA   . CYS A 1 113 ? -8.084  -3.277  3.031   1.00 52.23 ? 113 CYS A CA   1  
ATOM 1725   C C    . CYS A 1 113 ? -7.611  -3.263  4.495   1.00 52.34 ? 113 CYS A C    1  
ATOM 1726   O O    . CYS A 1 113 ? -6.789  -2.425  4.888   1.00 63.13 ? 113 CYS A O    1  
ATOM 1727   C CB   . CYS A 1 113 ? -9.464  -2.604  2.929   1.00 31.30 ? 113 CYS A CB   1  
ATOM 1728   S SG   . CYS A 1 113 ? -9.485  -0.853  3.403   1.00 4.23  ? 113 CYS A SG   1  
ATOM 1729   H H    . CYS A 1 113 ? -8.970  -4.996  2.137   1.00 13.02 ? 113 CYS A H    1  
ATOM 1730   H HA   . CYS A 1 113 ? -7.382  -2.717  2.427   1.00 61.20 ? 113 CYS A HA   1  
ATOM 1731   H HB2  . CYS A 1 113 ? -9.817  -2.666  1.909   1.00 65.14 ? 113 CYS A HB2  1  
ATOM 1732   H HB3  . CYS A 1 113 ? -10.167 -3.120  3.578   1.00 35.22 ? 113 CYS A HB3  1  
ATOM 1733   H HG   . CYS A 1 113 ? -8.645  -0.681  4.419   1.00 14.34 ? 113 CYS A HG   1  
ATOM 1734   N N    . ILE A 1 114 ? -8.146  -4.219  5.279   1.00 45.14 ? 114 ILE A N    1  
ATOM 1735   C CA   . ILE A 1 114 ? -7.766  -4.427  6.685   1.00 74.50 ? 114 ILE A CA   1  
ATOM 1736   C C    . ILE A 1 114 ? -6.291  -4.815  6.770   1.00 21.10 ? 114 ILE A C    1  
ATOM 1737   O O    . ILE A 1 114 ? -5.511  -4.099  7.397   1.00 14.42 ? 114 ILE A O    1  
ATOM 1738   C CB   . ILE A 1 114 ? -8.685  -5.513  7.379   1.00 35.52 ? 114 ILE A CB   1  
ATOM 1739   C CG1  . ILE A 1 114 ? -10.126 -4.918  7.554   1.00 4.10  ? 114 ILE A CG1  1  
ATOM 1740   C CG2  . ILE A 1 114 ? -8.081  -6.013  8.728   1.00 4.35  ? 114 ILE A CG2  1  
ATOM 1741   C CD1  . ILE A 1 114 ? -11.183 -5.865  8.061   1.00 44.15 ? 114 ILE A CD1  1  
ATOM 1742   H H    . ILE A 1 114 ? -8.812  -4.820  4.886   1.00 5.43  ? 114 ILE A H    1  
ATOM 1743   H HA   . ILE A 1 114 ? -7.905  -3.481  7.210   1.00 64.30 ? 114 ILE A HA   1  
ATOM 1744   H HB   . ILE A 1 114 ? -8.745  -6.373  6.715   1.00 31.34 ? 114 ILE A HB   1  
ATOM 1745   H HG12 . ILE A 1 114 ? -10.086 -4.093  8.251   1.00 10.21 ? 114 ILE A HG12 1  
ATOM 1746   H HG13 . ILE A 1 114 ? -10.473 -4.539  6.596   1.00 5.14  ? 114 ILE A HG13 1  
ATOM 1747   H HG21 . ILE A 1 114 ? -8.740  -6.713  9.202   1.00 12.04 ? 114 ILE A HG21 1  
ATOM 1748   H HG22 . ILE A 1 114 ? -7.925  -5.177  9.390   1.00 61.12 ? 114 ILE A HG22 1  
ATOM 1749   H HG23 . ILE A 1 114 ? -7.132  -6.499  8.549   1.00 30.42 ? 114 ILE A HG23 1  
ATOM 1750   H HD11 . ILE A 1 114 ? -12.158 -5.407  7.931   1.00 33.43 ? 114 ILE A HD11 1  
ATOM 1751   H HD12 . ILE A 1 114 ? -11.021 -6.062  9.110   1.00 52.04 ? 114 ILE A HD12 1  
ATOM 1752   H HD13 . ILE A 1 114 ? -11.156 -6.788  7.511   1.00 70.44 ? 114 ILE A HD13 1  
ATOM 1753   N N    . THR A 1 115 ? -5.930  -5.908  6.065   1.00 64.11 ? 115 THR A N    1  
ATOM 1754   C CA   . THR A 1 115 ? -4.587  -6.510  6.089   1.00 31.02 ? 115 THR A CA   1  
ATOM 1755   C C    . THR A 1 115 ? -3.490  -5.461  5.841   1.00 32.11 ? 115 THR A C    1  
ATOM 1756   O O    . THR A 1 115 ? -2.455  -5.435  6.530   1.00 25.24 ? 115 THR A O    1  
ATOM 1757   C CB   . THR A 1 115 ? -4.463  -7.619  4.988   1.00 61.41 ? 115 THR A CB   1  
ATOM 1758   O OG1  . THR A 1 115 ? -5.437  -8.649  5.191   1.00 53.55 ? 115 THR A OG1  1  
ATOM 1759   C CG2  . THR A 1 115 ? -3.055  -8.237  4.940   1.00 13.11 ? 115 THR A CG2  1  
ATOM 1760   H H    . THR A 1 115 ? -6.598  -6.317  5.483   1.00 55.13 ? 115 THR A H    1  
ATOM 1761   H HA   . THR A 1 115 ? -4.448  -6.967  7.064   1.00 41.35 ? 115 THR A HA   1  
ATOM 1762   H HB   . THR A 1 115 ? -4.666  -7.166  4.020   1.00 74.10 ? 115 THR A HB   1  
ATOM 1763   H HG1  . THR A 1 115 ? -5.669  -8.691  6.121   1.00 10.14 ? 115 THR A HG1  1  
ATOM 1764   H HG21 . THR A 1 115 ? -2.728  -8.487  5.939   1.00 52.54 ? 115 THR A HG21 1  
ATOM 1765   H HG22 . THR A 1 115 ? -2.360  -7.529  4.516   1.00 45.41 ? 115 THR A HG22 1  
ATOM 1766   H HG23 . THR A 1 115 ? -3.064  -9.132  4.331   1.00 11.43 ? 115 THR A HG23 1  
ATOM 1767   N N    . SER A 1 116 ? -3.758  -4.599  4.851   1.00 24.25 ? 116 SER A N    1  
ATOM 1768   C CA   . SER A 1 116 ? -2.836  -3.557  4.427   1.00 65.03 ? 116 SER A CA   1  
ATOM 1769   C C    . SER A 1 116 ? -2.594  -2.568  5.582   1.00 1.41  ? 116 SER A C    1  
ATOM 1770   O O    . SER A 1 116 ? -1.451  -2.301  5.924   1.00 52.55 ? 116 SER A O    1  
ATOM 1771   C CB   . SER A 1 116 ? -3.387  -2.846  3.171   1.00 5.12  ? 116 SER A CB   1  
ATOM 1772   O OG   . SER A 1 116 ? -2.451  -1.919  2.628   1.00 45.34 ? 116 SER A OG   1  
ATOM 1773   H H    . SER A 1 116 ? -4.624  -4.668  4.392   1.00 22.44 ? 116 SER A H    1  
ATOM 1774   H HA   . SER A 1 116 ? -1.897  -4.043  4.171   1.00 3.41  ? 116 SER A HA   1  
ATOM 1775   H HB2  . SER A 1 116 ? -3.611  -3.586  2.412   1.00 75.34 ? 116 SER A HB2  1  
ATOM 1776   H HB3  . SER A 1 116 ? -4.296  -2.312  3.423   1.00 24.12 ? 116 SER A HB3  1  
ATOM 1777   H HG   . SER A 1 116 ? -2.214  -2.193  1.728   1.00 61.02 ? 116 SER A HG   1  
ATOM 1778   N N    . MET A 1 117 ? -3.692  -2.100  6.223   1.00 22.44 ? 117 MET A N    1  
ATOM 1779   C CA   . MET A 1 117 ? -3.626  -1.121  7.342   1.00 42.45 ? 117 MET A CA   1  
ATOM 1780   C C    . MET A 1 117 ? -2.903  -1.717  8.565   1.00 25.54 ? 117 MET A C    1  
ATOM 1781   O O    . MET A 1 117 ? -2.120  -1.021  9.220   1.00 4.03  ? 117 MET A O    1  
ATOM 1782   C CB   . MET A 1 117 ? -5.039  -0.648  7.765   1.00 60.42 ? 117 MET A CB   1  
ATOM 1783   C CG   . MET A 1 117 ? -5.855  0.044   6.672   1.00 33.55 ? 117 MET A CG   1  
ATOM 1784   S SD   . MET A 1 117 ? -7.435  0.666   7.283   1.00 62.11 ? 117 MET A SD   1  
ATOM 1785   C CE   . MET A 1 117 ? -8.087  -0.736  8.204   1.00 4.55  ? 117 MET A CE   1  
ATOM 1786   H H    . MET A 1 117 ? -4.572  -2.438  5.948   1.00 61.30 ? 117 MET A H    1  
ATOM 1787   H HA   . MET A 1 117 ? -3.063  -0.261  6.995   1.00 11.02 ? 117 MET A HA   1  
ATOM 1788   H HB2  . MET A 1 117 ? -5.606  -1.508  8.103   1.00 44.22 ? 117 MET A HB2  1  
ATOM 1789   H HB3  . MET A 1 117 ? -4.944  0.046   8.597   1.00 15.30 ? 117 MET A HB3  1  
ATOM 1790   H HG2  . MET A 1 117 ? -5.288  0.881   6.276   1.00 3.44  ? 117 MET A HG2  1  
ATOM 1791   H HG3  . MET A 1 117 ? -6.047  -0.660  5.874   1.00 65.33 ? 117 MET A HG3  1  
ATOM 1792   H HE1  . MET A 1 117 ? -7.852  -1.666  7.702   1.00 73.33 ? 117 MET A HE1  1  
ATOM 1793   H HE2  . MET A 1 117 ? -9.155  -0.633  8.288   1.00 33.42 ? 117 MET A HE2  1  
ATOM 1794   H HE3  . MET A 1 117 ? -7.668  -0.753  9.185   1.00 72.13 ? 117 MET A HE3  1  
ATOM 1795   N N    . VAL A 1 118 ? -3.186  -3.008  8.852   1.00 41.43 ? 118 VAL A N    1  
ATOM 1796   C CA   . VAL A 1 118 ? -2.532  -3.766  9.943   1.00 60.23 ? 118 VAL A CA   1  
ATOM 1797   C C    . VAL A 1 118 ? -0.999  -3.747  9.748   1.00 1.31  ? 118 VAL A C    1  
ATOM 1798   O O    . VAL A 1 118 ? -0.235  -3.422  10.668  1.00 1.54  ? 118 VAL A O    1  
ATOM 1799   C CB   . VAL A 1 118 ? -3.041  -5.266  9.990   1.00 44.10 ? 118 VAL A CB   1  
ATOM 1800   C CG1  . VAL A 1 118 ? -2.327  -6.082  11.095  1.00 64.20 ? 118 VAL A CG1  1  
ATOM 1801   C CG2  . VAL A 1 118 ? -4.585  -5.358  10.129  1.00 64.12 ? 118 VAL A CG2  1  
ATOM 1802   H H    . VAL A 1 118 ? -3.854  -3.468  8.307   1.00 51.55 ? 118 VAL A H    1  
ATOM 1803   H HA   . VAL A 1 118 ? -2.780  -3.282  10.885  1.00 52.31 ? 118 VAL A HA   1  
ATOM 1804   H HB   . VAL A 1 118 ? -2.779  -5.725  9.037   1.00 63.21 ? 118 VAL A HB   1  
ATOM 1805   H HG11 . VAL A 1 118 ? -1.291  -6.237  10.819  1.00 5.13  ? 118 VAL A HG11 1  
ATOM 1806   H HG12 . VAL A 1 118 ? -2.805  -7.046  11.219  1.00 14.22 ? 118 VAL A HG12 1  
ATOM 1807   H HG13 . VAL A 1 118 ? -2.359  -5.544  12.030  1.00 52.35 ? 118 VAL A HG13 1  
ATOM 1808   H HG21 . VAL A 1 118 ? -4.927  -4.829  11.006  1.00 72.14 ? 118 VAL A HG21 1  
ATOM 1809   H HG22 . VAL A 1 118 ? -4.891  -6.397  10.200  1.00 44.50 ? 118 VAL A HG22 1  
ATOM 1810   H HG23 . VAL A 1 118 ? -5.047  -4.919  9.258   1.00 61.20 ? 118 VAL A HG23 1  
ATOM 1811   N N    . SER A 1 119 ? -0.582  -4.053  8.510   1.00 64.51 ? 119 SER A N    1  
ATOM 1812   C CA   . SER A 1 119 ? 0.834   -4.139  8.129   1.00 21.14 ? 119 SER A CA   1  
ATOM 1813   C C    . SER A 1 119 ? 1.484   -2.728  8.033   1.00 21.44 ? 119 SER A C    1  
ATOM 1814   O O    . SER A 1 119 ? 2.695   -2.585  8.234   1.00 73.13 ? 119 SER A O    1  
ATOM 1815   C CB   . SER A 1 119 ? 0.945   -4.918  6.793   1.00 42.10 ? 119 SER A CB   1  
ATOM 1816   O OG   . SER A 1 119 ? 2.287   -5.068  6.354   1.00 63.13 ? 119 SER A OG   1  
ATOM 1817   H H    . SER A 1 119 ? -1.261  -4.235  7.822   1.00 63.25 ? 119 SER A H    1  
ATOM 1818   H HA   . SER A 1 119 ? 1.342   -4.705  8.907   1.00 21.52 ? 119 SER A HA   1  
ATOM 1819   H HB2  . SER A 1 119 ? 0.524   -5.906  6.926   1.00 45.24 ? 119 SER A HB2  1  
ATOM 1820   H HB3  . SER A 1 119 ? 0.383   -4.402  6.022   1.00 43.40 ? 119 SER A HB3  1  
ATOM 1821   H HG   . SER A 1 119 ? 2.878   -4.566  6.927   1.00 73.42 ? 119 SER A HG   1  
ATOM 1822   N N    . ARG A 1 120 ? 0.659   -1.691  7.742   1.00 24.11 ? 120 ARG A N    1  
ATOM 1823   C CA   . ARG A 1 120 ? 1.105   -0.270  7.695   1.00 41.41 ? 120 ARG A CA   1  
ATOM 1824   C C    . ARG A 1 120 ? 1.358   0.264   9.113   1.00 40.12 ? 120 ARG A C    1  
ATOM 1825   O O    . ARG A 1 120 ? 2.190   1.159   9.301   1.00 53.03 ? 120 ARG A O    1  
ATOM 1826   C CB   . ARG A 1 120 ? 0.057   0.621   6.952   1.00 52.31 ? 120 ARG A CB   1  
ATOM 1827   C CG   . ARG A 1 120 ? -0.018  0.376   5.424   1.00 24.43 ? 120 ARG A CG   1  
ATOM 1828   C CD   . ARG A 1 120 ? -1.166  1.139   4.723   1.00 11.35 ? 120 ARG A CD   1  
ATOM 1829   N NE   . ARG A 1 120 ? -1.229  0.804   3.285   1.00 54.33 ? 120 ARG A NE   1  
ATOM 1830   C CZ   . ARG A 1 120 ? -0.576  1.446   2.299   1.00 52.00 ? 120 ARG A CZ   1  
ATOM 1831   N NH1  . ARG A 1 120 ? 0.207   2.493   2.565   1.00 73.12 ? 120 ARG A NH1  1  
ATOM 1832   N NH2  . ARG A 1 120 ? -0.690  1.021   1.046   1.00 30.44 ? 120 ARG A NH2  1  
ATOM 1833   H H    . ARG A 1 120 ? -0.284  -1.885  7.576   1.00 13.44 ? 120 ARG A H    1  
ATOM 1834   H HA   . ARG A 1 120 ? 2.043   -0.235  7.144   1.00 53.31 ? 120 ARG A HA   1  
ATOM 1835   H HB2  . ARG A 1 120 ? -0.922  0.428   7.377   1.00 32.21 ? 120 ARG A HB2  1  
ATOM 1836   H HB3  . ARG A 1 120 ? 0.303   1.667   7.113   1.00 14.32 ? 120 ARG A HB3  1  
ATOM 1837   H HG2  . ARG A 1 120 ? 0.920   0.683   4.975   1.00 70.22 ? 120 ARG A HG2  1  
ATOM 1838   H HG3  . ARG A 1 120 ? -0.154  -0.687  5.253   1.00 2.23  ? 120 ARG A HG3  1  
ATOM 1839   H HD2  . ARG A 1 120 ? -2.108  0.856   5.183   1.00 23.34 ? 120 ARG A HD2  1  
ATOM 1840   H HD3  . ARG A 1 120 ? -1.019  2.207   4.840   1.00 13.22 ? 120 ARG A HD3  1  
ATOM 1841   H HE   . ARG A 1 120 ? -1.793  0.035   3.040   1.00 51.02 ? 120 ARG A HE   1  
ATOM 1842   H HH11 . ARG A 1 120 ? 0.322   2.815   3.506   1.00 60.11 ? 120 ARG A HH11 1  
ATOM 1843   H HH12 . ARG A 1 120 ? 0.692   2.961   1.816   1.00 10.20 ? 120 ARG A HH12 1  
ATOM 1844   H HH21 . ARG A 1 120 ? -1.258  0.221   0.832   1.00 21.31 ? 120 ARG A HH21 1  
ATOM 1845   H HH22 . ARG A 1 120 ? -0.204  1.500   0.305   1.00 40.20 ? 120 ARG A HH22 1  
ATOM 1846   N N    . GLY A 1 121 ? 0.636   -0.313  10.103  1.00 15.13 ? 121 GLY A N    1  
ATOM 1847   C CA   . GLY A 1 121 ? 0.841   -0.002  11.523  1.00 33.23 ? 121 GLY A CA   1  
ATOM 1848   C C    . GLY A 1 121 ? 2.021   -0.752  12.130  1.00 2.52  ? 121 GLY A C    1  
ATOM 1849   O O    . GLY A 1 121 ? 2.266   -0.638  13.333  1.00 44.44 ? 121 GLY A O    1  
ATOM 1850   H H    . GLY A 1 121 ? -0.048  -0.977  9.860   1.00 62.25 ? 121 GLY A H    1  
ATOM 1851   H HA2  . GLY A 1 121 ? 1.006   1.064   11.643  1.00 13.12 ? 121 GLY A HA2  1  
ATOM 1852   H HA3  . GLY A 1 121 ? -0.056  -0.274  12.063  1.00 5.21  ? 121 GLY A HA3  1  
ATOM 1853   N N    . THR A 1 122 ? 2.740   -1.519  11.273  1.00 70.11 ? 122 THR A N    1  
ATOM 1854   C CA   . THR A 1 122 ? 3.920   -2.325  11.642  1.00 34.34 ? 122 THR A CA   1  
ATOM 1855   C C    . THR A 1 122 ? 3.527   -3.410  12.676  1.00 2.04  ? 122 THR A C    1  
ATOM 1856   O O    . THR A 1 122 ? 4.204   -3.651  13.684  1.00 3.44  ? 122 THR A O    1  
ATOM 1857   C CB   . THR A 1 122 ? 5.111   -1.414  12.131  1.00 44.03 ? 122 THR A CB   1  
ATOM 1858   O OG1  . THR A 1 122 ? 5.216   -0.263  11.274  1.00 52.51 ? 122 THR A OG1  1  
ATOM 1859   C CG2  . THR A 1 122 ? 6.465   -2.155  12.122  1.00 10.12 ? 122 THR A CG2  1  
ATOM 1860   H H    . THR A 1 122 ? 2.452   -1.544  10.339  1.00 62.54 ? 122 THR A H    1  
ATOM 1861   H HA   . THR A 1 122 ? 4.231   -2.831  10.735  1.00 22.42 ? 122 THR A HA   1  
ATOM 1862   H HB   . THR A 1 122 ? 4.905   -1.073  13.141  1.00 22.04 ? 122 THR A HB   1  
ATOM 1863   H HG1  . THR A 1 122 ? 5.020   -0.522  10.369  1.00 3.41  ? 122 THR A HG1  1  
ATOM 1864   H HG21 . THR A 1 122 ? 7.243   -1.487  12.467  1.00 64.24 ? 122 THR A HG21 1  
ATOM 1865   H HG22 . THR A 1 122 ? 6.699   -2.486  11.119  1.00 42.53 ? 122 THR A HG22 1  
ATOM 1866   H HG23 . THR A 1 122 ? 6.416   -3.014  12.779  1.00 65.02 ? 122 THR A HG23 1  
ATOM 1867   N N    . PHE A 1 123 ? 2.386   -4.053  12.391  1.00 50.22 ? 123 PHE A N    1  
ATOM 1868   C CA   . PHE A 1 123 ? 1.848   -5.166  13.184  1.00 52.40 ? 123 PHE A CA   1  
ATOM 1869   C C    . PHE A 1 123 ? 1.817   -6.429  12.282  1.00 41.11 ? 123 PHE A C    1  
ATOM 1870   O O    . PHE A 1 123 ? 1.614   -6.280  11.067  1.00 75.02 ? 123 PHE A O    1  
ATOM 1871   C CB   . PHE A 1 123 ? 0.419   -4.793  13.689  1.00 41.04 ? 123 PHE A CB   1  
ATOM 1872   C CG   . PHE A 1 123 ? -0.128  -5.728  14.771  1.00 0.34  ? 123 PHE A CG   1  
ATOM 1873   C CD1  . PHE A 1 123 ? 0.108   -5.463  16.118  1.00 44.32 ? 123 PHE A CD1  1  
ATOM 1874   C CD2  . PHE A 1 123 ? -0.842  -6.883  14.443  1.00 41.52 ? 123 PHE A CD2  1  
ATOM 1875   C CE1  . PHE A 1 123 ? -0.354  -6.314  17.097  1.00 74.11 ? 123 PHE A CE1  1  
ATOM 1876   C CE2  . PHE A 1 123 ? -1.303  -7.736  15.427  1.00 54.43 ? 123 PHE A CE2  1  
ATOM 1877   C CZ   . PHE A 1 123 ? -1.063  -7.450  16.754  1.00 4.53  ? 123 PHE A CZ   1  
ATOM 1878   H H    . PHE A 1 123 ? 1.874   -3.761  11.604  1.00 72.14 ? 123 PHE A H    1  
ATOM 1879   H HA   . PHE A 1 123 ? 2.504   -5.344  14.040  1.00 42.20 ? 123 PHE A HA   1  
ATOM 1880   H HB2  . PHE A 1 123 ? 0.442   -3.785  14.096  1.00 40.13 ? 123 PHE A HB2  1  
ATOM 1881   H HB3  . PHE A 1 123 ? -0.269  -4.803  12.848  1.00 45.13 ? 123 PHE A HB3  1  
ATOM 1882   H HD1  . PHE A 1 123 ? 0.657   -4.571  16.397  1.00 50.32 ? 123 PHE A HD1  1  
ATOM 1883   H HD2  . PHE A 1 123 ? -1.035  -7.111  13.401  1.00 54.32 ? 123 PHE A HD2  1  
ATOM 1884   H HE1  . PHE A 1 123 ? -0.148  -6.096  18.135  1.00 51.03 ? 123 PHE A HE1  1  
ATOM 1885   H HE2  . PHE A 1 123 ? -1.854  -8.624  15.154  1.00 53.35 ? 123 PHE A HE2  1  
ATOM 1886   H HZ   . PHE A 1 123 ? -1.419  -8.120  17.525  1.00 41.20 ? 123 PHE A HZ   1  
ATOM 1887   N N    . PRO A 1 124 ? 2.062   -7.674  12.848  1.00 4.33  ? 124 PRO A N    1  
ATOM 1888   C CA   . PRO A 1 124 ? 1.883   -8.967  12.134  1.00 23.14 ? 124 PRO A CA   1  
ATOM 1889   C C    . PRO A 1 124 ? 0.682   -8.997  11.171  1.00 61.21 ? 124 PRO A C    1  
ATOM 1890   O O    . PRO A 1 124 ? -0.429  -8.601  11.552  1.00 54.11 ? 124 PRO A O    1  
ATOM 1891   C CB   . PRO A 1 124 ? 1.644   -9.947  13.298  1.00 21.01 ? 124 PRO A CB   1  
ATOM 1892   C CG   . PRO A 1 124 ? 2.497   -9.428  14.409  1.00 12.43 ? 124 PRO A CG   1  
ATOM 1893   C CD   . PRO A 1 124 ? 2.607   -7.916  14.217  1.00 14.53 ? 124 PRO A CD   1  
ATOM 1894   H HA   . PRO A 1 124 ? 2.786   -9.246  11.600  1.00 25.23 ? 124 PRO A HA   1  
ATOM 1895   H HB2  . PRO A 1 124 ? 0.590   -9.945  13.586  1.00 3.42  ? 124 PRO A HB2  1  
ATOM 1896   H HB3  . PRO A 1 124 ? 1.948   -10.949 13.023  1.00 31.13 ? 124 PRO A HB3  1  
ATOM 1897   H HG2  . PRO A 1 124 ? 2.035   -9.659  15.367  1.00 51.32 ? 124 PRO A HG2  1  
ATOM 1898   H HG3  . PRO A 1 124 ? 3.485   -9.879  14.364  1.00 71.43 ? 124 PRO A HG3  1  
ATOM 1899   H HD2  . PRO A 1 124 ? 2.017   -7.393  14.960  1.00 22.30 ? 124 PRO A HD2  1  
ATOM 1900   H HD3  . PRO A 1 124 ? 3.640   -7.593  14.277  1.00 20.33 ? 124 PRO A HD3  1  
ATOM 1901   N N    . GLN A 1 125 ? 0.929   -9.475  9.937   1.00 3.45  ? 125 GLN A N    1  
ATOM 1902   C CA   . GLN A 1 125 ? -0.084  -9.536  8.877   1.00 41.51 ? 125 GLN A CA   1  
ATOM 1903   C C    . GLN A 1 125 ? -1.287  -10.393 9.313   1.00 21.34 ? 125 GLN A C    1  
ATOM 1904   O O    . GLN A 1 125 ? -1.115  -11.505 9.834   1.00 54.43 ? 125 GLN A O    1  
ATOM 1905   C CB   . GLN A 1 125 ? 0.508   -10.133 7.575   1.00 23.44 ? 125 GLN A CB   1  
ATOM 1906   C CG   . GLN A 1 125 ? -0.473  -10.084 6.379   1.00 10.42 ? 125 GLN A CG   1  
ATOM 1907   C CD   . GLN A 1 125 ? -0.233  -11.129 5.302   1.00 33.35 ? 125 GLN A CD   1  
ATOM 1908   O OE1  . GLN A 1 125 ? 0.231   -12.236 5.586   1.00 71.13 ? 125 GLN A OE1  1  
ATOM 1909   N NE2  . GLN A 1 125 ? -0.553  -10.797 4.059   1.00 45.22 ? 125 GLN A NE2  1  
ATOM 1910   H H    . GLN A 1 125 ? 1.825   -9.805  9.738   1.00 64.20 ? 125 GLN A H    1  
ATOM 1911   H HA   . GLN A 1 125 ? -0.418  -8.522  8.681   1.00 22.34 ? 125 GLN A HA   1  
ATOM 1912   H HB2  . GLN A 1 125 ? 1.403   -9.576  7.312   1.00 51.14 ? 125 GLN A HB2  1  
ATOM 1913   H HB3  . GLN A 1 125 ? 0.789   -11.164 7.756   1.00 71.13 ? 125 GLN A HB3  1  
ATOM 1914   H HG2  . GLN A 1 125 ? -1.482  -10.231 6.745   1.00 63.12 ? 125 GLN A HG2  1  
ATOM 1915   H HG3  . GLN A 1 125 ? -0.410  -9.098  5.930   1.00 2.12  ? 125 GLN A HG3  1  
ATOM 1916   H HE21 . GLN A 1 125 ? -0.924  -9.910  3.895   1.00 31.13 ? 125 GLN A HE21 1  
ATOM 1917   H HE22 . GLN A 1 125 ? -0.403  -11.460 3.352   1.00 23.31 ? 125 GLN A HE22 1  
ATOM 1918   N N    . LEU A 1 126 ? -2.501  -9.878  9.079   1.00 33.21 ? 126 LEU A N    1  
ATOM 1919   C CA   . LEU A 1 126 ? -3.740  -10.592 9.394   1.00 62.42 ? 126 LEU A CA   1  
ATOM 1920   C C    . LEU A 1 126 ? -4.427  -11.009 8.092   1.00 74.35 ? 126 LEU A C    1  
ATOM 1921   O O    . LEU A 1 126 ? -4.916  -10.163 7.349   1.00 25.15 ? 126 LEU A O    1  
ATOM 1922   C CB   . LEU A 1 126 ? -4.680  -9.709  10.252  1.00 53.32 ? 126 LEU A CB   1  
ATOM 1923   C CG   . LEU A 1 126 ? -6.093  -10.314 10.536  1.00 55.22 ? 126 LEU A CG   1  
ATOM 1924   C CD1  . LEU A 1 126 ? -6.014  -11.679 11.266  1.00 65.22 ? 126 LEU A CD1  1  
ATOM 1925   C CD2  . LEU A 1 126 ? -6.977  -9.312  11.297  1.00 23.34 ? 126 LEU A CD2  1  
ATOM 1926   H H    . LEU A 1 126 ? -2.566  -8.990  8.657   1.00 34.42 ? 126 LEU A H    1  
ATOM 1927   H HA   . LEU A 1 126 ? -3.493  -11.490 9.963   1.00 73.44 ? 126 LEU A HA   1  
ATOM 1928   H HB2  . LEU A 1 126 ? -4.188  -9.511  11.201  1.00 60.33 ? 126 LEU A HB2  1  
ATOM 1929   H HB3  . LEU A 1 126 ? -4.816  -8.759  9.740   1.00 42.04 ? 126 LEU A HB3  1  
ATOM 1930   H HG   . LEU A 1 126 ? -6.576  -10.503 9.585   1.00 3.21  ? 126 LEU A HG   1  
ATOM 1931   H HD11 . LEU A 1 126 ? -5.427  -12.373 10.679  1.00 75.33 ? 126 LEU A HD11 1  
ATOM 1932   H HD12 . LEU A 1 126 ? -7.010  -12.082 11.386  1.00 4.00  ? 126 LEU A HD12 1  
ATOM 1933   H HD13 . LEU A 1 126 ? -5.563  -11.560 12.237  1.00 12.01 ? 126 LEU A HD13 1  
ATOM 1934   H HD21 . LEU A 1 126 ? -7.967  -9.722  11.424  1.00 45.31 ? 126 LEU A HD21 1  
ATOM 1935   H HD22 . LEU A 1 126 ? -7.052  -8.390  10.735  1.00 73.41 ? 126 LEU A HD22 1  
ATOM 1936   H HD23 . LEU A 1 126 ? -6.551  -9.100  12.271  1.00 32.21 ? 126 LEU A HD23 1  
ATOM 1937   N N    . ASN A 1 127 ? -4.444  -12.317 7.823   1.00 21.13 ? 127 ASN A N    1  
ATOM 1938   C CA   . ASN A 1 127 ? -5.189  -12.896 6.699   1.00 44.42 ? 127 ASN A CA   1  
ATOM 1939   C C    . ASN A 1 127 ? -6.497  -13.456 7.261   1.00 2.22  ? 127 ASN A C    1  
ATOM 1940   O O    . ASN A 1 127 ? -6.470  -14.440 8.014   1.00 2.31  ? 127 ASN A O    1  
ATOM 1941   C CB   . ASN A 1 127 ? -4.382  -14.027 6.003   1.00 75.54 ? 127 ASN A CB   1  
ATOM 1942   C CG   . ASN A 1 127 ? -2.965  -13.608 5.619   1.00 74.13 ? 127 ASN A CG   1  
ATOM 1943   O OD1  . ASN A 1 127 ? -2.743  -13.035 4.559   1.00 52.24 ? 127 ASN A OD1  1  
ATOM 1944   N ND2  . ASN A 1 127 ? -1.996  -13.909 6.476   1.00 42.11 ? 127 ASN A ND2  1  
ATOM 1945   H H    . ASN A 1 127 ? -3.944  -12.919 8.408   1.00 23.40 ? 127 ASN A H    1  
ATOM 1946   H HA   . ASN A 1 127 ? -5.404  -12.108 5.970   1.00 33.24 ? 127 ASN A HA   1  
ATOM 1947   H HB2  . ASN A 1 127 ? -4.318  -14.884 6.668   1.00 75.42 ? 127 ASN A HB2  1  
ATOM 1948   H HB3  . ASN A 1 127 ? -4.908  -14.328 5.100   1.00 71.02 ? 127 ASN A HB3  1  
ATOM 1949   H HD21 . ASN A 1 127 ? -2.234  -14.385 7.299   1.00 73.23 ? 127 ASN A HD21 1  
ATOM 1950   H HD22 . ASN A 1 127 ? -1.087  -13.630 6.256   1.00 20.05 ? 127 ASN A HD22 1  
ATOM 1951   N N    . LEU A 1 128 ? -7.627  -12.791 6.951   1.00 12.21 ? 128 LEU A N    1  
ATOM 1952   C CA   . LEU A 1 128 ? -8.959  -13.253 7.373   1.00 54.04 ? 128 LEU A CA   1  
ATOM 1953   C C    . LEU A 1 128 ? -9.260  -14.595 6.674   1.00 61.40 ? 128 LEU A C    1  
ATOM 1954   O O    . LEU A 1 128 ? -9.318  -14.657 5.444   1.00 72.53 ? 128 LEU A O    1  
ATOM 1955   C CB   . LEU A 1 128 ? -10.066 -12.193 7.046   1.00 10.12 ? 128 LEU A CB   1  
ATOM 1956   C CG   . LEU A 1 128 ? -10.114 -10.902 7.945   1.00 21.43 ? 128 LEU A CG   1  
ATOM 1957   C CD1  . LEU A 1 128 ? -10.278 -11.275 9.441   1.00 22.20 ? 128 LEU A CD1  1  
ATOM 1958   C CD2  . LEU A 1 128 ? -8.886  -9.975  7.711   1.00 0.30  ? 128 LEU A CD2  1  
ATOM 1959   H H    . LEU A 1 128 ? -7.560  -11.972 6.420   1.00 25.24 ? 128 LEU A H    1  
ATOM 1960   H HA   . LEU A 1 128 ? -8.925  -13.408 8.454   1.00 43.30 ? 128 LEU A HA   1  
ATOM 1961   H HB2  . LEU A 1 128 ? -9.935  -11.881 6.014   1.00 31.41 ? 128 LEU A HB2  1  
ATOM 1962   H HB3  . LEU A 1 128 ? -11.036 -12.682 7.117   1.00 41.11 ? 128 LEU A HB3  1  
ATOM 1963   H HG   . LEU A 1 128 ? -10.998 -10.332 7.671   1.00 22.54 ? 128 LEU A HG   1  
ATOM 1964   H HD11 . LEU A 1 128 ? -11.158 -11.899 9.568   1.00 53.31 ? 128 LEU A HD11 1  
ATOM 1965   H HD12 . LEU A 1 128 ? -10.398 -10.378 10.033  1.00 13.33 ? 128 LEU A HD12 1  
ATOM 1966   H HD13 . LEU A 1 128 ? -9.406  -11.816 9.786   1.00 14.02 ? 128 LEU A HD13 1  
ATOM 1967   H HD21 . LEU A 1 128 ? -7.974  -10.499 7.970   1.00 21.35 ? 128 LEU A HD21 1  
ATOM 1968   H HD22 . LEU A 1 128 ? -8.972  -9.086  8.323   1.00 23.24 ? 128 LEU A HD22 1  
ATOM 1969   H HD23 . LEU A 1 128 ? -8.845  -9.681  6.670   1.00 43.20 ? 128 LEU A HD23 1  
ATOM 1970   N N    . ALA A 1 129 ? -9.427  -15.655 7.473   1.00 71.35 ? 129 ALA A N    1  
ATOM 1971   C CA   . ALA A 1 129 ? -9.636  -17.020 6.970   1.00 12.22 ? 129 ALA A CA   1  
ATOM 1972   C C    . ALA A 1 129 ? -11.008 -17.149 6.262   1.00 32.24 ? 129 ALA A C    1  
ATOM 1973   O O    . ALA A 1 129 ? -11.962 -16.462 6.655   1.00 32.43 ? 129 ALA A O    1  
ATOM 1974   C CB   . ALA A 1 129 ? -9.501  -18.008 8.132   1.00 21.24 ? 129 ALA A CB   1  
ATOM 1975   H H    . ALA A 1 129 ? -9.411  -15.515 8.441   1.00 3.23  ? 129 ALA A H    1  
ATOM 1976   H HA   . ALA A 1 129 ? -8.845  -17.231 6.255   1.00 32.33 ? 129 ALA A HA   1  
ATOM 1977   H HB1  . ALA A 1 129 ? -8.521  -17.914 8.582   1.00 2.34  ? 129 ALA A HB1  1  
ATOM 1978   H HB2  . ALA A 1 129 ? -9.634  -19.022 7.777   1.00 10.05 ? 129 ALA A HB2  1  
ATOM 1979   H HB3  . ALA A 1 129 ? -10.256 -17.791 8.880   1.00 13.25 ? 129 ALA A HB3  1  
ATOM 1980   N N    . PRO A 1 130 ? -11.113 -17.999 5.179   1.00 51.33 ? 130 PRO A N    1  
ATOM 1981   C CA   . PRO A 1 130 ? -12.378 -18.207 4.431   1.00 30.42 ? 130 PRO A CA   1  
ATOM 1982   C C    . PRO A 1 130 ? -13.556 -18.637 5.325   1.00 30.22 ? 130 PRO A C    1  
ATOM 1983   O O    . PRO A 1 130 ? -13.564 -19.749 5.861   1.00 32.10 ? 130 PRO A O    1  
ATOM 1984   C CB   . PRO A 1 130 ? -12.014 -19.328 3.415   1.00 63.23 ? 130 PRO A CB   1  
ATOM 1985   C CG   . PRO A 1 130 ? -10.545 -19.172 3.214   1.00 50.20 ? 130 PRO A CG   1  
ATOM 1986   C CD   . PRO A 1 130 ? -10.007 -18.805 4.578   1.00 1.12  ? 130 PRO A CD   1  
ATOM 1987   H HA   . PRO A 1 130 ? -12.651 -17.306 3.884   1.00 1.13  ? 130 PRO A HA   1  
ATOM 1988   H HB2  . PRO A 1 130 ? -12.251 -20.316 3.822   1.00 60.25 ? 130 PRO A HB2  1  
ATOM 1989   H HB3  . PRO A 1 130 ? -12.540 -19.180 2.482   1.00 11.15 ? 130 PRO A HB3  1  
ATOM 1990   H HG2  . PRO A 1 130 ? -10.113 -20.107 2.865   1.00 73.20 ? 130 PRO A HG2  1  
ATOM 1991   H HG3  . PRO A 1 130 ? -10.342 -18.377 2.501   1.00 63.20 ? 130 PRO A HG3  1  
ATOM 1992   H HD2  . PRO A 1 130 ? -9.810  -19.696 5.169   1.00 11.51 ? 130 PRO A HD2  1  
ATOM 1993   H HD3  . PRO A 1 130 ? -9.106  -18.218 4.483   1.00 34.12 ? 130 PRO A HD3  1  
ATOM 1994   N N    . VAL A 1 131 ? -14.519 -17.729 5.509   1.00 71.53 ? 131 VAL A N    1  
ATOM 1995   C CA   . VAL A 1 131 ? -15.807 -18.050 6.123   1.00 22.41 ? 131 VAL A CA   1  
ATOM 1996   C C    . VAL A 1 131 ? -16.824 -18.169 4.992   1.00 35.01 ? 131 VAL A C    1  
ATOM 1997   O O    . VAL A 1 131 ? -17.118 -17.174 4.313   1.00 74.12 ? 131 VAL A O    1  
ATOM 1998   C CB   . VAL A 1 131 ? -16.263 -16.947 7.149   1.00 31.31 ? 131 VAL A CB   1  
ATOM 1999   C CG1  . VAL A 1 131 ? -17.626 -17.306 7.804   1.00 73.11 ? 131 VAL A CG1  1  
ATOM 2000   C CG2  . VAL A 1 131 ? -15.159 -16.710 8.207   1.00 34.24 ? 131 VAL A CG2  1  
ATOM 2001   H H    . VAL A 1 131 ? -14.358 -16.808 5.219   1.00 4.12  ? 131 VAL A H    1  
ATOM 2002   H HA   . VAL A 1 131 ? -15.727 -19.006 6.649   1.00 32.32 ? 131 VAL A HA   1  
ATOM 2003   H HB   . VAL A 1 131 ? -16.400 -16.015 6.602   1.00 31.11 ? 131 VAL A HB   1  
ATOM 2004   H HG11 . VAL A 1 131 ? -17.923 -16.522 8.491   1.00 53.22 ? 131 VAL A HG11 1  
ATOM 2005   H HG12 . VAL A 1 131 ? -17.541 -18.239 8.347   1.00 54.13 ? 131 VAL A HG12 1  
ATOM 2006   H HG13 . VAL A 1 131 ? -18.382 -17.411 7.037   1.00 14.12 ? 131 VAL A HG13 1  
ATOM 2007   H HG21 . VAL A 1 131 ? -15.477 -15.954 8.912   1.00 10.14 ? 131 VAL A HG21 1  
ATOM 2008   H HG22 . VAL A 1 131 ? -14.252 -16.377 7.715   1.00 75.12 ? 131 VAL A HG22 1  
ATOM 2009   H HG23 . VAL A 1 131 ? -14.952 -17.633 8.739   1.00 32.45 ? 131 VAL A HG23 1  
ATOM 2010   N N    . ASN A 1 132 ? -17.328 -19.391 4.771   1.00 10.03 ? 132 ASN A N    1  
ATOM 2011   C CA   . ASN A 1 132 ? -18.332 -19.656 3.740   1.00 51.22 ? 132 ASN A CA   1  
ATOM 2012   C C    . ASN A 1 132 ? -19.715 -19.276 4.288   1.00 71.11 ? 132 ASN A C    1  
ATOM 2013   O O    . ASN A 1 132 ? -20.356 -20.054 5.011   1.00 22.44 ? 132 ASN A O    1  
ATOM 2014   C CB   . ASN A 1 132 ? -18.273 -21.135 3.286   1.00 72.33 ? 132 ASN A CB   1  
ATOM 2015   C CG   . ASN A 1 132 ? -19.297 -21.498 2.197   1.00 70.05 ? 132 ASN A CG   1  
ATOM 2016   O OD1  . ASN A 1 132 ? -19.687 -20.658 1.386   1.00 21.54 ? 132 ASN A OD1  1  
ATOM 2017   N ND2  . ASN A 1 132 ? -19.721 -22.754 2.168   1.00 3.15  ? 132 ASN A ND2  1  
ATOM 2018   H H    . ASN A 1 132 ? -17.012 -20.140 5.325   1.00 12.44 ? 132 ASN A H    1  
ATOM 2019   H HA   . ASN A 1 132 ? -18.105 -19.021 2.881   1.00 60.11 ? 132 ASN A HA   1  
ATOM 2020   H HB2  . ASN A 1 132 ? -17.289 -21.344 2.893   1.00 14.23 ? 132 ASN A HB2  1  
ATOM 2021   H HB3  . ASN A 1 132 ? -18.443 -21.769 4.152   1.00 62.11 ? 132 ASN A HB3  1  
ATOM 2022   H HD21 . ASN A 1 132 ? -19.347 -23.381 2.830   1.00 23.43 ? 132 ASN A HD21 1  
ATOM 2023   H HD22 . ASN A 1 132 ? -20.415 -23.002 1.524   1.00 12.53 ? 132 ASN A HD22 1  
ATOM 2024   N N    . PHE A 1 133 ? -20.126 -18.035 3.968   1.00 62.31 ? 133 PHE A N    1  
ATOM 2025   C CA   . PHE A 1 133 ? -21.422 -17.462 4.379   1.00 33.13 ? 133 PHE A CA   1  
ATOM 2026   C C    . PHE A 1 133 ? -22.597 -18.321 3.888   1.00 14.31 ? 133 PHE A C    1  
ATOM 2027   O O    . PHE A 1 133 ? -23.634 -18.402 4.558   1.00 5.43  ? 133 PHE A O    1  
ATOM 2028   C CB   . PHE A 1 133 ? -21.559 -16.014 3.845   1.00 22.32 ? 133 PHE A CB   1  
ATOM 2029   C CG   . PHE A 1 133 ? -20.454 -15.064 4.319   1.00 24.44 ? 133 PHE A CG   1  
ATOM 2030   C CD1  . PHE A 1 133 ? -20.509 -14.476 5.583   1.00 41.11 ? 133 PHE A CD1  1  
ATOM 2031   C CD2  . PHE A 1 133 ? -19.361 -14.766 3.504   1.00 40.11 ? 133 PHE A CD2  1  
ATOM 2032   C CE1  . PHE A 1 133 ? -19.512 -13.620 6.010   1.00 14.53 ? 133 PHE A CE1  1  
ATOM 2033   C CE2  . PHE A 1 133 ? -18.365 -13.908 3.932   1.00 4.52  ? 133 PHE A CE2  1  
ATOM 2034   C CZ   . PHE A 1 133 ? -18.440 -13.336 5.186   1.00 34.54 ? 133 PHE A CZ   1  
ATOM 2035   H H    . PHE A 1 133 ? -19.519 -17.475 3.440   1.00 65.30 ? 133 PHE A H    1  
ATOM 2036   H HA   . PHE A 1 133 ? -21.440 -17.438 5.464   1.00 12.45 ? 133 PHE A HA   1  
ATOM 2037   H HB2  . PHE A 1 133 ? -21.552 -16.033 2.760   1.00 42.51 ? 133 PHE A HB2  1  
ATOM 2038   H HB3  . PHE A 1 133 ? -22.513 -15.605 4.172   1.00 62.23 ? 133 PHE A HB3  1  
ATOM 2039   H HD1  . PHE A 1 133 ? -21.346 -14.691 6.236   1.00 72.23 ? 133 PHE A HD1  1  
ATOM 2040   H HD2  . PHE A 1 133 ? -19.295 -15.214 2.518   1.00 53.34 ? 133 PHE A HD2  1  
ATOM 2041   H HE1  . PHE A 1 133 ? -19.570 -13.170 6.993   1.00 34.53 ? 133 PHE A HE1  1  
ATOM 2042   H HE2  . PHE A 1 133 ? -17.528 -13.686 3.285   1.00 30.24 ? 133 PHE A HE2  1  
ATOM 2043   H HZ   . PHE A 1 133 ? -17.660 -12.665 5.522   1.00 42.45 ? 133 PHE A HZ   1  
ATOM 2044   N N    . ASP A 1 134 ? -22.400 -18.953 2.710   1.00 64.32 ? 134 ASP A N    1  
ATOM 2045   C CA   . ASP A 1 134 ? -23.376 -19.869 2.095   1.00 65.25 ? 134 ASP A CA   1  
ATOM 2046   C C    . ASP A 1 134 ? -23.706 -21.030 3.045   1.00 54.54 ? 134 ASP A C    1  
ATOM 2047   O O    . ASP A 1 134 ? -24.878 -21.249 3.350   1.00 5.22  ? 134 ASP A O    1  
ATOM 2048   C CB   . ASP A 1 134 ? -22.824 -20.416 0.746   1.00 3.43  ? 134 ASP A CB   1  
ATOM 2049   C CG   . ASP A 1 134 ? -23.688 -21.533 0.115   1.00 4.20  ? 134 ASP A CG   1  
ATOM 2050   O OD1  . ASP A 1 134 ? -24.655 -21.213 -0.597  1.00 21.21 ? 134 ASP A OD1  1  
ATOM 2051   O OD2  . ASP A 1 134 ? -23.422 -22.731 0.367   1.00 21.04 ? 134 ASP A OD2  1  
ATOM 2052   H H    . ASP A 1 134 ? -21.553 -18.803 2.244   1.00 62.40 ? 134 ASP A H    1  
ATOM 2053   H HA   . ASP A 1 134 ? -24.281 -19.296 1.900   1.00 20.05 ? 134 ASP A HA   1  
ATOM 2054   H HB2  . ASP A 1 134 ? -22.752 -19.598 0.043   1.00 35.33 ? 134 ASP A HB2  1  
ATOM 2055   H HB3  . ASP A 1 134 ? -21.825 -20.804 0.915   1.00 71.23 ? 134 ASP A HB3  1  
ATOM 2056   N N    . ALA A 1 135 ? -22.652 -21.719 3.539   1.00 73.34 ? 135 ALA A N    1  
ATOM 2057   C CA   . ALA A 1 135 ? -22.796 -22.932 4.369   1.00 52.24 ? 135 ALA A CA   1  
ATOM 2058   C C    . ALA A 1 135 ? -23.532 -22.630 5.670   1.00 74.23 ? 135 ALA A C    1  
ATOM 2059   O O    . ALA A 1 135 ? -24.546 -23.243 5.944   1.00 62.21 ? 135 ALA A O    1  
ATOM 2060   C CB   . ALA A 1 135 ? -21.443 -23.579 4.676   1.00 24.41 ? 135 ALA A CB   1  
ATOM 2061   H H    . ALA A 1 135 ? -21.751 -21.400 3.334   1.00 74.42 ? 135 ALA A H    1  
ATOM 2062   H HA   . ALA A 1 135 ? -23.378 -23.656 3.797   1.00 14.54 ? 135 ALA A HA   1  
ATOM 2063   H HB1  . ALA A 1 135 ? -21.588 -24.488 5.240   1.00 72.10 ? 135 ALA A HB1  1  
ATOM 2064   H HB2  . ALA A 1 135 ? -20.826 -22.900 5.248   1.00 71.12 ? 135 ALA A HB2  1  
ATOM 2065   H HB3  . ALA A 1 135 ? -20.939 -23.821 3.756   1.00 21.12 ? 135 ALA A HB3  1  
ATOM 2066   N N    . LEU A 1 136 ? -23.037 -21.650 6.440   1.00 51.24 ? 136 LEU A N    1  
ATOM 2067   C CA   . LEU A 1 136 ? -23.609 -21.308 7.770   1.00 23.41 ? 136 LEU A CA   1  
ATOM 2068   C C    . LEU A 1 136 ? -25.084 -20.843 7.648   1.00 71.43 ? 136 LEU A C    1  
ATOM 2069   O O    . LEU A 1 136 ? -25.903 -21.096 8.549   1.00 22.12 ? 136 LEU A O    1  
ATOM 2070   C CB   . LEU A 1 136 ? -22.745 -20.225 8.490   1.00 30.33 ? 136 LEU A CB   1  
ATOM 2071   C CG   . LEU A 1 136 ? -21.375 -20.681 9.118   1.00 42.31 ? 136 LEU A CG   1  
ATOM 2072   C CD1  . LEU A 1 136 ? -20.394 -21.263 8.072   1.00 70.30 ? 136 LEU A CD1  1  
ATOM 2073   C CD2  . LEU A 1 136 ? -20.726 -19.515 9.914   1.00 75.35 ? 136 LEU A CD2  1  
ATOM 2074   H H    . LEU A 1 136 ? -22.259 -21.140 6.111   1.00 2.21  ? 136 LEU A H    1  
ATOM 2075   H HA   . LEU A 1 136 ? -23.597 -22.224 8.366   1.00 31.42 ? 136 LEU A HA   1  
ATOM 2076   H HB2  . LEU A 1 136 ? -22.542 -19.432 7.778   1.00 62.44 ? 136 LEU A HB2  1  
ATOM 2077   H HB3  . LEU A 1 136 ? -23.345 -19.799 9.292   1.00 34.12 ? 136 LEU A HB3  1  
ATOM 2078   H HG   . LEU A 1 136 ? -21.576 -21.475 9.827   1.00 14.01 ? 136 LEU A HG   1  
ATOM 2079   H HD11 . LEU A 1 136 ? -20.842 -22.127 7.596   1.00 22.31 ? 136 LEU A HD11 1  
ATOM 2080   H HD12 . LEU A 1 136 ? -19.480 -21.567 8.560   1.00 52.40 ? 136 LEU A HD12 1  
ATOM 2081   H HD13 . LEU A 1 136 ? -20.166 -20.519 7.317   1.00 21.03 ? 136 LEU A HD13 1  
ATOM 2082   H HD21 . LEU A 1 136 ? -21.405 -19.186 10.693  1.00 62.35 ? 136 LEU A HD21 1  
ATOM 2083   H HD22 . LEU A 1 136 ? -20.513 -18.684 9.255   1.00 22.03 ? 136 LEU A HD22 1  
ATOM 2084   H HD23 . LEU A 1 136 ? -19.804 -19.852 10.372  1.00 11.33 ? 136 LEU A HD23 1  
ATOM 2085   N N    . PHE A 1 137 ? -25.404 -20.181 6.520   1.00 40.44 ? 137 PHE A N    1  
ATOM 2086   C CA   . PHE A 1 137 ? -26.782 -19.766 6.187   1.00 62.34 ? 137 PHE A CA   1  
ATOM 2087   C C    . PHE A 1 137 ? -27.629 -21.006 5.821   1.00 14.24 ? 137 PHE A C    1  
ATOM 2088   O O    . PHE A 1 137 ? -28.816 -21.076 6.156   1.00 64.51 ? 137 PHE A O    1  
ATOM 2089   C CB   . PHE A 1 137 ? -26.758 -18.730 5.029   1.00 23.12 ? 137 PHE A CB   1  
ATOM 2090   C CG   . PHE A 1 137 ? -28.118 -18.088 4.711   1.00 63.51 ? 137 PHE A CG   1  
ATOM 2091   C CD1  . PHE A 1 137 ? -28.920 -18.566 3.673   1.00 22.50 ? 137 PHE A CD1  1  
ATOM 2092   C CD2  . PHE A 1 137 ? -28.602 -17.021 5.477   1.00 54.33 ? 137 PHE A CD2  1  
ATOM 2093   C CE1  . PHE A 1 137 ? -30.146 -17.989 3.397   1.00 63.12 ? 137 PHE A CE1  1  
ATOM 2094   C CE2  . PHE A 1 137 ? -29.829 -16.445 5.198   1.00 61.22 ? 137 PHE A CE2  1  
ATOM 2095   C CZ   . PHE A 1 137 ? -30.605 -16.936 4.163   1.00 23.44 ? 137 PHE A CZ   1  
ATOM 2096   H H    . PHE A 1 137 ? -24.685 -19.963 5.888   1.00 33.02 ? 137 PHE A H    1  
ATOM 2097   H HA   . PHE A 1 137 ? -27.216 -19.297 7.068   1.00 32.04 ? 137 PHE A HA   1  
ATOM 2098   H HB2  . PHE A 1 137 ? -26.071 -17.933 5.294   1.00 44.31 ? 137 PHE A HB2  1  
ATOM 2099   H HB3  . PHE A 1 137 ? -26.388 -19.213 4.128   1.00 73.32 ? 137 PHE A HB3  1  
ATOM 2100   H HD1  . PHE A 1 137 ? -28.566 -19.394 3.067   1.00 0.42  ? 137 PHE A HD1  1  
ATOM 2101   H HD2  . PHE A 1 137 ? -27.999 -16.634 6.291   1.00 72.03 ? 137 PHE A HD2  1  
ATOM 2102   H HE1  . PHE A 1 137 ? -30.751 -18.374 2.586   1.00 64.33 ? 137 PHE A HE1  1  
ATOM 2103   H HE2  . PHE A 1 137 ? -30.187 -15.620 5.795   1.00 21.21 ? 137 PHE A HE2  1  
ATOM 2104   H HZ   . PHE A 1 137 ? -31.565 -16.487 3.945   1.00 33.40 ? 137 PHE A HZ   1  
ATOM 2105   N N    . MET A 1 138 ? -26.990 -21.983 5.139   1.00 20.22 ? 138 MET A N    1  
ATOM 2106   C CA   . MET A 1 138 ? -27.623 -23.271 4.776   1.00 72.11 ? 138 MET A CA   1  
ATOM 2107   C C    . MET A 1 138 ? -27.954 -24.088 6.027   1.00 32.02 ? 138 MET A C    1  
ATOM 2108   O O    . MET A 1 138 ? -29.016 -24.694 6.083   1.00 71.04 ? 138 MET A O    1  
ATOM 2109   C CB   . MET A 1 138 ? -26.721 -24.120 3.823   1.00 62.32 ? 138 MET A CB   1  
ATOM 2110   C CG   . MET A 1 138 ? -26.631 -23.648 2.352   1.00 10.41 ? 138 MET A CG   1  
ATOM 2111   S SD   . MET A 1 138 ? -27.874 -24.394 1.253   1.00 35.31 ? 138 MET A SD   1  
ATOM 2112   C CE   . MET A 1 138 ? -29.421 -23.706 1.836   1.00 71.02 ? 138 MET A CE   1  
ATOM 2113   H H    . MET A 1 138 ? -26.058 -21.834 4.881   1.00 0.33  ? 138 MET A H    1  
ATOM 2114   H HA   . MET A 1 138 ? -28.554 -23.041 4.261   1.00 11.25 ? 138 MET A HA   1  
ATOM 2115   H HB2  . MET A 1 138 ? -25.715 -24.138 4.232   1.00 24.42 ? 138 MET A HB2  1  
ATOM 2116   H HB3  . MET A 1 138 ? -27.093 -25.140 3.812   1.00 20.51 ? 138 MET A HB3  1  
ATOM 2117   H HG2  . MET A 1 138 ? -26.747 -22.572 2.316   1.00 62.51 ? 138 MET A HG2  1  
ATOM 2118   H HG3  . MET A 1 138 ? -25.651 -23.901 1.967   1.00 2.13  ? 138 MET A HG3  1  
ATOM 2119   H HE1  . MET A 1 138 ? -29.361 -22.627 1.830   1.00 42.54 ? 138 MET A HE1  1  
ATOM 2120   H HE2  . MET A 1 138 ? -29.610 -24.050 2.842   1.00 64.44 ? 138 MET A HE2  1  
ATOM 2121   H HE3  . MET A 1 138 ? -30.228 -24.020 1.192   1.00 10.21 ? 138 MET A HE3  1  
ATOM 2122   N N    . ASN A 1 139 ? -27.052 -24.055 7.045   1.00 23.31 ? 139 ASN A N    1  
ATOM 2123   C CA   . ASN A 1 139 ? -27.225 -24.823 8.312   1.00 35.22 ? 139 ASN A CA   1  
ATOM 2124   C C    . ASN A 1 139 ? -28.573 -24.468 8.978   1.00 72.22 ? 139 ASN A C    1  
ATOM 2125   O O    . ASN A 1 139 ? -29.191 -25.301 9.652   1.00 25.41 ? 139 ASN A O    1  
ATOM 2126   C CB   . ASN A 1 139 ? -26.046 -24.568 9.310   1.00 2.44  ? 139 ASN A CB   1  
ATOM 2127   C CG   . ASN A 1 139 ? -24.689 -25.209 8.928   1.00 64.15 ? 139 ASN A CG   1  
ATOM 2128   O OD1  . ASN A 1 139 ? -23.936 -25.649 9.796   1.00 43.00 ? 139 ASN A OD1  1  
ATOM 2129   N ND2  . ASN A 1 139 ? -24.339 -25.228 7.656   1.00 51.04 ? 139 ASN A ND2  1  
ATOM 2130   H H    . ASN A 1 139 ? -26.265 -23.474 6.955   1.00 13.45 ? 139 ASN A H    1  
ATOM 2131   H HA   . ASN A 1 139 ? -27.241 -25.877 8.050   1.00 62.52 ? 139 ASN A HA   1  
ATOM 2132   H HB2  . ASN A 1 139 ? -25.889 -23.502 9.388   1.00 32.42 ? 139 ASN A HB2  1  
ATOM 2133   H HB3  . ASN A 1 139 ? -26.326 -24.943 10.289  1.00 13.23 ? 139 ASN A HB3  1  
ATOM 2134   H HD21 . ASN A 1 139 ? -24.947 -24.839 7.006   1.00 40.11 ? 139 ASN A HD21 1  
ATOM 2135   H HD22 . ASN A 1 139 ? -23.466 -25.613 7.418   1.00 53.42 ? 139 ASN A HD22 1  
ATOM 2136   N N    . TYR A 1 140 ? -29.006 -23.216 8.753   1.00 32.13 ? 140 TYR A N    1  
ATOM 2137   C CA   . TYR A 1 140 ? -30.316 -22.708 9.182   1.00 50.33 ? 140 TYR A CA   1  
ATOM 2138   C C    . TYR A 1 140 ? -31.410 -23.047 8.138   1.00 12.23 ? 140 TYR A C    1  
ATOM 2139   O O    . TYR A 1 140 ? -32.446 -23.635 8.481   1.00 21.31 ? 140 TYR A O    1  
ATOM 2140   C CB   . TYR A 1 140 ? -30.223 -21.163 9.400   1.00 63.42 ? 140 TYR A CB   1  
ATOM 2141   C CG   . TYR A 1 140 ? -31.588 -20.453 9.549   1.00 2.20  ? 140 TYR A CG   1  
ATOM 2142   C CD1  . TYR A 1 140 ? -32.404 -20.668 10.667  1.00 22.24 ? 140 TYR A CD1  1  
ATOM 2143   C CD2  . TYR A 1 140 ? -32.071 -19.602 8.547   1.00 23.24 ? 140 TYR A CD2  1  
ATOM 2144   C CE1  . TYR A 1 140 ? -33.642 -20.066 10.773  1.00 24.50 ? 140 TYR A CE1  1  
ATOM 2145   C CE2  . TYR A 1 140 ? -33.302 -18.997 8.659   1.00 30.20 ? 140 TYR A CE2  1  
ATOM 2146   C CZ   . TYR A 1 140 ? -34.084 -19.232 9.769   1.00 75.12 ? 140 TYR A CZ   1  
ATOM 2147   O OH   . TYR A 1 140 ? -35.320 -18.638 9.866   1.00 43.41 ? 140 TYR A OH   1  
ATOM 2148   H H    . TYR A 1 140 ? -28.405 -22.601 8.278   1.00 43.31 ? 140 TYR A H    1  
ATOM 2149   H HA   . TYR A 1 140 ? -30.572 -23.182 10.131  1.00 34.45 ? 140 TYR A HA   1  
ATOM 2150   H HB2  . TYR A 1 140 ? -29.651 -20.967 10.299  1.00 71.31 ? 140 TYR A HB2  1  
ATOM 2151   H HB3  . TYR A 1 140 ? -29.698 -20.719 8.555   1.00 25.40 ? 140 TYR A HB3  1  
ATOM 2152   H HD1  . TYR A 1 140 ? -32.055 -21.322 11.460  1.00 23.12 ? 140 TYR A HD1  1  
ATOM 2153   H HD2  . TYR A 1 140 ? -31.457 -19.418 7.672   1.00 42.20 ? 140 TYR A HD2  1  
ATOM 2154   H HE1  . TYR A 1 140 ? -34.255 -20.245 11.645  1.00 51.22 ? 140 TYR A HE1  1  
ATOM 2155   H HE2  . TYR A 1 140 ? -33.652 -18.344 7.874   1.00 21.42 ? 140 TYR A HE2  1  
ATOM 2156   H HH   . TYR A 1 140 ? -35.784 -18.734 9.028   1.00 1.20  ? 140 TYR A HH   1  
ATOM 2157   N N    . LEU A 1 141 ? -31.149 -22.682 6.869   1.00 51.21 ? 141 LEU A N    1  
ATOM 2158   C CA   . LEU A 1 141 ? -32.190 -22.570 5.825   1.00 34.41 ? 141 LEU A CA   1  
ATOM 2159   C C    . LEU A 1 141 ? -32.796 -23.931 5.409   1.00 70.42 ? 141 LEU A C    1  
ATOM 2160   O O    . LEU A 1 141 ? -34.021 -24.098 5.409   1.00 30.51 ? 141 LEU A O    1  
ATOM 2161   C CB   . LEU A 1 141 ? -31.609 -21.849 4.574   1.00 11.43 ? 141 LEU A CB   1  
ATOM 2162   C CG   . LEU A 1 141 ? -32.632 -21.520 3.434   1.00 74.22 ? 141 LEU A CG   1  
ATOM 2163   C CD1  . LEU A 1 141 ? -33.691 -20.496 3.902   1.00 64.45 ? 141 LEU A CD1  1  
ATOM 2164   C CD2  . LEU A 1 141 ? -31.910 -21.054 2.143   1.00 44.43 ? 141 LEU A CD2  1  
ATOM 2165   H H    . LEU A 1 141 ? -30.223 -22.501 6.620   1.00 24.22 ? 141 LEU A H    1  
ATOM 2166   H HA   . LEU A 1 141 ? -32.984 -21.951 6.229   1.00 33.43 ? 141 LEU A HA   1  
ATOM 2167   H HB2  . LEU A 1 141 ? -31.146 -20.920 4.899   1.00 61.44 ? 141 LEU A HB2  1  
ATOM 2168   H HB3  . LEU A 1 141 ? -30.828 -22.480 4.160   1.00 42.44 ? 141 LEU A HB3  1  
ATOM 2169   H HG   . LEU A 1 141 ? -33.170 -22.430 3.187   1.00 65.32 ? 141 LEU A HG   1  
ATOM 2170   H HD11 . LEU A 1 141 ? -33.211 -19.562 4.173   1.00 53.01 ? 141 LEU A HD11 1  
ATOM 2171   H HD12 . LEU A 1 141 ? -34.219 -20.886 4.763   1.00 1.54  ? 141 LEU A HD12 1  
ATOM 2172   H HD13 . LEU A 1 141 ? -34.403 -20.316 3.108   1.00 43.20 ? 141 LEU A HD13 1  
ATOM 2173   H HD21 . LEU A 1 141 ? -31.323 -21.871 1.749   1.00 0.04  ? 141 LEU A HD21 1  
ATOM 2174   H HD22 . LEU A 1 141 ? -31.255 -20.225 2.361   1.00 25.50 ? 141 LEU A HD22 1  
ATOM 2175   H HD23 . LEU A 1 141 ? -32.637 -20.753 1.400   1.00 72.35 ? 141 LEU A HD23 1  
ATOM 2176   N N    . GLN A 1 142 ? -31.940 -24.907 5.078   1.00 31.33 ? 142 GLN A N    1  
ATOM 2177   C CA   . GLN A 1 142 ? -32.392 -26.170 4.445   1.00 32.14 ? 142 GLN A CA   1  
ATOM 2178   C C    . GLN A 1 142 ? -31.457 -27.354 4.778   1.00 24.21 ? 142 GLN A C    1  
ATOM 2179   O O    . GLN A 1 142 ? -31.764 -28.500 4.426   1.00 62.45 ? 142 GLN A O    1  
ATOM 2180   C CB   . GLN A 1 142 ? -32.530 -25.946 2.901   1.00 72.12 ? 142 GLN A CB   1  
ATOM 2181   C CG   . GLN A 1 142 ? -33.141 -27.115 2.088   1.00 14.22 ? 142 GLN A CG   1  
ATOM 2182   C CD   . GLN A 1 142 ? -34.490 -27.612 2.632   1.00 61.13 ? 142 GLN A CD   1  
ATOM 2183   O OE1  . GLN A 1 142 ? -35.546 -27.097 2.278   1.00 14.11 ? 142 GLN A OE1  1  
ATOM 2184   N NE2  . GLN A 1 142 ? -34.471 -28.637 3.474   1.00 25.31 ? 142 GLN A NE2  1  
ATOM 2185   H H    . GLN A 1 142 ? -30.988 -24.778 5.257   1.00 12.12 ? 142 GLN A H    1  
ATOM 2186   H HA   . GLN A 1 142 ? -33.374 -26.410 4.846   1.00 73.10 ? 142 GLN A HA   1  
ATOM 2187   H HB2  . GLN A 1 142 ? -33.151 -25.073 2.738   1.00 32.10 ? 142 GLN A HB2  1  
ATOM 2188   H HB3  . GLN A 1 142 ? -31.545 -25.734 2.494   1.00 72.01 ? 142 GLN A HB3  1  
ATOM 2189   H HG2  . GLN A 1 142 ? -33.289 -26.785 1.066   1.00 65.04 ? 142 GLN A HG2  1  
ATOM 2190   H HG3  . GLN A 1 142 ? -32.436 -27.942 2.089   1.00 34.24 ? 142 GLN A HG3  1  
ATOM 2191   H HE21 . GLN A 1 142 ? -33.601 -29.031 3.708   1.00 63.11 ? 142 GLN A HE21 1  
ATOM 2192   H HE22 . GLN A 1 142 ? -35.325 -28.964 3.824   1.00 12.11 ? 142 GLN A HE22 1  
ATOM 2193   N N    . GLN A 1 143 ? -30.348 -27.063 5.500   1.00 2.21  ? 143 GLN A N    1  
ATOM 2194   C CA   . GLN A 1 143 ? -29.364 -28.069 5.975   1.00 65.12 ? 143 GLN A CA   1  
ATOM 2195   C C    . GLN A 1 143 ? -28.554 -28.667 4.796   1.00 40.13 ? 143 GLN A C    1  
ATOM 2196   O O    . GLN A 1 143 ? -29.128 -29.226 3.854   1.00 23.13 ? 143 GLN A O    1  
ATOM 2197   C CB   . GLN A 1 143 ? -30.092 -29.161 6.814   1.00 13.23 ? 143 GLN A CB   1  
ATOM 2198   C CG   . GLN A 1 143 ? -29.243 -30.349 7.275   1.00 72.21 ? 143 GLN A CG   1  
ATOM 2199   C CD   . GLN A 1 143 ? -30.106 -31.382 7.990   1.00 13.01 ? 143 GLN A CD   1  
ATOM 2200   O OE1  . GLN A 1 143 ? -30.283 -31.328 9.202   1.00 41.50 ? 143 GLN A OE1  1  
ATOM 2201   N NE2  . GLN A 1 143 ? -30.679 -32.304 7.230   1.00 32.32 ? 143 GLN A NE2  1  
ATOM 2202   H H    . GLN A 1 143 ? -30.196 -26.136 5.739   1.00 44.03 ? 143 GLN A H    1  
ATOM 2203   H HA   . GLN A 1 143 ? -28.675 -27.539 6.622   1.00 43.20 ? 143 GLN A HA   1  
ATOM 2204   H HB2  . GLN A 1 143 ? -30.505 -28.685 7.699   1.00 0.21  ? 143 GLN A HB2  1  
ATOM 2205   H HB3  . GLN A 1 143 ? -30.923 -29.546 6.224   1.00 64.34 ? 143 GLN A HB3  1  
ATOM 2206   H HG2  . GLN A 1 143 ? -28.773 -30.811 6.413   1.00 73.43 ? 143 GLN A HG2  1  
ATOM 2207   H HG3  . GLN A 1 143 ? -28.471 -30.000 7.956   1.00 5.34  ? 143 GLN A HG3  1  
ATOM 2208   H HE21 . GLN A 1 143 ? -30.511 -32.276 6.262   1.00 52.32 ? 143 GLN A HE21 1  
ATOM 2209   H HE22 . GLN A 1 143 ? -31.252 -32.966 7.658   1.00 2.25  ? 143 GLN A HE22 1  
ATOM 2210   N N    . GLN A 1 144 ? -27.213 -28.557 4.865   1.00 51.42 ? 144 GLN A N    1  
ATOM 2211   C CA   . GLN A 1 144 ? -26.313 -28.936 3.757   1.00 23.43 ? 144 GLN A CA   1  
ATOM 2212   C C    . GLN A 1 144 ? -25.079 -29.689 4.298   1.00 64.33 ? 144 GLN A C    1  
ATOM 2213   O O    . GLN A 1 144 ? -24.178 -29.073 4.889   1.00 72.21 ? 144 GLN A O    1  
ATOM 2214   C CB   . GLN A 1 144 ? -25.890 -27.665 2.954   1.00 50.24 ? 144 GLN A CB   1  
ATOM 2215   C CG   . GLN A 1 144 ? -24.985 -27.919 1.717   1.00 72.24 ? 144 GLN A CG   1  
ATOM 2216   C CD   . GLN A 1 144 ? -25.676 -28.637 0.535   1.00 22.41 ? 144 GLN A CD   1  
ATOM 2217   O OE1  . GLN A 1 144 ? -26.602 -29.436 0.703   1.00 40.34 ? 144 GLN A OE1  1  
ATOM 2218   N NE2  . GLN A 1 144 ? -25.213 -28.365 -0.675  1.00 22.04 ? 144 GLN A NE2  1  
ATOM 2219   H H    . GLN A 1 144 ? -26.815 -28.229 5.698   1.00 73.14 ? 144 GLN A H    1  
ATOM 2220   H HA   . GLN A 1 144 ? -26.855 -29.603 3.088   1.00 2.35  ? 144 GLN A HA   1  
ATOM 2221   H HB2  . GLN A 1 144 ? -26.787 -27.161 2.613   1.00 60.32 ? 144 GLN A HB2  1  
ATOM 2222   H HB3  . GLN A 1 144 ? -25.363 -26.989 3.626   1.00 2.13  ? 144 GLN A HB3  1  
ATOM 2223   H HG2  . GLN A 1 144 ? -24.618 -26.961 1.365   1.00 11.30 ? 144 GLN A HG2  1  
ATOM 2224   H HG3  . GLN A 1 144 ? -24.138 -28.517 2.028   1.00 0.31  ? 144 GLN A HG3  1  
ATOM 2225   H HE21 . GLN A 1 144 ? -24.468 -27.730 -0.753  1.00 44.22 ? 144 GLN A HE21 1  
ATOM 2226   H HE22 . GLN A 1 144 ? -25.629 -28.811 -1.438  1.00 44.04 ? 144 GLN A HE22 1  
ATOM 2227   N N    . ALA A 1 145 ? -25.082 -31.024 4.095   1.00 75.12 ? 145 ALA A N    1  
ATOM 2228   C CA   . ALA A 1 145 ? -23.993 -31.945 4.496   1.00 12.14 ? 145 ALA A CA   1  
ATOM 2229   C C    . ALA A 1 145 ? -24.336 -33.377 4.034   1.00 2.13  ? 145 ALA A C    1  
ATOM 2230   O O    . ALA A 1 145 ? -25.513 -33.738 4.008   1.00 63.32 ? 145 ALA A O    1  
ATOM 2231   C CB   . ALA A 1 145 ? -23.773 -31.918 6.030   1.00 34.43 ? 145 ALA A CB   1  
ATOM 2232   H H    . ALA A 1 145 ? -25.859 -31.415 3.645   1.00 74.01 ? 145 ALA A H    1  
ATOM 2233   H HA   . ALA A 1 145 ? -23.080 -31.624 4.007   1.00 14.40 ? 145 ALA A HA   1  
ATOM 2234   H HB1  . ALA A 1 145 ? -22.966 -32.588 6.297   1.00 30.40 ? 145 ALA A HB1  1  
ATOM 2235   H HB2  . ALA A 1 145 ? -24.675 -32.224 6.543   1.00 45.21 ? 145 ALA A HB2  1  
ATOM 2236   H HB3  . ALA A 1 145 ? -23.513 -30.913 6.344   1.00 74.32 ? 145 ALA A HB3  1  
ATOM 2237   N N    . GLY A 1 146 ? -23.319 -34.171 3.631   1.00 44.53 ? 146 GLY A N    1  
ATOM 2238   C CA   . GLY A 1 146 ? -23.504 -35.609 3.365   1.00 41.31 ? 146 GLY A CA   1  
ATOM 2239   C C    . GLY A 1 146 ? -22.702 -36.096 2.161   1.00 31.33 ? 146 GLY A C    1  
ATOM 2240   O O    . GLY A 1 146 ? -22.757 -35.475 1.096   1.00 71.53 ? 146 GLY A O    1  
ATOM 2241   H H    . GLY A 1 146 ? -22.436 -33.771 3.486   1.00 33.54 ? 146 GLY A H    1  
ATOM 2242   H HA2  . GLY A 1 146 ? -23.192 -36.157 4.243   1.00 65.13 ? 146 GLY A HA2  1  
ATOM 2243   H HA3  . GLY A 1 146 ? -24.553 -35.818 3.182   1.00 71.22 ? 146 GLY A HA3  1  
ATOM 2244   N N    . GLU A 1 147 ? -21.974 -37.225 2.336   1.00 15.40 ? 147 GLU A N    1  
ATOM 2245   C CA   . GLU A 1 147 ? -21.142 -37.853 1.280   1.00 21.34 ? 147 GLU A CA   1  
ATOM 2246   C C    . GLU A 1 147 ? -21.123 -39.388 1.448   1.00 3.53  ? 147 GLU A C    1  
ATOM 2247   O O    . GLU A 1 147 ? -21.136 -39.892 2.575   1.00 54.03 ? 147 GLU A O    1  
ATOM 2248   C CB   . GLU A 1 147 ? -19.689 -37.279 1.323   1.00 3.41  ? 147 GLU A CB   1  
ATOM 2249   C CG   . GLU A 1 147 ? -19.462 -35.982 0.510   1.00 35.23 ? 147 GLU A CG   1  
ATOM 2250   C CD   . GLU A 1 147 ? -19.613 -36.212 -1.004  1.00 30.04 ? 147 GLU A CD   1  
ATOM 2251   O OE1  . GLU A 1 147 ? -20.643 -35.805 -1.590  1.00 4.31  ? 147 GLU A OE1  1  
ATOM 2252   O OE2  . GLU A 1 147 ? -18.717 -36.845 -1.612  1.00 42.41 ? 147 GLU A OE2  1  
ATOM 2253   H H    . GLU A 1 147 ? -21.994 -37.656 3.217   1.00 20.12 ? 147 GLU A H    1  
ATOM 2254   H HA   . GLU A 1 147 ? -21.592 -37.620 0.317   1.00 43.02 ? 147 GLU A HA   1  
ATOM 2255   H HB2  . GLU A 1 147 ? -19.430 -37.071 2.357   1.00 11.43 ? 147 GLU A HB2  1  
ATOM 2256   H HB3  . GLU A 1 147 ? -18.990 -38.028 0.952   1.00 1.10  ? 147 GLU A HB3  1  
ATOM 2257   H HG2  . GLU A 1 147 ? -20.177 -35.231 0.836   1.00 44.12 ? 147 GLU A HG2  1  
ATOM 2258   H HG3  . GLU A 1 147 ? -18.458 -35.615 0.704   1.00 40.54 ? 147 GLU A HG3  1  
ATOM 2259   N N    . GLY A 1 148 ? -21.058 -40.111 0.307   1.00 52.03 ? 148 GLY A N    1  
ATOM 2260   C CA   . GLY A 1 148 ? -21.092 -41.583 0.280   1.00 32.24 ? 148 GLY A CA   1  
ATOM 2261   C C    . GLY A 1 148 ? -19.702 -42.209 0.242   1.00 33.00 ? 148 GLY A C    1  
ATOM 2262   O O    . GLY A 1 148 ? -19.374 -42.968 -0.678  1.00 50.24 ? 148 GLY A O    1  
ATOM 2263   H H    . GLY A 1 148 ? -20.979 -39.630 -0.541  1.00 54.21 ? 148 GLY A H    1  
ATOM 2264   H HA2  . GLY A 1 148 ? -21.621 -41.952 1.150   1.00 62.44 ? 148 GLY A HA2  1  
ATOM 2265   H HA3  . GLY A 1 148 ? -21.638 -41.891 -0.601  1.00 2.42  ? 148 GLY A HA3  1  
ATOM 2266   N N    . THR A 1 149 ? -18.879 -41.881 1.243   1.00 23.13 ? 149 THR A N    1  
ATOM 2267   C CA   . THR A 1 149 ? -17.497 -42.384 1.353   1.00 65.54 ? 149 THR A CA   1  
ATOM 2268   C C    . THR A 1 149 ? -17.461 -43.627 2.273   1.00 34.22 ? 149 THR A C    1  
ATOM 2269   O O    . THR A 1 149 ? -17.654 -43.503 3.487   1.00 15.50 ? 149 THR A O    1  
ATOM 2270   C CB   . THR A 1 149 ? -16.576 -41.260 1.927   1.00 4.10  ? 149 THR A CB   1  
ATOM 2271   O OG1  . THR A 1 149 ? -17.124 -40.793 3.164   1.00 31.45 ? 149 THR A OG1  1  
ATOM 2272   C CG2  . THR A 1 149 ? -16.432 -40.064 0.966   1.00 32.10 ? 149 THR A CG2  1  
ATOM 2273   H H    . THR A 1 149 ? -19.206 -41.274 1.940   1.00 2.13  ? 149 THR A H    1  
ATOM 2274   H HA   . THR A 1 149 ? -17.137 -42.657 0.363   1.00 24.34 ? 149 THR A HA   1  
ATOM 2275   H HB   . THR A 1 149 ? -15.590 -41.673 2.118   1.00 54.31 ? 149 THR A HB   1  
ATOM 2276   H HG1  . THR A 1 149 ? -16.948 -41.439 3.854   1.00 20.22 ? 149 THR A HG1  1  
ATOM 2277   H HG21 . THR A 1 149 ? -15.811 -39.303 1.424   1.00 1.44  ? 149 THR A HG21 1  
ATOM 2278   H HG22 . THR A 1 149 ? -17.405 -39.641 0.750   1.00 40.21 ? 149 THR A HG22 1  
ATOM 2279   H HG23 . THR A 1 149 ? -15.970 -40.387 0.042   1.00 44.13 ? 149 THR A HG23 1  
ATOM 2280   N N    . GLU A 1 150 ? -17.222 -44.826 1.696   1.00 53.33 ? 150 GLU A N    1  
ATOM 2281   C CA   . GLU A 1 150 ? -17.274 -46.099 2.458   1.00 14.01 ? 150 GLU A CA   1  
ATOM 2282   C C    . GLU A 1 150 ? -16.382 -47.187 1.818   1.00 70.01 ? 150 GLU A C    1  
ATOM 2283   O O    . GLU A 1 150 ? -15.569 -47.817 2.501   1.00 41.41 ? 150 GLU A O    1  
ATOM 2284   C CB   . GLU A 1 150 ? -18.752 -46.581 2.572   1.00 60.14 ? 150 GLU A CB   1  
ATOM 2285   C CG   . GLU A 1 150 ? -19.520 -46.611 1.234   1.00 53.24 ? 150 GLU A CG   1  
ATOM 2286   C CD   . GLU A 1 150 ? -20.957 -47.107 1.372   1.00 70.04 ? 150 GLU A CD   1  
ATOM 2287   O OE1  . GLU A 1 150 ? -21.901 -46.289 1.288   1.00 71.55 ? 150 GLU A OE1  1  
ATOM 2288   O OE2  . GLU A 1 150 ? -21.147 -48.328 1.563   1.00 11.35 ? 150 GLU A OE2  1  
ATOM 2289   H H    . GLU A 1 150 ? -17.014 -44.857 0.736   1.00 42.33 ? 150 GLU A H    1  
ATOM 2290   H HA   . GLU A 1 150 ? -16.894 -45.900 3.457   1.00 54.14 ? 150 GLU A HA   1  
ATOM 2291   H HB2  . GLU A 1 150 ? -18.765 -47.580 2.999   1.00 32.11 ? 150 GLU A HB2  1  
ATOM 2292   H HB3  . GLU A 1 150 ? -19.278 -45.917 3.250   1.00 71.33 ? 150 GLU A HB3  1  
ATOM 2293   H HG2  . GLU A 1 150 ? -19.525 -45.610 0.815   1.00 51.12 ? 150 GLU A HG2  1  
ATOM 2294   H HG3  . GLU A 1 150 ? -18.993 -47.267 0.543   1.00 12.10 ? 150 GLU A HG3  1  
ATOM 2295   N N    . GLU A 1 151 ? -16.541 -47.375 0.502   1.00 63.35 ? 151 GLU A N    1  
ATOM 2296   C CA   . GLU A 1 151 ? -15.852 -48.428 -0.268  1.00 30.20 ? 151 GLU A CA   1  
ATOM 2297   C C    . GLU A 1 151 ? -14.419 -48.002 -0.618  1.00 61.22 ? 151 GLU A C    1  
ATOM 2298   O O    . GLU A 1 151 ? -14.140 -46.818 -0.844  1.00 61.23 ? 151 GLU A O    1  
ATOM 2299   C CB   . GLU A 1 151 ? -16.641 -48.801 -1.564  1.00 40.45 ? 151 GLU A CB   1  
ATOM 2300   C CG   . GLU A 1 151 ? -16.800 -47.685 -2.629  1.00 42.31 ? 151 GLU A CG   1  
ATOM 2301   C CD   . GLU A 1 151 ? -17.789 -46.573 -2.223  1.00 55.30 ? 151 GLU A CD   1  
ATOM 2302   O OE1  . GLU A 1 151 ? -17.368 -45.539 -1.643  1.00 3.41  ? 151 GLU A OE1  1  
ATOM 2303   O OE2  . GLU A 1 151 ? -18.999 -46.738 -2.466  1.00 24.42 ? 151 GLU A OE2  1  
ATOM 2304   H H    . GLU A 1 151 ? -17.146 -46.781 0.029   1.00 11.30 ? 151 GLU A H    1  
ATOM 2305   H HA   . GLU A 1 151 ? -15.804 -49.311 0.366   1.00 13.42 ? 151 GLU A HA   1  
ATOM 2306   H HB2  . GLU A 1 151 ? -16.142 -49.642 -2.034  1.00 30.30 ? 151 GLU A HB2  1  
ATOM 2307   H HB3  . GLU A 1 151 ? -17.634 -49.126 -1.273  1.00 13.22 ? 151 GLU A HB3  1  
ATOM 2308   H HG2  . GLU A 1 151 ? -15.828 -47.246 -2.821  1.00 63.44 ? 151 GLU A HG2  1  
ATOM 2309   H HG3  . GLU A 1 151 ? -17.150 -48.139 -3.553  1.00 73.12 ? 151 GLU A HG3  1  
ATOM 2310   N N    . HIS A 1 152 ? -13.515 -48.988 -0.628  1.00 43.21 ? 152 HIS A N    1  
ATOM 2311   C CA   . HIS A 1 152 ? -12.105 -48.818 -1.018  1.00 14.32 ? 152 HIS A CA   1  
ATOM 2312   C C    . HIS A 1 152 ? -11.750 -49.874 -2.083  1.00 51.12 ? 152 HIS A C    1  
ATOM 2313   O O    . HIS A 1 152 ? -12.405 -50.919 -2.169  1.00 24.42 ? 152 HIS A O    1  
ATOM 2314   C CB   . HIS A 1 152 ? -11.168 -48.968 0.220   1.00 55.15 ? 152 HIS A CB   1  
ATOM 2315   C CG   . HIS A 1 152 ? -11.282 -47.868 1.262   1.00 22.32 ? 152 HIS A CG   1  
ATOM 2316   N ND1  . HIS A 1 152 ? -10.236 -47.034 1.597   1.00 55.51 ? 152 HIS A ND1  1  
ATOM 2317   C CD2  . HIS A 1 152 ? -12.312 -47.494 2.061   1.00 10.22 ? 152 HIS A CD2  1  
ATOM 2318   C CE1  . HIS A 1 152 ? -10.617 -46.202 2.544   1.00 51.53 ? 152 HIS A CE1  1  
ATOM 2319   N NE2  . HIS A 1 152 ? -11.872 -46.460 2.846   1.00 31.33 ? 152 HIS A NE2  1  
ATOM 2320   H H    . HIS A 1 152 ? -13.810 -49.884 -0.364  1.00 41.02 ? 152 HIS A H    1  
ATOM 2321   H HA   . HIS A 1 152 ? -11.975 -47.827 -1.451  1.00 33.33 ? 152 HIS A HA   1  
ATOM 2322   H HB2  . HIS A 1 152 ? -11.385 -49.907 0.716   1.00 60.52 ? 152 HIS A HB2  1  
ATOM 2323   H HB3  . HIS A 1 152 ? -10.137 -48.991 -0.119  1.00 21.02 ? 152 HIS A HB3  1  
ATOM 2324   H HD1  . HIS A 1 152 ? -9.335  -47.065 1.212   1.00 74.44 ? 152 HIS A HD1  1  
ATOM 2325   H HD2  . HIS A 1 152 ? -13.304 -47.924 2.068   1.00 14.04 ? 152 HIS A HD2  1  
ATOM 2326   H HE1  . HIS A 1 152 ? -10.006 -45.428 2.988   1.00 32.04 ? 152 HIS A HE1  1  
ATOM 2327   H HE2  . HIS A 1 152 ? -12.323 -46.144 3.657   1.00 37.99 ? 152 HIS A HE2  1  
ATOM 2328   N N    . GLN A 1 153 ? -10.724 -49.576 -2.895  1.00 71.44 ? 153 GLN A N    1  
ATOM 2329   C CA   . GLN A 1 153 ? -10.157 -50.523 -3.874  1.00 51.21 ? 153 GLN A CA   1  
ATOM 2330   C C    . GLN A 1 153 ? -9.611  -51.765 -3.134  1.00 54.12 ? 153 GLN A C    1  
ATOM 2331   O O    . GLN A 1 153 ? -8.583  -51.695 -2.448  1.00 35.25 ? 153 GLN A O    1  
ATOM 2332   C CB   . GLN A 1 153 ? -9.052  -49.800 -4.716  1.00 32.13 ? 153 GLN A CB   1  
ATOM 2333   C CG   . GLN A 1 153 ? -8.467  -50.578 -5.935  1.00 10.20 ? 153 GLN A CG   1  
ATOM 2334   C CD   . GLN A 1 153 ? -7.367  -51.605 -5.598  1.00 54.21 ? 153 GLN A CD   1  
ATOM 2335   O OE1  . GLN A 1 153 ? -6.191  -51.259 -5.535  1.00 13.43 ? 153 GLN A OE1  1  
ATOM 2336   N NE2  . GLN A 1 153 ? -7.734  -52.865 -5.412  1.00 63.33 ? 153 GLN A NE2  1  
ATOM 2337   H H    . GLN A 1 153 ? -10.345 -48.676 -2.850  1.00 4.01  ? 153 GLN A H    1  
ATOM 2338   H HA   . GLN A 1 153 ? -10.960 -50.831 -4.543  1.00 64.23 ? 153 GLN A HA   1  
ATOM 2339   H HB2  . GLN A 1 153 ? -9.481  -48.875 -5.093  1.00 52.11 ? 153 GLN A HB2  1  
ATOM 2340   H HB3  . GLN A 1 153 ? -8.232  -49.534 -4.056  1.00 30.34 ? 153 GLN A HB3  1  
ATOM 2341   H HG2  . GLN A 1 153 ? -9.278  -51.090 -6.434  1.00 13.15 ? 153 GLN A HG2  1  
ATOM 2342   H HG3  . GLN A 1 153 ? -8.045  -49.856 -6.627  1.00 22.53 ? 153 GLN A HG3  1  
ATOM 2343   H HE21 . GLN A 1 153 ? -8.687  -53.090 -5.499  1.00 3.54  ? 153 GLN A HE21 1  
ATOM 2344   H HE22 . GLN A 1 153 ? -7.043  -53.516 -5.185  1.00 14.32 ? 153 GLN A HE22 1  
ATOM 2345   N N    . ASP A 1 154 ? -10.356 -52.879 -3.237  1.00 53.23 ? 154 ASP A N    1  
ATOM 2346   C CA   . ASP A 1 154 ? -9.954  -54.189 -2.692  1.00 52.40 ? 154 ASP A CA   1  
ATOM 2347   C C    . ASP A 1 154 ? -9.574  -55.132 -3.838  1.00 21.22 ? 154 ASP A C    1  
ATOM 2348   O O    . ASP A 1 154 ? -10.037 -54.960 -4.974  1.00 70.41 ? 154 ASP A O    1  
ATOM 2349   C CB   . ASP A 1 154 ? -11.097 -54.799 -1.835  1.00 62.44 ? 154 ASP A CB   1  
ATOM 2350   C CG   . ASP A 1 154 ? -12.327 -55.223 -2.656  1.00 13.41 ? 154 ASP A CG   1  
ATOM 2351   O OD1  . ASP A 1 154 ? -13.087 -54.339 -3.098  1.00 0.34  ? 154 ASP A OD1  1  
ATOM 2352   O OD2  . ASP A 1 154 ? -12.533 -56.436 -2.868  1.00 53.22 ? 154 ASP A OD2  1  
ATOM 2353   H H    . ASP A 1 154 ? -11.222 -52.818 -3.694  1.00 14.01 ? 154 ASP A H    1  
ATOM 2354   H HA   . ASP A 1 154 ? -9.082  -54.044 -2.057  1.00 74.02 ? 154 ASP A HA   1  
ATOM 2355   H HB2  . ASP A 1 154 ? -10.713 -55.660 -1.298  1.00 1.23  ? 154 ASP A HB2  1  
ATOM 2356   H HB3  . ASP A 1 154 ? -11.415 -54.059 -1.102  1.00 31.55 ? 154 ASP A HB3  1  
ATOM 2357   N N    . ALA A 1 155 ? -8.727  -56.119 -3.529  1.00 72.05 ? 155 ALA A N    1  
ATOM 2358   C CA   . ALA A 1 155 ? -8.250  -57.118 -4.498  1.00 2.22  ? 155 ALA A CA   1  
ATOM 2359   C C    . ALA A 1 155 ? -8.589  -58.526 -3.973  1.00 12.43 ? 155 ALA A C    1  
ATOM 2360   O O    . ALA A 1 155 ? -7.923  -58.983 -3.020  1.00 51.21 ? 155 ALA A O    1  
ATOM 2361   C CB   . ALA A 1 155 ? -6.736  -56.942 -4.736  1.00 24.50 ? 155 ALA A CB   1  
ATOM 2362   O OXT  . ALA A 1 155 ? -9.521  -59.168 -4.500  1.00 37.99 ? 155 ALA A OXT  1  
ATOM 2363   H H    . ALA A 1 155 ? -8.412  -56.187 -2.603  1.00 24.24 ? 155 ALA A H    1  
ATOM 2364   H HA   . ALA A 1 155 ? -8.758  -56.955 -5.454  1.00 53.31 ? 155 ALA A HA   1  
ATOM 2365   H HB1  . ALA A 1 155 ? -6.390  -57.670 -5.460  1.00 10.22 ? 155 ALA A HB1  1  
ATOM 2366   H HB2  . ALA A 1 155 ? -6.198  -57.080 -3.808  1.00 61.44 ? 155 ALA A HB2  1  
ATOM 2367   H HB3  . ALA A 1 155 ? -6.542  -55.946 -5.113  1.00 30.50 ? 155 ALA A HB3  1  
ATOM 2368   N N    . MET B 1 1   ? 16.932  27.836  27.898  1.00 52.52 ? 1   MET B N    1  
ATOM 2369   C CA   . MET B 1 1   ? 17.197  28.963  26.971  1.00 24.00 ? 1   MET B CA   1  
ATOM 2370   C C    . MET B 1 1   ? 18.666  28.932  26.536  1.00 50.10 ? 1   MET B C    1  
ATOM 2371   O O    . MET B 1 1   ? 19.542  29.392  27.280  1.00 63.24 ? 1   MET B O    1  
ATOM 2372   C CB   . MET B 1 1   ? 16.831  30.313  27.647  1.00 53.11 ? 1   MET B CB   1  
ATOM 2373   C CG   . MET B 1 1   ? 15.340  30.472  27.985  1.00 75.40 ? 1   MET B CG   1  
ATOM 2374   S SD   . MET B 1 1   ? 14.978  31.969  28.933  1.00 71.43 ? 1   MET B SD   1  
ATOM 2375   C CE   . MET B 1 1   ? 15.640  33.265  27.881  1.00 0.24  ? 1   MET B CE   1  
ATOM 2376   H H1   . MET B 1 1   ? 17.541  27.912  28.737  1.00 37.99 ? 1   MET B H1   1  
ATOM 2377   H H2   . MET B 1 1   ? 17.133  26.931  27.427  1.00 37.99 ? 1   MET B H2   1  
ATOM 2378   H H3   . MET B 1 1   ? 15.941  27.842  28.195  1.00 37.99 ? 1   MET B H3   1  
ATOM 2379   H HA   . MET B 1 1   ? 16.571  28.825  26.094  1.00 4.44  ? 1   MET B HA   1  
ATOM 2380   H HB2  . MET B 1 1   ? 17.393  30.408  28.569  1.00 44.11 ? 1   MET B HB2  1  
ATOM 2381   H HB3  . MET B 1 1   ? 17.113  31.127  26.988  1.00 12.50 ? 1   MET B HB3  1  
ATOM 2382   H HG2  . MET B 1 1   ? 14.770  30.506  27.065  1.00 55.42 ? 1   MET B HG2  1  
ATOM 2383   H HG3  . MET B 1 1   ? 15.018  29.616  28.567  1.00 1.32  ? 1   MET B HG3  1  
ATOM 2384   H HE1  . MET B 1 1   ? 15.415  34.229  28.314  1.00 52.34 ? 1   MET B HE1  1  
ATOM 2385   H HE2  . MET B 1 1   ? 15.193  33.202  26.900  1.00 22.55 ? 1   MET B HE2  1  
ATOM 2386   H HE3  . MET B 1 1   ? 16.712  33.151  27.797  1.00 62.24 ? 1   MET B HE3  1  
ATOM 2387   N N    . SER B 1 2   ? 18.918  28.337  25.345  1.00 22.40 ? 2   SER B N    1  
ATOM 2388   C CA   . SER B 1 2   ? 20.265  28.190  24.758  1.00 65.53 ? 2   SER B CA   1  
ATOM 2389   C C    . SER B 1 2   ? 21.173  27.317  25.647  1.00 14.22 ? 2   SER B C    1  
ATOM 2390   O O    . SER B 1 2   ? 22.345  27.654  25.857  1.00 42.40 ? 2   SER B O    1  
ATOM 2391   C CB   . SER B 1 2   ? 20.909  29.581  24.463  1.00 53.04 ? 2   SER B CB   1  
ATOM 2392   O OG   . SER B 1 2   ? 20.186  30.279  23.467  1.00 24.42 ? 2   SER B OG   1  
ATOM 2393   H H    . SER B 1 2   ? 18.159  27.959  24.848  1.00 70.20 ? 2   SER B H    1  
ATOM 2394   H HA   . SER B 1 2   ? 20.133  27.668  23.817  1.00 75.21 ? 2   SER B HA   1  
ATOM 2395   H HB2  . SER B 1 2   ? 20.919  30.180  25.366  1.00 51.31 ? 2   SER B HB2  1  
ATOM 2396   H HB3  . SER B 1 2   ? 21.924  29.446  24.115  1.00 22.32 ? 2   SER B HB3  1  
ATOM 2397   H HG   . SER B 1 2   ? 20.354  29.867  22.610  1.00 71.34 ? 2   SER B HG   1  
ATOM 2398   N N    . GLU B 1 3   ? 20.621  26.189  26.160  1.00 15.40 ? 3   GLU B N    1  
ATOM 2399   C CA   . GLU B 1 3   ? 21.386  25.226  26.976  1.00 11.05 ? 3   GLU B CA   1  
ATOM 2400   C C    . GLU B 1 3   ? 22.520  24.622  26.133  1.00 31.54 ? 3   GLU B C    1  
ATOM 2401   O O    . GLU B 1 3   ? 22.300  23.688  25.349  1.00 2.24  ? 3   GLU B O    1  
ATOM 2402   C CB   . GLU B 1 3   ? 20.479  24.104  27.567  1.00 45.32 ? 3   GLU B CB   1  
ATOM 2403   C CG   . GLU B 1 3   ? 19.297  24.600  28.431  1.00 24.50 ? 3   GLU B CG   1  
ATOM 2404   C CD   . GLU B 1 3   ? 19.680  25.677  29.463  1.00 21.12 ? 3   GLU B CD   1  
ATOM 2405   O OE1  . GLU B 1 3   ? 20.374  25.353  30.452  1.00 44.24 ? 3   GLU B OE1  1  
ATOM 2406   O OE2  . GLU B 1 3   ? 19.276  26.854  29.299  1.00 1.54  ? 3   GLU B OE2  1  
ATOM 2407   H H    . GLU B 1 3   ? 19.678  26.004  25.980  1.00 45.04 ? 3   GLU B H    1  
ATOM 2408   H HA   . GLU B 1 3   ? 21.821  25.779  27.802  1.00 1.32  ? 3   GLU B HA   1  
ATOM 2409   H HB2  . GLU B 1 3   ? 20.074  23.521  26.749  1.00 71.14 ? 3   GLU B HB2  1  
ATOM 2410   H HB3  . GLU B 1 3   ? 21.089  23.448  28.181  1.00 4.20  ? 3   GLU B HB3  1  
ATOM 2411   H HG2  . GLU B 1 3   ? 18.540  25.004  27.770  1.00 10.40 ? 3   GLU B HG2  1  
ATOM 2412   H HG3  . GLU B 1 3   ? 18.872  23.750  28.959  1.00 44.40 ? 3   GLU B HG3  1  
ATOM 2413   N N    . GLN B 1 4   ? 23.718  25.227  26.262  1.00 30.42 ? 4   GLN B N    1  
ATOM 2414   C CA   . GLN B 1 4   ? 24.910  24.824  25.511  1.00 72.00 ? 4   GLN B CA   1  
ATOM 2415   C C    . GLN B 1 4   ? 25.424  23.477  26.041  1.00 2.52  ? 4   GLN B C    1  
ATOM 2416   O O    . GLN B 1 4   ? 26.176  23.417  27.022  1.00 52.12 ? 4   GLN B O    1  
ATOM 2417   C CB   . GLN B 1 4   ? 26.012  25.925  25.580  1.00 73.01 ? 4   GLN B CB   1  
ATOM 2418   C CG   . GLN B 1 4   ? 25.606  27.282  24.971  1.00 51.55 ? 4   GLN B CG   1  
ATOM 2419   C CD   . GLN B 1 4   ? 26.746  28.305  24.975  1.00 40.33 ? 4   GLN B CD   1  
ATOM 2420   O OE1  . GLN B 1 4   ? 26.916  29.063  25.927  1.00 0.01  ? 4   GLN B OE1  1  
ATOM 2421   N NE2  . GLN B 1 4   ? 27.542  28.314  23.913  1.00 30.55 ? 4   GLN B NE2  1  
ATOM 2422   H H    . GLN B 1 4   ? 23.792  25.980  26.888  1.00 65.42 ? 4   GLN B H    1  
ATOM 2423   H HA   . GLN B 1 4   ? 24.618  24.697  24.471  1.00 53.25 ? 4   GLN B HA   1  
ATOM 2424   H HB2  . GLN B 1 4   ? 26.278  26.086  26.616  1.00 42.12 ? 4   GLN B HB2  1  
ATOM 2425   H HB3  . GLN B 1 4   ? 26.890  25.572  25.050  1.00 43.22 ? 4   GLN B HB3  1  
ATOM 2426   H HG2  . GLN B 1 4   ? 25.284  27.122  23.949  1.00 2.51  ? 4   GLN B HG2  1  
ATOM 2427   H HG3  . GLN B 1 4   ? 24.775  27.688  25.538  1.00 60.23 ? 4   GLN B HG3  1  
ATOM 2428   H HE21 . GLN B 1 4   ? 27.357  27.673  23.192  1.00 31.24 ? 4   GLN B HE21 1  
ATOM 2429   H HE22 . GLN B 1 4   ? 28.279  28.957  23.889  1.00 51.33 ? 4   GLN B HE22 1  
ATOM 2430   N N    . ASN B 1 5   ? 24.931  22.400  25.416  1.00 64.14 ? 5   ASN B N    1  
ATOM 2431   C CA   . ASN B 1 5   ? 25.357  21.025  25.699  1.00 73.34 ? 5   ASN B CA   1  
ATOM 2432   C C    . ASN B 1 5   ? 26.641  20.708  24.906  1.00 30.04 ? 5   ASN B C    1  
ATOM 2433   O O    . ASN B 1 5   ? 26.885  21.297  23.840  1.00 23.53 ? 5   ASN B O    1  
ATOM 2434   C CB   . ASN B 1 5   ? 24.207  20.044  25.317  1.00 20.20 ? 5   ASN B CB   1  
ATOM 2435   C CG   . ASN B 1 5   ? 24.480  18.569  25.658  1.00 42.13 ? 5   ASN B CG   1  
ATOM 2436   O OD1  . ASN B 1 5   ? 25.188  18.247  26.613  1.00 2.04  ? 5   ASN B OD1  1  
ATOM 2437   N ND2  . ASN B 1 5   ? 23.932  17.661  24.867  1.00 45.15 ? 5   ASN B ND2  1  
ATOM 2438   H H    . ASN B 1 5   ? 24.238  22.537  24.736  1.00 71.13 ? 5   ASN B H    1  
ATOM 2439   H HA   . ASN B 1 5   ? 25.561  20.939  26.765  1.00 34.42 ? 5   ASN B HA   1  
ATOM 2440   H HB2  . ASN B 1 5   ? 23.311  20.337  25.845  1.00 43.45 ? 5   ASN B HB2  1  
ATOM 2441   H HB3  . ASN B 1 5   ? 24.021  20.125  24.251  1.00 1.55  ? 5   ASN B HB3  1  
ATOM 2442   H HD21 . ASN B 1 5   ? 23.393  17.970  24.111  1.00 41.32 ? 5   ASN B HD21 1  
ATOM 2443   H HD22 . ASN B 1 5   ? 24.094  16.716  25.069  1.00 52.04 ? 5   ASN B HD22 1  
ATOM 2444   N N    . ASN B 1 6   ? 27.452  19.775  25.441  1.00 42.10 ? 6   ASN B N    1  
ATOM 2445   C CA   . ASN B 1 6   ? 28.687  19.294  24.783  1.00 13.24 ? 6   ASN B CA   1  
ATOM 2446   C C    . ASN B 1 6   ? 28.343  18.589  23.461  1.00 12.03 ? 6   ASN B C    1  
ATOM 2447   O O    . ASN B 1 6   ? 29.067  18.704  22.463  1.00 12.54 ? 6   ASN B O    1  
ATOM 2448   C CB   . ASN B 1 6   ? 29.452  18.318  25.709  1.00 0.24  ? 6   ASN B CB   1  
ATOM 2449   C CG   . ASN B 1 6   ? 29.812  18.929  27.064  1.00 1.55  ? 6   ASN B CG   1  
ATOM 2450   O OD1  . ASN B 1 6   ? 29.055  18.817  28.028  1.00 34.34 ? 6   ASN B OD1  1  
ATOM 2451   N ND2  . ASN B 1 6   ? 30.958  19.581  27.150  1.00 43.11 ? 6   ASN B ND2  1  
ATOM 2452   H H    . ASN B 1 6   ? 27.205  19.389  26.309  1.00 4.34  ? 6   ASN B H    1  
ATOM 2453   H HA   . ASN B 1 6   ? 29.316  20.159  24.574  1.00 72.12 ? 6   ASN B HA   1  
ATOM 2454   H HB2  . ASN B 1 6   ? 28.837  17.440  25.885  1.00 45.45 ? 6   ASN B HB2  1  
ATOM 2455   H HB3  . ASN B 1 6   ? 30.368  18.002  25.216  1.00 2.01  ? 6   ASN B HB3  1  
ATOM 2456   H HD21 . ASN B 1 6   ? 31.518  19.641  26.347  1.00 52.11 ? 6   ASN B HD21 1  
ATOM 2457   H HD22 . ASN B 1 6   ? 31.204  19.976  28.011  1.00 74.14 ? 6   ASN B HD22 1  
ATOM 2458   N N    . THR B 1 7   ? 27.216  17.862  23.482  1.00 44.43 ? 7   THR B N    1  
ATOM 2459   C CA   . THR B 1 7   ? 26.657  17.215  22.296  1.00 63.42 ? 7   THR B CA   1  
ATOM 2460   C C    . THR B 1 7   ? 25.625  18.161  21.652  1.00 63.21 ? 7   THR B C    1  
ATOM 2461   O O    . THR B 1 7   ? 24.510  18.314  22.173  1.00 22.34 ? 7   THR B O    1  
ATOM 2462   C CB   . THR B 1 7   ? 25.986  15.849  22.675  1.00 45.22 ? 7   THR B CB   1  
ATOM 2463   O OG1  . THR B 1 7   ? 26.883  15.089  23.494  1.00 73.12 ? 7   THR B OG1  1  
ATOM 2464   C CG2  . THR B 1 7   ? 25.610  15.019  21.431  1.00 34.33 ? 7   THR B CG2  1  
ATOM 2465   H H    . THR B 1 7   ? 26.739  17.772  24.332  1.00 50.23 ? 7   THR B H    1  
ATOM 2466   H HA   . THR B 1 7   ? 27.465  17.016  21.591  1.00 12.33 ? 7   THR B HA   1  
ATOM 2467   H HB   . THR B 1 7   ? 25.086  16.039  23.254  1.00 74.51 ? 7   THR B HB   1  
ATOM 2468   H HG1  . THR B 1 7   ? 27.744  15.519  23.511  1.00 31.00 ? 7   THR B HG1  1  
ATOM 2469   H HG21 . THR B 1 7   ? 26.502  14.797  20.858  1.00 44.43 ? 7   THR B HG21 1  
ATOM 2470   H HG22 . THR B 1 7   ? 24.922  15.577  20.812  1.00 73.33 ? 7   THR B HG22 1  
ATOM 2471   H HG23 . THR B 1 7   ? 25.135  14.093  21.737  1.00 73.43 ? 7   THR B HG23 1  
ATOM 2472   N N    . GLU B 1 8   ? 26.022  18.835  20.551  1.00 42.44 ? 8   GLU B N    1  
ATOM 2473   C CA   . GLU B 1 8   ? 25.115  19.720  19.800  1.00 33.11 ? 8   GLU B CA   1  
ATOM 2474   C C    . GLU B 1 8   ? 24.102  18.822  19.070  1.00 32.54 ? 8   GLU B C    1  
ATOM 2475   O O    . GLU B 1 8   ? 24.436  18.204  18.057  1.00 24.43 ? 8   GLU B O    1  
ATOM 2476   C CB   . GLU B 1 8   ? 25.916  20.650  18.826  1.00 44.23 ? 8   GLU B CB   1  
ATOM 2477   C CG   . GLU B 1 8   ? 25.165  21.927  18.360  1.00 71.42 ? 8   GLU B CG   1  
ATOM 2478   C CD   . GLU B 1 8   ? 24.029  21.669  17.347  1.00 71.43 ? 8   GLU B CD   1  
ATOM 2479   O OE1  . GLU B 1 8   ? 22.846  21.593  17.749  1.00 32.03 ? 8   GLU B OE1  1  
ATOM 2480   O OE2  . GLU B 1 8   ? 24.323  21.536  16.138  1.00 12.35 ? 8   GLU B OE2  1  
ATOM 2481   H H    . GLU B 1 8   ? 26.939  18.721  20.231  1.00 63.20 ? 8   GLU B H    1  
ATOM 2482   H HA   . GLU B 1 8   ? 24.582  20.342  20.522  1.00 73.54 ? 8   GLU B HA   1  
ATOM 2483   H HB2  . GLU B 1 8   ? 26.825  20.967  19.326  1.00 64.25 ? 8   GLU B HB2  1  
ATOM 2484   H HB3  . GLU B 1 8   ? 26.198  20.084  17.946  1.00 5.12  ? 8   GLU B HB3  1  
ATOM 2485   H HG2  . GLU B 1 8   ? 24.750  22.418  19.233  1.00 64.31 ? 8   GLU B HG2  1  
ATOM 2486   H HG3  . GLU B 1 8   ? 25.884  22.606  17.907  1.00 5.04  ? 8   GLU B HG3  1  
ATOM 2487   N N    . MET B 1 9   ? 22.897  18.728  19.675  1.00 64.20 ? 9   MET B N    1  
ATOM 2488   C CA   . MET B 1 9   ? 21.769  17.839  19.289  1.00 54.20 ? 9   MET B CA   1  
ATOM 2489   C C    . MET B 1 9   ? 22.157  16.344  19.129  1.00 25.24 ? 9   MET B C    1  
ATOM 2490   O O    . MET B 1 9   ? 23.330  15.960  19.155  1.00 43.20 ? 9   MET B O    1  
ATOM 2491   C CB   . MET B 1 9   ? 20.967  18.354  18.042  1.00 63.01 ? 9   MET B CB   1  
ATOM 2492   C CG   . MET B 1 9   ? 21.634  18.219  16.660  1.00 11.44 ? 9   MET B CG   1  
ATOM 2493   S SD   . MET B 1 9   ? 20.445  18.388  15.306  1.00 30.12 ? 9   MET B SD   1  
ATOM 2494   C CE   . MET B 1 9   ? 19.505  16.857  15.437  1.00 64.25 ? 9   MET B CE   1  
ATOM 2495   H H    . MET B 1 9   ? 22.754  19.302  20.455  1.00 14.33 ? 9   MET B H    1  
ATOM 2496   H HA   . MET B 1 9   ? 21.093  17.883  20.139  1.00 0.12  ? 9   MET B HA   1  
ATOM 2497   H HB2  . MET B 1 9   ? 20.032  17.810  17.997  1.00 24.34 ? 9   MET B HB2  1  
ATOM 2498   H HB3  . MET B 1 9   ? 20.732  19.402  18.200  1.00 54.45 ? 9   MET B HB3  1  
ATOM 2499   H HG2  . MET B 1 9   ? 22.393  18.988  16.557  1.00 40.31 ? 9   MET B HG2  1  
ATOM 2500   H HG3  . MET B 1 9   ? 22.106  17.247  16.590  1.00 50.31 ? 9   MET B HG3  1  
ATOM 2501   H HE1  . MET B 1 9   ? 19.081  16.765  16.425  1.00 0.25  ? 9   MET B HE1  1  
ATOM 2502   H HE2  . MET B 1 9   ? 20.159  16.017  15.251  1.00 71.00 ? 9   MET B HE2  1  
ATOM 2503   H HE3  . MET B 1 9   ? 18.711  16.862  14.706  1.00 1.41  ? 9   MET B HE3  1  
ATOM 2504   N N    . THR B 1 10  ? 21.127  15.504  18.996  1.00 53.31 ? 10  THR B N    1  
ATOM 2505   C CA   . THR B 1 10  ? 21.253  14.057  18.764  1.00 74.14 ? 10  THR B CA   1  
ATOM 2506   C C    . THR B 1 10  ? 19.974  13.603  18.055  1.00 14.23 ? 10  THR B C    1  
ATOM 2507   O O    . THR B 1 10  ? 18.880  14.094  18.381  1.00 22.03 ? 10  THR B O    1  
ATOM 2508   C CB   . THR B 1 10  ? 21.433  13.242  20.114  1.00 43.40 ? 10  THR B CB   1  
ATOM 2509   O OG1  . THR B 1 10  ? 22.570  13.731  20.854  1.00 2.41  ? 10  THR B OG1  1  
ATOM 2510   C CG2  . THR B 1 10  ? 21.606  11.722  19.886  1.00 72.20 ? 10  THR B CG2  1  
ATOM 2511   H H    . THR B 1 10  ? 20.220  15.873  19.069  1.00 53.03 ? 10  THR B H    1  
ATOM 2512   H HA   . THR B 1 10  ? 22.111  13.882  18.118  1.00 31.11 ? 10  THR B HA   1  
ATOM 2513   H HB   . THR B 1 10  ? 20.549  13.399  20.730  1.00 50.20 ? 10  THR B HB   1  
ATOM 2514   H HG1  . THR B 1 10  ? 23.155  14.217  20.264  1.00 62.43 ? 10  THR B HG1  1  
ATOM 2515   H HG21 . THR B 1 10  ? 20.749  11.331  19.353  1.00 10.12 ? 10  THR B HG21 1  
ATOM 2516   H HG22 . THR B 1 10  ? 21.686  11.221  20.841  1.00 24.10 ? 10  THR B HG22 1  
ATOM 2517   H HG23 . THR B 1 10  ? 22.504  11.533  19.311  1.00 71.52 ? 10  THR B HG23 1  
ATOM 2518   N N    . PHE B 1 11  ? 20.113  12.700  17.080  1.00 12.41 ? 11  PHE B N    1  
ATOM 2519   C CA   . PHE B 1 11  ? 18.978  12.108  16.370  1.00 61.22 ? 11  PHE B CA   1  
ATOM 2520   C C    . PHE B 1 11  ? 19.264  10.622  16.122  1.00 24.32 ? 11  PHE B C    1  
ATOM 2521   O O    . PHE B 1 11  ? 20.356  10.260  15.670  1.00 44.40 ? 11  PHE B O    1  
ATOM 2522   C CB   . PHE B 1 11  ? 18.697  12.851  15.026  1.00 25.23 ? 11  PHE B CB   1  
ATOM 2523   C CG   . PHE B 1 11  ? 17.478  12.297  14.275  1.00 31.01 ? 11  PHE B CG   1  
ATOM 2524   C CD1  . PHE B 1 11  ? 16.196  12.741  14.590  1.00 1.21  ? 11  PHE B CD1  1  
ATOM 2525   C CD2  . PHE B 1 11  ? 17.605  11.303  13.293  1.00 71.22 ? 11  PHE B CD2  1  
ATOM 2526   C CE1  . PHE B 1 11  ? 15.093  12.222  13.956  1.00 33.44 ? 11  PHE B CE1  1  
ATOM 2527   C CE2  . PHE B 1 11  ? 16.495  10.791  12.660  1.00 44.12 ? 11  PHE B CE2  1  
ATOM 2528   C CZ   . PHE B 1 11  ? 15.241  11.251  12.996  1.00 51.04 ? 11  PHE B CZ   1  
ATOM 2529   H H    . PHE B 1 11  ? 21.016  12.406  16.837  1.00 12.12 ? 11  PHE B H    1  
ATOM 2530   H HA   . PHE B 1 11  ? 18.094  12.193  17.010  1.00 14.01 ? 11  PHE B HA   1  
ATOM 2531   H HB2  . PHE B 1 11  ? 18.514  13.901  15.235  1.00 71.11 ? 11  PHE B HB2  1  
ATOM 2532   H HB3  . PHE B 1 11  ? 19.564  12.779  14.381  1.00 42.44 ? 11  PHE B HB3  1  
ATOM 2533   H HD1  . PHE B 1 11  ? 16.070  13.510  15.344  1.00 41.41 ? 11  PHE B HD1  1  
ATOM 2534   H HD2  . PHE B 1 11  ? 18.589  10.938  13.023  1.00 73.03 ? 11  PHE B HD2  1  
ATOM 2535   H HE1  . PHE B 1 11  ? 14.106  12.576  14.216  1.00 44.45 ? 11  PHE B HE1  1  
ATOM 2536   H HE2  . PHE B 1 11  ? 16.605  10.025  11.904  1.00 22.22 ? 11  PHE B HE2  1  
ATOM 2537   H HZ   . PHE B 1 11  ? 14.369  10.845  12.503  1.00 14.02 ? 11  PHE B HZ   1  
ATOM 2538   N N    . GLN B 1 12  ? 18.271  9.781   16.437  1.00 10.02 ? 12  GLN B N    1  
ATOM 2539   C CA   . GLN B 1 12  ? 18.275  8.354   16.106  1.00 44.50 ? 12  GLN B CA   1  
ATOM 2540   C C    . GLN B 1 12  ? 16.841  7.935   15.765  1.00 72.13 ? 12  GLN B C    1  
ATOM 2541   O O    . GLN B 1 12  ? 15.909  8.275   16.496  1.00 42.41 ? 12  GLN B O    1  
ATOM 2542   C CB   . GLN B 1 12  ? 18.822  7.512   17.291  1.00 4.41  ? 12  GLN B CB   1  
ATOM 2543   C CG   . GLN B 1 12  ? 18.805  5.982   17.049  1.00 43.12 ? 12  GLN B CG   1  
ATOM 2544   C CD   . GLN B 1 12  ? 19.286  5.135   18.232  1.00 61.32 ? 12  GLN B CD   1  
ATOM 2545   O OE1  . GLN B 1 12  ? 19.849  4.060   18.034  1.00 70.14 ? 12  GLN B OE1  1  
ATOM 2546   N NE2  . GLN B 1 12  ? 19.053  5.587   19.464  1.00 44.21 ? 12  GLN B NE2  1  
ATOM 2547   H H    . GLN B 1 12  ? 17.499  10.137  16.929  1.00 54.54 ? 12  GLN B H    1  
ATOM 2548   H HA   . GLN B 1 12  ? 18.910  8.202   15.231  1.00 14.24 ? 12  GLN B HA   1  
ATOM 2549   H HB2  . GLN B 1 12  ? 19.846  7.818   17.484  1.00 42.12 ? 12  GLN B HB2  1  
ATOM 2550   H HB3  . GLN B 1 12  ? 18.229  7.728   18.176  1.00 20.12 ? 12  GLN B HB3  1  
ATOM 2551   H HG2  . GLN B 1 12  ? 17.790  5.677   16.821  1.00 74.44 ? 12  GLN B HG2  1  
ATOM 2552   H HG3  . GLN B 1 12  ? 19.433  5.765   16.192  1.00 1.10  ? 12  GLN B HG3  1  
ATOM 2553   H HE21 . GLN B 1 12  ? 18.586  6.438   19.567  1.00 34.10 ? 12  GLN B HE21 1  
ATOM 2554   H HE22 . GLN B 1 12  ? 19.360  5.047   20.222  1.00 11.53 ? 12  GLN B HE22 1  
ATOM 2555   N N    . ILE B 1 13  ? 16.677  7.229   14.643  1.00 14.02 ? 13  ILE B N    1  
ATOM 2556   C CA   . ILE B 1 13  ? 15.388  6.652   14.237  1.00 1.01  ? 13  ILE B CA   1  
ATOM 2557   C C    . ILE B 1 13  ? 15.177  5.316   14.982  1.00 61.43 ? 13  ILE B C    1  
ATOM 2558   O O    . ILE B 1 13  ? 16.056  4.440   14.987  1.00 74.30 ? 13  ILE B O    1  
ATOM 2559   C CB   . ILE B 1 13  ? 15.319  6.460   12.673  1.00 35.21 ? 13  ILE B CB   1  
ATOM 2560   C CG1  . ILE B 1 13  ? 13.930  5.891   12.217  1.00 44.44 ? 13  ILE B CG1  1  
ATOM 2561   C CG2  . ILE B 1 13  ? 16.483  5.577   12.153  1.00 3.40  ? 13  ILE B CG2  1  
ATOM 2562   C CD1  . ILE B 1 13  ? 13.782  5.743   10.710  1.00 34.21 ? 13  ILE B CD1  1  
ATOM 2563   H H    . ILE B 1 13  ? 17.455  7.081   14.072  1.00 3.43  ? 13  ILE B H    1  
ATOM 2564   H HA   . ILE B 1 13  ? 14.600  7.353   14.527  1.00 15.20 ? 13  ILE B HA   1  
ATOM 2565   H HB   . ILE B 1 13  ? 15.447  7.446   12.229  1.00 13.23 ? 13  ILE B HB   1  
ATOM 2566   H HG12 . ILE B 1 13  ? 13.780  4.912   12.655  1.00 61.23 ? 13  ILE B HG12 1  
ATOM 2567   H HG13 . ILE B 1 13  ? 13.142  6.551   12.560  1.00 73.33 ? 13  ILE B HG13 1  
ATOM 2568   H HG21 . ILE B 1 13  ? 17.431  6.013   12.440  1.00 31.41 ? 13  ILE B HG21 1  
ATOM 2569   H HG22 . ILE B 1 13  ? 16.441  5.505   11.074  1.00 40.31 ? 13  ILE B HG22 1  
ATOM 2570   H HG23 . ILE B 1 13  ? 16.405  4.583   12.578  1.00 64.40 ? 13  ILE B HG23 1  
ATOM 2571   H HD11 . ILE B 1 13  ? 12.805  5.345   10.486  1.00 74.11 ? 13  ILE B HD11 1  
ATOM 2572   H HD12 . ILE B 1 13  ? 14.538  5.068   10.333  1.00 41.41 ? 13  ILE B HD12 1  
ATOM 2573   H HD13 . ILE B 1 13  ? 13.892  6.709   10.237  1.00 63.15 ? 13  ILE B HD13 1  
ATOM 2574   N N    . GLN B 1 14  ? 14.028  5.193   15.654  1.00 71.20 ? 14  GLN B N    1  
ATOM 2575   C CA   . GLN B 1 14  ? 13.670  3.991   16.431  1.00 42.33 ? 14  GLN B CA   1  
ATOM 2576   C C    . GLN B 1 14  ? 12.564  3.204   15.723  1.00 35.21 ? 14  GLN B C    1  
ATOM 2577   O O    . GLN B 1 14  ? 12.629  1.973   15.644  1.00 63.44 ? 14  GLN B O    1  
ATOM 2578   C CB   . GLN B 1 14  ? 13.229  4.398   17.858  1.00 1.35  ? 14  GLN B CB   1  
ATOM 2579   C CG   . GLN B 1 14  ? 14.336  5.042   18.707  1.00 1.25  ? 14  GLN B CG   1  
ATOM 2580   C CD   . GLN B 1 14  ? 15.423  4.047   19.131  1.00 4.41  ? 14  GLN B CD   1  
ATOM 2581   O OE1  . GLN B 1 14  ? 16.390  3.817   18.410  1.00 53.35 ? 14  GLN B OE1  1  
ATOM 2582   N NE2  . GLN B 1 14  ? 15.274  3.468   20.317  1.00 14.00 ? 14  GLN B NE2  1  
ATOM 2583   H H    . GLN B 1 14  ? 13.396  5.944   15.637  1.00 55.33 ? 14  GLN B H    1  
ATOM 2584   H HA   . GLN B 1 14  ? 14.549  3.351   16.509  1.00 13.55 ? 14  GLN B HA   1  
ATOM 2585   H HB2  . GLN B 1 14  ? 12.413  5.105   17.777  1.00 64.42 ? 14  GLN B HB2  1  
ATOM 2586   H HB3  . GLN B 1 14  ? 12.866  3.519   18.383  1.00 51.41 ? 14  GLN B HB3  1  
ATOM 2587   H HG2  . GLN B 1 14  ? 14.799  5.837   18.133  1.00 2.34  ? 14  GLN B HG2  1  
ATOM 2588   H HG3  . GLN B 1 14  ? 13.891  5.472   19.599  1.00 4.13  ? 14  GLN B HG3  1  
ATOM 2589   H HE21 . GLN B 1 14  ? 14.488  3.708   20.854  1.00 51.10 ? 14  GLN B HE21 1  
ATOM 2590   H HE22 . GLN B 1 14  ? 15.952  2.828   20.606  1.00 44.44 ? 14  GLN B HE22 1  
ATOM 2591   N N    . ARG B 1 15  ? 11.551  3.913   15.189  1.00 71.45 ? 15  ARG B N    1  
ATOM 2592   C CA   . ARG B 1 15  ? 10.392  3.259   14.557  1.00 31.21 ? 15  ARG B CA   1  
ATOM 2593   C C    . ARG B 1 15  ? 9.587   4.268   13.716  1.00 33.32 ? 15  ARG B C    1  
ATOM 2594   O O    . ARG B 1 15  ? 9.610   5.463   13.989  1.00 1.44  ? 15  ARG B O    1  
ATOM 2595   C CB   . ARG B 1 15  ? 9.498   2.603   15.661  1.00 2.40  ? 15  ARG B CB   1  
ATOM 2596   C CG   . ARG B 1 15  ? 8.472   1.571   15.149  1.00 75.31 ? 15  ARG B CG   1  
ATOM 2597   C CD   . ARG B 1 15  ? 7.644   0.955   16.293  1.00 31.42 ? 15  ARG B CD   1  
ATOM 2598   N NE   . ARG B 1 15  ? 6.755   -0.109  15.813  1.00 43.34 ? 15  ARG B NE   1  
ATOM 2599   C CZ   . ARG B 1 15  ? 7.075   -1.412  15.735  1.00 55.43 ? 15  ARG B CZ   1  
ATOM 2600   N NH1  . ARG B 1 15  ? 8.278   -1.854  16.084  1.00 61.45 ? 15  ARG B NH1  1  
ATOM 2601   N NH2  . ARG B 1 15  ? 6.174   -2.279  15.317  1.00 45.40 ? 15  ARG B NH2  1  
ATOM 2602   H H    . ARG B 1 15  ? 11.588  4.896   15.216  1.00 74.52 ? 15  ARG B H    1  
ATOM 2603   H HA   . ARG B 1 15  ? 10.770  2.482   13.895  1.00 3.25  ? 15  ARG B HA   1  
ATOM 2604   H HB2  . ARG B 1 15  ? 10.150  2.099   16.367  1.00 32.33 ? 15  ARG B HB2  1  
ATOM 2605   H HB3  . ARG B 1 15  ? 8.960   3.384   16.199  1.00 10.24 ? 15  ARG B HB3  1  
ATOM 2606   H HG2  . ARG B 1 15  ? 7.798   2.057   14.450  1.00 21.52 ? 15  ARG B HG2  1  
ATOM 2607   H HG3  . ARG B 1 15  ? 9.002   0.777   14.634  1.00 24.50 ? 15  ARG B HG3  1  
ATOM 2608   H HD2  . ARG B 1 15  ? 8.314   0.553   17.046  1.00 5.44  ? 15  ARG B HD2  1  
ATOM 2609   H HD3  . ARG B 1 15  ? 7.038   1.733   16.743  1.00 55.13 ? 15  ARG B HD3  1  
ATOM 2610   H HE   . ARG B 1 15  ? 5.855   0.165   15.528  1.00 34.34 ? 15  ARG B HE   1  
ATOM 2611   H HH11 . ARG B 1 15  ? 8.981   -1.218  16.415  1.00 3.32  ? 15  ARG B HH11 1  
ATOM 2612   H HH12 . ARG B 1 15  ? 8.488   -2.843  16.000  1.00 11.11 ? 15  ARG B HH12 1  
ATOM 2613   H HH21 . ARG B 1 15  ? 5.244   -1.978  15.077  1.00 2.33  ? 15  ARG B HH21 1  
ATOM 2614   H HH22 . ARG B 1 15  ? 6.410   -3.263  15.256  1.00 52.21 ? 15  ARG B HH22 1  
ATOM 2615   N N    . ILE B 1 16  ? 8.928   3.757   12.661  1.00 21.25 ? 16  ILE B N    1  
ATOM 2616   C CA   . ILE B 1 16  ? 7.926   4.485   11.840  1.00 33.44 ? 16  ILE B CA   1  
ATOM 2617   C C    . ILE B 1 16  ? 6.749   3.524   11.649  1.00 14.31 ? 16  ILE B C    1  
ATOM 2618   O O    . ILE B 1 16  ? 6.973   2.344   11.373  1.00 63.35 ? 16  ILE B O    1  
ATOM 2619   C CB   . ILE B 1 16  ? 8.478   4.914   10.423  1.00 62.23 ? 16  ILE B CB   1  
ATOM 2620   C CG1  . ILE B 1 16  ? 9.720   5.850   10.559  1.00 43.13 ? 16  ILE B CG1  1  
ATOM 2621   C CG2  . ILE B 1 16  ? 7.368   5.579   9.558   1.00 14.02 ? 16  ILE B CG2  1  
ATOM 2622   C CD1  . ILE B 1 16  ? 10.428  6.137   9.251   1.00 3.54  ? 16  ILE B CD1  1  
ATOM 2623   H H    . ILE B 1 16  ? 9.108   2.826   12.425  1.00 45.21 ? 16  ILE B H    1  
ATOM 2624   H HA   . ILE B 1 16  ? 7.593   5.371   12.386  1.00 54.12 ? 16  ILE B HA   1  
ATOM 2625   H HB   . ILE B 1 16  ? 8.790   4.005   9.904   1.00 11.23 ? 16  ILE B HB   1  
ATOM 2626   H HG12 . ILE B 1 16  ? 9.416   6.798   10.980  1.00 63.12 ? 16  ILE B HG12 1  
ATOM 2627   H HG13 . ILE B 1 16  ? 10.443  5.389   11.222  1.00 62.13 ? 16  ILE B HG13 1  
ATOM 2628   H HG21 . ILE B 1 16  ? 6.969   6.441   10.074  1.00 15.43 ? 16  ILE B HG21 1  
ATOM 2629   H HG22 . ILE B 1 16  ? 6.565   4.874   9.381   1.00 5.33  ? 16  ILE B HG22 1  
ATOM 2630   H HG23 . ILE B 1 16  ? 7.775   5.891   8.604   1.00 52.31 ? 16  ILE B HG23 1  
ATOM 2631   H HD11 . ILE B 1 16  ? 11.233  6.828   9.427   1.00 2.21  ? 16  ILE B HD11 1  
ATOM 2632   H HD12 . ILE B 1 16  ? 9.735   6.571   8.543   1.00 3.13  ? 16  ILE B HD12 1  
ATOM 2633   H HD13 . ILE B 1 16  ? 10.832  5.222   8.850   1.00 31.14 ? 16  ILE B HD13 1  
ATOM 2634   N N    . TYR B 1 17  ? 5.517   4.024   11.817  1.00 11.43 ? 17  TYR B N    1  
ATOM 2635   C CA   . TYR B 1 17  ? 4.304   3.192   11.817  1.00 21.55 ? 17  TYR B CA   1  
ATOM 2636   C C    . TYR B 1 17  ? 3.062   4.080   11.738  1.00 74.04 ? 17  TYR B C    1  
ATOM 2637   O O    . TYR B 1 17  ? 3.039   5.192   12.281  1.00 34.21 ? 17  TYR B O    1  
ATOM 2638   C CB   . TYR B 1 17  ? 4.236   2.282   13.090  1.00 72.43 ? 17  TYR B CB   1  
ATOM 2639   C CG   . TYR B 1 17  ? 4.321   3.037   14.432  1.00 20.45 ? 17  TYR B CG   1  
ATOM 2640   C CD1  . TYR B 1 17  ? 5.516   3.633   14.840  1.00 32.14 ? 17  TYR B CD1  1  
ATOM 2641   C CD2  . TYR B 1 17  ? 3.221   3.169   15.278  1.00 73.33 ? 17  TYR B CD2  1  
ATOM 2642   C CE1  . TYR B 1 17  ? 5.612   4.320   16.016  1.00 2.42  ? 17  TYR B CE1  1  
ATOM 2643   C CE2  . TYR B 1 17  ? 3.326   3.861   16.465  1.00 75.23 ? 17  TYR B CE2  1  
ATOM 2644   C CZ   . TYR B 1 17  ? 4.517   4.431   16.823  1.00 64.44 ? 17  TYR B CZ   1  
ATOM 2645   O OH   . TYR B 1 17  ? 4.613   5.108   17.998  1.00 53.11 ? 17  TYR B OH   1  
ATOM 2646   H H    . TYR B 1 17  ? 5.412   4.994   11.937  1.00 71.32 ? 17  TYR B H    1  
ATOM 2647   H HA   . TYR B 1 17  ? 4.338   2.564   10.930  1.00 45.24 ? 17  TYR B HA   1  
ATOM 2648   H HB2  . TYR B 1 17  ? 3.310   1.715   13.073  1.00 2.33  ? 17  TYR B HB2  1  
ATOM 2649   H HB3  . TYR B 1 17  ? 5.062   1.576   13.058  1.00 41.14 ? 17  TYR B HB3  1  
ATOM 2650   H HD1  . TYR B 1 17  ? 6.389   3.543   14.203  1.00 40.44 ? 17  TYR B HD1  1  
ATOM 2651   H HD2  . TYR B 1 17  ? 2.272   2.720   15.000  1.00 31.14 ? 17  TYR B HD2  1  
ATOM 2652   H HE1  . TYR B 1 17  ? 6.551   4.771   16.301  1.00 64.31 ? 17  TYR B HE1  1  
ATOM 2653   H HE2  . TYR B 1 17  ? 2.463   3.960   17.106  1.00 14.32 ? 17  TYR B HE2  1  
ATOM 2654   H HH   . TYR B 1 17  ? 5.030   5.962   17.837  1.00 41.43 ? 17  TYR B HH   1  
ATOM 2655   N N    . THR B 1 18  ? 2.036   3.571   11.062  1.00 11.34 ? 18  THR B N    1  
ATOM 2656   C CA   . THR B 1 18  ? 0.736   4.223   10.972  1.00 2.20  ? 18  THR B CA   1  
ATOM 2657   C C    . THR B 1 18  ? -0.027  4.005   12.294  1.00 53.21 ? 18  THR B C    1  
ATOM 2658   O O    . THR B 1 18  ? -0.214  2.867   12.732  1.00 1.52  ? 18  THR B O    1  
ATOM 2659   C CB   . THR B 1 18  ? -0.070  3.650   9.769   1.00 53.24 ? 18  THR B CB   1  
ATOM 2660   O OG1  . THR B 1 18  ? 0.646   3.880   8.540   1.00 5.01  ? 18  THR B OG1  1  
ATOM 2661   C CG2  . THR B 1 18  ? -1.474  4.254   9.669   1.00 4.23  ? 18  THR B CG2  1  
ATOM 2662   H H    . THR B 1 18  ? 2.156   2.710   10.617  1.00 73.23 ? 18  THR B H    1  
ATOM 2663   H HA   . THR B 1 18  ? 0.893   5.290   10.805  1.00 10.35 ? 18  THR B HA   1  
ATOM 2664   H HB   . THR B 1 18  ? -0.168  2.573   9.903   1.00 22.22 ? 18  THR B HB   1  
ATOM 2665   H HG1  . THR B 1 18  ? 1.460   3.363   8.543   1.00 53.31 ? 18  THR B HG1  1  
ATOM 2666   H HG21 . THR B 1 18  ? -2.065  3.966   10.530  1.00 50.31 ? 18  THR B HG21 1  
ATOM 2667   H HG22 . THR B 1 18  ? -1.959  3.903   8.775   1.00 22.40 ? 18  THR B HG22 1  
ATOM 2668   H HG23 . THR B 1 18  ? -1.430  5.328   9.619   1.00 23.35 ? 18  THR B HG23 1  
ATOM 2669   N N    . LYS B 1 19  ? -0.416  5.109   12.937  1.00 34.34 ? 19  LYS B N    1  
ATOM 2670   C CA   . LYS B 1 19  ? -1.149  5.083   14.216  1.00 61.32 ? 19  LYS B CA   1  
ATOM 2671   C C    . LYS B 1 19  ? -2.645  5.250   14.001  1.00 64.44 ? 19  LYS B C    1  
ATOM 2672   O O    . LYS B 1 19  ? -3.437  4.810   14.830  1.00 32.35 ? 19  LYS B O    1  
ATOM 2673   C CB   . LYS B 1 19  ? -0.644  6.205   15.146  1.00 63.34 ? 19  LYS B CB   1  
ATOM 2674   C CG   . LYS B 1 19  ? 0.873   6.174   15.367  1.00 12.55 ? 19  LYS B CG   1  
ATOM 2675   C CD   . LYS B 1 19  ? 1.331   7.108   16.501  1.00 72.04 ? 19  LYS B CD   1  
ATOM 2676   C CE   . LYS B 1 19  ? 0.775   6.684   17.867  1.00 63.31 ? 19  LYS B CE   1  
ATOM 2677   N NZ   . LYS B 1 19  ? 1.241   7.574   18.952  1.00 72.23 ? 19  LYS B NZ   1  
ATOM 2678   H H    . LYS B 1 19  ? -0.194  5.975   12.542  1.00 23.14 ? 19  LYS B H    1  
ATOM 2679   H HA   . LYS B 1 19  ? -0.967  4.126   14.701  1.00 74.03 ? 19  LYS B HA   1  
ATOM 2680   H HB2  . LYS B 1 19  ? -0.909  7.171   14.717  1.00 71.15 ? 19  LYS B HB2  1  
ATOM 2681   H HB3  . LYS B 1 19  ? -1.135  6.113   16.112  1.00 30.41 ? 19  LYS B HB3  1  
ATOM 2682   H HG2  . LYS B 1 19  ? 1.175   5.156   15.605  1.00 1.21  ? 19  LYS B HG2  1  
ATOM 2683   H HG3  . LYS B 1 19  ? 1.361   6.473   14.445  1.00 61.25 ? 19  LYS B HG3  1  
ATOM 2684   H HD2  . LYS B 1 19  ? 2.417   7.099   16.547  1.00 11.53 ? 19  LYS B HD2  1  
ATOM 2685   H HD3  . LYS B 1 19  ? 0.996   8.119   16.282  1.00 3.34  ? 19  LYS B HD3  1  
ATOM 2686   H HE2  . LYS B 1 19  ? -0.307  6.713   17.835  1.00 60.43 ? 19  LYS B HE2  1  
ATOM 2687   H HE3  . LYS B 1 19  ? 1.095   5.671   18.086  1.00 0.21  ? 19  LYS B HE3  1  
ATOM 2688   H HZ1  . LYS B 1 19  ? 0.965   8.553   18.762  1.00 43.31 ? 19  LYS B HZ1  1  
ATOM 2689   H HZ2  . LYS B 1 19  ? 2.274   7.534   19.029  1.00 13.33 ? 19  LYS B HZ2  1  
ATOM 2690   H HZ3  . LYS B 1 19  ? 0.826   7.286   19.861  1.00 1.12  ? 19  LYS B HZ3  1  
ATOM 2691   N N    . ASP B 1 20  ? -3.019  5.926   12.906  1.00 71.11 ? 20  ASP B N    1  
ATOM 2692   C CA   . ASP B 1 20  ? -4.418  6.308   12.662  1.00 10.44 ? 20  ASP B CA   1  
ATOM 2693   C C    . ASP B 1 20  ? -4.670  6.571   11.177  1.00 2.03  ? 20  ASP B C    1  
ATOM 2694   O O    . ASP B 1 20  ? -3.839  7.183   10.501  1.00 50.32 ? 20  ASP B O    1  
ATOM 2695   C CB   . ASP B 1 20  ? -4.793  7.555   13.499  1.00 71.01 ? 20  ASP B CB   1  
ATOM 2696   C CG   . ASP B 1 20  ? -6.267  7.970   13.370  1.00 1.40  ? 20  ASP B CG   1  
ATOM 2697   O OD1  . ASP B 1 20  ? -6.575  8.860   12.549  1.00 33.13 ? 20  ASP B OD1  1  
ATOM 2698   O OD2  . ASP B 1 20  ? -7.121  7.396   14.084  1.00 72.41 ? 20  ASP B OD2  1  
ATOM 2699   H H    . ASP B 1 20  ? -2.340  6.155   12.236  1.00 11.45 ? 20  ASP B H    1  
ATOM 2700   H HA   . ASP B 1 20  ? -5.043  5.474   12.974  1.00 34.31 ? 20  ASP B HA   1  
ATOM 2701   H HB2  . ASP B 1 20  ? -4.585  7.346   14.541  1.00 62.25 ? 20  ASP B HB2  1  
ATOM 2702   H HB3  . ASP B 1 20  ? -4.168  8.386   13.191  1.00 3.34  ? 20  ASP B HB3  1  
ATOM 2703   N N    . ILE B 1 21  ? -5.840  6.109   10.705  1.00 10.01 ? 21  ILE B N    1  
ATOM 2704   C CA   . ILE B 1 21  ? -6.332  6.283   9.334   1.00 74.04 ? 21  ILE B CA   1  
ATOM 2705   C C    . ILE B 1 21  ? -7.833  6.551   9.402   1.00 43.33 ? 21  ILE B C    1  
ATOM 2706   O O    . ILE B 1 21  ? -8.553  5.950   10.207  1.00 62.03 ? 21  ILE B O    1  
ATOM 2707   C CB   . ILE B 1 21  ? -6.085  5.019   8.399   1.00 35.54 ? 21  ILE B CB   1  
ATOM 2708   C CG1  . ILE B 1 21  ? -4.577  4.701   8.276   1.00 2.41  ? 21  ILE B CG1  1  
ATOM 2709   C CG2  . ILE B 1 21  ? -6.714  5.209   6.986   1.00 54.31 ? 21  ILE B CG2  1  
ATOM 2710   C CD1  . ILE B 1 21  ? -3.764  5.800   7.645   1.00 15.21 ? 21  ILE B CD1  1  
ATOM 2711   H H    . ILE B 1 21  ? -6.428  5.655   11.337  1.00 15.15 ? 21  ILE B H    1  
ATOM 2712   H HA   . ILE B 1 21  ? -5.836  7.150   8.896   1.00 12.40 ? 21  ILE B HA   1  
ATOM 2713   H HB   . ILE B 1 21  ? -6.576  4.164   8.863   1.00 64.31 ? 21  ILE B HB   1  
ATOM 2714   H HG12 . ILE B 1 21  ? -4.169  4.539   9.266   1.00 62.23 ? 21  ILE B HG12 1  
ATOM 2715   H HG13 . ILE B 1 21  ? -4.421  3.808   7.697   1.00 42.33 ? 21  ILE B HG13 1  
ATOM 2716   H HG21 . ILE B 1 21  ? -7.794  5.246   7.064   1.00 44.32 ? 21  ILE B HG21 1  
ATOM 2717   H HG22 . ILE B 1 21  ? -6.438  4.389   6.344   1.00 4.24  ? 21  ILE B HG22 1  
ATOM 2718   H HG23 . ILE B 1 21  ? -6.361  6.134   6.545   1.00 12.45 ? 21  ILE B HG23 1  
ATOM 2719   H HD11 . ILE B 1 21  ? -3.754  6.665   8.294   1.00 13.44 ? 21  ILE B HD11 1  
ATOM 2720   H HD12 . ILE B 1 21  ? -4.178  6.081   6.693   1.00 54.41 ? 21  ILE B HD12 1  
ATOM 2721   H HD13 . ILE B 1 21  ? -2.750  5.458   7.503   1.00 63.34 ? 21  ILE B HD13 1  
ATOM 2722   N N    . SER B 1 22  ? -8.279  7.439   8.532   1.00 22.53 ? 22  SER B N    1  
ATOM 2723   C CA   . SER B 1 22  ? -9.678  7.737   8.320   1.00 54.42 ? 22  SER B CA   1  
ATOM 2724   C C    . SER B 1 22  ? -9.852  8.059   6.836   1.00 1.24  ? 22  SER B C    1  
ATOM 2725   O O    . SER B 1 22  ? -9.050  8.813   6.268   1.00 53.24 ? 22  SER B O    1  
ATOM 2726   C CB   . SER B 1 22  ? -10.118 8.921   9.208   1.00 25.42 ? 22  SER B CB   1  
ATOM 2727   O OG   . SER B 1 22  ? -11.515 9.105   9.156   1.00 51.50 ? 22  SER B OG   1  
ATOM 2728   H H    . SER B 1 22  ? -7.622  7.911   7.983   1.00 64.41 ? 22  SER B H    1  
ATOM 2729   H HA   . SER B 1 22  ? -10.268 6.851   8.575   1.00 61.25 ? 22  SER B HA   1  
ATOM 2730   H HB2  . SER B 1 22  ? -9.837  8.729   10.235  1.00 32.01 ? 22  SER B HB2  1  
ATOM 2731   H HB3  . SER B 1 22  ? -9.638  9.833   8.876   1.00 63.35 ? 22  SER B HB3  1  
ATOM 2732   H HG   . SER B 1 22  ? -11.753 9.421   8.283   1.00 5.45  ? 22  SER B HG   1  
ATOM 2733   N N    . PHE B 1 23  ? -10.850 7.444   6.203   1.00 34.34 ? 23  PHE B N    1  
ATOM 2734   C CA   . PHE B 1 23  ? -11.225 7.740   4.821   1.00 63.23 ? 23  PHE B CA   1  
ATOM 2735   C C    . PHE B 1 23  ? -12.736 7.585   4.707   1.00 34.25 ? 23  PHE B C    1  
ATOM 2736   O O    . PHE B 1 23  ? -13.249 6.473   4.782   1.00 11.01 ? 23  PHE B O    1  
ATOM 2737   C CB   . PHE B 1 23  ? -10.494 6.818   3.800   1.00 10.23 ? 23  PHE B CB   1  
ATOM 2738   C CG   . PHE B 1 23  ? -10.850 7.124   2.334   1.00 3.43  ? 23  PHE B CG   1  
ATOM 2739   C CD1  . PHE B 1 23  ? -10.189 8.139   1.638   1.00 42.23 ? 23  PHE B CD1  1  
ATOM 2740   C CD2  . PHE B 1 23  ? -11.863 6.425   1.669   1.00 44.44 ? 23  PHE B CD2  1  
ATOM 2741   C CE1  . PHE B 1 23  ? -10.526 8.446   0.336   1.00 42.44 ? 23  PHE B CE1  1  
ATOM 2742   C CE2  . PHE B 1 23  ? -12.196 6.732   0.364   1.00 33.42 ? 23  PHE B CE2  1  
ATOM 2743   C CZ   . PHE B 1 23  ? -11.528 7.743   -0.303  1.00 3.50  ? 23  PHE B CZ   1  
ATOM 2744   H H    . PHE B 1 23  ? -11.368 6.769   6.689   1.00 0.13  ? 23  PHE B H    1  
ATOM 2745   H HA   . PHE B 1 23  ? -10.962 8.781   4.614   1.00 75.14 ? 23  PHE B HA   1  
ATOM 2746   H HB2  . PHE B 1 23  ? -9.422  6.938   3.923   1.00 41.44 ? 23  PHE B HB2  1  
ATOM 2747   H HB3  . PHE B 1 23  ? -10.748 5.780   4.003   1.00 21.03 ? 23  PHE B HB3  1  
ATOM 2748   H HD1  . PHE B 1 23  ? -9.401  8.692   2.133   1.00 14.25 ? 23  PHE B HD1  1  
ATOM 2749   H HD2  . PHE B 1 23  ? -12.392 5.632   2.185   1.00 53.22 ? 23  PHE B HD2  1  
ATOM 2750   H HE1  . PHE B 1 23  ? -10.002 9.237   -0.186  1.00 21.14 ? 23  PHE B HE1  1  
ATOM 2751   H HE2  . PHE B 1 23  ? -12.981 6.182   -0.137  1.00 55.14 ? 23  PHE B HE2  1  
ATOM 2752   H HZ   . PHE B 1 23  ? -11.791 7.984   -1.325  1.00 21.12 ? 23  PHE B HZ   1  
ATOM 2753   N N    . GLU B 1 24  ? -13.446 8.703   4.528   1.00 13.33 ? 24  GLU B N    1  
ATOM 2754   C CA   . GLU B 1 24  ? -14.907 8.708   4.451   1.00 33.10 ? 24  GLU B CA   1  
ATOM 2755   C C    . GLU B 1 24  ? -15.324 9.207   3.075   1.00 74.33 ? 24  GLU B C    1  
ATOM 2756   O O    . GLU B 1 24  ? -14.800 10.201  2.568   1.00 73.24 ? 24  GLU B O    1  
ATOM 2757   C CB   . GLU B 1 24  ? -15.556 9.613   5.547   1.00 4.14  ? 24  GLU B CB   1  
ATOM 2758   C CG   . GLU B 1 24  ? -14.904 9.544   6.953   1.00 74.31 ? 24  GLU B CG   1  
ATOM 2759   C CD   . GLU B 1 24  ? -13.802 10.605  7.156   1.00 12.22 ? 24  GLU B CD   1  
ATOM 2760   O OE1  . GLU B 1 24  ? -12.653 10.388  6.717   1.00 4.14  ? 24  GLU B OE1  1  
ATOM 2761   O OE2  . GLU B 1 24  ? -14.092 11.669  7.754   1.00 33.31 ? 24  GLU B OE2  1  
ATOM 2762   H H    . GLU B 1 24  ? -12.967 9.560   4.452   1.00 21.12 ? 24  GLU B H    1  
ATOM 2763   H HA   . GLU B 1 24  ? -15.269 7.682   4.582   1.00 21.22 ? 24  GLU B HA   1  
ATOM 2764   H HB2  . GLU B 1 24  ? -15.536 10.653  5.215   1.00 63.10 ? 24  GLU B HB2  1  
ATOM 2765   H HB3  . GLU B 1 24  ? -16.595 9.320   5.646   1.00 31.50 ? 24  GLU B HB3  1  
ATOM 2766   H HG2  . GLU B 1 24  ? -15.675 9.691   7.702   1.00 74.31 ? 24  GLU B HG2  1  
ATOM 2767   H HG3  . GLU B 1 24  ? -14.470 8.554   7.101   1.00 44.22 ? 24  GLU B HG3  1  
ATOM 2768   N N    . ALA B 1 25  ? -16.263 8.503   2.484   1.00 24.43 ? 25  ALA B N    1  
ATOM 2769   C CA   . ALA B 1 25  ? -16.923 8.895   1.253   1.00 34.35 ? 25  ALA B CA   1  
ATOM 2770   C C    . ALA B 1 25  ? -18.437 8.906   1.554   1.00 3.13  ? 25  ALA B C    1  
ATOM 2771   O O    . ALA B 1 25  ? -19.135 7.914   1.315   1.00 15.23 ? 25  ALA B O    1  
ATOM 2772   C CB   . ALA B 1 25  ? -16.501 7.946   0.121   1.00 62.23 ? 25  ALA B CB   1  
ATOM 2773   H H    . ALA B 1 25  ? -16.538 7.671   2.903   1.00 23.12 ? 25  ALA B H    1  
ATOM 2774   H HA   . ALA B 1 25  ? -16.615 9.903   0.985   1.00 24.12 ? 25  ALA B HA   1  
ATOM 2775   H HB1  . ALA B 1 25  ? -15.428 7.992   -0.016  1.00 21.22 ? 25  ALA B HB1  1  
ATOM 2776   H HB2  . ALA B 1 25  ? -16.990 8.235   -0.797  1.00 32.00 ? 25  ALA B HB2  1  
ATOM 2777   H HB3  . ALA B 1 25  ? -16.788 6.931   0.364   1.00 25.20 ? 25  ALA B HB3  1  
ATOM 2778   N N    . PRO B 1 26  ? -18.949 10.023  2.185   1.00 1.44  ? 26  PRO B N    1  
ATOM 2779   C CA   . PRO B 1 26  ? -20.346 10.103  2.709   1.00 44.43 ? 26  PRO B CA   1  
ATOM 2780   C C    . PRO B 1 26  ? -21.398 10.074  1.586   1.00 71.51 ? 26  PRO B C    1  
ATOM 2781   O O    . PRO B 1 26  ? -22.494 9.542   1.751   1.00 22.23 ? 26  PRO B O    1  
ATOM 2782   C CB   . PRO B 1 26  ? -20.350 11.459  3.467   1.00 74.15 ? 26  PRO B CB   1  
ATOM 2783   C CG   . PRO B 1 26  ? -19.290 12.280  2.795   1.00 41.24 ? 26  PRO B CG   1  
ATOM 2784   C CD   . PRO B 1 26  ? -18.204 11.301  2.429   1.00 42.13 ? 26  PRO B CD   1  
ATOM 2785   H HA   . PRO B 1 26  ? -20.549 9.296   3.408   1.00 33.23 ? 26  PRO B HA   1  
ATOM 2786   H HB2  . PRO B 1 26  ? -21.326 11.938  3.401   1.00 31.45 ? 26  PRO B HB2  1  
ATOM 2787   H HB3  . PRO B 1 26  ? -20.093 11.303  4.508   1.00 52.12 ? 26  PRO B HB3  1  
ATOM 2788   H HG2  . PRO B 1 26  ? -19.695 12.756  1.902   1.00 1.23  ? 26  PRO B HG2  1  
ATOM 2789   H HG3  . PRO B 1 26  ? -18.898 13.035  3.469   1.00 2.33  ? 26  PRO B HG3  1  
ATOM 2790   H HD2  . PRO B 1 26  ? -17.683 11.625  1.534   1.00 72.40 ? 26  PRO B HD2  1  
ATOM 2791   H HD3  . PRO B 1 26  ? -17.501 11.181  3.247   1.00 23.23 ? 26  PRO B HD3  1  
ATOM 2792   N N    . ASN B 1 27  ? -21.023 10.646  0.439   1.00 23.42 ? 27  ASN B N    1  
ATOM 2793   C CA   . ASN B 1 27  ? -21.848 10.700  -0.775  1.00 72.21 ? 27  ASN B CA   1  
ATOM 2794   C C    . ASN B 1 27  ? -21.169 9.919   -1.899  1.00 0.31  ? 27  ASN B C    1  
ATOM 2795   O O    . ASN B 1 27  ? -21.355 10.232  -3.055  1.00 52.30 ? 27  ASN B O    1  
ATOM 2796   C CB   . ASN B 1 27  ? -22.135 12.176  -1.180  1.00 40.32 ? 27  ASN B CB   1  
ATOM 2797   C CG   . ASN B 1 27  ? -20.887 13.050  -1.362  1.00 5.31  ? 27  ASN B CG   1  
ATOM 2798   O OD1  . ASN B 1 27  ? -19.833 12.809  -0.775  1.00 51.51 ? 27  ASN B OD1  1  
ATOM 2799   N ND2  . ASN B 1 27  ? -21.013 14.094  -2.142  1.00 23.54 ? 27  ASN B ND2  1  
ATOM 2800   H H    . ASN B 1 27  ? -20.136 11.057  0.402   1.00 34.12 ? 27  ASN B H    1  
ATOM 2801   H HA   . ASN B 1 27  ? -22.793 10.210  -0.565  1.00 23.12 ? 27  ASN B HA   1  
ATOM 2802   H HB2  . ASN B 1 27  ? -22.685 12.176  -2.116  1.00 64.30 ? 27  ASN B HB2  1  
ATOM 2803   H HB3  . ASN B 1 27  ? -22.756 12.627  -0.430  1.00 0.52  ? 27  ASN B HB3  1  
ATOM 2804   H HD21 . ASN B 1 27  ? -21.886 14.254  -2.559  1.00 44.51 ? 27  ASN B HD21 1  
ATOM 2805   H HD22 . ASN B 1 27  ? -20.228 14.663  -2.286  1.00 20.41 ? 27  ASN B HD22 1  
ATOM 2806   N N    . ALA B 1 28  ? -20.429 8.861   -1.509  1.00 71.54 ? 28  ALA B N    1  
ATOM 2807   C CA   . ALA B 1 28  ? -19.624 7.999   -2.420  1.00 60.34 ? 28  ALA B CA   1  
ATOM 2808   C C    . ALA B 1 28  ? -20.316 7.596   -3.766  1.00 3.40  ? 28  ALA B C    1  
ATOM 2809   O O    . ALA B 1 28  ? -19.680 7.710   -4.815  1.00 32.15 ? 28  ALA B O    1  
ATOM 2810   C CB   . ALA B 1 28  ? -19.156 6.744   -1.671  1.00 4.33  ? 28  ALA B CB   1  
ATOM 2811   H H    . ALA B 1 28  ? -20.402 8.652   -0.545  1.00 65.32 ? 28  ALA B H    1  
ATOM 2812   H HA   . ALA B 1 28  ? -18.733 8.571   -2.659  1.00 24.43 ? 28  ALA B HA   1  
ATOM 2813   H HB1  . ALA B 1 28  ? -19.968 6.030   -1.585  1.00 41.24 ? 28  ALA B HB1  1  
ATOM 2814   H HB2  . ALA B 1 28  ? -18.823 7.012   -0.679  1.00 62.03 ? 28  ALA B HB2  1  
ATOM 2815   H HB3  . ALA B 1 28  ? -18.331 6.286   -2.202  1.00 73.44 ? 28  ALA B HB3  1  
ATOM 2816   N N    . PRO B 1 29  ? -21.609 7.096   -3.783  1.00 4.15  ? 29  PRO B N    1  
ATOM 2817   C CA   . PRO B 1 29  ? -22.299 6.749   -5.053  1.00 21.33 ? 29  PRO B CA   1  
ATOM 2818   C C    . PRO B 1 29  ? -22.899 7.988   -5.769  1.00 10.22 ? 29  PRO B C    1  
ATOM 2819   O O    . PRO B 1 29  ? -23.076 7.988   -6.994  1.00 21.41 ? 29  PRO B O    1  
ATOM 2820   C CB   . PRO B 1 29  ? -23.415 5.753   -4.597  1.00 35.40 ? 29  PRO B CB   1  
ATOM 2821   C CG   . PRO B 1 29  ? -23.222 5.557   -3.111  1.00 30.41 ? 29  PRO B CG   1  
ATOM 2822   C CD   . PRO B 1 29  ? -22.485 6.771   -2.625  1.00 25.22 ? 29  PRO B CD   1  
ATOM 2823   H HA   . PRO B 1 29  ? -21.621 6.237   -5.740  1.00 72.32 ? 29  PRO B HA   1  
ATOM 2824   H HB2  . PRO B 1 29  ? -24.408 6.152   -4.810  1.00 5.10  ? 29  PRO B HB2  1  
ATOM 2825   H HB3  . PRO B 1 29  ? -23.298 4.804   -5.112  1.00 41.33 ? 29  PRO B HB3  1  
ATOM 2826   H HG2  . PRO B 1 29  ? -24.184 5.471   -2.615  1.00 14.01 ? 29  PRO B HG2  1  
ATOM 2827   H HG3  . PRO B 1 29  ? -22.629 4.663   -2.916  1.00 54.44 ? 29  PRO B HG3  1  
ATOM 2828   H HD2  . PRO B 1 29  ? -23.171 7.591   -2.417  1.00 74.33 ? 29  PRO B HD2  1  
ATOM 2829   H HD3  . PRO B 1 29  ? -21.899 6.541   -1.743  1.00 33.20 ? 29  PRO B HD3  1  
ATOM 2830   N N    . HIS B 1 30  ? -23.195 9.047   -4.985  1.00 24.23 ? 30  HIS B N    1  
ATOM 2831   C CA   . HIS B 1 30  ? -23.940 10.237  -5.469  1.00 20.31 ? 30  HIS B CA   1  
ATOM 2832   C C    . HIS B 1 30  ? -23.020 11.376  -5.925  1.00 30.35 ? 30  HIS B C    1  
ATOM 2833   O O    . HIS B 1 30  ? -23.479 12.265  -6.636  1.00 63.30 ? 30  HIS B O    1  
ATOM 2834   C CB   . HIS B 1 30  ? -24.932 10.726  -4.389  1.00 12.51 ? 30  HIS B CB   1  
ATOM 2835   C CG   . HIS B 1 30  ? -26.110 9.796   -4.209  1.00 44.15 ? 30  HIS B CG   1  
ATOM 2836   N ND1  . HIS B 1 30  ? -26.141 8.770   -3.289  1.00 12.50 ? 30  HIS B ND1  1  
ATOM 2837   C CD2  . HIS B 1 30  ? -27.295 9.734   -4.866  1.00 72.11 ? 30  HIS B CD2  1  
ATOM 2838   C CE1  . HIS B 1 30  ? -27.285 8.123   -3.392  1.00 51.35 ? 30  HIS B CE1  1  
ATOM 2839   N NE2  . HIS B 1 30  ? -28.001 8.688   -4.335  1.00 54.40 ? 30  HIS B NE2  1  
ATOM 2840   H H    . HIS B 1 30  ? -22.888 9.034   -4.054  1.00 43.41 ? 30  HIS B H    1  
ATOM 2841   H HA   . HIS B 1 30  ? -24.517 9.930   -6.341  1.00 25.10 ? 30  HIS B HA   1  
ATOM 2842   H HB2  . HIS B 1 30  ? -24.420 10.815  -3.435  1.00 14.41 ? 30  HIS B HB2  1  
ATOM 2843   H HB3  . HIS B 1 30  ? -25.323 11.701  -4.669  1.00 12.11 ? 30  HIS B HB3  1  
ATOM 2844   H HD1  . HIS B 1 30  ? -25.438 8.558   -2.639  1.00 71.51 ? 30  HIS B HD1  1  
ATOM 2845   H HD2  . HIS B 1 30  ? -27.621 10.385  -5.667  1.00 61.54 ? 30  HIS B HD2  1  
ATOM 2846   H HE1  . HIS B 1 30  ? -27.584 7.268   -2.798  1.00 63.43 ? 30  HIS B HE1  1  
ATOM 2847   H HE2  . HIS B 1 30  ? -28.964 8.565   -4.438  1.00 37.99 ? 30  HIS B HE2  1  
ATOM 2848   N N    . VAL B 1 31  ? -21.734 11.328  -5.542  1.00 41.05 ? 31  VAL B N    1  
ATOM 2849   C CA   . VAL B 1 31  ? -20.702 12.307  -5.981  1.00 75.15 ? 31  VAL B CA   1  
ATOM 2850   C C    . VAL B 1 31  ? -20.454 12.242  -7.514  1.00 43.04 ? 31  VAL B C    1  
ATOM 2851   O O    . VAL B 1 31  ? -19.820 13.122  -8.087  1.00 65.20 ? 31  VAL B O    1  
ATOM 2852   C CB   . VAL B 1 31  ? -19.346 12.078  -5.206  1.00 62.30 ? 31  VAL B CB   1  
ATOM 2853   C CG1  . VAL B 1 31  ? -18.705 10.719  -5.572  1.00 41.42 ? 31  VAL B CG1  1  
ATOM 2854   C CG2  . VAL B 1 31  ? -18.352 13.245  -5.435  1.00 20.15 ? 31  VAL B CG2  1  
ATOM 2855   H H    . VAL B 1 31  ? -21.469 10.628  -4.919  1.00 34.40 ? 31  VAL B H    1  
ATOM 2856   H HA   . VAL B 1 31  ? -21.070 13.303  -5.737  1.00 40.01 ? 31  VAL B HA   1  
ATOM 2857   H HB   . VAL B 1 31  ? -19.580 12.047  -4.140  1.00 5.41  ? 31  VAL B HB   1  
ATOM 2858   H HG11 . VAL B 1 31  ? -19.401 9.918   -5.359  1.00 55.11 ? 31  VAL B HG11 1  
ATOM 2859   H HG12 . VAL B 1 31  ? -17.802 10.567  -4.994  1.00 13.13 ? 31  VAL B HG12 1  
ATOM 2860   H HG13 . VAL B 1 31  ? -18.457 10.704  -6.629  1.00 2.10  ? 31  VAL B HG13 1  
ATOM 2861   H HG21 . VAL B 1 31  ? -18.802 14.176  -5.114  1.00 41.44 ? 31  VAL B HG21 1  
ATOM 2862   H HG22 . VAL B 1 31  ? -18.101 13.315  -6.485  1.00 73.52 ? 31  VAL B HG22 1  
ATOM 2863   H HG23 . VAL B 1 31  ? -17.448 13.074  -4.864  1.00 31.13 ? 31  VAL B HG23 1  
ATOM 2864   N N    . PHE B 1 32  ? -20.971 11.182  -8.162  1.00 41.32 ? 32  PHE B N    1  
ATOM 2865   C CA   . PHE B 1 32  ? -20.906 10.996  -9.629  1.00 50.20 ? 32  PHE B CA   1  
ATOM 2866   C C    . PHE B 1 32  ? -21.528 12.192  -10.414 1.00 73.15 ? 32  PHE B C    1  
ATOM 2867   O O    . PHE B 1 32  ? -21.155 12.446  -11.567 1.00 53.41 ? 32  PHE B O    1  
ATOM 2868   C CB   . PHE B 1 32  ? -21.594 9.647   -10.000 1.00 64.33 ? 32  PHE B CB   1  
ATOM 2869   C CG   . PHE B 1 32  ? -21.644 9.334   -11.503 1.00 32.42 ? 32  PHE B CG   1  
ATOM 2870   C CD1  . PHE B 1 32  ? -20.469 9.256   -12.257 1.00 30.41 ? 32  PHE B CD1  1  
ATOM 2871   C CD2  . PHE B 1 32  ? -22.861 9.142   -12.161 1.00 33.45 ? 32  PHE B CD2  1  
ATOM 2872   C CE1  . PHE B 1 32  ? -20.512 9.004   -13.612 1.00 41.13 ? 32  PHE B CE1  1  
ATOM 2873   C CE2  . PHE B 1 32  ? -22.899 8.882   -13.517 1.00 54.44 ? 32  PHE B CE2  1  
ATOM 2874   C CZ   . PHE B 1 32  ? -21.726 8.815   -14.242 1.00 22.04 ? 32  PHE B CZ   1  
ATOM 2875   H H    . PHE B 1 32  ? -21.398 10.482  -7.627  1.00 44.00 ? 32  PHE B H    1  
ATOM 2876   H HA   . PHE B 1 32  ? -19.858 10.931  -9.896  1.00 61.22 ? 32  PHE B HA   1  
ATOM 2877   H HB2  . PHE B 1 32  ? -21.057 8.839   -9.516  1.00 41.43 ? 32  PHE B HB2  1  
ATOM 2878   H HB3  . PHE B 1 32  ? -22.611 9.659   -9.616  1.00 54.30 ? 32  PHE B HB3  1  
ATOM 2879   H HD1  . PHE B 1 32  ? -19.512 9.400   -11.767 1.00 43.45 ? 32  PHE B HD1  1  
ATOM 2880   H HD2  . PHE B 1 32  ? -23.784 9.191   -11.597 1.00 42.52 ? 32  PHE B HD2  1  
ATOM 2881   H HE1  . PHE B 1 32  ? -19.594 8.945   -14.182 1.00 72.22 ? 32  PHE B HE1  1  
ATOM 2882   H HE2  . PHE B 1 32  ? -23.850 8.734   -14.013 1.00 72.21 ? 32  PHE B HE2  1  
ATOM 2883   H HZ   . PHE B 1 32  ? -21.758 8.620   -15.306 1.00 4.54  ? 32  PHE B HZ   1  
ATOM 2884   N N    . GLN B 1 33  ? -22.467 12.915  -9.775  1.00 22.40 ? 33  GLN B N    1  
ATOM 2885   C CA   . GLN B 1 33  ? -23.083 14.135  -10.349 1.00 1.14  ? 33  GLN B CA   1  
ATOM 2886   C C    . GLN B 1 33  ? -22.079 15.309  -10.368 1.00 11.24 ? 33  GLN B C    1  
ATOM 2887   O O    . GLN B 1 33  ? -22.172 16.198  -11.212 1.00 72.42 ? 33  GLN B O    1  
ATOM 2888   C CB   . GLN B 1 33  ? -24.365 14.507  -9.551  1.00 31.22 ? 33  GLN B CB   1  
ATOM 2889   C CG   . GLN B 1 33  ? -24.128 14.877  -8.070  1.00 3.33  ? 33  GLN B CG   1  
ATOM 2890   C CD   . GLN B 1 33  ? -25.408 14.927  -7.227  1.00 14.50 ? 33  GLN B CD   1  
ATOM 2891   O OE1  . GLN B 1 33  ? -26.480 15.286  -7.716  1.00 21.22 ? 33  GLN B OE1  1  
ATOM 2892   N NE2  . GLN B 1 33  ? -25.309 14.539  -5.968  1.00 41.22 ? 33  GLN B NE2  1  
ATOM 2893   H H    . GLN B 1 33  ? -22.757 12.615  -8.888  1.00 12.42 ? 33  GLN B H    1  
ATOM 2894   H HA   . GLN B 1 33  ? -23.369 13.912  -11.377 1.00 63.25 ? 33  GLN B HA   1  
ATOM 2895   H HB2  . GLN B 1 33  ? -24.857 15.342  -10.041 1.00 41.23 ? 33  GLN B HB2  1  
ATOM 2896   H HB3  . GLN B 1 33  ? -25.039 13.657  -9.582  1.00 3.45  ? 33  GLN B HB3  1  
ATOM 2897   H HG2  . GLN B 1 33  ? -23.455 14.147  -7.637  1.00 22.33 ? 33  GLN B HG2  1  
ATOM 2898   H HG3  . GLN B 1 33  ? -23.652 15.850  -8.031  1.00 73.44 ? 33  GLN B HG3  1  
ATOM 2899   H HE21 . GLN B 1 33  ? -24.427 14.243  -5.640  1.00 34.21 ? 33  GLN B HE21 1  
ATOM 2900   H HE22 . GLN B 1 33  ? -26.113 14.559  -5.414  1.00 42.42 ? 33  GLN B HE22 1  
ATOM 2901   N N    . LYS B 1 34  ? -21.142 15.300  -9.410  1.00 14.32 ? 34  LYS B N    1  
ATOM 2902   C CA   . LYS B 1 34  ? -20.062 16.296  -9.294  1.00 13.40 ? 34  LYS B CA   1  
ATOM 2903   C C    . LYS B 1 34  ? -18.743 15.638  -9.700  1.00 30.41 ? 34  LYS B C    1  
ATOM 2904   O O    . LYS B 1 34  ? -17.952 15.189  -8.848  1.00 74.33 ? 34  LYS B O    1  
ATOM 2905   C CB   . LYS B 1 34  ? -19.981 16.828  -7.847  1.00 31.34 ? 34  LYS B CB   1  
ATOM 2906   C CG   . LYS B 1 34  ? -21.258 17.505  -7.354  1.00 51.14 ? 34  LYS B CG   1  
ATOM 2907   C CD   . LYS B 1 34  ? -21.586 18.834  -8.063  1.00 41.34 ? 34  LYS B CD   1  
ATOM 2908   C CE   . LYS B 1 34  ? -22.987 19.342  -7.685  1.00 71.00 ? 34  LYS B CE   1  
ATOM 2909   N NZ   . LYS B 1 34  ? -23.141 19.536  -6.219  1.00 53.33 ? 34  LYS B NZ   1  
ATOM 2910   H H    . LYS B 1 34  ? -21.172 14.581  -8.752  1.00 14.51 ? 34  LYS B H    1  
ATOM 2911   H HA   . LYS B 1 34  ? -20.267 17.127  -9.971  1.00 34.35 ? 34  LYS B HA   1  
ATOM 2912   H HB2  . LYS B 1 34  ? -19.760 15.994  -7.183  1.00 13.12 ? 34  LYS B HB2  1  
ATOM 2913   H HB3  . LYS B 1 34  ? -19.170 17.539  -7.780  1.00 70.24 ? 34  LYS B HB3  1  
