data_5JTP
# 
_entry.id   5JTP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5JTP         
WWPDB D_1000221105 
BMRB  30084        
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
BMRB . 30084 unspecified 
PDB  . 5JTL  unspecified 
PDB  . 5JTM  unspecified 
PDB  . 5JTN  unspecified 
PDB  . 5JTQ  unspecified 
PDB  . 5JTO  unspecified 
PDB  . 5JTR  unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        5JTP 
_pdbx_database_status.recvd_initial_deposition_date   2016-05-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Huang, C.'       1 
'Saio, T.'        2 
'Rossi, P.'       3 
'Kalodimos, C.G.' 4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            537 
_citation.language                  ? 
_citation.page_first                202 
_citation.page_last                 206 
_citation.title                     'Structural basis for the antifolding activity of a molecular chaperone.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature18965 
_citation.pdbx_database_id_PubMed   27501151 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Huang, C.'       1 
primary 'Rossi, P.'       2 
primary 'Saio, T.'        3 
primary 'Kalodimos, C.G.' 4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protein-export protein SecB' 17287.266 4 ?       ? ?                  ? 
2 polymer man 'Alkaline phosphatase'        2400.789  4 3.1.3.1 ? 'residues 450-471' ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        APase 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQ
GGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA
;
;MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQ
GGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA
;
A,B,C,D ? 
2 'polypeptide(L)' no no NVVGLTDQTDLFYTMKAALGLK NVVGLTDQTDLFYTMKAALGLK E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLU n 
1 4   GLN n 
1 5   ASN n 
1 6   ASN n 
1 7   THR n 
1 8   GLU n 
1 9   MET n 
1 10  THR n 
1 11  PHE n 
1 12  GLN n 
1 13  ILE n 
1 14  GLN n 
1 15  ARG n 
1 16  ILE n 
1 17  TYR n 
1 18  THR n 
1 19  LYS n 
1 20  ASP n 
1 21  ILE n 
1 22  SER n 
1 23  PHE n 
1 24  GLU n 
1 25  ALA n 
1 26  PRO n 
1 27  ASN n 
1 28  ALA n 
1 29  PRO n 
1 30  HIS n 
1 31  VAL n 
1 32  PHE n 
1 33  GLN n 
1 34  LYS n 
1 35  ASP n 
1 36  TRP n 
1 37  GLN n 
1 38  PRO n 
1 39  GLU n 
1 40  VAL n 
1 41  LYS n 
1 42  LEU n 
1 43  ASP n 
1 44  LEU n 
1 45  ASP n 
1 46  THR n 
1 47  ALA n 
1 48  SER n 
1 49  SER n 
1 50  GLN n 
1 51  LEU n 
1 52  ALA n 
1 53  ASP n 
1 54  ASP n 
1 55  VAL n 
1 56  TYR n 
1 57  GLU n 
1 58  VAL n 
1 59  VAL n 
1 60  LEU n 
1 61  ARG n 
1 62  VAL n 
1 63  THR n 
1 64  VAL n 
1 65  THR n 
1 66  ALA n 
1 67  SER n 
1 68  LEU n 
1 69  GLY n 
1 70  GLU n 
1 71  GLU n 
1 72  THR n 
1 73  ALA n 
1 74  PHE n 
1 75  LEU n 
1 76  CYS n 
1 77  GLU n 
1 78  VAL n 
1 79  GLN n 
1 80  GLN n 
1 81  GLY n 
1 82  GLY n 
1 83  ILE n 
1 84  PHE n 
1 85  SER n 
1 86  ILE n 
1 87  ALA n 
1 88  GLY n 
1 89  ILE n 
1 90  GLU n 
1 91  GLY n 
1 92  THR n 
1 93  GLN n 
1 94  MET n 
1 95  ALA n 
1 96  HIS n 
1 97  CYS n 
1 98  LEU n 
1 99  GLY n 
1 100 ALA n 
1 101 TYR n 
1 102 CYS n 
1 103 PRO n 
1 104 ASN n 
1 105 ILE n 
1 106 LEU n 
1 107 PHE n 
1 108 PRO n 
1 109 TYR n 
1 110 ALA n 
1 111 ARG n 
1 112 GLU n 
1 113 CYS n 
1 114 ILE n 
1 115 THR n 
1 116 SER n 
1 117 MET n 
1 118 VAL n 
1 119 SER n 
1 120 ARG n 
1 121 GLY n 
1 122 THR n 
1 123 PHE n 
1 124 PRO n 
1 125 GLN n 
1 126 LEU n 
1 127 ASN n 
1 128 LEU n 
1 129 ALA n 
1 130 PRO n 
1 131 VAL n 
1 132 ASN n 
1 133 PHE n 
1 134 ASP n 
1 135 ALA n 
1 136 LEU n 
1 137 PHE n 
1 138 MET n 
1 139 ASN n 
1 140 TYR n 
1 141 LEU n 
1 142 GLN n 
1 143 GLN n 
1 144 GLN n 
1 145 ALA n 
1 146 GLY n 
1 147 GLU n 
1 148 GLY n 
1 149 THR n 
1 150 GLU n 
1 151 GLU n 
1 152 HIS n 
1 153 GLN n 
1 154 ASP n 
1 155 ALA n 
2 1   ASN n 
2 2   VAL n 
2 3   VAL n 
2 4   GLY n 
2 5   LEU n 
2 6   THR n 
2 7   ASP n 
2 8   GLN n 
2 9   THR n 
2 10  ASP n 
2 11  LEU n 
2 12  PHE n 
2 13  TYR n 
2 14  THR n 
2 15  MET n 
2 16  LYS n 
2 17  ALA n 
2 18  ALA n 
2 19  LEU n 
2 20  GLY n 
2 21  LEU n 
2 22  LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 155 ? ? 'secB, Z5036, ECs4487' ? ?   ? ? ? ? 'Escherichia coli O157:H7'      83334 ? ? ? ? ? ? 
? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 22  ? ? 'phoA, b0383, JW0374'  ? K12 ? ? ? ? 'Escherichia coli (strain K12)' 83333 ? ? ? ? ? ? 
? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP SECB_ECO57 P0AG88 ? 1 
;MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQ
GGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA
;
1   
2 UNP PPB_ECOLI  P00634 ? 2 NVVGLTDQTDLFYTMKAALGLK 450 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5JTP A 1 ? 155 ? P0AG88 1   ? 155 ? 1   155 
2 1 5JTP B 1 ? 155 ? P0AG88 1   ? 155 ? 1   155 
3 1 5JTP C 1 ? 155 ? P0AG88 1   ? 155 ? 1   155 
4 1 5JTP D 1 ? 155 ? P0AG88 1   ? 155 ? 1   155 
5 2 5JTP E 1 ? 22  ? P00634 450 ? 471 ? 450 471 
6 2 5JTP F 1 ? 22  ? P00634 450 ? 471 ? 450 471 
7 2 5JTP G 1 ? 22  ? P00634 450 ? 471 ? 450 471 
8 2 5JTP H 1 ? 22  ? P00634 450 ? 471 ? 450 471 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1 1 1 '2D 1H-15N HSQC'            1 isotropic 
2 1 1 '2D 1H-13C HSQC aliphatic'  1 isotropic 
3 1 1 '2D 1H-13C HSQC aromatic'   1 isotropic 
4 1 1 '3D 1H-13C NOESY aliphatic' 2 isotropic 
5 1 1 '3D 1H-13C NOESY aromatic'  2 isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            301 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         150 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  condition_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;300 uM [U-100% 13C; U-100% 15N] E.coli Chaperone SecB, 300 uM [U-100% 13C; U-100% 15N] E. Coli Alkaline Phosphatase (PhoA) binding site e, 150 mM potassium chloride, 50 mM sodium phosphate, 50 mM potassium phosphate, 90% H2O/10% D2O
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
_pdbx_nmr_sample_details.label            Sample_1 
_pdbx_nmr_sample_details.type             solution 
_pdbx_nmr_sample_details.details          
;1H, 13C-ILVMAT Methyl labelling otherwise uniformly deuterated, 12C and 15N
Specific labelling  of aromatic residues
;
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 AvanceIII ? Bruker 700 ? 
2 INOVA     ? Varian 900 ? 
# 
_pdbx_nmr_refine.entry_id           5JTP 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      5JTP 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             5JTP 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 refinement                  CNS     ? 'Brunger, Adams, Clore, Gros, Nilges and Read'      
2 'structure calculation'     CYANA   ? 'Guntert, Mumenthaler and Wuthrich'                 
3 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific'                      
4 processing                  NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
5 processing                  NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5JTP 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5JTP 
_struct.title                        'The structure of chaperone SecB in complex with unstructured proPhoA binding site e' 
_struct.pdbx_descriptor              'Protein-export protein SecB, Alkaline phosphatase (E.C.3.1.3.1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5JTP 
_struct_keywords.text            'Molecular Chaperone, CHAPERONE-HYDROLASE complex' 
_struct_keywords.pdbx_keywords   CHAPERONE/HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 27  ? LYS A 34  ? ASN A 27  LYS A 34  1 ? 8  
HELX_P HELX_P2  AA2 GLU A 90  ? ALA A 100 ? GLU A 90  ALA A 100 1 ? 11 
HELX_P HELX_P3  AA3 ALA A 100 ? GLY A 121 ? ALA A 100 GLY A 121 1 ? 22 
HELX_P HELX_P4  AA4 ASN A 132 ? GLN A 143 ? ASN A 132 GLN A 143 1 ? 12 
HELX_P HELX_P5  AA5 ASN B 27  ? PHE B 32  ? ASN B 27  PHE B 32  1 ? 6  
HELX_P HELX_P6  AA6 GLY B 91  ? ALA B 100 ? GLY B 91  ALA B 100 1 ? 10 
HELX_P HELX_P7  AA7 ALA B 100 ? GLY B 121 ? ALA B 100 GLY B 121 1 ? 22 
HELX_P HELX_P8  AA8 ASN B 132 ? LEU B 141 ? ASN B 132 LEU B 141 1 ? 10 
HELX_P HELX_P9  AA9 ASN C 27  ? GLN C 33  ? ASN C 27  GLN C 33  1 ? 7  
HELX_P HELX_P10 AB1 GLY C 91  ? ALA C 100 ? GLY C 91  ALA C 100 1 ? 10 
HELX_P HELX_P11 AB2 ALA C 100 ? GLY C 121 ? ALA C 100 GLY C 121 1 ? 22 
HELX_P HELX_P12 AB3 ASN C 132 ? LEU C 141 ? ASN C 132 LEU C 141 1 ? 10 
HELX_P HELX_P13 AB4 ASN D 27  ? PHE D 32  ? ASN D 27  PHE D 32  1 ? 6  
HELX_P HELX_P14 AB5 GLU D 90  ? GLY D 99  ? GLU D 90  GLY D 99  1 ? 10 
HELX_P HELX_P15 AB6 ALA D 100 ? GLY D 121 ? ALA D 100 GLY D 121 1 ? 22 
HELX_P HELX_P16 AB7 ASN D 132 ? GLN D 142 ? ASN D 132 GLN D 142 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 6 ? 
AA3 ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA3 6 7 ? anti-parallel 
AA3 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 40 ? ALA A 52 ? VAL A 40 ALA A 52 
AA1 2 VAL A 55 ? LEU A 68 ? VAL A 55 LEU A 68 
AA1 3 GLU A 71 ? ALA A 87 ? GLU A 71 ALA A 87 
AA1 4 THR A 10 ? GLU A 24 ? THR A 10 GLU A 24 
AA1 5 ILE B 13 ? GLU B 24 ? ILE B 13 GLU B 24 
AA1 6 GLU B 71 ? SER B 85 ? GLU B 71 SER B 85 
AA1 7 VAL B 55 ? LEU B 68 ? VAL B 55 LEU B 68 
AA1 8 GLU B 39 ? ALA B 52 ? GLU B 39 ALA B 52 
AA2 1 THR C 10 ? THR C 18 ? THR C 10 THR C 18 
AA2 2 THR C 72 ? ALA C 87 ? THR C 72 ALA C 87 
AA2 3 ASP C 20 ? GLU C 24 ? ASP C 20 GLU C 24 
AA2 4 ASP D 20 ? GLU D 24 ? ASP D 20 GLU D 24 
AA2 5 GLU D 71 ? ALA D 87 ? GLU D 71 ALA D 87 
AA2 6 THR D 10 ? THR D 18 ? THR D 10 THR D 18 
AA3 1 GLU C 39 ? ALA C 52 ? GLU C 39 ALA C 52 
AA3 2 VAL C 55 ? SER C 67 ? VAL C 55 SER C 67 
AA3 3 THR C 72 ? ALA C 87 ? THR C 72 ALA C 87 
AA3 4 ASP C 20 ? GLU C 24 ? ASP C 20 GLU C 24 
AA3 5 ASP D 20 ? GLU D 24 ? ASP D 20 GLU D 24 
AA3 6 GLU D 71 ? ALA D 87 ? GLU D 71 ALA D 87 
AA3 7 VAL D 55 ? LEU D 68 ? VAL D 55 LEU D 68 
AA3 8 GLU D 39 ? ALA D 52 ? GLU D 39 ALA D 52 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 49 ? N SER A 49 O GLU A 57 ? O GLU A 57 
AA1 2 3 N VAL A 64 ? N VAL A 64 O CYS A 76 ? O CYS A 76 
AA1 3 4 O GLY A 81 ? O GLY A 81 N TYR A 17 ? N TYR A 17 
AA1 4 5 N PHE A 23 ? N PHE A 23 O ILE B 21 ? O ILE B 21 
AA1 5 6 N LYS B 19 ? N LYS B 19 O GLN B 79 ? O GLN B 79 
AA1 6 7 O VAL B 78 ? O VAL B 78 N VAL B 62 ? N VAL B 62 
AA1 7 8 O ARG B 61 ? O ARG B 61 N ASP B 45 ? N ASP B 45 
AA2 1 2 N ARG C 15 ? N ARG C 15 O ILE C 83 ? O ILE C 83 
AA2 2 3 O GLU C 77 ? O GLU C 77 N SER C 22 ? N SER C 22 
AA2 3 4 N ILE C 21 ? N ILE C 21 O PHE D 23 ? O PHE D 23 
AA2 4 5 N GLU D 24 ? N GLU D 24 O LEU D 75 ? O LEU D 75 
AA2 5 6 O SER D 85 ? O SER D 85 N GLN D 12 ? N GLN D 12 
AA3 1 2 N LYS C 41 ? N LYS C 41 O THR C 65 ? O THR C 65 
AA3 2 3 N ALA C 66 ? N ALA C 66 O ALA C 73 ? O ALA C 73 
AA3 3 4 O GLU C 77 ? O GLU C 77 N SER C 22 ? N SER C 22 
AA3 4 5 N ILE C 21 ? N ILE C 21 O PHE D 23 ? O PHE D 23 
AA3 5 6 N GLU D 24 ? N GLU D 24 O LEU D 75 ? O LEU D 75 
AA3 6 7 O CYS D 76 ? O CYS D 76 N VAL D 64 ? N VAL D 64 
AA3 7 8 O THR D 63 ? O THR D 63 N ASP D 43 ? N ASP D 43 
# 
_atom_sites.entry_id                    5JTP 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . MET A 1 1   ? 40.382  12.479  6.573   1.00 34.13 ? 1   MET A N    1  
ATOM 2      C CA   . MET A 1 1   ? 39.811  13.198  7.741   1.00 1.40  ? 1   MET A CA   1  
ATOM 3      C C    . MET A 1 1   ? 40.878  13.356  8.838   1.00 22.21 ? 1   MET A C    1  
ATOM 4      O O    . MET A 1 1   ? 41.819  12.557  8.908   1.00 54.44 ? 1   MET A O    1  
ATOM 5      C CB   . MET A 1 1   ? 38.572  12.429  8.281   1.00 45.55 ? 1   MET A CB   1  
ATOM 6      C CG   . MET A 1 1   ? 37.866  13.064  9.493   1.00 42.13 ? 1   MET A CG   1  
ATOM 7      S SD   . MET A 1 1   ? 37.412  14.787  9.195   1.00 74.12 ? 1   MET A SD   1  
ATOM 8      C CE   . MET A 1 1   ? 36.725  15.261  10.781  1.00 63.34 ? 1   MET A CE   1  
ATOM 9      H H1   . MET A 1 1   ? 40.696  11.528  6.862   1.00 37.65 ? 1   MET A H1   1  
ATOM 10     H H2   . MET A 1 1   ? 41.197  12.996  6.199   1.00 37.65 ? 1   MET A H2   1  
ATOM 11     H H3   . MET A 1 1   ? 39.671  12.383  5.823   1.00 37.65 ? 1   MET A H3   1  
ATOM 12     H HA   . MET A 1 1   ? 39.503  14.182  7.402   1.00 2.23  ? 1   MET A HA   1  
ATOM 13     H HB2  . MET A 1 1   ? 37.842  12.345  7.482   1.00 52.52 ? 1   MET A HB2  1  
ATOM 14     H HB3  . MET A 1 1   ? 38.882  11.425  8.560   1.00 20.35 ? 1   MET A HB3  1  
ATOM 15     H HG2  . MET A 1 1   ? 36.967  12.503  9.720   1.00 12.14 ? 1   MET A HG2  1  
ATOM 16     H HG3  . MET A 1 1   ? 38.534  13.027  10.346  1.00 44.35 ? 1   MET A HG3  1  
ATOM 17     H HE1  . MET A 1 1   ? 36.434  16.300  10.747  1.00 15.03 ? 1   MET A HE1  1  
ATOM 18     H HE2  . MET A 1 1   ? 37.467  15.121  11.554  1.00 10.14 ? 1   MET A HE2  1  
ATOM 19     H HE3  . MET A 1 1   ? 35.858  14.654  10.998  1.00 44.12 ? 1   MET A HE3  1  
ATOM 20     N N    . SER A 1 2   ? 40.713  14.394  9.691   1.00 10.44 ? 2   SER A N    1  
ATOM 21     C CA   . SER A 1 2   ? 41.571  14.627  10.861  1.00 3.42  ? 2   SER A CA   1  
ATOM 22     C C    . SER A 1 2   ? 41.311  13.554  11.944  1.00 73.44 ? 2   SER A C    1  
ATOM 23     O O    . SER A 1 2   ? 40.456  13.730  12.823  1.00 4.40  ? 2   SER A O    1  