ATOM 2914   H HG2  . LYS B 1 34  ? -22.084 16.819  -7.502  1.00 45.41 ? 34  LYS B HG2  1  
ATOM 2915   H HG3  . LYS B 1 34  ? -21.154 17.696  -6.289  1.00 65.44 ? 34  LYS B HG3  1  
ATOM 2916   H HD2  . LYS B 1 34  ? -20.853 19.579  -7.772  1.00 13.30 ? 34  LYS B HD2  1  
ATOM 2917   H HD3  . LYS B 1 34  ? -21.540 18.692  -9.135  1.00 64.03 ? 34  LYS B HD3  1  
ATOM 2918   H HE2  . LYS B 1 34  ? -23.162 20.287  -8.175  1.00 0.20  ? 34  LYS B HE2  1  
ATOM 2919   H HE3  . LYS B 1 34  ? -23.727 18.625  -8.020  1.00 43.15 ? 34  LYS B HE3  1  
ATOM 2920   H HZ1  . LYS B 1 34  ? -22.930 18.652  -5.715  1.00 20.44 ? 34  LYS B HZ1  1  
ATOM 2921   H HZ2  . LYS B 1 34  ? -24.115 19.821  -5.995  1.00 15.04 ? 34  LYS B HZ2  1  
ATOM 2922   H HZ3  . LYS B 1 34  ? -22.495 20.275  -5.883  1.00 64.53 ? 34  LYS B HZ3  1  
ATOM 2923   N N    . ASP B 1 35  ? -18.531 15.547  -11.005 1.00 23.13 ? 35  ASP B N    1  
ATOM 2924   C CA   . ASP B 1 35  ? -17.381 14.850  -11.585 1.00 54.44 ? 35  ASP B CA   1  
ATOM 2925   C C    . ASP B 1 35  ? -16.440 15.854  -12.272 1.00 1.42  ? 35  ASP B C    1  
ATOM 2926   O O    . ASP B 1 35  ? -16.846 16.524  -13.222 1.00 33.43 ? 35  ASP B O    1  
ATOM 2927   C CB   . ASP B 1 35  ? -17.870 13.734  -12.562 1.00 62.42 ? 35  ASP B CB   1  
ATOM 2928   C CG   . ASP B 1 35  ? -18.662 14.223  -13.793 1.00 60.13 ? 35  ASP B CG   1  
ATOM 2929   O OD1  . ASP B 1 35  ? -19.735 14.840  -13.616 1.00 33.14 ? 35  ASP B OD1  1  
ATOM 2930   O OD2  . ASP B 1 35  ? -18.220 13.980  -14.939 1.00 51.35 ? 35  ASP B OD2  1  
ATOM 2931   H H    . ASP B 1 35  ? -19.178 15.960  -11.612 1.00 15.11 ? 35  ASP B H    1  
ATOM 2932   H HA   . ASP B 1 35  ? -16.831 14.367  -10.775 1.00 52.34 ? 35  ASP B HA   1  
ATOM 2933   H HB2  . ASP B 1 35  ? -17.004 13.176  -12.909 1.00 62.44 ? 35  ASP B HB2  1  
ATOM 2934   H HB3  . ASP B 1 35  ? -18.505 13.043  -12.007 1.00 21.13 ? 35  ASP B HB3  1  
ATOM 2935   N N    . TRP B 1 36  ? -15.259 16.060  -11.637 1.00 63.21 ? 36  TRP B N    1  
ATOM 2936   C CA   . TRP B 1 36  ? -13.979 16.580  -12.217 1.00 5.11  ? 36  TRP B CA   1  
ATOM 2937   C C    . TRP B 1 36  ? -13.068 17.076  -11.076 1.00 70.24 ? 36  TRP B C    1  
ATOM 2938   O O    . TRP B 1 36  ? -13.197 16.571  -9.956  1.00 41.44 ? 36  TRP B O    1  
ATOM 2939   C CB   . TRP B 1 36  ? -14.127 17.596  -13.409 1.00 72.30 ? 36  TRP B CB   1  
ATOM 2940   C CG   . TRP B 1 36  ? -14.126 16.963  -14.820 1.00 61.50 ? 36  TRP B CG   1  
ATOM 2941   C CD1  . TRP B 1 36  ? -13.924 17.634  -16.003 1.00 55.54 ? 36  TRP B CD1  1  
ATOM 2942   C CD2  . TRP B 1 36  ? -14.316 15.562  -15.205 1.00 43.35 ? 36  TRP B CD2  1  
ATOM 2943   N NE1  . TRP B 1 36  ? -14.028 16.775  -17.066 1.00 44.31 ? 36  TRP B NE1  1  
ATOM 2944   C CE2  . TRP B 1 36  ? -14.254 15.506  -16.607 1.00 52.34 ? 36  TRP B CE2  1  
ATOM 2945   C CE3  . TRP B 1 36  ? -14.543 14.353  -14.512 1.00 0.14  ? 36  TRP B CE3  1  
ATOM 2946   C CZ2  . TRP B 1 36  ? -14.415 14.311  -17.313 1.00 43.32 ? 36  TRP B CZ2  1  
ATOM 2947   C CZ3  . TRP B 1 36  ? -14.699 13.186  -15.203 1.00 2.23  ? 36  TRP B CZ3  1  
ATOM 2948   C CH2  . TRP B 1 36  ? -14.637 13.162  -16.589 1.00 74.33 ? 36  TRP B CH2  1  
ATOM 2949   H H    . TRP B 1 36  ? -15.242 15.846  -10.679 1.00 31.11 ? 36  TRP B H    1  
ATOM 2950   H HA   . TRP B 1 36  ? -13.481 15.698  -12.599 1.00 70.43 ? 36  TRP B HA   1  
ATOM 2951   H HB2  . TRP B 1 36  ? -15.060 18.137  -13.298 1.00 63.20 ? 36  TRP B HB2  1  
ATOM 2952   H HB3  . TRP B 1 36  ? -13.313 18.315  -13.371 1.00 23.20 ? 36  TRP B HB3  1  
ATOM 2953   H HD1  . TRP B 1 36  ? -13.745 18.697  -16.078 1.00 43.42 ? 36  TRP B HD1  1  
ATOM 2954   H HE1  . TRP B 1 36  ? -13.941 17.029  -18.013 1.00 15.34 ? 36  TRP B HE1  1  
ATOM 2955   H HE3  . TRP B 1 36  ? -14.594 14.339  -13.433 1.00 30.31 ? 36  TRP B HE3  1  
ATOM 2956   H HZ2  . TRP B 1 36  ? -14.365 14.283  -18.398 1.00 14.11 ? 36  TRP B HZ2  1  
ATOM 2957   H HZ3  . TRP B 1 36  ? -14.874 12.257  -14.665 1.00 64.45 ? 36  TRP B HZ3  1  
ATOM 2958   H HH2  . TRP B 1 36  ? -14.773 12.212  -17.084 1.00 33.45 ? 36  TRP B HH2  1  
ATOM 2959   N N    . GLN B 1 37  ? -12.086 17.960  -11.390 1.00 11.11 ? 37  GLN B N    1  
ATOM 2960   C CA   . GLN B 1 37  ? -11.087 18.491  -10.427 1.00 5.30  ? 37  GLN B CA   1  
ATOM 2961   C C    . GLN B 1 37  ? -11.765 19.018  -9.130  1.00 31.12 ? 37  GLN B C    1  
ATOM 2962   O O    . GLN B 1 37  ? -12.446 20.053  -9.173  1.00 53.12 ? 37  GLN B O    1  
ATOM 2963   C CB   . GLN B 1 37  ? -10.202 19.617  -11.075 1.00 45.43 ? 37  GLN B CB   1  
ATOM 2964   C CG   . GLN B 1 37  ? -9.615  19.301  -12.486 1.00 1.44  ? 37  GLN B CG   1  
ATOM 2965   C CD   . GLN B 1 37  ? -10.494 19.767  -13.665 1.00 72.42 ? 37  GLN B CD   1  
ATOM 2966   O OE1  . GLN B 1 37  ? -11.716 19.860  -13.566 1.00 63.34 ? 37  GLN B OE1  1  
ATOM 2967   N NE2  . GLN B 1 37  ? -9.878  20.052  -14.797 1.00 50.24 ? 37  GLN B NE2  1  
ATOM 2968   H H    . GLN B 1 37  ? -12.029 18.260  -12.310 1.00 14.03 ? 37  GLN B H    1  
ATOM 2969   H HA   . GLN B 1 37  ? -10.440 17.664  -10.165 1.00 25.41 ? 37  GLN B HA   1  
ATOM 2970   H HB2  . GLN B 1 37  ? -10.789 20.528  -11.149 1.00 53.14 ? 37  GLN B HB2  1  
ATOM 2971   H HB3  . GLN B 1 37  ? -9.368  19.818  -10.407 1.00 34.43 ? 37  GLN B HB3  1  
ATOM 2972   H HG2  . GLN B 1 37  ? -8.644  19.775  -12.575 1.00 53.24 ? 37  GLN B HG2  1  
ATOM 2973   H HG3  . GLN B 1 37  ? -9.480  18.227  -12.573 1.00 40.42 ? 37  GLN B HG3  1  
ATOM 2974   H HE21 . GLN B 1 37  ? -8.903  19.953  -14.836 1.00 35.41 ? 37  GLN B HE21 1  
ATOM 2975   H HE22 . GLN B 1 37  ? -10.422 20.355  -15.551 1.00 41.52 ? 37  GLN B HE22 1  
ATOM 2976   N N    . PRO B 1 38  ? -11.636 18.277  -7.973  1.00 0.45  ? 38  PRO B N    1  
ATOM 2977   C CA   . PRO B 1 38  ? -12.218 18.704  -6.694  1.00 62.42 ? 38  PRO B CA   1  
ATOM 2978   C C    . PRO B 1 38  ? -11.296 19.701  -5.977  1.00 33.54 ? 38  PRO B C    1  
ATOM 2979   O O    . PRO B 1 38  ? -10.070 19.704  -6.207  1.00 24.03 ? 38  PRO B O    1  
ATOM 2980   C CB   . PRO B 1 38  ? -12.341 17.371  -5.918  1.00 12.21 ? 38  PRO B CB   1  
ATOM 2981   C CG   . PRO B 1 38  ? -11.188 16.538  -6.391  1.00 45.44 ? 38  PRO B CG   1  
ATOM 2982   C CD   . PRO B 1 38  ? -10.896 16.983  -7.819  1.00 1.42  ? 38  PRO B CD   1  
ATOM 2983   H HA   . PRO B 1 38  ? -13.202 19.147  -6.826  1.00 23.53 ? 38  PRO B HA   1  
ATOM 2984   H HB2  . PRO B 1 38  ? -12.294 17.542  -4.842  1.00 1.40  ? 38  PRO B HB2  1  
ATOM 2985   H HB3  . PRO B 1 38  ? -13.279 16.884  -6.164  1.00 24.50 ? 38  PRO B HB3  1  
ATOM 2986   H HG2  . PRO B 1 38  ? -10.325 16.710  -5.754  1.00 73.23 ? 38  PRO B HG2  1  
ATOM 2987   H HG3  . PRO B 1 38  ? -11.452 15.485  -6.376  1.00 23.11 ? 38  PRO B HG3  1  
ATOM 2988   H HD2  . PRO B 1 38  ? -9.832  17.132  -7.966  1.00 21.10 ? 38  PRO B HD2  1  
ATOM 2989   H HD3  . PRO B 1 38  ? -11.264 16.247  -8.528  1.00 63.32 ? 38  PRO B HD3  1  
ATOM 2990   N N    . GLU B 1 39  ? -11.885 20.567  -5.144  1.00 53.41 ? 39  GLU B N    1  
ATOM 2991   C CA   . GLU B 1 39  ? -11.117 21.465  -4.283  1.00 62.45 ? 39  GLU B CA   1  
ATOM 2992   C C    . GLU B 1 39  ? -10.459 20.625  -3.175  1.00 52.10 ? 39  GLU B C    1  
ATOM 2993   O O    . GLU B 1 39  ? -11.135 20.172  -2.239  1.00 4.21  ? 39  GLU B O    1  
ATOM 2994   C CB   . GLU B 1 39  ? -12.039 22.563  -3.695  1.00 40.25 ? 39  GLU B CB   1  
ATOM 2995   C CG   . GLU B 1 39  ? -11.313 23.603  -2.815  1.00 10.25 ? 39  GLU B CG   1  
ATOM 2996   C CD   . GLU B 1 39  ? -12.252 24.684  -2.264  1.00 22.42 ? 39  GLU B CD   1  
ATOM 2997   O OE1  . GLU B 1 39  ? -13.021 24.389  -1.328  1.00 24.44 ? 39  GLU B OE1  1  
ATOM 2998   O OE2  . GLU B 1 39  ? -12.254 25.825  -2.786  1.00 55.54 ? 39  GLU B OE2  1  
ATOM 2999   H H    . GLU B 1 39  ? -12.862 20.606  -5.111  1.00 71.22 ? 39  GLU B H    1  
ATOM 3000   H HA   . GLU B 1 39  ? -10.343 21.939  -4.884  1.00 1.31  ? 39  GLU B HA   1  
ATOM 3001   H HB2  . GLU B 1 39  ? -12.518 23.089  -4.517  1.00 61.21 ? 39  GLU B HB2  1  
ATOM 3002   H HB3  . GLU B 1 39  ? -12.812 22.087  -3.098  1.00 61.23 ? 39  GLU B HB3  1  
ATOM 3003   H HG2  . GLU B 1 39  ? -10.844 23.090  -1.980  1.00 11.11 ? 39  GLU B HG2  1  
ATOM 3004   H HG3  . GLU B 1 39  ? -10.539 24.075  -3.413  1.00 74.10 ? 39  GLU B HG3  1  
ATOM 3005   N N    . VAL B 1 40  ? -9.153  20.366  -3.345  1.00 23.43 ? 40  VAL B N    1  
ATOM 3006   C CA   . VAL B 1 40  ? -8.349  19.595  -2.391  1.00 54.42 ? 40  VAL B CA   1  
ATOM 3007   C C    . VAL B 1 40  ? -7.769  20.563  -1.349  1.00 13.34 ? 40  VAL B C    1  
ATOM 3008   O O    . VAL B 1 40  ? -7.370  21.677  -1.691  1.00 21.21 ? 40  VAL B O    1  
ATOM 3009   C CB   . VAL B 1 40  ? -7.205  18.790  -3.129  1.00 74.43 ? 40  VAL B CB   1  
ATOM 3010   C CG1  . VAL B 1 40  ? -6.317  17.991  -2.138  1.00 44.34 ? 40  VAL B CG1  1  
ATOM 3011   C CG2  . VAL B 1 40  ? -7.800  17.862  -4.225  1.00 33.10 ? 40  VAL B CG2  1  
ATOM 3012   H H    . VAL B 1 40  ? -8.712  20.716  -4.146  1.00 62.34 ? 40  VAL B H    1  
ATOM 3013   H HA   . VAL B 1 40  ? -9.003  18.881  -1.888  1.00 55.15 ? 40  VAL B HA   1  
ATOM 3014   H HB   . VAL B 1 40  ? -6.561  19.513  -3.629  1.00 43.30 ? 40  VAL B HB   1  
ATOM 3015   H HG11 . VAL B 1 40  ? -5.874  18.668  -1.420  1.00 2.31  ? 40  VAL B HG11 1  
ATOM 3016   H HG12 . VAL B 1 40  ? -5.526  17.486  -2.679  1.00 23.01 ? 40  VAL B HG12 1  
ATOM 3017   H HG13 . VAL B 1 40  ? -6.916  17.254  -1.614  1.00 31.30 ? 40  VAL B HG13 1  
ATOM 3018   H HG21 . VAL B 1 40  ? -8.364  18.454  -4.936  1.00 44.25 ? 40  VAL B HG21 1  
ATOM 3019   H HG22 . VAL B 1 40  ? -8.457  17.128  -3.775  1.00 42.22 ? 40  VAL B HG22 1  
ATOM 3020   H HG23 . VAL B 1 40  ? -7.001  17.350  -4.749  1.00 23.21 ? 40  VAL B HG23 1  
ATOM 3021   N N    . LYS B 1 41  ? -7.743  20.124  -0.088  1.00 41.14 ? 41  LYS B N    1  
ATOM 3022   C CA   . LYS B 1 41  ? -7.336  20.936  1.062   1.00 50.51 ? 41  LYS B CA   1  
ATOM 3023   C C    . LYS B 1 41  ? -6.390  20.119  1.946   1.00 15.12 ? 41  LYS B C    1  
ATOM 3024   O O    . LYS B 1 41  ? -6.722  19.005  2.362   1.00 0.33  ? 41  LYS B O    1  
ATOM 3025   C CB   . LYS B 1 41  ? -8.588  21.382  1.874   1.00 11.23 ? 41  LYS B CB   1  
ATOM 3026   C CG   . LYS B 1 41  ? -8.262  22.131  3.191   1.00 43.22 ? 41  LYS B CG   1  
ATOM 3027   C CD   . LYS B 1 41  ? -9.521  22.550  3.994   1.00 22.10 ? 41  LYS B CD   1  
ATOM 3028   C CE   . LYS B 1 41  ? -9.158  23.167  5.359   1.00 75.31 ? 41  LYS B CE   1  
ATOM 3029   N NZ   . LYS B 1 41  ? -8.442  22.204  6.243   1.00 74.40 ? 41  LYS B NZ   1  
ATOM 3030   H H    . LYS B 1 41  ? -7.999  19.197  0.077   1.00 31.44 ? 41  LYS B H    1  
ATOM 3031   H HA   . LYS B 1 41  ? -6.811  21.825  0.698   1.00 54.33 ? 41  LYS B HA   1  
ATOM 3032   H HB2  . LYS B 1 41  ? -9.188  22.034  1.249   1.00 21.14 ? 41  LYS B HB2  1  
ATOM 3033   H HB3  . LYS B 1 41  ? -9.178  20.501  2.118   1.00 54.34 ? 41  LYS B HB3  1  
ATOM 3034   H HG2  . LYS B 1 41  ? -7.657  21.480  3.813   1.00 43.11 ? 41  LYS B HG2  1  
ATOM 3035   H HG3  . LYS B 1 41  ? -7.687  23.021  2.952   1.00 74.20 ? 41  LYS B HG3  1  
ATOM 3036   H HD2  . LYS B 1 41  ? -10.082 23.281  3.418   1.00 65.10 ? 41  LYS B HD2  1  
ATOM 3037   H HD3  . LYS B 1 41  ? -10.148 21.677  4.160   1.00 61.33 ? 41  LYS B HD3  1  
ATOM 3038   H HE2  . LYS B 1 41  ? -8.522  24.029  5.204   1.00 24.00 ? 41  LYS B HE2  1  
ATOM 3039   H HE3  . LYS B 1 41  ? -10.065 23.484  5.857   1.00 24.10 ? 41  LYS B HE3  1  
ATOM 3040   H HZ1  . LYS B 1 41  ? -7.557  21.893  5.796   1.00 12.20 ? 41  LYS B HZ1  1  
ATOM 3041   H HZ2  . LYS B 1 41  ? -9.039  21.367  6.422   1.00 72.44 ? 41  LYS B HZ2  1  
ATOM 3042   H HZ3  . LYS B 1 41  ? -8.218  22.654  7.156   1.00 21.43 ? 41  LYS B HZ3  1  
ATOM 3043   N N    . LEU B 1 42  ? -5.214  20.692  2.210   1.00 33.22 ? 42  LEU B N    1  
ATOM 3044   C CA   . LEU B 1 42  ? -4.204  20.123  3.112   1.00 50.32 ? 42  LEU B CA   1  
ATOM 3045   C C    . LEU B 1 42  ? -4.340  20.774  4.496   1.00 1.44  ? 42  LEU B C    1  
ATOM 3046   O O    . LEU B 1 42  ? -4.724  21.954  4.603   1.00 43.30 ? 42  LEU B O    1  
ATOM 3047   C CB   . LEU B 1 42  ? -2.784  20.395  2.546   1.00 20.52 ? 42  LEU B CB   1  
ATOM 3048   C CG   . LEU B 1 42  ? -2.529  19.919  1.081   1.00 64.34 ? 42  LEU B CG   1  
ATOM 3049   C CD1  . LEU B 1 42  ? -1.150  20.399  0.576   1.00 24.22 ? 42  LEU B CD1  1  
ATOM 3050   C CD2  . LEU B 1 42  ? -2.684  18.383  0.943   1.00 3.12  ? 42  LEU B CD2  1  
ATOM 3051   H H    . LEU B 1 42  ? -5.015  21.547  1.780   1.00 20.12 ? 42  LEU B H    1  
ATOM 3052   H HA   . LEU B 1 42  ? -4.361  19.042  3.196   1.00 13.14 ? 42  LEU B HA   1  
ATOM 3053   H HB2  . LEU B 1 42  ? -2.605  21.468  2.589   1.00 31.50 ? 42  LEU B HB2  1  
ATOM 3054   H HB3  . LEU B 1 42  ? -2.058  19.910  3.192   1.00 75.04 ? 42  LEU B HB3  1  
ATOM 3055   H HG   . LEU B 1 42  ? -3.274  20.374  0.439   1.00 3.20  ? 42  LEU B HG   1  
ATOM 3056   H HD11 . LEU B 1 42  ? -1.013  20.088  -0.451  1.00 4.20  ? 42  LEU B HD11 1  
ATOM 3057   H HD12 . LEU B 1 42  ? -0.358  19.978  1.184   1.00 1.01  ? 42  LEU B HD12 1  
ATOM 3058   H HD13 . LEU B 1 42  ? -1.100  21.480  0.626   1.00 52.24 ? 42  LEU B HD13 1  
ATOM 3059   H HD21 . LEU B 1 42  ? -2.501  18.092  -0.084  1.00 5.45  ? 42  LEU B HD21 1  
ATOM 3060   H HD22 . LEU B 1 42  ? -3.688  18.090  1.217   1.00 12.20 ? 42  LEU B HD22 1  
ATOM 3061   H HD23 . LEU B 1 42  ? -1.975  17.879  1.589   1.00 22.10 ? 42  LEU B HD23 1  
ATOM 3062   N N    . ASP B 1 43  ? -4.029  19.998  5.539   1.00 54.30 ? 43  ASP B N    1  
ATOM 3063   C CA   . ASP B 1 43  ? -3.920  20.505  6.914   1.00 63.24 ? 43  ASP B CA   1  
ATOM 3064   C C    . ASP B 1 43  ? -3.064  19.538  7.732   1.00 5.15  ? 43  ASP B C    1  
ATOM 3065   O O    . ASP B 1 43  ? -3.462  18.395  7.972   1.00 15.11 ? 43  ASP B O    1  
ATOM 3066   C CB   . ASP B 1 43  ? -5.321  20.694  7.562   1.00 72.34 ? 43  ASP B CB   1  
ATOM 3067   C CG   . ASP B 1 43  ? -5.267  21.208  9.020   1.00 52.23 ? 43  ASP B CG   1  
ATOM 3068   O OD1  . ASP B 1 43  ? -4.475  22.127  9.313   1.00 60.02 ? 43  ASP B OD1  1  
ATOM 3069   O OD2  . ASP B 1 43  ? -6.050  20.722  9.864   1.00 1.41  ? 43  ASP B OD2  1  
ATOM 3070   H H    . ASP B 1 43  ? -3.880  19.038  5.381   1.00 55.42 ? 43  ASP B H    1  
ATOM 3071   H HA   . ASP B 1 43  ? -3.417  21.472  6.876   1.00 54.22 ? 43  ASP B HA   1  
ATOM 3072   H HB2  . ASP B 1 43  ? -5.883  21.410  6.974   1.00 52.14 ? 43  ASP B HB2  1  
ATOM 3073   H HB3  . ASP B 1 43  ? -5.849  19.743  7.541   1.00 41.40 ? 43  ASP B HB3  1  
ATOM 3074   N N    . LEU B 1 44  ? -1.872  20.007  8.135   1.00 31.44 ? 44  LEU B N    1  
ATOM 3075   C CA   . LEU B 1 44  ? -0.918  19.217  8.928   1.00 70.14 ? 44  LEU B CA   1  
ATOM 3076   C C    . LEU B 1 44  ? -1.026  19.629  10.399  1.00 31.12 ? 44  LEU B C    1  
ATOM 3077   O O    . LEU B 1 44  ? -1.050  20.818  10.719  1.00 62.44 ? 44  LEU B O    1  
ATOM 3078   C CB   . LEU B 1 44  ? 0.551   19.377  8.403   1.00 51.33 ? 44  LEU B CB   1  
ATOM 3079   C CG   . LEU B 1 44  ? 0.952   18.500  7.160   1.00 32.44 ? 44  LEU B CG   1  
ATOM 3080   C CD1  . LEU B 1 44  ? 0.061   18.776  5.928   1.00 10.35 ? 44  LEU B CD1  1  
ATOM 3081   C CD2  . LEU B 1 44  ? 2.457   18.666  6.822   1.00 15.35 ? 44  LEU B CD2  1  
ATOM 3082   H H    . LEU B 1 44  ? -1.635  20.931  7.910   1.00 75.15 ? 44  LEU B H    1  
ATOM 3083   H HA   . LEU B 1 44  ? -1.200  18.166  8.844   1.00 64.05 ? 44  LEU B HA   1  
ATOM 3084   H HB2  . LEU B 1 44  ? 0.710   20.422  8.147   1.00 21.43 ? 44  LEU B HB2  1  
ATOM 3085   H HB3  . LEU B 1 44  ? 1.230   19.128  9.213   1.00 34.23 ? 44  LEU B HB3  1  
ATOM 3086   H HG   . LEU B 1 44  ? 0.799   17.458  7.420   1.00 50.22 ? 44  LEU B HG   1  
ATOM 3087   H HD11 . LEU B 1 44  ? 0.381   18.158  5.100   1.00 50.01 ? 44  LEU B HD11 1  
ATOM 3088   H HD12 . LEU B 1 44  ? 0.131   19.819  5.644   1.00 54.33 ? 44  LEU B HD12 1  
ATOM 3089   H HD13 . LEU B 1 44  ? -0.968  18.542  6.167   1.00 62.35 ? 44  LEU B HD13 1  
ATOM 3090   H HD21 . LEU B 1 44  ? 2.674   19.699  6.575   1.00 11.12 ? 44  LEU B HD21 1  
ATOM 3091   H HD22 . LEU B 1 44  ? 2.715   18.038  5.982   1.00 0.02  ? 44  LEU B HD22 1  
ATOM 3092   H HD23 . LEU B 1 44  ? 3.055   18.370  7.676   1.00 72.45 ? 44  LEU B HD23 1  
ATOM 3093   N N    . ASP B 1 45  ? -1.077  18.623  11.277  1.00 52.11 ? 45  ASP B N    1  
ATOM 3094   C CA   . ASP B 1 45  ? -1.205  18.803  12.735  1.00 52.13 ? 45  ASP B CA   1  
ATOM 3095   C C    . ASP B 1 45  ? -0.040  18.085  13.428  1.00 43.03 ? 45  ASP B C    1  
ATOM 3096   O O    . ASP B 1 45  ? 0.381   17.003  12.995  1.00 24.40 ? 45  ASP B O    1  
ATOM 3097   C CB   . ASP B 1 45  ? -2.579  18.261  13.221  1.00 12.33 ? 45  ASP B CB   1  
ATOM 3098   C CG   . ASP B 1 45  ? -2.749  18.222  14.756  1.00 33.15 ? 45  ASP B CG   1  
ATOM 3099   O OD1  . ASP B 1 45  ? -2.969  19.288  15.365  1.00 41.42 ? 45  ASP B OD1  1  
ATOM 3100   O OD2  . ASP B 1 45  ? -2.666  17.118  15.353  1.00 22.33 ? 45  ASP B OD2  1  
ATOM 3101   H H    . ASP B 1 45  ? -1.017  17.708  10.930  1.00 55.31 ? 45  ASP B H    1  
ATOM 3102   H HA   . ASP B 1 45  ? -1.143  19.868  12.959  1.00 10.40 ? 45  ASP B HA   1  
ATOM 3103   H HB2  . ASP B 1 45  ? -3.361  18.887  12.814  1.00 41.44 ? 45  ASP B HB2  1  
ATOM 3104   H HB3  . ASP B 1 45  ? -2.714  17.255  12.829  1.00 41.41 ? 45  ASP B HB3  1  
ATOM 3105   N N    . THR B 1 46  ? 0.475   18.705  14.497  1.00 44.44 ? 46  THR B N    1  
ATOM 3106   C CA   . THR B 1 46  ? 1.652   18.222  15.224  1.00 42.12 ? 46  THR B CA   1  
ATOM 3107   C C    . THR B 1 46  ? 1.243   17.674  16.608  1.00 32.01 ? 46  THR B C    1  
ATOM 3108   O O    . THR B 1 46  ? 0.688   18.404  17.443  1.00 44.32 ? 46  THR B O    1  
ATOM 3109   C CB   . THR B 1 46  ? 2.714   19.373  15.372  1.00 61.11 ? 46  THR B CB   1  
ATOM 3110   O OG1  . THR B 1 46  ? 2.135   20.528  16.012  1.00 35.30 ? 46  THR B OG1  1  
ATOM 3111   C CG2  . THR B 1 46  ? 3.295   19.792  14.000  1.00 23.22 ? 46  THR B CG2  1  
ATOM 3112   H H    . THR B 1 46  ? 0.045   19.529  14.808  1.00 64.21 ? 46  THR B H    1  
ATOM 3113   H HA   . THR B 1 46  ? 2.110   17.417  14.646  1.00 43.33 ? 46  THR B HA   1  
ATOM 3114   H HB   . THR B 1 46  ? 3.529   19.013  15.991  1.00 72.31 ? 46  THR B HB   1  
ATOM 3115   H HG1  . THR B 1 46  ? 1.340   20.272  16.492  1.00 4.43  ? 46  THR B HG1  1  
ATOM 3116   H HG21 . THR B 1 46  ? 3.770   18.940  13.528  1.00 72.41 ? 46  THR B HG21 1  
ATOM 3117   H HG22 . THR B 1 46  ? 4.027   20.573  14.137  1.00 14.31 ? 46  THR B HG22 1  
ATOM 3118   H HG23 . THR B 1 46  ? 2.501   20.159  13.358  1.00 21.12 ? 46  THR B HG23 1  
ATOM 3119   N N    . ALA B 1 47  ? 1.485   16.368  16.816  1.00 13.24 ? 47  ALA B N    1  
ATOM 3120   C CA   . ALA B 1 47  ? 1.266   15.677  18.102  1.00 75.21 ? 47  ALA B CA   1  
ATOM 3121   C C    . ALA B 1 47  ? 2.570   14.996  18.532  1.00 14.55 ? 47  ALA B C    1  
ATOM 3122   O O    . ALA B 1 47  ? 3.294   14.476  17.684  1.00 61.24 ? 47  ALA B O    1  
ATOM 3123   C CB   . ALA B 1 47  ? 0.130   14.646  17.966  1.00 61.43 ? 47  ALA B CB   1  
ATOM 3124   H H    . ALA B 1 47  ? 1.828   15.836  16.062  1.00 1.41  ? 47  ALA B H    1  
ATOM 3125   H HA   . ALA B 1 47  ? 0.976   16.410  18.859  1.00 73.35 ? 47  ALA B HA   1  
ATOM 3126   H HB1  . ALA B 1 47  ? 0.391   13.903  17.221  1.00 1.32  ? 47  ALA B HB1  1  
ATOM 3127   H HB2  . ALA B 1 47  ? -0.779  15.145  17.661  1.00 52.42 ? 47  ALA B HB2  1  
ATOM 3128   H HB3  . ALA B 1 47  ? -0.039  14.155  18.917  1.00 62.50 ? 47  ALA B HB3  1  
ATOM 3129   N N    . SER B 1 48  ? 2.891   15.038  19.835  1.00 34.23 ? 48  SER B N    1  
ATOM 3130   C CA   . SER B 1 48  ? 4.088   14.372  20.387  1.00 35.13 ? 48  SER B CA   1  
ATOM 3131   C C    . SER B 1 48  ? 3.818   13.830  21.794  1.00 14.41 ? 48  SER B C    1  
ATOM 3132   O O    . SER B 1 48  ? 2.859   14.244  22.460  1.00 24.23 ? 48  SER B O    1  
ATOM 3133   C CB   . SER B 1 48  ? 5.296   15.340  20.402  1.00 53.33 ? 48  SER B CB   1  
ATOM 3134   O OG   . SER B 1 48  ? 5.013   16.527  21.137  1.00 22.14 ? 48  SER B OG   1  
ATOM 3135   H H    . SER B 1 48  ? 2.294   15.517  20.452  1.00 53.40 ? 48  SER B H    1  
ATOM 3136   H HA   . SER B 1 48  ? 4.330   13.524  19.744  1.00 72.04 ? 48  SER B HA   1  
ATOM 3137   H HB2  . SER B 1 48  ? 6.153   14.853  20.850  1.00 41.21 ? 48  SER B HB2  1  
ATOM 3138   H HB3  . SER B 1 48  ? 5.542   15.620  19.386  1.00 54.02 ? 48  SER B HB3  1  
ATOM 3139   H HG   . SER B 1 48  ? 4.061   16.644  21.211  1.00 12.41 ? 48  SER B HG   1  
ATOM 3140   N N    . SER B 1 49  ? 4.696   12.916  22.231  1.00 31.32 ? 49  SER B N    1  
ATOM 3141   C CA   . SER B 1 49  ? 4.680   12.331  23.577  1.00 2.43  ? 49  SER B CA   1  
ATOM 3142   C C    . SER B 1 49  ? 6.069   11.763  23.898  1.00 61.30 ? 49  SER B C    1  
ATOM 3143   O O    . SER B 1 49  ? 6.755   11.270  22.997  1.00 2.15  ? 49  SER B O    1  
ATOM 3144   C CB   . SER B 1 49  ? 3.618   11.208  23.660  1.00 25.54 ? 49  SER B CB   1  
ATOM 3145   O OG   . SER B 1 49  ? 3.841   10.206  22.673  1.00 64.54 ? 49  SER B OG   1  
ATOM 3146   H H    . SER B 1 49  ? 5.392   12.612  21.609  1.00 10.21 ? 49  SER B H    1  
ATOM 3147   H HA   . SER B 1 49  ? 4.440   13.116  24.291  1.00 43.42 ? 49  SER B HA   1  
ATOM 3148   H HB2  . SER B 1 49  ? 3.652   10.743  24.637  1.00 5.11  ? 49  SER B HB2  1  
ATOM 3149   H HB3  . SER B 1 49  ? 2.633   11.631  23.506  1.00 14.55 ? 49  SER B HB3  1  
ATOM 3150   H HG   . SER B 1 49  ? 4.343   10.585  21.937  1.00 4.20  ? 49  SER B HG   1  
ATOM 3151   N N    . GLN B 1 50  ? 6.482   11.838  25.171  1.00 33.22 ? 50  GLN B N    1  
ATOM 3152   C CA   . GLN B 1 50  ? 7.737   11.231  25.636  1.00 63.34 ? 50  GLN B CA   1  
ATOM 3153   C C    . GLN B 1 50  ? 7.418   9.854   26.245  1.00 73.22 ? 50  GLN B C    1  
ATOM 3154   O O    . GLN B 1 50  ? 6.739   9.767   27.274  1.00 63.31 ? 50  GLN B O    1  
ATOM 3155   C CB   . GLN B 1 50  ? 8.451   12.153  26.667  1.00 74.14 ? 50  GLN B CB   1  
ATOM 3156   C CG   . GLN B 1 50  ? 9.866   11.668  27.047  1.00 73.42 ? 50  GLN B CG   1  
ATOM 3157   C CD   . GLN B 1 50  ? 10.654  12.611  27.962  1.00 2.43  ? 50  GLN B CD   1  
ATOM 3158   O OE1  . GLN B 1 50  ? 10.455  13.825  27.962  1.00 61.23 ? 50  GLN B OE1  1  
ATOM 3159   N NE2  . GLN B 1 50  ? 11.598  12.059  28.708  1.00 20.52 ? 50  GLN B NE2  1  
ATOM 3160   H H    . GLN B 1 50  ? 5.920   12.309  25.822  1.00 4.31  ? 50  GLN B H    1  
ATOM 3161   H HA   . GLN B 1 50  ? 8.395   11.095  24.774  1.00 2.32  ? 50  GLN B HA   1  
ATOM 3162   H HB2  . GLN B 1 50  ? 8.533   13.147  26.241  1.00 13.05 ? 50  GLN B HB2  1  
ATOM 3163   H HB3  . GLN B 1 50  ? 7.852   12.213  27.571  1.00 15.42 ? 50  GLN B HB3  1  
ATOM 3164   H HG2  . GLN B 1 50  ? 9.773   10.712  27.548  1.00 52.40 ? 50  GLN B HG2  1  
ATOM 3165   H HG3  . GLN B 1 50  ? 10.439  11.525  26.136  1.00 24.31 ? 50  GLN B HG3  1  
ATOM 3166   H HE21 . GLN B 1 50  ? 11.733  11.090  28.637  1.00 45.30 ? 50  GLN B HE21 1  
ATOM 3167   H HE22 . GLN B 1 50  ? 12.130  12.641  29.290  1.00 22.20 ? 50  GLN B HE22 1  
ATOM 3168   N N    . LEU B 1 51  ? 7.876   8.787   25.568  1.00 31.44 ? 51  LEU B N    1  
ATOM 3169   C CA   . LEU B 1 51  ? 7.649   7.391   25.998  1.00 3.11  ? 51  LEU B CA   1  
ATOM 3170   C C    . LEU B 1 51  ? 8.532   7.045   27.194  1.00 1.24  ? 51  LEU B C    1  
ATOM 3171   O O    . LEU B 1 51  ? 8.081   6.433   28.165  1.00 74.20 ? 51  LEU B O    1  
ATOM 3172   C CB   . LEU B 1 51  ? 7.960   6.417   24.836  1.00 2.44  ? 51  LEU B CB   1  
ATOM 3173   C CG   . LEU B 1 51  ? 7.130   6.626   23.542  1.00 34.12 ? 51  LEU B CG   1  
ATOM 3174   C CD1  . LEU B 1 51  ? 7.574   5.643   22.436  1.00 43.54 ? 51  LEU B CD1  1  
ATOM 3175   C CD2  . LEU B 1 51  ? 5.614   6.528   23.827  1.00 73.31 ? 51  LEU B CD2  1  
ATOM 3176   H H    . LEU B 1 51  ? 8.389   8.944   24.751  1.00 55.23 ? 51  LEU B H    1  
ATOM 3177   H HA   . LEU B 1 51  ? 6.606   7.286   26.281  1.00 12.34 ? 51  LEU B HA   1  
ATOM 3178   H HB2  . LEU B 1 51  ? 9.015   6.514   24.585  1.00 51.22 ? 51  LEU B HB2  1  
ATOM 3179   H HB3  . LEU B 1 51  ? 7.792   5.400   25.184  1.00 3.53  ? 51  LEU B HB3  1  
ATOM 3180   H HG   . LEU B 1 51  ? 7.322   7.627   23.169  1.00 24.05 ? 51  LEU B HG   1  
ATOM 3181   H HD11 . LEU B 1 51  ? 7.501   4.623   22.788  1.00 75.43 ? 51  LEU B HD11 1  
ATOM 3182   H HD12 . LEU B 1 51  ? 8.598   5.852   22.159  1.00 15.33 ? 51  LEU B HD12 1  
ATOM 3183   H HD13 . LEU B 1 51  ? 6.944   5.767   21.564  1.00 43.41 ? 51  LEU B HD13 1  
ATOM 3184   H HD21 . LEU B 1 51  ? 5.324   7.300   24.522  1.00 60.30 ? 51  LEU B HD21 1  
ATOM 3185   H HD22 . LEU B 1 51  ? 5.375   5.561   24.248  1.00 44.20 ? 51  LEU B HD22 1  
ATOM 3186   H HD23 . LEU B 1 51  ? 5.062   6.661   22.905  1.00 52.35 ? 51  LEU B HD23 1  
ATOM 3187   N N    . ALA B 1 52  ? 9.797   7.443   27.084  1.00 13.00 ? 52  ALA B N    1  
ATOM 3188   C CA   . ALA B 1 52  ? 10.826  7.159   28.082  1.00 22.33 ? 52  ALA B CA   1  
ATOM 3189   C C    . ALA B 1 52  ? 11.892  8.248   28.041  1.00 40.13 ? 52  ALA B C    1  
ATOM 3190   O O    . ALA B 1 52  ? 11.768  9.232   27.306  1.00 34.55 ? 52  ALA B O    1  
ATOM 3191   C CB   . ALA B 1 52  ? 11.447  5.772   27.823  1.00 31.43 ? 52  ALA B CB   1  
ATOM 3192   H H    . ALA B 1 52  ? 10.050  7.967   26.296  1.00 5.21  ? 52  ALA B H    1  
ATOM 3193   H HA   . ALA B 1 52  ? 10.365  7.157   29.066  1.00 10.21 ? 52  ALA B HA   1  
ATOM 3194   H HB1  . ALA B 1 52  ? 11.655  5.652   26.768  1.00 32.21 ? 52  ALA B HB1  1  
ATOM 3195   H HB2  . ALA B 1 52  ? 10.769  5.008   28.145  1.00 23.21 ? 52  ALA B HB2  1  
ATOM 3196   H HB3  . ALA B 1 52  ? 12.371  5.670   28.380  1.00 72.32 ? 52  ALA B HB3  1  
ATOM 3197   N N    . ASP B 1 53  ? 12.951  8.039   28.821  1.00 50.32 ? 53  ASP B N    1  
ATOM 3198   C CA   . ASP B 1 53  ? 14.063  8.993   28.929  1.00 40.11 ? 53  ASP B CA   1  
ATOM 3199   C C    . ASP B 1 53  ? 14.862  8.984   27.615  1.00 71.21 ? 53  ASP B C    1  
ATOM 3200   O O    . ASP B 1 53  ? 15.373  7.933   27.213  1.00 2.13  ? 53  ASP B O    1  
ATOM 3201   C CB   . ASP B 1 53  ? 14.963  8.651   30.142  1.00 15.01 ? 53  ASP B CB   1  
ATOM 3202   C CG   . ASP B 1 53  ? 15.981  9.762   30.448  1.00 61.42 ? 53  ASP B CG   1  
ATOM 3203   O OD1  . ASP B 1 53  ? 15.560  10.830  30.949  1.00 73.43 ? 53  ASP B OD1  1  
ATOM 3204   O OD2  . ASP B 1 53  ? 17.187  9.587   30.188  1.00 55.34 ? 53  ASP B OD2  1  
ATOM 3205   H H    . ASP B 1 53  ? 13.000  7.190   29.317  1.00 11.42 ? 53  ASP B H    1  
ATOM 3206   H HA   . ASP B 1 53  ? 13.634  9.981   29.080  1.00 51.21 ? 53  ASP B HA   1  
ATOM 3207   H HB2  . ASP B 1 53  ? 14.335  8.513   31.018  1.00 30.24 ? 53  ASP B HB2  1  
ATOM 3208   H HB3  . ASP B 1 53  ? 15.492  7.722   29.949  1.00 62.34 ? 53  ASP B HB3  1  
ATOM 3209   N N    . ASP B 1 54  ? 14.872  10.148  26.927  1.00 35.05 ? 54  ASP B N    1  
ATOM 3210   C CA   . ASP B 1 54  ? 15.500  10.360  25.591  1.00 4.22  ? 54  ASP B CA   1  
ATOM 3211   C C    . ASP B 1 54  ? 14.739  9.651   24.447  1.00 23.45 ? 54  ASP B C    1  
ATOM 3212   O O    . ASP B 1 54  ? 15.103  9.814   23.282  1.00 4.21  ? 54  ASP B O    1  
ATOM 3213   C CB   . ASP B 1 54  ? 17.012  9.985   25.547  1.00 42.42 ? 54  ASP B CB   1  
ATOM 3214   C CG   . ASP B 1 54  ? 17.867  10.728  26.584  1.00 71.14 ? 54  ASP B CG   1  
ATOM 3215   O OD1  . ASP B 1 54  ? 17.981  11.963  26.498  1.00 50.44 ? 54  ASP B OD1  1  
ATOM 3216   O OD2  . ASP B 1 54  ? 18.449  10.075  27.479  1.00 63.20 ? 54  ASP B OD2  1  
ATOM 3217   H H    . ASP B 1 54  ? 14.428  10.921  27.341  1.00 61.32 ? 54  ASP B H    1  
ATOM 3218   H HA   . ASP B 1 54  ? 15.421  11.424  25.400  1.00 24.10 ? 54  ASP B HA   1  
ATOM 3219   H HB2  . ASP B 1 54  ? 17.107  8.921   25.715  1.00 62.31 ? 54  ASP B HB2  1  
ATOM 3220   H HB3  . ASP B 1 54  ? 17.407  10.209  24.558  1.00 43.24 ? 54  ASP B HB3  1  
ATOM 3221   N N    . VAL B 1 55  ? 13.664  8.908   24.766  1.00 74.51 ? 55  VAL B N    1  
ATOM 3222   C CA   . VAL B 1 55  ? 12.819  8.239   23.767  1.00 5.12  ? 55  VAL B CA   1  
ATOM 3223   C C    . VAL B 1 55  ? 11.514  9.028   23.623  1.00 50.51 ? 55  VAL B C    1  
ATOM 3224   O O    . VAL B 1 55  ? 10.704  9.103   24.560  1.00 23.43 ? 55  VAL B O    1  
ATOM 3225   C CB   . VAL B 1 55  ? 12.492  6.750   24.162  1.00 11.10 ? 55  VAL B CB   1  
ATOM 3226   C CG1  . VAL B 1 55  ? 11.484  6.111   23.169  1.00 32.03 ? 55  VAL B CG1  1  
ATOM 3227   C CG2  . VAL B 1 55  ? 13.787  5.907   24.265  1.00 73.04 ? 55  VAL B CG2  1  
ATOM 3228   H H    . VAL B 1 55  ? 13.422  8.819   25.705  1.00 60.22 ? 55  VAL B H    1  
ATOM 3229   H HA   . VAL B 1 55  ? 13.344  8.236   22.808  1.00 43.41 ? 55  VAL B HA   1  
ATOM 3230   H HB   . VAL B 1 55  ? 12.023  6.761   25.148  1.00 65.24 ? 55  VAL B HB   1  
ATOM 3231   H HG11 . VAL B 1 55  ? 11.088  5.206   23.589  1.00 64.23 ? 55  VAL B HG11 1  
ATOM 3232   H HG12 . VAL B 1 55  ? 11.974  5.884   22.232  1.00 33.03 ? 55  VAL B HG12 1  
ATOM 3233   H HG13 . VAL B 1 55  ? 10.664  6.793   22.981  1.00 43.42 ? 55  VAL B HG13 1  
ATOM 3234   H HG21 . VAL B 1 55  ? 14.280  5.873   23.301  1.00 64.50 ? 55  VAL B HG21 1  
ATOM 3235   H HG22 . VAL B 1 55  ? 13.547  4.901   24.580  1.00 41.31 ? 55  VAL B HG22 1  
ATOM 3236   H HG23 . VAL B 1 55  ? 14.455  6.353   24.988  1.00 41.33 ? 55  VAL B HG23 1  
ATOM 3237   N N    . TYR B 1 56  ? 11.328  9.621   22.445  1.00 72.43 ? 56  TYR B N    1  
ATOM 3238   C CA   . TYR B 1 56  ? 10.161  10.441  22.129  1.00 62.32 ? 56  TYR B CA   1  
ATOM 3239   C C    . TYR B 1 56  ? 9.391   9.800   20.988  1.00 32.43 ? 56  TYR B C    1  
ATOM 3240   O O    . TYR B 1 56  ? 9.879   8.875   20.334  1.00 2.53  ? 56  TYR B O    1  
ATOM 3241   C CB   . TYR B 1 56  ? 10.599  11.887  21.759  1.00 14.01 ? 56  TYR B CB   1  
ATOM 3242   C CG   . TYR B 1 56  ? 11.371  12.599  22.887  1.00 14.42 ? 56  TYR B CG   1  
ATOM 3243   C CD1  . TYR B 1 56  ? 10.740  13.478  23.765  1.00 3.42  ? 56  TYR B CD1  1  
ATOM 3244   C CD2  . TYR B 1 56  ? 12.728  12.348  23.103  1.00 22.13 ? 56  TYR B CD2  1  
ATOM 3245   C CE1  . TYR B 1 56  ? 11.433  14.069  24.805  1.00 73.23 ? 56  TYR B CE1  1  
ATOM 3246   C CE2  . TYR B 1 56  ? 13.415  12.946  24.137  1.00 70.40 ? 56  TYR B CE2  1  
ATOM 3247   C CZ   . TYR B 1 56  ? 12.766  13.797  24.984  1.00 11.31 ? 56  TYR B CZ   1  
ATOM 3248   O OH   . TYR B 1 56  ? 13.447  14.365  26.026  1.00 5.31  ? 56  TYR B OH   1  
ATOM 3249   H H    . TYR B 1 56  ? 12.001  9.490   21.746  1.00 32.13 ? 56  TYR B H    1  
ATOM 3250   H HA   . TYR B 1 56  ? 9.511   10.467  23.004  1.00 2.31  ? 56  TYR B HA   1  
ATOM 3251   H HB2  . TYR B 1 56  ? 11.241  11.850  20.881  1.00 42.52 ? 56  TYR B HB2  1  
ATOM 3252   H HB3  . TYR B 1 56  ? 9.719   12.477  21.519  1.00 31.14 ? 56  TYR B HB3  1  
ATOM 3253   H HD1  . TYR B 1 56  ? 9.688   13.699  23.628  1.00 51.24 ? 56  TYR B HD1  1  
ATOM 3254   H HD2  . TYR B 1 56  ? 13.254  11.672  22.434  1.00 22.05 ? 56  TYR B HD2  1  
ATOM 3255   H HE1  . TYR B 1 56  ? 10.920  14.749  25.475  1.00 5.20  ? 56  TYR B HE1  1  
ATOM 3256   H HE2  . TYR B 1 56  ? 14.468  12.734  24.278  1.00 54.43 ? 56  TYR B HE2  1  
ATOM 3257   H HH   . TYR B 1 56  ? 12.921  14.296  26.832  1.00 72.44 ? 56  TYR B HH   1  
ATOM 3258   N N    . GLU B 1 57  ? 8.194   10.315  20.748  1.00 11.35 ? 57  GLU B N    1  
ATOM 3259   C CA   . GLU B 1 57  ? 7.267   9.752   19.784  1.00 14.23 ? 57  GLU B CA   1  
ATOM 3260   C C    . GLU B 1 57  ? 6.550   10.919  19.088  1.00 74.43 ? 57  GLU B C    1  
ATOM 3261   O O    . GLU B 1 57  ? 5.710   11.593  19.699  1.00 31.33 ? 57  GLU B O    1  
ATOM 3262   C CB   . GLU B 1 57  ? 6.302   8.786   20.533  1.00 42.55 ? 57  GLU B CB   1  
ATOM 3263   C CG   . GLU B 1 57  ? 5.593   7.752   19.649  1.00 71.32 ? 57  GLU B CG   1  
ATOM 3264   C CD   . GLU B 1 57  ? 4.540   8.339   18.708  1.00 4.34  ? 57  GLU B CD   1  
ATOM 3265   O OE1  . GLU B 1 57  ? 4.631   8.151   17.473  1.00 62.45 ? 57  GLU B OE1  1  
ATOM 3266   O OE2  . GLU B 1 57  ? 3.610   8.987   19.218  1.00 45.14 ? 57  GLU B OE2  1  
ATOM 3267   H H    . GLU B 1 57  ? 7.919   11.114  21.241  1.00 63.24 ? 57  GLU B H    1  
ATOM 3268   H HA   . GLU B 1 57  ? 7.832   9.184   19.041  1.00 53.22 ? 57  GLU B HA   1  
ATOM 3269   H HB2  . GLU B 1 57  ? 6.877   8.238   21.275  1.00 35.14 ? 57  GLU B HB2  1  
ATOM 3270   H HB3  . GLU B 1 57  ? 5.548   9.364   21.059  1.00 34.12 ? 57  GLU B HB3  1  
ATOM 3271   H HG2  . GLU B 1 57  ? 6.348   7.239   19.064  1.00 62.34 ? 57  GLU B HG2  1  
ATOM 3272   H HG3  . GLU B 1 57  ? 5.107   7.024   20.291  1.00 0.43  ? 57  GLU B HG3  1  
ATOM 3273   N N    . VAL B 1 58  ? 6.937   11.170  17.827  1.00 45.14 ? 58  VAL B N    1  
ATOM 3274   C CA   . VAL B 1 58  ? 6.431   12.278  17.006  1.00 34.00 ? 58  VAL B CA   1  
ATOM 3275   C C    . VAL B 1 58  ? 5.415   11.739  15.992  1.00 25.50 ? 58  VAL B C    1  
ATOM 3276   O O    . VAL B 1 58  ? 5.734   10.864  15.187  1.00 11.44 ? 58  VAL B O    1  
ATOM 3277   C CB   . VAL B 1 58  ? 7.622   13.011  16.256  1.00 22.13 ? 58  VAL B CB   1  
ATOM 3278   C CG1  . VAL B 1 58  ? 7.123   14.140  15.314  1.00 31.12 ? 58  VAL B CG1  1  
ATOM 3279   C CG2  . VAL B 1 58  ? 8.659   13.553  17.275  1.00 54.00 ? 58  VAL B CG2  1  
ATOM 3280   H H    . VAL B 1 58  ? 7.589   10.567  17.419  1.00 44.21 ? 58  VAL B H    1  
ATOM 3281   H HA   . VAL B 1 58  ? 5.938   12.998  17.658  1.00 5.21  ? 58  VAL B HA   1  
ATOM 3282   H HB   . VAL B 1 58  ? 8.130   12.274  15.634  1.00 42.13 ? 58  VAL B HB   1  
ATOM 3283   H HG11 . VAL B 1 58  ? 6.576   14.882  15.883  1.00 1.43  ? 58  VAL B HG11 1  
ATOM 3284   H HG12 . VAL B 1 58  ? 6.473   13.725  14.556  1.00 24.20 ? 58  VAL B HG12 1  
ATOM 3285   H HG13 . VAL B 1 58  ? 7.969   14.615  14.830  1.00 40.13 ? 58  VAL B HG13 1  
ATOM 3286   H HG21 . VAL B 1 58  ? 9.045   12.735  17.868  1.00 53.35 ? 58  VAL B HG21 1  
ATOM 3287   H HG22 . VAL B 1 58  ? 8.191   14.278  17.930  1.00 0.41  ? 58  VAL B HG22 1  
ATOM 3288   H HG23 . VAL B 1 58  ? 9.479   14.027  16.748  1.00 11.55 ? 58  VAL B HG23 1  
ATOM 3289   N N    . VAL B 1 59  ? 4.189   12.268  16.065  1.00 54.13 ? 59  VAL B N    1  
ATOM 3290   C CA   . VAL B 1 59  ? 3.098   11.951  15.140  1.00 14.21 ? 59  VAL B CA   1  
ATOM 3291   C C    . VAL B 1 59  ? 2.893   13.139  14.198  1.00 14.02 ? 59  VAL B C    1  
ATOM 3292   O O    . VAL B 1 59  ? 2.635   14.264  14.658  1.00 64.25 ? 59  VAL B O    1  
ATOM 3293   C CB   . VAL B 1 59  ? 1.751   11.667  15.911  1.00 13.41 ? 59  VAL B CB   1  
ATOM 3294   C CG1  . VAL B 1 59  ? 0.647   11.159  14.955  1.00 34.21 ? 59  VAL B CG1  1  
ATOM 3295   C CG2  . VAL B 1 59  ? 1.978   10.699  17.086  1.00 30.44 ? 59  VAL B CG2  1  
ATOM 3296   H H    . VAL B 1 59  ? 4.010   12.907  16.775  1.00 25.40 ? 59  VAL B H    1  
ATOM 3297   H HA   . VAL B 1 59  ? 3.363   11.062  14.560  1.00 61.03 ? 59  VAL B HA   1  
ATOM 3298   H HB   . VAL B 1 59  ? 1.401   12.611  16.336  1.00 50.12 ? 59  VAL B HB   1  
ATOM 3299   H HG11 . VAL B 1 59  ? 0.389   11.937  14.252  1.00 51.13 ? 59  VAL B HG11 1  
ATOM 3300   H HG12 . VAL B 1 59  ? -0.237  10.888  15.518  1.00 24.23 ? 59  VAL B HG12 1  
ATOM 3301   H HG13 . VAL B 1 59  ? 1.001   10.295  14.408  1.00 32.20 ? 59  VAL B HG13 1  
ATOM 3302   H HG21 . VAL B 1 59  ? 2.437   9.786   16.730  1.00 14.22 ? 59  VAL B HG21 1  
ATOM 3303   H HG22 . VAL B 1 59  ? 1.036   10.463  17.563  1.00 72.31 ? 59  VAL B HG22 1  
ATOM 3304   H HG23 . VAL B 1 59  ? 2.634   11.159  17.814  1.00 30.22 ? 59  VAL B HG23 1  
ATOM 3305   N N    . LEU B 1 60  ? 3.016   12.894  12.890  1.00 73.41 ? 60  LEU B N    1  
ATOM 3306   C CA   . LEU B 1 60  ? 2.742   13.909  11.874  1.00 34.43 ? 60  LEU B CA   1  
ATOM 3307   C C    . LEU B 1 60  ? 1.437   13.524  11.167  1.00 14.22 ? 60  LEU B C    1  
ATOM 3308   O O    . LEU B 1 60  ? 1.359   12.478  10.505  1.00 40.11 ? 60  LEU B O    1  
ATOM 3309   C CB   . LEU B 1 60  ? 3.947   14.043  10.889  1.00 31.44 ? 60  LEU B CB   1  
ATOM 3310   C CG   . LEU B 1 60  ? 4.025   15.366  10.028  1.00 44.41 ? 60  LEU B CG   1  
ATOM 3311   C CD1  . LEU B 1 60  ? 3.017   15.391  8.856   1.00 64.15 ? 60  LEU B CD1  1  
ATOM 3312   C CD2  . LEU B 1 60  ? 3.864   16.631  10.922  1.00 63.41 ? 60  LEU B CD2  1  
ATOM 3313   H H    . LEU B 1 60  ? 3.291   11.999  12.599  1.00 53.14 ? 60  LEU B H    1  
ATOM 3314   H HA   . LEU B 1 60  ? 2.595   14.864  12.379  1.00 13.42 ? 60  LEU B HA   1  
ATOM 3315   H HB2  . LEU B 1 60  ? 4.861   13.972  11.473  1.00 73.41 ? 60  LEU B HB2  1  
ATOM 3316   H HB3  . LEU B 1 60  ? 3.930   13.194  10.210  1.00 34.32 ? 60  LEU B HB3  1  
ATOM 3317   H HG   . LEU B 1 60  ? 5.013   15.418  9.582   1.00 44.34 ? 60  LEU B HG   1  
ATOM 3318   H HD11 . LEU B 1 60  ? 2.001   15.353  9.238   1.00 43.23 ? 60  LEU B HD11 1  
ATOM 3319   H HD12 . LEU B 1 60  ? 3.183   14.538  8.214   1.00 23.33 ? 60  LEU B HD12 1  
ATOM 3320   H HD13 . LEU B 1 60  ? 3.146   16.296  8.279   1.00 33.42 ? 60  LEU B HD13 1  
ATOM 3321   H HD21 . LEU B 1 60  ? 3.967   17.522  10.315  1.00 35.05 ? 60  LEU B HD21 1  
ATOM 3322   H HD22 . LEU B 1 60  ? 4.631   16.638  11.685  1.00 42.14 ? 60  LEU B HD22 1  
ATOM 3323   H HD23 . LEU B 1 60  ? 2.890   16.632  11.395  1.00 13.03 ? 60  LEU B HD23 1  
ATOM 3324   N N    . ARG B 1 61  ? 0.417   14.368  11.351  1.00 64.34 ? 61  ARG B N    1  
ATOM 3325   C CA   . ARG B 1 61  ? -0.901  14.190  10.745  1.00 42.11 ? 61  ARG B CA   1  
ATOM 3326   C C    . ARG B 1 61  ? -0.963  14.960  9.428   1.00 4.40  ? 61  ARG B C    1  
ATOM 3327   O O    . ARG B 1 61  ? -0.584  16.129  9.375   1.00 22.45 ? 61  ARG B O    1  
ATOM 3328   C CB   . ARG B 1 61  ? -1.998  14.712  11.712  1.00 34.14 ? 61  ARG B CB   1  
ATOM 3329   C CG   . ARG B 1 61  ? -3.457  14.458  11.247  1.00 74.43 ? 61  ARG B CG   1  
ATOM 3330   C CD   . ARG B 1 61  ? -4.492  15.342  11.976  1.00 53.14 ? 61  ARG B CD   1  
ATOM 3331   N NE   . ARG B 1 61  ? -4.310  15.368  13.441  1.00 61.23 ? 61  ARG B NE   1  
ATOM 3332   C CZ   . ARG B 1 61  ? -5.201  14.965  14.360  1.00 33.22 ? 61  ARG B CZ   1  
ATOM 3333   N NH1  . ARG B 1 61  ? -6.388  14.468  14.008  1.00 44.42 ? 61  ARG B NH1  1  
ATOM 3334   N NH2  . ARG B 1 61  ? -4.899  15.113  15.639  1.00 44.43 ? 61  ARG B NH2  1  
ATOM 3335   H H    . ARG B 1 61  ? 0.562   15.155  11.921  1.00 43.15 ? 61  ARG B H    1  
ATOM 3336   H HA   . ARG B 1 61  ? -1.056  13.130  10.546  1.00 32.24 ? 61  ARG B HA   1  
ATOM 3337   H HB2  . ARG B 1 61  ? -1.862  14.229  12.675  1.00 34.32 ? 61  ARG B HB2  1  
ATOM 3338   H HB3  . ARG B 1 61  ? -1.860  15.781  11.849  1.00 4.22  ? 61  ARG B HB3  1  
ATOM 3339   H HG2  . ARG B 1 61  ? -3.525  14.653  10.183  1.00 23.45 ? 61  ARG B HG2  1  
ATOM 3340   H HG3  . ARG B 1 61  ? -3.701  13.417  11.427  1.00 42.12 ? 61  ARG B HG3  1  
ATOM 3341   H HD2  . ARG B 1 61  ? -4.400  16.358  11.609  1.00 13.22 ? 61  ARG B HD2  1  
ATOM 3342   H HD3  . ARG B 1 61  ? -5.488  14.979  11.744  1.00 13.42 ? 61  ARG B HD3  1  
ATOM 3343   H HE   . ARG B 1 61  ? -3.450  15.714  13.764  1.00 13.22 ? 61  ARG B HE   1  
ATOM 3344   H HH11 . ARG B 1 61  ? -6.634  14.380  13.036  1.00 72.11 ? 61  ARG B HH11 1  
ATOM 3345   H HH12 . ARG B 1 61  ? -7.043  14.171  14.709  1.00 45.12 ? 61  ARG B HH12 1  
ATOM 3346   H HH21 . ARG B 1 61  ? -4.013  15.514  15.900  1.00 22.11 ? 61  ARG B HH21 1  
ATOM 3347   H HH22 . ARG B 1 61  ? -5.541  14.823  16.350  1.00 50.25 ? 61  ARG B HH22 1  
ATOM 3348   N N    . VAL B 1 62  ? -1.406  14.272  8.374   1.00 73.42 ? 62  VAL B N    1  
ATOM 3349   C CA   . VAL B 1 62  ? -1.682  14.853  7.055   1.00 44.23 ? 62  VAL B CA   1  
ATOM 3350   C C    . VAL B 1 62  ? -3.161  14.606  6.737   1.00 21.44 ? 62  VAL B C    1  
ATOM 3351   O O    . VAL B 1 62  ? -3.558  13.467  6.457   1.00 15.11 ? 62  VAL B O    1  
ATOM 3352   C CB   . VAL B 1 62  ? -0.760  14.202  5.954   1.00 4.13  ? 62  VAL B CB   1  
ATOM 3353   C CG1  . VAL B 1 62  ? -1.025  14.807  4.541   1.00 3.21  ? 62  VAL B CG1  1  
ATOM 3354   C CG2  . VAL B 1 62  ? 0.735   14.292  6.354   1.00 32.12 ? 62  VAL B CG2  1  
ATOM 3355   H H    . VAL B 1 62  ? -1.553  13.311  8.489   1.00 71.43 ? 62  VAL B H    1  
ATOM 3356   H HA   . VAL B 1 62  ? -1.490  15.927  7.083   1.00 71.40 ? 62  VAL B HA   1  
ATOM 3357   H HB   . VAL B 1 62  ? -1.015  13.138  5.902   1.00 5.32  ? 62  VAL B HB   1  
ATOM 3358   H HG11 . VAL B 1 62  ? -1.964  14.423  4.164   1.00 71.34 ? 62  VAL B HG11 1  
ATOM 3359   H HG12 . VAL B 1 62  ? -0.237  14.525  3.857   1.00 71.32 ? 62  VAL B HG12 1  
ATOM 3360   H HG13 . VAL B 1 62  ? -1.091  15.874  4.581   1.00 24.50 ? 62  VAL B HG13 1  
ATOM 3361   H HG21 . VAL B 1 62  ? 1.290   13.514  5.865   1.00 12.21 ? 62  VAL B HG21 1  
ATOM 3362   H HG22 . VAL B 1 62  ? 0.839   14.166  7.425   1.00 70.14 ? 62  VAL B HG22 1  
ATOM 3363   H HG23 . VAL B 1 62  ? 1.143   15.257  6.073   1.00 72.50 ? 62  VAL B HG23 1  
ATOM 3364   N N    . THR B 1 63  ? -3.978  15.657  6.857   1.00 44.31 ? 63  THR B N    1  
ATOM 3365   C CA   . THR B 1 63  ? -5.404  15.593  6.540   1.00 5.44  ? 63  THR B CA   1  
ATOM 3366   C C    . THR B 1 63  ? -5.644  16.161  5.139   1.00 74.03 ? 63  THR B C    1  
ATOM 3367   O O    . THR B 1 63  ? -5.144  17.244  4.797   1.00 10.51 ? 63  THR B O    1  
ATOM 3368   C CB   . THR B 1 63  ? -6.259  16.377  7.585   1.00 44.03 ? 63  THR B CB   1  
ATOM 3369   O OG1  . THR B 1 63  ? -5.834  16.029  8.915   1.00 12.41 ? 63  THR B OG1  1  
ATOM 3370   C CG2  . THR B 1 63  ? -7.767  16.075  7.431   1.00 73.13 ? 63  THR B CG2  1  
ATOM 3371   H H    . THR B 1 63  ? -3.610  16.504  7.180   1.00 43.31 ? 63  THR B H    1  
ATOM 3372   H HA   . THR B 1 63  ? -5.714  14.543  6.560   1.00 44.40 ? 63  THR B HA   1  
ATOM 3373   H HB   . THR B 1 63  ? -6.102  17.443  7.447   1.00 44.14 ? 63  THR B HB   1  
ATOM 3374   H HG1  . THR B 1 63  ? -6.370  15.299  9.237   1.00 33.23 ? 63  THR B HG1  1  
ATOM 3375   H HG21 . THR B 1 63  ? -8.308  16.542  8.231   1.00 3.12  ? 63  THR B HG21 1  
ATOM 3376   H HG22 . THR B 1 63  ? -7.939  15.006  7.467   1.00 3.41  ? 63  THR B HG22 1  
ATOM 3377   H HG23 . THR B 1 63  ? -8.124  16.462  6.484   1.00 72.15 ? 63  THR B HG23 1  
ATOM 3378   N N    . VAL B 1 64  ? -6.394  15.401  4.338   1.00 32.21 ? 64  VAL B N    1  
ATOM 3379   C CA   . VAL B 1 64  ? -6.781  15.767  2.975   1.00 73.24 ? 64  VAL B CA   1  
ATOM 3380   C C    . VAL B 1 64  ? -8.306  15.760  2.874   1.00 33.33 ? 64  VAL B C    1  
ATOM 3381   O O    . VAL B 1 64  ? -8.947  14.741  3.132   1.00 34.54 ? 64  VAL B O    1  
ATOM 3382   C CB   . VAL B 1 64  ? -6.188  14.776  1.906   1.00 4.33  ? 64  VAL B CB   1  
ATOM 3383   C CG1  . VAL B 1 64  ? -6.697  15.106  0.476   1.00 13.22 ? 64  VAL B CG1  1  
ATOM 3384   C CG2  . VAL B 1 64  ? -4.642  14.757  1.970   1.00 11.12 ? 64  VAL B CG2  1  
ATOM 3385   H H    . VAL B 1 64  ? -6.719  14.553  4.696   1.00 31.20 ? 64  VAL B H    1  
ATOM 3386   H HA   . VAL B 1 64  ? -6.407  16.771  2.759   1.00 15.13 ? 64  VAL B HA   1  
ATOM 3387   H HB   . VAL B 1 64  ? -6.538  13.772  2.154   1.00 60.35 ? 64  VAL B HB   1  
ATOM 3388   H HG11 . VAL B 1 64  ? -6.454  14.301  -0.190  1.00 42.22 ? 64  VAL B HG11 1  
ATOM 3389   H HG12 . VAL B 1 64  ? -6.238  16.017  0.117   1.00 65.14 ? 64  VAL B HG12 1  
ATOM 3390   H HG13 . VAL B 1 64  ? -7.771  15.233  0.489   1.00 54.50 ? 64  VAL B HG13 1  
ATOM 3391   H HG21 . VAL B 1 64  ? -4.236  15.717  1.709   1.00 32.14 ? 64  VAL B HG21 1  
ATOM 3392   H HG22 . VAL B 1 64  ? -4.254  14.009  1.292   1.00 34.11 ? 64  VAL B HG22 1  
ATOM 3393   H HG23 . VAL B 1 64  ? -4.329  14.514  2.977   1.00 64.35 ? 64  VAL B HG23 1  
ATOM 3394   N N    . THR B 1 65  ? -8.874  16.893  2.495   1.00 31.52 ? 65  THR B N    1  
ATOM 3395   C CA   . THR B 1 65  ? -10.296 17.014  2.197   1.00 14.44 ? 65  THR B CA   1  
ATOM 3396   C C    . THR B 1 65  ? -10.457 17.348  0.717   1.00 62.34 ? 65  THR B C    1  
ATOM 3397   O O    . THR B 1 65  ? -9.637  18.064  0.151   1.00 72.14 ? 65  THR B O    1  
ATOM 3398   C CB   . THR B 1 65  ? -10.944 18.127  3.089   1.00 55.41 ? 65  THR B CB   1  
ATOM 3399   O OG1  . THR B 1 65  ? -10.768 17.800  4.484   1.00 33.11 ? 65  THR B OG1  1  
ATOM 3400   C CG2  . THR B 1 65  ? -12.444 18.348  2.792   1.00 14.44 ? 65  THR B CG2  1  
ATOM 3401   H H    . THR B 1 65  ? -8.312  17.690  2.406   1.00 53.40 ? 65  THR B H    1  
ATOM 3402   H HA   . THR B 1 65  ? -10.780 16.056  2.401   1.00 22.33 ? 65  THR B HA   1  
ATOM 3403   H HB   . THR B 1 65  ? -10.420 19.059  2.899   1.00 64.01 ? 65  THR B HB   1  
ATOM 3404   H HG1  . THR B 1 65  ? -10.450 16.893  4.567   1.00 1.11  ? 65  THR B HG1  1  
ATOM 3405   H HG21 . THR B 1 65  ? -12.989 17.427  2.947   1.00 34.33 ? 65  THR B HG21 1  
ATOM 3406   H HG22 . THR B 1 65  ? -12.575 18.671  1.768   1.00 63.34 ? 65  THR B HG22 1  
ATOM 3407   H HG23 . THR B 1 65  ? -12.835 19.107  3.452   1.00 4.44  ? 65  THR B HG23 1  
ATOM 3408   N N    . ALA B 1 66  ? -11.500 16.805  0.091   1.00 23.14 ? 66  ALA B N    1  
ATOM 3409   C CA   . ALA B 1 66  ? -11.844 17.111  -1.299  1.00 63.14 ? 66  ALA B CA   1  
ATOM 3410   C C    . ALA B 1 66  ? -13.354 17.255  -1.409  1.00 53.01 ? 66  ALA B C    1  
ATOM 3411   O O    . ALA B 1 66  ? -14.093 16.530  -0.727  1.00 52.34 ? 66  ALA B O    1  
ATOM 3412   C CB   . ALA B 1 66  ? -11.306 16.025  -2.242  1.00 10.30 ? 66  ALA B CB   1  
ATOM 3413   H H    . ALA B 1 66  ? -12.077 16.172  0.589   1.00 61.13 ? 66  ALA B H    1  
ATOM 3414   H HA   . ALA B 1 66  ? -11.382 18.062  -1.569  1.00 32.21 ? 66  ALA B HA   1  
ATOM 3415   H HB1  . ALA B 1 66  ? -10.231 15.955  -2.142  1.00 31.10 ? 66  ALA B HB1  1  
ATOM 3416   H HB2  . ALA B 1 66  ? -11.549 16.274  -3.267  1.00 45.31 ? 66  ALA B HB2  1  
ATOM 3417   H HB3  . ALA B 1 66  ? -11.748 15.065  -1.995  1.00 71.31 ? 66  ALA B HB3  1  
ATOM 3418   N N    . SER B 1 67  ? -13.804 18.203  -2.249  1.00 5.11  ? 67  SER B N    1  
ATOM 3419   C CA   . SER B 1 67  ? -15.233 18.497  -2.447  1.00 1.21  ? 67  SER B CA   1  
ATOM 3420   C C    . SER B 1 67  ? -15.462 19.270  -3.760  1.00 54.55 ? 67  SER B C    1  
ATOM 3421   O O    . SER B 1 67  ? -14.593 20.033  -4.188  1.00 62.42 ? 67  SER B O    1  
ATOM 3422   C CB   . SER B 1 67  ? -15.766 19.305  -1.231  1.00 61.35 ? 67  SER B CB   1  
ATOM 3423   O OG   . SER B 1 67  ? -14.961 20.449  -0.967  1.00 24.11 ? 67  SER B OG   1  
ATOM 3424   H H    . SER B 1 67  ? -13.145 18.740  -2.743  1.00 3.03  ? 67  SER B H    1  
ATOM 3425   H HA   . SER B 1 67  ? -15.762 17.550  -2.508  1.00 22.21 ? 67  SER B HA   1  
ATOM 3426   H HB2  . SER B 1 67  ? -16.779 19.635  -1.424  1.00 12.34 ? 67  SER B HB2  1  
ATOM 3427   H HB3  . SER B 1 67  ? -15.761 18.674  -0.351  1.00 21.52 ? 67  SER B HB3  1  
ATOM 3428   H HG   . SER B 1 67  ? -14.031 20.215  -1.041  1.00 44.24 ? 67  SER B HG   1  
ATOM 3429   N N    . LEU B 1 68  ? -16.633 19.044  -4.407  1.00 61.12 ? 68  LEU B N    1  
ATOM 3430   C CA   . LEU B 1 68  ? -17.067 19.810  -5.597  1.00 20.43 ? 68  LEU B CA   1  
ATOM 3431   C C    . LEU B 1 68  ? -18.441 20.430  -5.307  1.00 73.30 ? 68  LEU B C    1  
ATOM 3432   O O    . LEU B 1 68  ? -19.368 19.725  -4.870  1.00 74.43 ? 68  LEU B O    1  
ATOM 3433   C CB   . LEU B 1 68  ? -17.175 18.947  -6.886  1.00 41.12 ? 68  LEU B CB   1  
ATOM 3434   C CG   . LEU B 1 68  ? -15.959 18.034  -7.250  1.00 32.14 ? 68  LEU B CG   1  
ATOM 3435   C CD1  . LEU B 1 68  ? -16.030 16.676  -6.523  1.00 64.14 ? 68  LEU B CD1  1  
ATOM 3436   C CD2  . LEU B 1 68  ? -15.842 17.840  -8.773  1.00 14.35 ? 68  LEU B CD2  1  
ATOM 3437   H H    . LEU B 1 68  ? -17.238 18.353  -4.058  1.00 54.43 ? 68  LEU B H    1  
ATOM 3438   H HA   . LEU B 1 68  ? -16.349 20.613  -5.771  1.00 3.20  ? 68  LEU B HA   1  
ATOM 3439   H HB2  . LEU B 1 68  ? -18.058 18.317  -6.800  1.00 73.23 ? 68  LEU B HB2  1  
ATOM 3440   H HB3  . LEU B 1 68  ? -17.347 19.628  -7.714  1.00 21.11 ? 68  LEU B HB3  1  
ATOM 3441   H HG   . LEU B 1 68  ? -15.047 18.520  -6.918  1.00 3.02  ? 68  LEU B HG   1  
ATOM 3442   H HD11 . LEU B 1 68  ? -15.163 16.079  -6.776  1.00 64.31 ? 68  LEU B HD11 1  
ATOM 3443   H HD12 . LEU B 1 68  ? -16.927 16.142  -6.812  1.00 62.34 ? 68  LEU B HD12 1  
ATOM 3444   H HD13 . LEU B 1 68  ? -16.043 16.839  -5.452  1.00 11.14 ? 68  LEU B HD13 1  
ATOM 3445   H HD21 . LEU B 1 68  ? -16.746 17.388  -9.159  1.00 44.24 ? 68  LEU B HD21 1  
ATOM 3446   H HD22 . LEU B 1 68  ? -14.998 17.197  -8.997  1.00 25.55 ? 68  LEU B HD22 1  
ATOM 3447   H HD23 . LEU B 1 68  ? -15.688 18.800  -9.248  1.00 63.30 ? 68  LEU B HD23 1  
ATOM 3448   N N    . GLY B 1 69  ? -18.567 21.734  -5.581  1.00 52.44 ? 69  GLY B N    1  
ATOM 3449   C CA   . GLY B 1 69  ? -19.787 22.470  -5.292  1.00 14.21 ? 69  GLY B CA   1  
ATOM 3450   C C    . GLY B 1 69  ? -19.944 22.684  -3.797  1.00 71.01 ? 69  GLY B C    1  
ATOM 3451   O O    . GLY B 1 69  ? -19.078 23.297  -3.167  1.00 32.04 ? 69  GLY B O    1  
ATOM 3452   H H    . GLY B 1 69  ? -17.802 22.211  -5.963  1.00 1.22  ? 69  GLY B H    1  
ATOM 3453   H HA2  . GLY B 1 69  ? -19.733 23.432  -5.786  1.00 52.51 ? 69  GLY B HA2  1  
ATOM 3454   H HA3  . GLY B 1 69  ? -20.644 21.919  -5.681  1.00 63.42 ? 69  GLY B HA3  1  
ATOM 3455   N N    . GLU B 1 70  ? -21.029 22.152  -3.222  1.00 31.33 ? 70  GLU B N    1  
ATOM 3456   C CA   . GLU B 1 70  ? -21.276 22.203  -1.768  1.00 24.33 ? 70  GLU B CA   1  
ATOM 3457   C C    . GLU B 1 70  ? -21.268 20.792  -1.159  1.00 23.33 ? 70  GLU B C    1  
ATOM 3458   O O    . GLU B 1 70  ? -21.533 20.640  0.037   1.00 64.51 ? 70  GLU B O    1  
ATOM 3459   C CB   . GLU B 1 70  ? -22.629 22.912  -1.484  1.00 54.03 ? 70  GLU B CB   1  
ATOM 3460   C CG   . GLU B 1 70  ? -22.743 24.348  -2.037  1.00 35.12 ? 70  GLU B CG   1  
ATOM 3461   C CD   . GLU B 1 70  ? -21.663 25.300  -1.496  1.00 34.52 ? 70  GLU B CD   1  
ATOM 3462   O OE1  . GLU B 1 70  ? -21.623 25.528  -0.268  1.00 62.53 ? 70  GLU B OE1  1  
ATOM 3463   O OE2  . GLU B 1 70  ? -20.873 25.850  -2.293  1.00 5.54  ? 70  GLU B OE2  1  
ATOM 3464   H H    . GLU B 1 70  ? -21.696 21.717  -3.794  1.00 53.53 ? 70  GLU B H    1  
ATOM 3465   H HA   . GLU B 1 70  ? -20.477 22.772  -1.296  1.00 50.25 ? 70  GLU B HA   1  
ATOM 3466   H HB2  . GLU B 1 70  ? -23.431 22.321  -1.916  1.00 33.32 ? 70  GLU B HB2  1  
ATOM 3467   H HB3  . GLU B 1 70  ? -22.781 22.955  -0.411  1.00 75.22 ? 70  GLU B HB3  1  
ATOM 3468   H HG2  . GLU B 1 70  ? -22.673 24.306  -3.120  1.00 21.32 ? 70  GLU B HG2  1  
ATOM 3469   H HG3  . GLU B 1 70  ? -23.718 24.745  -1.772  1.00 72.54 ? 70  GLU B HG3  1  
ATOM 3470   N N    . GLU B 1 71  ? -20.947 19.760  -1.972  1.00 33.12 ? 71  GLU B N    1  
ATOM 3471   C CA   . GLU B 1 71  ? -20.918 18.353  -1.503  1.00 34.51 ? 71  GLU B CA   1  
ATOM 3472   C C    . GLU B 1 71  ? -19.494 17.782  -1.619  1.00 71.21 ? 71  GLU B C    1  
ATOM 3473   O O    . GLU B 1 71  ? -18.660 18.312  -2.356  1.00 50.30 ? 71  GLU B O    1  
ATOM 3474   C CB   . GLU B 1 71  ? -21.944 17.469  -2.277  1.00 33.42 ? 71  GLU B CB   1  
ATOM 3475   C CG   . GLU B 1 71  ? -21.544 17.072  -3.714  1.00 20.14 ? 71  GLU B CG   1  
ATOM 3476   C CD   . GLU B 1 71  ? -22.635 16.253  -4.441  1.00 14.54 ? 71  GLU B CD   1  
ATOM 3477   O OE1  . GLU B 1 71  ? -22.582 15.001  -4.424  1.00 10.44 ? 71  GLU B OE1  1  
ATOM 3478   O OE2  . GLU B 1 71  ? -23.554 16.871  -5.028  1.00 71.34 ? 71  GLU B OE2  1  
ATOM 3479   H H    . GLU B 1 71  ? -20.696 19.949  -2.898  1.00 63.34 ? 71  GLU B H    1  
ATOM 3480   H HA   . GLU B 1 71  ? -21.190 18.350  -0.444  1.00 35.53 ? 71  GLU B HA   1  
ATOM 3481   H HB2  . GLU B 1 71  ? -22.107 16.558  -1.713  1.00 64.15 ? 71  GLU B HB2  1  
ATOM 3482   H HB3  . GLU B 1 71  ? -22.883 18.007  -2.330  1.00 74.13 ? 71  GLU B HB3  1  
ATOM 3483   H HG2  . GLU B 1 71  ? -21.348 17.975  -4.283  1.00 70.14 ? 71  GLU B HG2  1  
ATOM 3484   H HG3  . GLU B 1 71  ? -20.628 16.484  -3.671  1.00 72.43 ? 71  GLU B HG3  1  
ATOM 3485   N N    . THR B 1 72  ? -19.251 16.680  -0.896  1.00 20.13 ? 72  THR B N    1  
ATOM 3486   C CA   . THR B 1 72  ? -17.914 16.081  -0.725  1.00 33.31 ? 72  THR B CA   1  
ATOM 3487   C C    . THR B 1 72  ? -17.496 15.257  -1.970  1.00 34.21 ? 72  THR B C    1  
ATOM 3488   O O    . THR B 1 72  ? -18.341 14.774  -2.707  1.00 1.42  ? 72  THR B O    1  
ATOM 3489   C CB   . THR B 1 72  ? -17.930 15.165  0.545   1.00 12.44 ? 72  THR B CB   1  
ATOM 3490   O OG1  . THR B 1 72  ? -18.485 15.904  1.644   1.00 71.20 ? 72  THR B OG1  1  
ATOM 3491   C CG2  . THR B 1 72  ? -16.533 14.654  0.951   1.00 51.54 ? 72  THR B CG2  1  
ATOM 3492   H H    . THR B 1 72  ? -20.010 16.232  -0.469  1.00 44.31 ? 72  THR B H    1  
ATOM 3493   H HA   . THR B 1 72  ? -17.200 16.884  -0.563  1.00 21.21 ? 72  THR B HA   1  
ATOM 3494   H HB   . THR B 1 72  ? -18.575 14.309  0.347   1.00 63.22 ? 72  THR B HB   1  
ATOM 3495   H HG1  . THR B 1 72  ? -19.434 16.008  1.513   1.00 63.55 ? 72  THR B HG1  1  
ATOM 3496   H HG21 . THR B 1 72  ? -16.628 13.845  1.662   1.00 1.10  ? 72  THR B HG21 1  
ATOM 3497   H HG22 . THR B 1 72  ? -15.974 15.451  1.422   1.00 45.42 ? 72  THR B HG22 1  
ATOM 3498   H HG23 . THR B 1 72  ? -15.992 14.301  0.081   1.00 73.35 ? 72  THR B HG23 1  
ATOM 3499   N N    . ALA B 1 73  ? -16.183 15.151  -2.206  1.00 63.12 ? 73  ALA B N    1  
ATOM 3500   C CA   . ALA B 1 73  ? -15.606 14.201  -3.172  1.00 41.02 ? 73  ALA B CA   1  
ATOM 3501   C C    . ALA B 1 73  ? -15.141 12.967  -2.396  1.00 65.42 ? 73  ALA B C    1  
ATOM 3502   O O    . ALA B 1 73  ? -15.654 11.860  -2.581  1.00 61.31 ? 73  ALA B O    1  
ATOM 3503   C CB   . ALA B 1 73  ? -14.441 14.847  -3.933  1.00 31.12 ? 73  ALA B CB   1  
ATOM 3504   H H    . ALA B 1 73  ? -15.578 15.724  -1.704  1.00 22.53 ? 73  ALA B H    1  
ATOM 3505   H HA   . ALA B 1 73  ? -16.373 13.908  -3.894  1.00 62.44 ? 73  ALA B HA   1  
ATOM 3506   H HB1  . ALA B 1 73  ? -14.777 15.761  -4.397  1.00 14.24 ? 73  ALA B HB1  1  
ATOM 3507   H HB2  . ALA B 1 73  ? -14.081 14.175  -4.698  1.00 4.11  ? 73  ALA B HB2  1  
ATOM 3508   H HB3  . ALA B 1 73  ? -13.632 15.073  -3.248  1.00 31.21 ? 73  ALA B HB3  1  
ATOM 3509   N N    . PHE B 1 74  ? -14.176 13.210  -1.490  1.00 61.43 ? 74  PHE B N    1  
ATOM 3510   C CA   . PHE B 1 74  ? -13.656 12.209  -0.552  1.00 42.41 ? 74  PHE B CA   1  
ATOM 3511   C C    . PHE B 1 74  ? -12.965 12.915  0.628   1.00 11.30 ? 74  PHE B C    1  
ATOM 3512   O O    . PHE B 1 74  ? -12.477 14.049  0.503   1.00 44.04 ? 74  PHE B O    1  
ATOM 3513   C CB   . PHE B 1 74  ? -12.687 11.210  -1.254  1.00 53.04 ? 74  PHE B CB   1  
ATOM 3514   C CG   . PHE B 1 74  ? -11.463 11.837  -1.944  1.00 14.04 ? 74  PHE B CG   1  
ATOM 3515   C CD1  . PHE B 1 74  ? -10.257 12.013  -1.257  1.00 15.30 ? 74  PHE B CD1  1  
ATOM 3516   C CD2  . PHE B 1 74  ? -11.519 12.240  -3.282  1.00 54.14 ? 74  PHE B CD2  1  
ATOM 3517   C CE1  . PHE B 1 74  ? -9.157  12.573  -1.880  1.00 14.32 ? 74  PHE B CE1  1  
ATOM 3518   C CE2  . PHE B 1 74  ? -10.418 12.798  -3.904  1.00 35.21 ? 74  PHE B CE2  1  
ATOM 3519   C CZ   . PHE B 1 74  ? -9.236  12.964  -3.204  1.00 15.44 ? 74  PHE B CZ   1  
ATOM 3520   H H    . PHE B 1 74  ? -13.801 14.117  -1.445  1.00 71.14 ? 74  PHE B H    1  
ATOM 3521   H HA   . PHE B 1 74  ? -14.510 11.655  -0.158  1.00 73.44 ? 74  PHE B HA   1  
ATOM 3522   H HB2  . PHE B 1 74  ? -12.329 10.493  -0.523  1.00 31.45 ? 74  PHE B HB2  1  
ATOM 3523   H HB3  . PHE B 1 74  ? -13.248 10.665  -2.008  1.00 33.52 ? 74  PHE B HB3  1  
ATOM 3524   H HD1  . PHE B 1 74  ? -10.187 11.706  -0.219  1.00 53.40 ? 74  PHE B HD1  1  
ATOM 3525   H HD2  . PHE B 1 74  ? -12.442 12.113  -3.836  1.00 64.42 ? 74  PHE B HD2  1  
ATOM 3526   H HE1  . PHE B 1 74  ? -8.234  12.701  -1.333  1.00 33.21 ? 74  PHE B HE1  1  
ATOM 3527   H HE2  . PHE B 1 74  ? -10.481 13.104  -4.940  1.00 40.12 ? 74  PHE B HE2  1  
ATOM 3528   H HZ   . PHE B 1 74  ? -8.376  13.402  -3.692  1.00 62.21 ? 74  PHE B HZ   1  
ATOM 3529   N N    . LEU B 1 75  ? -12.947 12.229  1.768   1.00 3.10  ? 75  LEU B N    1  
ATOM 3530   C CA   . LEU B 1 75  ? -12.309 12.688  3.011   1.00 23.12 ? 75  LEU B CA   1  
ATOM 3531   C C    . LEU B 1 75  ? -11.222 11.682  3.370   1.00 14.44 ? 75  LEU B C    1  
ATOM 3532   O O    . LEU B 1 75  ? -11.441 10.480  3.230   1.00 4.41  ? 75  LEU B O    1  
ATOM 3533   C CB   . LEU B 1 75  ? -13.367 12.780  4.147   1.00 0.50  ? 75  LEU B CB   1  
ATOM 3534   C CG   . LEU B 1 75  ? -14.580 13.712  3.853   1.00 22.13 ? 75  LEU B CG   1  
ATOM 3535   C CD1  . LEU B 1 75  ? -15.658 13.616  4.950   1.00 22.42 ? 75  LEU B CD1  1  
ATOM 3536   C CD2  . LEU B 1 75  ? -14.124 15.174  3.632   1.00 55.34 ? 75  LEU B CD2  1  
ATOM 3537   H H    . LEU B 1 75  ? -13.371 11.349  1.778   1.00 65.20 ? 75  LEU B H    1  
ATOM 3538   H HA   . LEU B 1 75  ? -11.860 13.667  2.848   1.00 25.25 ? 75  LEU B HA   1  
ATOM 3539   H HB2  . LEU B 1 75  ? -13.746 11.776  4.341   1.00 70.12 ? 75  LEU B HB2  1  
ATOM 3540   H HB3  . LEU B 1 75  ? -12.879 13.131  5.052   1.00 61.14 ? 75  LEU B HB3  1  
ATOM 3541   H HG   . LEU B 1 75  ? -15.043 13.380  2.931   1.00 71.50 ? 75  LEU B HG   1  
ATOM 3542   H HD11 . LEU B 1 75  ? -15.883 12.576  5.154   1.00 3.40  ? 75  LEU B HD11 1  
ATOM 3543   H HD12 . LEU B 1 75  ? -16.558 14.106  4.610   1.00 54.54 ? 75  LEU B HD12 1  
ATOM 3544   H HD13 . LEU B 1 75  ? -15.311 14.094  5.851   1.00 41.12 ? 75  LEU B HD13 1  
ATOM 3545   H HD21 . LEU B 1 75  ? -13.474 15.223  2.767   1.00 1.34  ? 75  LEU B HD21 1  
ATOM 3546   H HD22 . LEU B 1 75  ? -13.589 15.534  4.499   1.00 32.10 ? 75  LEU B HD22 1  
ATOM 3547   H HD23 . LEU B 1 75  ? -14.988 15.805  3.458   1.00 63.23 ? 75  LEU B HD23 1  
ATOM 3548   N N    . CYS B 1 76  ? -10.062 12.168  3.813   1.00 53.22 ? 76  CYS B N    1  
ATOM 3549   C CA   . CYS B 1 76  ? -8.928  11.315  4.183   1.00 11.23 ? 76  CYS B CA   1  
ATOM 3550   C C    . CYS B 1 76  ? -8.098  11.999  5.272   1.00 70.13 ? 76  CYS B C    1  
ATOM 3551   O O    . CYS B 1 76  ? -8.072  13.229  5.367   1.00 22.10 ? 76  CYS B O    1  
ATOM 3552   C CB   . CYS B 1 76  ? -8.044  10.984  2.951   1.00 1.32  ? 76  CYS B CB   1  
ATOM 3553   S SG   . CYS B 1 76  ? -6.750  9.761   3.287   1.00 50.14 ? 76  CYS B SG   1  
ATOM 3554   H H    . CYS B 1 76  ? -9.964  13.136  3.912   1.00 60.35 ? 76  CYS B H    1  
ATOM 3555   H HA   . CYS B 1 76  ? -9.327  10.386  4.588   1.00 23.43 ? 76  CYS B HA   1  
ATOM 3556   H HB2  . CYS B 1 76  ? -8.669  10.584  2.164   1.00 14.02 ? 76  CYS B HB2  1  
ATOM 3557   H HB3  . CYS B 1 76  ? -7.560  11.886  2.590   1.00 50.22 ? 76  CYS B HB3  1  
ATOM 3558   H HG   . CYS B 1 76  ? -7.237  8.887   4.160   1.00 15.41 ? 76  CYS B HG   1  
ATOM 3559   N N    . GLU B 1 77  ? -7.432  11.182  6.090   1.00 3.03  ? 77  GLU B N    1  
ATOM 3560   C CA   . GLU B 1 77  ? -6.543  11.637  7.151   1.00 22.13 ? 77  GLU B CA   1  
ATOM 3561   C C    . GLU B 1 77  ? -5.673  10.472  7.578   1.00 44.01 ? 77  GLU B C    1  
ATOM 3562   O O    . GLU B 1 77  ? -6.168  9.356   7.782   1.00 13.45 ? 77  GLU B O    1  
ATOM 3563   C CB   . GLU B 1 77  ? -7.318  12.186  8.383   1.00 15.23 ? 77  GLU B CB   1  
ATOM 3564   C CG   . GLU B 1 77  ? -6.400  12.700  9.516   1.00 11.31 ? 77  GLU B CG   1  
ATOM 3565   C CD   . GLU B 1 77  ? -7.158  13.266  10.722  1.00 33.43 ? 77  GLU B CD   1  
ATOM 3566   O OE1  . GLU B 1 77  ? -7.773  14.340  10.593  1.00 41.42 ? 77  GLU B OE1  1  
ATOM 3567   O OE2  . GLU B 1 77  ? -7.113  12.671  11.813  1.00 30.42 ? 77  GLU B OE2  1  
ATOM 3568   H H    . GLU B 1 77  ? -7.534  10.216  5.967   1.00 71.20 ? 77  GLU B H    1  
ATOM 3569   H HA   . GLU B 1 77  ? -5.904  12.424  6.740   1.00 52.41 ? 77  GLU B HA   1  
ATOM 3570   H HB2  . GLU B 1 77  ? -7.952  13.005  8.056   1.00 73.50 ? 77  GLU B HB2  1  
ATOM 3571   H HB3  . GLU B 1 77  ? -7.952  11.399  8.783   1.00 41.13 ? 77  GLU B HB3  1  
ATOM 3572   H HG2  . GLU B 1 77  ? -5.767  11.883  9.849   1.00 72.12 ? 77  GLU B HG2  1  
ATOM 3573   H HG3  . GLU B 1 77  ? -5.761  13.482  9.112   1.00 25.15 ? 77  GLU B HG3  1  
ATOM 3574   N N    . VAL B 1 78  ? -4.376  10.731  7.674   1.00 13.00 ? 78  VAL B N    1  
ATOM 3575   C CA   . VAL B 1 78  ? -3.393  9.770   8.158   1.00 65.21 ? 78  VAL B CA   1  
ATOM 3576   C C    . VAL B 1 78  ? -2.626  10.401  9.313   1.00 63.00 ? 78  VAL B C    1  
ATOM 3577   O O    . VAL B 1 78  ? -2.400  11.615  9.329   1.00 14.21 ? 78  VAL B O    1  
ATOM 3578   C CB   . VAL B 1 78  ? -2.397  9.353   7.010   1.00 73.33 ? 78  VAL B CB   1  
ATOM 3579   C CG1  . VAL B 1 78  ? -1.307  8.370   7.522   1.00 12.11 ? 78  VAL B CG1  1  
ATOM 3580   C CG2  . VAL B 1 78  ? -3.184  8.757   5.812   1.00 62.23 ? 78  VAL B CG2  1  
ATOM 3581   H H    . VAL B 1 78  ? -4.058  11.621  7.403   1.00 50.12 ? 78  VAL B H    1  
ATOM 3582   H HA   . VAL B 1 78  ? -3.911  8.877   8.518   1.00 74.11 ? 78  VAL B HA   1  
ATOM 3583   H HB   . VAL B 1 78  ? -1.888  10.254  6.659   1.00 44.42 ? 78  VAL B HB   1  
ATOM 3584   H HG11 . VAL B 1 78  ? -0.547  8.244   6.785   1.00 31.20 ? 78  VAL B HG11 1  
ATOM 3585   H HG12 . VAL B 1 78  ? -1.746  7.408   7.737   1.00 72.12 ? 78  VAL B HG12 1  
ATOM 3586   H HG13 . VAL B 1 78  ? -0.861  8.755   8.419   1.00 55.54 ? 78  VAL B HG13 1  
ATOM 3587   H HG21 . VAL B 1 78  ? -3.463  7.729   6.010   1.00 70.02 ? 78  VAL B HG21 1  
ATOM 3588   H HG22 . VAL B 1 78  ? -2.592  8.807   4.922   1.00 74.13 ? 78  VAL B HG22 1  
ATOM 3589   H HG23 . VAL B 1 78  ? -4.082  9.334   5.645   1.00 32.32 ? 78  VAL B HG23 1  
ATOM 3590   N N    . GLN B 1 79  ? -2.235  9.566   10.273  1.00 64.44 ? 79  GLN B N    1  
ATOM 3591   C CA   . GLN B 1 79  ? -1.325  9.946   11.346  1.00 0.45  ? 79  GLN B CA   1  
ATOM 3592   C C    . GLN B 1 79  ? -0.157  8.982   11.317  1.00 54.41 ? 79  GLN B C    1  
ATOM 3593   O O    . GLN B 1 79  ? -0.249  7.865   11.844  1.00 5.03  ? 79  GLN B O    1  
ATOM 3594   C CB   . GLN B 1 79  ? -2.004  9.936   12.743  1.00 2.44  ? 79  GLN B CB   1  
ATOM 3595   C CG   . GLN B 1 79  ? -3.035  11.053  13.001  1.00 41.11 ? 79  GLN B CG   1  
ATOM 3596   C CD   . GLN B 1 79  ? -3.454  11.178  14.477  1.00 1.21  ? 79  GLN B CD   1  
ATOM 3597   O OE1  . GLN B 1 79  ? -3.756  12.268  14.954  1.00 13.53 ? 79  GLN B OE1  1  
ATOM 3598   N NE2  . GLN B 1 79  ? -3.484  10.067  15.212  1.00 74.43 ? 79  GLN B NE2  1  
ATOM 3599   H H    . GLN B 1 79  ? -2.542  8.630   10.223  1.00 73.42 ? 79  GLN B H    1  
ATOM 3600   H HA   . GLN B 1 79  ? -0.946  10.945  11.136  1.00 63.22 ? 79  GLN B HA   1  
ATOM 3601   H HB2  . GLN B 1 79  ? -2.506  8.983   12.876  1.00 0.35  ? 79  GLN B HB2  1  
ATOM 3602   H HB3  . GLN B 1 79  ? -1.233  10.015  13.505  1.00 33.15 ? 79  GLN B HB3  1  
ATOM 3603   H HG2  . GLN B 1 79  ? -2.614  11.999  12.683  1.00 75.32 ? 79  GLN B HG2  1  
ATOM 3604   H HG3  . GLN B 1 79  ? -3.923  10.850  12.413  1.00 72.52 ? 79  GLN B HG3  1  
ATOM 3605   H HE21 . GLN B 1 79  ? -3.239  9.222   14.791  1.00 12.05 ? 79  GLN B HE21 1  
ATOM 3606   H HE22 . GLN B 1 79  ? -3.766  10.139  16.147  1.00 4.31  ? 79  GLN B HE22 1  
ATOM 3607   N N    . GLN B 1 80  ? 0.919   9.393   10.643  1.00 65.54 ? 80  GLN B N    1  
ATOM 3608   C CA   . GLN B 1 80  ? 2.139   8.611   10.583  1.00 74.40 ? 80  GLN B CA   1  
ATOM 3609   C C    . GLN B 1 80  ? 2.985   8.970   11.803  1.00 3.41  ? 80  GLN B C    1  
ATOM 3610   O O    . GLN B 1 80  ? 3.580   10.053  11.856  1.00 60.24 ? 80  GLN B O    1  
ATOM 3611   C CB   . GLN B 1 80  ? 2.907   8.874   9.261   1.00 10.24 ? 80  GLN B CB   1  
ATOM 3612   C CG   . GLN B 1 80  ? 3.964   7.801   8.940   1.00 72.42 ? 80  GLN B CG   1  
ATOM 3613   C CD   . GLN B 1 80  ? 3.363   6.415   8.649   1.00 62.23 ? 80  GLN B CD   1  
ATOM 3614   O OE1  . GLN B 1 80  ? 3.966   5.391   8.960   1.00 72.44 ? 80  GLN B OE1  1  
ATOM 3615   N NE2  . GLN B 1 80  ? 2.212   6.371   7.975   1.00 55.43 ? 80  GLN B NE2  1  
ATOM 3616   H H    . GLN B 1 80  ? 0.891   10.264  10.185  1.00 62.31 ? 80  GLN B H    1  
ATOM 3617   H HA   . GLN B 1 80  ? 1.870   7.552   10.627  1.00 62.22 ? 80  GLN B HA   1  
ATOM 3618   H HB2  . GLN B 1 80  ? 2.194   8.896   8.443   1.00 44.02 ? 80  GLN B HB2  1  
ATOM 3619   H HB3  . GLN B 1 80  ? 3.398   9.844   9.308   1.00 60.21 ? 80  GLN B HB3  1  
ATOM 3620   H HG2  . GLN B 1 80  ? 4.524   8.115   8.067   1.00 75.53 ? 80  GLN B HG2  1  
ATOM 3621   H HG3  . GLN B 1 80  ? 4.643   7.717   9.781   1.00 73.34 ? 80  GLN B HG3  1  
ATOM 3622   H HE21 . GLN B 1 80  ? 1.803   7.217   7.687   1.00 74.31 ? 80  GLN B HE21 1  
ATOM 3623   H HE22 . GLN B 1 80  ? 1.816   5.494   7.800   1.00 22.12 ? 80  GLN B HE22 1  
ATOM 3624   N N    . GLY B 1 81  ? 2.970   8.080   12.798  1.00 3.14  ? 81  GLY B N    1  
ATOM 3625   C CA   . GLY B 1 81  ? 3.762   8.250   14.004  1.00 43.43 ? 81  GLY B CA   1  
ATOM 3626   C C    . GLY B 1 81  ? 5.136   7.651   13.836  1.00 50.41 ? 81  GLY B C    1  
ATOM 3627   O O    . GLY B 1 81  ? 5.352   6.791   12.966  1.00 4.01  ? 81  GLY B O    1  
ATOM 3628   H H    . GLY B 1 81  ? 2.425   7.273   12.698  1.00 24.35 ? 81  GLY B H    1  
ATOM 3629   H HA2  . GLY B 1 81  ? 3.849   9.307   14.246  1.00 3.10  ? 81  GLY B HA2  1  
ATOM 3630   H HA3  . GLY B 1 81  ? 3.265   7.748   14.824  1.00 12.45 ? 81  GLY B HA3  1  
ATOM 3631   N N    . GLY B 1 82  ? 6.065   8.097   14.667  1.00 53.45 ? 82  GLY B N    1  
ATOM 3632   C CA   . GLY B 1 82  ? 7.433   7.651   14.591  1.00 2.02  ? 82  GLY B CA   1  
ATOM 3633   C C    . GLY B 1 82  ? 8.147   7.879   15.892  1.00 73.30 ? 82  GLY B C    1  
ATOM 3634   O O    . GLY B 1 82  ? 8.170   8.998   16.401  1.00 40.15 ? 82  GLY B O    1  
ATOM 3635   H H    . GLY B 1 82  ? 5.809   8.746   15.362  1.00 42.02 ? 82  GLY B H    1  
ATOM 3636   H HA2  . GLY B 1 82  ? 7.462   6.593   14.338  1.00 53.40 ? 82  GLY B HA2  1  
ATOM 3637   H HA3  . GLY B 1 82  ? 7.942   8.207   13.813  1.00 42.25 ? 82  GLY B HA3  1  
ATOM 3638   N N    . ILE B 1 83  ? 8.736   6.817   16.431  1.00 3.32  ? 83  ILE B N    1  
ATOM 3639   C CA   . ILE B 1 83  ? 9.543   6.889   17.644  1.00 61.14 ? 83  ILE B CA   1  
ATOM 3640   C C    . ILE B 1 83  ? 10.973  7.270   17.237  1.00 34.30 ? 83  ILE B C    1  
ATOM 3641   O O    . ILE B 1 83  ? 11.523  6.700   16.288  1.00 43.40 ? 83  ILE B O    1  
ATOM 3642   C CB   . ILE B 1 83  ? 9.517   5.519   18.419  1.00 64.55 ? 83  ILE B CB   1  
ATOM 3643   C CG1  . ILE B 1 83  ? 8.035   5.064   18.647  1.00 20.21 ? 83  ILE B CG1  1  
ATOM 3644   C CG2  . ILE B 1 83  ? 10.292  5.626   19.758  1.00 34.01 ? 83  ILE B CG2  1  
ATOM 3645   C CD1  . ILE B 1 83  ? 7.856   3.674   19.222  1.00 74.22 ? 83  ILE B CD1  1  
ATOM 3646   H H    . ILE B 1 83  ? 8.630   5.953   15.989  1.00 30.45 ? 83  ILE B H    1  
ATOM 3647   H HA   . ILE B 1 83  ? 9.129   7.666   18.294  1.00 2.30  ? 83  ILE B HA   1  
ATOM 3648   H HB   . ILE B 1 83  ? 10.020  4.771   17.804  1.00 32.33 ? 83  ILE B HB   1  
ATOM 3649   H HG12 . ILE B 1 83  ? 7.545   5.752   19.322  1.00 13.45 ? 83  ILE B HG12 1  
ATOM 3650   H HG13 . ILE B 1 83  ? 7.513   5.083   17.701  1.00 2.23  ? 83  ILE B HG13 1  
ATOM 3651   H HG21 . ILE B 1 83  ? 11.328  5.877   19.563  1.00 15.42 ? 83  ILE B HG21 1  
ATOM 3652   H HG22 . ILE B 1 83  ? 10.254  4.688   20.282  1.00 42.21 ? 83  ILE B HG22 1  
ATOM 3653   H HG23 . ILE B 1 83  ? 9.852   6.396   20.381  1.00 11.34 ? 83  ILE B HG23 1  
ATOM 3654   H HD11 . ILE B 1 83  ? 6.804   3.434   19.243  1.00 63.41 ? 83  ILE B HD11 1  
ATOM 3655   H HD12 . ILE B 1 83  ? 8.250   3.643   20.228  1.00 11.14 ? 83  ILE B HD12 1  
ATOM 3656   H HD13 . ILE B 1 83  ? 8.376   2.952   18.606  1.00 32.42 ? 83  ILE B HD13 1  
ATOM 3657   N N    . PHE B 1 84  ? 11.544  8.265   17.923  1.00 60.22 ? 84  PHE B N    1  
ATOM 3658   C CA   . PHE B 1 84  ? 12.906  8.765   17.667  1.00 74.54 ? 84  PHE B CA   1  
ATOM 3659   C C    . PHE B 1 84  ? 13.588  9.035   19.021  1.00 73.30 ? 84  PHE B C    1  
ATOM 3660   O O    . PHE B 1 84  ? 12.988  9.667   19.905  1.00 52.53 ? 84  PHE B O    1  
ATOM 3661   C CB   . PHE B 1 84  ? 12.883  10.083  16.823  1.00 24.13 ? 84  PHE B CB   1  
ATOM 3662   C CG   . PHE B 1 84  ? 12.136  10.012  15.473  1.00 32.15 ? 84  PHE B CG   1  
ATOM 3663   C CD1  . PHE B 1 84  ? 10.864  10.577  15.324  1.00 74.12 ? 84  PHE B CD1  1  
ATOM 3664   C CD2  . PHE B 1 84  ? 12.700  9.372   14.360  1.00 25.24 ? 84  PHE B CD2  1  
ATOM 3665   C CE1  . PHE B 1 84  ? 10.201  10.534  14.107  1.00 55.24 ? 84  PHE B CE1  1  
ATOM 3666   C CE2  . PHE B 1 84  ? 12.031  9.330   13.138  1.00 44.14 ? 84  PHE B CE2  1  
ATOM 3667   C CZ   . PHE B 1 84  ? 10.780  9.901   13.019  1.00 41.50 ? 84  PHE B CZ   1  
ATOM 3668   H H    . PHE B 1 84  ? 11.034  8.668   18.653  1.00 12.41 ? 84  PHE B H    1  
ATOM 3669   H HA   . PHE B 1 84  ? 13.470  8.002   17.129  1.00 40.24 ? 84  PHE B HA   1  
ATOM 3670   H HB2  . PHE B 1 84  ? 12.423  10.871  17.416  1.00 23.23 ? 84  PHE B HB2  1  
ATOM 3671   H HB3  . PHE B 1 84  ? 13.908  10.380  16.613  1.00 2.53  ? 84  PHE B HB3  1  
ATOM 3672   H HD1  . PHE B 1 84  ? 10.399  11.074  16.169  1.00 11.23 ? 84  PHE B HD1  1  
ATOM 3673   H HD2  . PHE B 1 84  ? 13.680  8.920   14.450  1.00 53.12 ? 84  PHE B HD2  1  
ATOM 3674   H HE1  . PHE B 1 84  ? 9.217   10.975  14.011  1.00 34.14 ? 84  PHE B HE1  1  
ATOM 3675   H HE2  . PHE B 1 84  ? 12.490  8.843   12.274  1.00 40.21 ? 84  PHE B HE2  1  
ATOM 3676   H HZ   . PHE B 1 84  ? 10.258  9.869   12.071  1.00 63.00 ? 84  PHE B HZ   1  
ATOM 3677   N N    . SER B 1 85  ? 14.838  8.561   19.180  1.00 52.33 ? 85  SER B N    1  
ATOM 3678   C CA   . SER B 1 85  ? 15.664  8.878   20.351  1.00 74.23 ? 85  SER B CA   1  
ATOM 3679   C C    . SER B 1 85  ? 16.467  10.152  20.058  1.00 1.50  ? 85  SER B C    1  
ATOM 3680   O O    . SER B 1 85  ? 17.456  10.127  19.310  1.00 15.01 ? 85  SER B O    1  
ATOM 3681   C CB   . SER B 1 85  ? 16.585  7.696   20.738  1.00 71.12 ? 85  SER B CB   1  
ATOM 3682   O OG   . SER B 1 85  ? 15.821  6.566   21.128  1.00 33.41 ? 85  SER B OG   1  
ATOM 3683   H H    . SER B 1 85  ? 15.214  7.989   18.481  1.00 22.34 ? 85  SER B H    1  
ATOM 3684   H HA   . SER B 1 85  ? 14.993  9.073   21.189  1.00 3.44  ? 85  SER B HA   1  
ATOM 3685   H HB2  . SER B 1 85  ? 17.205  7.419   19.894  1.00 53.35 ? 85  SER B HB2  1  
ATOM 3686   H HB3  . SER B 1 85  ? 17.220  7.982   21.569  1.00 43.44 ? 85  SER B HB3  1  
ATOM 3687   H HG   . SER B 1 85  ? 15.054  6.858   21.629  1.00 71.34 ? 85  SER B HG   1  
ATOM 3688   N N    . ILE B 1 86  ? 15.989  11.273  20.620  1.00 0.52  ? 86  ILE B N    1  
ATOM 3689   C CA   . ILE B 1 86  ? 16.564  12.610  20.407  1.00 60.43 ? 86  ILE B CA   1  
ATOM 3690   C C    . ILE B 1 86  ? 16.893  13.256  21.771  1.00 72.21 ? 86  ILE B C    1  
ATOM 3691   O O    . ILE B 1 86  ? 16.133  13.132  22.732  1.00 54.25 ? 86  ILE B O    1  
ATOM 3692   C CB   . ILE B 1 86  ? 15.597  13.535  19.551  1.00 13.10 ? 86  ILE B CB   1  
ATOM 3693   C CG1  . ILE B 1 86  ? 14.171  13.615  20.187  1.00 70.25 ? 86  ILE B CG1  1  
ATOM 3694   C CG2  . ILE B 1 86  ? 15.519  13.042  18.084  1.00 20.04 ? 86  ILE B CG2  1  
ATOM 3695   C CD1  . ILE B 1 86  ? 13.143  14.415  19.397  1.00 55.15 ? 86  ILE B CD1  1  
ATOM 3696   H H    . ILE B 1 86  ? 15.221  11.192  21.230  1.00 52.50 ? 86  ILE B H    1  
ATOM 3697   H HA   . ILE B 1 86  ? 17.498  12.494  19.852  1.00 11.23 ? 86  ILE B HA   1  
ATOM 3698   H HB   . ILE B 1 86  ? 16.028  14.538  19.532  1.00 52.23 ? 86  ILE B HB   1  
ATOM 3699   H HG12 . ILE B 1 86  ? 13.775  12.615  20.297  1.00 64.13 ? 86  ILE B HG12 1  
ATOM 3700   H HG13 . ILE B 1 86  ? 14.246  14.067  21.168  1.00 33.55 ? 86  ILE B HG13 1  
ATOM 3701   H HG21 . ILE B 1 86  ? 16.511  13.024  17.650  1.00 34.35 ? 86  ILE B HG21 1  
ATOM 3702   H HG22 . ILE B 1 86  ? 14.894  13.706  17.501  1.00 13.24 ? 86  ILE B HG22 1  
ATOM 3703   H HG23 . ILE B 1 86  ? 15.101  12.043  18.055  1.00 1.31  ? 86  ILE B HG23 1  
ATOM 3704   H HD11 . ILE B 1 86  ? 12.214  14.442  19.946  1.00 20.32 ? 86  ILE B HD11 1  
ATOM 3705   H HD12 . ILE B 1 86  ? 12.976  13.945  18.437  1.00 62.52 ? 86  ILE B HD12 1  
ATOM 3706   H HD13 . ILE B 1 86  ? 13.500  15.425  19.246  1.00 50.13 ? 86  ILE B HD13 1  
ATOM 3707   N N    . ALA B 1 87  ? 18.053  13.912  21.828  1.00 21.51 ? 87  ALA B N    1  
ATOM 3708   C CA   . ALA B 1 87  ? 18.579  14.584  23.037  1.00 14.34 ? 87  ALA B CA   1  
ATOM 3709   C C    . ALA B 1 87  ? 19.547  15.687  22.610  1.00 25.32 ? 87  ALA B C    1  
ATOM 3710   O O    . ALA B 1 87  ? 19.910  15.762  21.436  1.00 44.20 ? 87  ALA B O    1  
ATOM 3711   C CB   . ALA B 1 87  ? 19.279  13.581  23.970  1.00 20.42 ? 87  ALA B CB   1  
ATOM 3712   H H    . ALA B 1 87  ? 18.591  13.959  21.009  1.00 42.15 ? 87  ALA B H    1  
ATOM 3713   H HA   . ALA B 1 87  ? 17.747  15.035  23.570  1.00 71.24 ? 87  ALA B HA   1  
ATOM 3714   H HB1  . ALA B 1 87  ? 19.629  14.093  24.862  1.00 55.32 ? 87  ALA B HB1  1  
ATOM 3715   H HB2  . ALA B 1 87  ? 20.120  13.127  23.465  1.00 74.43 ? 87  ALA B HB2  1  
ATOM 3716   H HB3  . ALA B 1 87  ? 18.579  12.809  24.261  1.00 42.14 ? 87  ALA B HB3  1  
ATOM 3717   N N    . GLY B 1 88  ? 19.916  16.590  23.543  1.00 42.40 ? 88  GLY B N    1  
ATOM 3718   C CA   . GLY B 1 88  ? 20.850  17.699  23.245  1.00 62.10 ? 88  GLY B CA   1  
ATOM 3719   C C    . GLY B 1 88  ? 20.184  18.883  22.540  1.00 15.43 ? 88  GLY B C    1  
ATOM 3720   O O    . GLY B 1 88  ? 20.673  20.016  22.624  1.00 31.45 ? 88  GLY B O    1  
ATOM 3721   H H    . GLY B 1 88  ? 19.542  16.509  24.446  1.00 25.15 ? 88  GLY B H    1  
ATOM 3722   H HA2  . GLY B 1 88  ? 21.270  18.046  24.182  1.00 10.13 ? 88  GLY B HA2  1  
ATOM 3723   H HA3  . GLY B 1 88  ? 21.659  17.336  22.623  1.00 2.14  ? 88  GLY B HA3  1  
ATOM 3724   N N    . ILE B 1 89  ? 19.109  18.577  21.784  1.00 1.12  ? 89  ILE B N    1  
ATOM 3725   C CA   . ILE B 1 89  ? 18.286  19.542  21.053  1.00 14.21 ? 89  ILE B CA   1  
ATOM 3726   C C    . ILE B 1 89  ? 17.763  20.658  21.991  1.00 24.33 ? 89  ILE B C    1  
ATOM 3727   O O    . ILE B 1 89  ? 17.310  20.384  23.113  1.00 40.30 ? 89  ILE B O    1  
ATOM 3728   C CB   . ILE B 1 89  ? 17.068  18.802  20.358  1.00 34.24 ? 89  ILE B CB   1  
ATOM 3729   C CG1  . ILE B 1 89  ? 16.166  18.054  21.409  1.00 52.15 ? 89  ILE B CG1  1  
ATOM 3730   C CG2  . ILE B 1 89  ? 17.557  17.818  19.265  1.00 61.13 ? 89  ILE B CG2  1  
ATOM 3731   C CD1  . ILE B 1 89  ? 14.904  17.408  20.849  1.00 35.15 ? 89  ILE B CD1  1  
ATOM 3732   H H    . ILE B 1 89  ? 18.856  17.649  21.717  1.00 65.15 ? 89  ILE B H    1  
ATOM 3733   H HA   . ILE B 1 89  ? 18.908  19.985  20.276  1.00 24.45 ? 89  ILE B HA   1  
ATOM 3734   H HB   . ILE B 1 89  ? 16.467  19.558  19.862  1.00 74.22 ? 89  ILE B HB   1  
ATOM 3735   H HG12 . ILE B 1 89  ? 16.744  17.268  21.875  1.00 2.22  ? 89  ILE B HG12 1  
ATOM 3736   H HG13 . ILE B 1 89  ? 15.858  18.755  22.176  1.00 55.14 ? 89  ILE B HG13 1  
ATOM 3737   H HG21 . ILE B 1 89  ? 18.192  17.061  19.710  1.00 41.35 ? 89  ILE B HG21 1  
ATOM 3738   H HG22 . ILE B 1 89  ? 18.120  18.355  18.512  1.00 41.53 ? 89  ILE B HG22 1  
ATOM 3739   H HG23 . ILE B 1 89  ? 16.707  17.340  18.795  1.00 2.03  ? 89  ILE B HG23 1  
ATOM 3740   H HD11 . ILE B 1 89  ? 15.172  16.662  20.113  1.00 21.04 ? 89  ILE B HD11 1  
ATOM 3741   H HD12 . ILE B 1 89  ? 14.278  18.160  20.390  1.00 43.42 ? 89  ILE B HD12 1  
ATOM 3742   H HD13 . ILE B 1 89  ? 14.360  16.934  21.654  1.00 33.34 ? 89  ILE B HD13 1  
ATOM 3743   N N    . GLU B 1 90  ? 17.851  21.910  21.519  1.00 15.34 ? 90  GLU B N    1  
ATOM 3744   C CA   . GLU B 1 90  ? 17.400  23.088  22.280  1.00 75.20 ? 90  GLU B CA   1  
ATOM 3745   C C    . GLU B 1 90  ? 16.966  24.208  21.325  1.00 32.34 ? 90  GLU B C    1  
ATOM 3746   O O    . GLU B 1 90  ? 17.601  24.423  20.286  1.00 63.44 ? 90  GLU B O    1  
ATOM 3747   C CB   . GLU B 1 90  ? 18.550  23.591  23.214  1.00 22.52 ? 90  GLU B CB   1  
ATOM 3748   C CG   . GLU B 1 90  ? 18.373  25.010  23.820  1.00 64.43 ? 90  GLU B CG   1  
ATOM 3749   C CD   . GLU B 1 90  ? 17.256  25.148  24.887  1.00 14.21 ? 90  GLU B CD   1  
ATOM 3750   O OE1  . GLU B 1 90  ? 16.096  24.739  24.651  1.00 22.33 ? 90  GLU B OE1  1  
ATOM 3751   O OE2  . GLU B 1 90  ? 17.522  25.731  25.950  1.00 40.45 ? 90  GLU B OE2  1  
ATOM 3752   H H    . GLU B 1 90  ? 18.250  22.050  20.633  1.00 11.44 ? 90  GLU B H    1  
ATOM 3753   H HA   . GLU B 1 90  ? 16.545  22.797  22.891  1.00 24.24 ? 90  GLU B HA   1  
ATOM 3754   H HB2  . GLU B 1 90  ? 18.650  22.892  24.037  1.00 4.42  ? 90  GLU B HB2  1  
ATOM 3755   H HB3  . GLU B 1 90  ? 19.478  23.579  22.646  1.00 71.21 ? 90  GLU B HB3  1  
ATOM 3756   H HG2  . GLU B 1 90  ? 19.319  25.306  24.265  1.00 33.51 ? 90  GLU B HG2  1  
ATOM 3757   H HG3  . GLU B 1 90  ? 18.154  25.700  23.013  1.00 72.53 ? 90  GLU B HG3  1  
ATOM 3758   N N    . GLY B 1 91  ? 15.867  24.898  21.715  1.00 14.11 ? 91  GLY B N    1  
ATOM 3759   C CA   . GLY B 1 91  ? 15.400  26.119  21.068  1.00 71.44 ? 91  GLY B CA   1  
ATOM 3760   C C    . GLY B 1 91  ? 15.151  25.955  19.575  1.00 24.41 ? 91  GLY B C    1  
ATOM 3761   O O    . GLY B 1 91  ? 14.243  25.224  19.165  1.00 63.20 ? 91  GLY B O    1  
ATOM 3762   H H    . GLY B 1 91  ? 15.368  24.563  22.492  1.00 21.44 ? 91  GLY B H    1  
ATOM 3763   H HA2  . GLY B 1 91  ? 14.473  26.417  21.544  1.00 50.32 ? 91  GLY B HA2  1  
ATOM 3764   H HA3  . GLY B 1 91  ? 16.130  26.898  21.235  1.00 32.43 ? 91  GLY B HA3  1  
ATOM 3765   N N    . THR B 1 92  ? 16.012  26.605  18.777  1.00 54.01 ? 92  THR B N    1  
ATOM 3766   C CA   . THR B 1 92  ? 15.980  26.547  17.316  1.00 13.33 ? 92  THR B CA   1  
ATOM 3767   C C    . THR B 1 92  ? 16.323  25.131  16.806  1.00 62.14 ? 92  THR B C    1  
ATOM 3768   O O    . THR B 1 92  ? 15.667  24.616  15.903  1.00 43.43 ? 92  THR B O    1  
ATOM 3769   C CB   . THR B 1 92  ? 16.992  27.584  16.735  1.00 12.44 ? 92  THR B CB   1  
ATOM 3770   O OG1  . THR B 1 92  ? 16.685  28.902  17.235  1.00 42.11 ? 92  THR B OG1  1  
ATOM 3771   C CG2  . THR B 1 92  ? 16.996  27.608  15.201  1.00 11.35 ? 92  THR B CG2  1  
ATOM 3772   H H    . THR B 1 92  ? 16.703  27.160  19.197  1.00 1.34  ? 92  THR B H    1  
ATOM 3773   H HA   . THR B 1 92  ? 14.982  26.821  16.984  1.00 5.11  ? 92  THR B HA   1  
ATOM 3774   H HB   . THR B 1 92  ? 17.990  27.315  17.077  1.00 12.40 ? 92  THR B HB   1  
ATOM 3775   H HG1  . THR B 1 92  ? 15.725  29.011  17.307  1.00 33.20 ? 92  THR B HG1  1  
ATOM 3776   H HG21 . THR B 1 92  ? 17.713  28.338  14.851  1.00 63.41 ? 92  THR B HG21 1  
ATOM 3777   H HG22 . THR B 1 92  ? 16.014  27.872  14.834  1.00 1.52  ? 92  THR B HG22 1  
ATOM 3778   H HG23 . THR B 1 92  ? 17.270  26.632  14.817  1.00 12.04 ? 92  THR B HG23 1  
ATOM 3779   N N    . GLN B 1 93  ? 17.349  24.514  17.420  1.00 63.41 ? 93  GLN B N    1  
ATOM 3780   C CA   . GLN B 1 93  ? 17.854  23.178  17.030  1.00 40.51 ? 93  GLN B CA   1  
ATOM 3781   C C    . GLN B 1 93  ? 16.833  22.081  17.364  1.00 64.13 ? 93  GLN B C    1  
ATOM 3782   O O    . GLN B 1 93  ? 16.746  21.072  16.653  1.00 40.33 ? 93  GLN B O    1  
ATOM 3783   C CB   . GLN B 1 93  ? 19.222  22.899  17.715  1.00 21.42 ? 93  GLN B CB   1  
ATOM 3784   C CG   . GLN B 1 93  ? 20.316  23.937  17.382  1.00 3.14  ? 93  GLN B CG   1  
ATOM 3785   C CD   . GLN B 1 93  ? 20.625  24.049  15.879  1.00 63.45 ? 93  GLN B CD   1  
ATOM 3786   O OE1  . GLN B 1 93  ? 20.021  24.855  15.161  1.00 20.22 ? 93  GLN B OE1  1  
ATOM 3787   N NE2  . GLN B 1 93  ? 21.559  23.241  15.398  1.00 71.14 ? 93  GLN B NE2  1  
ATOM 3788   H H    . GLN B 1 93  ? 17.779  24.969  18.173  1.00 64.52 ? 93  GLN B H    1  
ATOM 3789   H HA   . GLN B 1 93  ? 17.999  23.189  15.955  1.00 71.40 ? 93  GLN B HA   1  
ATOM 3790   H HB2  . GLN B 1 93  ? 19.078  22.893  18.792  1.00 22.00 ? 93  GLN B HB2  1  
ATOM 3791   H HB3  . GLN B 1 93  ? 19.580  21.920  17.412  1.00 32.34 ? 93  GLN B HB3  1  
ATOM 3792   H HG2  . GLN B 1 93  ? 19.991  24.907  17.737  1.00 3.55  ? 93  GLN B HG2  1  
ATOM 3793   H HG3  . GLN B 1 93  ? 21.226  23.662  17.905  1.00 33.40 ? 93  GLN B HG3  1  
ATOM 3794   H HE21 . GLN B 1 93  ? 22.001  22.621  16.021  1.00 5.41  ? 93  GLN B HE21 1  
ATOM 3795   H HE22 . GLN B 1 93  ? 21.776  23.296  14.444  1.00 34.22 ? 93  GLN B HE22 1  
ATOM 3796   N N    . MET B 1 94  ? 16.062  22.296  18.448  1.00 24.12 ? 94  MET B N    1  
ATOM 3797   C CA   . MET B 1 94  ? 14.950  21.405  18.818  1.00 73.20 ? 94  MET B CA   1  
ATOM 3798   C C    . MET B 1 94  ? 13.834  21.498  17.774  1.00 3.51  ? 94  MET B C    1  
ATOM 3799   O O    . MET B 1 94  ? 13.461  20.493  17.156  1.00 71.31 ? 94  MET B O    1  
ATOM 3800   C CB   . MET B 1 94  ? 14.385  21.748  20.226  1.00 2.04  ? 94  MET B CB   1  
ATOM 3801   C CG   . MET B 1 94  ? 13.169  20.900  20.617  1.00 12.55 ? 94  MET B CG   1  
ATOM 3802   S SD   . MET B 1 94  ? 12.449  21.346  22.201  1.00 43.51 ? 94  MET B SD   1  
ATOM 3803   C CE   . MET B 1 94  ? 11.055  20.224  22.232  1.00 53.04 ? 94  MET B CE   1  
ATOM 3804   H H    . MET B 1 94  ? 16.245  23.082  19.005  1.00 64.31 ? 94  MET B H    1  
ATOM 3805   H HA   . MET B 1 94  ? 15.332  20.387  18.833  1.00 33.52 ? 94  MET B HA   1  
ATOM 3806   H HB2  . MET B 1 94  ? 15.164  21.589  20.965  1.00 62.24 ? 94  MET B HB2  1  
ATOM 3807   H HB3  . MET B 1 94  ? 14.094  22.795  20.251  1.00 61.33 ? 94  MET B HB3  1  
ATOM 3808   H HG2  . MET B 1 94  ? 12.405  21.018  19.857  1.00 33.40 ? 94  MET B HG2  1  
ATOM 3809   H HG3  . MET B 1 94  ? 13.468  19.860  20.658  1.00 55.42 ? 94  MET B HG3  1  
ATOM 3810   H HE1  . MET B 1 94  ? 10.413  20.417  21.385  1.00 44.30 ? 94  MET B HE1  1  
ATOM 3811   H HE2  . MET B 1 94  ? 10.500  20.372  23.146  1.00 34.34 ? 94  MET B HE2  1  
ATOM 3812   H HE3  . MET B 1 94  ? 11.413  19.204  22.189  1.00 35.34 ? 94  MET B HE3  1  
ATOM 3813   N N    . ALA B 1 95  ? 13.344  22.732  17.582  1.00 32.13 ? 95  ALA B N    1  
ATOM 3814   C CA   . ALA B 1 95  ? 12.218  23.044  16.688  1.00 52.21 ? 95  ALA B CA   1  
ATOM 3815   C C    . ALA B 1 95  ? 12.492  22.597  15.239  1.00 23.45 ? 95  ALA B C    1  
ATOM 3816   O O    . ALA B 1 95  ? 11.592  22.141  14.542  1.00 74.52 ? 95  ALA B O    1  
ATOM 3817   C CB   . ALA B 1 95  ? 11.921  24.551  16.755  1.00 64.20 ? 95  ALA B CB   1  
ATOM 3818   H H    . ALA B 1 95  ? 13.761  23.472  18.067  1.00 12.34 ? 95  ALA B H    1  
ATOM 3819   H HA   . ALA B 1 95  ? 11.344  22.516  17.060  1.00 22.21 ? 95  ALA B HA   1  
ATOM 3820   H HB1  . ALA B 1 95  ? 12.770  25.110  16.382  1.00 53.13 ? 95  ALA B HB1  1  
ATOM 3821   H HB2  . ALA B 1 95  ? 11.729  24.840  17.782  1.00 62.02 ? 95  ALA B HB2  1  
ATOM 3822   H HB3  . ALA B 1 95  ? 11.051  24.785  16.153  1.00 5.30  ? 95  ALA B HB3  1  
ATOM 3823   N N    . HIS B 1 96  ? 13.751  22.731  14.808  1.00 55.12 ? 96  HIS B N    1  
ATOM 3824   C CA   . HIS B 1 96  ? 14.190  22.350  13.455  1.00 30.12 ? 96  HIS B CA   1  
ATOM 3825   C C    . HIS B 1 96  ? 14.322  20.817  13.322  1.00 13.02 ? 96  HIS B C    1  
ATOM 3826   O O    . HIS B 1 96  ? 14.106  20.268  12.237  1.00 40.41 ? 96  HIS B O    1  
ATOM 3827   C CB   . HIS B 1 96  ? 15.531  23.052  13.141  1.00 65.45 ? 96  HIS B CB   1  
ATOM 3828   C CG   . HIS B 1 96  ? 16.093  22.761  11.775  1.00 32.21 ? 96  HIS B CG   1  
ATOM 3829   N ND1  . HIS B 1 96  ? 17.203  21.977  11.576  1.00 25.12 ? 96  HIS B ND1  1  
ATOM 3830   C CD2  . HIS B 1 96  ? 15.686  23.151  10.543  1.00 42.22 ? 96  HIS B CD2  1  
ATOM 3831   C CE1  . HIS B 1 96  ? 17.455  21.894  10.291  1.00 11.02 ? 96  HIS B CE1  1  
ATOM 3832   N NE2  . HIS B 1 96  ? 16.549  22.596  9.638   1.00 12.15 ? 96  HIS B NE2  1  
ATOM 3833   H H    . HIS B 1 96  ? 14.413  23.099  15.425  1.00 63.32 ? 96  HIS B H    1  
ATOM 3834   H HA   . HIS B 1 96  ? 13.438  22.699  12.746  1.00 1.21  ? 96  HIS B HA   1  
ATOM 3835   H HB2  . HIS B 1 96  ? 15.389  24.124  13.212  1.00 0.41  ? 96  HIS B HB2  1  
ATOM 3836   H HB3  . HIS B 1 96  ? 16.270  22.754  13.880  1.00 53.11 ? 96  HIS B HB3  1  
ATOM 3837   H HD1  . HIS B 1 96  ? 17.727  21.535  12.277  1.00 44.02 ? 96  HIS B HD1  1  
ATOM 3838   H HD2  . HIS B 1 96  ? 14.849  23.798  10.315  1.00 22.32 ? 96  HIS B HD2  1  
ATOM 3839   H HE1  . HIS B 1 96  ? 18.252  21.321  9.840   1.00 15.22 ? 96  HIS B HE1  1  
ATOM 3840   H HE2  . HIS B 1 96  ? 16.335  22.452  8.693   1.00 37.99 ? 96  HIS B HE2  1  
ATOM 3841   N N    . CYS B 1 97  ? 14.685  20.136  14.430  1.00 35.44 ? 97  CYS B N    1  
ATOM 3842   C CA   . CYS B 1 97  ? 14.844  18.668  14.437  1.00 30.52 ? 97  CYS B CA   1  
ATOM 3843   C C    . CYS B 1 97  ? 13.475  17.974  14.303  1.00 13.21 ? 97  CYS B C    1  
ATOM 3844   O O    . CYS B 1 97  ? 13.169  17.385  13.267  1.00 42.25 ? 97  CYS B O    1  
ATOM 3845   C CB   . CYS B 1 97  ? 15.570  18.192  15.719  1.00 41.43 ? 97  CYS B CB   1  
ATOM 3846   S SG   . CYS B 1 97  ? 15.800  16.396  15.834  1.00 34.40 ? 97  CYS B SG   1  
ATOM 3847   H H    . CYS B 1 97  ? 14.849  20.634  15.259  1.00 63.53 ? 97  CYS B H    1  
ATOM 3848   H HA   . CYS B 1 97  ? 15.455  18.400  13.579  1.00 51.02 ? 97  CYS B HA   1  
ATOM 3849   H HB2  . CYS B 1 97  ? 16.553  18.642  15.757  1.00 53.31 ? 97  CYS B HB2  1  
ATOM 3850   H HB3  . CYS B 1 97  ? 15.008  18.507  16.590  1.00 10.10 ? 97  CYS B HB3  1  
ATOM 3851   H HG   . CYS B 1 97  ? 14.761  15.804  15.262  1.00 11.34 ? 97  CYS B HG   1  
ATOM 3852   N N    . LEU B 1 98  ? 12.625  18.101  15.331  1.00 61.21 ? 98  LEU B N    1  
ATOM 3853   C CA   . LEU B 1 98  ? 11.332  17.380  15.388  1.00 33.30 ? 98  LEU B CA   1  
ATOM 3854   C C    . LEU B 1 98  ? 10.207  18.104  14.614  1.00 20.52 ? 98  LEU B C    1  
ATOM 3855   O O    . LEU B 1 98  ? 9.157   17.507  14.387  1.00 43.20 ? 98  LEU B O    1  
ATOM 3856   C CB   . LEU B 1 98  ? 10.920  17.070  16.872  1.00 74.44 ? 98  LEU B CB   1  
ATOM 3857   C CG   . LEU B 1 98  ? 11.118  18.198  17.953  1.00 4.22  ? 98  LEU B CG   1  
ATOM 3858   C CD1  . LEU B 1 98  ? 10.407  19.515  17.580  1.00 61.34 ? 98  LEU B CD1  1  
ATOM 3859   C CD2  . LEU B 1 98  ? 10.671  17.705  19.354  1.00 24.44 ? 98  LEU B CD2  1  
ATOM 3860   H H    . LEU B 1 98  ? 12.868  18.696  16.070  1.00 1.24  ? 98  LEU B H    1  
ATOM 3861   H HA   . LEU B 1 98  ? 11.485  16.424  14.887  1.00 74.32 ? 98  LEU B HA   1  
ATOM 3862   H HB2  . LEU B 1 98  ? 9.872   16.779  16.880  1.00 4.02  ? 98  LEU B HB2  1  
ATOM 3863   H HB3  . LEU B 1 98  ? 11.494  16.206  17.194  1.00 52.45 ? 98  LEU B HB3  1  
ATOM 3864   H HG   . LEU B 1 98  ? 12.177  18.425  18.016  1.00 2.45  ? 98  LEU B HG   1  
ATOM 3865   H HD11 . LEU B 1 98  ? 9.346   19.330  17.421  1.00 41.01 ? 98  LEU B HD11 1  
ATOM 3866   H HD12 . LEU B 1 98  ? 10.836  19.912  16.669  1.00 1.44  ? 98  LEU B HD12 1  
ATOM 3867   H HD13 . LEU B 1 98  ? 10.529  20.242  18.372  1.00 40.30 ? 98  LEU B HD13 1  
ATOM 3868   H HD21 . LEU B 1 98  ? 11.236  16.822  19.627  1.00 45.34 ? 98  LEU B HD21 1  
ATOM 3869   H HD22 . LEU B 1 98  ? 9.615   17.464  19.343  1.00 2.41  ? 98  LEU B HD22 1  
ATOM 3870   H HD23 . LEU B 1 98  ? 10.853  18.479  20.090  1.00 11.03 ? 98  LEU B HD23 1  
ATOM 3871   N N    . GLY B 1 99  ? 10.430  19.382  14.230  1.00 71.12 ? 99  GLY B N    1  
ATOM 3872   C CA   . GLY B 1 99  ? 9.404   20.203  13.552  1.00 22.41 ? 99  GLY B CA   1  
ATOM 3873   C C    . GLY B 1 99  ? 9.644   20.394  12.056  1.00 74.51 ? 99  GLY B C    1  
ATOM 3874   O O    . GLY B 1 99  ? 8.843   21.057  11.382  1.00 44.30 ? 99  GLY B O    1  
ATOM 3875   H H    . GLY B 1 99  ? 11.304  19.784  14.423  1.00 22.24 ? 99  GLY B H    1  
ATOM 3876   H HA2  . GLY B 1 99  ? 8.426   19.759  13.687  1.00 33.03 ? 99  GLY B HA2  1  
ATOM 3877   H HA3  . GLY B 1 99  ? 9.397   21.180  14.019  1.00 64.13 ? 99  GLY B HA3  1  
ATOM 3878   N N    . ALA B 1 100 ? 10.739  19.806  11.525  1.00 74.02 ? 100 ALA B N    1  
ATOM 3879   C CA   . ALA B 1 100 ? 11.095  19.916  10.089  1.00 20.30 ? 100 ALA B CA   1  
ATOM 3880   C C    . ALA B 1 100 ? 11.720  18.609  9.576   1.00 12.34 ? 100 ALA B C    1  
ATOM 3881   O O    . ALA B 1 100 ? 11.232  18.013  8.603   1.00 50.22 ? 100 ALA B O    1  
ATOM 3882   C CB   . ALA B 1 100 ? 12.050  21.102  9.862   1.00 12.42 ? 100 ALA B CB   1  
ATOM 3883   H H    . ALA B 1 100 ? 11.324  19.286  12.115  1.00 63.34 ? 100 ALA B H    1  
ATOM 3884   H HA   . ALA B 1 100 ? 10.183  20.106  9.519   1.00 24.42 ? 100 ALA B HA   1  
ATOM 3885   H HB1  . ALA B 1 100 ? 12.273  21.190  8.810   1.00 15.30 ? 100 ALA B HB1  1  
ATOM 3886   H HB2  . ALA B 1 100 ? 12.975  20.956  10.410  1.00 71.22 ? 100 ALA B HB2  1  
ATOM 3887   H HB3  . ALA B 1 100 ? 11.579  22.015  10.195  1.00 2.00  ? 100 ALA B HB3  1  
ATOM 3888   N N    . TYR B 1 101 ? 12.774  18.155  10.273  1.00 12.13 ? 101 TYR B N    1  
ATOM 3889   C CA   . TYR B 1 101 ? 13.592  16.995  9.860   1.00 64.15 ? 101 TYR B CA   1  
ATOM 3890   C C    . TYR B 1 101 ? 12.808  15.664  10.035  1.00 75.43 ? 101 TYR B C    1  
ATOM 3891   O O    . TYR B 1 101 ? 12.681  14.877  9.088   1.00 1.54  ? 101 TYR B O    1  
ATOM 3892   C CB   . TYR B 1 101 ? 14.907  17.008  10.690  1.00 25.21 ? 101 TYR B CB   1  
ATOM 3893   C CG   . TYR B 1 101 ? 15.978  15.998  10.260  1.00 2.42  ? 101 TYR B CG   1  
ATOM 3894   C CD1  . TYR B 1 101 ? 16.906  16.316  9.263   1.00 51.21 ? 101 TYR B CD1  1  
ATOM 3895   C CD2  . TYR B 1 101 ? 16.085  14.743  10.873  1.00 22.14 ? 101 TYR B CD2  1  
ATOM 3896   C CE1  . TYR B 1 101 ? 17.887  15.420  8.888   1.00 42.03 ? 101 TYR B CE1  1  
ATOM 3897   C CE2  . TYR B 1 101 ? 17.062  13.846  10.494  1.00 45.40 ? 101 TYR B CE2  1  
ATOM 3898   C CZ   . TYR B 1 101 ? 17.964  14.191  9.510   1.00 54.51 ? 101 TYR B CZ   1  
ATOM 3899   O OH   . TYR B 1 101 ? 18.947  13.300  9.143   1.00 32.33 ? 101 TYR B OH   1  
ATOM 3900   H H    . TYR B 1 101 ? 13.018  18.620  11.102  1.00 32.42 ? 101 TYR B H    1  
ATOM 3901   H HA   . TYR B 1 101 ? 13.839  17.120  8.811   1.00 24.35 ? 101 TYR B HA   1  
ATOM 3902   H HB2  . TYR B 1 101 ? 15.348  17.997  10.627  1.00 31.34 ? 101 TYR B HB2  1  
ATOM 3903   H HB3  . TYR B 1 101 ? 14.667  16.817  11.731  1.00 72.30 ? 101 TYR B HB3  1  
ATOM 3904   H HD1  . TYR B 1 101 ? 16.847  17.281  8.773   1.00 3.35  ? 101 TYR B HD1  1  
ATOM 3905   H HD2  . TYR B 1 101 ? 15.378  14.472  11.648  1.00 74.12 ? 101 TYR B HD2  1  
ATOM 3906   H HE1  . TYR B 1 101 ? 18.596  15.688  8.114   1.00 22.33 ? 101 TYR B HE1  1  
ATOM 3907   H HE2  . TYR B 1 101 ? 17.122  12.881  10.978  1.00 53.31 ? 101 TYR B HE2  1  
ATOM 3908   H HH   . TYR B 1 101 ? 19.796  13.750  9.140   1.00 1.14  ? 101 TYR B HH   1  
ATOM 3909   N N    . CYS B 1 102 ? 12.265  15.454  11.250  1.00 3.34  ? 102 CYS B N    1  
ATOM 3910   C CA   . CYS B 1 102 ? 11.518  14.227  11.621  1.00 12.32 ? 102 CYS B CA   1  
ATOM 3911   C C    . CYS B 1 102 ? 10.167  14.090  10.845  1.00 12.01 ? 102 CYS B C    1  
ATOM 3912   O O    . CYS B 1 102 ? 9.871   12.996  10.357  1.00 55.41 ? 102 CYS B O    1  
ATOM 3913   C CB   . CYS B 1 102 ? 11.291  14.180  13.155  1.00 21.34 ? 102 CYS B CB   1  
ATOM 3914   S SG   . CYS B 1 102 ? 12.793  14.445  14.121  1.00 44.45 ? 102 CYS B SG   1  
ATOM 3915   H H    . CYS B 1 102 ? 12.368  16.151  11.926  1.00 5.33  ? 102 CYS B H    1  
ATOM 3916   H HA   . CYS B 1 102 ? 12.148  13.383  11.349  1.00 63.44 ? 102 CYS B HA   1  
ATOM 3917   H HB2  . CYS B 1 102 ? 10.584  14.949  13.442  1.00 43.33 ? 102 CYS B HB2  1  
ATOM 3918   H HB3  . CYS B 1 102 ? 10.891  13.213  13.433  1.00 71.52 ? 102 CYS B HB3  1  
ATOM 3919   H HG   . CYS B 1 102 ? 13.784  14.678  13.274  1.00 43.25 ? 102 CYS B HG   1  
ATOM 3920   N N    . PRO B 1 103 ? 9.312   15.177  10.723  1.00 2.42  ? 103 PRO B N    1  
ATOM 3921   C CA   . PRO B 1 103 ? 8.081   15.139  9.882   1.00 32.23 ? 103 PRO B CA   1  
ATOM 3922   C C    . PRO B 1 103 ? 8.345   14.747  8.421   1.00 31.24 ? 103 PRO B C    1  
ATOM 3923   O O    . PRO B 1 103 ? 7.551   14.026  7.823   1.00 51.12 ? 103 PRO B O    1  
ATOM 3924   C CB   . PRO B 1 103 ? 7.556   16.592  9.949   1.00 62.21 ? 103 PRO B CB   1  
ATOM 3925   C CG   . PRO B 1 103 ? 8.037   17.091  11.265  1.00 13.31 ? 103 PRO B CG   1  
ATOM 3926   C CD   . PRO B 1 103 ? 9.409   16.486  11.431  1.00 12.34 ? 103 PRO B CD   1  
ATOM 3927   H HA   . PRO B 1 103 ? 7.341   14.464  10.312  1.00 10.44 ? 103 PRO B HA   1  
ATOM 3928   H HB2  . PRO B 1 103 ? 7.961   17.191  9.128   1.00 24.21 ? 103 PRO B HB2  1  
ATOM 3929   H HB3  . PRO B 1 103 ? 6.474   16.606  9.913   1.00 62.04 ? 103 PRO B HB3  1  
ATOM 3930   H HG2  . PRO B 1 103 ? 8.092   18.175  11.257  1.00 24.51 ? 103 PRO B HG2  1  
ATOM 3931   H HG3  . PRO B 1 103 ? 7.383   16.754  12.065  1.00 12.44 ? 103 PRO B HG3  1  
ATOM 3932   H HD2  . PRO B 1 103 ? 10.169  17.112  10.975  1.00 34.14 ? 103 PRO B HD2  1  
ATOM 3933   H HD3  . PRO B 1 103 ? 9.637   16.334  12.479  1.00 53.04 ? 103 PRO B HD3  1  
ATOM 3934   N N    . ASN B 1 104 ? 9.474   15.239  7.872   1.00 12.33 ? 104 ASN B N    1  
ATOM 3935   C CA   . ASN B 1 104 ? 9.859   15.002  6.459   1.00 3.21  ? 104 ASN B CA   1  
ATOM 3936   C C    . ASN B 1 104 ? 10.257  13.517  6.224   1.00 43.01 ? 104 ASN B C    1  
ATOM 3937   O O    . ASN B 1 104 ? 10.213  13.028  5.090   1.00 12.50 ? 104 ASN B O    1  
ATOM 3938   C CB   . ASN B 1 104 ? 11.008  15.971  6.058   1.00 3.52  ? 104 ASN B CB   1  
ATOM 3939   C CG   . ASN B 1 104 ? 11.305  16.021  4.551   1.00 51.13 ? 104 ASN B CG   1  
ATOM 3940   O OD1  . ASN B 1 104 ? 10.426  15.795  3.716   1.00 15.54 ? 104 ASN B OD1  1  
ATOM 3941   N ND2  . ASN B 1 104 ? 12.535  16.365  4.200   1.00 40.05 ? 104 ASN B ND2  1  
ATOM 3942   H H    . ASN B 1 104 ? 10.066  15.789  8.431   1.00 64.14 ? 104 ASN B H    1  
ATOM 3943   H HA   . ASN B 1 104 ? 8.987   15.225  5.847   1.00 32.45 ? 104 ASN B HA   1  
ATOM 3944   H HB2  . ASN B 1 104 ? 10.748  16.976  6.372   1.00 12.25 ? 104 ASN B HB2  1  
ATOM 3945   H HB3  . ASN B 1 104 ? 11.914  15.673  6.578   1.00 5.23  ? 104 ASN B HB3  1  
ATOM 3946   H HD21 . ASN B 1 104 ? 13.176  16.570  4.911   1.00 74.41 ? 104 ASN B HD21 1  
ATOM 3947   H HD22 . ASN B 1 104 ? 12.753  16.392  3.247   1.00 35.20 ? 104 ASN B HD22 1  
ATOM 3948   N N    . ILE B 1 105 ? 10.650  12.815  7.310   1.00 64.54 ? 105 ILE B N    1  
ATOM 3949   C CA   . ILE B 1 105 ? 10.898  11.357  7.285   1.00 62.50 ? 105 ILE B CA   1  
ATOM 3950   C C    . ILE B 1 105 ? 9.558   10.599  7.224   1.00 2.21  ? 105 ILE B C    1  
ATOM 3951   O O    . ILE B 1 105 ? 9.395   9.661   6.433   1.00 30.14 ? 105 ILE B O    1  
ATOM 3952   C CB   . ILE B 1 105 ? 11.703  10.880  8.555   1.00 11.35 ? 105 ILE B CB   1  
ATOM 3953   C CG1  . ILE B 1 105 ? 13.116  11.542  8.605   1.00 34.14 ? 105 ILE B CG1  1  
ATOM 3954   C CG2  . ILE B 1 105 ? 11.811  9.332   8.618   1.00 11.44 ? 105 ILE B CG2  1  
ATOM 3955   C CD1  . ILE B 1 105 ? 13.931  11.180  9.834   1.00 50.14 ? 105 ILE B CD1  1  
ATOM 3956   H H    . ILE B 1 105 ? 10.772  13.296  8.156   1.00 22.34 ? 105 ILE B H    1  
ATOM 3957   H HA   . ILE B 1 105 ? 11.482  11.121  6.396   1.00 73.50 ? 105 ILE B HA   1  
ATOM 3958   H HB   . ILE B 1 105 ? 11.143  11.201  9.435   1.00 20.22 ? 105 ILE B HB   1  
ATOM 3959   H HG12 . ILE B 1 105 ? 13.688  11.242  7.736   1.00 11.43 ? 105 ILE B HG12 1  
ATOM 3960   H HG13 . ILE B 1 105 ? 13.007  12.620  8.595   1.00 33.44 ? 105 ILE B HG13 1  
ATOM 3961   H HG21 . ILE B 1 105 ? 12.281  9.032   9.537   1.00 14.52 ? 105 ILE B HG21 1  
ATOM 3962   H HG22 . ILE B 1 105 ? 12.393  8.965   7.785   1.00 34.33 ? 105 ILE B HG22 1  
ATOM 3963   H HG23 . ILE B 1 105 ? 10.822  8.894   8.579   1.00 33.34 ? 105 ILE B HG23 1  
ATOM 3964   H HD11 . ILE B 1 105 ? 14.911  11.613  9.756   1.00 11.42 ? 105 ILE B HD11 1  
ATOM 3965   H HD12 . ILE B 1 105 ? 14.026  10.106  9.911   1.00 44.10 ? 105 ILE B HD12 1  
ATOM 3966   H HD13 . ILE B 1 105 ? 13.445  11.563  10.720  1.00 1.51  ? 105 ILE B HD13 1  
ATOM 3967   N N    . LEU B 1 106 ? 8.613   11.026  8.078   1.00 21.14 ? 106 LEU B N    1  
ATOM 3968   C CA   . LEU B 1 106 ? 7.308   10.360  8.245   1.00 73.54 ? 106 LEU B CA   1  
ATOM 3969   C C    . LEU B 1 106 ? 6.371   10.631  7.040   1.00 4.45  ? 106 LEU B C    1  
ATOM 3970   O O    . LEU B 1 106 ? 5.485   9.822   6.731   1.00 3.45  ? 106 LEU B O    1  
ATOM 3971   C CB   . LEU B 1 106 ? 6.638   10.854  9.558   1.00 62.15 ? 106 LEU B CB   1  
ATOM 3972   C CG   . LEU B 1 106 ? 7.435   10.587  10.878  1.00 33.45 ? 106 LEU B CG   1  
ATOM 3973   C CD1  . LEU B 1 106 ? 6.739   11.239  12.099  1.00 61.54 ? 106 LEU B CD1  1  
ATOM 3974   C CD2  . LEU B 1 106 ? 7.662   9.070   11.095  1.00 43.43 ? 106 LEU B CD2  1  
ATOM 3975   H H    . LEU B 1 106 ? 8.798   11.827  8.614   1.00 42.05 ? 106 LEU B H    1  
ATOM 3976   H HA   . LEU B 1 106 ? 7.494   9.290   8.320   1.00 43.34 ? 106 LEU B HA   1  
ATOM 3977   H HB2  . LEU B 1 106 ? 6.473   11.924  9.468   1.00 42.15 ? 106 LEU B HB2  1  
ATOM 3978   H HB3  . LEU B 1 106 ? 5.668   10.374  9.648   1.00 2.21  ? 106 LEU B HB3  1  
ATOM 3979   H HG   . LEU B 1 106 ? 8.414   11.049  10.787  1.00 42.20 ? 106 LEU B HG   1  
ATOM 3980   H HD11 . LEU B 1 106 ? 5.754   10.811  12.237  1.00 41.42 ? 106 LEU B HD11 1  
ATOM 3981   H HD12 . LEU B 1 106 ? 6.644   12.304  11.935  1.00 10.31 ? 106 LEU B HD12 1  
ATOM 3982   H HD13 . LEU B 1 106 ? 7.330   11.073  12.991  1.00 72.02 ? 106 LEU B HD13 1  
ATOM 3983   H HD21 . LEU B 1 106 ? 6.710   8.559   11.167  1.00 52.32 ? 106 LEU B HD21 1  
ATOM 3984   H HD22 . LEU B 1 106 ? 8.222   8.910   12.009  1.00 44.40 ? 106 LEU B HD22 1  
ATOM 3985   H HD23 . LEU B 1 106 ? 8.226   8.664   10.266  1.00 73.40 ? 106 LEU B HD23 1  
ATOM 3986   N N    . PHE B 1 107 ? 6.603   11.780  6.375   1.00 4.43  ? 107 PHE B N    1  
ATOM 3987   C CA   . PHE B 1 107 ? 5.743   12.312  5.295   1.00 32.40 ? 107 PHE B CA   1  
ATOM 3988   C C    . PHE B 1 107 ? 5.551   11.336  4.088   1.00 33.14 ? 107 PHE B C    1  
ATOM 3989   O O    . PHE B 1 107 ? 4.412   11.142  3.683   1.00 4.45  ? 107 PHE B O    1  
ATOM 3990   C CB   . PHE B 1 107 ? 6.257   13.711  4.826   1.00 65.12 ? 107 PHE B CB   1  
ATOM 3991   C CG   . PHE B 1 107 ? 5.490   14.288  3.635   1.00 44.34 ? 107 PHE B CG   1  
ATOM 3992   C CD1  . PHE B 1 107 ? 4.149   14.652  3.763   1.00 24.52 ? 107 PHE B CD1  1  
ATOM 3993   C CD2  . PHE B 1 107 ? 6.104   14.445  2.388   1.00 1.33  ? 107 PHE B CD2  1  
ATOM 3994   C CE1  . PHE B 1 107 ? 3.451   15.153  2.684   1.00 2.41  ? 107 PHE B CE1  1  
ATOM 3995   C CE2  . PHE B 1 107 ? 5.406   14.952  1.311   1.00 71.02 ? 107 PHE B CE2  1  
ATOM 3996   C CZ   . PHE B 1 107 ? 4.079   15.302  1.457   1.00 55.13 ? 107 PHE B CZ   1  
ATOM 3997   H H    . PHE B 1 107 ? 7.389   12.304  6.632   1.00 11.33 ? 107 PHE B H    1  
ATOM 3998   H HA   . PHE B 1 107 ? 4.766   12.458  5.744   1.00 71.21 ? 107 PHE B HA   1  
ATOM 3999   H HB2  . PHE B 1 107 ? 6.172   14.411  5.648   1.00 43.24 ? 107 PHE B HB2  1  
ATOM 4000   H HB3  . PHE B 1 107 ? 7.308   13.631  4.554   1.00 22.54 ? 107 PHE B HB3  1  
ATOM 4001   H HD1  . PHE B 1 107 ? 3.651   14.536  4.723   1.00 73.34 ? 107 PHE B HD1  1  
ATOM 4002   H HD2  . PHE B 1 107 ? 7.148   14.173  2.274   1.00 41.30 ? 107 PHE B HD2  1  
ATOM 4003   H HE1  . PHE B 1 107 ? 2.412   15.432  2.796   1.00 12.24 ? 107 PHE B HE1  1  
ATOM 4004   H HE2  . PHE B 1 107 ? 5.898   15.066  0.353   1.00 70.31 ? 107 PHE B HE2  1  
ATOM 4005   H HZ   . PHE B 1 107 ? 3.528   15.689  0.612   1.00 53.10 ? 107 PHE B HZ   1  
ATOM 4006   N N    . PRO B 1 108 ? 6.632   10.735  3.468   1.00 2.23  ? 108 PRO B N    1  
ATOM 4007   C CA   . PRO B 1 108 ? 6.477   9.765   2.337   1.00 75.53 ? 108 PRO B CA   1  
ATOM 4008   C C    . PRO B 1 108 ? 5.504   8.595   2.634   1.00 71.40 ? 108 PRO B C    1  
ATOM 4009   O O    . PRO B 1 108 ? 4.734   8.174   1.764   1.00 60.42 ? 108 PRO B O    1  
ATOM 4010   C CB   . PRO B 1 108 ? 7.917   9.238   2.127   1.00 71.00 ? 108 PRO B CB   1  
ATOM 4011   C CG   . PRO B 1 108 ? 8.793   10.359  2.587   1.00 54.41 ? 108 PRO B CG   1  
ATOM 4012   C CD   . PRO B 1 108 ? 8.073   10.978  3.757   1.00 71.31 ? 108 PRO B CD   1  
ATOM 4013   H HA   . PRO B 1 108 ? 6.144   10.279  1.439   1.00 4.45  ? 108 PRO B HA   1  
ATOM 4014   H HB2  . PRO B 1 108 ? 8.088   8.337   2.721   1.00 74.44 ? 108 PRO B HB2  1  
ATOM 4015   H HB3  . PRO B 1 108 ? 8.096   9.025   1.080   1.00 44.44 ? 108 PRO B HB3  1  
ATOM 4016   H HG2  . PRO B 1 108 ? 9.764   9.975   2.893   1.00 65.24 ? 108 PRO B HG2  1  
ATOM 4017   H HG3  . PRO B 1 108 ? 8.916   11.093  1.796   1.00 73.54 ? 108 PRO B HG3  1  
ATOM 4018   H HD2  . PRO B 1 108 ? 8.362   10.499  4.689   1.00 72.03 ? 108 PRO B HD2  1  
ATOM 4019   H HD3  . PRO B 1 108 ? 8.276   12.043  3.813   1.00 41.51 ? 108 PRO B HD3  1  
ATOM 4020   N N    . TYR B 1 109 ? 5.555   8.103   3.882   1.00 71.25 ? 109 TYR B N    1  
ATOM 4021   C CA   . TYR B 1 109 ? 4.723   6.978   4.357   1.00 50.22 ? 109 TYR B CA   1  
ATOM 4022   C C    . TYR B 1 109 ? 3.249   7.412   4.488   1.00 20.42 ? 109 TYR B C    1  
ATOM 4023   O O    . TYR B 1 109 ? 2.335   6.689   4.078   1.00 55.14 ? 109 TYR B O    1  
ATOM 4024   C CB   . TYR B 1 109 ? 5.238   6.488   5.726   1.00 35.44 ? 109 TYR B CB   1  
ATOM 4025   C CG   . TYR B 1 109 ? 6.694   5.995   5.765   1.00 73.04 ? 109 TYR B CG   1  
ATOM 4026   C CD1  . TYR B 1 109 ? 7.765   6.896   5.790   1.00 71.45 ? 109 TYR B CD1  1  
ATOM 4027   C CD2  . TYR B 1 109 ? 6.996   4.632   5.816   1.00 3.44  ? 109 TYR B CD2  1  
ATOM 4028   C CE1  . TYR B 1 109 ? 9.070   6.455   5.862   1.00 21.31 ? 109 TYR B CE1  1  
ATOM 4029   C CE2  . TYR B 1 109 ? 8.301   4.195   5.883   1.00 20.42 ? 109 TYR B CE2  1  
ATOM 4030   C CZ   . TYR B 1 109 ? 9.330   5.104   5.908   1.00 34.42 ? 109 TYR B CZ   1  
ATOM 4031   O OH   . TYR B 1 109 ? 10.624  4.660   6.003   1.00 2.43  ? 109 TYR B OH   1  
ATOM 4032   H H    . TYR B 1 109 ? 6.176   8.517   4.515   1.00 15.50 ? 109 TYR B H    1  
ATOM 4033   H HA   . TYR B 1 109 ? 4.797   6.167   3.636   1.00 14.11 ? 109 TYR B HA   1  
ATOM 4034   H HB2  . TYR B 1 109 ? 5.160   7.304   6.438   1.00 12.11 ? 109 TYR B HB2  1  
ATOM 4035   H HB3  . TYR B 1 109 ? 4.599   5.677   6.073   1.00 2.45  ? 109 TYR B HB3  1  
ATOM 4036   H HD1  . TYR B 1 109 ? 7.560   7.960   5.752   1.00 12.02 ? 109 TYR B HD1  1  
ATOM 4037   H HD2  . TYR B 1 109 ? 6.190   3.908   5.795   1.00 65.10 ? 109 TYR B HD2  1  
ATOM 4038   H HE1  . TYR B 1 109 ? 9.883   7.171   5.883   1.00 14.03 ? 109 TYR B HE1  1  
ATOM 4039   H HE2  . TYR B 1 109 ? 8.510   3.138   5.919   1.00 3.22  ? 109 TYR B HE2  1  
ATOM 4040   H HH   . TYR B 1 109 ? 10.713  3.833   5.520   1.00 61.25 ? 109 TYR B HH   1  
ATOM 4041   N N    . ALA B 1 110 ? 3.048   8.605   5.086   1.00 4.41  ? 110 ALA B N    1  
ATOM 4042   C CA   . ALA B 1 110 ? 1.715   9.230   5.239   1.00 10.32 ? 110 ALA B CA   1  
ATOM 4043   C C    . ALA B 1 110 ? 1.086   9.527   3.864   1.00 64.55 ? 110 ALA B C    1  
ATOM 4044   O O    . ALA B 1 110 ? -0.119  9.369   3.670   1.00 25.33 ? 110 ALA B O    1  
ATOM 4045   C CB   . ALA B 1 110 ? 1.833   10.524  6.062   1.00 2.54  ? 110 ALA B CB   1  
ATOM 4046   H H    . ALA B 1 110 ? 3.834   9.089   5.435   1.00 62.12 ? 110 ALA B H    1  
ATOM 4047   H HA   . ALA B 1 110 ? 1.079   8.538   5.783   1.00 23.11 ? 110 ALA B HA   1  
ATOM 4048   H HB1  . ALA B 1 110 ? 2.241   10.301  7.031   1.00 24.52 ? 110 ALA B HB1  1  
ATOM 4049   H HB2  . ALA B 1 110 ? 0.858   10.980  6.185   1.00 71.53 ? 110 ALA B HB2  1  
ATOM 4050   H HB3  . ALA B 1 110 ? 2.490   11.217  5.560   1.00 24.23 ? 110 ALA B HB3  1  
ATOM 4051   N N    . ARG B 1 111 ? 1.956   9.938   2.930   1.00 21.22 ? 111 ARG B N    1  
ATOM 4052   C CA   . ARG B 1 111 ? 1.608   10.304  1.544   1.00 23.05 ? 111 ARG B CA   1  
ATOM 4053   C C    . ARG B 1 111 ? 1.049   9.083   0.797   1.00 11.12 ? 111 ARG B C    1  
ATOM 4054   O O    . ARG B 1 111 ? -0.037  9.152   0.216   1.00 41.40 ? 111 ARG B O    1  
ATOM 4055   C CB   . ARG B 1 111 ? 2.874   10.853  0.821   1.00 30.02 ? 111 ARG B CB   1  
ATOM 4056   C CG   . ARG B 1 111 ? 2.665   11.347  -0.633  1.00 54.43 ? 111 ARG B CG   1  
ATOM 4057   C CD   . ARG B 1 111 ? 3.997   11.717  -1.321  1.00 53.41 ? 111 ARG B CD   1  
ATOM 4058   N NE   . ARG B 1 111 ? 3.801   12.236  -2.691  1.00 42.04 ? 111 ARG B NE   1  
ATOM 4059   C CZ   . ARG B 1 111 ? 4.541   11.913  -3.772  1.00 12.13 ? 111 ARG B CZ   1  
ATOM 4060   N NH1  . ARG B 1 111 ? 5.557   11.052  -3.681  1.00 71.30 ? 111 ARG B NH1  1  
ATOM 4061   N NH2  . ARG B 1 111 ? 4.271   12.487  -4.938  1.00 70.15 ? 111 ARG B NH2  1  
ATOM 4062   H H    . ARG B 1 111 ? 2.893   9.983   3.191   1.00 4.15  ? 111 ARG B H    1  
ATOM 4063   H HA   . ARG B 1 111 ? 0.852   11.084  1.579   1.00 32.02 ? 111 ARG B HA   1  
ATOM 4064   H HB2  . ARG B 1 111 ? 3.265   11.681  1.402   1.00 0.41  ? 111 ARG B HB2  1  
ATOM 4065   H HB3  . ARG B 1 111 ? 3.628   10.068  0.805   1.00 73.04 ? 111 ARG B HB3  1  
ATOM 4066   H HG2  . ARG B 1 111 ? 2.184   10.562  -1.205  1.00 61.43 ? 111 ARG B HG2  1  
ATOM 4067   H HG3  . ARG B 1 111 ? 2.021   12.220  -0.621  1.00 42.22 ? 111 ARG B HG3  1  
ATOM 4068   H HD2  . ARG B 1 111 ? 4.495   12.485  -0.734  1.00 42.11 ? 111 ARG B HD2  1  
ATOM 4069   H HD3  . ARG B 1 111 ? 4.629   10.835  -1.355  1.00 63.44 ? 111 ARG B HD3  1  
ATOM 4070   H HE   . ARG B 1 111 ? 3.068   12.877  -2.811  1.00 10.23 ? 111 ARG B HE   1  
ATOM 4071   H HH11 . ARG B 1 111 ? 5.778   10.625  -2.801  1.00 54.53 ? 111 ARG B HH11 1  
ATOM 4072   H HH12 . ARG B 1 111 ? 6.099   10.823  -4.491  1.00 20.13 ? 111 ARG B HH12 1  
ATOM 4073   H HH21 . ARG B 1 111 ? 3.517   13.148  -5.011  1.00 20.34 ? 111 ARG B HH21 1  
ATOM 4074   H HH22 . ARG B 1 111 ? 4.811   12.263  -5.750  1.00 64.33 ? 111 ARG B HH22 1  
ATOM 4075   N N    . GLU B 1 112 ? 1.803   7.959   0.852   1.00 71.45 ? 112 GLU B N    1  
ATOM 4076   C CA   . GLU B 1 112 ? 1.432   6.695   0.171   1.00 54.02 ? 112 GLU B CA   1  
ATOM 4077   C C    . GLU B 1 112 ? 0.188   6.078   0.832   1.00 0.14  ? 112 GLU B C    1  
ATOM 4078   O O    . GLU B 1 112 ? -0.604  5.410   0.168   1.00 30.33 ? 112 GLU B O    1  
ATOM 4079   C CB   . GLU B 1 112 ? 2.635   5.698   0.181   1.00 45.11 ? 112 GLU B CB   1  
ATOM 4080   C CG   . GLU B 1 112 ? 2.546   4.497   -0.821  1.00 12.32 ? 112 GLU B CG   1  
ATOM 4081   C CD   . GLU B 1 112 ? 1.801   3.237   -0.298  1.00 4.25  ? 112 GLU B CD   1  
ATOM 4082   O OE1  . GLU B 1 112 ? 2.352   2.528   0.575   1.00 72.14 ? 112 GLU B OE1  1  
ATOM 4083   O OE2  . GLU B 1 112 ? 0.684   2.923   -0.778  1.00 54.23 ? 112 GLU B OE2  1  
ATOM 4084   H H    . GLU B 1 112 ? 2.636   7.978   1.371   1.00 60.14 ? 112 GLU B H    1  
ATOM 4085   H HA   . GLU B 1 112 ? 1.190   6.937   -0.863  1.00 62.22 ? 112 GLU B HA   1  
ATOM 4086   H HB2  . GLU B 1 112 ? 3.534   6.258   -0.056  1.00 52.23 ? 112 GLU B HB2  1  
ATOM 4087   H HB3  . GLU B 1 112 ? 2.751   5.296   1.184   1.00 23.34 ? 112 GLU B HB3  1  
ATOM 4088   H HG2  . GLU B 1 112 ? 2.053   4.839   -1.723  1.00 41.33 ? 112 GLU B HG2  1  
ATOM 4089   H HG3  . GLU B 1 112 ? 3.558   4.198   -1.088  1.00 34.32 ? 112 GLU B HG3  1  
ATOM 4090   N N    . CYS B 1 113 ? 0.017   6.324   2.144   1.00 35.41 ? 113 CYS B N    1  
ATOM 4091   C CA   . CYS B 1 113 ? -1.139  5.819   2.899   1.00 31.04 ? 113 CYS B CA   1  
ATOM 4092   C C    . CYS B 1 113 ? -2.439  6.512   2.424   1.00 13.22 ? 113 CYS B C    1  
ATOM 4093   O O    . CYS B 1 113 ? -3.460  5.849   2.241   1.00 32.54 ? 113 CYS B O    1  
ATOM 4094   C CB   . CYS B 1 113 ? -0.929  5.988   4.418   1.00 60.43 ? 113 CYS B CB   1  
ATOM 4095   S SG   . CYS B 1 113 ? -1.853  4.785   5.384   1.00 32.20 ? 113 CYS B SG   1  
ATOM 4096   H H    . CYS B 1 113 ? 0.695   6.851   2.615   1.00 62.31 ? 113 CYS B H    1  
ATOM 4097   H HA   . CYS B 1 113 ? -1.223  4.755   2.685   1.00 65.03 ? 113 CYS B HA   1  
ATOM 4098   H HB2  . CYS B 1 113 ? 0.119   5.855   4.657   1.00 32.14 ? 113 CYS B HB2  1  
ATOM 4099   H HB3  . CYS B 1 113 ? -1.246  6.981   4.743   1.00 1.24  ? 113 CYS B HB3  1  
ATOM 4100   H HG   . CYS B 1 113 ? -3.146  4.971   5.135   1.00 74.14 ? 113 CYS B HG   1  
ATOM 4101   N N    . ILE B 1 114 ? -2.365  7.845   2.199   1.00 21.12 ? 114 ILE B N    1  
ATOM 4102   C CA   . ILE B 1 114 ? -3.473  8.638   1.600   1.00 60.44 ? 114 ILE B CA   1  
ATOM 4103   C C    . ILE B 1 114 ? -3.760  8.132   0.182   1.00 65.01 ? 114 ILE B C    1  
ATOM 4104   O O    . ILE B 1 114 ? -4.906  7.847   -0.151  1.00 25.13 ? 114 ILE B O    1  
ATOM 4105   C CB   . ILE B 1 114 ? -3.142  10.190  1.577   1.00 24.22 ? 114 ILE B CB   1  
ATOM 4106   C CG1  . ILE B 1 114 ? -2.982  10.691  3.039   1.00 23.45 ? 114 ILE B CG1  1  
ATOM 4107   C CG2  . ILE B 1 114 ? -4.219  11.031  0.814   1.00 4.13  ? 114 ILE B CG2  1  
ATOM 4108   C CD1  . ILE B 1 114 ? -2.613  12.137  3.223   1.00 33.04 ? 114 ILE B CD1  1  
ATOM 4109   H H    . ILE B 1 114 ? -1.535  8.307   2.434   1.00 14.13 ? 114 ILE B H    1  
ATOM 4110   H HA   . ILE B 1 114 ? -4.362  8.487   2.214   1.00 54.04 ? 114 ILE B HA   1  
ATOM 4111   H HB   . ILE B 1 114 ? -2.194  10.321  1.060   1.00 22.40 ? 114 ILE B HB   1  
ATOM 4112   H HG12 . ILE B 1 114 ? -3.910  10.536  3.571   1.00 31.10 ? 114 ILE B HG12 1  
ATOM 4113   H HG13 . ILE B 1 114 ? -2.210  10.104  3.524   1.00 15.24 ? 114 ILE B HG13 1  
ATOM 4114   H HG21 . ILE B 1 114 ? -4.441  10.572  -0.143  1.00 62.23 ? 114 ILE B HG21 1  
ATOM 4115   H HG22 . ILE B 1 114 ? -3.842  12.030  0.640   1.00 53.22 ? 114 ILE B HG22 1  
ATOM 4116   H HG23 . ILE B 1 114 ? -5.129  11.103  1.399   1.00 23.44 ? 114 ILE B HG23 1  
ATOM 4117   H HD11 . ILE B 1 114 ? -2.671  12.382  4.274   1.00 45.41 ? 114 ILE B HD11 1  
ATOM 4118   H HD12 . ILE B 1 114 ? -3.292  12.772  2.678   1.00 61.53 ? 114 ILE B HD12 1  
ATOM 4119   H HD13 . ILE B 1 114 ? -1.606  12.319  2.881   1.00 64.45 ? 114 ILE B HD13 1  
ATOM 4120   N N    . THR B 1 115 ? -2.686  7.975   -0.611  1.00 15.32 ? 115 THR B N    1  
ATOM 4121   C CA   . THR B 1 115 ? -2.742  7.486   -2.002  1.00 44.22 ? 115 THR B CA   1  
ATOM 4122   C C    . THR B 1 115 ? -3.428  6.094   -2.092  1.00 35.35 ? 115 THR B C    1  
ATOM 4123   O O    . THR B 1 115 ? -4.159  5.806   -3.054  1.00 25.25 ? 115 THR B O    1  
ATOM 4124   C CB   . THR B 1 115 ? -1.284  7.436   -2.583  1.00 24.24 ? 115 THR B CB   1  
ATOM 4125   O OG1  . THR B 1 115 ? -0.699  8.751   -2.537  1.00 62.42 ? 115 THR B OG1  1  
ATOM 4126   C CG2  . THR B 1 115 ? -1.217  6.915   -4.023  1.00 33.01 ? 115 THR B CG2  1  
ATOM 4127   H H    . THR B 1 115 ? -1.806  8.195   -0.242  1.00 61.44 ? 115 THR B H    1  
ATOM 4128   H HA   . THR B 1 115 ? -3.315  8.202   -2.583  1.00 33.31 ? 115 THR B HA   1  
ATOM 4129   H HB   . THR B 1 115 ? -0.688  6.783   -1.953  1.00 54.22 ? 115 THR B HB   1  
ATOM 4130   H HG1  . THR B 1 115 ? -1.351  9.404   -2.812  1.00 65.43 ? 115 THR B HG1  1  
ATOM 4131   H HG21 . THR B 1 115 ? -1.493  5.872   -4.057  1.00 24.33 ? 115 THR B HG21 1  
ATOM 4132   H HG22 . THR B 1 115 ? -0.216  7.029   -4.409  1.00 63.45 ? 115 THR B HG22 1  
ATOM 4133   H HG23 . THR B 1 115 ? -1.899  7.480   -4.645  1.00 61.10 ? 115 THR B HG23 1  
ATOM 4134   N N    . SER B 1 116 ? -3.210  5.261   -1.057  1.00 24.52 ? 116 SER B N    1  
ATOM 4135   C CA   . SER B 1 116 ? -3.810  3.924   -0.958  1.00 50.43 ? 116 SER B CA   1  
ATOM 4136   C C    . SER B 1 116 ? -5.328  4.042   -0.719  1.00 63.50 ? 116 SER B C    1  
ATOM 4137   O O    . SER B 1 116 ? -6.117  3.425   -1.432  1.00 62.42 ? 116 SER B O    1  
ATOM 4138   C CB   . SER B 1 116 ? -3.137  3.112   0.179   1.00 70.20 ? 116 SER B CB   1  
ATOM 4139   O OG   . SER B 1 116 ? -3.612  1.772   0.220   1.00 4.45  ? 116 SER B OG   1  
ATOM 4140   H H    . SER B 1 116 ? -2.628  5.565   -0.330  1.00 53.13 ? 116 SER B H    1  
ATOM 4141   H HA   . SER B 1 116 ? -3.640  3.410   -1.901  1.00 73.23 ? 116 SER B HA   1  
ATOM 4142   H HB2  . SER B 1 116 ? -2.066  3.084   0.015   1.00 43.34 ? 116 SER B HB2  1  
ATOM 4143   H HB3  . SER B 1 116 ? -3.336  3.579   1.141   1.00 21.54 ? 116 SER B HB3  1  
ATOM 4144   H HG   . SER B 1 116 ? -3.327  1.314   -0.583  1.00 1.44  ? 116 SER B HG   1  
ATOM 4145   N N    . MET B 1 117 ? -5.722  4.895   0.253   1.00 24.54 ? 117 MET B N    1  
ATOM 4146   C CA   . MET B 1 117 ? -7.133  5.015   0.702   1.00 12.11 ? 117 MET B CA   1  
ATOM 4147   C C    . MET B 1 117 ? -8.014  5.684   -0.372  1.00 54.21 ? 117 MET B C    1  
ATOM 4148   O O    . MET B 1 117 ? -9.189  5.337   -0.513  1.00 44.45 ? 117 MET B O    1  
ATOM 4149   C CB   . MET B 1 117 ? -7.237  5.774   2.053   1.00 35.22 ? 117 MET B CB   1  
ATOM 4150   C CG   . MET B 1 117 ? -6.362  5.186   3.168   1.00 22.45 ? 117 MET B CG   1  
ATOM 4151   S SD   . MET B 1 117 ? -6.404  3.379   3.219   1.00 41.04 ? 117 MET B SD   1  
ATOM 4152   C CE   . MET B 1 117 ? -5.003  3.012   4.276   1.00 52.41 ? 117 MET B CE   1  
ATOM 4153   H H    . MET B 1 117 ? -5.047  5.471   0.668   1.00 1.13  ? 117 MET B H    1  
ATOM 4154   H HA   . MET B 1 117 ? -7.507  4.004   0.853   1.00 74.40 ? 117 MET B HA   1  
ATOM 4155   H HB2  . MET B 1 117 ? -6.948  6.809   1.903   1.00 73.41 ? 117 MET B HB2  1  
ATOM 4156   H HB3  . MET B 1 117 ? -8.270  5.751   2.389   1.00 32.55 ? 117 MET B HB3  1  
ATOM 4157   H HG2  . MET B 1 117 ? -5.341  5.499   3.012   1.00 53.43 ? 117 MET B HG2  1  
ATOM 4158   H HG3  . MET B 1 117 ? -6.704  5.563   4.126   1.00 72.35 ? 117 MET B HG3  1  
ATOM 4159   H HE1  . MET B 1 117 ? -5.204  3.361   5.279   1.00 52.54 ? 117 MET B HE1  1  
ATOM 4160   H HE2  . MET B 1 117 ? -4.122  3.508   3.893   1.00 44.11 ? 117 MET B HE2  1  
ATOM 4161   H HE3  . MET B 1 117 ? -4.835  1.948   4.290   1.00 40.44 ? 117 MET B HE3  1  
ATOM 4162   N N    . VAL B 1 118 ? -7.421  6.628   -1.132  1.00 43.54 ? 118 VAL B N    1  
ATOM 4163   C CA   . VAL B 1 118 ? -8.083  7.282   -2.289  1.00 51.21 ? 118 VAL B CA   1  
ATOM 4164   C C    . VAL B 1 118 ? -8.387  6.234   -3.380  1.00 71.22 ? 118 VAL B C    1  
ATOM 4165   O O    . VAL B 1 118 ? -9.460  6.250   -3.993  1.00 13.03 ? 118 VAL B O    1  
ATOM 4166   C CB   . VAL B 1 118 ? -7.191  8.456   -2.863  1.00 44.03 ? 118 VAL B CB   1  
ATOM 4167   C CG1  . VAL B 1 118 ? -7.768  9.066   -4.170  1.00 74.22 ? 118 VAL B CG1  1  
ATOM 4168   C CG2  . VAL B 1 118 ? -6.990  9.553   -1.788  1.00 12.31 ? 118 VAL B CG2  1  
ATOM 4169   H H    . VAL B 1 118 ? -6.508  6.893   -0.909  1.00 3.11  ? 118 VAL B H    1  
ATOM 4170   H HA   . VAL B 1 118 ? -9.025  7.703   -1.939  1.00 23.20 ? 118 VAL B HA   1  
ATOM 4171   H HB   . VAL B 1 118 ? -6.212  8.044   -3.098  1.00 13.25 ? 118 VAL B HB   1  
ATOM 4172   H HG11 . VAL B 1 118 ? -7.121  9.862   -4.522  1.00 44.03 ? 118 VAL B HG11 1  
ATOM 4173   H HG12 . VAL B 1 118 ? -8.757  9.468   -3.988  1.00 62.32 ? 118 VAL B HG12 1  
ATOM 4174   H HG13 . VAL B 1 118 ? -7.832  8.300   -4.932  1.00 50.32 ? 118 VAL B HG13 1  
ATOM 4175   H HG21 . VAL B 1 118 ? -6.541  9.118   -0.904  1.00 71.20 ? 118 VAL B HG21 1  
ATOM 4176   H HG22 . VAL B 1 118 ? -7.944  9.991   -1.522  1.00 22.21 ? 118 VAL B HG22 1  
ATOM 4177   H HG23 . VAL B 1 118 ? -6.338  10.327  -2.170  1.00 45.42 ? 118 VAL B HG23 1  
ATOM 4178   N N    . SER B 1 119 ? -7.438  5.301   -3.565  1.00 42.40 ? 119 SER B N    1  
ATOM 4179   C CA   . SER B 1 119 ? -7.571  4.186   -4.522  1.00 11.43 ? 119 SER B CA   1  
ATOM 4180   C C    . SER B 1 119 ? -8.624  3.160   -4.063  1.00 35.23 ? 119 SER B C    1  
ATOM 4181   O O    . SER B 1 119 ? -9.219  2.451   -4.882  1.00 60.20 ? 119 SER B O    1  
ATOM 4182   C CB   . SER B 1 119 ? -6.220  3.484   -4.693  1.00 34.44 ? 119 SER B CB   1  
ATOM 4183   O OG   . SER B 1 119 ? -6.261  2.592   -5.779  1.00 63.34 ? 119 SER B OG   1  
ATOM 4184   H H    . SER B 1 119 ? -6.605  5.375   -3.049  1.00 71.32 ? 119 SER B H    1  
ATOM 4185   H HA   . SER B 1 119 ? -7.877  4.598   -5.479  1.00 62.41 ? 119 SER B HA   1  
ATOM 4186   H HB2  . SER B 1 119 ? -5.450  4.221   -4.883  1.00 73.11 ? 119 SER B HB2  1  
ATOM 4187   H HB3  . SER B 1 119 ? -5.967  2.929   -3.795  1.00 41.11 ? 119 SER B HB3  1  
ATOM 4188   H HG   . SER B 1 119 ? -5.958  3.052   -6.568  1.00 51.42 ? 119 SER B HG   1  
ATOM 4189   N N    . ARG B 1 120 ? -8.825  3.076   -2.742  1.00 33.22 ? 120 ARG B N    1  
ATOM 4190   C CA   . ARG B 1 120 ? -9.842  2.203   -2.133  1.00 72.54 ? 120 ARG B CA   1  
ATOM 4191   C C    . ARG B 1 120 ? -11.233 2.830   -2.298  1.00 15.34 ? 120 ARG B C    1  
ATOM 4192   O O    . ARG B 1 120 ? -12.212 2.111   -2.467  1.00 42.43 ? 120 ARG B O    1  
ATOM 4193   C CB   . ARG B 1 120 ? -9.486  1.945   -0.650  1.00 24.11 ? 120 ARG B CB   1  
ATOM 4194   C CG   . ARG B 1 120 ? -8.138  1.223   -0.481  1.00 1.13  ? 120 ARG B CG   1  
ATOM 4195   C CD   . ARG B 1 120 ? -7.683  1.059   0.980   1.00 32.04 ? 120 ARG B CD   1  
ATOM 4196   N NE   . ARG B 1 120 ? -6.320  0.500   1.046   1.00 20.24 ? 120 ARG B NE   1  
ATOM 4197   C CZ   . ARG B 1 120 ? -5.989  -0.765  0.743   1.00 24.34 ? 120 ARG B CZ   1  
ATOM 4198   N NH1  . ARG B 1 120 ? -6.906  -1.637  0.346   1.00 24.51 ? 120 ARG B NH1  1  
ATOM 4199   N NH2  . ARG B 1 120 ? -4.726  -1.136  0.784   1.00 64.22 ? 120 ARG B NH2  1  
ATOM 4200   H H    . ARG B 1 120 ? -8.269  3.627   -2.154  1.00 71.34 ? 120 ARG B H    1  
ATOM 4201   H HA   . ARG B 1 120 ? -9.830  1.249   -2.664  1.00 3.23  ? 120 ARG B HA   1  
ATOM 4202   H HB2  . ARG B 1 120 ? -9.441  2.898   -0.130  1.00 71.50 ? 120 ARG B HB2  1  
ATOM 4203   H HB3  . ARG B 1 120 ? -10.262 1.334   -0.197  1.00 3.51  ? 120 ARG B HB3  1  
ATOM 4204   H HG2  . ARG B 1 120 ? -8.212  0.238   -0.927  1.00 12.34 ? 120 ARG B HG2  1  
ATOM 4205   H HG3  . ARG B 1 120 ? -7.378  1.785   -1.015  1.00 3.22  ? 120 ARG B HG3  1  
ATOM 4206   H HD2  . ARG B 1 120 ? -7.681  2.031   1.462   1.00 40.44 ? 120 ARG B HD2  1  
ATOM 4207   H HD3  . ARG B 1 120 ? -8.369  0.402   1.504   1.00 44.04 ? 120 ARG B HD3  1  
ATOM 4208   H HE   . ARG B 1 120 ? -5.605  1.114   1.327   1.00 3.01  ? 120 ARG B HE   1  
ATOM 4209   H HH11 . ARG B 1 120 ? -7.865  -1.370  0.278   1.00 51.33 ? 120 ARG B HH11 1  
ATOM 4210   H HH12 . ARG B 1 120 ? -6.637  -2.582  0.119   1.00 40.21 ? 120 ARG B HH12 1  
ATOM 4211   H HH21 . ARG B 1 120 ? -4.016  -0.483  1.048   1.00 52.02 ? 120 ARG B HH21 1  
ATOM 4212   H HH22 . ARG B 1 120 ? -4.469  -2.086  0.552   1.00 71.30 ? 120 ARG B HH22 1  
ATOM 4213   N N    . GLY B 1 121 ? -11.290 4.181   -2.293  1.00 73.00 ? 121 GLY B N    1  
ATOM 4214   C CA   . GLY B 1 121 ? -12.500 4.920   -2.690  1.00 21.11 ? 121 GLY B CA   1  
ATOM 4215   C C    . GLY B 1 121 ? -12.647 5.016   -4.203  1.00 1.23  ? 121 GLY B C    1  
ATOM 4216   O O    . GLY B 1 121 ? -13.599 5.622   -4.700  1.00 64.23 ? 121 GLY B O    1  
ATOM 4217   H H    . GLY B 1 121 ? -10.491 4.685   -2.024  1.00 43.52 ? 121 GLY B H    1  
ATOM 4218   H HA2  . GLY B 1 121 ? -13.374 4.424   -2.288  1.00 33.32 ? 121 GLY B HA2  1  
ATOM 4219   H HA3  . GLY B 1 121 ? -12.444 5.923   -2.283  1.00 24.31 ? 121 GLY B HA3  1  
ATOM 4220   N N    . THR B 1 122 ? -11.664 4.415   -4.913  1.00 34.10 ? 122 THR B N    1  
ATOM 4221   C CA   . THR B 1 122 ? -11.640 4.193   -6.370  1.00 34.40 ? 122 THR B CA   1  
ATOM 4222   C C    . THR B 1 122 ? -11.679 5.518   -7.173  1.00 43.40 ? 122 THR B C    1  
ATOM 4223   O O    . THR B 1 122 ? -12.232 5.593   -8.279  1.00 44.04 ? 122 THR B O    1  
ATOM 4224   C CB   . THR B 1 122 ? -12.742 3.156   -6.827  1.00 50.33 ? 122 THR B CB   1  
ATOM 4225   O OG1  . THR B 1 122 ? -14.062 3.661   -6.592  1.00 52.35 ? 122 THR B OG1  1  
ATOM 4226   C CG2  . THR B 1 122 ? -12.615 1.813   -6.080  1.00 30.32 ? 122 THR B CG2  1  
ATOM 4227   H H    . THR B 1 122 ? -10.890 4.105   -4.413  1.00 63.24 ? 122 THR B H    1  
ATOM 4228   H HA   . THR B 1 122 ? -10.672 3.734   -6.577  1.00 40.34 ? 122 THR B HA   1  
ATOM 4229   H HB   . THR B 1 122 ? -12.621 2.972   -7.891  1.00 61.11 ? 122 THR B HB   1  
ATOM 4230   H HG1  . THR B 1 122 ? -14.204 3.769   -5.646  1.00 34.04 ? 122 THR B HG1  1  
ATOM 4231   H HG21 . THR B 1 122 ? -11.606 1.465   -6.100  1.00 13.03 ? 122 THR B HG21 1  
ATOM 4232   H HG22 . THR B 1 122 ? -13.254 1.073   -6.544  1.00 22.04 ? 122 THR B HG22 1  
ATOM 4233   H HG23 . THR B 1 122 ? -12.918 1.943   -5.049  1.00 41.13 ? 122 THR B HG23 1  
ATOM 4234   N N    . PHE B 1 123 ? -11.043 6.557   -6.598  1.00 40.14 ? 123 PHE B N    1  
ATOM 4235   C CA   . PHE B 1 123 ? -10.820 7.856   -7.266  1.00 31.23 ? 123 PHE B CA   1  
ATOM 4236   C C    . PHE B 1 123 ? -9.418  7.872   -7.929  1.00 3.20  ? 123 PHE B C    1  
ATOM 4237   O O    . PHE B 1 123 ? -8.540  7.102   -7.518  1.00 50.43 ? 123 PHE B O    1  
ATOM 4238   C CB   . PHE B 1 123 ? -10.977 9.031   -6.252  1.00 34.54 ? 123 PHE B CB   1  
ATOM 4239   C CG   . PHE B 1 123 ? -12.423 9.261   -5.804  1.00 64.12 ? 123 PHE B CG   1  
ATOM 4240   C CD1  . PHE B 1 123 ? -13.353 9.807   -6.696  1.00 34.14 ? 123 PHE B CD1  1  
ATOM 4241   C CD2  . PHE B 1 123 ? -12.857 8.927   -4.520  1.00 1.51  ? 123 PHE B CD2  1  
ATOM 4242   C CE1  . PHE B 1 123 ? -14.667 10.014  -6.318  1.00 31.30 ? 123 PHE B CE1  1  
ATOM 4243   C CE2  . PHE B 1 123 ? -14.174 9.136   -4.142  1.00 42.43 ? 123 PHE B CE2  1  
ATOM 4244   C CZ   . PHE B 1 123 ? -15.077 9.678   -5.040  1.00 71.23 ? 123 PHE B CZ   1  
ATOM 4245   H H    . PHE B 1 123 ? -10.692 6.437   -5.689  1.00 63.22 ? 123 PHE B H    1  
ATOM 4246   H HA   . PHE B 1 123 ? -11.569 7.967   -8.048  1.00 73.53 ? 123 PHE B HA   1  
ATOM 4247   H HB2  . PHE B 1 123 ? -10.363 8.832   -5.379  1.00 74.21 ? 123 PHE B HB2  1  
ATOM 4248   H HB3  . PHE B 1 123 ? -10.627 9.947   -6.715  1.00 2.51  ? 123 PHE B HB3  1  
ATOM 4249   H HD1  . PHE B 1 123 ? -13.035 10.076  -7.698  1.00 31.40 ? 123 PHE B HD1  1  
ATOM 4250   H HD2  . PHE B 1 123 ? -12.155 8.505   -3.811  1.00 71.01 ? 123 PHE B HD2  1  
ATOM 4251   H HE1  . PHE B 1 123 ? -15.374 10.439  -7.026  1.00 64.35 ? 123 PHE B HE1  1  
ATOM 4252   H HE2  . PHE B 1 123 ? -14.496 8.878   -3.143  1.00 61.52 ? 123 PHE B HE2  1  
ATOM 4253   H HZ   . PHE B 1 123 ? -16.105 9.841   -4.744  1.00 31.30 ? 123 PHE B HZ   1  
ATOM 4254   N N    . PRO B 1 124 ? -9.200  8.731   -8.995  1.00 42.34 ? 124 PRO B N    1  
ATOM 4255   C CA   . PRO B 1 124 ? -7.881  8.877   -9.681  1.00 14.31 ? 124 PRO B CA   1  
ATOM 4256   C C    . PRO B 1 124 ? -6.712  9.245   -8.744  1.00 61.25 ? 124 PRO B C    1  
ATOM 4257   O O    . PRO B 1 124 ? -6.919  9.668   -7.596  1.00 72.12 ? 124 PRO B O    1  
ATOM 4258   C CB   . PRO B 1 124 ? -8.134  10.006  -10.720 1.00 32.11 ? 124 PRO B CB   1  
ATOM 4259   C CG   . PRO B 1 124 ? -9.605  9.947   -10.984 1.00 62.12 ? 124 PRO B CG   1  
ATOM 4260   C CD   . PRO B 1 124 ? -10.236 9.578   -9.657  1.00 65.51 ? 124 PRO B CD   1  
ATOM 4261   H HA   . PRO B 1 124 ? -7.622  7.960   -10.202 1.00 63.32 ? 124 PRO B HA   1  
ATOM 4262   H HB2  . PRO B 1 124 ? -7.849  10.982  -10.313 1.00 21.32 ? 124 PRO B HB2  1  
ATOM 4263   H HB3  . PRO B 1 124 ? -7.581  9.816   -11.630 1.00 44.33 ? 124 PRO B HB3  1  
ATOM 4264   H HG2  . PRO B 1 124 ? -9.962  10.917  -11.324 1.00 23.54 ? 124 PRO B HG2  1  
ATOM 4265   H HG3  . PRO B 1 124 ? -9.829  9.188   -11.728 1.00 51.13 ? 124 PRO B HG3  1  
ATOM 4266   H HD2  . PRO B 1 124 ? -10.441 10.465  -9.065  1.00 42.10 ? 124 PRO B HD2  1  
ATOM 4267   H HD3  . PRO B 1 124 ? -11.150 9.017   -9.814  1.00 63.43 ? 124 PRO B HD3  1  
ATOM 4268   N N    . GLN B 1 125 ? -5.486  9.112   -9.289  1.00 33.52 ? 125 GLN B N    1  
ATOM 4269   C CA   . GLN B 1 125 ? -4.244  9.249   -8.522  1.00 74.02 ? 125 GLN B CA   1  
ATOM 4270   C C    . GLN B 1 125 ? -4.085  10.634  -7.852  1.00 11.20 ? 125 GLN B C    1  
ATOM 4271   O O    . GLN B 1 125 ? -4.271  11.679  -8.487  1.00 61.15 ? 125 GLN B O    1  
ATOM 4272   C CB   . GLN B 1 125 ? -3.002  8.921   -9.414  1.00 14.51 ? 125 GLN B CB   1  
ATOM 4273   C CG   . GLN B 1 125 ? -1.621  9.232   -8.772  1.00 41.31 ? 125 GLN B CG   1  
ATOM 4274   C CD   . GLN B 1 125 ? -1.324  8.501   -7.445  1.00 74.21 ? 125 GLN B CD   1  
ATOM 4275   O OE1  . GLN B 1 125 ? -2.214  8.106   -6.707  1.00 4.42  ? 125 GLN B OE1  1  
ATOM 4276   N NE2  . GLN B 1 125 ? -0.059  8.390   -7.082  1.00 13.04 ? 125 GLN B NE2  1  
ATOM 4277   H H    . GLN B 1 125 ? -5.423  8.917   -10.245 1.00 53.21 ? 125 GLN B H    1  
ATOM 4278   H HA   . GLN B 1 125 ? -4.289  8.498   -7.736  1.00 4.43  ? 125 GLN B HA   1  
ATOM 4279   H HB2  . GLN B 1 125 ? -3.030  7.865   -9.661  1.00 23.42 ? 125 GLN B HB2  1  
ATOM 4280   H HB3  . GLN B 1 125 ? -3.080  9.486   -10.337 1.00 33.41 ? 125 GLN B HB3  1  
ATOM 4281   H HG2  . GLN B 1 125 ? -0.849  8.962   -9.481  1.00 23.11 ? 125 GLN B HG2  1  
ATOM 4282   H HG3  . GLN B 1 125 ? -1.567  10.296  -8.590  1.00 71.24 ? 125 GLN B HG3  1  
ATOM 4283   H HE21 . GLN B 1 125 ? 0.624   8.765   -7.656  1.00 20.52 ? 125 GLN B HE21 1  
ATOM 4284   H HE22 . GLN B 1 125 ? 0.140   7.906   -6.251  1.00 43.41 ? 125 GLN B HE22 1  
ATOM 4285   N N    . LEU B 1 126 ? -3.690  10.588  -6.565  1.00 52.04 ? 126 LEU B N    1  
ATOM 4286   C CA   . LEU B 1 126 ? -3.418  11.761  -5.733  1.00 65.23 ? 126 LEU B CA   1  
ATOM 4287   C C    . LEU B 1 126 ? -1.972  11.649  -5.217  1.00 4.52  ? 126 LEU B C    1  
ATOM 4288   O O    . LEU B 1 126 ? -1.696  10.923  -4.257  1.00 53.03 ? 126 LEU B O    1  
ATOM 4289   C CB   . LEU B 1 126 ? -4.442  11.849  -4.556  1.00 11.23 ? 126 LEU B CB   1  
ATOM 4290   C CG   . LEU B 1 126 ? -4.230  13.013  -3.523  1.00 34.33 ? 126 LEU B CG   1  
ATOM 4291   C CD1  . LEU B 1 126 ? -4.244  14.410  -4.194  1.00 11.05 ? 126 LEU B CD1  1  
ATOM 4292   C CD2  . LEU B 1 126 ? -5.268  12.931  -2.376  1.00 13.53 ? 126 LEU B CD2  1  
ATOM 4293   H H    . LEU B 1 126 ? -3.541  9.698   -6.164  1.00 14.11 ? 126 LEU B H    1  
ATOM 4294   H HA   . LEU B 1 126 ? -3.506  12.656  -6.348  1.00 23.20 ? 126 LEU B HA   1  
ATOM 4295   H HB2  . LEU B 1 126 ? -5.438  11.950  -4.984  1.00 62.42 ? 126 LEU B HB2  1  
ATOM 4296   H HB3  . LEU B 1 126 ? -4.408  10.908  -4.017  1.00 54.10 ? 126 LEU B HB3  1  
ATOM 4297   H HG   . LEU B 1 126 ? -3.251  12.893  -3.078  1.00 51.43 ? 126 LEU B HG   1  
ATOM 4298   H HD11 . LEU B 1 126 ? -4.088  15.176  -3.445  1.00 22.14 ? 126 LEU B HD11 1  
ATOM 4299   H HD12 . LEU B 1 126 ? -5.195  14.580  -4.684  1.00 12.52 ? 126 LEU B HD12 1  
ATOM 4300   H HD13 . LEU B 1 126 ? -3.451  14.468  -4.927  1.00 40.45 ? 126 LEU B HD13 1  
ATOM 4301   H HD21 . LEU B 1 126 ? -5.180  11.975  -1.876  1.00 43.23 ? 126 LEU B HD21 1  
ATOM 4302   H HD22 . LEU B 1 126 ? -6.272  13.033  -2.773  1.00 13.41 ? 126 LEU B HD22 1  
ATOM 4303   H HD23 . LEU B 1 126 ? -5.086  13.721  -1.660  1.00 44.53 ? 126 LEU B HD23 1  
ATOM 4304   N N    . ASN B 1 127 ? -1.043  12.313  -5.924  1.00 51.22 ? 127 ASN B N    1  
ATOM 4305   C CA   . ASN B 1 127 ? 0.359   12.455  -5.486  1.00 53.21 ? 127 ASN B CA   1  
ATOM 4306   C C    . ASN B 1 127 ? 0.591   13.912  -5.050  1.00 10.34 ? 127 ASN B C    1  
ATOM 4307   O O    . ASN B 1 127 ? 0.500   14.837  -5.866  1.00 35.12 ? 127 ASN B O    1  
ATOM 4308   C CB   . ASN B 1 127 ? 1.372   12.014  -6.597  1.00 75.03 ? 127 ASN B CB   1  
ATOM 4309   C CG   . ASN B 1 127 ? 1.126   12.624  -7.985  1.00 3.54  ? 127 ASN B CG   1  
ATOM 4310   O OD1  . ASN B 1 127 ? 1.637   13.694  -8.314  1.00 14.24 ? 127 ASN B OD1  1  
ATOM 4311   N ND2  . ASN B 1 127 ? 0.358   11.933  -8.807  1.00 63.55 ? 127 ASN B ND2  1  
ATOM 4312   H H    . ASN B 1 127 ? -1.316  12.741  -6.766  1.00 51.31 ? 127 ASN B H    1  
ATOM 4313   H HA   . ASN B 1 127 ? 0.505   11.807  -4.617  1.00 65.23 ? 127 ASN B HA   1  
ATOM 4314   H HB2  . ASN B 1 127 ? 2.374   12.290  -6.287  1.00 61.43 ? 127 ASN B HB2  1  
ATOM 4315   H HB3  . ASN B 1 127 ? 1.340   10.934  -6.685  1.00 52.53 ? 127 ASN B HB3  1  
ATOM 4316   H HD21 . ASN B 1 127 ? -0.002  11.087  -8.486  1.00 54.11 ? 127 ASN B HD21 1  
ATOM 4317   H HD22 . ASN B 1 127 ? 0.194   12.287  -9.704  1.00 41.31 ? 127 ASN B HD22 1  
ATOM 4318   N N    . LEU B 1 128 ? 0.827   14.105  -3.740  1.00 0.43  ? 128 LEU B N    1  
ATOM 4319   C CA   . LEU B 1 128 ? 1.124   15.430  -3.167  1.00 74.21 ? 128 LEU B CA   1  
ATOM 4320   C C    . LEU B 1 128 ? 2.574   15.840  -3.517  1.00 52.13 ? 128 LEU B C    1  
ATOM 4321   O O    . LEU B 1 128 ? 3.480   14.996  -3.511  1.00 73.23 ? 128 LEU B O    1  
ATOM 4322   C CB   . LEU B 1 128 ? 0.874   15.405  -1.625  1.00 22.33 ? 128 LEU B CB   1  
ATOM 4323   C CG   . LEU B 1 128 ? 1.170   16.728  -0.829  1.00 13.25 ? 128 LEU B CG   1  
ATOM 4324   C CD1  . LEU B 1 128 ? 0.514   17.961  -1.490  1.00 31.01 ? 128 LEU B CD1  1  
ATOM 4325   C CD2  . LEU B 1 128 ? 0.731   16.599  0.656   1.00 2.12  ? 128 LEU B CD2  1  
ATOM 4326   H H    . LEU B 1 128 ? 0.787   13.333  -3.137  1.00 3.14  ? 128 LEU B H    1  
ATOM 4327   H HA   . LEU B 1 128 ? 0.437   16.146  -3.618  1.00 0.10  ? 128 LEU B HA   1  
ATOM 4328   H HB2  . LEU B 1 128 ? -0.168  15.140  -1.461  1.00 60.15 ? 128 LEU B HB2  1  
ATOM 4329   H HB3  . LEU B 1 128 ? 1.486   14.614  -1.201  1.00 34.32 ? 128 LEU B HB3  1  
ATOM 4330   H HG   . LEU B 1 128 ? 2.239   16.901  -0.837  1.00 41.23 ? 128 LEU B HG   1  
ATOM 4331   H HD11 . LEU B 1 128 ? 0.743   18.849  -0.916  1.00 13.53 ? 128 LEU B HD11 1  
ATOM 4332   H HD12 . LEU B 1 128 ? -0.561  17.834  -1.536  1.00 20.13 ? 128 LEU B HD12 1  
ATOM 4333   H HD13 . LEU B 1 128 ? 0.901   18.083  -2.494  1.00 54.05 ? 128 LEU B HD13 1  
ATOM 4334   H HD21 . LEU B 1 128 ? 1.245   15.763  1.115   1.00 24.12 ? 128 LEU B HD21 1  
ATOM 4335   H HD22 . LEU B 1 128 ? -0.338  16.435  0.717   1.00 43.33 ? 128 LEU B HD22 1  
ATOM 4336   H HD23 . LEU B 1 128 ? 0.983   17.504  1.192   1.00 73.14 ? 128 LEU B HD23 1  
ATOM 4337   N N    . ALA B 1 129 ? 2.751   17.132  -3.848  1.00 13.52 ? 129 ALA B N    1  
ATOM 4338   C CA   . ALA B 1 129 ? 4.045   17.727  -4.222  1.00 52.30 ? 129 ALA B CA   1  
ATOM 4339   C C    . ALA B 1 129 ? 5.061   17.663  -3.055  1.00 71.12 ? 129 ALA B C    1  
ATOM 4340   O O    . ALA B 1 129 ? 4.656   17.731  -1.882  1.00 44.13 ? 129 ALA B O    1  
ATOM 4341   C CB   . ALA B 1 129 ? 3.812   19.188  -4.663  1.00 45.25 ? 129 ALA B CB   1  
ATOM 4342   H H    . ALA B 1 129 ? 1.967   17.720  -3.837  1.00 64.51 ? 129 ALA B H    1  
ATOM 4343   H HA   . ALA B 1 129 ? 4.434   17.173  -5.070  1.00 55.03 ? 129 ALA B HA   1  
ATOM 4344   H HB1  . ALA B 1 129 ? 3.389   19.755  -3.843  1.00 2.13  ? 129 ALA B HB1  1  
ATOM 4345   H HB2  . ALA B 1 129 ? 3.124   19.210  -5.498  1.00 60.21 ? 129 ALA B HB2  1  
ATOM 4346   H HB3  . ALA B 1 129 ? 4.753   19.637  -4.963  1.00 53.34 ? 129 ALA B HB3  1  
ATOM 4347   N N    . PRO B 1 130 ? 6.398   17.528  -3.354  1.00 41.44 ? 130 PRO B N    1  
ATOM 4348   C CA   . PRO B 1 130 ? 7.442   17.547  -2.314  1.00 55.10 ? 130 PRO B CA   1  
ATOM 4349   C C    . PRO B 1 130 ? 7.597   18.962  -1.745  1.00 31.03 ? 130 PRO B C    1  
ATOM 4350   O O    . PRO B 1 130 ? 8.022   19.868  -2.458  1.00 2.32  ? 130 PRO B O    1  
ATOM 4351   C CB   . PRO B 1 130 ? 8.743   17.089  -3.054  1.00 23.12 ? 130 PRO B CB   1  
ATOM 4352   C CG   . PRO B 1 130 ? 8.306   16.667  -4.425  1.00 11.42 ? 130 PRO B CG   1  
ATOM 4353   C CD   . PRO B 1 130 ? 6.997   17.374  -4.704  1.00 74.32 ? 130 PRO B CD   1  
ATOM 4354   H HA   . PRO B 1 130 ? 7.210   16.849  -1.510  1.00 12.25 ? 130 PRO B HA   1  
ATOM 4355   H HB2  . PRO B 1 130 ? 9.464   17.905  -3.112  1.00 42.34 ? 130 PRO B HB2  1  
ATOM 4356   H HB3  . PRO B 1 130 ? 9.191   16.250  -2.532  1.00 31.32 ? 130 PRO B HB3  1  
ATOM 4357   H HG2  . PRO B 1 130 ? 9.056   16.949  -5.161  1.00 74.23 ? 130 PRO B HG2  1  
ATOM 4358   H HG3  . PRO B 1 130 ? 8.154   15.589  -4.451  1.00 34.04 ? 130 PRO B HG3  1  
ATOM 4359   H HD2  . PRO B 1 130 ? 7.170   18.344  -5.163  1.00 75.13 ? 130 PRO B HD2  1  
ATOM 4360   H HD3  . PRO B 1 130 ? 6.367   16.768  -5.343  1.00 53.51 ? 130 PRO B HD3  1  
ATOM 4361   N N    . VAL B 1 131 ? 7.189   19.157  -0.494  1.00 0.12  ? 131 VAL B N    1  
ATOM 4362   C CA   . VAL B 1 131 ? 7.442   20.408  0.227   1.00 32.30 ? 131 VAL B CA   1  
ATOM 4363   C C    . VAL B 1 131 ? 8.654   20.181  1.134   1.00 63.11 ? 131 VAL B C    1  
ATOM 4364   O O    . VAL B 1 131 ? 8.649   19.260  1.957   1.00 53.34 ? 131 VAL B O    1  
ATOM 4365   C CB   . VAL B 1 131 ? 6.191   20.872  1.064   1.00 21.25 ? 131 VAL B CB   1  
ATOM 4366   C CG1  . VAL B 1 131 ? 6.479   22.198  1.819   1.00 31.23 ? 131 VAL B CG1  1  
ATOM 4367   C CG2  . VAL B 1 131 ? 4.942   20.998  0.150   1.00 61.22 ? 131 VAL B CG2  1  
ATOM 4368   H H    . VAL B 1 131 ? 6.708   18.438  -0.036  1.00 22.13 ? 131 VAL B H    1  
ATOM 4369   H HA   . VAL B 1 131 ? 7.679   21.193  -0.500  1.00 40.35 ? 131 VAL B HA   1  
ATOM 4370   H HB   . VAL B 1 131 ? 5.980   20.108  1.810   1.00 12.24 ? 131 VAL B HB   1  
ATOM 4371   H HG11 . VAL B 1 131 ? 5.610   22.488  2.396   1.00 22.40 ? 131 VAL B HG11 1  
ATOM 4372   H HG12 . VAL B 1 131 ? 6.715   22.986  1.112   1.00 44.10 ? 131 VAL B HG12 1  
ATOM 4373   H HG13 . VAL B 1 131 ? 7.318   22.059  2.487   1.00 3.42  ? 131 VAL B HG13 1  
ATOM 4374   H HG21 . VAL B 1 131 ? 4.087   21.310  0.734   1.00 21.21 ? 131 VAL B HG21 1  
ATOM 4375   H HG22 . VAL B 1 131 ? 4.729   20.039  -0.304  1.00 40.02 ? 131 VAL B HG22 1  
ATOM 4376   H HG23 . VAL B 1 131 ? 5.128   21.726  -0.635  1.00 62.05 ? 131 VAL B HG23 1  
ATOM 4377   N N    . ASN B 1 132 ? 9.702   20.994  0.935   1.00 55.11 ? 132 ASN B N    1  
ATOM 4378   C CA   . ASN B 1 132 ? 10.931  20.947  1.737   1.00 51.34 ? 132 ASN B CA   1  
ATOM 4379   C C    . ASN B 1 132 ? 10.634  21.564  3.116   1.00 14.54 ? 132 ASN B C    1  
ATOM 4380   O O    . ASN B 1 132 ? 10.774  22.772  3.304   1.00 22.02 ? 132 ASN B O    1  
ATOM 4381   C CB   . ASN B 1 132 ? 12.077  21.719  0.999   1.00 11.43 ? 132 ASN B CB   1  
ATOM 4382   C CG   . ASN B 1 132 ? 13.472  21.581  1.640   1.00 25.32 ? 132 ASN B CG   1  
ATOM 4383   O OD1  . ASN B 1 132 ? 13.626  21.162  2.785   1.00 72.03 ? 132 ASN B OD1  1  
ATOM 4384   N ND2  . ASN B 1 132 ? 14.502  22.006  0.918   1.00 13.13 ? 132 ASN B ND2  1  
ATOM 4385   H H    . ASN B 1 132 ? 9.636   21.671  0.226   1.00 42.11 ? 132 ASN B H    1  
ATOM 4386   H HA   . ASN B 1 132 ? 11.221  19.906  1.862   1.00 14.54 ? 132 ASN B HA   1  
ATOM 4387   H HB2  . ASN B 1 132 ? 12.142  21.348  -0.015  1.00 50.15 ? 132 ASN B HB2  1  
ATOM 4388   H HB3  . ASN B 1 132 ? 11.826  22.774  0.961   1.00 62.14 ? 132 ASN B HB3  1  
ATOM 4389   H HD21 . ASN B 1 132 ? 14.328  22.380  0.030   1.00 5.13  ? 132 ASN B HD21 1  
ATOM 4390   H HD22 . ASN B 1 132 ? 15.402  21.942  1.311   1.00 35.52 ? 132 ASN B HD22 1  
ATOM 4391   N N    . PHE B 1 133 ? 10.178  20.714  4.057   1.00 54.42 ? 133 PHE B N    1  
ATOM 4392   C CA   . PHE B 1 133 ? 9.788   21.139  5.424   1.00 11.01 ? 133 PHE B CA   1  
ATOM 4393   C C    . PHE B 1 133 ? 10.984  21.730  6.182   1.00 13.42 ? 133 PHE B C    1  
ATOM 4394   O O    . PHE B 1 133 ? 10.823  22.631  7.009   1.00 42.22 ? 133 PHE B O    1  
ATOM 4395   C CB   . PHE B 1 133 ? 9.191   19.942  6.210   1.00 14.41 ? 133 PHE B CB   1  
ATOM 4396   C CG   . PHE B 1 133 ? 7.940   19.339  5.561   1.00 21.15 ? 133 PHE B CG   1  
ATOM 4397   C CD1  . PHE B 1 133 ? 6.709   19.995  5.633   1.00 34.22 ? 133 PHE B CD1  1  
ATOM 4398   C CD2  . PHE B 1 133 ? 7.998   18.126  4.872   1.00 41.41 ? 133 PHE B CD2  1  
ATOM 4399   C CE1  . PHE B 1 133 ? 5.581   19.455  5.040   1.00 72.51 ? 133 PHE B CE1  1  
ATOM 4400   C CE2  . PHE B 1 133 ? 6.870   17.589  4.283   1.00 10.14 ? 133 PHE B CE2  1  
ATOM 4401   C CZ   . PHE B 1 133 ? 5.662   18.252  4.365   1.00 52.43 ? 133 PHE B CZ   1  
ATOM 4402   H H    . PHE B 1 133 ? 10.094  19.764  3.820   1.00 22.24 ? 133 PHE B H    1  
ATOM 4403   H HA   . PHE B 1 133 ? 9.027   21.907  5.325   1.00 55.51 ? 133 PHE B HA   1  
ATOM 4404   H HB2  . PHE B 1 133 ? 9.942   19.162  6.295   1.00 3.43  ? 133 PHE B HB2  1  
ATOM 4405   H HB3  . PHE B 1 133 ? 8.921   20.270  7.209   1.00 11.40 ? 133 PHE B HB3  1  
ATOM 4406   H HD1  . PHE B 1 133 ? 6.638   20.938  6.162   1.00 71.23 ? 133 PHE B HD1  1  
ATOM 4407   H HD2  . PHE B 1 133 ? 8.943   17.600  4.801   1.00 61.13 ? 133 PHE B HD2  1  
ATOM 4408   H HE1  . PHE B 1 133 ? 4.634   19.974  5.107   1.00 71.31 ? 133 PHE B HE1  1  
ATOM 4409   H HE2  . PHE B 1 133 ? 6.935   16.647  3.755   1.00 5.24  ? 133 PHE B HE2  1  
ATOM 4410   H HZ   . PHE B 1 133 ? 4.780   17.829  3.901   1.00 15.22 ? 133 PHE B HZ   1  
ATOM 4411   N N    . ASP B 1 134 ? 12.174  21.194  5.870   1.00 14.11 ? 134 ASP B N    1  
ATOM 4412   C CA   . ASP B 1 134 ? 13.455  21.621  6.445   1.00 62.02 ? 134 ASP B CA   1  
ATOM 4413   C C    . ASP B 1 134 ? 13.733  23.110  6.142   1.00 14.53 ? 134 ASP B C    1  
ATOM 4414   O O    . ASP B 1 134 ? 13.862  23.923  7.067   1.00 73.33 ? 134 ASP B O    1  
ATOM 4415   C CB   . ASP B 1 134 ? 14.593  20.721  5.898   1.00 42.21 ? 134 ASP B CB   1  
ATOM 4416   C CG   . ASP B 1 134 ? 15.960  21.051  6.509   1.00 4.21  ? 134 ASP B CG   1  
ATOM 4417   O OD1  . ASP B 1 134 ? 16.252  20.557  7.610   1.00 52.11 ? 134 ASP B OD1  1  
ATOM 4418   O OD2  . ASP B 1 134 ? 16.728  21.830  5.912   1.00 32.23 ? 134 ASP B OD2  1  
ATOM 4419   H H    . ASP B 1 134 ? 12.185  20.473  5.216   1.00 71.41 ? 134 ASP B H    1  
ATOM 4420   H HA   . ASP B 1 134 ? 13.394  21.487  7.519   1.00 44.33 ? 134 ASP B HA   1  
ATOM 4421   H HB2  . ASP B 1 134 ? 14.357  19.680  6.114   1.00 4.54  ? 134 ASP B HB2  1  
ATOM 4422   H HB3  . ASP B 1 134 ? 14.651  20.844  4.818   1.00 51.32 ? 134 ASP B HB3  1  
ATOM 4423   N N    . ALA B 1 135 ? 13.783  23.444  4.836   1.00 41.03 ? 135 ALA B N    1  
ATOM 4424   C CA   . ALA B 1 135 ? 14.095  24.804  4.349   1.00 1.12  ? 135 ALA B CA   1  
ATOM 4425   C C    . ALA B 1 135 ? 12.952  25.784  4.665   1.00 11.12 ? 135 ALA B C    1  
ATOM 4426   O O    . ALA B 1 135 ? 13.201  26.933  5.021   1.00 40.24 ? 135 ALA B O    1  
ATOM 4427   C CB   . ALA B 1 135 ? 14.387  24.788  2.837   1.00 41.55 ? 135 ALA B CB   1  
ATOM 4428   H H    . ALA B 1 135 ? 13.596  22.748  4.175   1.00 40.11 ? 135 ALA B H    1  
ATOM 4429   H HA   . ALA B 1 135 ? 14.999  25.140  4.858   1.00 33.42 ? 135 ALA B HA   1  
ATOM 4430   H HB1  . ALA B 1 135 ? 14.687  25.774  2.504   1.00 23.45 ? 135 ALA B HB1  1  
ATOM 4431   H HB2  . ALA B 1 135 ? 13.501  24.486  2.293   1.00 2.55  ? 135 ALA B HB2  1  
ATOM 4432   H HB3  . ALA B 1 135 ? 15.183  24.085  2.626   1.00 54.54 ? 135 ALA B HB3  1  
ATOM 4433   N N    . LEU B 1 136 ? 11.703  25.298  4.531   1.00 15.24 ? 136 LEU B N    1  
ATOM 4434   C CA   . LEU B 1 136 ? 10.474  26.081  4.814   1.00 73.32 ? 136 LEU B CA   1  
ATOM 4435   C C    . LEU B 1 136 ? 10.458  26.565  6.280   1.00 2.14  ? 136 LEU B C    1  
ATOM 4436   O O    . LEU B 1 136 ? 10.055  27.700  6.575   1.00 61.50 ? 136 LEU B O    1  
ATOM 4437   C CB   . LEU B 1 136 ? 9.210   25.220  4.516   1.00 20.22 ? 136 LEU B CB   1  
ATOM 4438   C CG   . LEU B 1 136 ? 7.819   25.922  4.689   1.00 51.42 ? 136 LEU B CG   1  
ATOM 4439   C CD1  . LEU B 1 136 ? 7.650   27.100  3.696   1.00 5.52  ? 136 LEU B CD1  1  
ATOM 4440   C CD2  . LEU B 1 136 ? 6.655   24.899  4.573   1.00 60.51 ? 136 LEU B CD2  1  
ATOM 4441   H H    . LEU B 1 136 ? 11.602  24.375  4.218   1.00 73.45 ? 136 LEU B H    1  
ATOM 4442   H HA   . LEU B 1 136 ? 10.475  26.945  4.159   1.00 1.05  ? 136 LEU B HA   1  
ATOM 4443   H HB2  . LEU B 1 136 ? 9.282   24.859  3.492   1.00 60.32 ? 136 LEU B HB2  1  
ATOM 4444   H HB3  . LEU B 1 136 ? 9.235   24.353  5.172   1.00 71.14 ? 136 LEU B HB3  1  
ATOM 4445   H HG   . LEU B 1 136 ? 7.775   26.348  5.685   1.00 25.44 ? 136 LEU B HG   1  
ATOM 4446   H HD11 . LEU B 1 136 ? 6.689   27.573  3.852   1.00 2.42  ? 136 LEU B HD11 1  
ATOM 4447   H HD12 . LEU B 1 136 ? 7.709   26.741  2.676   1.00 70.15 ? 136 LEU B HD12 1  
ATOM 4448   H HD13 . LEU B 1 136 ? 8.432   27.830  3.862   1.00 52.03 ? 136 LEU B HD13 1  
ATOM 4449   H HD21 . LEU B 1 136 ? 5.710   25.400  4.741   1.00 62.24 ? 136 LEU B HD21 1  
ATOM 4450   H HD22 . LEU B 1 136 ? 6.778   24.123  5.315   1.00 52.50 ? 136 LEU B HD22 1  
ATOM 4451   H HD23 . LEU B 1 136 ? 6.652   24.452  3.586   1.00 12.20 ? 136 LEU B HD23 1  
ATOM 4452   N N    . PHE B 1 137 ? 10.915  25.687  7.188   1.00 11.32 ? 137 PHE B N    1  
ATOM 4453   C CA   . PHE B 1 137 ? 10.972  25.985  8.629   1.00 11.10 ? 137 PHE B CA   1  
ATOM 4454   C C    . PHE B 1 137 ? 12.182  26.892  8.956   1.00 25.42 ? 137 PHE B C    1  
ATOM 4455   O O    . PHE B 1 137 ? 12.120  27.694  9.896   1.00 13.31 ? 137 PHE B O    1  
ATOM 4456   C CB   . PHE B 1 137 ? 11.008  24.676  9.450   1.00 44.03 ? 137 PHE B CB   1  
ATOM 4457   C CG   . PHE B 1 137 ? 10.712  24.883  10.934  1.00 64.42 ? 137 PHE B CG   1  
ATOM 4458   C CD1  . PHE B 1 137 ? 11.736  24.970  11.870  1.00 51.34 ? 137 PHE B CD1  1  
ATOM 4459   C CD2  . PHE B 1 137 ? 9.394   25.028  11.381  1.00 61.41 ? 137 PHE B CD2  1  
ATOM 4460   C CE1  . PHE B 1 137 ? 11.457  25.195  13.199  1.00 62.21 ? 137 PHE B CE1  1  
ATOM 4461   C CE2  . PHE B 1 137 ? 9.117   25.246  12.717  1.00 51.41 ? 137 PHE B CE2  1  
ATOM 4462   C CZ   . PHE B 1 137 ? 10.150  25.330  13.627  1.00 53.04 ? 137 PHE B CZ   1  
ATOM 4463   H H    . PHE B 1 137 ? 11.210  24.802  6.878   1.00 11.51 ? 137 PHE B H    1  
ATOM 4464   H HA   . PHE B 1 137 ? 10.064  26.528  8.886   1.00 33.42 ? 137 PHE B HA   1  
ATOM 4465   H HB2  . PHE B 1 137 ? 10.266  23.990  9.052   1.00 11.33 ? 137 PHE B HB2  1  
ATOM 4466   H HB3  . PHE B 1 137 ? 11.987  24.214  9.352   1.00 32.22 ? 137 PHE B HB3  1  
ATOM 4467   H HD1  . PHE B 1 137 ? 12.766  24.862  11.547  1.00 61.40 ? 137 PHE B HD1  1  
ATOM 4468   H HD2  . PHE B 1 137 ? 8.580   24.962  10.669  1.00 63.13 ? 137 PHE B HD2  1  
ATOM 4469   H HE1  . PHE B 1 137 ? 12.268  25.261  13.914  1.00 73.34 ? 137 PHE B HE1  1  
ATOM 4470   H HE2  . PHE B 1 137 ? 8.094   25.351  13.049  1.00 61.34 ? 137 PHE B HE2  1  
ATOM 4471   H HZ   . PHE B 1 137 ? 9.940   25.507  14.674  1.00 41.31 ? 137 PHE B HZ   1  
ATOM 4472   N N    . MET B 1 138 ? 13.274  26.768  8.168   1.00 61.21 ? 138 MET B N    1  
ATOM 4473   C CA   . MET B 1 138 ? 14.430  27.696  8.255   1.00 43.35 ? 138 MET B CA   1  
ATOM 4474   C C    . MET B 1 138 ? 13.983  29.124  7.884   1.00 10.21 ? 138 MET B C    1  
ATOM 4475   O O    . MET B 1 138 ? 14.442  30.092  8.478   1.00 32.22 ? 138 MET B O    1  
ATOM 4476   C CB   . MET B 1 138 ? 15.592  27.261  7.315   1.00 52.41 ? 138 MET B CB   1  
ATOM 4477   C CG   . MET B 1 138 ? 16.320  25.968  7.708   1.00 74.02 ? 138 MET B CG   1  
ATOM 4478   S SD   . MET B 1 138 ? 17.697  25.603  6.596   1.00 61.35 ? 138 MET B SD   1  
ATOM 4479   C CE   . MET B 1 138 ? 18.487  24.207  7.393   1.00 44.51 ? 138 MET B CE   1  
ATOM 4480   H H    . MET B 1 138 ? 13.297  26.041  7.509   1.00 1.24  ? 138 MET B H    1  
ATOM 4481   H HA   . MET B 1 138 ? 14.785  27.694  9.286   1.00 51.34 ? 138 MET B HA   1  
ATOM 4482   H HB2  . MET B 1 138 ? 15.193  27.125  6.316   1.00 73.33 ? 138 MET B HB2  1  
ATOM 4483   H HB3  . MET B 1 138 ? 16.331  28.057  7.278   1.00 54.44 ? 138 MET B HB3  1  
ATOM 4484   H HG2  . MET B 1 138 ? 16.706  26.070  8.714   1.00 23.04 ? 138 MET B HG2  1  
ATOM 4485   H HG3  . MET B 1 138 ? 15.622  25.143  7.672   1.00 4.03  ? 138 MET B HG3  1  
ATOM 4486   H HE1  . MET B 1 138 ? 19.341  23.893  6.809   1.00 12.11 ? 138 MET B HE1  1  
ATOM 4487   H HE2  . MET B 1 138 ? 17.786  23.389  7.469   1.00 13.32 ? 138 MET B HE2  1  
ATOM 4488   H HE3  . MET B 1 138 ? 18.812  24.495  8.382   1.00 62.15 ? 138 MET B HE3  1  
ATOM 4489   N N    . ASN B 1 139 ? 13.050  29.209  6.913   1.00 74.11 ? 139 ASN B N    1  
ATOM 4490   C CA   . ASN B 1 139 ? 12.484  30.484  6.412   1.00 4.24  ? 139 ASN B CA   1  
ATOM 4491   C C    . ASN B 1 139 ? 11.496  31.072  7.434   1.00 64.41 ? 139 ASN B C    1  
ATOM 4492   O O    . ASN B 1 139 ? 11.367  32.298  7.547   1.00 31.31 ? 139 ASN B O    1  
ATOM 4493   C CB   . ASN B 1 139 ? 11.787  30.251  5.035   1.00 64.00 ? 139 ASN B CB   1  
ATOM 4494   C CG   . ASN B 1 139 ? 12.751  30.019  3.845   1.00 2.35  ? 139 ASN B CG   1  
ATOM 4495   O OD1  . ASN B 1 139 ? 12.416  30.327  2.701   1.00 70.13 ? 139 ASN B OD1  1  
ATOM 4496   N ND2  . ASN B 1 139 ? 13.939  29.468  4.087   1.00 64.11 ? 139 ASN B ND2  1  
ATOM 4497   H H    . ASN B 1 139 ? 12.723  28.375  6.520   1.00 55.41 ? 139 ASN B H    1  
ATOM 4498   H HA   . ASN B 1 139 ? 13.302  31.190  6.277   1.00 4.51  ? 139 ASN B HA   1  
ATOM 4499   H HB2  . ASN B 1 139 ? 11.145  29.380  5.110   1.00 34.20 ? 139 ASN B HB2  1  
ATOM 4500   H HB3  . ASN B 1 139 ? 11.165  31.111  4.802   1.00 71.12 ? 139 ASN B HB3  1  
ATOM 4501   H HD21 . ASN B 1 139 ? 14.165  29.224  5.006   1.00 22.42 ? 139 ASN B HD21 1  
ATOM 4502   H HD22 . ASN B 1 139 ? 14.539  29.323  3.327   1.00 32.32 ? 139 ASN B HD22 1  
ATOM 4503   N N    . TYR B 1 140 ? 10.812  30.175  8.172   1.00 71.02 ? 140 TYR B N    1  
ATOM 4504   C CA   . TYR B 1 140 ? 9.927   30.541  9.301   1.00 34.13 ? 140 TYR B CA   1  
ATOM 4505   C C    . TYR B 1 140 ? 10.744  31.238  10.414  1.00 1.30  ? 140 TYR B C    1  
ATOM 4506   O O    . TYR B 1 140 ? 10.262  32.169  11.070  1.00 31.42 ? 140 TYR B O    1  
ATOM 4507   C CB   . TYR B 1 140 ? 9.226   29.264  9.854   1.00 64.54 ? 140 TYR B CB   1  
ATOM 4508   C CG   . TYR B 1 140 ? 8.162   29.509  10.940  1.00 22.11 ? 140 TYR B CG   1  
ATOM 4509   C CD1  . TYR B 1 140 ? 6.887   29.980  10.612  1.00 31.32 ? 140 TYR B CD1  1  
ATOM 4510   C CD2  . TYR B 1 140 ? 8.421   29.242  12.290  1.00 42.01 ? 140 TYR B CD2  1  
ATOM 4511   C CE1  . TYR B 1 140 ? 5.922   30.179  11.583  1.00 24.25 ? 140 TYR B CE1  1  
ATOM 4512   C CE2  . TYR B 1 140 ? 7.459   29.444  13.261  1.00 42.55 ? 140 TYR B CE2  1  
ATOM 4513   C CZ   . TYR B 1 140 ? 6.212   29.909  12.904  1.00 71.13 ? 140 TYR B CZ   1  
ATOM 4514   O OH   . TYR B 1 140 ? 5.251   30.106  13.870  1.00 2.32  ? 140 TYR B OH   1  
ATOM 4515   H H    . TYR B 1 140 ? 10.903  29.226  7.941   1.00 73.24 ? 140 TYR B H    1  
ATOM 4516   H HA   . TYR B 1 140 ? 9.173   31.229  8.926   1.00 63.21 ? 140 TYR B HA   1  
ATOM 4517   H HB2  . TYR B 1 140 ? 8.740   28.746  9.034   1.00 14.14 ? 140 TYR B HB2  1  
ATOM 4518   H HB3  . TYR B 1 140 ? 9.982   28.603  10.274  1.00 4.31  ? 140 TYR B HB3  1  
ATOM 4519   H HD1  . TYR B 1 140 ? 6.655   30.198  9.576   1.00 53.54 ? 140 TYR B HD1  1  
ATOM 4520   H HD2  . TYR B 1 140 ? 9.401   28.879  12.577  1.00 5.44  ? 140 TYR B HD2  1  
ATOM 4521   H HE1  . TYR B 1 140 ? 4.941   30.542  11.301  1.00 42.13 ? 140 TYR B HE1  1  
ATOM 4522   H HE2  . TYR B 1 140 ? 7.687   29.231  14.297  1.00 44.22 ? 140 TYR B HE2  1  
ATOM 4523   H HH   . TYR B 1 140 ? 4.417   29.719  13.575  1.00 63.53 ? 140 TYR B HH   1  
ATOM 4524   N N    . LEU B 1 141 ? 11.995  30.761  10.602  1.00 43.43 ? 141 LEU B N    1  
ATOM 4525   C CA   . LEU B 1 141 ? 12.951  31.303  11.589  1.00 61.31 ? 141 LEU B CA   1  
ATOM 4526   C C    . LEU B 1 141 ? 13.967  32.248  10.911  1.00 22.14 ? 141 LEU B C    1  
ATOM 4527   O O    . LEU B 1 141 ? 15.046  32.482  11.467  1.00 40.54 ? 141 LEU B O    1  
ATOM 4528   C CB   . LEU B 1 141 ? 13.691  30.123  12.292  1.00 12.25 ? 141 LEU B CB   1  
ATOM 4529   C CG   . LEU B 1 141 ? 12.787  29.023  12.937  1.00 52.21 ? 141 LEU B CG   1  
ATOM 4530   C CD1  . LEU B 1 141 ? 13.644  27.937  13.624  1.00 40.24 ? 141 LEU B CD1  1  
ATOM 4531   C CD2  . LEU B 1 141 ? 11.742  29.628  13.908  1.00 21.43 ? 141 LEU B CD2  1  
ATOM 4532   H H    . LEU B 1 141 ? 12.286  30.003  10.051  1.00 24.33 ? 141 LEU B H    1  
ATOM 4533   H HA   . LEU B 1 141 ? 12.403  31.872  12.337  1.00 63.12 ? 141 LEU B HA   1  
ATOM 4534   H HB2  . LEU B 1 141 ? 14.332  29.645  11.556  1.00 53.43 ? 141 LEU B HB2  1  
ATOM 4535   H HB3  . LEU B 1 141 ? 14.327  30.536  13.068  1.00 35.32 ? 141 LEU B HB3  1  
ATOM 4536   H HG   . LEU B 1 141 ? 12.235  28.528  12.143  1.00 21.23 ? 141 LEU B HG   1  
ATOM 4537   H HD11 . LEU B 1 141 ? 13.000  27.195  14.077  1.00 71.41 ? 141 LEU B HD11 1  
ATOM 4538   H HD12 . LEU B 1 141 ? 14.268  28.382  14.387  1.00 52.54 ? 141 LEU B HD12 1  
ATOM 4539   H HD13 . LEU B 1 141 ? 14.274  27.453  12.887  1.00 75.51 ? 141 LEU B HD13 1  
ATOM 4540   H HD21 . LEU B 1 141 ? 11.054  28.854  14.223  1.00 3.45  ? 141 LEU B HD21 1  
ATOM 4541   H HD22 . LEU B 1 141 ? 11.183  30.405  13.405  1.00 63.11 ? 141 LEU B HD22 1  
ATOM 4542   H HD23 . LEU B 1 141 ? 12.238  30.047  14.774  1.00 23.32 ? 141 LEU B HD23 1  
ATOM 4543   N N    . GLN B 1 142 ? 13.590  32.798  9.720   1.00 3.11  ? 142 GLN B N    1  
ATOM 4544   C CA   . GLN B 1 142 ? 14.440  33.694  8.890   1.00 52.22 ? 142 GLN B CA   1  
ATOM 4545   C C    . GLN B 1 142 ? 15.634  32.893  8.320   1.00 32.10 ? 142 GLN B C    1  
ATOM 4546   O O    . GLN B 1 142 ? 15.590  32.451  7.170   1.00 71.11 ? 142 GLN B O    1  
ATOM 4547   C CB   . GLN B 1 142 ? 14.881  34.968  9.684   1.00 31.24 ? 142 GLN B CB   1  
ATOM 4548   C CG   . GLN B 1 142 ? 13.706  35.770  10.284  1.00 14.21 ? 142 GLN B CG   1  
ATOM 4549   C CD   . GLN B 1 142 ? 14.151  36.875  11.240  1.00 31.32 ? 142 GLN B CD   1  
ATOM 4550   O OE1  . GLN B 1 142 ? 14.356  38.023  10.841  1.00 2.45  ? 142 GLN B OE1  1  
ATOM 4551   N NE2  . GLN B 1 142 ? 14.322  36.526  12.505  1.00 31.14 ? 142 GLN B NE2  1  
ATOM 4552   H H    . GLN B 1 142 ? 12.701  32.576  9.378   1.00 61.41 ? 142 GLN B H    1  
ATOM 4553   H HA   . GLN B 1 142 ? 13.829  34.009  8.050   1.00 71.52 ? 142 GLN B HA   1  
ATOM 4554   H HB2  . GLN B 1 142 ? 15.530  34.657  10.496  1.00 73.03 ? 142 GLN B HB2  1  
ATOM 4555   H HB3  . GLN B 1 142 ? 15.444  35.622  9.026   1.00 31.41 ? 142 GLN B HB3  1  
ATOM 4556   H HG2  . GLN B 1 142 ? 13.132  36.221  9.480   1.00 55.41 ? 142 GLN B HG2  1  
ATOM 4557   H HG3  . GLN B 1 142 ? 13.063  35.085  10.827  1.00 40.01 ? 142 GLN B HG3  1  
ATOM 4558   H HE21 . GLN B 1 142 ? 14.153  35.589  12.753  1.00 50.34 ? 142 GLN B HE21 1  
ATOM 4559   H HE22 . GLN B 1 142 ? 14.617  37.208  13.140  1.00 65.41 ? 142 GLN B HE22 1  
ATOM 4560   N N    . GLN B 1 143 ? 16.664  32.670  9.155   1.00 44.31 ? 143 GLN B N    1  
ATOM 4561   C CA   . GLN B 1 143 ? 17.796  31.758  8.871   1.00 20.00 ? 143 GLN B CA   1  
ATOM 4562   C C    . GLN B 1 143 ? 18.369  31.245  10.198  1.00 34.20 ? 143 GLN B C    1  
ATOM 4563   O O    . GLN B 1 143 ? 18.322  31.943  11.219  1.00 31.42 ? 143 GLN B O    1  
ATOM 4564   C CB   . GLN B 1 143 ? 18.929  32.424  8.007   1.00 63.10 ? 143 GLN B CB   1  
ATOM 4565   C CG   . GLN B 1 143 ? 18.702  32.417  6.472   1.00 31.23 ? 143 GLN B CG   1  
ATOM 4566   C CD   . GLN B 1 143 ? 18.687  31.011  5.825   1.00 55.10 ? 143 GLN B CD   1  
ATOM 4567   O OE1  . GLN B 1 143 ? 18.309  30.005  6.436   1.00 1.53  ? 143 GLN B OE1  1  
ATOM 4568   N NE2  . GLN B 1 143 ? 19.116  30.926  4.579   1.00 52.43 ? 143 GLN B NE2  1  
ATOM 4569   H H    . GLN B 1 143 ? 16.654  33.117  10.027  1.00 32.35 ? 143 GLN B H    1  
ATOM 4570   H HA   . GLN B 1 143 ? 17.395  30.902  8.327   1.00 1.01  ? 143 GLN B HA   1  
ATOM 4571   H HB2  . GLN B 1 143 ? 19.040  33.455  8.323   1.00 34.22 ? 143 GLN B HB2  1  
ATOM 4572   H HB3  . GLN B 1 143 ? 19.873  31.916  8.197   1.00 73.32 ? 143 GLN B HB3  1  
ATOM 4573   H HG2  . GLN B 1 143 ? 17.748  32.890  6.259   1.00 11.21 ? 143 GLN B HG2  1  
ATOM 4574   H HG3  . GLN B 1 143 ? 19.488  33.003  6.008   1.00 35.01 ? 143 GLN B HG3  1  
ATOM 4575   H HE21 . GLN B 1 143 ? 19.414  31.744  4.135   1.00 4.24  ? 143 GLN B HE21 1  
ATOM 4576   H HE22 . GLN B 1 143 ? 19.097  30.048  4.142   1.00 62.11 ? 143 GLN B HE22 1  
ATOM 4577   N N    . GLN B 1 144 ? 18.925  30.024  10.162  1.00 64.32 ? 144 GLN B N    1  
ATOM 4578   C CA   . GLN B 1 144 ? 19.515  29.363  11.340  1.00 50.22 ? 144 GLN B CA   1  
ATOM 4579   C C    . GLN B 1 144 ? 20.669  28.429  10.922  1.00 53.34 ? 144 GLN B C    1  
ATOM 4580   O O    . GLN B 1 144 ? 20.977  28.305  9.732   1.00 42.23 ? 144 GLN B O    1  
ATOM 4581   C CB   . GLN B 1 144 ? 18.406  28.618  12.151  1.00 23.24 ? 144 GLN B CB   1  
ATOM 4582   C CG   . GLN B 1 144 ? 17.524  27.590  11.384  1.00 5.14  ? 144 GLN B CG   1  
ATOM 4583   C CD   . GLN B 1 144 ? 18.205  26.242  11.123  1.00 11.13 ? 144 GLN B CD   1  
ATOM 4584   O OE1  . GLN B 1 144 ? 18.796  26.023  10.072  1.00 0.22  ? 144 GLN B OE1  1  
ATOM 4585   N NE2  . GLN B 1 144 ? 18.188  25.358  12.112  1.00 0.55  ? 144 GLN B NE2  1  
ATOM 4586   H H    . GLN B 1 144 ? 18.943  29.546  9.307   1.00 23.44 ? 144 GLN B H    1  
ATOM 4587   H HA   . GLN B 1 144 ? 19.941  30.140  11.975  1.00 15.41 ? 144 GLN B HA   1  
ATOM 4588   H HB2  . GLN B 1 144 ? 18.879  28.092  12.971  1.00 10.23 ? 144 GLN B HB2  1  
ATOM 4589   H HB3  . GLN B 1 144 ? 17.746  29.369  12.580  1.00 12.20 ? 144 GLN B HB3  1  
ATOM 4590   H HG2  . GLN B 1 144 ? 16.624  27.407  11.960  1.00 44.52 ? 144 GLN B HG2  1  
ATOM 4591   H HG3  . GLN B 1 144 ? 17.246  28.025  10.432  1.00 23.24 ? 144 GLN B HG3  1  
ATOM 4592   H HE21 . GLN B 1 144 ? 17.743  25.604  12.949  1.00 70.22 ? 144 GLN B HE21 1  
ATOM 4593   H HE22 . GLN B 1 144 ? 18.660  24.509  11.977  1.00 21.04 ? 144 GLN B HE22 1  
ATOM 4594   N N    . ALA B 1 145 ? 21.302  27.783  11.920  1.00 34.44 ? 145 ALA B N    1  
ATOM 4595   C CA   . ALA B 1 145 ? 22.451  26.875  11.714  1.00 52.23 ? 145 ALA B CA   1  
ATOM 4596   C C    . ALA B 1 145 ? 21.985  25.421  11.493  1.00 63.33 ? 145 ALA B C    1  
ATOM 4597   O O    . ALA B 1 145 ? 21.060  24.944  12.162  1.00 30.13 ? 145 ALA B O    1  
ATOM 4598   C CB   . ALA B 1 145 ? 23.398  26.959  12.925  1.00 40.21 ? 145 ALA B CB   1  
ATOM 4599   H H    . ALA B 1 145 ? 20.982  27.919  12.835  1.00 12.12 ? 145 ALA B H    1  
ATOM 4600   H HA   . ALA B 1 145 ? 23.002  27.211  10.833  1.00 2.34  ? 145 ALA B HA   1  
ATOM 4601   H HB1  . ALA B 1 145 ? 24.265  26.331  12.760  1.00 62.23 ? 145 ALA B HB1  1  
ATOM 4602   H HB2  . ALA B 1 145 ? 22.886  26.631  13.821  1.00 41.54 ? 145 ALA B HB2  1  
ATOM 4603   H HB3  . ALA B 1 145 ? 23.724  27.984  13.060  1.00 25.42 ? 145 ALA B HB3  1  
ATOM 4604   N N    . GLY B 1 146 ? 22.641  24.732  10.547  1.00 62.42 ? 146 GLY B N    1  
ATOM 4605   C CA   . GLY B 1 146 ? 22.396  23.311  10.262  1.00 0.03  ? 146 GLY B CA   1  
ATOM 4606   C C    . GLY B 1 146 ? 23.691  22.601  9.907   1.00 54.40 ? 146 GLY B C    1  
ATOM 4607   O O    . GLY B 1 146 ? 23.747  21.796  8.972   1.00 34.14 ? 146 GLY B O    1  
ATOM 4608   H H    . GLY B 1 146 ? 23.318  25.202  10.023  1.00 22.44 ? 146 GLY B H    1  
ATOM 4609   H HA2  . GLY B 1 146 ? 21.965  22.825  11.133  1.00 54.24 ? 146 GLY B HA2  1  
ATOM 4610   H HA3  . GLY B 1 146 ? 21.705  23.231  9.433   1.00 21.13 ? 146 GLY B HA3  1  
ATOM 4611   N N    . GLU B 1 147 ? 24.737  22.908  10.690  1.00 4.23  ? 147 GLU B N    1  
ATOM 4612   C CA   . GLU B 1 147 ? 26.108  22.408  10.476  1.00 24.11 ? 147 GLU B CA   1  
ATOM 4613   C C    . GLU B 1 147 ? 26.818  22.338  11.837  1.00 53.32 ? 147 GLU B C    1  
ATOM 4614   O O    . GLU B 1 147 ? 26.704  23.272  12.644  1.00 74.23 ? 147 GLU B O    1  
ATOM 4615   C CB   . GLU B 1 147 ? 26.853  23.340  9.456   1.00 3.51  ? 147 GLU B CB   1  
ATOM 4616   C CG   . GLU B 1 147 ? 28.382  23.102  9.247   1.00 0.54  ? 147 GLU B CG   1  
ATOM 4617   C CD   . GLU B 1 147 ? 29.281  23.837  10.269  1.00 44.11 ? 147 GLU B CD   1  
ATOM 4618   O OE1  . GLU B 1 147 ? 30.105  23.182  10.951  1.00 64.21 ? 147 GLU B OE1  1  
ATOM 4619   O OE2  . GLU B 1 147 ? 29.144  25.073  10.406  1.00 73.54 ? 147 GLU B OE2  1  
ATOM 4620   H H    . GLU B 1 147 ? 24.574  23.486  11.470  1.00 25.02 ? 147 GLU B H    1  
ATOM 4621   H HA   . GLU B 1 147 ? 26.041  21.404  10.060  1.00 60.23 ? 147 GLU B HA   1  
ATOM 4622   H HB2  . GLU B 1 147 ? 26.368  23.225  8.494   1.00 12.05 ? 147 GLU B HB2  1  
ATOM 4623   H HB3  . GLU B 1 147 ? 26.712  24.370  9.770   1.00 25.31 ? 147 GLU B HB3  1  
ATOM 4624   H HG2  . GLU B 1 147 ? 28.575  22.036  9.309   1.00 3.23  ? 147 GLU B HG2  1  
ATOM 4625   H HG3  . GLU B 1 147 ? 28.654  23.442  8.255   1.00 11.34 ? 147 GLU B HG3  1  
ATOM 4626   N N    . GLY B 1 148 ? 27.567  21.242  12.065  1.00 35.33 ? 148 GLY B N    1  
ATOM 4627   C CA   . GLY B 1 148 ? 28.263  21.017  13.331  1.00 20.21 ? 148 GLY B CA   1  
ATOM 4628   C C    . GLY B 1 148 ? 29.338  19.951  13.222  1.00 14.54 ? 148 GLY B C    1  
ATOM 4629   O O    . GLY B 1 148 ? 29.424  19.241  12.208  1.00 32.10 ? 148 GLY B O    1  
ATOM 4630   H H    . GLY B 1 148 ? 27.658  20.575  11.352  1.00 71.33 ? 148 GLY B H    1  
ATOM 4631   H HA2  . GLY B 1 148 ? 28.726  21.942  13.655  1.00 43.01 ? 148 GLY B HA2  1  
ATOM 4632   H HA3  . GLY B 1 148 ? 27.541  20.707  14.078  1.00 65.01 ? 148 GLY B HA3  1  
ATOM 4633   N N    . THR B 1 149 ? 30.168  19.849  14.270  1.00 71.15 ? 149 THR B N    1  
ATOM 4634   C CA   . THR B 1 149 ? 31.234  18.839  14.371  1.00 42.20 ? 149 THR B CA   1  
ATOM 4635   C C    . THR B 1 149 ? 30.705  17.614  15.133  1.00 31.21 ? 149 THR B C    1  
ATOM 4636   O O    . THR B 1 149 ? 30.046  17.762  16.175  1.00 63.12 ? 149 THR B O    1  
ATOM 4637   C CB   . THR B 1 149 ? 32.483  19.431  15.109  1.00 74.12 ? 149 THR B CB   1  
ATOM 4638   O OG1  . THR B 1 149 ? 32.877  20.641  14.452  1.00 31.22 ? 149 THR B OG1  1  
ATOM 4639   C CG2  . THR B 1 149 ? 33.683  18.460  15.135  1.00 13.32 ? 149 THR B CG2  1  
ATOM 4640   H H    . THR B 1 149 ? 30.050  20.469  15.021  1.00 4.10  ? 149 THR B H    1  
ATOM 4641   H HA   . THR B 1 149 ? 31.534  18.544  13.366  1.00 4.52  ? 149 THR B HA   1  
ATOM 4642   H HB   . THR B 1 149 ? 32.208  19.672  16.132  1.00 35.24 ? 149 THR B HB   1  
ATOM 4643   H HG1  . THR B 1 149 ? 32.119  21.236  14.406  1.00 30.44 ? 149 THR B HG1  1  
ATOM 4644   H HG21 . THR B 1 149 ? 33.995  18.230  14.120  1.00 24.41 ? 149 THR B HG21 1  
ATOM 4645   H HG22 . THR B 1 149 ? 33.403  17.545  15.635  1.00 71.51 ? 149 THR B HG22 1  
ATOM 4646   H HG23 . THR B 1 149 ? 34.505  18.918  15.669  1.00 65.10 ? 149 THR B HG23 1  
ATOM 4647   N N    . GLU B 1 150 ? 30.995  16.420  14.596  1.00 51.41 ? 150 GLU B N    1  
ATOM 4648   C CA   . GLU B 1 150 ? 30.567  15.145  15.185  1.00 44.15 ? 150 GLU B CA   1  
ATOM 4649   C C    . GLU B 1 150 ? 31.365  14.834  16.461  1.00 53.11 ? 150 GLU B C    1  
ATOM 4650   O O    . GLU B 1 150 ? 32.568  15.125  16.544  1.00 73.43 ? 150 GLU B O    1  
ATOM 4651   C CB   . GLU B 1 150 ? 30.759  13.988  14.172  1.00 3.55  ? 150 GLU B CB   1  
ATOM 4652   C CG   . GLU B 1 150 ? 30.002  14.154  12.847  1.00 54.20 ? 150 GLU B CG   1  
ATOM 4653   C CD   . GLU B 1 150 ? 30.220  12.966  11.895  1.00 11.53 ? 150 GLU B CD   1  
ATOM 4654   O OE1  . GLU B 1 150 ? 29.503  11.960  12.012  1.00 14.33 ? 150 GLU B OE1  1  
ATOM 4655   O OE2  . GLU B 1 150 ? 31.121  13.036  11.035  1.00 74.11 ? 150 GLU B OE2  1  
ATOM 4656   H H    . GLU B 1 150 ? 31.532  16.399  13.777  1.00 14.42 ? 150 GLU B H    1  
ATOM 4657   H HA   . GLU B 1 150 ? 29.511  15.227  15.432  1.00 62.01 ? 150 GLU B HA   1  
ATOM 4658   H HB2  . GLU B 1 150 ? 31.817  13.899  13.940  1.00 55.20 ? 150 GLU B HB2  1  
ATOM 4659   H HB3  . GLU B 1 150 ? 30.432  13.062  14.633  1.00 53.55 ? 150 GLU B HB3  1  
ATOM 4660   H HG2  . GLU B 1 150 ? 28.941  14.255  13.057  1.00 11.44 ? 150 GLU B HG2  1  
ATOM 4661   H HG3  . GLU B 1 150 ? 30.345  15.062  12.363  1.00 65.10 ? 150 GLU B HG3  1  
ATOM 4662   N N    . GLU B 1 151 ? 30.671  14.250  17.442  1.00 51.11 ? 151 GLU B N    1  
ATOM 4663   C CA   . GLU B 1 151 ? 31.279  13.695  18.648  1.00 62.44 ? 151 GLU B CA   1  
ATOM 4664   C C    . GLU B 1 151 ? 30.482  12.436  19.042  1.00 52.23 ? 151 GLU B C    1  
ATOM 4665   O O    . GLU B 1 151 ? 29.419  12.533  19.671  1.00 22.00 ? 151 GLU B O    1  
ATOM 4666   C CB   . GLU B 1 151 ? 31.293  14.758  19.788  1.00 10.32 ? 151 GLU B CB   1  
ATOM 4667   C CG   . GLU B 1 151 ? 32.048  14.319  21.055  1.00 34.32 ? 151 GLU B CG   1  
ATOM 4668   C CD   . GLU B 1 151 ? 33.541  14.040  20.803  1.00 62.20 ? 151 GLU B CD   1  
ATOM 4669   O OE1  . GLU B 1 151 ? 34.346  14.995  20.828  1.00 14.41 ? 151 GLU B OE1  1  
ATOM 4670   O OE2  . GLU B 1 151 ? 33.917  12.867  20.570  1.00 62.13 ? 151 GLU B OE2  1  
ATOM 4671   H H    . GLU B 1 151 ? 29.695  14.205  17.356  1.00 63.42 ? 151 GLU B H    1  
ATOM 4672   H HA   . GLU B 1 151 ? 32.306  13.404  18.418  1.00 64.32 ? 151 GLU B HA   1  
ATOM 4673   H HB2  . GLU B 1 151 ? 31.759  15.665  19.415  1.00 42.54 ? 151 GLU B HB2  1  
ATOM 4674   H HB3  . GLU B 1 151 ? 30.268  14.990  20.064  1.00 42.20 ? 151 GLU B HB3  1  
ATOM 4675   H HG2  . GLU B 1 151 ? 31.956  15.100  21.803  1.00 30.44 ? 151 GLU B HG2  1  
ATOM 4676   H HG3  . GLU B 1 151 ? 31.580  13.418  21.439  1.00 43.03 ? 151 GLU B HG3  1  
ATOM 4677   N N    . HIS B 1 152 ? 30.971  11.265  18.596  1.00 3.24  ? 152 HIS B N    1  
ATOM 4678   C CA   . HIS B 1 152 ? 30.298  9.964   18.804  1.00 21.32 ? 152 HIS B CA   1  
ATOM 4679   C C    . HIS B 1 152 ? 31.332  8.852   19.075  1.00 35.35 ? 152 HIS B C    1  
ATOM 4680   O O    . HIS B 1 152 ? 32.283  8.673   18.307  1.00 12.30 ? 152 HIS B O    1  
ATOM 4681   C CB   . HIS B 1 152 ? 29.389  9.608   17.586  1.00 42.52 ? 152 HIS B CB   1  
ATOM 4682   C CG   . HIS B 1 152 ? 30.054  9.684   16.230  1.00 34.41 ? 152 HIS B CG   1  
ATOM 4683   N ND1  . HIS B 1 152 ? 30.995  8.781   15.795  1.00 24.42 ? 152 HIS B ND1  1  
ATOM 4684   C CD2  . HIS B 1 152 ? 29.902  10.570  15.217  1.00 0.33  ? 152 HIS B CD2  1  
ATOM 4685   C CE1  . HIS B 1 152 ? 31.391  9.103   14.580  1.00 60.23 ? 152 HIS B CE1  1  
ATOM 4686   N NE2  . HIS B 1 152 ? 30.741  10.184  14.204  1.00 23.34 ? 152 HIS B NE2  1  
ATOM 4687   H H    . HIS B 1 152 ? 31.821  11.274  18.112  1.00 53.12 ? 152 HIS B H    1  
ATOM 4688   H HA   . HIS B 1 152 ? 29.664  10.058  19.688  1.00 53.34 ? 152 HIS B HA   1  
ATOM 4689   H HB2  . HIS B 1 152 ? 29.007  8.600   17.703  1.00 30.14 ? 152 HIS B HB2  1  
ATOM 4690   H HB3  . HIS B 1 152 ? 28.550  10.289  17.575  1.00 3.12  ? 152 HIS B HB3  1  
ATOM 4691   H HD1  . HIS B 1 152 ? 31.338  8.023   16.312  1.00 55.44 ? 152 HIS B HD1  1  
ATOM 4692   H HD2  . HIS B 1 152 ? 29.252  11.434  15.214  1.00 24.24 ? 152 HIS B HD2  1  
ATOM 4693   H HE1  . HIS B 1 152 ? 32.120  8.564   13.989  1.00 20.04 ? 152 HIS B HE1  1  
ATOM 4694   H HE2  . HIS B 1 152 ? 30.680  10.500  13.277  1.00 37.99 ? 152 HIS B HE2  1  
ATOM 4695   N N    . GLN B 1 153 ? 31.120  8.112   20.175  1.00 22.55 ? 153 GLN B N    1  
ATOM 4696   C CA   . GLN B 1 153 ? 32.016  7.027   20.634  1.00 73.35 ? 153 GLN B CA   1  
ATOM 4697   C C    . GLN B 1 153 ? 31.230  6.185   21.672  1.00 25.32 ? 153 GLN B C    1  
ATOM 4698   O O    . GLN B 1 153 ? 30.288  6.700   22.286  1.00 71.01 ? 153 GLN B O    1  
ATOM 4699   C CB   . GLN B 1 153 ? 33.333  7.651   21.255  1.00 70.23 ? 153 GLN B CB   1  
ATOM 4700   C CG   . GLN B 1 153 ? 34.639  6.820   21.142  1.00 12.10 ? 153 GLN B CG   1  
ATOM 4701   C CD   . GLN B 1 153 ? 34.635  5.497   21.910  1.00 43.24 ? 153 GLN B CD   1  
ATOM 4702   O OE1  . GLN B 1 153 ? 34.346  4.443   21.351  1.00 10.41 ? 153 GLN B OE1  1  
ATOM 4703   N NE2  . GLN B 1 153 ? 34.896  5.548   23.206  1.00 13.20 ? 153 GLN B NE2  1  
ATOM 4704   H H    . GLN B 1 153 ? 30.321  8.306   20.713  1.00 43.23 ? 153 GLN B H    1  
ATOM 4705   H HA   . GLN B 1 153 ? 32.266  6.405   19.778  1.00 72.30 ? 153 GLN B HA   1  
ATOM 4706   H HB2  . GLN B 1 153 ? 33.517  8.604   20.765  1.00 32.31 ? 153 GLN B HB2  1  
ATOM 4707   H HB3  . GLN B 1 153 ? 33.166  7.862   22.308  1.00 12.11 ? 153 GLN B HB3  1  
ATOM 4708   H HG2  . GLN B 1 153 ? 34.811  6.600   20.094  1.00 75.25 ? 153 GLN B HG2  1  
ATOM 4709   H HG3  . GLN B 1 153 ? 35.465  7.425   21.506  1.00 71.22 ? 153 GLN B HG3  1  
ATOM 4710   H HE21 . GLN B 1 153 ? 35.081  6.423   23.608  1.00 45.11 ? 153 GLN B HE21 1  
ATOM 4711   H HE22 . GLN B 1 153 ? 34.870  4.713   23.716  1.00 3.40  ? 153 GLN B HE22 1  
ATOM 4712   N N    . ASP B 1 154 ? 31.597  4.901   21.834  1.00 55.20 ? 154 ASP B N    1  
ATOM 4713   C CA   . ASP B 1 154 ? 31.046  4.008   22.886  1.00 3.05  ? 154 ASP B CA   1  
ATOM 4714   C C    . ASP B 1 154 ? 31.170  4.658   24.284  1.00 20.52 ? 154 ASP B C    1  
ATOM 4715   O O    . ASP B 1 154 ? 32.267  5.062   24.683  1.00 13.34 ? 154 ASP B O    1  
ATOM 4716   C CB   . ASP B 1 154 ? 31.798  2.653   22.882  1.00 51.10 ? 154 ASP B CB   1  
ATOM 4717   C CG   . ASP B 1 154 ? 31.627  1.881   21.570  1.00 45.10 ? 154 ASP B CG   1  
ATOM 4718   O OD1  . ASP B 1 154 ? 32.354  2.168   20.598  1.00 54.43 ? 154 ASP B OD1  1  
ATOM 4719   O OD2  . ASP B 1 154 ? 30.767  0.979   21.502  1.00 73.34 ? 154 ASP B OD2  1  
ATOM 4720   H H    . ASP B 1 154 ? 32.257  4.527   21.215  1.00 30.22 ? 154 ASP B H    1  
ATOM 4721   H HA   . ASP B 1 154 ? 29.997  3.830   22.653  1.00 22.12 ? 154 ASP B HA   1  
ATOM 4722   H HB2  . ASP B 1 154 ? 32.858  2.838   23.040  1.00 50.20 ? 154 ASP B HB2  1  
ATOM 4723   H HB3  . ASP B 1 154 ? 31.435  2.037   23.702  1.00 15.32 ? 154 ASP B HB3  1  
ATOM 4724   N N    . ALA B 1 155 ? 30.034  4.773   24.996  1.00 73.35 ? 155 ALA B N    1  
ATOM 4725   C CA   . ALA B 1 155 ? 29.972  5.324   26.363  1.00 0.50  ? 155 ALA B CA   1  
ATOM 4726   C C    . ALA B 1 155 ? 28.915  4.532   27.170  1.00 13.10 ? 155 ALA B C    1  
ATOM 4727   O O    . ALA B 1 155 ? 29.286  3.530   27.810  1.00 63.32 ? 155 ALA B O    1  
ATOM 4728   C CB   . ALA B 1 155 ? 29.674  6.847   26.330  1.00 13.53 ? 155 ALA B CB   1  
ATOM 4729   O OXT  . ALA B 1 155 ? 27.712  4.868   27.114  1.00 37.99 ? 155 ALA B OXT  1  
ATOM 4730   H H    . ALA B 1 155 ? 29.198  4.464   24.588  1.00 52.03 ? 155 ALA B H    1  
ATOM 4731   H HA   . ALA B 1 155 ? 30.950  5.183   26.834  1.00 63.10 ? 155 ALA B HA   1  
ATOM 4732   H HB1  . ALA B 1 155 ? 28.714  7.024   25.863  1.00 51.10 ? 155 ALA B HB1  1  
ATOM 4733   H HB2  . ALA B 1 155 ? 30.441  7.357   25.764  1.00 34.12 ? 155 ALA B HB2  1  
ATOM 4734   H HB3  . ALA B 1 155 ? 29.656  7.244   27.339  1.00 4.03  ? 155 ALA B HB3  1  
ATOM 4735   N N    . MET C 1 1   ? -31.374 -33.258 11.217  1.00 33.24 ? 1   MET C N    1  
ATOM 4736   C CA   . MET C 1 1   ? -30.000 -33.104 11.731  1.00 30.51 ? 1   MET C CA   1  
ATOM 4737   C C    . MET C 1 1   ? -29.429 -34.487 12.079  1.00 24.21 ? 1   MET C C    1  
ATOM 4738   O O    . MET C 1 1   ? -29.451 -34.892 13.243  1.00 64.31 ? 1   MET C O    1  
ATOM 4739   C CB   . MET C 1 1   ? -29.977 -32.145 12.963  1.00 32.23 ? 1   MET C CB   1  
ATOM 4740   C CG   . MET C 1 1   ? -30.495 -30.723 12.687  1.00 41.42 ? 1   MET C CG   1  
ATOM 4741   S SD   . MET C 1 1   ? -32.250 -30.683 12.251  1.00 51.14 ? 1   MET C SD   1  
ATOM 4742   C CE   . MET C 1 1   ? -32.477 -28.972 11.767  1.00 15.24 ? 1   MET C CE   1  
ATOM 4743   H H1   . MET C 1 1   ? -31.768 -32.334 10.950  1.00 37.99 ? 1   MET C H1   1  
ATOM 4744   H H2   . MET C 1 1   ? -31.983 -33.685 11.945  1.00 37.99 ? 1   MET C H2   1  
ATOM 4745   H H3   . MET C 1 1   ? -31.375 -33.877 10.384  1.00 37.99 ? 1   MET C H3   1  
ATOM 4746   H HA   . MET C 1 1   ? -29.399 -32.674 10.934  1.00 63.21 ? 1   MET C HA   1  
ATOM 4747   H HB2  . MET C 1 1   ? -30.589 -32.575 13.752  1.00 55.12 ? 1   MET C HB2  1  
ATOM 4748   H HB3  . MET C 1 1   ? -28.956 -32.069 13.328  1.00 41.33 ? 1   MET C HB3  1  
ATOM 4749   H HG2  . MET C 1 1   ? -30.352 -30.117 13.575  1.00 42.42 ? 1   MET C HG2  1  
ATOM 4750   H HG3  . MET C 1 1   ? -29.929 -30.295 11.870  1.00 40.03 ? 1   MET C HG3  1  
ATOM 4751   H HE1  . MET C 1 1   ? -33.513 -28.806 11.503  1.00 32.40 ? 1   MET C HE1  1  
ATOM 4752   H HE2  . MET C 1 1   ? -31.853 -28.753 10.914  1.00 23.23 ? 1   MET C HE2  1  
ATOM 4753   H HE3  . MET C 1 1   ? -32.206 -28.324 12.588  1.00 75.21 ? 1   MET C HE3  1  
ATOM 4754   N N    . SER C 1 2   ? -28.972 -35.216 11.038  1.00 51.23 ? 2   SER C N    1  
ATOM 4755   C CA   . SER C 1 2   ? -28.365 -36.556 11.155  1.00 53.30 ? 2   SER C CA   1  
ATOM 4756   C C    . SER C 1 2   ? -27.895 -37.009 9.751   1.00 35.42 ? 2   SER C C    1  
ATOM 4757   O O    . SER C 1 2   ? -28.676 -37.602 8.997   1.00 54.41 ? 2   SER C O    1  
ATOM 4758   C CB   . SER C 1 2   ? -29.368 -37.589 11.756  1.00 22.31 ? 2   SER C CB   1  
ATOM 4759   O OG   . SER C 1 2   ? -28.733 -38.822 12.070  1.00 40.25 ? 2   SER C OG   1  
ATOM 4760   H H    . SER C 1 2   ? -29.038 -34.826 10.142  1.00 44.02 ? 2   SER C H    1  
ATOM 4761   H HA   . SER C 1 2   ? -27.501 -36.473 11.808  1.00 73.05 ? 2   SER C HA   1  
ATOM 4762   H HB2  . SER C 1 2   ? -29.794 -37.184 12.666  1.00 22.24 ? 2   SER C HB2  1  
ATOM 4763   H HB3  . SER C 1 2   ? -30.167 -37.777 11.048  1.00 23.41 ? 2   SER C HB3  1  
ATOM 4764   H HG   . SER C 1 2   ? -29.105 -39.186 12.880  1.00 53.23 ? 2   SER C HG   1  
ATOM 4765   N N    . GLU C 1 3   ? -26.640 -36.661 9.390   1.00 52.23 ? 3   GLU C N    1  
ATOM 4766   C CA   . GLU C 1 3   ? -26.054 -36.973 8.068   1.00 51.41 ? 3   GLU C CA   1  
ATOM 4767   C C    . GLU C 1 3   ? -24.514 -36.855 8.134   1.00 1.21  ? 3   GLU C C    1  
ATOM 4768   O O    . GLU C 1 3   ? -23.971 -35.846 8.611   1.00 53.02 ? 3   GLU C O    1  
ATOM 4769   C CB   . GLU C 1 3   ? -26.663 -36.061 6.941   1.00 61.41 ? 3   GLU C CB   1  
ATOM 4770   C CG   . GLU C 1 3   ? -26.374 -34.540 7.024   1.00 4.43  ? 3   GLU C CG   1  
ATOM 4771   C CD   . GLU C 1 3   ? -26.912 -33.855 8.290   1.00 1.32  ? 3   GLU C CD   1  
ATOM 4772   O OE1  . GLU C 1 3   ? -26.112 -33.341 9.103   1.00 15.53 ? 3   GLU C OE1  1  
ATOM 4773   O OE2  . GLU C 1 3   ? -28.142 -33.842 8.489   1.00 32.42 ? 3   GLU C OE2  1  
ATOM 4774   H H    . GLU C 1 3   ? -26.083 -36.174 10.038  1.00 30.03 ? 3   GLU C H    1  
ATOM 4775   H HA   . GLU C 1 3   ? -26.303 -38.010 7.842   1.00 2.35  ? 3   GLU C HA   1  
ATOM 4776   H HB2  . GLU C 1 3   ? -26.303 -36.413 5.980   1.00 33.13 ? 3   GLU C HB2  1  
ATOM 4777   H HB3  . GLU C 1 3   ? -27.741 -36.192 6.953   1.00 14.45 ? 3   GLU C HB3  1  
ATOM 4778   H HG2  . GLU C 1 3   ? -25.301 -34.393 6.975   1.00 42.42 ? 3   GLU C HG2  1  
ATOM 4779   H HG3  . GLU C 1 3   ? -26.824 -34.059 6.161   1.00 1.03  ? 3   GLU C HG3  1  
ATOM 4780   N N    . GLN C 1 4   ? -23.819 -37.911 7.683   1.00 21.02 ? 4   GLN C N    1  
ATOM 4781   C CA   . GLN C 1 4   ? -22.349 -37.997 7.756   1.00 65.12 ? 4   GLN C CA   1  
ATOM 4782   C C    . GLN C 1 4   ? -21.703 -37.345 6.517   1.00 73.11 ? 4   GLN C C    1  
ATOM 4783   O O    . GLN C 1 4   ? -21.681 -37.944 5.434   1.00 44.45 ? 4   GLN C O    1  
ATOM 4784   C CB   . GLN C 1 4   ? -21.922 -39.488 7.892   1.00 50.13 ? 4   GLN C CB   1  
ATOM 4785   C CG   . GLN C 1 4   ? -22.469 -40.186 9.152   1.00 21.14 ? 4   GLN C CG   1  
ATOM 4786   C CD   . GLN C 1 4   ? -22.081 -41.665 9.247   1.00 71.13 ? 4   GLN C CD   1  
ATOM 4787   O OE1  . GLN C 1 4   ? -22.810 -42.535 8.773   1.00 54.22 ? 4   GLN C OE1  1  
ATOM 4788   N NE2  . GLN C 1 4   ? -20.938 -41.952 9.852   1.00 33.34 ? 4   GLN C NE2  1  
ATOM 4789   H H    . GLN C 1 4   ? -24.316 -38.666 7.292   1.00 21.41 ? 4   GLN C H    1  
ATOM 4790   H HA   . GLN C 1 4   ? -22.019 -37.462 8.645   1.00 34.14 ? 4   GLN C HA   1  
ATOM 4791   H HB2  . GLN C 1 4   ? -22.272 -40.033 7.022   1.00 42.44 ? 4   GLN C HB2  1  
ATOM 4792   H HB3  . GLN C 1 4   ? -20.838 -39.541 7.920   1.00 72.31 ? 4   GLN C HB3  1  
ATOM 4793   H HG2  . GLN C 1 4   ? -22.093 -39.667 10.028  1.00 52.43 ? 4   GLN C HG2  1  
ATOM 4794   H HG3  . GLN C 1 4   ? -23.551 -40.112 9.148   1.00 22.12 ? 4   GLN C HG3  1  
ATOM 4795   H HE21 . GLN C 1 4   ? -20.402 -41.208 10.208  1.00 5.11  ? 4   GLN C HE21 1  
ATOM 4796   H HE22 . GLN C 1 4   ? -20.674 -42.892 9.922   1.00 42.21 ? 4   GLN C HE22 1  
ATOM 4797   N N    . ASN C 1 5   ? -21.232 -36.099 6.672   1.00 10.22 ? 5   ASN C N    1  
ATOM 4798   C CA   . ASN C 1 5   ? -20.459 -35.402 5.626   1.00 22.15 ? 5   ASN C CA   1  
ATOM 4799   C C    . ASN C 1 5   ? -18.978 -35.761 5.789   1.00 41.12 ? 5   ASN C C    1  
ATOM 4800   O O    . ASN C 1 5   ? -18.425 -35.612 6.882   1.00 33.45 ? 5   ASN C O    1  
ATOM 4801   C CB   . ASN C 1 5   ? -20.661 -33.872 5.726   1.00 34.02 ? 5   ASN C CB   1  
ATOM 4802   C CG   . ASN C 1 5   ? -20.117 -33.108 4.518   1.00 54.51 ? 5   ASN C CG   1  
ATOM 4803   O OD1  . ASN C 1 5   ? -20.085 -33.627 3.400   1.00 34.13 ? 5   ASN C OD1  1  
ATOM 4804   N ND2  . ASN C 1 5   ? -19.732 -31.867 4.726   1.00 74.10 ? 5   ASN C ND2  1  
ATOM 4805   H H    . ASN C 1 5   ? -21.407 -35.631 7.517   1.00 54.13 ? 5   ASN C H    1  
ATOM 4806   H HA   . ASN C 1 5   ? -20.815 -35.747 4.653   1.00 24.21 ? 5   ASN C HA   1  
ATOM 4807   H HB2  . ASN C 1 5   ? -21.720 -33.663 5.795   1.00 24.54 ? 5   ASN C HB2  1  
ATOM 4808   H HB3  . ASN C 1 5   ? -20.173 -33.502 6.621   1.00 63.14 ? 5   ASN C HB3  1  
ATOM 4809   H HD21 . ASN C 1 5   ? -19.818 -31.497 5.627   1.00 65.54 ? 5   ASN C HD21 1  
ATOM 4810   H HD22 . ASN C 1 5   ? -19.352 -31.373 3.971   1.00 62.44 ? 5   ASN C HD22 1  
ATOM 4811   N N    . ASN C 1 6   ? -18.344 -36.213 4.708   1.00 74.02 ? 6   ASN C N    1  
ATOM 4812   C CA   . ASN C 1 6   ? -17.008 -36.824 4.772   1.00 30.53 ? 6   ASN C CA   1  
ATOM 4813   C C    . ASN C 1 6   ? -16.308 -36.667 3.418   1.00 2.14  ? 6   ASN C C    1  
ATOM 4814   O O    . ASN C 1 6   ? -16.809 -37.185 2.419   1.00 61.23 ? 6   ASN C O    1  
ATOM 4815   C CB   . ASN C 1 6   ? -17.157 -38.325 5.157   1.00 20.51 ? 6   ASN C CB   1  
ATOM 4816   C CG   . ASN C 1 6   ? -15.838 -39.066 5.401   1.00 43.03 ? 6   ASN C CG   1  
ATOM 4817   O OD1  . ASN C 1 6   ? -14.783 -38.691 4.897   1.00 34.31 ? 6   ASN C OD1  1  
ATOM 4818   N ND2  . ASN C 1 6   ? -15.904 -40.169 6.138   1.00 12.11 ? 6   ASN C ND2  1  
ATOM 4819   H H    . ASN C 1 6   ? -18.770 -36.114 3.829   1.00 25.43 ? 6   ASN C H    1  
ATOM 4820   H HA   . ASN C 1 6   ? -16.425 -36.317 5.539   1.00 23.13 ? 6   ASN C HA   1  
ATOM 4821   H HB2  . ASN C 1 6   ? -17.745 -38.388 6.064   1.00 41.22 ? 6   ASN C HB2  1  
ATOM 4822   H HB3  . ASN C 1 6   ? -17.691 -38.842 4.367   1.00 55.52 ? 6   ASN C HB3  1  
ATOM 4823   H HD21 . ASN C 1 6   ? -16.778 -40.444 6.481   1.00 74.53 ? 6   ASN C HD21 1  
ATOM 4824   H HD22 . ASN C 1 6   ? -15.076 -40.667 6.300   1.00 73.24 ? 6   ASN C HD22 1  
ATOM 4825   N N    . THR C 1 7   ? -15.154 -35.957 3.406   1.00 13.42 ? 7   THR C N    1  
ATOM 4826   C CA   . THR C 1 7   ? -14.353 -35.717 2.192   1.00 5.23  ? 7   THR C CA   1  
ATOM 4827   C C    . THR C 1 7   ? -15.158 -34.817 1.214   1.00 62.41 ? 7   THR C C    1  
ATOM 4828   O O    . THR C 1 7   ? -15.817 -35.284 0.278   1.00 23.23 ? 7   THR C O    1  
ATOM 4829   C CB   . THR C 1 7   ? -13.889 -37.069 1.527   1.00 42.23 ? 7   THR C CB   1  
ATOM 4830   O OG1  . THR C 1 7   ? -13.148 -37.841 2.489   1.00 43.40 ? 7   THR C OG1  1  
ATOM 4831   C CG2  . THR C 1 7   ? -13.022 -36.863 0.277   1.00 72.40 ? 7   THR C CG2  1  
ATOM 4832   H H    . THR C 1 7   ? -14.855 -35.549 4.246   1.00 42.14 ? 7   THR C H    1  
ATOM 4833   H HA   . THR C 1 7   ? -13.457 -35.172 2.506   1.00 0.41  ? 7   THR C HA   1  
ATOM 4834   H HB   . THR C 1 7   ? -14.778 -37.634 1.243   1.00 71.22 ? 7   THR C HB   1  
ATOM 4835   H HG1  . THR C 1 7   ? -13.734 -38.077 3.212   1.00 33.51 ? 7   THR C HG1  1  
ATOM 4836   H HG21 . THR C 1 7   ? -12.727 -37.826 -0.117  1.00 52.33 ? 7   THR C HG21 1  
ATOM 4837   H HG22 . THR C 1 7   ? -12.135 -36.296 0.528   1.00 63.54 ? 7   THR C HG22 1  
ATOM 4838   H HG23 . THR C 1 7   ? -13.585 -36.323 -0.476  1.00 21.02 ? 7   THR C HG23 1  
ATOM 4839   N N    . GLU C 1 8   ? -15.118 -33.511 1.493   1.00 5.40  ? 8   GLU C N    1  
ATOM 4840   C CA   . GLU C 1 8   ? -15.983 -32.493 0.855   1.00 22.02 ? 8   GLU C CA   1  
ATOM 4841   C C    . GLU C 1 8   ? -15.169 -31.219 0.552   1.00 33.22 ? 8   GLU C C    1  
ATOM 4842   O O    . GLU C 1 8   ? -15.746 -30.135 0.376   1.00 24.22 ? 8   GLU C O    1  
ATOM 4843   C CB   . GLU C 1 8   ? -17.176 -32.163 1.809   1.00 71.21 ? 8   GLU C CB   1  
ATOM 4844   C CG   . GLU C 1 8   ? -16.788 -31.517 3.166   1.00 54.23 ? 8   GLU C CG   1  
ATOM 4845   C CD   . GLU C 1 8   ? -16.003 -32.443 4.115   1.00 41.44 ? 8   GLU C CD   1  
ATOM 4846   O OE1  . GLU C 1 8   ? -16.617 -33.367 4.679   1.00 14.03 ? 8   GLU C OE1  1  
ATOM 4847   O OE2  . GLU C 1 8   ? -14.775 -32.247 4.300   1.00 21.12 ? 8   GLU C OE2  1  
ATOM 4848   H H    . GLU C 1 8   ? -14.488 -33.208 2.181   1.00 2.03  ? 8   GLU C H    1  
ATOM 4849   H HA   . GLU C 1 8   ? -16.364 -32.891 -0.079  1.00 25.44 ? 8   GLU C HA   1  
ATOM 4850   H HB2  . GLU C 1 8   ? -17.852 -31.486 1.298   1.00 23.45 ? 8   GLU C HB2  1  
ATOM 4851   H HB3  . GLU C 1 8   ? -17.713 -33.080 2.018   1.00 41.43 ? 8   GLU C HB3  1  
ATOM 4852   H HG2  . GLU C 1 8   ? -16.200 -30.629 2.966   1.00 14.41 ? 8   GLU C HG2  1  
ATOM 4853   H HG3  . GLU C 1 8   ? -17.704 -31.207 3.669   1.00 21.25 ? 8   GLU C HG3  1  
ATOM 4854   N N    . MET C 1 9   ? -13.831 -31.404 0.418   1.00 32.11 ? 9   MET C N    1  
ATOM 4855   C CA   . MET C 1 9   ? -12.820 -30.318 0.404   1.00 10.41 ? 9   MET C CA   1  
ATOM 4856   C C    . MET C 1 9   ? -12.752 -29.603 1.775   1.00 73.30 ? 9   MET C C    1  
ATOM 4857   O O    . MET C 1 9   ? -13.705 -28.948 2.203   1.00 3.22  ? 9   MET C O    1  
ATOM 4858   C CB   . MET C 1 9   ? -13.078 -29.283 -0.746  1.00 0.21  ? 9   MET C CB   1  
ATOM 4859   C CG   . MET C 1 9   ? -12.095 -28.104 -0.807  1.00 10.10 ? 9   MET C CG   1  
ATOM 4860   S SD   . MET C 1 9   ? -12.492 -26.934 -2.129  1.00 1.35  ? 9   MET C SD   1  
ATOM 4861   C CE   . MET C 1 9   ? -14.151 -26.396 -1.685  1.00 2.13  ? 9   MET C CE   1  
ATOM 4862   H H    . MET C 1 9   ? -13.512 -32.322 0.320   1.00 64.41 ? 9   MET C H    1  
ATOM 4863   H HA   . MET C 1 9   ? -11.863 -30.801 0.216   1.00 44.11 ? 9   MET C HA   1  
ATOM 4864   H HB2  . MET C 1 9   ? -13.030 -29.801 -1.696  1.00 11.02 ? 9   MET C HB2  1  
ATOM 4865   H HB3  . MET C 1 9   ? -14.079 -28.880 -0.631  1.00 44.42 ? 9   MET C HB3  1  
ATOM 4866   H HG2  . MET C 1 9   ? -12.115 -27.575 0.138   1.00 3.43  ? 9   MET C HG2  1  
ATOM 4867   H HG3  . MET C 1 9   ? -11.092 -28.489 -0.976  1.00 40.32 ? 9   MET C HG3  1  
ATOM 4868   H HE1  . MET C 1 9   ? -14.822 -27.244 -1.683  1.00 23.54 ? 9   MET C HE1  1  
ATOM 4869   H HE2  . MET C 1 9   ? -14.497 -25.668 -2.404  1.00 40.14 ? 9   MET C HE2  1  
ATOM 4870   H HE3  . MET C 1 9   ? -14.134 -25.948 -0.703  1.00 43.44 ? 9   MET C HE3  1  
ATOM 4871   N N    . THR C 1 10  ? -11.601 -29.739 2.450   1.00 61.31 ? 10  THR C N    1  
ATOM 4872   C CA   . THR C 1 10  ? -11.295 -29.021 3.691   1.00 55.14 ? 10  THR C CA   1  
ATOM 4873   C C    . THR C 1 10  ? -10.216 -27.970 3.367   1.00 74.32 ? 10  THR C C    1  
ATOM 4874   O O    . THR C 1 10  ? -9.027  -28.296 3.220   1.00 12.10 ? 10  THR C O    1  
ATOM 4875   C CB   . THR C 1 10  ? -10.820 -30.014 4.805   1.00 70.22 ? 10  THR C CB   1  
ATOM 4876   O OG1  . THR C 1 10  ? -11.752 -31.114 4.903   1.00 63.41 ? 10  THR C OG1  1  
ATOM 4877   C CG2  . THR C 1 10  ? -10.699 -29.331 6.183   1.00 15.51 ? 10  THR C CG2  1  
ATOM 4878   H H    . THR C 1 10  ? -10.930 -30.353 2.099   1.00 24.10 ? 10  THR C H    1  
ATOM 4879   H HA   . THR C 1 10  ? -12.196 -28.514 4.041   1.00 64.13 ? 10  THR C HA   1  
ATOM 4880   H HB   . THR C 1 10  ? -9.848  -30.413 4.527   1.00 52.31 ? 10  THR C HB   1  
ATOM 4881   H HG1  . THR C 1 10  ? -12.627 -30.840 4.594   1.00 52.22 ? 10  THR C HG1  1  
ATOM 4882   H HG21 . THR C 1 10  ? -10.361 -30.049 6.915   1.00 70.42 ? 10  THR C HG21 1  
ATOM 4883   H HG22 . THR C 1 10  ? -11.661 -28.942 6.488   1.00 40.11 ? 10  THR C HG22 1  
ATOM 4884   H HG23 . THR C 1 10  ? -9.987  -28.518 6.128   1.00 40.54 ? 10  THR C HG23 1  
ATOM 4885   N N    . PHE C 1 11  ? -10.674 -26.723 3.191   1.00 51.11 ? 11  PHE C N    1  
ATOM 4886   C CA   . PHE C 1 11  ? -9.844  -25.604 2.721   1.00 20.10 ? 11  PHE C CA   1  
ATOM 4887   C C    . PHE C 1 11  ? -9.534  -24.667 3.895   1.00 35.40 ? 11  PHE C C    1  
ATOM 4888   O O    . PHE C 1 11  ? -10.442 -24.271 4.622   1.00 61.51 ? 11  PHE C O    1  
ATOM 4889   C CB   . PHE C 1 11  ? -10.586 -24.834 1.592   1.00 23.34 ? 11  PHE C CB   1  
ATOM 4890   C CG   . PHE C 1 11  ? -9.746  -23.738 0.911   1.00 35.41 ? 11  PHE C CG   1  
ATOM 4891   C CD1  . PHE C 1 11  ? -8.959  -24.033 -0.201  1.00 72.31 ? 11  PHE C CD1  1  
ATOM 4892   C CD2  . PHE C 1 11  ? -9.737  -22.419 1.383   1.00 54.32 ? 11  PHE C CD2  1  
ATOM 4893   C CE1  . PHE C 1 11  ? -8.202  -23.055 -0.820  1.00 32.41 ? 11  PHE C CE1  1  
ATOM 4894   C CE2  . PHE C 1 11  ? -8.976  -21.447 0.763   1.00 53.23 ? 11  PHE C CE2  1  
ATOM 4895   C CZ   . PHE C 1 11  ? -8.212  -21.765 -0.338  1.00 71.15 ? 11  PHE C CZ   1  
ATOM 4896   H H    . PHE C 1 11  ? -11.611 -26.543 3.410   1.00 63.34 ? 11  PHE C H    1  
ATOM 4897   H HA   . PHE C 1 11  ? -8.910  -26.004 2.321   1.00 63.52 ? 11  PHE C HA   1  
ATOM 4898   H HB2  . PHE C 1 11  ? -10.893 -25.543 0.831   1.00 35.30 ? 11  PHE C HB2  1  
ATOM 4899   H HB3  . PHE C 1 11  ? -11.479 -24.372 2.005   1.00 54.42 ? 11  PHE C HB3  1  
ATOM 4900   H HD1  . PHE C 1 11  ? -8.948  -25.045 -0.590  1.00 62.52 ? 11  PHE C HD1  1  
ATOM 4901   H HD2  . PHE C 1 11  ? -10.334 -22.158 2.252   1.00 74.30 ? 11  PHE C HD2  1  
ATOM 4902   H HE1  . PHE C 1 11  ? -7.597  -23.306 -1.682  1.00 74.24 ? 11  PHE C HE1  1  
ATOM 4903   H HE2  . PHE C 1 11  ? -8.981  -20.433 1.140   1.00 64.43 ? 11  PHE C HE2  1  
ATOM 4904   H HZ   . PHE C 1 11  ? -7.617  -21.002 -0.824  1.00 14.14 ? 11  PHE C HZ   1  
ATOM 4905   N N    . GLN C 1 12  ? -8.248  -24.327 4.063   1.00 4.31  ? 12  GLN C N    1  
ATOM 4906   C CA   . GLN C 1 12  ? -7.780  -23.351 5.062   1.00 41.10 ? 12  GLN C CA   1  
ATOM 4907   C C    . GLN C 1 12  ? -6.493  -22.671 4.556   1.00 21.40 ? 12  GLN C C    1  
ATOM 4908   O O    . GLN C 1 12  ? -5.626  -23.324 3.961   1.00 43.35 ? 12  GLN C O    1  
ATOM 4909   C CB   . GLN C 1 12  ? -7.563  -24.002 6.473   1.00 75.40 ? 12  GLN C CB   1  
ATOM 4910   C CG   . GLN C 1 12  ? -6.732  -25.316 6.515   1.00 74.40 ? 12  GLN C CG   1  
ATOM 4911   C CD   . GLN C 1 12  ? -7.532  -26.574 6.128   1.00 32.40 ? 12  GLN C CD   1  
ATOM 4912   O OE1  . GLN C 1 12  ? -8.735  -26.659 6.370   1.00 14.44 ? 12  GLN C OE1  1  
ATOM 4913   N NE2  . GLN C 1 12  ? -6.873  -27.553 5.529   1.00 63.41 ? 12  GLN C NE2  1  
ATOM 4914   H H    . GLN C 1 12  ? -7.579  -24.756 3.489   1.00 70.21 ? 12  GLN C H    1  
ATOM 4915   H HA   . GLN C 1 12  ? -8.550  -22.584 5.149   1.00 44.11 ? 12  GLN C HA   1  
ATOM 4916   H HB2  . GLN C 1 12  ? -7.069  -23.276 7.108   1.00 4.14  ? 12  GLN C HB2  1  
ATOM 4917   H HB3  . GLN C 1 12  ? -8.537  -24.208 6.903   1.00 44.11 ? 12  GLN C HB3  1  
ATOM 4918   H HG2  . GLN C 1 12  ? -5.887  -25.218 5.845   1.00 41.51 ? 12  GLN C HG2  1  
ATOM 4919   H HG3  . GLN C 1 12  ? -6.358  -25.454 7.526   1.00 34.25 ? 12  GLN C HG3  1  
ATOM 4920   H HE21 . GLN C 1 12  ? -5.919  -27.436 5.368   1.00 73.14 ? 12  GLN C HE21 1  
ATOM 4921   H HE22 . GLN C 1 12  ? -7.374  -28.354 5.270   1.00 60.24 ? 12  GLN C HE22 1  
ATOM 4922   N N    . ILE C 1 13  ? -6.396  -21.350 4.780   1.00 42.42 ? 13  ILE C N    1  
ATOM 4923   C CA   . ILE C 1 13  ? -5.237  -20.530 4.362   1.00 51.02 ? 13  ILE C CA   1  
ATOM 4924   C C    . ILE C 1 13  ? -4.147  -20.563 5.452   1.00 55.31 ? 13  ILE C C    1  
ATOM 4925   O O    . ILE C 1 13  ? -4.463  -20.601 6.640   1.00 11.11 ? 13  ILE C O    1  
ATOM 4926   C CB   . ILE C 1 13  ? -5.679  -19.041 4.016   1.00 2.44  ? 13  ILE C CB   1  
ATOM 4927   C CG1  . ILE C 1 13  ? -6.374  -18.291 5.230   1.00 4.03  ? 13  ILE C CG1  1  
ATOM 4928   C CG2  . ILE C 1 13  ? -6.601  -19.044 2.769   1.00 54.01 ? 13  ILE C CG2  1  
ATOM 4929   C CD1  . ILE C 1 13  ? -5.442  -17.547 6.189   1.00 44.12 ? 13  ILE C CD1  1  
ATOM 4930   H H    . ILE C 1 13  ? -7.124  -20.910 5.267   1.00 24.25 ? 13  ILE C H    1  
ATOM 4931   H HA   . ILE C 1 13  ? -4.823  -20.976 3.453   1.00 11.11 ? 13  ILE C HA   1  
ATOM 4932   H HB   . ILE C 1 13  ? -4.779  -18.491 3.739   1.00 74.15 ? 13  ILE C HB   1  
ATOM 4933   H HG12 . ILE C 1 13  ? -7.072  -17.555 4.849   1.00 32.14 ? 13  ILE C HG12 1  
ATOM 4934   H HG13 . ILE C 1 13  ? -6.935  -19.012 5.817   1.00 71.12 ? 13  ILE C HG13 1  
ATOM 4935   H HG21 . ILE C 1 13  ? -7.504  -19.607 2.977   1.00 31.43 ? 13  ILE C HG21 1  
ATOM 4936   H HG22 . ILE C 1 13  ? -6.085  -19.502 1.937   1.00 54.11 ? 13  ILE C HG22 1  
ATOM 4937   H HG23 . ILE C 1 13  ? -6.864  -18.029 2.503   1.00 63.43 ? 13  ILE C HG23 1  
ATOM 4938   H HD11 . ILE C 1 13  ? -6.029  -17.050 6.946   1.00 11.24 ? 13  ILE C HD11 1  
ATOM 4939   H HD12 . ILE C 1 13  ? -4.872  -16.814 5.638   1.00 24.15 ? 13  ILE C HD12 1  
ATOM 4940   H HD13 . ILE C 1 13  ? -4.766  -18.248 6.660   1.00 43.12 ? 13  ILE C HD13 1  
ATOM 4941   N N    . GLN C 1 14  ? -2.867  -20.593 5.046   1.00 24.24 ? 14  GLN C N    1  
ATOM 4942   C CA   . GLN C 1 14  ? -1.731  -20.529 5.989   1.00 1.31  ? 14  GLN C CA   1  
ATOM 4943   C C    . GLN C 1 14  ? -1.128  -19.112 6.015   1.00 61.31 ? 14  GLN C C    1  
ATOM 4944   O O    . GLN C 1 14  ? -0.956  -18.526 7.095   1.00 5.45  ? 14  GLN C O    1  
ATOM 4945   C CB   . GLN C 1 14  ? -0.649  -21.581 5.615   1.00 33.45 ? 14  GLN C CB   1  
ATOM 4946   C CG   . GLN C 1 14  ? -1.079  -23.058 5.812   1.00 32.34 ? 14  GLN C CG   1  
ATOM 4947   C CD   . GLN C 1 14  ? 0.068   -24.065 5.609   1.00 3.22  ? 14  GLN C CD   1  
ATOM 4948   O OE1  . GLN C 1 14  ? 1.234   -23.760 5.852   1.00 62.01 ? 14  GLN C OE1  1  
ATOM 4949   N NE2  . GLN C 1 14  ? -0.253  -25.276 5.177   1.00 53.44 ? 14  GLN C NE2  1  
ATOM 4950   H H    . GLN C 1 14  ? -2.678  -20.663 4.087   1.00 64.44 ? 14  GLN C H    1  
ATOM 4951   H HA   . GLN C 1 14  ? -2.099  -20.761 6.986   1.00 2.22  ? 14  GLN C HA   1  
ATOM 4952   H HB2  . GLN C 1 14  ? -0.385  -21.444 4.571   1.00 65.25 ? 14  GLN C HB2  1  
ATOM 4953   H HB3  . GLN C 1 14  ? 0.236   -21.405 6.214   1.00 24.52 ? 14  GLN C HB3  1  
ATOM 4954   H HG2  . GLN C 1 14  ? -1.459  -23.183 6.818   1.00 4.42  ? 14  GLN C HG2  1  
ATOM 4955   H HG3  . GLN C 1 14  ? -1.870  -23.282 5.105   1.00 31.43 ? 14  GLN C HG3  1  
ATOM 4956   H HE21 . GLN C 1 14  ? -1.195  -25.477 5.012   1.00 52.41 ? 14  GLN C HE21 1  
ATOM 4957   H HE22 . GLN C 1 14  ? 0.471   -25.922 5.042   1.00 71.31 ? 14  GLN C HE22 1  
ATOM 4958   N N    . ARG C 1 15  ? -0.836  -18.554 4.816   1.00 52.42 ? 15  ARG C N    1  
ATOM 4959   C CA   . ARG C 1 15  ? -0.117  -17.266 4.693   1.00 34.32 ? 15  ARG C CA   1  
ATOM 4960   C C    . ARG C 1 15  ? -0.192  -16.732 3.248   1.00 51.33 ? 15  ARG C C    1  
ATOM 4961   O O    . ARG C 1 15  ? 0.152   -17.445 2.310   1.00 30.23 ? 15  ARG C O    1  
ATOM 4962   C CB   . ARG C 1 15  ? 1.367   -17.468 5.128   1.00 61.11 ? 15  ARG C CB   1  
ATOM 4963   C CG   . ARG C 1 15  ? 2.211   -16.182 5.281   1.00 32.43 ? 15  ARG C CG   1  
ATOM 4964   C CD   . ARG C 1 15  ? 3.606   -16.488 5.871   1.00 65.33 ? 15  ARG C CD   1  
ATOM 4965   N NE   . ARG C 1 15  ? 4.410   -15.273 6.117   1.00 13.23 ? 15  ARG C NE   1  
ATOM 4966   C CZ   . ARG C 1 15  ? 5.444   -15.186 6.984   1.00 65.34 ? 15  ARG C CZ   1  
ATOM 4967   N NH1  . ARG C 1 15  ? 5.811   -16.230 7.720   1.00 11.14 ? 15  ARG C NH1  1  
ATOM 4968   N NH2  . ARG C 1 15  ? 6.146   -14.067 7.071   1.00 23.34 ? 15  ARG C NH2  1  
ATOM 4969   H H    . ARG C 1 15  ? -1.113  -19.021 3.997   1.00 74.43 ? 15  ARG C H    1  
ATOM 4970   H HA   . ARG C 1 15  ? -0.590  -16.549 5.363   1.00 73.15 ? 15  ARG C HA   1  
ATOM 4971   H HB2  . ARG C 1 15  ? 1.365   -17.978 6.086   1.00 1.35  ? 15  ARG C HB2  1  
ATOM 4972   H HB3  . ARG C 1 15  ? 1.858   -18.114 4.405   1.00 42.30 ? 15  ARG C HB3  1  
ATOM 4973   H HG2  . ARG C 1 15  ? 2.330   -15.717 4.307   1.00 54.13 ? 15  ARG C HG2  1  
ATOM 4974   H HG3  . ARG C 1 15  ? 1.693   -15.495 5.942   1.00 73.24 ? 15  ARG C HG3  1  
ATOM 4975   H HD2  . ARG C 1 15  ? 3.478   -17.023 6.807   1.00 10.33 ? 15  ARG C HD2  1  
ATOM 4976   H HD3  . ARG C 1 15  ? 4.146   -17.126 5.177   1.00 43.25 ? 15  ARG C HD3  1  
ATOM 4977   H HE   . ARG C 1 15  ? 4.170   -14.473 5.595   1.00 12.44 ? 15  ARG C HE   1  
ATOM 4978   H HH11 . ARG C 1 15  ? 5.329   -17.102 7.634   1.00 23.53 ? 15  ARG C HH11 1  
ATOM 4979   H HH12 . ARG C 1 15  ? 6.582   -16.148 8.357   1.00 15.12 ? 15  ARG C HH12 1  
ATOM 4980   H HH21 . ARG C 1 15  ? 5.915   -13.279 6.490   1.00 14.41 ? 15  ARG C HH21 1  
ATOM 4981   H HH22 . ARG C 1 15  ? 6.914   -13.995 7.713   1.00 13.45 ? 15  ARG C HH22 1  
ATOM 4982   N N    . ILE C 1 16  ? -0.638  -15.475 3.090   1.00 44.43 ? 16  ILE C N    1  
ATOM 4983   C CA   . ILE C 1 16  ? -0.681  -14.769 1.785   1.00 44.44 ? 16  ILE C CA   1  
ATOM 4984   C C    . ILE C 1 16  ? 0.418   -13.697 1.786   1.00 51.24 ? 16  ILE C C    1  
ATOM 4985   O O    . ILE C 1 16  ? 0.683   -13.105 2.831   1.00 72.13 ? 16  ILE C O    1  
ATOM 4986   C CB   . ILE C 1 16  ? -2.075  -14.074 1.560   1.00 12.10 ? 16  ILE C CB   1  
ATOM 4987   C CG1  . ILE C 1 16  ? -3.236  -15.123 1.634   1.00 62.23 ? 16  ILE C CG1  1  
ATOM 4988   C CG2  . ILE C 1 16  ? -2.108  -13.282 0.222   1.00 24.12 ? 16  ILE C CG2  1  
ATOM 4989   C CD1  . ILE C 1 16  ? -4.628  -14.520 1.607   1.00 51.15 ? 16  ILE C CD1  1  
ATOM 4990   H H    . ILE C 1 16  ? -0.949  -14.989 3.883   1.00 44.53 ? 16  ILE C H    1  
ATOM 4991   H HA   . ILE C 1 16  ? -0.500  -15.483 0.978   1.00 42.00 ? 16  ILE C HA   1  
ATOM 4992   H HB   . ILE C 1 16  ? -2.217  -13.352 2.367   1.00 13.13 ? 16  ILE C HB   1  
ATOM 4993   H HG12 . ILE C 1 16  ? -3.161  -15.807 0.799   1.00 75.43 ? 16  ILE C HG12 1  
ATOM 4994   H HG13 . ILE C 1 16  ? -3.148  -15.688 2.555   1.00 11.33 ? 16  ILE C HG13 1  
ATOM 4995   H HG21 . ILE C 1 16  ? -2.980  -12.653 0.191   1.00 44.04 ? 16  ILE C HG21 1  
ATOM 4996   H HG22 . ILE C 1 16  ? -2.133  -13.967 -0.614  1.00 3.03  ? 16  ILE C HG22 1  
ATOM 4997   H HG23 . ILE C 1 16  ? -1.226  -12.658 0.141   1.00 21.45 ? 16  ILE C HG23 1  
ATOM 4998   H HD11 . ILE C 1 16  ? -4.764  -13.880 2.468   1.00 64.45 ? 16  ILE C HD11 1  
ATOM 4999   H HD12 . ILE C 1 16  ? -5.359  -15.311 1.629   1.00 14.41 ? 16  ILE C HD12 1  
ATOM 5000   H HD13 . ILE C 1 16  ? -4.757  -13.941 0.704   1.00 33.15 ? 16  ILE C HD13 1  
ATOM 5001   N N    . TYR C 1 17  ? 1.065   -13.473 0.623   1.00 43.45 ? 17  TYR C N    1  
ATOM 5002   C CA   . TYR C 1 17  ? 2.180   -12.515 0.494   1.00 32.20 ? 17  TYR C CA   1  
ATOM 5003   C C    . TYR C 1 17  ? 2.582   -12.330 -0.971  1.00 32.41 ? 17  TYR C C    1  
ATOM 5004   O O    . TYR C 1 17  ? 2.240   -13.136 -1.841  1.00 54.20 ? 17  TYR C O    1  
ATOM 5005   C CB   . TYR C 1 17  ? 3.419   -12.993 1.318   1.00 12.53 ? 17  TYR C CB   1  
ATOM 5006   C CG   . TYR C 1 17  ? 3.927   -14.410 0.979   1.00 71.23 ? 17  TYR C CG   1  
ATOM 5007   C CD1  . TYR C 1 17  ? 3.306   -15.554 1.510   1.00 5.03  ? 17  TYR C CD1  1  
ATOM 5008   C CD2  . TYR C 1 17  ? 5.014   -14.607 0.134   1.00 33.23 ? 17  TYR C CD2  1  
ATOM 5009   C CE1  . TYR C 1 17  ? 3.755   -16.823 1.208   1.00 72.41 ? 17  TYR C CE1  1  
ATOM 5010   C CE2  . TYR C 1 17  ? 5.455   -15.874 -0.161  1.00 53.43 ? 17  TYR C CE2  1  
ATOM 5011   C CZ   . TYR C 1 17  ? 4.830   -16.972 0.368   1.00 64.12 ? 17  TYR C CZ   1  
ATOM 5012   O OH   . TYR C 1 17  ? 5.312   -18.217 0.068   1.00 55.24 ? 17  TYR C OH   1  
ATOM 5013   H H    . TYR C 1 17  ? 0.782   -13.963 -0.175  1.00 14.22 ? 17  TYR C H    1  
ATOM 5014   H HA   . TYR C 1 17  ? 1.833   -11.547 0.877   1.00 43.41 ? 17  TYR C HA   1  
ATOM 5015   H HB2  . TYR C 1 17  ? 4.237   -12.290 1.172   1.00 14.30 ? 17  TYR C HB2  1  
ATOM 5016   H HB3  . TYR C 1 17  ? 3.157   -12.983 2.370   1.00 35.44 ? 17  TYR C HB3  1  
ATOM 5017   H HD1  . TYR C 1 17  ? 2.459   -15.431 2.173   1.00 32.51 ? 17  TYR C HD1  1  
ATOM 5018   H HD2  . TYR C 1 17  ? 5.522   -13.748 -0.295  1.00 22.14 ? 17  TYR C HD2  1  
ATOM 5019   H HE1  . TYR C 1 17  ? 3.262   -17.691 1.632   1.00 34.21 ? 17  TYR C HE1  1  
ATOM 5020   H HE2  . TYR C 1 17  ? 6.298   -16.007 -0.817  1.00 32.12 ? 17  TYR C HE2  1  
ATOM 5021   H HH   . TYR C 1 17  ? 4.669   -18.701 -0.464  1.00 3.32  ? 17  TYR C HH   1  
ATOM 5022   N N    . THR C 1 18  ? 3.335   -11.261 -1.221  1.00 43.51 ? 18  THR C N    1  
ATOM 5023   C CA   . THR C 1 18  ? 3.935   -10.994 -2.521  1.00 41.31 ? 18  THR C CA   1  
ATOM 5024   C C    . THR C 1 18  ? 5.276   -11.750 -2.602  1.00 55.13 ? 18  THR C C    1  
ATOM 5025   O O    . THR C 1 18  ? 6.218   -11.438 -1.873  1.00 54.14 ? 18  THR C O    1  
ATOM 5026   C CB   . THR C 1 18  ? 4.126   -9.450  -2.723  1.00 54.33 ? 18  THR C CB   1  
ATOM 5027   O OG1  . THR C 1 18  ? 5.033   -8.905  -1.746  1.00 52.44 ? 18  THR C OG1  1  
ATOM 5028   C CG2  . THR C 1 18  ? 2.781   -8.698  -2.614  1.00 22.40 ? 18  THR C CG2  1  
ATOM 5029   H H    . THR C 1 18  ? 3.501   -10.625 -0.496  1.00 40.03 ? 18  THR C H    1  
ATOM 5030   H HA   . THR C 1 18  ? 3.265   -11.363 -3.300  1.00 11.12 ? 18  THR C HA   1  
ATOM 5031   H HB   . THR C 1 18  ? 4.538   -9.273  -3.713  1.00 51.42 ? 18  THR C HB   1  
ATOM 5032   H HG1  . THR C 1 18  ? 5.939   -9.094  -2.007  1.00 50.12 ? 18  THR C HG1  1  
ATOM 5033   H HG21 . THR C 1 18  ? 2.955   -7.643  -2.539  1.00 75.22 ? 18  THR C HG21 1  
ATOM 5034   H HG22 . THR C 1 18  ? 2.245   -9.018  -1.733  1.00 43.54 ? 18  THR C HG22 1  
ATOM 5035   H HG23 . THR C 1 18  ? 2.175   -8.897  -3.491  1.00 44.32 ? 18  THR C HG23 1  
ATOM 5036   N N    . LYS C 1 19  ? 5.321   -12.801 -3.440  1.00 1.05  ? 19  LYS C N    1  
ATOM 5037   C CA   . LYS C 1 19  ? 6.566   -13.548 -3.729  1.00 4.42  ? 19  LYS C CA   1  
ATOM 5038   C C    . LYS C 1 19  ? 7.540   -12.657 -4.487  1.00 43.13 ? 19  LYS C C    1  
ATOM 5039   O O    . LYS C 1 19  ? 8.752   -12.805 -4.378  1.00 0.52  ? 19  LYS C O    1  
ATOM 5040   C CB   . LYS C 1 19  ? 6.283   -14.787 -4.606  1.00 21.43 ? 19  LYS C CB   1  
ATOM 5041   C CG   . LYS C 1 19  ? 5.231   -15.775 -4.037  1.00 75.23 ? 19  LYS C CG   1  
ATOM 5042   C CD   . LYS C 1 19  ? 5.848   -17.046 -3.429  1.00 44.05 ? 19  LYS C CD   1  
ATOM 5043   C CE   . LYS C 1 19  ? 6.540   -17.937 -4.474  1.00 60.43 ? 19  LYS C CE   1  
ATOM 5044   N NZ   . LYS C 1 19  ? 7.140   -19.140 -3.841  1.00 32.40 ? 19  LYS C NZ   1  
ATOM 5045   H H    . LYS C 1 19  ? 4.494   -13.079 -3.884  1.00 54.33 ? 19  LYS C H    1  
ATOM 5046   H HA   . LYS C 1 19  ? 7.010   -13.864 -2.789  1.00 21.44 ? 19  LYS C HA   1  
ATOM 5047   H HB2  . LYS C 1 19  ? 5.943   -14.453 -5.585  1.00 42.13 ? 19  LYS C HB2  1  
ATOM 5048   H HB3  . LYS C 1 19  ? 7.224   -15.317 -4.734  1.00 11.13 ? 19  LYS C HB3  1  
ATOM 5049   H HG2  . LYS C 1 19  ? 4.655   -15.274 -3.266  1.00 40.34 ? 19  LYS C HG2  1  
ATOM 5050   H HG3  . LYS C 1 19  ? 4.550   -16.069 -4.831  1.00 11.13 ? 19  LYS C HG3  1  
ATOM 5051   H HD2  . LYS C 1 19  ? 6.575   -16.759 -2.675  1.00 61.52 ? 19  LYS C HD2  1  
ATOM 5052   H HD3  . LYS C 1 19  ? 5.060   -17.619 -2.951  1.00 22.15 ? 19  LYS C HD3  1  
ATOM 5053   H HE2  . LYS C 1 19  ? 5.813   -18.256 -5.214  1.00 74.30 ? 19  LYS C HE2  1  
ATOM 5054   H HE3  . LYS C 1 19  ? 7.324   -17.371 -4.963  1.00 42.51 ? 19  LYS C HE3  1  
ATOM 5055   H HZ1  . LYS C 1 19  ? 8.083   -18.925 -3.471  1.00 74.11 ? 19  LYS C HZ1  1  
ATOM 5056   H HZ2  . LYS C 1 19  ? 7.210   -19.914 -4.528  1.00 51.22 ? 19  LYS C HZ2  1  
ATOM 5057   H HZ3  . LYS C 1 19  ? 6.537   -19.460 -3.056  1.00 14.15 ? 19  LYS C HZ3  1  
ATOM 5058   N N    . ASP C 1 20  ? 6.965   -11.781 -5.308  1.00 61.13 ? 20  ASP C N    1  
ATOM 5059   C CA   . ASP C 1 20  ? 7.713   -10.859 -6.147  1.00 42.04 ? 20  ASP C CA   1  
ATOM 5060   C C    . ASP C 1 20  ? 6.844   -9.641  -6.472  1.00 34.30 ? 20  ASP C C    1  
ATOM 5061   O O    . ASP C 1 20  ? 5.608   -9.726  -6.507  1.00 72.30 ? 20  ASP C O    1  
ATOM 5062   C CB   . ASP C 1 20  ? 8.192   -11.580 -7.432  1.00 63.01 ? 20  ASP C CB   1  
ATOM 5063   C CG   . ASP C 1 20  ? 8.982   -10.690 -8.412  1.00 21.02 ? 20  ASP C CG   1  
ATOM 5064   O OD1  . ASP C 1 20  ? 8.360   -10.103 -9.326  1.00 23.32 ? 20  ASP C OD1  1  
ATOM 5065   O OD2  . ASP C 1 20  ? 10.221  -10.594 -8.285  1.00 64.41 ? 20  ASP C OD2  1  
ATOM 5066   H H    . ASP C 1 20  ? 5.985   -11.757 -5.351  1.00 24.32 ? 20  ASP C H    1  
ATOM 5067   H HA   . ASP C 1 20  ? 8.581   -10.522 -5.581  1.00 2.02  ? 20  ASP C HA   1  
ATOM 5068   H HB2  . ASP C 1 20  ? 8.823   -12.411 -7.143  1.00 23.54 ? 20  ASP C HB2  1  
ATOM 5069   H HB3  . ASP C 1 20  ? 7.326   -11.980 -7.948  1.00 14.04 ? 20  ASP C HB3  1  
ATOM 5070   N N    . ILE C 1 21  ? 7.517   -8.511  -6.665  1.00 14.50 ? 21  ILE C N    1  
ATOM 5071   C CA   . ILE C 1 21  ? 6.930   -7.234  -7.076  1.00 0.24  ? 21  ILE C CA   1  
ATOM 5072   C C    . ILE C 1 21  ? 7.888   -6.626  -8.107  1.00 3.15  ? 21  ILE C C    1  
ATOM 5073   O O    . ILE C 1 21  ? 9.103   -6.850  -8.023  1.00 63.42 ? 21  ILE C O    1  
ATOM 5074   C CB   . ILE C 1 21  ? 6.775   -6.226  -5.863  1.00 42.54 ? 21  ILE C CB   1  
ATOM 5075   C CG1  . ILE C 1 21  ? 5.953   -6.862  -4.695  1.00 53.04 ? 21  ILE C CG1  1  
ATOM 5076   C CG2  . ILE C 1 21  ? 6.137   -4.892  -6.331  1.00 53.12 ? 21  ILE C CG2  1  
ATOM 5077   C CD1  . ILE C 1 21  ? 5.811   -5.996  -3.455  1.00 11.23 ? 21  ILE C CD1  1  
ATOM 5078   H H    . ILE C 1 21  ? 8.491   -8.541  -6.550  1.00 71.13 ? 21  ILE C H    1  
ATOM 5079   H HA   . ILE C 1 21  ? 5.955   -7.410  -7.535  1.00 55.14 ? 21  ILE C HA   1  
ATOM 5080   H HB   . ILE C 1 21  ? 7.777   -5.997  -5.488  1.00 13.23 ? 21  ILE C HB   1  
ATOM 5081   H HG12 . ILE C 1 21  ? 4.953   -7.092  -5.042  1.00 22.15 ? 21  ILE C HG12 1  
ATOM 5082   H HG13 . ILE C 1 21  ? 6.431   -7.785  -4.388  1.00 20.11 ? 21  ILE C HG13 1  
ATOM 5083   H HG21 . ILE C 1 21  ? 6.192   -4.168  -5.538  1.00 11.54 ? 21  ILE C HG21 1  
ATOM 5084   H HG22 . ILE C 1 21  ? 5.100   -5.048  -6.599  1.00 52.41 ? 21  ILE C HG22 1  
ATOM 5085   H HG23 . ILE C 1 21  ? 6.671   -4.505  -7.191  1.00 20.13 ? 21  ILE C HG23 1  
ATOM 5086   H HD11 . ILE C 1 21  ? 5.281   -5.095  -3.705  1.00 4.42  ? 21  ILE C HD11 1  
ATOM 5087   H HD12 . ILE C 1 21  ? 6.785   -5.743  -3.072  1.00 14.24 ? 21  ILE C HD12 1  
ATOM 5088   H HD13 . ILE C 1 21  ? 5.256   -6.539  -2.702  1.00 2.43  ? 21  ILE C HD13 1  
ATOM 5089   N N    . SER C 1 22  ? 7.354   -5.860  -9.061  1.00 24.22 ? 22  SER C N    1  
ATOM 5090   C CA   . SER C 1 22  ? 8.159   -5.139  -10.038 1.00 14.24 ? 22  SER C CA   1  
ATOM 5091   C C    . SER C 1 22  ? 7.350   -4.002  -10.678 1.00 52.32 ? 22  SER C C    1  
ATOM 5092   O O    . SER C 1 22  ? 6.111   -4.051  -10.748 1.00 65.22 ? 22  SER C O    1  
ATOM 5093   C CB   . SER C 1 22  ? 8.716   -6.097  -11.128 1.00 4.42  ? 22  SER C CB   1  
ATOM 5094   O OG   . SER C 1 22  ? 9.653   -5.434  -11.971 1.00 14.25 ? 22  SER C OG   1  
ATOM 5095   H H    . SER C 1 22  ? 6.380   -5.779  -9.110  1.00 3.32  ? 22  SER C H    1  
ATOM 5096   H HA   . SER C 1 22  ? 8.991   -4.696  -9.491  1.00 32.30 ? 22  SER C HA   1  
ATOM 5097   H HB2  . SER C 1 22  ? 9.217   -6.931  -10.654 1.00 13.25 ? 22  SER C HB2  1  
ATOM 5098   H HB3  . SER C 1 22  ? 7.905   -6.475  -11.742 1.00 1.32  ? 22  SER C HB3  1  
ATOM 5099   H HG   . SER C 1 22  ? 10.340  -5.026  -11.426 1.00 44.43 ? 22  SER C HG   1  
ATOM 5100   N N    . PHE C 1 23  ? 8.074   -2.967  -11.104 1.00 45.14 ? 23  PHE C N    1  
ATOM 5101   C CA   . PHE C 1 23  ? 7.538   -1.850  -11.885 1.00 73.54 ? 23  PHE C CA   1  
ATOM 5102   C C    . PHE C 1 23  ? 8.639   -1.374  -12.830 1.00 4.21  ? 23  PHE C C    1  
ATOM 5103   O O    . PHE C 1 23  ? 9.812   -1.386  -12.461 1.00 32.33 ? 23  PHE C O    1  
ATOM 5104   C CB   . PHE C 1 23  ? 7.079   -0.689  -10.957 1.00 3.24  ? 23  PHE C CB   1  
ATOM 5105   C CG   . PHE C 1 23  ? 6.441   0.503   -11.688 1.00 73.31 ? 23  PHE C CG   1  
ATOM 5106   C CD1  . PHE C 1 23  ? 7.146   1.691   -11.900 1.00 1.15  ? 23  PHE C CD1  1  
ATOM 5107   C CD2  . PHE C 1 23  ? 5.135   0.422   -12.177 1.00 31.24 ? 23  PHE C CD2  1  
ATOM 5108   C CE1  . PHE C 1 23  ? 6.565   2.749   -12.573 1.00 42.12 ? 23  PHE C CE1  1  
ATOM 5109   C CE2  . PHE C 1 23  ? 4.556   1.483   -12.848 1.00 32.32 ? 23  PHE C CE2  1  
ATOM 5110   C CZ   . PHE C 1 23  ? 5.271   2.645   -13.046 1.00 45.43 ? 23  PHE C CZ   1  
ATOM 5111   H H    . PHE C 1 23  ? 9.035   -2.958  -10.894 1.00 12.11 ? 23  PHE C H    1  
ATOM 5112   H HA   . PHE C 1 23  ? 6.688   -2.207  -12.472 1.00 63.12 ? 23  PHE C HA   1  
ATOM 5113   H HB2  . PHE C 1 23  ? 6.348   -1.077  -10.257 1.00 64.31 ? 23  PHE C HB2  1  
ATOM 5114   H HB3  . PHE C 1 23  ? 7.933   -0.327  -10.389 1.00 33.01 ? 23  PHE C HB3  1  
ATOM 5115   H HD1  . PHE C 1 23  ? 8.162   1.781   -11.533 1.00 5.25  ? 23  PHE C HD1  1  
ATOM 5116   H HD2  . PHE C 1 23  ? 4.569   -0.490  -12.025 1.00 33.34 ? 23  PHE C HD2  1  
ATOM 5117   H HE1  . PHE C 1 23  ? 7.124   3.661   -12.729 1.00 52.15 ? 23  PHE C HE1  1  
ATOM 5118   H HE2  . PHE C 1 23  ? 3.542   1.399   -13.220 1.00 3.04  ? 23  PHE C HE2  1  
ATOM 5119   H HZ   . PHE C 1 23  ? 4.819   3.473   -13.571 1.00 13.31 ? 23  PHE C HZ   1  
ATOM 5120   N N    . GLU C 1 24  ? 8.258   -1.003  -14.051 1.00 41.54 ? 24  GLU C N    1  
ATOM 5121   C CA   . GLU C 1 24  ? 9.140   -0.331  -15.009 1.00 43.03 ? 24  GLU C CA   1  
ATOM 5122   C C    . GLU C 1 24  ? 8.406   0.868   -15.613 1.00 12.04 ? 24  GLU C C    1  
ATOM 5123   O O    . GLU C 1 24  ? 7.174   0.872   -15.737 1.00 52.15 ? 24  GLU C O    1  
ATOM 5124   C CB   . GLU C 1 24  ? 9.577   -1.274  -16.160 1.00 40.22 ? 24  GLU C CB   1  
ATOM 5125   C CG   . GLU C 1 24  ? 10.425  -2.492  -15.752 1.00 74.22 ? 24  GLU C CG   1  
ATOM 5126   C CD   . GLU C 1 24  ? 10.889  -3.301  -16.974 1.00 11.11 ? 24  GLU C CD   1  
ATOM 5127   O OE1  . GLU C 1 24  ? 12.088  -3.256  -17.322 1.00 53.43 ? 24  GLU C OE1  1  
ATOM 5128   O OE2  . GLU C 1 24  ? 10.042  -3.951  -17.621 1.00 75.42 ? 24  GLU C OE2  1  
ATOM 5129   H H    . GLU C 1 24  ? 7.343   -1.190  -14.325 1.00 54.31 ? 24  GLU C H    1  
ATOM 5130   H HA   . GLU C 1 24  ? 10.025  0.027   -14.480 1.00 11.51 ? 24  GLU C HA   1  
ATOM 5131   H HB2  . GLU C 1 24  ? 8.683   -1.645  -16.653 1.00 12.24 ? 24  GLU C HB2  1  
ATOM 5132   H HB3  . GLU C 1 24  ? 10.146  -0.697  -16.883 1.00 63.43 ? 24  GLU C HB3  1  
ATOM 5133   H HG2  . GLU C 1 24  ? 11.292  -2.149  -15.190 1.00 54.42 ? 24  GLU C HG2  1  
ATOM 5134   H HG3  . GLU C 1 24  ? 9.830   -3.135  -15.113 1.00 25.23 ? 24  GLU C HG3  1  
ATOM 5135   N N    . ALA C 1 25  ? 9.191   1.867   -15.986 1.00 72.32 ? 25  ALA C N    1  
ATOM 5136   C CA   . ALA C 1 25  ? 8.743   3.017   -16.754 1.00 32.33 ? 25  ALA C CA   1  
ATOM 5137   C C    . ALA C 1 25  ? 9.943   3.489   -17.598 1.00 51.42 ? 25  ALA C C    1  
ATOM 5138   O O    . ALA C 1 25  ? 10.689  4.384   -17.183 1.00 62.44 ? 25  ALA C O    1  
ATOM 5139   C CB   . ALA C 1 25  ? 8.184   4.111   -15.820 1.00 50.30 ? 25  ALA C CB   1  
ATOM 5140   H H    . ALA C 1 25  ? 10.133  1.834   -15.720 1.00 11.12 ? 25  ALA C H    1  
ATOM 5141   H HA   . ALA C 1 25  ? 7.947   2.701   -17.429 1.00 15.21 ? 25  ALA C HA   1  
ATOM 5142   H HB1  . ALA C 1 25  ? 7.363   3.711   -15.239 1.00 54.04 ? 25  ALA C HB1  1  
ATOM 5143   H HB2  . ALA C 1 25  ? 7.827   4.946   -16.408 1.00 31.45 ? 25  ALA C HB2  1  
ATOM 5144   H HB3  . ALA C 1 25  ? 8.962   4.457   -15.152 1.00 40.10 ? 25  ALA C HB3  1  
ATOM 5145   N N    . PRO C 1 26  ? 10.210  2.810   -18.767 1.00 34.32 ? 26  PRO C N    1  
ATOM 5146   C CA   . PRO C 1 26  ? 11.359  3.149   -19.640 1.00 75.44 ? 26  PRO C CA   1  
ATOM 5147   C C    . PRO C 1 26  ? 11.180  4.527   -20.311 1.00 1.33  ? 26  PRO C C    1  
ATOM 5148   O O    . PRO C 1 26  ? 12.140  5.286   -20.483 1.00 45.24 ? 26  PRO C O    1  
ATOM 5149   C CB   . PRO C 1 26  ? 11.379  1.988   -20.674 1.00 22.11 ? 26  PRO C CB   1  
ATOM 5150   C CG   . PRO C 1 26  ? 9.973   1.465   -20.709 1.00 43.15 ? 26  PRO C CG   1  
ATOM 5151   C CD   . PRO C 1 26  ? 9.427   1.654   -19.309 1.00 62.45 ? 26  PRO C CD   1  
ATOM 5152   H HA   . PRO C 1 26  ? 12.292  3.148   -19.078 1.00 61.33 ? 26  PRO C HA   1  
ATOM 5153   H HB2  . PRO C 1 26  ? 11.692  2.346   -21.653 1.00 72.42 ? 26  PRO C HB2  1  
ATOM 5154   H HB3  . PRO C 1 26  ? 12.055  1.207   -20.343 1.00 63.31 ? 26  PRO C HB3  1  
ATOM 5155   H HG2  . PRO C 1 26  ? 9.386   2.032   -21.429 1.00 74.03 ? 26  PRO C HG2  1  
ATOM 5156   H HG3  . PRO C 1 26  ? 9.966   0.412   -20.974 1.00 43.31 ? 26  PRO C HG3  1  
ATOM 5157   H HD2  . PRO C 1 26  ? 8.369   1.887   -19.342 1.00 42.33 ? 26  PRO C HD2  1  
ATOM 5158   H HD3  . PRO C 1 26  ? 9.594   0.765   -18.708 1.00 53.34 ? 26  PRO C HD3  1  
ATOM 5159   N N    . ASN C 1 27  ? 9.919   4.851   -20.645 1.00 42.10 ? 27  ASN C N    1  
ATOM 5160   C CA   . ASN C 1 27  ? 9.535   6.104   -21.322 1.00 40.43 ? 27  ASN C CA   1  
ATOM 5161   C C    . ASN C 1 27  ? 8.928   7.083   -20.290 1.00 53.42 ? 27  ASN C C    1  
ATOM 5162   O O    . ASN C 1 27  ? 8.059   7.894   -20.625 1.00 74.01 ? 27  ASN C O    1  
ATOM 5163   C CB   . ASN C 1 27  ? 8.515   5.781   -22.459 1.00 22.15 ? 27  ASN C CB   1  
ATOM 5164   C CG   . ASN C 1 27  ? 9.041   4.798   -23.526 1.00 41.33 ? 27  ASN C CG   1  
ATOM 5165   O OD1  . ASN C 1 27  ? 9.858   3.924   -23.252 1.00 33.54 ? 27  ASN C OD1  1  
ATOM 5166   N ND2  . ASN C 1 27  ? 8.565   4.918   -24.744 1.00 4.43  ? 27  ASN C ND2  1  
ATOM 5167   H H    . ASN C 1 27  ? 9.209   4.218   -20.418 1.00 12.04 ? 27  ASN C H    1  
ATOM 5168   H HA   . ASN C 1 27  ? 10.421  6.564   -21.758 1.00 23.42 ? 27  ASN C HA   1  
ATOM 5169   H HB2  . ASN C 1 27  ? 7.620   5.348   -22.023 1.00 54.03 ? 27  ASN C HB2  1  
ATOM 5170   H HB3  . ASN C 1 27  ? 8.243   6.709   -22.954 1.00 72.24 ? 27  ASN C HB3  1  
ATOM 5171   H HD21 . ASN C 1 27  ? 7.910   5.614   -24.919 1.00 13.35 ? 27  ASN C HD21 1  
ATOM 5172   H HD22 . ASN C 1 27  ? 8.892   4.295   -25.430 1.00 61.14 ? 27  ASN C HD22 1  
ATOM 5173   N N    . ALA C 1 28  ? 9.429   6.995   -19.038 1.00 11.15 ? 28  ALA C N    1  
ATOM 5174   C CA   . ALA C 1 28  ? 8.927   7.763   -17.880 1.00 4.31  ? 28  ALA C CA   1  
ATOM 5175   C C    . ALA C 1 28  ? 9.009   9.312   -18.046 1.00 14.20 ? 28  ALA C C    1  
ATOM 5176   O O    . ALA C 1 28  ? 8.009   9.978   -17.803 1.00 4.42  ? 28  ALA C O    1  
ATOM 5177   C CB   . ALA C 1 28  ? 9.626   7.295   -16.602 1.00 21.55 ? 28  ALA C CB   1  
ATOM 5178   H H    . ALA C 1 28  ? 10.174  6.375   -18.883 1.00 25.12 ? 28  ALA C H    1  
ATOM 5179   H HA   . ALA C 1 28  ? 7.878   7.494   -17.776 1.00 72.31 ? 28  ALA C HA   1  
ATOM 5180   H HB1  . ALA C 1 28  ? 9.155   7.743   -15.737 1.00 43.33 ? 28  ALA C HB1  1  
ATOM 5181   H HB2  . ALA C 1 28  ? 10.670  7.577   -16.625 1.00 10.50 ? 28  ALA C HB2  1  
ATOM 5182   H HB3  . ALA C 1 28  ? 9.555   6.221   -16.525 1.00 42.22 ? 28  ALA C HB3  1  
ATOM 5183   N N    . PRO C 1 29  ? 10.182  9.940   -18.427 1.00 71.33 ? 29  PRO C N    1  
ATOM 5184   C CA   . PRO C 1 29  ? 10.224  11.407  -18.699 1.00 53.30 ? 29  PRO C CA   1  
ATOM 5185   C C    . PRO C 1 29  ? 9.492   11.749  -20.016 1.00 62.54 ? 29  PRO C C    1  
ATOM 5186   O O    . PRO C 1 29  ? 8.811   12.775  -20.132 1.00 31.42 ? 29  PRO C O    1  
ATOM 5187   C CB   . PRO C 1 29  ? 11.745  11.729  -18.792 1.00 11.54 ? 29  PRO C CB   1  
ATOM 5188   C CG   . PRO C 1 29  ? 12.443  10.510  -18.251 1.00 1.22  ? 29  PRO C CG   1  
ATOM 5189   C CD   . PRO C 1 29  ? 11.543  9.345   -18.584 1.00 12.11 ? 29  PRO C CD   1  
ATOM 5190   H HA   . PRO C 1 29  ? 9.776   11.970  -17.879 1.00 35.11 ? 29  PRO C HA   1  
ATOM 5191   H HB2  . PRO C 1 29  ? 12.041  11.920  -19.829 1.00 62.11 ? 29  PRO C HB2  1  
ATOM 5192   H HB3  . PRO C 1 29  ? 11.981  12.594  -18.186 1.00 11.15 ? 29  PRO C HB3  1  
ATOM 5193   H HG2  . PRO C 1 29  ? 13.414  10.395  -18.722 1.00 53.52 ? 29  PRO C HG2  1  
ATOM 5194   H HG3  . PRO C 1 29  ? 12.560  10.589  -17.173 1.00 44.45 ? 29  PRO C HG3  1  
ATOM 5195   H HD2  . PRO C 1 29  ? 11.704  9.003   -19.604 1.00 32.41 ? 29  PRO C HD2  1  
ATOM 5196   H HD3  . PRO C 1 29  ? 11.694  8.528   -17.887 1.00 2.23  ? 29  PRO C HD3  1  
ATOM 5197   N N    . HIS C 1 30  ? 9.633   10.816  -20.974 1.00 50.54 ? 30  HIS C N    1  
ATOM 5198   C CA   . HIS C 1 30  ? 9.079   10.881  -22.340 1.00 41.34 ? 30  HIS C CA   1  
ATOM 5199   C C    . HIS C 1 30  ? 7.527   10.919  -22.360 1.00 60.32 ? 30  HIS C C    1  
ATOM 5200   O O    . HIS C 1 30  ? 6.928   11.369  -23.341 1.00 3.42  ? 30  HIS C O    1  
ATOM 5201   C CB   . HIS C 1 30  ? 9.629   9.669   -23.140 1.00 62.22 ? 30  HIS C CB   1  
ATOM 5202   C CG   . HIS C 1 30  ? 9.113   9.524   -24.548 1.00 23.10 ? 30  HIS C CG   1  
ATOM 5203   N ND1  . HIS C 1 30  ? 9.169   10.530  -25.480 1.00 55.30 ? 30  HIS C ND1  1  
ATOM 5204   C CD2  . HIS C 1 30  ? 8.490   8.494   -25.158 1.00 62.03 ? 30  HIS C CD2  1  
ATOM 5205   C CE1  . HIS C 1 30  ? 8.601   10.126  -26.595 1.00 14.15 ? 30  HIS C CE1  1  
ATOM 5206   N NE2  . HIS C 1 30  ? 8.186   8.899   -26.423 1.00 73.21 ? 30  HIS C NE2  1  
ATOM 5207   H H    . HIS C 1 30  ? 10.159  10.021  -20.747 1.00 40.31 ? 30  HIS C H    1  
ATOM 5208   H HA   . HIS C 1 30  ? 9.448   11.795  -22.799 1.00 62.23 ? 30  HIS C HA   1  
ATOM 5209   H HB2  . HIS C 1 30  ? 10.704  9.754   -23.205 1.00 75.24 ? 30  HIS C HB2  1  
ATOM 5210   H HB3  . HIS C 1 30  ? 9.389   8.758   -22.604 1.00 74.44 ? 30  HIS C HB3  1  
ATOM 5211   H HD1  . HIS C 1 30  ? 9.598   11.398  -25.356 1.00 72.33 ? 30  HIS C HD1  1  
ATOM 5212   H HD2  . HIS C 1 30  ? 8.263   7.527   -24.721 1.00 41.43 ? 30  HIS C HD2  1  
ATOM 5213   H HE1  . HIS C 1 30  ? 8.460   10.718  -27.483 1.00 43.40 ? 30  HIS C HE1  1  
ATOM 5214   H HE2  . HIS C 1 30  ? 7.796   8.337   -27.120 1.00 37.99 ? 30  HIS C HE2  1  
ATOM 5215   N N    . VAL C 1 31  ? 6.890   10.416  -21.285 1.00 44.33 ? 31  VAL C N    1  
ATOM 5216   C CA   . VAL C 1 31  ? 5.411   10.322  -21.181 1.00 64.01 ? 31  VAL C CA   1  
ATOM 5217   C C    . VAL C 1 31  ? 4.708   11.705  -21.250 1.00 53.35 ? 31  VAL C C    1  
ATOM 5218   O O    . VAL C 1 31  ? 3.514   11.780  -21.556 1.00 35.13 ? 31  VAL C O    1  
ATOM 5219   C CB   . VAL C 1 31  ? 4.981   9.558   -19.869 1.00 72.31 ? 31  VAL C CB   1  
ATOM 5220   C CG1  . VAL C 1 31  ? 5.067   10.451  -18.609 1.00 1.32  ? 31  VAL C CG1  1  
ATOM 5221   C CG2  . VAL C 1 31  ? 3.580   8.931   -20.016 1.00 21.13 ? 31  VAL C CG2  1  
ATOM 5222   H H    . VAL C 1 31  ? 7.431   10.084  -20.537 1.00 43.31 ? 31  VAL C H    1  
ATOM 5223   H HA   . VAL C 1 31  ? 5.077   9.736   -22.035 1.00 54.12 ? 31  VAL C HA   1  
ATOM 5224   H HB   . VAL C 1 31  ? 5.686   8.740   -19.728 1.00 24.05 ? 31  VAL C HB   1  
ATOM 5225   H HG11 . VAL C 1 31  ? 4.370   11.277  -18.693 1.00 21.51 ? 31  VAL C HG11 1  
ATOM 5226   H HG12 . VAL C 1 31  ? 6.070   10.846  -18.510 1.00 62.50 ? 31  VAL C HG12 1  
ATOM 5227   H HG13 . VAL C 1 31  ? 4.827   9.870   -17.729 1.00 43.14 ? 31  VAL C HG13 1  
ATOM 5228   H HG21 . VAL C 1 31  ? 3.324   8.389   -19.113 1.00 24.24 ? 31  VAL C HG21 1  
ATOM 5229   H HG22 . VAL C 1 31  ? 3.569   8.244   -20.852 1.00 63.32 ? 31  VAL C HG22 1  
ATOM 5230   H HG23 . VAL C 1 31  ? 2.842   9.707   -20.185 1.00 64.11 ? 31  VAL C HG23 1  
ATOM 5231   N N    . PHE C 1 32  ? 5.466   12.783  -20.968 1.00 74.11 ? 32  PHE C N    1  
ATOM 5232   C CA   . PHE C 1 32  ? 4.961   14.174  -21.028 1.00 52.54 ? 32  PHE C CA   1  
ATOM 5233   C C    . PHE C 1 32  ? 4.526   14.539  -22.465 1.00 33.44 ? 32  PHE C C    1  
ATOM 5234   O O    . PHE C 1 32  ? 3.497   15.192  -22.671 1.00 20.34 ? 32  PHE C O    1  
ATOM 5235   C CB   . PHE C 1 32  ? 6.056   15.174  -20.533 1.00 25.12 ? 32  PHE C CB   1  
ATOM 5236   C CG   . PHE C 1 32  ? 6.419   15.131  -19.033 1.00 44.20 ? 32  PHE C CG   1  
ATOM 5237   C CD1  . PHE C 1 32  ? 7.009   16.242  -18.408 1.00 23.12 ? 32  PHE C CD1  1  
ATOM 5238   C CD2  . PHE C 1 32  ? 6.179   14.001  -18.250 1.00 5.51  ? 32  PHE C CD2  1  
ATOM 5239   C CE1  . PHE C 1 32  ? 7.341   16.213  -17.061 1.00 64.03 ? 32  PHE C CE1  1  
ATOM 5240   C CE2  . PHE C 1 32  ? 6.510   13.975  -16.912 1.00 70.34 ? 32  PHE C CE2  1  
ATOM 5241   C CZ   . PHE C 1 32  ? 7.088   15.081  -16.316 1.00 64.44 ? 32  PHE C CZ   1  
ATOM 5242   H H    . PHE C 1 32  ? 6.395   12.637  -20.698 1.00 73.41 ? 32  PHE C H    1  
ATOM 5243   H HA   . PHE C 1 32  ? 4.097   14.241  -20.374 1.00 4.35  ? 32  PHE C HA   1  
ATOM 5244   H HB2  . PHE C 1 32  ? 6.969   14.988  -21.083 1.00 32.05 ? 32  PHE C HB2  1  
ATOM 5245   H HB3  . PHE C 1 32  ? 5.725   16.184  -20.758 1.00 41.25 ? 32  PHE C HB3  1  
ATOM 5246   H HD1  . PHE C 1 32  ? 7.208   17.135  -18.987 1.00 70.34 ? 32  PHE C HD1  1  
ATOM 5247   H HD2  . PHE C 1 32  ? 5.726   13.128  -18.703 1.00 60.30 ? 32  PHE C HD2  1  
ATOM 5248   H HE1  . PHE C 1 32  ? 7.797   17.077  -16.595 1.00 41.11 ? 32  PHE C HE1  1  
ATOM 5249   H HE2  . PHE C 1 32  ? 6.306   13.086  -16.324 1.00 30.42 ? 32  PHE C HE2  1  
ATOM 5250   H HZ   . PHE C 1 32  ? 7.346   15.055  -15.264 1.00 75.44 ? 32  PHE C HZ   1  
ATOM 5251   N N    . GLN C 1 33  ? 5.324   14.088  -23.454 1.00 15.21 ? 33  GLN C N    1  
ATOM 5252   C CA   . GLN C 1 33  ? 5.089   14.357  -24.892 1.00 30.14 ? 33  GLN C CA   1  
ATOM 5253   C C    . GLN C 1 33  ? 4.362   13.155  -25.558 1.00 21.33 ? 33  GLN C C    1  
ATOM 5254   O O    . GLN C 1 33  ? 4.414   12.975  -26.777 1.00 74.41 ? 33  GLN C O    1  
ATOM 5255   C CB   . GLN C 1 33  ? 6.452   14.676  -25.585 1.00 44.41 ? 33  GLN C CB   1  
ATOM 5256   C CG   . GLN C 1 33  ? 7.436   13.496  -25.635 1.00 63.25 ? 33  GLN C CG   1  
ATOM 5257   C CD   . GLN C 1 33  ? 8.804   13.851  -26.223 1.00 41.43 ? 33  GLN C CD   1  
ATOM 5258   O OE1  . GLN C 1 33  ? 9.010   13.795  -27.432 1.00 65.43 ? 33  GLN C OE1  1  
ATOM 5259   N NE2  . GLN C 1 33  ? 9.752   14.185  -25.367 1.00 14.21 ? 33  GLN C NE2  1  
ATOM 5260   H H    . GLN C 1 33  ? 6.100   13.549  -23.204 1.00 70.50 ? 33  GLN C H    1  
ATOM 5261   H HA   . GLN C 1 33  ? 4.444   15.230  -24.979 1.00 62.45 ? 33  GLN C HA   1  
ATOM 5262   H HB2  . GLN C 1 33  ? 6.260   15.005  -26.602 1.00 43.14 ? 33  GLN C HB2  1  
ATOM 5263   H HB3  . GLN C 1 33  ? 6.930   15.491  -25.051 1.00 62.43 ? 33  GLN C HB3  1  
ATOM 5264   H HG2  . GLN C 1 33  ? 7.573   13.121  -24.626 1.00 34.10 ? 33  GLN C HG2  1  
ATOM 5265   H HG3  . GLN C 1 33  ? 7.002   12.704  -26.237 1.00 12.31 ? 33  GLN C HG3  1  
ATOM 5266   H HE21 . GLN C 1 33  ? 9.534   14.190  -24.413 1.00 20.13 ? 33  GLN C HE21 1  
ATOM 5267   H HE22 . GLN C 1 33  ? 10.634  14.422  -25.721 1.00 4.25  ? 33  GLN C HE22 1  
ATOM 5268   N N    . LYS C 1 34  ? 3.660   12.359  -24.734 1.00 1.34  ? 34  LYS C N    1  
ATOM 5269   C CA   . LYS C 1 34  ? 2.894   11.175  -25.171 1.00 14.23 ? 34  LYS C CA   1  
ATOM 5270   C C    . LYS C 1 34  ? 1.381   11.459  -25.064 1.00 31.25 ? 34  LYS C C    1  
ATOM 5271   O O    . LYS C 1 34  ? 0.947   12.233  -24.203 1.00 2.10  ? 34  LYS C O    1  
ATOM 5272   C CB   . LYS C 1 34  ? 3.267   9.961   -24.270 1.00 11.34 ? 34  LYS C CB   1  
ATOM 5273   C CG   . LYS C 1 34  ? 2.433   8.679   -24.513 1.00 23.50 ? 34  LYS C CG   1  
ATOM 5274   C CD   . LYS C 1 34  ? 2.584   7.620   -23.395 1.00 73.03 ? 34  LYS C CD   1  
ATOM 5275   C CE   . LYS C 1 34  ? 3.867   6.784   -23.490 1.00 54.41 ? 34  LYS C CE   1  
ATOM 5276   N NZ   . LYS C 1 34  ? 5.126   7.564   -23.348 1.00 32.54 ? 34  LYS C NZ   1  
ATOM 5277   H H    . LYS C 1 34  ? 3.633   12.589  -23.786 1.00 20.15 ? 34  LYS C H    1  
ATOM 5278   H HA   . LYS C 1 34  ? 3.146   10.944  -26.206 1.00 72.25 ? 34  LYS C HA   1  
ATOM 5279   H HB2  . LYS C 1 34  ? 4.311   9.721   -24.432 1.00 11.32 ? 34  LYS C HB2  1  
ATOM 5280   H HB3  . LYS C 1 34  ? 3.144   10.250  -23.230 1.00 64.35 ? 34  LYS C HB3  1  
ATOM 5281   H HG2  . LYS C 1 34  ? 1.386   8.961   -24.577 1.00 62.33 ? 34  LYS C HG2  1  
ATOM 5282   H HG3  . LYS C 1 34  ? 2.727   8.240   -25.463 1.00 61.00 ? 34  LYS C HG3  1  
ATOM 5283   H HD2  . LYS C 1 34  ? 2.569   8.118   -22.434 1.00 15.03 ? 34  LYS C HD2  1  
ATOM 5284   H HD3  . LYS C 1 34  ? 1.734   6.950   -23.448 1.00 21.54 ? 34  LYS C HD3  1  
ATOM 5285   H HE2  . LYS C 1 34  ? 3.849   6.040   -22.707 1.00 34.20 ? 34  LYS C HE2  1  
ATOM 5286   H HE3  . LYS C 1 34  ? 3.881   6.276   -24.445 1.00 2.11  ? 34  LYS C HE3  1  
ATOM 5287   H HZ1  . LYS C 1 34  ? 5.942   6.920   -23.411 1.00 75.45 ? 34  LYS C HZ1  1  
ATOM 5288   H HZ2  . LYS C 1 34  ? 5.145   8.043   -22.435 1.00 2.14  ? 34  LYS C HZ2  1  
ATOM 5289   H HZ3  . LYS C 1 34  ? 5.204   8.270   -24.113 1.00 72.11 ? 34  LYS C HZ3  1  
ATOM 5290   N N    . ASP C 1 35  ? 0.598   10.809  -25.943 1.00 41.14 ? 35  ASP C N    1  
ATOM 5291   C CA   . ASP C 1 35  ? -0.870  10.806  -25.875 1.00 51.51 ? 35  ASP C CA   1  
ATOM 5292   C C    . ASP C 1 35  ? -1.316  9.806   -24.797 1.00 3.15  ? 35  ASP C C    1  
ATOM 5293   O O    . ASP C 1 35  ? -0.918  8.630   -24.821 1.00 3.13  ? 35  ASP C O    1  
ATOM 5294   C CB   . ASP C 1 35  ? -1.475  10.423  -27.250 1.00 25.42 ? 35  ASP C CB   1  