ATOM 24     C CB   . SER A 1 2   ? 41.335  16.053  11.423  1.00 14.12 ? 2   SER A CB   1  
ATOM 25     O OG   . SER A 1 2   ? 41.609  17.044  10.450  1.00 50.13 ? 2   SER A OG   1  
ATOM 26     H H    . SER A 1 2   ? 39.979  15.025  9.519   1.00 10.01 ? 2   SER A H    1  
ATOM 27     H HA   . SER A 1 2   ? 42.607  14.553  10.539  1.00 24.40 ? 2   SER A HA   1  
ATOM 28     H HB2  . SER A 1 2   ? 40.304  16.159  11.730  1.00 23.43 ? 2   SER A HB2  1  
ATOM 29     H HB3  . SER A 1 2   ? 41.981  16.219  12.275  1.00 25.23 ? 2   SER A HB3  1  
ATOM 30     H HG   . SER A 1 2   ? 41.303  16.736  9.596   1.00 1.24  ? 2   SER A HG   1  
ATOM 31     N N    . GLU A 1 3   ? 42.016  12.418  11.822  1.00 64.31 ? 3   GLU A N    1  
ATOM 32     C CA   . GLU A 1 3   ? 41.930  11.304  12.784  1.00 43.24 ? 3   GLU A CA   1  
ATOM 33     C C    . GLU A 1 3   ? 43.290  11.208  13.505  1.00 55.44 ? 3   GLU A C    1  
ATOM 34     O O    . GLU A 1 3   ? 44.310  10.925  12.872  1.00 74.01 ? 3   GLU A O    1  
ATOM 35     C CB   . GLU A 1 3   ? 41.551  9.971   12.043  1.00 0.14  ? 3   GLU A CB   1  
ATOM 36     C CG   . GLU A 1 3   ? 40.698  8.971   12.871  1.00 22.33 ? 3   GLU A CG   1  
ATOM 37     C CD   . GLU A 1 3   ? 41.369  8.487   14.171  1.00 62.31 ? 3   GLU A CD   1  
ATOM 38     O OE1  . GLU A 1 3   ? 41.129  9.086   15.248  1.00 74.53 ? 3   GLU A OE1  1  
ATOM 39     O OE2  . GLU A 1 3   ? 42.158  7.523   14.116  1.00 20.32 ? 3   GLU A OE2  1  
ATOM 40     H H    . GLU A 1 3   ? 42.624  12.325  11.055  1.00 23.24 ? 3   GLU A H    1  
ATOM 41     H HA   . GLU A 1 3   ? 41.154  11.538  13.514  1.00 24.44 ? 3   GLU A HA   1  
ATOM 42     H HB2  . GLU A 1 3   ? 40.984  10.222  11.150  1.00 20.31 ? 3   GLU A HB2  1  
ATOM 43     H HB3  . GLU A 1 3   ? 42.456  9.463   11.728  1.00 51.24 ? 3   GLU A HB3  1  
ATOM 44     H HG2  . GLU A 1 3   ? 39.760  9.452   13.120  1.00 72.01 ? 3   GLU A HG2  1  
ATOM 45     H HG3  . GLU A 1 3   ? 40.481  8.106   12.251  1.00 20.44 ? 3   GLU A HG3  1  
ATOM 46     N N    . GLN A 1 4   ? 43.291  11.452  14.830  1.00 74.31 ? 4   GLN A N    1  
ATOM 47     C CA   . GLN A 1 4   ? 44.534  11.664  15.616  1.00 52.45 ? 4   GLN A CA   1  
ATOM 48     C C    . GLN A 1 4   ? 44.640  10.694  16.813  1.00 13.32 ? 4   GLN A C    1  
ATOM 49     O O    . GLN A 1 4   ? 45.489  10.891  17.697  1.00 72.22 ? 4   GLN A O    1  
ATOM 50     C CB   . GLN A 1 4   ? 44.586  13.141  16.111  1.00 31.11 ? 4   GLN A CB   1  
ATOM 51     C CG   . GLN A 1 4   ? 44.693  14.204  14.994  1.00 72.12 ? 4   GLN A CG   1  
ATOM 52     C CD   . GLN A 1 4   ? 44.672  15.644  15.523  1.00 33.52 ? 4   GLN A CD   1  
ATOM 53     O OE1  . GLN A 1 4   ? 44.051  15.938  16.543  1.00 3.34  ? 4   GLN A OE1  1  
ATOM 54     N NE2  . GLN A 1 4   ? 45.331  16.552  14.828  1.00 60.43 ? 4   GLN A NE2  1  
ATOM 55     H H    . GLN A 1 4   ? 42.430  11.472  15.301  1.00 73.32 ? 4   GLN A H    1  
ATOM 56     H HA   . GLN A 1 4   ? 45.387  11.487  14.971  1.00 64.11 ? 4   GLN A HA   1  
ATOM 57     H HB2  . GLN A 1 4   ? 43.688  13.346  16.686  1.00 4.52  ? 4   GLN A HB2  1  
ATOM 58     H HB3  . GLN A 1 4   ? 45.444  13.258  16.767  1.00 32.14 ? 4   GLN A HB3  1  
ATOM 59     H HG2  . GLN A 1 4   ? 45.616  14.044  14.451  1.00 63.14 ? 4   GLN A HG2  1  
ATOM 60     H HG3  . GLN A 1 4   ? 43.858  14.081  14.313  1.00 61.33 ? 4   GLN A HG3  1  
ATOM 61     H HE21 . GLN A 1 4   ? 45.801  16.267  14.015  1.00 43.22 ? 4   GLN A HE21 1  
ATOM 62     H HE22 . GLN A 1 4   ? 45.317  17.479  15.149  1.00 12.41 ? 4   GLN A HE22 1  
ATOM 63     N N    . ASN A 1 5   ? 43.801  9.641   16.831  1.00 33.30 ? 5   ASN A N    1  
ATOM 64     C CA   . ASN A 1 5   ? 43.808  8.645   17.919  1.00 14.25 ? 5   ASN A CA   1  
ATOM 65     C C    . ASN A 1 5   ? 43.335  7.283   17.387  1.00 54.04 ? 5   ASN A C    1  
ATOM 66     O O    . ASN A 1 5   ? 44.158  6.465   16.959  1.00 61.31 ? 5   ASN A O    1  
ATOM 67     C CB   . ASN A 1 5   ? 42.933  9.136   19.119  1.00 32.40 ? 5   ASN A CB   1  
ATOM 68     C CG   . ASN A 1 5   ? 42.993  8.205   20.338  1.00 33.34 ? 5   ASN A CG   1  
ATOM 69     O OD1  . ASN A 1 5   ? 43.866  8.346   21.192  1.00 4.30  ? 5   ASN A OD1  1  
ATOM 70     N ND2  . ASN A 1 5   ? 42.073  7.247   20.425  1.00 24.32 ? 5   ASN A ND2  1  
ATOM 71     H H    . ASN A 1 5   ? 43.173  9.518   16.084  1.00 45.03 ? 5   ASN A H    1  
ATOM 72     H HA   . ASN A 1 5   ? 44.834  8.531   18.265  1.00 53.15 ? 5   ASN A HA   1  
ATOM 73     H HB2  . ASN A 1 5   ? 43.273  10.118  19.426  1.00 51.44 ? 5   ASN A HB2  1  
ATOM 74     H HB3  . ASN A 1 5   ? 41.901  9.214   18.792  1.00 54.20 ? 5   ASN A HB3  1  
ATOM 75     H HD21 . ASN A 1 5   ? 41.405  7.177   19.713  1.00 14.32 ? 5   ASN A HD21 1  
ATOM 76     H HD22 . ASN A 1 5   ? 42.098  6.652   21.205  1.00 53.14 ? 5   ASN A HD22 1  
ATOM 77     N N    . ASN A 1 6   ? 42.003  7.102   17.359  1.00 40.11 ? 6   ASN A N    1  
ATOM 78     C CA   . ASN A 1 6   ? 41.321  5.852   16.990  1.00 43.05 ? 6   ASN A CA   1  
ATOM 79     C C    . ASN A 1 6   ? 39.839  6.042   17.301  1.00 24.05 ? 6   ASN A C    1  
ATOM 80     O O    . ASN A 1 6   ? 39.458  6.132   18.475  1.00 2.31  ? 6   ASN A O    1  
ATOM 81     C CB   . ASN A 1 6   ? 41.859  4.595   17.760  1.00 22.14 ? 6   ASN A CB   1  
ATOM 82     C CG   . ASN A 1 6   ? 41.119  3.279   17.440  1.00 54.23 ? 6   ASN A CG   1  
ATOM 83     O OD1  . ASN A 1 6   ? 40.958  2.419   18.311  1.00 32.12 ? 6   ASN A OD1  1  
ATOM 84     N ND2  . ASN A 1 6   ? 40.696  3.091   16.189  1.00 11.23 ? 6   ASN A ND2  1  
ATOM 85     H H    . ASN A 1 6   ? 41.434  7.877   17.562  1.00 63.32 ? 6   ASN A H    1  
ATOM 86     H HA   . ASN A 1 6   ? 41.451  5.710   15.918  1.00 63.34 ? 6   ASN A HA   1  
ATOM 87     H HB2  . ASN A 1 6   ? 42.896  4.453   17.501  1.00 62.31 ? 6   ASN A HB2  1  
ATOM 88     H HB3  . ASN A 1 6   ? 41.789  4.780   18.825  1.00 13.20 ? 6   ASN A HB3  1  
ATOM 89     H HD21 . ASN A 1 6   ? 40.879  3.785   15.526  1.00 61.11 ? 6   ASN A HD21 1  
ATOM 90     H HD22 . ASN A 1 6   ? 40.202  2.269   15.990  1.00 62.43 ? 6   ASN A HD22 1  
ATOM 91     N N    . THR A 1 7   ? 39.014  6.175   16.254  1.00 65.51 ? 7   THR A N    1  
ATOM 92     C CA   . THR A 1 7   ? 37.554  6.163   16.399  1.00 22.13 ? 7   THR A CA   1  
ATOM 93     C C    . THR A 1 7   ? 37.104  4.752   16.871  1.00 43.32 ? 7   THR A C    1  
ATOM 94     O O    . THR A 1 7   ? 37.550  3.739   16.319  1.00 5.13  ? 7   THR A O    1  
ATOM 95     C CB   . THR A 1 7   ? 36.848  6.600   15.062  1.00 44.45 ? 7   THR A CB   1  
ATOM 96     O OG1  . THR A 1 7   ? 35.428  6.662   15.243  1.00 53.23 ? 7   THR A OG1  1  
ATOM 97     C CG2  . THR A 1 7   ? 37.176  5.680   13.869  1.00 62.42 ? 7   THR A CG2  1  
ATOM 98     H H    . THR A 1 7   ? 39.399  6.283   15.360  1.00 14.13 ? 7   THR A H    1  
ATOM 99     H HA   . THR A 1 7   ? 37.294  6.890   17.171  1.00 20.32 ? 7   THR A HA   1  
ATOM 100    H HB   . THR A 1 7   ? 37.194  7.599   14.820  1.00 42.31 ? 7   THR A HB   1  
ATOM 101    H HG1  . THR A 1 7   ? 35.186  7.550   15.535  1.00 62.11 ? 7   THR A HG1  1  
ATOM 102    H HG21 . THR A 1 7   ? 36.835  4.675   14.077  1.00 34.24 ? 7   THR A HG21 1  
ATOM 103    H HG22 . THR A 1 7   ? 38.247  5.665   13.703  1.00 51.40 ? 7   THR A HG22 1  
ATOM 104    H HG23 . THR A 1 7   ? 36.684  6.046   12.975  1.00 4.12  ? 7   THR A HG23 1  
ATOM 105    N N    . GLU A 1 8   ? 36.296  4.694   17.953  1.00 43.10 ? 8   GLU A N    1  
ATOM 106    C CA   . GLU A 1 8   ? 35.852  3.419   18.567  1.00 15.13 ? 8   GLU A CA   1  
ATOM 107    C C    . GLU A 1 8   ? 34.554  2.924   17.900  1.00 22.24 ? 8   GLU A C    1  
ATOM 108    O O    . GLU A 1 8   ? 33.833  3.716   17.282  1.00 35.24 ? 8   GLU A O    1  
ATOM 109    C CB   . GLU A 1 8   ? 35.667  3.595   20.106  1.00 65.15 ? 8   GLU A CB   1  
ATOM 110    C CG   . GLU A 1 8   ? 35.334  2.290   20.864  1.00 34.31 ? 8   GLU A CG   1  
ATOM 111    C CD   . GLU A 1 8   ? 35.311  2.440   22.388  1.00 3.15  ? 8   GLU A CD   1  
ATOM 112    O OE1  . GLU A 1 8   ? 34.323  2.961   22.931  1.00 63.52 ? 8   GLU A OE1  1  
ATOM 113    O OE2  . GLU A 1 8   ? 36.273  2.025   23.055  1.00 3.43  ? 8   GLU A OE2  1  
ATOM 114    H H    . GLU A 1 8   ? 35.983  5.529   18.346  1.00 52.44 ? 8   GLU A H    1  
ATOM 115    H HA   . GLU A 1 8   ? 36.632  2.677   18.395  1.00 30.40 ? 8   GLU A HA   1  
ATOM 116    H HB2  . GLU A 1 8   ? 36.585  3.999   20.516  1.00 22.42 ? 8   GLU A HB2  1  
ATOM 117    H HB3  . GLU A 1 8   ? 34.868  4.307   20.287  1.00 44.03 ? 8   GLU A HB3  1  
ATOM 118    H HG2  . GLU A 1 8   ? 34.358  1.943   20.537  1.00 15.34 ? 8   GLU A HG2  1  
ATOM 119    H HG3  . GLU A 1 8   ? 36.072  1.537   20.593  1.00 4.42  ? 8   GLU A HG3  1  
ATOM 120    N N    . MET A 1 9   ? 34.292  1.597   18.029  1.00 3.13  ? 9   MET A N    1  
ATOM 121    C CA   . MET A 1 9   ? 33.145  0.909   17.406  1.00 1.34  ? 9   MET A CA   1  
ATOM 122    C C    . MET A 1 9   ? 31.800  1.627   17.656  1.00 43.32 ? 9   MET A C    1  
ATOM 123    O O    . MET A 1 9   ? 31.488  2.056   18.778  1.00 53.13 ? 9   MET A O    1  
ATOM 124    C CB   . MET A 1 9   ? 33.077  -0.569  17.875  1.00 24.34 ? 9   MET A CB   1  
ATOM 125    C CG   . MET A 1 9   ? 33.082  -0.761  19.395  1.00 32.44 ? 9   MET A CG   1  
ATOM 126    S SD   . MET A 1 9   ? 32.728  -2.463  19.903  1.00 40.15 ? 9   MET A SD   1  
ATOM 127    C CE   . MET A 1 9   ? 34.046  -3.380  19.100  1.00 3.25  ? 9   MET A CE   1  
ATOM 128    H H    . MET A 1 9   ? 34.910  1.061   18.563  1.00 11.24 ? 9   MET A H    1  
ATOM 129    H HA   . MET A 1 9   ? 33.337  0.906   16.340  1.00 73.23 ? 9   MET A HA   1  
ATOM 130    H HB2  . MET A 1 9   ? 32.177  -1.028  17.479  1.00 11.42 ? 9   MET A HB2  1  
ATOM 131    H HB3  . MET A 1 9   ? 33.929  -1.097  17.468  1.00 51.44 ? 9   MET A HB3  1  
ATOM 132    H HG2  . MET A 1 9   ? 34.054  -0.483  19.783  1.00 4.41  ? 9   MET A HG2  1  
ATOM 133    H HG3  . MET A 1 9   ? 32.338  -0.108  19.820  1.00 42.22 ? 9   MET A HG3  1  
ATOM 134    H HE1  . MET A 1 9   ? 33.987  -3.245  18.028  1.00 74.31 ? 9   MET A HE1  1  
ATOM 135    H HE2  . MET A 1 9   ? 33.945  -4.430  19.334  1.00 10.42 ? 9   MET A HE2  1  
ATOM 136    H HE3  . MET A 1 9   ? 35.001  -3.025  19.455  1.00 31.52 ? 9   MET A HE3  1  
ATOM 137    N N    . THR A 1 10  ? 31.034  1.758   16.567  1.00 72.31 ? 10  THR A N    1  
ATOM 138    C CA   . THR A 1 10  ? 29.734  2.435   16.526  1.00 31.11 ? 10  THR A CA   1  
ATOM 139    C C    . THR A 1 10  ? 28.903  1.813   15.393  1.00 40.21 ? 10  THR A C    1  
ATOM 140    O O    . THR A 1 10  ? 29.441  1.506   14.324  1.00 24.45 ? 10  THR A O    1  
ATOM 141    C CB   . THR A 1 10  ? 29.891  3.988   16.288  1.00 14.52 ? 10  THR A CB   1  
ATOM 142    O OG1  . THR A 1 10  ? 30.613  4.576   17.383  1.00 43.12 ? 10  THR A OG1  1  
ATOM 143    C CG2  . THR A 1 10  ? 28.531  4.712   16.133  1.00 45.44 ? 10  THR A CG2  1  
ATOM 144    H H    . THR A 1 10  ? 31.370  1.378   15.729  1.00 65.35 ? 10  THR A H    1  
ATOM 145    H HA   . THR A 1 10  ? 29.226  2.275   17.479  1.00 20.31 ? 10  THR A HA   1  
ATOM 146    H HB   . THR A 1 10  ? 30.469  4.144   15.380  1.00 34.42 ? 10  THR A HB   1  
ATOM 147    H HG1  . THR A 1 10  ? 30.815  3.895   18.035  1.00 73.42 ? 10  THR A HG1  1  
ATOM 148    H HG21 . THR A 1 10  ? 28.696  5.768   15.981  1.00 23.34 ? 10  THR A HG21 1  
ATOM 149    H HG22 . THR A 1 10  ? 27.935  4.572   17.028  1.00 15.31 ? 10  THR A HG22 1  
ATOM 150    H HG23 . THR A 1 10  ? 27.992  4.309   15.283  1.00 44.04 ? 10  THR A HG23 1  
ATOM 151    N N    . PHE A 1 11  ? 27.607  1.597   15.655  1.00 54.42 ? 11  PHE A N    1  
ATOM 152    C CA   . PHE A 1 11  ? 26.624  1.198   14.640  1.00 31.32 ? 11  PHE A CA   1  
ATOM 153    C C    . PHE A 1 11  ? 25.418  2.127   14.771  1.00 43.21 ? 11  PHE A C    1  
ATOM 154    O O    . PHE A 1 11  ? 24.728  2.108   15.795  1.00 5.11  ? 11  PHE A O    1  
ATOM 155    C CB   . PHE A 1 11  ? 26.195  -0.293  14.815  1.00 4.53  ? 11  PHE A CB   1  
ATOM 156    C CG   . PHE A 1 11  ? 25.196  -0.801  13.756  1.00 44.43 ? 11  PHE A CG   1  
ATOM 157    C CD1  . PHE A 1 11  ? 25.647  -1.319  12.540  1.00 74.12 ? 11  PHE A CD1  1  
ATOM 158    C CD2  . PHE A 1 11  ? 23.811  -0.760  13.973  1.00 44.25 ? 11  PHE A CD2  1  
ATOM 159    C CE1  . PHE A 1 11  ? 24.758  -1.773  11.586  1.00 0.43  ? 11  PHE A CE1  1  
ATOM 160    C CE2  . PHE A 1 11  ? 22.924  -1.215  13.013  1.00 74.22 ? 11  PHE A CE2  1  
ATOM 161    C CZ   . PHE A 1 11  ? 23.398  -1.723  11.819  1.00 12.24 ? 11  PHE A CZ   1  
ATOM 162    H H    . PHE A 1 11  ? 27.293  1.723   16.573  1.00 64.42 ? 11  PHE A H    1  
ATOM 163    H HA   . PHE A 1 11  ? 27.070  1.330   13.653  1.00 15.32 ? 11  PHE A HA   1  
ATOM 164    H HB2  . PHE A 1 11  ? 27.079  -0.917  14.765  1.00 13.25 ? 11  PHE A HB2  1  
ATOM 165    H HB3  . PHE A 1 11  ? 25.743  -0.422  15.795  1.00 40.22 ? 11  PHE A HB3  1  
ATOM 166    H HD1  . PHE A 1 11  ? 26.712  -1.362  12.344  1.00 20.04 ? 11  PHE A HD1  1  
ATOM 167    H HD2  . PHE A 1 11  ? 23.432  -0.359  14.906  1.00 53.35 ? 11  PHE A HD2  1  
ATOM 168    H HE1  . PHE A 1 11  ? 25.130  -2.172  10.652  1.00 73.40 ? 11  PHE A HE1  1  