ATOM 5295   C CG   . ASP C 1 35  ? -3.017  10.519  -27.276 1.00 1.12  ? 35  ASP C CG   1  
ATOM 5296   O OD1  . ASP C 1 35  ? -3.554  11.625  -27.528 1.00 3.21  ? 35  ASP C OD1  1  
ATOM 5297   O OD2  . ASP C 1 35  ? -3.697  9.504   -27.029 1.00 4.13  ? 35  ASP C OD2  1  
ATOM 5298   H H    . ASP C 1 35  ? 1.028   10.294  -26.651 1.00 70.30 ? 35  ASP C H    1  
ATOM 5299   H HA   . ASP C 1 35  ? -1.203  11.811  -25.606 1.00 11.43 ? 35  ASP C HA   1  
ATOM 5300   H HB2  . ASP C 1 35  ? -1.072  11.091  -28.007 1.00 44.13 ? 35  ASP C HB2  1  
ATOM 5301   H HB3  . ASP C 1 35  ? -1.180  9.406   -27.502 1.00 64.01 ? 35  ASP C HB3  1  
ATOM 5302   N N    . TRP C 1 36  ? -2.131  10.283  -23.852 1.00 3.12  ? 36  TRP C N    1  
ATOM 5303   C CA   . TRP C 1 36  ? -2.586  9.484   -22.706 1.00 32.15 ? 36  TRP C CA   1  
ATOM 5304   C C    . TRP C 1 36  ? -3.827  8.648   -23.104 1.00 25.25 ? 36  TRP C C    1  
ATOM 5305   O O    . TRP C 1 36  ? -4.972  9.001   -22.784 1.00 74.43 ? 36  TRP C O    1  
ATOM 5306   C CB   . TRP C 1 36  ? -2.876  10.405  -21.482 1.00 21.22 ? 36  TRP C CB   1  
ATOM 5307   C CG   . TRP C 1 36  ? -1.794  11.429  -21.195 1.00 44.45 ? 36  TRP C CG   1  
ATOM 5308   C CD1  . TRP C 1 36  ? -1.640  12.646  -21.803 1.00 65.33 ? 36  TRP C CD1  1  
ATOM 5309   C CD2  . TRP C 1 36  ? -0.736  11.335  -20.229 1.00 21.35 ? 36  TRP C CD2  1  
ATOM 5310   N NE1  . TRP C 1 36  ? -0.550  13.296  -21.291 1.00 73.10 ? 36  TRP C NE1  1  
ATOM 5311   C CE2  . TRP C 1 36  ? 0.018   12.518  -20.322 1.00 33.30 ? 36  TRP C CE2  1  
ATOM 5312   C CE3  . TRP C 1 36  ? -0.352  10.367  -19.298 1.00 71.12 ? 36  TRP C CE3  1  
ATOM 5313   C CZ2  . TRP C 1 36  ? 1.126   12.759  -19.520 1.00 52.24 ? 36  TRP C CZ2  1  
ATOM 5314   C CZ3  . TRP C 1 36  ? 0.748   10.607  -18.500 1.00 54.50 ? 36  TRP C CZ3  1  
ATOM 5315   C CH2  . TRP C 1 36  ? 1.477   11.796  -18.616 1.00 74.51 ? 36  TRP C CH2  1  
ATOM 5316   H H    . TRP C 1 36  ? -2.437  11.211  -23.928 1.00 55.33 ? 36  TRP C H    1  
ATOM 5317   H HA   . TRP C 1 36  ? -1.786  8.797   -22.436 1.00 14.13 ? 36  TRP C HA   1  
ATOM 5318   H HB2  . TRP C 1 36  ? -3.802  10.946  -21.643 1.00 24.15 ? 36  TRP C HB2  1  
ATOM 5319   H HB3  . TRP C 1 36  ? -2.990  9.788   -20.597 1.00 31.13 ? 36  TRP C HB3  1  
ATOM 5320   H HD1  . TRP C 1 36  ? -2.285  13.021  -22.587 1.00 64.42 ? 36  TRP C HD1  1  
ATOM 5321   H HE1  . TRP C 1 36  ? -0.233  14.181  -21.574 1.00 3.40  ? 36  TRP C HE1  1  
ATOM 5322   H HE3  . TRP C 1 36  ? -0.902  9.441   -19.197 1.00 22.34 ? 36  TRP C HE3  1  
ATOM 5323   H HZ2  . TRP C 1 36  ? 1.699   13.675  -19.597 1.00 25.01 ? 36  TRP C HZ2  1  
ATOM 5324   H HZ3  . TRP C 1 36  ? 1.059   9.866   -17.772 1.00 13.31 ? 36  TRP C HZ3  1  
ATOM 5325   H HH2  . TRP C 1 36  ? 2.334   11.944  -17.969 1.00 51.11 ? 36  TRP C HH2  1  
ATOM 5326   N N    . GLN C 1 37  ? -3.577  7.575   -23.864 1.00 62.03 ? 37  GLN C N    1  
ATOM 5327   C CA   . GLN C 1 37  ? -4.594  6.592   -24.268 1.00 73.01 ? 37  GLN C CA   1  
ATOM 5328   C C    . GLN C 1 37  ? -3.861  5.319   -24.743 1.00 20.21 ? 37  GLN C C    1  
ATOM 5329   O O    . GLN C 1 37  ? -3.625  5.143   -25.945 1.00 14.33 ? 37  GLN C O    1  
ATOM 5330   C CB   . GLN C 1 37  ? -5.546  7.156   -25.370 1.00 3.12  ? 37  GLN C CB   1  
ATOM 5331   C CG   . GLN C 1 37  ? -6.736  6.237   -25.732 1.00 53.23 ? 37  GLN C CG   1  
ATOM 5332   C CD   . GLN C 1 37  ? -7.612  6.762   -26.878 1.00 41.44 ? 37  GLN C CD   1  
ATOM 5333   O OE1  . GLN C 1 37  ? -7.138  7.443   -27.789 1.00 42.22 ? 37  GLN C OE1  1  
ATOM 5334   N NE2  . GLN C 1 37  ? -8.895  6.433   -26.848 1.00 5.51  ? 37  GLN C NE2  1  
ATOM 5335   H H    . GLN C 1 37  ? -2.661  7.437   -24.179 1.00 54.11 ? 37  GLN C H    1  
ATOM 5336   H HA   . GLN C 1 37  ? -5.182  6.340   -23.386 1.00 20.25 ? 37  GLN C HA   1  
ATOM 5337   H HB2  . GLN C 1 37  ? -5.949  8.104   -25.022 1.00 0.12  ? 37  GLN C HB2  1  
ATOM 5338   H HB3  . GLN C 1 37  ? -4.968  7.341   -26.267 1.00 12.23 ? 37  GLN C HB3  1  
ATOM 5339   H HG2  . GLN C 1 37  ? -6.350  5.265   -26.025 1.00 22.14 ? 37  GLN C HG2  1  
ATOM 5340   H HG3  . GLN C 1 37  ? -7.352  6.116   -24.847 1.00 24.22 ? 37  GLN C HG3  1  
ATOM 5341   H HE21 . GLN C 1 37  ? -9.210  5.879   -26.103 1.00 11.41 ? 37  GLN C HE21 1  
ATOM 5342   H HE22 . GLN C 1 37  ? -9.474  6.753   -27.569 1.00 24.44 ? 37  GLN C HE22 1  
ATOM 5343   N N    . PRO C 1 38  ? -3.400  4.454   -23.787 1.00 54.21 ? 38  PRO C N    1  
ATOM 5344   C CA   . PRO C 1 38  ? -2.646  3.237   -24.110 1.00 53.22 ? 38  PRO C CA   1  
ATOM 5345   C C    . PRO C 1 38  ? -3.563  2.029   -24.373 1.00 63.45 ? 38  PRO C C    1  
ATOM 5346   O O    . PRO C 1 38  ? -4.697  1.959   -23.872 1.00 34.13 ? 38  PRO C O    1  
ATOM 5347   C CB   . PRO C 1 38  ? -1.778  3.031   -22.844 1.00 11.21 ? 38  PRO C CB   1  
ATOM 5348   C CG   . PRO C 1 38  ? -2.556  3.650   -21.710 1.00 61.32 ? 38  PRO C CG   1  
ATOM 5349   C CD   . PRO C 1 38  ? -3.599  4.582   -22.320 1.00 50.22 ? 38  PRO C CD   1  
ATOM 5350   H HA   . PRO C 1 38  ? -1.998  3.390   -24.972 1.00 13.41 ? 38  PRO C HA   1  
ATOM 5351   H HB2  . PRO C 1 38  ? -1.601  1.969   -22.669 1.00 65.23 ? 38  PRO C HB2  1  
ATOM 5352   H HB3  . PRO C 1 38  ? -0.826  3.533   -22.956 1.00 50.34 ? 38  PRO C HB3  1  
ATOM 5353   H HG2  . PRO C 1 38  ? -3.040  2.870   -21.128 1.00 14.21 ? 38  PRO C HG2  1  
ATOM 5354   H HG3  . PRO C 1 38  ? -1.888  4.218   -21.068 1.00 10.55 ? 38  PRO C HG3  1  
ATOM 5355   H HD2  . PRO C 1 38  ? -4.600  4.270   -22.044 1.00 52.44 ? 38  PRO C HD2  1  
ATOM 5356   H HD3  . PRO C 1 38  ? -3.430  5.604   -21.998 1.00 32.11 ? 38  PRO C HD3  1  
ATOM 5357   N N    . GLU C 1 39  ? -3.055  1.079   -25.162 1.00 22.25 ? 39  GLU C N    1  
ATOM 5358   C CA   . GLU C 1 39  ? -3.674  -0.234  -25.319 1.00 12.24 ? 39  GLU C CA   1  
ATOM 5359   C C    . GLU C 1 39  ? -3.140  -1.100  -24.176 1.00 2.24  ? 39  GLU C C    1  
ATOM 5360   O O    . GLU C 1 39  ? -2.051  -1.690  -24.266 1.00 4.34  ? 39  GLU C O    1  
ATOM 5361   C CB   . GLU C 1 39  ? -3.335  -0.843  -26.708 1.00 62.33 ? 39  GLU C CB   1  
ATOM 5362   C CG   . GLU C 1 39  ? -3.898  -2.258  -26.959 1.00 50.42 ? 39  GLU C CG   1  
ATOM 5363   C CD   . GLU C 1 39  ? -5.435  -2.312  -26.956 1.00 54.31 ? 39  GLU C CD   1  
ATOM 5364   O OE1  . GLU C 1 39  ? -6.039  -2.715  -25.938 1.00 21.22 ? 39  GLU C OE1  1  
ATOM 5365   O OE2  . GLU C 1 39  ? -6.048  -1.943  -27.979 1.00 10.01 ? 39  GLU C OE2  1  
ATOM 5366   H H    . GLU C 1 39  ? -2.233  1.268   -25.656 1.00 41.25 ? 39  GLU C H    1  
ATOM 5367   H HA   . GLU C 1 39  ? -4.757  -0.131  -25.224 1.00 1.34  ? 39  GLU C HA   1  
ATOM 5368   H HB2  . GLU C 1 39  ? -3.722  -0.185  -27.479 1.00 55.31 ? 39  GLU C HB2  1  
ATOM 5369   H HB3  . GLU C 1 39  ? -2.256  -0.886  -26.809 1.00 64.33 ? 39  GLU C HB3  1  
ATOM 5370   H HG2  . GLU C 1 39  ? -3.539  -2.607  -27.923 1.00 64.12 ? 39  GLU C HG2  1  
ATOM 5371   H HG3  . GLU C 1 39  ? -3.516  -2.922  -26.189 1.00 60.22 ? 39  GLU C HG3  1  
ATOM 5372   N N    . VAL C 1 40  ? -3.861  -1.056  -23.048 1.00 43.21 ? 40  VAL C N    1  
ATOM 5373   C CA   . VAL C 1 40  ? -3.487  -1.795  -21.844 1.00 32.23 ? 40  VAL C CA   1  
ATOM 5374   C C    . VAL C 1 40  ? -3.833  -3.277  -22.038 1.00 31.10 ? 40  VAL C C    1  
ATOM 5375   O O    . VAL C 1 40  ? -4.977  -3.612  -22.320 1.00 75.03 ? 40  VAL C O    1  
ATOM 5376   C CB   . VAL C 1 40  ? -4.183  -1.233  -20.549 1.00 51.44 ? 40  VAL C CB   1  
ATOM 5377   C CG1  . VAL C 1 40  ? -3.688  -1.975  -19.283 1.00 71.24 ? 40  VAL C CG1  1  
ATOM 5378   C CG2  . VAL C 1 40  ? -3.976  0.299   -20.426 1.00 24.31 ? 40  VAL C CG2  1  
ATOM 5379   H H    . VAL C 1 40  ? -4.679  -0.513  -23.035 1.00 50.12 ? 40  VAL C H    1  
ATOM 5380   H HA   . VAL C 1 40  ? -2.406  -1.693  -21.717 1.00 33.00 ? 40  VAL C HA   1  
ATOM 5381   H HB   . VAL C 1 40  ? -5.255  -1.415  -20.639 1.00 23.41 ? 40  VAL C HB   1  
ATOM 5382   H HG11 . VAL C 1 40  ? -2.619  -1.840  -19.167 1.00 61.12 ? 40  VAL C HG11 1  
ATOM 5383   H HG12 . VAL C 1 40  ? -3.903  -3.033  -19.374 1.00 40.21 ? 40  VAL C HG12 1  
ATOM 5384   H HG13 . VAL C 1 40  ? -4.195  -1.591  -18.406 1.00 72.51 ? 40  VAL C HG13 1  
ATOM 5385   H HG21 . VAL C 1 40  ? -4.385  0.790   -21.303 1.00 60.42 ? 40  VAL C HG21 1  
ATOM 5386   H HG22 . VAL C 1 40  ? -2.921  0.527   -20.356 1.00 0.54  ? 40  VAL C HG22 1  
ATOM 5387   H HG23 . VAL C 1 40  ? -4.482  0.672   -19.545 1.00 43.34 ? 40  VAL C HG23 1  
ATOM 5388   N N    . LYS C 1 41  ? -2.814  -4.129  -21.946 1.00 1.21  ? 41  LYS C N    1  
ATOM 5389   C CA   . LYS C 1 41  ? -2.930  -5.582  -22.054 1.00 41.23 ? 41  LYS C CA   1  
ATOM 5390   C C    . LYS C 1 41  ? -2.674  -6.225  -20.676 1.00 42.52 ? 41  LYS C C    1  
ATOM 5391   O O    . LYS C 1 41  ? -1.692  -5.885  -19.999 1.00 22.31 ? 41  LYS C O    1  
ATOM 5392   C CB   . LYS C 1 41  ? -1.882  -6.091  -23.077 1.00 3.52  ? 41  LYS C CB   1  
ATOM 5393   C CG   . LYS C 1 41  ? -1.993  -5.466  -24.489 1.00 53.32 ? 41  LYS C CG   1  
ATOM 5394   C CD   . LYS C 1 41  ? -0.858  -5.949  -25.415 1.00 31.41 ? 41  LYS C CD   1  
ATOM 5395   C CE   . LYS C 1 41  ? -0.964  -5.407  -26.845 1.00 35.24 ? 41  LYS C CE   1  
ATOM 5396   N NZ   . LYS C 1 41  ? 0.096   -5.987  -27.710 1.00 34.12 ? 41  LYS C NZ   1  
ATOM 5397   H H    . LYS C 1 41  ? -1.925  -3.758  -21.810 1.00 70.24 ? 41  LYS C H    1  
ATOM 5398   H HA   . LYS C 1 41  ? -3.932  -5.841  -22.401 1.00 65.20 ? 41  LYS C HA   1  
ATOM 5399   H HB2  . LYS C 1 41  ? -0.886  -5.876  -22.692 1.00 53.04 ? 41  LYS C HB2  1  
ATOM 5400   H HB3  . LYS C 1 41  ? -1.984  -7.165  -23.176 1.00 71.43 ? 41  LYS C HB3  1  
ATOM 5401   H HG2  . LYS C 1 41  ? -2.949  -5.740  -24.925 1.00 62.44 ? 41  LYS C HG2  1  
ATOM 5402   H HG3  . LYS C 1 41  ? -1.939  -4.386  -24.400 1.00 53.11 ? 41  LYS C HG3  1  
ATOM 5403   H HD2  . LYS C 1 41  ? 0.094   -5.633  -24.997 1.00 44.42 ? 41  LYS C HD2  1  
ATOM 5404   H HD3  . LYS C 1 41  ? -0.877  -7.034  -25.452 1.00 53.44 ? 41  LYS C HD3  1  
ATOM 5405   H HE2  . LYS C 1 41  ? -1.932  -5.668  -27.257 1.00 51.23 ? 41  LYS C HE2  1  
ATOM 5406   H HE3  . LYS C 1 41  ? -0.857  -4.330  -26.832 1.00 3.11  ? 41  LYS C HE3  1  
ATOM 5407   H HZ1  . LYS C 1 41  ? 1.037   -5.751  -27.335 1.00 13.42 ? 41  LYS C HZ1  1  
ATOM 5408   H HZ2  . LYS C 1 41  ? 0.020   -5.613  -28.677 1.00 34.10 ? 41  LYS C HZ2  1  
ATOM 5409   H HZ3  . LYS C 1 41  ? 0.001   -7.022  -27.744 1.00 10.35 ? 41  LYS C HZ3  1  
ATOM 5410   N N    . LEU C 1 42  ? -3.574  -7.129  -20.262 1.00 55.45 ? 42  LEU C N    1  
ATOM 5411   C CA   . LEU C 1 42  ? -3.359  -8.001  -19.093 1.00 45.20 ? 42  LEU C CA   1  
ATOM 5412   C C    . LEU C 1 42  ? -2.613  -9.273  -19.545 1.00 0.34  ? 42  LEU C C    1  
ATOM 5413   O O    . LEU C 1 42  ? -3.081  -9.997  -20.435 1.00 32.31 ? 42  LEU C O    1  
ATOM 5414   C CB   . LEU C 1 42  ? -4.722  -8.379  -18.424 1.00 22.52 ? 42  LEU C CB   1  
ATOM 5415   C CG   . LEU C 1 42  ? -5.274  -7.355  -17.389 1.00 21.41 ? 42  LEU C CG   1  
ATOM 5416   C CD1  . LEU C 1 42  ? -6.689  -7.751  -16.900 1.00 1.44  ? 42  LEU C CD1  1  
ATOM 5417   C CD2  . LEU C 1 42  ? -4.285  -7.179  -16.209 1.00 11.21 ? 42  LEU C CD2  1  
ATOM 5418   H H    . LEU C 1 42  ? -4.412  -7.213  -20.760 1.00 25.21 ? 42  LEU C H    1  
ATOM 5419   H HA   . LEU C 1 42  ? -2.739  -7.447  -18.360 1.00 70.51 ? 42  LEU C HA   1  
ATOM 5420   H HB2  . LEU C 1 42  ? -5.465  -8.505  -19.209 1.00 33.44 ? 42  LEU C HB2  1  
ATOM 5421   H HB3  . LEU C 1 42  ? -4.615  -9.337  -17.917 1.00 74.24 ? 42  LEU C HB3  1  
ATOM 5422   H HG   . LEU C 1 42  ? -5.368  -6.389  -17.876 1.00 21.20 ? 42  LEU C HG   1  
ATOM 5423   H HD11 . LEU C 1 42  ? -6.656  -8.716  -16.410 1.00 51.34 ? 42  LEU C HD11 1  
ATOM 5424   H HD12 . LEU C 1 42  ? -7.364  -7.803  -17.745 1.00 21.55 ? 42  LEU C HD12 1  
ATOM 5425   H HD13 . LEU C 1 42  ? -7.058  -7.008  -16.204 1.00 74.04 ? 42  LEU C HD13 1  
ATOM 5426   H HD21 . LEU C 1 42  ? -3.333  -6.824  -16.584 1.00 52.54 ? 42  LEU C HD21 1  
ATOM 5427   H HD22 . LEU C 1 42  ? -4.139  -8.124  -15.703 1.00 1.03  ? 42  LEU C HD22 1  
ATOM 5428   H HD23 . LEU C 1 42  ? -4.678  -6.456  -15.508 1.00 73.21 ? 42  LEU C HD23 1  
ATOM 5429   N N    . ASP C 1 43  ? -1.460  -9.521  -18.928 1.00 13.03 ? 43  ASP C N    1  
ATOM 5430   C CA   . ASP C 1 43  ? -0.620  -10.696 -19.180 1.00 41.31 ? 43  ASP C CA   1  
ATOM 5431   C C    . ASP C 1 43  ? -0.435  -11.445 -17.854 1.00 32.24 ? 43  ASP C C    1  
ATOM 5432   O O    . ASP C 1 43  ? 0.315   -11.013 -16.983 1.00 43.04 ? 43  ASP C O    1  
ATOM 5433   C CB   . ASP C 1 43  ? 0.736   -10.228 -19.785 1.00 3.44  ? 43  ASP C CB   1  
ATOM 5434   C CG   . ASP C 1 43  ? 1.709   -11.372 -20.129 1.00 64.42 ? 43  ASP C CG   1  
ATOM 5435   O OD1  . ASP C 1 43  ? 2.870   -11.345 -19.666 1.00 11.31 ? 43  ASP C OD1  1  
ATOM 5436   O OD2  . ASP C 1 43  ? 1.321   -12.298 -20.871 1.00 13.54 ? 43  ASP C OD2  1  
ATOM 5437   H H    . ASP C 1 43  ? -1.150  -8.877  -18.274 1.00 73.23 ? 43  ASP C H    1  
ATOM 5438   H HA   . ASP C 1 43  ? -1.122  -11.352 -19.894 1.00 32.21 ? 43  ASP C HA   1  
ATOM 5439   H HB2  . ASP C 1 43  ? 0.535   -9.676  -20.695 1.00 63.03 ? 43  ASP C HB2  1  
ATOM 5440   H HB3  . ASP C 1 43  ? 1.220   -9.555  -19.077 1.00 43.52 ? 43  ASP C HB3  1  
ATOM 5441   N N    . LEU C 1 44  ? -1.165  -12.557 -17.694 1.00 21.15 ? 44  LEU C N    1  
ATOM 5442   C CA   . LEU C 1 44  ? -1.162  -13.362 -16.457 1.00 51.01 ? 44  LEU C CA   1  
ATOM 5443   C C    . LEU C 1 44  ? -0.495  -14.718 -16.729 1.00 23.51 ? 44  LEU C C    1  
ATOM 5444   O O    . LEU C 1 44  ? -0.601  -15.270 -17.832 1.00 22.32 ? 44  LEU C O    1  
ATOM 5445   C CB   . LEU C 1 44  ? -2.605  -13.583 -15.886 1.00 13.14 ? 44  LEU C CB   1  
ATOM 5446   C CG   . LEU C 1 44  ? -3.320  -12.330 -15.258 1.00 14.34 ? 44  LEU C CG   1  
ATOM 5447   C CD1  . LEU C 1 44  ? -3.796  -11.321 -16.323 1.00 43.41 ? 44  LEU C CD1  1  
ATOM 5448   C CD2  . LEU C 1 44  ? -4.491  -12.754 -14.334 1.00 13.42 ? 44  LEU C CD2  1  
ATOM 5449   H H    . LEU C 1 44  ? -1.716  -12.860 -18.443 1.00 31.21 ? 44  LEU C H    1  
ATOM 5450   H HA   . LEU C 1 44  ? -0.573  -12.828 -15.696 1.00 5.04  ? 44  LEU C HA   1  
ATOM 5451   H HB2  . LEU C 1 44  ? -3.233  -13.973 -16.683 1.00 64.23 ? 44  LEU C HB2  1  
ATOM 5452   H HB3  . LEU C 1 44  ? -2.539  -14.346 -15.115 1.00 34.51 ? 44  LEU C HB3  1  
ATOM 5453   H HG   . LEU C 1 44  ? -2.602  -11.805 -14.635 1.00 32.40 ? 44  LEU C HG   1  
ATOM 5454   H HD11 . LEU C 1 44  ? -4.521  -11.789 -16.980 1.00 52.03 ? 44  LEU C HD11 1  
ATOM 5455   H HD12 . LEU C 1 44  ? -2.952  -10.982 -16.906 1.00 13.11 ? 44  LEU C HD12 1  
ATOM 5456   H HD13 . LEU C 1 44  ? -4.252  -10.468 -15.837 1.00 63.20 ? 44  LEU C HD13 1  
ATOM 5457   H HD21 . LEU C 1 44  ? -4.957  -11.874 -13.911 1.00 63.42 ? 44  LEU C HD21 1  
ATOM 5458   H HD22 . LEU C 1 44  ? -4.115  -13.372 -13.532 1.00 64.22 ? 44  LEU C HD22 1  
ATOM 5459   H HD23 . LEU C 1 44  ? -5.228  -13.312 -14.901 1.00 62.51 ? 44  LEU C HD23 1  
ATOM 5460   N N    . ASP C 1 45  ? 0.190   -15.229 -15.705 1.00 40.04 ? 45  ASP C N    1  
ATOM 5461   C CA   . ASP C 1 45  ? 0.818   -16.560 -15.700 1.00 21.52 ? 45  ASP C CA   1  
ATOM 5462   C C    . ASP C 1 45  ? 0.563   -17.179 -14.320 1.00 24.44 ? 45  ASP C C    1  
ATOM 5463   O O    . ASP C 1 45  ? 0.703   -16.495 -13.305 1.00 50.52 ? 45  ASP C O    1  
ATOM 5464   C CB   . ASP C 1 45  ? 2.341   -16.447 -15.991 1.00 2.13  ? 45  ASP C CB   1  
ATOM 5465   C CG   . ASP C 1 45  ? 3.056   -17.808 -16.059 1.00 30.43 ? 45  ASP C CG   1  
ATOM 5466   O OD1  . ASP C 1 45  ? 3.080   -18.422 -17.148 1.00 12.33 ? 45  ASP C OD1  1  
ATOM 5467   O OD2  . ASP C 1 45  ? 3.578   -18.280 -15.023 1.00 2.10  ? 45  ASP C OD2  1  
ATOM 5468   H H    . ASP C 1 45  ? 0.264   -14.687 -14.892 1.00 62.51 ? 45  ASP C H    1  
ATOM 5469   H HA   . ASP C 1 45  ? 0.338   -17.174 -16.464 1.00 71.23 ? 45  ASP C HA   1  
ATOM 5470   H HB2  . ASP C 1 45  ? 2.477   -15.935 -16.936 1.00 21.21 ? 45  ASP C HB2  1  
ATOM 5471   H HB3  . ASP C 1 45  ? 2.803   -15.848 -15.210 1.00 54.20 ? 45  ASP C HB3  1  
ATOM 5472   N N    . THR C 1 46  ? 0.172   -18.455 -14.280 1.00 0.02  ? 46  THR C N    1  
ATOM 5473   C CA   . THR C 1 46  ? -0.237  -19.118 -13.029 1.00 12.14 ? 46  THR C CA   1  
ATOM 5474   C C    . THR C 1 46  ? 0.544   -20.426 -12.816 1.00 43.32 ? 46  THR C C    1  
ATOM 5475   O O    . THR C 1 46  ? 0.563   -21.299 -13.691 1.00 24.12 ? 46  THR C O    1  
ATOM 5476   C CB   . THR C 1 46  ? -1.778  -19.398 -13.035 1.00 34.33 ? 46  THR C CB   1  
ATOM 5477   O OG1  . THR C 1 46  ? -2.167  -20.033 -14.266 1.00 10.44 ? 46  THR C OG1  1  
ATOM 5478   C CG2  . THR C 1 46  ? -2.618  -18.121 -12.842 1.00 42.02 ? 46  THR C CG2  1  
ATOM 5479   H H    . THR C 1 46  ? 0.159   -18.971 -15.114 1.00 72.11 ? 46  THR C H    1  
ATOM 5480   H HA   . THR C 1 46  ? -0.020  -18.449 -12.194 1.00 43.02 ? 46  THR C HA   1  
ATOM 5481   H HB   . THR C 1 46  ? -2.007  -20.077 -12.219 1.00 55.03 ? 46  THR C HB   1  
ATOM 5482   H HG1  . THR C 1 46  ? -1.450  -20.596 -14.577 1.00 72.12 ? 46  THR C HG1  1  
ATOM 5483   H HG21 . THR C 1 46  ? -2.380  -17.663 -11.888 1.00 72.41 ? 46  THR C HG21 1  
ATOM 5484   H HG22 . THR C 1 46  ? -3.669  -18.370 -12.859 1.00 64.43 ? 46  THR C HG22 1  
ATOM 5485   H HG23 . THR C 1 46  ? -2.408  -17.414 -13.637 1.00 34.14 ? 46  THR C HG23 1  
ATOM 5486   N N    . ALA C 1 47  ? 1.167   -20.553 -11.633 1.00 33.21 ? 47  ALA C N    1  
ATOM 5487   C CA   . ALA C 1 47  ? 1.972   -21.725 -11.250 1.00 50.14 ? 47  ALA C CA   1  
ATOM 5488   C C    . ALA C 1 47  ? 1.478   -22.288 -9.908  1.00 1.31  ? 47  ALA C C    1  
ATOM 5489   O O    . ALA C 1 47  ? 0.721   -21.629 -9.181  1.00 11.23 ? 47  ALA C O    1  
ATOM 5490   C CB   . ALA C 1 47  ? 3.465   -21.338 -11.176 1.00 13.34 ? 47  ALA C CB   1  
ATOM 5491   H H    . ALA C 1 47  ? 1.071   -19.826 -10.977 1.00 12.52 ? 47  ALA C H    1  
ATOM 5492   H HA   . ALA C 1 47  ? 1.858   -22.495 -12.010 1.00 51.32 ? 47  ALA C HA   1  
ATOM 5493   H HB1  . ALA C 1 47  ? 3.787   -20.950 -12.134 1.00 14.44 ? 47  ALA C HB1  1  
ATOM 5494   H HB2  . ALA C 1 47  ? 4.062   -22.208 -10.929 1.00 71.42 ? 47  ALA C HB2  1  
ATOM 5495   H HB3  . ALA C 1 47  ? 3.616   -20.579 -10.417 1.00 1.30  ? 47  ALA C HB3  1  
ATOM 5496   N N    . SER C 1 48  ? 1.898   -23.521 -9.599  1.00 24.11 ? 48  SER C N    1  
ATOM 5497   C CA   . SER C 1 48  ? 1.593   -24.200 -8.329  1.00 43.32 ? 48  SER C CA   1  
ATOM 5498   C C    . SER C 1 48  ? 2.802   -25.051 -7.915  1.00 14.41 ? 48  SER C C    1  
ATOM 5499   O O    . SER C 1 48  ? 3.535   -25.549 -8.784  1.00 51.12 ? 48  SER C O    1  
ATOM 5500   C CB   . SER C 1 48  ? 0.327   -25.085 -8.474  1.00 41.40 ? 48  SER C CB   1  
ATOM 5501   O OG   . SER C 1 48  ? -0.804  -24.322 -8.879  1.00 14.50 ? 48  SER C OG   1  
ATOM 5502   H H    . SER C 1 48  ? 2.446   -24.002 -10.256 1.00 63.11 ? 48  SER C H    1  
ATOM 5503   H HA   . SER C 1 48  ? 1.419   -23.445 -7.563  1.00 75.02 ? 48  SER C HA   1  
ATOM 5504   H HB2  . SER C 1 48  ? 0.501   -25.854 -9.216  1.00 12.24 ? 48  SER C HB2  1  
ATOM 5505   H HB3  . SER C 1 48  ? 0.100   -25.555 -7.523  1.00 24.42 ? 48  SER C HB3  1  
ATOM 5506   H HG   . SER C 1 48  ? -0.639  -23.388 -8.707  1.00 11.51 ? 48  SER C HG   1  
ATOM 5507   N N    . SER C 1 49  ? 3.014   -25.201 -6.598  1.00 11.23 ? 49  SER C N    1  
ATOM 5508   C CA   . SER C 1 49  ? 4.117   -26.007 -6.047  1.00 60.04 ? 49  SER C CA   1  
ATOM 5509   C C    . SER C 1 49  ? 3.689   -26.642 -4.723  1.00 44.53 ? 49  SER C C    1  
ATOM 5510   O O    . SER C 1 49  ? 3.188   -25.942 -3.836  1.00 21.34 ? 49  SER C O    1  
ATOM 5511   C CB   . SER C 1 49  ? 5.380   -25.125 -5.853  1.00 1.10  ? 49  SER C CB   1  
ATOM 5512   O OG   . SER C 1 49  ? 5.075   -23.921 -5.166  1.00 51.23 ? 49  SER C OG   1  
ATOM 5513   H H    . SER C 1 49  ? 2.418   -24.740 -5.971  1.00 53.11 ? 49  SER C H    1  
ATOM 5514   H HA   . SER C 1 49  ? 4.346   -26.802 -6.754  1.00 23.23 ? 49  SER C HA   1  
ATOM 5515   H HB2  . SER C 1 49  ? 6.125   -25.666 -5.284  1.00 43.43 ? 49  SER C HB2  1  
ATOM 5516   H HB3  . SER C 1 49  ? 5.794   -24.870 -6.822  1.00 74.01 ? 49  SER C HB3  1  
ATOM 5517   H HG   . SER C 1 49  ? 4.864   -24.117 -4.247  1.00 72.12 ? 49  SER C HG   1  
ATOM 5518   N N    . GLN C 1 50  ? 3.883   -27.969 -4.596  1.00 65.43 ? 50  GLN C N    1  
ATOM 5519   C CA   . GLN C 1 50  ? 3.584   -28.694 -3.356  1.00 13.44 ? 50  GLN C CA   1  
ATOM 5520   C C    . GLN C 1 50  ? 4.677   -28.399 -2.320  1.00 62.52 ? 50  GLN C C    1  
ATOM 5521   O O    . GLN C 1 50  ? 5.864   -28.557 -2.608  1.00 31.33 ? 50  GLN C O    1  
ATOM 5522   C CB   . GLN C 1 50  ? 3.485   -30.224 -3.608  1.00 31.44 ? 50  GLN C CB   1  
ATOM 5523   C CG   . GLN C 1 50  ? 3.133   -31.042 -2.344  1.00 65.21 ? 50  GLN C CG   1  
ATOM 5524   C CD   . GLN C 1 50  ? 2.991   -32.551 -2.563  1.00 20.13 ? 50  GLN C CD   1  
ATOM 5525   O OE1  . GLN C 1 50  ? 3.632   -33.135 -3.433  1.00 72.13 ? 50  GLN C OE1  1  
ATOM 5526   N NE2  . GLN C 1 50  ? 2.156   -33.194 -1.757  1.00 41.13 ? 50  GLN C NE2  1  
ATOM 5527   H H    . GLN C 1 50  ? 4.252   -28.469 -5.356  1.00 64.23 ? 50  GLN C H    1  
ATOM 5528   H HA   . GLN C 1 50  ? 2.621   -28.334 -2.980  1.00 54.22 ? 50  GLN C HA   1  
ATOM 5529   H HB2  . GLN C 1 50  ? 2.718   -30.403 -4.358  1.00 22.01 ? 50  GLN C HB2  1  
ATOM 5530   H HB3  . GLN C 1 50  ? 4.434   -30.579 -3.996  1.00 21.53 ? 50  GLN C HB3  1  
ATOM 5531   H HG2  . GLN C 1 50  ? 3.911   -30.888 -1.604  1.00 53.24 ? 50  GLN C HG2  1  
ATOM 5532   H HG3  . GLN C 1 50  ? 2.196   -30.660 -1.944  1.00 40.04 ? 50  GLN C HG3  1  
ATOM 5533   H HE21 . GLN C 1 50  ? 1.682   -32.674 -1.075  1.00 31.21 ? 50  GLN C HE21 1  
ATOM 5534   H HE22 . GLN C 1 50  ? 2.055   -34.162 -1.874  1.00 24.24 ? 50  GLN C HE22 1  
ATOM 5535   N N    . LEU C 1 51  ? 4.260   -27.930 -1.141  1.00 41.43 ? 51  LEU C N    1  
ATOM 5536   C CA   . LEU C 1 51  ? 5.158   -27.678 0.005   1.00 45.34 ? 51  LEU C CA   1  
ATOM 5537   C C    . LEU C 1 51  ? 5.090   -28.838 1.008   1.00 3.05  ? 51  LEU C C    1  
ATOM 5538   O O    . LEU C 1 51  ? 6.079   -29.150 1.680   1.00 70.05 ? 51  LEU C O    1  
ATOM 5539   C CB   . LEU C 1 51  ? 4.762   -26.343 0.678   1.00 71.41 ? 51  LEU C CB   1  
ATOM 5540   C CG   . LEU C 1 51  ? 4.791   -25.089 -0.253  1.00 32.43 ? 51  LEU C CG   1  
ATOM 5541   C CD1  . LEU C 1 51  ? 4.223   -23.861 0.476   1.00 34.41 ? 51  LEU C CD1  1  
ATOM 5542   C CD2  . LEU C 1 51  ? 6.214   -24.817 -0.808  1.00 2.03  ? 51  LEU C CD2  1  
ATOM 5543   H H    . LEU C 1 51  ? 3.307   -27.725 -1.037  1.00 21.34 ? 51  LEU C H    1  
ATOM 5544   H HA   . LEU C 1 51  ? 6.179   -27.598 -0.362  1.00 70.31 ? 51  LEU C HA   1  
ATOM 5545   H HB2  . LEU C 1 51  ? 3.758   -26.450 1.082   1.00 33.51 ? 51  LEU C HB2  1  
ATOM 5546   H HB3  . LEU C 1 51  ? 5.440   -26.163 1.507   1.00 35.31 ? 51  LEU C HB3  1  
ATOM 5547   H HG   . LEU C 1 51  ? 4.145   -25.280 -1.104  1.00 22.13 ? 51  LEU C HG   1  
ATOM 5548   H HD11 . LEU C 1 51  ? 4.699   -23.739 1.441   1.00 70.14 ? 51  LEU C HD11 1  
ATOM 5549   H HD12 . LEU C 1 51  ? 3.159   -23.986 0.622   1.00 61.55 ? 51  LEU C HD12 1  
ATOM 5550   H HD13 . LEU C 1 51  ? 4.388   -22.969 -0.117  1.00 24.04 ? 51  LEU C HD13 1  
ATOM 5551   H HD21 . LEU C 1 51  ? 6.903   -24.643 0.009   1.00 11.52 ? 51  LEU C HD21 1  
ATOM 5552   H HD22 . LEU C 1 51  ? 6.197   -23.946 -1.451  1.00 74.42 ? 51  LEU C HD22 1  
ATOM 5553   H HD23 . LEU C 1 51  ? 6.550   -25.670 -1.383  1.00 0.11  ? 51  LEU C HD23 1  
ATOM 5554   N N    . ALA C 1 52  ? 3.904   -29.464 1.085   1.00 20.52 ? 52  ALA C N    1  
ATOM 5555   C CA   . ALA C 1 52  ? 3.628   -30.614 1.965   1.00 73.32 ? 52  ALA C CA   1  
ATOM 5556   C C    . ALA C 1 52  ? 2.379   -31.346 1.477   1.00 33.42 ? 52  ALA C C    1  
ATOM 5557   O O    . ALA C 1 52  ? 1.784   -30.970 0.457   1.00 1.21  ? 52  ALA C O    1  
ATOM 5558   C CB   . ALA C 1 52  ? 3.453   -30.157 3.427   1.00 42.30 ? 52  ALA C CB   1  
ATOM 5559   H H    . ALA C 1 52  ? 3.175   -29.142 0.514   1.00 53.54 ? 52  ALA C H    1  
ATOM 5560   H HA   . ALA C 1 52  ? 4.470   -31.298 1.914   1.00 1.02  ? 52  ALA C HA   1  
ATOM 5561   H HB1  . ALA C 1 52  ? 3.026   -30.958 4.021   1.00 73.53 ? 52  ALA C HB1  1  
ATOM 5562   H HB2  . ALA C 1 52  ? 2.803   -29.295 3.471   1.00 2.34  ? 52  ALA C HB2  1  
ATOM 5563   H HB3  . ALA C 1 52  ? 4.413   -29.900 3.835   1.00 31.32 ? 52  ALA C HB3  1  
ATOM 5564   N N    . ASP C 1 53  ? 1.991   -32.391 2.223   1.00 51.04 ? 53  ASP C N    1  
ATOM 5565   C CA   . ASP C 1 53  ? 0.781   -33.181 1.929   1.00 13.05 ? 53  ASP C CA   1  
ATOM 5566   C C    . ASP C 1 53  ? -0.454  -32.279 2.022   1.00 43.31 ? 53  ASP C C    1  
ATOM 5567   O O    . ASP C 1 53  ? -0.665  -31.624 3.056   1.00 12.50 ? 53  ASP C O    1  
ATOM 5568   C CB   . ASP C 1 53  ? 0.632   -34.382 2.896   1.00 3.03  ? 53  ASP C CB   1  
ATOM 5569   C CG   . ASP C 1 53  ? 1.759   -35.416 2.772   1.00 64.33 ? 53  ASP C CG   1  
ATOM 5570   O OD1  . ASP C 1 53  ? 2.757   -35.326 3.527   1.00 2.31  ? 53  ASP C OD1  1  
ATOM 5571   O OD2  . ASP C 1 53  ? 1.662   -36.321 1.915   1.00 43.41 ? 53  ASP C OD2  1  
ATOM 5572   H H    . ASP C 1 53  ? 2.533   -32.622 3.009   1.00 43.31 ? 53  ASP C H    1  
ATOM 5573   H HA   . ASP C 1 53  ? 0.878   -33.557 0.915   1.00 1.11  ? 53  ASP C HA   1  
ATOM 5574   H HB2  . ASP C 1 53  ? 0.610   -34.014 3.917   1.00 41.44 ? 53  ASP C HB2  1  
ATOM 5575   H HB3  . ASP C 1 53  ? -0.316  -34.885 2.699   1.00 30.12 ? 53  ASP C HB3  1  
ATOM 5576   N N    . ASP C 1 54  ? -1.213  -32.199 0.905   1.00 40.14 ? 54  ASP C N    1  
ATOM 5577   C CA   . ASP C 1 54  ? -2.443  -31.372 0.770   1.00 40.42 ? 54  ASP C CA   1  
ATOM 5578   C C    . ASP C 1 54  ? -2.146  -29.847 0.771   1.00 43.20 ? 54  ASP C C    1  
ATOM 5579   O O    . ASP C 1 54  ? -3.059  -29.034 0.593   1.00 12.33 ? 54  ASP C O    1  
ATOM 5580   C CB   . ASP C 1 54  ? -3.504  -31.730 1.858   1.00 34.31 ? 54  ASP C CB   1  
ATOM 5581   C CG   . ASP C 1 54  ? -3.886  -33.225 1.876   1.00 45.01 ? 54  ASP C CG   1  
ATOM 5582   O OD1  . ASP C 1 54  ? -3.283  -33.999 2.656   1.00 22.31 ? 54  ASP C OD1  1  
ATOM 5583   O OD2  . ASP C 1 54  ? -4.804  -33.636 1.130   1.00 54.33 ? 54  ASP C OD2  1  
ATOM 5584   H H    . ASP C 1 54  ? -0.941  -32.734 0.131   1.00 54.30 ? 54  ASP C H    1  
ATOM 5585   H HA   . ASP C 1 54  ? -2.862  -31.612 -0.198  1.00 13.30 ? 54  ASP C HA   1  
ATOM 5586   H HB2  . ASP C 1 54  ? -3.114  -31.460 2.834   1.00 14.44 ? 54  ASP C HB2  1  
ATOM 5587   H HB3  . ASP C 1 54  ? -4.402  -31.147 1.678   1.00 14.33 ? 54  ASP C HB3  1  
ATOM 5588   N N    . VAL C 1 55  ? -0.864  -29.464 0.952   1.00 12.13 ? 55  VAL C N    1  
ATOM 5589   C CA   . VAL C 1 55  ? -0.430  -28.067 0.970   1.00 63.43 ? 55  VAL C CA   1  
ATOM 5590   C C    . VAL C 1 55  ? 0.176   -27.720 -0.392  1.00 61.13 ? 55  VAL C C    1  
ATOM 5591   O O    . VAL C 1 55  ? 1.239   -28.240 -0.770  1.00 13.54 ? 55  VAL C O    1  
ATOM 5592   C CB   . VAL C 1 55  ? 0.626   -27.782 2.105   1.00 43.23 ? 55  VAL C CB   1  
ATOM 5593   C CG1  . VAL C 1 55  ? 1.082   -26.297 2.083   1.00 52.54 ? 55  VAL C CG1  1  
ATOM 5594   C CG2  . VAL C 1 55  ? 0.063   -28.191 3.490   1.00 31.43 ? 55  VAL C CG2  1  
ATOM 5595   H H    . VAL C 1 55  ? -0.183  -30.153 1.054   1.00 13.34 ? 55  VAL C H    1  
ATOM 5596   H HA   . VAL C 1 55  ? -1.301  -27.433 1.149   1.00 20.21 ? 55  VAL C HA   1  
ATOM 5597   H HB   . VAL C 1 55  ? 1.505   -28.400 1.910   1.00 44.12 ? 55  VAL C HB   1  
ATOM 5598   H HG11 . VAL C 1 55  ? 0.260   -25.653 2.374   1.00 44.21 ? 55  VAL C HG11 1  
ATOM 5599   H HG12 . VAL C 1 55  ? 1.401   -26.029 1.084   1.00 55.11 ? 55  VAL C HG12 1  
ATOM 5600   H HG13 . VAL C 1 55  ? 1.910   -26.150 2.758   1.00 10.43 ? 55  VAL C HG13 1  
ATOM 5601   H HG21 . VAL C 1 55  ? -0.813  -27.597 3.722   1.00 21.34 ? 55  VAL C HG21 1  
ATOM 5602   H HG22 . VAL C 1 55  ? 0.812   -28.033 4.255   1.00 13.50 ? 55  VAL C HG22 1  
ATOM 5603   H HG23 . VAL C 1 55  ? -0.211  -29.239 3.476   1.00 3.13  ? 55  VAL C HG23 1  
ATOM 5604   N N    . TYR C 1 56  ? -0.517  -26.845 -1.113  1.00 1.32  ? 56  TYR C N    1  
ATOM 5605   C CA   . TYR C 1 56  ? -0.108  -26.354 -2.426  1.00 42.42 ? 56  TYR C CA   1  
ATOM 5606   C C    . TYR C 1 56  ? -0.115  -24.835 -2.388  1.00 52.35 ? 56  TYR C C    1  
ATOM 5607   O O    . TYR C 1 56  ? -1.127  -24.210 -2.039  1.00 32.32 ? 56  TYR C O    1  
ATOM 5608   C CB   . TYR C 1 56  ? -1.049  -26.890 -3.548  1.00 0.22  ? 56  TYR C CB   1  
ATOM 5609   C CG   . TYR C 1 56  ? -0.675  -28.292 -4.051  1.00 41.31 ? 56  TYR C CG   1  
ATOM 5610   C CD1  . TYR C 1 56  ? -0.039  -28.469 -5.286  1.00 3.30  ? 56  TYR C CD1  1  
ATOM 5611   C CD2  . TYR C 1 56  ? -0.933  -29.430 -3.285  1.00 14.24 ? 56  TYR C CD2  1  
ATOM 5612   C CE1  . TYR C 1 56  ? 0.315   -29.723 -5.735  1.00 42.41 ? 56  TYR C CE1  1  
ATOM 5613   C CE2  . TYR C 1 56  ? -0.577  -30.684 -3.731  1.00 72.23 ? 56  TYR C CE2  1  
ATOM 5614   C CZ   . TYR C 1 56  ? 0.045   -30.828 -4.957  1.00 25.13 ? 56  TYR C CZ   1  
ATOM 5615   O OH   . TYR C 1 56  ? 0.396   -32.083 -5.407  1.00 50.31 ? 56  TYR C OH   1  
ATOM 5616   H H    . TYR C 1 56  ? -1.338  -26.481 -0.723  1.00 73.55 ? 56  TYR C H    1  
ATOM 5617   H HA   . TYR C 1 56  ? 0.912   -26.696 -2.624  1.00 41.42 ? 56  TYR C HA   1  
ATOM 5618   H HB2  . TYR C 1 56  ? -2.065  -26.934 -3.173  1.00 22.12 ? 56  TYR C HB2  1  
ATOM 5619   H HB3  . TYR C 1 56  ? -1.026  -26.214 -4.400  1.00 11.21 ? 56  TYR C HB3  1  
ATOM 5620   H HD1  . TYR C 1 56  ? 0.173   -27.600 -5.898  1.00 74.44 ? 56  TYR C HD1  1  
ATOM 5621   H HD2  . TYR C 1 56  ? -1.422  -29.318 -2.323  1.00 14.44 ? 56  TYR C HD2  1  
ATOM 5622   H HE1  . TYR C 1 56  ? 0.802   -29.835 -6.693  1.00 55.24 ? 56  TYR C HE1  1  
ATOM 5623   H HE2  . TYR C 1 56  ? -0.792  -31.553 -3.121  1.00 60.43 ? 56  TYR C HE2  1  
ATOM 5624   H HH   . TYR C 1 56  ? -0.371  -32.665 -5.368  1.00 15.42 ? 56  TYR C HH   1  
ATOM 5625   N N    . GLU C 1 57  ? 1.031   -24.261 -2.730  1.00 41.33 ? 57  GLU C N    1  
ATOM 5626   C CA   . GLU C 1 57  ? 1.187   -22.836 -2.916  1.00 75.13 ? 57  GLU C CA   1  
ATOM 5627   C C    . GLU C 1 57  ? 0.693   -22.474 -4.319  1.00 54.51 ? 57  GLU C C    1  
ATOM 5628   O O    . GLU C 1 57  ? 1.209   -22.997 -5.316  1.00 64.03 ? 57  GLU C O    1  
ATOM 5629   C CB   . GLU C 1 57  ? 2.673   -22.460 -2.754  1.00 72.40 ? 57  GLU C CB   1  
ATOM 5630   C CG   . GLU C 1 57  ? 3.002   -21.005 -3.138  1.00 25.32 ? 57  GLU C CG   1  
ATOM 5631   C CD   . GLU C 1 57  ? 4.490   -20.711 -3.056  1.00 31.41 ? 57  GLU C CD   1  
ATOM 5632   O OE1  . GLU C 1 57  ? 5.240   -21.181 -3.934  1.00 4.03  ? 57  GLU C OE1  1  
ATOM 5633   O OE2  . GLU C 1 57  ? 4.921   -20.008 -2.127  1.00 21.33 ? 57  GLU C OE2  1  
ATOM 5634   H H    . GLU C 1 57  ? 1.816   -24.828 -2.857  1.00 14.21 ? 57  GLU C H    1  
ATOM 5635   H HA   . GLU C 1 57  ? 0.600   -22.311 -2.162  1.00 74.32 ? 57  GLU C HA   1  
ATOM 5636   H HB2  . GLU C 1 57  ? 2.958   -22.614 -1.716  1.00 3.33  ? 57  GLU C HB2  1  
ATOM 5637   H HB3  . GLU C 1 57  ? 3.275   -23.124 -3.374  1.00 11.33 ? 57  GLU C HB3  1  
ATOM 5638   H HG2  . GLU C 1 57  ? 2.671   -20.828 -4.155  1.00 34.45 ? 57  GLU C HG2  1  
ATOM 5639   H HG3  . GLU C 1 57  ? 2.463   -20.334 -2.478  1.00 14.21 ? 57  GLU C HG3  1  
ATOM 5640   N N    . VAL C 1 58  ? -0.323  -21.617 -4.383  1.00 32.15 ? 58  VAL C N    1  
ATOM 5641   C CA   . VAL C 1 58  ? -0.821  -21.070 -5.636  1.00 22.15 ? 58  VAL C CA   1  
ATOM 5642   C C    . VAL C 1 58  ? -0.168  -19.708 -5.852  1.00 22.01 ? 58  VAL C C    1  
ATOM 5643   O O    . VAL C 1 58  ? -0.195  -18.848 -4.973  1.00 21.15 ? 58  VAL C O    1  
ATOM 5644   C CB   . VAL C 1 58  ? -2.392  -20.957 -5.613  1.00 2.35  ? 58  VAL C CB   1  
ATOM 5645   C CG1  . VAL C 1 58  ? -2.936  -20.207 -6.849  1.00 41.24 ? 58  VAL C CG1  1  
ATOM 5646   C CG2  . VAL C 1 58  ? -3.038  -22.364 -5.469  1.00 30.33 ? 58  VAL C CG2  1  
ATOM 5647   H H    . VAL C 1 58  ? -0.758  -21.339 -3.547  1.00 54.31 ? 58  VAL C H    1  
ATOM 5648   H HA   . VAL C 1 58  ? -0.526  -21.735 -6.457  1.00 73.45 ? 58  VAL C HA   1  
ATOM 5649   H HB   . VAL C 1 58  ? -2.672  -20.376 -4.734  1.00 23.51 ? 58  VAL C HB   1  
ATOM 5650   H HG11 . VAL C 1 58  ? -4.017  -20.154 -6.803  1.00 71.33 ? 58  VAL C HG11 1  
ATOM 5651   H HG12 . VAL C 1 58  ? -2.642  -20.727 -7.751  1.00 10.14 ? 58  VAL C HG12 1  
ATOM 5652   H HG13 . VAL C 1 58  ? -2.533  -19.204 -6.871  1.00 14.23 ? 58  VAL C HG13 1  
ATOM 5653   H HG21 . VAL C 1 58  ? -2.762  -22.985 -6.312  1.00 71.41 ? 58  VAL C HG21 1  
ATOM 5654   H HG22 . VAL C 1 58  ? -4.117  -22.275 -5.429  1.00 11.12 ? 58  VAL C HG22 1  
ATOM 5655   H HG23 . VAL C 1 58  ? -2.691  -22.829 -4.554  1.00 50.32 ? 58  VAL C HG23 1  
ATOM 5656   N N    . VAL C 1 59  ? 0.479   -19.568 -7.006  1.00 1.45  ? 59  VAL C N    1  
ATOM 5657   C CA   . VAL C 1 59  ? 1.120   -18.335 -7.438  1.00 32.42 ? 59  VAL C CA   1  
ATOM 5658   C C    . VAL C 1 59  ? 0.275   -17.729 -8.558  1.00 75.30 ? 59  VAL C C    1  
ATOM 5659   O O    . VAL C 1 59  ? -0.076  -18.418 -9.530  1.00 70.15 ? 59  VAL C O    1  
ATOM 5660   C CB   . VAL C 1 59  ? 2.579   -18.605 -7.955  1.00 2.53  ? 59  VAL C CB   1  
ATOM 5661   C CG1  . VAL C 1 59  ? 3.255   -17.286 -8.426  1.00 12.14 ? 59  VAL C CG1  1  
ATOM 5662   C CG2  . VAL C 1 59  ? 3.420   -19.343 -6.868  1.00 24.34 ? 59  VAL C CG2  1  
ATOM 5663   H H    . VAL C 1 59  ? 0.521   -20.339 -7.603  1.00 40.24 ? 59  VAL C H    1  
ATOM 5664   H HA   . VAL C 1 59  ? 1.169   -17.638 -6.596  1.00 41.44 ? 59  VAL C HA   1  
ATOM 5665   H HB   . VAL C 1 59  ? 2.510   -19.263 -8.825  1.00 22.34 ? 59  VAL C HB   1  
ATOM 5666   H HG11 . VAL C 1 59  ? 4.120   -17.515 -9.018  1.00 74.20 ? 59  VAL C HG11 1  
ATOM 5667   H HG12 . VAL C 1 59  ? 3.553   -16.693 -7.571  1.00 42.44 ? 59  VAL C HG12 1  
ATOM 5668   H HG13 . VAL C 1 59  ? 2.561   -16.713 -9.027  1.00 74.24 ? 59  VAL C HG13 1  
ATOM 5669   H HG21 . VAL C 1 59  ? 3.788   -18.636 -6.132  1.00 0.33  ? 59  VAL C HG21 1  
ATOM 5670   H HG22 . VAL C 1 59  ? 4.246   -19.850 -7.327  1.00 4.12  ? 59  VAL C HG22 1  
ATOM 5671   H HG23 . VAL C 1 59  ? 2.806   -20.081 -6.369  1.00 52.13 ? 59  VAL C HG23 1  
ATOM 5672   N N    . LEU C 1 60  ? -0.036  -16.447 -8.412  1.00 75.45 ? 60  LEU C N    1  
ATOM 5673   C CA   . LEU C 1 60  ? -0.804  -15.680 -9.382  1.00 61.12 ? 60  LEU C CA   1  
ATOM 5674   C C    . LEU C 1 60  ? 0.042   -14.479 -9.809  1.00 71.43 ? 60  LEU C C    1  
ATOM 5675   O O    . LEU C 1 60  ? 0.107   -13.459 -9.111  1.00 32.14 ? 60  LEU C O    1  
ATOM 5676   C CB   . LEU C 1 60  ? -2.175  -15.249 -8.769  1.00 41.40 ? 60  LEU C CB   1  
ATOM 5677   C CG   . LEU C 1 60  ? -3.110  -14.369 -9.669  1.00 60.44 ? 60  LEU C CG   1  
ATOM 5678   C CD1  . LEU C 1 60  ? -3.419  -15.048 -11.024 1.00 11.14 ? 60  LEU C CD1  1  
ATOM 5679   C CD2  . LEU C 1 60  ? -4.417  -13.993 -8.917  1.00 63.20 ? 60  LEU C CD2  1  
ATOM 5680   H H    . LEU C 1 60  ? 0.287   -15.986 -7.617  1.00 0.11  ? 60  LEU C H    1  
ATOM 5681   H HA   . LEU C 1 60  ? -0.982  -16.309 -10.252 1.00 51.01 ? 60  LEU C HA   1  
ATOM 5682   H HB2  . LEU C 1 60  ? -2.718  -16.149 -8.492  1.00 61.43 ? 60  LEU C HB2  1  
ATOM 5683   H HB3  . LEU C 1 60  ? -1.970  -14.694 -7.854  1.00 51.21 ? 60  LEU C HB3  1  
ATOM 5684   H HG   . LEU C 1 60  ? -2.593  -13.446 -9.896  1.00 15.22 ? 60  LEU C HG   1  
ATOM 5685   H HD11 . LEU C 1 60  ? -4.048  -14.400 -11.621 1.00 24.41 ? 60  LEU C HD11 1  
ATOM 5686   H HD12 . LEU C 1 60  ? -3.928  -15.990 -10.863 1.00 61.43 ? 60  LEU C HD12 1  
ATOM 5687   H HD13 . LEU C 1 60  ? -2.495  -15.230 -11.558 1.00 14.53 ? 60  LEU C HD13 1  
ATOM 5688   H HD21 . LEU C 1 60  ? -4.975  -14.892 -8.671  1.00 51.14 ? 60  LEU C HD21 1  
ATOM 5689   H HD22 . LEU C 1 60  ? -5.029  -13.355 -9.541  1.00 40.52 ? 60  LEU C HD22 1  
ATOM 5690   H HD23 . LEU C 1 60  ? -4.173  -13.464 -8.006  1.00 32.03 ? 60  LEU C HD23 1  
ATOM 5691   N N    . ARG C 1 61  ? 0.741   -14.652 -10.930 1.00 32.32 ? 61  ARG C N    1  
ATOM 5692   C CA   . ARG C 1 61  ? 1.542   -13.603 -11.557 1.00 43.13 ? 61  ARG C CA   1  
ATOM 5693   C C    . ARG C 1 61  ? 0.621   -12.792 -12.466 1.00 72.10 ? 61  ARG C C    1  
ATOM 5694   O O    . ARG C 1 61  ? 0.065   -13.323 -13.427 1.00 10.54 ? 61  ARG C O    1  
ATOM 5695   C CB   . ARG C 1 61  ? 2.740   -14.257 -12.324 1.00 65.04 ? 61  ARG C CB   1  
ATOM 5696   C CG   . ARG C 1 61  ? 3.663   -13.314 -13.164 1.00 24.33 ? 61  ARG C CG   1  
ATOM 5697   C CD   . ARG C 1 61  ? 3.165   -13.080 -14.604 1.00 24.20 ? 61  ARG C CD   1  
ATOM 5698   N NE   . ARG C 1 61  ? 4.169   -12.426 -15.448 1.00 60.21 ? 61  ARG C NE   1  
ATOM 5699   C CZ   . ARG C 1 61  ? 4.156   -12.424 -16.785 1.00 33.21 ? 61  ARG C CZ   1  
ATOM 5700   N NH1  . ARG C 1 61  ? 3.201   -13.067 -17.460 1.00 54.44 ? 61  ARG C NH1  1  
ATOM 5701   N NH2  . ARG C 1 61  ? 5.093   -11.763 -17.448 1.00 61.20 ? 61  ARG C NH2  1  
ATOM 5702   H H    . ARG C 1 61  ? 0.707   -15.532 -11.371 1.00 42.40 ? 61  ARG C H    1  
ATOM 5703   H HA   . ARG C 1 61  ? 1.933   -12.952 -10.770 1.00 11.24 ? 61  ARG C HA   1  
ATOM 5704   H HB2  . ARG C 1 61  ? 3.364   -14.756 -11.588 1.00 41.24 ? 61  ARG C HB2  1  
ATOM 5705   H HB3  . ARG C 1 61  ? 2.346   -15.021 -12.987 1.00 3.03  ? 61  ARG C HB3  1  
ATOM 5706   H HG2  . ARG C 1 61  ? 3.735   -12.355 -12.663 1.00 2.24  ? 61  ARG C HG2  1  
ATOM 5707   H HG3  . ARG C 1 61  ? 4.655   -13.754 -13.210 1.00 43.43 ? 61  ARG C HG3  1  
ATOM 5708   H HD2  . ARG C 1 61  ? 2.904   -14.036 -15.042 1.00 23.14 ? 61  ARG C HD2  1  
ATOM 5709   H HD3  . ARG C 1 61  ? 2.275   -12.458 -14.570 1.00 71.40 ? 61  ARG C HD3  1  
ATOM 5710   H HE   . ARG C 1 61  ? 4.897   -11.951 -14.988 1.00 11.44 ? 61  ARG C HE   1  
ATOM 5711   H HH11 . ARG C 1 61  ? 2.479   -13.553 -16.966 1.00 74.42 ? 61  ARG C HH11 1  
ATOM 5712   H HH12 . ARG C 1 61  ? 3.202   -13.060 -18.466 1.00 10.43 ? 61  ARG C HH12 1  
ATOM 5713   H HH21 . ARG C 1 61  ? 5.802   -11.252 -16.942 1.00 24.24 ? 61  ARG C HH21 1  
ATOM 5714   H HH22 . ARG C 1 61  ? 5.093   -11.754 -18.453 1.00 31.51 ? 61  ARG C HH22 1  
ATOM 5715   N N    . VAL C 1 62  ? 0.415   -11.522 -12.110 1.00 33.34 ? 62  VAL C N    1  
ATOM 5716   C CA   . VAL C 1 62  ? -0.355  -10.570 -12.917 1.00 41.22 ? 62  VAL C CA   1  
ATOM 5717   C C    . VAL C 1 62  ? 0.604   -9.493  -13.425 1.00 44.22 ? 62  VAL C C    1  
ATOM 5718   O O    . VAL C 1 62  ? 1.396   -8.956  -12.646 1.00 24.52 ? 62  VAL C O    1  
ATOM 5719   C CB   . VAL C 1 62  ? -1.504  -9.875  -12.091 1.00 63.35 ? 62  VAL C CB   1  
ATOM 5720   C CG1  . VAL C 1 62  ? -2.465  -9.089  -13.028 1.00 55.22 ? 62  VAL C CG1  1  
ATOM 5721   C CG2  . VAL C 1 62  ? -2.258  -10.884 -11.194 1.00 35.54 ? 62  VAL C CG2  1  
ATOM 5722   H H    . VAL C 1 62  ? 0.799   -11.209 -11.264 1.00 2.41  ? 62  VAL C H    1  
ATOM 5723   H HA   . VAL C 1 62  ? -0.798  -11.101 -13.766 1.00 14.33 ? 62  VAL C HA   1  
ATOM 5724   H HB   . VAL C 1 62  ? -1.039  -9.143  -11.423 1.00 65.11 ? 62  VAL C HB   1  
ATOM 5725   H HG11 . VAL C 1 62  ? -3.002  -9.776  -13.670 1.00 21.34 ? 62  VAL C HG11 1  
ATOM 5726   H HG12 . VAL C 1 62  ? -1.893  -8.404  -13.640 1.00 72.51 ? 62  VAL C HG12 1  
ATOM 5727   H HG13 . VAL C 1 62  ? -3.167  -8.516  -12.445 1.00 64.00 ? 62  VAL C HG13 1  
ATOM 5728   H HG21 . VAL C 1 62  ? -2.846  -11.548 -11.792 1.00 3.44  ? 62  VAL C HG21 1  
ATOM 5729   H HG22 . VAL C 1 62  ? -2.904  -10.355 -10.507 1.00 4.14  ? 62  VAL C HG22 1  
ATOM 5730   H HG23 . VAL C 1 62  ? -1.541  -11.465 -10.633 1.00 11.42 ? 62  VAL C HG23 1  
ATOM 5731   N N    . THR C 1 63  ? 0.521   -9.187  -14.715 1.00 4.20  ? 63  THR C N    1  
ATOM 5732   C CA   . THR C 1 63  ? 1.309   -8.122  -15.339 1.00 53.05 ? 63  THR C CA   1  
ATOM 5733   C C    . THR C 1 63  ? 0.367   -7.216  -16.113 1.00 5.31  ? 63  THR C C    1  
ATOM 5734   O O    . THR C 1 63  ? -0.403  -7.673  -16.963 1.00 20.14 ? 63  THR C O    1  
ATOM 5735   C CB   . THR C 1 63  ? 2.407   -8.682  -16.301 1.00 53.23 ? 63  THR C CB   1  
ATOM 5736   O OG1  . THR C 1 63  ? 3.140   -9.701  -15.627 1.00 11.23 ? 63  THR C OG1  1  
ATOM 5737   C CG2  . THR C 1 63  ? 3.376   -7.580  -16.786 1.00 1.22  ? 63  THR C CG2  1  
ATOM 5738   H H    . THR C 1 63  ? -0.107  -9.689  -15.273 1.00 74.42 ? 63  THR C H    1  
ATOM 5739   H HA   . THR C 1 63  ? 1.796   -7.538  -14.551 1.00 50.11 ? 63  THR C HA   1  
ATOM 5740   H HB   . THR C 1 63  ? 1.925   -9.128  -17.167 1.00 5.40  ? 63  THR C HB   1  
ATOM 5741   H HG1  . THR C 1 63  ? 4.019   -9.770  -16.009 1.00 53.50 ? 63  THR C HG1  1  
ATOM 5742   H HG21 . THR C 1 63  ? 4.135   -8.011  -17.418 1.00 20.14 ? 63  THR C HG21 1  
ATOM 5743   H HG22 . THR C 1 63  ? 3.853   -7.108  -15.935 1.00 33.24 ? 63  THR C HG22 1  
ATOM 5744   H HG23 . THR C 1 63  ? 2.832   -6.830  -17.348 1.00 43.45 ? 63  THR C HG23 1  
ATOM 5745   N N    . VAL C 1 64  ? 0.413   -5.939  -15.787 1.00 25.02 ? 64  VAL C N    1  
ATOM 5746   C CA   . VAL C 1 64  ? -0.346  -4.913  -16.471 1.00 4.23  ? 64  VAL C CA   1  
ATOM 5747   C C    . VAL C 1 64  ? 0.621   -4.107  -17.327 1.00 33.33 ? 64  VAL C C    1  
ATOM 5748   O O    . VAL C 1 64  ? 1.492   -3.400  -16.796 1.00 55.31 ? 64  VAL C O    1  
ATOM 5749   C CB   . VAL C 1 64  ? -1.083  -3.972  -15.458 1.00 15.43 ? 64  VAL C CB   1  
ATOM 5750   C CG1  . VAL C 1 64  ? -1.980  -2.980  -16.218 1.00 31.13 ? 64  VAL C CG1  1  
ATOM 5751   C CG2  . VAL C 1 64  ? -1.878  -4.795  -14.410 1.00 24.32 ? 64  VAL C CG2  1  
ATOM 5752   H H    . VAL C 1 64  ? 0.999   -5.672  -15.052 1.00 62.33 ? 64  VAL C H    1  
ATOM 5753   H HA   . VAL C 1 64  ? -1.095  -5.385  -17.113 1.00 51.31 ? 64  VAL C HA   1  
ATOM 5754   H HB   . VAL C 1 64  ? -0.330  -3.392  -14.921 1.00 55.04 ? 64  VAL C HB   1  
ATOM 5755   H HG11 . VAL C 1 64  ? -1.369  -2.341  -16.832 1.00 3.13  ? 64  VAL C HG11 1  
ATOM 5756   H HG12 . VAL C 1 64  ? -2.549  -2.377  -15.525 1.00 1.53  ? 64  VAL C HG12 1  
ATOM 5757   H HG13 . VAL C 1 64  ? -2.656  -3.524  -16.863 1.00 43.32 ? 64  VAL C HG13 1  
ATOM 5758   H HG21 . VAL C 1 64  ? -1.318  -5.680  -14.140 1.00 54.22 ? 64  VAL C HG21 1  
ATOM 5759   H HG22 . VAL C 1 64  ? -2.829  -5.092  -14.789 1.00 10.11 ? 64  VAL C HG22 1  
ATOM 5760   H HG23 . VAL C 1 64  ? -2.032  -4.199  -13.527 1.00 1.34  ? 64  VAL C HG23 1  
ATOM 5761   N N    . THR C 1 65  ? 0.501   -4.258  -18.645 1.00 30.41 ? 65  THR C N    1  
ATOM 5762   C CA   . THR C 1 65  ? 1.291   -3.491  -19.600 1.00 44.54 ? 65  THR C CA   1  
ATOM 5763   C C    . THR C 1 65  ? 0.398   -2.448  -20.263 1.00 60.32 ? 65  THR C C    1  
ATOM 5764   O O    . THR C 1 65  ? -0.654  -2.785  -20.777 1.00 34.03 ? 65  THR C O    1  
ATOM 5765   C CB   . THR C 1 65  ? 1.938   -4.407  -20.702 1.00 54.12 ? 65  THR C CB   1  
ATOM 5766   O OG1  . THR C 1 65  ? 2.535   -5.573  -20.096 1.00 71.02 ? 65  THR C OG1  1  
ATOM 5767   C CG2  . THR C 1 65  ? 3.014   -3.634  -21.521 1.00 3.02  ? 65  THR C CG2  1  
ATOM 5768   H H    . THR C 1 65  ? -0.150  -4.902  -18.988 1.00 31.44 ? 65  THR C H    1  
ATOM 5769   H HA   . THR C 1 65  ? 2.081   -2.988  -19.054 1.00 13.14 ? 65  THR C HA   1  
ATOM 5770   H HB   . THR C 1 65  ? 1.161   -4.749  -21.383 1.00 71.52 ? 65  THR C HB   1  
ATOM 5771   H HG1  . THR C 1 65  ? 2.061   -5.803  -19.295 1.00 24.23 ? 65  THR C HG1  1  
ATOM 5772   H HG21 . THR C 1 65  ? 3.752   -4.323  -21.905 1.00 32.51 ? 65  THR C HG21 1  
ATOM 5773   H HG22 . THR C 1 65  ? 3.518   -2.911  -20.890 1.00 13.03 ? 65  THR C HG22 1  
ATOM 5774   H HG23 . THR C 1 65  ? 2.546   -3.114  -22.348 1.00 33.31 ? 65  THR C HG23 1  
ATOM 5775   N N    . ALA C 1 66  ? 0.820   -1.188  -20.232 1.00 63.33 ? 66  ALA C N    1  
ATOM 5776   C CA   . ALA C 1 66  ? 0.118   -0.093  -20.906 1.00 61.13 ? 66  ALA C CA   1  
ATOM 5777   C C    . ALA C 1 66  ? 1.011   0.423   -22.022 1.00 62.24 ? 66  ALA C C    1  
ATOM 5778   O O    . ALA C 1 66  ? 2.072   0.970   -21.732 1.00 14.20 ? 66  ALA C O    1  
ATOM 5779   C CB   . ALA C 1 66  ? -0.223  1.018   -19.903 1.00 63.22 ? 66  ALA C CB   1  
ATOM 5780   H H    . ALA C 1 66  ? 1.654   -0.985  -19.749 1.00 0.32  ? 66  ALA C H    1  
ATOM 5781   H HA   . ALA C 1 66  ? -0.821  -0.470  -21.332 1.00 71.21 ? 66  ALA C HA   1  
ATOM 5782   H HB1  . ALA C 1 66  ? -0.861  1.747   -20.374 1.00 12.22 ? 66  ALA C HB1  1  
ATOM 5783   H HB2  . ALA C 1 66  ? 0.683   1.511   -19.569 1.00 34.42 ? 66  ALA C HB2  1  
ATOM 5784   H HB3  . ALA C 1 66  ? -0.736  0.597   -19.045 1.00 0.21  ? 66  ALA C HB3  1  
ATOM 5785   N N    . SER C 1 67  ? 0.618   0.191   -23.285 1.00 71.13 ? 67  SER C N    1  
ATOM 5786   C CA   . SER C 1 67  ? 1.374   0.661   -24.459 1.00 53.21 ? 67  SER C CA   1  
ATOM 5787   C C    . SER C 1 67  ? 0.405   0.971   -25.612 1.00 74.42 ? 67  SER C C    1  
ATOM 5788   O O    . SER C 1 67  ? -0.378  0.109   -25.999 1.00 70.31 ? 67  SER C O    1  
ATOM 5789   C CB   . SER C 1 67  ? 2.405   -0.415  -24.918 1.00 54.55 ? 67  SER C CB   1  
ATOM 5790   O OG   . SER C 1 67  ? 3.290   -0.778  -23.870 1.00 24.40 ? 67  SER C OG   1  
ATOM 5791   H H    . SER C 1 67  ? -0.206  -0.328  -23.436 1.00 10.14 ? 67  SER C H    1  
ATOM 5792   H HA   . SER C 1 67  ? 1.907   1.576   -24.179 1.00 55.14 ? 67  SER C HA   1  
ATOM 5793   H HB2  . SER C 1 67  ? 1.884   -1.304  -25.245 1.00 55.13 ? 67  SER C HB2  1  
ATOM 5794   H HB3  . SER C 1 67  ? 2.995   -0.029  -25.746 1.00 5.22  ? 67  SER C HB3  1  
ATOM 5795   H HG   . SER C 1 67  ? 4.188   -0.853  -24.214 1.00 71.14 ? 67  SER C HG   1  
ATOM 5796   N N    . LEU C 1 68  ? 0.485   2.188   -26.179 1.00 72.41 ? 68  LEU C N    1  
ATOM 5797   C CA   . LEU C 1 68  ? -0.337  2.612   -27.341 1.00 21.14 ? 68  LEU C CA   1  
ATOM 5798   C C    . LEU C 1 68  ? 0.379   2.210   -28.654 1.00 73.32 ? 68  LEU C C    1  
ATOM 5799   O O    . LEU C 1 68  ? 0.696   3.054   -29.508 1.00 22.14 ? 68  LEU C O    1  
ATOM 5800   C CB   . LEU C 1 68  ? -0.707  4.147   -27.302 1.00 13.41 ? 68  LEU C CB   1  
ATOM 5801   C CG   . LEU C 1 68  ? 0.393   5.165   -26.825 1.00 53.20 ? 68  LEU C CG   1  
ATOM 5802   C CD1  . LEU C 1 68  ? 0.130   6.585   -27.388 1.00 64.23 ? 68  LEU C CD1  1  
ATOM 5803   C CD2  . LEU C 1 68  ? 0.495   5.215   -25.276 1.00 70.43 ? 68  LEU C CD2  1  
ATOM 5804   H H    . LEU C 1 68  ? 1.146   2.814   -25.825 1.00 71.10 ? 68  LEU C H    1  
ATOM 5805   H HA   . LEU C 1 68  ? -1.268  2.043   -27.300 1.00 74.01 ? 68  LEU C HA   1  
ATOM 5806   H HB2  . LEU C 1 68  ? -1.015  4.434   -28.302 1.00 34.20 ? 68  LEU C HB2  1  
ATOM 5807   H HB3  . LEU C 1 68  ? -1.575  4.266   -26.657 1.00 40.24 ? 68  LEU C HB3  1  
ATOM 5808   H HG   . LEU C 1 68  ? 1.355   4.841   -27.204 1.00 34.42 ? 68  LEU C HG   1  
ATOM 5809   H HD11 . LEU C 1 68  ? 0.118   6.546   -28.468 1.00 41.33 ? 68  LEU C HD11 1  
ATOM 5810   H HD12 . LEU C 1 68  ? 0.916   7.258   -27.071 1.00 14.30 ? 68  LEU C HD12 1  
ATOM 5811   H HD13 . LEU C 1 68  ? -0.824  6.958   -27.032 1.00 53.01 ? 68  LEU C HD13 1  
ATOM 5812   H HD21 . LEU C 1 68  ? 0.728   4.228   -24.896 1.00 10.12 ? 68  LEU C HD21 1  
ATOM 5813   H HD22 . LEU C 1 68  ? -0.441  5.553   -24.845 1.00 21.32 ? 68  LEU C HD22 1  
ATOM 5814   H HD23 . LEU C 1 68  ? 1.285   5.895   -24.988 1.00 13.13 ? 68  LEU C HD23 1  
ATOM 5815   N N    . GLY C 1 69  ? 0.626   0.891   -28.783 1.00 64.43 ? 69  GLY C N    1  
ATOM 5816   C CA   . GLY C 1 69  ? 1.443   0.312   -29.851 1.00 31.44 ? 69  GLY C CA   1  
ATOM 5817   C C    . GLY C 1 69  ? 2.782   -0.135  -29.292 1.00 12.31 ? 69  GLY C C    1  
ATOM 5818   O O    . GLY C 1 69  ? 2.823   -0.976  -28.387 1.00 13.42 ? 69  GLY C O    1  
ATOM 5819   H H    . GLY C 1 69  ? 0.230   0.282   -28.122 1.00 55.43 ? 69  GLY C H    1  
ATOM 5820   H HA2  . GLY C 1 69  ? 0.927   -0.548  -30.262 1.00 44.42 ? 69  GLY C HA2  1  
ATOM 5821   H HA3  . GLY C 1 69  ? 1.601   1.035   -30.647 1.00 33.33 ? 69  GLY C HA3  1  
ATOM 5822   N N    . GLU C 1 70  ? 3.875   0.447   -29.805 1.00 23.34 ? 70  GLU C N    1  
ATOM 5823   C CA   . GLU C 1 70  ? 5.240   0.230   -29.281 1.00 30.13 ? 70  GLU C CA   1  
ATOM 5824   C C    . GLU C 1 70  ? 5.542   1.270   -28.186 1.00 2.54  ? 70  GLU C C    1  
ATOM 5825   O O    . GLU C 1 70  ? 6.394   1.052   -27.321 1.00 74.33 ? 70  GLU C O    1  
ATOM 5826   C CB   . GLU C 1 70  ? 6.278   0.349   -30.430 1.00 54.42 ? 70  GLU C CB   1  
ATOM 5827   C CG   . GLU C 1 70  ? 6.029   -0.605  -31.620 1.00 43.24 ? 70  GLU C CG   1  
ATOM 5828   C CD   . GLU C 1 70  ? 7.053   -0.439  -32.757 1.00 1.41  ? 70  GLU C CD   1  
ATOM 5829   O OE1  . GLU C 1 70  ? 7.066   0.631   -33.405 1.00 60.42 ? 70  GLU C OE1  1  
ATOM 5830   O OE2  . GLU C 1 70  ? 7.849   -1.365  -33.006 1.00 65.32 ? 70  GLU C OE2  1  
ATOM 5831   H H    . GLU C 1 70  ? 3.761   1.056   -30.570 1.00 55.42 ? 70  GLU C H    1  
ATOM 5832   H HA   . GLU C 1 70  ? 5.297   -0.768  -28.848 1.00 54.31 ? 70  GLU C HA   1  
ATOM 5833   H HB2  . GLU C 1 70  ? 6.268   1.369   -30.808 1.00 34.33 ? 70  GLU C HB2  1  
ATOM 5834   H HB3  . GLU C 1 70  ? 7.267   0.142   -30.032 1.00 22.03 ? 70  GLU C HB3  1  
ATOM 5835   H HG2  . GLU C 1 70  ? 6.058   -1.630  -31.258 1.00 74.55 ? 70  GLU C HG2  1  
ATOM 5836   H HG3  . GLU C 1 70  ? 5.038   -0.408  -32.018 1.00 62.33 ? 70  GLU C HG3  1  
ATOM 5837   N N    . GLU C 1 71  ? 4.824   2.404   -28.259 1.00 71.24 ? 71  GLU C N    1  
ATOM 5838   C CA   . GLU C 1 71  ? 4.958   3.524   -27.326 1.00 15.21 ? 71  GLU C CA   1  
ATOM 5839   C C    . GLU C 1 71  ? 4.448   3.126   -25.925 1.00 1.21  ? 71  GLU C C    1  
ATOM 5840   O O    . GLU C 1 71  ? 3.237   3.163   -25.655 1.00 63.43 ? 71  GLU C O    1  
ATOM 5841   C CB   . GLU C 1 71  ? 4.187   4.746   -27.894 1.00 31.14 ? 71  GLU C CB   1  
ATOM 5842   C CG   . GLU C 1 71  ? 4.287   6.033   -27.061 1.00 34.42 ? 71  GLU C CG   1  
ATOM 5843   C CD   . GLU C 1 71  ? 5.731   6.500   -26.841 1.00 61.34 ? 71  GLU C CD   1  
ATOM 5844   O OE1  . GLU C 1 71  ? 6.222   6.449   -25.696 1.00 70.20 ? 71  GLU C OE1  1  
ATOM 5845   O OE2  . GLU C 1 71  ? 6.384   6.924   -27.815 1.00 35.42 ? 71  GLU C OE2  1  
ATOM 5846   H H    . GLU C 1 71  ? 4.178   2.491   -28.985 1.00 61.51 ? 71  GLU C H    1  
ATOM 5847   H HA   . GLU C 1 71  ? 6.010   3.775   -27.263 1.00 31.42 ? 71  GLU C HA   1  
ATOM 5848   H HB2  . GLU C 1 71  ? 4.567   4.962   -28.889 1.00 32.34 ? 71  GLU C HB2  1  
ATOM 5849   H HB3  . GLU C 1 71  ? 3.137   4.483   -27.984 1.00 32.34 ? 71  GLU C HB3  1  
ATOM 5850   H HG2  . GLU C 1 71  ? 3.742   6.823   -27.571 1.00 22.53 ? 71  GLU C HG2  1  
ATOM 5851   H HG3  . GLU C 1 71  ? 3.817   5.858   -26.099 1.00 63.41 ? 71  GLU C HG3  1  
ATOM 5852   N N    . THR C 1 72  ? 5.387   2.714   -25.052 1.00 34.54 ? 72  THR C N    1  
ATOM 5853   C CA   . THR C 1 72  ? 5.059   2.183   -23.722 1.00 34.23 ? 72  THR C CA   1  
ATOM 5854   C C    . THR C 1 72  ? 4.839   3.320   -22.705 1.00 34.11 ? 72  THR C C    1  
ATOM 5855   O O    . THR C 1 72  ? 5.669   4.224   -22.550 1.00 33.13 ? 72  THR C O    1  
ATOM 5856   C CB   . THR C 1 72  ? 6.147   1.177   -23.212 1.00 61.41 ? 72  THR C CB   1  
ATOM 5857   O OG1  . THR C 1 72  ? 6.345   0.148   -24.204 1.00 2.11  ? 72  THR C OG1  1  
ATOM 5858   C CG2  . THR C 1 72  ? 5.727   0.517   -21.877 1.00 40.33 ? 72  THR C CG2  1  
ATOM 5859   H H    . THR C 1 72  ? 6.327   2.770   -25.315 1.00 35.50 ? 72  THR C H    1  
ATOM 5860   H HA   . THR C 1 72  ? 4.125   1.623   -23.823 1.00 42.51 ? 72  THR C HA   1  
ATOM 5861   H HB   . THR C 1 72  ? 7.085   1.708   -23.066 1.00 34.25 ? 72  THR C HB   1  
ATOM 5862   H HG1  . THR C 1 72  ? 6.473   0.553   -25.066 1.00 2.31  ? 72  THR C HG1  1  
ATOM 5863   H HG21 . THR C 1 72  ? 5.733   1.255   -21.086 1.00 74.24 ? 72  THR C HG21 1  
ATOM 5864   H HG22 . THR C 1 72  ? 6.404   -0.284  -21.627 1.00 24.10 ? 72  THR C HG22 1  
ATOM 5865   H HG23 . THR C 1 72  ? 4.727   0.110   -21.974 1.00 73.45 ? 72  THR C HG23 1  
ATOM 5866   N N    . ALA C 1 73  ? 3.678   3.253   -22.055 1.00 51.00 ? 73  ALA C N    1  
ATOM 5867   C CA   . ALA C 1 73  ? 3.230   4.197   -21.028 1.00 35.44 ? 73  ALA C CA   1  
ATOM 5868   C C    . ALA C 1 73  ? 3.834   3.824   -19.665 1.00 2.24  ? 73  ALA C C    1  
ATOM 5869   O O    . ALA C 1 73  ? 4.466   4.663   -19.006 1.00 13.32 ? 73  ALA C O    1  
ATOM 5870   C CB   . ALA C 1 73  ? 1.694   4.192   -20.994 1.00 33.00 ? 73  ALA C CB   1  
ATOM 5871   H H    . ALA C 1 73  ? 3.088   2.510   -22.280 1.00 32.22 ? 73  ALA C H    1  
ATOM 5872   H HA   . ALA C 1 73  ? 3.561   5.198   -21.309 1.00 51.40 ? 73  ALA C HA   1  
ATOM 5873   H HB1  . ALA C 1 73  ? 1.343   4.893   -20.257 1.00 13.01 ? 73  ALA C HB1  1  
ATOM 5874   H HB2  . ALA C 1 73  ? 1.334   3.202   -20.743 1.00 35.45 ? 73  ALA C HB2  1  
ATOM 5875   H HB3  . ALA C 1 73  ? 1.309   4.474   -21.965 1.00 61.52 ? 73  ALA C HB3  1  
ATOM 5876   N N    . PHE C 1 74  ? 3.626   2.550   -19.266 1.00 61.41 ? 74  PHE C N    1  
ATOM 5877   C CA   . PHE C 1 74  ? 4.240   1.956   -18.058 1.00 64.04 ? 74  PHE C CA   1  
ATOM 5878   C C    . PHE C 1 74  ? 4.135   0.420   -18.103 1.00 64.12 ? 74  PHE C C    1  
ATOM 5879   O O    . PHE C 1 74  ? 3.432   -0.154  -18.951 1.00 30.11 ? 74  PHE C O    1  
ATOM 5880   C CB   . PHE C 1 74  ? 3.610   2.515   -16.736 1.00 33.32 ? 74  PHE C CB   1  
ATOM 5881   C CG   . PHE C 1 74  ? 2.121   2.193   -16.509 1.00 11.43 ? 74  PHE C CG   1  
ATOM 5882   C CD1  . PHE C 1 74  ? 1.121   3.044   -16.975 1.00 74.00 ? 74  PHE C CD1  1  
ATOM 5883   C CD2  . PHE C 1 74  ? 1.729   1.035   -15.823 1.00 2.05  ? 74  PHE C CD2  1  
ATOM 5884   C CE1  . PHE C 1 74  ? -0.217  2.753   -16.764 1.00 20.03 ? 74  PHE C CE1  1  
ATOM 5885   C CE2  . PHE C 1 74  ? 0.393   0.746   -15.618 1.00 31.24 ? 74  PHE C CE2  1  
ATOM 5886   C CZ   . PHE C 1 74  ? -0.581  1.604   -16.089 1.00 62.33 ? 74  PHE C CZ   1  
ATOM 5887   H H    . PHE C 1 74  ? 3.039   1.979   -19.814 1.00 2.31  ? 74  PHE C H    1  
ATOM 5888   H HA   . PHE C 1 74  ? 5.301   2.212   -18.073 1.00 65.30 ? 74  PHE C HA   1  
ATOM 5889   H HB2  . PHE C 1 74  ? 4.165   2.124   -15.889 1.00 42.41 ? 74  PHE C HB2  1  
ATOM 5890   H HB3  . PHE C 1 74  ? 3.719   3.596   -16.734 1.00 41.24 ? 74  PHE C HB3  1  
ATOM 5891   H HD1  . PHE C 1 74  ? 1.396   3.948   -17.508 1.00 14.40 ? 74  PHE C HD1  1  
ATOM 5892   H HD2  . PHE C 1 74  ? 2.488   0.357   -15.450 1.00 52.44 ? 74  PHE C HD2  1  
ATOM 5893   H HE1  . PHE C 1 74  ? -0.979  3.426   -17.135 1.00 74.21 ? 74  PHE C HE1  1  
ATOM 5894   H HE2  . PHE C 1 74  ? 0.110   -0.153  -15.088 1.00 31.31 ? 74  PHE C HE2  1  
ATOM 5895   H HZ   . PHE C 1 74  ? -1.627  1.380   -15.928 1.00 32.11 ? 74  PHE C HZ   1  
ATOM 5896   N N    . LEU C 1 75  ? 4.833   -0.218  -17.160 1.00 2.35  ? 75  LEU C N    1  
ATOM 5897   C CA   . LEU C 1 75  ? 4.849   -1.677  -16.965 1.00 21.11 ? 75  LEU C CA   1  
ATOM 5898   C C    . LEU C 1 75  ? 4.752   -1.916  -15.451 1.00 21.32 ? 75  LEU C C    1  
ATOM 5899   O O    . LEU C 1 75  ? 5.398   -1.217  -14.680 1.00 62.33 ? 75  LEU C O    1  
ATOM 5900   C CB   . LEU C 1 75  ? 6.169   -2.271  -17.569 1.00 71.32 ? 75  LEU C CB   1  
ATOM 5901   C CG   . LEU C 1 75  ? 6.275   -3.831  -17.795 1.00 35.23 ? 75  LEU C CG   1  
ATOM 5902   C CD1  . LEU C 1 75  ? 6.418   -4.645  -16.481 1.00 25.44 ? 75  LEU C CD1  1  
ATOM 5903   C CD2  . LEU C 1 75  ? 5.086   -4.336  -18.638 1.00 65.31 ? 75  LEU C CD2  1  
ATOM 5904   H H    . LEU C 1 75  ? 5.370   0.323   -16.546 1.00 12.44 ? 75  LEU C H    1  
ATOM 5905   H HA   . LEU C 1 75  ? 3.982   -2.115  -17.462 1.00 12.25 ? 75  LEU C HA   1  
ATOM 5906   H HB2  . LEU C 1 75  ? 6.325   -1.795  -18.532 1.00 35.55 ? 75  LEU C HB2  1  
ATOM 5907   H HB3  . LEU C 1 75  ? 6.997   -1.970  -16.930 1.00 73.44 ? 75  LEU C HB3  1  
ATOM 5908   H HG   . LEU C 1 75  ? 7.175   -4.026  -18.371 1.00 44.25 ? 75  LEU C HG   1  
ATOM 5909   H HD11 . LEU C 1 75  ? 7.231   -4.246  -15.896 1.00 30.43 ? 75  LEU C HD11 1  
ATOM 5910   H HD12 . LEU C 1 75  ? 6.627   -5.678  -16.710 1.00 74.33 ? 75  LEU C HD12 1  
ATOM 5911   H HD13 . LEU C 1 75  ? 5.503   -4.584  -15.902 1.00 2.20  ? 75  LEU C HD13 1  
ATOM 5912   H HD21 . LEU C 1 75  ? 4.173   -4.304  -18.055 1.00 0.33  ? 75  LEU C HD21 1  
ATOM 5913   H HD22 . LEU C 1 75  ? 5.261   -5.351  -18.972 1.00 1.24  ? 75  LEU C HD22 1  
ATOM 5914   H HD23 . LEU C 1 75  ? 4.968   -3.709  -19.510 1.00 40.44 ? 75  LEU C HD23 1  
ATOM 5915   N N    . CYS C 1 76  ? 3.949   -2.893  -15.039 1.00 30.21 ? 76  CYS C N    1  
ATOM 5916   C CA   . CYS C 1 76  ? 3.800   -3.279  -13.624 1.00 73.35 ? 76  CYS C CA   1  
ATOM 5917   C C    . CYS C 1 76  ? 3.549   -4.781  -13.562 1.00 0.02  ? 76  CYS C C    1  
ATOM 5918   O O    . CYS C 1 76  ? 2.859   -5.320  -14.426 1.00 53.43 ? 76  CYS C O    1  
ATOM 5919   C CB   . CYS C 1 76  ? 2.643   -2.500  -12.949 1.00 74.05 ? 76  CYS C CB   1  
ATOM 5920   S SG   . CYS C 1 76  ? 2.462   -2.836  -11.180 1.00 31.30 ? 76  CYS C SG   1  
ATOM 5921   H H    . CYS C 1 76  ? 3.443   -3.395  -15.711 1.00 2.33  ? 76  CYS C H    1  
ATOM 5922   H HA   . CYS C 1 76  ? 4.734   -3.057  -13.105 1.00 43.45 ? 76  CYS C HA   1  
ATOM 5923   H HB2  . CYS C 1 76  ? 2.822   -1.439  -13.057 1.00 62.40 ? 76  CYS C HB2  1  
ATOM 5924   H HB3  . CYS C 1 76  ? 1.701   -2.749  -13.429 1.00 64.52 ? 76  CYS C HB3  1  
ATOM 5925   H HG   . CYS C 1 76  ? 3.584   -3.395  -10.747 1.00 42.22 ? 76  CYS C HG   1  
ATOM 5926   N N    . GLU C 1 77  ? 4.107   -5.446  -12.543 1.00 63.04 ? 77  GLU C N    1  
ATOM 5927   C CA   . GLU C 1 77  ? 4.030   -6.905  -12.401 1.00 72.00 ? 77  GLU C CA   1  
ATOM 5928   C C    . GLU C 1 77  ? 4.189   -7.292  -10.937 1.00 24.32 ? 77  GLU C C    1  
ATOM 5929   O O    . GLU C 1 77  ? 5.039   -6.752  -10.233 1.00 42.24 ? 77  GLU C O    1  
ATOM 5930   C CB   . GLU C 1 77  ? 5.124   -7.603  -13.263 1.00 40.13 ? 77  GLU C CB   1  
ATOM 5931   C CG   . GLU C 1 77  ? 5.143   -9.145  -13.156 1.00 4.13  ? 77  GLU C CG   1  
ATOM 5932   C CD   . GLU C 1 77  ? 6.246   -9.803  -13.997 1.00 35.44 ? 77  GLU C CD   1  
ATOM 5933   O OE1  . GLU C 1 77  ? 7.353   -10.044 -13.470 1.00 53.31 ? 77  GLU C OE1  1  
ATOM 5934   O OE2  . GLU C 1 77  ? 6.018   -10.074 -15.198 1.00 45.33 ? 77  GLU C OE2  1  
ATOM 5935   H H    . GLU C 1 77  ? 4.580   -4.937  -11.850 1.00 71.01 ? 77  GLU C H    1  
ATOM 5936   H HA   . GLU C 1 77  ? 3.042   -7.223  -12.732 1.00 33.50 ? 77  GLU C HA   1  
ATOM 5937   H HB2  . GLU C 1 77  ? 4.964   -7.336  -14.304 1.00 52.23 ? 77  GLU C HB2  1  
ATOM 5938   H HB3  . GLU C 1 77  ? 6.097   -7.228  -12.962 1.00 2.52  ? 77  GLU C HB3  1  
ATOM 5939   H HG2  . GLU C 1 77  ? 5.287   -9.420  -12.115 1.00 72.05 ? 77  GLU C HG2  1  
ATOM 5940   H HG3  . GLU C 1 77  ? 4.177   -9.528  -13.479 1.00 10.34 ? 77  GLU C HG3  1  
ATOM 5941   N N    . VAL C 1 78  ? 3.333   -8.215  -10.485 1.00 63.33 ? 78  VAL C N    1  
ATOM 5942   C CA   . VAL C 1 78  ? 3.354   -8.764  -9.126  1.00 14.04 ? 78  VAL C CA   1  
ATOM 5943   C C    . VAL C 1 78  ? 3.110   -10.276 -9.212  1.00 4.40  ? 78  VAL C C    1  
ATOM 5944   O O    . VAL C 1 78  ? 2.215   -10.725 -9.933  1.00 61.13 ? 78  VAL C O    1  
ATOM 5945   C CB   . VAL C 1 78  ? 2.239   -8.115  -8.210  1.00 2.15  ? 78  VAL C CB   1  
ATOM 5946   C CG1  . VAL C 1 78  ? 2.229   -8.752  -6.788  1.00 22.43 ? 78  VAL C CG1  1  
ATOM 5947   C CG2  . VAL C 1 78  ? 2.404   -6.571  -8.141  1.00 61.34 ? 78  VAL C CG2  1  
ATOM 5948   H H    . VAL C 1 78  ? 2.653   -8.554  -11.104 1.00 41.02 ? 78  VAL C H    1  
ATOM 5949   H HA   . VAL C 1 78  ? 4.335   -8.579  -8.680  1.00 33.33 ? 78  VAL C HA   1  
ATOM 5950   H HB   . VAL C 1 78  ? 1.266   -8.322  -8.667  1.00 3.41  ? 78  VAL C HB   1  
ATOM 5951   H HG11 . VAL C 1 78  ? 2.984   -8.293  -6.159  1.00 74.14 ? 78  VAL C HG11 1  
ATOM 5952   H HG12 . VAL C 1 78  ? 2.432   -9.807  -6.858  1.00 42.10 ? 78  VAL C HG12 1  
ATOM 5953   H HG13 . VAL C 1 78  ? 1.266   -8.630  -6.343  1.00 40.42 ? 78  VAL C HG13 1  
ATOM 5954   H HG21 . VAL C 1 78  ? 3.213   -6.307  -7.469  1.00 52.34 ? 78  VAL C HG21 1  
ATOM 5955   H HG22 . VAL C 1 78  ? 1.491   -6.118  -7.803  1.00 14.14 ? 78  VAL C HG22 1  
ATOM 5956   H HG23 . VAL C 1 78  ? 2.626   -6.186  -9.124  1.00 53.34 ? 78  VAL C HG23 1  
ATOM 5957   N N    . GLN C 1 79  ? 3.901   -11.050 -8.467  1.00 21.53 ? 79  GLN C N    1  
ATOM 5958   C CA   . GLN C 1 79  ? 3.694   -12.487 -8.295  1.00 75.12 ? 79  GLN C CA   1  
ATOM 5959   C C    . GLN C 1 79  ? 3.143   -12.718 -6.890  1.00 31.14 ? 79  GLN C C    1  
ATOM 5960   O O    . GLN C 1 79  ? 3.897   -12.843 -5.921  1.00 74.54 ? 79  GLN C O    1  
ATOM 5961   C CB   . GLN C 1 79  ? 5.016   -13.269 -8.558  1.00 33.14 ? 79  GLN C CB   1  
ATOM 5962   C CG   . GLN C 1 79  ? 5.504   -13.191 -10.019 1.00 1.10  ? 79  GLN C CG   1  
ATOM 5963   C CD   . GLN C 1 79  ? 6.821   -13.933 -10.276 1.00 0.20  ? 79  GLN C CD   1  
ATOM 5964   O OE1  . GLN C 1 79  ? 6.832   -15.140 -10.527 1.00 13.43 ? 79  GLN C OE1  1  
ATOM 5965   N NE2  . GLN C 1 79  ? 7.927   -13.210 -10.264 1.00 63.14 ? 79  GLN C NE2  1  
ATOM 5966   H H    . GLN C 1 79  ? 4.643   -10.630 -7.993  1.00 74.20 ? 79  GLN C H    1  
ATOM 5967   H HA   . GLN C 1 79  ? 2.939   -12.813 -9.008  1.00 31.11 ? 79  GLN C HA   1  
ATOM 5968   H HB2  . GLN C 1 79  ? 5.793   -12.867 -7.916  1.00 51.21 ? 79  GLN C HB2  1  
ATOM 5969   H HB3  . GLN C 1 79  ? 4.866   -14.315 -8.305  1.00 74.01 ? 79  GLN C HB3  1  
ATOM 5970   H HG2  . GLN C 1 79  ? 4.742   -13.616 -10.663 1.00 11.55 ? 79  GLN C HG2  1  
ATOM 5971   H HG3  . GLN C 1 79  ? 5.634   -12.146 -10.284 1.00 71.51 ? 79  GLN C HG3  1  
ATOM 5972   H HE21 . GLN C 1 79  ? 7.846   -12.244 -10.099 1.00 13.44 ? 79  GLN C HE21 1  
ATOM 5973   H HE22 . GLN C 1 79  ? 8.783   -13.662 -10.415 1.00 5.23  ? 79  GLN C HE22 1  
ATOM 5974   N N    . GLN C 1 80  ? 1.806   -12.674 -6.790  1.00 74.20 ? 80  GLN C N    1  
ATOM 5975   C CA   . GLN C 1 80  ? 1.087   -12.845 -5.531  1.00 42.13 ? 80  GLN C CA   1  
ATOM 5976   C C    . GLN C 1 80  ? 0.960   -14.340 -5.205  1.00 61.22 ? 80  GLN C C    1  
ATOM 5977   O O    . GLN C 1 80  ? 0.210   -15.058 -5.866  1.00 1.51  ? 80  GLN C O    1  
ATOM 5978   C CB   . GLN C 1 80  ? -0.317  -12.181 -5.616  1.00 72.22 ? 80  GLN C CB   1  
ATOM 5979   C CG   . GLN C 1 80  ? -1.063  -12.167 -4.271  1.00 74.24 ? 80  GLN C CG   1  
ATOM 5980   C CD   . GLN C 1 80  ? -0.416  -11.255 -3.232  1.00 24.01 ? 80  GLN C CD   1  
ATOM 5981   O OE1  . GLN C 1 80  ? -0.387  -11.571 -2.046  1.00 3.41  ? 80  GLN C OE1  1  
ATOM 5982   N NE2  . GLN C 1 80  ? 0.000   -10.064 -3.650  1.00 60.24 ? 80  GLN C NE2  1  
ATOM 5983   H H    . GLN C 1 80  ? 1.281   -12.524 -7.606  1.00 44.32 ? 80  GLN C H    1  
ATOM 5984   H HA   . GLN C 1 80  ? 1.659   -12.352 -4.742  1.00 51.23 ? 80  GLN C HA   1  
ATOM 5985   H HB2  . GLN C 1 80  ? -0.196  -11.155 -5.947  1.00 33.23 ? 80  GLN C HB2  1  
ATOM 5986   H HB3  . GLN C 1 80  ? -0.931  -12.704 -6.348  1.00 55.04 ? 80  GLN C HB3  1  
ATOM 5987   H HG2  . GLN C 1 80  ? -2.076  -11.821 -4.439  1.00 10.50 ? 80  GLN C HG2  1  
ATOM 5988   H HG3  . GLN C 1 80  ? -1.099  -13.178 -3.879  1.00 3.31  ? 80  GLN C HG3  1  
ATOM 5989   H HE21 . GLN C 1 80  ? -0.130  -9.825  -4.593  1.00 22.24 ? 80  GLN C HE21 1  
ATOM 5990   H HE22 . GLN C 1 80  ? 0.407   -9.471  -2.994  1.00 43.53 ? 80  GLN C HE22 1  
ATOM 5991   N N    . GLY C 1 81  ? 1.718   -14.798 -4.203  1.00 51.50 ? 81  GLY C N    1  
ATOM 5992   C CA   . GLY C 1 81  ? 1.684   -16.192 -3.770  1.00 12.34 ? 81  GLY C CA   1  
ATOM 5993   C C    . GLY C 1 81  ? 0.905   -16.367 -2.482  1.00 21.22 ? 81  GLY C C    1  
ATOM 5994   O O    . GLY C 1 81  ? 0.927   -15.498 -1.603  1.00 74.31 ? 81  GLY C O    1  
ATOM 5995   H H    . GLY C 1 81  ? 2.300   -14.168 -3.731  1.00 71.10 ? 81  GLY C H    1  
ATOM 5996   H HA2  . GLY C 1 81  ? 1.243   -16.815 -4.546  1.00 24.02 ? 81  GLY C HA2  1  
ATOM 5997   H HA3  . GLY C 1 81  ? 2.697   -16.520 -3.604  1.00 23.05 ? 81  GLY C HA3  1  
ATOM 5998   N N    . GLY C 1 82  ? 0.223   -17.500 -2.368  1.00 2.52  ? 82  GLY C N    1  
ATOM 5999   C CA   . GLY C 1 82  ? -0.568  -17.822 -1.197  1.00 31.10 ? 82  GLY C CA   1  
ATOM 6000   C C    . GLY C 1 82  ? -0.454  -19.282 -0.874  1.00 61.32 ? 82  GLY C C    1  
ATOM 6001   O O    . GLY C 1 82  ? -0.648  -20.132 -1.753  1.00 22.25 ? 82  GLY C O    1  
ATOM 6002   H H    . GLY C 1 82  ? 0.263   -18.147 -3.103  1.00 42.02 ? 82  GLY C H    1  
ATOM 6003   H HA2  . GLY C 1 82  ? -0.239  -17.228 -0.344  1.00 12.21 ? 82  GLY C HA2  1  
ATOM 6004   H HA3  . GLY C 1 82  ? -1.604  -17.593 -1.402  1.00 41.11 ? 82  GLY C HA3  1  
ATOM 6005   N N    . ILE C 1 83  ? -0.111  -19.588 0.375   1.00 25.34 ? 83  ILE C N    1  
ATOM 6006   C CA   . ILE C 1 83  ? -0.044  -20.959 0.846   1.00 4.32  ? 83  ILE C CA   1  
ATOM 6007   C C    . ILE C 1 83  ? -1.466  -21.405 1.195   1.00 44.41 ? 83  ILE C C    1  
ATOM 6008   O O    . ILE C 1 83  ? -2.089  -20.858 2.119   1.00 25.50 ? 83  ILE C O    1  
ATOM 6009   C CB   . ILE C 1 83  ? 0.888   -21.131 2.099   1.00 25.20 ? 83  ILE C CB   1  
ATOM 6010   C CG1  . ILE C 1 83  ? 2.219   -20.315 1.959   1.00 44.43 ? 83  ILE C CG1  1  
ATOM 6011   C CG2  . ILE C 1 83  ? 1.170   -22.630 2.348   1.00 72.34 ? 83  ILE C CG2  1  
ATOM 6012   C CD1  . ILE C 1 83  ? 3.014   -20.541 0.678   1.00 40.21 ? 83  ILE C CD1  1  
ATOM 6013   H H    . ILE C 1 83  ? 0.107   -18.869 0.991   1.00 31.45 ? 83  ILE C H    1  
ATOM 6014   H HA   . ILE C 1 83  ? 0.349   -21.575 0.034   1.00 73.10 ? 83  ILE C HA   1  
ATOM 6015   H HB   . ILE C 1 83  ? 0.351   -20.753 2.971   1.00 1.01  ? 83  ILE C HB   1  
ATOM 6016   H HG12 . ILE C 1 83  ? 1.984   -19.261 2.002   1.00 75.53 ? 83  ILE C HG12 1  
ATOM 6017   H HG13 . ILE C 1 83  ? 2.867   -20.554 2.792   1.00 62.21 ? 83  ILE C HG13 1  
ATOM 6018   H HG21 . ILE C 1 83  ? 0.237   -23.169 2.458   1.00 44.12 ? 83  ILE C HG21 1  
ATOM 6019   H HG22 . ILE C 1 83  ? 1.741   -22.742 3.245   1.00 0.42  ? 83  ILE C HG22 1  
ATOM 6020   H HG23 . ILE C 1 83  ? 1.727   -23.046 1.518   1.00 43.01 ? 83  ILE C HG23 1  
ATOM 6021   H HD11 . ILE C 1 83  ? 3.949   -20.009 0.743   1.00 3.22  ? 83  ILE C HD11 1  
ATOM 6022   H HD12 . ILE C 1 83  ? 2.457   -20.173 -0.173  1.00 11.52 ? 83  ILE C HD12 1  
ATOM 6023   H HD13 . ILE C 1 83  ? 3.222   -21.591 0.540   1.00 53.21 ? 83  ILE C HD13 1  
ATOM 6024   N N    . PHE C 1 84  ? -1.969  -22.378 0.443   1.00 31.13 ? 84  PHE C N    1  
ATOM 6025   C CA   . PHE C 1 84  ? -3.349  -22.871 0.571   1.00 23.31 ? 84  PHE C CA   1  
ATOM 6026   C C    . PHE C 1 84  ? -3.317  -24.368 0.885   1.00 0.43  ? 84  PHE C C    1  
ATOM 6027   O O    . PHE C 1 84  ? -2.529  -25.116 0.300   1.00 62.41 ? 84  PHE C O    1  
ATOM 6028   C CB   . PHE C 1 84  ? -4.165  -22.607 -0.727  1.00 74.30 ? 84  PHE C CB   1  
ATOM 6029   C CG   . PHE C 1 84  ? -4.342  -21.124 -1.092  1.00 13.23 ? 84  PHE C CG   1  
ATOM 6030   C CD1  . PHE C 1 84  ? -3.748  -20.578 -2.226  1.00 71.52 ? 84  PHE C CD1  1  
ATOM 6031   C CD2  . PHE C 1 84  ? -5.113  -20.275 -0.293  1.00 5.34  ? 84  PHE C CD2  1  
ATOM 6032   C CE1  . PHE C 1 84  ? -3.915  -19.242 -2.550  1.00 33.14 ? 84  PHE C CE1  1  
ATOM 6033   C CE2  . PHE C 1 84  ? -5.281  -18.937 -0.619  1.00 31.04 ? 84  PHE C CE2  1  
ATOM 6034   C CZ   . PHE C 1 84  ? -4.684  -18.424 -1.747  1.00 32.24 ? 84  PHE C CZ   1  
ATOM 6035   H H    . PHE C 1 84  ? -1.372  -22.813 -0.203  1.00 51.52 ? 84  PHE C H    1  
ATOM 6036   H HA   . PHE C 1 84  ? -3.828  -22.348 1.401   1.00 63.32 ? 84  PHE C HA   1  
ATOM 6037   H HB2  . PHE C 1 84  ? -3.675  -23.108 -1.558  1.00 70.22 ? 84  PHE C HB2  1  
ATOM 6038   H HB3  . PHE C 1 84  ? -5.156  -23.036 -0.611  1.00 44.13 ? 84  PHE C HB3  1  
ATOM 6039   H HD1  . PHE C 1 84  ? -3.144  -21.210 -2.865  1.00 62.12 ? 84  PHE C HD1  1  
ATOM 6040   H HD2  . PHE C 1 84  ? -5.588  -20.672 0.596   1.00 55.34 ? 84  PHE C HD2  1  
ATOM 6041   H HE1  . PHE C 1 84  ? -3.443  -18.837 -3.435  1.00 44.24 ? 84  PHE C HE1  1  
ATOM 6042   H HE2  . PHE C 1 84  ? -5.891  -18.292 0.011   1.00 35.30 ? 84  PHE C HE2  1  
ATOM 6043   H HZ   . PHE C 1 84  ? -4.814  -17.379 -2.002  1.00 64.40 ? 84  PHE C HZ   1  
ATOM 6044   N N    . SER C 1 85  ? -4.166  -24.794 1.821   1.00 15.43 ? 85  SER C N    1  
ATOM 6045   C CA   . SER C 1 85  ? -4.296  -26.201 2.213   1.00 54.01 ? 85  SER C CA   1  
ATOM 6046   C C    . SER C 1 85  ? -5.653  -26.719 1.718   1.00 35.32 ? 85  SER C C    1  
ATOM 6047   O O    . SER C 1 85  ? -6.695  -26.349 2.271   1.00 71.13 ? 85  SER C O    1  
ATOM 6048   C CB   . SER C 1 85  ? -4.169  -26.329 3.749   1.00 42.33 ? 85  SER C CB   1  
ATOM 6049   O OG   . SER C 1 85  ? -3.037  -25.621 4.225   1.00 52.41 ? 85  SER C OG   1  
ATOM 6050   H H    . SER C 1 85  ? -4.741  -24.136 2.261   1.00 3.43  ? 85  SER C H    1  
ATOM 6051   H HA   . SER C 1 85  ? -3.500  -26.778 1.743   1.00 71.44 ? 85  SER C HA   1  
ATOM 6052   H HB2  . SER C 1 85  ? -5.053  -25.922 4.229   1.00 65.03 ? 85  SER C HB2  1  
ATOM 6053   H HB3  . SER C 1 85  ? -4.064  -27.370 4.023   1.00 64.25 ? 85  SER C HB3  1  
ATOM 6054   H HG   . SER C 1 85  ? -3.148  -24.686 4.023   1.00 74.24 ? 85  SER C HG   1  
ATOM 6055   N N    . ILE C 1 86  ? -5.637  -27.537 0.650   1.00 71.54 ? 86  ILE C N    1  
ATOM 6056   C CA   . ILE C 1 86  ? -6.849  -28.126 0.056   1.00 33.14 ? 86  ILE C CA   1  
ATOM 6057   C C    . ILE C 1 86  ? -6.750  -29.643 0.268   1.00 31.51 ? 86  ILE C C    1  
ATOM 6058   O O    . ILE C 1 86  ? -5.878  -30.294 -0.319  1.00 24.35 ? 86  ILE C O    1  
ATOM 6059   C CB   . ILE C 1 86  ? -7.018  -27.824 -1.499  1.00 52.54 ? 86  ILE C CB   1  
ATOM 6060   C CG1  . ILE C 1 86  ? -6.658  -26.333 -1.888  1.00 41.54 ? 86  ILE C CG1  1  
ATOM 6061   C CG2  . ILE C 1 86  ? -8.455  -28.195 -1.965  1.00 4.41  ? 86  ILE C CG2  1  
ATOM 6062   C CD1  . ILE C 1 86  ? -5.167  -26.060 -2.131  1.00 73.53 ? 86  ILE C CD1  1  
ATOM 6063   H H    . ILE C 1 86  ? -4.772  -27.769 0.254   1.00 11.14 ? 86  ILE C H    1  
ATOM 6064   H HA   . ILE C 1 86  ? -7.724  -27.743 0.587   1.00 4.24  ? 86  ILE C HA   1  
ATOM 6065   H HB   . ILE C 1 86  ? -6.336  -28.485 -2.038  1.00 43.25 ? 86  ILE C HB   1  
ATOM 6066   H HG12 . ILE C 1 86  ? -7.176  -26.059 -2.798  1.00 11.22 ? 86  ILE C HG12 1  
ATOM 6067   H HG13 . ILE C 1 86  ? -6.985  -25.671 -1.095  1.00 13.31 ? 86  ILE C HG13 1  
ATOM 6068   H HG21 . ILE C 1 86  ? -8.553  -28.018 -3.029  1.00 20.23 ? 86  ILE C HG21 1  
ATOM 6069   H HG22 . ILE C 1 86  ? -9.182  -27.592 -1.437  1.00 45.24 ? 86  ILE C HG22 1  
ATOM 6070   H HG23 . ILE C 1 86  ? -8.648  -29.242 -1.761  1.00 45.34 ? 86  ILE C HG23 1  
ATOM 6071   H HD11 . ILE C 1 86  ? -4.813  -26.675 -2.952  1.00 41.24 ? 86  ILE C HD11 1  
ATOM 6072   H HD12 . ILE C 1 86  ? -4.602  -26.292 -1.239  1.00 4.34  ? 86  ILE C HD12 1  
ATOM 6073   H HD13 . ILE C 1 86  ? -5.028  -25.018 -2.381  1.00 31.22 ? 86  ILE C HD13 1  
ATOM 6074   N N    . ALA C 1 87  ? -7.630  -30.193 1.119   1.00 61.11 ? 87  ALA C N    1  
ATOM 6075   C CA   . ALA C 1 87  ? -7.538  -31.590 1.576   1.00 62.23 ? 87  ALA C CA   1  
ATOM 6076   C C    . ALA C 1 87  ? -8.809  -32.376 1.253   1.00 11.11 ? 87  ALA C C    1  
ATOM 6077   O O    . ALA C 1 87  ? -9.882  -31.798 1.038   1.00 2.11  ? 87  ALA C O    1  
ATOM 6078   C CB   . ALA C 1 87  ? -7.250  -31.621 3.088   1.00 42.11 ? 87  ALA C CB   1  
ATOM 6079   H H    . ALA C 1 87  ? -8.369  -29.641 1.446   1.00 41.33 ? 87  ALA C H    1  
ATOM 6080   H HA   . ALA C 1 87  ? -6.700  -32.069 1.068   1.00 11.14 ? 87  ALA C HA   1  
ATOM 6081   H HB1  . ALA C 1 87  ? -8.065  -31.161 3.633   1.00 60.12 ? 87  ALA C HB1  1  
ATOM 6082   H HB2  . ALA C 1 87  ? -6.335  -31.079 3.294   1.00 52.34 ? 87  ALA C HB2  1  
ATOM 6083   H HB3  . ALA C 1 87  ? -7.131  -32.646 3.415   1.00 74.35 ? 87  ALA C HB3  1  
ATOM 6084   N N    . GLY C 1 88  ? -8.655  -33.705 1.201   1.00 12.32 ? 88  GLY C N    1  
ATOM 6085   C CA   . GLY C 1 88  ? -9.767  -34.635 1.042   1.00 13.34 ? 88  GLY C CA   1  
ATOM 6086   C C    . GLY C 1 88  ? -9.943  -35.085 -0.397  1.00 42.40 ? 88  GLY C C    1  
ATOM 6087   O O    . GLY C 1 88  ? -9.833  -36.280 -0.702  1.00 53.32 ? 88  GLY C O    1  
ATOM 6088   H H    . GLY C 1 88  ? -7.741  -34.066 1.248   1.00 52.20 ? 88  GLY C H    1  
ATOM 6089   H HA2  . GLY C 1 88  ? -9.574  -35.499 1.660   1.00 44.52 ? 88  GLY C HA2  1  
ATOM 6090   H HA3  . GLY C 1 88  ? -10.690 -34.175 1.381   1.00 71.42 ? 88  GLY C HA3  1  
ATOM 6091   N N    . ILE C 1 89  ? -10.200 -34.120 -1.295  1.00 21.50 ? 89  ILE C N    1  
ATOM 6092   C CA   . ILE C 1 89  ? -10.523 -34.407 -2.713  1.00 31.14 ? 89  ILE C CA   1  
ATOM 6093   C C    . ILE C 1 89  ? -9.360  -34.031 -3.650  1.00 72.33 ? 89  ILE C C    1  
ATOM 6094   O O    . ILE C 1 89  ? -8.338  -33.489 -3.205  1.00 41.23 ? 89  ILE C O    1  
ATOM 6095   C CB   . ILE C 1 89  ? -11.880 -33.705 -3.140  1.00 50.24 ? 89  ILE C CB   1  
ATOM 6096   C CG1  . ILE C 1 89  ? -11.973 -32.203 -2.683  1.00 4.01  ? 89  ILE C CG1  1  
ATOM 6097   C CG2  . ILE C 1 89  ? -13.094 -34.501 -2.594  1.00 41.04 ? 89  ILE C CG2  1  
ATOM 6098   C CD1  . ILE C 1 89  ? -11.059 -31.205 -3.383  1.00 3.50  ? 89  ILE C CD1  1  
ATOM 6099   H H    . ILE C 1 89  ? -10.148 -33.181 -1.007  1.00 40.33 ? 89  ILE C H    1  
ATOM 6100   H HA   . ILE C 1 89  ? -10.667 -35.485 -2.813  1.00 34.32 ? 89  ILE C HA   1  
ATOM 6101   H HB   . ILE C 1 89  ? -11.943 -33.741 -4.226  1.00 14.23 ? 89  ILE C HB   1  
ATOM 6102   H HG12 . ILE C 1 89  ? -12.983 -31.850 -2.844  1.00 23.32 ? 89  ILE C HG12 1  
ATOM 6103   H HG13 . ILE C 1 89  ? -11.761 -32.147 -1.619  1.00 44.32 ? 89  ILE C HG13 1  
ATOM 6104   H HG21 . ILE C 1 89  ? -13.071 -34.512 -1.512  1.00 41.43 ? 89  ILE C HG21 1  
ATOM 6105   H HG22 . ILE C 1 89  ? -13.057 -35.521 -2.960  1.00 71.12 ? 89  ILE C HG22 1  
ATOM 6106   H HG23 . ILE C 1 89  ? -14.014 -34.041 -2.929  1.00 50.31 ? 89  ILE C HG23 1  
ATOM 6107   H HD11 . ILE C 1 89  ? -10.024 -31.455 -3.191  1.00 11.54 ? 89  ILE C HD11 1  
ATOM 6108   H HD12 . ILE C 1 89  ? -11.262 -30.212 -3.011  1.00 11.25 ? 89  ILE C HD12 1  
ATOM 6109   H HD13 . ILE C 1 89  ? -11.245 -31.233 -4.448  1.00 3.22  ? 89  ILE C HD13 1  
ATOM 6110   N N    . GLU C 1 90  ? -9.554  -34.298 -4.955  1.00 22.20 ? 90  GLU C N    1  
ATOM 6111   C CA   . GLU C 1 90  ? -8.527  -34.068 -5.986  1.00 43.23 ? 90  GLU C CA   1  
ATOM 6112   C C    . GLU C 1 90  ? -9.188  -33.844 -7.365  1.00 61.33 ? 90  GLU C C    1  
ATOM 6113   O O    . GLU C 1 90  ? -10.416 -33.692 -7.454  1.00 72.43 ? 90  GLU C O    1  
ATOM 6114   C CB   . GLU C 1 90  ? -7.563  -35.285 -6.049  1.00 61.42 ? 90  GLU C CB   1  
ATOM 6115   C CG   . GLU C 1 90  ? -8.238  -36.600 -6.480  1.00 14.02 ? 90  GLU C CG   1  
ATOM 6116   C CD   . GLU C 1 90  ? -7.235  -37.718 -6.739  1.00 31.42 ? 90  GLU C CD   1  
ATOM 6117   O OE1  . GLU C 1 90  ? -6.875  -37.950 -7.914  1.00 2.32  ? 90  GLU C OE1  1  
ATOM 6118   O OE2  . GLU C 1 90  ? -6.782  -38.353 -5.770  1.00 64.45 ? 90  GLU C OE2  1  
ATOM 6119   H H    . GLU C 1 90  ? -10.420 -34.674 -5.235  1.00 31.33 ? 90  GLU C H    1  
ATOM 6120   H HA   . GLU C 1 90  ? -7.964  -33.176 -5.723  1.00 41.12 ? 90  GLU C HA   1  
ATOM 6121   H HB2  . GLU C 1 90  ? -6.763  -35.062 -6.754  1.00 43.32 ? 90  GLU C HB2  1  
ATOM 6122   H HB3  . GLU C 1 90  ? -7.118  -35.433 -5.069  1.00 62.23 ? 90  GLU C HB3  1  
ATOM 6123   H HG2  . GLU C 1 90  ? -8.929  -36.917 -5.703  1.00 1.40  ? 90  GLU C HG2  1  
ATOM 6124   H HG3  . GLU C 1 90  ? -8.800  -36.411 -7.391  1.00 51.21 ? 90  GLU C HG3  1  
ATOM 6125   N N    . GLY C 1 91  ? -8.344  -33.809 -8.425  1.00 44.41 ? 91  GLY C N    1  
ATOM 6126   C CA   . GLY C 1 91  ? -8.803  -33.812 -9.818  1.00 41.22 ? 91  GLY C CA   1  
ATOM 6127   C C    . GLY C 1 91  ? -9.668  -32.613 -10.193 1.00 60.01 ? 91  GLY C C    1  
ATOM 6128   O O    . GLY C 1 91  ? -9.285  -31.474 -9.929  1.00 32.30 ? 91  GLY C O    1  
ATOM 6129   H H    . GLY C 1 91  ? -7.383  -33.781 -8.254  1.00 44.43 ? 91  GLY C H    1  
ATOM 6130   H HA2  . GLY C 1 91  ? -7.933  -33.818 -10.464 1.00 52.43 ? 91  GLY C HA2  1  
ATOM 6131   H HA3  . GLY C 1 91  ? -9.360  -34.726 -9.992  1.00 61.13 ? 91  GLY C HA3  1  
ATOM 6132   N N    . THR C 1 92  ? -10.846 -32.889 -10.790 1.00 60.23 ? 92  THR C N    1  
ATOM 6133   C CA   . THR C 1 92  ? -11.800 -31.861 -11.252 1.00 63.14 ? 92  THR C CA   1  
ATOM 6134   C C    . THR C 1 92  ? -12.440 -31.099 -10.067 1.00 4.41  ? 92  THR C C    1  
ATOM 6135   O O    . THR C 1 92  ? -12.750 -29.903 -10.180 1.00 33.24 ? 92  THR C O    1  
ATOM 6136   C CB   . THR C 1 92  ? -12.915 -32.520 -12.133 1.00 35.51 ? 92  THR C CB   1  
ATOM 6137   O OG1  . THR C 1 92  ? -13.551 -33.578 -11.396 1.00 4.44  ? 92  THR C OG1  1  
ATOM 6138   C CG2  . THR C 1 92  ? -12.352 -33.095 -13.450 1.00 11.52 ? 92  THR C CG2  1  
ATOM 6139   H H    . THR C 1 92  ? -11.086 -33.831 -10.931 1.00 65.15 ? 92  THR C H    1  
ATOM 6140   H HA   . THR C 1 92  ? -11.256 -31.153 -11.871 1.00 61.34 ? 92  THR C HA   1  
ATOM 6141   H HB   . THR C 1 92  ? -13.661 -31.767 -12.377 1.00 64.44 ? 92  THR C HB   1  
ATOM 6142   H HG1  . THR C 1 92  ? -14.234 -33.208 -10.832 1.00 32.11 ? 92  THR C HG1  1  
ATOM 6143   H HG21 . THR C 1 92  ? -11.903 -32.303 -14.037 1.00 71.42 ? 92  THR C HG21 1  
ATOM 6144   H HG22 . THR C 1 92  ? -13.152 -33.547 -14.020 1.00 25.32 ? 92  THR C HG22 1  
ATOM 6145   H HG23 . THR C 1 92  ? -11.602 -33.848 -13.233 1.00 2.20  ? 92  THR C HG23 1  
ATOM 6146   N N    . GLN C 1 93  ? -12.611 -31.812 -8.934  1.00 74.14 ? 93  GLN C N    1  
ATOM 6147   C CA   . GLN C 1 93  ? -13.179 -31.249 -7.688  1.00 24.21 ? 93  GLN C CA   1  
ATOM 6148   C C    . GLN C 1 93  ? -12.246 -30.166 -7.124  1.00 1.00  ? 93  GLN C C    1  
ATOM 6149   O O    . GLN C 1 93  ? -12.687 -29.067 -6.754  1.00 3.43  ? 93  GLN C O    1  
ATOM 6150   C CB   . GLN C 1 93  ? -13.384 -32.374 -6.636  1.00 42.42 ? 93  GLN C CB   1  
ATOM 6151   C CG   . GLN C 1 93  ? -14.308 -33.519 -7.089  1.00 25.13 ? 93  GLN C CG   1  
ATOM 6152   C CD   . GLN C 1 93  ? -14.426 -34.634 -6.047  1.00 64.54 ? 93  GLN C CD   1  
ATOM 6153   O OE1  . GLN C 1 93  ? -15.289 -34.598 -5.174  1.00 4.53  ? 93  GLN C OE1  1  
ATOM 6154   N NE2  . GLN C 1 93  ? -13.548 -35.621 -6.123  1.00 31.45 ? 93  GLN C NE2  1  
ATOM 6155   H H    . GLN C 1 93  ? -12.333 -32.752 -8.934  1.00 12.42 ? 93  GLN C H    1  
ATOM 6156   H HA   . GLN C 1 93  ? -14.140 -30.803 -7.923  1.00 62.54 ? 93  GLN C HA   1  
ATOM 6157   H HB2  . GLN C 1 93  ? -12.415 -32.800 -6.390  1.00 53.23 ? 93  GLN C HB2  1  
ATOM 6158   H HB3  . GLN C 1 93  ? -13.804 -31.938 -5.734  1.00 63.41 ? 93  GLN C HB3  1  
ATOM 6159   H HG2  . GLN C 1 93  ? -15.299 -33.117 -7.282  1.00 71.30 ? 93  GLN C HG2  1  
ATOM 6160   H HG3  . GLN C 1 93  ? -13.916 -33.939 -8.009  1.00 22.20 ? 93  GLN C HG3  1  
ATOM 6161   H HE21 . GLN C 1 93  ? -12.875 -35.589 -6.835  1.00 41.32 ? 93  GLN C HE21 1  
ATOM 6162   H HE22 . GLN C 1 93  ? -13.605 -36.341 -5.462  1.00 32.14 ? 93  GLN C HE22 1  
ATOM 6163   N N    . MET C 1 94  ? -10.941 -30.494 -7.083  1.00 2.30  ? 94  MET C N    1  
ATOM 6164   C CA   . MET C 1 94  ? -9.906  -29.573 -6.585  1.00 74.14 ? 94  MET C CA   1  
ATOM 6165   C C    . MET C 1 94  ? -9.553  -28.516 -7.645  1.00 60.01 ? 94  MET C C    1  
ATOM 6166   O O    . MET C 1 94  ? -9.127  -27.423 -7.297  1.00 25.35 ? 94  MET C O    1  
ATOM 6167   C CB   . MET C 1 94  ? -8.646  -30.358 -6.134  1.00 71.41 ? 94  MET C CB   1  
ATOM 6168   C CG   . MET C 1 94  ? -7.594  -29.507 -5.414  1.00 21.03 ? 94  MET C CG   1  
ATOM 6169   S SD   . MET C 1 94  ? -6.169  -30.464 -4.885  1.00 3.32  ? 94  MET C SD   1  
ATOM 6170   C CE   . MET C 1 94  ? -5.053  -29.184 -4.309  1.00 11.23 ? 94  MET C CE   1  
ATOM 6171   H H    . MET C 1 94  ? -10.671 -31.387 -7.393  1.00 65.31 ? 94  MET C H    1  
ATOM 6172   H HA   . MET C 1 94  ? -10.316 -29.057 -5.719  1.00 12.24 ? 94  MET C HA   1  
ATOM 6173   H HB2  . MET C 1 94  ? -8.954  -31.151 -5.460  1.00 61.02 ? 94  MET C HB2  1  
ATOM 6174   H HB3  . MET C 1 94  ? -8.179  -30.813 -7.003  1.00 44.33 ? 94  MET C HB3  1  
ATOM 6175   H HG2  . MET C 1 94  ? -7.257  -28.728 -6.083  1.00 44.03 ? 94  MET C HG2  1  
ATOM 6176   H HG3  . MET C 1 94  ? -8.047  -29.053 -4.540  1.00 11.55 ? 94  MET C HG3  1  
ATOM 6177   H HE1  . MET C 1 94  ? -4.138  -29.638 -3.955  1.00 5.41  ? 94  MET C HE1  1  
ATOM 6178   H HE2  . MET C 1 94  ? -5.516  -28.639 -3.504  1.00 71.32 ? 94  MET C HE2  1  
ATOM 6179   H HE3  . MET C 1 94  ? -4.830  -28.508 -5.123  1.00 61.22 ? 94  MET C HE3  1  
ATOM 6180   N N    . ALA C 1 95  ? -9.760  -28.843 -8.936  1.00 72.14 ? 95  ALA C N    1  
ATOM 6181   C CA   . ALA C 1 95  ? -9.541  -27.893 -10.056 1.00 24.21 ? 95  ALA C CA   1  
ATOM 6182   C C    . ALA C 1 95  ? -10.493 -26.687 -9.951  1.00 34.12 ? 95  ALA C C    1  
ATOM 6183   O O    . ALA C 1 95  ? -10.142 -25.572 -10.344 1.00 14.13 ? 95  ALA C O    1  
ATOM 6184   C CB   . ALA C 1 95  ? -9.716  -28.600 -11.405 1.00 65.31 ? 95  ALA C CB   1  
ATOM 6185   H H    . ALA C 1 95  ? -10.069 -29.748 -9.144  1.00 14.02 ? 95  ALA C H    1  
ATOM 6186   H HA   . ALA C 1 95  ? -8.514  -27.537 -9.993  1.00 35.12 ? 95  ALA C HA   1  
ATOM 6187   H HB1  . ALA C 1 95  ? -10.731 -28.963 -11.501 1.00 53.41 ? 95  ALA C HB1  1  
ATOM 6188   H HB2  . ALA C 1 95  ? -9.033  -29.439 -11.468 1.00 55.43 ? 95  ALA C HB2  1  
ATOM 6189   H HB3  . ALA C 1 95  ? -9.505  -27.911 -12.214 1.00 31.23 ? 95  ALA C HB3  1  
ATOM 6190   N N    . HIS C 1 96  ? -11.702 -26.944 -9.419  1.00 53.40 ? 96  HIS C N    1  
ATOM 6191   C CA   . HIS C 1 96  ? -12.679 -25.891 -9.085  1.00 1.21  ? 96  HIS C CA   1  
ATOM 6192   C C    . HIS C 1 96  ? -12.153 -24.985 -7.947  1.00 24.12 ? 96  HIS C C    1  
ATOM 6193   O O    . HIS C 1 96  ? -12.416 -23.788 -7.930  1.00 5.01  ? 96  HIS C O    1  
ATOM 6194   C CB   . HIS C 1 96  ? -14.027 -26.535 -8.670  1.00 10.54 ? 96  HIS C CB   1  
ATOM 6195   C CG   . HIS C 1 96  ? -15.060 -25.546 -8.166  1.00 33.24 ? 96  HIS C CG   1  
ATOM 6196   N ND1  . HIS C 1 96  ? -15.186 -25.211 -6.835  1.00 12.23 ? 96  HIS C ND1  1  
ATOM 6197   C CD2  . HIS C 1 96  ? -15.961 -24.782 -8.823  1.00 30.03 ? 96  HIS C CD2  1  
ATOM 6198   C CE1  . HIS C 1 96  ? -16.104 -24.278 -6.705  1.00 65.33 ? 96  HIS C CE1  1  
ATOM 6199   N NE2  . HIS C 1 96  ? -16.594 -23.998 -7.895  1.00 23.43 ? 96  HIS C NE2  1  
ATOM 6200   H H    . HIS C 1 96  ? -11.952 -27.883 -9.261  1.00 24.34 ? 96  HIS C H    1  
ATOM 6201   H HA   . HIS C 1 96  ? -12.836 -25.284 -9.977  1.00 71.45 ? 96  HIS C HA   1  
ATOM 6202   H HB2  . HIS C 1 96  ? -14.449 -27.049 -9.524  1.00 53.21 ? 96  HIS C HB2  1  
ATOM 6203   H HB3  . HIS C 1 96  ? -13.848 -27.261 -7.883  1.00 60.22 ? 96  HIS C HB3  1  
ATOM 6204   H HD1  . HIS C 1 96  ? -14.686 -25.607 -6.093  1.00 42.33 ? 96  HIS C HD1  1  
ATOM 6205   H HD2  . HIS C 1 96  ? -16.159 -24.800 -9.883  1.00 21.13 ? 96  HIS C HD2  1  
ATOM 6206   H HE1  . HIS C 1 96  ? -16.380 -23.790 -5.781  1.00 4.23  ? 96  HIS C HE1  1  
ATOM 6207   H HE2  . HIS C 1 96  ? -17.048 -23.152 -8.107  1.00 37.99 ? 96  HIS C HE2  1  
ATOM 6208   N N    . CYS C 1 97  ? -11.443 -25.584 -6.981  1.00 11.30 ? 97  CYS C N    1  
ATOM 6209   C CA   . CYS C 1 97  ? -10.940 -24.859 -5.796  1.00 64.52 ? 97  CYS C CA   1  
ATOM 6210   C C    . CYS C 1 97  ? -9.711  -23.998 -6.151  1.00 24.22 ? 97  CYS C C    1  
ATOM 6211   O O    . CYS C 1 97  ? -9.756  -22.765 -6.052  1.00 52.14 ? 97  CYS C O    1  
ATOM 6212   C CB   . CYS C 1 97  ? -10.587 -25.855 -4.672  1.00 32.43 ? 97  CYS C CB   1  
ATOM 6213   S SG   . CYS C 1 97  ? -9.976  -25.074 -3.161  1.00 34.14 ? 97  CYS C SG   1  
ATOM 6214   H H    . CYS C 1 97  ? -11.247 -26.537 -7.067  1.00 61.34 ? 97  CYS C H    1  
ATOM 6215   H HA   . CYS C 1 97  ? -11.734 -24.206 -5.440  1.00 3.51  ? 97  CYS C HA   1  
ATOM 6216   H HB2  . CYS C 1 97  ? -11.469 -26.423 -4.408  1.00 52.24 ? 97  CYS C HB2  1  
ATOM 6217   H HB3  . CYS C 1 97  ? -9.821  -26.538 -5.021  1.00 44.24 ? 97  CYS C HB3  1  
ATOM 6218   H HG   . CYS C 1 97  ? -11.005 -24.515 -2.542  1.00 41.43 ? 97  CYS C HG   1  
ATOM 6219   N N    . LEU C 1 98  ? -8.633  -24.663 -6.609  1.00 14.43 ? 98  LEU C N    1  
ATOM 6220   C CA   . LEU C 1 98  ? -7.344  -24.009 -6.897  1.00 23.11 ? 98  LEU C CA   1  
ATOM 6221   C C    . LEU C 1 98  ? -7.445  -23.120 -8.145  1.00 63.32 ? 98  LEU C C    1  
ATOM 6222   O O    . LEU C 1 98  ? -6.821  -22.075 -8.189  1.00 0.01  ? 98  LEU C O    1  
ATOM 6223   C CB   . LEU C 1 98  ? -6.203  -25.074 -7.032  1.00 51.01 ? 98  LEU C CB   1  
ATOM 6224   C CG   . LEU C 1 98  ? -6.245  -26.030 -8.293  1.00 25.15 ? 98  LEU C CG   1  
ATOM 6225   C CD1  . LEU C 1 98  ? -5.395  -25.495 -9.473  1.00 3.10  ? 98  LEU C CD1  1  
ATOM 6226   C CD2  . LEU C 1 98  ? -5.837  -27.472 -7.932  1.00 74.24 ? 98  LEU C CD2  1  
ATOM 6227   H H    . LEU C 1 98  ? -8.707  -25.622 -6.753  1.00 54.32 ? 98  LEU C H    1  
ATOM 6228   H HA   . LEU C 1 98  ? -7.111  -23.369 -6.046  1.00 63.35 ? 98  LEU C HA   1  
ATOM 6229   H HB2  . LEU C 1 98  ? -5.249  -24.549 -7.029  1.00 70.21 ? 98  LEU C HB2  1  
ATOM 6230   H HB3  . LEU C 1 98  ? -6.232  -25.687 -6.138  1.00 1.04  ? 98  LEU C HB3  1  
ATOM 6231   H HG   . LEU C 1 98  ? -7.270  -26.076 -8.646  1.00 61.24 ? 98  LEU C HG   1  
ATOM 6232   H HD11 . LEU C 1 98  ? -5.767  -24.522 -9.774  1.00 31.12 ? 98  LEU C HD11 1  
ATOM 6233   H HD12 . LEU C 1 98  ? -5.468  -26.170 -10.315 1.00 33.45 ? 98  LEU C HD12 1  
ATOM 6234   H HD13 . LEU C 1 98  ? -4.358  -25.404 -9.176  1.00 72.51 ? 98  LEU C HD13 1  
ATOM 6235   H HD21 . LEU C 1 98  ? -4.820  -27.487 -7.559  1.00 52.21 ? 98  LEU C HD21 1  
ATOM 6236   H HD22 . LEU C 1 98  ? -5.908  -28.105 -8.807  1.00 13.50 ? 98  LEU C HD22 1  
ATOM 6237   H HD23 . LEU C 1 98  ? -6.502  -27.853 -7.169  1.00 21.23 ? 98  LEU C HD23 1  
ATOM 6238   N N    . GLY C 1 99  ? -8.267  -23.540 -9.133  1.00 71.25 ? 99  GLY C N    1  
ATOM 6239   C CA   . GLY C 1 99  ? -8.352  -22.863 -10.437 1.00 32.31 ? 99  GLY C CA   1  
ATOM 6240   C C    . GLY C 1 99  ? -9.388  -21.749 -10.508 1.00 64.22 ? 99  GLY C C    1  
ATOM 6241   O O    . GLY C 1 99  ? -9.503  -21.079 -11.544 1.00 25.54 ? 99  GLY C O    1  
ATOM 6242   H H    . GLY C 1 99  ? -8.826  -24.330 -8.975  1.00 11.14 ? 99  GLY C H    1  
ATOM 6243   H HA2  . GLY C 1 99  ? -7.385  -22.449 -10.692 1.00 22.14 ? 99  GLY C HA2  1  
ATOM 6244   H HA3  . GLY C 1 99  ? -8.603  -23.607 -11.183 1.00 71.53 ? 99  GLY C HA3  1  
ATOM 6245   N N    . ALA C 1 100 ? -10.142 -21.534 -9.412  1.00 20.41 ? 100 ALA C N    1  
ATOM 6246   C CA   . ALA C 1 100 ? -11.231 -20.532 -9.377  1.00 12.33 ? 100 ALA C CA   1  
ATOM 6247   C C    . ALA C 1 100 ? -11.212 -19.737 -8.063  1.00 74.02 ? 100 ALA C C    1  
ATOM 6248   O O    . ALA C 1 100 ? -11.057 -18.507 -8.078  1.00 74.00 ? 100 ALA C O    1  
ATOM 6249   C CB   . ALA C 1 100 ? -12.588 -21.217 -9.590  1.00 74.42 ? 100 ALA C CB   1  
ATOM 6250   H H    . ALA C 1 100 ? -9.962  -22.063 -8.606  1.00 25.44 ? 100 ALA C H    1  
ATOM 6251   H HA   . ALA C 1 100 ? -11.082 -19.829 -10.200 1.00 74.44 ? 100 ALA C HA   1  
ATOM 6252   H HB1  . ALA C 1 100 ? -13.362 -20.473 -9.689  1.00 5.40  ? 100 ALA C HB1  1  
ATOM 6253   H HB2  . ALA C 1 100 ? -12.823 -21.859 -8.746  1.00 11.12 ? 100 ALA C HB2  1  
ATOM 6254   H HB3  . ALA C 1 100 ? -12.554 -21.815 -10.492 1.00 61.11 ? 100 ALA C HB3  1  
ATOM 6255   N N    . TYR C 1 101 ? -11.316 -20.451 -6.927  1.00 12.44 ? 101 TYR C N    1  
ATOM 6256   C CA   . TYR C 1 101 ? -11.440 -19.825 -5.594  1.00 31.45 ? 101 TYR C CA   1  
ATOM 6257   C C    . TYR C 1 101 ? -10.102 -19.191 -5.135  1.00 65.00 ? 101 TYR C C    1  
ATOM 6258   O O    . TYR C 1 101 ? -10.079 -18.031 -4.711  1.00 24.32 ? 101 TYR C O    1  
ATOM 6259   C CB   . TYR C 1 101 ? -11.944 -20.867 -4.558  1.00 25.35 ? 101 TYR C CB   1  
ATOM 6260   C CG   . TYR C 1 101 ? -12.267 -20.271 -3.178  1.00 64.23 ? 101 TYR C CG   1  
ATOM 6261   C CD1  . TYR C 1 101 ? -13.477 -19.608 -2.948  1.00 74.13 ? 101 TYR C CD1  1  
ATOM 6262   C CD2  . TYR C 1 101 ? -11.360 -20.350 -2.114  1.00 4.35  ? 101 TYR C CD2  1  
ATOM 6263   C CE1  . TYR C 1 101 ? -13.761 -19.043 -1.718  1.00 1.20  ? 101 TYR C CE1  1  
ATOM 6264   C CE2  . TYR C 1 101 ? -11.649 -19.793 -0.885  1.00 34.13 ? 101 TYR C CE2  1  
ATOM 6265   C CZ   . TYR C 1 101 ? -12.845 -19.143 -0.691  1.00 42.24 ? 101 TYR C CZ   1  
ATOM 6266   O OH   . TYR C 1 101 ? -13.112 -18.563 0.527   1.00 63.42 ? 101 TYR C OH   1  
ATOM 6267   H H    . TYR C 1 101 ? -11.308 -21.430 -6.986  1.00 11.32 ? 101 TYR C H    1  
ATOM 6268   H HA   . TYR C 1 101 ? -12.182 -19.032 -5.677  1.00 13.34 ? 101 TYR C HA   1  
ATOM 6269   H HB2  . TYR C 1 101 ? -12.844 -21.335 -4.939  1.00 72.00 ? 101 TYR C HB2  1  
ATOM 6270   H HB3  . TYR C 1 101 ? -11.187 -21.635 -4.427  1.00 44.32 ? 101 TYR C HB3  1  
ATOM 6271   H HD1  . TYR C 1 101 ? -14.202 -19.535 -3.753  1.00 63.12 ? 101 TYR C HD1  1  
ATOM 6272   H HD2  . TYR C 1 101 ? -10.417 -20.861 -2.261  1.00 11.25 ? 101 TYR C HD2  1  
ATOM 6273   H HE1  . TYR C 1 101 ? -14.706 -18.537 -1.562  1.00 23.51 ? 101 TYR C HE1  1  
ATOM 6274   H HE2  . TYR C 1 101 ? -10.933 -19.869 -0.077  1.00 51.40 ? 101 TYR C HE2  1  
ATOM 6275   H HH   . TYR C 1 101 ? -13.941 -18.899 0.869   1.00 11.21 ? 101 TYR C HH   1  
ATOM 6276   N N    . CYS C 1 102 ? -8.999  -19.962 -5.240  1.00 51.34 ? 102 CYS C N    1  
ATOM 6277   C CA   . CYS C 1 102 ? -7.646  -19.523 -4.801  1.00 72.44 ? 102 CYS C CA   1  
ATOM 6278   C C    . CYS C 1 102 ? -7.154  -18.215 -5.514  1.00 43.01 ? 102 CYS C C    1  
ATOM 6279   O O    . CYS C 1 102 ? -6.639  -17.322 -4.827  1.00 5.43  ? 102 CYS C O    1  
ATOM 6280   C CB   . CYS C 1 102 ? -6.624  -20.674 -4.957  1.00 71.44 ? 102 CYS C CB   1  
ATOM 6281   S SG   . CYS C 1 102 ? -7.042  -22.154 -4.009  1.00 53.05 ? 102 CYS C SG   1  
ATOM 6282   H H    . CYS C 1 102 ? -9.095  -20.863 -5.617  1.00 13.34 ? 102 CYS C H    1  
ATOM 6283   H HA   . CYS C 1 102 ? -7.733  -19.304 -3.738  1.00 32.11 ? 102 CYS C HA   1  
ATOM 6284   H HB2  . CYS C 1 102 ? -6.562  -20.964 -6.000  1.00 61.01 ? 102 CYS C HB2  1  
ATOM 6285   H HB3  . CYS C 1 102 ? -5.647  -20.343 -4.626  1.00 43.04 ? 102 CYS C HB3  1  
ATOM 6286   H HG   . CYS C 1 102 ? -8.036  -21.849 -3.195  1.00 35.14 ? 102 CYS C HG   1  
ATOM 6287   N N    . PRO C 1 103 ? -7.304  -18.057 -6.888  1.00 34.34 ? 103 PRO C N    1  
ATOM 6288   C CA   . PRO C 1 103 ? -7.005  -16.776 -7.584  1.00 72.31 ? 103 PRO C CA   1  
ATOM 6289   C C    . PRO C 1 103 ? -7.806  -15.584 -7.031  1.00 75.30 ? 103 PRO C C    1  
ATOM 6290   O O    . PRO C 1 103 ? -7.283  -14.488 -6.949  1.00 52.45 ? 103 PRO C O    1  
ATOM 6291   C CB   . PRO C 1 103 ? -7.401  -17.044 -9.059  1.00 1.41  ? 103 PRO C CB   1  
ATOM 6292   C CG   . PRO C 1 103 ? -7.300  -18.523 -9.209  1.00 0.41  ? 103 PRO C CG   1  
ATOM 6293   C CD   . PRO C 1 103 ? -7.699  -19.099 -7.871  1.00 21.45 ? 103 PRO C CD   1  
ATOM 6294   H HA   . PRO C 1 103 ? -5.939  -16.551 -7.530  1.00 0.20  ? 103 PRO C HA   1  
ATOM 6295   H HB2  . PRO C 1 103 ? -8.419  -16.698 -9.258  1.00 13.33 ? 103 PRO C HB2  1  
ATOM 6296   H HB3  . PRO C 1 103 ? -6.711  -16.550 -9.733  1.00 23.34 ? 103 PRO C HB3  1  
ATOM 6297   H HG2  . PRO C 1 103 ? -7.971  -18.869 -9.990  1.00 22.43 ? 103 PRO C HG2  1  
ATOM 6298   H HG3  . PRO C 1 103 ? -6.277  -18.810 -9.443  1.00 33.12 ? 103 PRO C HG3  1  
ATOM 6299   H HD2  . PRO C 1 103 ? -8.768  -19.275 -7.827  1.00 24.43 ? 103 PRO C HD2  1  
ATOM 6300   H HD3  . PRO C 1 103 ? -7.166  -20.020 -7.676  1.00 51.24 ? 103 PRO C HD3  1  
ATOM 6301   N N    . ASN C 1 104 ? -9.075  -15.842 -6.643  1.00 4.23  ? 104 ASN C N    1  
ATOM 6302   C CA   . ASN C 1 104 ? -10.002 -14.807 -6.106  1.00 22.04 ? 104 ASN C CA   1  
ATOM 6303   C C    . ASN C 1 104 ? -9.555  -14.305 -4.715  1.00 55.14 ? 104 ASN C C    1  
ATOM 6304   O O    . ASN C 1 104 ? -9.933  -13.204 -4.304  1.00 1.32  ? 104 ASN C O    1  
ATOM 6305   C CB   . ASN C 1 104 ? -11.468 -15.357 -6.051  1.00 2.44  ? 104 ASN C CB   1  
ATOM 6306   C CG   . ASN C 1 104 ? -12.173 -15.450 -7.424  1.00 43.12 ? 104 ASN C CG   1  
ATOM 6307   O OD1  . ASN C 1 104 ? -13.389 -15.280 -7.529  1.00 32.13 ? 104 ASN C OD1  1  
ATOM 6308   N ND2  . ASN C 1 104 ? -11.433 -15.750 -8.484  1.00 23.43 ? 104 ASN C ND2  1  
ATOM 6309   H H    . ASN C 1 104 ? -9.397  -16.767 -6.701  1.00 44.04 ? 104 ASN C H    1  
ATOM 6310   H HA   . ASN C 1 104 ? -9.977  -13.960 -6.791  1.00 65.40 ? 104 ASN C HA   1  
ATOM 6311   H HB2  . ASN C 1 104 ? -11.451 -16.355 -5.626  1.00 12.32 ? 104 ASN C HB2  1  
ATOM 6312   H HB3  . ASN C 1 104 ? -12.067 -14.726 -5.401  1.00 52.21 ? 104 ASN C HB3  1  
ATOM 6313   H HD21 . ASN C 1 104 ? -10.476 -15.903 -8.359  1.00 73.21 ? 104 ASN C HD21 1  
ATOM 6314   H HD22 . ASN C 1 104 ? -11.879 -15.815 -9.348  1.00 72.42 ? 104 ASN C HD22 1  
ATOM 6315   N N    . ILE C 1 105 ? -8.758  -15.123 -3.997  1.00 41.23 ? 105 ILE C N    1  
ATOM 6316   C CA   . ILE C 1 105 ? -8.198  -14.744 -2.679  1.00 50.41 ? 105 ILE C CA   1  
ATOM 6317   C C    . ILE C 1 105 ? -6.917  -13.903 -2.870  1.00 43.01 ? 105 ILE C C    1  
ATOM 6318   O O    . ILE C 1 105 ? -6.664  -12.953 -2.119  1.00 41.33 ? 105 ILE C O    1  
ATOM 6319   C CB   . ILE C 1 105 ? -7.900  -16.017 -1.785  1.00 14.20 ? 105 ILE C CB   1  
ATOM 6320   C CG1  . ILE C 1 105 ? -9.147  -16.963 -1.733  1.00 24.42 ? 105 ILE C CG1  1  
ATOM 6321   C CG2  . ILE C 1 105 ? -7.453  -15.618 -0.353  1.00 10.44 ? 105 ILE C CG2  1  
ATOM 6322   C CD1  . ILE C 1 105 ? -10.437 -16.329 -1.209  1.00 35.10 ? 105 ILE C CD1  1  
ATOM 6323   H H    . ILE C 1 105 ? -8.545  -16.009 -4.364  1.00 55.12 ? 105 ILE C H    1  
ATOM 6324   H HA   . ILE C 1 105 ? -8.940  -14.134 -2.163  1.00 54.32 ? 105 ILE C HA   1  
ATOM 6325   H HB   . ILE C 1 105 ? -7.076  -16.562 -2.246  1.00 3.15  ? 105 ILE C HB   1  
ATOM 6326   H HG12 . ILE C 1 105 ? -9.353  -17.326 -2.731  1.00 45.11 ? 105 ILE C HG12 1  
ATOM 6327   H HG13 . ILE C 1 105 ? -8.921  -17.814 -1.101  1.00 33.14 ? 105 ILE C HG13 1  
ATOM 6328   H HG21 . ILE C 1 105 ? -6.560  -15.006 -0.405  1.00 61.14 ? 105 ILE C HG21 1  
ATOM 6329   H HG22 . ILE C 1 105 ? -7.236  -16.500 0.227   1.00 23.23 ? 105 ILE C HG22 1  
ATOM 6330   H HG23 . ILE C 1 105 ? -8.235  -15.063 0.137   1.00 20.41 ? 105 ILE C HG23 1  
ATOM 6331   H HD11 . ILE C 1 105 ? -10.359 -16.178 -0.141  1.00 24.30 ? 105 ILE C HD11 1  
ATOM 6332   H HD12 . ILE C 1 105 ? -11.271 -16.981 -1.420  1.00 35.22 ? 105 ILE C HD12 1  
ATOM 6333   H HD13 . ILE C 1 105 ? -10.608 -15.378 -1.693  1.00 73.23 ? 105 ILE C HD13 1  
ATOM 6334   N N    . LEU C 1 106 ? -6.132  -14.257 -3.905  1.00 63.50 ? 106 LEU C N    1  
ATOM 6335   C CA   . LEU C 1 106 ? -4.859  -13.580 -4.241  1.00 71.25 ? 106 LEU C CA   1  
ATOM 6336   C C    . LEU C 1 106 ? -5.083  -12.300 -5.062  1.00 2.21  ? 106 LEU C C    1  
ATOM 6337   O O    . LEU C 1 106 ? -4.245  -11.402 -5.044  1.00 12.52 ? 106 LEU C O    1  
ATOM 6338   C CB   . LEU C 1 106 ? -3.942  -14.549 -5.031  1.00 41.34 ? 106 LEU C CB   1  
ATOM 6339   C CG   . LEU C 1 106 ? -3.491  -15.827 -4.264  1.00 41.05 ? 106 LEU C CG   1  
ATOM 6340   C CD1  . LEU C 1 106 ? -2.622  -16.739 -5.159  1.00 21.52 ? 106 LEU C CD1  1  
ATOM 6341   C CD2  . LEU C 1 106 ? -2.765  -15.451 -2.948  1.00 3.33  ? 106 LEU C CD2  1  
ATOM 6342   H H    . LEU C 1 106 ? -6.422  -15.004 -4.472  1.00 14.24 ? 106 LEU C H    1  
ATOM 6343   H HA   . LEU C 1 106 ? -4.363  -13.308 -3.311  1.00 73.40 ? 106 LEU C HA   1  
ATOM 6344   H HB2  . LEU C 1 106 ? -4.469  -14.854 -5.932  1.00 52.40 ? 106 LEU C HB2  1  
ATOM 6345   H HB3  . LEU C 1 106 ? -3.050  -14.007 -5.332  1.00 3.34  ? 106 LEU C HB3  1  
ATOM 6346   H HG   . LEU C 1 106 ? -4.376  -16.396 -3.992  1.00 60.21 ? 106 LEU C HG   1  
ATOM 6347   H HD11 . LEU C 1 106 ? -3.183  -17.029 -6.037  1.00 3.40  ? 106 LEU C HD11 1  
ATOM 6348   H HD12 . LEU C 1 106 ? -2.345  -17.632 -4.612  1.00 73.54 ? 106 LEU C HD12 1  
ATOM 6349   H HD13 . LEU C 1 106 ? -1.723  -16.217 -5.464  1.00 13.33 ? 106 LEU C HD13 1  
ATOM 6350   H HD21 . LEU C 1 106 ? -2.468  -16.351 -2.426  1.00 61.32 ? 106 LEU C HD21 1  
ATOM 6351   H HD22 . LEU C 1 106 ? -3.431  -14.883 -2.312  1.00 65.12 ? 106 LEU C HD22 1  
ATOM 6352   H HD23 . LEU C 1 106 ? -1.886  -14.856 -3.166  1.00 74.44 ? 106 LEU C HD23 1  
ATOM 6353   N N    . PHE C 1 107 ? -6.217  -12.245 -5.776  1.00 13.14 ? 107 PHE C N    1  
ATOM 6354   C CA   . PHE C 1 107 ? -6.548  -11.158 -6.722  1.00 53.51 ? 107 PHE C CA   1  
ATOM 6355   C C    . PHE C 1 107 ? -6.582  -9.746  -6.062  1.00 24.14 ? 107 PHE C C    1  
ATOM 6356   O O    . PHE C 1 107 ? -5.984  -8.833  -6.618  1.00 2.14  ? 107 PHE C O    1  
ATOM 6357   C CB   . PHE C 1 107 ? -7.880  -11.473 -7.473  1.00 40.40 ? 107 PHE C CB   1  
ATOM 6358   C CG   . PHE C 1 107 ? -8.306  -10.398 -8.468  1.00 35.40 ? 107 PHE C CG   1  
ATOM 6359   C CD1  . PHE C 1 107 ? -7.535  -10.135 -9.602  1.00 33.44 ? 107 PHE C CD1  1  
ATOM 6360   C CD2  . PHE C 1 107 ? -9.468  -9.650  -8.267  1.00 52.44 ? 107 PHE C CD2  1  
ATOM 6361   C CE1  . PHE C 1 107 ? -7.915  -9.156  -10.498 1.00 21.52 ? 107 PHE C CE1  1  
ATOM 6362   C CE2  . PHE C 1 107 ? -9.846  -8.675  -9.164  1.00 5.34  ? 107 PHE C CE2  1  
ATOM 6363   C CZ   . PHE C 1 107 ? -9.070  -8.426  -10.277 1.00 31.12 ? 107 PHE C CZ   1  
ATOM 6364   H H    . PHE C 1 107 ? -6.864  -12.971 -5.666  1.00 54.22 ? 107 PHE C H    1  
ATOM 6365   H HA   . PHE C 1 107 ? -5.751  -11.151 -7.459  1.00 21.10 ? 107 PHE C HA   1  
ATOM 6366   H HB2  . PHE C 1 107 ? -7.763  -12.400 -8.019  1.00 15.11 ? 107 PHE C HB2  1  
ATOM 6367   H HB3  . PHE C 1 107 ? -8.677  -11.605 -6.743  1.00 50.33 ? 107 PHE C HB3  1  
ATOM 6368   H HD1  . PHE C 1 107 ? -6.623  -10.704 -9.773  1.00 44.22 ? 107 PHE C HD1  1  
ATOM 6369   H HD2  . PHE C 1 107 ? -10.080 -9.846  -7.393  1.00 12.35 ? 107 PHE C HD2  1  
ATOM 6370   H HE1  . PHE C 1 107 ? -7.310  -8.959  -11.371 1.00 22.22 ? 107 PHE C HE1  1  
ATOM 6371   H HE2  . PHE C 1 107 ? -10.747 -8.102  -8.989  1.00 43.41 ? 107 PHE C HE2  1  
ATOM 6372   H HZ   . PHE C 1 107 ? -9.365  -7.657  -10.976 1.00 72.41 ? 107 PHE C HZ   1  
ATOM 6373   N N    . PRO C 1 108 ? -7.281  -9.522  -4.890  1.00 60.22 ? 108 PRO C N    1  
ATOM 6374   C CA   . PRO C 1 108 ? -7.300  -8.187  -4.221  1.00 40.55 ? 108 PRO C CA   1  
ATOM 6375   C C    . PRO C 1 108 ? -5.888  -7.681  -3.828  1.00 72.25 ? 108 PRO C C    1  
ATOM 6376   O O    . PRO C 1 108 ? -5.574  -6.490  -3.974  1.00 31.05 ? 108 PRO C O    1  
ATOM 6377   C CB   . PRO C 1 108 ? -8.178  -8.428  -2.963  1.00 74.21 ? 108 PRO C CB   1  
ATOM 6378   C CG   . PRO C 1 108 ? -9.012  -9.622  -3.301  1.00 14.50 ? 108 PRO C CG   1  
ATOM 6379   C CD   . PRO C 1 108 ? -8.130  -10.497 -4.148  1.00 31.15 ? 108 PRO C CD   1  
ATOM 6380   H HA   . PRO C 1 108 ? -7.775  -7.445  -4.860  1.00 33.35 ? 108 PRO C HA   1  
ATOM 6381   H HB2  . PRO C 1 108 ? -7.552  -8.623  -2.088  1.00 71.12 ? 108 PRO C HB2  1  
ATOM 6382   H HB3  . PRO C 1 108 ? -8.810  -7.569  -2.771  1.00 20.35 ? 108 PRO C HB3  1  
ATOM 6383   H HG2  . PRO C 1 108 ? -9.310  -10.142 -2.394  1.00 22.10 ? 108 PRO C HG2  1  
ATOM 6384   H HG3  . PRO C 1 108 ? -9.890  -9.325  -3.866  1.00 53.23 ? 108 PRO C HG3  1  
ATOM 6385   H HD2  . PRO C 1 108 ? -7.516  -11.152 -3.530  1.00 61.11 ? 108 PRO C HD2  1  
ATOM 6386   H HD3  . PRO C 1 108 ? -8.725  -11.089 -4.836  1.00 61.44 ? 108 PRO C HD3  1  
ATOM 6387   N N    . TYR C 1 109 ? -5.056  -8.616  -3.339  1.00 1.41  ? 109 TYR C N    1  
ATOM 6388   C CA   . TYR C 1 109 ? -3.673  -8.335  -2.900  1.00 61.40 ? 109 TYR C CA   1  
ATOM 6389   C C    . TYR C 1 109 ? -2.753  -8.021  -4.096  1.00 32.30 ? 109 TYR C C    1  
ATOM 6390   O O    . TYR C 1 109 ? -1.914  -7.115  -4.020  1.00 65.51 ? 109 TYR C O    1  
ATOM 6391   C CB   . TYR C 1 109 ? -3.116  -9.538  -2.118  1.00 72.23 ? 109 TYR C CB   1  
ATOM 6392   C CG   . TYR C 1 109 ? -3.794  -9.838  -0.772  1.00 21.54 ? 109 TYR C CG   1  
ATOM 6393   C CD1  . TYR C 1 109 ? -4.860  -10.740 -0.675  1.00 65.42 ? 109 TYR C CD1  1  
ATOM 6394   C CD2  . TYR C 1 109 ? -3.344  -9.237  0.406   1.00 3.03  ? 109 TYR C CD2  1  
ATOM 6395   C CE1  . TYR C 1 109 ? -5.445  -11.028 0.544   1.00 13.15 ? 109 TYR C CE1  1  
ATOM 6396   C CE2  . TYR C 1 109 ? -3.931  -9.522  1.621   1.00 74.44 ? 109 TYR C CE2  1  
ATOM 6397   C CZ   . TYR C 1 109 ? -4.975  -10.416 1.689   1.00 63.24 ? 109 TYR C CZ   1  
ATOM 6398   O OH   . TYR C 1 109 ? -5.542  -10.708 2.907   1.00 73.44 ? 109 TYR C OH   1  
ATOM 6399   H H    . TYR C 1 109 ? -5.386  -9.536  -3.269  1.00 72.12 ? 109 TYR C H    1  
ATOM 6400   H HA   . TYR C 1 109 ? -3.698  -7.469  -2.244  1.00 61.44 ? 109 TYR C HA   1  
ATOM 6401   H HB2  . TYR C 1 109 ? -3.206  -10.427 -2.736  1.00 45.15 ? 109 TYR C HB2  1  
ATOM 6402   H HB3  . TYR C 1 109 ? -2.058  -9.375  -1.923  1.00 1.22  ? 109 TYR C HB3  1  
ATOM 6403   H HD1  . TYR C 1 109 ? -5.228  -11.222 -1.572  1.00 23.14 ? 109 TYR C HD1  1  
ATOM 6404   H HD2  . TYR C 1 109 ? -2.525  -8.529  0.361   1.00 43.03 ? 109 TYR C HD2  1  
ATOM 6405   H HE1  . TYR C 1 109 ? -6.266  -11.734 0.597   1.00 43.10 ? 109 TYR C HE1  1  
ATOM 6406   H HE2  . TYR C 1 109 ? -3.564  -9.046  2.518   1.00 43.35 ? 109 TYR C HE2  1  
ATOM 6407   H HH   . TYR C 1 109 ? -5.589  -9.905  3.440   1.00 74.43 ? 109 TYR C HH   1  
ATOM 6408   N N    . ALA C 1 110 ? -2.898  -8.812  -5.181  1.00 64.21 ? 110 ALA C N    1  
ATOM 6409   C CA   . ALA C 1 110 ? -2.178  -8.587  -6.454  1.00 64.22 ? 110 ALA C CA   1  
ATOM 6410   C C    . ALA C 1 110 ? -2.527  -7.188  -6.993  1.00 42.03 ? 110 ALA C C    1  
ATOM 6411   O O    . ALA C 1 110 ? -1.646  -6.409  -7.343  1.00 70.11 ? 110 ALA C O    1  
ATOM 6412   C CB   . ALA C 1 110 ? -2.546  -9.677  -7.490  1.00 73.41 ? 110 ALA C CB   1  
ATOM 6413   H H    . ALA C 1 110 ? -3.521  -9.565  -5.125  1.00 20.42 ? 110 ALA C H    1  
ATOM 6414   H HA   . ALA C 1 110 ? -1.111  -8.646  -6.252  1.00 51.23 ? 110 ALA C HA   1  
ATOM 6415   H HB1  . ALA C 1 110 ? -2.141  -10.626 -7.190  1.00 11.24 ? 110 ALA C HB1  1  
ATOM 6416   H HB2  . ALA C 1 110 ? -2.153  -9.421  -8.468  1.00 21.55 ? 110 ALA C HB2  1  
ATOM 6417   H HB3  . ALA C 1 110 ? -3.616  -9.765  -7.553  1.00 4.43  ? 110 ALA C HB3  1  
ATOM 6418   N N    . ARG C 1 111 ? -3.841  -6.898  -6.969  1.00 61.41 ? 111 ARG C N    1  
ATOM 6419   C CA   . ARG C 1 111 ? -4.450  -5.641  -7.447  1.00 13.44 ? 111 ARG C CA   1  
ATOM 6420   C C    . ARG C 1 111 ? -3.837  -4.407  -6.754  1.00 42.21 ? 111 ARG C C    1  
ATOM 6421   O O    . ARG C 1 111 ? -3.415  -3.475  -7.434  1.00 61.50 ? 111 ARG C O    1  
ATOM 6422   C CB   . ARG C 1 111 ? -5.993  -5.689  -7.202  1.00 11.32 ? 111 ARG C CB   1  
ATOM 6423   C CG   . ARG C 1 111 ? -6.755  -4.358  -7.422  1.00 62.41 ? 111 ARG C CG   1  
ATOM 6424   C CD   . ARG C 1 111 ? -8.236  -4.418  -6.968  1.00 25.32 ? 111 ARG C CD   1  
ATOM 6425   N NE   . ARG C 1 111 ? -8.799  -3.063  -6.789  1.00 62.34 ? 111 ARG C NE   1  
ATOM 6426   C CZ   . ARG C 1 111 ? -8.663  -2.309  -5.674  1.00 40.32 ? 111 ARG C CZ   1  
ATOM 6427   N NH1  . ARG C 1 111 ? -7.984  -2.764  -4.612  1.00 34.53 ? 111 ARG C NH1  1  
ATOM 6428   N NH2  . ARG C 1 111 ? -9.176  -1.088  -5.649  1.00 64.50 ? 111 ARG C NH2  1  
ATOM 6429   H H    . ARG C 1 111 ? -4.436  -7.575  -6.598  1.00 32.20 ? 111 ARG C H    1  
ATOM 6430   H HA   . ARG C 1 111 ? -4.265  -5.573  -8.518  1.00 41.34 ? 111 ARG C HA   1  
ATOM 6431   H HB2  . ARG C 1 111 ? -6.421  -6.436  -7.861  1.00 20.13 ? 111 ARG C HB2  1  
ATOM 6432   H HB3  . ARG C 1 111 ? -6.164  -6.008  -6.176  1.00 22.13 ? 111 ARG C HB3  1  
ATOM 6433   H HG2  . ARG C 1 111 ? -6.258  -3.581  -6.855  1.00 75.25 ? 111 ARG C HG2  1  
ATOM 6434   H HG3  . ARG C 1 111 ? -6.720  -4.101  -8.474  1.00 70.22 ? 111 ARG C HG3  1  
ATOM 6435   H HD2  . ARG C 1 111 ? -8.818  -4.940  -7.718  1.00 4.00  ? 111 ARG C HD2  1  
ATOM 6436   H HD3  . ARG C 1 111 ? -8.305  -4.958  -6.030  1.00 65.34 ? 111 ARG C HD3  1  
ATOM 6437   H HE   . ARG C 1 111 ? -9.322  -2.702  -7.536  1.00 74.00 ? 111 ARG C HE   1  
ATOM 6438   H HH11 . ARG C 1 111 ? -7.573  -3.680  -4.627  1.00 52.14 ? 111 ARG C HH11 1  
ATOM 6439   H HH12 . ARG C 1 111 ? -7.887  -2.200  -3.793  1.00 74.44 ? 111 ARG C HH12 1  
ATOM 6440   H HH21 . ARG C 1 111 ? -9.670  -0.731  -6.448  1.00 65.44 ? 111 ARG C HH21 1  
ATOM 6441   H HH22 . ARG C 1 111 ? -9.083  -0.511  -4.840  1.00 71.41 ? 111 ARG C HH22 1  
ATOM 6442   N N    . GLU C 1 112 ? -3.793  -4.416  -5.402  1.00 10.34 ? 112 GLU C N    1  
ATOM 6443   C CA   . GLU C 1 112 ? -3.319  -3.248  -4.609  1.00 75.43 ? 112 GLU C CA   1  
ATOM 6444   C C    . GLU C 1 112 ? -1.802  -3.076  -4.775  1.00 74.33 ? 112 GLU C C    1  
ATOM 6445   O O    . GLU C 1 112 ? -1.307  -1.955  -4.788  1.00 63.33 ? 112 GLU C O    1  
ATOM 6446   C CB   . GLU C 1 112 ? -3.720  -3.387  -3.101  1.00 52.31 ? 112 GLU C CB   1  
ATOM 6447   C CG   . GLU C 1 112 ? -3.790  -2.051  -2.278  1.00 12.21 ? 112 GLU C CG   1  
ATOM 6448   C CD   . GLU C 1 112 ? -2.469  -1.591  -1.604  1.00 22.13 ? 112 GLU C CD   1  
ATOM 6449   O OE1  . GLU C 1 112 ? -2.148  -2.070  -0.491  1.00 74.45 ? 112 GLU C OE1  1  
ATOM 6450   O OE2  . GLU C 1 112 ? -1.755  -0.732  -2.162  1.00 61.31 ? 112 GLU C OE2  1  
ATOM 6451   H H    . GLU C 1 112 ? -4.076  -5.227  -4.925  1.00 55.22 ? 112 GLU C H    1  
ATOM 6452   H HA   . GLU C 1 112 ? -3.807  -2.366  -5.013  1.00 2.30  ? 112 GLU C HA   1  
ATOM 6453   H HB2  . GLU C 1 112 ? -4.701  -3.851  -3.058  1.00 72.55 ? 112 GLU C HB2  1  
ATOM 6454   H HB3  . GLU C 1 112 ? -3.022  -4.054  -2.605  1.00 65.32 ? 112 GLU C HB3  1  
ATOM 6455   H HG2  . GLU C 1 112 ? -4.133  -1.257  -2.934  1.00 24.21 ? 112 GLU C HG2  1  
ATOM 6456   H HG3  . GLU C 1 112 ? -4.535  -2.179  -1.497  1.00 43.23 ? 112 GLU C HG3  1  
ATOM 6457   N N    . CYS C 1 113 ? -1.077  -4.200  -4.933  1.00 62.21 ? 113 CYS C N    1  
ATOM 6458   C CA   . CYS C 1 113 ? 0.389   -4.183  -5.124  1.00 2.55  ? 113 CYS C CA   1  
ATOM 6459   C C    . CYS C 1 113 ? 0.761   -3.621  -6.519  1.00 64.04 ? 113 CYS C C    1  
ATOM 6460   O O    . CYS C 1 113 ? 1.825   -3.010  -6.693  1.00 1.01  ? 113 CYS C O    1  
ATOM 6461   C CB   . CYS C 1 113 ? 0.966   -5.597  -4.924  1.00 0.30  ? 113 CYS C CB   1  
ATOM 6462   S SG   . CYS C 1 113 ? 2.757   -5.646  -4.699  1.00 34.04 ? 113 CYS C SG   1  
ATOM 6463   H H    . CYS C 1 113 ? -1.541  -5.068  -4.921  1.00 64.21 ? 113 CYS C H    1  
ATOM 6464   H HA   . CYS C 1 113 ? 0.810   -3.530  -4.365  1.00 33.44 ? 113 CYS C HA   1  
ATOM 6465   H HB2  . CYS C 1 113 ? 0.519   -6.044  -4.046  1.00 64.10 ? 113 CYS C HB2  1  
ATOM 6466   H HB3  . CYS C 1 113 ? 0.735   -6.218  -5.789  1.00 44.43 ? 113 CYS C HB3  1  
ATOM 6467   H HG   . CYS C 1 113 ? 3.293   -4.582  -5.288  1.00 62.43 ? 113 CYS C HG   1  
ATOM 6468   N N    . ILE C 1 114 ? -0.134  -3.855  -7.502  1.00 74.54 ? 114 ILE C N    1  
ATOM 6469   C CA   . ILE C 1 114 ? -0.022  -3.292  -8.862  1.00 20.34 ? 114 ILE C CA   1  
ATOM 6470   C C    . ILE C 1 114 ? -0.327  -1.792  -8.828  1.00 63.52 ? 114 ILE C C    1  
ATOM 6471   O O    . ILE C 1 114 ? 0.466   -0.985  -9.318  1.00 10.31 ? 114 ILE C O    1  
ATOM 6472   C CB   . ILE C 1 114 ? -0.990  -4.031  -9.873  1.00 2.33  ? 114 ILE C CB   1  
ATOM 6473   C CG1  . ILE C 1 114 ? -0.503  -5.497  -10.113 1.00 13.51 ? 114 ILE C CG1  1  
ATOM 6474   C CG2  . ILE C 1 114 ? -1.145  -3.271  -11.224 1.00 53.42 ? 114 ILE C CG2  1  
ATOM 6475   C CD1  . ILE C 1 114 ? -1.417  -6.339  -10.975 1.00 40.15 ? 114 ILE C CD1  1  
ATOM 6476   H H    . ILE C 1 114 ? -0.904  -4.426  -7.299  1.00 65.33 ? 114 ILE C H    1  
ATOM 6477   H HA   . ILE C 1 114 ? 1.003   -3.435  -9.203  1.00 71.41 ? 114 ILE C HA   1  
ATOM 6478   H HB   . ILE C 1 114 ? -1.975  -4.071  -9.412  1.00 73.14 ? 114 ILE C HB   1  
ATOM 6479   H HG12 . ILE C 1 114 ? 0.465   -5.479  -10.597 1.00 2.15  ? 114 ILE C HG12 1  
ATOM 6480   H HG13 . ILE C 1 114 ? -0.403  -6.002  -9.159  1.00 45.24 ? 114 ILE C HG13 1  
ATOM 6481   H HG21 . ILE C 1 114 ? -1.774  -3.840  -11.881 1.00 74.44 ? 114 ILE C HG21 1  
ATOM 6482   H HG22 . ILE C 1 114 ? -0.180  -3.134  -11.687 1.00 33.52 ? 114 ILE C HG22 1  
ATOM 6483   H HG23 . ILE C 1 114 ? -1.604  -2.312  -11.069 1.00 73.30 ? 114 ILE C HG23 1  
ATOM 6484   H HD11 . ILE C 1 114 ? -1.029  -7.344  -11.026 1.00 12.24 ? 114 ILE C HD11 1  