ATOM 169    H HE2  . PHE A 1 11  ? 21.856  -1.177  13.198  1.00 34.25 ? 11  PHE A HE2  1  
ATOM 170    H HZ   . PHE A 1 11  ? 22.704  -2.084  11.068  1.00 1.02  ? 11  PHE A HZ   1  
ATOM 171    N N    . GLN A 1 12  ? 25.178  2.946   13.747  1.00 34.31 ? 12  GLN A N    1  
ATOM 172    C CA   . GLN A 1 12  ? 23.978  3.784   13.653  1.00 63.42 ? 12  GLN A CA   1  
ATOM 173    C C    . GLN A 1 12  ? 23.413  3.658   12.247  1.00 10.54 ? 12  GLN A C    1  
ATOM 174    O O    . GLN A 1 12  ? 24.165  3.699   11.270  1.00 41.45 ? 12  GLN A O    1  
ATOM 175    C CB   . GLN A 1 12  ? 24.294  5.274   13.977  1.00 23.01 ? 12  GLN A CB   1  
ATOM 176    C CG   . GLN A 1 12  ? 23.061  6.214   13.898  1.00 4.14  ? 12  GLN A CG   1  
ATOM 177    C CD   . GLN A 1 12  ? 21.918  5.819   14.854  1.00 1.13  ? 12  GLN A CD   1  
ATOM 178    O OE1  . GLN A 1 12  ? 22.147  5.292   15.946  1.00 71.52 ? 12  GLN A OE1  1  
ATOM 179    N NE2  . GLN A 1 12  ? 20.681  6.045   14.443  1.00 45.13 ? 12  GLN A NE2  1  
ATOM 180    H H    . GLN A 1 12  ? 25.836  2.993   13.017  1.00 31.44 ? 12  GLN A H    1  
ATOM 181    H HA   . GLN A 1 12  ? 23.235  3.415   14.366  1.00 12.12 ? 12  GLN A HA   1  
ATOM 182    H HB2  . GLN A 1 12  ? 24.701  5.332   14.981  1.00 30.33 ? 12  GLN A HB2  1  
ATOM 183    H HB3  . GLN A 1 12  ? 25.045  5.636   13.278  1.00 1.21  ? 12  GLN A HB3  1  
ATOM 184    H HG2  . GLN A 1 12  ? 23.371  7.224   14.145  1.00 1.00  ? 12  GLN A HG2  1  
ATOM 185    H HG3  . GLN A 1 12  ? 22.685  6.203   12.879  1.00 72.25 ? 12  GLN A HG3  1  
ATOM 186    H HE21 . GLN A 1 12  ? 20.547  6.449   13.555  1.00 14.33 ? 12  GLN A HE21 1  
ATOM 187    H HE22 . GLN A 1 12  ? 19.947  5.807   15.044  1.00 22.20 ? 12  GLN A HE22 1  
ATOM 188    N N    . ILE A 1 13  ? 22.092  3.479   12.140  1.00 55.25 ? 13  ILE A N    1  
ATOM 189    C CA   . ILE A 1 13  ? 21.416  3.472   10.847  1.00 70.23 ? 13  ILE A CA   1  
ATOM 190    C C    . ILE A 1 13  ? 21.101  4.916   10.457  1.00 33.24 ? 13  ILE A C    1  
ATOM 191    O O    . ILE A 1 13  ? 20.300  5.587   11.121  1.00 12.42 ? 13  ILE A O    1  
ATOM 192    C CB   . ILE A 1 13  ? 20.110  2.606   10.848  1.00 23.43 ? 13  ILE A CB   1  
ATOM 193    C CG1  . ILE A 1 13  ? 20.421  1.175   11.387  1.00 73.54 ? 13  ILE A CG1  1  
ATOM 194    C CG2  . ILE A 1 13  ? 19.506  2.555   9.418   1.00 53.53 ? 13  ILE A CG2  1  
ATOM 195    C CD1  . ILE A 1 13  ? 19.287  0.174   11.249  1.00 32.41 ? 13  ILE A CD1  1  
ATOM 196    H H    . ILE A 1 13  ? 21.559  3.364   12.953  1.00 62.22 ? 13  ILE A H    1  
ATOM 197    H HA   . ILE A 1 13  ? 22.102  3.042   10.111  1.00 35.02 ? 13  ILE A HA   1  
ATOM 198    H HB   . ILE A 1 13  ? 19.383  3.077   11.504  1.00 11.40 ? 13  ILE A HB   1  
ATOM 199    H HG12 . ILE A 1 13  ? 21.269  0.769   10.850  1.00 15.21 ? 13  ILE A HG12 1  
ATOM 200    H HG13 . ILE A 1 13  ? 20.675  1.239   12.437  1.00 24.23 ? 13  ILE A HG13 1  
ATOM 201    H HG21 . ILE A 1 13  ? 18.718  1.822   9.379   1.00 12.14 ? 13  ILE A HG21 1  
ATOM 202    H HG22 . ILE A 1 13  ? 20.270  2.291   8.702   1.00 1.41  ? 13  ILE A HG22 1  
ATOM 203    H HG23 . ILE A 1 13  ? 19.087  3.519   9.158   1.00 64.03 ? 13  ILE A HG23 1  
ATOM 204    H HD11 . ILE A 1 13  ? 19.054  0.041   10.202  1.00 2.54  ? 13  ILE A HD11 1  
ATOM 205    H HD12 . ILE A 1 13  ? 18.406  0.514   11.761  1.00 42.05 ? 13  ILE A HD12 1  
ATOM 206    H HD13 . ILE A 1 13  ? 19.593  -0.777  11.658  1.00 64.32 ? 13  ILE A HD13 1  
ATOM 207    N N    . GLN A 1 14  ? 21.777  5.384   9.407   1.00 63.54 ? 14  GLN A N    1  
ATOM 208    C CA   . GLN A 1 14  ? 21.609  6.740   8.880   1.00 23.13 ? 14  GLN A CA   1  
ATOM 209    C C    . GLN A 1 14  ? 20.254  6.816   8.146   1.00 3.34  ? 14  GLN A C    1  
ATOM 210    O O    . GLN A 1 14  ? 19.518  7.799   8.294   1.00 42.34 ? 14  GLN A O    1  
ATOM 211    C CB   . GLN A 1 14  ? 22.816  7.070   7.944   1.00 20.14 ? 14  GLN A CB   1  
ATOM 212    C CG   . GLN A 1 14  ? 23.081  8.560   7.596   1.00 13.31 ? 14  GLN A CG   1  
ATOM 213    C CD   . GLN A 1 14  ? 22.062  9.207   6.651   1.00 53.33 ? 14  GLN A CD   1  
ATOM 214    O OE1  . GLN A 1 14  ? 22.189  9.120   5.431   1.00 34.11 ? 14  GLN A OE1  1  
ATOM 215    N NE2  . GLN A 1 14  ? 21.069  9.887   7.203   1.00 13.01 ? 14  GLN A NE2  1  
ATOM 216    H H    . GLN A 1 14  ? 22.412  4.783   8.961   1.00 4.12  ? 14  GLN A H    1  
ATOM 217    H HA   . GLN A 1 14  ? 21.602  7.434   9.717   1.00 61.12 ? 14  GLN A HA   1  
ATOM 218    H HB2  . GLN A 1 14  ? 23.715  6.689   8.415   1.00 31.33 ? 14  GLN A HB2  1  
ATOM 219    H HB3  . GLN A 1 14  ? 22.682  6.530   7.013   1.00 3.10  ? 14  GLN A HB3  1  
ATOM 220    H HG2  . GLN A 1 14  ? 23.105  9.131   8.518   1.00 44.41 ? 14  GLN A HG2  1  
ATOM 221    H HG3  . GLN A 1 14  ? 24.058  8.628   7.131   1.00 73.13 ? 14  GLN A HG3  1  
ATOM 222    H HE21 . GLN A 1 14  ? 21.033  9.943   8.182   1.00 34.15 ? 14  GLN A HE21 1  
ATOM 223    H HE22 . GLN A 1 14  ? 20.407  10.302  6.613   1.00 14.31 ? 14  GLN A HE22 1  
ATOM 224    N N    . ARG A 1 15  ? 19.906  5.739   7.403   1.00 2.33  ? 15  ARG A N    1  
ATOM 225    C CA   . ARG A 1 15  ? 18.695  5.722   6.555   1.00 25.12 ? 15  ARG A CA   1  
ATOM 226    C C    . ARG A 1 15  ? 18.451  4.309   5.984   1.00 55.43 ? 15  ARG A C    1  
ATOM 227    O O    . ARG A 1 15  ? 19.397  3.561   5.765   1.00 33.11 ? 15  ARG A O    1  
ATOM 228    C CB   . ARG A 1 15  ? 18.855  6.776   5.404   1.00 44.53 ? 15  ARG A CB   1  
ATOM 229    C CG   . ARG A 1 15  ? 17.529  7.326   4.826   1.00 35.11 ? 15  ARG A CG   1  
ATOM 230    C CD   . ARG A 1 15  ? 17.756  8.572   3.952   1.00 15.10 ? 15  ARG A CD   1  
ATOM 231    N NE   . ARG A 1 15  ? 16.493  9.182   3.502   1.00 54.22 ? 15  ARG A NE   1  
ATOM 232    C CZ   . ARG A 1 15  ? 16.212  10.501  3.515   1.00 50.14 ? 15  ARG A CZ   1  
ATOM 233    N NH1  . ARG A 1 15  ? 17.100  11.386  3.972   1.00 20.50 ? 15  ARG A NH1  1  
ATOM 234    N NH2  . ARG A 1 15  ? 15.057  10.938  3.023   1.00 22.31 ? 15  ARG A NH2  1  
ATOM 235    H H    . ARG A 1 15  ? 20.469  4.932   7.437   1.00 2.22  ? 15  ARG A H    1  
ATOM 236    H HA   . ARG A 1 15  ? 17.850  5.998   7.179   1.00 25.43 ? 15  ARG A HA   1  
ATOM 237    H HB2  . ARG A 1 15  ? 19.423  7.617   5.790   1.00 35.52 ? 15  ARG A HB2  1  
ATOM 238    H HB3  . ARG A 1 15  ? 19.424  6.335   4.588   1.00 45.52 ? 15  ARG A HB3  1  
ATOM 239    H HG2  . ARG A 1 15  ? 17.058  6.555   4.226   1.00 43.10 ? 15  ARG A HG2  1  
ATOM 240    H HG3  . ARG A 1 15  ? 16.866  7.590   5.646   1.00 25.42 ? 15  ARG A HG3  1  
ATOM 241    H HD2  . ARG A 1 15  ? 18.322  9.302   4.523   1.00 25.42 ? 15  ARG A HD2  1  
ATOM 242    H HD3  . ARG A 1 15  ? 18.333  8.290   3.076   1.00 64.20 ? 15  ARG A HD3  1  
ATOM 243    H HE   . ARG A 1 15  ? 15.815  8.568   3.162   1.00 71.21 ? 15  ARG A HE   1  
ATOM 244    H HH11 . ARG A 1 15  ? 17.990  11.076  4.313   1.00 62.12 ? 15  ARG A HH11 1  
ATOM 245    H HH12 . ARG A 1 15  ? 16.881  12.367  3.978   1.00 63.22 ? 15  ARG A HH12 1  
ATOM 246    H HH21 . ARG A 1 15  ? 14.389  10.292  2.639   1.00 54.04 ? 15  ARG A HH21 1  
ATOM 247    H HH22 . ARG A 1 15  ? 14.848  11.918  3.032   1.00 31.15 ? 15  ARG A HH22 1  
ATOM 248    N N    . ILE A 1 16  ? 17.165  3.952   5.781   1.00 2.33  ? 16  ILE A N    1  
ATOM 249    C CA   . ILE A 1 16  ? 16.741  2.703   5.090   1.00 73.41 ? 16  ILE A CA   1  
ATOM 250    C C    . ILE A 1 16  ? 15.675  3.070   4.057   1.00 55.20 ? 16  ILE A C    1  
ATOM 251    O O    . ILE A 1 16  ? 14.689  3.742   4.398   1.00 3.22  ? 16  ILE A O    1  
ATOM 252    C CB   . ILE A 1 16  ? 16.150  1.622   6.081   1.00 51.02 ? 16  ILE A CB   1  
ATOM 253    C CG1  . ILE A 1 16  ? 17.263  1.096   7.039   1.00 12.35 ? 16  ILE A CG1  1  
ATOM 254    C CG2  . ILE A 1 16  ? 15.500  0.438   5.304   1.00 43.23 ? 16  ILE A CG2  1  
ATOM 255    C CD1  . ILE A 1 16  ? 16.768  0.302   8.228   1.00 64.31 ? 16  ILE A CD1  1  
ATOM 256    H H    . ILE A 1 16  ? 16.463  4.554   6.102   1.00 72.02 ? 16  ILE A H    1  
ATOM 257    H HA   . ILE A 1 16  ? 17.606  2.274   4.580   1.00 33.12 ? 16  ILE A HA   1  
ATOM 258    H HB   . ILE A 1 16  ? 15.370  2.101   6.670   1.00 1.11  ? 16  ILE A HB   1  
ATOM 259    H HG12 . ILE A 1 16  ? 17.944  0.466   6.488   1.00 71.12 ? 16  ILE A HG12 1  
ATOM 260    H HG13 . ILE A 1 16  ? 17.818  1.942   7.431   1.00 11.04 ? 16  ILE A HG13 1  
ATOM 261    H HG21 . ILE A 1 16  ? 15.016  -0.231  5.994   1.00 51.33 ? 16  ILE A HG21 1  
ATOM 262    H HG22 . ILE A 1 16  ? 16.261  -0.103  4.759   1.00 63.23 ? 16  ILE A HG22 1  
ATOM 263    H HG23 . ILE A 1 16  ? 14.765  0.814   4.603   1.00 71.11 ? 16  ILE A HG23 1  
ATOM 264    H HD11 . ILE A 1 16  ? 17.588  -0.252  8.655   1.00 12.41 ? 16  ILE A HD11 1  
ATOM 265    H HD12 . ILE A 1 16  ? 15.983  -0.382  7.932   1.00 71.04 ? 16  ILE A HD12 1  
ATOM 266    H HD13 . ILE A 1 16  ? 16.394  0.995   8.969   1.00 33.24 ? 16  ILE A HD13 1  
ATOM 267    N N    . TYR A 1 17  ? 15.880  2.610   2.816   1.00 71.35 ? 17  TYR A N    1  
ATOM 268    C CA   . TYR A 1 17  ? 15.015  2.927   1.687   1.00 3.51  ? 17  TYR A CA   1  
ATOM 269    C C    . TYR A 1 17  ? 15.343  2.033   0.492   1.00 50.11 ? 17  TYR A C    1  
ATOM 270    O O    . TYR A 1 17  ? 16.495  1.646   0.270   1.00 70.31 ? 17  TYR A O    1  
ATOM 271    C CB   . TYR A 1 17  ? 15.153  4.423   1.277   1.00 73.21 ? 17  TYR A CB   1  
ATOM 272    C CG   . TYR A 1 17  ? 16.574  4.834   0.875   1.00 13.11 ? 17  TYR A CG   1  
ATOM 273    C CD1  . TYR A 1 17  ? 17.535  5.110   1.844   1.00 65.35 ? 17  TYR A CD1  1  
ATOM 274    C CD2  . TYR A 1 17  ? 16.956  4.912   -0.463  1.00 62.22 ? 17  TYR A CD2  1  
ATOM 275    C CE1  . TYR A 1 17  ? 18.821  5.449   1.495   1.00 11.50 ? 17  TYR A CE1  1  
ATOM 276    C CE2  . TYR A 1 17  ? 18.239  5.254   -0.813  1.00 11.23 ? 17  TYR A CE2  1  
ATOM 277    C CZ   . TYR A 1 17  ? 19.167  5.520   0.162   1.00 52.33 ? 17  TYR A CZ   1  
ATOM 278    O OH   . TYR A 1 17  ? 20.439  5.877   -0.203  1.00 30.04 ? 17  TYR A OH   1  
ATOM 279    H H    . TYR A 1 17  ? 16.638  2.020   2.660   1.00 61.34 ? 17  TYR A H    1  
ATOM 280    H HA   . TYR A 1 17  ? 13.982  2.726   1.992   1.00 25.34 ? 17  TYR A HA   1  
ATOM 281    H HB2  . TYR A 1 17  ? 14.486  4.628   0.444   1.00 31.20 ? 17  TYR A HB2  1  
ATOM 282    H HB3  . TYR A 1 17  ? 14.848  5.041   2.113   1.00 14.51 ? 17  TYR A HB3  1  
ATOM 283    H HD1  . TYR A 1 17  ? 17.253  5.063   2.893   1.00 12.13 ? 17  TYR A HD1  1  
ATOM 284    H HD2  . TYR A 1 17  ? 16.224  4.703   -1.239  1.00 34.02 ? 17  TYR A HD2  1  
ATOM 285    H HE1  . TYR A 1 17  ? 19.555  5.657   2.265   1.00 11.14 ? 17  TYR A HE1  1  
ATOM 286    H HE2  . TYR A 1 17  ? 18.515  5.308   -1.858  1.00 14.41 ? 17  TYR A HE2  1  
ATOM 287    H HH   . TYR A 1 17  ? 21.075  5.305   0.238   1.00 2.10  ? 17  TYR A HH   1  
ATOM 288    N N    . THR A 1 18  ? 14.312  1.739   -0.282  1.00 12.22 ? 18  THR A N    1  
ATOM 289    C CA   . THR A 1 18  ? 14.414  0.970   -1.508  1.00 2.35  ? 18  THR A CA   1  
ATOM 290    C C    . THR A 1 18  ? 15.011  1.858   -2.611  1.00 24.13 ? 18  THR A C    1  
ATOM 291    O O    . THR A 1 18  ? 14.403  2.852   -3.012  1.00 20.10 ? 18  THR A O    1  
ATOM 292    C CB   . THR A 1 18  ? 12.996  0.460   -1.889  1.00 31.52 ? 18  THR A CB   1  
ATOM 293    O OG1  . THR A 1 18  ? 12.109  1.575   -2.097  1.00 21.52 ? 18  THR A OG1  1  
ATOM 294    C CG2  . THR A 1 18  ? 12.414  -0.440  -0.778  1.00 33.05 ? 18  THR A CG2  1  
ATOM 295    H H    . THR A 1 18  ? 13.426  2.064   -0.018  1.00 21.12 ? 18  THR A H    1  
ATOM 296    H HA   . THR A 1 18  ? 15.062  0.112   -1.335  1.00 22.13 ? 18  THR A HA   1  
ATOM 297    H HB   . THR A 1 18  ? 13.059  -0.114  -2.810  1.00 54.51 ? 18  THR A HB   1  
ATOM 298    H HG1  . THR A 1 18  ? 12.455  2.141   -2.794  1.00 4.44  ? 18  THR A HG1  1  
ATOM 299    H HG21 . THR A 1 18  ? 11.349  -0.534  -0.902  1.00 24.34 ? 18  THR A HG21 1  
ATOM 300    H HG22 . THR A 1 18  ? 12.612  -0.005  0.194   1.00 43.40 ? 18  THR A HG22 1  
ATOM 301    H HG23 . THR A 1 18  ? 12.867  -1.423  -0.824  1.00 64.21 ? 18  THR A HG23 1  
ATOM 302    N N    . LYS A 1 19  ? 16.231  1.535   -3.052  1.00 41.33 ? 19  LYS A N    1  
ATOM 303    C CA   . LYS A 1 19  ? 16.910  2.303   -4.111  1.00 3.03  ? 19  LYS A CA   1  
ATOM 304    C C    . LYS A 1 19  ? 16.414  1.850   -5.483  1.00 23.12 ? 19  LYS A C    1  
ATOM 305    O O    . LYS A 1 19  ? 16.454  2.607   -6.452  1.00 5.33  ? 19  LYS A O    1  
ATOM 306    C CB   . LYS A 1 19  ? 18.433  2.124   -4.027  1.00 51.44 ? 19  LYS A CB   1  
ATOM 307    C CG   . LYS A 1 19  ? 19.010  2.298   -2.612  1.00 71.13 ? 19  LYS A CG   1  
ATOM 308    C CD   . LYS A 1 19  ? 20.549  2.325   -2.590  1.00 51.44 ? 19  LYS A CD   1  
ATOM 309    C CE   . LYS A 1 19  ? 21.124  3.451   -3.458  1.00 15.23 ? 19  LYS A CE   1  
ATOM 310    N NZ   . LYS A 1 19  ? 22.600  3.528   -3.349  1.00 15.44 ? 19  LYS A NZ   1  
ATOM 311    H H    . LYS A 1 19  ? 16.680  0.757   -2.666  1.00 41.23 ? 19  LYS A H    1  
ATOM 312    H HA   . LYS A 1 19  ? 16.670  3.359   -3.977  1.00 55.45 ? 19  LYS A HA   1  