ATOM 6485   H HD12 . ILE C 1 114 ? -1.461  -5.926  -11.973 1.00 64.12 ? 114 ILE C HD12 1  
ATOM 6486   H HD13 . ILE C 1 114 ? -2.410  -6.362  -10.552 1.00 64.21 ? 114 ILE C HD13 1  
ATOM 6487   N N    . THR C 1 115 ? -1.473  -1.440  -8.216  1.00 4.21  ? 115 THR C N    1  
ATOM 6488   C CA   . THR C 1 115 ? -1.971  -0.062  -8.155  1.00 51.43 ? 115 THR C CA   1  
ATOM 6489   C C    . THR C 1 115 ? -0.954  0.865   -7.457  1.00 74.14 ? 115 THR C C    1  
ATOM 6490   O O    . THR C 1 115 ? -0.725  1.999   -7.902  1.00 1.34  ? 115 THR C O    1  
ATOM 6491   C CB   . THR C 1 115 ? -3.336  0.012   -7.394  1.00 42.55 ? 115 THR C CB   1  
ATOM 6492   O OG1  . THR C 1 115 ? -4.323  -0.812  -8.046  1.00 32.10 ? 115 THR C OG1  1  
ATOM 6493   C CG2  . THR C 1 115 ? -3.856  1.459   -7.289  1.00 75.42 ? 115 THR C CG2  1  
ATOM 6494   H H    . THR C 1 115 ? -1.994  -2.134  -7.776  1.00 63.14 ? 115 THR C H    1  
ATOM 6495   H HA   . THR C 1 115 ? -2.126  0.270   -9.180  1.00 22.24 ? 115 THR C HA   1  
ATOM 6496   H HB   . THR C 1 115 ? -3.189  -0.375  -6.389  1.00 63.44 ? 115 THR C HB   1  
ATOM 6497   H HG1  . THR C 1 115 ? -4.045  -1.000  -8.949  1.00 73.32 ? 115 THR C HG1  1  
ATOM 6498   H HG21 . THR C 1 115 ? -4.758  1.482   -6.697  1.00 52.24 ? 115 THR C HG21 1  
ATOM 6499   H HG22 . THR C 1 115 ? -4.068  1.853   -8.273  1.00 53.32 ? 115 THR C HG22 1  
ATOM 6500   H HG23 . THR C 1 115 ? -3.110  2.083   -6.813  1.00 42.04 ? 115 THR C HG23 1  
ATOM 6501   N N    . SER C 1 116 ? -0.352  0.345   -6.367  1.00 3.41  ? 116 SER C N    1  
ATOM 6502   C CA   . SER C 1 116 ? 0.659   1.059   -5.579  1.00 25.52 ? 116 SER C CA   1  
ATOM 6503   C C    . SER C 1 116 ? 1.866   1.396   -6.470  1.00 30.42 ? 116 SER C C    1  
ATOM 6504   O O    . SER C 1 116 ? 2.332   2.513   -6.470  1.00 61.22 ? 116 SER C O    1  
ATOM 6505   C CB   . SER C 1 116 ? 1.088   0.219   -4.353  1.00 31.24 ? 116 SER C CB   1  
ATOM 6506   O OG   . SER C 1 116 ? 1.970   0.935   -3.497  1.00 61.35 ? 116 SER C OG   1  
ATOM 6507   H H    . SER C 1 116 ? -0.597  -0.561  -6.089  1.00 11.12 ? 116 SER C H    1  
ATOM 6508   H HA   . SER C 1 116 ? 0.208   1.984   -5.226  1.00 52.14 ? 116 SER C HA   1  
ATOM 6509   H HB2  . SER C 1 116 ? 0.209   -0.049  -3.781  1.00 35.30 ? 116 SER C HB2  1  
ATOM 6510   H HB3  . SER C 1 116 ? 1.582   -0.689  -4.683  1.00 13.02 ? 116 SER C HB3  1  
ATOM 6511   H HG   . SER C 1 116 ? 1.468   1.612   -3.017  1.00 31.50 ? 116 SER C HG   1  
ATOM 6512   N N    . MET C 1 117 ? 2.309   0.424   -7.279  1.00 74.40 ? 117 MET C N    1  
ATOM 6513   C CA   . MET C 1 117 ? 3.453   0.595   -8.207  1.00 23.04 ? 117 MET C CA   1  
ATOM 6514   C C    . MET C 1 117 ? 3.140   1.622   -9.324  1.00 22.14 ? 117 MET C C    1  
ATOM 6515   O O    . MET C 1 117 ? 4.006   2.439   -9.668  1.00 33.22 ? 117 MET C O    1  
ATOM 6516   C CB   . MET C 1 117 ? 3.883   -0.794  -8.777  1.00 52.34 ? 117 MET C CB   1  
ATOM 6517   C CG   . MET C 1 117 ? 4.942   -1.506  -7.918  1.00 22.30 ? 117 MET C CG   1  
ATOM 6518   S SD   . MET C 1 117 ? 4.611   -1.386  -6.138  1.00 60.41 ? 117 MET C SD   1  
ATOM 6519   C CE   . MET C 1 117 ? 6.270   -1.438  -5.451  1.00 45.14 ? 117 MET C CE   1  
ATOM 6520   H H    . MET C 1 117 ? 1.851   -0.443  -7.259  1.00 14.23 ? 117 MET C H    1  
ATOM 6521   H HA   . MET C 1 117 ? 4.281   0.998   -7.621  1.00 44.03 ? 117 MET C HA   1  
ATOM 6522   H HB2  . MET C 1 117 ? 3.010   -1.439  -8.842  1.00 3.21  ? 117 MET C HB2  1  
ATOM 6523   H HB3  . MET C 1 117 ? 4.290   -0.669  -9.779  1.00 20.53 ? 117 MET C HB3  1  
ATOM 6524   H HG2  . MET C 1 117 ? 4.969   -2.554  -8.188  1.00 30.00 ? 117 MET C HG2  1  
ATOM 6525   H HG3  . MET C 1 117 ? 5.917   -1.068  -8.121  1.00 31.24 ? 117 MET C HG3  1  
ATOM 6526   H HE1  . MET C 1 117 ? 6.991   -1.597  -6.239  1.00 33.35 ? 117 MET C HE1  1  
ATOM 6527   H HE2  . MET C 1 117 ? 6.346   -2.232  -4.732  1.00 42.15 ? 117 MET C HE2  1  
ATOM 6528   H HE3  . MET C 1 117 ? 6.494   -0.503  -4.976  1.00 54.24 ? 117 MET C HE3  1  
ATOM 6529   N N    . VAL C 1 118 ? 1.901   1.592   -9.856  1.00 55.14 ? 118 VAL C N    1  
ATOM 6530   C CA   . VAL C 1 118 ? 1.427   2.579   -10.862 1.00 43.22 ? 118 VAL C CA   1  
ATOM 6531   C C    . VAL C 1 118 ? 1.436   4.005   -10.255 1.00 24.21 ? 118 VAL C C    1  
ATOM 6532   O O    . VAL C 1 118 ? 1.851   4.975   -10.907 1.00 53.23 ? 118 VAL C O    1  
ATOM 6533   C CB   . VAL C 1 118 ? -0.023  2.216   -11.384 1.00 63.55 ? 118 VAL C CB   1  
ATOM 6534   C CG1  . VAL C 1 118 ? -0.555  3.239   -12.427 1.00 13.05 ? 118 VAL C CG1  1  
ATOM 6535   C CG2  . VAL C 1 118 ? -0.067  0.773   -11.951 1.00 23.51 ? 118 VAL C CG2  1  
ATOM 6536   H H    . VAL C 1 118 ? 1.286   0.887   -9.564  1.00 15.11 ? 118 VAL C H    1  
ATOM 6537   H HA   . VAL C 1 118 ? 2.114   2.551   -11.706 1.00 63.55 ? 118 VAL C HA   1  
ATOM 6538   H HB   . VAL C 1 118 ? -0.695  2.247   -10.530 1.00 23.12 ? 118 VAL C HB   1  
ATOM 6539   H HG11 . VAL C 1 118 ? -1.556  2.962   -12.736 1.00 10.30 ? 118 VAL C HG11 1  
ATOM 6540   H HG12 . VAL C 1 118 ? 0.092   3.257   -13.295 1.00 14.21 ? 118 VAL C HG12 1  
ATOM 6541   H HG13 . VAL C 1 118 ? -0.584  4.227   -11.985 1.00 62.01 ? 118 VAL C HG13 1  
ATOM 6542   H HG21 . VAL C 1 118 ? 0.235   0.073   -11.182 1.00 64.22 ? 118 VAL C HG21 1  
ATOM 6543   H HG22 . VAL C 1 118 ? 0.604   0.683   -12.795 1.00 12.22 ? 118 VAL C HG22 1  
ATOM 6544   H HG23 . VAL C 1 118 ? -1.074  0.534   -12.268 1.00 14.21 ? 118 VAL C HG23 1  
ATOM 6545   N N    . SER C 1 119 ? 1.010   4.097   -8.980  1.00 44.10 ? 119 SER C N    1  
ATOM 6546   C CA   . SER C 1 119 ? 0.893   5.372   -8.253  1.00 71.45 ? 119 SER C CA   1  
ATOM 6547   C C    . SER C 1 119 ? 2.270   5.900   -7.800  1.00 43.05 ? 119 SER C C    1  
ATOM 6548   O O    . SER C 1 119 ? 2.456   7.110   -7.616  1.00 54.53 ? 119 SER C O    1  
ATOM 6549   C CB   . SER C 1 119 ? -0.048  5.188   -7.049  1.00 3.50  ? 119 SER C CB   1  
ATOM 6550   O OG   . SER C 1 119 ? 0.487   4.362   -6.041  1.00 42.33 ? 119 SER C OG   1  
ATOM 6551   H H    . SER C 1 119 ? 0.765   3.271   -8.508  1.00 11.44 ? 119 SER C H    1  
ATOM 6552   H HA   . SER C 1 119 ? 0.451   6.101   -8.928  1.00 25.20 ? 119 SER C HA   1  
ATOM 6553   H HB2  . SER C 1 119 ? -0.270  6.151   -6.614  1.00 32.11 ? 119 SER C HB2  1  
ATOM 6554   H HB3  . SER C 1 119 ? -0.963  4.742   -7.392  1.00 32.43 ? 119 SER C HB3  1  
ATOM 6555   H HG   . SER C 1 119 ? 1.193   4.826   -5.586  1.00 14.22 ? 119 SER C HG   1  
ATOM 6556   N N    . ARG C 1 120 ? 3.220   4.970   -7.614  1.00 4.01  ? 120 ARG C N    1  
ATOM 6557   C CA   . ARG C 1 120 ? 4.630   5.287   -7.296  1.00 23.25 ? 120 ARG C CA   1  
ATOM 6558   C C    . ARG C 1 120 ? 5.327   5.877   -8.522  1.00 63.22 ? 120 ARG C C    1  
ATOM 6559   O O    . ARG C 1 120 ? 6.161   6.769   -8.387  1.00 53.15 ? 120 ARG C O    1  
ATOM 6560   C CB   . ARG C 1 120 ? 5.366   4.023   -6.786  1.00 75.24 ? 120 ARG C CB   1  
ATOM 6561   C CG   . ARG C 1 120 ? 4.908   3.570   -5.391  1.00 63.00 ? 120 ARG C CG   1  
ATOM 6562   C CD   . ARG C 1 120 ? 5.417   2.168   -4.992  1.00 32.12 ? 120 ARG C CD   1  
ATOM 6563   N NE   . ARG C 1 120 ? 4.835   1.737   -3.710  1.00 11.21 ? 120 ARG C NE   1  
ATOM 6564   C CZ   . ARG C 1 120 ? 5.098   2.288   -2.514  1.00 51.22 ? 120 ARG C CZ   1  
ATOM 6565   N NH1  . ARG C 1 120 ? 5.944   3.302   -2.389  1.00 45.12 ? 120 ARG C NH1  1  
ATOM 6566   N NH2  . ARG C 1 120 ? 4.458   1.857   -1.452  1.00 53.15 ? 120 ARG C NH2  1  
ATOM 6567   H H    . ARG C 1 120 ? 2.959   4.031   -7.700  1.00 22.21 ? 120 ARG C H    1  
ATOM 6568   H HA   . ARG C 1 120 ? 4.633   6.037   -6.505  1.00 13.40 ? 120 ARG C HA   1  
ATOM 6569   H HB2  . ARG C 1 120 ? 5.194   3.213   -7.490  1.00 30.12 ? 120 ARG C HB2  1  
ATOM 6570   H HB3  . ARG C 1 120 ? 6.432   4.226   -6.743  1.00 54.21 ? 120 ARG C HB3  1  
ATOM 6571   H HG2  . ARG C 1 120 ? 5.260   4.285   -4.656  1.00 74.14 ? 120 ARG C HG2  1  
ATOM 6572   H HG3  . ARG C 1 120 ? 3.818   3.561   -5.372  1.00 3.20  ? 120 ARG C HG3  1  
ATOM 6573   H HD2  . ARG C 1 120 ? 5.120   1.457   -5.756  1.00 21.23 ? 120 ARG C HD2  1  
ATOM 6574   H HD3  . ARG C 1 120 ? 6.499   2.175   -4.914  1.00 22.01 ? 120 ARG C HD3  1  
ATOM 6575   H HE   . ARG C 1 120 ? 4.191   0.996   -3.749  1.00 55.54 ? 120 ARG C HE   1  
ATOM 6576   H HH11 . ARG C 1 120 ? 6.416   3.668   -3.188  1.00 55.01 ? 120 ARG C HH11 1  
ATOM 6577   H HH12 . ARG C 1 120 ? 6.125   3.699   -1.479  1.00 31.13 ? 120 ARG C HH12 1  
ATOM 6578   H HH21 . ARG C 1 120 ? 3.776   1.133   -1.532  1.00 31.45 ? 120 ARG C HH21 1  
ATOM 6579   H HH22 . ARG C 1 120 ? 4.642   2.274   -0.546  1.00 51.25 ? 120 ARG C HH22 1  
ATOM 6580   N N    . GLY C 1 121 ? 4.940   5.389   -9.725  1.00 2.24  ? 121 GLY C N    1  
ATOM 6581   C CA   . GLY C 1 121 ? 5.372   5.992   -10.993 1.00 50.15 ? 121 GLY C CA   1  
ATOM 6582   C C    . GLY C 1 121 ? 4.566   7.240   -11.348 1.00 23.51 ? 121 GLY C C    1  
ATOM 6583   O O    . GLY C 1 121 ? 4.725   7.789   -12.440 1.00 4.31  ? 121 GLY C O    1  
ATOM 6584   H H    . GLY C 1 121 ? 4.347   4.603   -9.748  1.00 42.23 ? 121 GLY C H    1  
ATOM 6585   H HA2  . GLY C 1 121 ? 6.419   6.269   -10.923 1.00 73.52 ? 121 GLY C HA2  1  
ATOM 6586   H HA3  . GLY C 1 121 ? 5.253   5.261   -11.782 1.00 63.25 ? 121 GLY C HA3  1  
ATOM 6587   N N    . THR C 1 122 ? 3.689   7.661   -10.398 1.00 21.22 ? 122 THR C N    1  
ATOM 6588   C CA   . THR C 1 122 ? 2.872   8.903   -10.417 1.00 31.11 ? 122 THR C CA   1  
ATOM 6589   C C    . THR C 1 122 ? 1.880   8.964   -11.599 1.00 54.24 ? 122 THR C C    1  
ATOM 6590   O O    . THR C 1 122 ? 1.327   10.029  -11.917 1.00 75.20 ? 122 THR C O    1  
ATOM 6591   C CB   . THR C 1 122 ? 3.769   10.198  -10.326 1.00 71.30 ? 122 THR C CB   1  
ATOM 6592   O OG1  . THR C 1 122 ? 4.649   10.310  -11.453 1.00 3.52  ? 122 THR C OG1  1  
ATOM 6593   C CG2  . THR C 1 122 ? 4.607   10.212  -9.025  1.00 42.05 ? 122 THR C CG2  1  
ATOM 6594   H H    . THR C 1 122 ? 3.579   7.086   -9.625  1.00 72.33 ? 122 THR C H    1  
ATOM 6595   H HA   . THR C 1 122 ? 2.271   8.871   -9.511  1.00 71.22 ? 122 THR C HA   1  
ATOM 6596   H HB   . THR C 1 122 ? 3.119   11.063  -10.321 1.00 70.21 ? 122 THR C HB   1  
ATOM 6597   H HG1  . THR C 1 122 ? 5.330   9.630   -11.393 1.00 44.13 ? 122 THR C HG1  1  
ATOM 6598   H HG21 . THR C 1 122 ? 3.993   10.509  -8.187  1.00 42.02 ? 122 THR C HG21 1  
ATOM 6599   H HG22 . THR C 1 122 ? 5.440   10.892  -9.132  1.00 55.30 ? 122 THR C HG22 1  
ATOM 6600   H HG23 . THR C 1 122 ? 5.007   9.229   -8.834  1.00 62.42 ? 122 THR C HG23 1  
ATOM 6601   N N    . PHE C 1 123 ? 1.599   7.783   -12.171 1.00 72.20 ? 123 PHE C N    1  
ATOM 6602   C CA   . PHE C 1 123 ? 0.642   7.607   -13.269 1.00 41.30 ? 123 PHE C CA   1  
ATOM 6603   C C    . PHE C 1 123 ? -0.786  7.434   -12.694 1.00 63.34 ? 123 PHE C C    1  
ATOM 6604   O O    . PHE C 1 123 ? -0.927  7.051   -11.521 1.00 21.51 ? 123 PHE C O    1  
ATOM 6605   C CB   . PHE C 1 123 ? 1.044   6.371   -14.126 1.00 73.32 ? 123 PHE C CB   1  
ATOM 6606   C CG   . PHE C 1 123 ? 2.417   6.494   -14.800 1.00 24.41 ? 123 PHE C CG   1  
ATOM 6607   C CD1  . PHE C 1 123 ? 2.666   7.526   -15.706 1.00 53.44 ? 123 PHE C CD1  1  
ATOM 6608   C CD2  . PHE C 1 123 ? 3.450   5.593   -14.534 1.00 51.51 ? 123 PHE C CD2  1  
ATOM 6609   C CE1  . PHE C 1 123 ? 3.896   7.653   -16.322 1.00 62.42 ? 123 PHE C CE1  1  
ATOM 6610   C CE2  . PHE C 1 123 ? 4.684   5.724   -15.153 1.00 55.32 ? 123 PHE C CE2  1  
ATOM 6611   C CZ   . PHE C 1 123 ? 4.907   6.754   -16.046 1.00 1.10  ? 123 PHE C CZ   1  
ATOM 6612   H H    . PHE C 1 123 ? 2.050   6.986   -11.823 1.00 61.31 ? 123 PHE C H    1  
ATOM 6613   H HA   . PHE C 1 123 ? 0.667   8.496   -13.894 1.00 22.23 ? 123 PHE C HA   1  
ATOM 6614   H HB2  . PHE C 1 123 ? 1.041   5.486   -13.498 1.00 5.12  ? 123 PHE C HB2  1  
ATOM 6615   H HB3  . PHE C 1 123 ? 0.308   6.235   -14.911 1.00 44.44 ? 123 PHE C HB3  1  
ATOM 6616   H HD1  . PHE C 1 123 ? 1.878   8.235   -15.934 1.00 21.14 ? 123 PHE C HD1  1  
ATOM 6617   H HD2  . PHE C 1 123 ? 3.283   4.779   -13.838 1.00 60.21 ? 123 PHE C HD2  1  
ATOM 6618   H HE1  . PHE C 1 123 ? 4.068   8.460   -17.023 1.00 13.41 ? 123 PHE C HE1  1  
ATOM 6619   H HE2  . PHE C 1 123 ? 5.475   5.017   -14.938 1.00 61.21 ? 123 PHE C HE2  1  
ATOM 6620   H HZ   . PHE C 1 123 ? 5.870   6.858   -16.528 1.00 65.25 ? 123 PHE C HZ   1  
ATOM 6621   N N    . PRO C 1 124 ? -1.866  7.747   -13.500 1.00 23.34 ? 124 PRO C N    1  
ATOM 6622   C CA   . PRO C 1 124 ? -3.273  7.493   -13.102 1.00 0.10  ? 124 PRO C CA   1  
ATOM 6623   C C    . PRO C 1 124 ? -3.488  6.039   -12.643 1.00 51.12 ? 124 PRO C C    1  
ATOM 6624   O O    . PRO C 1 124 ? -3.221  5.098   -13.406 1.00 12.22 ? 124 PRO C O    1  
ATOM 6625   C CB   . PRO C 1 124 ? -4.080  7.800   -14.392 1.00 72.54 ? 124 PRO C CB   1  
ATOM 6626   C CG   . PRO C 1 124 ? -3.229  8.774   -15.146 1.00 61.43 ? 124 PRO C CG   1  
ATOM 6627   C CD   . PRO C 1 124 ? -1.793  8.400   -14.836 1.00 61.15 ? 124 PRO C CD   1  
ATOM 6628   H HA   . PRO C 1 124 ? -3.578  8.174   -12.309 1.00 12.21 ? 124 PRO C HA   1  
ATOM 6629   H HB2  . PRO C 1 124 ? -4.237  6.890   -14.975 1.00 61.24 ? 124 PRO C HB2  1  
ATOM 6630   H HB3  . PRO C 1 124 ? -5.035  8.247   -14.145 1.00 62.10 ? 124 PRO C HB3  1  
ATOM 6631   H HG2  . PRO C 1 124 ? -3.424  8.695   -16.212 1.00 35.04 ? 124 PRO C HG2  1  
ATOM 6632   H HG3  . PRO C 1 124 ? -3.429  9.789   -14.809 1.00 71.44 ? 124 PRO C HG3  1  
ATOM 6633   H HD2  . PRO C 1 124 ? -1.408  7.708   -15.574 1.00 22.24 ? 124 PRO C HD2  1  
ATOM 6634   H HD3  . PRO C 1 124 ? -1.167  9.284   -14.796 1.00 34.41 ? 124 PRO C HD3  1  
ATOM 6635   N N    . GLN C 1 125 ? -3.938  5.890   -11.383 1.00 14.35 ? 125 GLN C N    1  
ATOM 6636   C CA   . GLN C 1 125 ? -4.146  4.581   -10.744 1.00 71.44 ? 125 GLN C CA   1  
ATOM 6637   C C    . GLN C 1 125 ? -5.111  3.690   -11.534 1.00 73.11 ? 125 GLN C C    1  
ATOM 6638   O O    . GLN C 1 125 ? -6.099  4.164   -12.109 1.00 13.02 ? 125 GLN C O    1  
ATOM 6639   C CB   . GLN C 1 125 ? -4.660  4.754   -9.294  1.00 12.34 ? 125 GLN C CB   1  
ATOM 6640   C CG   . GLN C 1 125 ? -3.617  5.302   -8.312  1.00 42.34 ? 125 GLN C CG   1  
ATOM 6641   C CD   . GLN C 1 125 ? -4.166  5.446   -6.896  1.00 13.13 ? 125 GLN C CD   1  
ATOM 6642   O OE1  . GLN C 1 125 ? -5.321  5.822   -6.701  1.00 15.12 ? 125 GLN C OE1  1  
ATOM 6643   N NE2  . GLN C 1 125 ? -3.374  5.084   -5.901  1.00 42.22 ? 125 GLN C NE2  1  
ATOM 6644   H H    . GLN C 1 125 ? -4.121  6.695   -10.858 1.00 51.01 ? 125 GLN C H    1  
ATOM 6645   H HA   . GLN C 1 125 ? -3.178  4.093   -10.708 1.00 52.31 ? 125 GLN C HA   1  
ATOM 6646   H HB2  . GLN C 1 125 ? -5.513  5.424   -9.298  1.00 4.22  ? 125 GLN C HB2  1  
ATOM 6647   H HB3  . GLN C 1 125 ? -4.988  3.785   -8.918  1.00 1.12  ? 125 GLN C HB3  1  
ATOM 6648   H HG2  . GLN C 1 125 ? -2.764  4.632   -8.299  1.00 65.44 ? 125 GLN C HG2  1  
ATOM 6649   H HG3  . GLN C 1 125 ? -3.294  6.281   -8.651  1.00 42.02 ? 125 GLN C HG3  1  
ATOM 6650   H HE21 . GLN C 1 125 ? -2.475  4.763   -6.112  1.00 31.33 ? 125 GLN C HE21 1  
ATOM 6651   H HE22 . GLN C 1 125 ? -3.740  5.103   -4.997  1.00 61.14 ? 125 GLN C HE22 1  
ATOM 6652   N N    . LEU C 1 126 ? -4.813  2.386   -11.524 1.00 53.12 ? 126 LEU C N    1  
ATOM 6653   C CA   . LEU C 1 126 ? -5.594  1.385   -12.241 1.00 42.42 ? 126 LEU C CA   1  
ATOM 6654   C C    . LEU C 1 126 ? -6.148  0.384   -11.215 1.00 61.02 ? 126 LEU C C    1  
ATOM 6655   O O    . LEU C 1 126 ? -5.390  -0.389  -10.619 1.00 74.23 ? 126 LEU C O    1  
ATOM 6656   C CB   . LEU C 1 126 ? -4.706  0.703   -13.336 1.00 22.31 ? 126 LEU C CB   1  
ATOM 6657   C CG   . LEU C 1 126 ? -5.470  -0.071  -14.471 1.00 24.22 ? 126 LEU C CG   1  
ATOM 6658   C CD1  . LEU C 1 126 ? -4.543  -0.354  -15.673 1.00 42.00 ? 126 LEU C CD1  1  
ATOM 6659   C CD2  . LEU C 1 126 ? -6.118  -1.380  -13.960 1.00 75.00 ? 126 LEU C CD2  1  
ATOM 6660   H H    . LEU C 1 126 ? -4.039  2.084   -11.000 1.00 73.20 ? 126 LEU C H    1  
ATOM 6661   H HA   . LEU C 1 126 ? -6.431  1.883   -12.736 1.00 33.21 ? 126 LEU C HA   1  
ATOM 6662   H HB2  . LEU C 1 126 ? -4.113  1.484   -13.808 1.00 55.33 ? 126 LEU C HB2  1  
ATOM 6663   H HB3  . LEU C 1 126 ? -4.016  0.014   -12.856 1.00 10.20 ? 126 LEU C HB3  1  
ATOM 6664   H HG   . LEU C 1 126 ? -6.270  0.562   -14.838 1.00 5.53  ? 126 LEU C HG   1  
ATOM 6665   H HD11 . LEU C 1 126 ? -3.723  -0.992  -15.367 1.00 42.15 ? 126 LEU C HD11 1  
ATOM 6666   H HD12 . LEU C 1 126 ? -4.146  0.577   -16.054 1.00 43.43 ? 126 LEU C HD12 1  
ATOM 6667   H HD13 . LEU C 1 126 ? -5.104  -0.844  -16.459 1.00 13.25 ? 126 LEU C HD13 1  
ATOM 6668   H HD21 . LEU C 1 126 ? -6.670  -1.845  -14.760 1.00 43.12 ? 126 LEU C HD21 1  
ATOM 6669   H HD22 . LEU C 1 126 ? -6.802  -1.157  -13.151 1.00 14.51 ? 126 LEU C HD22 1  
ATOM 6670   H HD23 . LEU C 1 126 ? -5.356  -2.063  -13.605 1.00 5.22  ? 126 LEU C HD23 1  
ATOM 6671   N N    . ASN C 1 127 ? -7.469  0.443   -10.995 1.00 43.30 ? 127 ASN C N    1  
ATOM 6672   C CA   . ASN C 1 127 ? -8.207  -0.562  -10.213 1.00 54.43 ? 127 ASN C CA   1  
ATOM 6673   C C    . ASN C 1 127 ? -8.728  -1.637  -11.174 1.00 24.14 ? 127 ASN C C    1  
ATOM 6674   O O    . ASN C 1 127 ? -9.486  -1.323  -12.100 1.00 71.43 ? 127 ASN C O    1  
ATOM 6675   C CB   . ASN C 1 127 ? -9.389  0.105   -9.447  1.00 33.41 ? 127 ASN C CB   1  
ATOM 6676   C CG   . ASN C 1 127 ? -8.995  0.885   -8.181  1.00 65.11 ? 127 ASN C CG   1  
ATOM 6677   O OD1  . ASN C 1 127 ? -9.814  1.048   -7.291  1.00 4.21  ? 127 ASN C OD1  1  
ATOM 6678   N ND2  . ASN C 1 127 ? -7.749  1.327   -8.048  1.00 24.50 ? 127 ASN C ND2  1  
ATOM 6679   H H    . ASN C 1 127 ? -7.974  1.192   -11.385 1.00 73.41 ? 127 ASN C H    1  
ATOM 6680   H HA   . ASN C 1 127 ? -7.524  -1.015  -9.492  1.00 55.03 ? 127 ASN C HA   1  
ATOM 6681   H HB2  . ASN C 1 127 ? -9.896  0.794   -10.109 1.00 14.31 ? 127 ASN C HB2  1  
ATOM 6682   H HB3  . ASN C 1 127 ? -10.096 -0.667  -9.153  1.00 12.22 ? 127 ASN C HB3  1  
ATOM 6683   H HD21 . ASN C 1 127 ? -7.107  1.145   -8.753  1.00 61.04 ? 127 ASN C HD21 1  
ATOM 6684   H HD22 . ASN C 1 127 ? -7.529  1.826   -7.233  1.00 12.52 ? 127 ASN C HD22 1  
ATOM 6685   N N    . LEU C 1 128 ? -8.287  -2.890  -10.970 1.00 64.22 ? 128 LEU C N    1  
ATOM 6686   C CA   . LEU C 1 128 ? -8.688  -4.019  -11.826 1.00 75.41 ? 128 LEU C CA   1  
ATOM 6687   C C    . LEU C 1 128 ? -10.161 -4.394  -11.514 1.00 4.23  ? 128 LEU C C    1  
ATOM 6688   O O    . LEU C 1 128 ? -10.563 -4.433  -10.338 1.00 0.41  ? 128 LEU C O    1  
ATOM 6689   C CB   . LEU C 1 128 ? -7.711  -5.233  -11.620 1.00 55.34 ? 128 LEU C CB   1  
ATOM 6690   C CG   . LEU C 1 128 ? -7.317  -6.052  -12.910 1.00 5.24  ? 128 LEU C CG   1  
ATOM 6691   C CD1  . LEU C 1 128 ? -8.542  -6.694  -13.614 1.00 2.34  ? 128 LEU C CD1  1  
ATOM 6692   C CD2  . LEU C 1 128 ? -6.512  -5.168  -13.893 1.00 11.41 ? 128 LEU C CD2  1  
ATOM 6693   H H    . LEU C 1 128 ? -7.679  -3.061  -10.220 1.00 52.33 ? 128 LEU C H    1  
ATOM 6694   H HA   . LEU C 1 128 ? -8.623  -3.682  -12.861 1.00 61.35 ? 128 LEU C HA   1  
ATOM 6695   H HB2  . LEU C 1 128 ? -6.791  -4.859  -11.178 1.00 65.24 ? 128 LEU C HB2  1  
ATOM 6696   H HB3  . LEU C 1 128 ? -8.154  -5.923  -10.905 1.00 52.53 ? 128 LEU C HB3  1  
ATOM 6697   H HG   . LEU C 1 128 ? -6.667  -6.868  -12.612 1.00 1.43  ? 128 LEU C HG   1  
ATOM 6698   H HD11 . LEU C 1 128 ? -9.073  -7.327  -12.916 1.00 65.32 ? 128 LEU C HD11 1  
ATOM 6699   H HD12 . LEU C 1 128 ? -8.211  -7.293  -14.451 1.00 23.43 ? 128 LEU C HD12 1  
ATOM 6700   H HD13 . LEU C 1 128 ? -9.212  -5.918  -13.974 1.00 55.22 ? 128 LEU C HD13 1  
ATOM 6701   H HD21 . LEU C 1 128 ? -5.628  -4.787  -13.399 1.00 1.11  ? 128 LEU C HD21 1  
ATOM 6702   H HD22 . LEU C 1 128 ? -7.121  -4.338  -14.228 1.00 12.41 ? 128 LEU C HD22 1  
ATOM 6703   H HD23 . LEU C 1 128 ? -6.211  -5.756  -14.751 1.00 1.24  ? 128 LEU C HD23 1  
ATOM 6704   N N    . ALA C 1 129 ? -10.941 -4.645  -12.583 1.00 13.34 ? 129 ALA C N    1  
ATOM 6705   C CA   . ALA C 1 129 ? -12.369 -4.995  -12.504 1.00 25.42 ? 129 ALA C CA   1  
ATOM 6706   C C    . ALA C 1 129 ? -12.582 -6.368  -11.818 1.00 44.02 ? 129 ALA C C    1  
ATOM 6707   O O    . ALA C 1 129 ? -11.693 -7.227  -11.883 1.00 62.13 ? 129 ALA C O    1  
ATOM 6708   C CB   . ALA C 1 129 ? -12.962 -4.991  -13.926 1.00 34.31 ? 129 ALA C CB   1  
ATOM 6709   H H    . ALA C 1 129 ? -10.534 -4.593  -13.471 1.00 51.32 ? 129 ALA C H    1  
ATOM 6710   H HA   . ALA C 1 129 ? -12.871 -4.225  -11.924 1.00 74.24 ? 129 ALA C HA   1  
ATOM 6711   H HB1  . ALA C 1 129 ? -12.476 -5.748  -14.528 1.00 1.33  ? 129 ALA C HB1  1  
ATOM 6712   H HB2  . ALA C 1 129 ? -12.807 -4.022  -14.382 1.00 74.42 ? 129 ALA C HB2  1  
ATOM 6713   H HB3  . ALA C 1 129 ? -14.024 -5.197  -13.884 1.00 62.15 ? 129 ALA C HB3  1  
ATOM 6714   N N    . PRO C 1 130 ? -13.761 -6.597  -11.140 1.00 4.53  ? 130 PRO C N    1  
ATOM 6715   C CA   . PRO C 1 130 ? -14.071 -7.894  -10.502 1.00 11.11 ? 130 PRO C CA   1  
ATOM 6716   C C    . PRO C 1 130 ? -14.244 -9.012  -11.556 1.00 4.25  ? 130 PRO C C    1  
ATOM 6717   O O    . PRO C 1 130 ? -15.305 -9.123  -12.190 1.00 35.51 ? 130 PRO C O    1  
ATOM 6718   C CB   . PRO C 1 130 ? -15.397 -7.627  -9.714  1.00 32.54 ? 130 PRO C CB   1  
ATOM 6719   C CG   . PRO C 1 130 ? -15.565 -6.135  -9.703  1.00 23.02 ? 130 PRO C CG   1  
ATOM 6720   C CD   . PRO C 1 130 ? -14.872 -5.626  -10.944 1.00 15.22 ? 130 PRO C CD   1  
ATOM 6721   H HA   . PRO C 1 130 ? -13.285 -8.178  -9.804  1.00 24.32 ? 130 PRO C HA   1  
ATOM 6722   H HB2  . PRO C 1 130 ? -16.243 -8.106  -10.212 1.00 13.42 ? 130 PRO C HB2  1  
ATOM 6723   H HB3  . PRO C 1 130 ? -15.314 -8.002  -8.703  1.00 62.32 ? 130 PRO C HB3  1  
ATOM 6724   H HG2  . PRO C 1 130 ? -16.622 -5.877  -9.722  1.00 5.54  ? 130 PRO C HG2  1  
ATOM 6725   H HG3  . PRO C 1 130 ? -15.098 -5.710  -8.818  1.00 5.10  ? 130 PRO C HG3  1  
ATOM 6726   H HD2  . PRO C 1 130 ? -15.547 -5.634  -11.798 1.00 53.51 ? 130 PRO C HD2  1  
ATOM 6727   H HD3  . PRO C 1 130 ? -14.490 -4.626  -10.785 1.00 32.25 ? 130 PRO C HD3  1  
ATOM 6728   N N    . VAL C 1 131 ? -13.180 -9.807  -11.765 1.00 54.31 ? 131 VAL C N    1  
ATOM 6729   C CA   . VAL C 1 131 ? -13.210 -10.951 -12.689 1.00 54.20 ? 131 VAL C CA   1  
ATOM 6730   C C    . VAL C 1 131 ? -13.459 -12.222 -11.860 1.00 53.24 ? 131 VAL C C    1  
ATOM 6731   O O    . VAL C 1 131 ? -12.586 -12.663 -11.101 1.00 53.20 ? 131 VAL C O    1  
ATOM 6732   C CB   . VAL C 1 131 ? -11.864 -11.075 -13.512 1.00 31.13 ? 131 VAL C CB   1  
ATOM 6733   C CG1  . VAL C 1 131 ? -11.899 -12.278 -14.496 1.00 52.31 ? 131 VAL C CG1  1  
ATOM 6734   C CG2  . VAL C 1 131 ? -11.543 -9.747  -14.254 1.00 22.40 ? 131 VAL C CG2  1  
ATOM 6735   H H    . VAL C 1 131 ? -12.348 -9.614  -11.282 1.00 74.31 ? 131 VAL C H    1  
ATOM 6736   H HA   . VAL C 1 131 ? -14.033 -10.813 -13.394 1.00 0.41  ? 131 VAL C HA   1  
ATOM 6737   H HB   . VAL C 1 131 ? -11.056 -11.257 -12.805 1.00 71.35 ? 131 VAL C HB   1  
ATOM 6738   H HG11 . VAL C 1 131 ? -12.707 -12.153 -15.207 1.00 33.12 ? 131 VAL C HG11 1  
ATOM 6739   H HG12 . VAL C 1 131 ? -12.051 -13.195 -13.943 1.00 62.34 ? 131 VAL C HG12 1  
ATOM 6740   H HG13 . VAL C 1 131 ? -10.959 -12.344 -15.033 1.00 52.14 ? 131 VAL C HG13 1  
ATOM 6741   H HG21 . VAL C 1 131 ? -10.602 -9.837  -14.782 1.00 54.30 ? 131 VAL C HG21 1  
ATOM 6742   H HG22 . VAL C 1 131 ? -11.469 -8.940  -13.537 1.00 72.20 ? 131 VAL C HG22 1  
ATOM 6743   H HG23 . VAL C 1 131 ? -12.331 -9.519  -14.962 1.00 13.32 ? 131 VAL C HG23 1  
ATOM 6744   N N    . ASN C 1 132 ? -14.673 -12.783 -12.003 1.00 43.10 ? 132 ASN C N    1  
ATOM 6745   C CA   . ASN C 1 132 ? -15.108 -13.983 -11.271 1.00 61.14 ? 132 ASN C CA   1  
ATOM 6746   C C    . ASN C 1 132 ? -14.855 -15.219 -12.152 1.00 33.23 ? 132 ASN C C    1  
ATOM 6747   O O    . ASN C 1 132 ? -15.624 -15.507 -13.084 1.00 0.32  ? 132 ASN C O    1  
ATOM 6748   C CB   . ASN C 1 132 ? -16.616 -13.858 -10.876 1.00 40.21 ? 132 ASN C CB   1  
ATOM 6749   C CG   . ASN C 1 132 ? -17.118 -14.937 -9.891  1.00 52.22 ? 132 ASN C CG   1  
ATOM 6750   O OD1  . ASN C 1 132 ? -16.570 -16.026 -9.798  1.00 73.41 ? 132 ASN C OD1  1  
ATOM 6751   N ND2  . ASN C 1 132 ? -18.200 -14.651 -9.180  1.00 61.34 ? 132 ASN C ND2  1  
ATOM 6752   H H    . ASN C 1 132 ? -15.303 -12.369 -12.629 1.00 72.33 ? 132 ASN C H    1  
ATOM 6753   H HA   . ASN C 1 132 ? -14.510 -14.065 -10.361 1.00 74.20 ? 132 ASN C HA   1  
ATOM 6754   H HB2  . ASN C 1 132 ? -16.772 -12.889 -10.416 1.00 34.01 ? 132 ASN C HB2  1  
ATOM 6755   H HB3  . ASN C 1 132 ? -17.220 -13.913 -11.772 1.00 73.24 ? 132 ASN C HB3  1  
ATOM 6756   H HD21 . ASN C 1 132 ? -18.626 -13.780 -9.309  1.00 11.53 ? 132 ASN C HD21 1  
ATOM 6757   H HD22 . ASN C 1 132 ? -18.530 -15.330 -8.556  1.00 72.31 ? 132 ASN C HD22 1  
ATOM 6758   N N    . PHE C 1 133 ? -13.737 -15.903 -11.875 1.00 71.12 ? 133 PHE C N    1  
ATOM 6759   C CA   . PHE C 1 133 ? -13.354 -17.158 -12.555 1.00 31.43 ? 133 PHE C CA   1  
ATOM 6760   C C    . PHE C 1 133 ? -14.320 -18.289 -12.154 1.00 12.31 ? 133 PHE C C    1  
ATOM 6761   O O    . PHE C 1 133 ? -14.721 -19.109 -12.989 1.00 44.50 ? 133 PHE C O    1  
ATOM 6762   C CB   . PHE C 1 133 ? -11.888 -17.531 -12.191 1.00 31.24 ? 133 PHE C CB   1  
ATOM 6763   C CG   . PHE C 1 133 ? -10.854 -16.428 -12.506 1.00 51.01 ? 133 PHE C CG   1  
ATOM 6764   C CD1  . PHE C 1 133 ? -10.295 -16.303 -13.779 1.00 51.23 ? 133 PHE C CD1  1  
ATOM 6765   C CD2  . PHE C 1 133 ? -10.449 -15.514 -11.528 1.00 35.11 ? 133 PHE C CD2  1  
ATOM 6766   C CE1  . PHE C 1 133 ? -9.367  -15.313 -14.060 1.00 51.23 ? 133 PHE C CE1  1  
ATOM 6767   C CE2  . PHE C 1 133 ? -9.522  -14.524 -11.808 1.00 54.10 ? 133 PHE C CE2  1  
ATOM 6768   C CZ   . PHE C 1 133 ? -8.982  -14.423 -13.074 1.00 14.14 ? 133 PHE C CZ   1  
ATOM 6769   H H    . PHE C 1 133 ? -13.140 -15.547 -11.185 1.00 44.22 ? 133 PHE C H    1  
ATOM 6770   H HA   . PHE C 1 133 ? -13.427 -17.002 -13.629 1.00 5.02  ? 133 PHE C HA   1  
ATOM 6771   H HB2  . PHE C 1 133 ? -11.829 -17.752 -11.129 1.00 3.22  ? 133 PHE C HB2  1  
ATOM 6772   H HB3  . PHE C 1 133 ? -11.605 -18.422 -12.743 1.00 72.45 ? 133 PHE C HB3  1  
ATOM 6773   H HD1  . PHE C 1 133 ? -10.589 -16.994 -14.557 1.00 31.40 ? 133 PHE C HD1  1  
ATOM 6774   H HD2  . PHE C 1 133 ? -10.869 -15.585 -10.534 1.00 41.22 ? 133 PHE C HD2  1  
ATOM 6775   H HE1  . PHE C 1 133 ? -8.945  -15.233 -15.055 1.00 22.02 ? 133 PHE C HE1  1  
ATOM 6776   H HE2  . PHE C 1 133 ? -9.222  -13.829 -11.035 1.00 63.04 ? 133 PHE C HE2  1  
ATOM 6777   H HZ   . PHE C 1 133 ? -8.259  -13.648 -13.296 1.00 72.11 ? 133 PHE C HZ   1  
ATOM 6778   N N    . ASP C 1 134 ? -14.729 -18.256 -10.871 1.00 33.43 ? 134 ASP C N    1  
ATOM 6779   C CA   . ASP C 1 134 ? -15.577 -19.286 -10.237 1.00 75.44 ? 134 ASP C CA   1  
ATOM 6780   C C    . ASP C 1 134 ? -16.974 -19.365 -10.876 1.00 73.55 ? 134 ASP C C    1  
ATOM 6781   O O    . ASP C 1 134 ? -17.594 -20.430 -10.877 1.00 73.01 ? 134 ASP C O    1  
ATOM 6782   C CB   . ASP C 1 134 ? -15.672 -18.997 -8.713  1.00 55.53 ? 134 ASP C CB   1  
ATOM 6783   C CG   . ASP C 1 134 ? -16.495 -20.040 -7.938  1.00 13.12 ? 134 ASP C CG   1  
ATOM 6784   O OD1  . ASP C 1 134 ? -17.662 -19.758 -7.579  1.00 10.34 ? 134 ASP C OD1  1  
ATOM 6785   O OD2  . ASP C 1 134 ? -15.983 -21.158 -7.713  1.00 31.52 ? 134 ASP C OD2  1  
ATOM 6786   H H    . ASP C 1 134 ? -14.457 -17.492 -10.322 1.00 35.33 ? 134 ASP C H    1  
ATOM 6787   H HA   . ASP C 1 134 ? -15.084 -20.243 -10.375 1.00 55.31 ? 134 ASP C HA   1  
ATOM 6788   H HB2  . ASP C 1 134 ? -14.667 -18.983 -8.300  1.00 34.44 ? 134 ASP C HB2  1  
ATOM 6789   H HB3  . ASP C 1 134 ? -16.115 -18.013 -8.569  1.00 41.12 ? 134 ASP C HB3  1  
ATOM 6790   N N    . ALA C 1 135 ? -17.439 -18.232 -11.428 1.00 44.32 ? 135 ALA C N    1  
ATOM 6791   C CA   . ALA C 1 135 ? -18.749 -18.123 -12.097 1.00 1.25  ? 135 ALA C CA   1  
ATOM 6792   C C    . ALA C 1 135 ? -18.855 -19.085 -13.291 1.00 20.24 ? 135 ALA C C    1  
ATOM 6793   O O    . ALA C 1 135 ? -19.891 -19.722 -13.492 1.00 0.11  ? 135 ALA C O    1  
ATOM 6794   C CB   . ALA C 1 135 ? -18.984 -16.678 -12.551 1.00 14.43 ? 135 ALA C CB   1  
ATOM 6795   H H    . ALA C 1 135 ? -16.879 -17.434 -11.375 1.00 70.05 ? 135 ALA C H    1  
ATOM 6796   H HA   . ALA C 1 135 ? -19.516 -18.372 -11.370 1.00 12.12 ? 135 ALA C HA   1  
ATOM 6797   H HB1  . ALA C 1 135 ? -18.899 -16.016 -11.703 1.00 11.11 ? 135 ALA C HB1  1  
ATOM 6798   H HB2  . ALA C 1 135 ? -19.974 -16.580 -12.978 1.00 51.14 ? 135 ALA C HB2  1  
ATOM 6799   H HB3  . ALA C 1 135 ? -18.244 -16.402 -13.291 1.00 74.02 ? 135 ALA C HB3  1  
ATOM 6800   N N    . LEU C 1 136 ? -17.759 -19.182 -14.068 1.00 43.44 ? 136 LEU C N    1  
ATOM 6801   C CA   . LEU C 1 136 ? -17.675 -20.081 -15.243 1.00 23.21 ? 136 LEU C CA   1  
ATOM 6802   C C    . LEU C 1 136 ? -17.808 -21.559 -14.806 1.00 73.33 ? 136 LEU C C    1  
ATOM 6803   O O    . LEU C 1 136 ? -18.575 -22.336 -15.401 1.00 11.14 ? 136 LEU C O    1  
ATOM 6804   C CB   . LEU C 1 136 ? -16.339 -19.855 -16.007 1.00 33.45 ? 136 LEU C CB   1  
ATOM 6805   C CG   . LEU C 1 136 ? -16.130 -20.726 -17.296 1.00 1.34  ? 136 LEU C CG   1  
ATOM 6806   C CD1  . LEU C 1 136 ? -17.218 -20.447 -18.369 1.00 22.33 ? 136 LEU C CD1  1  
ATOM 6807   C CD2  . LEU C 1 136 ? -14.698 -20.550 -17.866 1.00 75.35 ? 136 LEU C CD2  1  
ATOM 6808   H H    . LEU C 1 136 ? -16.981 -18.627 -13.841 1.00 41.50 ? 136 LEU C H    1  
ATOM 6809   H HA   . LEU C 1 136 ? -18.502 -19.837 -15.907 1.00 13.41 ? 136 LEU C HA   1  
ATOM 6810   H HB2  . LEU C 1 136 ? -16.282 -18.804 -16.289 1.00 50.14 ? 136 LEU C HB2  1  
ATOM 6811   H HB3  . LEU C 1 136 ? -15.520 -20.060 -15.322 1.00 44.53 ? 136 LEU C HB3  1  
ATOM 6812   H HG   . LEU C 1 136 ? -16.235 -21.768 -17.017 1.00 21.31 ? 136 LEU C HG   1  
ATOM 6813   H HD11 . LEU C 1 136 ? -17.195 -19.405 -18.664 1.00 44.14 ? 136 LEU C HD11 1  
ATOM 6814   H HD12 . LEU C 1 136 ? -18.194 -20.680 -17.964 1.00 63.20 ? 136 LEU C HD12 1  
ATOM 6815   H HD13 . LEU C 1 136 ? -17.043 -21.069 -19.237 1.00 74.21 ? 136 LEU C HD13 1  
ATOM 6816   H HD21 . LEU C 1 136 ? -14.533 -19.517 -18.146 1.00 24.03 ? 136 LEU C HD21 1  
ATOM 6817   H HD22 . LEU C 1 136 ? -14.570 -21.181 -18.735 1.00 31.13 ? 136 LEU C HD22 1  
ATOM 6818   H HD23 . LEU C 1 136 ? -13.974 -20.837 -17.115 1.00 31.24 ? 136 LEU C HD23 1  
ATOM 6819   N N    . PHE C 1 137 ? -17.063 -21.914 -13.746 1.00 42.05 ? 137 PHE C N    1  
ATOM 6820   C CA   . PHE C 1 137 ? -17.091 -23.265 -13.138 1.00 70.34 ? 137 PHE C CA   1  
ATOM 6821   C C    . PHE C 1 137 ? -18.479 -23.572 -12.522 1.00 63.23 ? 137 PHE C C    1  
ATOM 6822   O O    . PHE C 1 137 ? -18.912 -24.728 -12.494 1.00 0.32  ? 137 PHE C O    1  
ATOM 6823   C CB   . PHE C 1 137 ? -15.994 -23.379 -12.051 1.00 41.53 ? 137 PHE C CB   1  
ATOM 6824   C CG   . PHE C 1 137 ? -14.548 -23.335 -12.567 1.00 24.33 ? 137 PHE C CG   1  
ATOM 6825   C CD1  . PHE C 1 137 ? -13.957 -22.132 -12.957 1.00 23.14 ? 137 PHE C CD1  1  
ATOM 6826   C CD2  . PHE C 1 137 ? -13.780 -24.499 -12.658 1.00 64.14 ? 137 PHE C CD2  1  
ATOM 6827   C CE1  . PHE C 1 137 ? -12.650 -22.090 -13.412 1.00 43.52 ? 137 PHE C CE1  1  
ATOM 6828   C CE2  . PHE C 1 137 ? -12.472 -24.457 -13.115 1.00 41.45 ? 137 PHE C CE2  1  
ATOM 6829   C CZ   . PHE C 1 137 ? -11.908 -23.254 -13.495 1.00 74.42 ? 137 PHE C CZ   1  
ATOM 6830   H H    . PHE C 1 137 ? -16.470 -21.237 -13.350 1.00 41.44 ? 137 PHE C H    1  
ATOM 6831   H HA   . PHE C 1 137 ? -16.890 -23.990 -13.922 1.00 42.52 ? 137 PHE C HA   1  
ATOM 6832   H HB2  . PHE C 1 137 ? -16.115 -22.565 -11.342 1.00 31.20 ? 137 PHE C HB2  1  
ATOM 6833   H HB3  . PHE C 1 137 ? -16.127 -24.316 -11.514 1.00 23.44 ? 137 PHE C HB3  1  
ATOM 6834   H HD1  . PHE C 1 137 ? -14.531 -21.217 -12.896 1.00 41.33 ? 137 PHE C HD1  1  
ATOM 6835   H HD2  . PHE C 1 137 ? -14.214 -25.446 -12.364 1.00 11.44 ? 137 PHE C HD2  1  
ATOM 6836   H HE1  . PHE C 1 137 ? -12.210 -21.147 -13.710 1.00 52.31 ? 137 PHE C HE1  1  
ATOM 6837   H HE2  . PHE C 1 137 ? -11.893 -25.370 -13.177 1.00 22.34 ? 137 PHE C HE2  1  
ATOM 6838   H HZ   . PHE C 1 137 ? -10.887 -23.223 -13.852 1.00 64.42 ? 137 PHE C HZ   1  
ATOM 6839   N N    . MET C 1 138 ? -19.151 -22.511 -12.030 1.00 33.15 ? 138 MET C N    1  
ATOM 6840   C CA   . MET C 1 138 ? -20.482 -22.601 -11.389 1.00 4.03  ? 138 MET C CA   1  
ATOM 6841   C C    . MET C 1 138 ? -21.556 -23.012 -12.413 1.00 52.54 ? 138 MET C C    1  
ATOM 6842   O O    . MET C 1 138 ? -22.473 -23.773 -12.090 1.00 40.35 ? 138 MET C O    1  
ATOM 6843   C CB   . MET C 1 138 ? -20.862 -21.240 -10.735 1.00 52.14 ? 138 MET C CB   1  
ATOM 6844   C CG   . MET C 1 138 ? -22.167 -21.246 -9.918  1.00 24.11 ? 138 MET C CG   1  
ATOM 6845   S SD   . MET C 1 138 ? -22.595 -19.613 -9.261  1.00 31.14 ? 138 MET C SD   1  
ATOM 6846   C CE   . MET C 1 138 ? -21.161 -19.234 -8.245  1.00 53.30 ? 138 MET C CE   1  
ATOM 6847   H H    . MET C 1 138 ? -18.731 -21.629 -12.101 1.00 53.11 ? 138 MET C H    1  
ATOM 6848   H HA   . MET C 1 138 ? -20.424 -23.360 -10.613 1.00 53.15 ? 138 MET C HA   1  
ATOM 6849   H HB2  . MET C 1 138 ? -20.059 -20.936 -10.075 1.00 52.11 ? 138 MET C HB2  1  
ATOM 6850   H HB3  . MET C 1 138 ? -20.958 -20.488 -11.514 1.00 2.31  ? 138 MET C HB3  1  
ATOM 6851   H HG2  . MET C 1 138 ? -22.979 -21.579 -10.554 1.00 13.24 ? 138 MET C HG2  1  
ATOM 6852   H HG3  . MET C 1 138 ? -22.064 -21.935 -9.089  1.00 42.44 ? 138 MET C HG3  1  
ATOM 6853   H HE1  . MET C 1 138 ? -20.271 -19.228 -8.859  1.00 41.54 ? 138 MET C HE1  1  
ATOM 6854   H HE2  . MET C 1 138 ? -21.060 -19.981 -7.471  1.00 41.34 ? 138 MET C HE2  1  
ATOM 6855   H HE3  . MET C 1 138 ? -21.290 -18.263 -7.791  1.00 43.31 ? 138 MET C HE3  1  
ATOM 6856   N N    . ASN C 1 139 ? -21.436 -22.480 -13.646 1.00 72.21 ? 139 ASN C N    1  
ATOM 6857   C CA   . ASN C 1 139 ? -22.334 -22.846 -14.766 1.00 61.40 ? 139 ASN C CA   1  
ATOM 6858   C C    . ASN C 1 139 ? -22.095 -24.294 -15.210 1.00 51.35 ? 139 ASN C C    1  
ATOM 6859   O O    . ASN C 1 139 ? -23.048 -24.996 -15.564 1.00 61.25 ? 139 ASN C O    1  
ATOM 6860   C CB   . ASN C 1 139 ? -22.163 -21.887 -15.980 1.00 23.25 ? 139 ASN C CB   1  
ATOM 6861   C CG   . ASN C 1 139 ? -22.763 -20.500 -15.738 1.00 45.12 ? 139 ASN C CG   1  
ATOM 6862   O OD1  . ASN C 1 139 ? -23.950 -20.276 -15.977 1.00 62.43 ? 139 ASN C OD1  1  
ATOM 6863   N ND2  . ASN C 1 139 ? -21.949 -19.553 -15.305 1.00 2.12  ? 139 ASN C ND2  1  
ATOM 6864   H H    . ASN C 1 139 ? -20.725 -21.823 -13.807 1.00 54.20 ? 139 ASN C H    1  
ATOM 6865   H HA   . ASN C 1 139 ? -23.359 -22.771 -14.401 1.00 15.14 ? 139 ASN C HA   1  
ATOM 6866   H HB2  . ASN C 1 139 ? -21.107 -21.776 -16.201 1.00 60.50 ? 139 ASN C HB2  1  
ATOM 6867   H HB3  . ASN C 1 139 ? -22.652 -22.316 -16.850 1.00 21.14 ? 139 ASN C HB3  1  
ATOM 6868   H HD21 . ASN C 1 139 ? -21.009 -19.782 -15.172 1.00 41.31 ? 139 ASN C HD21 1  
ATOM 6869   H HD22 . ASN C 1 139 ? -22.323 -18.667 -15.117 1.00 3.31  ? 139 ASN C HD22 1  
ATOM 6870   N N    . TYR C 1 140 ? -20.816 -24.713 -15.225 1.00 62.24 ? 140 TYR C N    1  
ATOM 6871   C CA   . TYR C 1 140 ? -20.429 -26.083 -15.595 1.00 1.21  ? 140 TYR C CA   1  
ATOM 6872   C C    . TYR C 1 140 ? -20.850 -27.095 -14.489 1.00 5.54  ? 140 TYR C C    1  
ATOM 6873   O O    . TYR C 1 140 ? -21.971 -27.624 -14.518 1.00 31.43 ? 140 TYR C O    1  
ATOM 6874   C CB   . TYR C 1 140 ? -18.902 -26.161 -15.921 1.00 51.54 ? 140 TYR C CB   1  
ATOM 6875   C CG   . TYR C 1 140 ? -18.445 -27.561 -16.382 1.00 52.14 ? 140 TYR C CG   1  
ATOM 6876   C CD1  . TYR C 1 140 ? -18.807 -28.054 -17.639 1.00 34.42 ? 140 TYR C CD1  1  
ATOM 6877   C CD2  . TYR C 1 140 ? -17.700 -28.404 -15.545 1.00 3.00  ? 140 TYR C CD2  1  
ATOM 6878   C CE1  . TYR C 1 140 ? -18.449 -29.324 -18.041 1.00 51.15 ? 140 TYR C CE1  1  
ATOM 6879   C CE2  . TYR C 1 140 ? -17.337 -29.673 -15.952 1.00 73.13 ? 140 TYR C CE2  1  
ATOM 6880   C CZ   . TYR C 1 140 ? -17.716 -30.127 -17.197 1.00 4.32  ? 140 TYR C CZ   1  
ATOM 6881   O OH   . TYR C 1 140 ? -17.368 -31.395 -17.593 1.00 41.41 ? 140 TYR C OH   1  
ATOM 6882   H H    . TYR C 1 140 ? -20.114 -24.078 -14.978 1.00 65.31 ? 140 TYR C H    1  
ATOM 6883   H HA   . TYR C 1 140 ? -20.981 -26.335 -16.501 1.00 61.31 ? 140 TYR C HA   1  
ATOM 6884   H HB2  . TYR C 1 140 ? -18.670 -25.450 -16.709 1.00 52.22 ? 140 TYR C HB2  1  
ATOM 6885   H HB3  . TYR C 1 140 ? -18.338 -25.889 -15.034 1.00 54.31 ? 140 TYR C HB3  1  
ATOM 6886   H HD1  . TYR C 1 140 ? -19.383 -27.421 -18.312 1.00 73.13 ? 140 TYR C HD1  1  
ATOM 6887   H HD2  . TYR C 1 140 ? -17.405 -28.046 -14.566 1.00 61.25 ? 140 TYR C HD2  1  
ATOM 6888   H HE1  . TYR C 1 140 ? -18.741 -29.679 -19.016 1.00 23.05 ? 140 TYR C HE1  1  
ATOM 6889   H HE2  . TYR C 1 140 ? -16.762 -30.306 -15.291 1.00 52.55 ? 140 TYR C HE2  1  
ATOM 6890   H HH   . TYR C 1 140 ? -17.563 -32.015 -16.883 1.00 30.50 ? 140 TYR C HH   1  
ATOM 6891   N N    . LEU C 1 141 ? -19.968 -27.306 -13.500 1.00 71.33 ? 141 LEU C N    1  
ATOM 6892   C CA   . LEU C 1 141 ? -20.114 -28.363 -12.472 1.00 31.34 ? 141 LEU C CA   1  
ATOM 6893   C C    . LEU C 1 141 ? -18.937 -28.252 -11.477 1.00 72.02 ? 141 LEU C C    1  
ATOM 6894   O O    . LEU C 1 141 ? -18.061 -27.391 -11.649 1.00 62.33 ? 141 LEU C O    1  
ATOM 6895   C CB   . LEU C 1 141 ? -20.184 -29.787 -13.139 1.00 31.44 ? 141 LEU C CB   1  
ATOM 6896   C CG   . LEU C 1 141 ? -20.785 -30.943 -12.274 1.00 71.10 ? 141 LEU C CG   1  
ATOM 6897   C CD1  . LEU C 1 141 ? -22.235 -30.622 -11.830 1.00 74.23 ? 141 LEU C CD1  1  
ATOM 6898   C CD2  . LEU C 1 141 ? -20.693 -32.299 -13.020 1.00 63.41 ? 141 LEU C CD2  1  
ATOM 6899   H H    . LEU C 1 141 ? -19.191 -26.712 -13.437 1.00 35.22 ? 141 LEU C H    1  
ATOM 6900   H HA   . LEU C 1 141 ? -21.034 -28.175 -11.929 1.00 13.43 ? 141 LEU C HA   1  
ATOM 6901   H HB2  . LEU C 1 141 ? -20.779 -29.702 -14.042 1.00 54.04 ? 141 LEU C HB2  1  
ATOM 6902   H HB3  . LEU C 1 141 ? -19.178 -30.074 -13.436 1.00 42.41 ? 141 LEU C HB3  1  
ATOM 6903   H HG   . LEU C 1 141 ? -20.197 -31.033 -11.369 1.00 55.34 ? 141 LEU C HG   1  
ATOM 6904   H HD11 . LEU C 1 141 ? -22.622 -31.433 -11.229 1.00 14.44 ? 141 LEU C HD11 1  
ATOM 6905   H HD12 . LEU C 1 141 ? -22.872 -30.486 -12.696 1.00 51.00 ? 141 LEU C HD12 1  
ATOM 6906   H HD13 . LEU C 1 141 ? -22.242 -29.713 -11.239 1.00 71.13 ? 141 LEU C HD13 1  
ATOM 6907   H HD21 . LEU C 1 141 ? -21.084 -33.088 -12.392 1.00 65.32 ? 141 LEU C HD21 1  
ATOM 6908   H HD22 . LEU C 1 141 ? -19.659 -32.514 -13.252 1.00 31.30 ? 141 LEU C HD22 1  
ATOM 6909   H HD23 . LEU C 1 141 ? -21.264 -32.258 -13.940 1.00 64.14 ? 141 LEU C HD23 1  
ATOM 6910   N N    . GLN C 1 142 ? -18.961 -29.103 -10.418 1.00 71.12 ? 142 GLN C N    1  
ATOM 6911   C CA   . GLN C 1 142 ? -17.925 -29.183 -9.353  1.00 40.53 ? 142 GLN C CA   1  
ATOM 6912   C C    . GLN C 1 142 ? -18.036 -27.995 -8.373  1.00 30.12 ? 142 GLN C C    1  
ATOM 6913   O O    . GLN C 1 142 ? -17.190 -27.820 -7.495  1.00 13.10 ? 142 GLN C O    1  
ATOM 6914   C CB   . GLN C 1 142 ? -16.477 -29.327 -9.938  1.00 62.24 ? 142 GLN C CB   1  
ATOM 6915   C CG   . GLN C 1 142 ? -16.282 -30.492 -10.941 1.00 52.45 ? 142 GLN C CG   1  
ATOM 6916   C CD   . GLN C 1 142 ? -16.664 -31.867 -10.377 1.00 4.11  ? 142 GLN C CD   1  
ATOM 6917   O OE1  . GLN C 1 142 ? -15.842 -32.554 -9.779  1.00 4.44  ? 142 GLN C OE1  1  
ATOM 6918   N NE2  . GLN C 1 142 ? -17.906 -32.278 -10.579 1.00 24.31 ? 142 GLN C NE2  1  
ATOM 6919   H H    . GLN C 1 142 ? -19.735 -29.691 -10.333 1.00 51.42 ? 142 GLN C H    1  
ATOM 6920   H HA   . GLN C 1 142 ? -18.151 -30.078 -8.789  1.00 31.44 ? 142 GLN C HA   1  
ATOM 6921   H HB2  . GLN C 1 142 ? -16.221 -28.404 -10.445 1.00 54.11 ? 142 GLN C HB2  1  
ATOM 6922   H HB3  . GLN C 1 142 ? -15.781 -29.467 -9.119  1.00 2.42  ? 142 GLN C HB3  1  
ATOM 6923   H HG2  . GLN C 1 142 ? -16.890 -30.297 -11.817 1.00 3.53  ? 142 GLN C HG2  1  
ATOM 6924   H HG3  . GLN C 1 142 ? -15.240 -30.521 -11.242 1.00 24.23 ? 142 GLN C HG3  1  
ATOM 6925   H HE21 . GLN C 1 142 ? -18.515 -31.692 -11.073 1.00 63.03 ? 142 GLN C HE21 1  
ATOM 6926   H HE22 . GLN C 1 142 ? -18.160 -33.151 -10.230 1.00 23.44 ? 142 GLN C HE22 1  
ATOM 6927   N N    . GLN C 1 143 ? -19.125 -27.211 -8.519  1.00 25.34 ? 143 GLN C N    1  
ATOM 6928   C CA   . GLN C 1 143 ? -19.468 -26.081 -7.629  1.00 10.12 ? 143 GLN C CA   1  
ATOM 6929   C C    . GLN C 1 143 ? -19.993 -26.583 -6.265  1.00 5.52  ? 143 GLN C C    1  
ATOM 6930   O O    . GLN C 1 143 ? -20.063 -25.819 -5.295  1.00 24.01 ? 143 GLN C O    1  
ATOM 6931   C CB   . GLN C 1 143 ? -20.530 -25.153 -8.299  1.00 24.52 ? 143 GLN C CB   1  
ATOM 6932   C CG   . GLN C 1 143 ? -21.951 -25.747 -8.482  1.00 60.13 ? 143 GLN C CG   1  
ATOM 6933   C CD   . GLN C 1 143 ? -22.049 -26.825 -9.570  1.00 61.24 ? 143 GLN C CD   1  
ATOM 6934   O OE1  . GLN C 1 143 ? -21.847 -28.011 -9.312  1.00 3.03  ? 143 GLN C OE1  1  
ATOM 6935   N NE2  . GLN C 1 143 ? -22.338 -26.414 -10.792 1.00 31.03 ? 143 GLN C NE2  1  
ATOM 6936   H H    . GLN C 1 143 ? -19.726 -27.403 -9.261  1.00 22.04 ? 143 GLN C H    1  
ATOM 6937   H HA   . GLN C 1 143 ? -18.562 -25.507 -7.460  1.00 14.35 ? 143 GLN C HA   1  
ATOM 6938   H HB2  . GLN C 1 143 ? -20.623 -24.252 -7.701  1.00 61.33 ? 143 GLN C HB2  1  
ATOM 6939   H HB3  . GLN C 1 143 ? -20.160 -24.866 -9.275  1.00 12.44 ? 143 GLN C HB3  1  
ATOM 6940   H HG2  . GLN C 1 143 ? -22.268 -26.182 -7.542  1.00 41.11 ? 143 GLN C HG2  1  
ATOM 6941   H HG3  . GLN C 1 143 ? -22.627 -24.938 -8.735  1.00 24.32 ? 143 GLN C HG3  1  
ATOM 6942   H HE21 . GLN C 1 143 ? -22.472 -25.455 -10.939 1.00 52.14 ? 143 GLN C HE21 1  
ATOM 6943   H HE22 . GLN C 1 143 ? -22.415 -27.083 -11.501 1.00 43.43 ? 143 GLN C HE22 1  
ATOM 6944   N N    . GLN C 1 144 ? -20.362 -27.877 -6.230  1.00 41.35 ? 144 GLN C N    1  
ATOM 6945   C CA   . GLN C 1 144 ? -20.940 -28.544 -5.060  1.00 21.23 ? 144 GLN C CA   1  
ATOM 6946   C C    . GLN C 1 144 ? -19.924 -28.615 -3.899  1.00 12.43 ? 144 GLN C C    1  
ATOM 6947   O O    . GLN C 1 144 ? -18.884 -29.281 -4.012  1.00 72.00 ? 144 GLN C O    1  
ATOM 6948   C CB   . GLN C 1 144 ? -21.402 -29.973 -5.455  1.00 30.14 ? 144 GLN C CB   1  
ATOM 6949   C CG   . GLN C 1 144 ? -22.428 -30.022 -6.610  1.00 73.15 ? 144 GLN C CG   1  
ATOM 6950   C CD   . GLN C 1 144 ? -22.855 -31.444 -6.999  1.00 42.34 ? 144 GLN C CD   1  
ATOM 6951   O OE1  . GLN C 1 144 ? -22.087 -32.397 -6.868  1.00 5.23  ? 144 GLN C OE1  1  
ATOM 6952   N NE2  . GLN C 1 144 ? -24.070 -31.592 -7.502  1.00 23.52 ? 144 GLN C NE2  1  
ATOM 6953   H H    . GLN C 1 144 ? -20.233 -28.408 -7.039  1.00 24.13 ? 144 GLN C H    1  
ATOM 6954   H HA   . GLN C 1 144 ? -21.807 -27.970 -4.746  1.00 14.51 ? 144 GLN C HA   1  
ATOM 6955   H HB2  . GLN C 1 144 ? -20.530 -30.546 -5.757  1.00 45.52 ? 144 GLN C HB2  1  
ATOM 6956   H HB3  . GLN C 1 144 ? -21.844 -30.451 -4.588  1.00 30.33 ? 144 GLN C HB3  1  
ATOM 6957   H HG2  . GLN C 1 144 ? -23.307 -29.463 -6.313  1.00 52.34 ? 144 GLN C HG2  1  
ATOM 6958   H HG3  . GLN C 1 144 ? -21.989 -29.548 -7.480  1.00 52.03 ? 144 GLN C HG3  1  
ATOM 6959   H HE21 . GLN C 1 144 ? -24.633 -30.797 -7.598  1.00 33.51 ? 144 GLN C HE21 1  
ATOM 6960   H HE22 . GLN C 1 144 ? -24.355 -32.493 -7.759  1.00 50.22 ? 144 GLN C HE22 1  
ATOM 6961   N N    . ALA C 1 145 ? -20.254 -27.927 -2.796  1.00 71.53 ? 145 ALA C N    1  
ATOM 6962   C CA   . ALA C 1 145 ? -19.429 -27.887 -1.574  1.00 5.31  ? 145 ALA C CA   1  
ATOM 6963   C C    . ALA C 1 145 ? -20.327 -27.727 -0.330  1.00 12.12 ? 145 ALA C C    1  
ATOM 6964   O O    . ALA C 1 145 ? -21.567 -27.694 -0.435  1.00 42.32 ? 145 ALA C O    1  
ATOM 6965   C CB   . ALA C 1 145 ? -18.381 -26.759 -1.675  1.00 70.21 ? 145 ALA C CB   1  
ATOM 6966   H H    . ALA C 1 145 ? -21.097 -27.428 -2.798  1.00 73.05 ? 145 ALA C H    1  
ATOM 6967   H HA   . ALA C 1 145 ? -18.900 -28.834 -1.485  1.00 12.32 ? 145 ALA C HA   1  
ATOM 6968   H HB1  . ALA C 1 145 ? -17.762 -26.918 -2.549  1.00 42.10 ? 145 ALA C HB1  1  
ATOM 6969   H HB2  . ALA C 1 145 ? -17.754 -26.760 -0.793  1.00 15.35 ? 145 ALA C HB2  1  
ATOM 6970   H HB3  . ALA C 1 145 ? -18.878 -25.803 -1.760  1.00 30.32 ? 145 ALA C HB3  1  
ATOM 6971   N N    . GLY C 1 146 ? -19.682 -27.641 0.840   1.00 61.25 ? 146 GLY C N    1  
ATOM 6972   C CA   . GLY C 1 146 ? -20.362 -27.614 2.133   1.00 0.34  ? 146 GLY C CA   1  
ATOM 6973   C C    . GLY C 1 146 ? -19.497 -28.336 3.144   1.00 62.00 ? 146 GLY C C    1  
ATOM 6974   O O    . GLY C 1 146 ? -19.365 -29.556 3.061   1.00 52.42 ? 146 GLY C O    1  
ATOM 6975   H H    . GLY C 1 146 ? -18.698 -27.601 0.832   1.00 61.25 ? 146 GLY C H    1  
ATOM 6976   H HA2  . GLY C 1 146 ? -20.519 -26.582 2.434   1.00 71.13 ? 146 GLY C HA2  1  
ATOM 6977   H HA3  . GLY C 1 146 ? -21.322 -28.117 2.072   1.00 72.24 ? 146 GLY C HA3  1  
ATOM 6978   N N    . GLU C 1 147 ? -18.907 -27.580 4.082   1.00 14.13 ? 147 GLU C N    1  
ATOM 6979   C CA   . GLU C 1 147 ? -17.811 -28.059 4.949   1.00 25.43 ? 147 GLU C CA   1  
ATOM 6980   C C    . GLU C 1 147 ? -18.283 -29.148 5.946   1.00 43.41 ? 147 GLU C C    1  
ATOM 6981   O O    . GLU C 1 147 ? -19.446 -29.157 6.383   1.00 34.01 ? 147 GLU C O    1  
ATOM 6982   C CB   . GLU C 1 147 ? -17.156 -26.875 5.716   1.00 70.33 ? 147 GLU C CB   1  
ATOM 6983   C CG   . GLU C 1 147 ? -16.533 -25.749 4.847   1.00 31.14 ? 147 GLU C CG   1  
ATOM 6984   C CD   . GLU C 1 147 ? -17.583 -24.829 4.195   1.00 70.54 ? 147 GLU C CD   1  
ATOM 6985   O OE1  . GLU C 1 147 ? -18.135 -23.964 4.904   1.00 65.11 ? 147 GLU C OE1  1  
ATOM 6986   O OE2  . GLU C 1 147 ? -17.889 -24.994 2.993   1.00 24.42 ? 147 GLU C OE2  1  
ATOM 6987   H H    . GLU C 1 147 ? -19.224 -26.661 4.201   1.00 62.21 ? 147 GLU C H    1  
ATOM 6988   H HA   . GLU C 1 147 ? -17.059 -28.492 4.296   1.00 62.30 ? 147 GLU C HA   1  
ATOM 6989   H HB2  . GLU C 1 147 ? -17.909 -26.422 6.352   1.00 55.42 ? 147 GLU C HB2  1  
ATOM 6990   H HB3  . GLU C 1 147 ? -16.372 -27.275 6.358   1.00 30.24 ? 147 GLU C HB3  1  
ATOM 6991   H HG2  . GLU C 1 147 ? -15.891 -25.142 5.480   1.00 2.25  ? 147 GLU C HG2  1  
ATOM 6992   H HG3  . GLU C 1 147 ? -15.921 -26.199 4.072   1.00 35.00 ? 147 GLU C HG3  1  
ATOM 6993   N N    . GLY C 1 148 ? -17.351 -30.065 6.277   1.00 3.44  ? 148 GLY C N    1  
ATOM 6994   C CA   . GLY C 1 148 ? -17.597 -31.162 7.211   1.00 42.23 ? 148 GLY C CA   1  
ATOM 6995   C C    . GLY C 1 148 ? -16.300 -31.687 7.809   1.00 23.24 ? 148 GLY C C    1  
ATOM 6996   O O    . GLY C 1 148 ? -15.614 -30.954 8.528   1.00 62.34 ? 148 GLY C O    1  
ATOM 6997   H H    . GLY C 1 148 ? -16.468 -29.999 5.856   1.00 11.34 ? 148 GLY C H    1  
ATOM 6998   H HA2  . GLY C 1 148 ? -18.245 -30.824 8.017   1.00 41.32 ? 148 GLY C HA2  1  
ATOM 6999   H HA3  . GLY C 1 148 ? -18.092 -31.960 6.677   1.00 70.00 ? 148 GLY C HA3  1  
ATOM 7000   N N    . THR C 1 149 ? -15.949 -32.950 7.491   1.00 3.11  ? 149 THR C N    1  
ATOM 7001   C CA   . THR C 1 149 ? -14.789 -33.653 8.072   1.00 55.51 ? 149 THR C CA   1  
ATOM 7002   C C    . THR C 1 149 ? -14.051 -34.493 7.006   1.00 1.43  ? 149 THR C C    1  
ATOM 7003   O O    . THR C 1 149 ? -14.676 -35.269 6.287   1.00 71.32 ? 149 THR C O    1  
ATOM 7004   C CB   . THR C 1 149 ? -15.235 -34.612 9.236   1.00 63.12 ? 149 THR C CB   1  
ATOM 7005   O OG1  . THR C 1 149 ? -16.236 -35.540 8.773   1.00 15.21 ? 149 THR C OG1  1  
ATOM 7006   C CG2  . THR C 1 149 ? -15.779 -33.853 10.464  1.00 51.13 ? 149 THR C CG2  1  
ATOM 7007   H H    . THR C 1 149 ? -16.480 -33.421 6.819   1.00 24.12 ? 149 THR C H    1  
ATOM 7008   H HA   . THR C 1 149 ? -14.103 -32.913 8.475   1.00 60.13 ? 149 THR C HA   1  
ATOM 7009   H HB   . THR C 1 149 ? -14.369 -35.188 9.555   1.00 22.35 ? 149 THR C HB   1  
ATOM 7010   H HG1  . THR C 1 149 ? -16.373 -35.425 7.819   1.00 32.43 ? 149 THR C HG1  1  
ATOM 7011   H HG21 . THR C 1 149 ? -16.647 -33.269 10.183  1.00 71.04 ? 149 THR C HG21 1  
ATOM 7012   H HG22 . THR C 1 149 ? -15.016 -33.193 10.855  1.00 14.40 ? 149 THR C HG22 1  
ATOM 7013   H HG23 . THR C 1 149 ? -16.061 -34.562 11.232  1.00 61.03 ? 149 THR C HG23 1  
ATOM 7014   N N    . GLU C 1 150 ? -12.715 -34.350 6.941   1.00 2.35  ? 150 GLU C N    1  
ATOM 7015   C CA   . GLU C 1 150 ? -11.849 -35.195 6.088   1.00 64.13 ? 150 GLU C CA   1  
ATOM 7016   C C    . GLU C 1 150 ? -11.350 -36.425 6.881   1.00 43.20 ? 150 GLU C C    1  
ATOM 7017   O O    . GLU C 1 150 ? -11.458 -36.463 8.113   1.00 61.15 ? 150 GLU C O    1  
ATOM 7018   C CB   . GLU C 1 150 ? -10.664 -34.350 5.505   1.00 25.10 ? 150 GLU C CB   1  
ATOM 7019   C CG   . GLU C 1 150 ? -9.861  -33.469 6.507   1.00 3.15  ? 150 GLU C CG   1  
ATOM 7020   C CD   . GLU C 1 150 ? -9.068  -34.253 7.566   1.00 73.32 ? 150 GLU C CD   1  
ATOM 7021   O OE1  . GLU C 1 150 ? -9.241  -34.006 8.782   1.00 52.14 ? 150 GLU C OE1  1  
ATOM 7022   O OE2  . GLU C 1 150 ? -8.266  -35.138 7.183   1.00 25.11 ? 150 GLU C OE2  1  
ATOM 7023   H H    . GLU C 1 150 ? -12.293 -33.664 7.494   1.00 21.14 ? 150 GLU C H    1  
ATOM 7024   H HA   . GLU C 1 150 ? -12.451 -35.561 5.255   1.00 10.02 ? 150 GLU C HA   1  
ATOM 7025   H HB2  . GLU C 1 150 ? -9.963  -35.024 5.031   1.00 63.33 ? 150 GLU C HB2  1  
ATOM 7026   H HB3  . GLU C 1 150 ? -11.065 -33.692 4.739   1.00 54.55 ? 150 GLU C HB3  1  
ATOM 7027   H HG2  . GLU C 1 150 ? -9.155  -32.865 5.943   1.00 14.11 ? 150 GLU C HG2  1  
ATOM 7028   H HG3  . GLU C 1 150 ? -10.554 -32.800 7.002   1.00 11.12 ? 150 GLU C HG3  1  
ATOM 7029   N N    . GLU C 1 151 ? -10.779 -37.419 6.169   1.00 24.24 ? 151 GLU C N    1  
ATOM 7030   C CA   . GLU C 1 151 ? -10.255 -38.662 6.791   1.00 43.10 ? 151 GLU C CA   1  
ATOM 7031   C C    . GLU C 1 151 ? -8.726  -38.680 6.808   1.00 60.55 ? 151 GLU C C    1  
ATOM 7032   O O    . GLU C 1 151 ? -8.114  -38.528 7.873   1.00 4.24  ? 151 GLU C O    1  
ATOM 7033   C CB   . GLU C 1 151 ? -10.790 -39.914 6.039   1.00 62.41 ? 151 GLU C CB   1  
ATOM 7034   C CG   . GLU C 1 151 ? -12.314 -40.065 6.072   1.00 61.34 ? 151 GLU C CG   1  
ATOM 7035   C CD   . GLU C 1 151 ? -12.891 -40.243 7.489   1.00 54.55 ? 151 GLU C CD   1  
ATOM 7036   O OE1  . GLU C 1 151 ? -13.218 -39.235 8.154   1.00 43.00 ? 151 GLU C OE1  1  
ATOM 7037   O OE2  . GLU C 1 151 ? -13.026 -41.399 7.947   1.00 22.14 ? 151 GLU C OE2  1  
ATOM 7038   H H    . GLU C 1 151 ? -10.722 -37.323 5.197   1.00 53.12 ? 151 GLU C H    1  
ATOM 7039   H HA   . GLU C 1 151 ? -10.613 -38.710 7.821   1.00 14.32 ? 151 GLU C HA   1  
ATOM 7040   H HB2  . GLU C 1 151 ? -10.477 -39.859 5.000   1.00 64.30 ? 151 GLU C HB2  1  
ATOM 7041   H HB3  . GLU C 1 151 ? -10.356 -40.803 6.482   1.00 2.14  ? 151 GLU C HB3  1  
ATOM 7042   H HG2  . GLU C 1 151 ? -12.755 -39.176 5.631   1.00 71.24 ? 151 GLU C HG2  1  
ATOM 7043   H HG3  . GLU C 1 151 ? -12.596 -40.922 5.466   1.00 2.43  ? 151 GLU C HG3  1  
ATOM 7044   N N    . HIS C 1 152 ? -8.127  -38.843 5.602   1.00 25.32 ? 152 HIS C N    1  
ATOM 7045   C CA   . HIS C 1 152 ? -6.701  -39.171 5.433   1.00 60.02 ? 152 HIS C CA   1  
ATOM 7046   C C    . HIS C 1 152 ? -6.383  -40.532 6.083   1.00 62.24 ? 152 HIS C C    1  
ATOM 7047   O O    . HIS C 1 152 ? -5.781  -40.607 7.154   1.00 52.34 ? 152 HIS C O    1  
ATOM 7048   C CB   . HIS C 1 152 ? -5.761  -38.048 5.961   1.00 62.12 ? 152 HIS C CB   1  
ATOM 7049   C CG   . HIS C 1 152 ? -5.792  -36.782 5.153   1.00 74.52 ? 152 HIS C CG   1  
ATOM 7050   N ND1  . HIS C 1 152 ? -5.939  -35.533 5.711   1.00 43.35 ? 152 HIS C ND1  1  
ATOM 7051   C CD2  . HIS C 1 152 ? -5.677  -36.578 3.821   1.00 61.41 ? 152 HIS C CD2  1  
ATOM 7052   C CE1  . HIS C 1 152 ? -5.910  -34.624 4.767   1.00 50.33 ? 152 HIS C CE1  1  
ATOM 7053   N NE2  . HIS C 1 152 ? -5.754  -35.232 3.611   1.00 60.10 ? 152 HIS C NE2  1  
ATOM 7054   H H    . HIS C 1 152 ? -8.673  -38.732 4.794   1.00 45.24 ? 152 HIS C H    1  
ATOM 7055   H HA   . HIS C 1 152 ? -6.540  -39.274 4.366   1.00 1.14  ? 152 HIS C HA   1  
ATOM 7056   H HB2  . HIS C 1 152 ? -6.056  -37.793 6.972   1.00 11.54 ? 152 HIS C HB2  1  
ATOM 7057   H HB3  . HIS C 1 152 ? -4.737  -38.410 5.976   1.00 62.52 ? 152 HIS C HB3  1  
ATOM 7058   H HD1  . HIS C 1 152 ? -6.070  -35.346 6.662   1.00 31.24 ? 152 HIS C HD1  1  
ATOM 7059   H HD2  . HIS C 1 152 ? -5.543  -37.338 3.057   1.00 74.21 ? 152 HIS C HD2  1  
ATOM 7060   H HE1  . HIS C 1 152 ? -6.007  -33.554 4.910   1.00 71.15 ? 152 HIS C HE1  1  
ATOM 7061   H HE2  . HIS C 1 152 ? -5.462  -34.788 2.793   1.00 37.99 ? 152 HIS C HE2  1  
ATOM 7062   N N    . GLN C 1 153 ? -6.851  -41.598 5.428   1.00 70.34 ? 153 GLN C N    1  
ATOM 7063   C CA   . GLN C 1 153 ? -6.653  -42.989 5.877   1.00 72.45 ? 153 GLN C CA   1  
ATOM 7064   C C    . GLN C 1 153 ? -6.453  -43.904 4.637   1.00 31.23 ? 153 GLN C C    1  
ATOM 7065   O O    . GLN C 1 153 ? -6.398  -45.130 4.743   1.00 64.23 ? 153 GLN C O    1  
ATOM 7066   C CB   . GLN C 1 153 ? -7.876  -43.415 6.754   1.00 4.45  ? 153 GLN C CB   1  
ATOM 7067   C CG   . GLN C 1 153 ? -7.758  -44.782 7.462   1.00 40.04 ? 153 GLN C CG   1  
ATOM 7068   C CD   . GLN C 1 153 ? -8.919  -45.065 8.426   1.00 62.42 ? 153 GLN C CD   1  
ATOM 7069   O OE1  . GLN C 1 153 ? -9.950  -45.617 8.036   1.00 64.50 ? 153 GLN C OE1  1  
ATOM 7070   N NE2  . GLN C 1 153 ? -8.758  -44.678 9.688   1.00 63.40 ? 153 GLN C NE2  1  
ATOM 7071   H H    . GLN C 1 153 ? -7.354  -41.449 4.604   1.00 22.22 ? 153 GLN C H    1  
ATOM 7072   H HA   . GLN C 1 153 ? -5.750  -43.031 6.484   1.00 62.11 ? 153 GLN C HA   1  
ATOM 7073   H HB2  . GLN C 1 153 ? -8.019  -42.659 7.520   1.00 11.12 ? 153 GLN C HB2  1  
ATOM 7074   H HB3  . GLN C 1 153 ? -8.763  -43.429 6.127   1.00 32.32 ? 153 GLN C HB3  1  
ATOM 7075   H HG2  . GLN C 1 153 ? -7.735  -45.561 6.708   1.00 73.33 ? 153 GLN C HG2  1  
ATOM 7076   H HG3  . GLN C 1 153 ? -6.826  -44.805 8.017   1.00 23.11 ? 153 GLN C HG3  1  
ATOM 7077   H HE21 . GLN C 1 153 ? -7.913  -44.241 9.934   1.00 65.35 ? 153 GLN C HE21 1  
ATOM 7078   H HE22 . GLN C 1 153 ? -9.487  -44.833 10.324  1.00 64.25 ? 153 GLN C HE22 1  
ATOM 7079   N N    . ASP C 1 154 ? -6.279  -43.273 3.459   1.00 22.51 ? 154 ASP C N    1  
ATOM 7080   C CA   . ASP C 1 154 ? -6.144  -43.968 2.169   1.00 10.40 ? 154 ASP C CA   1  
ATOM 7081   C C    . ASP C 1 154 ? -4.946  -43.367 1.403   1.00 34.02 ? 154 ASP C C    1  
ATOM 7082   O O    . ASP C 1 154 ? -5.050  -42.267 0.845   1.00 11.24 ? 154 ASP C O    1  
ATOM 7083   C CB   . ASP C 1 154 ? -7.471  -43.825 1.374   1.00 52.12 ? 154 ASP C CB   1  
ATOM 7084   C CG   . ASP C 1 154 ? -7.511  -44.682 0.099   1.00 53.02 ? 154 ASP C CG   1  
ATOM 7085   O OD1  . ASP C 1 154 ? -7.149  -44.184 -0.988  1.00 70.44 ? 154 ASP C OD1  1  
ATOM 7086   O OD2  . ASP C 1 154 ? -7.904  -45.867 0.182   1.00 43.11 ? 154 ASP C OD2  1  
ATOM 7087   H H    . ASP C 1 154 ? -6.220  -42.300 3.459   1.00 62.13 ? 154 ASP C H    1  
ATOM 7088   H HA   . ASP C 1 154 ? -5.949  -45.022 2.360   1.00 74.21 ? 154 ASP C HA   1  
ATOM 7089   H HB2  . ASP C 1 154 ? -8.295  -44.124 2.014   1.00 34.22 ? 154 ASP C HB2  1  
ATOM 7090   H HB3  . ASP C 1 154 ? -7.612  -42.782 1.101   1.00 63.42 ? 154 ASP C HB3  1  
ATOM 7091   N N    . ALA C 1 155 ? -3.811  -44.094 1.418   1.00 10.33 ? 155 ALA C N    1  
ATOM 7092   C CA   . ALA C 1 155 ? -2.521  -43.630 0.861   1.00 35.44 ? 155 ALA C CA   1  
ATOM 7093   C C    . ALA C 1 155 ? -2.559  -43.560 -0.687  1.00 54.41 ? 155 ALA C C    1  
ATOM 7094   O O    . ALA C 1 155 ? -2.450  -42.449 -1.260  1.00 14.11 ? 155 ALA C O    1  
ATOM 7095   C CB   . ALA C 1 155 ? -1.399  -44.566 1.344   1.00 2.34  ? 155 ALA C CB   1  
ATOM 7096   O OXT  . ALA C 1 155 ? -2.733  -44.621 -1.325  1.00 37.99 ? 155 ALA C OXT  1  
ATOM 7097   H H    . ALA C 1 155 ? -3.843  -44.988 1.815   1.00 62.41 ? 155 ALA C H    1  
ATOM 7098   H HA   . ALA C 1 155 ? -2.321  -42.637 1.267   1.00 24.24 ? 155 ALA C HA   1  
ATOM 7099   H HB1  . ALA C 1 155 ? -1.558  -45.561 0.950   1.00 14.41 ? 155 ALA C HB1  1  
ATOM 7100   H HB2  . ALA C 1 155 ? -1.402  -44.607 2.424   1.00 70.32 ? 155 ALA C HB2  1  
ATOM 7101   H HB3  . ALA C 1 155 ? -0.437  -44.196 1.006   1.00 74.11 ? 155 ALA C HB3  1  
ATOM 7102   N N    . MET D 1 1   ? 43.428  22.849  -13.109 1.00 21.14 ? 1   MET D N    1  
ATOM 7103   C CA   . MET D 1 1   ? 42.083  22.754  -13.717 1.00 24.42 ? 1   MET D CA   1  
ATOM 7104   C C    . MET D 1 1   ? 41.049  23.279  -12.714 1.00 64.15 ? 1   MET D C    1  
ATOM 7105   O O    . MET D 1 1   ? 40.756  22.603  -11.727 1.00 13.43 ? 1   MET D O    1  
ATOM 7106   C CB   . MET D 1 1   ? 41.763  21.289  -14.135 1.00 33.25 ? 1   MET D CB   1  
ATOM 7107   C CG   . MET D 1 1   ? 42.718  20.688  -15.183 1.00 30.33 ? 1   MET D CG   1  
ATOM 7108   S SD   . MET D 1 1   ? 44.422  20.512  -14.585 1.00 22.12 ? 1   MET D SD   1  
ATOM 7109   C CE   . MET D 1 1   ? 45.255  19.814  -16.022 1.00 40.24 ? 1   MET D CE   1  
ATOM 7110   H H1   . MET D 1 1   ? 43.477  22.247  -12.268 1.00 37.99 ? 1   MET D H1   1  
ATOM 7111   H H2   . MET D 1 1   ? 43.617  23.826  -12.823 1.00 37.99 ? 1   MET D H2   1  
ATOM 7112   H H3   . MET D 1 1   ? 44.159  22.550  -13.784 1.00 37.99 ? 1   MET D H3   1  
ATOM 7113   H HA   . MET D 1 1   ? 42.073  23.387  -14.600 1.00 11.43 ? 1   MET D HA   1  
ATOM 7114   H HB2  . MET D 1 1   ? 41.799  20.661  -13.250 1.00 71.22 ? 1   MET D HB2  1  
ATOM 7115   H HB3  . MET D 1 1   ? 40.754  21.254  -14.537 1.00 13.22 ? 1   MET D HB3  1  
ATOM 7116   H HG2  . MET D 1 1   ? 42.354  19.709  -15.468 1.00 32.42 ? 1   MET D HG2  1  
ATOM 7117   H HG3  . MET D 1 1   ? 42.726  21.331  -16.055 1.00 21.40 ? 1   MET D HG3  1  
ATOM 7118   H HE1  . MET D 1 1   ? 45.106  20.459  -16.877 1.00 62.42 ? 1   MET D HE1  1  
ATOM 7119   H HE2  . MET D 1 1   ? 44.853  18.835  -16.236 1.00 52.31 ? 1   MET D HE2  1  
ATOM 7120   H HE3  . MET D 1 1   ? 46.313  19.729  -15.819 1.00 3.01  ? 1   MET D HE3  1  
ATOM 7121   N N    . SER D 1 2   ? 40.518  24.500  -12.956 1.00 45.20 ? 2   SER D N    1  
ATOM 7122   C CA   . SER D 1 2   ? 39.601  25.187  -12.014 1.00 2.01  ? 2   SER D CA   1  
ATOM 7123   C C    . SER D 1 2   ? 38.544  26.007  -12.773 1.00 72.11 ? 2   SER D C    1  
ATOM 7124   O O    . SER D 1 2   ? 38.716  26.312  -13.960 1.00 3.12  ? 2   SER D O    1  
ATOM 7125   C CB   . SER D 1 2   ? 40.405  26.119  -11.070 1.00 62.43 ? 2   SER D CB   1  
ATOM 7126   O OG   . SER D 1 2   ? 41.441  25.415  -10.406 1.00 62.33 ? 2   SER D OG   1  
ATOM 7127   H H    . SER D 1 2   ? 40.736  24.948  -13.797 1.00 72.30 ? 2   SER D H    1  
ATOM 7128   H HA   . SER D 1 2   ? 39.091  24.432  -11.418 1.00 41.04 ? 2   SER D HA   1  
ATOM 7129   H HB2  . SER D 1 2   ? 40.852  26.924  -11.639 1.00 64.12 ? 2   SER D HB2  1  
ATOM 7130   H HB3  . SER D 1 2   ? 39.748  26.539  -10.322 1.00 42.40 ? 2   SER D HB3  1  
ATOM 7131   H HG   . SER D 1 2   ? 41.054  24.804  -9.764  1.00 55.30 ? 2   SER D HG   1  
ATOM 7132   N N    . GLU D 1 3   ? 37.452  26.354  -12.062 1.00 24.21 ? 3   GLU D N    1  
ATOM 7133   C CA   . GLU D 1 3   ? 36.366  27.204  -12.580 1.00 1.53  ? 3   GLU D CA   1  
ATOM 7134   C C    . GLU D 1 3   ? 35.579  27.826  -11.401 1.00 13.13 ? 3   GLU D C    1  
ATOM 7135   O O    . GLU D 1 3   ? 35.070  27.105  -10.531 1.00 33.23 ? 3   GLU D O    1  
ATOM 7136   C CB   . GLU D 1 3   ? 35.434  26.396  -13.549 1.00 51.43 ? 3   GLU D CB   1  
ATOM 7137   C CG   . GLU D 1 3   ? 34.928  25.027  -13.019 1.00 15.31 ? 3   GLU D CG   1  
ATOM 7138   C CD   . GLU D 1 3   ? 34.073  24.250  -14.040 1.00 41.54 ? 3   GLU D CD   1  
ATOM 7139   O OE1  . GLU D 1 3   ? 32.824  24.348  -13.995 1.00 42.22 ? 3   GLU D OE1  1  
ATOM 7140   O OE2  . GLU D 1 3   ? 34.647  23.563  -14.920 1.00 51.52 ? 3   GLU D OE2  1  
ATOM 7141   H H    . GLU D 1 3   ? 37.368  26.018  -11.144 1.00 32.33 ? 3   GLU D H    1  
ATOM 7142   H HA   . GLU D 1 3   ? 36.833  28.016  -13.142 1.00 74.33 ? 3   GLU D HA   1  
ATOM 7143   H HB2  . GLU D 1 3   ? 34.571  27.006  -13.791 1.00 40.13 ? 3   GLU D HB2  1  
ATOM 7144   H HB3  . GLU D 1 3   ? 35.984  26.216  -14.465 1.00 14.10 ? 3   GLU D HB3  1  
ATOM 7145   H HG2  . GLU D 1 3   ? 35.786  24.419  -12.751 1.00 51.32 ? 3   GLU D HG2  1  
ATOM 7146   H HG3  . GLU D 1 3   ? 34.338  25.199  -12.127 1.00 11.30 ? 3   GLU D HG3  1  
ATOM 7147   N N    . GLN D 1 4   ? 35.534  29.180  -11.354 1.00 4.52  ? 4   GLN D N    1  
ATOM 7148   C CA   . GLN D 1 4   ? 34.783  29.946  -10.335 1.00 32.45 ? 4   GLN D CA   1  
ATOM 7149   C C    . GLN D 1 4   ? 33.864  30.978  -11.021 1.00 62.43 ? 4   GLN D C    1  
ATOM 7150   O O    . GLN D 1 4   ? 34.334  32.001  -11.526 1.00 32.05 ? 4   GLN D O    1  
ATOM 7151   C CB   . GLN D 1 4   ? 35.739  30.669  -9.342  1.00 35.55 ? 4   GLN D CB   1  
ATOM 7152   C CG   . GLN D 1 4   ? 36.650  29.735  -8.522  1.00 54.40 ? 4   GLN D CG   1  
ATOM 7153   C CD   . GLN D 1 4   ? 37.413  30.448  -7.400  1.00 0.34  ? 4   GLN D CD   1  
ATOM 7154   O OE1  . GLN D 1 4   ? 37.707  31.638  -7.478  1.00 2.34  ? 4   GLN D OE1  1  
ATOM 7155   N NE2  . GLN D 1 4   ? 37.753  29.724  -6.351  1.00 33.24 ? 4   GLN D NE2  1  
ATOM 7156   H H    . GLN D 1 4   ? 36.020  29.681  -12.041 1.00 20.44 ? 4   GLN D H    1  
ATOM 7157   H HA   . GLN D 1 4   ? 34.164  29.247  -9.772  1.00 52.10 ? 4   GLN D HA   1  
ATOM 7158   H HB2  . GLN D 1 4   ? 36.371  31.355  -9.902  1.00 1.43  ? 4   GLN D HB2  1  
ATOM 7159   H HB3  . GLN D 1 4   ? 35.141  31.251  -8.646  1.00 43.44 ? 4   GLN D HB3  1  
ATOM 7160   H HG2  . GLN D 1 4   ? 36.037  28.955  -8.084  1.00 42.43 ? 4   GLN D HG2  1  
ATOM 7161   H HG3  . GLN D 1 4   ? 37.372  29.276  -9.190  1.00 21.15 ? 4   GLN D HG3  1  
ATOM 7162   H HE21 . GLN D 1 4   ? 37.498  28.779  -6.339  1.00 3.40  ? 4   GLN D HE21 1  
ATOM 7163   H HE22 . GLN D 1 4   ? 38.259  30.160  -5.636  1.00 65.55 ? 4   GLN D HE22 1  
ATOM 7164   N N    . ASN D 1 5   ? 32.559  30.676  -11.038 1.00 53.30 ? 5   ASN D N    1  
ATOM 7165   C CA   . ASN D 1 5   ? 31.498  31.577  -11.542 1.00 41.32 ? 5   ASN D CA   1  
ATOM 7166   C C    . ASN D 1 5   ? 30.173  31.173  -10.871 1.00 51.32 ? 5   ASN D C    1  
ATOM 7167   O O    . ASN D 1 5   ? 30.077  30.072  -10.313 1.00 30.41 ? 5   ASN D O    1  
ATOM 7168   C CB   . ASN D 1 5   ? 31.403  31.497  -13.100 1.00 53.33 ? 5   ASN D CB   1  
ATOM 7169   C CG   . ASN D 1 5   ? 30.344  32.429  -13.721 1.00 33.54 ? 5   ASN D CG   1  
ATOM 7170   O OD1  . ASN D 1 5   ? 30.612  33.596  -14.001 1.00 34.52 ? 5   ASN D OD1  1  
ATOM 7171   N ND2  . ASN D 1 5   ? 29.143  31.919  -13.949 1.00 32.50 ? 5   ASN D ND2  1  
ATOM 7172   H H    . ASN D 1 5   ? 32.287  29.797  -10.699 1.00 64.25 ? 5   ASN D H    1  
ATOM 7173   H HA   . ASN D 1 5   ? 31.741  32.593  -11.242 1.00 32.12 ? 5   ASN D HA   1  
ATOM 7174   H HB2  . ASN D 1 5   ? 32.365  31.760  -13.525 1.00 35.00 ? 5   ASN D HB2  1  
ATOM 7175   H HB3  . ASN D 1 5   ? 31.175  30.473  -13.386 1.00 34.24 ? 5   ASN D HB3  1  
ATOM 7176   H HD21 . ASN D 1 5   ? 28.989  30.981  -13.713 1.00 73.03 ? 5   ASN D HD21 1  
ATOM 7177   H HD22 . ASN D 1 5   ? 28.460  32.496  -14.348 1.00 3.22  ? 5   ASN D HD22 1  
ATOM 7178   N N    . ASN D 1 6   ? 29.163  32.059  -10.903 1.00 32.12 ? 6   ASN D N    1  
ATOM 7179   C CA   . ASN D 1 6   ? 27.839  31.776  -10.327 1.00 72.13 ? 6   ASN D CA   1  
ATOM 7180   C C    . ASN D 1 6   ? 26.740  32.467  -11.156 1.00 23.12 ? 6   ASN D C    1  
ATOM 7181   O O    . ASN D 1 6   ? 26.640  33.697  -11.172 1.00 2.12  ? 6   ASN D O    1  
ATOM 7182   C CB   . ASN D 1 6   ? 27.776  32.235  -8.841  1.00 52.40 ? 6   ASN D CB   1  
ATOM 7183   C CG   . ASN D 1 6   ? 26.458  31.879  -8.124  1.00 63.41 ? 6   ASN D CG   1  
ATOM 7184   O OD1  . ASN D 1 6   ? 25.974  32.639  -7.289  1.00 23.10 ? 6   ASN D OD1  1  
ATOM 7185   N ND2  . ASN D 1 6   ? 25.893  30.707  -8.400  1.00 43.24 ? 6   ASN D ND2  1  
ATOM 7186   H H    . ASN D 1 6   ? 29.311  32.932  -11.330 1.00 62.15 ? 6   ASN D H    1  
ATOM 7187   H HA   . ASN D 1 6   ? 27.677  30.699  -10.363 1.00 51.44 ? 6   ASN D HA   1  
ATOM 7188   H HB2  . ASN D 1 6   ? 28.583  31.761  -8.297  1.00 12.44 ? 6   ASN D HB2  1  
ATOM 7189   H HB3  . ASN D 1 6   ? 27.915  33.312  -8.794  1.00 72.04 ? 6   ASN D HB3  1  
ATOM 7190   H HD21 . ASN D 1 6   ? 26.331  30.112  -9.045  1.00 13.41 ? 6   ASN D HD21 1  
ATOM 7191   H HD22 . ASN D 1 6   ? 25.054  30.485  -7.951  1.00 70.34 ? 6   ASN D HD22 1  
ATOM 7192   N N    . THR D 1 7   ? 25.958  31.655  -11.877 1.00 11.55 ? 7   THR D N    1  
ATOM 7193   C CA   . THR D 1 7   ? 24.722  32.094  -12.558 1.00 44.13 ? 7   THR D CA   1  
ATOM 7194   C C    . THR D 1 7   ? 23.570  32.139  -11.505 1.00 22.43 ? 7   THR D C    1  
ATOM 7195   O O    . THR D 1 7   ? 23.746  31.628  -10.386 1.00 41.00 ? 7   THR D O    1  
ATOM 7196   C CB   . THR D 1 7   ? 24.422  31.095  -13.737 1.00 40.33 ? 7   THR D CB   1  
ATOM 7197   O OG1  . THR D 1 7   ? 25.584  30.986  -14.569 1.00 11.52 ? 7   THR D OG1  1  
ATOM 7198   C CG2  . THR D 1 7   ? 23.226  31.499  -14.616 1.00 51.01 ? 7   THR D CG2  1  
ATOM 7199   H H    . THR D 1 7   ? 26.221  30.712  -11.959 1.00 33.11 ? 7   THR D H    1  
ATOM 7200   H HA   . THR D 1 7   ? 24.878  33.086  -12.966 1.00 24.14 ? 7   THR D HA   1  
ATOM 7201   H HB   . THR D 1 7   ? 24.225  30.118  -13.311 1.00 23.24 ? 7   THR D HB   1  
ATOM 7202   H HG1  . THR D 1 7   ? 26.198  30.356  -14.173 1.00 22.42 ? 7   THR D HG1  1  
ATOM 7203   H HG21 . THR D 1 7   ? 23.064  30.750  -15.377 1.00 32.51 ? 7   THR D HG21 1  
ATOM 7204   H HG22 . THR D 1 7   ? 23.422  32.454  -15.091 1.00 3.34  ? 7   THR D HG22 1  
ATOM 7205   H HG23 . THR D 1 7   ? 22.334  31.584  -14.006 1.00 52.41 ? 7   THR D HG23 1  
ATOM 7206   N N    . GLU D 1 8   ? 22.420  32.767  -11.842 1.00 3.13  ? 8   GLU D N    1  
ATOM 7207   C CA   . GLU D 1 8   ? 21.246  32.856  -10.941 1.00 53.54 ? 8   GLU D CA   1  
ATOM 7208   C C    . GLU D 1 8   ? 20.713  31.444  -10.571 1.00 20.03 ? 8   GLU D C    1  
ATOM 7209   O O    . GLU D 1 8   ? 20.018  30.810  -11.379 1.00 52.11 ? 8   GLU D O    1  
ATOM 7210   C CB   . GLU D 1 8   ? 20.137  33.719  -11.615 1.00 21.30 ? 8   GLU D CB   1  
ATOM 7211   C CG   . GLU D 1 8   ? 18.842  33.896  -10.790 1.00 42.24 ? 8   GLU D CG   1  
ATOM 7212   C CD   . GLU D 1 8   ? 17.803  34.789  -11.484 1.00 71.30 ? 8   GLU D CD   1  
ATOM 7213   O OE1  . GLU D 1 8   ? 17.829  36.022  -11.271 1.00 61.23 ? 8   GLU D OE1  1  
ATOM 7214   O OE2  . GLU D 1 8   ? 16.979  34.268  -12.266 1.00 12.23 ? 8   GLU D OE2  1  
ATOM 7215   H H    . GLU D 1 8   ? 22.360  33.192  -12.721 1.00 44.42 ? 8   GLU D H    1  
ATOM 7216   H HA   . GLU D 1 8   ? 21.568  33.358  -10.033 1.00 20.52 ? 8   GLU D HA   1  
ATOM 7217   H HB2  . GLU D 1 8   ? 20.546  34.706  -11.817 1.00 13.21 ? 8   GLU D HB2  1  
ATOM 7218   H HB3  . GLU D 1 8   ? 19.875  33.263  -12.565 1.00 31.53 ? 8   GLU D HB3  1  
ATOM 7219   H HG2  . GLU D 1 8   ? 18.402  32.918  -10.617 1.00 12.21 ? 8   GLU D HG2  1  
ATOM 7220   H HG3  . GLU D 1 8   ? 19.097  34.337  -9.831  1.00 24.11 ? 8   GLU D HG3  1  
ATOM 7221   N N    . MET D 1 9   ? 21.197  30.926  -9.407  1.00 62.42 ? 9   MET D N    1  
ATOM 7222   C CA   . MET D 1 9   ? 20.743  29.660  -8.779  1.00 34.24 ? 9   MET D CA   1  
ATOM 7223   C C    . MET D 1 9   ? 19.233  29.391  -8.962  1.00 23.22 ? 9   MET D C    1  
ATOM 7224   O O    . MET D 1 9   ? 18.401  30.259  -8.674  1.00 35.51 ? 9   MET D O    1  
ATOM 7225   C CB   . MET D 1 9   ? 21.103  29.601  -7.268  1.00 31.35 ? 9   MET D CB   1  
ATOM 7226   C CG   . MET D 1 9   ? 21.064  28.175  -6.666  1.00 34.54 ? 9   MET D CG   1  
ATOM 7227   S SD   . MET D 1 9   ? 20.657  28.152  -4.904  1.00 72.42 ? 9   MET D SD   1  
ATOM 7228   C CE   . MET D 1 9   ? 18.862  28.040  -4.939  1.00 53.42 ? 9   MET D CE   1  
ATOM 7229   H H    . MET D 1 9   ? 21.905  31.426  -8.952  1.00 42.41 ? 9   MET D H    1  
ATOM 7230   H HA   . MET D 1 9   ? 21.290  28.871  -9.283  1.00 22.15 ? 9   MET D HA   1  
ATOM 7231   H HB2  . MET D 1 9   ? 22.105  29.996  -7.133  1.00 15.03 ? 9   MET D HB2  1  
ATOM 7232   H HB3  . MET D 1 9   ? 20.414  30.224  -6.712  1.00 35.10 ? 9   MET D HB3  1  
ATOM 7233   H HG2  . MET D 1 9   ? 20.325  27.584  -7.195  1.00 2.21  ? 9   MET D HG2  1  
ATOM 7234   H HG3  . MET D 1 9   ? 22.034  27.710  -6.797  1.00 15.13 ? 9   MET D HG3  1  
ATOM 7235   H HE1  . MET D 1 9   ? 18.473  28.168  -3.941  1.00 50.32 ? 9   MET D HE1  1  
ATOM 7236   H HE2  . MET D 1 9   ? 18.574  27.069  -5.312  1.00 33.13 ? 9   MET D HE2  1  
ATOM 7237   H HE3  . MET D 1 9   ? 18.456  28.805  -5.584  1.00 22.30 ? 9   MET D HE3  1  
ATOM 7238   N N    . THR D 1 10  ? 18.903  28.192  -9.446  1.00 22.10 ? 10  THR D N    1  
ATOM 7239   C CA   . THR D 1 10  ? 17.533  27.689  -9.522  1.00 24.03 ? 10  THR D CA   1  
ATOM 7240   C C    . THR D 1 10  ? 17.548  26.205  -9.133  1.00 11.31 ? 10  THR D C    1  
ATOM 7241   O O    . THR D 1 10  ? 18.473  25.465  -9.511  1.00 10.22 ? 10  THR D O    1  
ATOM 7242   C CB   . THR D 1 10  ? 16.921  27.869  -10.956 1.00 51.22 ? 10  THR D CB   1  
ATOM 7243   O OG1  . THR D 1 10  ? 17.057  29.243  -11.380 1.00 62.53 ? 10  THR D OG1  1  
ATOM 7244   C CG2  . THR D 1 10  ? 15.428  27.467  -10.998 1.00 11.52 ? 10  THR D CG2  1  
ATOM 7245   H H    . THR D 1 10  ? 19.616  27.614  -9.764  1.00 63.23 ? 10  THR D H    1  
ATOM 7246   H HA   . THR D 1 10  ? 16.919  28.241  -8.802  1.00 35.25 ? 10  THR D HA   1  
ATOM 7247   H HB   . THR D 1 10  ? 17.472  27.242  -11.657 1.00 12.31 ? 10  THR D HB   1  
ATOM 7248   H HG1  . THR D 1 10  ? 17.271  29.798  -10.621 1.00 14.52 ? 10  THR D HG1  1  
ATOM 7249   H HG21 . THR D 1 10  ? 15.315  26.438  -10.682 1.00 52.15 ? 10  THR D HG21 1  
ATOM 7250   H HG22 . THR D 1 10  ? 15.050  27.567  -12.000 1.00 3.32  ? 10  THR D HG22 1  
ATOM 7251   H HG23 . THR D 1 10  ? 14.854  28.106  -10.339 1.00 70.44 ? 10  THR D HG23 1  
ATOM 7252   N N    . PHE D 1 11  ? 16.523  25.795  -8.376  1.00 14.03 ? 11  PHE D N    1  
ATOM 7253   C CA   . PHE D 1 11  ? 16.371  24.422  -7.887  1.00 73.22 ? 11  PHE D CA   1  
ATOM 7254   C C    . PHE D 1 11  ? 14.908  24.215  -7.472  1.00 51.54 ? 11  PHE D C    1  
ATOM 7255   O O    . PHE D 1 11  ? 14.488  24.659  -6.396  1.00 30.34 ? 11  PHE D O    1  
ATOM 7256   C CB   . PHE D 1 11  ? 17.347  24.102  -6.715  1.00 64.02 ? 11  PHE D CB   1  
ATOM 7257   C CG   . PHE D 1 11  ? 17.367  22.608  -6.349  1.00 12.03 ? 11  PHE D CG   1  
ATOM 7258   C CD1  . PHE D 1 11  ? 16.526  22.086  -5.361  1.00 44.53 ? 11  PHE D CD1  1  
ATOM 7259   C CD2  . PHE D 1 11  ? 18.211  21.721  -7.026  1.00 12.13 ? 11  PHE D CD2  1  
ATOM 7260   C CE1  . PHE D 1 11  ? 16.527  20.734  -5.064  1.00 54.33 ? 11  PHE D CE1  1  
ATOM 7261   C CE2  . PHE D 1 11  ? 18.216  20.372  -6.721  1.00 61.51 ? 11  PHE D CE2  1  
ATOM 7262   C CZ   . PHE D 1 11  ? 17.376  19.877  -5.741  1.00 11.31 ? 11  PHE D CZ   1  
ATOM 7263   H H    . PHE D 1 11  ? 15.817  26.441  -8.174  1.00 53.14 ? 11  PHE D H    1  
ATOM 7264   H HA   . PHE D 1 11  ? 16.593  23.752  -8.719  1.00 24.33 ? 11  PHE D HA   1  
ATOM 7265   H HB2  . PHE D 1 11  ? 18.353  24.395  -7.005  1.00 63.23 ? 11  PHE D HB2  1  
ATOM 7266   H HB3  . PHE D 1 11  ? 17.064  24.675  -5.836  1.00 53.15 ? 11  PHE D HB3  1  
ATOM 7267   H HD1  . PHE D 1 11  ? 15.861  22.754  -4.823  1.00 40.41 ? 11  PHE D HD1  1  
ATOM 7268   H HD2  . PHE D 1 11  ? 18.873  22.099  -7.797  1.00 51.51 ? 11  PHE D HD2  1  
ATOM 7269   H HE1  . PHE D 1 11  ? 15.869  20.349  -4.297  1.00 52.20 ? 11  PHE D HE1  1  
ATOM 7270   H HE2  . PHE D 1 11  ? 18.879  19.703  -7.252  1.00 72.23 ? 11  PHE D HE2  1  
ATOM 7271   H HZ   . PHE D 1 11  ? 17.378  18.820  -5.508  1.00 32.32 ? 11  PHE D HZ   1  
ATOM 7272   N N    . GLN D 1 12  ? 14.125  23.586  -8.364  1.00 13.23 ? 12  GLN D N    1  
ATOM 7273   C CA   . GLN D 1 12  ? 12.697  23.277  -8.134  1.00 22.40 ? 12  GLN D CA   1  
ATOM 7274   C C    . GLN D 1 12  ? 12.424  21.842  -8.613  1.00 30.31 ? 12  GLN D C    1  
ATOM 7275   O O    . GLN D 1 12  ? 12.811  21.487  -9.728  1.00 50.41 ? 12  GLN D O    1  
ATOM 7276   C CB   . GLN D 1 12  ? 11.787  24.267  -8.918  1.00 32.01 ? 12  GLN D CB   1  
ATOM 7277   C CG   . GLN D 1 12  ? 11.967  25.749  -8.568  1.00 3.05  ? 12  GLN D CG   1  
ATOM 7278   C CD   . GLN D 1 12  ? 11.145  26.681  -9.461  1.00 51.33 ? 12  GLN D CD   1  
ATOM 7279   O OE1  . GLN D 1 12  ? 10.007  27.030  -9.148  1.00 1.21  ? 12  GLN D OE1  1  
ATOM 7280   N NE2  . GLN D 1 12  ? 11.713  27.073  -10.587 1.00 53.14 ? 12  GLN D NE2  1  
ATOM 7281   H H    . GLN D 1 12  ? 14.525  23.312  -9.219  1.00 13.31 ? 12  GLN D H    1  
ATOM 7282   H HA   . GLN D 1 12  ? 12.482  23.349  -7.067  1.00 45.22 ? 12  GLN D HA   1  
ATOM 7283   H HB2  . GLN D 1 12  ? 11.978  24.147  -9.980  1.00 63.45 ? 12  GLN D HB2  1  
ATOM 7284   H HB3  . GLN D 1 12  ? 10.751  24.002  -8.727  1.00 4.21  ? 12  GLN D HB3  1  
ATOM 7285   H HG2  . GLN D 1 12  ? 11.667  25.904  -7.533  1.00 24.54 ? 12  GLN D HG2  1  
ATOM 7286   H HG3  . GLN D 1 12  ? 13.015  26.005  -8.667  1.00 62.22 ? 12  GLN D HG3  1  
ATOM 7287   H HE21 . GLN D 1 12  ? 12.619  26.753  -10.791 1.00 32.10 ? 12  GLN D HE21 1  
ATOM 7288   H HE22 . GLN D 1 12  ? 11.204  27.661  -11.173 1.00 12.42 ? 12  GLN D HE22 1  
ATOM 7289   N N    . ILE D 1 13  ? 11.760  21.024  -7.782  1.00 21.23 ? 13  ILE D N    1  
ATOM 7290   C CA   . ILE D 1 13  ? 11.417  19.641  -8.151  1.00 32.53 ? 13  ILE D CA   1  
ATOM 7291   C C    . ILE D 1 13  ? 10.142  19.647  -8.994  1.00 24.31 ? 13  ILE D C    1  
ATOM 7292   O O    . ILE D 1 13  ? 9.105   20.141  -8.544  1.00 52.43 ? 13  ILE D O    1  
ATOM 7293   C CB   . ILE D 1 13  ? 11.185  18.717  -6.906  1.00 13.43 ? 13  ILE D CB   1  
ATOM 7294   C CG1  . ILE D 1 13  ? 12.369  18.848  -5.905  1.00 61.12 ? 13  ILE D CG1  1  
ATOM 7295   C CG2  . ILE D 1 13  ? 10.976  17.247  -7.364  1.00 12.21 ? 13  ILE D CG2  1  
ATOM 7296   C CD1  . ILE D 1 13  ? 12.285  17.945  -4.696  1.00 63.33 ? 13  ILE D CD1  1  
ATOM 7297   H H    . ILE D 1 13  ? 11.466  21.366  -6.912  1.00 54.34 ? 13  ILE D H    1  
ATOM 7298   H HA   . ILE D 1 13  ? 12.245  19.229  -8.737  1.00 44.20 ? 13  ILE D HA   1  
ATOM 7299   H HB   . ILE D 1 13  ? 10.269  19.043  -6.406  1.00 3.51  ? 13  ILE D HB   1  
ATOM 7300   H HG12 . ILE D 1 13  ? 13.295  18.613  -6.413  1.00 61.04 ? 13  ILE D HG12 1  
ATOM 7301   H HG13 . ILE D 1 13  ? 12.420  19.867  -5.544  1.00 12.32 ? 13  ILE D HG13 1  
ATOM 7302   H HG21 . ILE D 1 13  ? 10.764  16.625  -6.510  1.00 62.53 ? 13  ILE D HG21 1  
ATOM 7303   H HG22 . ILE D 1 13  ? 11.868  16.880  -7.855  1.00 42.44 ? 13  ILE D HG22 1  
ATOM 7304   H HG23 . ILE D 1 13  ? 10.142  17.190  -8.055  1.00 13.51 ? 13  ILE D HG23 1  
ATOM 7305   H HD11 . ILE D 1 13  ? 12.372  16.915  -5.012  1.00 1.23  ? 13  ILE D HD11 1  
ATOM 7306   H HD12 . ILE D 1 13  ? 11.349  18.077  -4.180  1.00 25.15 ? 13  ILE D HD12 1  
ATOM 7307   H HD13 . ILE D 1 13  ? 13.098  18.176  -4.027  1.00 61.55 ? 13  ILE D HD13 1  
ATOM 7308   N N    . GLN D 1 14  ? 10.229  19.104  -10.207 1.00 40.03 ? 14  GLN D N    1  
ATOM 7309   C CA   . GLN D 1 14  ? 9.082   19.002  -11.117 1.00 42.33 ? 14  GLN D CA   1  
ATOM 7310   C C    . GLN D 1 14  ? 8.299   17.709  -10.864 1.00 13.02 ? 14  GLN D C    1  
ATOM 7311   O O    . GLN D 1 14  ? 7.079   17.685  -11.020 1.00 24.33 ? 14  GLN D O    1  
ATOM 7312   C CB   . GLN D 1 14  ? 9.546   19.099  -12.596 1.00 51.44 ? 14  GLN D CB   1  
ATOM 7313   C CG   . GLN D 1 14  ? 9.976   20.516  -13.039 1.00 73.43 ? 14  GLN D CG   1  
ATOM 7314   C CD   . GLN D 1 14  ? 10.333  20.617  -14.527 1.00 12.13 ? 14  GLN D CD   1  
ATOM 7315   O OE1  . GLN D 1 14  ? 9.839   19.850  -15.355 1.00 31.41 ? 14  GLN D OE1  1  
ATOM 7316   N NE2  . GLN D 1 14  ? 11.144  21.598  -14.886 1.00 63.33 ? 14  GLN D NE2  1  
ATOM 7317   H H    . GLN D 1 14  ? 11.089  18.738  -10.492 1.00 73.24 ? 14  GLN D H    1  
ATOM 7318   H HA   . GLN D 1 14  ? 8.418   19.839  -10.912 1.00 33.34 ? 14  GLN D HA   1  
ATOM 7319   H HB2  . GLN D 1 14  ? 10.385  18.428  -12.743 1.00 21.42 ? 14  GLN D HB2  1  
ATOM 7320   H HB3  . GLN D 1 14  ? 8.732   18.779  -13.241 1.00 13.40 ? 14  GLN D HB3  1  
ATOM 7321   H HG2  . GLN D 1 14  ? 9.165   21.209  -12.841 1.00 22.34 ? 14  GLN D HG2  1  
ATOM 7322   H HG3  . GLN D 1 14  ? 10.841  20.809  -12.453 1.00 53.12 ? 14  GLN D HG3  1  
ATOM 7323   H HE21 . GLN D 1 14  ? 11.473  22.205  -14.191 1.00 51.43 ? 14  GLN D HE21 1  
ATOM 7324   H HE22 . GLN D 1 14  ? 11.368  21.687  -15.833 1.00 24.02 ? 14  GLN D HE22 1  
ATOM 7325   N N    . ARG D 1 15  ? 9.003   16.640  -10.444 1.00 4.14  ? 15  ARG D N    1  
ATOM 7326   C CA   . ARG D 1 15  ? 8.391   15.305  -10.299 1.00 52.41 ? 15  ARG D CA   1  
ATOM 7327   C C    . ARG D 1 15  ? 9.328   14.364  -9.513  1.00 12.51 ? 15  ARG D C    1  
ATOM 7328   O O    . ARG D 1 15  ? 10.548  14.460  -9.638  1.00 41.11 ? 15  ARG D O    1  
ATOM 7329   C CB   . ARG D 1 15  ? 8.087   14.740  -11.723 1.00 65.11 ? 15  ARG D CB   1  
ATOM 7330   C CG   . ARG D 1 15  ? 7.204   13.474  -11.790 1.00 71.44 ? 15  ARG D CG   1  
ATOM 7331   C CD   . ARG D 1 15  ? 6.980   13.012  -13.248 1.00 53.12 ? 15  ARG D CD   1  
ATOM 7332   N NE   . ARG D 1 15  ? 6.213   11.760  -13.338 1.00 2.20  ? 15  ARG D NE   1  
ATOM 7333   C CZ   . ARG D 1 15  ? 6.291   10.861  -14.339 1.00 14.52 ? 15  ARG D CZ   1  
ATOM 7334   N NH1  . ARG D 1 15  ? 7.106   11.056  -15.373 1.00 75.13 ? 15  ARG D NH1  1  
ATOM 7335   N NH2  . ARG D 1 15  ? 5.553   9.763   -14.297 1.00 61.10 ? 15  ARG D NH2  1  
ATOM 7336   H H    . ARG D 1 15  ? 9.955   16.755  -10.214 1.00 41.10 ? 15  ARG D H    1  
ATOM 7337   H HA   . ARG D 1 15  ? 7.463   15.419  -9.750  1.00 4.51  ? 15  ARG D HA   1  
ATOM 7338   H HB2  . ARG D 1 15  ? 7.590   15.517  -12.291 1.00 54.45 ? 15  ARG D HB2  1  
ATOM 7339   H HB3  . ARG D 1 15  ? 9.031   14.520  -12.212 1.00 14.40 ? 15  ARG D HB3  1  
ATOM 7340   H HG2  . ARG D 1 15  ? 7.688   12.675  -11.238 1.00 43.13 ? 15  ARG D HG2  1  
ATOM 7341   H HG3  . ARG D 1 15  ? 6.242   13.686  -11.336 1.00 75.13 ? 15  ARG D HG3  1  
ATOM 7342   H HD2  . ARG D 1 15  ? 6.440   13.786  -13.781 1.00 74.25 ? 15  ARG D HD2  1  
ATOM 7343   H HD3  . ARG D 1 15  ? 7.949   12.870  -13.721 1.00 14.43 ? 15  ARG D HD3  1  
ATOM 7344   H HE   . ARG D 1 15  ? 5.595   11.579  -12.604 1.00 63.20 ? 15  ARG D HE   1  
ATOM 7345   H HH11 . ARG D 1 15  ? 7.669   11.882  -15.421 1.00 55.34 ? 15  ARG D HH11 1  
ATOM 7346   H HH12 . ARG D 1 15  ? 7.150   10.386  -16.118 1.00 41.51 ? 15  ARG D HH12 1  
ATOM 7347   H HH21 . ARG D 1 15  ? 4.948   9.587   -13.508 1.00 74.21 ? 15  ARG D HH21 1  
ATOM 7348   H HH22 . ARG D 1 15  ? 5.609   9.092   -15.029 1.00 72.31 ? 15  ARG D HH22 1  
ATOM 7349   N N    . ILE D 1 16  ? 8.742   13.470  -8.691  1.00 31.41 ? 16  ILE D N    1  
ATOM 7350   C CA   . ILE D 1 16  ? 9.472   12.394  -7.974  1.00 31.32 ? 16  ILE D CA   1  
ATOM 7351   C C    . ILE D 1 16  ? 8.662   11.118  -8.175  1.00 52.02 ? 16  ILE D C    1  
ATOM 7352   O O    . ILE D 1 16  ? 7.428   11.144  -8.043  1.00 71.54 ? 16  ILE D O    1  
ATOM 7353   C CB   . ILE D 1 16  ? 9.706   12.639  -6.412  1.00 52.13 ? 16  ILE D CB   1  
ATOM 7354   C CG1  . ILE D 1 16  ? 8.376   12.628  -5.551  1.00 42.41 ? 16  ILE D CG1  1  
ATOM 7355   C CG2  . ILE D 1 16  ? 10.521  13.925  -6.157  1.00 74.52 ? 16  ILE D CG2  1  
ATOM 7356   C CD1  . ILE D 1 16  ? 7.310   13.646  -5.948  1.00 74.30 ? 16  ILE D CD1  1  
ATOM 7357   H H    . ILE D 1 16  ? 7.765   13.497  -8.592  1.00 42.30 ? 16  ILE D H    1  
ATOM 7358   H HA   . ILE D 1 16  ? 10.449  12.267  -8.455  1.00 24.33 ? 16  ILE D HA   1  
ATOM 7359   H HB   . ILE D 1 16  ? 10.329  11.814  -6.065  1.00 52.02 ? 16  ILE D HB   1  
ATOM 7360   H HG12 . ILE D 1 16  ? 7.920   11.650  -5.626  1.00 22.34 ? 16  ILE D HG12 1  
ATOM 7361   H HG13 . ILE D 1 16  ? 8.624   12.806  -4.510  1.00 23.42 ? 16  ILE D HG13 1  
ATOM 7362   H HG21 . ILE D 1 16  ? 10.697  14.048  -5.096  1.00 71.45 ? 16  ILE D HG21 1  
ATOM 7363   H HG22 . ILE D 1 16  ? 9.975   14.783  -6.528  1.00 62.44 ? 16  ILE D HG22 1  
ATOM 7364   H HG23 . ILE D 1 16  ? 11.473  13.864  -6.672  1.00 41.31 ? 16  ILE D HG23 1  
ATOM 7365   H HD11 . ILE D 1 16  ? 7.744   14.636  -5.962  1.00 12.15 ? 16  ILE D HD11 1  
ATOM 7366   H HD12 . ILE D 1 16  ? 6.500   13.623  -5.235  1.00 11.51 ? 16  ILE D HD12 1  
ATOM 7367   H HD13 . ILE D 1 16  ? 6.928   13.411  -6.933  1.00 31.01 ? 16  ILE D HD13 1  
ATOM 7368   N N    . TYR D 1 17  ? 9.329   10.025  -8.533  1.00 64.45 ? 17  TYR D N    1  
ATOM 7369   C CA   . TYR D 1 17  ? 8.645   8.782   -8.892  1.00 32.55 ? 17  TYR D CA   1  
ATOM 7370   C C    . TYR D 1 17  ? 9.626   7.622   -8.980  1.00 64.41 ? 17  TYR D C    1  
ATOM 7371   O O    . TYR D 1 17  ? 10.846  7.804   -9.024  1.00 71.40 ? 17  TYR D O    1  
ATOM 7372   C CB   . TYR D 1 17  ? 7.878   8.942   -10.242 1.00 35.35 ? 17  TYR D CB   1  
ATOM 7373   C CG   . TYR D 1 17  ? 8.759   9.282   -11.456 1.00 15.02 ? 17  TYR D CG   1  
ATOM 7374   C CD1  . TYR D 1 17  ? 9.286   10.567  -11.640 1.00 20.32 ? 17  TYR D CD1  1  
ATOM 7375   C CD2  . TYR D 1 17  ? 9.052   8.327   -12.419 1.00 22.21 ? 17  TYR D CD2  1  
ATOM 7376   C CE1  . TYR D 1 17  ? 10.064  10.878  -12.735 1.00 13.14 ? 17  TYR D CE1  1  
ATOM 7377   C CE2  . TYR D 1 17  ? 9.829   8.637   -13.503 1.00 54.41 ? 17  TYR D CE2  1  
ATOM 7378   C CZ   . TYR D 1 17  ? 10.332  9.906   -13.664 1.00 55.45 ? 17  TYR D CZ   1  
ATOM 7379   O OH   . TYR D 1 17  ? 11.088  10.202  -14.774 1.00 62.31 ? 17  TYR D OH   1  
ATOM 7380   H H    . TYR D 1 17  ? 10.312  10.047  -8.559  1.00 64.24 ? 17  TYR D H    1  
ATOM 7381   H HA   . TYR D 1 17  ? 7.927   8.558   -8.103  1.00 22.42 ? 17  TYR D HA   1  
ATOM 7382   H HB2  . TYR D 1 17  ? 7.342   8.021   -10.455 1.00 32.01 ? 17  TYR D HB2  1  
ATOM 7383   H HB3  . TYR D 1 17  ? 7.148   9.737   -10.133 1.00 75.32 ? 17  TYR D HB3  1  
ATOM 7384   H HD1  . TYR D 1 17  ? 9.070   11.332  -10.904 1.00 33.22 ? 17  TYR D HD1  1  
ATOM 7385   H HD2  . TYR D 1 17  ? 8.663   7.319   -12.304 1.00 31.10 ? 17  TYR D HD2  1  
ATOM 7386   H HE1  . TYR D 1 17  ? 10.457  11.880  -12.858 1.00 53.15 ? 17  TYR D HE1  1  
ATOM 7387   H HE2  . TYR D 1 17  ? 10.045  7.875   -14.234 1.00 0.21  ? 17  TYR D HE2  1  
ATOM 7388   H HH   . TYR D 1 17  ? 11.926  10.604  -14.503 1.00 64.34 ? 17  TYR D HH   1  
ATOM 7389   N N    . THR D 1 18  ? 9.058   6.430   -9.027  1.00 72.15 ? 18  THR D N    1  
ATOM 7390   C CA   . THR D 1 18  ? 9.804   5.192   -9.217  1.00 1.45  ? 18  THR D CA   1  
ATOM 7391   C C    . THR D 1 18  ? 9.838   4.861   -10.715 1.00 64.33 ? 18  THR D C    1  
ATOM 7392   O O    . THR D 1 18  ? 8.789   4.755   -11.359 1.00 43.25 ? 18  THR D O    1  
ATOM 7393   C CB   . THR D 1 18  ? 9.154   4.030   -8.414  1.00 44.04 ? 18  THR D CB   1  
ATOM 7394   O OG1  . THR D 1 18  ? 7.794   3.820   -8.837  1.00 13.13 ? 18  THR D OG1  1  
ATOM 7395   C CG2  . THR D 1 18  ? 9.177   4.306   -6.895  1.00 74.13 ? 18  THR D CG2  1  
ATOM 7396   H H    . THR D 1 18  ? 8.079   6.383   -8.947  1.00 41.00 ? 18  THR D H    1  
ATOM 7397   H HA   . THR D 1 18  ? 10.825  5.331   -8.852  1.00 12.01 ? 18  THR D HA   1  
ATOM 7398   H HB   . THR D 1 18  ? 9.714   3.119   -8.603  1.00 32.22 ? 18  THR D HB   1  
ATOM 7399   H HG1  . THR D 1 18  ? 7.763   3.712   -9.796  1.00 51.51 ? 18  THR D HG1  1  
ATOM 7400   H HG21 . THR D 1 18  ? 10.197  4.435   -6.562  1.00 51.22 ? 18  THR D HG21 1  
ATOM 7401   H HG22 . THR D 1 18  ? 8.735   3.473   -6.366  1.00 4.34  ? 18  THR D HG22 1  
ATOM 7402   H HG23 . THR D 1 18  ? 8.613   5.205   -6.674  1.00 35.14 ? 18  THR D HG23 1  
ATOM 7403   N N    . LYS D 1 19  ? 11.045  4.751   -11.269 1.00 15.41 ? 19  LYS D N    1  
ATOM 7404   C CA   . LYS D 1 19  ? 11.246  4.397   -12.685 1.00 4.31  ? 19  LYS D CA   1  
ATOM 7405   C C    . LYS D 1 19  ? 11.322  2.881   -12.840 1.00 14.45 ? 19  LYS D C    1  
ATOM 7406   O O    . LYS D 1 19  ? 10.950  2.331   -13.876 1.00 25.10 ? 19  LYS D O    1  
ATOM 7407   C CB   . LYS D 1 19  ? 12.541  5.047   -13.217 1.00 32.23 ? 19  LYS D CB   1  
ATOM 7408   C CG   . LYS D 1 19  ? 12.637  6.557   -12.924 1.00 52.12 ? 19  LYS D CG   1  
ATOM 7409   C CD   . LYS D 1 19  ? 13.704  7.267   -13.775 1.00 75.23 ? 19  LYS D CD   1  
ATOM 7410   C CE   . LYS D 1 19  ? 13.402  7.173   -15.280 1.00 21.53 ? 19  LYS D CE   1  
ATOM 7411   N NZ   . LYS D 1 19  ? 14.411  7.880   -16.091 1.00 24.31 ? 19  LYS D NZ   1  
ATOM 7412   H H    . LYS D 1 19  ? 11.833  4.910   -10.708 1.00 13.44 ? 19  LYS D H    1  
ATOM 7413   H HA   . LYS D 1 19  ? 10.402  4.773   -13.260 1.00 74.44 ? 19  LYS D HA   1  
ATOM 7414   H HB2  . LYS D 1 19  ? 13.399  4.555   -12.762 1.00 11.35 ? 19  LYS D HB2  1  
ATOM 7415   H HB3  . LYS D 1 19  ? 12.588  4.901   -14.291 1.00 35.32 ? 19  LYS D HB3  1  
ATOM 7416   H HG2  . LYS D 1 19  ? 11.673  7.017   -13.115 1.00 13.24 ? 19  LYS D HG2  1  
ATOM 7417   H HG3  . LYS D 1 19  ? 12.881  6.691   -11.875 1.00 20.31 ? 19  LYS D HG3  1  
ATOM 7418   H HD2  . LYS D 1 19  ? 13.737  8.313   -13.490 1.00 11.34 ? 19  LYS D HD2  1  
ATOM 7419   H HD3  . LYS D 1 19  ? 14.674  6.815   -13.577 1.00 33.21 ? 19  LYS D HD3  1  
ATOM 7420   H HE2  . LYS D 1 19  ? 13.391  6.132   -15.573 1.00 4.10  ? 19  LYS D HE2  1  
ATOM 7421   H HE3  . LYS D 1 19  ? 12.431  7.607   -15.479 1.00 32.44 ? 19  LYS D HE3  1  
ATOM 7422   H HZ1  . LYS D 1 19  ? 15.358  7.513   -15.889 1.00 3.43  ? 19  LYS D HZ1  1  
ATOM 7423   H HZ2  . LYS D 1 19  ? 14.392  8.890   -15.872 1.00 23.24 ? 19  LYS D HZ2  1  
ATOM 7424   H HZ3  . LYS D 1 19  ? 14.215  7.758   -17.093 1.00 2.13  ? 19  LYS D HZ3  1  
ATOM 7425   N N    . ASP D 1 20  ? 11.842  2.232   -11.792 1.00 23.42 ? 20  ASP D N    1  
ATOM 7426   C CA   . ASP D 1 20  ? 12.024  0.781   -11.733 1.00 35.22 ? 20  ASP D CA   1  
ATOM 7427   C C    . ASP D 1 20  ? 11.982  0.331   -10.266 1.00 32.52 ? 20  ASP D C    1  
ATOM 7428   O O    . ASP D 1 20  ? 12.505  1.016   -9.386  1.00 41.32 ? 20  ASP D O    1  
ATOM 7429   C CB   . ASP D 1 20  ? 13.360  0.374   -12.419 1.00 44.34 ? 20  ASP D CB   1  
ATOM 7430   C CG   . ASP D 1 20  ? 13.767  -1.092  -12.188 1.00 2.41  ? 20  ASP D CG   1  
ATOM 7431   O OD1  . ASP D 1 20  ? 13.201  -1.993  -12.842 1.00 25.12 ? 20  ASP D OD1  1  
ATOM 7432   O OD2  . ASP D 1 20  ? 14.654  -1.345  -11.343 1.00 51.12 ? 20  ASP D OD2  1  
ATOM 7433   H H    . ASP D 1 20  ? 12.116  2.760   -11.013 1.00 42.12 ? 20  ASP D H    1  
ATOM 7434   H HA   . ASP D 1 20  ? 11.193  0.317   -12.259 1.00 13.41 ? 20  ASP D HA   1  
ATOM 7435   H HB2  . ASP D 1 20  ? 13.261  0.535   -13.485 1.00 4.50  ? 20  ASP D HB2  1  
ATOM 7436   H HB3  . ASP D 1 20  ? 14.153  1.019   -12.052 1.00 25.22 ? 20  ASP D HB3  1  
ATOM 7437   N N    . ILE D 1 21  ? 11.321  -0.805  -10.022 1.00 42.51 ? 21  ILE D N    1  
ATOM 7438   C CA   . ILE D 1 21  ? 11.188  -1.423  -8.692  1.00 63.30 ? 21  ILE D CA   1  
ATOM 7439   C C    . ILE D 1 21  ? 11.342  -2.948  -8.864  1.00 61.23 ? 21  ILE D C    1  
ATOM 7440   O O    . ILE D 1 21  ? 11.011  -3.488  -9.931  1.00 55.42 ? 21  ILE D O    1  
ATOM 7441   C CB   . ILE D 1 21  ? 9.779   -1.122  -8.011  1.00 43.11 ? 21  ILE D CB   1  
ATOM 7442   C CG1  . ILE D 1 21  ? 9.475   0.407   -7.922  1.00 45.34 ? 21  ILE D CG1  1  
ATOM 7443   C CG2  . ILE D 1 21  ? 9.704   -1.760  -6.608  1.00 31.41 ? 21  ILE D CG2  1  
ATOM 7444   C CD1  . ILE D 1 21  ? 8.051   0.733   -7.499  1.00 40.40 ? 21  ILE D CD1  1  
ATOM 7445   H H    . ILE D 1 21  ? 10.920  -1.274  -10.784 1.00 72.11 ? 21  ILE D H    1  
ATOM 7446   H HA   . ILE D 1 21  ? 11.987  -1.048  -8.042  1.00 54.24 ? 21  ILE D HA   1  
ATOM 7447   H HB   . ILE D 1 21  ? 8.997   -1.590  -8.613  1.00 31.22 ? 21  ILE D HB   1  
ATOM 7448   H HG12 . ILE D 1 21  ? 10.145  0.875   -7.210  1.00 65.10 ? 21  ILE D HG12 1  
ATOM 7449   H HG13 . ILE D 1 21  ? 9.635   0.858   -8.894  1.00 23.31 ? 21  ILE D HG13 1  
ATOM 7450   H HG21 . ILE D 1 21  ? 8.748   -1.552  -6.160  1.00 51.31 ? 21  ILE D HG21 1  
ATOM 7451   H HG22 . ILE D 1 21  ? 10.488  -1.365  -5.973  1.00 70.10 ? 21  ILE D HG22 1  
ATOM 7452   H HG23 . ILE D 1 21  ? 9.820   -2.834  -6.685  1.00 71.44 ? 21  ILE D HG23 1  
ATOM 7453   H HD11 . ILE D 1 21  ? 7.948   1.784   -7.350  1.00 11.23 ? 21  ILE D HD11 1  
ATOM 7454   H HD12 . ILE D 1 21  ? 7.819   0.230   -6.575  1.00 13.24 ? 21  ILE D HD12 1  
ATOM 7455   H HD13 . ILE D 1 21  ? 7.363   0.414   -8.267  1.00 0.53  ? 21  ILE D HD13 1  
ATOM 7456   N N    . SER D 1 22  ? 11.838  -3.622  -7.813  1.00 74.12 ? 22  SER D N    1  
ATOM 7457   C CA   . SER D 1 22  ? 11.868  -5.081  -7.727  1.00 14.42 ? 22  SER D CA   1  
ATOM 7458   C C    . SER D 1 22  ? 11.983  -5.525  -6.262  1.00 71.40 ? 22  SER D C    1  
ATOM 7459   O O    . SER D 1 22  ? 12.915  -5.132  -5.558  1.00 4.45  ? 22  SER D O    1  
ATOM 7460   C CB   . SER D 1 22  ? 13.039  -5.665  -8.555  1.00 15.12 ? 22  SER D CB   1  
ATOM 7461   O OG   . SER D 1 22  ? 13.147  -7.073  -8.409  1.00 23.22 ? 22  SER D OG   1  
ATOM 7462   H H    . SER D 1 22  ? 12.193  -3.111  -7.063  1.00 34.23 ? 22  SER D H    1  
ATOM 7463   H HA   . SER D 1 22  ? 10.925  -5.446  -8.133  1.00 1.31  ? 22  SER D HA   1  
ATOM 7464   H HB2  . SER D 1 22  ? 12.887  -5.444  -9.605  1.00 71.22 ? 22  SER D HB2  1  
ATOM 7465   H HB3  . SER D 1 22  ? 13.973  -5.215  -8.236  1.00 44.45 ? 22  SER D HB3  1  
ATOM 7466   H HG   . SER D 1 22  ? 13.713  -7.271  -7.654  1.00 21.24 ? 22  SER D HG   1  
ATOM 7467   N N    . PHE D 1 23  ? 11.007  -6.312  -5.812  1.00 10.12 ? 23  PHE D N    1  
ATOM 7468   C CA   . PHE D 1 23  ? 11.085  -7.083  -4.571  1.00 44.02 ? 23  PHE D CA   1  
ATOM 7469   C C    . PHE D 1 23  ? 11.091  -8.557  -4.971  1.00 10.43 ? 23  PHE D C    1  
ATOM 7470   O O    . PHE D 1 23  ? 10.171  -9.006  -5.636  1.00 71.54 ? 23  PHE D O    1  
ATOM 7471   C CB   . PHE D 1 23  ? 9.881   -6.761  -3.639  1.00 35.44 ? 23  PHE D CB   1  
ATOM 7472   C CG   . PHE D 1 23  ? 9.746   -7.692  -2.425  1.00 72.22 ? 23  PHE D CG   1  
ATOM 7473   C CD1  . PHE D 1 23  ? 10.603  -7.571  -1.329  1.00 44.32 ? 23  PHE D CD1  1  
ATOM 7474   C CD2  . PHE D 1 23  ? 8.784   -8.703  -2.397  1.00 13.12 ? 23  PHE D CD2  1  
ATOM 7475   C CE1  . PHE D 1 23  ? 10.504  -8.430  -0.252  1.00 45.45 ? 23  PHE D CE1  1  
ATOM 7476   C CE2  . PHE D 1 23  ? 8.686   -9.556  -1.318  1.00 24.21 ? 23  PHE D CE2  1  
ATOM 7477   C CZ   . PHE D 1 23  ? 9.544   -9.423  -0.246  1.00 52.11 ? 23  PHE D CZ   1  
ATOM 7478   H H    . PHE D 1 23  ? 10.195  -6.394  -6.351  1.00 44.41 ? 23  PHE D H    1  
ATOM 7479   H HA   . PHE D 1 23  ? 12.022  -6.840  -4.054  1.00 15.42 ? 23  PHE D HA   1  
ATOM 7480   H HB2  . PHE D 1 23  ? 9.994   -5.750  -3.269  1.00 24.24 ? 23  PHE D HB2  1  
ATOM 7481   H HB3  . PHE D 1 23  ? 8.954   -6.809  -4.213  1.00 62.43 ? 23  PHE D HB3  1  
ATOM 7482   H HD1  . PHE D 1 23  ? 11.357  -6.793  -1.329  1.00 21.20 ? 23  PHE D HD1  1  
ATOM 7483   H HD2  . PHE D 1 23  ? 8.103   -8.814  -3.236  1.00 53.54 ? 23  PHE D HD2  1  
ATOM 7484   H HE1  . PHE D 1 23  ? 11.178  -8.324  0.588   1.00 63.44 ? 23  PHE D HE1  1  
ATOM 7485   H HE2  . PHE D 1 23  ? 7.936   -10.331 -1.313  1.00 33.11 ? 23  PHE D HE2  1  
ATOM 7486   H HZ   . PHE D 1 23  ? 9.469   -10.103 0.592   1.00 22.34 ? 23  PHE D HZ   1  
ATOM 7487   N N    . GLU D 1 24  ? 12.137  -9.299  -4.595  1.00 43.42 ? 24  GLU D N    1  
ATOM 7488   C CA   . GLU D 1 24  ? 12.259  -10.729 -4.927  1.00 72.53 ? 24  GLU D CA   1  
ATOM 7489   C C    . GLU D 1 24  ? 12.390  -11.548 -3.641  1.00 21.44 ? 24  GLU D C    1  
ATOM 7490   O O    . GLU D 1 24  ? 13.333  -11.362 -2.875  1.00 52.43 ? 24  GLU D O    1  
ATOM 7491   C CB   . GLU D 1 24  ? 13.493  -10.960 -5.840  1.00 35.34 ? 24  GLU D CB   1  
ATOM 7492   C CG   . GLU D 1 24  ? 13.467  -10.162 -7.159  1.00 20.10 ? 24  GLU D CG   1  
ATOM 7493   C CD   . GLU D 1 24  ? 14.725  -10.360 -8.016  1.00 34.05 ? 24  GLU D CD   1  
ATOM 7494   O OE1  . GLU D 1 24  ? 14.728  -11.244 -8.902  1.00 1.24  ? 24  GLU D OE1  1  
ATOM 7495   O OE2  . GLU D 1 24  ? 15.726  -9.644  -7.799  1.00 20.45 ? 24  GLU D OE2  1  
ATOM 7496   H H    . GLU D 1 24  ? 12.862  -8.872  -4.094  1.00 24.54 ? 24  GLU D H    1  
ATOM 7497   H HA   . GLU D 1 24  ? 11.360  -11.046 -5.463  1.00 52.21 ? 24  GLU D HA   1  
ATOM 7498   H HB2  . GLU D 1 24  ? 14.392  -10.681 -5.293  1.00 63.34 ? 24  GLU D HB2  1  
ATOM 7499   H HB3  . GLU D 1 24  ? 13.556  -12.017 -6.084  1.00 14.21 ? 24  GLU D HB3  1  
ATOM 7500   H HG2  . GLU D 1 24  ? 12.594  -10.467 -7.735  1.00 13.02 ? 24  GLU D HG2  1  
ATOM 7501   H HG3  . GLU D 1 24  ? 13.369  -9.110  -6.920  1.00 11.10 ? 24  GLU D HG3  1  
ATOM 7502   N N    . ALA D 1 25  ? 11.420  -12.429 -3.400  1.00 14.32 ? 25  ALA D N    1  
ATOM 7503   C CA   . ALA D 1 25  ? 11.469  -13.418 -2.315  1.00 31.01 ? 25  ALA D CA   1  
ATOM 7504   C C    . ALA D 1 25  ? 11.752  -14.799 -2.947  1.00 11.23 ? 25  ALA D C    1  
ATOM 7505   O O    . ALA D 1 25  ? 10.813  -15.505 -3.324  1.00 40.35 ? 25  ALA D O    1  
ATOM 7506   C CB   . ALA D 1 25  ? 10.145  -13.390 -1.516  1.00 42.25 ? 25  ALA D CB   1  
ATOM 7507   H H    . ALA D 1 25  ? 10.633  -12.415 -3.978  1.00 74.43 ? 25  ALA D H    1  
ATOM 7508   H HA   . ALA D 1 25  ? 12.281  -13.164 -1.637  1.00 73.13 ? 25  ALA D HA   1  
ATOM 7509   H HB1  . ALA D 1 25  ? 9.869   -12.373 -1.304  1.00 15.23 ? 25  ALA D HB1  1  
ATOM 7510   H HB2  . ALA D 1 25  ? 10.264  -13.928 -0.588  1.00 74.23 ? 25  ALA D HB2  1  
ATOM 7511   H HB3  . ALA D 1 25  ? 9.353   -13.852 -2.093  1.00 43.33 ? 25  ALA D HB3  1  
ATOM 7512   N N    . PRO D 1 26  ? 13.066  -15.179 -3.143  1.00 3.34  ? 26  PRO D N    1  
ATOM 7513   C CA   . PRO D 1 26  ? 13.446  -16.392 -3.916  1.00 70.32 ? 26  PRO D CA   1  
ATOM 7514   C C    . PRO D 1 26  ? 13.133  -17.699 -3.164  1.00 11.50 ? 26  PRO D C    1  
ATOM 7515   O O    . PRO D 1 26  ? 12.709  -18.688 -3.767  1.00 55.20 ? 26  PRO D O    1  
ATOM 7516   C CB   . PRO D 1 26  ? 14.969  -16.206 -4.132  1.00 32.14 ? 26  PRO D CB   1  
ATOM 7517   C CG   . PRO D 1 26  ? 15.427  -15.388 -2.964  1.00 11.14 ? 26  PRO D CG   1  
ATOM 7518   C CD   . PRO D 1 26  ? 14.275  -14.462 -2.627  1.00 32.01 ? 26  PRO D CD   1  
ATOM 7519   H HA   . PRO D 1 26  ? 12.945  -16.410 -4.882  1.00 51.33 ? 26  PRO D HA   1  
ATOM 7520   H HB2  . PRO D 1 26  ? 15.477  -17.168 -4.167  1.00 72.21 ? 26  PRO D HB2  1  
ATOM 7521   H HB3  . PRO D 1 26  ? 15.152  -15.668 -5.056  1.00 14.02 ? 26  PRO D HB3  1  
ATOM 7522   H HG2  . PRO D 1 26  ? 15.655  -16.040 -2.122  1.00 22.22 ? 26  PRO D HG2  1  
ATOM 7523   H HG3  . PRO D 1 26  ? 16.306  -14.809 -3.228  1.00 3.21  ? 26  PRO D HG3  1  
ATOM 7524   H HD2  . PRO D 1 26  ? 14.205  -14.315 -1.554  1.00 3.31  ? 26  PRO D HD2  1  
ATOM 7525   H HD3  . PRO D 1 26  ? 14.394  -13.505 -3.126  1.00 71.42 ? 26  PRO D HD3  1  
ATOM 7526   N N    . ASN D 1 27  ? 13.321  -17.671 -1.835  1.00 52.04 ? 27  ASN D N    1  
ATOM 7527   C CA   . ASN D 1 27  ? 13.115  -18.825 -0.944  1.00 32.33 ? 27  ASN D CA   1  
ATOM 7528   C C    . ASN D 1 27  ? 11.921  -18.530 -0.029  1.00 13.40 ? 27  ASN D C    1  
ATOM 7529   O O    . ASN D 1 27  ? 11.942  -18.902 1.133   1.00 22.15 ? 27  ASN D O    1  
ATOM 7530   C CB   . ASN D 1 27  ? 14.387  -19.054 -0.072  1.00 31.13 ? 27  ASN D CB   1  
ATOM 7531   C CG   . ASN D 1 27  ? 15.665  -19.308 -0.857  1.00 43.33 ? 27  ASN D CG   1  
ATOM 7532   O OD1  . ASN D 1 27  ? 15.644  -19.860 -1.956  1.00 40.51 ? 27  ASN D OD1  1  
ATOM 7533   N ND2  . ASN D 1 27  ? 16.789  -18.925 -0.284  1.00 64.25 ? 27  ASN D ND2  1  
ATOM 7534   H H    . ASN D 1 27  ? 13.600  -16.829 -1.427  1.00 33.23 ? 27  ASN D H    1  
ATOM 7535   H HA   . ASN D 1 27  ? 12.905  -19.721 -1.533  1.00 11.31 ? 27  ASN D HA   1  
ATOM 7536   H HB2  . ASN D 1 27  ? 14.543  -18.180 0.552   1.00 31.30 ? 27  ASN D HB2  1  
ATOM 7537   H HB3  . ASN D 1 27  ? 14.220  -19.912 0.577   1.00 42.33 ? 27  ASN D HB3  1  
ATOM 7538   H HD21 . ASN D 1 27  ? 16.737  -18.506 0.608   1.00 43.13 ? 27  ASN D HD21 1  
ATOM 7539   H HD22 . ASN D 1 27  ? 17.622  -19.074 -0.764  1.00 20.31 ? 27  ASN D HD22 1  
ATOM 7540   N N    . ALA D 1 28  ? 10.870  -17.911 -0.594  1.00 61.44 ? 28  ALA D N    1  
ATOM 7541   C CA   . ALA D 1 28  ? 9.772   -17.296 0.180   1.00 0.44  ? 28  ALA D CA   1  
ATOM 7542   C C    . ALA D 1 28  ? 9.133   -18.253 1.238   1.00 45.21 ? 28  ALA D C    1  
ATOM 7543   O O    . ALA D 1 28  ? 9.331   -18.009 2.433   1.00 24.13 ? 28  ALA D O    1  
ATOM 7544   C CB   . ALA D 1 28  ? 8.752   -16.648 -0.772  1.00 5.43  ? 28  ALA D CB   1  
ATOM 7545   H H    . ALA D 1 28  ? 10.834  -17.855 -1.571  1.00 63.10 ? 28  ALA D H    1  
ATOM 7546   H HA   . ALA D 1 28  ? 10.235  -16.485 0.738   1.00 0.15  ? 28  ALA D HA   1  
ATOM 7547   H HB1  . ALA D 1 28  ? 8.051   -16.049 -0.209  1.00 34.33 ? 28  ALA D HB1  1  
ATOM 7548   H HB2  . ALA D 1 28  ? 8.214   -17.414 -1.313  1.00 12.04 ? 28  ALA D HB2  1  
ATOM 7549   H HB3  . ALA D 1 28  ? 9.270   -16.015 -1.482  1.00 61.32 ? 28  ALA D HB3  1  
ATOM 7550   N N    . PRO D 1 29  ? 8.443   -19.398 0.886   1.00 34.10 ? 29  PRO D N    1  
ATOM 7551   C CA   . PRO D 1 29  ? 7.848   -20.273 1.931   1.00 51.03 ? 29  PRO D CA   1  
ATOM 7552   C C    . PRO D 1 29  ? 8.876   -21.247 2.559   1.00 71.32 ? 29  PRO D C    1  
ATOM 7553   O O    . PRO D 1 29  ? 8.597   -21.907 3.572   1.00 35.11 ? 29  PRO D O    1  
ATOM 7554   C CB   . PRO D 1 29  ? 6.750   -20.998 1.143   1.00 43.04 ? 29  PRO D CB   1  
ATOM 7555   C CG   . PRO D 1 29  ? 7.334   -21.193 -0.221  1.00 11.44 ? 29  PRO D CG   1  
ATOM 7556   C CD   . PRO D 1 29  ? 8.189   -19.959 -0.488  1.00 72.51 ? 29  PRO D CD   1  
ATOM 7557   H HA   . PRO D 1 29  ? 7.396   -19.684 2.726   1.00 43.22 ? 29  PRO D HA   1  
ATOM 7558   H HB2  . PRO D 1 29  ? 6.491   -21.946 1.615   1.00 73.40 ? 29  PRO D HB2  1  
ATOM 7559   H HB3  . PRO D 1 29  ? 5.867   -20.362 1.080   1.00 3.04  ? 29  PRO D HB3  1  
ATOM 7560   H HG2  . PRO D 1 29  ? 7.945   -22.095 -0.236  1.00 33.03 ? 29  PRO D HG2  1  
ATOM 7561   H HG3  . PRO D 1 29  ? 6.537   -21.269 -0.955  1.00 70.13 ? 29  PRO D HG3  1  
ATOM 7562   H HD2  . PRO D 1 29  ? 9.124   -20.235 -0.975  1.00 64.53 ? 29  PRO D HD2  1  
ATOM 7563   H HD3  . PRO D 1 29  ? 7.650   -19.242 -1.094  1.00 25.44 ? 29  PRO D HD3  1  
ATOM 7564   N N    . HIS D 1 30  ? 10.069  -21.304 1.940   1.00 75.35 ? 30  HIS D N    1  
ATOM 7565   C CA   . HIS D 1 30  ? 11.208  -22.125 2.388   1.00 33.15 ? 30  HIS D CA   1  
ATOM 7566   C C    . HIS D 1 30  ? 11.860  -21.502 3.632   1.00 13.32 ? 30  HIS D C    1  
ATOM 7567   O O    . HIS D 1 30  ? 12.203  -22.216 4.592   1.00 32.01 ? 30  HIS D O    1  
ATOM 7568   C CB   . HIS D 1 30  ? 12.226  -22.229 1.218   1.00 51.33 ? 30  HIS D CB   1  
ATOM 7569   C CG   . HIS D 1 30  ? 13.536  -22.938 1.497   1.00 33.54 ? 30  HIS D CG   1  
ATOM 7570   N ND1  . HIS D 1 30  ? 14.658  -22.733 0.729   1.00 12.25 ? 30  HIS D ND1  1  
ATOM 7571   C CD2  . HIS D 1 30  ? 13.888  -23.870 2.417   1.00 23.45 ? 30  HIS D CD2  1  
ATOM 7572   C CE1  . HIS D 1 30  ? 15.631  -23.504 1.156   1.00 24.45 ? 30  HIS D CE1  1  
ATOM 7573   N NE2  . HIS D 1 30  ? 15.197  -24.204 2.179   1.00 4.34  ? 30  HIS D NE2  1  
ATOM 7574   H H    . HIS D 1 30  ? 10.192  -20.759 1.140   1.00 63.24 ? 30  HIS D H    1  
ATOM 7575   H HA   . HIS D 1 30  ? 10.838  -23.119 2.631   1.00 23.02 ? 30  HIS D HA   1  
ATOM 7576   H HB2  . HIS D 1 30  ? 11.755  -22.757 0.402   1.00 42.52 ? 30  HIS D HB2  1  
ATOM 7577   H HB3  . HIS D 1 30  ? 12.464  -21.224 0.881   1.00 25.30 ? 30  HIS D HB3  1  
ATOM 7578   H HD1  . HIS D 1 30  ? 14.731  -22.108 -0.019  1.00 53.23 ? 30  HIS D HD1  1  
ATOM 7579   H HD2  . HIS D 1 30  ? 13.263  -24.253 3.212   1.00 42.43 ? 30  HIS D HD2  1  
ATOM 7580   H HE1  . HIS D 1 30  ? 16.622  -23.546 0.740   1.00 15.10 ? 30  HIS D HE1  1  
ATOM 7581   H HE2  . HIS D 1 30  ? 15.783  -24.642 2.828   1.00 37.99 ? 30  HIS D HE2  1  
ATOM 7582   N N    . VAL D 1 31  ? 12.014  -20.171 3.609   1.00 4.22  ? 31  VAL D N    1  
ATOM 7583   C CA   . VAL D 1 31  ? 12.735  -19.442 4.656   1.00 4.52  ? 31  VAL D CA   1  
ATOM 7584   C C    . VAL D 1 31  ? 11.824  -19.239 5.873   1.00 25.33 ? 31  VAL D C    1  
ATOM 7585   O O    . VAL D 1 31  ? 12.295  -19.308 6.993   1.00 23.32 ? 31  VAL D O    1  
ATOM 7586   C CB   . VAL D 1 31  ? 13.307  -18.054 4.145   1.00 61.15 ? 31  VAL D CB   1  
ATOM 7587   C CG1  . VAL D 1 31  ? 12.186  -17.017 3.879   1.00 51.01 ? 31  VAL D CG1  1  
ATOM 7588   C CG2  . VAL D 1 31  ? 14.384  -17.489 5.110   1.00 13.51 ? 31  VAL D CG2  1  
ATOM 7589   H H    . VAL D 1 31  ? 11.611  -19.663 2.876   1.00 4.04  ? 31  VAL D H    1  
ATOM 7590   H HA   . VAL D 1 31  ? 13.579  -20.067 4.956   1.00 3.31  ? 31  VAL D HA   1  
ATOM 7591   H HB   . VAL D 1 31  ? 13.794  -18.245 3.189   1.00 12.42 ? 31  VAL D HB   1  
ATOM 7592   H HG11 . VAL D 1 31  ? 11.485  -17.417 3.157   1.00 61.32 ? 31  VAL D HG11 1  
ATOM 7593   H HG12 . VAL D 1 31  ? 12.610  -16.100 3.489   1.00 1.02  ? 31  VAL D HG12 1  
ATOM 7594   H HG13 . VAL D 1 31  ? 11.657  -16.800 4.805   1.00 64.02 ? 31  VAL D HG13 1  
ATOM 7595   H HG21 . VAL D 1 31  ? 15.187  -18.209 5.222   1.00 75.35 ? 31  VAL D HG21 1  
ATOM 7596   H HG22 . VAL D 1 31  ? 13.947  -17.291 6.080   1.00 32.51 ? 31  VAL D HG22 1  
ATOM 7597   H HG23 . VAL D 1 31  ? 14.789  -16.568 4.708   1.00 75.42 ? 31  VAL D HG23 1  
ATOM 7598   N N    . PHE D 1 32  ? 10.497  -19.060 5.626   1.00 5.10  ? 32  PHE D N    1  
ATOM 7599   C CA   . PHE D 1 32  ? 9.482   -18.757 6.675   1.00 51.52 ? 32  PHE D CA   1  
ATOM 7600   C C    . PHE D 1 32  ? 9.439   -19.797 7.816   1.00 13.31 ? 32  PHE D C    1  
ATOM 7601   O O    . PHE D 1 32  ? 8.969   -19.499 8.917   1.00 53.55 ? 32  PHE D O    1  
ATOM 7602   C CB   . PHE D 1 32  ? 8.062   -18.613 6.049   1.00 74.04 ? 32  PHE D CB   1  
ATOM 7603   C CG   . PHE D 1 32  ? 7.828   -17.354 5.199   1.00 33.13 ? 32  PHE D CG   1  
ATOM 7604   C CD1  . PHE D 1 32  ? 8.534   -16.173 5.438   1.00 65.14 ? 32  PHE D CD1  1  
ATOM 7605   C CD2  . PHE D 1 32  ? 6.866   -17.342 4.182   1.00 43.30 ? 32  PHE D CD2  1  
ATOM 7606   C CE1  . PHE D 1 32  ? 8.292   -15.038 4.689   1.00 13.31 ? 32  PHE D CE1  1  
ATOM 7607   C CE2  . PHE D 1 32  ? 6.635   -16.198 3.434   1.00 24.33 ? 32  PHE D CE2  1  
ATOM 7608   C CZ   . PHE D 1 32  ? 7.348   -15.049 3.685   1.00 12.12 ? 32  PHE D CZ   1  
ATOM 7609   H H    . PHE D 1 32  ? 10.194  -19.112 4.695   1.00 23.35 ? 32  PHE D H    1  
ATOM 7610   H HA   . PHE D 1 32  ? 9.759   -17.805 7.109   1.00 11.51 ? 32  PHE D HA   1  
ATOM 7611   H HB2  . PHE D 1 32  ? 7.876   -19.473 5.420   1.00 73.22 ? 32  PHE D HB2  1  
ATOM 7612   H HB3  . PHE D 1 32  ? 7.320   -18.605 6.843   1.00 61.04 ? 32  PHE D HB3  1  
ATOM 7613   H HD1  . PHE D 1 32  ? 9.284   -16.146 6.222   1.00 31.52 ? 32  PHE D HD1  1  
ATOM 7614   H HD2  . PHE D 1 32  ? 6.297   -18.240 3.975   1.00 62.13 ? 32  PHE D HD2  1  
ATOM 7615   H HE1  . PHE D 1 32  ? 8.848   -14.134 4.892   1.00 62.35 ? 32  PHE D HE1  1  
ATOM 7616   H HE2  . PHE D 1 32  ? 5.894   -16.209 2.647   1.00 33.41 ? 32  PHE D HE2  1  
ATOM 7617   H HZ   . PHE D 1 32  ? 7.166   -14.155 3.100   1.00 12.21 ? 32  PHE D HZ   1  
ATOM 7618   N N    . GLN D 1 33  ? 9.917   -21.010 7.533   1.00 12.20 ? 33  GLN D N    1  
ATOM 7619   C CA   . GLN D 1 33  ? 9.964   -22.105 8.519   1.00 3.23  ? 33  GLN D CA   1  
ATOM 7620   C C    . GLN D 1 33  ? 11.033  -21.815 9.597   1.00 33.11 ? 33  GLN D C    1  
ATOM 7621   O O    . GLN D 1 33  ? 10.853  -22.161 10.769  1.00 14.12 ? 33  GLN D O    1  
ATOM 7622   C CB   . GLN D 1 33  ? 10.267  -23.429 7.771   1.00 51.03 ? 33  GLN D CB   1  
ATOM 7623   C CG   . GLN D 1 33  ? 9.315   -23.706 6.585   1.00 21.41 ? 33  GLN D CG   1  
ATOM 7624   C CD   . GLN D 1 33  ? 9.705   -24.946 5.779   1.00 4.23  ? 33  GLN D CD   1  
ATOM 7625   O OE1  . GLN D 1 33  ? 9.227   -26.051 6.031   1.00 24.40 ? 33  GLN D OE1  1  
ATOM 7626   N NE2  . GLN D 1 33  ? 10.607  -24.771 4.828   1.00 42.21 ? 33  GLN D NE2  1  
ATOM 7627   H H    . GLN D 1 33  ? 10.253  -21.175 6.629   1.00 30.01 ? 33  GLN D H    1  
ATOM 7628   H HA   . GLN D 1 33  ? 8.988   -22.181 8.998   1.00 72.04 ? 33  GLN D HA   1  
ATOM 7629   H HB2  . GLN D 1 33  ? 11.284  -23.390 7.389   1.00 30.52 ? 33  GLN D HB2  1  
ATOM 7630   H HB3  . GLN D 1 33  ? 10.191  -24.257 8.468   1.00 14.23 ? 33  GLN D HB3  1  
ATOM 7631   H HG2  . GLN D 1 33  ? 8.309   -23.844 6.971   1.00 23.14 ? 33  GLN D HG2  1  
ATOM 7632   H HG3  . GLN D 1 33  ? 9.318   -22.844 5.924   1.00 72.11 ? 33  GLN D HG3  1  
ATOM 7633   H HE21 . GLN D 1 33  ? 10.971  -23.873 4.692   1.00 20.31 ? 33  GLN D HE21 1  
ATOM 7634   H HE22 . GLN D 1 33  ? 10.868  -25.546 4.299   1.00 2.53  ? 33  GLN D HE22 1  
ATOM 7635   N N    . LYS D 1 34  ? 12.155  -21.195 9.171   1.00 43.05 ? 34  LYS D N    1  
ATOM 7636   C CA   . LYS D 1 34  ? 13.198  -20.672 10.076  1.00 54.21 ? 34  LYS D CA   1  
ATOM 7637   C C    . LYS D 1 34  ? 13.643  -19.237 9.661   1.00 31.12 ? 34  LYS D C    1  
ATOM 7638   O O    . LYS D 1 34  ? 14.813  -18.986 9.354   1.00 62.44 ? 34  LYS D O    1  
ATOM 7639   C CB   . LYS D 1 34  ? 14.364  -21.711 10.154  1.00 54.35 ? 34  LYS D CB   1  
ATOM 7640   C CG   . LYS D 1 34  ? 14.754  -22.402 8.805   1.00 54.22 ? 34  LYS D CG   1  
ATOM 7641   C CD   . LYS D 1 34  ? 15.619  -21.529 7.872   1.00 34.13 ? 34  LYS D CD   1  
ATOM 7642   C CE   . LYS D 1 34  ? 16.016  -22.227 6.561   1.00 64.41 ? 34  LYS D CE   1  
ATOM 7643   N NZ   . LYS D 1 34  ? 17.115  -21.493 5.874   1.00 62.25 ? 34  LYS D NZ   1  
ATOM 7644   H H    . LYS D 1 34  ? 12.276  -21.068 8.209   1.00 32.14 ? 34  LYS D H    1  
ATOM 7645   H HA   . LYS D 1 34  ? 12.758  -20.586 11.069  1.00 12.31 ? 34  LYS D HA   1  
ATOM 7646   H HB2  . LYS D 1 34  ? 15.245  -21.224 10.555  1.00 63.21 ? 34  LYS D HB2  1  
ATOM 7647   H HB3  . LYS D 1 34  ? 14.071  -22.494 10.851  1.00 15.41 ? 34  LYS D HB3  1  
ATOM 7648   H HG2  . LYS D 1 34  ? 15.307  -23.307 9.032   1.00 41.14 ? 34  LYS D HG2  1  
ATOM 7649   H HG3  . LYS D 1 34  ? 13.842  -22.677 8.283   1.00 43.15 ? 34  LYS D HG3  1  
ATOM 7650   H HD2  . LYS D 1 34  ? 15.069  -20.625 7.628   1.00 22.44 ? 34  LYS D HD2  1  
ATOM 7651   H HD3  . LYS D 1 34  ? 16.521  -21.251 8.407   1.00 0.34  ? 34  LYS D HD3  1  
ATOM 7652   H HE2  . LYS D 1 34  ? 16.353  -23.236 6.774   1.00 24.12 ? 34  LYS D HE2  1  
ATOM 7653   H HE3  . LYS D 1 34  ? 15.156  -22.267 5.903   1.00 53.01 ? 34  LYS D HE3  1  
ATOM 7654   H HZ1  . LYS D 1 34  ? 17.996  -21.567 6.425   1.00 25.02 ? 34  LYS D HZ1  1  
ATOM 7655   H HZ2  . LYS D 1 34  ? 16.874  -20.488 5.774   1.00 72.21 ? 34  LYS D HZ2  1  
ATOM 7656   H HZ3  . LYS D 1 34  ? 17.281  -21.890 4.933   1.00 41.05 ? 34  LYS D HZ3  1  
ATOM 7657   N N    . ASP D 1 35  ? 12.710  -18.282 9.723   1.00 22.51 ? 35  ASP D N    1  
ATOM 7658   C CA   . ASP D 1 35  ? 12.937  -16.884 9.279   1.00 41.12 ? 35  ASP D CA   1  
ATOM 7659   C C    . ASP D 1 35  ? 13.034  -15.967 10.495  1.00 4.23  ? 35  ASP D C    1  
ATOM 7660   O O    . ASP D 1 35  ? 12.018  -15.573 11.066  1.00 23.43 ? 35  ASP D O    1  
ATOM 7661   C CB   . ASP D 1 35  ? 11.825  -16.430 8.299   1.00 41.55 ? 35  ASP D CB   1  
ATOM 7662   C CG   . ASP D 1 35  ? 11.806  -14.915 8.023   1.00 50.20 ? 35  ASP D CG   1  
ATOM 7663   O OD1  . ASP D 1 35  ? 10.799  -14.237 8.346   1.00 21.13 ? 35  ASP D OD1  1  
ATOM 7664   O OD2  . ASP D 1 35  ? 12.803  -14.404 7.498   1.00 32.11 ? 35  ASP D OD2  1  
ATOM 7665   H H    . ASP D 1 35  ? 11.829  -18.513 10.080  1.00 73.14 ? 35  ASP D H    1  
ATOM 7666   H HA   . ASP D 1 35  ? 13.890  -16.847 8.749   1.00 62.55 ? 35  ASP D HA   1  
ATOM 7667   H HB2  . ASP D 1 35  ? 11.968  -16.943 7.353   1.00 44.01 ? 35  ASP D HB2  1  
ATOM 7668   H HB3  . ASP D 1 35  ? 10.867  -16.730 8.701   1.00 74.50 ? 35  ASP D HB3  1  
ATOM 7669   N N    . TRP D 1 36  ? 14.272  -15.657 10.910  1.00 10.30 ? 36  TRP D N    1  
ATOM 7670   C CA   . TRP D 1 36  ? 14.569  -14.979 12.194  1.00 42.42 ? 36  TRP D CA   1  
ATOM 7671   C C    . TRP D 1 36  ? 15.330  -13.682 11.882  1.00 43.50 ? 36  TRP D C    1  
ATOM 7672   O O    . TRP D 1 36  ? 15.102  -13.110 10.820  1.00 22.54 ? 36  TRP D O    1  
ATOM 7673   C CB   . TRP D 1 36  ? 15.368  -15.933 13.151  1.00 53.54 ? 36  TRP D CB   1  
ATOM 7674   C CG   . TRP D 1 36  ? 14.802  -17.344 13.255  1.00 62.32 ? 36  TRP D CG   1  
ATOM 7675   C CD1  . TRP D 1 36  ? 15.502  -18.511 13.132  1.00 41.23 ? 36  TRP D CD1  1  