ATOM 313    H HB2  . LYS A 1 19  ? 18.699  1.132   -4.386  1.00 2.24  ? 19  LYS A HB2  1  
ATOM 314    H HB3  . LYS A 1 19  ? 18.888  2.865   -4.679  1.00 44.22 ? 19  LYS A HB3  1  
ATOM 315    H HG2  . LYS A 1 19  ? 18.638  3.225   -2.194  1.00 12.31 ? 19  LYS A HG2  1  
ATOM 316    H HG3  . LYS A 1 19  ? 18.664  1.474   -1.995  1.00 50.14 ? 19  LYS A HG3  1  
ATOM 317    H HD2  . LYS A 1 19  ? 20.882  2.468   -1.568  1.00 13.15 ? 19  LYS A HD2  1  
ATOM 318    H HD3  . LYS A 1 19  ? 20.924  1.373   -2.954  1.00 0.14  ? 19  LYS A HD3  1  
ATOM 319    H HE2  . LYS A 1 19  ? 20.861  3.271   -4.489  1.00 71.04 ? 19  LYS A HE2  1  
ATOM 320    H HE3  . LYS A 1 19  ? 20.702  4.399   -3.138  1.00 63.04 ? 19  LYS A HE3  1  
ATOM 321    H HZ1  . LYS A 1 19  ? 22.973  4.224   -4.017  1.00 14.42 ? 19  LYS A HZ1  1  
ATOM 322    H HZ2  . LYS A 1 19  ? 23.027  2.602   -3.552  1.00 74.41 ? 19  LYS A HZ2  1  
ATOM 323    H HZ3  . LYS A 1 19  ? 22.870  3.812   -2.386  1.00 30.53 ? 19  LYS A HZ3  1  
ATOM 324    N N    . ASP A 1 20  ? 15.982  0.584   -5.539  1.00 70.04 ? 20  ASP A N    1  
ATOM 325    C CA   . ASP A 1 20  ? 15.385  -0.023  -6.730  1.00 21.33 ? 20  ASP A CA   1  
ATOM 326    C C    . ASP A 1 20  ? 14.269  -0.984  -6.320  1.00 41.22 ? 20  ASP A C    1  
ATOM 327    O O    . ASP A 1 20  ? 14.377  -1.706  -5.321  1.00 53.43 ? 20  ASP A O    1  
ATOM 328    C CB   . ASP A 1 20  ? 16.453  -0.747  -7.593  1.00 12.10 ? 20  ASP A CB   1  
ATOM 329    C CG   . ASP A 1 20  ? 15.863  -1.585  -8.751  1.00 23.15 ? 20  ASP A CG   1  
ATOM 330    O OD1  . ASP A 1 20  ? 15.910  -2.835  -8.683  1.00 63.31 ? 20  ASP A OD1  1  
ATOM 331    O OD2  . ASP A 1 20  ? 15.354  -0.991  -9.723  1.00 12.15 ? 20  ASP A OD2  1  
ATOM 332    H H    . ASP A 1 20  ? 16.067  0.031   -4.734  1.00 31.24 ? 20  ASP A H    1  
ATOM 333    H HA   . ASP A 1 20  ? 14.947  0.777   -7.326  1.00 2.40  ? 20  ASP A HA   1  
ATOM 334    H HB2  . ASP A 1 20  ? 17.120  -0.004  -8.020  1.00 33.15 ? 20  ASP A HB2  1  
ATOM 335    H HB3  . ASP A 1 20  ? 17.041  -1.398  -6.953  1.00 50.43 ? 20  ASP A HB3  1  
ATOM 336    N N    . ILE A 1 21  ? 13.189  -0.949  -7.104  1.00 54.14 ? 21  ILE A N    1  
ATOM 337    C CA   . ILE A 1 21  ? 12.037  -1.836  -6.980  1.00 43.44 ? 21  ILE A CA   1  
ATOM 338    C C    . ILE A 1 21  ? 11.642  -2.269  -8.400  1.00 12.10 ? 21  ILE A C    1  
ATOM 339    O O    . ILE A 1 21  ? 11.676  -1.456  -9.340  1.00 62.32 ? 21  ILE A O    1  
ATOM 340    C CB   . ILE A 1 21  ? 10.804  -1.143  -6.277  1.00 44.12 ? 21  ILE A CB   1  
ATOM 341    C CG1  . ILE A 1 21  ? 11.173  -0.608  -4.861  1.00 51.15 ? 21  ILE A CG1  1  
ATOM 342    C CG2  . ILE A 1 21  ? 9.610   -2.115  -6.190  1.00 41.11 ? 21  ILE A CG2  1  
ATOM 343    C CD1  . ILE A 1 21  ? 10.031  0.073   -4.125  1.00 70.34 ? 21  ILE A CD1  1  
ATOM 344    H H    . ILE A 1 21  ? 13.177  -0.293  -7.832  1.00 10.20 ? 21  ILE A H    1  
ATOM 345    H HA   . ILE A 1 21  ? 12.326  -2.718  -6.402  1.00 34.02 ? 21  ILE A HA   1  
ATOM 346    H HB   . ILE A 1 21  ? 10.497  -0.300  -6.895  1.00 45.15 ? 21  ILE A HB   1  
ATOM 347    H HG12 . ILE A 1 21  ? 11.511  -1.429  -4.244  1.00 15.53 ? 21  ILE A HG12 1  
ATOM 348    H HG13 . ILE A 1 21  ? 11.977  0.114   -4.952  1.00 32.25 ? 21  ILE A HG13 1  
ATOM 349    H HG21 . ILE A 1 21  ? 9.303   -2.407  -7.188  1.00 1.21  ? 21  ILE A HG21 1  
ATOM 350    H HG22 . ILE A 1 21  ? 8.778   -1.640  -5.689  1.00 11.12 ? 21  ILE A HG22 1  
ATOM 351    H HG23 . ILE A 1 21  ? 9.900   -2.999  -5.637  1.00 52.31 ? 21  ILE A HG23 1  
ATOM 352    H HD11 . ILE A 1 21  ? 9.261   -0.645  -3.906  1.00 20.12 ? 21  ILE A HD11 1  
ATOM 353    H HD12 . ILE A 1 21  ? 9.613   0.860   -4.740  1.00 43.41 ? 21  ILE A HD12 1  
ATOM 354    H HD13 . ILE A 1 21  ? 10.398  0.496   -3.205  1.00 70.31 ? 21  ILE A HD13 1  
ATOM 355    N N    . SER A 1 22  ? 11.261  -3.537  -8.539  1.00 54.12 ? 22  SER A N    1  
ATOM 356    C CA   . SER A 1 22  ? 10.859  -4.125  -9.813  1.00 62.54 ? 22  SER A CA   1  
ATOM 357    C C    . SER A 1 22  ? 9.790   -5.196  -9.548  1.00 70.14 ? 22  SER A C    1  
ATOM 358    O O    . SER A 1 22  ? 9.915   -5.989  -8.615  1.00 54.34 ? 22  SER A O    1  
ATOM 359    C CB   . SER A 1 22  ? 12.089  -4.726  -10.543 1.00 51.55 ? 22  SER A CB   1  
ATOM 360    O OG   . SER A 1 22  ? 11.752  -5.153  -11.855 1.00 15.11 ? 22  SER A OG   1  
ATOM 361    H H    . SER A 1 22  ? 11.243  -4.107  -7.742  1.00 12.12 ? 22  SER A H    1  
ATOM 362    H HA   . SER A 1 22  ? 10.425  -3.339  -10.435 1.00 25.51 ? 22  SER A HA   1  
ATOM 363    H HB2  . SER A 1 22  ? 12.865  -3.976  -10.616 1.00 13.23 ? 22  SER A HB2  1  
ATOM 364    H HB3  . SER A 1 22  ? 12.468  -5.578  -9.988  1.00 22.11 ? 22  SER A HB3  1  
ATOM 365    H HG   . SER A 1 22  ? 11.945  -4.445  -12.482 1.00 11.15 ? 22  SER A HG   1  
ATOM 366    N N    . PHE A 1 23  ? 8.723   -5.177  -10.346 1.00 1.10  ? 23  PHE A N    1  
ATOM 367    C CA   . PHE A 1 23  ? 7.662   -6.191  -10.323 1.00 71.13 ? 23  PHE A CA   1  
ATOM 368    C C    . PHE A 1 23  ? 7.259   -6.474  -11.757 1.00 30.21 ? 23  PHE A C    1  
ATOM 369    O O    . PHE A 1 23  ? 6.880   -5.559  -12.479 1.00 33.02 ? 23  PHE A O    1  
ATOM 370    C CB   . PHE A 1 23  ? 6.437   -5.715  -9.498  1.00 35.10 ? 23  PHE A CB   1  
ATOM 371    C CG   . PHE A 1 23  ? 5.258   -6.698  -9.451  1.00 43.21 ? 23  PHE A CG   1  
ATOM 372    C CD1  . PHE A 1 23  ? 5.410   -7.961  -8.878  1.00 44.44 ? 23  PHE A CD1  1  
ATOM 373    C CD2  . PHE A 1 23  ? 4.002   -6.363  -9.960  1.00 73.42 ? 23  PHE A CD2  1  
ATOM 374    C CE1  . PHE A 1 23  ? 4.355   -8.850  -8.819  1.00 15.03 ? 23  PHE A CE1  1  
ATOM 375    C CE2  . PHE A 1 23  ? 2.954   -7.260  -9.903  1.00 2.24  ? 23  PHE A CE2  1  
ATOM 376    C CZ   . PHE A 1 23  ? 3.130   -8.500  -9.332  1.00 60.10 ? 23  PHE A CZ   1  
ATOM 377    H H    . PHE A 1 23  ? 8.643   -4.442  -10.994 1.00 63.30 ? 23  PHE A H    1  
ATOM 378    H HA   . PHE A 1 23  ? 8.064   -7.101  -9.873  1.00 3.15  ? 23  PHE A HA   1  
ATOM 379    H HB2  . PHE A 1 23  ? 6.753   -5.539  -8.478  1.00 1.24  ? 23  PHE A HB2  1  
ATOM 380    H HB3  . PHE A 1 23  ? 6.081   -4.775  -9.909  1.00 43.31 ? 23  PHE A HB3  1  
ATOM 381    H HD1  . PHE A 1 23  ? 6.372   -8.249  -8.471  1.00 43.25 ? 23  PHE A HD1  1  
ATOM 382    H HD2  . PHE A 1 23  ? 3.848   -5.384  -10.411 1.00 11.22 ? 23  PHE A HD2  1  
ATOM 383    H HE1  . PHE A 1 23  ? 4.494   -9.828  -8.370  1.00 33.41 ? 23  PHE A HE1  1  
ATOM 384    H HE2  . PHE A 1 23  ? 1.991   -6.993  -10.315 1.00 42.23 ? 23  PHE A HE2  1  
ATOM 385    H HZ   . PHE A 1 23  ? 2.301   -9.198  -9.288  1.00 72.32 ? 23  PHE A HZ   1  
ATOM 386    N N    . GLU A 1 24  ? 7.381   -7.733  -12.167 1.00 4.45  ? 24  GLU A N    1  
ATOM 387    C CA   . GLU A 1 24  ? 6.993   -8.186  -13.498 1.00 24.41 ? 24  GLU A CA   1  
ATOM 388    C C    . GLU A 1 24  ? 6.007   -9.346  -13.356 1.00 25.41 ? 24  GLU A C    1  
ATOM 389    O O    . GLU A 1 24  ? 6.372   -10.438 -12.921 1.00 3.40  ? 24  GLU A O    1  
ATOM 390    C CB   . GLU A 1 24  ? 8.244   -8.616  -14.313 1.00 4.22  ? 24  GLU A CB   1  
ATOM 391    C CG   . GLU A 1 24  ? 9.243   -7.470  -14.582 1.00 21.03 ? 24  GLU A CG   1  
ATOM 392    C CD   . GLU A 1 24  ? 10.448  -7.914  -15.424 1.00 4.01  ? 24  GLU A CD   1  
ATOM 393    O OE1  . GLU A 1 24  ? 11.515  -8.222  -14.857 1.00 53.44 ? 24  GLU A OE1  1  
ATOM 394    O OE2  . GLU A 1 24  ? 10.318  -7.992  -16.658 1.00 22.44 ? 24  GLU A OE2  1  
ATOM 395    H H    . GLU A 1 24  ? 7.749   -8.388  -11.547 1.00 2.12  ? 24  GLU A H    1  
ATOM 396    H HA   . GLU A 1 24  ? 6.499   -7.361  -14.019 1.00 23.21 ? 24  GLU A HA   1  
ATOM 397    H HB2  . GLU A 1 24  ? 8.763   -9.404  -13.771 1.00 50.43 ? 24  GLU A HB2  1  
ATOM 398    H HB3  . GLU A 1 24  ? 7.919   -9.015  -15.270 1.00 61.43 ? 24  GLU A HB3  1  
ATOM 399    H HG2  . GLU A 1 24  ? 8.728   -6.666  -15.103 1.00 70.33 ? 24  GLU A HG2  1  
ATOM 400    H HG3  . GLU A 1 24  ? 9.597   -7.090  -13.629 1.00 4.21  ? 24  GLU A HG3  1  
ATOM 401    N N    . ALA A 1 25  ? 4.753   -9.076  -13.715 1.00 71.30 ? 25  ALA A N    1  
ATOM 402    C CA   . ALA A 1 25  ? 3.696   -10.078 -13.854 1.00 25.32 ? 25  ALA A CA   1  
ATOM 403    C C    . ALA A 1 25  ? 3.099   -9.921  -15.272 1.00 72.33 ? 25  ALA A C    1  
ATOM 404    O O    . ALA A 1 25  ? 2.034   -9.307  -15.439 1.00 35.13 ? 25  ALA A O    1  
ATOM 405    C CB   . ALA A 1 25  ? 2.634   -9.913  -12.733 1.00 2.04  ? 25  ALA A CB   1  
ATOM 406    H H    . ALA A 1 25  ? 4.525   -8.144  -13.907 1.00 42.43 ? 25  ALA A H    1  
ATOM 407    H HA   . ALA A 1 25  ? 4.132   -11.074 -13.774 1.00 53.43 ? 25  ALA A HA   1  
ATOM 408    H HB1  . ALA A 1 25  ? 1.704   -10.336 -13.051 1.00 62.13 ? 25  ALA A HB1  1  
ATOM 409    H HB2  . ALA A 1 25  ? 2.481   -8.867  -12.507 1.00 52.42 ? 25  ALA A HB2  1  
ATOM 410    H HB3  . ALA A 1 25  ? 2.948   -10.428 -11.840 1.00 15.21 ? 25  ALA A HB3  1  
ATOM 411    N N    . PRO A 1 26  ? 3.820   -10.410 -16.343 1.00 53.11 ? 26  PRO A N    1  
ATOM 412    C CA   . PRO A 1 26  ? 3.306   -10.363 -17.732 1.00 31.43 ? 26  PRO A CA   1  
ATOM 413    C C    . PRO A 1 26  ? 2.207   -11.422 -17.942 1.00 4.40  ? 26  PRO A C    1  
ATOM 414    O O    . PRO A 1 26  ? 1.251   -11.216 -18.700 1.00 21.01 ? 26  PRO A O    1  
ATOM 415    C CB   . PRO A 1 26  ? 4.574   -10.647 -18.582 1.00 70.15 ? 26  PRO A CB   1  
ATOM 416    C CG   . PRO A 1 26  ? 5.441   -11.504 -17.705 1.00 23.33 ? 26  PRO A CG   1  
ATOM 417    C CD   . PRO A 1 26  ? 5.185   -11.035 -16.282 1.00 50.34 ? 26  PRO A CD   1  
ATOM 418    H HA   . PRO A 1 26  ? 2.906   -9.383  -17.976 1.00 5.51  ? 26  PRO A HA   1  
ATOM 419    H HB2  . PRO A 1 26  ? 4.317   -11.158 -19.509 1.00 61.21 ? 26  PRO A HB2  1  
ATOM 420    H HB3  . PRO A 1 26  ? 5.082   -9.718  -18.807 1.00 23.41 ? 26  PRO A HB3  1  
ATOM 421    H HG2  . PRO A 1 26  ? 5.162   -12.551 -17.822 1.00 52.05 ? 26  PRO A HG2  1  
ATOM 422    H HG3  . PRO A 1 26  ? 6.487   -11.372 -17.960 1.00 71.52 ? 26  PRO A HG3  1  
ATOM 423    H HD2  . PRO A 1 26  ? 5.194   -11.876 -15.596 1.00 42.42 ? 26  PRO A HD2  1  
ATOM 424    H HD3  . PRO A 1 26  ? 5.923   -10.302 -15.977 1.00 73.33 ? 26  PRO A HD3  1  
ATOM 425    N N    . ASN A 1 27  ? 2.337   -12.538 -17.201 1.00 71.30 ? 27  ASN A N    1  
ATOM 426    C CA   . ASN A 1 27  ? 1.416   -13.676 -17.257 1.00 60.04 ? 27  ASN A CA   1  
ATOM 427    C C    . ASN A 1 27  ? 0.455   -13.633 -16.070 1.00 60.41 ? 27  ASN A C    1  
ATOM 428    O O    . ASN A 1 27  ? -0.165  -14.639 -15.742 1.00 52.44 ? 27  ASN A O    1  
ATOM 429    C CB   . ASN A 1 27  ? 2.208   -14.999 -17.244 1.00 35.51 ? 27  ASN A CB   1  
ATOM 430    C CG   . ASN A 1 27  ? 3.260   -15.064 -18.342 1.00 21.21 ? 27  ASN A CG   1  
ATOM 431    O OD1  . ASN A 1 27  ? 2.968   -15.453 -19.467 1.00 70.41 ? 27  ASN A OD1  1  
ATOM 432    N ND2  . ASN A 1 27  ? 4.491   -14.700 -18.020 1.00 44.54 ? 27  ASN A ND2  1  
ATOM 433    H H    . ASN A 1 27  ? 3.086   -12.586 -16.570 1.00 42.01 ? 27  ASN A H    1  
ATOM 434    H HA   . ASN A 1 27  ? 0.836   -13.619 -18.178 1.00 23.23 ? 27  ASN A HA   1  
ATOM 435    H HB2  . ASN A 1 27  ? 2.701   -15.119 -16.286 1.00 4.34  ? 27  ASN A HB2  1  
ATOM 436    H HB3  . ASN A 1 27  ? 1.522   -15.829 -17.384 1.00 44.52 ? 27  ASN A HB3  1  
ATOM 437    H HD21 . ASN A 1 27  ? 4.663   -14.413 -17.099 1.00 75.41 ? 27  ASN A HD21 1  
ATOM 438    H HD22 . ASN A 1 27  ? 5.182   -14.737 -18.715 1.00 0.42  ? 27  ASN A HD22 1  
ATOM 439    N N    . ALA A 1 28  ? 0.319   -12.444 -15.454 1.00 54.22 ? 28  ALA A N    1  
ATOM 440    C CA   . ALA A 1 28  ? -0.611  -12.204 -14.335 1.00 41.03 ? 28  ALA A CA   1  
ATOM 441    C C    . ALA A 1 28  ? -2.076  -12.649 -14.686 1.00 15.14 ? 28  ALA A C    1  
ATOM 442    O O    . ALA A 1 28  ? -2.678  -13.392 -13.903 1.00 11.40 ? 28  ALA A O    1  
ATOM 443    C CB   . ALA A 1 28  ? -0.548  -10.724 -13.913 1.00 33.44 ? 28  ALA A CB   1  
ATOM 444    H H    . ALA A 1 28  ? 0.868   -11.694 -15.764 1.00 2.53  ? 28  ALA A H    1  
ATOM 445    H HA   . ALA A 1 28  ? -0.248  -12.796 -13.497 1.00 33.40 ? 28  ALA A HA   1  
ATOM 446    H HB1  . ALA A 1 28  ? -0.868  -10.606 -12.889 1.00 54.12 ? 28  ALA A HB1  1  
ATOM 447    H HB2  . ALA A 1 28  ? -1.184  -10.129 -14.554 1.00 12.55 ? 28  ALA A HB2  1  
ATOM 448    H HB3  . ALA A 1 28  ? 0.463   -10.362 -14.003 1.00 71.24 ? 28  ALA A HB3  1  
ATOM 449    N N    . PRO A 1 29  ? -2.662  -12.261 -15.887 1.00 13.25 ? 29  PRO A N    1  
ATOM 450    C CA   . PRO A 1 29  ? -4.003  -12.758 -16.305 1.00 24.22 ? 29  PRO A CA   1  
ATOM 451    C C    . PRO A 1 29  ? -3.988  -14.217 -16.834 1.00 61.41 ? 29  PRO A C    1  
ATOM 452    O O    . PRO A 1 29  ? -5.044  -14.855 -16.914 1.00 23.20 ? 29  PRO A O    1  
ATOM 453    C CB   . PRO A 1 29  ? -4.410  -11.763 -17.407 1.00 54.53 ? 29  PRO A CB   1  
ATOM 454    C CG   . PRO A 1 29  ? -3.118  -11.346 -18.037 1.00 44.23 ? 29  PRO A CG   1  
ATOM 455    C CD   . PRO A 1 29  ? -2.125  -11.279 -16.902 1.00 72.32 ? 29  PRO A CD   1  
ATOM 456    H HA   . PRO A 1 29  ? -4.710  -12.699 -15.482 1.00 4.32  ? 29  PRO A HA   1  
ATOM 457    H HB2  . PRO A 1 29  ? -5.071  -12.237 -18.132 1.00 25.23 ? 29  PRO A HB2  1  
ATOM 458    H HB3  . PRO A 1 29  ? -4.905  -10.904 -16.970 1.00 61.31 ? 29  PRO A HB3  1  
ATOM 459    H HG2  . PRO A 1 29  ? -2.808  -12.087 -18.777 1.00 15.22 ? 29  PRO A HG2  1  
ATOM 460    H HG3  . PRO A 1 29  ? -3.219  -10.375 -18.507 1.00 60.30 ? 29  PRO A HG3  1  
ATOM 461    H HD2  . PRO A 1 29  ? -1.132  -11.573 -17.240 1.00 4.14  ? 29  PRO A HD2  1  
ATOM 462    H HD3  . PRO A 1 29  ? -2.091  -10.282 -16.476 1.00 34.35 ? 29  PRO A HD3  1  
ATOM 463    N N    . HIS A 1 30  ? -2.787  -14.728 -17.197 1.00 21.21 ? 30  HIS A N    1  
ATOM 464    C CA   . HIS A 1 30  ? -2.612  -16.125 -17.665 1.00 42.53 ? 30  HIS A CA   1  
ATOM 465    C C    . HIS A 1 30  ? -2.819  -17.092 -16.497 1.00 63.34 ? 30  HIS A C    1  
ATOM 466    O O    . HIS A 1 30  ? -3.572  -18.054 -16.606 1.00 51.32 ? 30  HIS A O    1  
ATOM 467    C CB   . HIS A 1 30  ? -1.197  -16.375 -18.256 1.00 33.13 ? 30  HIS A CB   1  
ATOM 468    C CG   . HIS A 1 30  ? -0.861  -15.670 -19.539 1.00 55.01 ? 30  HIS A CG   1  
ATOM 469    N ND1  . HIS A 1 30  ? 0.161   -16.090 -20.363 1.00 72.25 ? 30  HIS A ND1  1  
ATOM 470    C CD2  . HIS A 1 30  ? -1.379  -14.568 -20.123 1.00 5.41  ? 30  HIS A CD2  1  
ATOM 471    C CE1  . HIS A 1 30  ? 0.251   -15.286 -21.396 1.00 33.33 ? 30  HIS A CE1  1  
ATOM 472    N NE2  . HIS A 1 30  ? -0.671  -14.357 -21.273 1.00 0.52  ? 30  HIS A NE2  1  
ATOM 473    H H    . HIS A 1 30  ? -1.996  -14.153 -17.131 1.00 0.02  ? 30  HIS A H    1  
ATOM 474    H HA   . HIS A 1 30  ? -3.360  -16.319 -18.430 1.00 42.53 ? 30  HIS A HA   1  
ATOM 475    H HB2  . HIS A 1 30  ? -0.456  -16.072 -17.530 1.00 64.01 ? 30  HIS A HB2  1  
ATOM 476    H HB3  . HIS A 1 30  ? -1.075  -17.442 -18.438 1.00 23.53 ? 30  HIS A HB3  1  
ATOM 477    H HD1  . HIS A 1 30  ? 0.737   -16.871 -20.208 1.00 31.34 ? 30  HIS A HD1  1  
ATOM 478    H HD2  . HIS A 1 30  ? -2.199  -13.967 -19.753 1.00 71.11 ? 30  HIS A HD2  1  
ATOM 479    H HE1  . HIS A 1 30  ? 0.968   -15.366 -22.201 1.00 3.25  ? 30  HIS A HE1  1  
ATOM 480    H HE2  . HIS A 1 30  ? -0.769  -13.579 -21.862 1.00 37.65 ? 30  HIS A HE2  1  
ATOM 481    N N    . VAL A 1 31  ? -2.138  -16.797 -15.375 1.00 23.25 ? 31  VAL A N    1  
ATOM 482    C CA   . VAL A 1 31  ? -2.131  -17.648 -14.170 1.00 1.34  ? 31  VAL A CA   1  
ATOM 483    C C    . VAL A 1 31  ? -3.482  -17.574 -13.426 1.00 3.35  ? 31  VAL A C    1  
ATOM 484    O O    . VAL A 1 31  ? -3.833  -18.471 -12.644 1.00 73.21 ? 31  VAL A O    1  
ATOM 485    C CB   . VAL A 1 31  ? -0.926  -17.266 -13.232 1.00 42.22 ? 31  VAL A CB   1  
ATOM 486    C CG1  . VAL A 1 31  ? -0.822  -18.204 -12.009 1.00 51.22 ? 31  VAL A CG1  1  
ATOM 487    C CG2  . VAL A 1 31  ? 0.398   -17.267 -14.029 1.00 13.31 ? 31  VAL A CG2  1  
ATOM 488    H H    . VAL A 1 31  ? -1.611  -15.971 -15.356 1.00 42.10 ? 31  VAL A H    1  
ATOM 489    H HA   . VAL A 1 31  ? -1.986  -18.675 -14.501 1.00 63.32 ? 31  VAL A HA   1  
ATOM 490    H HB   . VAL A 1 31  ? -1.090  -16.254 -12.864 1.00 51.13 ? 31  VAL A HB   1  
ATOM 491    H HG11 . VAL A 1 31  ? 0.012   -17.906 -11.387 1.00 71.50 ? 31  VAL A HG11 1  
ATOM 492    H HG12 . VAL A 1 31  ? -0.673  -19.224 -12.341 1.00 3.13  ? 31  VAL A HG12 1  
ATOM 493    H HG13 . VAL A 1 31  ? -1.736  -18.149 -11.430 1.00 72.40 ? 31  VAL A HG13 1  
ATOM 494    H HG21 . VAL A 1 31  ? 0.600   -18.262 -14.407 1.00 20.31 ? 31  VAL A HG21 1  
ATOM 495    H HG22 . VAL A 1 31  ? 1.211   -16.956 -13.391 1.00 61.11 ? 31  VAL A HG22 1  
ATOM 496    H HG23 . VAL A 1 31  ? 0.322   -16.581 -14.864 1.00 73.51 ? 31  VAL A HG23 1  
ATOM 497    N N    . PHE A 1 32  ? -4.246  -16.500 -13.700 1.00 42.32 ? 32  PHE A N    1  
ATOM 498    C CA   . PHE A 1 32  ? -5.657  -16.382 -13.288 1.00 22.25 ? 32  PHE A CA   1  
ATOM 499    C C    . PHE A 1 32  ? -6.501  -17.524 -13.912 1.00 45.33 ? 32  PHE A C    1  
ATOM 500    O O    . PHE A 1 32  ? -7.442  -18.028 -13.296 1.00 33.01 ? 32  PHE A O    1  
ATOM 501    C CB   . PHE A 1 32  ? -6.204  -14.994 -13.713 1.00 63.12 ? 32  PHE A CB   1  
ATOM 502    C CG   . PHE A 1 32  ? -7.654  -14.705 -13.305 1.00 53.12 ? 32  PHE A CG   1  
ATOM 503    C CD1  . PHE A 1 32  ? -8.685  -14.670 -14.252 1.00 60.22 ? 32  PHE A CD1  1  
ATOM 504    C CD2  . PHE A 1 32  ? -7.984  -14.461 -11.968 1.00 21.33 ? 32  PHE A CD2  1  
ATOM 505    C CE1  . PHE A 1 32  ? -9.989  -14.396 -13.875 1.00 14.33 ? 32  PHE A CE1  1  
ATOM 506    C CE2  . PHE A 1 32  ? -9.291  -14.190 -11.595 1.00 73.03 ? 32  PHE A CE2  1  
ATOM 507    C CZ   . PHE A 1 32  ? -10.292 -14.157 -12.549 1.00 22.43 ? 32  PHE A CZ   1  
ATOM 508    H H    . PHE A 1 32  ? -3.837  -15.756 -14.194 1.00 13.40 ? 32  PHE A H    1  
ATOM 509    H HA   . PHE A 1 32  ? -5.694  -16.464 -12.208 1.00 72.42 ? 32  PHE A HA   1  
ATOM 510    H HB2  . PHE A 1 32  ? -5.580  -14.228 -13.270 1.00 21.43 ? 32  PHE A HB2  1  
ATOM 511    H HB3  . PHE A 1 32  ? -6.129  -14.905 -14.795 1.00 50.25 ? 32  PHE A HB3  1  
ATOM 512    H HD1  . PHE A 1 32  ? -8.457  -14.857 -15.294 1.00 44.13 ? 32  PHE A HD1  1  
ATOM 513    H HD2  . PHE A 1 32  ? -7.206  -14.486 -11.214 1.00 72.22 ? 32  PHE A HD2  1  
ATOM 514    H HE1  . PHE A 1 32  ? -10.774 -14.373 -14.621 1.00 61.33 ? 32  PHE A HE1  1  
ATOM 515    H HE2  . PHE A 1 32  ? -9.530  -14.001 -10.555 1.00 44.11 ? 32  PHE A HE2  1  
ATOM 516    H HZ   . PHE A 1 32  ? -11.314 -13.942 -12.255 1.00 51.53 ? 32  PHE A HZ   1  
ATOM 517    N N    . GLN A 1 33  ? -6.126  -17.918 -15.138 1.00 12.22 ? 33  GLN A N    1  
ATOM 518    C CA   . GLN A 1 33  ? -6.802  -18.975 -15.917 1.00 61.23 ? 33  GLN A CA   1  
ATOM 519    C C    . GLN A 1 33  ? -6.116  -20.344 -15.704 1.00 31.20 ? 33  GLN A C    1  
ATOM 520    O O    . GLN A 1 33  ? -6.750  -21.391 -15.876 1.00 11.24 ? 33  GLN A O    1  
ATOM 521    C CB   . GLN A 1 33  ? -6.811  -18.563 -17.413 1.00 51.12 ? 33  GLN A CB   1  
ATOM 522    C CG   . GLN A 1 33  ? -7.517  -17.211 -17.666 1.00 72.34 ? 33  GLN A CG   1  
ATOM 523    C CD   . GLN A 1 33  ? -7.420  -16.723 -19.113 1.00 5.31  ? 33  GLN A CD   1  
ATOM 524    O OE1  . GLN A 1 33  ? -8.267  -17.036 -19.952 1.00 35.33 ? 33  GLN A OE1  1  
ATOM 525    N NE2  . GLN A 1 33  ? -6.384  -15.954 -19.420 1.00 72.12 ? 33  GLN A NE2  1  
ATOM 526    H H    . GLN A 1 33  ? -5.348  -17.482 -15.540 1.00 3.04  ? 33  GLN A H    1  
ATOM 527    H HA   . GLN A 1 33  ? -7.832  -19.052 -15.569 1.00 70.21 ? 33  GLN A HA   1  
ATOM 528    H HB2  . GLN A 1 33  ? -5.783  -18.485 -17.766 1.00 2.20  ? 33  GLN A HB2  1  
ATOM 529    H HB3  . GLN A 1 33  ? -7.319  -19.328 -17.992 1.00 10.30 ? 33  GLN A HB3  1  
ATOM 530    H HG2  . GLN A 1 33  ? -8.565  -17.309 -17.403 1.00 23.23 ? 33  GLN A HG2  1  
ATOM 531    H HG3  . GLN A 1 33  ? -7.068  -16.463 -17.017 1.00 13.23 ? 33  GLN A HG3  1  
ATOM 532    H HE21 . GLN A 1 33  ? -5.740  -15.737 -18.715 1.00 63.30 ? 33  GLN A HE21 1  
ATOM 533    H HE22 . GLN A 1 33  ? -6.300  -15.635 -20.344 1.00 12.34 ? 33  GLN A HE22 1  
ATOM 534    N N    . LYS A 1 34  ? -4.818  -20.320 -15.327 1.00 15.15 ? 34  LYS A N    1  
ATOM 535    C CA   . LYS A 1 34  ? -4.058  -21.531 -14.932 1.00 71.31 ? 34  LYS A CA   1  
ATOM 536    C C    . LYS A 1 34  ? -4.461  -21.976 -13.512 1.00 41.41 ? 34  LYS A C    1  
ATOM 537    O O    . LYS A 1 34  ? -5.172  -21.258 -12.798 1.00 1.41  ? 34  LYS A O    1  
ATOM 538    C CB   . LYS A 1 34  ? -2.520  -21.272 -14.953 1.00 24.33 ? 34  LYS A CB   1  
ATOM 539    C CG   . LYS A 1 34  ? -1.904  -20.912 -16.318 1.00 2.12  ? 34  LYS A CG   1  
ATOM 540    C CD   . LYS A 1 34  ? -1.908  -22.082 -17.325 1.00 62.21 ? 34  LYS A CD   1  
ATOM 541    C CE   . LYS A 1 34  ? -0.998  -21.805 -18.536 1.00 10.32 ? 34  LYS A CE   1  
ATOM 542    N NZ   . LYS A 1 34  ? 0.419   -21.579 -18.121 1.00 51.32 ? 34  LYS A NZ   1  
ATOM 543    H H    . LYS A 1 34  ? -4.357  -19.456 -15.303 1.00 75.51 ? 34  LYS A H    1  
ATOM 544    H HA   . LYS A 1 34  ? -4.299  -22.328 -15.633 1.00 5.43  ? 34  LYS A HA   1  
ATOM 545    H HB2  . LYS A 1 34  ? -2.299  -20.459 -14.270 1.00 70.40 ? 34  LYS A HB2  1  
ATOM 546    H HB3  . LYS A 1 34  ? -2.014  -22.162 -14.587 1.00 71.24 ? 34  LYS A HB3  1  
ATOM 547    H HG2  . LYS A 1 34  ? -2.462  -20.087 -16.745 1.00 54.25 ? 34  LYS A HG2  1  
ATOM 548    H HG3  . LYS A 1 34  ? -0.878  -20.593 -16.157 1.00 23.22 ? 34  LYS A HG3  1  
ATOM 549    H HD2  . LYS A 1 34  ? -1.559  -22.983 -16.829 1.00 44.03 ? 34  LYS A HD2  1  
ATOM 550    H HD3  . LYS A 1 34  ? -2.922  -22.241 -17.676 1.00 4.41  ? 34  LYS A HD3  1  
ATOM 551    H HE2  . LYS A 1 34  ? -1.033  -22.652 -19.208 1.00 54.24 ? 34  LYS A HE2  1  
ATOM 552    H HE3  . LYS A 1 34  ? -1.352  -20.922 -19.057 1.00 50.12 ? 34  LYS A HE3  1  
ATOM 553    H HZ1  . LYS A 1 34  ? 0.476   -20.788 -17.450 1.00 71.20 ? 34  LYS A HZ1  1  
ATOM 554    H HZ2  . LYS A 1 34  ? 1.011   -21.351 -18.944 1.00 41.11 ? 34  LYS A HZ2  1  
ATOM 555    H HZ3  . LYS A 1 34  ? 0.799   -22.425 -17.663 1.00 60.13 ? 34  LYS A HZ3  1  
ATOM 556    N N    . ASP A 1 35  ? -3.985  -23.162 -13.119 1.00 54.32 ? 35  ASP A N    1  
ATOM 557    C CA   . ASP A 1 35  ? -4.096  -23.657 -11.735 1.00 24.04 ? 35  ASP A CA   1  
ATOM 558    C C    . ASP A 1 35  ? -2.965  -23.013 -10.907 1.00 42.45 ? 35  ASP A C    1  
ATOM 559    O O    . ASP A 1 35  ? -1.830  -22.905 -11.397 1.00 1.24  ? 35  ASP A O    1  
ATOM 560    C CB   . ASP A 1 35  ? -3.986  -25.209 -11.711 1.00 31.22 ? 35  ASP A CB   1  
ATOM 561    C CG   . ASP A 1 35  ? -4.455  -25.829 -10.381 1.00 5.14  ? 35  ASP A CG   1  
ATOM 562    O OD1  . ASP A 1 35  ? -3.678  -25.879 -9.415  1.00 24.53 ? 35  ASP A OD1  1  
ATOM 563    O OD2  . ASP A 1 35  ? -5.623  -26.252 -10.290 1.00 34.41 ? 35  ASP A OD2  1  
ATOM 564    H H    . ASP A 1 35  ? -3.532  -23.725 -13.777 1.00 4.12  ? 35  ASP A H    1  
ATOM 565    H HA   . ASP A 1 35  ? -5.064  -23.352 -11.334 1.00 21.03 ? 35  ASP A HA   1  
ATOM 566    H HB2  . ASP A 1 35  ? -4.589  -25.616 -12.517 1.00 44.34 ? 35  ASP A HB2  1  
ATOM 567    H HB3  . ASP A 1 35  ? -2.949  -25.498 -11.886 1.00 2.14  ? 35  ASP A HB3  1  
ATOM 568    N N    . TRP A 1 36  ? -3.275  -22.585 -9.670  1.00 14.33 ? 36  TRP A N    1  
ATOM 569    C CA   . TRP A 1 36  ? -2.317  -21.875 -8.802  1.00 64.54 ? 36  TRP A CA   1  
ATOM 570    C C    . TRP A 1 36  ? -1.301  -22.868 -8.194  1.00 64.40 ? 36  TRP A C    1  
ATOM 571    O O    . TRP A 1 36  ? -1.489  -23.397 -7.094  1.00 24.22 ? 36  TRP A O    1  
ATOM 572    C CB   . TRP A 1 36  ? -3.079  -21.054 -7.721  1.00 3.10  ? 36  TRP A CB   1  
ATOM 573    C CG   . TRP A 1 36  ? -2.208  -20.199 -6.807  1.00 62.22 ? 36  TRP A CG   1  
ATOM 574    C CD1  . TRP A 1 36  ? -2.183  -20.222 -5.437  1.00 53.11 ? 36  TRP A CD1  1  
ATOM 575    C CD2  . TRP A 1 36  ? -1.253  -19.189 -7.199  1.00 73.21 ? 36  TRP A CD2  1  
ATOM 576    N NE1  . TRP A 1 36  ? -1.273  -19.310 -4.964  1.00 14.55 ? 36  TRP A NE1  1  
ATOM 577    C CE2  . TRP A 1 36  ? -0.693  -18.663 -6.021  1.00 12.34 ? 36  TRP A CE2  1  
ATOM 578    C CE3  . TRP A 1 36  ? -0.815  -18.686 -8.430  1.00 23.54 ? 36  TRP A CE3  1  
ATOM 579    C CZ2  . TRP A 1 36  ? 0.277   -17.661 -6.038  1.00 12.02 ? 36  TRP A CZ2  1  
ATOM 580    C CZ3  . TRP A 1 36  ? 0.144   -17.692 -8.447  1.00 75.30 ? 36  TRP A CZ3  1  
ATOM 581    C CH2  . TRP A 1 36  ? 0.681   -17.188 -7.257  1.00 72.43 ? 36  TRP A CH2  1  
ATOM 582    H H    . TRP A 1 36  ? -4.171  -22.766 -9.325  1.00 3.43  ? 36  TRP A H    1  
ATOM 583    H HA   . TRP A 1 36  ? -1.767  -21.174 -9.431  1.00 31.11 ? 36  TRP A HA   1  
ATOM 584    H HB2  . TRP A 1 36  ? -3.774  -20.388 -8.216  1.00 70.03 ? 36  TRP A HB2  1  
ATOM 585    H HB3  . TRP A 1 36  ? -3.646  -21.739 -7.101  1.00 23.44 ? 36  TRP A HB3  1  
ATOM 586    H HD1  . TRP A 1 36  ? -2.792  -20.875 -4.825  1.00 64.01 ? 36  TRP A HD1  1  
ATOM 587    H HE1  . TRP A 1 36  ? -1.074  -19.149 -4.016  1.00 3.44  ? 36  TRP A HE1  1  
ATOM 588    H HE3  . TRP A 1 36  ? -1.220  -19.063 -9.360  1.00 31.22 ? 36  TRP A HE3  1  
ATOM 589    H HZ2  . TRP A 1 36  ? 0.699   -17.259 -5.127  1.00 41.13 ? 36  TRP A HZ2  1  
ATOM 590    H HZ3  . TRP A 1 36  ? 0.489   -17.293 -9.394  1.00 44.44 ? 36  TRP A HZ3  1  
ATOM 591    H HH2  . TRP A 1 36  ? 1.428   -16.408 -7.319  1.00 32.43 ? 36  TRP A HH2  1  
ATOM 592    N N    . GLN A 1 37  ? -0.253  -23.159 -8.991  1.00 42.33 ? 37  GLN A N    1  
ATOM 593    C CA   . GLN A 1 37  ? 0.889   -24.013 -8.606  1.00 55.23 ? 37  GLN A CA   1  
ATOM 594    C C    . GLN A 1 37  ? 2.206   -23.263 -8.936  1.00 51.23 ? 37  GLN A C    1  
ATOM 595    O O    . GLN A 1 37  ? 2.819   -23.515 -9.973  1.00 61.23 ? 37  GLN A O    1  
ATOM 596    C CB   . GLN A 1 37  ? 0.828   -25.376 -9.371  1.00 60.43 ? 37  GLN A CB   1  
ATOM 597    C CG   . GLN A 1 37  ? -0.393  -26.263 -9.048  1.00 14.31 ? 37  GLN A CG   1  
ATOM 598    C CD   . GLN A 1 37  ? -0.561  -27.454 -10.005 1.00 32.32 ? 37  GLN A CD   1  
ATOM 599    O OE1  . GLN A 1 37  ? -0.193  -27.384 -11.181 1.00 70.01 ? 37  GLN A OE1  1  
ATOM 600    N NE2  . GLN A 1 37  ? -1.129  -28.550 -9.521  1.00 43.34 ? 37  GLN A NE2  1  
ATOM 601    H H    . GLN A 1 37  ? -0.254  -22.786 -9.897  1.00 14.13 ? 37  GLN A H    1  