ATOM 7676   C CD2  . TRP D 1 36  ? 13.424  -17.735 13.447  1.00 54.25 ? 36  TRP D CD2  1  
ATOM 7677   N NE1  . TRP D 1 36  ? 14.658  -19.583 13.229  1.00 44.21 ? 36  TRP D NE1  1  
ATOM 7678   C CE2  . TRP D 1 36  ? 13.382  -19.135 13.413  1.00 45.01 ? 36  TRP D CE2  1  
ATOM 7679   C CE3  . TRP D 1 36  ? 12.223  -17.040 13.621  1.00 3.01  ? 36  TRP D CE3  1  
ATOM 7680   C CZ2  . TRP D 1 36  ? 12.197  -19.851 13.568  1.00 23.34 ? 36  TRP D CZ2  1  
ATOM 7681   C CZ3  . TRP D 1 36  ? 11.056  -17.744 13.758  1.00 42.41 ? 36  TRP D CZ3  1  
ATOM 7682   C CH2  . TRP D 1 36  ? 11.044  -19.136 13.723  1.00 31.30 ? 36  TRP D CH2  1  
ATOM 7683   H H    . TRP D 1 36  ? 15.021  -15.869 10.315  1.00 65.11 ? 36  TRP D H    1  
ATOM 7684   H HA   . TRP D 1 36  ? 13.626  -14.707 12.671  1.00 42.10 ? 36  TRP D HA   1  
ATOM 7685   H HB2  . TRP D 1 36  ? 16.394  -16.012 12.807  1.00 43.20 ? 36  TRP D HB2  1  
ATOM 7686   H HB3  . TRP D 1 36  ? 15.368  -15.504 14.148  1.00 60.32 ? 36  TRP D HB3  1  
ATOM 7687   H HD1  . TRP D 1 36  ? 16.571  -18.567 12.982  1.00 42.04 ? 36  TRP D HD1  1  
ATOM 7688   H HE1  . TRP D 1 36  ? 14.926  -20.522 13.170  1.00 4.41  ? 36  TRP D HE1  1  
ATOM 7689   H HE3  . TRP D 1 36  ? 12.207  -15.958 13.650  1.00 74.14 ? 36  TRP D HE3  1  
ATOM 7690   H HZ2  . TRP D 1 36  ? 12.178  -20.935 13.546  1.00 22.45 ? 36  TRP D HZ2  1  
ATOM 7691   H HZ3  . TRP D 1 36  ? 10.117  -17.213 13.884  1.00 23.13 ? 36  TRP D HZ3  1  
ATOM 7692   H HH2  . TRP D 1 36  ? 10.095  -19.642 13.821  1.00 74.14 ? 36  TRP D HH2  1  
ATOM 7693   N N    . GLN D 1 37  ? 16.134  -13.168 12.838  1.00 52.35 ? 37  GLN D N    1  
ATOM 7694   C CA   . GLN D 1 37  ? 16.840  -11.875 12.699  1.00 14.25 ? 37  GLN D CA   1  
ATOM 7695   C C    . GLN D 1 37  ? 17.713  -11.791 11.411  1.00 20.20 ? 37  GLN D C    1  
ATOM 7696   O O    . GLN D 1 37  ? 18.738  -12.474 11.321  1.00 72.11 ? 37  GLN D O    1  
ATOM 7697   C CB   . GLN D 1 37  ? 17.679  -11.593 13.975  1.00 34.13 ? 37  GLN D CB   1  
ATOM 7698   C CG   . GLN D 1 37  ? 18.339  -10.199 13.995  1.00 54.53 ? 37  GLN D CG   1  
ATOM 7699   C CD   . GLN D 1 37  ? 19.017  -9.856  15.322  1.00 20.00 ? 37  GLN D CD   1  
ATOM 7700   O OE1  . GLN D 1 37  ? 19.477  -10.733 16.052  1.00 33.00 ? 37  GLN D OE1  1  
ATOM 7701   N NE2  . GLN D 1 37  ? 19.083  -8.577  15.642  1.00 44.45 ? 37  GLN D NE2  1  
ATOM 7702   H H    . GLN D 1 37  ? 16.257  -13.668 13.662  1.00 72.11 ? 37  GLN D H    1  
ATOM 7703   H HA   . GLN D 1 37  ? 16.067  -11.118 12.636  1.00 55.44 ? 37  GLN D HA   1  
ATOM 7704   H HB2  . GLN D 1 37  ? 17.030  -11.673 14.843  1.00 54.35 ? 37  GLN D HB2  1  
ATOM 7705   H HB3  . GLN D 1 37  ? 18.458  -12.346 14.058  1.00 64.10 ? 37  GLN D HB3  1  
ATOM 7706   H HG2  . GLN D 1 37  ? 19.090  -10.157 13.215  1.00 20.44 ? 37  GLN D HG2  1  
ATOM 7707   H HG3  . GLN D 1 37  ? 17.575  -9.458  13.791  1.00 13.23 ? 37  GLN D HG3  1  
ATOM 7708   H HE21 . GLN D 1 37  ? 18.698  -7.925  15.026  1.00 41.43 ? 37  GLN D HE21 1  
ATOM 7709   H HE22 . GLN D 1 37  ? 19.523  -8.336  16.482  1.00 12.32 ? 37  GLN D HE22 1  
ATOM 7710   N N    . PRO D 1 38  ? 17.293  -10.958 10.386  1.00 52.45 ? 38  PRO D N    1  
ATOM 7711   C CA   . PRO D 1 38  ? 18.027  -10.815 9.108   1.00 63.21 ? 38  PRO D CA   1  
ATOM 7712   C C    . PRO D 1 38  ? 19.343  -10.033 9.256   1.00 51.54 ? 38  PRO D C    1  
ATOM 7713   O O    . PRO D 1 38  ? 19.411  -9.043  10.004  1.00 64.25 ? 38  PRO D O    1  
ATOM 7714   C CB   . PRO D 1 38  ? 17.022  -10.056 8.170   1.00 60.14 ? 38  PRO D CB   1  
ATOM 7715   C CG   . PRO D 1 38  ? 15.710  -10.052 8.910   1.00 3.34  ? 38  PRO D CG   1  
ATOM 7716   C CD   . PRO D 1 38  ? 16.068  -10.109 10.377  1.00 35.31 ? 38  PRO D CD   1  
ATOM 7717   H HA   . PRO D 1 38  ? 18.242  -11.792 8.686   1.00 0.54  ? 38  PRO D HA   1  
ATOM 7718   H HB2  . PRO D 1 38  ? 17.360  -9.033  7.977   1.00 72.31 ? 38  PRO D HB2  1  
ATOM 7719   H HB3  . PRO D 1 38  ? 16.915  -10.582 7.228   1.00 44.44 ? 38  PRO D HB3  1  
ATOM 7720   H HG2  . PRO D 1 38  ? 15.154  -9.146  8.684   1.00 12.54 ? 38  PRO D HG2  1  
ATOM 7721   H HG3  . PRO D 1 38  ? 15.120  -10.924 8.641   1.00 32.31 ? 38  PRO D HG3  1  
ATOM 7722   H HD2  . PRO D 1 38  ? 16.276  -9.114  10.766  1.00 23.23 ? 38  PRO D HD2  1  
ATOM 7723   H HD3  . PRO D 1 38  ? 15.267  -10.570 10.945  1.00 33.30 ? 38  PRO D HD3  1  
ATOM 7724   N N    . GLU D 1 39  ? 20.384  -10.509 8.559   1.00 41.11 ? 39  GLU D N    1  
ATOM 7725   C CA   . GLU D 1 39  ? 21.619  -9.751  8.350   1.00 74.04 ? 39  GLU D CA   1  
ATOM 7726   C C    . GLU D 1 39  ? 21.512  -9.060  6.988   1.00 72.11 ? 39  GLU D C    1  
ATOM 7727   O O    . GLU D 1 39  ? 21.410  -9.718  5.948   1.00 41.52 ? 39  GLU D O    1  
ATOM 7728   C CB   . GLU D 1 39  ? 22.852  -10.676 8.408   1.00 73.22 ? 39  GLU D CB   1  
ATOM 7729   C CG   . GLU D 1 39  ? 24.208  -9.948  8.274   1.00 44.53 ? 39  GLU D CG   1  
ATOM 7730   C CD   . GLU D 1 39  ? 25.404  -10.885 8.491   1.00 32.15 ? 39  GLU D CD   1  
ATOM 7731   O OE1  . GLU D 1 39  ? 25.902  -10.980 9.639   1.00 44.22 ? 39  GLU D OE1  1  
ATOM 7732   O OE2  . GLU D 1 39  ? 25.825  -11.565 7.530   1.00 32.05 ? 39  GLU D OE2  1  
ATOM 7733   H H    . GLU D 1 39  ? 20.320  -11.407 8.171   1.00 24.25 ? 39  GLU D H    1  
ATOM 7734   H HA   . GLU D 1 39  ? 21.702  -8.995  9.136   1.00 43.53 ? 39  GLU D HA   1  
ATOM 7735   H HB2  . GLU D 1 39  ? 22.837  -11.199 9.358   1.00 71.34 ? 39  GLU D HB2  1  
ATOM 7736   H HB3  . GLU D 1 39  ? 22.778  -11.412 7.612   1.00 4.24  ? 39  GLU D HB3  1  
ATOM 7737   H HG2  . GLU D 1 39  ? 24.273  -9.514  7.279   1.00 3.45  ? 39  GLU D HG2  1  
ATOM 7738   H HG3  . GLU D 1 39  ? 24.252  -9.143  9.003   1.00 24.12 ? 39  GLU D HG3  1  
ATOM 7739   N N    . VAL D 1 40  ? 21.511  -7.736  7.021   1.00 22.12 ? 40  VAL D N    1  
ATOM 7740   C CA   . VAL D 1 40  ? 21.210  -6.889  5.863   1.00 74.45 ? 40  VAL D CA   1  
ATOM 7741   C C    . VAL D 1 40  ? 22.478  -6.276  5.246   1.00 24.12 ? 40  VAL D C    1  
ATOM 7742   O O    . VAL D 1 40  ? 23.476  -6.017  5.931   1.00 60.53 ? 40  VAL D O    1  
ATOM 7743   C CB   . VAL D 1 40  ? 20.184  -5.758  6.255   1.00 33.10 ? 40  VAL D CB   1  
ATOM 7744   C CG1  . VAL D 1 40  ? 18.745  -6.316  6.360   1.00 30.22 ? 40  VAL D CG1  1  
ATOM 7745   C CG2  . VAL D 1 40  ? 20.606  -5.054  7.574   1.00 4.33  ? 40  VAL D CG2  1  
ATOM 7746   H H    . VAL D 1 40  ? 21.736  -7.301  7.868   1.00 51.12 ? 40  VAL D H    1  
ATOM 7747   H HA   . VAL D 1 40  ? 20.738  -7.516  5.103   1.00 4.53  ? 40  VAL D HA   1  
ATOM 7748   H HB   . VAL D 1 40  ? 20.186  -5.009  5.463   1.00 71.42 ? 40  VAL D HB   1  
ATOM 7749   H HG11 . VAL D 1 40  ? 18.695  -7.086  7.121   1.00 12.31 ? 40  VAL D HG11 1  
ATOM 7750   H HG12 . VAL D 1 40  ? 18.451  -6.738  5.408   1.00 13.42 ? 40  VAL D HG12 1  
ATOM 7751   H HG13 . VAL D 1 40  ? 18.065  -5.515  6.613   1.00 12.43 ? 40  VAL D HG13 1  
ATOM 7752   H HG21 . VAL D 1 40  ? 20.646  -5.774  8.382   1.00 42.21 ? 40  VAL D HG21 1  
ATOM 7753   H HG22 . VAL D 1 40  ? 19.895  -4.277  7.820   1.00 4.51  ? 40  VAL D HG22 1  
ATOM 7754   H HG23 . VAL D 1 40  ? 21.585  -4.607  7.447   1.00 0.01  ? 40  VAL D HG23 1  
ATOM 7755   N N    . LYS D 1 41  ? 22.392  -6.057  3.924   1.00 22.12 ? 41  LYS D N    1  
ATOM 7756   C CA   . LYS D 1 41  ? 23.419  -5.406  3.091   1.00 32.52 ? 41  LYS D CA   1  
ATOM 7757   C C    . LYS D 1 41  ? 22.752  -4.268  2.294   1.00 4.33  ? 41  LYS D C    1  
ATOM 7758   O O    . LYS D 1 41  ? 21.616  -4.414  1.828   1.00 51.24 ? 41  LYS D O    1  
ATOM 7759   C CB   . LYS D 1 41  ? 24.096  -6.433  2.130   1.00 5.34  ? 41  LYS D CB   1  
ATOM 7760   C CG   . LYS D 1 41  ? 24.995  -5.808  1.032   1.00 73.14 ? 41  LYS D CG   1  
ATOM 7761   C CD   . LYS D 1 41  ? 26.200  -5.014  1.598   1.00 62.30 ? 41  LYS D CD   1  
ATOM 7762   C CE   . LYS D 1 41  ? 26.902  -4.157  0.530   1.00 14.24 ? 41  LYS D CE   1  
ATOM 7763   N NZ   . LYS D 1 41  ? 27.199  -4.920  -0.707  1.00 10.14 ? 41  LYS D NZ   1  
ATOM 7764   H H    . LYS D 1 41  ? 21.574  -6.349  3.474   1.00 2.14  ? 41  LYS D H    1  
ATOM 7765   H HA   . LYS D 1 41  ? 24.176  -4.980  3.750   1.00 40.54 ? 41  LYS D HA   1  
ATOM 7766   H HB2  . LYS D 1 41  ? 24.707  -7.108  2.721   1.00 20.23 ? 41  LYS D HB2  1  
ATOM 7767   H HB3  . LYS D 1 41  ? 23.320  -7.022  1.640   1.00 73.44 ? 41  LYS D HB3  1  
ATOM 7768   H HG2  . LYS D 1 41  ? 25.372  -6.603  0.395   1.00 25.21 ? 41  LYS D HG2  1  
ATOM 7769   H HG3  . LYS D 1 41  ? 24.385  -5.143  0.429   1.00 54.23 ? 41  LYS D HG3  1  
ATOM 7770   H HD2  . LYS D 1 41  ? 25.850  -4.355  2.387   1.00 42.13 ? 41  LYS D HD2  1  
ATOM 7771   H HD3  . LYS D 1 41  ? 26.917  -5.712  2.017   1.00 3.02  ? 41  LYS D HD3  1  
ATOM 7772   H HE2  . LYS D 1 41  ? 26.265  -3.321  0.272   1.00 33.41 ? 41  LYS D HE2  1  
ATOM 7773   H HE3  . LYS D 1 41  ? 27.833  -3.777  0.936   1.00 43.34 ? 41  LYS D HE3  1  
ATOM 7774   H HZ1  . LYS D 1 41  ? 27.643  -4.297  -1.413  1.00 31.11 ? 41  LYS D HZ1  1  
ATOM 7775   H HZ2  . LYS D 1 41  ? 26.317  -5.295  -1.114  1.00 2.34  ? 41  LYS D HZ2  1  
ATOM 7776   H HZ3  . LYS D 1 41  ? 27.842  -5.709  -0.503  1.00 14.35 ? 41  LYS D HZ3  1  
ATOM 7777   N N    . LEU D 1 42  ? 23.455  -3.126  2.183   1.00 15.30 ? 42  LEU D N    1  
ATOM 7778   C CA   . LEU D 1 42  ? 22.963  -1.937  1.469   1.00 62.34 ? 42  LEU D CA   1  
ATOM 7779   C C    . LEU D 1 42  ? 23.949  -1.592  0.330   1.00 21.52 ? 42  LEU D C    1  
ATOM 7780   O O    . LEU D 1 42  ? 25.114  -1.256  0.584   1.00 0.42  ? 42  LEU D O    1  
ATOM 7781   C CB   . LEU D 1 42  ? 22.803  -0.750  2.482   1.00 12.24 ? 42  LEU D CB   1  
ATOM 7782   C CG   . LEU D 1 42  ? 21.643  0.277   2.215   1.00 53.31 ? 42  LEU D CG   1  
ATOM 7783   C CD1  . LEU D 1 42  ? 21.612  1.369   3.312   1.00 22.04 ? 42  LEU D CD1  1  
ATOM 7784   C CD2  . LEU D 1 42  ? 21.716  0.905   0.804   1.00 23.11 ? 42  LEU D CD2  1  
ATOM 7785   H H    . LEU D 1 42  ? 24.336  -3.079  2.606   1.00 63.10 ? 42  LEU D H    1  
ATOM 7786   H HA   . LEU D 1 42  ? 21.989  -2.170  1.036   1.00 15.33 ? 42  LEU D HA   1  
ATOM 7787   H HB2  . LEU D 1 42  ? 22.636  -1.178  3.466   1.00 25.34 ? 42  LEU D HB2  1  
ATOM 7788   H HB3  . LEU D 1 42  ? 23.739  -0.199  2.524   1.00 51.04 ? 42  LEU D HB3  1  
ATOM 7789   H HG   . LEU D 1 42  ? 20.699  -0.253  2.277   1.00 1.21  ? 42  LEU D HG   1  
ATOM 7790   H HD11 . LEU D 1 42  ? 21.481  0.906   4.284   1.00 2.24  ? 42  LEU D HD11 1  
ATOM 7791   H HD12 . LEU D 1 42  ? 20.783  2.042   3.134   1.00 40.33 ? 42  LEU D HD12 1  
ATOM 7792   H HD13 . LEU D 1 42  ? 22.536  1.933   3.305   1.00 41.24 ? 42  LEU D HD13 1  
ATOM 7793   H HD21 . LEU D 1 42  ? 22.660  1.421   0.678   1.00 70.31 ? 42  LEU D HD21 1  
ATOM 7794   H HD22 . LEU D 1 42  ? 20.905  1.607   0.670   1.00 25.21 ? 42  LEU D HD22 1  
ATOM 7795   H HD23 . LEU D 1 42  ? 21.633  0.126   0.054   1.00 44.30 ? 42  LEU D HD23 1  
ATOM 7796   N N    . ASP D 1 43  ? 23.474  -1.712  -0.915  1.00 22.41 ? 43  ASP D N    1  
ATOM 7797   C CA   . ASP D 1 43  ? 24.204  -1.289  -2.126  1.00 41.24 ? 43  ASP D CA   1  
ATOM 7798   C C    . ASP D 1 43  ? 23.516  -0.046  -2.699  1.00 15.23 ? 43  ASP D C    1  
ATOM 7799   O O    . ASP D 1 43  ? 22.292  0.056   -2.664  1.00 43.30 ? 43  ASP D O    1  
ATOM 7800   C CB   . ASP D 1 43  ? 24.216  -2.419  -3.196  1.00 42.23 ? 43  ASP D CB   1  
ATOM 7801   C CG   . ASP D 1 43  ? 25.064  -3.640  -2.797  1.00 63.03 ? 43  ASP D CG   1  
ATOM 7802   O OD1  . ASP D 1 43  ? 26.256  -3.715  -3.180  1.00 74.34 ? 43  ASP D OD1  1  
ATOM 7803   O OD2  . ASP D 1 43  ? 24.552  -4.530  -2.083  1.00 71.51 ? 43  ASP D OD2  1  
ATOM 7804   H H    . ASP D 1 43  ? 22.580  -2.099  -1.031  1.00 60.35 ? 43  ASP D H    1  
ATOM 7805   H HA   . ASP D 1 43  ? 25.228  -1.039  -1.851  1.00 5.41  ? 43  ASP D HA   1  
ATOM 7806   H HB2  . ASP D 1 43  ? 23.196  -2.754  -3.364  1.00 45.52 ? 43  ASP D HB2  1  
ATOM 7807   H HB3  . ASP D 1 43  ? 24.599  -2.019  -4.128  1.00 31.40 ? 43  ASP D HB3  1  
ATOM 7808   N N    . LEU D 1 44  ? 24.305  0.909   -3.213  1.00 53.13 ? 44  LEU D N    1  
ATOM 7809   C CA   . LEU D 1 44  ? 23.773  2.156   -3.809  1.00 43.45 ? 44  LEU D CA   1  
ATOM 7810   C C    . LEU D 1 44  ? 24.253  2.270   -5.259  1.00 44.34 ? 44  LEU D C    1  
ATOM 7811   O O    . LEU D 1 44  ? 25.360  1.852   -5.581  1.00 61.21 ? 44  LEU D O    1  
ATOM 7812   C CB   . LEU D 1 44  ? 24.192  3.421   -2.993  1.00 12.24 ? 44  LEU D CB   1  
ATOM 7813   C CG   . LEU D 1 44  ? 23.753  3.450   -1.481  1.00 42.44 ? 44  LEU D CG   1  
ATOM 7814   C CD1  . LEU D 1 44  ? 24.743  2.674   -0.577  1.00 44.33 ? 44  LEU D CD1  1  
ATOM 7815   C CD2  . LEU D 1 44  ? 23.546  4.898   -0.978  1.00 4.52  ? 44  LEU D CD2  1  
ATOM 7816   H H    . LEU D 1 44  ? 25.272  0.767   -3.210  1.00 51.54 ? 44  LEU D H    1  
ATOM 7817   H HA   . LEU D 1 44  ? 22.680  2.098   -3.815  1.00 73.52 ? 44  LEU D HA   1  
ATOM 7818   H HB2  . LEU D 1 44  ? 25.277  3.519   -3.040  1.00 23.44 ? 44  LEU D HB2  1  
ATOM 7819   H HB3  . LEU D 1 44  ? 23.764  4.289   -3.485  1.00 1.42  ? 44  LEU D HB3  1  
ATOM 7820   H HG   . LEU D 1 44  ? 22.793  2.947   -1.392  1.00 13.32 ? 44  LEU D HG   1  
ATOM 7821   H HD11 . LEU D 1 44  ? 24.798  1.643   -0.901  1.00 43.25 ? 44  LEU D HD11 1  
ATOM 7822   H HD12 . LEU D 1 44  ? 24.395  2.700   0.447   1.00 62.23 ? 44  LEU D HD12 1  
ATOM 7823   H HD13 . LEU D 1 44  ? 25.727  3.123   -0.632  1.00 15.22 ? 44  LEU D HD13 1  
ATOM 7824   H HD21 . LEU D 1 44  ? 23.214  4.884   0.050   1.00 14.02 ? 44  LEU D HD21 1  
ATOM 7825   H HD22 . LEU D 1 44  ? 22.796  5.387   -1.586  1.00 51.43 ? 44  LEU D HD22 1  
ATOM 7826   H HD23 . LEU D 1 44  ? 24.476  5.447   -1.049  1.00 23.42 ? 44  LEU D HD23 1  
ATOM 7827   N N    . ASP D 1 45  ? 23.399  2.824   -6.119  1.00 54.45 ? 45  ASP D N    1  
ATOM 7828   C CA   . ASP D 1 45  ? 23.701  3.076   -7.540  1.00 3.31  ? 45  ASP D CA   1  
ATOM 7829   C C    . ASP D 1 45  ? 22.925  4.317   -7.988  1.00 25.20 ? 45  ASP D C    1  
ATOM 7830   O O    . ASP D 1 45  ? 21.970  4.727   -7.326  1.00 31.10 ? 45  ASP D O    1  
ATOM 7831   C CB   . ASP D 1 45  ? 23.354  1.839   -8.416  1.00 70.34 ? 45  ASP D CB   1  
ATOM 7832   C CG   . ASP D 1 45  ? 23.683  2.028   -9.914  1.00 60.31 ? 45  ASP D CG   1  
ATOM 7833   O OD1  . ASP D 1 45  ? 24.882  2.056   -10.262 1.00 42.12 ? 45  ASP D OD1  1  
ATOM 7834   O OD2  . ASP D 1 45  ? 22.750  2.180   -10.739 1.00 34.03 ? 45  ASP D OD2  1  
ATOM 7835   H H    . ASP D 1 45  ? 22.508  3.079   -5.789  1.00 3.12  ? 45  ASP D H    1  
ATOM 7836   H HA   . ASP D 1 45  ? 24.765  3.290   -7.627  1.00 12.51 ? 45  ASP D HA   1  
ATOM 7837   H HB2  . ASP D 1 45  ? 23.915  0.987   -8.051  1.00 73.04 ? 45  ASP D HB2  1  
ATOM 7838   H HB3  . ASP D 1 45  ? 22.296  1.622   -8.311  1.00 23.13 ? 45  ASP D HB3  1  
ATOM 7839   N N    . THR D 1 46  ? 23.370  4.944   -9.077  1.00 12.14 ? 46  THR D N    1  
ATOM 7840   C CA   . THR D 1 46  ? 22.736  6.149   -9.624  1.00 74.10 ? 46  THR D CA   1  
ATOM 7841   C C    . THR D 1 46  ? 22.630  6.054   -11.155 1.00 44.21 ? 46  THR D C    1  
ATOM 7842   O O    . THR D 1 46  ? 23.215  5.161   -11.782 1.00 50.22 ? 46  THR D O    1  
ATOM 7843   C CB   . THR D 1 46  ? 23.541  7.427   -9.199  1.00 43.51 ? 46  THR D CB   1  
ATOM 7844   O OG1  . THR D 1 46  ? 22.867  8.630   -9.613  1.00 13.44 ? 46  THR D OG1  1  
ATOM 7845   C CG2  . THR D 1 46  ? 24.968  7.425   -9.770  1.00 25.03 ? 46  THR D CG2  1  
ATOM 7846   H H    . THR D 1 46  ? 24.150  4.574   -9.547  1.00 4.11  ? 46  THR D H    1  
ATOM 7847   H HA   . THR D 1 46  ? 21.726  6.232   -9.218  1.00 23.43 ? 46  THR D HA   1  
ATOM 7848   H HB   . THR D 1 46  ? 23.611  7.436   -8.113  1.00 1.21  ? 46  THR D HB   1  
ATOM 7849   H HG1  . THR D 1 46  ? 21.993  8.659   -9.217  1.00 0.11  ? 46  THR D HG1  1  
ATOM 7850   H HG21 . THR D 1 46  ? 25.491  8.316   -9.443  1.00 64.14 ? 46  THR D HG21 1  
ATOM 7851   H HG22 . THR D 1 46  ? 24.931  7.414   -10.851 1.00 33.32 ? 46  THR D HG22 1  
ATOM 7852   H HG23 . THR D 1 46  ? 25.503  6.551   -9.422  1.00 52.33 ? 46  THR D HG23 1  
ATOM 7853   N N    . ALA D 1 47  ? 21.863  6.985   -11.729 1.00 24.24 ? 47  ALA D N    1  
ATOM 7854   C CA   . ALA D 1 47  ? 21.713  7.164   -13.178 1.00 23.34 ? 47  ALA D CA   1  
ATOM 7855   C C    . ALA D 1 47  ? 21.404  8.633   -13.451 1.00 72.34 ? 47  ALA D C    1  
ATOM 7856   O O    . ALA D 1 47  ? 20.861  9.324   -12.580 1.00 25.42 ? 47  ALA D O    1  
ATOM 7857   C CB   . ALA D 1 47  ? 20.610  6.258   -13.741 1.00 40.14 ? 47  ALA D CB   1  
ATOM 7858   H H    . ALA D 1 47  ? 21.376  7.605   -11.142 1.00 31.54 ? 47  ALA D H    1  
ATOM 7859   H HA   . ALA D 1 47  ? 22.656  6.908   -13.659 1.00 3.12  ? 47  ALA D HA   1  
ATOM 7860   H HB1  . ALA D 1 47  ? 20.794  5.238   -13.446 1.00 54.42 ? 47  ALA D HB1  1  
ATOM 7861   H HB2  . ALA D 1 47  ? 20.598  6.317   -14.823 1.00 52.12 ? 47  ALA D HB2  1  
ATOM 7862   H HB3  . ALA D 1 47  ? 19.645  6.568   -13.360 1.00 63.12 ? 47  ALA D HB3  1  
ATOM 7863   N N    . SER D 1 48  ? 21.742  9.111   -14.650 1.00 14.51 ? 48  SER D N    1  
ATOM 7864   C CA   . SER D 1 48  ? 21.603  10.529  -14.996 1.00 43.23 ? 48  SER D CA   1  
ATOM 7865   C C    . SER D 1 48  ? 21.319  10.707  -16.490 1.00 63.24 ? 48  SER D C    1  
ATOM 7866   O O    . SER D 1 48  ? 21.766  9.901   -17.314 1.00 1.24  ? 48  SER D O    1  
ATOM 7867   C CB   . SER D 1 48  ? 22.903  11.262  -14.598 1.00 73.42 ? 48  SER D CB   1  
ATOM 7868   O OG   . SER D 1 48  ? 24.048  10.675  -15.201 1.00 25.34 ? 48  SER D OG   1  
ATOM 7869   H H    . SER D 1 48  ? 22.097  8.494   -15.326 1.00 43.13 ? 48  SER D H    1  
ATOM 7870   H HA   . SER D 1 48  ? 20.770  10.947  -14.431 1.00 54.34 ? 48  SER D HA   1  
ATOM 7871   H HB2  . SER D 1 48  ? 22.849  12.296  -14.908 1.00 11.43 ? 48  SER D HB2  1  
ATOM 7872   H HB3  . SER D 1 48  ? 23.024  11.222  -13.524 1.00 51.10 ? 48  SER D HB3  1  
ATOM 7873   H HG   . SER D 1 48  ? 24.006  9.716   -15.109 1.00 74.32 ? 48  SER D HG   1  
ATOM 7874   N N    . SER D 1 49  ? 20.597  11.793  -16.807 1.00 14.43 ? 49  SER D N    1  
ATOM 7875   C CA   . SER D 1 49  ? 20.281  12.206  -18.181 1.00 1.43  ? 49  SER D CA   1  
ATOM 7876   C C    . SER D 1 49  ? 19.567  13.567  -18.141 1.00 22.35 ? 49  SER D C    1  
ATOM 7877   O O    . SER D 1 49  ? 18.599  13.735  -17.380 1.00 73.13 ? 49  SER D O    1  
ATOM 7878   C CB   . SER D 1 49  ? 19.389  11.157  -18.907 1.00 54.10 ? 49  SER D CB   1  
ATOM 7879   O OG   . SER D 1 49  ? 18.162  10.923  -18.218 1.00 41.33 ? 49  SER D OG   1  
ATOM 7880   H H    . SER D 1 49  ? 20.258  12.350  -16.072 1.00 51.34 ? 49  SER D H    1  
ATOM 7881   H HA   . SER D 1 49  ? 21.219  12.314  -18.720 1.00 34.50 ? 49  SER D HA   1  
ATOM 7882   H HB2  . SER D 1 49  ? 19.160  11.505  -19.907 1.00 2.15  ? 49  SER D HB2  1  
ATOM 7883   H HB3  . SER D 1 49  ? 19.927  10.219  -18.977 1.00 43.03 ? 49  SER D HB3  1  
ATOM 7884   H HG   . SER D 1 49  ? 18.094  11.524  -17.464 1.00 42.11 ? 49  SER D HG   1  
ATOM 7885   N N    . GLN D 1 50  ? 20.075  14.540  -18.919 1.00 73.04 ? 50  GLN D N    1  
ATOM 7886   C CA   . GLN D 1 50  ? 19.424  15.847  -19.091 1.00 32.23 ? 50  GLN D CA   1  
ATOM 7887   C C    . GLN D 1 50  ? 18.127  15.655  -19.886 1.00 74.34 ? 50  GLN D C    1  
ATOM 7888   O O    . GLN D 1 50  ? 18.144  15.046  -20.959 1.00 3.33  ? 50  GLN D O    1  
ATOM 7889   C CB   . GLN D 1 50  ? 20.359  16.844  -19.829 1.00 14.43 ? 50  GLN D CB   1  
ATOM 7890   C CG   . GLN D 1 50  ? 19.697  18.211  -20.135 1.00 54.32 ? 50  GLN D CG   1  
ATOM 7891   C CD   . GLN D 1 50  ? 20.614  19.241  -20.796 1.00 25.31 ? 50  GLN D CD   1  
ATOM 7892   O OE1  . GLN D 1 50  ? 21.548  18.900  -21.522 1.00 21.52 ? 50  GLN D OE1  1  
ATOM 7893   N NE2  . GLN D 1 50  ? 20.340  20.515  -20.553 1.00 43.42 ? 50  GLN D NE2  1  
ATOM 7894   H H    . GLN D 1 50  ? 20.904  14.365  -19.407 1.00 0.31  ? 50  GLN D H    1  
ATOM 7895   H HA   . GLN D 1 50  ? 19.190  16.239  -18.103 1.00 25.25 ? 50  GLN D HA   1  
ATOM 7896   H HB2  . GLN D 1 50  ? 21.240  17.015  -19.217 1.00 41.31 ? 50  GLN D HB2  1  
ATOM 7897   H HB3  . GLN D 1 50  ? 20.672  16.398  -20.766 1.00 15.14 ? 50  GLN D HB3  1  
ATOM 7898   H HG2  . GLN D 1 50  ? 18.858  18.045  -20.798 1.00 62.52 ? 50  GLN D HG2  1  
ATOM 7899   H HG3  . GLN D 1 50  ? 19.325  18.626  -19.203 1.00 42.41 ? 50  GLN D HG3  1  
ATOM 7900   H HE21 . GLN D 1 50  ? 19.580  20.722  -19.972 1.00 71.11 ? 50  GLN D HE21 1  
ATOM 7901   H HE22 . GLN D 1 50  ? 20.905  21.195  -20.972 1.00 20.23 ? 50  GLN D HE22 1  
ATOM 7902   N N    . LEU D 1 51  ? 17.015  16.161  -19.345 1.00 42.00 ? 51  LEU D N    1  
ATOM 7903   C CA   . LEU D 1 51  ? 15.686  16.003  -19.956 1.00 23.42 ? 51  LEU D CA   1  
ATOM 7904   C C    . LEU D 1 51  ? 15.354  17.187  -20.872 1.00 42.21 ? 51  LEU D C    1  
ATOM 7905   O O    . LEU D 1 51  ? 14.724  16.999  -21.912 1.00 65.50 ? 51  LEU D O    1  
ATOM 7906   C CB   . LEU D 1 51  ? 14.615  15.836  -18.851 1.00 40.32 ? 51  LEU D CB   1  
ATOM 7907   C CG   . LEU D 1 51  ? 14.868  14.679  -17.830 1.00 53.31 ? 51  LEU D CG   1  
ATOM 7908   C CD1  . LEU D 1 51  ? 13.694  14.555  -16.841 1.00 14.12 ? 51  LEU D CD1  1  
ATOM 7909   C CD2  . LEU D 1 51  ? 15.160  13.326  -18.536 1.00 43.53 ? 51  LEU D CD2  1  
ATOM 7910   H H    . LEU D 1 51  ? 17.087  16.657  -18.504 1.00 45.31 ? 51  LEU D H    1  
ATOM 7911   H HA   . LEU D 1 51  ? 15.698  15.098  -20.561 1.00 43.23 ? 51  LEU D HA   1  
ATOM 7912   H HB2  . LEU D 1 51  ? 14.546  16.772  -18.298 1.00 3.40  ? 51  LEU D HB2  1  
ATOM 7913   H HB3  . LEU D 1 51  ? 13.656  15.660  -19.330 1.00 51.43 ? 51  LEU D HB3  1  
ATOM 7914   H HG   . LEU D 1 51  ? 15.747  14.927  -17.244 1.00 71.30 ? 51  LEU D HG   1  
ATOM 7915   H HD11 . LEU D 1 51  ? 13.905  13.781  -16.114 1.00 14.23 ? 51  LEU D HD11 1  
ATOM 7916   H HD12 . LEU D 1 51  ? 12.787  14.305  -17.371 1.00 64.31 ? 51  LEU D HD12 1  
ATOM 7917   H HD13 . LEU D 1 51  ? 13.557  15.496  -16.323 1.00 11.22 ? 51  LEU D HD13 1  
ATOM 7918   H HD21 . LEU D 1 51  ? 14.329  13.057  -19.178 1.00 35.03 ? 51  LEU D HD21 1  
ATOM 7919   H HD22 . LEU D 1 51  ? 15.303  12.548  -17.796 1.00 14.32 ? 51  LEU D HD22 1  
ATOM 7920   H HD23 . LEU D 1 51  ? 16.059  13.413  -19.131 1.00 74.33 ? 51  LEU D HD23 1  
ATOM 7921   N N    . ALA D 1 52  ? 15.794  18.400  -20.476 1.00 61.40 ? 52  ALA D N    1  
ATOM 7922   C CA   . ALA D 1 52  ? 15.503  19.652  -21.209 1.00 63.42 ? 52  ALA D CA   1  
ATOM 7923   C C    . ALA D 1 52  ? 16.413  20.796  -20.734 1.00 43.51 ? 52  ALA D C    1  
ATOM 7924   O O    . ALA D 1 52  ? 17.375  20.577  -19.983 1.00 62.31 ? 52  ALA D O    1  
ATOM 7925   C CB   . ALA D 1 52  ? 14.016  20.037  -21.037 1.00 65.04 ? 52  ALA D CB   1  
ATOM 7926   H H    . ALA D 1 52  ? 16.340  18.454  -19.668 1.00 63.24 ? 52  ALA D H    1  
ATOM 7927   H HA   . ALA D 1 52  ? 15.690  19.480  -22.263 1.00 65.42 ? 52  ALA D HA   1  
ATOM 7928   H HB1  . ALA D 1 52  ? 13.832  21.015  -21.466 1.00 42.31 ? 52  ALA D HB1  1  
ATOM 7929   H HB2  . ALA D 1 52  ? 13.759  20.054  -19.988 1.00 33.34 ? 52  ALA D HB2  1  
ATOM 7930   H HB3  . ALA D 1 52  ? 13.401  19.316  -21.542 1.00 11.14 ? 52  ALA D HB3  1  
ATOM 7931   N N    . ASP D 1 53  ? 16.090  22.013  -21.213 1.00 65.44 ? 53  ASP D N    1  
ATOM 7932   C CA   . ASP D 1 53  ? 16.771  23.268  -20.825 1.00 51.13 ? 53  ASP D CA   1  
ATOM 7933   C C    . ASP D 1 53  ? 16.685  23.488  -19.308 1.00 65.22 ? 53  ASP D C    1  
ATOM 7934   O O    . ASP D 1 53  ? 15.582  23.658  -18.771 1.00 21.21 ? 53  ASP D O    1  
ATOM 7935   C CB   . ASP D 1 53  ? 16.149  24.484  -21.573 1.00 10.01 ? 53  ASP D CB   1  
ATOM 7936   C CG   . ASP D 1 53  ? 16.483  24.506  -23.069 1.00 43.15 ? 53  ASP D CG   1  
ATOM 7937   O OD1  . ASP D 1 53  ? 15.852  23.757  -23.846 1.00 41.35 ? 53  ASP D OD1  1  
ATOM 7938   O OD2  . ASP D 1 53  ? 17.377  25.279  -23.481 1.00 33.32 ? 53  ASP D OD2  1  
ATOM 7939   H H    . ASP D 1 53  ? 15.353  22.065  -21.864 1.00 32.15 ? 53  ASP D H    1  
ATOM 7940   H HA   . ASP D 1 53  ? 17.811  23.175  -21.113 1.00 61.30 ? 53  ASP D HA   1  
ATOM 7941   H HB2  . ASP D 1 53  ? 15.070  24.455  -21.463 1.00 32.54 ? 53  ASP D HB2  1  
ATOM 7942   H HB3  . ASP D 1 53  ? 16.510  25.406  -21.123 1.00 63.21 ? 53  ASP D HB3  1  
ATOM 7943   N N    . ASP D 1 54  ? 17.857  23.444  -18.632 1.00 54.43 ? 54  ASP D N    1  
ATOM 7944   C CA   . ASP D 1 54  ? 17.992  23.634  -17.165 1.00 22.13 ? 54  ASP D CA   1  
ATOM 7945   C C    . ASP D 1 54  ? 17.241  22.550  -16.356 1.00 62.15 ? 54  ASP D C    1  
ATOM 7946   O O    . ASP D 1 54  ? 17.067  22.682  -15.144 1.00 13.04 ? 54  ASP D O    1  
ATOM 7947   C CB   . ASP D 1 54  ? 17.534  25.059  -16.727 1.00 44.11 ? 54  ASP D CB   1  
ATOM 7948   C CG   . ASP D 1 54  ? 18.257  26.198  -17.466 1.00 14.44 ? 54  ASP D CG   1  
ATOM 7949   O OD1  . ASP D 1 54  ? 17.701  26.731  -18.459 1.00 34.33 ? 54  ASP D OD1  1  
ATOM 7950   O OD2  . ASP D 1 54  ? 19.379  26.569  -17.061 1.00 12.44 ? 54  ASP D OD2  1  
ATOM 7951   H H    . ASP D 1 54  ? 18.675  23.286  -19.146 1.00 74.33 ? 54  ASP D H    1  
ATOM 7952   H HA   . ASP D 1 54  ? 19.045  23.532  -16.938 1.00 64.43 ? 54  ASP D HA   1  
ATOM 7953   H HB2  . ASP D 1 54  ? 16.467  25.155  -16.898 1.00 43.33 ? 54  ASP D HB2  1  
ATOM 7954   H HB3  . ASP D 1 54  ? 17.717  25.174  -15.663 1.00 25.24 ? 54  ASP D HB3  1  
ATOM 7955   N N    . VAL D 1 55  ? 16.817  21.468  -17.034 1.00 70.44 ? 55  VAL D N    1  
ATOM 7956   C CA   . VAL D 1 55  ? 16.105  20.347  -16.416 1.00 43.13 ? 55  VAL D CA   1  
ATOM 7957   C C    . VAL D 1 55  ? 16.980  19.091  -16.531 1.00 70.31 ? 55  VAL D C    1  
ATOM 7958   O O    . VAL D 1 55  ? 17.302  18.633  -17.636 1.00 21.21 ? 55  VAL D O    1  
ATOM 7959   C CB   . VAL D 1 55  ? 14.697  20.096  -17.075 1.00 65.51 ? 55  VAL D CB   1  
ATOM 7960   C CG1  . VAL D 1 55  ? 13.988  18.893  -16.411 1.00 24.51 ? 55  VAL D CG1  1  
ATOM 7961   C CG2  . VAL D 1 55  ? 13.814  21.371  -17.022 1.00 64.21 ? 55  VAL D CG2  1  
ATOM 7962   H H    . VAL D 1 55  ? 17.005  21.418  -17.989 1.00 44.21 ? 55  VAL D H    1  
ATOM 7963   H HA   . VAL D 1 55  ? 15.950  20.573  -15.357 1.00 0.41  ? 55  VAL D HA   1  
ATOM 7964   H HB   . VAL D 1 55  ? 14.857  19.846  -18.127 1.00 14.03 ? 55  VAL D HB   1  
ATOM 7965   H HG11 . VAL D 1 55  ? 14.566  17.991  -16.578 1.00 44.45 ? 55  VAL D HG11 1  
ATOM 7966   H HG12 . VAL D 1 55  ? 13.010  18.763  -16.837 1.00 52.41 ? 55  VAL D HG12 1  
ATOM 7967   H HG13 . VAL D 1 55  ? 13.893  19.061  -15.345 1.00 71.31 ? 55  VAL D HG13 1  
ATOM 7968   H HG21 . VAL D 1 55  ? 13.628  21.650  -15.992 1.00 63.14 ? 55  VAL D HG21 1  
ATOM 7969   H HG22 . VAL D 1 55  ? 12.870  21.185  -17.518 1.00 14.00 ? 55  VAL D HG22 1  
ATOM 7970   H HG23 . VAL D 1 55  ? 14.322  22.184  -17.526 1.00 33.42 ? 55  VAL D HG23 1  
ATOM 7971   N N    . TYR D 1 56  ? 17.347  18.551  -15.372 1.00 43.13 ? 56  TYR D N    1  
ATOM 7972   C CA   . TYR D 1 56  ? 18.274  17.426  -15.234 1.00 72.45 ? 56  TYR D CA   1  
ATOM 7973   C C    . TYR D 1 56  ? 17.641  16.401  -14.299 1.00 71.40 ? 56  TYR D C    1  
ATOM 7974   O O    . TYR D 1 56  ? 17.127  16.772  -13.236 1.00 41.25 ? 56  TYR D O    1  
ATOM 7975   C CB   . TYR D 1 56  ? 19.632  17.908  -14.654 1.00 3.51  ? 56  TYR D CB   1  
ATOM 7976   C CG   . TYR D 1 56  ? 20.373  18.933  -15.533 1.00 44.42 ? 56  TYR D CG   1  
ATOM 7977   C CD1  . TYR D 1 56  ? 21.241  18.527  -16.550 1.00 74.35 ? 56  TYR D CD1  1  
ATOM 7978   C CD2  . TYR D 1 56  ? 20.183  20.305  -15.358 1.00 41.33 ? 56  TYR D CD2  1  
ATOM 7979   C CE1  . TYR D 1 56  ? 21.887  19.451  -17.346 1.00 53.11 ? 56  TYR D CE1  1  
ATOM 7980   C CE2  . TYR D 1 56  ? 20.829  21.225  -16.152 1.00 1.34  ? 56  TYR D CE2  1  
ATOM 7981   C CZ   . TYR D 1 56  ? 21.674  20.795  -17.144 1.00 44.04 ? 56  TYR D CZ   1  
ATOM 7982   O OH   . TYR D 1 56  ? 22.306  21.714  -17.935 1.00 14.05 ? 56  TYR D OH   1  
ATOM 7983   H H    . TYR D 1 56  ? 16.945  18.913  -14.555 1.00 73.15 ? 56  TYR D H    1  
ATOM 7984   H HA   . TYR D 1 56  ? 18.436  16.972  -16.212 1.00 74.52 ? 56  TYR D HA   1  
ATOM 7985   H HB2  . TYR D 1 56  ? 19.460  18.362  -13.682 1.00 23.12 ? 56  TYR D HB2  1  
ATOM 7986   H HB3  . TYR D 1 56  ? 20.283  17.049  -14.518 1.00 24.51 ? 56  TYR D HB3  1  
ATOM 7987   H HD1  . TYR D 1 56  ? 21.409  17.468  -16.710 1.00 70.54 ? 56  TYR D HD1  1  
ATOM 7988   H HD2  . TYR D 1 56  ? 19.516  20.650  -14.575 1.00 33.15 ? 56  TYR D HD2  1  
ATOM 7989   H HE1  . TYR D 1 56  ? 22.555  19.116  -18.129 1.00 43.54 ? 56  TYR D HE1  1  
ATOM 7990   H HE2  . TYR D 1 56  ? 20.666  22.284  -15.994 1.00 5.30  ? 56  TYR D HE2  1  
ATOM 7991   H HH   . TYR D 1 56  ? 22.190  21.472  -18.857 1.00 70.33 ? 56  TYR D HH   1  
ATOM 7992   N N    . GLU D 1 57  ? 17.661  15.128  -14.700 1.00 61.55 ? 57  GLU D N    1  
ATOM 7993   C CA   . GLU D 1 57  ? 17.106  14.035  -13.895 1.00 43.32 ? 57  GLU D CA   1  
ATOM 7994   C C    . GLU D 1 57  ? 18.222  13.296  -13.146 1.00 13.22 ? 57  GLU D C    1  
ATOM 7995   O O    . GLU D 1 57  ? 19.205  12.844  -13.759 1.00 64.13 ? 57  GLU D O    1  
ATOM 7996   C CB   . GLU D 1 57  ? 16.343  13.052  -14.802 1.00 63.22 ? 57  GLU D CB   1  
ATOM 7997   C CG   . GLU D 1 57  ? 15.694  11.862  -14.066 1.00 55.02 ? 57  GLU D CG   1  
ATOM 7998   C CD   . GLU D 1 57  ? 15.135  10.828  -15.033 1.00 23.13 ? 57  GLU D CD   1  
ATOM 7999   O OE1  . GLU D 1 57  ? 13.901  10.683  -15.145 1.00 40.03 ? 57  GLU D OE1  1  
ATOM 8000   O OE2  . GLU D 1 57  ? 15.947  10.153  -15.706 1.00 72.12 ? 57  GLU D OE2  1  
ATOM 8001   H H    . GLU D 1 57  ? 18.061  14.910  -15.569 1.00 50.02 ? 57  GLU D H    1  
ATOM 8002   H HA   . GLU D 1 57  ? 16.405  14.455  -13.171 1.00 24.20 ? 57  GLU D HA   1  
ATOM 8003   H HB2  . GLU D 1 57  ? 15.557  13.600  -15.310 1.00 40.43 ? 57  GLU D HB2  1  
ATOM 8004   H HB3  . GLU D 1 57  ? 17.023  12.665  -15.556 1.00 22.34 ? 57  GLU D HB3  1  
ATOM 8005   H HG2  . GLU D 1 57  ? 16.441  11.379  -13.436 1.00 72.34 ? 57  GLU D HG2  1  
ATOM 8006   H HG3  . GLU D 1 57  ? 14.891  12.235  -13.435 1.00 14.53 ? 57  GLU D HG3  1  
ATOM 8007   N N    . VAL D 1 58  ? 18.059  13.190  -11.822 1.00 20.42 ? 58  VAL D N    1  
ATOM 8008   C CA   . VAL D 1 58  ? 18.904  12.358  -10.966 1.00 14.14 ? 58  VAL D CA   1  
ATOM 8009   C C    . VAL D 1 58  ? 18.066  11.141  -10.543 1.00 43.14 ? 58  VAL D C    1  
ATOM 8010   O O    . VAL D 1 58  ? 17.006  11.307  -9.940  1.00 12.45 ? 58  VAL D O    1  
ATOM 8011   C CB   . VAL D 1 58  ? 19.397  13.148  -9.689  1.00 1.12  ? 58  VAL D CB   1  
ATOM 8012   C CG1  . VAL D 1 58  ? 20.369  12.294  -8.833  1.00 54.05 ? 58  VAL D CG1  1  
ATOM 8013   C CG2  . VAL D 1 58  ? 20.028  14.511  -10.081 1.00 73.50 ? 58  VAL D CG2  1  
ATOM 8014   H H    . VAL D 1 58  ? 17.321  13.685  -11.400 1.00 4.32  ? 58  VAL D H    1  
ATOM 8015   H HA   . VAL D 1 58  ? 19.778  12.024  -11.533 1.00 53.35 ? 58  VAL D HA   1  
ATOM 8016   H HB   . VAL D 1 58  ? 18.523  13.361  -9.070  1.00 12.01 ? 58  VAL D HB   1  
ATOM 8017   H HG11 . VAL D 1 58  ? 20.676  12.853  -7.957  1.00 11.44 ? 58  VAL D HG11 1  
ATOM 8018   H HG12 . VAL D 1 58  ? 21.243  12.035  -9.415  1.00 55.23 ? 58  VAL D HG12 1  
ATOM 8019   H HG13 . VAL D 1 58  ? 19.871  11.386  -8.516  1.00 53.42 ? 58  VAL D HG13 1  
ATOM 8020   H HG21 . VAL D 1 58  ? 19.305  15.097  -10.636 1.00 1.52  ? 58  VAL D HG21 1  
ATOM 8021   H HG22 . VAL D 1 58  ? 20.901  14.350  -10.699 1.00 61.54 ? 58  VAL D HG22 1  
ATOM 8022   H HG23 . VAL D 1 58  ? 20.316  15.056  -9.191  1.00 52.55 ? 58  VAL D HG23 1  
ATOM 8023   N N    . VAL D 1 59  ? 18.500  9.935   -10.929 1.00 11.24 ? 59  VAL D N    1  
ATOM 8024   C CA   . VAL D 1 59  ? 17.896  8.677   -10.468 1.00 61.54 ? 59  VAL D CA   1  
ATOM 8025   C C    . VAL D 1 59  ? 18.785  8.116   -9.353  1.00 3.02  ? 59  VAL D C    1  
ATOM 8026   O O    . VAL D 1 59  ? 20.007  8.060   -9.519  1.00 44.12 ? 59  VAL D O    1  
ATOM 8027   C CB   . VAL D 1 59  ? 17.789  7.615   -11.629 1.00 72.30 ? 59  VAL D CB   1  
ATOM 8028   C CG1  . VAL D 1 59  ? 17.028  6.347   -11.167 1.00 12.42 ? 59  VAL D CG1  1  
ATOM 8029   C CG2  . VAL D 1 59  ? 17.161  8.223   -12.914 1.00 54.54 ? 59  VAL D CG2  1  
ATOM 8030   H H    . VAL D 1 59  ? 19.255  9.884   -11.550 1.00 25.05 ? 59  VAL D H    1  
ATOM 8031   H HA   . VAL D 1 59  ? 16.894  8.877   -10.075 1.00 53.10 ? 59  VAL D HA   1  
ATOM 8032   H HB   . VAL D 1 59  ? 18.806  7.302   -11.885 1.00 42.43 ? 59  VAL D HB   1  
ATOM 8033   H HG11 . VAL D 1 59  ? 17.190  5.551   -11.874 1.00 64.22 ? 59  VAL D HG11 1  
ATOM 8034   H HG12 . VAL D 1 59  ? 15.968  6.552   -11.098 1.00 10.31 ? 59  VAL D HG12 1  
ATOM 8035   H HG13 . VAL D 1 59  ? 17.388  6.034   -10.199 1.00 53.42 ? 59  VAL D HG13 1  
ATOM 8036   H HG21 . VAL D 1 59  ? 17.203  7.499   -13.715 1.00 22.44 ? 59  VAL D HG21 1  
ATOM 8037   H HG22 . VAL D 1 59  ? 17.714  9.104   -13.207 1.00 15.05 ? 59  VAL D HG22 1  
ATOM 8038   H HG23 . VAL D 1 59  ? 16.125  8.494   -12.741 1.00 10.54 ? 59  VAL D HG23 1  
ATOM 8039   N N    . LEU D 1 60  ? 18.191  7.707   -8.225  1.00 63.55 ? 60  LEU D N    1  
ATOM 8040   C CA   . LEU D 1 60  ? 18.943  7.129   -7.104  1.00 73.02 ? 60  LEU D CA   1  
ATOM 8041   C C    . LEU D 1 60  ? 18.355  5.746   -6.782  1.00 44.31 ? 60  LEU D C    1  
ATOM 8042   O O    . LEU D 1 60  ? 17.219  5.632   -6.309  1.00 73.45 ? 60  LEU D O    1  
ATOM 8043   C CB   . LEU D 1 60  ? 18.918  8.093   -5.864  1.00 1.31  ? 60  LEU D CB   1  
ATOM 8044   C CG   . LEU D 1 60  ? 20.056  7.919   -4.780  1.00 13.11 ? 60  LEU D CG   1  
ATOM 8045   C CD1  . LEU D 1 60  ? 19.895  6.634   -3.926  1.00 2.32  ? 60  LEU D CD1  1  
ATOM 8046   C CD2  . LEU D 1 60  ? 21.463  7.979   -5.439  1.00 33.33 ? 60  LEU D CD2  1  
ATOM 8047   H H    . LEU D 1 60  ? 17.222  7.797   -8.142  1.00 1.30  ? 60  LEU D H    1  
ATOM 8048   H HA   . LEU D 1 60  ? 19.979  6.998   -7.428  1.00 4.12  ? 60  LEU D HA   1  
ATOM 8049   H HB2  . LEU D 1 60  ? 18.972  9.112   -6.236  1.00 42.45 ? 60  LEU D HB2  1  
ATOM 8050   H HB3  . LEU D 1 60  ? 17.956  7.982   -5.366  1.00 72.25 ? 60  LEU D HB3  1  
ATOM 8051   H HG   . LEU D 1 60  ? 19.995  8.757   -4.092  1.00 12.53 ? 60  LEU D HG   1  
ATOM 8052   H HD11 . LEU D 1 60  ? 20.668  6.596   -3.170  1.00 33.14 ? 60  LEU D HD11 1  
ATOM 8053   H HD12 . LEU D 1 60  ? 19.974  5.756   -4.559  1.00 24.31 ? 60  LEU D HD12 1  
ATOM 8054   H HD13 . LEU D 1 60  ? 18.927  6.637   -3.446  1.00 21.32 ? 60  LEU D HD13 1  
ATOM 8055   H HD21 . LEU D 1 60  ? 21.582  8.923   -5.956  1.00 41.41 ? 60  LEU D HD21 1  
ATOM 8056   H HD22 . LEU D 1 60  ? 21.579  7.168   -6.145  1.00 34.13 ? 60  LEU D HD22 1  
ATOM 8057   H HD23 . LEU D 1 60  ? 22.229  7.899   -4.676  1.00 22.22 ? 60  LEU D HD23 1  
ATOM 8058   N N    . ARG D 1 61  ? 19.145  4.711   -7.076  1.00 74.11 ? 61  ARG D N    1  
ATOM 8059   C CA   . ARG D 1 61  ? 18.818  3.319   -6.785  1.00 63.45 ? 61  ARG D CA   1  
ATOM 8060   C C    . ARG D 1 61  ? 19.343  2.944   -5.387  1.00 11.24 ? 61  ARG D C    1  
ATOM 8061   O O    . ARG D 1 61  ? 20.550  3.034   -5.134  1.00 50.41 ? 61  ARG D O    1  
ATOM 8062   C CB   . ARG D 1 61  ? 19.470  2.403   -7.854  1.00 33.40 ? 61  ARG D CB   1  
ATOM 8063   C CG   . ARG D 1 61  ? 19.096  0.904   -7.757  1.00 35.45 ? 61  ARG D CG   1  
ATOM 8064   C CD   . ARG D 1 61  ? 20.053  -0.010  -8.560  1.00 2.22  ? 61  ARG D CD   1  
ATOM 8065   N NE   . ARG D 1 61  ? 20.400  0.542   -9.883  1.00 41.12 ? 61  ARG D NE   1  
ATOM 8066   C CZ   . ARG D 1 61  ? 20.046  0.041   -11.072 1.00 62.24 ? 61  ARG D CZ   1  
ATOM 8067   N NH1  . ARG D 1 61  ? 19.297  -1.056  -11.169 1.00 12.45 ? 61  ARG D NH1  1  
ATOM 8068   N NH2  . ARG D 1 61  ? 20.480  0.639   -12.165 1.00 11.15 ? 61  ARG D NH2  1  
ATOM 8069   H H    . ARG D 1 61  ? 19.999  4.897   -7.515  1.00 1.11  ? 61  ARG D H    1  
ATOM 8070   H HA   . ARG D 1 61  ? 17.736  3.196   -6.818  1.00 24.23 ? 61  ARG D HA   1  
ATOM 8071   H HB2  . ARG D 1 61  ? 19.171  2.759   -8.835  1.00 74.12 ? 61  ARG D HB2  1  
ATOM 8072   H HB3  . ARG D 1 61  ? 20.552  2.494   -7.778  1.00 45.35 ? 61  ARG D HB3  1  
ATOM 8073   H HG2  . ARG D 1 61  ? 19.119  0.602   -6.717  1.00 45.13 ? 61  ARG D HG2  1  
ATOM 8074   H HG3  . ARG D 1 61  ? 18.087  0.769   -8.137  1.00 73.21 ? 61  ARG D HG3  1  
ATOM 8075   H HD2  . ARG D 1 61  ? 20.970  -0.141  -7.998  1.00 5.53  ? 61  ARG D HD2  1  
ATOM 8076   H HD3  . ARG D 1 61  ? 19.584  -0.979  -8.690  1.00 31.21 ? 61  ARG D HD3  1  
ATOM 8077   H HE   . ARG D 1 61  ? 20.958  1.351   -9.880  1.00 41.40 ? 61  ARG D HE   1  
ATOM 8078   H HH11 . ARG D 1 61  ? 18.986  -1.534  -10.340 1.00 72.52 ? 61  ARG D HH11 1  
ATOM 8079   H HH12 . ARG D 1 61  ? 19.043  -1.419  -12.069 1.00 72.52 ? 61  ARG D HH12 1  
ATOM 8080   H HH21 . ARG D 1 61  ? 21.062  1.459   -12.090 1.00 32.25 ? 61  ARG D HH21 1  
ATOM 8081   H HH22 . ARG D 1 61  ? 20.230  0.288   -13.067 1.00 33.55 ? 61  ARG D HH22 1  
ATOM 8082   N N    . VAL D 1 62  ? 18.432  2.574   -4.480  1.00 61.33 ? 62  VAL D N    1  
ATOM 8083   C CA   . VAL D 1 62  ? 18.790  1.918   -3.210  1.00 72.23 ? 62  VAL D CA   1  
ATOM 8084   C C    . VAL D 1 62  ? 18.493  0.420   -3.354  1.00 15.52 ? 62  VAL D C    1  
ATOM 8085   O O    . VAL D 1 62  ? 17.398  0.047   -3.795  1.00 41.34 ? 62  VAL D O    1  
ATOM 8086   C CB   . VAL D 1 62  ? 17.982  2.496   -1.985  1.00 55.42 ? 62  VAL D CB   1  
ATOM 8087   C CG1  . VAL D 1 62  ? 18.375  1.782   -0.660  1.00 24.43 ? 62  VAL D CG1  1  
ATOM 8088   C CG2  . VAL D 1 62  ? 18.157  4.027   -1.878  1.00 0.14  ? 62  VAL D CG2  1  
ATOM 8089   H H    . VAL D 1 62  ? 17.482  2.744   -4.669  1.00 65.30 ? 62  VAL D H    1  
ATOM 8090   H HA   . VAL D 1 62  ? 19.858  2.060   -3.024  1.00 1.52  ? 62  VAL D HA   1  
ATOM 8091   H HB   . VAL D 1 62  ? 16.922  2.299   -2.161  1.00 55.51 ? 62  VAL D HB   1  
ATOM 8092   H HG11 . VAL D 1 62  ? 17.585  1.897   0.068   1.00 22.24 ? 62  VAL D HG11 1  
ATOM 8093   H HG12 . VAL D 1 62  ? 19.291  2.199   -0.264  1.00 72.31 ? 62  VAL D HG12 1  
ATOM 8094   H HG13 . VAL D 1 62  ? 18.519  0.729   -0.845  1.00 34.03 ? 62  VAL D HG13 1  
ATOM 8095   H HG21 . VAL D 1 62  ? 19.209  4.277   -1.893  1.00 3.45  ? 62  VAL D HG21 1  
ATOM 8096   H HG22 . VAL D 1 62  ? 17.719  4.388   -0.955  1.00 15.21 ? 62  VAL D HG22 1  
ATOM 8097   H HG23 . VAL D 1 62  ? 17.666  4.509   -2.712  1.00 43.13 ? 62  VAL D HG23 1  
ATOM 8098   N N    . THR D 1 63  ? 19.463  -0.425  -2.993  1.00 31.04 ? 63  THR D N    1  
ATOM 8099   C CA   . THR D 1 63  ? 19.311  -1.880  -3.033  1.00 65.53 ? 63  THR D CA   1  
ATOM 8100   C C    . THR D 1 63  ? 19.539  -2.468  -1.632  1.00 3.23  ? 63  THR D C    1  
ATOM 8101   O O    . THR D 1 63  ? 20.506  -2.132  -0.942  1.00 13.40 ? 63  THR D O    1  
ATOM 8102   C CB   . THR D 1 63  ? 20.294  -2.524  -4.072  1.00 44.21 ? 63  THR D CB   1  
ATOM 8103   O OG1  . THR D 1 63  ? 20.178  -1.844  -5.338  1.00 10.34 ? 63  THR D OG1  1  
ATOM 8104   C CG2  . THR D 1 63  ? 20.020  -4.031  -4.278  1.00 74.35 ? 63  THR D CG2  1  
ATOM 8105   H H    . THR D 1 63  ? 20.316  -0.056  -2.691  1.00 21.12 ? 63  THR D H    1  
ATOM 8106   H HA   . THR D 1 63  ? 18.284  -2.104  -3.334  1.00 32.45 ? 63  THR D HA   1  
ATOM 8107   H HB   . THR D 1 63  ? 21.311  -2.402  -3.714  1.00 1.00  ? 63  THR D HB   1  
ATOM 8108   H HG1  . THR D 1 63  ? 19.996  -2.489  -6.033  1.00 43.44 ? 63  THR D HG1  1  
ATOM 8109   H HG21 . THR D 1 63  ? 20.263  -4.578  -3.377  1.00 11.14 ? 63  THR D HG21 1  
ATOM 8110   H HG22 . THR D 1 63  ? 20.618  -4.398  -5.095  1.00 2.15  ? 63  THR D HG22 1  
ATOM 8111   H HG23 . THR D 1 63  ? 18.972  -4.184  -4.516  1.00 53.01 ? 63  THR D HG23 1  
ATOM 8112   N N    . VAL D 1 64  ? 18.600  -3.326  -1.232  1.00 40.24 ? 64  VAL D N    1  
ATOM 8113   C CA   . VAL D 1 64  ? 18.531  -3.952  0.082   1.00 32.10 ? 64  VAL D CA   1  
ATOM 8114   C C    . VAL D 1 64  ? 18.540  -5.480  -0.092  1.00 3.54  ? 64  VAL D C    1  
ATOM 8115   O O    . VAL D 1 64  ? 17.552  -6.073  -0.542  1.00 63.21 ? 64  VAL D O    1  
ATOM 8116   C CB   . VAL D 1 64  ? 17.226  -3.475  0.823   1.00 5.30  ? 64  VAL D CB   1  
ATOM 8117   C CG1  . VAL D 1 64  ? 17.031  -4.194  2.176   1.00 61.24 ? 64  VAL D CG1  1  
ATOM 8118   C CG2  . VAL D 1 64  ? 17.222  -1.926  0.966   1.00 40.23 ? 64  VAL D CG2  1  
ATOM 8119   H H    . VAL D 1 64  ? 17.908  -3.552  -1.868  1.00 25.21 ? 64  VAL D H    1  
ATOM 8120   H HA   . VAL D 1 64  ? 19.398  -3.647  0.672   1.00 14.03 ? 64  VAL D HA   1  
ATOM 8121   H HB   . VAL D 1 64  ? 16.377  -3.741  0.194   1.00 22.30 ? 64  VAL D HB   1  
ATOM 8122   H HG11 . VAL D 1 64  ? 16.850  -5.248  2.004   1.00 43.45 ? 64  VAL D HG11 1  
ATOM 8123   H HG12 . VAL D 1 64  ? 16.183  -3.773  2.699   1.00 3.45  ? 64  VAL D HG12 1  
ATOM 8124   H HG13 . VAL D 1 64  ? 17.915  -4.084  2.785   1.00 63.35 ? 64  VAL D HG13 1  
ATOM 8125   H HG21 . VAL D 1 64  ? 18.098  -1.599  1.508   1.00 40.54 ? 64  VAL D HG21 1  
ATOM 8126   H HG22 . VAL D 1 64  ? 16.338  -1.595  1.479   1.00 42.22 ? 64  VAL D HG22 1  
ATOM 8127   H HG23 . VAL D 1 64  ? 17.225  -1.479  -0.021  1.00 65.00 ? 64  VAL D HG23 1  
ATOM 8128   N N    . THR D 1 65  ? 19.680  -6.096  0.229   1.00 60.15 ? 65  THR D N    1  
ATOM 8129   C CA   . THR D 1 65  ? 19.875  -7.546  0.148   1.00 34.11 ? 65  THR D CA   1  
ATOM 8130   C C    . THR D 1 65  ? 19.912  -8.133  1.569   1.00 24.30 ? 65  THR D C    1  
ATOM 8131   O O    . THR D 1 65  ? 20.866  -7.900  2.318   1.00 73.22 ? 65  THR D O    1  
ATOM 8132   C CB   . THR D 1 65  ? 21.205  -7.864  -0.617  1.00 51.21 ? 65  THR D CB   1  
ATOM 8133   O OG1  . THR D 1 65  ? 21.148  -7.278  -1.927  1.00 72.15 ? 65  THR D OG1  1  
ATOM 8134   C CG2  . THR D 1 65  ? 21.470  -9.377  -0.754  1.00 53.22 ? 65  THR D CG2  1  
ATOM 8135   H H    . THR D 1 65  ? 20.435  -5.549  0.527   1.00 55.34 ? 65  THR D H    1  
ATOM 8136   H HA   . THR D 1 65  ? 19.045  -7.989  -0.407  1.00 50.45 ? 65  THR D HA   1  
ATOM 8137   H HB   . THR D 1 65  ? 22.035  -7.413  -0.080  1.00 3.23  ? 65  THR D HB   1  
ATOM 8138   H HG1  . THR D 1 65  ? 21.854  -7.645  -2.466  1.00 24.40 ? 65  THR D HG1  1  
ATOM 8139   H HG21 . THR D 1 65  ? 20.725  -9.819  -1.399  1.00 21.23 ? 65  THR D HG21 1  
ATOM 8140   H HG22 . THR D 1 65  ? 21.420  -9.849  0.216   1.00 52.20 ? 65  THR D HG22 1  
ATOM 8141   H HG23 . THR D 1 65  ? 22.449  -9.541  -1.182  1.00 31.15 ? 65  THR D HG23 1  
ATOM 8142   N N    . ALA D 1 66  ? 18.857  -8.867  1.951   1.00 5.32  ? 66  ALA D N    1  
ATOM 8143   C CA   . ALA D 1 66  ? 18.795  -9.547  3.252   1.00 74.14 ? 66  ALA D CA   1  
ATOM 8144   C C    . ALA D 1 66  ? 19.199  -11.010 3.081   1.00 3.24  ? 66  ALA D C    1  
ATOM 8145   O O    . ALA D 1 66  ? 18.777  -11.672 2.124   1.00 72.45 ? 66  ALA D O    1  
ATOM 8146   C CB   . ALA D 1 66  ? 17.387  -9.473  3.854   1.00 73.12 ? 66  ALA D CB   1  
ATOM 8147   H H    . ALA D 1 66  ? 18.102  -8.971  1.329   1.00 42.54 ? 66  ALA D H    1  
ATOM 8148   H HA   . ALA D 1 66  ? 19.487  -9.053  3.945   1.00 34.23 ? 66  ALA D HA   1  
ATOM 8149   H HB1  . ALA D 1 66  ? 16.664  -9.899  3.167   1.00 33.22 ? 66  ALA D HB1  1  
ATOM 8150   H HB2  . ALA D 1 66  ? 17.122  -8.464  4.059   1.00 24.11 ? 66  ALA D HB2  1  
ATOM 8151   H HB3  . ALA D 1 66  ? 17.356  -10.027 4.781   1.00 32.44 ? 66  ALA D HB3  1  
ATOM 8152   N N    . SER D 1 67  ? 20.010  -11.498 4.014   1.00 3.04  ? 67  SER D N    1  
ATOM 8153   C CA   . SER D 1 67  ? 20.373  -12.908 4.122   1.00 53.43 ? 67  SER D CA   1  
ATOM 8154   C C    . SER D 1 67  ? 20.373  -13.292 5.602   1.00 1.10  ? 67  SER D C    1  
ATOM 8155   O O    . SER D 1 67  ? 21.058  -12.655 6.409   1.00 11.12 ? 67  SER D O    1  
ATOM 8156   C CB   . SER D 1 67  ? 21.766  -13.142 3.482   1.00 21.35 ? 67  SER D CB   1  
ATOM 8157   O OG   . SER D 1 67  ? 22.759  -12.258 4.017   1.00 0.10  ? 67  SER D OG   1  
ATOM 8158   H H    . SER D 1 67  ? 20.403  -10.875 4.656   1.00 22.30 ? 67  SER D H    1  
ATOM 8159   H HA   . SER D 1 67  ? 19.629  -13.511 3.597   1.00 61.02 ? 67  SER D HA   1  
ATOM 8160   H HB2  . SER D 1 67  ? 22.081  -14.161 3.659   1.00 4.03  ? 67  SER D HB2  1  
ATOM 8161   H HB3  . SER D 1 67  ? 21.701  -12.974 2.416   1.00 42.31 ? 67  SER D HB3  1  
ATOM 8162   H HG   . SER D 1 67  ? 22.616  -12.139 4.966   1.00 10.41 ? 67  SER D HG   1  
ATOM 8163   N N    . LEU D 1 68  ? 19.580  -14.305 5.967   1.00 25.42 ? 68  LEU D N    1  
ATOM 8164   C CA   . LEU D 1 68  ? 19.577  -14.864 7.334   1.00 12.33 ? 68  LEU D CA   1  
ATOM 8165   C C    . LEU D 1 68  ? 19.731  -16.383 7.270   1.00 15.33 ? 68  LEU D C    1  
ATOM 8166   O O    . LEU D 1 68  ? 19.152  -17.043 6.389   1.00 21.23 ? 68  LEU D O    1  
ATOM 8167   C CB   . LEU D 1 68  ? 18.305  -14.415 8.109   1.00 74.03 ? 68  LEU D CB   1  
ATOM 8168   C CG   . LEU D 1 68  ? 16.905  -14.804 7.503   1.00 54.51 ? 68  LEU D CG   1  
ATOM 8169   C CD1  . LEU D 1 68  ? 16.406  -16.196 7.966   1.00 24.11 ? 68  LEU D CD1  1  
ATOM 8170   C CD2  . LEU D 1 68  ? 15.860  -13.716 7.801   1.00 1.12  ? 68  LEU D CD2  1  
ATOM 8171   H H    . LEU D 1 68  ? 18.949  -14.673 5.302   1.00 3.43  ? 68  LEU D H    1  
ATOM 8172   H HA   . LEU D 1 68  ? 20.454  -14.462 7.859   1.00 63.22 ? 68  LEU D HA   1  
ATOM 8173   H HB2  . LEU D 1 68  ? 18.367  -14.805 9.122   1.00 64.54 ? 68  LEU D HB2  1  
ATOM 8174   H HB3  . LEU D 1 68  ? 18.355  -13.332 8.179   1.00 33.11 ? 68  LEU D HB3  1  
ATOM 8175   H HG   . LEU D 1 68  ? 17.003  -14.854 6.423   1.00 44.04 ? 68  LEU D HG   1  
ATOM 8176   H HD11 . LEU D 1 68  ? 15.459  -16.416 7.492   1.00 10.24 ? 68  LEU D HD11 1  
ATOM 8177   H HD12 . LEU D 1 68  ? 16.279  -16.209 9.041   1.00 51.12 ? 68  LEU D HD12 1  
ATOM 8178   H HD13 . LEU D 1 68  ? 17.126  -16.953 7.683   1.00 15.23 ? 68  LEU D HD13 1  
ATOM 8179   H HD21 . LEU D 1 68  ? 16.203  -12.766 7.412   1.00 71.44 ? 68  LEU D HD21 1  
ATOM 8180   H HD22 . LEU D 1 68  ? 15.703  -13.629 8.868   1.00 25.45 ? 68  LEU D HD22 1  
ATOM 8181   H HD23 . LEU D 1 68  ? 14.926  -13.972 7.323   1.00 4.34  ? 68  LEU D HD23 1  
ATOM 8182   N N    . GLY D 1 69  ? 20.565  -16.920 8.169   1.00 42.22 ? 69  GLY D N    1  
ATOM 8183   C CA   . GLY D 1 69  ? 20.807  -18.346 8.239   1.00 61.55 ? 69  GLY D CA   1  
ATOM 8184   C C    . GLY D 1 69  ? 21.802  -18.807 7.196   1.00 71.04 ? 69  GLY D C    1  
ATOM 8185   O O    . GLY D 1 69  ? 22.973  -18.423 7.232   1.00 52.22 ? 69  GLY D O    1  
ATOM 8186   H H    . GLY D 1 69  ? 21.028  -16.327 8.793   1.00 52.12 ? 69  GLY D H    1  
ATOM 8187   H HA2  . GLY D 1 69  ? 21.196  -18.583 9.220   1.00 64.44 ? 69  GLY D HA2  1  
ATOM 8188   H HA3  . GLY D 1 69  ? 19.863  -18.885 8.096   1.00 73.34 ? 69  GLY D HA3  1  
ATOM 8189   N N    . GLU D 1 70  ? 21.315  -19.601 6.242   1.00 31.01 ? 70  GLU D N    1  
ATOM 8190   C CA   . GLU D 1 70  ? 22.147  -20.253 5.218   1.00 20.21 ? 70  GLU D CA   1  
ATOM 8191   C C    . GLU D 1 70  ? 21.792  -19.751 3.812   1.00 72.13 ? 70  GLU D C    1  
ATOM 8192   O O    . GLU D 1 70  ? 22.378  -20.209 2.832   1.00 64.20 ? 70  GLU D O    1  
ATOM 8193   C CB   . GLU D 1 70  ? 21.880  -21.776 5.313   1.00 3.31  ? 70  GLU D CB   1  
ATOM 8194   C CG   . GLU D 1 70  ? 20.405  -22.162 5.035   1.00 13.33 ? 70  GLU D CG   1  
ATOM 8195   C CD   . GLU D 1 70  ? 20.015  -23.540 5.574   1.00 53.54 ? 70  GLU D CD   1  
ATOM 8196   O OE1  . GLU D 1 70  ? 20.395  -24.560 4.961   1.00 72.23 ? 70  GLU D OE1  1  
ATOM 8197   O OE2  . GLU D 1 70  ? 19.329  -23.608 6.617   1.00 11.15 ? 70  GLU D OE2  1  
ATOM 8198   H H    . GLU D 1 70  ? 20.345  -19.756 6.219   1.00 12.03 ? 70  GLU D H    1  
ATOM 8199   H HA   . GLU D 1 70  ? 23.198  -20.057 5.415   1.00 1.42  ? 70  GLU D HA   1  
ATOM 8200   H HB2  . GLU D 1 70  ? 22.514  -22.299 4.597   1.00 31.51 ? 70  GLU D HB2  1  
ATOM 8201   H HB3  . GLU D 1 70  ? 22.143  -22.115 6.309   1.00 71.22 ? 70  GLU D HB3  1  
ATOM 8202   H HG2  . GLU D 1 70  ? 19.756  -21.412 5.483   1.00 34.44 ? 70  GLU D HG2  1  
ATOM 8203   H HG3  . GLU D 1 70  ? 20.243  -22.150 3.962   1.00 63.23 ? 70  GLU D HG3  1  
ATOM 8204   N N    . GLU D 1 71  ? 20.862  -18.782 3.721   1.00 52.21 ? 71  GLU D N    1  
ATOM 8205   C CA   . GLU D 1 71  ? 20.252  -18.387 2.435   1.00 52.30 ? 71  GLU D CA   1  
ATOM 8206   C C    . GLU D 1 71  ? 19.718  -16.949 2.484   1.00 54.00 ? 71  GLU D C    1  
ATOM 8207   O O    . GLU D 1 71  ? 19.776  -16.279 3.528   1.00 52.44 ? 71  GLU D O    1  
ATOM 8208   C CB   . GLU D 1 71  ? 19.109  -19.387 2.082   1.00 14.14 ? 71  GLU D CB   1  
ATOM 8209   C CG   . GLU D 1 71  ? 17.956  -19.426 3.115   1.00 62.43 ? 71  GLU D CG   1  
ATOM 8210   C CD   . GLU D 1 71  ? 16.966  -20.579 2.882   1.00 33.14 ? 71  GLU D CD   1  
ATOM 8211   O OE1  . GLU D 1 71  ? 17.380  -21.745 3.020   1.00 72.31 ? 71  GLU D OE1  1  
ATOM 8212   O OE2  . GLU D 1 71  ? 15.777  -20.338 2.609   1.00 74.51 ? 71  GLU D OE2  1  
ATOM 8213   H H    . GLU D 1 71  ? 20.575  -18.320 4.536   1.00 5.33  ? 71  GLU D H    1  
ATOM 8214   H HA   . GLU D 1 71  ? 21.018  -18.437 1.666   1.00 43.42 ? 71  GLU D HA   1  
ATOM 8215   H HB2  . GLU D 1 71  ? 18.697  -19.126 1.113   1.00 51.20 ? 71  GLU D HB2  1  
ATOM 8216   H HB3  . GLU D 1 71  ? 19.534  -20.383 2.013   1.00 54.13 ? 71  GLU D HB3  1  
ATOM 8217   H HG2  . GLU D 1 71  ? 18.381  -19.534 4.108   1.00 12.41 ? 71  GLU D HG2  1  
ATOM 8218   H HG3  . GLU D 1 71  ? 17.423  -18.481 3.068   1.00 42.03 ? 71  GLU D HG3  1  
ATOM 8219   N N    . THR D 1 72  ? 19.222  -16.489 1.322   1.00 53.32 ? 72  THR D N    1  
ATOM 8220   C CA   . THR D 1 72  ? 18.562  -15.193 1.178   1.00 35.44 ? 72  THR D CA   1  
ATOM 8221   C C    . THR D 1 72  ? 17.223  -15.163 1.953   1.00 1.51  ? 72  THR D C    1  
ATOM 8222   O O    . THR D 1 72  ? 16.451  -16.133 1.927   1.00 33.30 ? 72  THR D O    1  
ATOM 8223   C CB   . THR D 1 72  ? 18.289  -14.890 -0.332  1.00 51.31 ? 72  THR D CB   1  
ATOM 8224   O OG1  . THR D 1 72  ? 19.525  -14.934 -1.063  1.00 11.21 ? 72  THR D OG1  1  
ATOM 8225   C CG2  . THR D 1 72  ? 17.614  -13.516 -0.548  1.00 55.21 ? 72  THR D CG2  1  
ATOM 8226   H H    . THR D 1 72  ? 19.308  -17.053 0.520   1.00 1.01  ? 72  THR D H    1  
ATOM 8227   H HA   . THR D 1 72  ? 19.231  -14.426 1.568   1.00 74.22 ? 72  THR D HA   1  
ATOM 8228   H HB   . THR D 1 72  ? 17.637  -15.665 -0.727  1.00 45.11 ? 72  THR D HB   1  
ATOM 8229   H HG1  . THR D 1 72  ? 19.342  -14.882 -2.005  1.00 54.12 ? 72  THR D HG1  1  
ATOM 8230   H HG21 . THR D 1 72  ? 17.305  -13.420 -1.574  1.00 52.24 ? 72  THR D HG21 1  
ATOM 8231   H HG22 . THR D 1 72  ? 18.309  -12.721 -0.318  1.00 3.23  ? 72  THR D HG22 1  
ATOM 8232   H HG23 . THR D 1 72  ? 16.745  -13.425 0.092   1.00 54.15 ? 72  THR D HG23 1  
ATOM 8233   N N    . ALA D 1 73  ? 16.981  -14.030 2.627   1.00 63.14 ? 73  ALA D N    1  
ATOM 8234   C CA   . ALA D 1 73  ? 15.704  -13.725 3.282   1.00 65.25 ? 73  ALA D CA   1  
ATOM 8235   C C    . ALA D 1 73  ? 14.741  -13.172 2.216   1.00 0.43  ? 73  ALA D C    1  
ATOM 8236   O O    . ALA D 1 73  ? 13.748  -13.809 1.834   1.00 40.20 ? 73  ALA D O    1  
ATOM 8237   C CB   . ALA D 1 73  ? 15.932  -12.683 4.398   1.00 32.45 ? 73  ALA D CB   1  
ATOM 8238   H H    . ALA D 1 73  ? 17.690  -13.354 2.656   1.00 13.32 ? 73  ALA D H    1  
ATOM 8239   H HA   . ALA D 1 73  ? 15.297  -14.634 3.723   1.00 21.31 ? 73  ALA D HA   1  
ATOM 8240   H HB1  . ALA D 1 73  ? 16.200  -11.743 3.955   1.00 41.02 ? 73  ALA D HB1  1  
ATOM 8241   H HB2  . ALA D 1 73  ? 16.743  -12.981 5.039   1.00 44.10 ? 73  ALA D HB2  1  
ATOM 8242   H HB3  . ALA D 1 73  ? 15.033  -12.557 4.986   1.00 14.31 ? 73  ALA D HB3  1  
ATOM 8243   N N    . PHE D 1 74  ? 15.120  -11.987 1.705   1.00 33.53 ? 74  PHE D N    1  
ATOM 8244   C CA   . PHE D 1 74  ? 14.401  -11.256 0.655   1.00 40.43 ? 74  PHE D CA   1  
ATOM 8245   C C    . PHE D 1 74  ? 15.378  -10.309 -0.063  1.00 22.02 ? 74  PHE D C    1  
ATOM 8246   O O    . PHE D 1 74  ? 16.478  -10.028 0.439   1.00 62.10 ? 74  PHE D O    1  
ATOM 8247   C CB   . PHE D 1 74  ? 13.195  -10.464 1.244   1.00 50.51 ? 74  PHE D CB   1  
ATOM 8248   C CG   . PHE D 1 74  ? 13.549  -9.412  2.314   1.00 40.10 ? 74  PHE D CG   1  
ATOM 8249   C CD1  . PHE D 1 74  ? 13.834  -8.088  1.962   1.00 74.24 ? 74  PHE D CD1  1  
ATOM 8250   C CD2  . PHE D 1 74  ? 13.597  -9.753  3.668   1.00 73.44 ? 74  PHE D CD2  1  
ATOM 8251   C CE1  . PHE D 1 74  ? 14.152  -7.147  2.926   1.00 24.11 ? 74  PHE D CE1  1  
ATOM 8252   C CE2  . PHE D 1 74  ? 13.911  -8.810  4.632   1.00 15.31 ? 74  PHE D CE2  1  
ATOM 8253   C CZ   . PHE D 1 74  ? 14.191  -7.508  4.261   1.00 23.30 ? 74  PHE D CZ   1  
ATOM 8254   H H    . PHE D 1 74  ? 15.938  -11.582 2.054   1.00 51.34 ? 74  PHE D H    1  
ATOM 8255   H HA   . PHE D 1 74  ? 14.032  -11.980 -0.072  1.00 64.34 ? 74  PHE D HA   1  
ATOM 8256   H HB2  . PHE D 1 74  ? 12.674  -9.958  0.436   1.00 3.12  ? 74  PHE D HB2  1  
ATOM 8257   H HB3  . PHE D 1 74  ? 12.506  -11.173 1.691   1.00 4.31  ? 74  PHE D HB3  1  
ATOM 8258   H HD1  . PHE D 1 74  ? 13.804  -7.797  0.918   1.00 52.00 ? 74  PHE D HD1  1  
ATOM 8259   H HD2  . PHE D 1 74  ? 13.377  -10.772 3.967   1.00 52.31 ? 74  PHE D HD2  1  
ATOM 8260   H HE1  . PHE D 1 74  ? 14.371  -6.130  2.635   1.00 34.41 ? 74  PHE D HE1  1  
ATOM 8261   H HE2  . PHE D 1 74  ? 13.942  -9.096  5.676   1.00 22.24 ? 74  PHE D HE2  1  
ATOM 8262   H HZ   . PHE D 1 74  ? 14.440  -6.774  5.014   1.00 54.55 ? 74  PHE D HZ   1  
ATOM 8263   N N    . LEU D 1 75  ? 14.953  -9.822  -1.229  1.00 42.31 ? 75  LEU D N    1  
ATOM 8264   C CA   . LEU D 1 75  ? 15.695  -8.857  -2.052  1.00 31.41 ? 75  LEU D CA   1  
ATOM 8265   C C    . LEU D 1 75  ? 14.768  -7.671  -2.335  1.00 24.32 ? 75  LEU D C    1  
ATOM 8266   O O    . LEU D 1 75  ? 13.561  -7.848  -2.492  1.00 45.44 ? 75  LEU D O    1  
ATOM 8267   C CB   . LEU D 1 75  ? 16.184  -9.523  -3.378  1.00 61.21 ? 75  LEU D CB   1  
ATOM 8268   C CG   . LEU D 1 75  ? 17.135  -10.755 -3.201  1.00 2.31  ? 75  LEU D CG   1  
ATOM 8269   C CD1  . LEU D 1 75  ? 17.498  -11.407 -4.553  1.00 71.22 ? 75  LEU D CD1  1  
ATOM 8270   C CD2  . LEU D 1 75  ? 18.399  -10.385 -2.389  1.00 3.14  ? 75  LEU D CD2  1  
ATOM 8271   H H    . LEU D 1 75  ? 14.074  -10.104 -1.548  1.00 14.24 ? 75  LEU D H    1  
ATOM 8272   H HA   . LEU D 1 75  ? 16.559  -8.502  -1.488  1.00 14.45 ? 75  LEU D HA   1  
ATOM 8273   H HB2  . LEU D 1 75  ? 15.309  -9.842  -3.943  1.00 50.10 ? 75  LEU D HB2  1  
ATOM 8274   H HB3  . LEU D 1 75  ? 16.706  -8.775  -3.967  1.00 12.15 ? 75  LEU D HB3  1  
ATOM 8275   H HG   . LEU D 1 75  ? 16.602  -11.506 -2.630  1.00 31.21 ? 75  LEU D HG   1  
ATOM 8276   H HD11 . LEU D 1 75  ? 18.222  -12.196 -4.396  1.00 52.10 ? 75  LEU D HD11 1  
ATOM 8277   H HD12 . LEU D 1 75  ? 17.913  -10.668 -5.227  1.00 62.33 ? 75  LEU D HD12 1  
ATOM 8278   H HD13 . LEU D 1 75  ? 16.608  -11.832 -4.991  1.00 23.32 ? 75  LEU D HD13 1  
ATOM 8279   H HD21 . LEU D 1 75  ? 18.932  -9.571  -2.864  1.00 24.25 ? 75  LEU D HD21 1  
ATOM 8280   H HD22 . LEU D 1 75  ? 19.056  -11.244 -2.320  1.00 63.21 ? 75  LEU D HD22 1  
ATOM 8281   H HD23 . LEU D 1 75  ? 18.112  -10.087 -1.389  1.00 0.34  ? 75  LEU D HD23 1  
ATOM 8282   N N    . CYS D 1 76  ? 15.345  -6.475  -2.379  1.00 21.21 ? 76  CYS D N    1  
ATOM 8283   C CA   . CYS D 1 76  ? 14.620  -5.215  -2.602  1.00 54.12 ? 76  CYS D CA   1  
ATOM 8284   C C    . CYS D 1 76  ? 15.522  -4.276  -3.407  1.00 52.02 ? 76  CYS D C    1  
ATOM 8285   O O    . CYS D 1 76  ? 16.731  -4.253  -3.187  1.00 2.40  ? 76  CYS D O    1  
ATOM 8286   C CB   . CYS D 1 76  ? 14.193  -4.575  -1.243  1.00 41.14 ? 76  CYS D CB   1  
ATOM 8287   S SG   . CYS D 1 76  ? 12.432  -4.716  -0.875  1.00 32.25 ? 76  CYS D SG   1  
ATOM 8288   H H    . CYS D 1 76  ? 16.317  -6.427  -2.254  1.00 34.22 ? 76  CYS D H    1  
ATOM 8289   H HA   . CYS D 1 76  ? 13.727  -5.432  -3.191  1.00 72.10 ? 76  CYS D HA   1  
ATOM 8290   H HB2  . CYS D 1 76  ? 14.724  -5.050  -0.429  1.00 15.44 ? 76  CYS D HB2  1  
ATOM 8291   H HB3  . CYS D 1 76  ? 14.432  -3.513  -1.230  1.00 11.40 ? 76  CYS D HB3  1  
ATOM 8292   H HG   . CYS D 1 76  ? 11.920  -3.493  -0.932  1.00 52.20 ? 76  CYS D HG   1  
ATOM 8293   N N    . GLU D 1 77  ? 14.941  -3.559  -4.374  1.00 11.32 ? 77  GLU D N    1  
ATOM 8294   C CA   . GLU D 1 77  ? 15.667  -2.575  -5.184  1.00 44.41 ? 77  GLU D CA   1  
ATOM 8295   C C    . GLU D 1 77  ? 14.679  -1.573  -5.776  1.00 11.34 ? 77  GLU D C    1  
ATOM 8296   O O    . GLU D 1 77  ? 13.662  -1.973  -6.342  1.00 74.12 ? 77  GLU D O    1  
ATOM 8297   C CB   . GLU D 1 77  ? 16.483  -3.280  -6.302  1.00 63.14 ? 77  GLU D CB   1  
ATOM 8298   C CG   . GLU D 1 77  ? 17.410  -2.336  -7.078  1.00 61.44 ? 77  GLU D CG   1  
ATOM 8299   C CD   . GLU D 1 77  ? 18.258  -3.050  -8.132  1.00 3.11  ? 77  GLU D CD   1  
ATOM 8300   O OE1  . GLU D 1 77  ? 19.217  -3.756  -7.759  1.00 62.31 ? 77  GLU D OE1  1  
ATOM 8301   O OE2  . GLU D 1 77  ? 17.990  -2.890  -9.338  1.00 21.10 ? 77  GLU D OE2  1  
ATOM 8302   H H    . GLU D 1 77  ? 13.983  -3.692  -4.547  1.00 41.51 ? 77  GLU D H    1  
ATOM 8303   H HA   . GLU D 1 77  ? 16.345  -2.035  -4.523  1.00 62.01 ? 77  GLU D HA   1  
ATOM 8304   H HB2  . GLU D 1 77  ? 17.088  -4.061  -5.850  1.00 55.45 ? 77  GLU D HB2  1  
ATOM 8305   H HB3  . GLU D 1 77  ? 15.796  -3.743  -7.006  1.00 42.43 ? 77  GLU D HB3  1  
ATOM 8306   H HG2  . GLU D 1 77  ? 16.804  -1.574  -7.562  1.00 31.43 ? 77  GLU D HG2  1  
ATOM 8307   H HG3  . GLU D 1 77  ? 18.078  -1.847  -6.371  1.00 21.21 ? 77  GLU D HG3  1  
ATOM 8308   N N    . VAL D 1 78  ? 14.967  -0.267  -5.620  1.00 70.25 ? 78  VAL D N    1  
ATOM 8309   C CA   . VAL D 1 78  ? 14.104  0.821   -6.121  1.00 14.23 ? 78  VAL D CA   1  
ATOM 8310   C C    . VAL D 1 78  ? 14.966  1.912   -6.752  1.00 63.20 ? 78  VAL D C    1  
ATOM 8311   O O    . VAL D 1 78  ? 15.801  2.514   -6.071  1.00 24.53 ? 78  VAL D O    1  
ATOM 8312   C CB   . VAL D 1 78  ? 13.235  1.482   -4.978  1.00 61.14 ? 78  VAL D CB   1  
ATOM 8313   C CG1  . VAL D 1 78  ? 12.308  2.584   -5.558  1.00 74.35 ? 78  VAL D CG1  1  
ATOM 8314   C CG2  . VAL D 1 78  ? 12.437  0.419   -4.193  1.00 41.22 ? 78  VAL D CG2  1  
ATOM 8315   H H    . VAL D 1 78  ? 15.797  -0.026  -5.159  1.00 73.12 ? 78  VAL D H    1  
ATOM 8316   H HA   . VAL D 1 78  ? 13.427  0.412   -6.876  1.00 1.10  ? 78  VAL D HA   1  
ATOM 8317   H HB   . VAL D 1 78  ? 13.918  1.966   -4.273  1.00 2.24  ? 78  VAL D HB   1  
ATOM 8318   H HG11 . VAL D 1 78  ? 12.908  3.401   -5.941  1.00 33.13 ? 78  VAL D HG11 1  
ATOM 8319   H HG12 . VAL D 1 78  ? 11.645  2.962   -4.793  1.00 61.32 ? 78  VAL D HG12 1  
ATOM 8320   H HG13 . VAL D 1 78  ? 11.723  2.179   -6.373  1.00 62.24 ? 78  VAL D HG13 1  
ATOM 8321   H HG21 . VAL D 1 78  ? 11.543  0.123   -4.729  1.00 23.31 ? 78  VAL D HG21 1  
ATOM 8322   H HG22 . VAL D 1 78  ? 12.167  0.789   -3.220  1.00 5.35  ? 78  VAL D HG22 1  
ATOM 8323   H HG23 . VAL D 1 78  ? 13.055  -0.459  -4.050  1.00 55.55 ? 78  VAL D HG23 1  
ATOM 8324   N N    . GLN D 1 79  ? 14.744  2.165   -8.046  1.00 52.52 ? 79  GLN D N    1  
ATOM 8325   C CA   . GLN D 1 79  ? 15.314  3.308   -8.754  1.00 61.21 ? 79  GLN D CA   1  
ATOM 8326   C C    . GLN D 1 79  ? 14.356  4.508   -8.627  1.00 43.13 ? 79  GLN D C    1  
ATOM 8327   O O    . GLN D 1 79  ? 13.413  4.652   -9.421  1.00 32.11 ? 79  GLN D O    1  
ATOM 8328   C CB   . GLN D 1 79  ? 15.561  2.951   -10.244 1.00 42.30 ? 79  GLN D CB   1  
ATOM 8329   C CG   . GLN D 1 79  ? 16.505  1.753   -10.477 1.00 62.44 ? 79  GLN D CG   1  
ATOM 8330   C CD   . GLN D 1 79  ? 16.787  1.491   -11.961 1.00 1.51  ? 79  GLN D CD   1  
ATOM 8331   O OE1  . GLN D 1 79  ? 16.807  2.413   -12.771 1.00 42.12 ? 79  GLN D OE1  1  
ATOM 8332   N NE2  . GLN D 1 79  ? 16.966  0.238   -12.334 1.00 41.51 ? 79  GLN D NE2  1  
ATOM 8333   H H    . GLN D 1 79  ? 14.182  1.545   -8.547  1.00 50.24 ? 79  GLN D H    1  
ATOM 8334   H HA   . GLN D 1 79  ? 16.260  3.564   -8.289  1.00 3.25  ? 79  GLN D HA   1  
ATOM 8335   H HB2  . GLN D 1 79  ? 14.604  2.720   -10.709 1.00 53.24 ? 79  GLN D HB2  1  
ATOM 8336   H HB3  . GLN D 1 79  ? 15.980  3.817   -10.746 1.00 64.11 ? 79  GLN D HB3  1  
ATOM 8337   H HG2  . GLN D 1 79  ? 17.453  1.945   -9.981  1.00 43.22 ? 79  GLN D HG2  1  
ATOM 8338   H HG3  . GLN D 1 79  ? 16.051  0.869   -10.042 1.00 33.34 ? 79  GLN D HG3  1  
ATOM 8339   H HE21 . GLN D 1 79  ? 16.913  -0.463  -11.647 1.00 53.03 ? 79  GLN D HE21 1  
ATOM 8340   H HE22 . GLN D 1 79  ? 17.119  0.057   -13.282 1.00 24.55 ? 79  GLN D HE22 1  
ATOM 8341   N N    . GLN D 1 80  ? 14.569  5.328   -7.582  1.00 72.01 ? 80  GLN D N    1  
ATOM 8342   C CA   . GLN D 1 80  ? 13.787  6.548   -7.343  1.00 62.20 ? 80  GLN D CA   1  
ATOM 8343   C C    . GLN D 1 80  ? 14.321  7.684   -8.236  1.00 51.21 ? 80  GLN D C    1  
ATOM 8344   O O    . GLN D 1 80  ? 15.304  8.348   -7.884  1.00 61.12 ? 80  GLN D O    1  
ATOM 8345   C CB   . GLN D 1 80  ? 13.855  6.961   -5.845  1.00 2.41  ? 80  GLN D CB   1  
ATOM 8346   C CG   . GLN D 1 80  ? 12.891  8.107   -5.460  1.00 40.51 ? 80  GLN D CG   1  
ATOM 8347   C CD   . GLN D 1 80  ? 11.409  7.709   -5.498  1.00 55.50 ? 80  GLN D CD   1  
ATOM 8348   O OE1  . GLN D 1 80  ? 10.549  8.520   -5.841  1.00 14.50 ? 80  GLN D OE1  1  
ATOM 8349   N NE2  . GLN D 1 80  ? 11.091  6.489   -5.061  1.00 71.13 ? 80  GLN D NE2  1  
ATOM 8350   H H    . GLN D 1 80  ? 15.280  5.101   -6.946  1.00 21.13 ? 80  GLN D H    1  
ATOM 8351   H HA   . GLN D 1 80  ? 12.745  6.343   -7.604  1.00 23.43 ? 80  GLN D HA   1  
ATOM 8352   H HB2  . GLN D 1 80  ? 13.616  6.097   -5.232  1.00 1.35  ? 80  GLN D HB2  1  
ATOM 8353   H HB3  . GLN D 1 80  ? 14.869  7.275   -5.611  1.00 0.13  ? 80  GLN D HB3  1  
ATOM 8354   H HG2  . GLN D 1 80  ? 13.126  8.437   -4.455  1.00 11.12 ? 80  GLN D HG2  1  
ATOM 8355   H HG3  . GLN D 1 80  ? 13.047  8.933   -6.144  1.00 12.43 ? 80  GLN D HG3  1  
ATOM 8356   H HE21 . GLN D 1 80  ? 11.810  5.907   -4.731  1.00 31.33 ? 80  GLN D HE21 1  
ATOM 8357   H HE22 . GLN D 1 80  ? 10.151  6.225   -5.088  1.00 64.14 ? 80  GLN D HE22 1  
ATOM 8358   N N    . GLY D 1 81  ? 13.698  7.865   -9.409  1.00 2.11  ? 81  GLY D N    1  
ATOM 8359   C CA   . GLY D 1 81  ? 14.076  8.935   -10.325 1.00 52.23 ? 81  GLY D CA   1  
ATOM 8360   C C    . GLY D 1 81  ? 13.354  10.227  -9.999  1.00 0.42  ? 81  GLY D C    1  
ATOM 8361   O O    . GLY D 1 81  ? 12.163  10.212  -9.657  1.00 52.13 ? 81  GLY D O    1  
ATOM 8362   H H    . GLY D 1 81  ? 12.949  7.277   -9.640  1.00 64.14 ? 81  GLY D H    1  
ATOM 8363   H HA2  . GLY D 1 81  ? 15.149  9.093   -10.278 1.00 44.14 ? 81  GLY D HA2  1  
ATOM 8364   H HA3  . GLY D 1 81  ? 13.820  8.637   -11.332 1.00 60.51 ? 81  GLY D HA3  1  
ATOM 8365   N N    . GLY D 1 82  ? 14.062  11.351  -10.131 1.00 43.10 ? 82  GLY D N    1  
ATOM 8366   C CA   . GLY D 1 82  ? 13.516  12.656  -9.809  1.00 54.44 ? 82  GLY D CA   1  
ATOM 8367   C C    . GLY D 1 82  ? 13.876  13.666  -10.866 1.00 63.43 ? 82  GLY D C    1  
ATOM 8368   O O    . GLY D 1 82  ? 15.049  13.789  -11.242 1.00 42.51 ? 82  GLY D O    1  
ATOM 8369   H H    . GLY D 1 82  ? 14.982  11.293  -10.464 1.00 44.45 ? 82  GLY D H    1  
ATOM 8370   H HA2  . GLY D 1 82  ? 12.433  12.599  -9.709  1.00 35.54 ? 82  GLY D HA2  1  
ATOM 8371   H HA3  . GLY D 1 82  ? 13.932  12.981  -8.865  1.00 42.54 ? 82  GLY D HA3  1  
ATOM 8372   N N    . ILE D 1 83  ? 12.866  14.390  -11.346 1.00 62.43 ? 83  ILE D N    1  
ATOM 8373   C CA   . ILE D 1 83  ? 13.038  15.471  -12.306 1.00 51.21 ? 83  ILE D CA   1  
ATOM 8374   C C    . ILE D 1 83  ? 13.267  16.765  -11.518 1.00 1.14  ? 83  ILE D C    1  
ATOM 8375   O O    . ILE D 1 83  ? 12.418  17.172  -10.712 1.00 62.53 ? 83  ILE D O    1  
ATOM 8376   C CB   . ILE D 1 83  ? 11.788  15.607  -13.249 1.00 13.13 ? 83  ILE D CB   1  
ATOM 8377   C CG1  . ILE D 1 83  ? 11.499  14.236  -13.959 1.00 42.51 ? 83  ILE D CG1  1  
ATOM 8378   C CG2  . ILE D 1 83  ? 11.994  16.762  -14.268 1.00 64.44 ? 83  ILE D CG2  1  
ATOM 8379   C CD1  . ILE D 1 83  ? 10.334  14.239  -14.933 1.00 65.34 ? 83  ILE D CD1  1  
ATOM 8380   H H    . ILE D 1 83  ? 11.964  14.185  -11.036 1.00 41.32 ? 83  ILE D H    1  
ATOM 8381   H HA   . ILE D 1 83  ? 13.914  15.253  -12.921 1.00 43.33 ? 83  ILE D HA   1  
ATOM 8382   H HB   . ILE D 1 83  ? 10.927  15.864  -12.630 1.00 14.22 ? 83  ILE D HB   1  
ATOM 8383   H HG12 . ILE D 1 83  ? 12.373  13.925  -14.512 1.00 13.12 ? 83  ILE D HG12 1  
ATOM 8384   H HG13 . ILE D 1 83  ? 11.283  13.486  -13.205 1.00 21.53 ? 83  ILE D HG13 1  
ATOM 8385   H HG21 . ILE D 1 83  ? 12.164  17.693  -13.739 1.00 64.21 ? 83  ILE D HG21 1  
ATOM 8386   H HG22 . ILE D 1 83  ? 11.120  16.870  -14.883 1.00 24.45 ? 83  ILE D HG22 1  
ATOM 8387   H HG23 . ILE D 1 83  ? 12.847  16.552  -14.899 1.00 43.55 ? 83  ILE D HG23 1  
ATOM 8388   H HD11 . ILE D 1 83  ? 10.210  13.247  -15.341 1.00 43.42 ? 83  ILE D HD11 1  
ATOM 8389   H HD12 . ILE D 1 83  ? 10.535  14.933  -15.735 1.00 13.31 ? 83  ILE D HD12 1  
ATOM 8390   H HD13 . ILE D 1 83  ? 9.429   14.531  -14.418 1.00 4.22  ? 83  ILE D HD13 1  
ATOM 8391   N N    . PHE D 1 84  ? 14.429  17.379  -11.738 1.00 44.52 ? 84  PHE D N    1  
ATOM 8392   C CA   . PHE D 1 84  ? 14.867  18.589  -11.029 1.00 43.12 ? 84  PHE D CA   1  
ATOM 8393   C C    . PHE D 1 84  ? 15.126  19.702  -12.046 1.00 61.51 ? 84  PHE D C    1  
ATOM 8394   O O    . PHE D 1 84  ? 15.540  19.437  -13.179 1.00 15.31 ? 84  PHE D O    1  
ATOM 8395   C CB   . PHE D 1 84  ? 16.163  18.315  -10.214 1.00 22.11 ? 84  PHE D CB   1  
ATOM 8396   C CG   . PHE D 1 84  ? 16.025  17.259  -9.111  1.00 72.51 ? 84  PHE D CG   1  
ATOM 8397   C CD1  . PHE D 1 84  ? 16.544  15.968  -9.265  1.00 22.34 ? 84  PHE D CD1  1  
ATOM 8398   C CD2  . PHE D 1 84  ? 15.378  17.564  -7.911  1.00 63.03 ? 84  PHE D CD2  1  
ATOM 8399   C CE1  . PHE D 1 84  ? 16.418  15.025  -8.256  1.00 73.11 ? 84  PHE D CE1  1  
ATOM 8400   C CE2  . PHE D 1 84  ? 15.253  16.618  -6.906  1.00 40.34 ? 84  PHE D CE2  1  
ATOM 8401   C CZ   . PHE D 1 84  ? 15.774  15.353  -7.078  1.00 11.23 ? 84  PHE D CZ   1  
ATOM 8402   H H    . PHE D 1 84  ? 15.016  17.014  -12.436 1.00 51.33 ? 84  PHE D H    1  
ATOM 8403   H HA   . PHE D 1 84  ? 14.077  18.909  -10.347 1.00 23.11 ? 84  PHE D HA   1  
ATOM 8404   H HB2  . PHE D 1 84  ? 16.945  17.992  -10.897 1.00 25.15 ? 84  PHE D HB2  1  
ATOM 8405   H HB3  . PHE D 1 84  ? 16.488  19.242  -9.746  1.00 64.10 ? 84  PHE D HB3  1  
ATOM 8406   H HD1  . PHE D 1 84  ? 17.051  15.704  -10.185 1.00 15.21 ? 84  PHE D HD1  1  
ATOM 8407   H HD2  . PHE D 1 84  ? 14.965  18.555  -7.766  1.00 71.55 ? 84  PHE D HD2  1  
ATOM 8408   H HE1  . PHE D 1 84  ? 16.823  14.029  -8.391  1.00 52.22 ? 84  PHE D HE1  1  
ATOM 8409   H HE2  . PHE D 1 84  ? 14.750  16.874  -5.983  1.00 13.22 ? 84  PHE D HE2  1  
ATOM 8410   H HZ   . PHE D 1 84  ? 15.677  14.616  -6.290  1.00 22.10 ? 84  PHE D HZ   1  
ATOM 8411   N N    . SER D 1 85  ? 14.872  20.940  -11.630 1.00 14.22 ? 85  SER D N    1  
ATOM 8412   C CA   . SER D 1 85  ? 15.202  22.134  -12.402 1.00 74.20 ? 85  SER D CA   1  
ATOM 8413   C C    . SER D 1 85  ? 16.507  22.696  -11.830 1.00 22.54 ? 85  SER D C    1  
ATOM 8414   O O    . SER D 1 85  ? 16.483  23.440  -10.852 1.00 21.15 ? 85  SER D O    1  
ATOM 8415   C CB   . SER D 1 85  ? 14.048  23.161  -12.298 1.00 5.42  ? 85  SER D CB   1  
ATOM 8416   O OG   . SER D 1 85  ? 12.809  22.575  -12.667 1.00 44.21 ? 85  SER D OG   1  
ATOM 8417   H H    . SER D 1 85  ? 14.463  21.057  -10.750 1.00 33.40 ? 85  SER D H    1  
ATOM 8418   H HA   . SER D 1 85  ? 15.349  21.860  -13.451 1.00 52.30 ? 85  SER D HA   1  
ATOM 8419   H HB2  . SER D 1 85  ? 13.965  23.518  -11.276 1.00 43.02 ? 85  SER D HB2  1  
ATOM 8420   H HB3  . SER D 1 85  ? 14.243  23.996  -12.954 1.00 45.24 ? 85  SER D HB3  1  
ATOM 8421   H HG   . SER D 1 85  ? 12.807  21.645  -12.415 1.00 10.15 ? 85  SER D HG   1  
ATOM 8422   N N    . ILE D 1 86  ? 17.640  22.298  -12.420 1.00 61.40 ? 86  ILE D N    1  
ATOM 8423   C CA   . ILE D 1 86  ? 18.977  22.617  -11.901 1.00 64.01 ? 86  ILE D CA   1  
ATOM 8424   C C    . ILE D 1 86  ? 19.624  23.683  -12.799 1.00 51.14 ? 86  ILE D C    1  
ATOM 8425   O O    . ILE D 1 86  ? 19.825  23.459  -13.998 1.00 14.01 ? 86  ILE D O    1  
ATOM 8426   C CB   . ILE D 1 86  ? 19.888  21.328  -11.843 1.00 53.32 ? 86  ILE D CB   1  
ATOM 8427   C CG1  . ILE D 1 86  ? 19.245  20.233  -10.926 1.00 61.01 ? 86  ILE D CG1  1  
ATOM 8428   C CG2  . ILE D 1 86  ? 21.332  21.673  -11.391 1.00 12.14 ? 86  ILE D CG2  1  
ATOM 8429   C CD1  . ILE D 1 86  ? 20.007  18.915  -10.857 1.00 11.34 ? 86  ILE D CD1  1  
ATOM 8430   H H    . ILE D 1 86  ? 17.577  21.782  -13.248 1.00 24.54 ? 86  ILE D H    1  
ATOM 8431   H HA   . ILE D 1 86  ? 18.876  23.010  -10.885 1.00 11.43 ? 86  ILE D HA   1  
ATOM 8432   H HB   . ILE D 1 86  ? 19.956  20.927  -12.854 1.00 31.42 ? 86  ILE D HB   1  
ATOM 8433   H HG12 . ILE D 1 86  ? 19.163  20.609  -9.914  1.00 32.24 ? 86  ILE D HG12 1  
ATOM 8434   H HG13 . ILE D 1 86  ? 18.250  20.006  -11.291 1.00 63.31 ? 86  ILE D HG13 1  
ATOM 8435   H HG21 . ILE D 1 86  ? 21.775  22.379  -12.084 1.00 3.23  ? 86  ILE D HG21 1  
ATOM 8436   H HG22 . ILE D 1 86  ? 21.938  20.777  -11.372 1.00 31.34 ? 86  ILE D HG22 1  
ATOM 8437   H HG23 . ILE D 1 86  ? 21.314  22.110  -10.401 1.00 21.10 ? 86  ILE D HG23 1  
ATOM 8438   H HD11 . ILE D 1 86  ? 20.993  19.084  -10.449 1.00 61.23 ? 86  ILE D HD11 1  
ATOM 8439   H HD12 . ILE D 1 86  ? 20.093  18.494  -11.848 1.00 54.32 ? 86  ILE D HD12 1  
ATOM 8440   H HD13 . ILE D 1 86  ? 19.470  18.226  -10.221 1.00 12.11 ? 86  ILE D HD13 1  
ATOM 8441   N N    . ALA D 1 87  ? 19.916  24.841  -12.196 1.00 1.11  ? 87  ALA D N    1  
ATOM 8442   C CA   . ALA D 1 87  ? 20.592  25.963  -12.854 1.00 51.04 ? 87  ALA D CA   1  
ATOM 8443   C C    . ALA D 1 87  ? 21.367  26.774  -11.811 1.00 71.35 ? 87  ALA D C    1  
ATOM 8444   O O    . ALA D 1 87  ? 21.141  26.634  -10.601 1.00 3.50  ? 87  ALA D O    1  
ATOM 8445   C CB   . ALA D 1 87  ? 19.577  26.855  -13.605 1.00 3.11  ? 87  ALA D CB   1  
ATOM 8446   H H    . ALA D 1 87  ? 19.663  24.947  -11.252 1.00 73.22 ? 87  ALA D H    1  
ATOM 8447   H HA   . ALA D 1 87  ? 21.298  25.562  -13.577 1.00 2.21  ? 87  ALA D HA   1  
ATOM 8448   H HB1  . ALA D 1 87  ? 20.097  27.665  -14.105 1.00 70.41 ? 87  ALA D HB1  1  
ATOM 8449   H HB2  . ALA D 1 87  ? 18.860  27.271  -12.910 1.00 14.03 ? 87  ALA D HB2  1  
ATOM 8450   H HB3  . ALA D 1 87  ? 19.050  26.266  -14.346 1.00 51.44 ? 87  ALA D HB3  1  
ATOM 8451   N N    . GLY D 1 88  ? 22.332  27.562  -12.295 1.00 13.44 ? 88  GLY D N    1  
ATOM 8452   C CA   . GLY D 1 88  ? 23.038  28.562  -11.493 1.00 32.20 ? 88  GLY D CA   1  
ATOM 8453   C C    . GLY D 1 88  ? 24.175  28.032  -10.627 1.00 33.24 ? 88  GLY D C    1  
ATOM 8454   O O    . GLY D 1 88  ? 25.099  28.784  -10.293 1.00 53.14 ? 88  GLY D O    1  
ATOM 8455   H H    . GLY D 1 88  ? 22.583  27.454  -13.236 1.00 13.14 ? 88  GLY D H    1  
ATOM 8456   H HA2  . GLY D 1 88  ? 23.448  29.288  -12.175 1.00 21.41 ? 88  GLY D HA2  1  
ATOM 8457   H HA3  . GLY D 1 88  ? 22.327  29.074  -10.853 1.00 21.24 ? 88  GLY D HA3  1  
ATOM 8458   N N    . ILE D 1 89  ? 24.136  26.733  -10.294 1.00 21.22 ? 89  ILE D N    1  
ATOM 8459   C CA   . ILE D 1 89  ? 25.197  26.070  -9.523  1.00 43.45 ? 89  ILE D CA   1  
ATOM 8460   C C    . ILE D 1 89  ? 26.153  25.382  -10.500 1.00 73.23 ? 89  ILE D C    1  
ATOM 8461   O O    . ILE D 1 89  ? 25.718  24.735  -11.461 1.00 62.31 ? 89  ILE D O    1  
ATOM 8462   C CB   . ILE D 1 89  ? 24.624  25.034  -8.474  1.00 73.03 ? 89  ILE D CB   1  
ATOM 8463   C CG1  . ILE D 1 89  ? 23.666  23.991  -9.150  1.00 21.41 ? 89  ILE D CG1  1  
ATOM 8464   C CG2  . ILE D 1 89  ? 23.913  25.766  -7.309  1.00 43.24 ? 89  ILE D CG2  1  
ATOM 8465   C CD1  . ILE D 1 89  ? 23.125  22.908  -8.222  1.00 2.44  ? 89  ILE D CD1  1  
ATOM 8466   H H    . ILE D 1 89  ? 23.368  26.202  -10.577 1.00 23.23 ? 89  ILE D H    1  
ATOM 8467   H HA   . ILE D 1 89  ? 25.756  26.838  -8.978  1.00 72.31 ? 89  ILE D HA   1  
ATOM 8468   H HB   . ILE D 1 89  ? 25.475  24.501  -8.045  1.00 71.11 ? 89  ILE D HB   1  
ATOM 8469   H HG12 . ILE D 1 89  ? 22.812  24.510  -9.568  1.00 64.52 ? 89  ILE D HG12 1  
ATOM 8470   H HG13 . ILE D 1 89  ? 24.194  23.493  -9.954  1.00 71.40 ? 89  ILE D HG13 1  
ATOM 8471   H HG21 . ILE D 1 89  ? 23.559  25.044  -6.585  1.00 55.32 ? 89  ILE D HG21 1  
ATOM 8472   H HG22 . ILE D 1 89  ? 23.073  26.331  -7.690  1.00 13.13 ? 89  ILE D HG22 1  
ATOM 8473   H HG23 . ILE D 1 89  ? 24.606  26.444  -6.823  1.00 75.05 ? 89  ILE D HG23 1  
ATOM 8474   H HD11 . ILE D 1 89  ? 22.496  22.235  -8.788  1.00 64.33 ? 89  ILE D HD11 1  
ATOM 8475   H HD12 . ILE D 1 89  ? 22.539  23.359  -7.432  1.00 31.32 ? 89  ILE D HD12 1  
ATOM 8476   H HD13 . ILE D 1 89  ? 23.944  22.351  -7.790  1.00 33.42 ? 89  ILE D HD13 1  
ATOM 8477   N N    . GLU D 1 90  ? 27.456  25.544  -10.242 1.00 74.43 ? 90  GLU D N    1  
ATOM 8478   C CA   . GLU D 1 90  ? 28.527  25.147  -11.173 1.00 60.42 ? 90  GLU D CA   1  
ATOM 8479   C C    . GLU D 1 90  ? 29.862  25.022  -10.422 1.00 60.20 ? 90  GLU D C    1  
ATOM 8480   O O    . GLU D 1 90  ? 29.950  25.382  -9.239  1.00 25.11 ? 90  GLU D O    1  
ATOM 8481   C CB   . GLU D 1 90  ? 28.611  26.179  -12.324 1.00 23.22 ? 90  GLU D CB   1  
ATOM 8482   C CG   . GLU D 1 90  ? 28.653  27.640  -11.843 1.00 32.45 ? 90  GLU D CG   1  
ATOM 8483   C CD   . GLU D 1 90  ? 28.651  28.645  -12.991 1.00 45.42 ? 90  GLU D CD   1  
ATOM 8484   O OE1  . GLU D 1 90  ? 27.674  29.411  -13.129 1.00 0.33  ? 90  GLU D OE1  1  
ATOM 8485   O OE2  . GLU D 1 90  ? 29.631  28.674  -13.765 1.00 10.44 ? 90  GLU D OE2  1  
ATOM 8486   H H    . GLU D 1 90  ? 27.714  25.963  -9.392  1.00 54.12 ? 90  GLU D H    1  
ATOM 8487   H HA   . GLU D 1 90  ? 28.271  24.171  -11.583 1.00 73.45 ? 90  GLU D HA   1  
ATOM 8488   H HB2  . GLU D 1 90  ? 29.504  25.982  -12.915 1.00 20.11 ? 90  GLU D HB2  1  
ATOM 8489   H HB3  . GLU D 1 90  ? 27.745  26.057  -12.967 1.00 73.33 ? 90  GLU D HB3  1  
ATOM 8490   H HG2  . GLU D 1 90  ? 27.787  27.821  -11.210 1.00 44.44 ? 90  GLU D HG2  1  
ATOM 8491   H HG3  . GLU D 1 90  ? 29.546  27.790  -11.247 1.00 13.32 ? 90  GLU D HG3  1  
ATOM 8492   N N    . GLY D 1 91  ? 30.898  24.521  -11.127 1.00 55.13 ? 91  GLY D N    1  
ATOM 8493   C CA   . GLY D 1 91  ? 32.184  24.198  -10.508 1.00 60.31 ? 91  GLY D CA   1  
ATOM 8494   C C    . GLY D 1 91  ? 32.068  23.098  -9.452  1.00 41.01 ? 91  GLY D C    1  
ATOM 8495   O O    . GLY D 1 91  ? 31.345  22.106  -9.647  1.00 70.05 ? 91  GLY D O    1  
ATOM 8496   H H    . GLY D 1 91  ? 30.790  24.382  -12.090 1.00 73.23 ? 91  GLY D H    1  
ATOM 8497   H HA2  . GLY D 1 91  ? 32.862  23.867  -11.283 1.00 64.20 ? 91  GLY D HA2  1  
ATOM 8498   H HA3  . GLY D 1 91  ? 32.592  25.093  -10.055 1.00 64.40 ? 91  GLY D HA3  1  
ATOM 8499   N N    . THR D 1 92  ? 32.759  23.292  -8.319  1.00 4.43  ? 92  THR D N    1  
ATOM 8500   C CA   . THR D 1 92  ? 32.751  22.356  -7.183  1.00 60.35 ? 92  THR D CA   1  
ATOM 8501   C C    . THR D 1 92  ? 31.457  22.490  -6.347  1.00 75.42 ? 92  THR D C    1  
ATOM 8502   O O    . THR D 1 92  ? 31.094  21.567  -5.606  1.00 42.13 ? 92  THR D O    1  
ATOM 8503   C CB   . THR D 1 92  ? 34.007  22.608  -6.291  1.00 32.50 ? 92  THR D CB   1  
ATOM 8504   O OG1  . THR D 1 92  ? 34.084  24.007  -5.964  1.00 34.03 ? 92  THR D OG1  1  
ATOM 8505   C CG2  . THR D 1 92  ? 35.314  22.180  -6.994  1.00 1.32  ? 92  THR D CG2  1  
ATOM 8506   H H    . THR D 1 92  ? 33.303  24.108  -8.237  1.00 13.33 ? 92  THR D H    1  
ATOM 8507   H HA   . THR D 1 92  ? 32.807  21.342  -7.572  1.00 52.02 ? 92  THR D HA   1  
ATOM 8508   H HB   . THR D 1 92  ? 33.906  22.039  -5.371  1.00 70.22 ? 92  THR D HB   1  
ATOM 8509   H HG1  . THR D 1 92  ? 34.165  24.112  -5.012  1.00 1.03  ? 92  THR D HG1  1  
ATOM 8510   H HG21 . THR D 1 92  ? 35.435  22.732  -7.918  1.00 5.44  ? 92  THR D HG21 1  
ATOM 8511   H HG22 . THR D 1 92  ? 35.286  21.119  -7.212  1.00 73.52 ? 92  THR D HG22 1  
ATOM 8512   H HG23 . THR D 1 92  ? 36.157  22.386  -6.349  1.00 62.02 ? 92  THR D HG23 1  
ATOM 8513   N N    . GLN D 1 93  ? 30.775  23.651  -6.483  1.00 71.34 ? 93  GLN D N    1  
ATOM 8514   C CA   . GLN D 1 93  ? 29.485  23.929  -5.817  1.00 31.44 ? 93  GLN D CA   1  
ATOM 8515   C C    . GLN D 1 93  ? 28.407  22.936  -6.301  1.00 4.40  ? 93  GLN D C    1  
ATOM 8516   O O    . GLN D 1 93  ? 27.674  22.345  -5.489  1.00 24.42 ? 93  GLN D O    1  
ATOM 8517   C CB   . GLN D 1 93  ? 29.036  25.386  -6.117  1.00 41.41 ? 93  GLN D CB   1  
ATOM 8518   C CG   . GLN D 1 93  ? 27.716  25.817  -5.434  1.00 41.43 ? 93  GLN D CG   1  
ATOM 8519   C CD   . GLN D 1 93  ? 27.166  27.155  -5.940  1.00 54.14 ? 93  GLN D CD   1  
ATOM 8520   O OE1  . GLN D 1 93  ? 27.330  27.511  -7.109  1.00 61.43 ? 93  GLN D OE1  1  
ATOM 8521   N NE2  . GLN D 1 93  ? 26.509  27.898  -5.073  1.00 52.33 ? 93  GLN D NE2  1  
ATOM 8522   H H    . GLN D 1 93  ? 31.161  24.347  -7.053  1.00 65.35 ? 93  GLN D H    1  
ATOM 8523   H HA   . GLN D 1 93  ? 29.627  23.814  -4.746  1.00 33.33 ? 93  GLN D HA   1  
ATOM 8524   H HB2  . GLN D 1 93  ? 29.821  26.063  -5.792  1.00 53.23 ? 93  GLN D HB2  1  
ATOM 8525   H HB3  . GLN D 1 93  ? 28.915  25.497  -7.190  1.00 3.43  ? 93  GLN D HB3  1  
ATOM 8526   H HG2  . GLN D 1 93  ? 26.964  25.057  -5.615  1.00 2.22  ? 93  GLN D HG2  1  
ATOM 8527   H HG3  . GLN D 1 93  ? 27.891  25.889  -4.366  1.00 74.20 ? 93  GLN D HG3  1  
ATOM 8528   H HE21 . GLN D 1 93  ? 26.408  27.562  -4.159  1.00 41.14 ? 93  GLN D HE21 1  
ATOM 8529   H HE22 . GLN D 1 93  ? 26.147  28.754  -5.380  1.00 54.41 ? 93  GLN D HE22 1  
ATOM 8530   N N    . MET D 1 94  ? 28.339  22.766  -7.643  1.00 20.40 ? 94  MET D N    1  
ATOM 8531   C CA   . MET D 1 94  ? 27.388  21.837  -8.294  1.00 33.03 ? 94  MET D CA   1  
ATOM 8532   C C    . MET D 1 94  ? 27.717  20.397  -7.892  1.00 23.53 ? 94  MET D C    1  
ATOM 8533   O O    . MET D 1 94  ? 26.828  19.650  -7.513  1.00 24.52 ? 94  MET D O    1  
ATOM 8534   C CB   . MET D 1 94  ? 27.438  21.978  -9.844  1.00 74.33 ? 94  MET D CB   1  
ATOM 8535   C CG   . MET D 1 94  ? 26.199  21.448  -10.597 1.00 20.43 ? 94  MET D CG   1  
ATOM 8536   S SD   . MET D 1 94  ? 25.889  19.687  -10.373 1.00 34.21 ? 94  MET D SD   1  
ATOM 8537   C CE   . MET D 1 94  ? 24.292  19.497  -11.163 1.00 52.42 ? 94  MET D CE   1  
ATOM 8538   H H    . MET D 1 94  ? 28.953  23.284  -8.208  1.00 60.30 ? 94  MET D H    1  
ATOM 8539   H HA   . MET D 1 94  ? 26.387  22.085  -7.946  1.00 62.21 ? 94  MET D HA   1  
ATOM 8540   H HB2  . MET D 1 94  ? 27.540  23.028  -10.083 1.00 5.32  ? 94  MET D HB2  1  
ATOM 8541   H HB3  . MET D 1 94  ? 28.313  21.459  -10.225 1.00 1.43  ? 94  MET D HB3  1  
ATOM 8542   H HG2  . MET D 1 94  ? 25.325  21.992  -10.259 1.00 22.34 ? 94  MET D HG2  1  
ATOM 8543   H HG3  . MET D 1 94  ? 26.335  21.633  -11.657 1.00 23.53 ? 94  MET D HG3  1  
ATOM 8544   H HE1  . MET D 1 94  ? 23.563  20.111  -10.656 1.00 51.11 ? 94  MET D HE1  1  
ATOM 8545   H HE2  . MET D 1 94  ? 23.988  18.462  -11.113 1.00 14.11 ? 94  MET D HE2  1  
ATOM 8546   H HE3  . MET D 1 94  ? 24.361  19.802  -12.197 1.00 24.12 ? 94  MET D HE3  1  
ATOM 8547   N N    . ALA D 1 95  ? 29.019  20.052  -7.971  1.00 62.21 ? 95  ALA D N    1  
ATOM 8548   C CA   . ALA D 1 95  ? 29.547  18.708  -7.641  1.00 32.22 ? 95  ALA D CA   1  
ATOM 8549   C C    . ALA D 1 95  ? 29.123  18.245  -6.228  1.00 55.52 ? 95  ALA D C    1  
ATOM 8550   O O    . ALA D 1 95  ? 28.738  17.083  -6.023  1.00 71.30 ? 95  ALA D O    1  
ATOM 8551   C CB   . ALA D 1 95  ? 31.079  18.723  -7.768  1.00 63.33 ? 95  ALA D CB   1  
ATOM 8552   H H    . ALA D 1 95  ? 29.656  20.734  -8.269  1.00 33.33 ? 95  ALA D H    1  
ATOM 8553   H HA   . ALA D 1 95  ? 29.156  18.006  -8.372  1.00 23.24 ? 95  ALA D HA   1  
ATOM 8554   H HB1  . ALA D 1 95  ? 31.475  17.731  -7.583  1.00 22.12 ? 95  ALA D HB1  1  
ATOM 8555   H HB2  . ALA D 1 95  ? 31.502  19.415  -7.052  1.00 3.31  ? 95  ALA D HB2  1  
ATOM 8556   H HB3  . ALA D 1 95  ? 31.355  19.034  -8.767  1.00 3.44  ? 95  ALA D HB3  1  
ATOM 8557   N N    . HIS D 1 96  ? 29.190  19.184  -5.275  1.00 32.53 ? 96  HIS D N    1  
ATOM 8558   C CA   . HIS D 1 96  ? 28.774  18.953  -3.883  1.00 51.32 ? 96  HIS D CA   1  
ATOM 8559   C C    . HIS D 1 96  ? 27.249  18.736  -3.786  1.00 64.34 ? 96  HIS D C    1  
ATOM 8560   O O    . HIS D 1 96  ? 26.803  17.771  -3.171  1.00 65.22 ? 96  HIS D O    1  
ATOM 8561   C CB   . HIS D 1 96  ? 29.204  20.144  -3.004  1.00 10.52 ? 96  HIS D CB   1  
ATOM 8562   C CG   . HIS D 1 96  ? 28.715  20.069  -1.573  1.00 31.03 ? 96  HIS D CG   1  
ATOM 8563   N ND1  . HIS D 1 96  ? 27.801  20.956  -1.047  1.00 11.40 ? 96  HIS D ND1  1  
ATOM 8564   C CD2  . HIS D 1 96  ? 29.025  19.215  -0.563  1.00 22.23 ? 96  HIS D CD2  1  
ATOM 8565   C CE1  . HIS D 1 96  ? 27.573  20.657  0.213   1.00 65.43 ? 96  HIS D CE1  1  
ATOM 8566   N NE2  . HIS D 1 96  ? 28.299  19.606  0.533   1.00 43.41 ? 96  HIS D NE2  1  
ATOM 8567   H H    . HIS D 1 96  ? 29.534  20.068  -5.521  1.00 31.21 ? 96  HIS D H    1  
ATOM 8568   H HA   . HIS D 1 96  ? 29.280  18.054  -3.528  1.00 22.14 ? 96  HIS D HA   1  
ATOM 8569   H HB2  . HIS D 1 96  ? 30.287  20.194  -2.982  1.00 40.23 ? 96  HIS D HB2  1  
ATOM 8570   H HB3  . HIS D 1 96  ? 28.825  21.063  -3.441  1.00 3.31  ? 96  HIS D HB3  1  
ATOM 8571   H HD1  . HIS D 1 96  ? 27.386  21.703  -1.528  1.00 23.54 ? 96  HIS D HD1  1  
ATOM 8572   H HD2  . HIS D 1 96  ? 29.715  18.383  -0.614  1.00 62.53 ? 96  HIS D HD2  1  
ATOM 8573   H HE1  . HIS D 1 96  ? 26.903  21.185  0.875   1.00 31.45 ? 96  HIS D HE1  1  
ATOM 8574   H HE2  . HIS D 1 96  ? 28.181  19.080  1.352   1.00 37.99 ? 96  HIS D HE2  1  
ATOM 8575   N N    . CYS D 1 97  ? 26.471  19.655  -4.392  1.00 75.14 ? 97  CYS D N    1  
ATOM 8576   C CA   . CYS D 1 97  ? 24.987  19.614  -4.351  1.00 35.42 ? 97  CYS D CA   1  
ATOM 8577   C C    . CYS D 1 97  ? 24.439  18.332  -5.013  1.00 32.12 ? 97  CYS D C    1  
ATOM 8578   O O    . CYS D 1 97  ? 23.452  17.751  -4.554  1.00 42.34 ? 97  CYS D O    1  
ATOM 8579   C CB   . CYS D 1 97  ? 24.401  20.864  -5.045  1.00 64.44 ? 97  CYS D CB   1  
ATOM 8580   S SG   . CYS D 1 97  ? 22.592  20.969  -5.026  1.00 71.04 ? 97  CYS D SG   1  
ATOM 8581   H H    . CYS D 1 97  ? 26.905  20.382  -4.890  1.00 64.11 ? 97  CYS D H    1  
ATOM 8582   H HA   . CYS D 1 97  ? 24.686  19.624  -3.309  1.00 4.43  ? 97  CYS D HA   1  
ATOM 8583   H HB2  . CYS D 1 97  ? 24.776  21.749  -4.551  1.00 74.55 ? 97  CYS D HB2  1  
ATOM 8584   H HB3  . CYS D 1 97  ? 24.720  20.882  -6.081  1.00 3.42  ? 97  CYS D HB3  1  
ATOM 8585   H HG   . CYS D 1 97  ? 22.101  19.801  -5.422  1.00 43.54 ? 97  CYS D HG   1  
ATOM 8586   N N    . LEU D 1 98  ? 25.131  17.898  -6.073  1.00 30.51 ? 98  LEU D N    1  
ATOM 8587   C CA   . LEU D 1 98  ? 24.778  16.719  -6.888  1.00 13.34 ? 98  LEU D CA   1  
ATOM 8588   C C    . LEU D 1 98  ? 25.022  15.443  -6.065  1.00 30.01 ? 98  LEU D C    1  
ATOM 8589   O O    . LEU D 1 98  ? 24.191  14.537  -6.053  1.00 60.42 ? 98  LEU D O    1  
ATOM 8590   C CB   . LEU D 1 98  ? 25.665  16.731  -8.180  1.00 63.21 ? 98  LEU D CB   1  
ATOM 8591   C CG   . LEU D 1 98  ? 25.165  15.943  -9.446  1.00 25.32 ? 98  LEU D CG   1  
ATOM 8592   C CD1  . LEU D 1 98  ? 26.084  16.250  -10.642 1.00 22.12 ? 98  LEU D CD1  1  
ATOM 8593   C CD2  . LEU D 1 98  ? 25.057  14.415  -9.223  1.00 33.24 ? 98  LEU D CD2  1  
ATOM 8594   H H    . LEU D 1 98  ? 25.935  18.392  -6.318  1.00 62.45 ? 98  LEU D H    1  
ATOM 8595   H HA   . LEU D 1 98  ? 23.727  16.789  -7.164  1.00 34.51 ? 98  LEU D HA   1  
ATOM 8596   H HB2  . LEU D 1 98  ? 25.784  17.771  -8.475  1.00 34.14 ? 98  LEU D HB2  1  
ATOM 8597   H HB3  . LEU D 1 98  ? 26.655  16.358  -7.919  1.00 1.14  ? 98  LEU D HB3  1  
ATOM 8598   H HG   . LEU D 1 98  ? 24.174  16.303  -9.707  1.00 22.32 ? 98  LEU D HG   1  
ATOM 8599   H HD11 . LEU D 1 98  ? 26.045  17.310  -10.867 1.00 24.32 ? 98  LEU D HD11 1  
ATOM 8600   H HD12 . LEU D 1 98  ? 25.750  15.700  -11.510 1.00 44.31 ? 98  LEU D HD12 1  
ATOM 8601   H HD13 . LEU D 1 98  ? 27.105  15.971  -10.416 1.00 3.20  ? 98  LEU D HD13 1  
ATOM 8602   H HD21 . LEU D 1 98  ? 24.351  14.216  -8.424  1.00 24.53 ? 98  LEU D HD21 1  
ATOM 8603   H HD22 . LEU D 1 98  ? 26.023  14.007  -8.949  1.00 61.13 ? 98  LEU D HD22 1  
ATOM 8604   H HD23 . LEU D 1 98  ? 24.709  13.936  -10.127 1.00 23.44 ? 98  LEU D HD23 1  
ATOM 8605   N N    . GLY D 1 99  ? 26.190  15.401  -5.401  1.00 72.55 ? 99  GLY D N    1  
ATOM 8606   C CA   . GLY D 1 99  ? 26.620  14.242  -4.628  1.00 4.32  ? 99  GLY D CA   1  
ATOM 8607   C C    . GLY D 1 99  ? 25.924  14.109  -3.279  1.00 52.42 ? 99  GLY D C    1  
ATOM 8608   O O    . GLY D 1 99  ? 25.847  13.008  -2.726  1.00 54.40 ? 99  GLY D O    1  
ATOM 8609   H H    . GLY D 1 99  ? 26.777  16.186  -5.441  1.00 55.34 ? 99  GLY D H    1  
ATOM 8610   H HA2  . GLY D 1 99  ? 26.445  13.342  -5.205  1.00 51.21 ? 99  GLY D HA2  1  
ATOM 8611   H HA3  . GLY D 1 99  ? 27.685  14.329  -4.454  1.00 75.15 ? 99  GLY D HA3  1  
ATOM 8612   N N    . ALA D 1 100 ? 25.391  15.228  -2.751  1.00 50.51 ? 100 ALA D N    1  
ATOM 8613   C CA   . ALA D 1 100 ? 24.869  15.292  -1.369  1.00 74.34 ? 100 ALA D CA   1  
ATOM 8614   C C    . ALA D 1 100 ? 23.360  15.597  -1.325  1.00 61.51 ? 100 ALA D C    1  
ATOM 8615   O O    . ALA D 1 100 ? 22.558  14.731  -0.959  1.00 33.12 ? 100 ALA D O    1  
ATOM 8616   C CB   . ALA D 1 100 ? 25.663  16.339  -0.577  1.00 30.21 ? 100 ALA D CB   1  
ATOM 8617   H H    . ALA D 1 100 ? 25.351  16.036  -3.308  1.00 63.44 ? 100 ALA D H    1  
ATOM 8618   H HA   . ALA D 1 100 ? 25.034  14.326  -0.888  1.00 20.35 ? 100 ALA D HA   1  
ATOM 8619   H HB1  . ALA D 1 100 ? 25.322  16.360  0.450   1.00 53.30 ? 100 ALA D HB1  1  
ATOM 8620   H HB2  . ALA D 1 100 ? 25.526  17.322  -1.015  1.00 51.11 ? 100 ALA D HB2  1  
ATOM 8621   H HB3  . ALA D 1 100 ? 26.716  16.089  -0.594  1.00 23.21 ? 100 ALA D HB3  1  
ATOM 8622   N N    . TYR D 1 101 ? 22.986  16.817  -1.749  1.00 23.41 ? 101 TYR D N    1  
ATOM 8623   C CA   . TYR D 1 101 ? 21.639  17.385  -1.520  1.00 11.22 ? 101 TYR D CA   1  
ATOM 8624   C C    . TYR D 1 101 ? 20.556  16.720  -2.407  1.00 74.51 ? 101 TYR D C    1  
ATOM 8625   O O    . TYR D 1 101 ? 19.499  16.321  -1.905  1.00 24.24 ? 101 TYR D O    1  
ATOM 8626   C CB   . TYR D 1 101 ? 21.689  18.917  -1.757  1.00 30.53 ? 101 TYR D CB   1  
ATOM 8627   C CG   . TYR D 1 101 ? 20.371  19.660  -1.464  1.00 10.20 ? 101 TYR D CG   1  
ATOM 8628   C CD1  . TYR D 1 101 ? 19.825  19.675  -0.174  1.00 11.31 ? 101 TYR D CD1  1  
ATOM 8629   C CD2  . TYR D 1 101 ? 19.686  20.357  -2.466  1.00 14.44 ? 101 TYR D CD2  1  
ATOM 8630   C CE1  . TYR D 1 101 ? 18.648  20.349  0.099   1.00 53.41 ? 101 TYR D CE1  1  
ATOM 8631   C CE2  . TYR D 1 101 ? 18.512  21.029  -2.192  1.00 5.41  ? 101 TYR D CE2  1  
ATOM 8632   C CZ   . TYR D 1 101 ? 17.999  21.026  -0.913  1.00 44.22 ? 101 TYR D CZ   1  
ATOM 8633   O OH   . TYR D 1 101 ? 16.830  21.704  -0.650  1.00 3.24  ? 101 TYR D OH   1  
ATOM 8634   H H    . TYR D 1 101 ? 23.637  17.355  -2.244  1.00 54.12 ? 101 TYR D H    1  
ATOM 8635   H HA   . TYR D 1 101 ? 21.386  17.210  -0.476  1.00 14.34 ? 101 TYR D HA   1  
ATOM 8636   H HB2  . TYR D 1 101 ? 22.453  19.345  -1.115  1.00 52.44 ? 101 TYR D HB2  1  
ATOM 8637   H HB3  . TYR D 1 101 ? 21.967  19.103  -2.790  1.00 60.01 ? 101 TYR D HB3  1  
ATOM 8638   H HD1  . TYR D 1 101 ? 20.335  19.143  0.623   1.00 50.45 ? 101 TYR D HD1  1  
ATOM 8639   H HD2  . TYR D 1 101 ? 20.084  20.360  -3.474  1.00 30.30 ? 101 TYR D HD2  1  
ATOM 8640   H HE1  . TYR D 1 101 ? 18.245  20.347  1.104   1.00 42.23 ? 101 TYR D HE1  1  
ATOM 8641   H HE2  . TYR D 1 101 ? 18.001  21.561  -2.982  1.00 24.41 ? 101 TYR D HE2  1  
ATOM 8642   H HH   . TYR D 1 101 ? 16.210  21.564  -1.370  1.00 43.13 ? 101 TYR D HH   1  
ATOM 8643   N N    . CYS D 1 102 ? 20.852  16.601  -3.715  1.00 14.44 ? 102 CYS D N    1  
ATOM 8644   C CA   . CYS D 1 102 ? 19.913  16.064  -4.730  1.00 1.24  ? 102 CYS D CA   1  
ATOM 8645   C C    . CYS D 1 102 ? 19.470  14.587  -4.428  1.00 12.31 ? 102 CYS D C    1  
ATOM 8646   O O    . CYS D 1 102 ? 18.261  14.312  -4.454  1.00 22.31 ? 102 CYS D O    1  
ATOM 8647   C CB   . CYS D 1 102 ? 20.525  16.200  -6.151  1.00 23.10 ? 102 CYS D CB   1  
ATOM 8648   S SG   . CYS D 1 102 ? 21.053  17.880  -6.564  1.00 71.21 ? 102 CYS D SG   1  
ATOM 8649   H H    . CYS D 1 102 ? 21.737  16.889  -4.014  1.00 42.35 ? 102 CYS D H    1  
ATOM 8650   H HA   . CYS D 1 102 ? 19.024  16.694  -4.693  1.00 53.43 ? 102 CYS D HA   1  
ATOM 8651   H HB2  . CYS D 1 102 ? 21.397  15.562  -6.229  1.00 12.11 ? 102 CYS D HB2  1  
ATOM 8652   H HB3  . CYS D 1 102 ? 19.795  15.895  -6.891  1.00 64.24 ? 102 CYS D HB3  1  
ATOM 8653   H HG   . CYS D 1 102 ? 20.077  18.455  -7.244  1.00 70.01 ? 102 CYS D HG   1  
ATOM 8654   N N    . PRO D 1 103 ? 20.414  13.605  -4.121  1.00 43.43 ? 103 PRO D N    1  
ATOM 8655   C CA   . PRO D 1 103 ? 20.018  12.219  -3.757  1.00 51.32 ? 103 PRO D CA   1  
ATOM 8656   C C    . PRO D 1 103 ? 19.418  12.118  -2.334  1.00 53.15 ? 103 PRO D C    1  
ATOM 8657   O O    . PRO D 1 103 ? 18.684  11.168  -2.044  1.00 41.01 ? 103 PRO D O    1  
ATOM 8658   C CB   . PRO D 1 103 ? 21.346  11.426  -3.881  1.00 12.32 ? 103 PRO D CB   1  
ATOM 8659   C CG   . PRO D 1 103 ? 22.411  12.424  -3.571  1.00 42.15 ? 103 PRO D CG   1  
ATOM 8660   C CD   . PRO D 1 103 ? 21.905  13.735  -4.137  1.00 2.41  ? 103 PRO D CD   1  
ATOM 8661   H HA   . PRO D 1 103 ? 19.297  11.824  -4.468  1.00 0.45  ? 103 PRO D HA   1  
ATOM 8662   H HB2  . PRO D 1 103 ? 21.368  10.588  -3.183  1.00 32.22 ? 103 PRO D HB2  1  
ATOM 8663   H HB3  . PRO D 1 103 ? 21.467  11.054  -4.893  1.00 32.53 ? 103 PRO D HB3  1  
ATOM 8664   H HG2  . PRO D 1 103 ? 22.551  12.497  -2.493  1.00 61.33 ? 103 PRO D HG2  1  
ATOM 8665   H HG3  . PRO D 1 103 ? 23.345  12.147  -4.048  1.00 23.43 ? 103 PRO D HG3  1  
ATOM 8666   H HD2  . PRO D 1 103 ? 22.222  14.566  -3.517  1.00 73.31 ? 103 PRO D HD2  1  
ATOM 8667   H HD3  . PRO D 1 103 ? 22.258  13.876  -5.152  1.00 1.35  ? 103 PRO D HD3  1  
ATOM 8668   N N    . ASN D 1 104 ? 19.732  13.113  -1.468  1.00 2.14  ? 104 ASN D N    1  
ATOM 8669   C CA   . ASN D 1 104 ? 19.188  13.193  -0.089  1.00 62.44 ? 104 ASN D CA   1  
ATOM 8670   C C    . ASN D 1 104 ? 17.670  13.463  -0.120  1.00 31.53 ? 104 ASN D C    1  
ATOM 8671   O O    . ASN D 1 104 ? 16.942  13.030  0.774   1.00 30.02 ? 104 ASN D O    1  
ATOM 8672   C CB   . ASN D 1 104 ? 19.920  14.302  0.719   1.00 0.34  ? 104 ASN D CB   1  
ATOM 8673   C CG   . ASN D 1 104 ? 19.515  14.365  2.200   1.00 33.35 ? 104 ASN D CG   1  
ATOM 8674   O OD1  . ASN D 1 104 ? 18.592  15.086  2.579   1.00 64.50 ? 104 ASN D OD1  1  
ATOM 8675   N ND2  . ASN D 1 104 ? 20.211  13.618  3.048   1.00 22.13 ? 104 ASN D ND2  1  
ATOM 8676   H H    . ASN D 1 104 ? 20.347  13.817  -1.767  1.00 11.55 ? 104 ASN D H    1  
ATOM 8677   H HA   . ASN D 1 104 ? 19.363  12.232  0.389   1.00 11.14 ? 104 ASN D HA   1  
ATOM 8678   H HB2  . ASN D 1 104 ? 20.989  14.129  0.667   1.00 15.44 ? 104 ASN D HB2  1  
ATOM 8679   H HB3  . ASN D 1 104 ? 19.710  15.267  0.266   1.00 52.01 ? 104 ASN D HB3  1  
ATOM 8680   H HD21 . ASN D 1 104 ? 20.947  13.074  2.693   1.00 51.11 ? 104 ASN D HD21 1  
ATOM 8681   H HD22 . ASN D 1 104 ? 19.961  13.639  3.992   1.00 53.33 ? 104 ASN D HD22 1  
ATOM 8682   N N    . ILE D 1 105 ? 17.220  14.199  -1.155  1.00 73.11 ? 105 ILE D N    1  
ATOM 8683   C CA   . ILE D 1 105 ? 15.789  14.470  -1.407  1.00 62.43 ? 105 ILE D CA   1  
ATOM 8684   C C    . ILE D 1 105 ? 15.060  13.170  -1.814  1.00 41.01 ? 105 ILE D C    1  
ATOM 8685   O O    . ILE D 1 105 ? 13.938  12.891  -1.360  1.00 54.33 ? 105 ILE D O    1  
ATOM 8686   C CB   . ILE D 1 105 ? 15.614  15.535  -2.555  1.00 2.44  ? 105 ILE D CB   1  
ATOM 8687   C CG1  . ILE D 1 105 ? 16.286  16.907  -2.186  1.00 41.11 ? 105 ILE D CG1  1  
ATOM 8688   C CG2  . ILE D 1 105 ? 14.127  15.734  -2.939  1.00 74.01 ? 105 ILE D CG2  1  
ATOM 8689   C CD1  . ILE D 1 105 ? 15.749  17.602  -0.933  1.00 3.12  ? 105 ILE D CD1  1  
ATOM 8690   H H    . ILE D 1 105 ? 17.882  14.578  -1.773  1.00 70.22 ? 105 ILE D H    1  
ATOM 8691   H HA   . ILE D 1 105 ? 15.344  14.863  -0.492  1.00 12.54 ? 105 ILE D HA   1  
ATOM 8692   H HB   . ILE D 1 105 ? 16.120  15.141  -3.438  1.00 41.54 ? 105 ILE D HB   1  
ATOM 8693   H HG12 . ILE D 1 105 ? 17.342  16.746  -2.029  1.00 3.34  ? 105 ILE D HG12 1  
ATOM 8694   H HG13 . ILE D 1 105 ? 16.165  17.593  -3.016  1.00 33.42 ? 105 ILE D HG13 1  
ATOM 8695   H HG21 . ILE D 1 105 ? 14.075  16.265  -3.875  1.00 2.24  ? 105 ILE D HG21 1  
ATOM 8696   H HG22 . ILE D 1 105 ? 13.616  16.308  -2.179  1.00 2.22  ? 105 ILE D HG22 1  
ATOM 8697   H HG23 . ILE D 1 105 ? 13.623  14.787  -3.057  1.00 5.13  ? 105 ILE D HG23 1  
ATOM 8698   H HD11 . ILE D 1 105 ? 16.280  18.534  -0.786  1.00 40.44 ? 105 ILE D HD11 1  
ATOM 8699   H HD12 . ILE D 1 105 ? 15.898  16.971  -0.068  1.00 24.14 ? 105 ILE D HD12 1  
ATOM 8700   H HD13 . ILE D 1 105 ? 14.694  17.809  -1.050  1.00 72.11 ? 105 ILE D HD13 1  
ATOM 8701   N N    . LEU D 1 106 ? 15.722  12.391  -2.682  1.00 64.41 ? 106 LEU D N    1  
ATOM 8702   C CA   . LEU D 1 106 ? 15.150  11.173  -3.279  1.00 54.10 ? 106 LEU D CA   1  
ATOM 8703   C C    . LEU D 1 106 ? 15.082  10.015  -2.260  1.00 14.55 ? 106 LEU D C    1  
ATOM 8704   O O    . LEU D 1 106 ? 14.199  9.155   -2.346  1.00 61.13 ? 106 LEU D O    1  
ATOM 8705   C CB   . LEU D 1 106 ? 16.004  10.742  -4.501  1.00 74.00 ? 106 LEU D CB   1  
ATOM 8706   C CG   . LEU D 1 106 ? 16.024  11.742  -5.701  1.00 33.00 ? 106 LEU D CG   1  
ATOM 8707   C CD1  . LEU D 1 106 ? 17.073  11.329  -6.761  1.00 31.25 ? 106 LEU D CD1  1  
ATOM 8708   C CD2  . LEU D 1 106 ? 14.610  11.883  -6.320  1.00 5.14  ? 106 LEU D CD2  1  
ATOM 8709   H H    . LEU D 1 106 ? 16.638  12.644  -2.925  1.00 21.04 ? 106 LEU D H    1  
ATOM 8710   H HA   . LEU D 1 106 ? 14.142  11.415  -3.616  1.00 1.44  ? 106 LEU D HA   1  
ATOM 8711   H HB2  . LEU D 1 106 ? 17.025  10.594  -4.158  1.00 75.42 ? 106 LEU D HB2  1  
ATOM 8712   H HB3  . LEU D 1 106 ? 15.632  9.789   -4.864  1.00 63.15 ? 106 LEU D HB3  1  
ATOM 8713   H HG   . LEU D 1 106 ? 16.315  12.720  -5.331  1.00 61.21 ? 106 LEU D HG   1  
ATOM 8714   H HD11 . LEU D 1 106 ? 17.081  12.052  -7.568  1.00 33.31 ? 106 LEU D HD11 1  
ATOM 8715   H HD12 . LEU D 1 106 ? 16.835  10.351  -7.163  1.00 11.24 ? 106 LEU D HD12 1  
ATOM 8716   H HD13 . LEU D 1 106 ? 18.055  11.297  -6.307  1.00 55.12 ? 106 LEU D HD13 1  
ATOM 8717   H HD21 . LEU D 1 106 ? 14.640  12.591  -7.140  1.00 53.14 ? 106 LEU D HD21 1  
ATOM 8718   H HD22 . LEU D 1 106 ? 13.919  12.245  -5.571  1.00 63.12 ? 106 LEU D HD22 1  
ATOM 8719   H HD23 . LEU D 1 106 ? 14.269  10.923  -6.688  1.00 21.24 ? 106 LEU D HD23 1  
ATOM 8720   N N    . PHE D 1 107 ? 16.033  10.024  -1.306  1.00 55.30 ? 107 PHE D N    1  
ATOM 8721   C CA   . PHE D 1 107 ? 16.259  8.916   -0.351  1.00 62.44 ? 107 PHE D CA   1  
ATOM 8722   C C    . PHE D 1 107 ? 15.026  8.584   0.556   1.00 13.12 ? 107 PHE D C    1  
ATOM 8723   O O    . PHE D 1 107 ? 14.760  7.408   0.761   1.00 53.40 ? 107 PHE D O    1  
ATOM 8724   C CB   . PHE D 1 107 ? 17.537  9.182   0.503   1.00 74.23 ? 107 PHE D CB   1  
ATOM 8725   C CG   . PHE D 1 107 ? 17.968  7.983   1.352   1.00 71.53 ? 107 PHE D CG   1  
ATOM 8726   C CD1  . PHE D 1 107 ? 18.535  6.856   0.750   1.00 22.23 ? 107 PHE D CD1  1  
ATOM 8727   C CD2  . PHE D 1 107 ? 17.794  7.973   2.740   1.00 74.33 ? 107 PHE D CD2  1  
ATOM 8728   C CE1  . PHE D 1 107 ? 18.916  5.762   1.506   1.00 52.41 ? 107 PHE D CE1  1  
ATOM 8729   C CE2  . PHE D 1 107 ? 18.178  6.880   3.493   1.00 22.23 ? 107 PHE D CE2  1  
ATOM 8730   C CZ   . PHE D 1 107 ? 18.737  5.775   2.876   1.00 41.42 ? 107 PHE D CZ   1  
ATOM 8731   H H    . PHE D 1 107 ? 16.618  10.810  -1.249  1.00 35.30 ? 107 PHE D H    1  
ATOM 8732   H HA   . PHE D 1 107 ? 16.450  8.038   -0.960  1.00 60.04 ? 107 PHE D HA   1  
ATOM 8733   H HB2  . PHE D 1 107 ? 18.357  9.435   -0.158  1.00 61.14 ? 107 PHE D HB2  1  
ATOM 8734   H HB3  . PHE D 1 107 ? 17.357  10.027  1.164   1.00 20.31 ? 107 PHE D HB3  1  
ATOM 8735   H HD1  . PHE D 1 107 ? 18.678  6.840   -0.327  1.00 12.12 ? 107 PHE D HD1  1  
ATOM 8736   H HD2  . PHE D 1 107 ? 17.352  8.837   3.228   1.00 24.43 ? 107 PHE D HD2  1  
ATOM 8737   H HE1  . PHE D 1 107 ? 19.352  4.896   1.023   1.00 32.42 ? 107 PHE D HE1  1  
ATOM 8738   H HE2  . PHE D 1 107 ? 18.037  6.889   4.567   1.00 54.31 ? 107 PHE D HE2  1  
ATOM 8739   H HZ   . PHE D 1 107 ? 19.031  4.919   3.467   1.00 11.02 ? 107 PHE D HZ   1  
ATOM 8740   N N    . PRO D 1 108 ? 14.282  9.581   1.156   1.00 65.20 ? 108 PRO D N    1  
ATOM 8741   C CA   . PRO D 1 108 ? 13.019  9.299   1.905   1.00 34.23 ? 108 PRO D CA   1  
ATOM 8742   C C    . PRO D 1 108 ? 11.963  8.510   1.088   1.00 55.25 ? 108 PRO D C    1  
ATOM 8743   O O    . PRO D 1 108 ? 11.313  7.597   1.617   1.00 74.11 ? 108 PRO D O    1  
ATOM 8744   C CB   . PRO D 1 108 ? 12.499  10.714  2.266   1.00 43.31 ? 108 PRO D CB   1  
ATOM 8745   C CG   . PRO D 1 108 ? 13.732  11.558  2.328   1.00 51.00 ? 108 PRO D CG   1  
ATOM 8746   C CD   . PRO D 1 108 ? 14.632  11.023  1.244   1.00 14.20 ? 108 PRO D CD   1  
ATOM 8747   H HA   . PRO D 1 108 ? 13.236  8.750   2.819   1.00 62.35 ? 108 PRO D HA   1  
ATOM 8748   H HB2  . PRO D 1 108 ? 11.811  11.078  1.500   1.00 2.42  ? 108 PRO D HB2  1  
ATOM 8749   H HB3  . PRO D 1 108 ? 12.001  10.701  3.229   1.00 1.32  ? 108 PRO D HB3  1  
ATOM 8750   H HG2  . PRO D 1 108 ? 13.486  12.600  2.143   1.00 72.02 ? 108 PRO D HG2  1  
ATOM 8751   H HG3  . PRO D 1 108 ? 14.215  11.454  3.295   1.00 4.42  ? 108 PRO D HG3  1  
ATOM 8752   H HD2  . PRO D 1 108 ? 14.438  11.521  0.297   1.00 72.20 ? 108 PRO D HD2  1  
ATOM 8753   H HD3  . PRO D 1 108 ? 15.675  11.146  1.517   1.00 71.24 ? 108 PRO D HD3  1  
ATOM 8754   N N    . TYR D 1 109 ? 11.819  8.875   -0.199  1.00 20.31 ? 109 TYR D N    1  
ATOM 8755   C CA   . TYR D 1 109 ? 10.845  8.241   -1.120  1.00 74.11 ? 109 TYR D CA   1  
ATOM 8756   C C    . TYR D 1 109 ? 11.313  6.836   -1.553  1.00 55.44 ? 109 TYR D C    1  
ATOM 8757   O O    . TYR D 1 109 ? 10.493  5.926   -1.713  1.00 33.14 ? 109 TYR D O    1  
ATOM 8758   C CB   . TYR D 1 109 ? 10.627  9.138   -2.358  1.00 20.42 ? 109 TYR D CB   1  
ATOM 8759   C CG   . TYR D 1 109 ? 9.989   10.504  -2.056  1.00 30.10 ? 109 TYR D CG   1  
ATOM 8760   C CD1  . TYR D 1 109 ? 10.726  11.692  -2.138  1.00 4.02  ? 109 TYR D CD1  1  
ATOM 8761   C CD2  . TYR D 1 109 ? 8.639   10.601  -1.697  1.00 32.34 ? 109 TYR D CD2  1  
ATOM 8762   C CE1  . TYR D 1 109 ? 10.139  12.918  -1.877  1.00 35.22 ? 109 TYR D CE1  1  
ATOM 8763   C CE2  . TYR D 1 109 ? 8.054   11.825  -1.433  1.00 73.55 ? 109 TYR D CE2  1  
ATOM 8764   C CZ   . TYR D 1 109 ? 8.804   12.979  -1.527  1.00 22.21 ? 109 TYR D CZ   1  
ATOM 8765   O OH   . TYR D 1 109 ? 8.215   14.198  -1.276  1.00 15.24 ? 109 TYR D OH   1  
ATOM 8766   H H    . TYR D 1 109 ? 12.387  9.597   -0.546  1.00 22.25 ? 109 TYR D H    1  
ATOM 8767   H HA   . TYR D 1 109 ? 9.899   8.141   -0.589  1.00 62.45 ? 109 TYR D HA   1  
ATOM 8768   H HB2  . TYR D 1 109 ? 11.586  9.310   -2.841  1.00 54.11 ? 109 TYR D HB2  1  
ATOM 8769   H HB3  . TYR D 1 109 ? 9.980   8.622   -3.064  1.00 74.11 ? 109 TYR D HB3  1  
ATOM 8770   H HD1  . TYR D 1 109 ? 11.773  11.646  -2.413  1.00 44.22 ? 109 TYR D HD1  1  
ATOM 8771   H HD2  . TYR D 1 109 ? 8.046   9.698   -1.620  1.00 70.32 ? 109 TYR D HD2  1  
ATOM 8772   H HE1  . TYR D 1 109 ? 10.727  13.824  -1.946  1.00 33.01 ? 109 TYR D HE1  1  
ATOM 8773   H HE2  . TYR D 1 109 ? 7.008   11.874  -1.159  1.00 3.41  ? 109 TYR D HE2  1  
ATOM 8774   H HH   . TYR D 1 109 ? 7.754   14.167  -0.437  1.00 10.32 ? 109 TYR D HH   1  
ATOM 8775   N N    . ALA D 1 110 ? 12.638  6.687   -1.758  1.00 21.13 ? 110 ALA D N    1  
ATOM 8776   C CA   . ALA D 1 110 ? 13.264  5.386   -2.081  1.00 45.45 ? 110 ALA D CA   1  
ATOM 8777   C C    . ALA D 1 110 ? 13.082  4.411   -0.909  1.00 43.55 ? 110 ALA D C    1  
ATOM 8778   O O    . ALA D 1 110 ? 12.664  3.268   -1.104  1.00 71.54 ? 110 ALA D O    1  
ATOM 8779   C CB   . ALA D 1 110 ? 14.758  5.571   -2.396  1.00 33.23 ? 110 ALA D CB   1  
ATOM 8780   H H    . ALA D 1 110 ? 13.213  7.478   -1.683  1.00 51.55 ? 110 ALA D H    1  
ATOM 8781   H HA   . ALA D 1 110 ? 12.775  4.987   -2.964  1.00 32.00 ? 110 ALA D HA   1  
ATOM 8782   H HB1  . ALA D 1 110 ? 15.242  6.083   -1.577  1.00 70.11 ? 110 ALA D HB1  1  
ATOM 8783   H HB2  . ALA D 1 110 ? 14.873  6.155   -3.298  1.00 11.24 ? 110 ALA D HB2  1  
ATOM 8784   H HB3  . ALA D 1 110 ? 15.233  4.600   -2.535  1.00 73.32 ? 110 ALA D HB3  1  
ATOM 8785   N N    . ARG D 1 111 ? 13.385  4.924   0.303   1.00 3.41  ? 111 ARG D N    1  
ATOM 8786   C CA   . ARG D 1 111 ? 13.263  4.195   1.579   1.00 60.34 ? 111 ARG D CA   1  
ATOM 8787   C C    . ARG D 1 111 ? 11.850  3.627   1.741   1.00 54.42 ? 111 ARG D C    1  
ATOM 8788   O O    . ARG D 1 111 ? 11.691  2.424   1.935   1.00 23.44 ? 111 ARG D O    1  
ATOM 8789   C CB   . ARG D 1 111 ? 13.620  5.133   2.780   1.00 35.33 ? 111 ARG D CB   1  
ATOM 8790   C CG   . ARG D 1 111 ? 13.236  4.585   4.177   1.00 60.41 ? 111 ARG D CG   1  
ATOM 8791   C CD   . ARG D 1 111 ? 13.707  5.483   5.341   1.00 14.24 ? 111 ARG D CD   1  
ATOM 8792   N NE   . ARG D 1 111 ? 13.212  6.874   5.259   1.00 45.02 ? 111 ARG D NE   1  
ATOM 8793   C CZ   . ARG D 1 111 ? 13.943  7.976   5.538   1.00 30.25 ? 111 ARG D CZ   1  
ATOM 8794   N NH1  . ARG D 1 111 ? 15.219  7.877   5.927   1.00 12.35 ? 111 ARG D NH1  1  
ATOM 8795   N NH2  . ARG D 1 111 ? 13.389  9.175   5.436   1.00 55.41 ? 111 ARG D NH2  1  
ATOM 8796   H H    . ARG D 1 111 ? 13.696  5.844   0.334   1.00 43.35 ? 111 ARG D H    1  
ATOM 8797   H HA   . ARG D 1 111 ? 13.974  3.374   1.556   1.00 14.12 ? 111 ARG D HA   1  
ATOM 8798   H HB2  . ARG D 1 111 ? 14.691  5.315   2.768   1.00 50.23 ? 111 ARG D HB2  1  
ATOM 8799   H HB3  . ARG D 1 111 ? 13.114  6.086   2.642   1.00 34.21 ? 111 ARG D HB3  1  
ATOM 8800   H HG2  . ARG D 1 111 ? 12.157  4.501   4.228   1.00 52.40 ? 111 ARG D HG2  1  
ATOM 8801   H HG3  . ARG D 1 111 ? 13.671  3.594   4.297   1.00 33.32 ? 111 ARG D HG3  1  
ATOM 8802   H HD2  . ARG D 1 111 ? 13.353  5.052   6.271   1.00 25.20 ? 111 ARG D HD2  1  
ATOM 8803   H HD3  . ARG D 1 111 ? 14.793  5.490   5.354   1.00 1.31  ? 111 ARG D HD3  1  
ATOM 8804   H HE   . ARG D 1 111 ? 12.270  6.989   4.998   1.00 63.32 ? 111 ARG D HE   1  
ATOM 8805   H HH11 . ARG D 1 111 ? 15.655  6.973   6.016   1.00 44.13 ? 111 ARG D HH11 1  
ATOM 8806   H HH12 . ARG D 1 111 ? 15.750  8.700   6.132   1.00 42.12 ? 111 ARG D HH12 1  
ATOM 8807   H HH21 . ARG D 1 111 ? 12.432  9.266   5.151   1.00 51.21 ? 111 ARG D HH21 1  
ATOM 8808   H HH22 . ARG D 1 111 ? 13.925  9.995   5.642   1.00 24.03 ? 111 ARG D HH22 1  
ATOM 8809   N N    . GLU D 1 112 ? 10.849  4.517   1.607   1.00 21.23 ? 112 GLU D N    1  
ATOM 8810   C CA   . GLU D 1 112 ? 9.418   4.189   1.782   1.00 41.11 ? 112 GLU D CA   1  
ATOM 8811   C C    . GLU D 1 112 ? 8.986   3.084   0.806   1.00 21.30 ? 112 GLU D C    1  
ATOM 8812   O O    . GLU D 1 112 ? 8.319   2.124   1.207   1.00 30.11 ? 112 GLU D O    1  
ATOM 8813   C CB   . GLU D 1 112 ? 8.573   5.486   1.588   1.00 13.42 ? 112 GLU D CB   1  
ATOM 8814   C CG   . GLU D 1 112 ? 7.031   5.356   1.773   1.00 1.33  ? 112 GLU D CG   1  
ATOM 8815   C CD   . GLU D 1 112 ? 6.287   4.818   0.532   1.00 74.44 ? 112 GLU D CD   1  
ATOM 8816   O OE1  . GLU D 1 112 ? 6.296   5.507   -0.513  1.00 43.24 ? 112 GLU D OE1  1  
ATOM 8817   O OE2  . GLU D 1 112 ? 5.706   3.704   0.587   1.00 53.25 ? 112 GLU D OE2  1  
ATOM 8818   H H    . GLU D 1 112 ? 11.081  5.436   1.362   1.00 62.23 ? 112 GLU D H    1  
ATOM 8819   H HA   . GLU D 1 112 ? 9.281   3.833   2.800   1.00 61.11 ? 112 GLU D HA   1  
ATOM 8820   H HB2  . GLU D 1 112 ? 8.930   6.225   2.297   1.00 64.25 ? 112 GLU D HB2  1  
ATOM 8821   H HB3  . GLU D 1 112 ? 8.761   5.873   0.588   1.00 23.12 ? 112 GLU D HB3  1  
ATOM 8822   H HG2  . GLU D 1 112 ? 6.831   4.702   2.614   1.00 64.15 ? 112 GLU D HG2  1  
ATOM 8823   H HG3  . GLU D 1 112 ? 6.627   6.337   2.006   1.00 74.53 ? 112 GLU D HG3  1  
ATOM 8824   N N    . CYS D 1 113 ? 9.371   3.240   -0.474  1.00 14.11 ? 113 CYS D N    1  
ATOM 8825   C CA   . CYS D 1 113 ? 9.012   2.287   -1.546  1.00 61.52 ? 113 CYS D CA   1  
ATOM 8826   C C    . CYS D 1 113 ? 9.537   0.865   -1.246  1.00 63.21 ? 113 CYS D C    1  
ATOM 8827   O O    . CYS D 1 113 ? 8.900   -0.134  -1.614  1.00 63.22 ? 113 CYS D O    1  
ATOM 8828   C CB   . CYS D 1 113 ? 9.538   2.775   -2.906  1.00 1.34  ? 113 CYS D CB   1  
ATOM 8829   S SG   . CYS D 1 113 ? 9.030   1.749   -4.311  1.00 75.45 ? 113 CYS D SG   1  
ATOM 8830   H H    . CYS D 1 113 ? 9.907   4.026   -0.707  1.00 44.32 ? 113 CYS D H    1  
ATOM 8831   H HA   . CYS D 1 113 ? 7.930   2.251   -1.592  1.00 32.12 ? 113 CYS D HA   1  
ATOM 8832   H HB2  . CYS D 1 113 ? 9.174   3.779   -3.091  1.00 51.13 ? 113 CYS D HB2  1  
ATOM 8833   H HB3  . CYS D 1 113 ? 10.622  2.791   -2.891  1.00 54.44 ? 113 CYS D HB3  1  
ATOM 8834   H HG   . CYS D 1 113 ? 8.987   0.484   -3.910  1.00 50.42 ? 113 CYS D HG   1  
ATOM 8835   N N    . ILE D 1 114 ? 10.702  0.795   -0.572  1.00 13.11 ? 114 ILE D N    1  
ATOM 8836   C CA   . ILE D 1 114 ? 11.292  -0.477  -0.109  1.00 51.22 ? 114 ILE D CA   1  
ATOM 8837   C C    . ILE D 1 114 ? 10.496  -1.018  1.086   1.00 1.11  ? 114 ILE D C    1  
ATOM 8838   O O    . ILE D 1 114 ? 10.077  -2.173  1.078   1.00 2.12  ? 114 ILE D O    1  
ATOM 8839   C CB   . ILE D 1 114 ? 12.807  -0.303  0.289   1.00 61.32 ? 114 ILE D CB   1  
ATOM 8840   C CG1  . ILE D 1 114 ? 13.610  0.270   -0.914  1.00 41.21 ? 114 ILE D CG1  1  
ATOM 8841   C CG2  . ILE D 1 114 ? 13.430  -1.637  0.777   1.00 64.20 ? 114 ILE D CG2  1  
ATOM 8842   C CD1  . ILE D 1 114 ? 15.038  0.644   -0.615  1.00 71.44 ? 114 ILE D CD1  1  
ATOM 8843   H H    . ILE D 1 114 ? 11.179  1.632   -0.373  1.00 2.32  ? 114 ILE D H    1  
ATOM 8844   H HA   . ILE D 1 114 ? 11.233  -1.195  -0.925  1.00 53.42 ? 114 ILE D HA   1  
ATOM 8845   H HB   . ILE D 1 114 ? 12.858  0.409   1.111   1.00 74.43 ? 114 ILE D HB   1  
ATOM 8846   H HG12 . ILE D 1 114 ? 13.632  -0.459  -1.712  1.00 1.33  ? 114 ILE D HG12 1  
ATOM 8847   H HG13 . ILE D 1 114 ? 13.114  1.163   -1.278  1.00 54.44 ? 114 ILE D HG13 1  
ATOM 8848   H HG21 . ILE D 1 114 ? 12.888  -2.010  1.636   1.00 72.21 ? 114 ILE D HG21 1  
ATOM 8849   H HG22 . ILE D 1 114 ? 14.458  -1.481  1.046   1.00 3.42  ? 114 ILE D HG22 1  
ATOM 8850   H HG23 . ILE D 1 114 ? 13.393  -2.369  -0.016  1.00 65.33 ? 114 ILE D HG23 1  
ATOM 8851   H HD11 . ILE D 1 114 ? 15.489  1.065   -1.503  1.00 31.03 ? 114 ILE D HD11 1  
ATOM 8852   H HD12 . ILE D 1 114 ? 15.593  -0.235  -0.319  1.00 5.04  ? 114 ILE D HD12 1  
ATOM 8853   H HD13 . ILE D 1 114 ? 15.067  1.375   0.181   1.00 60.23 ? 114 ILE D HD13 1  
ATOM 8854   N N    . THR D 1 115 ? 10.262  -0.137  2.074   1.00 71.11 ? 115 THR D N    1  
ATOM 8855   C CA   . THR D 1 115 ? 9.609   -0.465  3.354   1.00 72.13 ? 115 THR D CA   1  
ATOM 8856   C C    . THR D 1 115 ? 8.221   -1.128  3.134   1.00 51.20 ? 115 THR D C    1  
ATOM 8857   O O    . THR D 1 115 ? 7.873   -2.118  3.796   1.00 62.45 ? 115 THR D O    1  
ATOM 8858   C CB   . THR D 1 115 ? 9.458   0.847   4.206   1.00 31.02 ? 115 THR D CB   1  
ATOM 8859   O OG1  . THR D 1 115 ? 10.712  1.546   4.272   1.00 11.04 ? 115 THR D OG1  1  
ATOM 8860   C CG2  . THR D 1 115 ? 8.982   0.576   5.634   1.00 41.10 ? 115 THR D CG2  1  
ATOM 8861   H H    . THR D 1 115 ? 10.527  0.792   1.930   1.00 51.30 ? 115 THR D H    1  
ATOM 8862   H HA   . THR D 1 115 ? 10.255  -1.153  3.892   1.00 1.43  ? 115 THR D HA   1  
ATOM 8863   H HB   . THR D 1 115 ? 8.738   1.495   3.717   1.00 3.13  ? 115 THR D HB   1  
ATOM 8864   H HG1  . THR D 1 115 ? 11.436  0.913   4.269   1.00 33.42 ? 115 THR D HG1  1  
ATOM 8865   H HG21 . THR D 1 115 ? 8.992   1.491   6.203   1.00 5.42  ? 115 THR D HG21 1  