ATOM 602    H HA   . GLN A 1 37  ? 0.852   -24.198 -7.536  1.00 74.15 ? 37  GLN A HA   1  
ATOM 603    H HB2  . GLN A 1 37  ? 0.821   -25.169 -10.439 1.00 15.12 ? 37  GLN A HB2  1  
ATOM 604    H HB3  . GLN A 1 37  ? 1.726   -25.943 -9.144  1.00 14.54 ? 37  GLN A HB3  1  
ATOM 605    H HG2  . GLN A 1 37  ? -0.290  -26.638 -8.035  1.00 12.25 ? 37  GLN A HG2  1  
ATOM 606    H HG3  . GLN A 1 37  ? -1.291  -25.655 -9.103  1.00 52.24 ? 37  GLN A HG3  1  
ATOM 607    H HE21 . GLN A 1 37  ? -1.415  -28.552 -8.583  1.00 5.21  ? 37  GLN A HE21 1  
ATOM 608    H HE22 . GLN A 1 37  ? -1.247  -29.311 -10.125 1.00 33.10 ? 37  GLN A HE22 1  
ATOM 609    N N    . PRO A 1 38  ? 2.630   -22.267 -8.098  1.00 62.44 ? 38  PRO A N    1  
ATOM 610    C CA   . PRO A 1 38  ? 3.882   -21.512 -8.328  1.00 43.25 ? 38  PRO A CA   1  
ATOM 611    C C    . PRO A 1 38  ? 5.102   -22.118 -7.587  1.00 35.41 ? 38  PRO A C    1  
ATOM 612    O O    . PRO A 1 38  ? 4.977   -22.668 -6.483  1.00 53.34 ? 38  PRO A O    1  
ATOM 613    C CB   . PRO A 1 38  ? 3.501   -20.132 -7.760  1.00 15.31 ? 38  PRO A CB   1  
ATOM 614    C CG   . PRO A 1 38  ? 2.633   -20.444 -6.570  1.00 31.21 ? 38  PRO A CG   1  
ATOM 615    C CD   . PRO A 1 38  ? 1.922   -21.761 -6.883  1.00 11.33 ? 38  PRO A CD   1  
ATOM 616    H HA   . PRO A 1 38  ? 4.109   -21.421 -9.391  1.00 3.34  ? 38  PRO A HA   1  
ATOM 617    H HB2  . PRO A 1 38  ? 4.394   -19.575 -7.472  1.00 52.12 ? 38  PRO A HB2  1  
ATOM 618    H HB3  . PRO A 1 38  ? 2.940   -19.566 -8.493  1.00 74.34 ? 38  PRO A HB3  1  
ATOM 619    H HG2  . PRO A 1 38  ? 3.253   -20.545 -5.681  1.00 50.22 ? 38  PRO A HG2  1  
ATOM 620    H HG3  . PRO A 1 38  ? 1.907   -19.654 -6.418  1.00 71.02 ? 38  PRO A HG3  1  
ATOM 621    H HD2  . PRO A 1 38  ? 2.025   -22.460 -6.060  1.00 64.33 ? 38  PRO A HD2  1  
ATOM 622    H HD3  . PRO A 1 38  ? 0.870   -21.589 -7.094  1.00 35.01 ? 38  PRO A HD3  1  
ATOM 623    N N    . GLU A 1 39  ? 6.284   -22.007 -8.209  1.00 22.13 ? 39  GLU A N    1  
ATOM 624    C CA   . GLU A 1 39  ? 7.560   -22.388 -7.583  1.00 52.45 ? 39  GLU A CA   1  
ATOM 625    C C    . GLU A 1 39  ? 8.232   -21.125 -7.022  1.00 11.31 ? 39  GLU A C    1  
ATOM 626    O O    . GLU A 1 39  ? 8.896   -20.386 -7.763  1.00 72.42 ? 39  GLU A O    1  
ATOM 627    C CB   . GLU A 1 39  ? 8.487   -23.083 -8.611  1.00 34.32 ? 39  GLU A CB   1  
ATOM 628    C CG   . GLU A 1 39  ? 9.832   -23.565 -8.020  1.00 71.24 ? 39  GLU A CG   1  
ATOM 629    C CD   . GLU A 1 39  ? 10.848  -23.993 -9.084  1.00 21.33 ? 39  GLU A CD   1  
ATOM 630    O OE1  . GLU A 1 39  ? 10.712  -25.105 -9.635  1.00 12.43 ? 39  GLU A OE1  1  
ATOM 631    O OE2  . GLU A 1 39  ? 11.800  -23.227 -9.363  1.00 41.33 ? 39  GLU A OE2  1  
ATOM 632    H H    . GLU A 1 39  ? 6.300   -21.665 -9.122  1.00 53.23 ? 39  GLU A H    1  
ATOM 633    H HA   . GLU A 1 39  ? 7.359   -23.078 -6.764  1.00 41.12 ? 39  GLU A HA   1  
ATOM 634    H HB2  . GLU A 1 39  ? 7.964   -23.940 -9.025  1.00 55.14 ? 39  GLU A HB2  1  
ATOM 635    H HB3  . GLU A 1 39  ? 8.693   -22.386 -9.419  1.00 65.34 ? 39  GLU A HB3  1  
ATOM 636    H HG2  . GLU A 1 39  ? 10.261  -22.762 -7.426  1.00 40.01 ? 39  GLU A HG2  1  
ATOM 637    H HG3  . GLU A 1 39  ? 9.639   -24.409 -7.363  1.00 65.11 ? 39  GLU A HG3  1  
ATOM 638    N N    . VAL A 1 40  ? 8.025   -20.864 -5.721  1.00 31.23 ? 40  VAL A N    1  
ATOM 639    C CA   . VAL A 1 40  ? 8.547   -19.663 -5.063  1.00 40.32 ? 40  VAL A CA   1  
ATOM 640    C C    . VAL A 1 40  ? 10.044  -19.849 -4.752  1.00 0.24  ? 40  VAL A C    1  
ATOM 641    O O    . VAL A 1 40  ? 10.423  -20.383 -3.709  1.00 55.42 ? 40  VAL A O    1  
ATOM 642    C CB   . VAL A 1 40  ? 7.744   -19.334 -3.750  1.00 40.32 ? 40  VAL A CB   1  
ATOM 643    C CG1  . VAL A 1 40  ? 8.228   -18.006 -3.129  1.00 62.12 ? 40  VAL A CG1  1  
ATOM 644    C CG2  . VAL A 1 40  ? 6.222   -19.315 -4.022  1.00 0.32  ? 40  VAL A CG2  1  
ATOM 645    H H    . VAL A 1 40  ? 7.516   -21.505 -5.188  1.00 33.52 ? 40  VAL A H    1  
ATOM 646    H HA   . VAL A 1 40  ? 8.427   -18.821 -5.749  1.00 15.13 ? 40  VAL A HA   1  
ATOM 647    H HB   . VAL A 1 40  ? 7.940   -20.127 -3.026  1.00 64.23 ? 40  VAL A HB   1  
ATOM 648    H HG11 . VAL A 1 40  ? 8.073   -17.196 -3.831  1.00 42.23 ? 40  VAL A HG11 1  
ATOM 649    H HG12 . VAL A 1 40  ? 9.282   -18.076 -2.893  1.00 4.15  ? 40  VAL A HG12 1  
ATOM 650    H HG13 . VAL A 1 40  ? 7.676   -17.803 -2.220  1.00 52.52 ? 40  VAL A HG13 1  
ATOM 651    H HG21 . VAL A 1 40  ? 5.685   -19.112 -3.103  1.00 52.50 ? 40  VAL A HG21 1  
ATOM 652    H HG22 . VAL A 1 40  ? 5.909   -20.278 -4.409  1.00 24.45 ? 40  VAL A HG22 1  
ATOM 653    H HG23 . VAL A 1 40  ? 5.988   -18.547 -4.751  1.00 2.44  ? 40  VAL A HG23 1  
ATOM 654    N N    . LYS A 1 41  ? 10.889  -19.435 -5.687  1.00 71.33 ? 41  LYS A N    1  
ATOM 655    C CA   . LYS A 1 41  ? 12.343  -19.510 -5.539  1.00 44.21 ? 41  LYS A CA   1  
ATOM 656    C C    . LYS A 1 41  ? 12.879  -18.129 -5.163  1.00 14.42 ? 41  LYS A C    1  
ATOM 657    O O    . LYS A 1 41  ? 12.548  -17.132 -5.814  1.00 4.44  ? 41  LYS A O    1  
ATOM 658    C CB   . LYS A 1 41  ? 12.977  -20.018 -6.856  1.00 11.13 ? 41  LYS A CB   1  
ATOM 659    C CG   . LYS A 1 41  ? 14.521  -20.138 -6.820  1.00 33.01 ? 41  LYS A CG   1  
ATOM 660    C CD   . LYS A 1 41  ? 15.108  -20.663 -8.151  1.00 11.34 ? 41  LYS A CD   1  
ATOM 661    C CE   . LYS A 1 41  ? 14.801  -19.752 -9.352  1.00 62.12 ? 41  LYS A CE   1  
ATOM 662    N NZ   . LYS A 1 41  ? 15.327  -18.368 -9.160  1.00 4.21  ? 41  LYS A NZ   1  
ATOM 663    H H    . LYS A 1 41  ? 10.523  -19.061 -6.515  1.00 32.11 ? 41  LYS A H    1  
ATOM 664    H HA   . LYS A 1 41  ? 12.578  -20.217 -4.740  1.00 64.01 ? 41  LYS A HA   1  
ATOM 665    H HB2  . LYS A 1 41  ? 12.564  -20.996 -7.082  1.00 43.34 ? 41  LYS A HB2  1  
ATOM 666    H HB3  . LYS A 1 41  ? 12.705  -19.338 -7.657  1.00 61.20 ? 41  LYS A HB3  1  
ATOM 667    H HG2  . LYS A 1 41  ? 14.949  -19.161 -6.614  1.00 21.24 ? 41  LYS A HG2  1  
ATOM 668    H HG3  . LYS A 1 41  ? 14.799  -20.818 -6.020  1.00 35.51 ? 41  LYS A HG3  1  
ATOM 669    H HD2  . LYS A 1 41  ? 16.186  -20.740 -8.046  1.00 3.34  ? 41  LYS A HD2  1  
ATOM 670    H HD3  . LYS A 1 41  ? 14.704  -21.655 -8.343  1.00 53.33 ? 41  LYS A HD3  1  
ATOM 671    H HE2  . LYS A 1 41  ? 15.260  -20.174 -10.236 1.00 60.22 ? 41  LYS A HE2  1  
ATOM 672    H HE3  . LYS A 1 41  ? 13.727  -19.704 -9.500  1.00 13.31 ? 41  LYS A HE3  1  
ATOM 673    H HZ1  . LYS A 1 41  ? 15.132  -17.784 -9.999  1.00 22.53 ? 41  LYS A HZ1  1  
ATOM 674    H HZ2  . LYS A 1 41  ? 16.356  -18.389 -9.003  1.00 63.32 ? 41  LYS A HZ2  1  
ATOM 675    H HZ3  . LYS A 1 41  ? 14.883  -17.918 -8.330  1.00 51.31 ? 41  LYS A HZ3  1  
ATOM 676    N N    . LEU A 1 42  ? 13.682  -18.078 -4.100  1.00 12.21 ? 42  LEU A N    1  
ATOM 677    C CA   . LEU A 1 42  ? 14.322  -16.845 -3.641  1.00 20.44 ? 42  LEU A CA   1  
ATOM 678    C C    . LEU A 1 42  ? 15.762  -16.809 -4.175  1.00 1.22  ? 42  LEU A C    1  
ATOM 679    O O    . LEU A 1 42  ? 16.399  -17.859 -4.358  1.00 45.14 ? 42  LEU A O    1  
ATOM 680    C CB   . LEU A 1 42  ? 14.278  -16.768 -2.087  1.00 33.11 ? 42  LEU A CB   1  
ATOM 681    C CG   . LEU A 1 42  ? 14.853  -15.472 -1.434  1.00 2.31  ? 42  LEU A CG   1  
ATOM 682    C CD1  . LEU A 1 42  ? 14.134  -14.225 -1.962  1.00 3.55  ? 42  LEU A CD1  1  
ATOM 683    C CD2  . LEU A 1 42  ? 14.799  -15.538 0.115   1.00 25.20 ? 42  LEU A CD2  1  
ATOM 684    H H    . LEU A 1 42  ? 13.876  -18.904 -3.615  1.00 24.51 ? 42  LEU A H    1  
ATOM 685    H HA   . LEU A 1 42  ? 13.773  -15.996 -4.051  1.00 52.53 ? 42  LEU A HA   1  
ATOM 686    H HB2  . LEU A 1 42  ? 13.243  -16.876 -1.776  1.00 65.31 ? 42  LEU A HB2  1  
ATOM 687    H HB3  . LEU A 1 42  ? 14.831  -17.618 -1.697  1.00 53.14 ? 42  LEU A HB3  1  
ATOM 688    H HG   . LEU A 1 42  ? 15.895  -15.376 -1.716  1.00 45.12 ? 42  LEU A HG   1  
ATOM 689    H HD11 . LEU A 1 42  ? 14.568  -13.344 -1.513  1.00 30.31 ? 42  LEU A HD11 1  
ATOM 690    H HD12 . LEU A 1 42  ? 13.080  -14.268 -1.717  1.00 22.11 ? 42  LEU A HD12 1  
ATOM 691    H HD13 . LEU A 1 42  ? 14.249  -14.164 -3.037  1.00 13.41 ? 42  LEU A HD13 1  
ATOM 692    H HD21 . LEU A 1 42  ? 13.775  -15.653 0.447   1.00 33.02 ? 42  LEU A HD21 1  
ATOM 693    H HD22 . LEU A 1 42  ? 15.211  -14.628 0.533   1.00 34.14 ? 42  LEU A HD22 1  
ATOM 694    H HD23 . LEU A 1 42  ? 15.386  -16.378 0.460   1.00 12.20 ? 42  LEU A HD23 1  
ATOM 695    N N    . ASP A 1 43  ? 16.235  -15.596 -4.469  1.00 34.13 ? 43  ASP A N    1  
ATOM 696    C CA   . ASP A 1 43  ? 17.579  -15.332 -4.998  1.00 34.54 ? 43  ASP A CA   1  
ATOM 697    C C    . ASP A 1 43  ? 18.158  -14.147 -4.204  1.00 24.33 ? 43  ASP A C    1  
ATOM 698    O O    . ASP A 1 43  ? 17.678  -13.015 -4.343  1.00 62.44 ? 43  ASP A O    1  
ATOM 699    C CB   . ASP A 1 43  ? 17.527  -14.986 -6.525  1.00 0.04  ? 43  ASP A CB   1  
ATOM 700    C CG   . ASP A 1 43  ? 16.806  -16.037 -7.405  1.00 32.53 ? 43  ASP A CG   1  
ATOM 701    O OD1  . ASP A 1 43  ? 15.559  -15.966 -7.552  1.00 4.23  ? 43  ASP A OD1  1  
ATOM 702    O OD2  . ASP A 1 43  ? 17.478  -16.921 -7.983  1.00 73.32 ? 43  ASP A OD2  1  
ATOM 703    H H    . ASP A 1 43  ? 15.648  -14.831 -4.319  1.00 1.44  ? 43  ASP A H    1  
ATOM 704    H HA   . ASP A 1 43  ? 18.202  -16.212 -4.843  1.00 3.33  ? 43  ASP A HA   1  
ATOM 705    H HB2  . ASP A 1 43  ? 17.014  -14.037 -6.650  1.00 2.44  ? 43  ASP A HB2  1  
ATOM 706    H HB3  . ASP A 1 43  ? 18.541  -14.870 -6.888  1.00 61.21 ? 43  ASP A HB3  1  
ATOM 707    N N    . LEU A 1 44  ? 19.157  -14.403 -3.348  1.00 71.23 ? 44  LEU A N    1  
ATOM 708    C CA   . LEU A 1 44  ? 19.759  -13.359 -2.493  1.00 75.35 ? 44  LEU A CA   1  
ATOM 709    C C    . LEU A 1 44  ? 21.036  -12.819 -3.151  1.00 73.54 ? 44  LEU A C    1  
ATOM 710    O O    . LEU A 1 44  ? 21.965  -13.570 -3.429  1.00 73.44 ? 44  LEU A O    1  
ATOM 711    C CB   . LEU A 1 44  ? 20.062  -13.921 -1.077  1.00 42.05 ? 44  LEU A CB   1  
ATOM 712    C CG   . LEU A 1 44  ? 18.821  -14.363 -0.240  1.00 13.32 ? 44  LEU A CG   1  
ATOM 713    C CD1  . LEU A 1 44  ? 19.263  -15.018 1.083   1.00 54.43 ? 44  LEU A CD1  1  
ATOM 714    C CD2  . LEU A 1 44  ? 17.862  -13.173 0.014   1.00 50.21 ? 44  LEU A CD2  1  
ATOM 715    H H    . LEU A 1 44  ? 19.506  -15.320 -3.288  1.00 3.43  ? 44  LEU A H    1  
ATOM 716    H HA   . LEU A 1 44  ? 19.043  -12.543 -2.393  1.00 51.22 ? 44  LEU A HA   1  
ATOM 717    H HB2  . LEU A 1 44  ? 20.722  -14.778 -1.190  1.00 13.53 ? 44  LEU A HB2  1  
ATOM 718    H HB3  . LEU A 1 44  ? 20.595  -13.162 -0.511  1.00 11.10 ? 44  LEU A HB3  1  
ATOM 719    H HG   . LEU A 1 44  ? 18.268  -15.113 -0.801  1.00 22.00 ? 44  LEU A HG   1  
ATOM 720    H HD11 . LEU A 1 44  ? 19.816  -14.302 1.682   1.00 33.44 ? 44  LEU A HD11 1  
ATOM 721    H HD12 . LEU A 1 44  ? 19.899  -15.867 0.869   1.00 14.42 ? 44  LEU A HD12 1  
ATOM 722    H HD13 . LEU A 1 44  ? 18.398  -15.356 1.634   1.00 63.31 ? 44  LEU A HD13 1  
ATOM 723    H HD21 . LEU A 1 44  ? 18.379  -12.389 0.555   1.00 25.12 ? 44  LEU A HD21 1  
ATOM 724    H HD22 . LEU A 1 44  ? 17.013  -13.509 0.597   1.00 13.45 ? 44  LEU A HD22 1  
ATOM 725    H HD23 . LEU A 1 44  ? 17.506  -12.784 -0.930  1.00 1.03  ? 44  LEU A HD23 1  
ATOM 726    N N    . ASP A 1 45  ? 21.043  -11.511 -3.423  1.00 53.14 ? 45  ASP A N    1  
ATOM 727    C CA   . ASP A 1 45  ? 22.196  -10.783 -3.980  1.00 52.24 ? 45  ASP A CA   1  
ATOM 728    C C    . ASP A 1 45  ? 22.461  -9.562  -3.089  1.00 11.44 ? 45  ASP A C    1  
ATOM 729    O O    . ASP A 1 45  ? 21.518  -8.955  -2.573  1.00 4.45  ? 45  ASP A O    1  
ATOM 730    C CB   . ASP A 1 45  ? 21.908  -10.370 -5.458  1.00 33.31 ? 45  ASP A CB   1  
ATOM 731    C CG   . ASP A 1 45  ? 23.041  -9.589  -6.164  1.00 2.25  ? 45  ASP A CG   1  
ATOM 732    O OD1  . ASP A 1 45  ? 22.753  -8.793  -7.080  1.00 24.11 ? 45  ASP A OD1  1  
ATOM 733    O OD2  . ASP A 1 45  ? 24.219  -9.770  -5.827  1.00 43.24 ? 45  ASP A OD2  1  
ATOM 734    H H    . ASP A 1 45  ? 20.231  -10.998 -3.234  1.00 11.41 ? 45  ASP A H    1  
ATOM 735    H HA   . ASP A 1 45  ? 23.070  -11.435 -3.953  1.00 14.21 ? 45  ASP A HA   1  
ATOM 736    H HB2  . ASP A 1 45  ? 21.722  -11.267 -6.035  1.00 14.00 ? 45  ASP A HB2  1  
ATOM 737    H HB3  . ASP A 1 45  ? 21.010  -9.763  -5.477  1.00 0.31  ? 45  ASP A HB3  1  
ATOM 738    N N    . THR A 1 46  ? 23.736  -9.206  -2.902  1.00 35.11 ? 46  THR A N    1  
ATOM 739    C CA   . THR A 1 46  ? 24.142  -8.107  -2.008  1.00 53.23 ? 46  THR A CA   1  
ATOM 740    C C    . THR A 1 46  ? 25.165  -7.207  -2.711  1.00 12.52 ? 46  THR A C    1  
ATOM 741    O O    . THR A 1 46  ? 26.061  -7.687  -3.422  1.00 34.32 ? 46  THR A O    1  
ATOM 742    C CB   . THR A 1 46  ? 24.709  -8.656  -0.647  1.00 43.31 ? 46  THR A CB   1  
ATOM 743    O OG1  . THR A 1 46  ? 23.664  -9.351  0.067   1.00 12.34 ? 46  THR A OG1  1  
ATOM 744    C CG2  . THR A 1 46  ? 25.311  -7.544  0.256   1.00 64.33 ? 46  THR A CG2  1  
ATOM 745    H H    . THR A 1 46  ? 24.435  -9.682  -3.405  1.00 41.31 ? 46  THR A H    1  
ATOM 746    H HA   . THR A 1 46  ? 23.254  -7.508  -1.782  1.00 62.53 ? 46  THR A HA   1  
ATOM 747    H HB   . THR A 1 46  ? 25.491  -9.375  -0.871  1.00 75.30 ? 46  THR A HB   1  
ATOM 748    H HG1  . THR A 1 46  ? 24.029  -9.783  0.843   1.00 24.23 ? 46  THR A HG1  1  
ATOM 749    H HG21 . THR A 1 46  ? 26.278  -7.246  -0.130  1.00 24.34 ? 46  THR A HG21 1  
ATOM 750    H HG22 . THR A 1 46  ? 25.430  -7.909  1.268   1.00 22.13 ? 46  THR A HG22 1  
ATOM 751    H HG23 . THR A 1 46  ? 24.657  -6.681  0.261   1.00 45.20 ? 46  THR A HG23 1  
ATOM 752    N N    . ALA A 1 47  ? 25.036  -5.900  -2.455  1.00 53.03 ? 47  ALA A N    1  
ATOM 753    C CA   . ALA A 1 47  ? 25.829  -4.845  -3.082  1.00 3.13  ? 47  ALA A CA   1  
ATOM 754    C C    . ALA A 1 47  ? 26.387  -3.921  -1.996  1.00 3.44  ? 47  ALA A C    1  
ATOM 755    O O    . ALA A 1 47  ? 25.805  -3.799  -0.908  1.00 4.35  ? 47  ALA A O    1  
ATOM 756    C CB   . ALA A 1 47  ? 24.965  -4.057  -4.088  1.00 13.35 ? 47  ALA A CB   1  
ATOM 757    H H    . ALA A 1 47  ? 24.375  -5.630  -1.785  1.00 0.32  ? 47  ALA A H    1  
ATOM 758    H HA   . ALA A 1 47  ? 26.658  -5.301  -3.616  1.00 42.01 ? 47  ALA A HA   1  
ATOM 759    H HB1  . ALA A 1 47  ? 24.597  -4.726  -4.853  1.00 22.23 ? 47  ALA A HB1  1  
ATOM 760    H HB2  . ALA A 1 47  ? 25.560  -3.280  -4.554  1.00 41.14 ? 47  ALA A HB2  1  
ATOM 761    H HB3  . ALA A 1 47  ? 24.124  -3.602  -3.575  1.00 42.52 ? 47  ALA A HB3  1  
ATOM 762    N N    . SER A 1 48  ? 27.525  -3.287  -2.291  1.00 42.30 ? 48  SER A N    1  
ATOM 763    C CA   . SER A 1 48  ? 28.238  -2.417  -1.349  1.00 53.11 ? 48  SER A CA   1  
ATOM 764    C C    . SER A 1 48  ? 28.507  -1.047  -2.006  1.00 43.43 ? 48  SER A C    1  
ATOM 765    O O    . SER A 1 48  ? 28.658  -0.961  -3.231  1.00 54.55 ? 48  SER A O    1  
ATOM 766    C CB   . SER A 1 48  ? 29.550  -3.110  -0.917  1.00 54.31 ? 48  SER A CB   1  
ATOM 767    O OG   . SER A 1 48  ? 30.168  -2.413  0.140   1.00 51.21 ? 48  SER A OG   1  
ATOM 768    H H    . SER A 1 48  ? 27.903  -3.398  -3.189  1.00 3.33  ? 48  SER A H    1  
ATOM 769    H HA   . SER A 1 48  ? 27.609  -2.262  -0.468  1.00 40.34 ? 48  SER A HA   1  
ATOM 770    H HB2  . SER A 1 48  ? 29.332  -4.112  -0.574  1.00 71.43 ? 48  SER A HB2  1  
ATOM 771    H HB3  . SER A 1 48  ? 30.237  -3.159  -1.753  1.00 24.33 ? 48  SER A HB3  1  
ATOM 772    H HG   . SER A 1 48  ? 29.598  -2.449  0.918   1.00 43.11 ? 48  SER A HG   1  
ATOM 773    N N    . SER A 1 49  ? 28.591  0.006   -1.174  1.00 31.40 ? 49  SER A N    1  
ATOM 774    C CA   . SER A 1 49  ? 28.663  1.405   -1.634  1.00 22.12 ? 49  SER A CA   1  
ATOM 775    C C    . SER A 1 49  ? 29.393  2.272   -0.588  1.00 33.22 ? 49  SER A C    1  
ATOM 776    O O    . SER A 1 49  ? 29.048  2.234   0.591   1.00 64.24 ? 49  SER A O    1  
ATOM 777    C CB   . SER A 1 49  ? 27.220  1.926   -1.857  1.00 41.34 ? 49  SER A CB   1  
ATOM 778    O OG   . SER A 1 49  ? 27.191  3.280   -2.277  1.00 41.04 ? 49  SER A OG   1  
ATOM 779    H H    . SER A 1 49  ? 28.591  -0.160  -0.209  1.00 62.54 ? 49  SER A H    1  
ATOM 780    H HA   . SER A 1 49  ? 29.210  1.440   -2.576  1.00 11.34 ? 49  SER A HA   1  
ATOM 781    H HB2  . SER A 1 49  ? 26.739  1.330   -2.619  1.00 12.44 ? 49  SER A HB2  1  
ATOM 782    H HB3  . SER A 1 49  ? 26.657  1.840   -0.934  1.00 21.44 ? 49  SER A HB3  1  
ATOM 783    H HG   . SER A 1 49  ? 26.372  3.687   -1.959  1.00 40.41 ? 49  SER A HG   1  
ATOM 784    N N    . GLN A 1 50  ? 30.414  3.034   -1.025  1.00 21.24 ? 50  GLN A N    1  
ATOM 785    C CA   . GLN A 1 50  ? 31.124  4.005   -0.168  1.00 63.53 ? 50  GLN A CA   1  
ATOM 786    C C    . GLN A 1 50  ? 30.617  5.412   -0.479  1.00 54.44 ? 50  GLN A C    1  
ATOM 787    O O    . GLN A 1 50  ? 30.901  5.958   -1.549  1.00 5.31  ? 50  GLN A O    1  
ATOM 788    C CB   . GLN A 1 50  ? 32.656  3.910   -0.396  1.00 53.10 ? 50  GLN A CB   1  
ATOM 789    C CG   . GLN A 1 50  ? 33.507  4.852   0.491   1.00 64.13 ? 50  GLN A CG   1  
ATOM 790    C CD   . GLN A 1 50  ? 35.020  4.656   0.309   1.00 75.43 ? 50  GLN A CD   1  
ATOM 791    O OE1  . GLN A 1 50  ? 35.493  3.559   -0.002  1.00 12.40 ? 50  GLN A OE1  1  
ATOM 792    N NE2  . GLN A 1 50  ? 35.790  5.705   0.524   1.00 5.53  ? 50  GLN A NE2  1  
ATOM 793    H H    . GLN A 1 50  ? 30.706  2.937   -1.955  1.00 14.35 ? 50  GLN A H    1  
ATOM 794    H HA   . GLN A 1 50  ? 30.910  3.771   0.878   1.00 23.34 ? 50  GLN A HA   1  
ATOM 795    H HB2  . GLN A 1 50  ? 32.968  2.888   -0.201  1.00 33.52 ? 50  GLN A HB2  1  
ATOM 796    H HB3  . GLN A 1 50  ? 32.869  4.137   -1.437  1.00 12.24 ? 50  GLN A HB3  1  
ATOM 797    H HG2  . GLN A 1 50  ? 33.256  5.877   0.239   1.00 12.24 ? 50  GLN A HG2  1  
ATOM 798    H HG3  . GLN A 1 50  ? 33.260  4.678   1.536   1.00 51.24 ? 50  GLN A HG3  1  
ATOM 799    H HE21 . GLN A 1 50  ? 35.361  6.545   0.787   1.00 64.45 ? 50  GLN A HE21 1  
ATOM 800    H HE22 . GLN A 1 50  ? 36.755  5.604   0.414   1.00 23.45 ? 50  GLN A HE22 1  
ATOM 801    N N    . LEU A 1 51  ? 29.846  5.981   0.452   1.00 40.31 ? 51  LEU A N    1  
ATOM 802    C CA   . LEU A 1 51  ? 29.248  7.315   0.289   1.00 0.22  ? 51  LEU A CA   1  
ATOM 803    C C    . LEU A 1 51  ? 30.203  8.401   0.791   1.00 42.21 ? 51  LEU A C    1  
ATOM 804    O O    . LEU A 1 51  ? 30.262  9.498   0.221   1.00 2.01  ? 51  LEU A O    1  
ATOM 805    C CB   . LEU A 1 51  ? 27.897  7.375   1.037   1.00 64.04 ? 51  LEU A CB   1  
ATOM 806    C CG   . LEU A 1 51  ? 26.839  6.326   0.581   1.00 33.42 ? 51  LEU A CG   1  
ATOM 807    C CD1  . LEU A 1 51  ? 25.524  6.501   1.354   1.00 14.22 ? 51  LEU A CD1  1  
ATOM 808    C CD2  . LEU A 1 51  ? 26.608  6.374   -0.947  1.00 41.25 ? 51  LEU A CD2  1  
ATOM 809    H H    . LEU A 1 51  ? 29.677  5.487   1.286   1.00 44.31 ? 51  LEU A H    1  
ATOM 810    H HA   . LEU A 1 51  ? 29.066  7.481   -0.773  1.00 40.50 ? 51  LEU A HA   1  
ATOM 811    H HB2  . LEU A 1 51  ? 28.087  7.231   2.100   1.00 42.15 ? 51  LEU A HB2  1  
ATOM 812    H HB3  . LEU A 1 51  ? 27.473  8.366   0.904   1.00 33.42 ? 51  LEU A HB3  1  
ATOM 813    H HG   . LEU A 1 51  ? 27.211  5.334   0.817   1.00 22.31 ? 51  LEU A HG   1  
ATOM 814    H HD11 . LEU A 1 51  ? 25.151  7.513   1.232   1.00 65.11 ? 51  LEU A HD11 1  
ATOM 815    H HD12 . LEU A 1 51  ? 25.697  6.310   2.404   1.00 23.40 ? 51  LEU A HD12 1  
ATOM 816    H HD13 . LEU A 1 51  ? 24.786  5.800   0.986   1.00 23.14 ? 51  LEU A HD13 1  
ATOM 817    H HD21 . LEU A 1 51  ? 27.535  6.158   -1.463  1.00 12.02 ? 51  LEU A HD21 1  
ATOM 818    H HD22 . LEU A 1 51  ? 26.256  7.355   -1.242  1.00 62.32 ? 51  LEU A HD22 1  
ATOM 819    H HD23 . LEU A 1 51  ? 25.870  5.632   -1.224  1.00 31.24 ? 51  LEU A HD23 1  
ATOM 820    N N    . ALA A 1 52  ? 30.944  8.069   1.857   1.00 30.31 ? 52  ALA A N    1  
ATOM 821    C CA   . ALA A 1 52  ? 31.947  8.959   2.463   1.00 5.22  ? 52  ALA A CA   1  
ATOM 822    C C    . ALA A 1 52  ? 32.945  8.151   3.298   1.00 41.44 ? 52  ALA A C    1  
ATOM 823    O O    . ALA A 1 52  ? 32.859  6.916   3.391   1.00 33.12 ? 52  ALA A O    1  
ATOM 824    C CB   . ALA A 1 52  ? 31.273  10.040  3.337   1.00 15.03 ? 52  ALA A CB   1  
ATOM 825    H H    . ALA A 1 52  ? 30.816  7.180   2.254   1.00 51.13 ? 52  ALA A H    1  
ATOM 826    H HA   . ALA A 1 52  ? 32.490  9.457   1.663   1.00 52.11 ? 52  ALA A HA   1  
ATOM 827    H HB1  . ALA A 1 52  ? 30.850  9.586   4.222   1.00 72.14 ? 52  ALA A HB1  1  
ATOM 828    H HB2  . ALA A 1 52  ? 30.484  10.518  2.783   1.00 20.34 ? 52  ALA A HB2  1  
ATOM 829    H HB3  . ALA A 1 52  ? 32.004  10.782  3.630   1.00 62.10 ? 52  ALA A HB3  1  
ATOM 830    N N    . ASP A 1 53  ? 33.892  8.879   3.895   1.00 41.21 ? 53  ASP A N    1  
ATOM 831    C CA   . ASP A 1 53  ? 34.830  8.342   4.886   1.00 35.22 ? 53  ASP A CA   1  
ATOM 832    C C    . ASP A 1 53  ? 34.055  7.966   6.163   1.00 64.20 ? 53  ASP A C    1  
ATOM 833    O O    . ASP A 1 53  ? 33.396  8.818   6.774   1.00 73.14 ? 53  ASP A O    1  
ATOM 834    C CB   . ASP A 1 53  ? 35.958  9.372   5.170   1.00 61.33 ? 53  ASP A CB   1  
ATOM 835    C CG   . ASP A 1 53  ? 35.454  10.748  5.665   1.00 73.35 ? 53  ASP A CG   1  
ATOM 836    O OD1  . ASP A 1 53  ? 34.801  11.472  4.879   1.00 70.21 ? 53  ASP A OD1  1  
ATOM 837    O OD2  . ASP A 1 53  ? 35.716  11.124  6.825   1.00 64.54 ? 53  ASP A OD2  1  
ATOM 838    H H    . ASP A 1 53  ? 33.961  9.829   3.666   1.00 72.30 ? 53  ASP A H    1  
ATOM 839    H HA   . ASP A 1 53  ? 35.277  7.444   4.459   1.00 42.44 ? 53  ASP A HA   1  
ATOM 840    H HB2  . ASP A 1 53  ? 36.636  8.954   5.912   1.00 24.32 ? 53  ASP A HB2  1  
ATOM 841    H HB3  . ASP A 1 53  ? 36.518  9.528   4.255   1.00 3.25  ? 53  ASP A HB3  1  
ATOM 842    N N    . ASP A 1 54  ? 34.073  6.655   6.479   1.00 42.31 ? 54  ASP A N    1  
ATOM 843    C CA   . ASP A 1 54  ? 33.354  6.054   7.624   1.00 71.11 ? 54  ASP A CA   1  
ATOM 844    C C    . ASP A 1 54  ? 31.814  6.098   7.467   1.00 55.34 ? 54  ASP A C    1  
ATOM 845    O O    . ASP A 1 54  ? 31.077  5.792   8.407   1.00 43.40 ? 54  ASP A O    1  
ATOM 846    C CB   . ASP A 1 54  ? 33.833  6.640   8.992   1.00 31.33 ? 54  ASP A CB   1  
ATOM 847    C CG   . ASP A 1 54  ? 35.291  6.258   9.321   1.00 61.34 ? 54  ASP A CG   1  
ATOM 848    O OD1  . ASP A 1 54  ? 36.220  6.831   8.719   1.00 31.11 ? 54  ASP A OD1  1  
ATOM 849    O OD2  . ASP A 1 54  ? 35.523  5.369   10.166  1.00 32.34 ? 54  ASP A OD2  1  
ATOM 850    H H    . ASP A 1 54  ? 34.607  6.062   5.917   1.00 32.44 ? 54  ASP A H    1  
ATOM 851    H HA   . ASP A 1 54  ? 33.622  5.005   7.610   1.00 1.24  ? 54  ASP A HA   1  
ATOM 852    H HB2  . ASP A 1 54  ? 33.756  7.724   8.958   1.00 4.14  ? 54  ASP A HB2  1  
ATOM 853    H HB3  . ASP A 1 54  ? 33.184  6.274   9.785   1.00 35.23 ? 54  ASP A HB3  1  
ATOM 854    N N    . VAL A 1 55  ? 31.327  6.442   6.257   1.00 11.42 ? 55  VAL A N    1  
ATOM 855    C CA   . VAL A 1 55  ? 29.897  6.348   5.902   1.00 61.01 ? 55  VAL A CA   1  
ATOM 856    C C    . VAL A 1 55  ? 29.770  5.306   4.792   1.00 31.23 ? 55  VAL A C    1  
ATOM 857    O O    . VAL A 1 55  ? 30.229  5.532   3.659   1.00 41.23 ? 55  VAL A O    1  
ATOM 858    C CB   . VAL A 1 55  ? 29.283  7.715   5.426   1.00 45.00 ? 55  VAL A CB   1  
ATOM 859    C CG1  . VAL A 1 55  ? 27.771  7.563   5.103   1.00 55.41 ? 55  VAL A CG1  1  
ATOM 860    C CG2  . VAL A 1 55  ? 29.529  8.829   6.472   1.00 30.44 ? 55  VAL A CG2  1  
ATOM 861    H H    . VAL A 1 55  ? 31.957  6.746   5.570   1.00 45.23 ? 55  VAL A H    1  
ATOM 862    H HA   . VAL A 1 55  ? 29.342  6.008   6.780   1.00 0.14  ? 55  VAL A HA   1  
ATOM 863    H HB   . VAL A 1 55  ? 29.786  8.010   4.508   1.00 0.21  ? 55  VAL A HB   1  
ATOM 864    H HG11 . VAL A 1 55  ? 27.383  8.491   4.712   1.00 43.34 ? 55  VAL A HG11 1  
ATOM 865    H HG12 . VAL A 1 55  ? 27.228  7.305   6.004   1.00 44.12 ? 55  VAL A HG12 1  
ATOM 866    H HG13 . VAL A 1 55  ? 27.630  6.781   4.367   1.00 54.11 ? 55  VAL A HG13 1  
ATOM 867    H HG21 . VAL A 1 55  ? 28.982  8.609   7.373   1.00 70.50 ? 55  VAL A HG21 1  
ATOM 868    H HG22 . VAL A 1 55  ? 29.202  9.785   6.082   1.00 70.22 ? 55  VAL A HG22 1  
ATOM 869    H HG23 . VAL A 1 55  ? 30.586  8.883   6.704   1.00 71.14 ? 55  VAL A HG23 1  
ATOM 870    N N    . TYR A 1 56  ? 29.149  4.172   5.115   1.00 70.25 ? 56  TYR A N    1  
ATOM 871    C CA   . TYR A 1 56  ? 29.115  3.006   4.223   1.00 50.02 ? 56  TYR A CA   1  
ATOM 872    C C    . TYR A 1 56  ? 27.672  2.514   4.106   1.00 54.13 ? 56  TYR A C    1  
ATOM 873    O O    . TYR A 1 56  ? 26.920  2.511   5.084   1.00 53.01 ? 56  TYR A O    1  
ATOM 874    C CB   . TYR A 1 56  ? 30.068  1.889   4.761   1.00 40.23 ? 56  TYR A CB   1  
ATOM 875    C CG   . TYR A 1 56  ? 30.769  1.069   3.669   1.00 3.01  ? 56  TYR A CG   1  
ATOM 876    C CD1  . TYR A 1 56  ? 30.677  -0.319  3.606   1.00 62.31 ? 56  TYR A CD1  1  
ATOM 877    C CD2  . TYR A 1 56  ? 31.545  1.704   2.699   1.00 61.03 ? 56  TYR A CD2  1  
ATOM 878    C CE1  . TYR A 1 56  ? 31.335  -1.032  2.622   1.00 63.02 ? 56  TYR A CE1  1  
ATOM 879    C CE2  . TYR A 1 56  ? 32.198  0.994   1.719   1.00 72.10 ? 56  TYR A CE2  1  
ATOM 880    C CZ   . TYR A 1 56  ? 32.094  -0.368  1.682   1.00 61.20 ? 56  TYR A CZ   1  
ATOM 881    O OH   . TYR A 1 56  ? 32.749  -1.069  0.698   1.00 51.25 ? 56  TYR A OH   1  
ATOM 882    H H    . TYR A 1 56  ? 28.678  4.121   5.973   1.00 33.04 ? 56  TYR A H    1  
ATOM 883    H HA   . TYR A 1 56  ? 29.457  3.324   3.232   1.00 30.24 ? 56  TYR A HA   1  
ATOM 884    H HB2  . TYR A 1 56  ? 30.843  2.348   5.363   1.00 44.32 ? 56  TYR A HB2  1  
ATOM 885    H HB3  . TYR A 1 56  ? 29.508  1.205   5.397   1.00 2.54  ? 56  TYR A HB3  1  
ATOM 886    H HD1  . TYR A 1 56  ? 30.082  -0.845  4.344   1.00 15.41 ? 56  TYR A HD1  1  
ATOM 887    H HD2  . TYR A 1 56  ? 31.634  2.785   2.721   1.00 22.25 ? 56  TYR A HD2  1  
ATOM 888    H HE1  . TYR A 1 56  ? 31.250  -2.113  2.589   1.00 41.54 ? 56  TYR A HE1  1  
ATOM 889    H HE2  . TYR A 1 56  ? 32.797  1.517   0.982   1.00 33.42 ? 56  TYR A HE2  1  
ATOM 890    H HH   . TYR A 1 56  ? 32.138  -1.696  0.294   1.00 53.31 ? 56  TYR A HH   1  