ATOM 8866   H HG22 . THR D 1 115 ? 9.637   -0.141  6.110   1.00 62.41 ? 115 THR D HG22 1  
ATOM 8867   H HG23 . THR D 1 115 ? 7.974   0.181   5.615   1.00 33.30 ? 115 THR D HG23 1  
ATOM 8868   N N    . SER D 1 116 ? 7.474   -0.589  2.151   1.00 33.32 ? 116 SER D N    1  
ATOM 8869   C CA   . SER D 1 116 ? 6.128   -1.062  1.794   1.00 5.44  ? 116 SER D CA   1  
ATOM 8870   C C    . SER D 1 116 ? 6.194   -2.436  1.087   1.00 31.55 ? 116 SER D C    1  
ATOM 8871   O O    . SER D 1 116 ? 5.345   -3.285  1.323   1.00 61.52 ? 116 SER D O    1  
ATOM 8872   C CB   . SER D 1 116 ? 5.432   -0.001  0.908   1.00 53.22 ? 116 SER D CB   1  
ATOM 8873   O OG   . SER D 1 116 ? 4.075   -0.332  0.615   1.00 72.11 ? 116 SER D OG   1  
ATOM 8874   H H    . SER D 1 116 ? 7.849   0.161   1.643   1.00 24.31 ? 116 SER D H    1  
ATOM 8875   H HA   . SER D 1 116 ? 5.558   -1.171  2.716   1.00 44.44 ? 116 SER D HA   1  
ATOM 8876   H HB2  . SER D 1 116 ? 5.441   0.952   1.424   1.00 65.35 ? 116 SER D HB2  1  
ATOM 8877   H HB3  . SER D 1 116 ? 5.972   0.103   -0.026  1.00 12.32 ? 116 SER D HB3  1  
ATOM 8878   H HG   . SER D 1 116 ? 3.499   0.386   0.926   1.00 30.15 ? 116 SER D HG   1  
ATOM 8879   N N    . MET D 1 117 ? 7.223   -2.650  0.236   1.00 22.45 ? 117 MET D N    1  
ATOM 8880   C CA   . MET D 1 117 ? 7.425   -3.946  -0.477  1.00 75.03 ? 117 MET D CA   1  
ATOM 8881   C C    . MET D 1 117 ? 7.692   -5.091  0.512   1.00 40.44 ? 117 MET D C    1  
ATOM 8882   O O    . MET D 1 117 ? 7.126   -6.183  0.382   1.00 2.32  ? 117 MET D O    1  
ATOM 8883   C CB   . MET D 1 117 ? 8.612   -3.880  -1.477  1.00 14.11 ? 117 MET D CB   1  
ATOM 8884   C CG   . MET D 1 117 ? 8.351   -3.148  -2.791  1.00 31.24 ? 117 MET D CG   1  
ATOM 8885   S SD   . MET D 1 117 ? 9.712   -3.420  -3.948  1.00 12.32 ? 117 MET D SD   1  
ATOM 8886   C CE   . MET D 1 117 ? 11.081  -2.572  -3.152  1.00 50.52 ? 117 MET D CE   1  
ATOM 8887   H H    . MET D 1 117 ? 7.870   -1.929  0.094   1.00 60.35 ? 117 MET D H    1  
ATOM 8888   H HA   . MET D 1 117 ? 6.514   -4.170  -1.026  1.00 12.24 ? 117 MET D HA   1  
ATOM 8889   H HB2  . MET D 1 117 ? 9.451   -3.392  -0.993  1.00 25.13 ? 117 MET D HB2  1  
ATOM 8890   H HB3  . MET D 1 117 ? 8.916   -4.893  -1.731  1.00 51.31 ? 117 MET D HB3  1  
ATOM 8891   H HG2  . MET D 1 117 ? 7.433   -3.520  -3.238  1.00 22.34 ? 117 MET D HG2  1  
ATOM 8892   H HG3  . MET D 1 117 ? 8.256   -2.088  -2.603  1.00 10.54 ? 117 MET D HG3  1  
ATOM 8893   H HE1  . MET D 1 117 ? 11.136  -1.571  -3.539  1.00 64.25 ? 117 MET D HE1  1  
ATOM 8894   H HE2  . MET D 1 117 ? 12.014  -3.084  -3.343  1.00 41.14 ? 117 MET D HE2  1  
ATOM 8895   H HE3  . MET D 1 117 ? 10.923  -2.519  -2.090  1.00 64.53 ? 117 MET D HE3  1  
ATOM 8896   N N    . VAL D 1 118 ? 8.572   -4.811  1.483   1.00 65.21 ? 118 VAL D N    1  
ATOM 8897   C CA   . VAL D 1 118 ? 9.019   -5.793  2.478   1.00 51.14 ? 118 VAL D CA   1  
ATOM 8898   C C    . VAL D 1 118 ? 7.826   -6.263  3.349   1.00 0.42  ? 118 VAL D C    1  
ATOM 8899   O O    . VAL D 1 118 ? 7.671   -7.463  3.606   1.00 52.11 ? 118 VAL D O    1  
ATOM 8900   C CB   . VAL D 1 118 ? 10.173  -5.184  3.363   1.00 22.13 ? 118 VAL D CB   1  
ATOM 8901   C CG1  . VAL D 1 118 ? 10.683  -6.182  4.411   1.00 61.34 ? 118 VAL D CG1  1  
ATOM 8902   C CG2  . VAL D 1 118 ? 11.352  -4.682  2.491   1.00 22.32 ? 118 VAL D CG2  1  
ATOM 8903   H H    . VAL D 1 118 ? 8.930   -3.902  1.537   1.00 54.12 ? 118 VAL D H    1  
ATOM 8904   H HA   . VAL D 1 118 ? 9.417   -6.652  1.938   1.00 71.13 ? 118 VAL D HA   1  
ATOM 8905   H HB   . VAL D 1 118 ? 9.767   -4.325  3.892   1.00 51.24 ? 118 VAL D HB   1  
ATOM 8906   H HG11 . VAL D 1 118 ? 11.462  -5.723  5.007   1.00 11.13 ? 118 VAL D HG11 1  
ATOM 8907   H HG12 . VAL D 1 118 ? 11.083  -7.063  3.923   1.00 15.13 ? 118 VAL D HG12 1  
ATOM 8908   H HG13 . VAL D 1 118 ? 9.870   -6.477  5.063   1.00 65.41 ? 118 VAL D HG13 1  
ATOM 8909   H HG21 . VAL D 1 118 ? 12.105  -4.224  3.120   1.00 55.15 ? 118 VAL D HG21 1  
ATOM 8910   H HG22 . VAL D 1 118 ? 10.995  -3.950  1.780   1.00 44.35 ? 118 VAL D HG22 1  
ATOM 8911   H HG23 . VAL D 1 118 ? 11.794  -5.512  1.951   1.00 71.24 ? 118 VAL D HG23 1  
ATOM 8912   N N    . SER D 1 119 ? 6.964   -5.303  3.743   1.00 41.00 ? 119 SER D N    1  
ATOM 8913   C CA   . SER D 1 119 ? 5.766   -5.578  4.568   1.00 62.32 ? 119 SER D CA   1  
ATOM 8914   C C    . SER D 1 119 ? 4.702   -6.400  3.784   1.00 60.53 ? 119 SER D C    1  
ATOM 8915   O O    . SER D 1 119 ? 3.975   -7.212  4.372   1.00 63.33 ? 119 SER D O    1  
ATOM 8916   C CB   . SER D 1 119 ? 5.179   -4.241  5.076   1.00 32.53 ? 119 SER D CB   1  
ATOM 8917   O OG   . SER D 1 119 ? 4.800   -3.395  4.007   1.00 1.11  ? 119 SER D OG   1  
ATOM 8918   H H    . SER D 1 119 ? 7.141   -4.373  3.475   1.00 41.34 ? 119 SER D H    1  
ATOM 8919   H HA   . SER D 1 119 ? 6.085   -6.162  5.429   1.00 52.40 ? 119 SER D HA   1  
ATOM 8920   H HB2  . SER D 1 119 ? 4.307   -4.433  5.685   1.00 71.15 ? 119 SER D HB2  1  
ATOM 8921   H HB3  . SER D 1 119 ? 5.919   -3.726  5.673   1.00 14.00 ? 119 SER D HB3  1  
ATOM 8922   H HG   . SER D 1 119 ? 3.936   -3.657  3.679   1.00 12.02 ? 119 SER D HG   1  
ATOM 8923   N N    . ARG D 1 120 ? 4.641   -6.184  2.448   1.00 43.25 ? 120 ARG D N    1  
ATOM 8924   C CA   . ARG D 1 120 ? 3.741   -6.936  1.528   1.00 44.13 ? 120 ARG D CA   1  
ATOM 8925   C C    . ARG D 1 120 ? 4.233   -8.383  1.338   1.00 11.24 ? 120 ARG D C    1  
ATOM 8926   O O    . ARG D 1 120 ? 3.427   -9.297  1.118   1.00 51.44 ? 120 ARG D O    1  
ATOM 8927   C CB   . ARG D 1 120 ? 3.646   -6.214  0.155   1.00 5.33  ? 120 ARG D CB   1  
ATOM 8928   C CG   . ARG D 1 120 ? 2.953   -4.836  0.209   1.00 53.03 ? 120 ARG D CG   1  
ATOM 8929   C CD   . ARG D 1 120 ? 3.026   -4.058  -1.123  1.00 63.13 ? 120 ARG D CD   1  
ATOM 8930   N NE   . ARG D 1 120 ? 2.553   -2.666  -0.957  1.00 55.13 ? 120 ARG D NE   1  
ATOM 8931   C CZ   . ARG D 1 120 ? 1.360   -2.185  -1.350  1.00 5.40  ? 120 ARG D CZ   1  
ATOM 8932   N NH1  . ARG D 1 120 ? 0.473   -2.966  -1.958  1.00 42.51 ? 120 ARG D NH1  1  
ATOM 8933   N NH2  . ARG D 1 120 ? 1.059   -0.911  -1.130  1.00 24.05 ? 120 ARG D NH2  1  
ATOM 8934   H H    . ARG D 1 120 ? 5.232   -5.503  2.065   1.00 72.24 ? 120 ARG D H    1  
ATOM 8935   H HA   . ARG D 1 120 ? 2.749   -6.967  1.976   1.00 21.15 ? 120 ARG D HA   1  
ATOM 8936   H HB2  . ARG D 1 120 ? 4.651   -6.077  -0.229  1.00 21.31 ? 120 ARG D HB2  1  
ATOM 8937   H HB3  . ARG D 1 120 ? 3.093   -6.843  -0.538  1.00 72.42 ? 120 ARG D HB3  1  
ATOM 8938   H HG2  . ARG D 1 120 ? 1.911   -4.978  0.469   1.00 71.13 ? 120 ARG D HG2  1  
ATOM 8939   H HG3  . ARG D 1 120 ? 3.427   -4.242  0.984   1.00 44.50 ? 120 ARG D HG3  1  
ATOM 8940   H HD2  . ARG D 1 120 ? 4.057   -4.033  -1.460  1.00 44.13 ? 120 ARG D HD2  1  
ATOM 8941   H HD3  . ARG D 1 120 ? 2.420   -4.564  -1.869  1.00 64.21 ? 120 ARG D HD3  1  
ATOM 8942   H HE   . ARG D 1 120 ? 3.170   -2.049  -0.500  1.00 13.13 ? 120 ARG D HE   1  
ATOM 8943   H HH11 . ARG D 1 120 ? 0.679   -3.934  -2.121  1.00 5.13  ? 120 ARG D HH11 1  
ATOM 8944   H HH12 . ARG D 1 120 ? -0.417  -2.587  -2.243  1.00 43.41 ? 120 ARG D HH12 1  
ATOM 8945   H HH21 . ARG D 1 120 ? 1.717   -0.307  -0.670  1.00 41.33 ? 120 ARG D HH21 1  
ATOM 8946   H HH22 . ARG D 1 120 ? 0.167   -0.545  -1.427  1.00 72.22 ? 120 ARG D HH22 1  
ATOM 8947   N N    . GLY D 1 121 ? 5.570   -8.572  1.435   1.00 71.11 ? 121 GLY D N    1  
ATOM 8948   C CA   . GLY D 1 121 ? 6.189   -9.906  1.411   1.00 63.22 ? 121 GLY D CA   1  
ATOM 8949   C C    . GLY D 1 121 ? 6.182   -10.579 2.779   1.00 24.02 ? 121 GLY D C    1  
ATOM 8950   O O    . GLY D 1 121 ? 6.813   -11.621 2.956   1.00 25.53 ? 121 GLY D O    1  
ATOM 8951   H H    . GLY D 1 121 ? 6.149   -7.783  1.535   1.00 4.24  ? 121 GLY D H    1  
ATOM 8952   H HA2  . GLY D 1 121 ? 5.664   -10.543 0.706   1.00 40.31 ? 121 GLY D HA2  1  
ATOM 8953   H HA3  . GLY D 1 121 ? 7.214   -9.799  1.084   1.00 63.14 ? 121 GLY D HA3  1  
ATOM 8954   N N    . THR D 1 122 ? 5.460   -9.942  3.738   1.00 72.40 ? 122 THR D N    1  
ATOM 8955   C CA   . THR D 1 122 ? 5.242   -10.388 5.135   1.00 1.24  ? 122 THR D CA   1  
ATOM 8956   C C    . THR D 1 122 ? 6.552   -10.519 5.938   1.00 33.12 ? 122 THR D C    1  
ATOM 8957   O O    . THR D 1 122 ? 6.636   -11.246 6.938   1.00 43.12 ? 122 THR D O    1  
ATOM 8958   C CB   . THR D 1 122 ? 4.356   -11.678 5.227   1.00 60.15 ? 122 THR D CB   1  
ATOM 8959   O OG1  . THR D 1 122 ? 5.036   -12.836 4.707   1.00 12.32 ? 122 THR D OG1  1  
ATOM 8960   C CG2  . THR D 1 122 ? 3.040   -11.496 4.468   1.00 33.31 ? 122 THR D CG2  1  
ATOM 8961   H H    . THR D 1 122 ? 5.040   -9.100  3.483   1.00 41.43 ? 122 THR D H    1  
ATOM 8962   H HA   . THR D 1 122 ? 4.677   -9.584  5.604   1.00 20.21 ? 122 THR D HA   1  
ATOM 8963   H HB   . THR D 1 122 ? 4.126   -11.859 6.272   1.00 42.33 ? 122 THR D HB   1  
ATOM 8964   H HG1  . THR D 1 122 ? 5.266   -12.693 3.785   1.00 3.24  ? 122 THR D HG1  1  
ATOM 8965   H HG21 . THR D 1 122 ? 3.242   -11.316 3.420   1.00 54.51 ? 122 THR D HG21 1  
ATOM 8966   H HG22 . THR D 1 122 ? 2.485   -10.660 4.866   1.00 61.01 ? 122 THR D HG22 1  
ATOM 8967   H HG23 . THR D 1 122 ? 2.439   -12.393 4.564   1.00 62.51 ? 122 THR D HG23 1  
ATOM 8968   N N    . PHE D 1 123 ? 7.553   -9.759  5.494   1.00 72.13 ? 123 PHE D N    1  
ATOM 8969   C CA   . PHE D 1 123 ? 8.834   -9.582  6.177   1.00 24.50 ? 123 PHE D CA   1  
ATOM 8970   C C    . PHE D 1 123 ? 8.802   -8.275  7.004   1.00 1.04  ? 123 PHE D C    1  
ATOM 8971   O O    . PHE D 1 123 ? 7.946   -7.409  6.753   1.00 0.53  ? 123 PHE D O    1  
ATOM 8972   C CB   . PHE D 1 123 ? 9.974   -9.563  5.115   1.00 42.14 ? 123 PHE D CB   1  
ATOM 8973   C CG   . PHE D 1 123 ? 10.355  -10.943 4.601   1.00 3.12  ? 123 PHE D CG   1  
ATOM 8974   C CD1  . PHE D 1 123 ? 10.911  -11.862 5.482   1.00 22.41 ? 123 PHE D CD1  1  
ATOM 8975   C CD2  . PHE D 1 123 ? 10.176  -11.323 3.269   1.00 72.43 ? 123 PHE D CD2  1  
ATOM 8976   C CE1  . PHE D 1 123 ? 11.285  -13.107 5.060   1.00 72.21 ? 123 PHE D CE1  1  
ATOM 8977   C CE2  . PHE D 1 123 ? 10.552  -12.585 2.842   1.00 51.43 ? 123 PHE D CE2  1  
ATOM 8978   C CZ   . PHE D 1 123 ? 11.110  -13.478 3.739   1.00 13.11 ? 123 PHE D CZ   1  
ATOM 8979   H H    . PHE D 1 123 ? 7.417   -9.273  4.652   1.00 30.05 ? 123 PHE D H    1  
ATOM 8980   H HA   . PHE D 1 123 ? 8.989   -10.419 6.856   1.00 30.20 ? 123 PHE D HA   1  
ATOM 8981   H HB2  . PHE D 1 123 ? 9.671   -8.948  4.273   1.00 3.12  ? 123 PHE D HB2  1  
ATOM 8982   H HB3  . PHE D 1 123 ? 10.865  -9.123  5.552   1.00 74.12 ? 123 PHE D HB3  1  
ATOM 8983   H HD1  . PHE D 1 123 ? 11.059  -11.583 6.523   1.00 54.03 ? 123 PHE D HD1  1  
ATOM 8984   H HD2  . PHE D 1 123 ? 9.743   -10.623 2.566   1.00 3.11  ? 123 PHE D HD2  1  
ATOM 8985   H HE1  . PHE D 1 123 ? 11.706  -13.804 5.781   1.00 1.54  ? 123 PHE D HE1  1  
ATOM 8986   H HE2  . PHE D 1 123 ? 10.416  -12.869 1.808   1.00 54.14 ? 123 PHE D HE2  1  
ATOM 8987   H HZ   . PHE D 1 123 ? 11.407  -14.466 3.409   1.00 3.24  ? 123 PHE D HZ   1  
ATOM 8988   N N    . PRO D 1 124 ? 9.722   -8.109  8.014   1.00 0.34  ? 124 PRO D N    1  
ATOM 8989   C CA   . PRO D 1 124 ? 9.778   -6.881  8.848   1.00 34.22 ? 124 PRO D CA   1  
ATOM 8990   C C    . PRO D 1 124 ? 10.181  -5.660  8.008   1.00 1.44  ? 124 PRO D C    1  
ATOM 8991   O O    . PRO D 1 124 ? 11.268  -5.649  7.406   1.00 50.13 ? 124 PRO D O    1  
ATOM 8992   C CB   . PRO D 1 124 ? 10.872  -7.211  9.887   1.00 61.33 ? 124 PRO D CB   1  
ATOM 8993   C CG   . PRO D 1 124 ? 11.746  -8.210  9.191   1.00 34.15 ? 124 PRO D CG   1  
ATOM 8994   C CD   . PRO D 1 124 ? 10.784  -9.080  8.425   1.00 73.44 ? 124 PRO D CD   1  
ATOM 8995   H HA   . PRO D 1 124 ? 8.832   -6.692  9.352   1.00 62.02 ? 124 PRO D HA   1  
ATOM 8996   H HB2  . PRO D 1 124 ? 11.430  -6.320  10.170  1.00 62.31 ? 124 PRO D HB2  1  
ATOM 8997   H HB3  . PRO D 1 124 ? 10.428  -7.657  10.769  1.00 45.13 ? 124 PRO D HB3  1  
ATOM 8998   H HG2  . PRO D 1 124 ? 12.433  -7.701  8.517   1.00 62.34 ? 124 PRO D HG2  1  
ATOM 8999   H HG3  . PRO D 1 124 ? 12.298  -8.800  9.913   1.00 63.22 ? 124 PRO D HG3  1  
ATOM 9000   H HD2  . PRO D 1 124 ? 11.269  -9.523  7.564   1.00 4.52  ? 124 PRO D HD2  1  
ATOM 9001   H HD3  . PRO D 1 124 ? 10.370  -9.856  9.063   1.00 64.22 ? 124 PRO D HD3  1  
ATOM 9002   N N    . GLN D 1 125 ? 9.296   -4.652  7.965   1.00 74.50 ? 125 GLN D N    1  
ATOM 9003   C CA   . GLN D 1 125 ? 9.519   -3.428  7.185   1.00 41.42 ? 125 GLN D CA   1  
ATOM 9004   C C    . GLN D 1 125 ? 10.844  -2.751  7.623   1.00 2.23  ? 125 GLN D C    1  
ATOM 9005   O O    . GLN D 1 125 ? 11.179  -2.732  8.823   1.00 1.52  ? 125 GLN D O    1  
ATOM 9006   C CB   . GLN D 1 125 ? 8.312   -2.466  7.339   1.00 43.14 ? 125 GLN D CB   1  
ATOM 9007   C CG   . GLN D 1 125 ? 8.200   -1.767  8.713   1.00 53.31 ? 125 GLN D CG   1  
ATOM 9008   C CD   . GLN D 1 125 ? 7.186   -0.624  8.755   1.00 23.51 ? 125 GLN D CD   1  
ATOM 9009   O OE1  . GLN D 1 125 ? 6.144   -0.656  8.098   1.00 53.21 ? 125 GLN D OE1  1  
ATOM 9010   N NE2  . GLN D 1 125 ? 7.512   0.413   9.507   1.00 32.54 ? 125 GLN D NE2  1  
ATOM 9011   H H    . GLN D 1 125 ? 8.467   -4.738  8.480   1.00 2.11  ? 125 GLN D H    1  
ATOM 9012   H HA   . GLN D 1 125 ? 9.606   -3.721  6.142   1.00 70.24 ? 125 GLN D HA   1  
ATOM 9013   H HB2  . GLN D 1 125 ? 8.384   -1.705  6.575   1.00 42.33 ? 125 GLN D HB2  1  
ATOM 9014   H HB3  . GLN D 1 125 ? 7.400   -3.029  7.169   1.00 22.33 ? 125 GLN D HB3  1  
ATOM 9015   H HG2  . GLN D 1 125 ? 7.909   -2.501  9.456   1.00 61.25 ? 125 GLN D HG2  1  
ATOM 9016   H HG3  . GLN D 1 125 ? 9.175   -1.374  8.979   1.00 45.11 ? 125 GLN D HG3  1  
ATOM 9017   H HE21 . GLN D 1 125 ? 8.369   0.387   9.979   1.00 33.42 ? 125 GLN D HE21 1  
ATOM 9018   H HE22 . GLN D 1 125 ? 6.881   1.161   9.568   1.00 54.41 ? 125 GLN D HE22 1  
ATOM 9019   N N    . LEU D 1 126 ? 11.615  -2.229  6.654   1.00 25.30 ? 126 LEU D N    1  
ATOM 9020   C CA   . LEU D 1 126 ? 12.984  -1.750  6.925   1.00 44.34 ? 126 LEU D CA   1  
ATOM 9021   C C    . LEU D 1 126 ? 13.014  -0.218  6.841   1.00 12.50 ? 126 LEU D C    1  
ATOM 9022   O O    . LEU D 1 126 ? 12.771  0.367   5.782   1.00 43.42 ? 126 LEU D O    1  
ATOM 9023   C CB   . LEU D 1 126 ? 14.020  -2.415  5.958   1.00 74.32 ? 126 LEU D CB   1  
ATOM 9024   C CG   . LEU D 1 126 ? 15.458  -2.659  6.556   1.00 71.45 ? 126 LEU D CG   1  
ATOM 9025   C CD1  . LEU D 1 126 ? 16.354  -3.423  5.563   1.00 33.25 ? 126 LEU D CD1  1  
ATOM 9026   C CD2  . LEU D 1 126 ? 16.144  -1.352  7.026   1.00 3.12  ? 126 LEU D CD2  1  
ATOM 9027   H H    . LEU D 1 126 ? 11.247  -2.134  5.751   1.00 75.21 ? 126 LEU D H    1  
ATOM 9028   H HA   . LEU D 1 126 ? 13.242  -2.041  7.947   1.00 41.33 ? 126 LEU D HA   1  
ATOM 9029   H HB2  . LEU D 1 126 ? 13.619  -3.378  5.654   1.00 71.30 ? 126 LEU D HB2  1  
ATOM 9030   H HB3  . LEU D 1 126 ? 14.120  -1.803  5.067   1.00 24.30 ? 126 LEU D HB3  1  
ATOM 9031   H HG   . LEU D 1 126 ? 15.357  -3.294  7.429   1.00 72.21 ? 126 LEU D HG   1  
ATOM 9032   H HD11 . LEU D 1 126 ? 16.483  -2.844  4.656   1.00 43.25 ? 126 LEU D HD11 1  
ATOM 9033   H HD12 . LEU D 1 126 ? 15.895  -4.373  5.314   1.00 24.54 ? 126 LEU D HD12 1  
ATOM 9034   H HD13 . LEU D 1 126 ? 17.321  -3.610  6.009   1.00 20.45 ? 126 LEU D HD13 1  
ATOM 9035   H HD21 . LEU D 1 126 ? 17.115  -1.582  7.445   1.00 43.25 ? 126 LEU D HD21 1  
ATOM 9036   H HD22 . LEU D 1 126 ? 15.538  -0.874  7.783   1.00 30.02 ? 126 LEU D HD22 1  
ATOM 9037   H HD23 . LEU D 1 126 ? 16.267  -0.676  6.188   1.00 44.35 ? 126 LEU D HD23 1  
ATOM 9038   N N    . ASN D 1 127 ? 13.347  0.402   7.975   1.00 13.13 ? 127 ASN D N    1  
ATOM 9039   C CA   . ASN D 1 127 ? 13.393  1.854   8.131   1.00 52.33 ? 127 ASN D CA   1  
ATOM 9040   C C    . ASN D 1 127 ? 14.858  2.307   8.019   1.00 24.50 ? 127 ASN D C    1  
ATOM 9041   O O    . ASN D 1 127 ? 15.615  2.222   8.990   1.00 65.12 ? 127 ASN D O    1  
ATOM 9042   C CB   . ASN D 1 127 ? 12.785  2.251   9.511   1.00 72.54 ? 127 ASN D CB   1  
ATOM 9043   C CG   . ASN D 1 127 ? 11.313  1.842   9.701   1.00 14.32 ? 127 ASN D CG   1  
ATOM 9044   O OD1  . ASN D 1 127 ? 10.809  0.900   9.091   1.00 72.03 ? 127 ASN D OD1  1  
ATOM 9045   N ND2  . ASN D 1 127 ? 10.622  2.531   10.583  1.00 42.15 ? 127 ASN D ND2  1  
ATOM 9046   H H    . ASN D 1 127 ? 13.570  -0.150  8.752   1.00 10.14 ? 127 ASN D H    1  
ATOM 9047   H HA   . ASN D 1 127 ? 12.807  2.318   7.338   1.00 12.33 ? 127 ASN D HA   1  
ATOM 9048   H HB2  . ASN D 1 127 ? 13.357  1.781   10.298  1.00 72.43 ? 127 ASN D HB2  1  
ATOM 9049   H HB3  . ASN D 1 127 ? 12.859  3.330   9.625   1.00 54.32 ? 127 ASN D HB3  1  
ATOM 9050   H HD21 . ASN D 1 127 ? 11.075  3.252   11.065  1.00 61.10 ? 127 ASN D HD21 1  
ATOM 9051   H HD22 . ASN D 1 127 ? 9.681   2.298   10.708  1.00 71.54 ? 127 ASN D HD22 1  
ATOM 9052   N N    . LEU D 1 128 ? 15.255  2.721   6.799   1.00 22.14 ? 128 LEU D N    1  
ATOM 9053   C CA   . LEU D 1 128 ? 16.623  3.191   6.505   1.00 30.13 ? 128 LEU D CA   1  
ATOM 9054   C C    . LEU D 1 128 ? 16.941  4.450   7.338   1.00 30.21 ? 128 LEU D C    1  
ATOM 9055   O O    . LEU D 1 128 ? 16.232  5.460   7.248   1.00 21.21 ? 128 LEU D O    1  
ATOM 9056   C CB   . LEU D 1 128 ? 16.807  3.489   4.976   1.00 22.43 ? 128 LEU D CB   1  
ATOM 9057   C CG   . LEU D 1 128 ? 16.942  2.264   4.008   1.00 35.31 ? 128 LEU D CG   1  
ATOM 9058   C CD1  . LEU D 1 128 ? 18.163  1.411   4.393   1.00 74.02 ? 128 LEU D CD1  1  
ATOM 9059   C CD2  . LEU D 1 128 ? 15.645  1.414   3.938   1.00 70.33 ? 128 LEU D CD2  1  
ATOM 9060   H H    . LEU D 1 128 ? 14.602  2.710   6.070   1.00 21.52 ? 128 LEU D H    1  
ATOM 9061   H HA   . LEU D 1 128 ? 17.307  2.396   6.787   1.00 32.43 ? 128 LEU D HA   1  
ATOM 9062   H HB2  . LEU D 1 128 ? 15.964  4.085   4.645   1.00 40.55 ? 128 LEU D HB2  1  
ATOM 9063   H HB3  . LEU D 1 128 ? 17.701  4.101   4.856   1.00 1.55  ? 128 LEU D HB3  1  
ATOM 9064   H HG   . LEU D 1 128 ? 17.132  2.640   3.006   1.00 61.01 ? 128 LEU D HG   1  
ATOM 9065   H HD11 . LEU D 1 128 ? 19.058  2.025   4.380   1.00 42.12 ? 128 LEU D HD11 1  
ATOM 9066   H HD12 . LEU D 1 128 ? 18.288  0.601   3.688   1.00 51.13 ? 128 LEU D HD12 1  
ATOM 9067   H HD13 . LEU D 1 128 ? 18.034  1.000   5.389   1.00 24.25 ? 128 LEU D HD13 1  
ATOM 9068   H HD21 . LEU D 1 128 ? 14.819  2.037   3.620   1.00 11.43 ? 128 LEU D HD21 1  
ATOM 9069   H HD22 . LEU D 1 128 ? 15.422  0.998   4.913   1.00 34.21 ? 128 LEU D HD22 1  
ATOM 9070   H HD23 . LEU D 1 128 ? 15.772  0.606   3.228   1.00 3.22  ? 128 LEU D HD23 1  
ATOM 9071   N N    . ALA D 1 129 ? 17.998  4.359   8.157   1.00 4.12  ? 129 ALA D N    1  
ATOM 9072   C CA   . ALA D 1 129 ? 18.463  5.465   9.000   1.00 31.30 ? 129 ALA D CA   1  
ATOM 9073   C C    . ALA D 1 129 ? 19.016  6.617   8.129   1.00 51.21 ? 129 ALA D C    1  
ATOM 9074   O O    . ALA D 1 129 ? 19.668  6.354   7.107   1.00 50.21 ? 129 ALA D O    1  
ATOM 9075   C CB   . ALA D 1 129 ? 19.517  4.949   9.992   1.00 32.12 ? 129 ALA D CB   1  
ATOM 9076   H H    . ALA D 1 129 ? 18.485  3.513   8.192   1.00 35.14 ? 129 ALA D H    1  
ATOM 9077   H HA   . ALA D 1 129 ? 17.610  5.825   9.572   1.00 55.21 ? 129 ALA D HA   1  
ATOM 9078   H HB1  . ALA D 1 129 ? 19.099  4.145   10.583  1.00 43.44 ? 129 ALA D HB1  1  
ATOM 9079   H HB2  . ALA D 1 129 ? 19.826  5.750   10.653  1.00 63.55 ? 129 ALA D HB2  1  
ATOM 9080   H HB3  . ALA D 1 129 ? 20.379  4.581   9.451   1.00 43.22 ? 129 ALA D HB3  1  
ATOM 9081   N N    . PRO D 1 130 ? 18.747  7.912   8.500   1.00 61.04 ? 130 PRO D N    1  
ATOM 9082   C CA   . PRO D 1 130 ? 19.199  9.074   7.711   1.00 10.51 ? 130 PRO D CA   1  
ATOM 9083   C C    . PRO D 1 130 ? 20.715  9.312   7.904   1.00 25.41 ? 130 PRO D C    1  
ATOM 9084   O O    . PRO D 1 130 ? 21.157  9.721   8.987   1.00 13.43 ? 130 PRO D O    1  
ATOM 9085   C CB   . PRO D 1 130 ? 18.329  10.254  8.258   1.00 73.34 ? 130 PRO D CB   1  
ATOM 9086   C CG   . PRO D 1 130 ? 17.368  9.638   9.247   1.00 12.52 ? 130 PRO D CG   1  
ATOM 9087   C CD   . PRO D 1 130 ? 18.014  8.358   9.713   1.00 23.43 ? 130 PRO D CD   1  
ATOM 9088   H HA   . PRO D 1 130 ? 18.987  8.929   6.653   1.00 12.01 ? 130 PRO D HA   1  
ATOM 9089   H HB2  . PRO D 1 130 ? 18.959  11.001  8.746   1.00 55.04 ? 130 PRO D HB2  1  
ATOM 9090   H HB3  . PRO D 1 130 ? 17.783  10.720  7.449   1.00 3.30  ? 130 PRO D HB3  1  
ATOM 9091   H HG2  . PRO D 1 130 ? 17.211  10.313  10.085  1.00 1.21  ? 130 PRO D HG2  1  
ATOM 9092   H HG3  . PRO D 1 130 ? 16.420  9.421   8.771   1.00 60.02 ? 130 PRO D HG3  1  
ATOM 9093   H HD2  . PRO D 1 130 ? 18.701  8.544   10.537  1.00 41.12 ? 130 PRO D HD2  1  
ATOM 9094   H HD3  . PRO D 1 130 ? 17.264  7.637   10.009  1.00 74.41 ? 130 PRO D HD3  1  
ATOM 9095   N N    . VAL D 1 131 ? 21.501  9.019   6.855   1.00 54.31 ? 131 VAL D N    1  
ATOM 9096   C CA   . VAL D 1 131 ? 22.972  9.127   6.886   1.00 74.31 ? 131 VAL D CA   1  
ATOM 9097   C C    . VAL D 1 131 ? 23.409  10.318  6.022   1.00 4.35  ? 131 VAL D C    1  
ATOM 9098   O O    . VAL D 1 131 ? 22.849  10.546  4.941   1.00 11.41 ? 131 VAL D O    1  
ATOM 9099   C CB   . VAL D 1 131 ? 23.655  7.796   6.377   1.00 4.45  ? 131 VAL D CB   1  
ATOM 9100   C CG1  . VAL D 1 131 ? 25.206  7.884   6.417   1.00 12.43 ? 131 VAL D CG1  1  
ATOM 9101   C CG2  . VAL D 1 131 ? 23.145  6.581   7.193   1.00 24.34 ? 131 VAL D CG2  1  
ATOM 9102   H H    . VAL D 1 131 ? 21.076  8.724   6.023   1.00 43.21 ? 131 VAL D H    1  
ATOM 9103   H HA   . VAL D 1 131 ? 23.289  9.302   7.917   1.00 42.53 ? 131 VAL D HA   1  
ATOM 9104   H HB   . VAL D 1 131 ? 23.361  7.642   5.339   1.00 70.35 ? 131 VAL D HB   1  
ATOM 9105   H HG11 . VAL D 1 131 ? 25.637  6.967   6.034   1.00 12.12 ? 131 VAL D HG11 1  
ATOM 9106   H HG12 . VAL D 1 131 ? 25.542  8.037   7.435   1.00 12.00 ? 131 VAL D HG12 1  
ATOM 9107   H HG13 . VAL D 1 131 ? 25.537  8.714   5.807   1.00 15.20 ? 131 VAL D HG13 1  
ATOM 9108   H HG21 . VAL D 1 131 ? 23.602  5.671   6.828   1.00 15.21 ? 131 VAL D HG21 1  
ATOM 9109   H HG22 . VAL D 1 131 ? 22.070  6.500   7.091   1.00 75.13 ? 131 VAL D HG22 1  
ATOM 9110   H HG23 . VAL D 1 131 ? 23.389  6.708   8.245   1.00 61.01 ? 131 VAL D HG23 1  
ATOM 9111   N N    . ASN D 1 132 ? 24.400  11.073  6.529   1.00 74.25 ? 132 ASN D N    1  
ATOM 9112   C CA   . ASN D 1 132 ? 24.931  12.266  5.859   1.00 14.24 ? 132 ASN D CA   1  
ATOM 9113   C C    . ASN D 1 132 ? 25.810  11.862  4.656   1.00 60.03 ? 132 ASN D C    1  
ATOM 9114   O O    . ASN D 1 132 ? 26.888  11.274  4.833   1.00 3.23  ? 132 ASN D O    1  
ATOM 9115   C CB   . ASN D 1 132 ? 25.753  13.118  6.861   1.00 20.22 ? 132 ASN D CB   1  
ATOM 9116   C CG   . ASN D 1 132 ? 26.279  14.419  6.243   1.00 23.24 ? 132 ASN D CG   1  
ATOM 9117   O OD1  . ASN D 1 132 ? 25.610  15.048  5.430   1.00 33.02 ? 132 ASN D OD1  1  
ATOM 9118   N ND2  . ASN D 1 132 ? 27.481  14.812  6.604   1.00 52.52 ? 132 ASN D ND2  1  
ATOM 9119   H H    . ASN D 1 132 ? 24.791  10.810  7.390   1.00 71.20 ? 132 ASN D H    1  
ATOM 9120   H HA   . ASN D 1 132 ? 24.085  12.857  5.507   1.00 31.12 ? 132 ASN D HA   1  
ATOM 9121   H HB2  . ASN D 1 132 ? 25.124  13.380  7.703   1.00 21.05 ? 132 ASN D HB2  1  
ATOM 9122   H HB3  . ASN D 1 132 ? 26.594  12.530  7.221   1.00 40.44 ? 132 ASN D HB3  1  
ATOM 9123   H HD21 . ASN D 1 132 ? 27.973  14.264  7.252   1.00 1.44  ? 132 ASN D HD21 1  
ATOM 9124   H HD22 . ASN D 1 132 ? 27.841  15.624  6.201   1.00 71.43 ? 132 ASN D HD22 1  
ATOM 9125   N N    . PHE D 1 133 ? 25.327  12.178  3.446   1.00 54.02 ? 133 PHE D N    1  
ATOM 9126   C CA   . PHE D 1 133 ? 26.048  11.914  2.185   1.00 72.53 ? 133 PHE D CA   1  
ATOM 9127   C C    . PHE D 1 133 ? 27.204  12.909  1.993   1.00 44.23 ? 133 PHE D C    1  
ATOM 9128   O O    . PHE D 1 133 ? 28.237  12.549  1.422   1.00 62.42 ? 133 PHE D O    1  
ATOM 9129   C CB   . PHE D 1 133 ? 25.073  11.969  0.976   1.00 11.41 ? 133 PHE D CB   1  
ATOM 9130   C CG   . PHE D 1 133 ? 23.911  10.961  1.066   1.00 41.11 ? 133 PHE D CG   1  
ATOM 9131   C CD1  . PHE D 1 133 ? 24.100  9.612   0.741   1.00 15.14 ? 133 PHE D CD1  1  
ATOM 9132   C CD2  . PHE D 1 133 ? 22.639  11.356  1.499   1.00 61.20 ? 133 PHE D CD2  1  
ATOM 9133   C CE1  . PHE D 1 133 ? 23.054  8.702   0.828   1.00 32.33 ? 133 PHE D CE1  1  
ATOM 9134   C CE2  . PHE D 1 133 ? 21.596  10.444  1.584   1.00 44.21 ? 133 PHE D CE2  1  
ATOM 9135   C CZ   . PHE D 1 133 ? 21.806  9.117   1.256   1.00 54.12 ? 133 PHE D CZ   1  
ATOM 9136   H H    . PHE D 1 133 ? 24.442  12.598  3.396   1.00 22.12 ? 133 PHE D H    1  
ATOM 9137   H HA   . PHE D 1 133 ? 26.468  10.915  2.245   1.00 45.14 ? 133 PHE D HA   1  
ATOM 9138   H HB2  . PHE D 1 133 ? 24.654  12.969  0.898   1.00 11.34 ? 133 PHE D HB2  1  
ATOM 9139   H HB3  . PHE D 1 133 ? 25.626  11.758  0.065   1.00 23.44 ? 133 PHE D HB3  1  
ATOM 9140   H HD1  . PHE D 1 133 ? 25.074  9.276   0.404   1.00 21.54 ? 133 PHE D HD1  1  
ATOM 9141   H HD2  . PHE D 1 133 ? 22.467  12.393  1.763   1.00 65.33 ? 133 PHE D HD2  1  
ATOM 9142   H HE1  . PHE D 1 133 ? 23.217  7.663   0.571   1.00 44.41 ? 133 PHE D HE1  1  
ATOM 9143   H HE2  . PHE D 1 133 ? 20.618  10.769  1.917   1.00 33.40 ? 133 PHE D HE2  1  
ATOM 9144   H HZ   . PHE D 1 133 ? 20.991  8.406   1.325   1.00 20.40 ? 133 PHE D HZ   1  
ATOM 9145   N N    . ASP D 1 134 ? 27.013  14.150  2.497   1.00 52.05 ? 134 ASP D N    1  
ATOM 9146   C CA   . ASP D 1 134 ? 28.003  15.249  2.401   1.00 53.55 ? 134 ASP D CA   1  
ATOM 9147   C C    . ASP D 1 134 ? 29.398  14.790  2.855   1.00 45.35 ? 134 ASP D C    1  
ATOM 9148   O O    . ASP D 1 134 ? 30.370  14.892  2.100   1.00 72.43 ? 134 ASP D O    1  
ATOM 9149   C CB   . ASP D 1 134 ? 27.549  16.467  3.262   1.00 43.40 ? 134 ASP D CB   1  
ATOM 9150   C CG   . ASP D 1 134 ? 26.276  17.159  2.756   1.00 42.42 ? 134 ASP D CG   1  
ATOM 9151   O OD1  . ASP D 1 134 ? 26.360  18.307  2.271   1.00 42.22 ? 134 ASP D OD1  1  
ATOM 9152   O OD2  . ASP D 1 134 ? 25.188  16.550  2.815   1.00 73.55 ? 134 ASP D OD2  1  
ATOM 9153   H H    . ASP D 1 134 ? 26.167  14.336  2.955   1.00 73.21 ? 134 ASP D H    1  
ATOM 9154   H HA   . ASP D 1 134 ? 28.057  15.555  1.366   1.00 1.14  ? 134 ASP D HA   1  
ATOM 9155   H HB2  . ASP D 1 134 ? 27.362  16.129  4.275   1.00 71.12 ? 134 ASP D HB2  1  
ATOM 9156   H HB3  . ASP D 1 134 ? 28.354  17.199  3.291   1.00 35.31 ? 134 ASP D HB3  1  
ATOM 9157   N N    . ALA D 1 135 ? 29.454  14.257  4.084   1.00 51.13 ? 135 ALA D N    1  
ATOM 9158   C CA   . ALA D 1 135 ? 30.703  13.826  4.747   1.00 44.03 ? 135 ALA D CA   1  
ATOM 9159   C C    . ALA D 1 135 ? 31.465  12.755  3.939   1.00 13.24 ? 135 ALA D C    1  
ATOM 9160   O O    . ALA D 1 135 ? 32.697  12.805  3.825   1.00 12.44 ? 135 ALA D O    1  
ATOM 9161   C CB   . ALA D 1 135 ? 30.358  13.303  6.137   1.00 30.52 ? 135 ALA D CB   1  
ATOM 9162   H H    . ALA D 1 135 ? 28.611  14.148  4.573   1.00 64.03 ? 135 ALA D H    1  
ATOM 9163   H HA   . ALA D 1 135 ? 31.338  14.698  4.867   1.00 61.42 ? 135 ALA D HA   1  
ATOM 9164   H HB1  . ALA D 1 135 ? 29.944  14.101  6.729   1.00 12.14 ? 135 ALA D HB1  1  
ATOM 9165   H HB2  . ALA D 1 135 ? 31.241  12.914  6.628   1.00 24.44 ? 135 ALA D HB2  1  
ATOM 9166   H HB3  . ALA D 1 135 ? 29.620  12.527  6.044   1.00 41.31 ? 135 ALA D HB3  1  
ATOM 9167   N N    . LEU D 1 136 ? 30.699  11.805  3.388   1.00 10.22 ? 136 LEU D N    1  
ATOM 9168   C CA   . LEU D 1 136 ? 31.226  10.692  2.565   1.00 23.23 ? 136 LEU D CA   1  
ATOM 9169   C C    . LEU D 1 136 ? 31.900  11.225  1.272   1.00 11.24 ? 136 LEU D C    1  
ATOM 9170   O O    . LEU D 1 136 ? 32.953  10.731  0.844   1.00 53.32 ? 136 LEU D O    1  
ATOM 9171   C CB   . LEU D 1 136 ? 30.062  9.721   2.205   1.00 52.13 ? 136 LEU D CB   1  
ATOM 9172   C CG   . LEU D 1 136 ? 29.250  9.128   3.411   1.00 52.11 ? 136 LEU D CG   1  
ATOM 9173   C CD1  . LEU D 1 136 ? 28.065  8.252   2.916   1.00 74.00 ? 136 LEU D CD1  1  
ATOM 9174   C CD2  . LEU D 1 136 ? 30.170  8.344   4.384   1.00 61.15 ? 136 LEU D CD2  1  
ATOM 9175   H H    . LEU D 1 136 ? 29.732  11.853  3.542   1.00 71.45 ? 136 LEU D H    1  
ATOM 9176   H HA   . LEU D 1 136 ? 31.964  10.157  3.155   1.00 41.40 ? 136 LEU D HA   1  
ATOM 9177   H HB2  . LEU D 1 136 ? 29.369  10.257  1.562   1.00 22.41 ? 136 LEU D HB2  1  
ATOM 9178   H HB3  . LEU D 1 136 ? 30.472  8.892   1.635   1.00 43.05 ? 136 LEU D HB3  1  
ATOM 9179   H HG   . LEU D 1 136 ? 28.821  9.955   3.972   1.00 44.32 ? 136 LEU D HG   1  
ATOM 9180   H HD11 . LEU D 1 136 ? 27.505  7.881   3.765   1.00 13.13 ? 136 LEU D HD11 1  
ATOM 9181   H HD12 . LEU D 1 136 ? 28.437  7.413   2.342   1.00 50.32 ? 136 LEU D HD12 1  
ATOM 9182   H HD13 . LEU D 1 136 ? 27.409  8.847   2.292   1.00 44.24 ? 136 LEU D HD13 1  
ATOM 9183   H HD21 . LEU D 1 136 ? 29.585  7.959   5.210   1.00 25.41 ? 136 LEU D HD21 1  
ATOM 9184   H HD22 . LEU D 1 136 ? 30.934  9.003   4.775   1.00 61.33 ? 136 LEU D HD22 1  
ATOM 9185   H HD23 . LEU D 1 136 ? 30.642  7.520   3.865   1.00 53.41 ? 136 LEU D HD23 1  
ATOM 9186   N N    . PHE D 1 137 ? 31.261  12.245  0.678   1.00 41.15 ? 137 PHE D N    1  
ATOM 9187   C CA   . PHE D 1 137 ? 31.674  12.855  -0.603  1.00 31.34 ? 137 PHE D CA   1  
ATOM 9188   C C    . PHE D 1 137 ? 32.851  13.826  -0.452  1.00 25.00 ? 137 PHE D C    1  
ATOM 9189   O O    . PHE D 1 137 ? 33.565  14.042  -1.432  1.00 72.41 ? 137 PHE D O    1  
ATOM 9190   C CB   . PHE D 1 137 ? 30.457  13.513  -1.317  1.00 23.12 ? 137 PHE D CB   1  
ATOM 9191   C CG   . PHE D 1 137 ? 29.632  12.497  -2.124  1.00 52.42 ? 137 PHE D CG   1  
ATOM 9192   C CD1  . PHE D 1 137 ? 28.733  11.629  -1.498  1.00 1.03  ? 137 PHE D CD1  1  
ATOM 9193   C CD2  . PHE D 1 137 ? 29.787  12.386  -3.507  1.00 62.12 ? 137 PHE D CD2  1  
ATOM 9194   C CE1  . PHE D 1 137 ? 28.019  10.693  -2.223  1.00 12.35 ? 137 PHE D CE1  1  
ATOM 9195   C CE2  . PHE D 1 137 ? 29.065  11.452  -4.231  1.00 50.23 ? 137 PHE D CE2  1  
ATOM 9196   C CZ   . PHE D 1 137 ? 28.182  10.608  -3.592  1.00 64.31 ? 137 PHE D CZ   1  
ATOM 9197   H H    . PHE D 1 137 ? 30.467  12.613  1.124   1.00 52.33 ? 137 PHE D H    1  
ATOM 9198   H HA   . PHE D 1 137 ? 32.032  12.044  -1.235  1.00 31.20 ? 137 PHE D HA   1  
ATOM 9199   H HB2  . PHE D 1 137 ? 29.809  13.974  -0.574  1.00 75.23 ? 137 PHE D HB2  1  
ATOM 9200   H HB3  . PHE D 1 137 ? 30.805  14.287  -1.997  1.00 14.23 ? 137 PHE D HB3  1  
ATOM 9201   H HD1  . PHE D 1 137 ? 28.594  11.691  -0.429  1.00 2.21  ? 137 PHE D HD1  1  
ATOM 9202   H HD2  . PHE D 1 137 ? 30.478  13.043  -4.022  1.00 35.41 ? 137 PHE D HD2  1  
ATOM 9203   H HE1  . PHE D 1 137 ? 27.327  10.028  -1.722  1.00 30.34 ? 137 PHE D HE1  1  
ATOM 9204   H HE2  . PHE D 1 137 ? 29.192  11.387  -5.306  1.00 12.43 ? 137 PHE D HE2  1  
ATOM 9205   H HZ   . PHE D 1 137 ? 27.624  9.876   -4.163  1.00 51.50 ? 137 PHE D HZ   1  
ATOM 9206   N N    . MET D 1 138 ? 33.021  14.438  0.747   1.00 72.14 ? 138 MET D N    1  
ATOM 9207   C CA   . MET D 1 138 ? 34.143  15.387  1.031   1.00 73.45 ? 138 MET D CA   1  
ATOM 9208   C C    . MET D 1 138 ? 35.487  14.815  0.541   1.00 5.43  ? 138 MET D C    1  
ATOM 9209   O O    . MET D 1 138 ? 36.246  15.495  -0.155  1.00 25.42 ? 138 MET D O    1  
ATOM 9210   C CB   . MET D 1 138 ? 34.283  15.711  2.544   1.00 64.25 ? 138 MET D CB   1  
ATOM 9211   C CG   . MET D 1 138 ? 33.030  16.263  3.219   1.00 63.33 ? 138 MET D CG   1  
ATOM 9212   S SD   . MET D 1 138 ? 32.322  17.705  2.389   1.00 50.32 ? 138 MET D SD   1  
ATOM 9213   C CE   . MET D 1 138 ? 30.899  18.031  3.439   1.00 61.05 ? 138 MET D CE   1  
ATOM 9214   H H    . MET D 1 138 ? 32.375  14.249  1.458   1.00 21.24 ? 138 MET D H    1  
ATOM 9215   H HA   . MET D 1 138 ? 33.931  16.306  0.493   1.00 33.11 ? 138 MET D HA   1  
ATOM 9216   H HB2  . MET D 1 138 ? 34.569  14.805  3.066   1.00 2.54  ? 138 MET D HB2  1  
ATOM 9217   H HB3  . MET D 1 138 ? 35.078  16.443  2.669   1.00 42.22 ? 138 MET D HB3  1  
ATOM 9218   H HG2  . MET D 1 138 ? 32.281  15.483  3.235   1.00 40.21 ? 138 MET D HG2  1  
ATOM 9219   H HG3  . MET D 1 138 ? 33.274  16.536  4.239   1.00 11.00 ? 138 MET D HG3  1  
ATOM 9220   H HE1  . MET D 1 138 ? 30.342  17.107  3.597   1.00 21.24 ? 138 MET D HE1  1  
ATOM 9221   H HE2  . MET D 1 138 ? 30.257  18.757  2.961   1.00 15.15 ? 138 MET D HE2  1  
ATOM 9222   H HE3  . MET D 1 138 ? 31.228  18.416  4.389   1.00 23.33 ? 138 MET D HE3  1  
ATOM 9223   N N    . ASN D 1 139 ? 35.723  13.534  0.894   1.00 42.44 ? 139 ASN D N    1  
ATOM 9224   C CA   . ASN D 1 139 ? 36.933  12.784  0.506   1.00 41.02 ? 139 ASN D CA   1  
ATOM 9225   C C    . ASN D 1 139 ? 37.029  12.648  -1.022  1.00 4.32  ? 139 ASN D C    1  
ATOM 9226   O O    . ASN D 1 139 ? 38.061  12.954  -1.604  1.00 11.43 ? 139 ASN D O    1  
ATOM 9227   C CB   . ASN D 1 139 ? 36.931  11.377  1.164   1.00 2.33  ? 139 ASN D CB   1  
ATOM 9228   C CG   . ASN D 1 139 ? 36.966  11.436  2.694   1.00 61.14 ? 139 ASN D CG   1  
ATOM 9229   O OD1  . ASN D 1 139 ? 35.924  11.473  3.351   1.00 3.42  ? 139 ASN D OD1  1  
ATOM 9230   N ND2  . ASN D 1 139 ? 38.166  11.456  3.271   1.00 2.25  ? 139 ASN D ND2  1  
ATOM 9231   H H    . ASN D 1 139 ? 35.050  13.076  1.444   1.00 1.12  ? 139 ASN D H    1  
ATOM 9232   H HA   . ASN D 1 139 ? 37.800  13.341  0.864   1.00 22.11 ? 139 ASN D HA   1  
ATOM 9233   H HB2  . ASN D 1 139 ? 36.037  10.841  0.863   1.00 63.10 ? 139 ASN D HB2  1  
ATOM 9234   H HB3  . ASN D 1 139 ? 37.798  10.818  0.823   1.00 70.11 ? 139 ASN D HB3  1  
ATOM 9235   H HD21 . ASN D 1 139 ? 38.958  11.429  2.692   1.00 73.44 ? 139 ASN D HD21 1  
ATOM 9236   H HD22 . ASN D 1 139 ? 38.210  11.506  4.249   1.00 63.42 ? 139 ASN D HD22 1  
ATOM 9237   N N    . TYR D 1 140 ? 35.916  12.221  -1.644  1.00 43.01 ? 140 TYR D N    1  
ATOM 9238   C CA   . TYR D 1 140 ? 35.830  11.943  -3.103  1.00 71.04 ? 140 TYR D CA   1  
ATOM 9239   C C    . TYR D 1 140 ? 36.156  13.197  -3.954  1.00 54.31 ? 140 TYR D C    1  
ATOM 9240   O O    . TYR D 1 140 ? 36.762  13.094  -5.028  1.00 51.22 ? 140 TYR D O    1  
ATOM 9241   C CB   . TYR D 1 140 ? 34.413  11.404  -3.446  1.00 33.04 ? 140 TYR D CB   1  
ATOM 9242   C CG   . TYR D 1 140 ? 34.194  11.054  -4.933  1.00 14.31 ? 140 TYR D CG   1  
ATOM 9243   C CD1  . TYR D 1 140 ? 34.772  9.910   -5.500  1.00 63.21 ? 140 TYR D CD1  1  
ATOM 9244   C CD2  . TYR D 1 140 ? 33.417  11.866  -5.769  1.00 51.41 ? 140 TYR D CD2  1  
ATOM 9245   C CE1  . TYR D 1 140 ? 34.578  9.594   -6.832  1.00 51.54 ? 140 TYR D CE1  1  
ATOM 9246   C CE2  . TYR D 1 140 ? 33.223  11.548  -7.100  1.00 0.24  ? 140 TYR D CE2  1  
ATOM 9247   C CZ   . TYR D 1 140 ? 33.805  10.415  -7.628  1.00 22.34 ? 140 TYR D CZ   1  
ATOM 9248   O OH   . TYR D 1 140 ? 33.610  10.104  -8.956  1.00 21.12 ? 140 TYR D OH   1  
ATOM 9249   H H    . TYR D 1 140 ? 35.113  12.093  -1.104  1.00 32.15 ? 140 TYR D H    1  
ATOM 9250   H HA   . TYR D 1 140 ? 36.559  11.172  -3.331  1.00 72.03 ? 140 TYR D HA   1  
ATOM 9251   H HB2  . TYR D 1 140 ? 34.229  10.505  -2.869  1.00 40.25 ? 140 TYR D HB2  1  
ATOM 9252   H HB3  . TYR D 1 140 ? 33.673  12.149  -3.162  1.00 74.10 ? 140 TYR D HB3  1  
ATOM 9253   H HD1  . TYR D 1 140 ? 35.379  9.262   -4.879  1.00 24.53 ? 140 TYR D HD1  1  
ATOM 9254   H HD2  . TYR D 1 140 ? 32.959  12.758  -5.359  1.00 63.42 ? 140 TYR D HD2  1  
ATOM 9255   H HE1  . TYR D 1 140 ? 35.034  8.705   -7.247  1.00 1.44  ? 140 TYR D HE1  1  
ATOM 9256   H HE2  . TYR D 1 140 ? 32.616  12.193  -7.724  1.00 65.33 ? 140 TYR D HE2  1  
ATOM 9257   H HH   . TYR D 1 140 ? 33.365  9.179   -9.035  1.00 44.12 ? 140 TYR D HH   1  
ATOM 9258   N N    . LEU D 1 141 ? 35.738  14.370  -3.454  1.00 33.12 ? 141 LEU D N    1  
ATOM 9259   C CA   . LEU D 1 141 ? 35.988  15.680  -4.101  1.00 31.35 ? 141 LEU D CA   1  
ATOM 9260   C C    . LEU D 1 141 ? 37.471  16.091  -3.961  1.00 64.32 ? 141 LEU D C    1  
ATOM 9261   O O    . LEU D 1 141 ? 37.993  16.828  -4.799  1.00 62.32 ? 141 LEU D O    1  
ATOM 9262   C CB   . LEU D 1 141 ? 35.034  16.777  -3.524  1.00 73.02 ? 141 LEU D CB   1  
ATOM 9263   C CG   . LEU D 1 141 ? 33.601  16.882  -4.170  1.00 51.34 ? 141 LEU D CG   1  
ATOM 9264   C CD1  . LEU D 1 141 ? 32.830  15.540  -4.157  1.00 53.42 ? 141 LEU D CD1  1  
ATOM 9265   C CD2  . LEU D 1 141 ? 32.780  18.016  -3.499  1.00 63.34 ? 141 LEU D CD2  1  
ATOM 9266   H H    . LEU D 1 141 ? 35.244  14.361  -2.609  1.00 13.32 ? 141 LEU D H    1  
ATOM 9267   H HA   . LEU D 1 141 ? 35.777  15.562  -5.162  1.00 41.34 ? 141 LEU D HA   1  
ATOM 9268   H HB2  . LEU D 1 141 ? 34.914  16.597  -2.460  1.00 42.02 ? 141 LEU D HB2  1  
ATOM 9269   H HB3  . LEU D 1 141 ? 35.516  17.745  -3.642  1.00 25.54 ? 141 LEU D HB3  1  
ATOM 9270   H HG   . LEU D 1 141 ? 33.722  17.153  -5.211  1.00 43.43 ? 141 LEU D HG   1  
ATOM 9271   H HD11 . LEU D 1 141 ? 32.658  15.220  -3.136  1.00 4.02  ? 141 LEU D HD11 1  
ATOM 9272   H HD12 . LEU D 1 141 ? 33.406  14.784  -4.672  1.00 63.01 ? 141 LEU D HD12 1  
ATOM 9273   H HD13 . LEU D 1 141 ? 31.879  15.661  -4.660  1.00 22.12 ? 141 LEU D HD13 1  
ATOM 9274   H HD21 . LEU D 1 141 ? 32.713  17.847  -2.431  1.00 4.21  ? 141 LEU D HD21 1  
ATOM 9275   H HD22 . LEU D 1 141 ? 31.783  18.046  -3.914  1.00 44.23 ? 141 LEU D HD22 1  
ATOM 9276   H HD23 . LEU D 1 141 ? 33.263  18.967  -3.680  1.00 63.24 ? 141 LEU D HD23 1  
ATOM 9277   N N    . GLN D 1 142 ? 38.122  15.624  -2.875  1.00 42.22 ? 142 GLN D N    1  
ATOM 9278   C CA   . GLN D 1 142 ? 39.577  15.804  -2.634  1.00 33.30 ? 142 GLN D CA   1  
ATOM 9279   C C    . GLN D 1 142 ? 40.396  14.671  -3.301  1.00 44.25 ? 142 GLN D C    1  
ATOM 9280   O O    . GLN D 1 142 ? 41.618  14.602  -3.129  1.00 13.32 ? 142 GLN D O    1  
ATOM 9281   C CB   . GLN D 1 142 ? 39.862  15.824  -1.103  1.00 62.33 ? 142 GLN D CB   1  
ATOM 9282   C CG   . GLN D 1 142 ? 39.040  16.867  -0.321  1.00 44.31 ? 142 GLN D CG   1  
ATOM 9283   C CD   . GLN D 1 142 ? 39.223  16.809  1.203   1.00 73.31 ? 142 GLN D CD   1  
ATOM 9284   O OE1  . GLN D 1 142 ? 40.290  16.469  1.710   1.00 72.12 ? 142 GLN D OE1  1  
ATOM 9285   N NE2  . GLN D 1 142 ? 38.171  17.129  1.944   1.00 65.31 ? 142 GLN D NE2  1  
ATOM 9286   H H    . GLN D 1 142 ? 37.601  15.132  -2.205  1.00 32.03 ? 142 GLN D H    1  
ATOM 9287   H HA   . GLN D 1 142 ? 39.886  16.754  -3.064  1.00 13.23 ? 142 GLN D HA   1  
ATOM 9288   H HB2  . GLN D 1 142 ? 39.640  14.842  -0.695  1.00 61.14 ? 142 GLN D HB2  1  
ATOM 9289   H HB3  . GLN D 1 142 ? 40.915  16.033  -0.943  1.00 0.15  ? 142 GLN D HB3  1  
ATOM 9290   H HG2  . GLN D 1 142 ? 39.315  17.860  -0.657  1.00 20.52 ? 142 GLN D HG2  1  
ATOM 9291   H HG3  . GLN D 1 142 ? 37.997  16.695  -0.550  1.00 24.50 ? 142 GLN D HG3  1  
ATOM 9292   H HE21 . GLN D 1 142 ? 37.341  17.379  1.487   1.00 44.40 ? 142 GLN D HE21 1  
ATOM 9293   H HE22 . GLN D 1 142 ? 38.270  17.106  2.918   1.00 20.30 ? 142 GLN D HE22 1  
ATOM 9294   N N    . GLN D 1 143 ? 39.704  13.773  -4.037  1.00 71.25 ? 143 GLN D N    1  
ATOM 9295   C CA   . GLN D 1 143 ? 40.314  12.612  -4.724  1.00 74.40 ? 143 GLN D CA   1  
ATOM 9296   C C    . GLN D 1 143 ? 39.839  12.549  -6.194  1.00 24.20 ? 143 GLN D C    1  
ATOM 9297   O O    . GLN D 1 143 ? 39.386  11.499  -6.671  1.00 13.02 ? 143 GLN D O    1  
ATOM 9298   C CB   . GLN D 1 143 ? 39.943  11.294  -3.978  1.00 10.24 ? 143 GLN D CB   1  
ATOM 9299   C CG   . GLN D 1 143 ? 40.439  11.194  -2.527  1.00 23.14 ? 143 GLN D CG   1  
ATOM 9300   C CD   . GLN D 1 143 ? 40.031  9.876   -1.870  1.00 73.11 ? 143 GLN D CD   1  
ATOM 9301   O OE1  . GLN D 1 143 ? 38.955  9.769   -1.283  1.00 14.24 ? 143 GLN D OE1  1  
ATOM 9302   N NE2  . GLN D 1 143 ? 40.880  8.866   -1.972  1.00 4.31  ? 143 GLN D NE2  1  
ATOM 9303   H H    . GLN D 1 143 ? 38.738  13.890  -4.111  1.00 60.44 ? 143 GLN D H    1  
ATOM 9304   H HA   . GLN D 1 143 ? 41.395  12.730  -4.722  1.00 70.43 ? 143 GLN D HA   1  
ATOM 9305   H HB2  . GLN D 1 143 ? 38.862  11.200  -3.968  1.00 2.05  ? 143 GLN D HB2  1  
ATOM 9306   H HB3  . GLN D 1 143 ? 40.353  10.454  -4.533  1.00 50.21 ? 143 GLN D HB3  1  
ATOM 9307   H HG2  . GLN D 1 143 ? 41.522  11.278  -2.516  1.00 31.45 ? 143 GLN D HG2  1  
ATOM 9308   H HG3  . GLN D 1 143 ? 40.015  12.018  -1.954  1.00 53.54 ? 143 GLN D HG3  1  
ATOM 9309   H HE21 . GLN D 1 143 ? 41.719  9.014   -2.460  1.00 43.34 ? 143 GLN D HE21 1  
ATOM 9310   H HE22 . GLN D 1 143 ? 40.639  8.015   -1.556  1.00 23.53 ? 143 GLN D HE22 1  
ATOM 9311   N N    . GLN D 1 144 ? 39.963  13.677  -6.910  1.00 1.32  ? 144 GLN D N    1  
ATOM 9312   C CA   . GLN D 1 144 ? 39.629  13.764  -8.350  1.00 42.21 ? 144 GLN D CA   1  
ATOM 9313   C C    . GLN D 1 144 ? 40.607  14.722  -9.055  1.00 41.15 ? 144 GLN D C    1  
ATOM 9314   O O    . GLN D 1 144 ? 41.186  15.600  -8.415  1.00 34.01 ? 144 GLN D O    1  
ATOM 9315   C CB   . GLN D 1 144 ? 38.149  14.213  -8.555  1.00 52.33 ? 144 GLN D CB   1  
ATOM 9316   C CG   . GLN D 1 144 ? 37.783  15.559  -7.901  1.00 73.31 ? 144 GLN D CG   1  
ATOM 9317   C CD   . GLN D 1 144 ? 36.351  16.007  -8.211  1.00 44.11 ? 144 GLN D CD   1  
ATOM 9318   O OE1  . GLN D 1 144 ? 35.408  15.689  -7.485  1.00 52.03 ? 144 GLN D OE1  1  
ATOM 9319   N NE2  . GLN D 1 144 ? 36.179  16.743  -9.302  1.00 21.53 ? 144 GLN D NE2  1  
ATOM 9320   H H    . GLN D 1 144 ? 40.288  14.486  -6.459  1.00 73.23 ? 144 GLN D H    1  
ATOM 9321   H HA   . GLN D 1 144 ? 39.760  12.773  -8.784  1.00 12.30 ? 144 GLN D HA   1  
ATOM 9322   H HB2  . GLN D 1 144 ? 37.947  14.284  -9.621  1.00 41.21 ? 144 GLN D HB2  1  
ATOM 9323   H HB3  . GLN D 1 144 ? 37.499  13.449  -8.138  1.00 72.43 ? 144 GLN D HB3  1  
ATOM 9324   H HG2  . GLN D 1 144 ? 37.893  15.464  -6.825  1.00 3.25  ? 144 GLN D HG2  1  
ATOM 9325   H HG3  . GLN D 1 144 ? 38.473  16.322  -8.254  1.00 72.22 ? 144 GLN D HG3  1  
ATOM 9326   H HE21 . GLN D 1 144 ? 36.971  16.961  -9.844  1.00 22.21 ? 144 GLN D HE21 1  
ATOM 9327   H HE22 . GLN D 1 144 ? 35.272  17.024  -9.528  1.00 53.42 ? 144 GLN D HE22 1  
ATOM 9328   N N    . ALA D 1 145 ? 40.789  14.529  -10.372 1.00 22.42 ? 145 ALA D N    1  
ATOM 9329   C CA   . ALA D 1 145 ? 41.705  15.334  -11.201 1.00 51.43 ? 145 ALA D CA   1  
ATOM 9330   C C    . ALA D 1 145 ? 41.252  15.237  -12.664 1.00 62.25 ? 145 ALA D C    1  
ATOM 9331   O O    . ALA D 1 145 ? 41.639  14.308  -13.380 1.00 42.30 ? 145 ALA D O    1  
ATOM 9332   C CB   . ALA D 1 145 ? 43.177  14.874  -11.032 1.00 61.23 ? 145 ALA D CB   1  
ATOM 9333   H H    . ALA D 1 145 ? 40.272  13.818  -10.814 1.00 22.13 ? 145 ALA D H    1  
ATOM 9334   H HA   . ALA D 1 145 ? 41.633  16.373  -10.879 1.00 74.22 ? 145 ALA D HA   1  
ATOM 9335   H HB1  . ALA D 1 145 ? 43.833  15.505  -11.624 1.00 63.33 ? 145 ALA D HB1  1  
ATOM 9336   H HB2  . ALA D 1 145 ? 43.284  13.848  -11.357 1.00 30.50 ? 145 ALA D HB2  1  
ATOM 9337   H HB3  . ALA D 1 145 ? 43.463  14.946  -9.990  1.00 33.24 ? 145 ALA D HB3  1  
ATOM 9338   N N    . GLY D 1 146 ? 40.367  16.164  -13.067 1.00 42.05 ? 146 GLY D N    1  
ATOM 9339   C CA   . GLY D 1 146 ? 39.795  16.180  -14.414 1.00 42.50 ? 146 GLY D CA   1  
ATOM 9340   C C    . GLY D 1 146 ? 38.523  17.003  -14.439 1.00 2.24  ? 146 GLY D C    1  
ATOM 9341   O O    . GLY D 1 146 ? 37.421  16.474  -14.637 1.00 11.41 ? 146 GLY D O    1  
ATOM 9342   H H    . GLY D 1 146 ? 40.085  16.852  -12.424 1.00 62.21 ? 146 GLY D H    1  
ATOM 9343   H HA2  . GLY D 1 146 ? 40.513  16.610  -15.103 1.00 22.14 ? 146 GLY D HA2  1  
ATOM 9344   H HA3  . GLY D 1 146 ? 39.569  15.167  -14.729 1.00 72.15 ? 146 GLY D HA3  1  
ATOM 9345   N N    . GLU D 1 147 ? 38.689  18.309  -14.191 1.00 24.15 ? 147 GLU D N    1  
ATOM 9346   C CA   . GLU D 1 147 ? 37.582  19.282  -14.140 1.00 11.45 ? 147 GLU D CA   1  
ATOM 9347   C C    . GLU D 1 147 ? 37.199  19.723  -15.569 1.00 23.21 ? 147 GLU D C    1  
ATOM 9348   O O    . GLU D 1 147 ? 37.926  19.432  -16.532 1.00 42.54 ? 147 GLU D O    1  
ATOM 9349   C CB   . GLU D 1 147 ? 37.978  20.501  -13.244 1.00 71.35 ? 147 GLU D CB   1  
ATOM 9350   C CG   . GLU D 1 147 ? 38.109  20.193  -11.724 1.00 12.14 ? 147 GLU D CG   1  
ATOM 9351   C CD   . GLU D 1 147 ? 39.123  19.077  -11.379 1.00 14.25 ? 147 GLU D CD   1  
ATOM 9352   O OE1  . GLU D 1 147 ? 38.747  18.072  -10.728 1.00 21.33 ? 147 GLU D OE1  1  
ATOM 9353   O OE2  . GLU D 1 147 ? 40.300  19.181  -11.789 1.00 60.15 ? 147 GLU D OE2  1  
ATOM 9354   H H    . GLU D 1 147 ? 39.600  18.636  -14.026 1.00 50.54 ? 147 GLU D H    1  
ATOM 9355   H HA   . GLU D 1 147 ? 36.724  18.786  -13.692 1.00 50.45 ? 147 GLU D HA   1  
ATOM 9356   H HB2  . GLU D 1 147 ? 38.932  20.887  -13.586 1.00 75.24 ? 147 GLU D HB2  1  
ATOM 9357   H HB3  . GLU D 1 147 ? 37.231  21.282  -13.363 1.00 64.42 ? 147 GLU D HB3  1  
ATOM 9358   H HG2  . GLU D 1 147 ? 38.422  21.103  -11.217 1.00 21.32 ? 147 GLU D HG2  1  
ATOM 9359   H HG3  . GLU D 1 147 ? 37.131  19.913  -11.346 1.00 14.44 ? 147 GLU D HG3  1  
ATOM 9360   N N    . GLY D 1 148 ? 36.065  20.441  -15.677 1.00 1.23  ? 148 GLY D N    1  
ATOM 9361   C CA   . GLY D 1 148 ? 35.464  20.799  -16.971 1.00 40.00 ? 148 GLY D CA   1  
ATOM 9362   C C    . GLY D 1 148 ? 36.286  21.782  -17.801 1.00 14.55 ? 148 GLY D C    1  
ATOM 9363   O O    . GLY D 1 148 ? 36.142  21.834  -19.034 1.00 22.02 ? 148 GLY D O    1  
ATOM 9364   H H    . GLY D 1 148 ? 35.624  20.743  -14.856 1.00 3.11  ? 148 GLY D H    1  
ATOM 9365   H HA2  . GLY D 1 148 ? 35.304  19.899  -17.553 1.00 41.44 ? 148 GLY D HA2  1  
ATOM 9366   H HA3  . GLY D 1 148 ? 34.502  21.248  -16.773 1.00 2.33  ? 148 GLY D HA3  1  
ATOM 9367   N N    . THR D 1 149 ? 37.124  22.577  -17.119 1.00 25.43 ? 149 THR D N    1  
ATOM 9368   C CA   . THR D 1 149 ? 37.990  23.581  -17.760 1.00 71.23 ? 149 THR D CA   1  
ATOM 9369   C C    . THR D 1 149 ? 39.128  23.985  -16.804 1.00 61.24 ? 149 THR D C    1  
ATOM 9370   O O    . THR D 1 149 ? 39.202  23.502  -15.659 1.00 10.03 ? 149 THR D O    1  
ATOM 9371   C CB   . THR D 1 149 ? 37.156  24.851  -18.178 1.00 71.23 ? 149 THR D CB   1  
ATOM 9372   O OG1  . THR D 1 149 ? 37.966  25.786  -18.919 1.00 13.25 ? 149 THR D OG1  1  
ATOM 9373   C CG2  . THR D 1 149 ? 36.556  25.565  -16.963 1.00 62.41 ? 149 THR D CG2  1  
ATOM 9374   H H    . THR D 1 149 ? 37.160  22.488  -16.140 1.00 44.23 ? 149 THR D H    1  
ATOM 9375   H HA   . THR D 1 149 ? 38.427  23.140  -18.655 1.00 25.35 ? 149 THR D HA   1  
ATOM 9376   H HB   . THR D 1 149 ? 36.344  24.525  -18.816 1.00 24.31 ? 149 THR D HB   1  
ATOM 9377   H HG1  . THR D 1 149 ? 37.699  26.685  -18.696 1.00 51.13 ? 149 THR D HG1  1  
ATOM 9378   H HG21 . THR D 1 149 ? 37.352  25.912  -16.315 1.00 75.34 ? 149 THR D HG21 1  
ATOM 9379   H HG22 . THR D 1 149 ? 35.921  24.885  -16.413 1.00 63.44 ? 149 THR D HG22 1  
ATOM 9380   H HG23 . THR D 1 149 ? 35.970  26.415  -17.292 1.00 54.32 ? 149 THR D HG23 1  
ATOM 9381   N N    . GLU D 1 150 ? 40.018  24.866  -17.295 1.00 24.22 ? 150 GLU D N    1  
ATOM 9382   C CA   . GLU D 1 150 ? 41.044  25.520  -16.477 1.00 21.21 ? 150 GLU D CA   1  
ATOM 9383   C C    . GLU D 1 150 ? 41.041  27.021  -16.787 1.00 43.31 ? 150 GLU D C    1  
ATOM 9384   O O    . GLU D 1 150 ? 41.488  27.447  -17.859 1.00 24.14 ? 150 GLU D O    1  
ATOM 9385   C CB   . GLU D 1 150 ? 42.446  24.906  -16.725 1.00 61.11 ? 150 GLU D CB   1  
ATOM 9386   C CG   . GLU D 1 150 ? 43.565  25.511  -15.846 1.00 1.51  ? 150 GLU D CG   1  
ATOM 9387   C CD   . GLU D 1 150 ? 44.904  24.777  -15.979 1.00 41.13 ? 150 GLU D CD   1  
ATOM 9388   O OE1  . GLU D 1 150 ? 45.787  25.247  -16.729 1.00 5.32  ? 150 GLU D OE1  1  
ATOM 9389   O OE2  . GLU D 1 150 ? 45.070  23.710  -15.349 1.00 43.51 ? 150 GLU D OE2  1  
ATOM 9390   H H    . GLU D 1 150 ? 39.972  25.089  -18.251 1.00 25.34 ? 150 GLU D H    1  
ATOM 9391   H HA   . GLU D 1 150 ? 40.781  25.382  -15.423 1.00 35.11 ? 150 GLU D HA   1  
ATOM 9392   H HB2  . GLU D 1 150 ? 42.394  23.839  -16.529 1.00 41.12 ? 150 GLU D HB2  1  
ATOM 9393   H HB3  . GLU D 1 150 ? 42.713  25.051  -17.768 1.00 63.10 ? 150 GLU D HB3  1  
ATOM 9394   H HG2  . GLU D 1 150 ? 43.704  26.552  -16.129 1.00 31.10 ? 150 GLU D HG2  1  
ATOM 9395   H HG3  . GLU D 1 150 ? 43.248  25.478  -14.805 1.00 4.04  ? 150 GLU D HG3  1  
ATOM 9396   N N    . GLU D 1 151 ? 40.483  27.798  -15.858 1.00 33.40 ? 151 GLU D N    1  
ATOM 9397   C CA   . GLU D 1 151 ? 40.425  29.255  -15.933 1.00 65.14 ? 151 GLU D CA   1  
ATOM 9398   C C    . GLU D 1 151 ? 40.406  29.808  -14.497 1.00 51.55 ? 151 GLU D C    1  
ATOM 9399   O O    . GLU D 1 151 ? 39.357  29.872  -13.837 1.00 45.31 ? 151 GLU D O    1  
ATOM 9400   C CB   . GLU D 1 151 ? 39.203  29.713  -16.791 1.00 51.21 ? 151 GLU D CB   1  
ATOM 9401   C CG   . GLU D 1 151 ? 37.862  29.032  -16.437 1.00 23.30 ? 151 GLU D CG   1  
ATOM 9402   C CD   . GLU D 1 151 ? 36.736  29.386  -17.410 1.00 1.23  ? 151 GLU D CD   1  
ATOM 9403   O OE1  . GLU D 1 151 ? 36.008  30.374  -17.170 1.00 31.42 ? 151 GLU D OE1  1  
ATOM 9404   O OE2  . GLU D 1 151 ? 36.575  28.675  -18.424 1.00 71.22 ? 151 GLU D OE2  1  
ATOM 9405   H H    . GLU D 1 151 ? 40.078  27.369  -15.081 1.00 51.45 ? 151 GLU D H    1  
ATOM 9406   H HA   . GLU D 1 151 ? 41.339  29.598  -16.419 1.00 63.32 ? 151 GLU D HA   1  
ATOM 9407   H HB2  . GLU D 1 151 ? 39.081  30.787  -16.687 1.00 62.12 ? 151 GLU D HB2  1  
ATOM 9408   H HB3  . GLU D 1 151 ? 39.423  29.498  -17.832 1.00 34.32 ? 151 GLU D HB3  1  
ATOM 9409   H HG2  . GLU D 1 151 ? 38.005  27.953  -16.441 1.00 33.34 ? 151 GLU D HG2  1  
ATOM 9410   H HG3  . GLU D 1 151 ? 37.571  29.334  -15.437 1.00 32.42 ? 151 GLU D HG3  1  
ATOM 9411   N N    . HIS D 1 152 ? 41.614  30.123  -13.999 1.00 52.43 ? 152 HIS D N    1  
ATOM 9412   C CA   . HIS D 1 152 ? 41.819  30.623  -12.638 1.00 62.43 ? 152 HIS D CA   1  
ATOM 9413   C C    . HIS D 1 152 ? 41.201  32.022  -12.475 1.00 20.32 ? 152 HIS D C    1  
ATOM 9414   O O    . HIS D 1 152 ? 41.804  33.031  -12.843 1.00 74.45 ? 152 HIS D O    1  
ATOM 9415   C CB   . HIS D 1 152 ? 43.334  30.623  -12.284 1.00 20.44 ? 152 HIS D CB   1  
ATOM 9416   C CG   . HIS D 1 152 ? 43.679  31.290  -10.967 1.00 31.23 ? 152 HIS D CG   1  
ATOM 9417   N ND1  . HIS D 1 152 ? 43.456  30.704  -9.740  1.00 40.42 ? 152 HIS D ND1  1  
ATOM 9418   C CD2  . HIS D 1 152 ? 44.222  32.508  -10.697 1.00 64.05 ? 152 HIS D CD2  1  
ATOM 9419   C CE1  . HIS D 1 152 ? 43.840  31.527  -8.783  1.00 2.54  ? 152 HIS D CE1  1  
ATOM 9420   N NE2  . HIS D 1 152 ? 44.306  32.623  -9.337  1.00 14.54 ? 152 HIS D NE2  1  
ATOM 9421   H H    . HIS D 1 152 ? 42.398  30.019  -14.581 1.00 53.21 ? 152 HIS D H    1  
ATOM 9422   H HA   . HIS D 1 152 ? 41.310  29.936  -11.961 1.00 61.23 ? 152 HIS D HA   1  
ATOM 9423   H HB2  . HIS D 1 152 ? 43.682  29.599  -12.231 1.00 44.22 ? 152 HIS D HB2  1  
ATOM 9424   H HB3  . HIS D 1 152 ? 43.880  31.132  -13.069 1.00 64.41 ? 152 HIS D HB3  1  
ATOM 9425   H HD1  . HIS D 1 152 ? 43.078  29.812  -9.594  1.00 34.42 ? 152 HIS D HD1  1  
ATOM 9426   H HD2  . HIS D 1 152 ? 44.530  33.250  -11.426 1.00 51.42 ? 152 HIS D HD2  1  
ATOM 9427   H HE1  . HIS D 1 152 ? 43.789  31.330  -7.720  1.00 25.44 ? 152 HIS D HE1  1  
ATOM 9428   H HE2  . HIS D 1 152 ? 44.536  33.443  -8.851  1.00 37.99 ? 152 HIS D HE2  1  
ATOM 9429   N N    . GLN D 1 153 ? 39.955  32.045  -11.999 1.00 14.44 ? 153 GLN D N    1  
ATOM 9430   C CA   . GLN D 1 153 ? 39.308  33.262  -11.495 1.00 53.43 ? 153 GLN D CA   1  
ATOM 9431   C C    . GLN D 1 153 ? 39.502  33.326  -9.973  1.00 13.45 ? 153 GLN D C    1  
ATOM 9432   O O    . GLN D 1 153 ? 39.653  32.284  -9.322  1.00 73.53 ? 153 GLN D O    1  
ATOM 9433   C CB   . GLN D 1 153 ? 37.803  33.280  -11.871 1.00 42.10 ? 153 GLN D CB   1  
ATOM 9434   C CG   . GLN D 1 153 ? 37.534  33.326  -13.399 1.00 15.54 ? 153 GLN D CG   1  
ATOM 9435   C CD   . GLN D 1 153 ? 36.065  33.562  -13.777 1.00 15.25 ? 153 GLN D CD   1  
ATOM 9436   O OE1  . GLN D 1 153 ? 35.315  34.213  -13.045 1.00 53.30 ? 153 GLN D OE1  1  
ATOM 9437   N NE2  . GLN D 1 153 ? 35.650  33.054  -14.930 1.00 70.41 ? 153 GLN D NE2  1  
ATOM 9438   H H    . GLN D 1 153 ? 39.445  31.206  -11.989 1.00 5.11  ? 153 GLN D H    1  
ATOM 9439   H HA   . GLN D 1 153 ? 39.797  34.128  -11.943 1.00 35.33 ? 153 GLN D HA   1  
ATOM 9440   H HB2  . GLN D 1 153 ? 37.330  32.389  -11.465 1.00 64.21 ? 153 GLN D HB2  1  
ATOM 9441   H HB3  . GLN D 1 153 ? 37.343  34.151  -11.419 1.00 52.04 ? 153 GLN D HB3  1  
ATOM 9442   H HG2  . GLN D 1 153 ? 38.121  34.126  -13.833 1.00 1.30  ? 153 GLN D HG2  1  
ATOM 9443   H HG3  . GLN D 1 153 ? 37.858  32.384  -13.828 1.00 33.34 ? 153 GLN D HG3  1  
ATOM 9444   H HE21 . GLN D 1 153 ? 36.297  32.562  -15.479 1.00 53.34 ? 153 GLN D HE21 1  
ATOM 9445   H HE22 . GLN D 1 153 ? 34.711  33.177  -15.179 1.00 43.35 ? 153 GLN D HE22 1  
ATOM 9446   N N    . ASP D 1 154 ? 39.504  34.547  -9.426  1.00 2.15  ? 154 ASP D N    1  
ATOM 9447   C CA   . ASP D 1 154 ? 39.775  34.795  -7.993  1.00 64.24 ? 154 ASP D CA   1  
ATOM 9448   C C    . ASP D 1 154 ? 39.223  36.172  -7.592  1.00 21.10 ? 154 ASP D C    1  
ATOM 9449   O O    . ASP D 1 154 ? 38.945  37.007  -8.458  1.00 41.13 ? 154 ASP D O    1  
ATOM 9450   C CB   . ASP D 1 154 ? 41.312  34.700  -7.717  1.00 43.30 ? 154 ASP D CB   1  
ATOM 9451   C CG   . ASP D 1 154 ? 41.691  34.811  -6.228  1.00 50.21 ? 154 ASP D CG   1  
ATOM 9452   O OD1  . ASP D 1 154 ? 42.362  35.792  -5.832  1.00 72.11 ? 154 ASP D OD1  1  
ATOM 9453   O OD2  . ASP D 1 154 ? 41.296  33.920  -5.441  1.00 20.45 ? 154 ASP D OD2  1  
ATOM 9454   H H    . ASP D 1 154 ? 39.307  35.316  -10.002 1.00 72.45 ? 154 ASP D H    1  
ATOM 9455   H HA   . ASP D 1 154 ? 39.258  34.032  -7.417  1.00 1.14  ? 154 ASP D HA   1  
ATOM 9456   H HB2  . ASP D 1 154 ? 41.670  33.743  -8.083  1.00 1.53  ? 154 ASP D HB2  1  
ATOM 9457   H HB3  . ASP D 1 154 ? 41.823  35.481  -8.273  1.00 72.03 ? 154 ASP D HB3  1  
ATOM 9458   N N    . ALA D 1 155 ? 39.044  36.388  -6.280  1.00 30.22 ? 155 ALA D N    1  
ATOM 9459   C CA   . ALA D 1 155 ? 38.568  37.660  -5.728  1.00 43.31 ? 155 ALA D CA   1  
ATOM 9460   C C    . ALA D 1 155 ? 39.746  38.655  -5.572  1.00 54.42 ? 155 ALA D C    1  
ATOM 9461   O O    . ALA D 1 155 ? 39.878  39.573  -6.403  1.00 51.20 ? 155 ALA D O    1  
ATOM 9462   C CB   . ALA D 1 155 ? 37.854  37.410  -4.388  1.00 13.34 ? 155 ALA D CB   1  
ATOM 9463   O OXT  . ALA D 1 155 ? 40.556  38.493  -4.633  1.00 37.99 ? 155 ALA D OXT  1  
ATOM 9464   H H    . ALA D 1 155 ? 39.251  35.664  -5.655  1.00 5.30  ? 155 ALA D H    1  
ATOM 9465   H HA   . ALA D 1 155 ? 37.832  38.076  -6.421  1.00 5.34  ? 155 ALA D HA   1  
ATOM 9466   H HB1  . ALA D 1 155 ? 37.046  36.704  -4.532  1.00 21.14 ? 155 ALA D HB1  1  
ATOM 9467   H HB2  . ALA D 1 155 ? 37.446  38.340  -4.010  1.00 52.40 ? 155 ALA D HB2  1  
ATOM 9468   H HB3  . ALA D 1 155 ? 38.553  37.007  -3.666  1.00 12.35 ? 155 ALA D HB3  1  
ATOM 9469   N N    . ALA E 2 1   ? -45.400 10.811  -0.520  1.00 61.45 ? 271 ALA E N    1  
ATOM 9470   C CA   . ALA E 2 1   ? -44.954 9.912   -1.607  1.00 62.15 ? 271 ALA E CA   1  
ATOM 9471   C C    . ALA E 2 1   ? -43.608 9.257   -1.238  1.00 45.42 ? 271 ALA E C    1  
ATOM 9472   O O    . ALA E 2 1   ? -42.598 9.953   -1.082  1.00 42.10 ? 271 ALA E O    1  
ATOM 9473   C CB   . ALA E 2 1   ? -44.848 10.695  -2.929  1.00 3.25  ? 271 ALA E CB   1  
ATOM 9474   H H1   . ALA E 2 1   ? -44.681 11.535  -0.341  1.00 37.99 ? 271 ALA E H1   1  
ATOM 9475   H H2   . ALA E 2 1   ? -45.551 10.271  0.354   1.00 37.99 ? 271 ALA E H2   1  
ATOM 9476   H H3   . ALA E 2 1   ? -46.291 11.277  -0.779  1.00 37.99 ? 271 ALA E H3   1  
ATOM 9477   H HA   . ALA E 2 1   ? -45.708 9.139   -1.730  1.00 43.24 ? 271 ALA E HA   1  
ATOM 9478   H HB1  . ALA E 2 1   ? -45.804 11.144  -3.164  1.00 62.03 ? 271 ALA E HB1  1  
ATOM 9479   H HB2  . ALA E 2 1   ? -44.563 10.029  -3.734  1.00 24.41 ? 271 ALA E HB2  1  
ATOM 9480   H HB3  . ALA E 2 1   ? -44.103 11.477  -2.834  1.00 32.51 ? 271 ALA E HB3  1  
ATOM 9481   N N    . ASN E 2 2   ? -43.614 7.919   -1.081  1.00 45.31 ? 272 ASN E N    1  
ATOM 9482   C CA   . ASN E 2 2   ? -42.399 7.120   -0.816  1.00 34.11 ? 272 ASN E CA   1  
ATOM 9483   C C    . ASN E 2 2   ? -42.626 5.689   -1.320  1.00 1.14  ? 272 ASN E C    1  
ATOM 9484   O O    . ASN E 2 2   ? -43.626 5.060   -0.970  1.00 52.05 ? 272 ASN E O    1  
ATOM 9485   C CB   . ASN E 2 2   ? -42.039 7.112   0.699   1.00 44.12 ? 272 ASN E CB   1  
ATOM 9486   C CG   . ASN E 2 2   ? -40.778 6.286   1.021   1.00 4.13  ? 272 ASN E CG   1  
ATOM 9487   O OD1  . ASN E 2 2   ? -40.862 5.095   1.329   1.00 53.34 ? 272 ASN E OD1  1  
ATOM 9488   N ND2  . ASN E 2 2   ? -39.607 6.909   0.949   1.00 24.33 ? 272 ASN E ND2  1  
ATOM 9489   H H    . ASN E 2 2   ? -44.470 7.442   -1.156  1.00 33.55 ? 272 ASN E H    1  
ATOM 9490   H HA   . ASN E 2 2   ? -41.577 7.566   -1.377  1.00 50.01 ? 272 ASN E HA   1  
ATOM 9491   H HB2  . ASN E 2 2   ? -41.880 8.132   1.027   1.00 24.14 ? 272 ASN E HB2  1  
ATOM 9492   H HB3  . ASN E 2 2   ? -42.869 6.699   1.262   1.00 62.43 ? 272 ASN E HB3  1  
ATOM 9493   H HD21 . ASN E 2 2   ? -39.604 7.857   0.700   1.00 54.00 ? 272 ASN E HD21 1  
ATOM 9494   H HD22 . ASN E 2 2   ? -38.794 6.395   1.137   1.00 31.54 ? 272 ASN E HD22 1  
ATOM 9495   N N    . GLN E 2 3   ? -41.708 5.204   -2.161  1.00 72.35 ? 273 GLN E N    1  
ATOM 9496   C CA   . GLN E 2 3   ? -41.751 3.846   -2.714  1.00 61.44 ? 273 GLN E CA   1  
ATOM 9497   C C    . GLN E 2 3   ? -41.162 2.859   -1.693  1.00 22.44 ? 273 GLN E C    1  
ATOM 9498   O O    . GLN E 2 3   ? -39.937 2.743   -1.564  1.00 30.41 ? 273 GLN E O    1  
ATOM 9499   C CB   . GLN E 2 3   ? -40.976 3.762   -4.073  1.00 23.32 ? 273 GLN E CB   1  
ATOM 9500   C CG   . GLN E 2 3   ? -41.605 4.531   -5.265  1.00 54.31 ? 273 GLN E CG   1  
ATOM 9501   C CD   . GLN E 2 3   ? -41.642 6.059   -5.096  1.00 21.43 ? 273 GLN E CD   1  
ATOM 9502   O OE1  . GLN E 2 3   ? -42.629 6.624   -4.626  1.00 70.23 ? 273 GLN E OE1  1  
ATOM 9503   N NE2  . GLN E 2 3   ? -40.556 6.730   -5.442  1.00 54.30 ? 273 GLN E NE2  1  
ATOM 9504   H H    . GLN E 2 3   ? -40.968 5.785   -2.421  1.00 62.25 ? 273 GLN E H    1  
ATOM 9505   H HA   . GLN E 2 3   ? -42.793 3.587   -2.894  1.00 3.23  ? 273 GLN E HA   1  
ATOM 9506   H HB2  . GLN E 2 3   ? -39.970 4.144   -3.926  1.00 54.10 ? 273 GLN E HB2  1  
ATOM 9507   H HB3  . GLN E 2 3   ? -40.897 2.715   -4.358  1.00 45.12 ? 273 GLN E HB3  1  
ATOM 9508   H HG2  . GLN E 2 3   ? -41.039 4.298   -6.160  1.00 31.51 ? 273 GLN E HG2  1  
ATOM 9509   H HG3  . GLN E 2 3   ? -42.620 4.177   -5.401  1.00 61.44 ? 273 GLN E HG3  1  
ATOM 9510   H HE21 . GLN E 2 3   ? -39.790 6.228   -5.788  1.00 3.03  ? 273 GLN E HE21 1  
ATOM 9511   H HE22 . GLN E 2 3   ? -40.556 7.699   -5.316  1.00 42.34 ? 273 GLN E HE22 1  
ATOM 9512   N N    . GLN E 2 4   ? -42.052 2.205   -0.927  1.00 71.12 ? 274 GLN E N    1  
ATOM 9513   C CA   . GLN E 2 4   ? -41.683 1.113   -0.015  1.00 71.35 ? 274 GLN E CA   1  
ATOM 9514   C C    . GLN E 2 4   ? -41.489 -0.179  -0.840  1.00 23.32 ? 274 GLN E C    1  
ATOM 9515   O O    . GLN E 2 4   ? -42.464 -0.760  -1.327  1.00 30.44 ? 274 GLN E O    1  
ATOM 9516   C CB   . GLN E 2 4   ? -42.782 0.926   1.072   1.00 13.23 ? 274 GLN E CB   1  
ATOM 9517   C CG   . GLN E 2 4   ? -42.519 -0.240  2.044   1.00 4.13  ? 274 GLN E CG   1  
ATOM 9518   C CD   . GLN E 2 4   ? -43.603 -0.412  3.112   1.00 31.22 ? 274 GLN E CD   1  
ATOM 9519   O OE1  . GLN E 2 4   ? -43.515 0.160   4.195   1.00 74.32 ? 274 GLN E OE1  1  
ATOM 9520   N NE2  . GLN E 2 4   ? -44.628 -1.192  2.810   1.00 43.31 ? 274 GLN E NE2  1  
ATOM 9521   H H    . GLN E 2 4   ? -42.990 2.472   -0.975  1.00 14.10 ? 274 GLN E H    1  
ATOM 9522   H HA   . GLN E 2 4   ? -40.744 1.377   0.472   1.00 63.40 ? 274 GLN E HA   1  
ATOM 9523   H HB2  . GLN E 2 4   ? -42.854 1.843   1.647   1.00 64.15 ? 274 GLN E HB2  1  
ATOM 9524   H HB3  . GLN E 2 4   ? -43.735 0.753   0.580   1.00 70.12 ? 274 GLN E HB3  1  
ATOM 9525   H HG2  . GLN E 2 4   ? -42.450 -1.155  1.468   1.00 72.24 ? 274 GLN E HG2  1  
ATOM 9526   H HG3  . GLN E 2 4   ? -41.568 -0.074  2.539   1.00 61.43 ? 274 GLN E HG3  1  
ATOM 9527   H HE21 . GLN E 2 4   ? -44.642 -1.615  1.926   1.00 72.10 ? 274 GLN E HE21 1  
ATOM 9528   H HE22 . GLN E 2 4   ? -45.326 -1.323  3.484   1.00 24.13 ? 274 GLN E HE22 1  
ATOM 9529   N N    . LYS E 2 5   ? -40.221 -0.574  -1.044  1.00 41.32 ? 275 LYS E N    1  
ATOM 9530   C CA   . LYS E 2 5   ? -39.863 -1.765  -1.846  1.00 4.43  ? 275 LYS E CA   1  
ATOM 9531   C C    . LYS E 2 5   ? -39.986 -3.053  -0.986  1.00 73.31 ? 275 LYS E C    1  
ATOM 9532   O O    . LYS E 2 5   ? -39.303 -3.184  0.041   1.00 62.11 ? 275 LYS E O    1  
ATOM 9533   C CB   . LYS E 2 5   ? -38.427 -1.611  -2.445  1.00 55.31 ? 275 LYS E CB   1  
ATOM 9534   C CG   . LYS E 2 5   ? -37.342 -1.239  -1.414  1.00 1.21  ? 275 LYS E CG   1  
ATOM 9535   C CD   . LYS E 2 5   ? -35.947 -1.030  -2.031  1.00 1.11  ? 275 LYS E CD   1  
ATOM 9536   C CE   . LYS E 2 5   ? -34.928 -0.515  -1.002  1.00 0.44  ? 275 LYS E CE   1  
ATOM 9537   N NZ   . LYS E 2 5   ? -35.301 0.821   -0.475  1.00 45.11 ? 275 LYS E NZ   1  
ATOM 9538   H H    . LYS E 2 5   ? -39.503 -0.048  -0.637  1.00 54.35 ? 275 LYS E H    1  
ATOM 9539   H HA   . LYS E 2 5   ? -40.569 -1.822  -2.670  1.00 32.25 ? 275 LYS E HA   1  
ATOM 9540   H HB2  . LYS E 2 5   ? -38.142 -2.546  -2.920  1.00 33.31 ? 275 LYS E HB2  1  
ATOM 9541   H HB3  . LYS E 2 5   ? -38.453 -0.838  -3.206  1.00 33.42 ? 275 LYS E HB3  1  
ATOM 9542   H HG2  . LYS E 2 5   ? -37.643 -0.324  -0.914  1.00 54.21 ? 275 LYS E HG2  1  
ATOM 9543   H HG3  . LYS E 2 5   ? -37.284 -2.034  -0.677  1.00 53.23 ? 275 LYS E HG3  1  
ATOM 9544   H HD2  . LYS E 2 5   ? -35.591 -1.974  -2.432  1.00 73.52 ? 275 LYS E HD2  1  
ATOM 9545   H HD3  . LYS E 2 5   ? -36.018 -0.308  -2.839  1.00 2.34  ? 275 LYS E HD3  1  
ATOM 9546   H HE2  . LYS E 2 5   ? -34.867 -1.210  -0.175  1.00 23.53 ? 275 LYS E HE2  1  
ATOM 9547   H HE3  . LYS E 2 5   ? -33.957 -0.442  -1.475  1.00 43.32 ? 275 LYS E HE3  1  
ATOM 9548   H HZ1  . LYS E 2 5   ? -35.331 1.518   -1.246  1.00 45.21 ? 275 LYS E HZ1  1  
ATOM 9549   H HZ2  . LYS E 2 5   ? -34.605 1.135   0.232   1.00 72.54 ? 275 LYS E HZ2  1  
ATOM 9550   H HZ3  . LYS E 2 5   ? -36.236 0.781   -0.023  1.00 10.34 ? 275 LYS E HZ3  1  
ATOM 9551   N N    . PRO E 2 6   ? -40.882 -4.025  -1.373  1.00 63.54 ? 276 PRO E N    1  
ATOM 9552   C CA   . PRO E 2 6   ? -41.040 -5.315  -0.643  1.00 2.34  ? 276 PRO E CA   1  
ATOM 9553   C C    . PRO E 2 6   ? -39.877 -6.311  -0.886  1.00 72.35 ? 276 PRO E C    1  
ATOM 9554   O O    . PRO E 2 6   ? -39.867 -7.407  -0.320  1.00 2.45  ? 276 PRO E O    1  
ATOM 9555   C CB   . PRO E 2 6   ? -42.387 -5.853  -1.188  1.00 21.34 ? 276 PRO E CB   1  
ATOM 9556   C CG   . PRO E 2 6   ? -42.485 -5.301  -2.575  1.00 74.35 ? 276 PRO E CG   1  
ATOM 9557   C CD   . PRO E 2 6   ? -41.840 -3.932  -2.521  1.00 42.24 ? 276 PRO E CD   1  
ATOM 9558   H HA   . PRO E 2 6   ? -41.127 -5.146  0.425   1.00 11.23 ? 276 PRO E HA   1  
ATOM 9559   H HB2  . PRO E 2 6   ? -42.395 -6.942  -1.189  1.00 63.22 ? 276 PRO E HB2  1  
ATOM 9560   H HB3  . PRO E 2 6   ? -43.205 -5.484  -0.582  1.00 65.44 ? 276 PRO E HB3  1  
ATOM 9561   H HG2  . PRO E 2 6   ? -41.952 -5.949  -3.269  1.00 71.44 ? 276 PRO E HG2  1  
ATOM 9562   H HG3  . PRO E 2 6   ? -43.524 -5.214  -2.874  1.00 24.22 ? 276 PRO E HG3  1  
ATOM 9563   H HD2  . PRO E 2 6   ? -41.316 -3.718  -3.448  1.00 52.50 ? 276 PRO E HD2  1  
ATOM 9564   H HD3  . PRO E 2 6   ? -42.584 -3.164  -2.332  1.00 64.44 ? 276 PRO E HD3  1  
ATOM 9565   N N    . LEU E 2 7   ? -38.910 -5.915  -1.735  1.00 13.31 ? 277 LEU E N    1  
ATOM 9566   C CA   . LEU E 2 7   ? -37.722 -6.730  -2.060  1.00 72.53 ? 277 LEU E CA   1  
ATOM 9567   C C    . LEU E 2 7   ? -36.665 -6.659  -0.955  1.00 54.32 ? 277 LEU E C    1  
ATOM 9568   O O    . LEU E 2 7   ? -35.965 -7.637  -0.688  1.00 63.54 ? 277 LEU E O    1  
ATOM 9569   C CB   . LEU E 2 7   ? -37.114 -6.261  -3.405  1.00 74.33 ? 277 LEU E CB   1  
ATOM 9570   C CG   . LEU E 2 7   ? -38.074 -6.332  -4.630  1.00 71.24 ? 277 LEU E CG   1  
ATOM 9571   C CD1  . LEU E 2 7   ? -37.354 -5.891  -5.928  1.00 43.33 ? 277 LEU E CD1  1  
ATOM 9572   C CD2  . LEU E 2 7   ? -38.698 -7.746  -4.752  1.00 2.24  ? 277 LEU E CD2  1  
ATOM 9573   H H    . LEU E 2 7   ? -39.007 -5.046  -2.172  1.00 43.32 ? 277 LEU E H    1  
ATOM 9574   H HA   . LEU E 2 7   ? -38.045 -7.759  -2.164  1.00 1.22  ? 277 LEU E HA   1  
ATOM 9575   H HB2  . LEU E 2 7   ? -36.780 -5.233  -3.289  1.00 75.51 ? 277 LEU E HB2  1  
ATOM 9576   H HB3  . LEU E 2 7   ? -36.245 -6.875  -3.620  1.00 61.53 ? 277 LEU E HB3  1  
ATOM 9577   H HG   . LEU E 2 7   ? -38.888 -5.634  -4.467  1.00 75.45 ? 277 LEU E HG   1  
ATOM 9578   H HD11 . LEU E 2 7   ? -38.045 -5.920  -6.760  1.00 2.53  ? 277 LEU E HD11 1  
ATOM 9579   H HD12 . LEU E 2 7   ? -36.520 -6.551  -6.136  1.00 50.23 ? 277 LEU E HD12 1  
ATOM 9580   H HD13 . LEU E 2 7   ? -36.983 -4.879  -5.813  1.00 22.31 ? 277 LEU E HD13 1  
ATOM 9581   H HD21 . LEU E 2 7   ? -39.371 -7.782  -5.598  1.00 44.34 ? 277 LEU E HD21 1  
ATOM 9582   H HD22 . LEU E 2 7   ? -39.252 -7.980  -3.849  1.00 4.01  ? 277 LEU E HD22 1  
ATOM 9583   H HD23 . LEU E 2 7   ? -37.915 -8.484  -4.882  1.00 74.42 ? 277 LEU E HD23 1  
ATOM 9584   N N    . LEU E 2 8   ? -36.546 -5.477  -0.339  1.00 14.35 ? 278 LEU E N    1  
ATOM 9585   C CA   . LEU E 2 8   ? -35.570 -5.221  0.724   1.00 61.23 ? 278 LEU E CA   1  
ATOM 9586   C C    . LEU E 2 8   ? -36.322 -5.299  2.066   1.00 32.12 ? 278 LEU E C    1  
ATOM 9587   O O    . LEU E 2 8   ? -37.088 -4.392  2.396   1.00 12.51 ? 278 LEU E O    1  
ATOM 9588   C CB   . LEU E 2 8   ? -34.894 -3.823  0.505   1.00 43.33 ? 278 LEU E CB   1  
ATOM 9589   C CG   . LEU E 2 8   ? -33.418 -3.647  1.015   1.00 34.12 ? 278 LEU E CG   1  
ATOM 9590   C CD1  . LEU E 2 8   ? -33.280 -3.857  2.546   1.00 31.43 ? 278 LEU E CD1  1  
ATOM 9591   C CD2  . LEU E 2 8   ? -32.456 -4.566  0.218   1.00 2.25  ? 278 LEU E CD2  1  
ATOM 9592   H H    . LEU E 2 8   ? -37.150 -4.753  -0.602  1.00 72.24 ? 278 LEU E H    1  
ATOM 9593   H HA   . LEU E 2 8   ? -34.804 -5.998  0.695   1.00 73.51 ? 278 LEU E HA   1  
ATOM 9594   H HB2  . LEU E 2 8   ? -34.899 -3.606  -0.563  1.00 61.32 ? 278 LEU E HB2  1  
ATOM 9595   H HB3  . LEU E 2 8   ? -35.508 -3.064  0.986   1.00 61.35 ? 278 LEU E HB3  1  
ATOM 9596   H HG   . LEU E 2 8   ? -33.113 -2.623  0.817   1.00 2.34  ? 278 LEU E HG   1  
ATOM 9597   H HD11 . LEU E 2 8   ? -32.256 -3.689  2.846   1.00 13.54 ? 278 LEU E HD11 1  
ATOM 9598   H HD12 . LEU E 2 8   ? -33.567 -4.871  2.808   1.00 43.12 ? 278 LEU E HD12 1  
ATOM 9599   H HD13 . LEU E 2 8   ? -33.923 -3.162  3.065   1.00 22.34 ? 278 LEU E HD13 1  
ATOM 9600   H HD21 . LEU E 2 8   ? -32.709 -5.607  0.387   1.00 74.14 ? 278 LEU E HD21 1  
ATOM 9601   H HD22 . LEU E 2 8   ? -31.435 -4.394  0.536   1.00 0.13  ? 278 LEU E HD22 1  
ATOM 9602   H HD23 . LEU E 2 8   ? -32.532 -4.347  -0.838  1.00 30.40 ? 278 LEU E HD23 1  
ATOM 9603   N N    . GLY E 2 9   ? -36.130 -6.412  2.793   1.00 31.43 ? 279 GLY E N    1  
ATOM 9604   C CA   . GLY E 2 9   ? -36.755 -6.617  4.105   1.00 65.33 ? 279 GLY E CA   1  
ATOM 9605   C C    . GLY E 2 9   ? -35.958 -7.573  4.976   1.00 31.34 ? 279 GLY E C    1  
ATOM 9606   O O    . GLY E 2 9   ? -36.519 -8.268  5.828   1.00 63.11 ? 279 GLY E O    1  
ATOM 9607   H H    . GLY E 2 9   ? -35.562 -7.119  2.422   1.00 65.33 ? 279 GLY E H    1  
ATOM 9608   H HA2  . GLY E 2 9   ? -36.842 -5.668  4.621   1.00 45.15 ? 279 GLY E HA2  1  
ATOM 9609   H HA3  . GLY E 2 9   ? -37.750 -7.023  3.957   1.00 30.22 ? 279 GLY E HA3  1  
ATOM 9610   N N    . LEU E 2 10  ? -34.636 -7.558  4.778   1.00 51.23 ? 280 LEU E N    1  
ATOM 9611   C CA   . LEU E 2 10  ? -33.683 -8.492  5.419   1.00 44.52 ? 280 LEU E CA   1  
ATOM 9612   C C    . LEU E 2 10  ? -32.264 -7.913  5.253   1.00 34.43 ? 280 LEU E C    1  
ATOM 9613   O O    . LEU E 2 10  ? -32.093 -6.935  4.503   1.00 22.43 ? 280 LEU E O    1  
ATOM 9614   C CB   . LEU E 2 10  ? -33.831 -9.915  4.774   1.00 55.21 ? 280 LEU E CB   1  
ATOM 9615   C CG   . LEU E 2 10  ? -33.103 -11.117 5.501   1.00 40.44 ? 280 LEU E CG   1  
ATOM 9616   C CD1  . LEU E 2 10  ? -34.016 -12.365 5.573   1.00 12.35 ? 280 LEU E CD1  1  
ATOM 9617   C CD2  . LEU E 2 10  ? -31.753 -11.466 4.827   1.00 4.23  ? 280 LEU E CD2  1  
ATOM 9618   H H    . LEU E 2 10  ? -34.271 -6.875  4.176   1.00 43.24 ? 280 LEU E H    1  
ATOM 9619   H HA   . LEU E 2 10  ? -33.921 -8.550  6.477   1.00 62.44 ? 280 LEU E HA   1  
ATOM 9620   H HB2  . LEU E 2 10  ? -34.895 -10.135 4.729   1.00 14.31 ? 280 LEU E HB2  1  
ATOM 9621   H HB3  . LEU E 2 10  ? -33.474 -9.861  3.748   1.00 10.14 ? 280 LEU E HB3  1  
ATOM 9622   H HG   . LEU E 2 10  ? -32.886 -10.828 6.528   1.00 23.21 ? 280 LEU E HG   1  
ATOM 9623   H HD11 . LEU E 2 10  ? -33.501 -13.172 6.077   1.00 74.34 ? 280 LEU E HD11 1  
ATOM 9624   H HD12 . LEU E 2 10  ? -34.288 -12.683 4.575   1.00 32.41 ? 280 LEU E HD12 1  
ATOM 9625   H HD13 . LEU E 2 10  ? -34.914 -12.121 6.125   1.00 22.25 ? 280 LEU E HD13 1  
ATOM 9626   H HD21 . LEU E 2 10  ? -31.104 -10.602 4.855   1.00 15.12 ? 280 LEU E HD21 1  
ATOM 9627   H HD22 . LEU E 2 10  ? -31.915 -11.757 3.800   1.00 60.31 ? 280 LEU E HD22 1  
ATOM 9628   H HD23 . LEU E 2 10  ? -31.278 -12.280 5.360   1.00 73.22 ? 280 LEU E HD23 1  
ATOM 9629   N N    . PHE E 2 11  ? -31.275 -8.471  5.998   1.00 63.11 ? 281 PHE E N    1  
ATOM 9630   C CA   . PHE E 2 11  ? -29.835 -8.144  5.833   1.00 41.24 ? 281 PHE E CA   1  
ATOM 9631   C C    . PHE E 2 11  ? -29.530 -6.730  6.420   1.00 3.15  ? 281 PHE E C    1  
ATOM 9632   O O    . PHE E 2 11  ? -28.622 -6.010  5.995   1.00 31.33 ? 281 PHE E O    1  
ATOM 9633   C CB   . PHE E 2 11  ? -29.418 -8.347  4.330   1.00 51.15 ? 281 PHE E CB   1  
ATOM 9634   C CG   . PHE E 2 11  ? -27.980 -8.013  3.964   1.00 44.31 ? 281 PHE E CG   1  
ATOM 9635   C CD1  . PHE E 2 11  ? -26.919 -8.775  4.436   1.00 12.35 ? 281 PHE E CD1  1  
ATOM 9636   C CD2  . PHE E 2 11  ? -27.702 -6.939  3.129   1.00 12.44 ? 281 PHE E CD2  1  
ATOM 9637   C CE1  . PHE E 2 11  ? -25.621 -8.467  4.073   1.00 42.43 ? 281 PHE E CE1  1  
ATOM 9638   C CE2  . PHE E 2 11  ? -26.418 -6.630  2.773   1.00 73.42 ? 281 PHE E CE2  1  
ATOM 9639   C CZ   . PHE E 2 11  ? -25.378 -7.392  3.243   1.00 71.32 ? 281 PHE E CZ   1  
ATOM 9640   H H    . PHE E 2 11  ? -31.529 -9.105  6.703   1.00 22.44 ? 281 PHE E H    1  
ATOM 9641   H HA   . PHE E 2 11  ? -29.289 -8.860  6.435   1.00 1.44  ? 281 PHE E HA   1  
ATOM 9642   H HB2  . PHE E 2 11  ? -29.582 -9.386  4.065   1.00 50.44 ? 281 PHE E HB2  1  
ATOM 9643   H HB3  . PHE E 2 11  ? -30.075 -7.742  3.711   1.00 30.24 ? 281 PHE E HB3  1  
ATOM 9644   H HD1  . PHE E 2 11  ? -27.115 -9.620  5.088   1.00 21.45 ? 281 PHE E HD1  1  
ATOM 9645   H HD2  . PHE E 2 11  ? -28.520 -6.337  2.753   1.00 11.11 ? 281 PHE E HD2  1  
ATOM 9646   H HE1  . PHE E 2 11  ? -24.799 -9.063  4.442   1.00 43.22 ? 281 PHE E HE1  1  
ATOM 9647   H HE2  . PHE E 2 11  ? -26.224 -5.785  2.125   1.00 3.12  ? 281 PHE E HE2  1  
ATOM 9648   H HZ   . PHE E 2 11  ? -24.374 -7.153  2.948   1.00 73.30 ? 281 PHE E HZ   1  
ATOM 9649   N N    . ALA E 2 12  ? -30.313 -6.369  7.446   1.00 50.15 ? 282 ALA E N    1  
ATOM 9650   C CA   . ALA E 2 12  ? -30.038 -5.224  8.338   1.00 72.01 ? 282 ALA E CA   1  
ATOM 9651   C C    . ALA E 2 12  ? -29.625 -5.756  9.730   1.00 41.45 ? 282 ALA E C    1  
ATOM 9652   O O    . ALA E 2 12  ? -29.514 -5.002  10.700  1.00 41.13 ? 282 ALA E O    1  
ATOM 9653   C CB   . ALA E 2 12  ? -31.292 -4.335  8.423   1.00 51.44 ? 282 ALA E CB   1  
ATOM 9654   H H    . ALA E 2 12  ? -31.119 -6.903  7.623   1.00 41.20 ? 282 ALA E H    1  
ATOM 9655   H HA   . ALA E 2 12  ? -29.216 -4.631  7.928   1.00 72.23 ? 282 ALA E HA   1  
ATOM 9656   H HB1  . ALA E 2 12  ? -31.096 -3.478  9.056   1.00 64.40 ? 282 ALA E HB1  1  
ATOM 9657   H HB2  . ALA E 2 12  ? -32.117 -4.902  8.836   1.00 35.21 ? 282 ALA E HB2  1  
ATOM 9658   H HB3  . ALA E 2 12  ? -31.559 -3.990  7.434   1.00 74.03 ? 282 ALA E HB3  1  
ATOM 9659   N N    . ASP E 2 13  ? -29.334 -7.066  9.775   1.00 5.03  ? 283 ASP E N    1  
ATOM 9660   C CA   . ASP E 2 13  ? -29.196 -7.849  11.010  1.00 53.11 ? 283 ASP E CA   1  
ATOM 9661   C C    . ASP E 2 13  ? -28.173 -8.972  10.790  1.00 54.32 ? 283 ASP E C    1  
ATOM 9662   O O    . ASP E 2 13  ? -28.062 -9.491  9.663   1.00 23.41 ? 283 ASP E O    1  
ATOM 9663   C CB   . ASP E 2 13  ? -30.575 -8.453  11.390  1.00 65.14 ? 283 ASP E CB   1  
ATOM 9664   C CG   . ASP E 2 13  ? -31.134 -9.412  10.305  1.00 42.21 ? 283 ASP E CG   1  
ATOM 9665   O OD1  . ASP E 2 13  ? -31.489 -8.938  9.190   1.00 4.51  ? 283 ASP E OD1  1  
ATOM 9666   O OD2  . ASP E 2 13  ? -31.220 -10.634 10.557  1.00 2.51  ? 283 ASP E OD2  1  
ATOM 9667   H H    . ASP E 2 13  ? -29.201 -7.536  8.927   1.00 52.45 ? 283 ASP E H    1  
ATOM 9668   H HA   . ASP E 2 13  ? -28.851 -7.196  11.806  1.00 63.12 ? 283 ASP E HA   1  
ATOM 9669   H HB2  . ASP E 2 13  ? -30.478 -8.991  12.329  1.00 3.12  ? 283 ASP E HB2  1  
ATOM 9670   H HB3  . ASP E 2 13  ? -31.286 -7.643  11.537  1.00 21.22 ? 283 ASP E HB3  1  
ATOM 9671   N N    . GLY E 2 14  ? -27.428 -9.331  11.852  1.00 3.33  ? 284 GLY E N    1  
ATOM 9672   C CA   . GLY E 2 14  ? -26.475 -10.445 11.793  1.00 53.42 ? 284 GLY E CA   1  
ATOM 9673   C C    . GLY E 2 14  ? -27.182 -11.776 11.540  1.00 25.10 ? 284 GLY E C    1  
ATOM 9674   O O    . GLY E 2 14  ? -27.761 -12.351 12.467  1.00 54.42 ? 284 GLY E O    1  
ATOM 9675   H H    . GLY E 2 14  ? -27.522 -8.826  12.688  1.00 61.04 ? 284 GLY E H    1  
ATOM 9676   H HA2  . GLY E 2 14  ? -25.756 -10.256 11.002  1.00 22.02 ? 284 GLY E HA2  1  
ATOM 9677   H HA3  . GLY E 2 14  ? -25.945 -10.502 12.733  1.00 41.31 ? 284 GLY E HA3  1  
ATOM 9678   N N    . ASN E 2 15  ? -27.152 -12.228 10.267  1.00 71.44 ? 285 ASN E N    1  
ATOM 9679   C CA   . ASN E 2 15  ? -27.890 -13.416 9.791   1.00 44.35 ? 285 ASN E CA   1  
ATOM 9680   C C    . ASN E 2 15  ? -27.509 -14.690 10.568  1.00 1.24  ? 285 ASN E C    1  
ATOM 9681   O O    . ASN E 2 15  ? -28.387 -15.403 11.073  1.00 10.45 ? 285 ASN E O    1  
ATOM 9682   C CB   . ASN E 2 15  ? -27.662 -13.626 8.270   1.00 31.21 ? 285 ASN E CB   1  
ATOM 9683   C CG   . ASN E 2 15  ? -28.192 -12.469 7.419   1.00 12.43 ? 285 ASN E CG   1  
ATOM 9684   O OD1  . ASN E 2 15  ? -27.478 -11.507 7.134   1.00 15.33 ? 285 ASN E OD1  1  
ATOM 9685   N ND2  . ASN E 2 15  ? -29.453 -12.549 7.020   1.00 52.11 ? 285 ASN E ND2  1  
ATOM 9686   H H    . ASN E 2 15  ? -26.621 -11.722 9.615   1.00 4.14  ? 285 ASN E H    1  
ATOM 9687   H HA   . ASN E 2 15  ? -28.943 -13.217 9.955   1.00 51.04 ? 285 ASN E HA   1  
ATOM 9688   H HB2  . ASN E 2 15  ? -26.599 -13.728 8.084   1.00 62.22 ? 285 ASN E HB2  1  
ATOM 9689   H HB3  . ASN E 2 15  ? -28.155 -14.540 7.953   1.00 20.13 ? 285 ASN E HB3  1  
ATOM 9690   H HD21 . ASN E 2 15  ? -29.977 -13.336 7.285   1.00 34.10 ? 285 ASN E HD21 1  
ATOM 9691   H HD22 . ASN E 2 15  ? -29.807 -11.819 6.480   1.00 44.02 ? 285 ASN E HD22 1  
ATOM 9692   N N    . MET E 2 16  ? -26.195 -14.954 10.667  1.00 22.22 ? 286 MET E N    1  
ATOM 9693   C CA   . MET E 2 16  ? -25.648 -16.137 11.368  1.00 12.02 ? 286 MET E CA   1  
ATOM 9694   C C    . MET E 2 16  ? -24.305 -15.778 12.057  1.00 12.35 ? 286 MET E C    1  
ATOM 9695   O O    . MET E 2 16  ? -23.556 -14.929 11.545  1.00 73.30 ? 286 MET E O    1  
ATOM 9696   C CB   . MET E 2 16  ? -25.482 -17.349 10.390  1.00 3.15  ? 286 MET E CB   1  
ATOM 9697   C CG   . MET E 2 16  ? -24.571 -17.103 9.178   1.00 42.14 ? 286 MET E CG   1  
ATOM 9698   S SD   . MET E 2 16  ? -25.232 -15.868 8.042   1.00 71.32 ? 286 MET E SD   1  
ATOM 9699   C CE   . MET E 2 16  ? -23.941 -15.773 6.807   1.00 4.55  ? 286 MET E CE   1  
ATOM 9700   H H    . MET E 2 16  ? -25.564 -14.329 10.254  1.00 33.25 ? 286 MET E H    1  
ATOM 9701   H HA   . MET E 2 16  ? -26.357 -16.413 12.143  1.00 73.22 ? 286 MET E HA   1  
ATOM 9702   H HB2  . MET E 2 16  ? -25.082 -18.191 10.945  1.00 15.24 ? 286 MET E HB2  1  
ATOM 9703   H HB3  . MET E 2 16  ? -26.464 -17.627 10.018  1.00 30.12 ? 286 MET E HB3  1  
ATOM 9704   H HG2  . MET E 2 16  ? -23.605 -16.769 9.528   1.00 64.41 ? 286 MET E HG2  1  
ATOM 9705   H HG3  . MET E 2 16  ? -24.449 -18.037 8.637   1.00 23.01 ? 286 MET E HG3  1  
ATOM 9706   H HE1  . MET E 2 16  ? -23.809 -16.741 6.343   1.00 53.32 ? 286 MET E HE1  1  
ATOM 9707   H HE2  . MET E 2 16  ? -23.015 -15.469 7.273   1.00 53.02 ? 286 MET E HE2  1  
ATOM 9708   H HE3  . MET E 2 16  ? -24.215 -15.050 6.053   1.00 32.41 ? 286 MET E HE3  1  
ATOM 9709   N N    . PRO E 2 17  ? -23.996 -16.393 13.254  1.00 73.22 ? 287 PRO E N    1  
ATOM 9710   C CA   . PRO E 2 17  ? -22.743 -16.118 14.006  1.00 74.52 ? 287 PRO E CA   1  
ATOM 9711   C C    . PRO E 2 17  ? -21.484 -16.581 13.236  1.00 52.33 ? 287 PRO E C    1  
ATOM 9712   O O    . PRO E 2 17  ? -21.418 -17.719 12.769  1.00 21.42 ? 287 PRO E O    1  
ATOM 9713   C CB   . PRO E 2 17  ? -22.930 -16.910 15.342  1.00 63.11 ? 287 PRO E CB   1  
ATOM 9714   C CG   . PRO E 2 17  ? -24.400 -17.217 15.412  1.00 62.35 ? 287 PRO E CG   1  
ATOM 9715   C CD   . PRO E 2 17  ? -24.844 -17.382 13.979  1.00 24.44 ? 287 PRO E CD   1  
ATOM 9716   H HA   . PRO E 2 17  ? -22.657 -15.056 14.227  1.00 22.03 ? 287 PRO E HA   1  
ATOM 9717   H HB2  . PRO E 2 17  ? -22.341 -17.830 15.335  1.00 60.34 ? 287 PRO E HB2  1  
ATOM 9718   H HB3  . PRO E 2 17  ? -22.635 -16.298 16.188  1.00 11.43 ? 287 PRO E HB3  1  
ATOM 9719   H HG2  . PRO E 2 17  ? -24.567 -18.132 15.974  1.00 4.15  ? 287 PRO E HG2  1  
ATOM 9720   H HG3  . PRO E 2 17  ? -24.939 -16.394 15.875  1.00 71.10 ? 287 PRO E HG3  1  
ATOM 9721   H HD2  . PRO E 2 17  ? -24.652 -18.393 13.625  1.00 70.32 ? 287 PRO E HD2  1  
ATOM 9722   H HD3  . PRO E 2 17  ? -25.895 -17.143 13.878  1.00 44.23 ? 287 PRO E HD3  1  
ATOM 9723   N N    . VAL E 2 18  ? -20.509 -15.673 13.089  1.00 2.24  ? 288 VAL E N    1  
ATOM 9724   C CA   . VAL E 2 18  ? -19.227 -15.961 12.425  1.00 70.01 ? 288 VAL E CA   1  
ATOM 9725   C C    . VAL E 2 18  ? -18.189 -16.324 13.501  1.00 61.23 ? 288 VAL E C    1  
ATOM 9726   O O    . VAL E 2 18  ? -17.961 -15.545 14.433  1.00 14.40 ? 288 VAL E O    1  
ATOM 9727   C CB   . VAL E 2 18  ? -18.735 -14.728 11.563  1.00 50.14 ? 288 VAL E CB   1  
ATOM 9728   C CG1  . VAL E 2 18  ? -17.367 -15.008 10.890  1.00 11.21 ? 288 VAL E CG1  1  
ATOM 9729   C CG2  . VAL E 2 18  ? -19.802 -14.334 10.507  1.00 0.33  ? 288 VAL E CG2  1  
ATOM 9730   H H    . VAL E 2 18  ? -20.649 -14.779 13.457  1.00 20.43 ? 288 VAL E H    1  
ATOM 9731   H HA   . VAL E 2 18  ? -19.366 -16.813 11.756  1.00 0.52  ? 288 VAL E HA   1  
ATOM 9732   H HB   . VAL E 2 18  ? -18.604 -13.878 12.233  1.00 60.04 ? 288 VAL E HB   1  
ATOM 9733   H HG11 . VAL E 2 18  ? -16.619 -15.201 11.649  1.00 53.23 ? 288 VAL E HG11 1  
ATOM 9734   H HG12 . VAL E 2 18  ? -17.062 -14.150 10.306  1.00 51.32 ? 288 VAL E HG12 1  
ATOM 9735   H HG13 . VAL E 2 18  ? -17.444 -15.871 10.238  1.00 21.45 ? 288 VAL E HG13 1  
ATOM 9736   H HG21 . VAL E 2 18  ? -19.465 -13.470 9.948   1.00 33.50 ? 288 VAL E HG21 1  
ATOM 9737   H HG22 . VAL E 2 18  ? -20.732 -14.093 11.004  1.00 32.23 ? 288 VAL E HG22 1  
ATOM 9738   H HG23 . VAL E 2 18  ? -19.967 -15.160 9.826   1.00 12.01 ? 288 VAL E HG23 1  
ATOM 9739   N N    . ARG E 2 19  ? -17.599 -17.526 13.375  1.00 61.10 ? 289 ARG E N    1  
ATOM 9740   C CA   . ARG E 2 19  ? -16.560 -18.025 14.298  1.00 21.34 ? 289 ARG E CA   1  
ATOM 9741   C C    . ARG E 2 19  ? -15.219 -17.358 13.946  1.00 1.14  ? 289 ARG E C    1  
ATOM 9742   O O    . ARG E 2 19  ? -14.983 -17.014 12.778  1.00 23.32 ? 289 ARG E O    1  
ATOM 9743   C CB   . ARG E 2 19  ? -16.411 -19.580 14.206  1.00 3.21  ? 289 ARG E CB   1  
ATOM 9744   C CG   . ARG E 2 19  ? -17.625 -20.428 14.691  1.00 33.13 ? 289 ARG E CG   1  
ATOM 9745   C CD   . ARG E 2 19  ? -18.852 -20.392 13.749  1.00 62.21 ? 289 ARG E CD   1  
ATOM 9746   N NE   . ARG E 2 19  ? -19.852 -21.413 14.121  1.00 71.13 ? 289 ARG E NE   1  
ATOM 9747   C CZ   . ARG E 2 19  ? -21.157 -21.403 13.797  1.00 43.02 ? 289 ARG E CZ   1  
ATOM 9748   N NH1  . ARG E 2 19  ? -21.684 -20.417 13.081  1.00 2.32  ? 289 ARG E NH1  1  
ATOM 9749   N NH2  . ARG E 2 19  ? -21.928 -22.408 14.178  1.00 45.45 ? 289 ARG E NH2  1  
ATOM 9750   H H    . ARG E 2 19  ? -17.850 -18.087 12.616  1.00 55.22 ? 289 ARG E H    1  
ATOM 9751   H HA   . ARG E 2 19  ? -16.841 -17.749 15.313  1.00 15.25 ? 289 ARG E HA   1  
ATOM 9752   H HB2  . ARG E 2 19  ? -16.216 -19.845 13.172  1.00 61.43 ? 289 ARG E HB2  1  
ATOM 9753   H HB3  . ARG E 2 19  ? -15.543 -19.876 14.796  1.00 41.31 ? 289 ARG E HB3  1  
ATOM 9754   H HG2  . ARG E 2 19  ? -17.305 -21.459 14.786  1.00 33.11 ? 289 ARG E HG2  1  
ATOM 9755   H HG3  . ARG E 2 19  ? -17.928 -20.071 15.671  1.00 75.02 ? 289 ARG E HG3  1  
ATOM 9756   H HD2  . ARG E 2 19  ? -19.305 -19.409 13.800  1.00 61.32 ? 289 ARG E HD2  1  
ATOM 9757   H HD3  . ARG E 2 19  ? -18.526 -20.581 12.731  1.00 0.45  ? 289 ARG E HD3  1  
ATOM 9758   H HE   . ARG E 2 19  ? -19.518 -22.169 14.656  1.00 54.23 ? 289 ARG E HE   1  
ATOM 9759   H HH11 . ARG E 2 19  ? -21.111 -19.655 12.769  1.00 62.01 ? 289 ARG E HH11 1  
ATOM 9760   H HH12 . ARG E 2 19  ? -22.659 -20.428 12.850  1.00 53.00 ? 289 ARG E HH12 1  
ATOM 9761   H HH21 . ARG E 2 19  ? -21.537 -23.172 14.704  1.00 10.20 ? 289 ARG E HH21 1  
ATOM 9762   H HH22 . ARG E 2 19  ? -22.901 -22.415 13.944  1.00 72.25 ? 289 ARG E HH22 1  
ATOM 9763   N N    . TRP E 2 20  ? -14.353 -17.165 14.954  1.00 62.13 ? 290 TRP E N    1  
ATOM 9764   C CA   . TRP E 2 20  ? -12.995 -16.643 14.731  1.00 72.31 ? 290 TRP E CA   1  
ATOM 9765   C C    . TRP E 2 20  ? -12.016 -17.816 14.528  1.00 55.22 ? 290 TRP E C    1  
ATOM 9766   O O    . TRP E 2 20  ? -11.912 -18.708 15.375  1.00 2.21  ? 290 TRP E O    1  
ATOM 9767   C CB   . TRP E 2 20  ? -12.545 -15.713 15.889  1.00 63.41 ? 290 TRP E CB   1  
ATOM 9768   C CG   . TRP E 2 20  ? -11.190 -15.043 15.678  1.00 41.54 ? 290 TRP E CG   1  
ATOM 9769   C CD1  . TRP E 2 20  ? -10.232 -14.828 16.633  1.00 44.41 ? 290 TRP E CD1  1  
ATOM 9770   C CD2  . TRP E 2 20  ? -10.641 -14.510 14.445  1.00 74.42 ? 290 TRP E CD2  1  
ATOM 9771   N NE1  . TRP E 2 20  ? -9.148  -14.203 16.079  1.00 14.12 ? 290 TRP E NE1  1  
ATOM 9772   C CE2  . TRP E 2 20  ? -9.367  -14.010 14.746  1.00 43.52 ? 290 TRP E CE2  1  
ATOM 9773   C CE3  . TRP E 2 20  ? -11.096 -14.420 13.116  1.00 54.23 ? 290 TRP E CE3  1  
ATOM 9774   C CZ2  . TRP E 2 20  ? -8.550  -13.422 13.783  1.00 34.12 ? 290 TRP E CZ2  1  
ATOM 9775   C CZ3  . TRP E 2 20  ? -10.286 -13.843 12.166  1.00 41.31 ? 290 TRP E CZ3  1  
ATOM 9776   C CH2  . TRP E 2 20  ? -9.022  -13.355 12.501  1.00 43.33 ? 290 TRP E CH2  1  
ATOM 9777   H H    . TRP E 2 20  ? -14.634 -17.382 15.869  1.00 11.14 ? 290 TRP E H    1  
ATOM 9778   H HA   . TRP E 2 20  ? -13.021 -16.052 13.814  1.00 4.42  ? 290 TRP E HA   1  
ATOM 9779   H HB2  . TRP E 2 20  ? -13.278 -14.925 16.007  1.00 10.53 ? 290 TRP E HB2  1  
ATOM 9780   H HB3  . TRP E 2 20  ? -12.503 -16.285 16.811  1.00 60.21 ? 290 TRP E HB3  1  
ATOM 9781   H HD1  . TRP E 2 20  ? -10.334 -15.102 17.674  1.00 55.12 ? 290 TRP E HD1  1  
ATOM 9782   H HE1  . TRP E 2 20  ? -8.335  -13.944 16.566  1.00 13.22 ? 290 TRP E HE1  1  
ATOM 9783   H HE3  . TRP E 2 20  ? -12.073 -14.792 12.837  1.00 64.54 ? 290 TRP E HE3  1  
ATOM 9784   H HZ2  . TRP E 2 20  ? -7.566  -13.037 14.030  1.00 52.32 ? 290 TRP E HZ2  1  
ATOM 9785   H HZ3  . TRP E 2 20  ? -10.626 -13.774 11.135  1.00 0.34  ? 290 TRP E HZ3  1  
ATOM 9786   H HH2  . TRP E 2 20  ? -8.419  -12.908 11.721  1.00 2.31  ? 290 TRP E HH2  1  
ATOM 9787   N N    . LEU E 2 21  ? -11.296 -17.779 13.393  1.00 42.30 ? 291 LEU E N    1  
ATOM 9788   C CA   . LEU E 2 21  ? -10.442 -18.884 12.919  1.00 11.30 ? 291 LEU E CA   1  
ATOM 9789   C C    . LEU E 2 21  ? -8.952  -18.577 13.179  1.00 13.32 ? 291 LEU E C    1  
ATOM 9790   O O    . LEU E 2 21  ? -8.068  -19.244 12.626  1.00 73.10 ? 291 LEU E O    1  
ATOM 9791   C CB   . LEU E 2 21  ? -10.688 -19.153 11.397  1.00 70.30 ? 291 LEU E CB   1  
ATOM 9792   C CG   . LEU E 2 21  ? -12.184 -19.124 10.898  1.00 2.21  ? 291 LEU E CG   1  
ATOM 9793   C CD1  . LEU E 2 21  ? -12.656 -17.676 10.617  1.00 71.32 ? 291 LEU E CD1  1  
ATOM 9794   C CD2  . LEU E 2 21  ? -12.395 -20.026 9.659   1.00 4.34  ? 291 LEU E CD2  1  
ATOM 9795   H H    . LEU E 2 21  ? -11.349 -16.968 12.846  1.00 73.25 ? 291 LEU E H    1  
ATOM 9796   H HA   . LEU E 2 21  ? -10.703 -19.780 13.475  1.00 63.01 ? 291 LEU E HA   1  
ATOM 9797   H HB2  . LEU E 2 21  ? -10.125 -18.418 10.823  1.00 73.45 ? 291 LEU E HB2  1  
ATOM 9798   H HB3  . LEU E 2 21  ? -10.272 -20.128 11.167  1.00 20.41 ? 291 LEU E HB3  1  
ATOM 9799   H HG   . LEU E 2 21  ? -12.820 -19.514 11.687  1.00 13.55 ? 291 LEU E HG   1  
ATOM 9800   H HD11 . LEU E 2 21  ? -12.057 -17.232 9.830   1.00 60.14 ? 291 LEU E HD11 1  
ATOM 9801   H HD12 . LEU E 2 21  ? -12.556 -17.083 11.517  1.00 73.23 ? 291 LEU E HD12 1  
ATOM 9802   H HD13 . LEU E 2 21  ? -13.696 -17.681 10.317  1.00 44.15 ? 291 LEU E HD13 1  
ATOM 9803   H HD21 . LEU E 2 21  ? -12.105 -21.041 9.898   1.00 44.20 ? 291 LEU E HD21 1  
ATOM 9804   H HD22 . LEU E 2 21  ? -11.792 -19.671 8.832   1.00 63.01 ? 291 LEU E HD22 1  
ATOM 9805   H HD23 . LEU E 2 21  ? -13.438 -20.016 9.369   1.00 42.24 ? 291 LEU E HD23 1  
ATOM 9806   N N    . GLY E 2 22  ? -8.688  -17.579 14.051  1.00 2.24  ? 292 GLY E N    1  
ATOM 9807   C CA   . GLY E 2 22  ? -7.322  -17.197 14.434  1.00 52.22 ? 292 GLY E CA   1  
ATOM 9808   C C    . GLY E 2 22  ? -7.131  -17.152 15.951  1.00 3.31  ? 292 GLY E C    1  
ATOM 9809   O O    . GLY E 2 22  ? -6.883  -16.068 16.502  1.00 35.22 ? 292 GLY E O    1  
ATOM 9810   H H    . GLY E 2 22  ? -9.439  -17.098 14.451  1.00 3.43  ? 292 GLY E H    1  
ATOM 9811   H HA2  . GLY E 2 22  ? -6.603  -17.894 14.014  1.00 2.44  ? 292 GLY E HA2  1  
ATOM 9812   H HA3  . GLY E 2 22  ? -7.117  -16.214 14.029  1.00 65.43 ? 292 GLY E HA3  1  
ATOM 9813   N N    . PRO E 2 23  ? -7.237  -18.319 16.682  1.00 35.33 ? 293 PRO E N    1  
ATOM 9814   C CA   . PRO E 2 23  ? -6.990  -18.366 18.141  1.00 31.31 ? 293 PRO E CA   1  
ATOM 9815   C C    . PRO E 2 23  ? -5.480  -18.352 18.464  1.00 55.40 ? 293 PRO E C    1  
ATOM 9816   O O    . PRO E 2 23  ? -4.656  -18.339 17.545  1.00 45.32 ? 293 PRO E O    1  
ATOM 9817   C CB   . PRO E 2 23  ? -7.655  -19.697 18.560  1.00 30.20 ? 293 PRO E CB   1  
ATOM 9818   C CG   . PRO E 2 23  ? -7.496  -20.587 17.370  1.00 23.33 ? 293 PRO E CG   1  
ATOM 9819   C CD   . PRO E 2 23  ? -7.570  -19.682 16.152  1.00 63.12 ? 293 PRO E CD   1  
ATOM 9820   H HA   . PRO E 2 23  ? -7.471  -17.540 18.652  1.00 43.21 ? 293 PRO E HA   1  
ATOM 9821   H HB2  . PRO E 2 23  ? -7.162  -20.113 19.439  1.00 25.20 ? 293 PRO E HB2  1  
ATOM 9822   H HB3  . PRO E 2 23  ? -8.707  -19.544 18.775  1.00 43.55 ? 293 PRO E HB3  1  
ATOM 9823   H HG2  . PRO E 2 23  ? -6.531  -21.084 17.416  1.00 10.23 ? 293 PRO E HG2  1  
ATOM 9824   H HG3  . PRO E 2 23  ? -8.289  -21.324 17.339  1.00 41.55 ? 293 PRO E HG3  1  
ATOM 9825   H HD2  . PRO E 2 23  ? -6.848  -19.989 15.403  1.00 12.25 ? 293 PRO E HD2  1  
ATOM 9826   H HD3  . PRO E 2 23  ? -8.570  -19.693 15.726  1.00 23.01 ? 293 PRO E HD3  1  
ATOM 9827   N N    . LYS E 2 24  ? -5.142  -18.335 19.776  1.00 52.11 ? 294 LYS E N    1  
ATOM 9828   C CA   . LYS E 2 24  ? -3.738  -18.297 20.283  1.00 33.20 ? 294 LYS E CA   1  
ATOM 9829   C C    . LYS E 2 24  ? -3.049  -16.936 19.950  1.00 41.10 ? 294 LYS E C    1  
ATOM 9830   O O    . LYS E 2 24  ? -1.826  -16.788 20.106  1.00 22.43 ? 294 LYS E O    1  
ATOM 9831   C CB   . LYS E 2 24  ? -2.941  -19.523 19.722  1.00 4.13  ? 294 LYS E CB   1  
ATOM 9832   C CG   . LYS E 2 24  ? -1.546  -19.784 20.336  1.00 71.02 ? 294 LYS E CG   1  
ATOM 9833   C CD   . LYS E 2 24  ? -0.860  -21.010 19.696  1.00 1.42  ? 294 LYS E CD   1  
ATOM 9834   C CE   . LYS E 2 24  ? -1.678  -22.296 19.886  1.00 1.04  ? 294 LYS E CE   1  
ATOM 9835   N NZ   . LYS E 2 24  ? -1.030  -23.457 19.249  1.00 65.43 ? 294 LYS E NZ   1  
ATOM 9836   H H    . LYS E 2 24  ? -5.864  -18.354 20.433  1.00 54.35 ? 294 LYS E H    1  
ATOM 9837   H HA   . LYS E 2 24  ? -3.796  -18.384 21.362  1.00 34.05 ? 294 LYS E HA   1  
ATOM 9838   H HB2  . LYS E 2 24  ? -3.543  -20.412 19.876  1.00 21.32 ? 294 LYS E HB2  1  
ATOM 9839   H HB3  . LYS E 2 24  ? -2.818  -19.388 18.650  1.00 41.20 ? 294 LYS E HB3  1  
ATOM 9840   H HG2  . LYS E 2 24  ? -0.922  -18.910 20.179  1.00 30.53 ? 294 LYS E HG2  1  
ATOM 9841   H HG3  . LYS E 2 24  ? -1.649  -19.954 21.404  1.00 34.41 ? 294 LYS E HG3  1  
ATOM 9842   H HD2  . LYS E 2 24  ? -0.729  -20.830 18.634  1.00 10.14 ? 294 LYS E HD2  1  
ATOM 9843   H HD3  . LYS E 2 24  ? 0.115   -21.147 20.152  1.00 1.30  ? 294 LYS E HD3  1  
ATOM 9844   H HE2  . LYS E 2 24  ? -1.786  -22.496 20.944  1.00 12.43 ? 294 LYS E HE2  1  
ATOM 9845   H HE3  . LYS E 2 24  ? -2.664  -22.163 19.448  1.00 31.35 ? 294 LYS E HE3  1  
ATOM 9846   H HZ1  . LYS E 2 24  ? -0.080  -23.597 19.643  1.00 72.33 ? 294 LYS E HZ1  1  
ATOM 9847   H HZ2  . LYS E 2 24  ? -0.948  -23.304 18.222  1.00 24.25 ? 294 LYS E HZ2  1  
ATOM 9848   H HZ3  . LYS E 2 24  ? -1.590  -24.317 19.411  1.00 13.05 ? 294 LYS E HZ3  1  
ATOM 9849   N N    . ALA E 2 25  ? -3.882  -15.948 19.524  1.00 34.03 ? 295 ALA E N    1  
ATOM 9850   C CA   . ALA E 2 25  ? -3.459  -14.595 19.102  1.00 15.44 ? 295 ALA E CA   1  
ATOM 9851   C C    . ALA E 2 25  ? -2.659  -14.592 17.776  1.00 50.22 ? 295 ALA E C    1  
ATOM 9852   O O    . ALA E 2 25  ? -2.005  -15.582 17.410  1.00 71.34 ? 295 ALA E O    1  
ATOM 9853   C CB   . ALA E 2 25  ? -2.681  -13.891 20.222  1.00 42.21 ? 295 ALA E CB   1  
ATOM 9854   H H    . ALA E 2 25  ? -4.840  -16.141 19.510  1.00 52.30 ? 295 ALA E H    1  
ATOM 9855   H HA   . ALA E 2 25  ? -4.375  -14.026 18.941  1.00 22.30 ? 295 ALA E HA   1  
ATOM 9856   H HB1  . ALA E 2 25  ? -2.465  -12.871 19.934  1.00 61.44 ? 295 ALA E HB1  1  
ATOM 9857   H HB2  . ALA E 2 25  ? -1.751  -14.413 20.414  1.00 54.32 ? 295 ALA E HB2  1  
ATOM 9858   H HB3  . ALA E 2 25  ? -3.276  -13.884 21.127  1.00 71.40 ? 295 ALA E HB3  1  
ATOM 9859   N N    . THR E 2 26  ? -2.715  -13.448 17.066  1.00 11.45 ? 296 THR E N    1  
ATOM 9860   C CA   . THR E 2 26  ? -1.986  -13.239 15.801  1.00 10.53 ? 296 THR E CA   1  
ATOM 9861   C C    . THR E 2 26  ? -0.530  -12.761 16.085  1.00 34.44 ? 296 THR E C    1  
ATOM 9862   O O    . THR E 2 26  ? -0.162  -11.596 15.882  1.00 32.13 ? 296 THR E O    1  
ATOM 9863   C CB   . THR E 2 26  ? -2.783  -12.263 14.848  1.00 4.03  ? 296 THR E CB   1  
ATOM 9864   O OG1  . THR E 2 26  ? -2.044  -12.009 13.638  1.00 42.22 ? 296 THR E OG1  1  
ATOM 9865   C CG2  . THR E 2 26  ? -3.156  -10.923 15.526  1.00 21.32 ? 296 THR E CG2  1  
ATOM 9866   H H    . THR E 2 26  ? -3.272  -12.721 17.405  1.00 3.40  ? 296 THR E H    1  
ATOM 9867   H HA   . THR E 2 26  ? -1.923  -14.202 15.293  1.00 4.25  ? 296 THR E HA   1  
ATOM 9868   H HB   . THR E 2 26  ? -3.710  -12.759 14.570  1.00 24.11 ? 296 THR E HB   1  
ATOM 9869   H HG1  . THR E 2 26  ? -1.324  -11.398 13.825  1.00 0.41  ? 296 THR E HG1  1  
ATOM 9870   H HG21 . THR E 2 26  ? -3.734  -10.317 14.841  1.00 65.35 ? 296 THR E HG21 1  
ATOM 9871   H HG22 . THR E 2 26  ? -2.257  -10.390 15.799  1.00 35.03 ? 296 THR E HG22 1  
ATOM 9872   H HG23 . THR E 2 26  ? -3.742  -11.112 16.418  1.00 54.42 ? 296 THR E HG23 1  
ATOM 9873   N N    . TYR E 2 27  ? 0.274   -13.697 16.614  1.00 54.44 ? 297 TYR E N    1  
ATOM 9874   C CA   . TYR E 2 27  ? 1.704   -13.487 16.938  1.00 70.32 ? 297 TYR E CA   1  
ATOM 9875   C C    . TYR E 2 27  ? 2.447   -14.824 16.842  1.00 62.21 ? 297 TYR E C    1  
ATOM 9876   O O    . TYR E 2 27  ? 3.293   -15.014 15.959  1.00 30.32 ? 297 TYR E O    1  
ATOM 9877   C CB   . TYR E 2 27  ? 1.895   -12.870 18.371  1.00 34.22 ? 297 TYR E CB   1  
ATOM 9878   C CG   . TYR E 2 27  ? 1.972   -11.338 18.401  1.00 50.41 ? 297 TYR E CG   1  
ATOM 9879   C CD1  . TYR E 2 27  ? 3.082   -10.676 17.884  1.00 43.35 ? 297 TYR E CD1  1  
ATOM 9880   C CD2  . TYR E 2 27  ? 0.965   -10.559 18.961  1.00 41.21 ? 297 TYR E CD2  1  
ATOM 9881   C CE1  . TYR E 2 27  ? 3.171   -9.305  17.923  1.00 42.42 ? 297 TYR E CE1  1  
ATOM 9882   C CE2  . TYR E 2 27  ? 1.054   -9.182  18.996  1.00 24.21 ? 297 TYR E CE2  1  
ATOM 9883   C CZ   . TYR E 2 27  ? 2.160   -8.562  18.477  1.00 75.03 ? 297 TYR E CZ   1  
ATOM 9884   O OH   . TYR E 2 27  ? 2.267   -7.190  18.524  1.00 45.41 ? 297 TYR E OH   1  
ATOM 9885   H H    . TYR E 2 27  ? -0.112  -14.581 16.791  1.00 71.01 ? 297 TYR E H    1  
ATOM 9886   H HA   . TYR E 2 27  ? 2.125   -12.808 16.197  1.00 45.13 ? 297 TYR E HA   1  
ATOM 9887   H HB2  . TYR E 2 27  ? 1.072   -13.181 19.006  1.00 75.24 ? 297 TYR E HB2  1  
ATOM 9888   H HB3  . TYR E 2 27  ? 2.818   -13.244 18.817  1.00 32.44 ? 297 TYR E HB3  1  
ATOM 9889   H HD1  . TYR E 2 27  ? 3.888   -11.253 17.439  1.00 53.41 ? 297 TYR E HD1  1  
ATOM 9890   H HD2  . TYR E 2 27  ? 0.096   -11.046 19.372  1.00 75.15 ? 297 TYR E HD2  1  
ATOM 9891   H HE1  . TYR E 2 27  ? 4.041   -8.816  17.514  1.00 12.01 ? 297 TYR E HE1  1  
ATOM 9892   H HE2  . TYR E 2 27  ? 0.252   -8.598  19.434  1.00 32.22 ? 297 TYR E HE2  1  
ATOM 9893   H HH   . TYR E 2 27  ? 2.096   -6.888  19.422  1.00 44.21 ? 297 TYR E HH   1  
ATOM 9894   N N    . HIS E 2 28  ? 2.108   -15.732 17.792  1.00 73.45 ? 298 HIS E N    1  
ATOM 9895   C CA   . HIS E 2 28  ? 2.779   -17.039 17.994  1.00 5.43  ? 298 HIS E CA   1  
ATOM 9896   C C    . HIS E 2 28  ? 4.266   -16.838 18.444  1.00 45.54 ? 298 HIS E C    1  
ATOM 9897   O O    . HIS E 2 28  ? 5.065   -17.778 18.466  1.00 1.31  ? 298 HIS E O    1  
ATOM 9898   C CB   . HIS E 2 28  ? 2.639   -17.945 16.718  1.00 33.05 ? 298 HIS E CB   1  
ATOM 9899   C CG   . HIS E 2 28  ? 2.992   -19.396 16.935  1.00 25.53 ? 298 HIS E CG   1  
ATOM 9900   N ND1  . HIS E 2 28  ? 4.281   -19.875 16.854  1.00 33.21 ? 298 HIS E ND1  1  
ATOM 9901   C CD2  . HIS E 2 28  ? 2.219   -20.460 17.264  1.00 52.01 ? 298 HIS E CD2  1  
ATOM 9902   C CE1  . HIS E 2 28  ? 4.286   -21.165 17.121  1.00 20.34 ? 298 HIS E CE1  1  
ATOM 9903   N NE2  . HIS E 2 28  ? 3.050   -21.547 17.372  1.00 54.34 ? 298 HIS E NE2  1  
ATOM 9904   H H    . HIS E 2 28  ? 1.366   -15.510 18.391  1.00 21.55 ? 298 HIS E H    1  
ATOM 9905   H HA   . HIS E 2 28  ? 2.261   -17.521 18.816  1.00 4.41  ? 298 HIS E HA   1  
ATOM 9906   H HB2  . HIS E 2 28  ? 1.612   -17.910 16.372  1.00 25.44 ? 298 HIS E HB2  1  
ATOM 9907   H HB3  . HIS E 2 28  ? 3.279   -17.560 15.929  1.00 73.04 ? 298 HIS E HB3  1  
ATOM 9908   H HD1  . HIS E 2 28  ? 5.076   -19.342 16.639  1.00 31.32 ? 298 HIS E HD1  1  
ATOM 9909   H HD2  . HIS E 2 28  ? 1.148   -20.452 17.424  1.00 61.34 ? 298 HIS E HD2  1  
ATOM 9910   H HE1  . HIS E 2 28  ? 5.161   -21.804 17.135  1.00 72.32 ? 298 HIS E HE1  1  
ATOM 9911   H HE2  . HIS E 2 28  ? 2.753   -22.480 17.401  1.00 37.99 ? 298 HIS E HE2  1  
ATOM 9912   N N    . GLY E 2 29  ? 4.602   -15.597 18.859  1.00 44.41 ? 299 GLY E N    1  
ATOM 9913   C CA   . GLY E 2 29  ? 5.960   -15.234 19.257  1.00 50.02 ? 299 GLY E CA   1  
ATOM 9914   C C    . GLY E 2 29  ? 6.202   -13.729 19.201  1.00 43.12 ? 299 GLY E C    1  
ATOM 9915   O O    . GLY E 2 29  ? 5.257   -12.937 19.091  1.00 10.33 ? 299 GLY E O    1  
ATOM 9916   H H    . GLY E 2 29  ? 3.905   -14.913 18.902  1.00 5.12  ? 299 GLY E H    1  
ATOM 9917   H HA2  . GLY E 2 29  ? 6.128   -15.573 20.270  1.00 0.21  ? 299 GLY E HA2  1  
ATOM 9918   H HA3  . GLY E 2 29  ? 6.671   -15.725 18.602  1.00 15.42 ? 299 GLY E HA3  1  
ATOM 9919   N N    . ASN E 2 30  ? 7.486   -13.351 19.271  1.00 61.34 ? 300 ASN E N    1  
ATOM 9920   C CA   . ASN E 2 30  ? 7.937   -11.937 19.277  1.00 51.12 ? 300 ASN E CA   1  
ATOM 9921   C C    . ASN E 2 30  ? 7.931   -11.368 17.830  1.00 75.05 ? 300 ASN E C    1  
ATOM 9922   O O    . ASN E 2 30  ? 7.638   -12.093 16.871  1.00 41.22 ? 300 ASN E O    1  
ATOM 9923   C CB   . ASN E 2 30  ? 9.361   -11.888 19.927  1.00 64.13 ? 300 ASN E CB   1  
ATOM 9924   C CG   . ASN E 2 30  ? 9.817   -10.497 20.402  1.00 53.35 ? 300 ASN E CG   1  
ATOM 9925   O OD1  . ASN E 2 30  ? 9.628   -10.139 21.556  1.00 34.43 ? 300 ASN E OD1  1  
ATOM 9926   N ND2  . ASN E 2 30  ? 10.431  -9.716  19.531  1.00 32.22 ? 300 ASN E ND2  1  
ATOM 9927   H H    . ASN E 2 30  ? 8.169   -14.050 19.320  1.00 1.00  ? 300 ASN E H    1  
ATOM 9928   H HA   . ASN E 2 30  ? 7.243   -11.358 19.880  1.00 11.51 ? 300 ASN E HA   1  
ATOM 9929   H HB2  . ASN E 2 30  ? 9.360   -12.538 20.795  1.00 11.12 ? 300 ASN E HB2  1  
ATOM 9930   H HB3  . ASN E 2 30  ? 10.089  -12.273 19.219  1.00 23.42 ? 300 ASN E HB3  1  
ATOM 9931   H HD21 . ASN E 2 30  ? 10.571  -10.056 18.619  1.00 15.11 ? 300 ASN E HD21 1  
ATOM 9932   H HD22 . ASN E 2 30  ? 10.711  -8.824  19.827  1.00 12.42 ? 300 ASN E HD22 1  
ATOM 9933   N N    . ILE E 2 31  ? 8.237   -10.068 17.680  1.00 35.12 ? 301 ILE E N    1  
ATOM 9934   C CA   . ILE E 2 31  ? 8.338   -9.393  16.357  1.00 52.33 ? 301 ILE E CA   1  
ATOM 9935   C C    . ILE E 2 31  ? 9.587   -8.478  16.320  1.00 71.34 ? 301 ILE E C    1  
ATOM 9936   O O    . ILE E 2 31  ? 10.604  -8.755  16.964  1.00 32.25 ? 301 ILE E O    1  
ATOM 9937   C CB   . ILE E 2 31  ? 7.018   -8.562  16.036  1.00 64.32 ? 301 ILE E CB   1  
ATOM 9938   C CG1  . ILE E 2 31  ? 6.612   -7.625  17.234  1.00 73.23 ? 301 ILE E CG1  1  
ATOM 9939   C CG2  . ILE E 2 31  ? 5.869   -9.504  15.638  1.00 24.03 ? 301 ILE E CG2  1  
ATOM 9940   C CD1  . ILE E 2 31  ? 5.452   -6.662  16.957  1.00 72.02 ? 301 ILE E CD1  1  
ATOM 9941   H H    . ILE E 2 31  ? 8.398   -9.532  18.484  1.00 2.44  ? 301 ILE E H    1  
ATOM 9942   H HA   . ILE E 2 31  ? 8.466   -10.151 15.587  1.00 42.45 ? 301 ILE E HA   1  
ATOM 9943   H HB   . ILE E 2 31  ? 7.226   -7.936  15.166  1.00 21.13 ? 301 ILE E HB   1  
ATOM 9944   H HG12 . ILE E 2 31  ? 6.324   -8.237  18.079  1.00 73.53 ? 301 ILE E HG12 1  
ATOM 9945   H HG13 . ILE E 2 31  ? 7.469   -7.026  17.522  1.00 30.01 ? 301 ILE E HG13 1  
ATOM 9946   H HG21 . ILE E 2 31  ? 4.983   -8.926  15.401  1.00 63.11 ? 301 ILE E HG21 1  
ATOM 9947   H HG22 . ILE E 2 31  ? 5.643   -10.170 16.461  1.00 41.24 ? 301 ILE E HG22 1  
ATOM 9948   H HG23 . ILE E 2 31  ? 6.153   -10.089 14.775  1.00 50.32 ? 301 ILE E HG23 1  
ATOM 9949   H HD11 . ILE E 2 31  ? 5.281   -6.043  17.829  1.00 20.41 ? 301 ILE E HD11 1  
ATOM 9950   H HD12 . ILE E 2 31  ? 4.550   -7.226  16.748  1.00 15.43 ? 301 ILE E HD12 1  
ATOM 9951   H HD13 . ILE E 2 31  ? 5.689   -6.033  16.113  1.00 25.13 ? 301 ILE E HD13 1  
ATOM 9952   N N    . ASP E 2 32  ? 9.524   -7.437  15.484  1.00 0.22  ? 302 ASP E N    1  
ATOM 9953   C CA   . ASP E 2 32  ? 10.416  -6.262  15.554  1.00 5.20  ? 302 ASP E CA   1  
ATOM 9954   C C    . ASP E 2 32  ? 10.204  -5.467  16.875  1.00 42.41 ? 302 ASP E C    1  
ATOM 9955   O O    . ASP E 2 32  ? 9.460   -5.892  17.775  1.00 21.44 ? 302 ASP E O    1  
ATOM 9956   C CB   . ASP E 2 32  ? 10.170  -5.367  14.305  1.00 52.23 ? 302 ASP E CB   1  
ATOM 9957   C CG   . ASP E 2 32  ? 8.669   -5.141  14.018  1.00 13.20 ? 302 ASP E CG   1  
ATOM 9958   O OD1  . ASP E 2 32  ? 8.044   -4.319  14.712  1.00 5.03  ? 302 ASP E OD1  1  
ATOM 9959   O OD2  . ASP E 2 32  ? 8.106   -5.829  13.137  1.00 70.13 ? 302 ASP E OD2  1  
ATOM 9960   H H    . ASP E 2 32  ? 8.851   -7.455  14.773  1.00 43.33 ? 302 ASP E H    1  
ATOM 9961   H HA   . ASP E 2 32  ? 11.441  -6.624  15.531  1.00 11.34 ? 302 ASP E HA   1  
ATOM 9962   H HB2  . ASP E 2 32  ? 10.647  -4.403  14.457  1.00 4.20  ? 302 ASP E HB2  1  
ATOM 9963   H HB3  . ASP E 2 32  ? 10.628  -5.834  13.444  1.00 0.32  ? 302 ASP E HB3  1  
ATOM 9964   N N    . LYS E 2 33  ? 10.854  -4.297  16.979  1.00 30.44 ? 303 LYS E N    1  
ATOM 9965   C CA   . LYS E 2 33  ? 10.892  -3.514  18.231  1.00 31.44 ? 303 LYS E CA   1  
ATOM 9966   C C    . LYS E 2 33  ? 10.926  -1.995  17.931  1.00 42.14 ? 303 LYS E C    1  
ATOM 9967   O O    . LYS E 2 33  ? 11.156  -1.596  16.782  1.00 54.21 ? 303 LYS E O    1  
ATOM 9968   C CB   . LYS E 2 33  ? 12.126  -3.966  19.071  1.00 43.55 ? 303 LYS E CB   1  
ATOM 9969   C CG   . LYS E 2 33  ? 13.484  -3.840  18.350  1.00 54.24 ? 303 LYS E CG   1  
ATOM 9970   C CD   . LYS E 2 33  ? 14.665  -4.261  19.253  1.00 41.54 ? 303 LYS E CD   1  
ATOM 9971   C CE   . LYS E 2 33  ? 14.557  -5.728  19.720  1.00 4.42  ? 303 LYS E CE   1  
ATOM 9972   N NZ   . LYS E 2 33  ? 15.597  -6.072  20.724  1.00 10.22 ? 303 LYS E NZ   1  
ATOM 9973   H H    . LYS E 2 33  ? 11.316  -3.937  16.188  1.00 1.31  ? 303 LYS E H    1  
ATOM 9974   H HA   . LYS E 2 33  ? 9.988   -3.723  18.795  1.00 60.44 ? 303 LYS E HA   1  
ATOM 9975   H HB2  . LYS E 2 33  ? 12.168  -3.380  19.985  1.00 11.12 ? 303 LYS E HB2  1  
ATOM 9976   H HB3  . LYS E 2 33  ? 11.986  -5.008  19.345  1.00 12.22 ? 303 LYS E HB3  1  
ATOM 9977   H HG2  . LYS E 2 33  ? 13.472  -4.472  17.468  1.00 54.32 ? 303 LYS E HG2  1  
ATOM 9978   H HG3  . LYS E 2 33  ? 13.623  -2.807  18.044  1.00 61.14 ? 303 LYS E HG3  1  
ATOM 9979   H HD2  . LYS E 2 33  ? 15.589  -4.137  18.701  1.00 50.54 ? 303 LYS E HD2  1  
ATOM 9980   H HD3  . LYS E 2 33  ? 14.689  -3.616  20.127  1.00 35.32 ? 303 LYS E HD3  1  
ATOM 9981   H HE2  . LYS E 2 33  ? 13.583  -5.890  20.168  1.00 35.25 ? 303 LYS E HE2  1  
ATOM 9982   H HE3  . LYS E 2 33  ? 14.666  -6.384  18.864  1.00 41.15 ? 303 LYS E HE3  1  
ATOM 9983   H HZ1  . LYS E 2 33  ? 15.548  -5.415  21.530  1.00 25.43 ? 303 LYS E HZ1  1  
ATOM 9984   H HZ2  . LYS E 2 33  ? 16.541  -6.012  20.299  1.00 63.12 ? 303 LYS E HZ2  1  
ATOM 9985   H HZ3  . LYS E 2 33  ? 15.449  -7.041  21.076  1.00 13.50 ? 303 LYS E HZ3  1  
ATOM 9986   N N    . PRO E 2 34  ? 10.639  -1.115  18.950  1.00 54.31 ? 304 PRO E N    1  
ATOM 9987   C CA   . PRO E 2 34  ? 10.802  0.358   18.814  1.00 64.34 ? 304 PRO E CA   1  
ATOM 9988   C C    . PRO E 2 34  ? 12.297  0.803   18.879  1.00 63.22 ? 304 PRO E C    1  
ATOM 9989   O O    . PRO E 2 34  ? 12.666  1.669   19.679  1.00 1.33  ? 304 PRO E O    1  
ATOM 9990   C CB   . PRO E 2 34  ? 9.967   0.895   20.008  1.00 31.52 ? 304 PRO E CB   1  
ATOM 9991   C CG   . PRO E 2 34  ? 10.040  -0.177  21.050  1.00 63.42 ? 304 PRO E CG   1  
ATOM 9992   C CD   . PRO E 2 34  ? 10.066  -1.482  20.288  1.00 14.32 ? 304 PRO E CD   1  
ATOM 9993   H HA   . PRO E 2 34  ? 10.370  0.717   17.881  1.00 1.11  ? 304 PRO E HA   1  
ATOM 9994   H HB2  . PRO E 2 34  ? 10.381  1.831   20.372  1.00 42.20 ? 304 PRO E HB2  1  
ATOM 9995   H HB3  . PRO E 2 34  ? 8.937   1.048   19.705  1.00 32.44 ? 304 PRO E HB3  1  
ATOM 9996   H HG2  . PRO E 2 34  ? 10.946  -0.058  21.640  1.00 65.43 ? 304 PRO E HG2  1  
ATOM 9997   H HG3  . PRO E 2 34  ? 9.169   -0.137  21.693  1.00 73.21 ? 304 PRO E HG3  1  
ATOM 9998   H HD2  . PRO E 2 34  ? 10.699  -2.205  20.791  1.00 12.02 ? 304 PRO E HD2  1  
ATOM 9999   H HD3  . PRO E 2 34  ? 9.063   -1.882  20.176  1.00 51.42 ? 304 PRO E HD3  1  
ATOM 10000  N N    . ALA E 2 35  ? 13.126  0.208   17.994  1.00 3.04  ? 305 ALA E N    1  
ATOM 10001  C CA   . ALA E 2 35  ? 14.567  0.494   17.861  1.00 73.42 ? 305 ALA E CA   1  
ATOM 10002  C C    . ALA E 2 35  ? 15.063  -0.140  16.547  1.00 51.22 ? 305 ALA E C    1  
ATOM 10003  O O    . ALA E 2 35  ? 14.991  -1.368  16.397  1.00 22.34 ? 305 ALA E O    1  
ATOM 10004  C CB   . ALA E 2 35  ? 15.365  -0.044  19.068  1.00 33.22 ? 305 ALA E CB   1  
ATOM 10005  H H    . ALA E 2 35  ? 12.745  -0.452  17.383  1.00 42.12 ? 305 ALA E H    1  
ATOM 10006  H HA   . ALA E 2 35  ? 14.695  1.575   17.812  1.00 3.33  ? 305 ALA E HA   1  
ATOM 10007  H HB1  . ALA E 2 35  ? 15.001  0.414   19.980  1.00 52.41 ? 305 ALA E HB1  1  
ATOM 10008  H HB2  . ALA E 2 35  ? 16.414  0.191   18.948  1.00 64.24 ? 305 ALA E HB2  1  
ATOM 10009  H HB3  . ALA E 2 35  ? 15.245  -1.118  19.138  1.00 64.41 ? 305 ALA E HB3  1  
ATOM 10010  N N    . VAL E 2 36  ? 15.517  0.701   15.583  1.00 45.22 ? 306 VAL E N    1  
ATOM 10011  C CA   . VAL E 2 36  ? 16.011  0.224   14.269  1.00 1.34  ? 306 VAL E CA   1  
ATOM 10012  C C    . VAL E 2 36  ? 17.403  -0.427  14.423  1.00 14.30 ? 306 VAL E C    1  
ATOM 10013  O O    . VAL E 2 36  ? 17.506  -1.658  14.509  1.00 55.22 ? 306 VAL E O    1  
ATOM 10014  C CB   . VAL E 2 36  ? 16.040  1.381   13.176  1.00 41.10 ? 306 VAL E CB   1  
ATOM 10015  C CG1  . VAL E 2 36  ? 16.591  0.882   11.809  1.00 32.11 ? 306 VAL E CG1  1  
ATOM 10016  C CG2  . VAL E 2 36  ? 14.637  2.015   13.001  1.00 24.25 ? 306 VAL E CG2  1  
ATOM 10017  H H    . VAL E 2 36  ? 15.517  1.663   15.762  1.00 22.21 ? 306 VAL E H    1  
ATOM 10018  H HA   . VAL E 2 36  ? 15.318  -0.541  13.918  1.00 45.21 ? 306 VAL E HA   1  
ATOM 10019  H HB   . VAL E 2 36  ? 16.712  2.160   13.533  1.00 55.33 ? 306 VAL E HB   1  
ATOM 10020  H HG11 . VAL E 2 36  ? 16.609  1.700   11.099  1.00 72.42 ? 306 VAL E HG11 1  
ATOM 10021  H HG12 . VAL E 2 36  ? 15.964  0.089   11.422  1.00 41.45 ? 306 VAL E HG12 1  
ATOM 10022  H HG13 . VAL E 2 36  ? 17.599  0.505   11.937  1.00 13.42 ? 306 VAL E HG13 1  
ATOM 10023  H HG21 . VAL E 2 36  ? 13.932  1.269   12.655  1.00 72.12 ? 306 VAL E HG21 1  
ATOM 10024  H HG22 . VAL E 2 36  ? 14.681  2.824   12.282  1.00 50.31 ? 306 VAL E HG22 1  
ATOM 10025  H HG23 . VAL E 2 36  ? 14.299  2.410   13.950  1.00 51.12 ? 306 VAL E HG23 1  
ATOM 10026  N N    . THR E 2 37  ? 18.472  0.397   14.502  1.00 32.21 ? 307 THR E N    1  
ATOM 10027  C CA   . THR E 2 37  ? 19.864  -0.096  14.512  1.00 31.23 ? 307 THR E CA   1  
ATOM 10028  C C    . THR E 2 37  ? 20.729  0.728   15.495  1.00 21.40 ? 307 THR E C    1  
ATOM 10029  O O    . THR E 2 37  ? 20.859  0.347   16.661  1.00 12.50 ? 307 THR E O    1  
ATOM 10030  C CB   . THR E 2 37  ? 20.478  -0.092  13.057  1.00 64.41 ? 307 THR E CB   1  
ATOM 10031  O OG1  . THR E 2 37  ? 20.228  1.176   12.422  1.00 43.14 ? 307 THR E OG1  1  
ATOM 10032  C CG2  . THR E 2 37  ? 19.917  -1.223  12.171  1.00 35.41 ? 307 THR E CG2  1  
ATOM 10033  H H    . THR E 2 37  ? 18.320  1.362   14.573  1.00 65.30 ? 307 THR E H    1  
ATOM 10034  H HA   . THR E 2 37  ? 19.858  -1.130  14.865  1.00 53.35 ? 307 THR E HA   1  
ATOM 10035  H HB   . THR E 2 37  ? 21.557  -0.224  13.136  1.00 71.45 ? 307 THR E HB   1  
ATOM 10036  H HG1  . THR E 2 37  ? 19.319  1.199   12.112  1.00 73.14 ? 307 THR E HG1  1  
ATOM 10037  H HG21 . THR E 2 37  ? 20.119  -2.184  12.629  1.00 72.11 ? 307 THR E HG21 1  
ATOM 10038  H HG22 . THR E 2 37  ? 20.384  -1.189  11.198  1.00 44.44 ? 307 THR E HG22 1  
ATOM 10039  H HG23 . THR E 2 37  ? 18.849  -1.096  12.058  1.00 32.35 ? 307 THR E HG23 1  
ATOM 10040  N N    . CYS E 2 38  ? 21.256  1.879   15.023  1.00 44.02 ? 308 CYS E N    1  
ATOM 10041  C CA   . CYS E 2 38  ? 22.194  2.743   15.778  1.00 72.24 ? 308 CYS E CA   1  
ATOM 10042  C C    . CYS E 2 38  ? 22.549  3.984   14.919  1.00 10.24 ? 308 CYS E C    1  
ATOM 10043  O O    . CYS E 2 38  ? 21.988  4.165   13.838  1.00 74.11 ? 308 CYS E O    1  
ATOM 10044  C CB   . CYS E 2 38  ? 23.485  1.956   16.166  1.00 44.05 ? 308 CYS E CB   1  
ATOM 10045  S SG   . CYS E 2 38  ? 24.627  2.860   17.231  1.00 14.44 ? 308 CYS E SG   1  
ATOM 10046  H H    . CYS E 2 38  ? 20.991  2.177   14.128  1.00 34.40 ? 308 CYS E H    1  
ATOM 10047  H HA   . CYS E 2 38  ? 21.688  3.078   16.676  1.00 14.40 ? 308 CYS E HA   1  
ATOM 10048  H HB2  . CYS E 2 38  ? 23.208  1.051   16.694  1.00 72.34 ? 308 CYS E HB2  1  
ATOM 10049  H HB3  . CYS E 2 38  ? 24.028  1.679   15.267  1.00 3.44  ? 308 CYS E HB3  1  
ATOM 10050  H HG   . CYS E 2 38  ? 25.685  3.201   16.508  1.00 52.42 ? 308 CYS E HG   1  
ATOM 10051  N N    . THR E 2 39  ? 23.453  4.856   15.435  1.00 21.14 ? 309 THR E N    1  
ATOM 10052  C CA   . THR E 2 39  ? 24.045  5.986   14.657  1.00 52.44 ? 309 THR E CA   1  
ATOM 10053  C C    . THR E 2 39  ? 25.599  6.113   14.864  1.00 34.23 ? 309 THR E C    1  
ATOM 10054  O O    . THR E 2 39  ? 26.305  6.293   13.863  1.00 23.55 ? 309 THR E O    1  
ATOM 10055  C CB   . THR E 2 39  ? 23.299  7.369   14.895  1.00 13.40 ? 309 THR E CB   1  
ATOM 10056  O OG1  . THR E 2 39  ? 22.967  7.535   16.279  1.00 11.40 ? 309 THR E OG1  1  
ATOM 10057  C CG2  . THR E 2 39  ? 22.007  7.492   14.054  1.00 42.20 ? 309 THR E CG2  1  
ATOM 10058  H H    . THR E 2 39  ? 23.720  4.741   16.365  1.00 15.33 ? 309 THR E H    1  
ATOM 10059  H HA   . THR E 2 39  ? 23.907  5.731   13.602  1.00 50.02 ? 309 THR E HA   1  
ATOM 10060  H HB   . THR E 2 39  ? 23.970  8.174   14.605  1.00 40.22 ? 309 THR E HB   1  
ATOM 10061  H HG1  . THR E 2 39  ? 22.603  6.710   16.617  1.00 2.30  ? 309 THR E HG1  1  
ATOM 10062  H HG21 . THR E 2 39  ? 21.310  6.716   14.347  1.00 65.53 ? 309 THR E HG21 1  
ATOM 10063  H HG22 . THR E 2 39  ? 22.243  7.377   13.002  1.00 75.54 ? 309 THR E HG22 1  
ATOM 10064  H HG23 . THR E 2 39  ? 21.555  8.458   14.218  1.00 63.50 ? 309 THR E HG23 1  
ATOM 10065  N N    . PRO E 2 40  ? 26.183  6.039   16.132  1.00 22.50 ? 310 PRO E N    1  
ATOM 10066  C CA   . PRO E 2 40  ? 27.659  5.900   16.327  1.00 32.33 ? 310 PRO E CA   1  
ATOM 10067  C C    . PRO E 2 40  ? 28.234  4.631   15.635  1.00 75.15 ? 310 PRO E C    1  
ATOM 10068  O O    . PRO E 2 40  ? 29.065  4.769   14.710  1.00 30.21 ? 310 PRO E O    1  
ATOM 10069  C CB   . PRO E 2 40  ? 27.823  5.823   17.875  1.00 52.51 ? 310 PRO E CB   1  
ATOM 10070  C CG   . PRO E 2 40  ? 26.604  6.504   18.413  1.00 10.52 ? 310 PRO E CG   1  
ATOM 10071  C CD   . PRO E 2 40  ? 25.495  6.160   17.449  1.00 11.44 ? 310 PRO E CD   1  
ATOM 10072  O OXT  . PRO E 2 40  ? 27.804  3.514   15.988  1.00 37.99 ? 310 PRO E OXT  1  
ATOM 10073  H HA   . PRO E 2 40  ? 28.169  6.786   15.949  1.00 74.33 ? 310 PRO E HA   1  
ATOM 10074  H HB2  . PRO E 2 40  ? 27.869  4.779   18.202  1.00 24.25 ? 310 PRO E HB2  1  
ATOM 10075  H HB3  . PRO E 2 40  ? 28.717  6.345   18.185  1.00 51.05 ? 310 PRO E HB3  1  
ATOM 10076  H HG2  . PRO E 2 40  ? 26.371  6.133   19.408  1.00 52.20 ? 310 PRO E HG2  1  
ATOM 10077  H HG3  . PRO E 2 40  ? 26.750  7.581   18.440  1.00 31.34 ? 310 PRO E HG3  1  
ATOM 10078  H HD2  . PRO E 2 40  ? 25.023  5.219   17.717  1.00 12.00 ? 310 PRO E HD2  1  
ATOM 10079  H HD3  . PRO E 2 40  ? 24.754  6.949   17.425  1.00 51.11 ? 310 PRO E HD3  1  
ATOM 10080  N N    . ALA F 2 1   ? 1.439   -35.095 -18.368 1.00 53.13 ? 271 ALA F N    1  
ATOM 10081  C CA   . ALA F 2 1   ? 0.401   -35.278 -19.399 1.00 23.02 ? 271 ALA F CA   1  
ATOM 10082  C C    . ALA F 2 1   ? 0.158   -36.774 -19.637 1.00 42.10 ? 271 ALA F C    1  
ATOM 10083  O O    . ALA F 2 1   ? 0.943   -37.439 -20.323 1.00 23.41 ? 271 ALA F O    1  
ATOM 10084  C CB   . ALA F 2 1   ? 0.811   -34.553 -20.692 1.00 22.21 ? 271 ALA F CB   1  
ATOM 10085  H H1   . ALA F 2 1   ? 2.325   -35.540 -18.671 1.00 37.99 ? 271 ALA F H1   1  
ATOM 10086  H H2   . ALA F 2 1   ? 1.137   -35.528 -17.478 1.00 37.99 ? 271 ALA F H2   1  
ATOM 10087  H H3   . ALA F 2 1   ? 1.610   -34.083 -18.205 1.00 37.99 ? 271 ALA F H3   1  
ATOM 10088  H HA   . ALA F 2 1   ? -0.518  -34.823 -19.032 1.00 31.20 ? 271 ALA F HA   1  
ATOM 10089  H HB1  . ALA F 2 1   ? 0.043   -34.677 -21.445 1.00 44.43 ? 271 ALA F HB1  1  
ATOM 10090  H HB2  . ALA F 2 1   ? 1.742   -34.965 -21.062 1.00 45.34 ? 271 ALA F HB2  1  
ATOM 10091  H HB3  . ALA F 2 1   ? 0.945   -33.498 -20.490 1.00 54.23 ? 271 ALA F HB3  1  
ATOM 10092  N N    . ASN F 2 2   ? -0.912  -37.304 -19.024 1.00 3.30  ? 272 ASN F N    1  
ATOM 10093  C CA   . ASN F 2 2   ? -1.324  -38.702 -19.191 1.00 41.52 ? 272 ASN F CA   1  
ATOM 10094  C C    . ASN F 2 2   ? -2.853  -38.796 -19.005 1.00 74.50 ? 272 ASN F C    1  
ATOM 10095  O O    . ASN F 2 2   ? -3.594  -38.852 -19.992 1.00 3.11  ? 272 ASN F O    1  
ATOM 10096  C CB   . ASN F 2 2   ? -0.538  -39.622 -18.213 1.00 51.32 ? 272 ASN F CB   1  
ATOM 10097  C CG   . ASN F 2 2   ? -0.861  -41.106 -18.394 1.00 53.23 ? 272 ASN F CG   1  
ATOM 10098  O OD1  . ASN F 2 2   ? -0.265  -41.792 -19.224 1.00 13.10 ? 272 ASN F OD1  1  
ATOM 10099  N ND2  . ASN F 2 2   ? -1.790  -41.614 -17.611 1.00 32.24 ? 272 ASN F ND2  1  
ATOM 10100  H H    . ASN F 2 2   ? -1.442  -36.732 -18.437 1.00 11.21 ? 272 ASN F H    1  
ATOM 10101  H HA   . ASN F 2 2   ? -1.087  -38.998 -20.215 1.00 43.24 ? 272 ASN F HA   1  
ATOM 10102  H HB2  . ASN F 2 2   ? 0.526   -39.482 -18.375 1.00 34.01 ? 272 ASN F HB2  1  
ATOM 10103  H HB3  . ASN F 2 2   ? -0.769  -39.335 -17.193 1.00 54.32 ? 272 ASN F HB3  1  
ATOM 10104  H HD21 . ASN F 2 2   ? -2.223  -41.026 -16.954 1.00 20.33 ? 272 ASN F HD21 1  
ATOM 10105  H HD22 . ASN F 2 2   ? -2.006  -42.561 -17.714 1.00 60.03 ? 272 ASN F HD22 1  
ATOM 10106  N N    . GLN F 2 3   ? -3.328  -38.769 -17.737 1.00 34.54 ? 273 GLN F N    1  
ATOM 10107  C CA   . GLN F 2 3   ? -4.775  -38.772 -17.401 1.00 31.15 ? 273 GLN F CA   1  
ATOM 10108  C C    . GLN F 2 3   ? -5.020  -37.933 -16.127 1.00 65.13 ? 273 GLN F C    1  
ATOM 10109  O O    . GLN F 2 3   ? -5.413  -36.765 -16.209 1.00 50.23 ? 273 GLN F O    1  
ATOM 10110  C CB   . GLN F 2 3   ? -5.338  -40.223 -17.207 1.00 11.12 ? 273 GLN F CB   1  
ATOM 10111  C CG   . GLN F 2 3   ? -5.452  -41.081 -18.482 1.00 3.04  ? 273 GLN F CG   1  
ATOM 10112  C CD   . GLN F 2 3   ? -6.074  -42.459 -18.221 1.00 33.42 ? 273 GLN F CD   1  
ATOM 10113  O OE1  . GLN F 2 3   ? -7.294  -42.628 -18.293 1.00 44.40 ? 273 GLN F OE1  1  
ATOM 10114  N NE2  . GLN F 2 3   ? -5.253  -43.440 -17.908 1.00 44.44 ? 273 GLN F NE2  1  
ATOM 10115  H H    . GLN F 2 3   ? -2.685  -38.728 -17.000 1.00 14.43 ? 273 GLN F H    1  
ATOM 10116  H HA   . GLN F 2 3   ? -5.312  -38.297 -18.222 1.00 11.13 ? 273 GLN F HA   1  
ATOM 10117  H HB2  . GLN F 2 3   ? -4.691  -40.745 -16.513 1.00 72.31 ? 273 GLN F HB2  1  
ATOM 10118  H HB3  . GLN F 2 3   ? -6.325  -40.155 -16.761 1.00 4.01  ? 273 GLN F HB3  1  
ATOM 10119  H HG2  . GLN F 2 3   ? -6.073  -40.553 -19.202 1.00 74.42 ? 273 GLN F HG2  1  
ATOM 10120  H HG3  . GLN F 2 3   ? -4.459  -41.211 -18.903 1.00 52.24 ? 273 GLN F HG3  1  
ATOM 10121  H HE21 . GLN F 2 3   ? -4.296  -43.243 -17.859 1.00 63.24 ? 273 GLN F HE21 1  
ATOM 10122  H HE22 . GLN F 2 3   ? -5.635  -44.326 -17.737 1.00 34.22 ? 273 GLN F HE22 1  
ATOM 10123  N N    . GLN F 2 4   ? -4.737  -38.534 -14.955 1.00 54.53 ? 274 GLN F N    1  
ATOM 10124  C CA   . GLN F 2 4   ? -5.085  -37.965 -13.637 1.00 61.35 ? 274 GLN F CA   1  
ATOM 10125  C C    . GLN F 2 4   ? -3.822  -37.499 -12.900 1.00 2.40  ? 274 GLN F C    1  
ATOM 10126  O O    . GLN F 2 4   ? -2.884  -38.281 -12.713 1.00 13.00 ? 274 GLN F O    1  
ATOM 10127  C CB   . GLN F 2 4   ? -5.812  -39.042 -12.779 1.00 74.21 ? 274 GLN F CB   1  
ATOM 10128  C CG   . GLN F 2 4   ? -7.190  -39.492 -13.312 1.00 13.20 ? 274 GLN F CG   1  
ATOM 10129  C CD   . GLN F 2 4   ? -7.780  -40.683 -12.540 1.00 73.14 ? 274 GLN F CD   1  
ATOM 10130  O OE1  . GLN F 2 4   ? -7.048  -41.551 -12.059 1.00 15.51 ? 274 GLN F OE1  1  
ATOM 10131  N NE2  . GLN F 2 4   ? -9.093  -40.720 -12.391 1.00 13.03 ? 274 GLN F NE2  1  
ATOM 10132  H H    . GLN F 2 4   ? -4.263  -39.390 -14.973 1.00 22.40 ? 274 GLN F H    1  
ATOM 10133  H HA   . GLN F 2 4   ? -5.751  -37.118 -13.782 1.00 4.00  ? 274 GLN F HA   1  
ATOM 10134  H HB2  . GLN F 2 4   ? -5.174  -39.920 -12.711 1.00 74.15 ? 274 GLN F HB2  1  
ATOM 10135  H HB3  . GLN F 2 4   ? -5.956  -38.651 -11.776 1.00 35.32 ? 274 GLN F HB3  1  
ATOM 10136  H HG2  . GLN F 2 4   ? -7.876  -38.657 -13.247 1.00 62.20 ? 274 GLN F HG2  1  
ATOM 10137  H HG3  . GLN F 2 4   ? -7.086  -39.781 -14.352 1.00 45.20 ? 274 GLN F HG3  1  
ATOM 10138  H HE21 . GLN F 2 4   ? -9.622  -39.992 -12.772 1.00 3.23  ? 274 GLN F HE21 1  
ATOM 10139  H HE22 . GLN F 2 4   ? -9.485  -41.476 -11.906 1.00 1.11  ? 274 GLN F HE22 1  
ATOM 10140  N N    . LYS F 2 5   ? -3.802  -36.223 -12.485 1.00 13.45 ? 275 LYS F N    1  
ATOM 10141  C CA   . LYS F 2 5   ? -2.741  -35.667 -11.625 1.00 44.11 ? 275 LYS F CA   1  
ATOM 10142  C C    . LYS F 2 5   ? -3.370  -35.298 -10.260 1.00 74.24 ? 275 LYS F C    1  
ATOM 10143  O O    . LYS F 2 5   ? -3.994  -34.237 -10.142 1.00 24.14 ? 275 LYS F O    1  
ATOM 10144  C CB   . LYS F 2 5   ? -2.057  -34.440 -12.304 1.00 23.02 ? 275 LYS F CB   1  
ATOM 10145  C CG   . LYS F 2 5   ? -1.447  -34.759 -13.691 1.00 72.41 ? 275 LYS F CG   1  
ATOM 10146  C CD   . LYS F 2 5   ? -0.556  -33.628 -14.251 1.00 53.42 ? 275 LYS F CD   1  
ATOM 10147  C CE   . LYS F 2 5   ? 0.716   -33.409 -13.418 1.00 41.34 ? 275 LYS F CE   1  
ATOM 10148  N NZ   . LYS F 2 5   ? 1.626   -32.423 -14.053 1.00 5.23  ? 275 LYS F NZ   1  
ATOM 10149  H H    . LYS F 2 5   ? -4.534  -35.632 -12.755 1.00 20.41 ? 275 LYS F H    1  
ATOM 10150  H HA   . LYS F 2 5   ? -1.987  -36.439 -11.466 1.00 31.32 ? 275 LYS F HA   1  
ATOM 10151  H HB2  . LYS F 2 5   ? -2.790  -33.647 -12.426 1.00 23.20 ? 275 LYS F HB2  1  
ATOM 10152  H HB3  . LYS F 2 5   ? -1.264  -34.076 -11.657 1.00 31.12 ? 275 LYS F HB3  1  
ATOM 10153  H HG2  . LYS F 2 5   ? -0.849  -35.664 -13.615 1.00 44.25 ? 275 LYS F HG2  1  
ATOM 10154  H HG3  . LYS F 2 5   ? -2.258  -34.940 -14.387 1.00 64.31 ? 275 LYS F HG3  1  
ATOM 10155  H HD2  . LYS F 2 5   ? -0.265  -33.883 -15.265 1.00 11.32 ? 275 LYS F HD2  1  
ATOM 10156  H HD3  . LYS F 2 5   ? -1.126  -32.705 -14.272 1.00 23.35 ? 275 LYS F HD3  1  
ATOM 10157  H HE2  . LYS F 2 5   ? 0.440   -33.047 -12.437 1.00 62.53 ? 275 LYS F HE2  1  
ATOM 10158  H HE3  . LYS F 2 5   ? 1.241   -34.351 -13.316 1.00 4.33  ? 275 LYS F HE3  1  
ATOM 10159  H HZ1  . LYS F 2 5   ? 1.917   -32.761 -14.995 1.00 43.22 ? 275 LYS F HZ1  1  
ATOM 10160  H HZ2  . LYS F 2 5   ? 2.473   -32.289 -13.469 1.00 61.23 ? 275 LYS F HZ2  1  
ATOM 10161  H HZ3  . LYS F 2 5   ? 1.149   -31.503 -14.160 1.00 60.52 ? 275 LYS F HZ3  1  
ATOM 10162  N N    . PRO F 2 6   ? -3.264  -36.206 -9.224  1.00 0.43  ? 276 PRO F N    1  
ATOM 10163  C CA   . PRO F 2 6   ? -3.894  -35.992 -7.896  1.00 42.24 ? 276 PRO F CA   1  
ATOM 10164  C C    . PRO F 2 6   ? -3.367  -34.730 -7.184  1.00 62.43 ? 276 PRO F C    1  
ATOM 10165  O O    . PRO F 2 6   ? -2.193  -34.351 -7.342  1.00 13.35 ? 276 PRO F O    1  
ATOM 10166  C CB   . PRO F 2 6   ? -3.546  -37.285 -7.104  1.00 21.13 ? 276 PRO F CB   1  
ATOM 10167  C CG   . PRO F 2 6   ? -2.363  -37.864 -7.808  1.00 61.51 ? 276 PRO F CG   1  
ATOM 10168  C CD   . PRO F 2 6   ? -2.531  -37.502 -9.266  1.00 21.15 ? 276 PRO F CD   1  
ATOM 10169  H HA   . PRO F 2 6   ? -4.975  -35.914 -7.995  1.00 55.02 ? 276 PRO F HA   1  
ATOM 10170  H HB2  . PRO F 2 6   ? -3.318  -37.055 -6.064  1.00 2.53  ? 276 PRO F HB2  1  
ATOM 10171  H HB3  . PRO F 2 6   ? -4.377  -37.980 -7.144  1.00 52.03 ? 276 PRO F HB3  1  
ATOM 10172  H HG2  . PRO F 2 6   ? -1.449  -37.430 -7.409  1.00 20.51 ? 276 PRO F HG2  1  
ATOM 10173  H HG3  . PRO F 2 6   ? -2.343  -38.942 -7.690  1.00 43.43 ? 276 PRO F HG3  1  
ATOM 10174  H HD2  . PRO F 2 6   ? -1.564  -37.388 -9.745  1.00 61.43 ? 276 PRO F HD2  1  
ATOM 10175  H HD3  . PRO F 2 6   ? -3.116  -38.254 -9.786  1.00 54.44 ? 276 PRO F HD3  1  
ATOM 10176  N N    . LEU F 2 7   ? -4.278  -34.092 -6.423  1.00 31.21 ? 277 LEU F N    1  
ATOM 10177  C CA   . LEU F 2 7   ? -4.029  -32.846 -5.670  1.00 71.01 ? 277 LEU F CA   1  
ATOM 10178  C C    . LEU F 2 7   ? -3.638  -31.660 -6.592  1.00 5.15  ? 277 LEU F C    1  
ATOM 10179  O O    . LEU F 2 7   ? -2.957  -30.723 -6.159  1.00 53.11 ? 277 LEU F O    1  
ATOM 10180  C CB   . LEU F 2 7   ? -2.988  -33.073 -4.535  1.00 3.42  ? 277 LEU F CB   1  
ATOM 10181  C CG   . LEU F 2 7   ? -3.401  -34.054 -3.388  1.00 23.40 ? 277 LEU F CG   1  
ATOM 10182  C CD1  . LEU F 2 7   ? -2.224  -34.291 -2.409  1.00 52.51 ? 277 LEU F CD1  1  
ATOM 10183  C CD2  . LEU F 2 7   ? -4.668  -33.551 -2.641  1.00 64.25 ? 277 LEU F CD2  1  
ATOM 10184  H H    . LEU F 2 7   ? -5.168  -34.490 -6.357  1.00 4.03  ? 277 LEU F H    1  
ATOM 10185  H HA   . LEU F 2 7   ? -4.973  -32.587 -5.208  1.00 22.32 ? 277 LEU F HA   1  
ATOM 10186  H HB2  . LEU F 2 7   ? -2.078  -33.449 -4.993  1.00 34.31 ? 277 LEU F HB2  1  
ATOM 10187  H HB3  . LEU F 2 7   ? -2.761  -32.111 -4.087  1.00 4.24  ? 277 LEU F HB3  1  
ATOM 10188  H HG   . LEU F 2 7   ? -3.644  -35.013 -3.829  1.00 53.30 ? 277 LEU F HG   1  
ATOM 10189  H HD11 . LEU F 2 7   ? -2.524  -34.997 -1.648  1.00 1.54  ? 277 LEU F HD11 1  
ATOM 10190  H HD12 . LEU F 2 7   ? -1.936  -33.358 -1.938  1.00 33.22 ? 277 LEU F HD12 1  
ATOM 10191  H HD13 . LEU F 2 7   ? -1.379  -34.693 -2.952  1.00 42.05 ? 277 LEU F HD13 1  
ATOM 10192  H HD21 . LEU F 2 7   ? -4.474  -32.585 -2.186  1.00 52.11 ? 277 LEU F HD21 1  
ATOM 10193  H HD22 . LEU F 2 7   ? -4.944  -34.256 -1.868  1.00 54.43 ? 277 LEU F HD22 1  
ATOM 10194  H HD23 . LEU F 2 7   ? -5.490  -33.458 -3.339  1.00 61.15 ? 277 LEU F HD23 1  
ATOM 10195  N N    . LEU F 2 8   ? -4.119  -31.704 -7.848  1.00 44.03 ? 278 LEU F N    1  
ATOM 10196  C CA   . LEU F 2 8   ? -3.996  -30.589 -8.817  1.00 42.14 ? 278 LEU F CA   1  
ATOM 10197  C C    . LEU F 2 8   ? -4.934  -30.862 -10.025 1.00 24.45 ? 278 LEU F C    1  
ATOM 10198  O O    . LEU F 2 8   ? -5.643  -31.881 -10.044 1.00 34.20 ? 278 LEU F O    1  
ATOM 10199  C CB   . LEU F 2 8   ? -2.502  -30.381 -9.271  1.00 64.34 ? 278 LEU F CB   1  
ATOM 10200  C CG   . LEU F 2 8   ? -2.083  -28.906 -9.615  1.00 60.12 ? 278 LEU F CG   1  
ATOM 10201  C CD1  . LEU F 2 8   ? -2.208  -27.974 -8.376  1.00 72.31 ? 278 LEU F CD1  1  
ATOM 10202  C CD2  . LEU F 2 8   ? -0.653  -28.856 -10.213 1.00 20.14 ? 278 LEU F CD2  1  
ATOM 10203  H H    . LEU F 2 8   ? -4.574  -32.522 -8.142  1.00 5.33  ? 278 LEU F H    1  
ATOM 10204  H HA   . LEU F 2 8   ? -4.348  -29.692 -8.321  1.00 31.31 ? 278 LEU F HA   1  
ATOM 10205  H HB2  . LEU F 2 8   ? -1.853  -30.737 -8.476  1.00 64.31 ? 278 LEU F HB2  1  
ATOM 10206  H HB3  . LEU F 2 8   ? -2.318  -30.999 -10.146 1.00 33.11 ? 278 LEU F HB3  1  
ATOM 10207  H HG   . LEU F 2 8   ? -2.764  -28.522 -10.368 1.00 52.21 ? 278 LEU F HG   1  
ATOM 10208  H HD11 . LEU F 2 8   ? -1.550  -28.313 -7.586  1.00 4.42  ? 278 LEU F HD11 1  
ATOM 10209  H HD12 . LEU F 2 8   ? -3.228  -27.983 -8.012  1.00 31.21 ? 278 LEU F HD12 1  
ATOM 10210  H HD13 . LEU F 2 8   ? -1.946  -26.960 -8.651  1.00 44.25 ? 278 LEU F HD13 1  
ATOM 10211  H HD21 . LEU F 2 8   ? -0.397  -27.834 -10.457 1.00 64.45 ? 278 LEU F HD21 1  
ATOM 10212  H HD22 . LEU F 2 8   ? -0.617  -29.452 -11.115 1.00 70.31 ? 278 LEU F HD22 1  
ATOM 10213  H HD23 . LEU F 2 8   ? 0.062   -29.245 -9.499  1.00 35.45 ? 278 LEU F HD23 1  
ATOM 10214  N N    . GLY F 2 9   ? -4.978  -29.924 -10.999 1.00 40.55 ? 279 GLY F N    1  
ATOM 10215  C CA   . GLY F 2 9   ? -5.717  -30.138 -12.253 1.00 63.14 ? 279 GLY F CA   1  
ATOM 10216  C C    . GLY F 2 9   ? -6.149  -28.842 -12.940 1.00 32.30 ? 279 GLY F C    1  
ATOM 10217  O O    . GLY F 2 9   ? -7.230  -28.791 -13.524 1.00 41.33 ? 279 GLY F O    1  
ATOM 10218  H H    . GLY F 2 9   ? -4.524  -29.074 -10.854 1.00 40.41 ? 279 GLY F H    1  
ATOM 10219  H HA2  . GLY F 2 9   ? -5.084  -30.690 -12.937 1.00 62.12 ? 279 GLY F HA2  1  
ATOM 10220  H HA3  . GLY F 2 9   ? -6.600  -30.736 -12.049 1.00 4.05  ? 279 GLY F HA3  1  
ATOM 10221  N N    . LEU F 2 10  ? -5.293  -27.803 -12.882 1.00 35.10 ? 280 LEU F N    1  
ATOM 10222  C CA   . LEU F 2 10  ? -5.548  -26.480 -13.536 1.00 62.22 ? 280 LEU F CA   1  
ATOM 10223  C C    . LEU F 2 10  ? -4.225  -25.671 -13.490 1.00 71.22 ? 280 LEU F C    1  
ATOM 10224  O O    . LEU F 2 10  ? -3.268  -26.104 -12.830 1.00 44.01 ? 280 LEU F O    1  
ATOM 10225  C CB   . LEU F 2 10  ? -6.757  -25.722 -12.834 1.00 54.45 ? 280 LEU F CB   1  
ATOM 10226  C CG   . LEU F 2 10  ? -7.784  -24.919 -13.740 1.00 75.21 ? 280 LEU F CG   1  
ATOM 10227  C CD1  . LEU F 2 10  ? -7.224  -23.562 -14.238 1.00 71.12 ? 280 LEU F CD1  1  
ATOM 10228  C CD2  . LEU F 2 10  ? -8.287  -25.784 -14.925 1.00 62.03 ? 280 LEU F CD2  1  
ATOM 10229  H H    . LEU F 2 10  ? -4.447  -27.923 -12.398 1.00 3.03  ? 280 LEU F H    1  
ATOM 10230  H HA   . LEU F 2 10  ? -5.791  -26.671 -14.579 1.00 2.14  ? 280 LEU F HA   1  
ATOM 10231  H HB2  . LEU F 2 10  ? -7.331  -26.461 -12.281 1.00 63.50 ? 280 LEU F HB2  1  
ATOM 10232  H HB3  . LEU F 2 10  ? -6.348  -25.030 -12.103 1.00 10.33 ? 280 LEU F HB3  1  
ATOM 10233  H HG   . LEU F 2 10  ? -8.653  -24.683 -13.132 1.00 43.32 ? 280 LEU F HG   1  
ATOM 10234  H HD11 . LEU F 2 10  ? -6.928  -22.959 -13.389 1.00 21.34 ? 280 LEU F HD11 1  
ATOM 10235  H HD12 . LEU F 2 10  ? -7.983  -23.032 -14.797 1.00 3.33  ? 280 LEU F HD12 1  
ATOM 10236  H HD13 . LEU F 2 10  ? -6.362  -23.729 -14.875 1.00 75.32 ? 280 LEU F HD13 1  
ATOM 10237  H HD21 . LEU F 2 10  ? -7.462  -26.031 -15.580 1.00 65.13 ? 280 LEU F HD21 1  
ATOM 10238  H HD22 . LEU F 2 10  ? -9.037  -25.241 -15.487 1.00 23.43 ? 280 LEU F HD22 1  
ATOM 10239  H HD23 . LEU F 2 10  ? -8.729  -26.696 -14.546 1.00 61.45 ? 280 LEU F HD23 1  
ATOM 10240  N N    . PHE F 2 11  ? -4.180  -24.547 -14.241 1.00 74.24 ? 281 PHE F N    1  
ATOM 10241  C CA   . PHE F 2 11  ? -3.039  -23.587 -14.327 1.00 61.13 ? 281 PHE F CA   1  
ATOM 10242  C C    . PHE F 2 11  ? -1.962  -24.104 -15.280 1.00 1.01  ? 281 PHE F C    1  
ATOM 10243  O O    . PHE F 2 11  ? -1.680  -23.496 -16.321 1.00 34.21 ? 281 PHE F O    1  
ATOM 10244  C CB   . PHE F 2 11  ? -2.420  -23.222 -12.943 1.00 4.41  ? 281 PHE F CB   1  
ATOM 10245  C CG   . PHE F 2 11  ? -3.345  -22.472 -11.994 1.00 22.22 ? 281 PHE F CG   1  
ATOM 10246  C CD1  . PHE F 2 11  ? -4.388  -21.669 -12.473 1.00 74.34 ? 281 PHE F CD1  1  
ATOM 10247  C CD2  . PHE F 2 11  ? -3.137  -22.529 -10.623 1.00 33.43 ? 281 PHE F CD2  1  
ATOM 10248  C CE1  . PHE F 2 11  ? -5.184  -20.955 -11.608 1.00 33.41 ? 281 PHE F CE1  1  
ATOM 10249  C CE2  . PHE F 2 11  ? -3.939  -21.823 -9.763  1.00 3.33  ? 281 PHE F CE2  1  
ATOM 10250  C CZ   . PHE F 2 11  ? -4.954  -21.034 -10.252 1.00 53.35 ? 281 PHE F CZ   1  
ATOM 10251  H H    . PHE F 2 11  ? -4.950  -24.366 -14.816 1.00 13.22 ? 281 PHE F H    1  
ATOM 10252  H HA   . PHE F 2 11  ? -3.447  -22.682 -14.763 1.00 4.43  ? 281 PHE F HA   1  
ATOM 10253  H HB2  . PHE F 2 11  ? -2.109  -24.138 -12.453 1.00 51.14 ? 281 PHE F HB2  1  
ATOM 10254  H HB3  . PHE F 2 11  ? -1.541  -22.603 -13.099 1.00 43.01 ? 281 PHE F HB3  1  
ATOM 10255  H HD1  . PHE F 2 11  ? -4.567  -21.606 -13.542 1.00 32.23 ? 281 PHE F HD1  1  
ATOM 10256  H HD2  . PHE F 2 11  ? -2.339  -23.145 -10.229 1.00 24.53 ? 281 PHE F HD2  1  
ATOM 10257  H HE1  . PHE F 2 11  ? -5.987  -20.337 -11.988 1.00 70.34 ? 281 PHE F HE1  1  
ATOM 10258  H HE2  . PHE F 2 11  ? -3.767  -21.883 -8.697  1.00 13.54 ? 281 PHE F HE2  1  
ATOM 10259  H HZ   . PHE F 2 11  ? -5.574  -20.471 -9.567  1.00 42.24 ? 281 PHE F HZ   1  
ATOM 10260  N N    . ALA F 2 12  ? -1.389  -25.257 -14.921 1.00 2.12  ? 282 ALA F N    1  
ATOM 10261  C CA   . ALA F 2 12  ? -0.399  -25.969 -15.737 1.00 31.12 ? 282 ALA F CA   1  
ATOM 10262  C C    . ALA F 2 12  ? -1.030  -26.539 -17.028 1.00 73.31 ? 282 ALA F C    1  
ATOM 10263  O O    . ALA F 2 12  ? -0.323  -27.032 -17.908 1.00 22.34 ? 282 ALA F O    1  
ATOM 10264  C CB   . ALA F 2 12  ? 0.241   -27.072 -14.887 1.00 25.44 ? 282 ALA F CB   1  
ATOM 10265  H H    . ALA F 2 12  ? -1.633  -25.643 -14.057 1.00 10.02 ? 282 ALA F H    1  
ATOM 10266  H HA   . ALA F 2 12  ? 0.380   -25.264 -16.015 1.00 35.43 ? 282 ALA F HA   1  
ATOM 10267  H HB1  . ALA F 2 12  ? -0.510  -27.799 -14.604 1.00 61.22 ? 282 ALA F HB1  1  
ATOM 10268  H HB2  . ALA F 2 12  ? 0.672   -26.639 -13.996 1.00 24.01 ? 282 ALA F HB2  1  
ATOM 10269  H HB3  . ALA F 2 12  ? 1.020   -27.567 -15.454 1.00 43.04 ? 282 ALA F HB3  1  
ATOM 10270  N N    . ASP F 2 13  ? -2.373  -26.460 -17.121 1.00 50.44 ? 283 ASP F N    1  
ATOM 10271  C CA   . ASP F 2 13  ? -3.134  -26.885 -18.299 1.00 33.13 ? 283 ASP F CA   1  
ATOM 10272  C C    . ASP F 2 13  ? -2.865  -25.943 -19.496 1.00 51.41 ? 283 ASP F C    1  
ATOM 10273  O O    . ASP F 2 13  ? -2.835  -26.393 -20.641 1.00 53.00 ? 283 ASP F O    1  
ATOM 10274  C CB   . ASP F 2 13  ? -4.656  -26.943 -17.970 1.00 45.44 ? 283 ASP F CB   1  
ATOM 10275  C CG   . ASP F 2 13  ? -5.336  -25.557 -17.885 1.00 32.31 ? 283 ASP F CG   1  
ATOM 10276  O OD1  . ASP F 2 13  ? -4.948  -24.737 -17.027 1.00 2.14  ? 283 ASP F OD1  1  
ATOM 10277  O OD2  . ASP F 2 13  ? -6.254  -25.282 -18.690 1.00 63.12 ? 283 ASP F OD2  1  
ATOM 10278  H H    . ASP F 2 13  ? -2.869  -26.103 -16.357 1.00 24.24 ? 283 ASP F H    1  
ATOM 10279  H HA   . ASP F 2 13  ? -2.798  -27.883 -18.560 1.00 15.12 ? 283 ASP F HA   1  
ATOM 10280  H HB2  . ASP F 2 13  ? -5.155  -27.533 -18.735 1.00 53.12 ? 283 ASP F HB2  1  
ATOM 10281  H HB3  . ASP F 2 13  ? -4.791  -27.448 -17.019 1.00 55.14 ? 283 ASP F HB3  1  
ATOM 10282  N N    . GLY F 2 14  ? -2.678  -24.632 -19.211 1.00 70.14 ? 284 GLY F N    1  
ATOM 10283  C CA   . GLY F 2 14  ? -2.382  -23.639 -20.252 1.00 25.44 ? 284 GLY F CA   1  
ATOM 10284  C C    . GLY F 2 14  ? -2.555  -22.189 -19.809 1.00 2.51  ? 284 GLY F C    1  
ATOM 10285  O O    . GLY F 2 14  ? -2.412  -21.289 -20.648 1.00 61.13 ? 284 GLY F O    1  
ATOM 10286  H H    . GLY F 2 14  ? -2.752  -24.344 -18.280 1.00 65.24 ? 284 GLY F H    1  
ATOM 10287  H HA2  . GLY F 2 14  ? -1.359  -23.776 -20.582 1.00 74.30 ? 284 GLY F HA2  1  
ATOM 10288  H HA3  . GLY F 2 14  ? -3.038  -23.814 -21.097 1.00 24.44 ? 284 GLY F HA3  1  
ATOM 10289  N N    . ASN F 2 15  ? -2.861  -21.967 -18.499 1.00 21.12 ? 285 ASN F N    1  
ATOM 10290  C CA   . ASN F 2 15  ? -3.096  -20.622 -17.890 1.00 74.21 ? 285 ASN F CA   1  
ATOM 10291  C C    . ASN F 2 15  ? -4.397  -19.991 -18.440 1.00 53.03 ? 285 ASN F C    1  
ATOM 10292  O O    . ASN F 2 15  ? -4.501  -19.728 -19.645 1.00 71.42 ? 285 ASN F O    1  
ATOM 10293  C CB   . ASN F 2 15  ? -1.895  -19.636 -18.099 1.00 75.13 ? 285 ASN F CB   1  
ATOM 10294  C CG   . ASN F 2 15  ? -0.573  -20.107 -17.477 1.00 63.14 ? 285 ASN F CG   1  
ATOM 10295  O OD1  . ASN F 2 15  ? -0.552  -20.777 -16.449 1.00 2.50  ? 285 ASN F OD1  1  
ATOM 10296  N ND2  . ASN F 2 15  ? 0.539   -19.759 -18.102 1.00 32.32 ? 285 ASN F ND2  1  
ATOM 10297  H H    . ASN F 2 15  ? -2.944  -22.745 -17.914 1.00 40.21 ? 285 ASN F H    1  
ATOM 10298  H HA   . ASN F 2 15  ? -3.223  -20.790 -16.825 1.00 73.15 ? 285 ASN F HA   1  
ATOM 10299  H HB2  . ASN F 2 15  ? -1.740  -19.497 -19.164 1.00 0.22  ? 285 ASN F HB2  1  
ATOM 10300  H HB3  . ASN F 2 15  ? -2.150  -18.675 -17.661 1.00 43.12 ? 285 ASN F HB3  1  
ATOM 10301  H HD21 . ASN F 2 15  ? 0.465   -19.228 -18.923 1.00 35.21 ? 285 ASN F HD21 1  
ATOM 10302  H HD22 . ASN F 2 15  ? 1.396   -20.043 -17.716 1.00 42.20 ? 285 ASN F HD22 1  
ATOM 10303  N N    . MET F 2 16  ? -5.377  -19.740 -17.550 1.00 3.13  ? 286 MET F N    1  
ATOM 10304  C CA   . MET F 2 16  ? -6.686  -19.168 -17.935 1.00 53.44 ? 286 MET F CA   1  
ATOM 10305  C C    . MET F 2 16  ? -6.526  -17.686 -18.366 1.00 22.31 ? 286 MET F C    1  
ATOM 10306  O O    . MET F 2 16  ? -6.131  -16.846 -17.542 1.00 24.42 ? 286 MET F O    1  
ATOM 10307  C CB   . MET F 2 16  ? -7.702  -19.317 -16.768 1.00 22.23 ? 286 MET F CB   1  
ATOM 10308  C CG   . MET F 2 16  ? -9.122  -18.818 -17.087 1.00 20.44 ? 286 MET F CG   1  
ATOM 10309  S SD   . MET F 2 16  ? -10.300 -19.160 -15.757 1.00 21.51 ? 286 MET F SD   1  
ATOM 10310  C CE   . MET F 2 16  ? -11.804 -18.424 -16.406 1.00 24.10 ? 286 MET F CE   1  
ATOM 10311  H H    . MET F 2 16  ? -5.216  -19.941 -16.604 1.00 35.32 ? 286 MET F H    1  
ATOM 10312  H HA   . MET F 2 16  ? -7.048  -19.745 -18.780 1.00 50.30 ? 286 MET F HA   1  
ATOM 10313  H HB2  . MET F 2 16  ? -7.768  -20.365 -16.505 1.00 65.45 ? 286 MET F HB2  1  
ATOM 10314  H HB3  . MET F 2 16  ? -7.335  -18.770 -15.907 1.00 22.15 ? 286 MET F HB3  1  
ATOM 10315  H HG2  . MET F 2 16  ? -9.090  -17.748 -17.252 1.00 24.42 ? 286 MET F HG2  1  
ATOM 10316  H HG3  . MET F 2 16  ? -9.475  -19.303 -17.993 1.00 24.10 ? 286 MET F HG3  1  
ATOM 10317  H HE1  . MET F 2 16  ? -12.606 -18.557 -15.694 1.00 32.42 ? 286 MET F HE1  1  
ATOM 10318  H HE2  . MET F 2 16  ? -12.068 -18.901 -17.339 1.00 61.12 ? 286 MET F HE2  1  
ATOM 10319  H HE3  . MET F 2 16  ? -11.643 -17.369 -16.572 1.00 43.33 ? 286 MET F HE3  1  
ATOM 10320  N N    . PRO F 2 17  ? -6.806  -17.345 -19.677 1.00 54.32 ? 287 PRO F N    1  
ATOM 10321  C CA   . PRO F 2 17  ? -6.589  -15.979 -20.207 1.00 44.21 ? 287 PRO F CA   1  
ATOM 10322  C C    . PRO F 2 17  ? -7.674  -14.981 -19.730 1.00 74.23 ? 287 PRO F C    1  
ATOM 10323  O O    . PRO F 2 17  ? -8.859  -15.338 -19.609 1.00 73.11 ? 287 PRO F O    1  
ATOM 10324  C CB   . PRO F 2 17  ? -6.643  -16.198 -21.741 1.00 31.02 ? 287 PRO F CB   1  
ATOM 10325  C CG   . PRO F 2 17  ? -7.583  -17.349 -21.931 1.00 70.11 ? 287 PRO F CG   1  
ATOM 10326  C CD   . PRO F 2 17  ? -7.362  -18.258 -20.734 1.00 1.23  ? 287 PRO F CD   1  
ATOM 10327  H HA   . PRO F 2 17  ? -5.604  -15.606 -19.927 1.00 63.14 ? 287 PRO F HA   1  
ATOM 10328  H HB2  . PRO F 2 17  ? -7.000  -15.303 -22.246 1.00 1.41  ? 287 PRO F HB2  1  
ATOM 10329  H HB3  . PRO F 2 17  ? -5.659  -16.457 -22.115 1.00 35.32 ? 287 PRO F HB3  1  
ATOM 10330  H HG2  . PRO F 2 17  ? -8.610  -16.987 -21.957 1.00 11.33 ? 287 PRO F HG2  1  
ATOM 10331  H HG3  . PRO F 2 17  ? -7.353  -17.877 -22.849 1.00 3.02  ? 287 PRO F HG3  1  
ATOM 10332  H HD2  . PRO F 2 17  ? -8.299  -18.700 -20.412 1.00 4.53  ? 287 PRO F HD2  1  
ATOM 10333  H HD3  . PRO F 2 17  ? -6.648  -19.039 -20.974 1.00 21.31 ? 287 PRO F HD3  1  
ATOM 10334  N N    . VAL F 2 18  ? -7.256  -13.730 -19.454 1.00 21.11 ? 288 VAL F N    1  
ATOM 10335  C CA   . VAL F 2 18  ? -8.160  -12.649 -19.003 1.00 72.10 ? 288 VAL F CA   1  
ATOM 10336  C C    . VAL F 2 18  ? -8.219  -11.555 -20.086 1.00 12.34 ? 288 VAL F C    1  
ATOM 10337  O O    . VAL F 2 18  ? -7.177  -11.111 -20.587 1.00 51.55 ? 288 VAL F O    1  
ATOM 10338  C CB   . VAL F 2 18  ? -7.692  -12.026 -17.626 1.00 33.52 ? 288 VAL F CB   1  
ATOM 10339  C CG1  . VAL F 2 18  ? -8.670  -10.924 -17.134 1.00 21.41 ? 288 VAL F CG1  1  
ATOM 10340  C CG2  . VAL F 2 18  ? -7.509  -13.129 -16.550 1.00 53.13 ? 288 VAL F CG2  1  
ATOM 10341  H H    . VAL F 2 18  ? -6.307  -13.520 -19.568 1.00 5.34  ? 288 VAL F H    1  
ATOM 10342  H HA   . VAL F 2 18  ? -9.159  -13.066 -18.869 1.00 41.42 ? 288 VAL F HA   1  
ATOM 10343  H HB   . VAL F 2 18  ? -6.720  -11.555 -17.784 1.00 41.51 ? 288 VAL F HB   1  
ATOM 10344  H HG11 . VAL F 2 18  ? -8.733  -10.137 -17.875 1.00 32.42 ? 288 VAL F HG11 1  
ATOM 10345  H HG12 . VAL F 2 18  ? -8.312  -10.502 -16.205 1.00 14.32 ? 288 VAL F HG12 1  
ATOM 10346  H HG13 . VAL F 2 18  ? -9.657  -11.345 -16.977 1.00 73.01 ? 288 VAL F HG13 1  
ATOM 10347  H HG21 . VAL F 2 18  ? -7.164  -12.687 -15.623 1.00 50.23 ? 288 VAL F HG21 1  
ATOM 10348  H HG22 . VAL F 2 18  ? -6.776  -13.849 -16.888 1.00 50.31 ? 288 VAL F HG22 1  
ATOM 10349  H HG23 . VAL F 2 18  ? -8.450  -13.637 -16.373 1.00 10.52 ? 288 VAL F HG23 1  
ATOM 10350  N N    . ARG F 2 19  ? -9.443  -11.145 -20.448 1.00 4.32  ? 289 ARG F N    1  
ATOM 10351  C CA   . ARG F 2 19  ? -9.696  -10.106 -21.463 1.00 12.43 ? 289 ARG F CA   1  
ATOM 10352  C C    . ARG F 2 19  ? -10.139 -8.811  -20.760 1.00 21.02 ? 289 ARG F C    1  
ATOM 10353  O O    . ARG F 2 19  ? -10.808 -8.864  -19.719 1.00 44.24 ? 289 ARG F O    1  
ATOM 10354  C CB   . ARG F 2 19  ? -10.793 -10.606 -22.447 1.00 34.51 ? 289 ARG F CB   1  
ATOM 10355  C CG   . ARG F 2 19  ? -11.152 -9.622  -23.592 1.00 61.42 ? 289 ARG F CG   1  
ATOM 10356  C CD   . ARG F 2 19  ? -12.227 -10.178 -24.547 1.00 41.01 ? 289 ARG F CD   1  
ATOM 10357  N NE   . ARG F 2 19  ? -12.481 -9.280  -25.693 1.00 34.50 ? 289 ARG F NE   1  
ATOM 10358  C CZ   . ARG F 2 19  ? -13.158 -9.623  -26.810 1.00 34.30 ? 289 ARG F CZ   1  
ATOM 10359  N NH1  . ARG F 2 19  ? -13.671 -10.846 -26.944 1.00 54.24 ? 289 ARG F NH1  1  
ATOM 10360  N NH2  . ARG F 2 19  ? -13.314 -8.743  -27.790 1.00 23.42 ? 289 ARG F NH2  1  
ATOM 10361  H H    . ARG F 2 19  ? -10.215 -11.547 -20.002 1.00 34.23 ? 289 ARG F H    1  
ATOM 10362  H HA   . ARG F 2 19  ? -8.773  -9.921  -22.017 1.00 15.15 ? 289 ARG F HA   1  
ATOM 10363  H HB2  . ARG F 2 19  ? -10.447 -11.532 -22.894 1.00 53.14 ? 289 ARG F HB2  1  
ATOM 10364  H HB3  . ARG F 2 19  ? -11.696 -10.816 -21.882 1.00 13.53 ? 289 ARG F HB3  1  
ATOM 10365  H HG2  . ARG F 2 19  ? -11.524 -8.702  -23.155 1.00 24.33 ? 289 ARG F HG2  1  
ATOM 10366  H HG3  . ARG F 2 19  ? -10.256 -9.401  -24.163 1.00 72.13 ? 289 ARG F HG3  1  
ATOM 10367  H HD2  . ARG F 2 19  ? -11.900 -11.144 -24.922 1.00 32.23 ? 289 ARG F HD2  1  
ATOM 10368  H HD3  . ARG F 2 19  ? -13.152 -10.308 -23.996 1.00 54.40 ? 289 ARG F HD3  1  
ATOM 10369  H HE   . ARG F 2 19  ? -12.128 -8.363  -25.622 1.00 65.21 ? 289 ARG F HE   1  
ATOM 10370  H HH11 . ARG F 2 19  ? -13.552 -11.527 -26.213 1.00 43.52 ? 289 ARG F HH11 1  
ATOM 10371  H HH12 . ARG F 2 19  ? -14.173 -11.097 -27.773 1.00 71.55 ? 289 ARG F HH12 1  
ATOM 10372  H HH21 . ARG F 2 19  ? -12.931 -7.814  -27.709 1.00 53.43 ? 289 ARG F HH21 1  
ATOM 10373  H HH22 . ARG F 2 19  ? -13.816 -8.994  -28.622 1.00 54.02 ? 289 ARG F HH22 1  
ATOM 10374  N N    . TRP F 2 20  ? -9.750  -7.659  -21.330 1.00 52.41 ? 290 TRP F N    1  
ATOM 10375  C CA   . TRP F 2 20  ? -10.142 -6.335  -20.812 1.00 32.34 ? 290 TRP F CA   1  
ATOM 10376  C C    . TRP F 2 20  ? -11.591 -5.972  -21.175 1.00 5.32  ? 290 TRP F C    1  
ATOM 10377  O O    . TRP F 2 20  ? -12.201 -6.551  -22.081 1.00 72.23 ? 290 TRP F O    1  
ATOM 10378  C CB   . TRP F 2 20  ? -9.177  -5.228  -21.328 1.00 12.41 ? 290 TRP F CB   1  
ATOM 10379  C CG   . TRP F 2 20  ? -7.964  -5.013  -20.461 1.00 52.24 ? 290 TRP F CG   1  
ATOM 10380  C CD1  . TRP F 2 20  ? -6.685  -5.431  -20.688 1.00 3.45  ? 290 TRP F CD1  1  
ATOM 10381  C CD2  . TRP F 2 20  ? -7.941  -4.318  -19.210 1.00 31.11 ? 290 TRP F CD2  1  
ATOM 10382  N NE1  . TRP F 2 20  ? -5.868  -5.004  -19.675 1.00 10.21 ? 290 TRP F NE1  1  
ATOM 10383  C CE2  . TRP F 2 20  ? -6.619  -4.335  -18.751 1.00 62.13 ? 290 TRP F CE2  1  
ATOM 10384  C CE3  . TRP F 2 20  ? -8.918  -3.680  -18.436 1.00 23.42 ? 290 TRP F CE3  1  
ATOM 10385  C CZ2  . TRP F 2 20  ? -6.242  -3.741  -17.558 1.00 72.02 ? 290 TRP F CZ2  1  
ATOM 10386  C CZ3  . TRP F 2 20  ? -8.542  -3.093  -17.250 1.00 13.23 ? 290 TRP F CZ3  1  
ATOM 10387  C CH2  . TRP F 2 20  ? -7.215  -3.129  -16.827 1.00 1.42  ? 290 TRP F CH2  1  
ATOM 10388  H H    . TRP F 2 20  ? -9.172  -7.698  -22.122 1.00 22.31 ? 290 TRP F H    1  
ATOM 10389  H HA   . TRP F 2 20  ? -10.073 -6.379  -19.727 1.00 43.00 ? 290 TRP F HA   1  
ATOM 10390  H HB2  . TRP F 2 20  ? -8.836  -5.485  -22.325 1.00 60.53 ? 290 TRP F HB2  1  
ATOM 10391  H HB3  . TRP F 2 20  ? -9.702  -4.276  -21.388 1.00 71.40 ? 290 TRP F HB3  1  
ATOM 10392  H HD1  . TRP F 2 20  ? -6.366  -5.983  -21.561 1.00 30.45 ? 290 TRP F HD1  1  
ATOM 10393  H HE1  . TRP F 2 20  ? -4.904  -5.170  -19.614 1.00 22.24 ? 290 TRP F HE1  1  
ATOM 10394  H HE3  . TRP F 2 20  ? -9.952  -3.649  -18.751 1.00 30.42 ? 290 TRP F HE3  1  
ATOM 10395  H HZ2  . TRP F 2 20  ? -5.215  -3.754  -17.210 1.00 23.33 ? 290 TRP F HZ2  1  
ATOM 10396  H HZ3  . TRP F 2 20  ? -9.282  -2.594  -16.632 1.00 43.34 ? 290 TRP F HZ3  1  
ATOM 10397  H HH2  . TRP F 2 20  ? -6.964  -2.662  -15.892 1.00 43.32 ? 290 TRP F HH2  1  
ATOM 10398  N N    . LEU F 2 21  ? -12.108 -4.985  -20.429 1.00 43.22 ? 291 LEU F N    1  
ATOM 10399  C CA   . LEU F 2 21  ? -13.423 -4.371  -20.660 1.00 21.10 ? 291 LEU F CA   1  
ATOM 10400  C C    . LEU F 2 21  ? -13.222 -3.134  -21.550 1.00 10.01 ? 291 LEU F C    1  
ATOM 10401  O O    . LEU F 2 21  ? -13.937 -2.932  -22.534 1.00 71.32 ? 291 LEU F O    1  
ATOM 10402  C CB   . LEU F 2 21  ? -14.105 -3.968  -19.310 1.00 3.31  ? 291 LEU F CB   1  
ATOM 10403  C CG   . LEU F 2 21  ? -14.435 -5.129  -18.301 1.00 45.35 ? 291 LEU F CG   1  
ATOM 10404  C CD1  . LEU F 2 21  ? -13.164 -5.746  -17.661 1.00 51.20 ? 291 LEU F CD1  1  
ATOM 10405  C CD2  . LEU F 2 21  ? -15.417 -4.647  -17.210 1.00 34.20 ? 291 LEU F CD2  1  
ATOM 10406  H H    . LEU F 2 21  ? -11.572 -4.651  -19.683 1.00 44.41 ? 291 LEU F H    1  
ATOM 10407  H HA   . LEU F 2 21  ? -14.059 -5.088  -21.181 1.00 51.33 ? 291 LEU F HA   1  
ATOM 10408  H HB2  . LEU F 2 21  ? -13.462 -3.253  -18.803 1.00 50.31 ? 291 LEU F HB2  1  
ATOM 10409  H HB3  . LEU F 2 21  ? -15.037 -3.461  -19.550 1.00 22.41 ? 291 LEU F HB3  1  
ATOM 10410  H HG   . LEU F 2 21  ? -14.930 -5.925  -18.845 1.00 3.25  ? 291 LEU F HG   1  
ATOM 10411  H HD11 . LEU F 2 21  ? -12.513 -6.125  -18.438 1.00 22.40 ? 291 LEU F HD11 1  
ATOM 10412  H HD12 . LEU F 2 21  ? -13.444 -6.563  -17.010 1.00 10.42 ? 291 LEU F HD12 1  
ATOM 10413  H HD13 . LEU F 2 21  ? -12.637 -4.995  -17.085 1.00 53.35 ? 291 LEU F HD13 1  
ATOM 10414  H HD21 . LEU F 2 21  ? -16.333 -4.301  -17.672 1.00 21.03 ? 291 LEU F HD21 1  
ATOM 10415  H HD22 . LEU F 2 21  ? -14.976 -3.837  -16.641 1.00 21.21 ? 291 LEU F HD22 1  
ATOM 10416  H HD23 . LEU F 2 21  ? -15.649 -5.466  -16.542 1.00 60.24 ? 291 LEU F HD23 1  
ATOM 10417  N N    . GLY F 2 22  ? -12.205 -2.333  -21.188 1.00 15.24 ? 292 GLY F N    1  
ATOM 10418  C CA   . GLY F 2 22  ? -11.842 -1.125  -21.917 1.00 41.14 ? 292 GLY F CA   1  
ATOM 10419  C C    . GLY F 2 22  ? -10.766 -0.326  -21.174 1.00 33.41 ? 292 GLY F C    1  
ATOM 10420  O O    . GLY F 2 22  ? -10.994 0.057   -20.017 1.00 53.40 ? 292 GLY F O    1  
ATOM 10421  H H    . GLY F 2 22  ? -11.681 -2.581  -20.401 1.00 64.41 ? 292 GLY F H    1  
ATOM 10422  H HA2  . GLY F 2 22  ? -11.484 -1.403  -22.897 1.00 51.00 ? 292 GLY F HA2  1  
ATOM 10423  H HA3  . GLY F 2 22  ? -12.718 -0.496  -22.035 1.00 74.30 ? 292 GLY F HA3  1  
ATOM 10424  N N    . PRO F 2 23  ? -9.574  -0.043  -21.806 1.00 52.51 ? 293 PRO F N    1  
ATOM 10425  C CA   . PRO F 2 23  ? -8.499  0.786   -21.185 1.00 71.21 ? 293 PRO F CA   1  
ATOM 10426  C C    . PRO F 2 23  ? -8.821  2.303   -21.208 1.00 13.45 ? 293 PRO F C    1  
ATOM 10427  O O    . PRO F 2 23  ? -8.054  3.115   -20.681 1.00 21.31 ? 293 PRO F O    1  
ATOM 10428  C CB   . PRO F 2 23  ? -7.269  0.454   -22.065 1.00 43.14 ? 293 PRO F CB   1  
ATOM 10429  C CG   . PRO F 2 23  ? -7.835  0.168   -23.419 1.00 21.41 ? 293 PRO F CG   1  
ATOM 10430  C CD   . PRO F 2 23  ? -9.168  -0.515  -23.167 1.00 11.52 ? 293 PRO F CD   1  
ATOM 10431  H HA   . PRO F 2 23  ? -8.308  0.481   -20.162 1.00 43.40 ? 293 PRO F HA   1  
ATOM 10432  H HB2  . PRO F 2 23  ? -6.572  1.293   -22.093 1.00 44.12 ? 293 PRO F HB2  1  
ATOM 10433  H HB3  . PRO F 2 23  ? -6.761  -0.423  -21.682 1.00 70.24 ? 293 PRO F HB3  1  
ATOM 10434  H HG2  . PRO F 2 23  ? -7.975  1.100   -23.966 1.00 51.05 ? 293 PRO F HG2  1  
ATOM 10435  H HG3  . PRO F 2 23  ? -7.175  -0.490  -23.975 1.00 0.33  ? 293 PRO F HG3  1  
ATOM 10436  H HD2  . PRO F 2 23  ? -9.895  -0.214  -23.913 1.00 54.23 ? 293 PRO F HD2  1  
ATOM 10437  H HD3  . PRO F 2 23  ? -9.052  -1.593  -23.175 1.00 74.55 ? 293 PRO F HD3  1  
ATOM 10438  N N    . LYS F 2 24  ? -9.970  2.649   -21.828 1.00 61.22 ? 294 LYS F N    1  
ATOM 10439  C CA   . LYS F 2 24  ? -10.470 4.027   -21.955 1.00 43.15 ? 294 LYS F CA   1  
ATOM 10440  C C    . LYS F 2 24  ? -10.748 4.670   -20.582 1.00 20.52 ? 294 LYS F C    1  
ATOM 10441  O O    . LYS F 2 24  ? -10.543 5.871   -20.408 1.00 31.13 ? 294 LYS F O    1  
ATOM 10442  C CB   . LYS F 2 24  ? -11.763 4.020   -22.819 1.00 30.24 ? 294 LYS F CB   1  
ATOM 10443  C CG   . LYS F 2 24  ? -11.559 3.514   -24.269 1.00 53.14 ? 294 LYS F CG   1  
ATOM 10444  C CD   . LYS F 2 24  ? -12.875 3.484   -25.082 1.00 65.02 ? 294 LYS F CD   1  
ATOM 10445  C CE   . LYS F 2 24  ? -12.655 3.130   -26.565 1.00 12.24 ? 294 LYS F CE   1  
ATOM 10446  N NZ   . LYS F 2 24  ? -13.926 3.173   -27.339 1.00 44.44 ? 294 LYS F NZ   1  
ATOM 10447  H H    . LYS F 2 24  ? -10.504 1.935   -22.224 1.00 22.20 ? 294 LYS F H    1  
ATOM 10448  H HA   . LYS F 2 24  ? -9.710  4.610   -22.465 1.00 72.23 ? 294 LYS F HA   1  
ATOM 10449  H HB2  . LYS F 2 24  ? -12.501 3.385   -22.337 1.00 41.41 ? 294 LYS F HB2  1  
ATOM 10450  H HB3  . LYS F 2 24  ? -12.161 5.030   -22.868 1.00 14.34 ? 294 LYS F HB3  1  
ATOM 10451  H HG2  . LYS F 2 24  ? -10.854 4.170   -24.770 1.00 61.33 ? 294 LYS F HG2  1  
ATOM 10452  H HG3  . LYS F 2 24  ? -11.144 2.511   -24.236 1.00 32.11 ? 294 LYS F HG3  1  
ATOM 10453  H HD2  . LYS F 2 24  ? -13.542 2.746   -24.646 1.00 62.33 ? 294 LYS F HD2  1  
ATOM 10454  H HD3  . LYS F 2 24  ? -13.348 4.459   -25.025 1.00 4.40  ? 294 LYS F HD3  1  
ATOM 10455  H HE2  . LYS F 2 24  ? -11.960 3.837   -27.001 1.00 63.45 ? 294 LYS F HE2  1  
ATOM 10456  H HE3  . LYS F 2 24  ? -12.238 2.131   -26.635 1.00 73.34 ? 294 LYS F HE3  1  
ATOM 10457  H HZ1  . LYS F 2 24  ? -13.733 3.050   -28.353 1.00 32.55 ? 294 LYS F HZ1  1  
ATOM 10458  H HZ2  . LYS F 2 24  ? -14.401 4.087   -27.199 1.00 62.31 ? 294 LYS F HZ2  1  
ATOM 10459  H HZ3  . LYS F 2 24  ? -14.563 2.413   -27.024 1.00 42.43 ? 294 LYS F HZ3  1  
ATOM 10460  N N    . ALA F 2 25  ? -11.179 3.834   -19.619 1.00 61.11 ? 295 ALA F N    1  
ATOM 10461  C CA   . ALA F 2 25  ? -11.580 4.267   -18.261 1.00 3.34  ? 295 ALA F CA   1  
ATOM 10462  C C    . ALA F 2 25  ? -10.383 4.752   -17.417 1.00 52.45 ? 295 ALA F C    1  
ATOM 10463  O O    . ALA F 2 25  ? -10.572 5.423   -16.395 1.00 63.24 ? 295 ALA F O    1  
ATOM 10464  C CB   . ALA F 2 25  ? -12.309 3.110   -17.548 1.00 61.01 ? 295 ALA F CB   1  
ATOM 10465  H H    . ALA F 2 25  ? -11.224 2.879   -19.832 1.00 50.23 ? 295 ALA F H    1  
ATOM 10466  H HA   . ALA F 2 25  ? -12.286 5.088   -18.368 1.00 53.43 ? 295 ALA F HA   1  
ATOM 10467  H HB1  . ALA F 2 25  ? -11.634 2.269   -17.422 1.00 42.43 ? 295 ALA F HB1  1  
ATOM 10468  H HB2  . ALA F 2 25  ? -13.157 2.794   -18.142 1.00 21.23 ? 295 ALA F HB2  1  
ATOM 10469  H HB3  . ALA F 2 25  ? -12.659 3.435   -16.577 1.00 65.45 ? 295 ALA F HB3  1  
ATOM 10470  N N    . THR F 2 26  ? -9.160  4.401   -17.849 1.00 3.15  ? 296 THR F N    1  
ATOM 10471  C CA   . THR F 2 26  ? -7.917  4.717   -17.126 1.00 32.14 ? 296 THR F CA   1  
ATOM 10472  C C    . THR F 2 26  ? -6.935  5.472   -18.049 1.00 4.31  ? 296 THR F C    1  
ATOM 10473  O O    . THR F 2 26  ? -7.004  5.354   -19.279 1.00 11.30 ? 296 THR F O    1  
ATOM 10474  C CB   . THR F 2 26  ? -7.259  3.393   -16.589 1.00 55.44 ? 296 THR F CB   1  
ATOM 10475  O OG1  . THR F 2 26  ? -8.235  2.634   -15.848 1.00 1.21  ? 296 THR F OG1  1  
ATOM 10476  C CG2  . THR F 2 26  ? -6.038  3.659   -15.677 1.00 41.40 ? 296 THR F CG2  1  
ATOM 10477  H H    . THR F 2 26  ? -9.086  3.908   -18.694 1.00 12.02 ? 296 THR F H    1  
ATOM 10478  H HA   . THR F 2 26  ? -8.153  5.356   -16.273 1.00 71.02 ? 296 THR F HA   1  
ATOM 10479  H HB   . THR F 2 26  ? -6.939  2.796   -17.438 1.00 34.42 ? 296 THR F HB   1  
ATOM 10480  H HG1  . THR F 2 26  ? -8.979  3.202   -15.623 1.00 64.34 ? 296 THR F HG1  1  
ATOM 10481  H HG21 . THR F 2 26  ? -5.282  4.204   -16.227 1.00 52.35 ? 296 THR F HG21 1  
ATOM 10482  H HG22 . THR F 2 26  ? -5.622  2.720   -15.339 1.00 4.42  ? 296 THR F HG22 1  
ATOM 10483  H HG23 . THR F 2 26  ? -6.345  4.241   -14.816 1.00 54.21 ? 296 THR F HG23 1  
ATOM 10484  N N    . TYR F 2 27  ? -6.079  6.305   -17.422 1.00 63.41 ? 297 TYR F N    1  
ATOM 10485  C CA   . TYR F 2 27  ? -4.879  6.889   -18.046 1.00 44.43 ? 297 TYR F CA   1  
ATOM 10486  C C    . TYR F 2 27  ? -5.254  7.942   -19.109 1.00 42.22 ? 297 TYR F C    1  
ATOM 10487  O O    . TYR F 2 27  ? -4.810  7.873   -20.253 1.00 55.53 ? 297 TYR F O    1  
ATOM 10488  C CB   . TYR F 2 27  ? -3.948  5.763   -18.618 1.00 50.03 ? 297 TYR F CB   1  
ATOM 10489  C CG   . TYR F 2 27  ? -2.456  6.123   -18.679 1.00 25.42 ? 297 TYR F CG   1  
ATOM 10490  C CD1  . TYR F 2 27  ? -1.654  5.982   -17.551 1.00 71.24 ? 297 TYR F CD1  1  
ATOM 10491  C CD2  . TYR F 2 27  ? -1.841  6.583   -19.854 1.00 74.50 ? 297 TYR F CD2  1  
ATOM 10492  C CE1  . TYR F 2 27  ? -0.313  6.272   -17.585 1.00 50.23 ? 297 TYR F CE1  1  
ATOM 10493  C CE2  . TYR F 2 27  ? -0.494  6.877   -19.884 1.00 12.02 ? 297 TYR F CE2  1  
ATOM 10494  C CZ   . TYR F 2 27  ? 0.261   6.719   -18.744 1.00 74.00 ? 297 TYR F CZ   1  
ATOM 10495  O OH   . TYR F 2 27  ? 1.602   6.986   -18.770 1.00 31.23 ? 297 TYR F OH   1  
ATOM 10496  H H    . TYR F 2 27  ? -6.274  6.546   -16.491 1.00 21.41 ? 297 TYR F H    1  
ATOM 10497  H HA   . TYR F 2 27  ? -4.347  7.401   -17.252 1.00 1.11  ? 297 TYR F HA   1  
ATOM 10498  H HB2  . TYR F 2 27  ? -4.042  4.876   -17.998 1.00 3.31  ? 297 TYR F HB2  1  
ATOM 10499  H HB3  . TYR F 2 27  ? -4.273  5.506   -19.622 1.00 71.44 ? 297 TYR F HB3  1  
ATOM 10500  H HD1  . TYR F 2 27  ? -2.098  5.632   -16.627 1.00 33.01 ? 297 TYR F HD1  1  
ATOM 10501  H HD2  . TYR F 2 27  ? -2.436  6.704   -20.753 1.00 24.51 ? 297 TYR F HD2  1  
ATOM 10502  H HE1  . TYR F 2 27  ? 0.284   6.152   -16.694 1.00 5.42  ? 297 TYR F HE1  1  
ATOM 10503  H HE2  . TYR F 2 27  ? -0.036  7.230   -20.802 1.00 22.13 ? 297 TYR F HE2  1  
ATOM 10504  H HH   . TYR F 2 27  ? 2.080   6.284   -18.318 1.00 1.53  ? 297 TYR F HH   1  
ATOM 10505  N N    . HIS F 2 28  ? -6.106  8.905   -18.709 1.00 53.54 ? 298 HIS F N    1  
ATOM 10506  C CA   . HIS F 2 28  ? -6.428  10.108  -19.529 1.00 45.03 ? 298 HIS F CA   1  
ATOM 10507  C C    . HIS F 2 28  ? -5.479  11.277  -19.147 1.00 42.23 ? 298 HIS F C    1  
ATOM 10508  O O    . HIS F 2 28  ? -5.604  12.405  -19.640 1.00 22.34 ? 298 HIS F O    1  
ATOM 10509  C CB   . HIS F 2 28  ? -7.926  10.489  -19.344 1.00 34.02 ? 298 HIS F CB   1  
ATOM 10510  C CG   . HIS F 2 28  ? -8.418  11.619  -20.222 1.00 21.15 ? 298 HIS F CG   1  
ATOM 10511  N ND1  . HIS F 2 28  ? -8.510  11.519  -21.589 1.00 14.01 ? 298 HIS F ND1  1  
ATOM 10512  C CD2  . HIS F 2 28  ? -8.829  12.877  -19.918 1.00 4.21  ? 298 HIS F CD2  1  
ATOM 10513  C CE1  . HIS F 2 28  ? -8.953  12.653  -22.089 1.00 33.14 ? 298 HIS F CE1  1  
ATOM 10514  N NE2  . HIS F 2 28  ? -9.153  13.491  -21.099 1.00 62.43 ? 298 HIS F NE2  1  
ATOM 10515  H H    . HIS F 2 28  ? -6.535  8.807   -17.834 1.00 54.34 ? 298 HIS F H    1  
ATOM 10516  H HA   . HIS F 2 28  ? -6.256  9.865   -20.575 1.00 62.22 ? 298 HIS F HA   1  
ATOM 10517  H HB2  . HIS F 2 28  ? -8.535  9.619   -19.559 1.00 75.10 ? 298 HIS F HB2  1  
ATOM 10518  H HB3  . HIS F 2 28  ? -8.092  10.772  -18.311 1.00 11.30 ? 298 HIS F HB3  1  
ATOM 10519  H HD1  . HIS F 2 28  ? -8.243  10.749  -22.122 1.00 41.12 ? 298 HIS F HD1  1  
ATOM 10520  H HD2  . HIS F 2 28  ? -8.886  13.314  -18.927 1.00 33.32 ? 298 HIS F HD2  1  
ATOM 10521  H HE1  . HIS F 2 28  ? -9.132  12.858  -23.136 1.00 54.00 ? 298 HIS F HE1  1  
ATOM 10522  H HE2  . HIS F 2 28  ? -9.433  14.426  -21.199 1.00 37.99 ? 298 HIS F HE2  1  
ATOM 10523  N N    . GLY F 2 29  ? -4.502  10.973  -18.274 1.00 10.53 ? 299 GLY F N    1  
ATOM 10524  C CA   . GLY F 2 29  ? -3.494  11.932  -17.848 1.00 20.15 ? 299 GLY F CA   1  
ATOM 10525  C C    . GLY F 2 29  ? -3.593  12.239  -16.369 1.00 61.11 ? 299 GLY F C    1  
ATOM 10526  O O    . GLY F 2 29  ? -4.696  12.316  -15.813 1.00 32.33 ? 299 GLY F O    1  
ATOM 10527  H H    . GLY F 2 29  ? -4.467  10.066  -17.914 1.00 0.02  ? 299 GLY F H    1  
ATOM 10528  H HA2  . GLY F 2 29  ? -2.519  11.511  -18.059 1.00 53.40 ? 299 GLY F HA2  1  
ATOM 10529  H HA3  . GLY F 2 29  ? -3.591  12.860  -18.404 1.00 42.44 ? 299 GLY F HA3  1  
ATOM 10530  N N    . ASN F 2 30  ? -2.431  12.349  -15.718 1.00 43.44 ? 300 ASN F N    1  
ATOM 10531  C CA   . ASN F 2 30  ? -2.313  12.880  -14.350 1.00 72.31 ? 300 ASN F CA   1  
ATOM 10532  C C    . ASN F 2 30  ? -1.181  13.921  -14.312 1.00 34.13 ? 300 ASN F C    1  
ATOM 10533  O O    . ASN F 2 30  ? -1.163  14.790  -13.437 1.00 65.24 ? 300 ASN F O    1  
ATOM 10534  C CB   . ASN F 2 30  ? -2.056  11.746  -13.321 1.00 62.30 ? 300 ASN F CB   1  
ATOM 10535  C CG   . ASN F 2 30  ? -2.215  12.196  -11.862 1.00 3.34  ? 300 ASN F CG   1  
ATOM 10536  O OD1  . ASN F 2 30  ? -1.256  12.616  -11.214 1.00 51.55 ? 300 ASN F OD1  1  
ATOM 10537  N ND2  . ASN F 2 30  ? -3.436  12.129  -11.343 1.00 72.51 ? 300 ASN F ND2  1  
ATOM 10538  H H    . ASN F 2 30  ? -1.616  12.060  -16.176 1.00 40.43 ? 300 ASN F H    1  
ATOM 10539  H HA   . ASN F 2 30  ? -3.250  13.385  -14.099 1.00 73.33 ? 300 ASN F HA   1  
ATOM 10540  H HB2  . ASN F 2 30  ? -2.756  10.939  -13.507 1.00 55.11 ? 300 ASN F HB2  1  
ATOM 10541  H HB3  . ASN F 2 30  ? -1.049  11.358  -13.455 1.00 41.41 ? 300 ASN F HB3  1  
ATOM 10542  H HD21 . ASN F 2 30  ? -4.163  11.799  -11.912 1.00 12.30 ? 300 ASN F HD21 1  
ATOM 10543  H HD22 . ASN F 2 30  ? -3.566  12.409  -10.412 1.00 65.31 ? 300 ASN F HD22 1  
ATOM 10544  N N    . ILE F 2 31  ? -0.253  13.825  -15.298 1.00 62.32 ? 301 ILE F N    1  
ATOM 10545  C CA   . ILE F 2 31  ? 0.957   14.656  -15.376 1.00 71.41 ? 301 ILE F CA   1  
ATOM 10546  C C    . ILE F 2 31  ? 0.899   15.542  -16.644 1.00 25.54 ? 301 ILE F C    1  
ATOM 10547  O O    . ILE F 2 31  ? 1.496   15.217  -17.675 1.00 15.11 ? 301 ILE F O    1  
ATOM 10548  C CB   . ILE F 2 31  ? 2.301   13.795  -15.393 1.00 50.11 ? 301 ILE F CB   1  
ATOM 10549  C CG1  . ILE F 2 31  ? 2.285   12.602  -14.356 1.00 52.44 ? 301 ILE F CG1  1  
ATOM 10550  C CG2  . ILE F 2 31  ? 3.527   14.708  -15.165 1.00 71.21 ? 301 ILE F CG2  1  
ATOM 10551  C CD1  . ILE F 2 31  ? 1.656   11.310  -14.878 1.00 4.43  ? 301 ILE F CD1  1  
ATOM 10552  H H    . ILE F 2 31  ? -0.402  13.180  -16.013 1.00 24.42 ? 301 ILE F H    1  
ATOM 10553  H HA   . ILE F 2 31  ? 0.986   15.313  -14.502 1.00 12.35 ? 301 ILE F HA   1  
ATOM 10554  H HB   . ILE F 2 31  ? 2.406   13.369  -16.394 1.00 50.25 ? 301 ILE F HB   1  
ATOM 10555  H HG12 . ILE F 2 31  ? 3.298   12.357  -14.063 1.00 63.01 ? 301 ILE F HG12 1  
ATOM 10556  H HG13 . ILE F 2 31  ? 1.732   12.900  -13.471 1.00 1.14  ? 301 ILE F HG13 1  
ATOM 10557  H HG21 . ILE F 2 31  ? 3.569   15.463  -15.943 1.00 30.21 ? 301 ILE F HG21 1  
ATOM 10558  H HG22 . ILE F 2 31  ? 4.433   14.122  -15.197 1.00 25.53 ? 301 ILE F HG22 1  
ATOM 10559  H HG23 . ILE F 2 31  ? 3.450   15.194  -14.201 1.00 51.31 ? 301 ILE F HG23 1  
ATOM 10560  H HD11 . ILE F 2 31  ? 2.195   10.975  -15.755 1.00 25.12 ? 301 ILE F HD11 1  
ATOM 10561  H HD12 . ILE F 2 31  ? 0.619   11.484  -15.135 1.00 55.20 ? 301 ILE F HD12 1  
ATOM 10562  H HD13 . ILE F 2 31  ? 1.710   10.548  -14.114 1.00 2.22  ? 301 ILE F HD13 1  
ATOM 10563  N N    . ASP F 2 32  ? 0.128   16.628  -16.576 1.00 21.23 ? 302 ASP F N    1  
ATOM 10564  C CA   . ASP F 2 32  ? 0.197   17.725  -17.574 1.00 43.31 ? 302 ASP F CA   1  
ATOM 10565  C C    . ASP F 2 32  ? 1.093   18.831  -17.006 1.00 64.44 ? 302 ASP F C    1  
ATOM 10566  O O    . ASP F 2 32  ? 1.387   18.815  -15.795 1.00 14.31 ? 302 ASP F O    1  
ATOM 10567  C CB   . ASP F 2 32  ? -1.215  18.267  -17.935 1.00 2.15  ? 302 ASP F CB   1  
ATOM 10568  C CG   . ASP F 2 32  ? -2.000  18.820  -16.728 1.00 2.31  ? 302 ASP F CG   1  
ATOM 10569  O OD1  . ASP F 2 32  ? -2.378  18.021  -15.850 1.00 41.24 ? 302 ASP F OD1  1  
ATOM 10570  O OD2  . ASP F 2 32  ? -2.280  20.041  -16.667 1.00 11.21 ? 302 ASP F OD2  1  
ATOM 10571  H H    . ASP F 2 32  ? -0.492  16.717  -15.823 1.00 41.42 ? 302 ASP F H    1  
ATOM 10572  H HA   . ASP F 2 32  ? 0.668   17.337  -18.478 1.00 63.21 ? 302 ASP F HA   1  
ATOM 10573  H HB2  . ASP F 2 32  ? -1.108  19.053  -18.679 1.00 43.22 ? 302 ASP F HB2  1  
ATOM 10574  H HB3  . ASP F 2 32  ? -1.793  17.463  -18.379 1.00 45.33 ? 302 ASP F HB3  1  
ATOM 10575  N N    . LYS F 2 33  ? 1.538   19.773  -17.886 1.00 64.43 ? 303 LYS F N    1  
ATOM 10576  C CA   . LYS F 2 33  ? 2.419   20.909  -17.489 1.00 75.22 ? 303 LYS F CA   1  
ATOM 10577  C C    . LYS F 2 33  ? 3.820   20.354  -17.027 1.00 4.20  ? 303 LYS F C    1  
ATOM 10578  O O    . LYS F 2 33  ? 4.136   19.197  -17.357 1.00 13.32 ? 303 LYS F O    1  
ATOM 10579  C CB   . LYS F 2 33  ? 1.655   21.764  -16.402 1.00 1.32  ? 303 LYS F CB   1  
ATOM 10580  C CG   . LYS F 2 33  ? 0.305   22.329  -16.892 1.00 1.34  ? 303 LYS F CG   1  
ATOM 10581  C CD   . LYS F 2 33  ? -0.474  23.097  -15.805 1.00 44.44 ? 303 LYS F CD   1  
ATOM 10582  C CE   . LYS F 2 33  ? -1.835  23.604  -16.323 1.00 14.34 ? 303 LYS F CE   1  
ATOM 10583  N NZ   . LYS F 2 33  ? -2.582  24.351  -15.282 1.00 52.01 ? 303 LYS F NZ   1  
ATOM 10584  H H    . LYS F 2 33  ? 1.266   19.699  -18.826 1.00 12.51 ? 303 LYS F H    1  
ATOM 10585  H HA   . LYS F 2 33  ? 2.575   21.512  -18.376 1.00 22.53 ? 303 LYS F HA   1  
ATOM 10586  H HB2  . LYS F 2 33  ? 1.471   21.138  -15.533 1.00 32.04 ? 303 LYS F HB2  1  
ATOM 10587  H HB3  . LYS F 2 33  ? 2.284   22.593  -16.102 1.00 72.01 ? 303 LYS F HB3  1  
ATOM 10588  H HG2  . LYS F 2 33  ? 0.491   23.000  -17.725 1.00 53.54 ? 303 LYS F HG2  1  
ATOM 10589  H HG3  . LYS F 2 33  ? -0.308  21.501  -17.242 1.00 62.41 ? 303 LYS F HG3  1  
ATOM 10590  H HD2  . LYS F 2 33  ? -0.646  22.437  -14.958 1.00 33.30 ? 303 LYS F HD2  1  
ATOM 10591  H HD3  . LYS F 2 33  ? 0.116   23.945  -15.479 1.00 14.42 ? 303 LYS F HD3  1  
ATOM 10592  H HE2  . LYS F 2 33  ? -1.674  24.255  -17.172 1.00 42.51 ? 303 LYS F HE2  1  
ATOM 10593  H HE3  . LYS F 2 33  ? -2.431  22.753  -16.633 1.00 52.04 ? 303 LYS F HE3  1  
ATOM 10594  H HZ1  . LYS F 2 33  ? -2.776  23.731  -14.469 1.00 1.33  ? 303 LYS F HZ1  1  
ATOM 10595  H HZ2  . LYS F 2 33  ? -3.483  24.691  -15.661 1.00 62.52 ? 303 LYS F HZ2  1  
ATOM 10596  H HZ3  . LYS F 2 33  ? -2.027  25.165  -14.955 1.00 22.20 ? 303 LYS F HZ3  1  
ATOM 10597  N N    . PRO F 2 34  ? 4.732   21.126  -16.318 1.00 62.31 ? 304 PRO F N    1  
ATOM 10598  C CA   . PRO F 2 34  ? 5.908   20.511  -15.615 1.00 73.13 ? 304 PRO F CA   1  
ATOM 10599  C C    . PRO F 2 34  ? 5.531   19.713  -14.327 1.00 3.35  ? 304 PRO F C    1  
ATOM 10600  O O    . PRO F 2 34  ? 6.410   19.452  -13.499 1.00 24.23 ? 304 PRO F O    1  
ATOM 10601  C CB   . PRO F 2 34  ? 6.816   21.744  -15.285 1.00 71.12 ? 304 PRO F CB   1  
ATOM 10602  C CG   . PRO F 2 34  ? 6.285   22.869  -16.130 1.00 11.34 ? 304 PRO F CG   1  
ATOM 10603  C CD   . PRO F 2 34  ? 4.808   22.612  -16.252 1.00 31.11 ? 304 PRO F CD   1  
ATOM 10604  H HA   . PRO F 2 34  ? 6.447   19.840  -16.280 1.00 73.54 ? 304 PRO F HA   1  
ATOM 10605  H HB2  . PRO F 2 34  ? 6.758   21.994  -14.221 1.00 71.12 ? 304 PRO F HB2  1  
ATOM 10606  H HB3  . PRO F 2 34  ? 7.841   21.530  -15.548 1.00 22.15 ? 304 PRO F HB3  1  
ATOM 10607  H HG2  . PRO F 2 34  ? 6.470   23.824  -15.642 1.00 51.34 ? 304 PRO F HG2  1  
ATOM 10608  H HG3  . PRO F 2 34  ? 6.748   22.859  -17.114 1.00 41.34 ? 304 PRO F HG3  1  
ATOM 10609  H HD2  . PRO F 2 34  ? 4.275   22.986  -15.381 1.00 50.35 ? 304 PRO F HD2  1  
ATOM 10610  H HD3  . PRO F 2 34  ? 4.414   23.061  -17.154 1.00 5.34  ? 304 PRO F HD3  1  
ATOM 10611  N N    . ALA F 2 35  ? 4.235   19.299  -14.207 1.00 44.52 ? 305 ALA F N    1  
ATOM 10612  C CA   . ALA F 2 35  ? 3.663   18.580  -13.047 1.00 31.43 ? 305 ALA F CA   1  
ATOM 10613  C C    . ALA F 2 35  ? 3.618   19.474  -11.792 1.00 64.33 ? 305 ALA F C    1  
ATOM 10614  O O    . ALA F 2 35  ? 2.549   19.961  -11.392 1.00 52.23 ? 305 ALA F O    1  
ATOM 10615  C CB   . ALA F 2 35  ? 4.387   17.243  -12.771 1.00 12.51 ? 305 ALA F CB   1  
ATOM 10616  H H    . ALA F 2 35  ? 3.632   19.486  -14.943 1.00 72.13 ? 305 ALA F H    1  
ATOM 10617  H HA   . ALA F 2 35  ? 2.633   18.339  -13.318 1.00 31.03 ? 305 ALA F HA   1  
ATOM 10618  H HB1  . ALA F 2 35  ? 4.408   16.651  -13.674 1.00 33.12 ? 305 ALA F HB1  1  
ATOM 10619  H HB2  . ALA F 2 35  ? 3.866   16.693  -12.000 1.00 41.11 ? 305 ALA F HB2  1  
ATOM 10620  H HB3  . ALA F 2 35  ? 5.403   17.436  -12.449 1.00 0.11  ? 305 ALA F HB3  1  
ATOM 10621  N N    . VAL F 2 36  ? 4.785   19.667  -11.176 1.00 22.13 ? 306 VAL F N    1  
ATOM 10622  C CA   . VAL F 2 36  ? 4.985   20.622  -10.084 1.00 54.33 ? 306 VAL F CA   1  
ATOM 10623  C C    . VAL F 2 36  ? 5.857   21.746  -10.667 1.00 71.54 ? 306 VAL F C    1  
ATOM 10624  O O    . VAL F 2 36  ? 6.988   21.495  -11.065 1.00 72.02 ? 306 VAL F O    1  
ATOM 10625  C CB   . VAL F 2 36  ? 5.695   19.939  -8.841  1.00 41.21 ? 306 VAL F CB   1  
ATOM 10626  C CG1  . VAL F 2 36  ? 5.869   20.928  -7.663  1.00 12.10 ? 306 VAL F CG1  1  
ATOM 10627  C CG2  . VAL F 2 36  ? 4.950   18.646  -8.390  1.00 31.34 ? 306 VAL F CG2  1  
ATOM 10628  H H    . VAL F 2 36  ? 5.566   19.158  -11.490 1.00 13.30 ? 306 VAL F H    1  
ATOM 10629  H HA   . VAL F 2 36  ? 4.019   21.025  -9.770  1.00 74.24 ? 306 VAL F HA   1  
ATOM 10630  H HB   . VAL F 2 36  ? 6.694   19.638  -9.160  1.00 72.13 ? 306 VAL F HB   1  
ATOM 10631  H HG11 . VAL F 2 36  ? 4.900   21.267  -7.312  1.00 40.44 ? 306 VAL F HG11 1  
ATOM 10632  H HG12 . VAL F 2 36  ? 6.446   21.784  -7.989  1.00 10.34 ? 306 VAL F HG12 1  
ATOM 10633  H HG13 . VAL F 2 36  ? 6.393   20.442  -6.850  1.00 13.12 ? 306 VAL F HG13 1  
ATOM 10634  H HG21 . VAL F 2 36  ? 3.943   18.885  -8.070  1.00 35.35 ? 306 VAL F HG21 1  
ATOM 10635  H HG22 . VAL F 2 36  ? 5.482   18.180  -7.569  1.00 31.41 ? 306 VAL F HG22 1  
ATOM 10636  H HG23 . VAL F 2 36  ? 4.903   17.946  -9.216  1.00 51.33 ? 306 VAL F HG23 1  
ATOM 10637  N N    . THR F 2 37  ? 5.296   22.955  -10.795 1.00 73.54 ? 307 THR F N    1  
ATOM 10638  C CA   . THR F 2 37  ? 6.003   24.105  -11.389 1.00 24.33 ? 307 THR F CA   1  
ATOM 10639  C C    . THR F 2 37  ? 6.889   24.820  -10.338 1.00 32.02 ? 307 THR F C    1  
ATOM 10640  O O    . THR F 2 37  ? 7.886   25.460  -10.690 1.00 22.21 ? 307 THR F O    1  
ATOM 10641  C CB   . THR F 2 37  ? 4.965   25.103  -12.008 1.00 1.12  ? 307 THR F CB   1  
ATOM 10642  O OG1  . THR F 2 37  ? 4.045   24.371  -12.839 1.00 4.14  ? 307 THR F OG1  1  
ATOM 10643  C CG2  . THR F 2 37  ? 5.621   26.222  -12.850 1.00 3.10  ? 307 THR F CG2  1  
ATOM 10644  H H    . THR F 2 37  ? 4.373   23.078  -10.503 1.00 3.23  ? 307 THR F H    1  
ATOM 10645  H HA   . THR F 2 37  ? 6.642   23.737  -12.195 1.00 42.41 ? 307 THR F HA   1  
ATOM 10646  H HB   . THR F 2 37  ? 4.401   25.562  -11.199 1.00 65.44 ? 307 THR F HB   1  
ATOM 10647  H HG1  . THR F 2 37  ? 4.012   24.770  -13.718 1.00 3.34  ? 307 THR F HG1  1  
ATOM 10648  H HG21 . THR F 2 37  ? 6.185   25.789  -13.667 1.00 31.20 ? 307 THR F HG21 1  
ATOM 10649  H HG22 . THR F 2 37  ? 6.286   26.809  -12.229 1.00 24.42 ? 307 THR F HG22 1  
ATOM 10650  H HG23 . THR F 2 37  ? 4.851   26.867  -13.251 1.00 53.22 ? 307 THR F HG23 1  
ATOM 10651  N N    . CYS F 2 38  ? 6.539   24.678  -9.043  1.00 74.22 ? 308 CYS F N    1  
ATOM 10652  C CA   . CYS F 2 38  ? 7.244   25.370  -7.940  1.00 13.43 ? 308 CYS F CA   1  
ATOM 10653  C C    . CYS F 2 38  ? 7.311   24.483  -6.683  1.00 14.14 ? 308 CYS F C    1  
ATOM 10654  O O    . CYS F 2 38  ? 6.333   23.815  -6.333  1.00 23.15 ? 308 CYS F O    1  
ATOM 10655  C CB   . CYS F 2 38  ? 6.541   26.709  -7.627  1.00 31.45 ? 308 CYS F CB   1  
ATOM 10656  S SG   . CYS F 2 38  ? 6.452   27.819  -9.050  1.00 71.04 ? 308 CYS F SG   1  
ATOM 10657  H H    . CYS F 2 38  ? 5.803   24.078  -8.822  1.00 41.24 ? 308 CYS F H    1  
ATOM 10658  H HA   . CYS F 2 38  ? 8.259   25.580  -8.269  1.00 42.03 ? 308 CYS F HA   1  
ATOM 10659  H HB2  . CYS F 2 38  ? 5.529   26.522  -7.294  1.00 32.22 ? 308 CYS F HB2  1  
ATOM 10660  H HB3  . CYS F 2 38  ? 7.080   27.229  -6.845  1.00 63.03 ? 308 CYS F HB3  1  
ATOM 10661  H HG   . CYS F 2 38  ? 7.440   27.485  -9.877  1.00 11.25 ? 308 CYS F HG   1  
ATOM 10662  N N    . THR F 2 39  ? 8.472   24.509  -6.000  1.00 42.45 ? 309 THR F N    1  
ATOM 10663  C CA   . THR F 2 39  ? 8.734   23.698  -4.799  1.00 43.14 ? 309 THR F CA   1  
ATOM 10664  C C    . THR F 2 39  ? 9.160   24.614  -3.624  1.00 44.02 ? 309 THR F C    1  
ATOM 10665  O O    . THR F 2 39  ? 10.219  25.248  -3.703  1.00 12.44 ? 309 THR F O    1  
ATOM 10666  C CB   . THR F 2 39  ? 9.852   22.651  -5.101  1.00 63.43 ? 309 THR F CB   1  
ATOM 10667  O OG1  . THR F 2 39  ? 9.483   21.885  -6.261  1.00 1.04  ? 309 THR F OG1  1  
ATOM 10668  C CG2  . THR F 2 39  ? 10.101  21.691  -3.921  1.00 23.42 ? 309 THR F CG2  1  
ATOM 10669  H H    . THR F 2 39  ? 9.185   25.101  -6.315  1.00 71.11 ? 309 THR F H    1  
ATOM 10670  H HA   . THR F 2 39  ? 7.828   23.158  -4.533  1.00 33.13 ? 309 THR F HA   1  
ATOM 10671  H HB   . THR F 2 39  ? 10.774  23.179  -5.324  1.00 72.54 ? 309 THR F HB   1  
ATOM 10672  H HG1  . THR F 2 39  ? 8.524   21.868  -6.346  1.00 14.41 ? 309 THR F HG1  1  
ATOM 10673  H HG21 . THR F 2 39  ? 10.414  22.250  -3.049  1.00 54.34 ? 309 THR F HG21 1  
ATOM 10674  H HG22 . THR F 2 39  ? 10.874  20.978  -4.183  1.00 25.32 ? 309 THR F HG22 1  
ATOM 10675  H HG23 . THR F 2 39  ? 9.188   21.155  -3.689  1.00 41.03 ? 309 THR F HG23 1  
ATOM 10676  N N    . PRO F 2 40  ? 8.316   24.730  -2.539  1.00 25.13 ? 310 PRO F N    1  
ATOM 10677  C CA   . PRO F 2 40  ? 8.658   25.498  -1.311  1.00 44.11 ? 310 PRO F CA   1  
ATOM 10678  C C    . PRO F 2 40  ? 9.703   24.740  -0.435  1.00 11.11 ? 310 PRO F C    1  
ATOM 10679  O O    . PRO F 2 40  ? 10.910  25.055  -0.522  1.00 73.14 ? 310 PRO F O    1  
ATOM 10680  C CB   . PRO F 2 40  ? 7.270   25.664  -0.587  1.00 22.02 ? 310 PRO F CB   1  
ATOM 10681  C CG   . PRO F 2 40  ? 6.239   25.159  -1.566  1.00 72.31 ? 310 PRO F CG   1  
ATOM 10682  C CD   . PRO F 2 40  ? 6.956   24.145  -2.422  1.00 31.31 ? 310 PRO F CD   1  
ATOM 10683  O OXT  . PRO F 2 40  ? 9.311   23.807  0.295   1.00 37.99 ? 310 PRO F OXT  1  
ATOM 10684  H HA   . PRO F 2 40  ? 9.052   26.479  -1.571  1.00 53.23 ? 310 PRO F HA   1  
ATOM 10685  H HB2  . PRO F 2 40  ? 7.247   25.077  0.336   1.00 71.34 ? 310 PRO F HB2  1  
ATOM 10686  H HB3  . PRO F 2 40  ? 7.090   26.703  -0.357  1.00 63.10 ? 310 PRO F HB3  1  
ATOM 10687  H HG2  . PRO F 2 40  ? 5.410   24.695  -1.035  1.00 34.11 ? 310 PRO F HG2  1  
ATOM 10688  H HG3  . PRO F 2 40  ? 5.873   25.975  -2.183  1.00 4.33  ? 310 PRO F HG3  1  
ATOM 10689  H HD2  . PRO F 2 40  ? 6.995   23.175  -1.930  1.00 30.42 ? 310 PRO F HD2  1  
ATOM 10690  H HD3  . PRO F 2 40  ? 6.478   24.056  -3.389  1.00 40.33 ? 310 PRO F HD3  1  
ATOM 10691  N N    . ALA G 2 1   ? 32.430  25.933  -28.261 1.00 31.41 ? 271 ALA G N    1  
ATOM 10692  C CA   . ALA G 2 1   ? 31.120  25.496  -27.735 1.00 33.24 ? 271 ALA G CA   1  
ATOM 10693  C C    . ALA G 2 1   ? 31.321  24.307  -26.782 1.00 41.01 ? 271 ALA G C    1  
ATOM 10694  O O    . ALA G 2 1   ? 31.614  23.197  -27.222 1.00 52.12 ? 271 ALA G O    1  
ATOM 10695  C CB   . ALA G 2 1   ? 30.162  25.141  -28.889 1.00 4.51  ? 271 ALA G CB   1  
ATOM 10696  H H1   . ALA G 2 1   ? 32.883  25.157  -28.787 1.00 37.99 ? 271 ALA G H1   1  
ATOM 10697  H H2   . ALA G 2 1   ? 33.051  26.211  -27.476 1.00 37.99 ? 271 ALA G H2   1  
ATOM 10698  H H3   . ALA G 2 1   ? 32.310  26.745  -28.897 1.00 37.99 ? 271 ALA G H3   1  
ATOM 10699  H HA   . ALA G 2 1   ? 30.690  26.328  -27.179 1.00 40.11 ? 271 ALA G HA   1  
ATOM 10700  H HB1  . ALA G 2 1   ? 30.041  25.998  -29.536 1.00 44.21 ? 271 ALA G HB1  1  
ATOM 10701  H HB2  . ALA G 2 1   ? 29.195  24.860  -28.491 1.00 41.20 ? 271 ALA G HB2  1  
ATOM 10702  H HB3  . ALA G 2 1   ? 30.564  24.314  -29.462 1.00 20.41 ? 271 ALA G HB3  1  
ATOM 10703  N N    . ASN G 2 2   ? 31.211  24.579  -25.475 1.00 13.11 ? 272 ASN G N    1  
ATOM 10704  C CA   . ASN G 2 2   ? 31.356  23.579  -24.399 1.00 30.52 ? 272 ASN G CA   1  
ATOM 10705  C C    . ASN G 2 2   ? 30.749  24.184  -23.122 1.00 61.25 ? 272 ASN G C    1  
ATOM 10706  O O    . ASN G 2 2   ? 31.297  25.135  -22.552 1.00 44.52 ? 272 ASN G O    1  
ATOM 10707  C CB   . ASN G 2 2   ? 32.859  23.191  -24.194 1.00 61.14 ? 272 ASN G CB   1  
ATOM 10708  C CG   . ASN G 2 2   ? 33.130  22.092  -23.146 1.00 24.43 ? 272 ASN G CG   1  
ATOM 10709  O OD1  . ASN G 2 2   ? 32.422  21.948  -22.156 1.00 31.15 ? 272 ASN G OD1  1  
ATOM 10710  N ND2  . ASN G 2 2   ? 34.180  21.320  -23.351 1.00 3.23  ? 272 ASN G ND2  1  
ATOM 10711  H H    . ASN G 2 2   ? 31.020  25.504  -25.213 1.00 3.23  ? 272 ASN G H    1  
ATOM 10712  H HA   . ASN G 2 2   ? 30.789  22.692  -24.682 1.00 1.34  ? 272 ASN G HA   1  
ATOM 10713  H HB2  . ASN G 2 2   ? 33.253  22.854  -25.144 1.00 41.44 ? 272 ASN G HB2  1  
ATOM 10714  H HB3  . ASN G 2 2   ? 33.410  24.076  -23.896 1.00 32.42 ? 272 ASN G HB3  1  
ATOM 10715  H HD21 . ASN G 2 2   ? 34.729  21.484  -24.149 1.00 4.45  ? 272 ASN G HD21 1  
ATOM 10716  H HD22 . ASN G 2 2   ? 34.369  20.619  -22.697 1.00 72.55 ? 272 ASN G HD22 1  
ATOM 10717  N N    . GLN G 2 3   ? 29.607  23.635  -22.708 1.00 72.15 ? 273 GLN G N    1  
ATOM 10718  C CA   . GLN G 2 3   ? 28.846  24.104  -21.537 1.00 21.04 ? 273 GLN G CA   1  
ATOM 10719  C C    . GLN G 2 3   ? 28.259  22.874  -20.815 1.00 50.45 ? 273 GLN G C    1  
ATOM 10720  O O    . GLN G 2 3   ? 28.270  21.771  -21.381 1.00 74.30 ? 273 GLN G O    1  
ATOM 10721  C CB   . GLN G 2 3   ? 27.728  25.093  -22.010 1.00 3.42  ? 273 GLN G CB   1  
ATOM 10722  C CG   . GLN G 2 3   ? 27.007  25.883  -20.897 1.00 2.32  ? 273 GLN G CG   1  
ATOM 10723  C CD   . GLN G 2 3   ? 27.960  26.716  -20.031 1.00 14.42 ? 273 GLN G CD   1  
ATOM 10724  O OE1  . GLN G 2 3   ? 28.431  26.262  -18.987 1.00 23.32 ? 273 GLN G OE1  1  
ATOM 10725  N NE2  . GLN G 2 3   ? 28.282  27.916  -20.480 1.00 32.22 ? 273 GLN G NE2  1  
ATOM 10726  H H    . GLN G 2 3   ? 29.251  22.872  -23.215 1.00 64.42 ? 273 GLN G H    1  
ATOM 10727  H HA   . GLN G 2 3   ? 29.526  24.616  -20.861 1.00 24.32 ? 273 GLN G HA   1  
ATOM 10728  H HB2  . GLN G 2 3   ? 28.171  25.814  -22.692 1.00 41.34 ? 273 GLN G HB2  1  
ATOM 10729  H HB3  . GLN G 2 3   ? 26.981  24.531  -22.563 1.00 13.23 ? 273 GLN G HB3  1  
ATOM 10730  H HG2  . GLN G 2 3   ? 26.279  26.545  -21.354 1.00 70.22 ? 273 GLN G HG2  1  
ATOM 10731  H HG3  . GLN G 2 3   ? 26.483  25.182  -20.258 1.00 51.34 ? 273 GLN G HG3  1  
ATOM 10732  H HE21 . GLN G 2 3   ? 27.901  28.210  -21.336 1.00 22.21 ? 273 GLN G HE21 1  
ATOM 10733  H HE22 . GLN G 2 3   ? 28.888  28.461  -19.944 1.00 43.13 ? 273 GLN G HE22 1  
ATOM 10734  N N    . GLN G 2 4   ? 27.774  23.071  -19.566 1.00 23.22 ? 274 GLN G N    1  
ATOM 10735  C CA   . GLN G 2 4   ? 27.126  22.018  -18.741 1.00 43.12 ? 274 GLN G CA   1  
ATOM 10736  C C    . GLN G 2 4   ? 28.166  20.961  -18.291 1.00 53.01 ? 274 GLN G C    1  
ATOM 10737  O O    . GLN G 2 4   ? 27.862  19.767  -18.187 1.00 74.31 ? 274 GLN G O    1  
ATOM 10738  C CB   . GLN G 2 4   ? 25.910  21.364  -19.493 1.00 13.54 ? 274 GLN G CB   1  
ATOM 10739  C CG   . GLN G 2 4   ? 24.864  22.372  -20.033 1.00 75.40 ? 274 GLN G CG   1  
ATOM 10740  C CD   . GLN G 2 4   ? 23.720  21.744  -20.844 1.00 33.50 ? 274 GLN G CD   1  
ATOM 10741  O OE1  . GLN G 2 4   ? 22.615  22.282  -20.875 1.00 31.43 ? 274 GLN G OE1  1  
ATOM 10742  N NE2  . GLN G 2 4   ? 23.966  20.619  -21.508 1.00 33.50 ? 274 GLN G NE2  1  
ATOM 10743  H H    . GLN G 2 4   ? 27.868  23.962  -19.174 1.00 4.11  ? 274 GLN G H    1  
ATOM 10744  H HA   . GLN G 2 4   ? 26.755  22.508  -17.847 1.00 74.43 ? 274 GLN G HA   1  
ATOM 10745  H HB2  . GLN G 2 4   ? 26.289  20.791  -20.333 1.00 13.13 ? 274 GLN G HB2  1  
ATOM 10746  H HB3  . GLN G 2 4   ? 25.406  20.683  -18.813 1.00 54.51 ? 274 GLN G HB3  1  
ATOM 10747  H HG2  . GLN G 2 4   ? 24.432  22.900  -19.188 1.00 53.54 ? 274 GLN G HG2  1  
ATOM 10748  H HG3  . GLN G 2 4   ? 25.372  23.090  -20.664 1.00 11.25 ? 274 GLN G HG3  1  
ATOM 10749  H HE21 . GLN G 2 4   ? 24.866  20.232  -21.461 1.00 20.33 ? 274 GLN G HE21 1  
ATOM 10750  H HE22 . GLN G 2 4   ? 23.232  20.213  -22.015 1.00 44.44 ? 274 GLN G HE22 1  
ATOM 10751  N N    . LYS G 2 5   ? 29.375  21.454  -17.955 1.00 71.43 ? 275 LYS G N    1  
ATOM 10752  C CA   . LYS G 2 5   ? 30.547  20.611  -17.622 1.00 41.51 ? 275 LYS G CA   1  
ATOM 10753  C C    . LYS G 2 5   ? 30.353  19.876  -16.253 1.00 72.41 ? 275 LYS G C    1  
ATOM 10754  O O    . LYS G 2 5   ? 30.516  18.655  -16.203 1.00 14.04 ? 275 LYS G O    1  
ATOM 10755  C CB   . LYS G 2 5   ? 31.847  21.467  -17.622 1.00 3.42  ? 275 LYS G CB   1  
ATOM 10756  C CG   . LYS G 2 5   ? 32.062  22.370  -18.874 1.00 71.11 ? 275 LYS G CG   1  
ATOM 10757  C CD   . LYS G 2 5   ? 33.000  23.561  -18.558 1.00 52.42 ? 275 LYS G CD   1  
ATOM 10758  C CE   . LYS G 2 5   ? 32.370  24.518  -17.528 1.00 61.44 ? 275 LYS G CE   1  
ATOM 10759  N NZ   . LYS G 2 5   ? 33.362  25.414  -16.894 1.00 31.25 ? 275 LYS G NZ   1  
ATOM 10760  H H    . LYS G 2 5   ? 29.479  22.426  -17.913 1.00 14.12 ? 275 LYS G H    1  
ATOM 10761  H HA   . LYS G 2 5   ? 30.636  19.859  -18.403 1.00 3.31  ? 275 LYS G HA   1  
ATOM 10762  H HB2  . LYS G 2 5   ? 31.835  22.097  -16.742 1.00 53.13 ? 275 LYS G HB2  1  
ATOM 10763  H HB3  . LYS G 2 5   ? 32.701  20.797  -17.541 1.00 71.14 ? 275 LYS G HB3  1  
ATOM 10764  H HG2  . LYS G 2 5   ? 32.502  21.777  -19.671 1.00 61.13 ? 275 LYS G HG2  1  
ATOM 10765  H HG3  . LYS G 2 5   ? 31.104  22.756  -19.211 1.00 52.21 ? 275 LYS G HG3  1  
ATOM 10766  H HD2  . LYS G 2 5   ? 33.937  23.181  -18.163 1.00 4.14  ? 275 LYS G HD2  1  
ATOM 10767  H HD3  . LYS G 2 5   ? 33.199  24.109  -19.472 1.00 42.22 ? 275 LYS G HD3  1  
ATOM 10768  H HE2  . LYS G 2 5   ? 31.625  25.128  -18.019 1.00 33.33 ? 275 LYS G HE2  1  
ATOM 10769  H HE3  . LYS G 2 5   ? 31.891  23.935  -16.747 1.00 33.21 ? 275 LYS G HE3  1  
ATOM 10770  H HZ1  . LYS G 2 5   ? 33.849  25.983  -17.612 1.00 1.44  ? 275 LYS G HZ1  1  
ATOM 10771  H HZ2  . LYS G 2 5   ? 34.067  24.850  -16.371 1.00 21.44 ? 275 LYS G HZ2  1  
ATOM 10772  H HZ3  . LYS G 2 5   ? 32.892  26.053  -16.223 1.00 62.30 ? 275 LYS G HZ3  1  
ATOM 10773  N N    . PRO G 2 6   ? 30.008  20.580  -15.099 1.00 33.25 ? 276 PRO G N    1  
ATOM 10774  C CA   . PRO G 2 6   ? 29.674  19.886  -13.836 1.00 13.40 ? 276 PRO G CA   1  
ATOM 10775  C C    . PRO G 2 6   ? 28.165  19.575  -13.711 1.00 41.01 ? 276 PRO G C    1  
ATOM 10776  O O    . PRO G 2 6   ? 27.746  18.908  -12.754 1.00 75.13 ? 276 PRO G O    1  
ATOM 10777  C CB   . PRO G 2 6   ? 30.139  20.910  -12.780 1.00 2.41  ? 276 PRO G CB   1  
ATOM 10778  C CG   . PRO G 2 6   ? 29.823  22.244  -13.392 1.00 65.33 ? 276 PRO G CG   1  
ATOM 10779  C CD   . PRO G 2 6   ? 29.950  22.068  -14.899 1.00 13.34 ? 276 PRO G CD   1  
ATOM 10780  H HA   . PRO G 2 6   ? 30.235  18.961  -13.721 1.00 3.24  ? 276 PRO G HA   1  
ATOM 10781  H HB2  . PRO G 2 6   ? 29.607  20.764  -11.837 1.00 53.11 ? 276 PRO G HB2  1  
ATOM 10782  H HB3  . PRO G 2 6   ? 31.205  20.817  -12.614 1.00 23.22 ? 276 PRO G HB3  1  
ATOM 10783  H HG2  . PRO G 2 6   ? 28.808  22.536  -13.126 1.00 74.32 ? 276 PRO G HG2  1  
ATOM 10784  H HG3  . PRO G 2 6   ? 30.523  22.995  -13.044 1.00 44.51 ? 276 PRO G HG3  1  
ATOM 10785  H HD2  . PRO G 2 6   ? 29.084  22.481  -15.409 1.00 0.23  ? 276 PRO G HD2  1  
ATOM 10786  H HD3  . PRO G 2 6   ? 30.854  22.540  -15.267 1.00 15.35 ? 276 PRO G HD3  1  
ATOM 10787  N N    . LEU G 2 7   ? 27.361  20.062  -14.691 1.00 61.22 ? 277 LEU G N    1  
ATOM 10788  C CA   . LEU G 2 7   ? 25.903  19.924  -14.669 1.00 12.23 ? 277 LEU G CA   1  
ATOM 10789  C C    . LEU G 2 7   ? 25.510  18.484  -15.021 1.00 70.11 ? 277 LEU G C    1  
ATOM 10790  O O    . LEU G 2 7   ? 25.448  18.108  -16.200 1.00 54.31 ? 277 LEU G O    1  
ATOM 10791  C CB   . LEU G 2 7   ? 25.216  20.956  -15.611 1.00 60.41 ? 277 LEU G CB   1  
ATOM 10792  C CG   . LEU G 2 7   ? 25.374  22.463  -15.209 1.00 2.21  ? 277 LEU G CG   1  
ATOM 10793  C CD1  . LEU G 2 7   ? 24.709  23.404  -16.243 1.00 43.13 ? 277 LEU G CD1  1  
ATOM 10794  C CD2  . LEU G 2 7   ? 24.822  22.725  -13.790 1.00 2.41  ? 277 LEU G CD2  1  
ATOM 10795  H H    . LEU G 2 7   ? 27.774  20.490  -15.465 1.00 44.43 ? 277 LEU G H    1  
ATOM 10796  H HA   . LEU G 2 7   ? 25.578  20.130  -13.651 1.00 52.14 ? 277 LEU G HA   1  
ATOM 10797  H HB2  . LEU G 2 7   ? 25.622  20.821  -16.608 1.00 64.33 ? 277 LEU G HB2  1  
ATOM 10798  H HB3  . LEU G 2 7   ? 24.153  20.730  -15.652 1.00 43.43 ? 277 LEU G HB3  1  
ATOM 10799  H HG   . LEU G 2 7   ? 26.431  22.705  -15.193 1.00 71.41 ? 277 LEU G HG   1  
ATOM 10800  H HD11 . LEU G 2 7   ? 23.644  23.206  -16.298 1.00 72.44 ? 277 LEU G HD11 1  
ATOM 10801  H HD12 . LEU G 2 7   ? 25.149  23.237  -17.216 1.00 51.12 ? 277 LEU G HD12 1  
ATOM 10802  H HD13 . LEU G 2 7   ? 24.870  24.435  -15.958 1.00 70.51 ? 277 LEU G HD13 1  
ATOM 10803  H HD21 . LEU G 2 7   ? 24.948  23.769  -13.537 1.00 14.11 ? 277 LEU G HD21 1  
ATOM 10804  H HD22 . LEU G 2 7   ? 25.369  22.126  -13.074 1.00 34.32 ? 277 LEU G HD22 1  
ATOM 10805  H HD23 . LEU G 2 7   ? 23.771  22.465  -13.740 1.00 62.23 ? 277 LEU G HD23 1  
ATOM 10806  N N    . LEU G 2 8   ? 25.341  17.687  -13.948 1.00 63.01 ? 278 LEU G N    1  
ATOM 10807  C CA   . LEU G 2 8   ? 24.829  16.317  -13.982 1.00 44.40 ? 278 LEU G CA   1  
ATOM 10808  C C    . LEU G 2 8   ? 25.884  15.324  -14.534 1.00 32.04 ? 278 LEU G C    1  
ATOM 10809  O O    . LEU G 2 8   ? 25.881  14.982  -15.721 1.00 31.15 ? 278 LEU G O    1  
ATOM 10810  C CB   . LEU G 2 8   ? 23.471  16.226  -14.738 1.00 51.24 ? 278 LEU G CB   1  
ATOM 10811  C CG   . LEU G 2 8   ? 22.701  14.890  -14.565 1.00 10.20 ? 278 LEU G CG   1  
ATOM 10812  C CD1  . LEU G 2 8   ? 22.280  14.666  -13.093 1.00 73.15 ? 278 LEU G CD1  1  
ATOM 10813  C CD2  . LEU G 2 8   ? 21.500  14.810  -15.525 1.00 2.13  ? 278 LEU G CD2  1  
ATOM 10814  H H    . LEU G 2 8   ? 25.604  18.051  -13.076 1.00 50.14 ? 278 LEU G H    1  
ATOM 10815  H HA   . LEU G 2 8   ? 24.648  16.052  -12.946 1.00 32.20 ? 278 LEU G HA   1  
ATOM 10816  H HB2  . LEU G 2 8   ? 22.832  17.039  -14.399 1.00 30.11 ? 278 LEU G HB2  1  
ATOM 10817  H HB3  . LEU G 2 8   ? 23.666  16.378  -15.797 1.00 2.42  ? 278 LEU G HB3  1  
ATOM 10818  H HG   . LEU G 2 8   ? 23.370  14.077  -14.824 1.00 23.13 ? 278 LEU G HG   1  
ATOM 10819  H HD11 . LEU G 2 8   ? 21.766  13.718  -13.001 1.00 32.34 ? 278 LEU G HD11 1  
ATOM 10820  H HD12 . LEU G 2 8   ? 21.621  15.461  -12.768 1.00 33.42 ? 278 LEU G HD12 1  
ATOM 10821  H HD13 . LEU G 2 8   ? 23.159  14.652  -12.461 1.00 62.10 ? 278 LEU G HD13 1  
ATOM 10822  H HD21 . LEU G 2 8   ? 21.844  14.919  -16.546 1.00 73.40 ? 278 LEU G HD21 1  
ATOM 10823  H HD22 . LEU G 2 8   ? 20.790  15.595  -15.304 1.00 60.24 ? 278 LEU G HD22 1  
ATOM 10824  H HD23 . LEU G 2 8   ? 21.013  13.849  -15.421 1.00 64.34 ? 278 LEU G HD23 1  
ATOM 10825  N N    . GLY G 2 9   ? 26.820  14.920  -13.653 1.00 50.45 ? 279 GLY G N    1  
ATOM 10826  C CA   . GLY G 2 9   ? 27.821  13.898  -13.958 1.00 32.02 ? 279 GLY G CA   1  
ATOM 10827  C C    . GLY G 2 9   ? 28.959  13.885  -12.937 1.00 70.41 ? 279 GLY G C    1  
ATOM 10828  O O    . GLY G 2 9   ? 30.133  13.974  -13.312 1.00 72.15 ? 279 GLY G O    1  
ATOM 10829  H H    . GLY G 2 9   ? 26.845  15.349  -12.783 1.00 4.32  ? 279 GLY G H    1  
ATOM 10830  H HA2  . GLY G 2 9   ? 27.342  12.925  -13.958 1.00 3.05  ? 279 GLY G HA2  1  
ATOM 10831  H HA3  . GLY G 2 9   ? 28.233  14.085  -14.947 1.00 31.33 ? 279 GLY G HA3  1  
ATOM 10832  N N    . LEU G 2 10  ? 28.612  13.782  -11.629 1.00 55.13 ? 280 LEU G N    1  
ATOM 10833  C CA   . LEU G 2 10  ? 29.610  13.736  -10.531 1.00 5.13  ? 280 LEU G CA   1  
ATOM 10834  C C    . LEU G 2 10  ? 29.951  12.269  -10.203 1.00 63.32 ? 280 LEU G C    1  
ATOM 10835  O O    . LEU G 2 10  ? 31.069  11.813  -10.459 1.00 13.42 ? 280 LEU G O    1  
ATOM 10836  C CB   . LEU G 2 10  ? 29.076  14.521  -9.281  1.00 0.34  ? 280 LEU G CB   1  
ATOM 10837  C CG   . LEU G 2 10  ? 30.061  14.751  -8.062  1.00 24.34 ? 280 LEU G CG   1  
ATOM 10838  C CD1  . LEU G 2 10  ? 30.099  13.553  -7.080  1.00 21.30 ? 280 LEU G CD1  1  
ATOM 10839  C CD2  . LEU G 2 10  ? 31.490  15.118  -8.549  1.00 3.14  ? 280 LEU G CD2  1  
ATOM 10840  H H    . LEU G 2 10  ? 27.663  13.732  -11.398 1.00 24.44 ? 280 LEU G H    1  
ATOM 10841  H HA   . LEU G 2 10  ? 30.517  14.230  -10.884 1.00 41.22 ? 280 LEU G HA   1  
ATOM 10842  H HB2  . LEU G 2 10  ? 28.752  15.498  -9.629  1.00 0.35  ? 280 LEU G HB2  1  
ATOM 10843  H HB3  . LEU G 2 10  ? 28.192  14.003  -8.910  1.00 64.34 ? 280 LEU G HB3  1  
ATOM 10844  H HG   . LEU G 2 10  ? 29.696  15.599  -7.489  1.00 42.14 ? 280 LEU G HG   1  
ATOM 10845  H HD11 . LEU G 2 10  ? 29.101  13.347  -6.718  1.00 4.04  ? 280 LEU G HD11 1  
ATOM 10846  H HD12 . LEU G 2 10  ? 30.737  13.785  -6.239  1.00 63.54 ? 280 LEU G HD12 1  
ATOM 10847  H HD13 . LEU G 2 10  ? 30.483  12.672  -7.586  1.00 1.42  ? 280 LEU G HD13 1  
ATOM 10848  H HD21 . LEU G 2 10  ? 31.914  14.293  -9.109  1.00 65.34 ? 280 LEU G HD21 1  
ATOM 10849  H HD22 . LEU G 2 10  ? 32.124  15.335  -7.699  1.00 31.41 ? 280 LEU G HD22 1  
ATOM 10850  H HD23 . LEU G 2 10  ? 31.442  15.994  -9.182  1.00 33.15 ? 280 LEU G HD23 1  
ATOM 10851  N N    . PHE G 2 11  ? 28.974  11.533  -9.643  1.00 42.42 ? 281 PHE G N    1  
ATOM 10852  C CA   . PHE G 2 11  ? 29.137  10.102  -9.309  1.00 65.31 ? 281 PHE G CA   1  
ATOM 10853  C C    . PHE G 2 11  ? 28.277  9.248   -10.254 1.00 51.54 ? 281 PHE G C    1  
ATOM 10854  O O    . PHE G 2 11  ? 27.175  9.658   -10.640 1.00 23.32 ? 281 PHE G O    1  
ATOM 10855  C CB   . PHE G 2 11  ? 28.813  9.826   -7.804  1.00 52.32 ? 281 PHE G CB   1  
ATOM 10856  C CG   . PHE G 2 11  ? 27.358  10.068  -7.342  1.00 42.02 ? 281 PHE G CG   1  
ATOM 10857  C CD1  . PHE G 2 11  ? 26.800  11.348  -7.345  1.00 31.10 ? 281 PHE G CD1  1  
ATOM 10858  C CD2  . PHE G 2 11  ? 26.561  9.012   -6.879  1.00 15.32 ? 281 PHE G CD2  1  
ATOM 10859  C CE1  . PHE G 2 11  ? 25.502  11.561  -6.912  1.00 33.03 ? 281 PHE G CE1  1  
ATOM 10860  C CE2  . PHE G 2 11  ? 25.262  9.232   -6.446  1.00 4.00  ? 281 PHE G CE2  1  
ATOM 10861  C CZ   . PHE G 2 11  ? 24.733  10.506  -6.465  1.00 43.34 ? 281 PHE G CZ   1  
ATOM 10862  H H    . PHE G 2 11  ? 28.112  11.958  -9.461  1.00 52.21 ? 281 PHE G H    1  
ATOM 10863  H HA   . PHE G 2 11  ? 30.181  9.836   -9.485  1.00 72.43 ? 281 PHE G HA   1  
ATOM 10864  H HB2  . PHE G 2 11  ? 29.064  8.796   -7.583  1.00 5.13  ? 281 PHE G HB2  1  
ATOM 10865  H HB3  . PHE G 2 11  ? 29.453  10.461  -7.200  1.00 21.21 ? 281 PHE G HB3  1  
ATOM 10866  H HD1  . PHE G 2 11  ? 27.392  12.186  -7.696  1.00 52.40 ? 281 PHE G HD1  1  
ATOM 10867  H HD2  . PHE G 2 11  ? 26.968  8.009   -6.860  1.00 10.44 ? 281 PHE G HD2  1  
ATOM 10868  H HE1  . PHE G 2 11  ? 25.090  12.562  -6.920  1.00 11.25 ? 281 PHE G HE1  1  
ATOM 10869  H HE2  . PHE G 2 11  ? 24.662  8.403   -6.097  1.00 64.34 ? 281 PHE G HE2  1  
ATOM 10870  H HZ   . PHE G 2 11  ? 23.718  10.677  -6.130  1.00 44.03 ? 281 PHE G HZ   1  
ATOM 10871  N N    . ALA G 2 12  ? 28.811  8.073   -10.639 1.00 10.42 ? 282 ALA G N    1  
ATOM 10872  C CA   . ALA G 2 12  ? 28.157  7.145   -11.594 1.00 63.41 ? 282 ALA G CA   1  
ATOM 10873  C C    . ALA G 2 12  ? 28.513  5.681   -11.270 1.00 74.50 ? 282 ALA G C    1  
ATOM 10874  O O    . ALA G 2 12  ? 27.698  4.782   -11.485 1.00 4.52  ? 282 ALA G O    1  
ATOM 10875  C CB   . ALA G 2 12  ? 28.559  7.496   -13.040 1.00 73.31 ? 282 ALA G CB   1  
ATOM 10876  H H    . ALA G 2 12  ? 29.684  7.824   -10.274 1.00 43.02 ? 282 ALA G H    1  
ATOM 10877  H HA   . ALA G 2 12  ? 27.078  7.268   -11.504 1.00 24.03 ? 282 ALA G HA   1  
ATOM 10878  H HB1  . ALA G 2 12  ? 29.628  7.372   -13.165 1.00 15.35 ? 282 ALA G HB1  1  
ATOM 10879  H HB2  . ALA G 2 12  ? 28.297  8.524   -13.251 1.00 54.23 ? 282 ALA G HB2  1  
ATOM 10880  H HB3  . ALA G 2 12  ? 28.041  6.849   -13.738 1.00 11.21 ? 282 ALA G HB3  1  
ATOM 10881  N N    . ASP G 2 13  ? 29.736  5.475   -10.735 1.00 25.10 ? 283 ASP G N    1  
ATOM 10882  C CA   . ASP G 2 13  ? 30.286  4.142   -10.390 1.00 30.55 ? 283 ASP G CA   1  
ATOM 10883  C C    . ASP G 2 13  ? 29.406  3.411   -9.348  1.00 12.14 ? 283 ASP G C    1  
ATOM 10884  O O    . ASP G 2 13  ? 29.040  2.239   -9.538  1.00 51.03 ? 283 ASP G O    1  
ATOM 10885  C CB   . ASP G 2 13  ? 31.744  4.306   -9.870  1.00 13.25 ? 283 ASP G CB   1  
ATOM 10886  C CG   . ASP G 2 13  ? 32.378  2.993   -9.376  1.00 5.14  ? 283 ASP G CG   1  
ATOM 10887  O OD1  . ASP G 2 13  ? 32.608  2.086   -10.197 1.00 1.40  ? 283 ASP G OD1  1  
ATOM 10888  O OD2  . ASP G 2 13  ? 32.650  2.864   -8.166  1.00 64.21 ? 283 ASP G OD2  1  
ATOM 10889  H H    . ASP G 2 13  ? 30.297  6.252   -10.571 1.00 34.41 ? 283 ASP G H    1  
ATOM 10890  H HA   . ASP G 2 13  ? 30.309  3.554   -11.301 1.00 21.44 ? 283 ASP G HA   1  
ATOM 10891  H HB2  . ASP G 2 13  ? 32.363  4.698   -10.671 1.00 13.25 ? 283 ASP G HB2  1  
ATOM 10892  H HB3  . ASP G 2 13  ? 31.746  5.026   -9.057  1.00 70.31 ? 283 ASP G HB3  1  
ATOM 10893  N N    . GLY G 2 14  ? 29.073  4.125   -8.257  1.00 5.41  ? 284 GLY G N    1  
ATOM 10894  C CA   . GLY G 2 14  ? 28.190  3.599   -7.208  1.00 61.41 ? 284 GLY G CA   1  
ATOM 10895  C C    . GLY G 2 14  ? 28.946  2.911   -6.077  1.00 5.23  ? 284 GLY G C    1  
ATOM 10896  O O    . GLY G 2 14  ? 30.167  3.036   -5.979  1.00 14.44 ? 284 GLY G O    1  
ATOM 10897  H H    . GLY G 2 14  ? 29.462  5.018   -8.148  1.00 24.23 ? 284 GLY G H    1  
ATOM 10898  H HA2  . GLY G 2 14  ? 27.626  4.421   -6.791  1.00 61.53 ? 284 GLY G HA2  1  
ATOM 10899  H HA3  . GLY G 2 14  ? 27.490  2.892   -7.645  1.00 63.33 ? 284 GLY G HA3  1  
ATOM 10900  N N    . ASN G 2 15  ? 28.192  2.164   -5.246  1.00 65.44 ? 285 ASN G N    1  
ATOM 10901  C CA   . ASN G 2 15  ? 28.670  1.523   -4.001  1.00 74.25 ? 285 ASN G CA   1  
ATOM 10902  C C    . ASN G 2 15  ? 29.377  2.534   -3.072  1.00 52.31 ? 285 ASN G C    1  
ATOM 10903  O O    . ASN G 2 15  ? 30.601  2.717   -3.135  1.00 0.24  ? 285 ASN G O    1  
ATOM 10904  C CB   . ASN G 2 15  ? 29.559  0.279   -4.285  1.00 4.52  ? 285 ASN G CB   1  
ATOM 10905  C CG   . ASN G 2 15  ? 28.772  -0.885  -4.888  1.00 53.32 ? 285 ASN G CG   1  
ATOM 10906  O OD1  . ASN G 2 15  ? 28.667  -1.024  -6.108  1.00 23.24 ? 285 ASN G OD1  1  
ATOM 10907  N ND2  . ASN G 2 15  ? 28.203  -1.724  -4.030  1.00 33.13 ? 285 ASN G ND2  1  
ATOM 10908  H H    . ASN G 2 15  ? 27.267  2.020   -5.499  1.00 3.43  ? 285 ASN G H    1  
ATOM 10909  H HA   . ASN G 2 15  ? 27.776  1.181   -3.484  1.00 71.25 ? 285 ASN G HA   1  
ATOM 10910  H HB2  . ASN G 2 15  ? 30.345  0.556   -4.977  1.00 4.13  ? 285 ASN G HB2  1  
ATOM 10911  H HB3  . ASN G 2 15  ? 30.014  -0.058  -3.361  1.00 34.44 ? 285 ASN G HB3  1  
ATOM 10912  H HD21 . ASN G 2 15  ? 28.319  -1.559  -3.070  1.00 2.21  ? 285 ASN G HD21 1  
ATOM 10913  H HD22 . ASN G 2 15  ? 27.684  -2.478  -4.386  1.00 63.33 ? 285 ASN G HD22 1  
ATOM 10914  N N    . MET G 2 16  ? 28.568  3.227   -2.252  1.00 31.52 ? 286 MET G N    1  
ATOM 10915  C CA   . MET G 2 16  ? 29.067  4.142   -1.204  1.00 5.34  ? 286 MET G CA   1  
ATOM 10916  C C    . MET G 2 16  ? 29.596  3.312   0.003   1.00 61.22 ? 286 MET G C    1  
ATOM 10917  O O    . MET G 2 16  ? 29.235  2.133   0.130   1.00 43.44 ? 286 MET G O    1  
ATOM 10918  C CB   . MET G 2 16  ? 27.929  5.116   -0.764  1.00 74.41 ? 286 MET G CB   1  
ATOM 10919  C CG   . MET G 2 16  ? 27.387  6.031   -1.870  1.00 11.12 ? 286 MET G CG   1  
ATOM 10920  S SD   . MET G 2 16  ? 26.144  7.185   -1.241  1.00 32.12 ? 286 MET G SD   1  
ATOM 10921  C CE   . MET G 2 16  ? 25.571  7.986   -2.740  1.00 44.24 ? 286 MET G CE   1  
ATOM 10922  H H    . MET G 2 16  ? 27.599  3.105   -2.347  1.00 52.34 ? 286 MET G H    1  
ATOM 10923  H HA   . MET G 2 16  ? 29.891  4.717   -1.620  1.00 25.21 ? 286 MET G HA   1  
ATOM 10924  H HB2  . MET G 2 16  ? 27.099  4.535   -0.381  1.00 55.35 ? 286 MET G HB2  1  
ATOM 10925  H HB3  . MET G 2 16  ? 28.301  5.748   0.035   1.00 51.25 ? 286 MET G HB3  1  
ATOM 10926  H HG2  . MET G 2 16  ? 28.205  6.599   -2.294  1.00 14.24 ? 286 MET G HG2  1  
ATOM 10927  H HG3  . MET G 2 16  ? 26.934  5.422   -2.644  1.00 13.43 ? 286 MET G HG3  1  
ATOM 10928  H HE1  . MET G 2 16  ? 26.399  8.487   -3.222  1.00 13.21 ? 286 MET G HE1  1  
ATOM 10929  H HE2  . MET G 2 16  ? 24.811  8.711   -2.490  1.00 21.31 ? 286 MET G HE2  1  
ATOM 10930  H HE3  . MET G 2 16  ? 25.157  7.247   -3.409  1.00 43.30 ? 286 MET G HE3  1  
ATOM 10931  N N    . PRO G 2 17  ? 30.452  3.895   0.920   1.00 10.00 ? 287 PRO G N    1  
ATOM 10932  C CA   . PRO G 2 17  ? 30.993  3.162   2.111   1.00 2.14  ? 287 PRO G CA   1  
ATOM 10933  C C    . PRO G 2 17  ? 29.954  2.977   3.261   1.00 54.32 ? 287 PRO G C    1  
ATOM 10934  O O    . PRO G 2 17  ? 30.310  3.036   4.446   1.00 22.15 ? 287 PRO G O    1  
ATOM 10935  C CB   . PRO G 2 17  ? 32.187  4.066   2.536   1.00 41.23 ? 287 PRO G CB   1  
ATOM 10936  C CG   . PRO G 2 17  ? 31.769  5.448   2.146   1.00 73.41 ? 287 PRO G CG   1  
ATOM 10937  C CD   . PRO G 2 17  ? 30.997  5.287   0.850   1.00 55.34 ? 287 PRO G CD   1  
ATOM 10938  H HA   . PRO G 2 17  ? 31.369  2.184   1.835   1.00 12.30 ? 287 PRO G HA   1  
ATOM 10939  H HB2  . PRO G 2 17  ? 32.370  3.990   3.606   1.00 43.51 ? 287 PRO G HB2  1  
ATOM 10940  H HB3  . PRO G 2 17  ? 33.082  3.783   1.994   1.00 33.34 ? 287 PRO G HB3  1  
ATOM 10941  H HG2  . PRO G 2 17  ? 31.137  5.875   2.922   1.00 53.31 ? 287 PRO G HG2  1  
ATOM 10942  H HG3  . PRO G 2 17  ? 32.638  6.076   1.988   1.00 25.33 ? 287 PRO G HG3  1  
ATOM 10943  H HD2  . PRO G 2 17  ? 30.192  6.013   0.791   1.00 24.00 ? 287 PRO G HD2  1  
ATOM 10944  H HD3  . PRO G 2 17  ? 31.656  5.394   -0.007  1.00 62.51 ? 287 PRO G HD3  1  
ATOM 10945  N N    . VAL G 2 18  ? 28.677  2.717   2.897   1.00 12.10 ? 288 VAL G N    1  
ATOM 10946  C CA   . VAL G 2 18  ? 27.606  2.433   3.857   1.00 22.22 ? 288 VAL G CA   1  
ATOM 10947  C C    . VAL G 2 18  ? 27.711  0.956   4.287   1.00 14.31 ? 288 VAL G C    1  
ATOM 10948  O O    . VAL G 2 18  ? 27.227  0.046   3.597   1.00 44.50 ? 288 VAL G O    1  
ATOM 10949  C CB   . VAL G 2 18  ? 26.174  2.739   3.259   1.00 51.22 ? 288 VAL G CB   1  
ATOM 10950  C CG1  . VAL G 2 18  ? 25.064  2.498   4.319   1.00 75.10 ? 288 VAL G CG1  1  
ATOM 10951  C CG2  . VAL G 2 18  ? 26.104  4.179   2.685   1.00 61.12 ? 288 VAL G CG2  1  
ATOM 10952  H H    . VAL G 2 18  ? 28.457  2.694   1.953   1.00 44.21 ? 288 VAL G H    1  
ATOM 10953  H HA   . VAL G 2 18  ? 27.755  3.072   4.730   1.00 64.34 ? 288 VAL G HA   1  
ATOM 10954  H HB   . VAL G 2 18  ? 25.995  2.047   2.435   1.00 31.30 ? 288 VAL G HB   1  
ATOM 10955  H HG11 . VAL G 2 18  ? 24.089  2.677   3.882   1.00 53.11 ? 288 VAL G HG11 1  
ATOM 10956  H HG12 . VAL G 2 18  ? 25.205  3.167   5.159   1.00 3.41  ? 288 VAL G HG12 1  
ATOM 10957  H HG13 . VAL G 2 18  ? 25.112  1.474   4.670   1.00 64.35 ? 288 VAL G HG13 1  
ATOM 10958  H HG21 . VAL G 2 18  ? 25.130  4.352   2.238   1.00 21.14 ? 288 VAL G HG21 1  
ATOM 10959  H HG22 . VAL G 2 18  ? 26.866  4.307   1.929   1.00 2.24  ? 288 VAL G HG22 1  
ATOM 10960  H HG23 . VAL G 2 18  ? 26.264  4.900   3.477   1.00 13.54 ? 288 VAL G HG23 1  
ATOM 10961  N N    . ARG G 2 19  ? 28.404  0.735   5.418   1.00 2.10  ? 289 ARG G N    1  
ATOM 10962  C CA   . ARG G 2 19  ? 28.577  -0.596  6.045   1.00 14.31 ? 289 ARG G CA   1  
ATOM 10963  C C    . ARG G 2 19  ? 27.450  -0.822  7.092   1.00 31.53 ? 289 ARG G C    1  
ATOM 10964  O O    . ARG G 2 19  ? 27.605  -1.595  8.051   1.00 63.05 ? 289 ARG G O    1  
ATOM 10965  C CB   . ARG G 2 19  ? 30.001  -0.643  6.702   1.00 72.05 ? 289 ARG G CB   1  
ATOM 10966  C CG   . ARG G 2 19  ? 30.496  -2.038  7.164   1.00 21.22 ? 289 ARG G CG   1  
ATOM 10967  C CD   . ARG G 2 19  ? 30.765  -3.007  5.995   1.00 74.31 ? 289 ARG G CD   1  
ATOM 10968  N NE   . ARG G 2 19  ? 31.206  -4.341  6.460   1.00 72.32 ? 289 ARG G NE   1  
ATOM 10969  C CZ   . ARG G 2 19  ? 32.440  -4.652  6.905   1.00 33.44 ? 289 ARG G CZ   1  
ATOM 10970  N NH1  . ARG G 2 19  ? 33.402  -3.737  6.966   1.00 32.13 ? 289 ARG G NH1  1  
ATOM 10971  N NH2  . ARG G 2 19  ? 32.697  -5.885  7.312   1.00 34.43 ? 289 ARG G NH2  1  
ATOM 10972  H H    . ARG G 2 19  ? 28.835  1.504   5.847   1.00 51.10 ? 289 ARG G H    1  
ATOM 10973  H HA   . ARG G 2 19  ? 28.507  -1.364  5.275   1.00 60.32 ? 289 ARG G HA   1  
ATOM 10974  H HB2  . ARG G 2 19  ? 30.722  -0.259  5.990   1.00 63.54 ? 289 ARG G HB2  1  
ATOM 10975  H HB3  . ARG G 2 19  ? 30.002  0.015   7.566   1.00 63.12 ? 289 ARG G HB3  1  
ATOM 10976  H HG2  . ARG G 2 19  ? 31.416  -1.916  7.726   1.00 13.02 ? 289 ARG G HG2  1  
ATOM 10977  H HG3  . ARG G 2 19  ? 29.745  -2.475  7.812   1.00 45.24 ? 289 ARG G HG3  1  
ATOM 10978  H HD2  . ARG G 2 19  ? 29.851  -3.129  5.426   1.00 24.21 ? 289 ARG G HD2  1  
ATOM 10979  H HD3  . ARG G 2 19  ? 31.529  -2.583  5.349   1.00 54.22 ? 289 ARG G HD3  1  
ATOM 10980  H HE   . ARG G 2 19  ? 30.531  -5.056  6.436   1.00 72.43 ? 289 ARG G HE   1  
ATOM 10981  H HH11 . ARG G 2 19  ? 33.220  -2.792  6.678   1.00 40.20 ? 289 ARG G HH11 1  
ATOM 10982  H HH12 . ARG G 2 19  ? 34.313  -3.985  7.301   1.00 1.14  ? 289 ARG G HH12 1  
ATOM 10983  H HH21 . ARG G 2 19  ? 31.977  -6.584  7.287   1.00 24.41 ? 289 ARG G HH21 1  
ATOM 10984  H HH22 . ARG G 2 19  ? 33.612  -6.128  7.645   1.00 3.45  ? 289 ARG G HH22 1  
ATOM 10985  N N    . TRP G 2 20  ? 26.296  -0.149  6.855   1.00 74.01 ? 290 TRP G N    1  
ATOM 10986  C CA   . TRP G 2 20  ? 25.163  -0.057  7.796   1.00 52.45 ? 290 TRP G CA   1  
ATOM 10987  C C    . TRP G 2 20  ? 25.526  0.674   9.100   1.00 33.14 ? 290 TRP G C    1  
ATOM 10988  O O    . TRP G 2 20  ? 26.680  1.035   9.355   1.00 53.43 ? 290 TRP G O    1  
ATOM 10989  C CB   . TRP G 2 20  ? 24.531  -1.453  8.100   1.00 53.21 ? 290 TRP G CB   1  
ATOM 10990  C CG   . TRP G 2 20  ? 23.536  -1.913  7.064   1.00 40.02 ? 290 TRP G CG   1  
ATOM 10991  C CD1  . TRP G 2 20  ? 23.730  -2.806  6.050   1.00 41.03 ? 290 TRP G CD1  1  
ATOM 10992  C CD2  . TRP G 2 20  ? 22.177  -1.469  6.948   1.00 52.00 ? 290 TRP G CD2  1  
ATOM 10993  N NE1  . TRP G 2 20  ? 22.559  -2.977  5.355   1.00 71.13 ? 290 TRP G NE1  1  
ATOM 10994  C CE2  . TRP G 2 20  ? 21.606  -2.160  5.872   1.00 13.32 ? 290 TRP G CE2  1  
ATOM 10995  C CE3  . TRP G 2 20  ? 21.382  -0.562  7.661   1.00 61.24 ? 290 TRP G CE3  1  
ATOM 10996  C CZ2  . TRP G 2 20  ? 20.287  -1.983  5.485   1.00 44.32 ? 290 TRP G CZ2  1  
ATOM 10997  C CZ3  . TRP G 2 20  ? 20.073  -0.383  7.274   1.00 45.24 ? 290 TRP G CZ3  1  
ATOM 10998  C CH2  . TRP G 2 20  ? 19.541  -1.096  6.196   1.00 52.33 ? 290 TRP G CH2  1  
ATOM 10999  H H    . TRP G 2 20  ? 26.198  0.297   5.995   1.00 23.14 ? 290 TRP G H    1  
ATOM 11000  H HA   . TRP G 2 20  ? 24.414  0.552   7.296   1.00 43.21 ? 290 TRP G HA   1  
ATOM 11001  H HB2  . TRP G 2 20  ? 25.320  -2.194  8.170   1.00 62.01 ? 290 TRP G HB2  1  
ATOM 11002  H HB3  . TRP G 2 20  ? 24.013  -1.420  9.056   1.00 22.22 ? 290 TRP G HB3  1  
ATOM 11003  H HD1  . TRP G 2 20  ? 24.657  -3.324  5.857   1.00 73.50 ? 290 TRP G HD1  1  
ATOM 11004  H HE1  . TRP G 2 20  ? 22.427  -3.584  4.605   1.00 72.21 ? 290 TRP G HE1  1  
ATOM 11005  H HE3  . TRP G 2 20  ? 21.782  0.001   8.492   1.00 5.13  ? 290 TRP G HE3  1  
ATOM 11006  H HZ2  . TRP G 2 20  ? 19.853  -2.526  4.655   1.00 72.34 ? 290 TRP G HZ2  1  
ATOM 11007  H HZ3  . TRP G 2 20  ? 19.442  0.318   7.810   1.00 21.45 ? 290 TRP G HZ3  1  
ATOM 11008  H HH2  . TRP G 2 20  ? 18.508  -0.921  5.922   1.00 11.21 ? 290 TRP G HH2  1  
ATOM 11009  N N    . LEU G 2 21  ? 24.483  0.912   9.898   1.00 21.13 ? 291 LEU G N    1  
ATOM 11010  C CA   . LEU G 2 21  ? 24.584  1.470   11.254  1.00 15.11 ? 291 LEU G CA   1  
ATOM 11011  C C    . LEU G 2 21  ? 24.348  0.332   12.276  1.00 1.11  ? 291 LEU G C    1  
ATOM 11012  O O    . LEU G 2 21  ? 24.656  0.464   13.463  1.00 41.43 ? 291 LEU G O    1  
ATOM 11013  C CB   . LEU G 2 21  ? 23.560  2.633   11.429  1.00 52.32 ? 291 LEU G CB   1  
ATOM 11014  C CG   . LEU G 2 21  ? 23.615  3.772   10.337  1.00 1.01  ? 291 LEU G CG   1  
ATOM 11015  C CD1  . LEU G 2 21  ? 22.840  3.379   9.049   1.00 70.51 ? 291 LEU G CD1  1  
ATOM 11016  C CD2  . LEU G 2 21  ? 23.120  5.127   10.895  1.00 20.21 ? 291 LEU G CD2  1  
ATOM 11017  H H    . LEU G 2 21  ? 23.590  0.705   9.556   1.00 74.04 ? 291 LEU G H    1  
ATOM 11018  H HA   . LEU G 2 21  ? 25.592  1.860   11.400  1.00 5.44  ? 291 LEU G HA   1  
ATOM 11019  H HB2  . LEU G 2 21  ? 22.556  2.210   11.437  1.00 12.23 ? 291 LEU G HB2  1  
ATOM 11020  H HB3  . LEU G 2 21  ? 23.733  3.084   12.401  1.00 4.33  ? 291 LEU G HB3  1  
ATOM 11021  H HG   . LEU G 2 21  ? 24.650  3.915   10.042  1.00 34.31 ? 291 LEU G HG   1  
ATOM 11022  H HD11 . LEU G 2 21  ? 23.252  2.465   8.643   1.00 43.53 ? 291 LEU G HD11 1  
ATOM 11023  H HD12 . LEU G 2 21  ? 22.935  4.162   8.311   1.00 10.11 ? 291 LEU G HD12 1  
ATOM 11024  H HD13 . LEU G 2 21  ? 21.790  3.230   9.276   1.00 5.13  ? 291 LEU G HD13 1  
ATOM 11025  H HD21 . LEU G 2 21  ? 23.725  5.409   11.746  1.00 12.10 ? 291 LEU G HD21 1  
ATOM 11026  H HD22 . LEU G 2 21  ? 22.086  5.044   11.205  1.00 0.42  ? 291 LEU G HD22 1  
ATOM 11027  H HD23 . LEU G 2 21  ? 23.205  5.891   10.133  1.00 31.14 ? 291 LEU G HD23 1  
ATOM 11028  N N    . GLY G 2 22  ? 23.804  -0.789  11.759  1.00 62.45 ? 292 GLY G N    1  
ATOM 11029  C CA   . GLY G 2 22  ? 23.590  -2.022  12.503  1.00 52.13 ? 292 GLY G CA   1  
ATOM 11030  C C    . GLY G 2 22  ? 23.392  -3.175  11.519  1.00 1.11  ? 292 GLY G C    1  
ATOM 11031  O O    . GLY G 2 22  ? 22.272  -3.368  11.034  1.00 75.33 ? 292 GLY G O    1  
ATOM 11032  H H    . GLY G 2 22  ? 23.545  -0.773  10.816  1.00 15.22 ? 292 GLY G H    1  
ATOM 11033  H HA2  . GLY G 2 22  ? 24.441  -2.223  13.144  1.00 11.13 ? 292 GLY G HA2  1  
ATOM 11034  H HA3  . GLY G 2 22  ? 22.702  -1.924  13.117  1.00 34.32 ? 292 GLY G HA3  1  
ATOM 11035  N N    . PRO G 2 23  ? 24.485  -3.941  11.171  1.00 31.22 ? 293 PRO G N    1  
ATOM 11036  C CA   . PRO G 2 23  ? 24.446  -5.010  10.122  1.00 34.14 ? 293 PRO G CA   1  
ATOM 11037  C C    . PRO G 2 23  ? 23.409  -6.131  10.381  1.00 55.12 ? 293 PRO G C    1  
ATOM 11038  O O    . PRO G 2 23  ? 22.981  -6.804  9.443   1.00 72.33 ? 293 PRO G O    1  
ATOM 11039  C CB   . PRO G 2 23  ? 25.895  -5.578  10.134  1.00 63.03 ? 293 PRO G CB   1  
ATOM 11040  C CG   . PRO G 2 23  ? 26.485  -5.151  11.443  1.00 23.42 ? 293 PRO G CG   1  
ATOM 11041  C CD   . PRO G 2 23  ? 25.853  -3.819  11.759  1.00 52.25 ? 293 PRO G CD   1  
ATOM 11042  H HA   . PRO G 2 23  ? 24.244  -4.577  9.146   1.00 34.23 ? 293 PRO G HA   1  
ATOM 11043  H HB2  . PRO G 2 23  ? 25.891  -6.664  10.042  1.00 32.54 ? 293 PRO G HB2  1  
ATOM 11044  H HB3  . PRO G 2 23  ? 26.467  -5.153  9.318   1.00 42.33 ? 293 PRO G HB3  1  
ATOM 11045  H HG2  . PRO G 2 23  ? 26.241  -5.881  12.213  1.00 43.41 ? 293 PRO G HG2  1  
ATOM 11046  H HG3  . PRO G 2 23  ? 27.562  -5.046  11.361  1.00 44.32 ? 293 PRO G HG3  1  
ATOM 11047  H HD2  . PRO G 2 23  ? 25.806  -3.667  12.831  1.00 24.35 ? 293 PRO G HD2  1  
ATOM 11048  H HD3  . PRO G 2 23  ? 26.403  -3.009  11.290  1.00 63.43 ? 293 PRO G HD3  1  
ATOM 11049  N N    . LYS G 2 24  ? 23.020  -6.319  11.652  1.00 34.31 ? 294 LYS G N    1  
ATOM 11050  C CA   . LYS G 2 24  ? 22.068  -7.362  12.055  1.00 52.21 ? 294 LYS G CA   1  
ATOM 11051  C C    . LYS G 2 24  ? 21.192  -6.830  13.203  1.00 31.24 ? 294 LYS G C    1  
ATOM 11052  O O    . LYS G 2 24  ? 21.554  -6.942  14.386  1.00 21.23 ? 294 LYS G O    1  
ATOM 11053  C CB   . LYS G 2 24  ? 22.832  -8.662  12.458  1.00 3.41  ? 294 LYS G CB   1  
ATOM 11054  C CG   . LYS G 2 24  ? 21.922  -9.835  12.892  1.00 75.22 ? 294 LYS G CG   1  
ATOM 11055  C CD   . LYS G 2 24  ? 22.709  -11.131 13.194  1.00 42.32 ? 294 LYS G CD   1  
ATOM 11056  C CE   . LYS G 2 24  ? 23.365  -11.726 11.939  1.00 51.35 ? 294 LYS G CE   1  
ATOM 11057  N NZ   . LYS G 2 24  ? 24.114  -12.980 12.225  1.00 23.13 ? 294 LYS G NZ   1  
ATOM 11058  H H    . LYS G 2 24  ? 23.380  -5.727  12.343  1.00 12.22 ? 294 LYS G H    1  
ATOM 11059  H HA   . LYS G 2 24  ? 21.423  -7.585  11.206  1.00 11.34 ? 294 LYS G HA   1  
ATOM 11060  H HB2  . LYS G 2 24  ? 23.425  -8.987  11.609  1.00 31.24 ? 294 LYS G HB2  1  
ATOM 11061  H HB3  . LYS G 2 24  ? 23.508  -8.434  13.278  1.00 32.54 ? 294 LYS G HB3  1  
ATOM 11062  H HG2  . LYS G 2 24  ? 21.383  -9.540  13.786  1.00 12.05 ? 294 LYS G HG2  1  
ATOM 11063  H HG3  . LYS G 2 24  ? 21.202  -10.035 12.102  1.00 24.12 ? 294 LYS G HG3  1  
ATOM 11064  H HD2  . LYS G 2 24  ? 23.482  -10.913 13.923  1.00 60.51 ? 294 LYS G HD2  1  
ATOM 11065  H HD3  . LYS G 2 24  ? 22.028  -11.863 13.612  1.00 10.13 ? 294 LYS G HD3  1  
ATOM 11066  H HE2  . LYS G 2 24  ? 22.597  -11.946 11.208  1.00 31.51 ? 294 LYS G HE2  1  
ATOM 11067  H HE3  . LYS G 2 24  ? 24.052  -10.998 11.521  1.00 62.23 ? 294 LYS G HE3  1  
ATOM 11068  H HZ1  . LYS G 2 24  ? 23.481  -13.681 12.655  1.00 3.43  ? 294 LYS G HZ1  1  
ATOM 11069  H HZ2  . LYS G 2 24  ? 24.902  -12.789 12.877  1.00 70.13 ? 294 LYS G HZ2  1  
ATOM 11070  H HZ3  . LYS G 2 24  ? 24.499  -13.375 11.341  1.00 65.14 ? 294 LYS G HZ3  1  
ATOM 11071  N N    . ALA G 2 25  ? 20.074  -6.181  12.816  1.00 43.02 ? 295 ALA G N    1  
ATOM 11072  C CA   . ALA G 2 25  ? 19.075  -5.629  13.749  1.00 5.44  ? 295 ALA G CA   1  
ATOM 11073  C C    . ALA G 2 25  ? 17.820  -5.212  12.957  1.00 4.11  ? 295 ALA G C    1  
ATOM 11074  O O    . ALA G 2 25  ? 17.817  -4.155  12.308  1.00 14.02 ? 295 ALA G O    1  
ATOM 11075  C CB   . ALA G 2 25  ? 19.647  -4.436  14.552  1.00 74.22 ? 295 ALA G CB   1  
ATOM 11076  H H    . ALA G 2 25  ? 19.915  -6.064  11.855  1.00 32.04 ? 295 ALA G H    1  
ATOM 11077  H HA   . ALA G 2 25  ? 18.802  -6.415  14.449  1.00 64.12 ? 295 ALA G HA   1  
ATOM 11078  H HB1  . ALA G 2 25  ? 19.930  -3.638  13.876  1.00 30.43 ? 295 ALA G HB1  1  
ATOM 11079  H HB2  . ALA G 2 25  ? 20.519  -4.757  15.106  1.00 1.31  ? 295 ALA G HB2  1  
ATOM 11080  H HB3  . ALA G 2 25  ? 18.902  -4.069  15.245  1.00 30.44 ? 295 ALA G HB3  1  
ATOM 11081  N N    . THR G 2 26  ? 16.777  -6.076  12.966  1.00 23.30 ? 296 THR G N    1  
ATOM 11082  C CA   . THR G 2 26  ? 15.511  -5.817  12.250  1.00 63.22 ? 296 THR G CA   1  
ATOM 11083  C C    . THR G 2 26  ? 14.308  -6.424  13.038  1.00 3.12  ? 296 THR G C    1  
ATOM 11084  O O    . THR G 2 26  ? 13.443  -5.680  13.513  1.00 23.20 ? 296 THR G O    1  
ATOM 11085  C CB   . THR G 2 26  ? 15.559  -6.386  10.779  1.00 44.41 ? 296 THR G CB   1  
ATOM 11086  O OG1  . THR G 2 26  ? 16.825  -6.075  10.155  1.00 50.32 ? 296 THR G OG1  1  
ATOM 11087  C CG2  . THR G 2 26  ? 14.432  -5.811  9.898   1.00 40.54 ? 296 THR G CG2  1  
ATOM 11088  H H    . THR G 2 26  ? 16.860  -6.910  13.472  1.00 54.32 ? 296 THR G H    1  
ATOM 11089  H HA   . THR G 2 26  ? 15.375  -4.738  12.193  1.00 71.01 ? 296 THR G HA   1  
ATOM 11090  H HB   . THR G 2 26  ? 15.455  -7.466  10.818  1.00 4.34  ? 296 THR G HB   1  
ATOM 11091  H HG1  . THR G 2 26  ? 17.118  -5.205  10.443  1.00 75.22 ? 296 THR G HG1  1  
ATOM 11092  H HG21 . THR G 2 26  ? 14.538  -4.736  9.820   1.00 13.52 ? 296 THR G HG21 1  
ATOM 11093  H HG22 . THR G 2 26  ? 13.472  -6.044  10.336  1.00 51.22 ? 296 THR G HG22 1  
ATOM 11094  H HG23 . THR G 2 26  ? 14.485  -6.245  8.908   1.00 25.31 ? 296 THR G HG23 1  
ATOM 11095  N N    . TYR G 2 27  ? 14.289  -7.775  13.217  1.00 45.45 ? 297 TYR G N    1  
ATOM 11096  C CA   . TYR G 2 27  ? 13.163  -8.496  13.900  1.00 72.43 ? 297 TYR G CA   1  
ATOM 11097  C C    . TYR G 2 27  ? 13.628  -9.853  14.435  1.00 61.43 ? 297 TYR G C    1  
ATOM 11098  O O    . TYR G 2 27  ? 14.671  -10.337 14.046  1.00 42.11 ? 297 TYR G O    1  
ATOM 11099  C CB   . TYR G 2 27  ? 11.929  -8.645  12.926  1.00 53.12 ? 297 TYR G CB   1  
ATOM 11100  C CG   . TYR G 2 27  ? 11.424  -10.078 12.537  1.00 32.35 ? 297 TYR G CG   1  
ATOM 11101  C CD1  . TYR G 2 27  ? 11.972  -10.794 11.449  1.00 43.22 ? 297 TYR G CD1  1  
ATOM 11102  C CD2  . TYR G 2 27  ? 10.343  -10.664 13.207  1.00 3.22  ? 297 TYR G CD2  1  
ATOM 11103  C CE1  . TYR G 2 27  ? 11.463  -12.028 11.066  1.00 4.23  ? 297 TYR G CE1  1  
ATOM 11104  C CE2  . TYR G 2 27  ? 9.852   -11.898 12.839  1.00 61.42 ? 297 TYR G CE2  1  
ATOM 11105  C CZ   . TYR G 2 27  ? 10.402  -12.567 11.765  1.00 1.14  ? 297 TYR G CZ   1  
ATOM 11106  O OH   . TYR G 2 27  ? 9.877   -13.774 11.395  1.00 75.42 ? 297 TYR G OH   1  
ATOM 11107  H H    . TYR G 2 27  ? 15.052  -8.302  12.897  1.00 62.25 ? 297 TYR G H    1  
ATOM 11108  H HA   . TYR G 2 27  ? 12.865  -7.889  14.755  1.00 13.10 ? 297 TYR G HA   1  
ATOM 11109  H HB2  . TYR G 2 27  ? 11.083  -8.130  13.364  1.00 51.12 ? 297 TYR G HB2  1  
ATOM 11110  H HB3  . TYR G 2 27  ? 12.167  -8.133  12.000  1.00 31.02 ? 297 TYR G HB3  1  
ATOM 11111  H HD1  . TYR G 2 27  ? 12.810  -10.369 10.905  1.00 74.43 ? 297 TYR G HD1  1  
ATOM 11112  H HD2  . TYR G 2 27  ? 9.904   -10.146 14.051  1.00 61.24 ? 297 TYR G HD2  1  
ATOM 11113  H HE1  . TYR G 2 27  ? 11.895  -12.560 10.212  1.00 12.32 ? 297 TYR G HE1  1  
ATOM 11114  H HE2  . TYR G 2 27  ? 9.022   -12.329 13.382  1.00 52.51 ? 297 TYR G HE2  1  
ATOM 11115  H HH   . TYR G 2 27  ? 10.512  -14.246 10.846  1.00 4.41  ? 297 TYR G HH   1  
ATOM 11116  N N    . HIS G 2 28  ? 12.835  -10.444 15.341  1.00 63.24 ? 298 HIS G N    1  
ATOM 11117  C CA   . HIS G 2 28  ? 13.019  -11.832 15.805  1.00 35.24 ? 298 HIS G CA   1  
ATOM 11118  C C    . HIS G 2 28  ? 11.710  -12.312 16.448  1.00 23.50 ? 298 HIS G C    1  
ATOM 11119  O O    . HIS G 2 28  ? 11.120  -11.577 17.235  1.00 62.53 ? 298 HIS G O    1  
ATOM 11120  C CB   . HIS G 2 28  ? 14.193  -11.945 16.812  1.00 11.21 ? 298 HIS G CB   1  
ATOM 11121  C CG   . HIS G 2 28  ? 14.432  -13.351 17.295  1.00 1.32  ? 298 HIS G CG   1  
ATOM 11122  N ND1  . HIS G 2 28  ? 14.000  -13.810 18.518  1.00 50.32 ? 298 HIS G ND1  1  
ATOM 11123  C CD2  . HIS G 2 28  ? 15.033  -14.405 16.695  1.00 30.43 ? 298 HIS G CD2  1  
ATOM 11124  C CE1  . HIS G 2 28  ? 14.324  -15.079 18.651  1.00 41.00 ? 298 HIS G CE1  1  
ATOM 11125  N NE2  . HIS G 2 28  ? 14.954  -15.468 17.561  1.00 2.54  ? 298 HIS G NE2  1  
ATOM 11126  H H    . HIS G 2 28  ? 12.088  -9.925  15.716  1.00 44.24 ? 298 HIS G H    1  
ATOM 11127  H HA   . HIS G 2 28  ? 13.231  -12.452 14.932  1.00 41.42 ? 298 HIS G HA   1  
ATOM 11128  H HB2  . HIS G 2 28  ? 15.104  -11.597 16.336  1.00 34.21 ? 298 HIS G HB2  1  
ATOM 11129  H HB3  . HIS G 2 28  ? 13.994  -11.316 17.675  1.00 43.12 ? 298 HIS G HB3  1  
ATOM 11130  H HD1  . HIS G 2 28  ? 13.527  -13.279 19.198  1.00 23.11 ? 298 HIS G HD1  1  
ATOM 11131  H HD2  . HIS G 2 28  ? 15.483  -14.412 15.711  1.00 53.13 ? 298 HIS G HD2  1  
ATOM 11132  H HE1  . HIS G 2 28  ? 14.107  -15.696 19.510  1.00 42.45 ? 298 HIS G HE1  1  
ATOM 11133  H HE2  . HIS G 2 28  ? 15.518  -16.269 17.514  1.00 37.99 ? 298 HIS G HE2  1  
ATOM 11134  N N    . GLY G 2 29  ? 11.270  -13.536 16.108  1.00 74.40 ? 299 GLY G N    1  
ATOM 11135  C CA   . GLY G 2 29  ? 10.032  -14.086 16.658  1.00 71.14 ? 299 GLY G CA   1  
ATOM 11136  C C    . GLY G 2 29  ? 9.940   -15.586 16.519  1.00 5.42  ? 299 GLY G C    1  
ATOM 11137  O O    . GLY G 2 29  ? 10.960  -16.276 16.615  1.00 50.12 ? 299 GLY G O    1  
ATOM 11138  H H    . GLY G 2 29  ? 11.782  -14.071 15.465  1.00 5.42  ? 299 GLY G H    1  
ATOM 11139  H HA2  . GLY G 2 29  ? 9.963   -13.839 17.714  1.00 2.52  ? 299 GLY G HA2  1  
ATOM 11140  H HA3  . GLY G 2 29  ? 9.198   -13.632 16.140  1.00 62.02 ? 299 GLY G HA3  1  
ATOM 11141  N N    . ASN G 2 30  ? 8.704   -16.083 16.312  1.00 30.22 ? 300 ASN G N    1  
ATOM 11142  C CA   . ASN G 2 30  ? 8.433   -17.512 16.101  1.00 55.14 ? 300 ASN G CA   1  
ATOM 11143  C C    . ASN G 2 30  ? 7.230   -17.669 15.154  1.00 65.53 ? 300 ASN G C    1  
ATOM 11144  O O    . ASN G 2 30  ? 6.069   -17.555 15.574  1.00 2.04  ? 300 ASN G O    1  
ATOM 11145  C CB   . ASN G 2 30  ? 8.193   -18.228 17.453  1.00 5.20  ? 300 ASN G CB   1  
ATOM 11146  C CG   . ASN G 2 30  ? 7.988   -19.743 17.329  1.00 22.21 ? 300 ASN G CG   1  
ATOM 11147  O OD1  . ASN G 2 30  ? 8.521   -20.392 16.425  1.00 51.43 ? 300 ASN G OD1  1  
ATOM 11148  N ND2  . ASN G 2 30  ? 7.216   -20.308 18.238  1.00 23.13 ? 300 ASN G ND2  1  
ATOM 11149  H H    . ASN G 2 30  ? 7.944   -15.462 16.305  1.00 74.15 ? 300 ASN G H    1  
ATOM 11150  H HA   . ASN G 2 30  ? 9.306   -17.955 15.624  1.00 4.20  ? 300 ASN G HA   1  
ATOM 11151  H HB2  . ASN G 2 30  ? 9.048   -18.063 18.094  1.00 14.52 ? 300 ASN G HB2  1  
ATOM 11152  H HB3  . ASN G 2 30  ? 7.316   -17.796 17.925  1.00 24.41 ? 300 ASN G HB3  1  
ATOM 11153  H HD21 . ASN G 2 30  ? 6.818   -19.734 18.929  1.00 41.30 ? 300 ASN G HD21 1  
ATOM 11154  H HD22 . ASN G 2 30  ? 7.076   -21.276 18.189  1.00 2.04  ? 300 ASN G HD22 1  
ATOM 11155  N N    . ILE G 2 31  ? 7.543   -17.894 13.868  1.00 51.40 ? 301 ILE G N    1  
ATOM 11156  C CA   . ILE G 2 31  ? 6.553   -17.995 12.791  1.00 73.21 ? 301 ILE G CA   1  
ATOM 11157  C C    . ILE G 2 31  ? 5.758   -19.308 12.880  1.00 50.21 ? 301 ILE G C    1  
ATOM 11158  O O    . ILE G 2 31  ? 6.343   -20.400 12.928  1.00 43.15 ? 301 ILE G O    1  
ATOM 11159  C CB   . ILE G 2 31  ? 7.243   -17.911 11.374  1.00 1.14  ? 301 ILE G CB   1  
ATOM 11160  C CG1  . ILE G 2 31  ? 7.971   -16.539 11.195  1.00 34.15 ? 301 ILE G CG1  1  
ATOM 11161  C CG2  . ILE G 2 31  ? 6.224   -18.164 10.218  1.00 53.23 ? 301 ILE G CG2  1  
ATOM 11162  C CD1  . ILE G 2 31  ? 8.739   -16.409 9.896   1.00 2.42  ? 301 ILE G CD1  1  
ATOM 11163  H H    . ILE G 2 31  ? 8.484   -18.001 13.634  1.00 71.20 ? 301 ILE G H    1  
ATOM 11164  H HA   . ILE G 2 31  ? 5.869   -17.151 12.882  1.00 74.13 ? 301 ILE G HA   1  
ATOM 11165  H HB   . ILE G 2 31  ? 7.988   -18.704 11.325  1.00 61.43 ? 301 ILE G HB   1  
ATOM 11166  H HG12 . ILE G 2 31  ? 7.247   -15.734 11.226  1.00 74.34 ? 301 ILE G HG12 1  
ATOM 11167  H HG13 . ILE G 2 31  ? 8.679   -16.400 12.005  1.00 4.04  ? 301 ILE G HG13 1  
ATOM 11168  H HG21 . ILE G 2 31  ? 5.775   -19.143 10.332  1.00 40.33 ? 301 ILE G HG21 1  
ATOM 11169  H HG22 . ILE G 2 31  ? 6.731   -18.121 9.262   1.00 4.01  ? 301 ILE G HG22 1  
ATOM 11170  H HG23 . ILE G 2 31  ? 5.448   -17.411 10.242  1.00 71.45 ? 301 ILE G HG23 1  
ATOM 11171  H HD11 . ILE G 2 31  ? 9.481   -17.200 9.835   1.00 45.55 ? 301 ILE G HD11 1  
ATOM 11172  H HD12 . ILE G 2 31  ? 9.247   -15.453 9.866   1.00 35.10 ? 301 ILE G HD12 1  
ATOM 11173  H HD13 . ILE G 2 31  ? 8.069   -16.480 9.051   1.00 42.34 ? 301 ILE G HD13 1  
ATOM 11174  N N    . ASP G 2 32  ? 4.430   -19.158 12.915  1.00 32.33 ? 302 ASP G N    1  
ATOM 11175  C CA   . ASP G 2 32  ? 3.470   -20.235 12.650  1.00 40.13 ? 302 ASP G CA   1  
ATOM 11176  C C    . ASP G 2 32  ? 2.066   -19.630 12.572  1.00 30.20 ? 302 ASP G C    1  
ATOM 11177  O O    . ASP G 2 32  ? 1.787   -18.605 13.208  1.00 51.42 ? 302 ASP G O    1  
ATOM 11178  C CB   . ASP G 2 32  ? 3.518   -21.359 13.721  1.00 73.13 ? 302 ASP G CB   1  
ATOM 11179  C CG   . ASP G 2 32  ? 2.564   -22.526 13.422  1.00 61.53 ? 302 ASP G CG   1  
ATOM 11180  O OD1  . ASP G 2 32  ? 2.603   -23.043 12.286  1.00 55.31 ? 302 ASP G OD1  1  
ATOM 11181  O OD2  . ASP G 2 32  ? 1.782   -22.936 14.315  1.00 41.13 ? 302 ASP G OD2  1  
ATOM 11182  H H    . ASP G 2 32  ? 4.072   -18.271 13.137  1.00 21.12 ? 302 ASP G H    1  
ATOM 11183  H HA   . ASP G 2 32  ? 3.719   -20.661 11.680  1.00 65.31 ? 302 ASP G HA   1  
ATOM 11184  H HB2  . ASP G 2 32  ? 4.529   -21.754 13.772  1.00 61.33 ? 302 ASP G HB2  1  
ATOM 11185  H HB3  . ASP G 2 32  ? 3.270   -20.932 14.688  1.00 11.32 ? 302 ASP G HB3  1  
ATOM 11186  N N    . LYS G 2 33  ? 1.211   -20.261 11.755  1.00 50.35 ? 303 LYS G N    1  
ATOM 11187  C CA   . LYS G 2 33  ? -0.217  -19.911 11.629  1.00 30.53 ? 303 LYS G CA   1  
ATOM 11188  C C    . LYS G 2 33  ? -0.944  -20.082 13.000  1.00 11.02 ? 303 LYS G C    1  
ATOM 11189  O O    . LYS G 2 33  ? -0.603  -20.996 13.762  1.00 2.53  ? 303 LYS G O    1  
ATOM 11190  C CB   . LYS G 2 33  ? -0.862  -20.760 10.471  1.00 23.12 ? 303 LYS G CB   1  
ATOM 11191  C CG   . LYS G 2 33  ? -0.538  -22.287 10.475  1.00 11.03 ? 303 LYS G CG   1  
ATOM 11192  C CD   . LYS G 2 33  ? -1.392  -23.106 11.469  1.00 50.31 ? 303 LYS G CD   1  
ATOM 11193  C CE   . LYS G 2 33  ? -0.946  -24.571 11.594  1.00 13.30 ? 303 LYS G CE   1  
ATOM 11194  N NZ   . LYS G 2 33  ? 0.393   -24.701 12.217  1.00 54.30 ? 303 LYS G NZ   1  
ATOM 11195  H H    . LYS G 2 33  ? 1.557   -20.997 11.214  1.00 62.43 ? 303 LYS G H    1  
ATOM 11196  H HA   . LYS G 2 33  ? -0.262  -18.860 11.351  1.00 24.25 ? 303 LYS G HA   1  
ATOM 11197  H HB2  . LYS G 2 33  ? -1.939  -20.645 10.507  1.00 53.14 ? 303 LYS G HB2  1  
ATOM 11198  H HB3  . LYS G 2 33  ? -0.514  -20.352 9.527   1.00 25.33 ? 303 LYS G HB3  1  
ATOM 11199  H HG2  . LYS G 2 33  ? -0.701  -22.680 9.477   1.00 54.34 ? 303 LYS G HG2  1  
ATOM 11200  H HG3  . LYS G 2 33  ? 0.513   -22.415 10.730  1.00 65.01 ? 303 LYS G HG3  1  
ATOM 11201  H HD2  . LYS G 2 33  ? -1.329  -22.645 12.447  1.00 64.21 ? 303 LYS G HD2  1  
ATOM 11202  H HD3  . LYS G 2 33  ? -2.427  -23.081 11.140  1.00 41.24 ? 303 LYS G HD3  1  
ATOM 11203  H HE2  . LYS G 2 33  ? -1.662  -25.104 12.206  1.00 65.32 ? 303 LYS G HE2  1  
ATOM 11204  H HE3  . LYS G 2 33  ? -0.920  -25.022 10.609  1.00 75.02 ? 303 LYS G HE3  1  
ATOM 11205  H HZ1  . LYS G 2 33  ? 0.649   -25.704 12.310  1.00 4.04  ? 303 LYS G HZ1  1  
ATOM 11206  H HZ2  . LYS G 2 33  ? 0.397   -24.267 13.164  1.00 13.43 ? 303 LYS G HZ2  1  
ATOM 11207  H HZ3  . LYS G 2 33  ? 1.110   -24.226 11.635  1.00 10.10 ? 303 LYS G HZ3  1  
ATOM 11208  N N    . PRO G 2 34  ? -1.911  -19.174 13.361  1.00 22.22 ? 304 PRO G N    1  
ATOM 11209  C CA   . PRO G 2 34  ? -2.643  -19.255 14.652  1.00 64.41 ? 304 PRO G CA   1  
ATOM 11210  C C    . PRO G 2 34  ? -3.655  -20.433 14.690  1.00 52.03 ? 304 PRO G C    1  
ATOM 11211  O O    . PRO G 2 34  ? -4.853  -20.253 14.426  1.00 14.35 ? 304 PRO G O    1  
ATOM 11212  C CB   . PRO G 2 34  ? -3.324  -17.862 14.751  1.00 0.45  ? 304 PRO G CB   1  
ATOM 11213  C CG   . PRO G 2 34  ? -3.512  -17.418 13.335  1.00 23.04 ? 304 PRO G CG   1  
ATOM 11214  C CD   . PRO G 2 34  ? -2.336  -17.984 12.562  1.00 62.22 ? 304 PRO G CD   1  
ATOM 11215  H HA   . PRO G 2 34  ? -1.952  -19.376 15.481  1.00 12.42 ? 304 PRO G HA   1  
ATOM 11216  H HB2  . PRO G 2 34  ? -4.279  -17.937 15.271  1.00 10.31 ? 304 PRO G HB2  1  
ATOM 11217  H HB3  . PRO G 2 34  ? -2.679  -17.170 15.276  1.00 51.01 ? 304 PRO G HB3  1  
ATOM 11218  H HG2  . PRO G 2 34  ? -4.450  -17.811 12.948  1.00 44.51 ? 304 PRO G HG2  1  
ATOM 11219  H HG3  . PRO G 2 34  ? -3.513  -16.335 13.277  1.00 2.13  ? 304 PRO G HG3  1  
ATOM 11220  H HD2  . PRO G 2 34  ? -2.642  -18.279 11.564  1.00 34.41 ? 304 PRO G HD2  1  
ATOM 11221  H HD3  . PRO G 2 34  ? -1.531  -17.259 12.503  1.00 72.35 ? 304 PRO G HD3  1  
ATOM 11222  N N    . ALA G 2 35  ? -3.111  -21.640 14.976  1.00 10.21 ? 305 ALA G N    1  
ATOM 11223  C CA   . ALA G 2 35  ? -3.843  -22.931 15.052  1.00 14.53 ? 305 ALA G CA   1  
ATOM 11224  C C    . ALA G 2 35  ? -4.304  -23.413 13.656  1.00 55.41 ? 305 ALA G C    1  
ATOM 11225  O O    . ALA G 2 35  ? -3.802  -24.435 13.179  1.00 1.04  ? 305 ALA G O    1  
ATOM 11226  C CB   . ALA G 2 35  ? -5.009  -22.902 16.066  1.00 24.32 ? 305 ALA G CB   1  
ATOM 11227  H H    . ALA G 2 35  ? -2.141  -21.667 15.128  1.00 22.51 ? 305 ALA G H    1  
ATOM 11228  H HA   . ALA G 2 35  ? -3.120  -23.656 15.426  1.00 52.12 ? 305 ALA G HA   1  
ATOM 11229  H HB1  . ALA G 2 35  ? -5.432  -23.895 16.171  1.00 61.42 ? 305 ALA G HB1  1  
ATOM 11230  H HB2  . ALA G 2 35  ? -5.780  -22.224 15.720  1.00 53.23 ? 305 ALA G HB2  1  
ATOM 11231  H HB3  . ALA G 2 35  ? -4.650  -22.564 17.029  1.00 71.43 ? 305 ALA G HB3  1  
ATOM 11232  N N    . VAL G 2 36  ? -5.273  -22.670 13.049  1.00 1.14  ? 306 VAL G N    1  
ATOM 11233  C CA   . VAL G 2 36  ? -5.805  -22.866 11.668  1.00 13.34 ? 306 VAL G CA   1  
ATOM 11234  C C    . VAL G 2 36  ? -5.886  -24.363 11.264  1.00 40.44 ? 306 VAL G C    1  
ATOM 11235  O O    . VAL G 2 36  ? -5.065  -24.874 10.478  1.00 54.14 ? 306 VAL G O    1  
ATOM 11236  C CB   . VAL G 2 36  ? -4.996  -22.024 10.600  1.00 21.22 ? 306 VAL G CB   1  
ATOM 11237  C CG1  . VAL G 2 36  ? -5.635  -22.109 9.187   1.00 53.32 ? 306 VAL G CG1  1  
ATOM 11238  C CG2  . VAL G 2 36  ? -4.829  -20.551 11.052  1.00 21.52 ? 306 VAL G CG2  1  
ATOM 11239  H H    . VAL G 2 36  ? -5.652  -21.934 13.565  1.00 42.41 ? 306 VAL G H    1  
ATOM 11240  H HA   . VAL G 2 36  ? -6.822  -22.478 11.681  1.00 65.34 ? 306 VAL G HA   1  
ATOM 11241  H HB   . VAL G 2 36  ? -3.998  -22.455 10.528  1.00 74.34 ? 306 VAL G HB   1  
ATOM 11242  H HG11 . VAL G 2 36  ? -6.638  -21.702 9.204   1.00 52.44 ? 306 VAL G HG11 1  
ATOM 11243  H HG12 . VAL G 2 36  ? -5.678  -23.145 8.867   1.00 23.43 ? 306 VAL G HG12 1  
ATOM 11244  H HG13 . VAL G 2 36  ? -5.035  -21.552 8.484   1.00 23.11 ? 306 VAL G HG13 1  
ATOM 11245  H HG21 . VAL G 2 36  ? -4.329  -20.521 12.014  1.00 51.34 ? 306 VAL G HG21 1  
ATOM 11246  H HG22 . VAL G 2 36  ? -5.