ATOM 891    N N    . GLU A 1 57  ? 27.308  2.089   2.905   1.00 73.03 ? 57  GLU A N    1  
ATOM 892    C CA   . GLU A 1 57  ? 25.947  1.709   2.550   1.00 34.41 ? 57  GLU A CA   1  
ATOM 893    C C    . GLU A 1 57  ? 25.946  0.271   2.026   1.00 14.43 ? 57  GLU A C    1  
ATOM 894    O O    . GLU A 1 57  ? 26.814  -0.113  1.229   1.00 42.24 ? 57  GLU A O    1  
ATOM 895    C CB   . GLU A 1 57  ? 25.411  2.700   1.490   1.00 11.11 ? 57  GLU A CB   1  
ATOM 896    C CG   . GLU A 1 57  ? 24.041  2.333   0.889   1.00 24.41 ? 57  GLU A CG   1  
ATOM 897    C CD   . GLU A 1 57  ? 23.554  3.333   -0.162  1.00 71.12 ? 57  GLU A CD   1  
ATOM 898    O OE1  . GLU A 1 57  ? 22.396  3.781   -0.088  1.00 5.35  ? 57  GLU A OE1  1  
ATOM 899    O OE2  . GLU A 1 57  ? 24.333  3.669   -1.081  1.00 1.33  ? 57  GLU A OE2  1  
ATOM 900    H H    . GLU A 1 57  ? 27.994  2.010   2.216   1.00 23.24 ? 57  GLU A H    1  
ATOM 901    H HA   . GLU A 1 57  ? 25.317  1.768   3.441   1.00 42.40 ? 57  GLU A HA   1  
ATOM 902    H HB2  . GLU A 1 57  ? 25.326  3.681   1.949   1.00 44.24 ? 57  GLU A HB2  1  
ATOM 903    H HB3  . GLU A 1 57  ? 26.132  2.767   0.678   1.00 64.34 ? 57  GLU A HB3  1  
ATOM 904    H HG2  . GLU A 1 57  ? 24.118  1.358   0.418   1.00 75.04 ? 57  GLU A HG2  1  
ATOM 905    H HG3  . GLU A 1 57  ? 23.316  2.275   1.695   1.00 62.50 ? 57  GLU A HG3  1  
ATOM 906    N N    . VAL A 1 58  ? 24.986  -0.521  2.512   1.00 62.20 ? 58  VAL A N    1  
ATOM 907    C CA   . VAL A 1 58  ? 24.774  -1.908  2.090   1.00 13.52 ? 58  VAL A CA   1  
ATOM 908    C C    . VAL A 1 58  ? 23.393  -1.998  1.436   1.00 42.21 ? 58  VAL A C    1  
ATOM 909    O O    . VAL A 1 58  ? 22.418  -1.488  1.985   1.00 4.31  ? 58  VAL A O    1  
ATOM 910    C CB   . VAL A 1 58  ? 24.867  -2.897  3.312   1.00 54.23 ? 58  VAL A CB   1  
ATOM 911    C CG1  . VAL A 1 58  ? 24.676  -4.366  2.870   1.00 3.25  ? 58  VAL A CG1  1  
ATOM 912    C CG2  . VAL A 1 58  ? 26.203  -2.703  4.070   1.00 25.51 ? 58  VAL A CG2  1  
ATOM 913    H H    . VAL A 1 58  ? 24.375  -0.147  3.181   1.00 2.44  ? 58  VAL A H    1  
ATOM 914    H HA   . VAL A 1 58  ? 25.540  -2.182  1.361   1.00 24.41 ? 58  VAL A HA   1  
ATOM 915    H HB   . VAL A 1 58  ? 24.061  -2.654  4.004   1.00 43.01 ? 58  VAL A HB   1  
ATOM 916    H HG11 . VAL A 1 58  ? 24.736  -5.021  3.732   1.00 51.32 ? 58  VAL A HG11 1  
ATOM 917    H HG12 . VAL A 1 58  ? 25.450  -4.638  2.163   1.00 63.11 ? 58  VAL A HG12 1  
ATOM 918    H HG13 . VAL A 1 58  ? 23.707  -4.484  2.401   1.00 61.04 ? 58  VAL A HG13 1  
ATOM 919    H HG21 . VAL A 1 58  ? 26.289  -1.676  4.403   1.00 30.02 ? 58  VAL A HG21 1  
ATOM 920    H HG22 . VAL A 1 58  ? 27.037  -2.936  3.416   1.00 31.24 ? 58  VAL A HG22 1  
ATOM 921    H HG23 . VAL A 1 58  ? 26.236  -3.359  4.932   1.00 11.42 ? 58  VAL A HG23 1  
ATOM 922    N N    . VAL A 1 59  ? 23.325  -2.611  0.249   1.00 12.42 ? 59  VAL A N    1  
ATOM 923    C CA   . VAL A 1 59  ? 22.078  -2.780  -0.508  1.00 62.24 ? 59  VAL A CA   1  
ATOM 924    C C    . VAL A 1 59  ? 21.767  -4.281  -0.625  1.00 54.12 ? 59  VAL A C    1  
ATOM 925    O O    . VAL A 1 59  ? 22.492  -5.009  -1.312  1.00 61.30 ? 59  VAL A O    1  
ATOM 926    C CB   . VAL A 1 59  ? 22.190  -2.142  -1.947  1.00 11.11 ? 59  VAL A CB   1  
ATOM 927    C CG1  . VAL A 1 59  ? 20.852  -2.249  -2.711  1.00 21.53 ? 59  VAL A CG1  1  
ATOM 928    C CG2  . VAL A 1 59  ? 22.691  -0.676  -1.885  1.00 43.22 ? 59  VAL A CG2  1  
ATOM 929    H H    . VAL A 1 59  ? 24.148  -2.968  -0.135  1.00 41.05 ? 59  VAL A H    1  
ATOM 930    H HA   . VAL A 1 59  ? 21.265  -2.282  0.030   1.00 23.15 ? 59  VAL A HA   1  
ATOM 931    H HB   . VAL A 1 59  ? 22.930  -2.714  -2.508  1.00 41.31 ? 59  VAL A HB   1  
ATOM 932    H HG11 . VAL A 1 59  ? 20.962  -1.832  -3.704  1.00 54.21 ? 59  VAL A HG11 1  
ATOM 933    H HG12 . VAL A 1 59  ? 20.079  -1.707  -2.181  1.00 53.21 ? 59  VAL A HG12 1  
ATOM 934    H HG13 . VAL A 1 59  ? 20.560  -3.291  -2.795  1.00 41.12 ? 59  VAL A HG13 1  
ATOM 935    H HG21 . VAL A 1 59  ? 23.658  -0.642  -1.398  1.00 54.11 ? 59  VAL A HG21 1  
ATOM 936    H HG22 . VAL A 1 59  ? 21.989  -0.070  -1.327  1.00 4.12  ? 59  VAL A HG22 1  
ATOM 937    H HG23 . VAL A 1 59  ? 22.785  -0.278  -2.889  1.00 33.24 ? 59  VAL A HG23 1  
ATOM 938    N N    . LEU A 1 60  ? 20.716  -4.741  0.071   1.00 32.11 ? 60  LEU A N    1  
ATOM 939    C CA   . LEU A 1 60  ? 20.259  -6.135  -0.019  1.00 42.02 ? 60  LEU A CA   1  
ATOM 940    C C    . LEU A 1 60  ? 19.211  -6.261  -1.142  1.00 24.13 ? 60  LEU A C    1  
ATOM 941    O O    . LEU A 1 60  ? 18.072  -5.798  -0.998  1.00 75.24 ? 60  LEU A O    1  
ATOM 942    C CB   . LEU A 1 60  ? 19.663  -6.626  1.329   1.00 70.22 ? 60  LEU A CB   1  
ATOM 943    C CG   . LEU A 1 60  ? 19.153  -8.111  1.338   1.00 63.34 ? 60  LEU A CG   1  
ATOM 944    C CD1  . LEU A 1 60  ? 20.291  -9.120  1.062   1.00 45.32 ? 60  LEU A CD1  1  
ATOM 945    C CD2  . LEU A 1 60  ? 18.405  -8.447  2.643   1.00 44.10 ? 60  LEU A CD2  1  
ATOM 946    H H    . LEU A 1 60  ? 20.227  -4.122  0.654   1.00 35.20 ? 60  LEU A H    1  
ATOM 947    H HA   . LEU A 1 60  ? 21.122  -6.762  -0.266  1.00 45.54 ? 60  LEU A HA   1  
ATOM 948    H HB2  . LEU A 1 60  ? 20.424  -6.515  2.099   1.00 23.52 ? 60  LEU A HB2  1  
ATOM 949    H HB3  . LEU A 1 60  ? 18.830  -5.976  1.587   1.00 65.32 ? 60  LEU A HB3  1  
ATOM 950    H HG   . LEU A 1 60  ? 18.443  -8.228  0.528   1.00 10.44 ? 60  LEU A HG   1  
ATOM 951    H HD11 . LEU A 1 60  ? 21.048  -9.044  1.833   1.00 13.43 ? 60  LEU A HD11 1  
ATOM 952    H HD12 . LEU A 1 60  ? 20.738  -8.911  0.100   1.00 42.21 ? 60  LEU A HD12 1  
ATOM 953    H HD13 . LEU A 1 60  ? 19.889  -10.125 1.053   1.00 60.01 ? 60  LEU A HD13 1  
ATOM 954    H HD21 . LEU A 1 60  ? 17.579  -7.761  2.774   1.00 22.01 ? 60  LEU A HD21 1  
ATOM 955    H HD22 . LEU A 1 60  ? 19.077  -8.363  3.487   1.00 50.35 ? 60  LEU A HD22 1  
ATOM 956    H HD23 . LEU A 1 60  ? 18.019  -9.458  2.593   1.00 13.42 ? 60  LEU A HD23 1  
ATOM 957    N N    . ARG A 1 61  ? 19.625  -6.853  -2.265  1.00 54.21 ? 61  ARG A N    1  
ATOM 958    C CA   . ARG A 1 61  ? 18.734  -7.183  -3.382  1.00 32.14 ? 61  ARG A CA   1  
ATOM 959    C C    . ARG A 1 61  ? 18.071  -8.546  -3.118  1.00 52.03 ? 61  ARG A C    1  
ATOM 960    O O    . ARG A 1 61  ? 18.702  -9.601  -3.262  1.00 63.10 ? 61  ARG A O    1  
ATOM 961    C CB   . ARG A 1 61  ? 19.549  -7.207  -4.703  1.00 22.32 ? 61  ARG A CB   1  
ATOM 962    C CG   . ARG A 1 61  ? 18.765  -7.667  -5.958  1.00 13.11 ? 61  ARG A CG   1  
ATOM 963    C CD   . ARG A 1 61  ? 19.643  -7.684  -7.213  1.00 25.51 ? 61  ARG A CD   1  
ATOM 964    N NE   . ARG A 1 61  ? 18.954  -8.265  -8.377  1.00 54.22 ? 61  ARG A NE   1  
ATOM 965    C CZ   . ARG A 1 61  ? 19.544  -8.952  -9.369  1.00 61.33 ? 61  ARG A CZ   1  
ATOM 966    N NH1  . ARG A 1 61  ? 20.858  -9.171  -9.358  1.00 44.31 ? 61  ARG A NH1  1  
ATOM 967    N NH2  . ARG A 1 61  ? 18.812  -9.424  -10.370 1.00 2.03  ? 61  ARG A NH2  1  
ATOM 968    H H    . ARG A 1 61  ? 20.571  -7.093  -2.339  1.00 35.22 ? 61  ARG A H    1  
ATOM 969    H HA   . ARG A 1 61  ? 17.964  -6.413  -3.453  1.00 33.44 ? 61  ARG A HA   1  
ATOM 970    H HB2  . ARG A 1 61  ? 19.931  -6.209  -4.888  1.00 33.11 ? 61  ARG A HB2  1  
ATOM 971    H HB3  . ARG A 1 61  ? 20.397  -7.876  -4.568  1.00 63.43 ? 61  ARG A HB3  1  
ATOM 972    H HG2  . ARG A 1 61  ? 18.384  -8.669  -5.786  1.00 64.04 ? 61  ARG A HG2  1  
ATOM 973    H HG3  . ARG A 1 61  ? 17.929  -6.994  -6.119  1.00 14.03 ? 61  ARG A HG3  1  
ATOM 974    H HD2  . ARG A 1 61  ? 19.935  -6.667  -7.455  1.00 51.50 ? 61  ARG A HD2  1  
ATOM 975    H HD3  . ARG A 1 61  ? 20.537  -8.267  -7.006  1.00 21.21 ? 61  ARG A HD3  1  
ATOM 976    H HE   . ARG A 1 61  ? 17.989  -8.135  -8.417  1.00 13.34 ? 61  ARG A HE   1  
ATOM 977    H HH11 . ARG A 1 61  ? 21.422  -8.823  -8.603  1.00 51.21 ? 61  ARG A HH11 1  
ATOM 978    H HH12 . ARG A 1 61  ? 21.291  -9.687  -10.102 1.00 0.33  ? 61  ARG A HH12 1  
ATOM 979    H HH21 . ARG A 1 61  ? 17.819  -9.271  -10.390 1.00 24.11 ? 61  ARG A HH21 1  
ATOM 980    H HH22 . ARG A 1 61  ? 19.247  -9.939  -11.111 1.00 42.31 ? 61  ARG A HH22 1  
ATOM 981    N N    . VAL A 1 62  ? 16.808  -8.513  -2.678  1.00 22.20 ? 62  VAL A N    1  
ATOM 982    C CA   . VAL A 1 62  ? 16.000  -9.720  -2.476  1.00 51.43 ? 62  VAL A CA   1  
ATOM 983    C C    . VAL A 1 62  ? 15.156  -9.947  -3.741  1.00 13.42 ? 62  VAL A C    1  
ATOM 984    O O    . VAL A 1 62  ? 14.165  -9.243  -3.975  1.00 31.42 ? 62  VAL A O    1  
ATOM 985    C CB   . VAL A 1 62  ? 15.097  -9.585  -1.190  1.00 4.33  ? 62  VAL A CB   1  
ATOM 986    C CG1  . VAL A 1 62  ? 14.287  -10.867 -0.916  1.00 2.24  ? 62  VAL A CG1  1  
ATOM 987    C CG2  . VAL A 1 62  ? 15.949  -9.212  0.038   1.00 4.01  ? 62  VAL A CG2  1  
ATOM 988    H H    . VAL A 1 62  ? 16.406  -7.645  -2.479  1.00 32.33 ? 62  VAL A H    1  
ATOM 989    H HA   . VAL A 1 62  ? 16.669  -10.573 -2.338  1.00 50.00 ? 62  VAL A HA   1  
ATOM 990    H HB   . VAL A 1 62  ? 14.389  -8.776  -1.360  1.00 5.22  ? 62  VAL A HB   1  
ATOM 991    H HG11 . VAL A 1 62  ? 13.649  -11.088 -1.765  1.00 54.40 ? 62  VAL A HG11 1  
ATOM 992    H HG12 . VAL A 1 62  ? 13.668  -10.733 -0.037  1.00 73.04 ? 62  VAL A HG12 1  
ATOM 993    H HG13 . VAL A 1 62  ? 14.960  -11.701 -0.753  1.00 71.52 ? 62  VAL A HG13 1  
ATOM 994    H HG21 . VAL A 1 62  ? 15.314  -9.098  0.908   1.00 65.03 ? 62  VAL A HG21 1  
ATOM 995    H HG22 . VAL A 1 62  ? 16.467  -8.277  -0.147  1.00 65.04 ? 62  VAL A HG22 1  
ATOM 996    H HG23 . VAL A 1 62  ? 16.681  -9.989  0.228   1.00 74.04 ? 62  VAL A HG23 1  
ATOM 997    N N    . THR A 1 63  ? 15.597  -10.895 -4.578  1.00 54.11 ? 63  THR A N    1  
ATOM 998    C CA   . THR A 1 63  ? 14.922  -11.247 -5.828  1.00 34.22 ? 63  THR A CA   1  
ATOM 999    C C    . THR A 1 63  ? 14.031  -12.471 -5.588  1.00 43.42 ? 63  THR A C    1  
ATOM 1000   O O    . THR A 1 63  ? 14.515  -13.576 -5.353  1.00 32.15 ? 63  THR A O    1  
ATOM 1001   C CB   . THR A 1 63  ? 15.959  -11.542 -6.966  1.00 63.43 ? 63  THR A CB   1  
ATOM 1002   O OG1  . THR A 1 63  ? 16.840  -10.414 -7.129  1.00 62.23 ? 63  THR A OG1  1  
ATOM 1003   C CG2  . THR A 1 63  ? 15.282  -11.872 -8.315  1.00 51.42 ? 63  THR A CG2  1  
ATOM 1004   H H    . THR A 1 63  ? 16.410  -11.381 -4.345  1.00 73.32 ? 63  THR A H    1  
ATOM 1005   H HA   . THR A 1 63  ? 14.300  -10.407 -6.136  1.00 62.15 ? 63  THR A HA   1  
ATOM 1006   H HB   . THR A 1 63  ? 16.561  -12.394 -6.668  1.00 64.22 ? 63  THR A HB   1  
ATOM 1007   H HG1  . THR A 1 63  ? 16.720  -10.039 -8.007  1.00 22.32 ? 63  THR A HG1  1  
ATOM 1008   H HG21 . THR A 1 63  ? 14.649  -12.745 -8.208  1.00 75.33 ? 63  THR A HG21 1  
ATOM 1009   H HG22 . THR A 1 63  ? 16.041  -12.074 -9.061  1.00 14.51 ? 63  THR A HG22 1  
ATOM 1010   H HG23 . THR A 1 63  ? 14.683  -11.031 -8.637  1.00 22.30 ? 63  THR A HG23 1  
ATOM 1011   N N    . VAL A 1 64  ? 12.726  -12.244 -5.625  1.00 22.43 ? 64  VAL A N    1  
ATOM 1012   C CA   . VAL A 1 64  ? 11.711  -13.288 -5.478  1.00 11.50 ? 64  VAL A CA   1  
ATOM 1013   C C    . VAL A 1 64  ? 11.151  -13.609 -6.853  1.00 72.05 ? 64  VAL A C    1  
ATOM 1014   O O    . VAL A 1 64  ? 10.874  -12.701 -7.621  1.00 12.32 ? 64  VAL A O    1  
ATOM 1015   C CB   . VAL A 1 64  ? 10.541  -12.795 -4.550  1.00 25.51 ? 64  VAL A CB   1  
ATOM 1016   C CG1  . VAL A 1 64  ? 9.311   -13.723 -4.621  1.00 0.01  ? 64  VAL A CG1  1  
ATOM 1017   C CG2  . VAL A 1 64  ? 11.030  -12.611 -3.101  1.00 3.32  ? 64  VAL A CG2  1  
ATOM 1018   H H    . VAL A 1 64  ? 12.423  -11.325 -5.775  1.00 11.02 ? 64  VAL A H    1  
ATOM 1019   H HA   . VAL A 1 64  ? 12.163  -14.182 -5.041  1.00 73.32 ? 64  VAL A HA   1  
ATOM 1020   H HB   . VAL A 1 64  ? 10.224  -11.818 -4.910  1.00 13.21 ? 64  VAL A HB   1  
ATOM 1021   H HG11 . VAL A 1 64  ? 9.572   -14.713 -4.272  1.00 31.14 ? 64  VAL A HG11 1  
ATOM 1022   H HG12 . VAL A 1 64  ? 8.953   -13.786 -5.638  1.00 45.13 ? 64  VAL A HG12 1  
ATOM 1023   H HG13 . VAL A 1 64  ? 8.522   -13.325 -4.009  1.00 73.01 ? 64  VAL A HG13 1  
ATOM 1024   H HG21 . VAL A 1 64  ? 11.450  -13.530 -2.738  1.00 33.04 ? 64  VAL A HG21 1  
ATOM 1025   H HG22 . VAL A 1 64  ? 10.203  -12.322 -2.466  1.00 10.05 ? 64  VAL A HG22 1  
ATOM 1026   H HG23 . VAL A 1 64  ? 11.789  -11.835 -3.065  1.00 21.15 ? 64  VAL A HG23 1  
ATOM 1027   N N    . THR A 1 65  ? 10.961  -14.889 -7.152  1.00 52.02 ? 65  THR A N    1  
ATOM 1028   C CA   . THR A 1 65  ? 10.326  -15.306 -8.397  1.00 64.44 ? 65  THR A CA   1  
ATOM 1029   C C    . THR A 1 65  ? 9.448   -16.529 -8.147  1.00 40.35 ? 65  THR A C    1  
ATOM 1030   O O    . THR A 1 65  ? 9.703   -17.317 -7.231  1.00 44.24 ? 65  THR A O    1  
ATOM 1031   C CB   . THR A 1 65  ? 11.388  -15.596 -9.509  1.00 73.33 ? 65  THR A CB   1  
ATOM 1032   O OG1  . THR A 1 65  ? 10.744  -15.939 -10.751 1.00 43.13 ? 65  THR A OG1  1  
ATOM 1033   C CG2  . THR A 1 65  ? 12.364  -16.717 -9.103  1.00 4.22  ? 65  THR A CG2  1  
ATOM 1034   H H    . THR A 1 65  ? 11.254  -15.580 -6.516  1.00 15.20 ? 65  THR A H    1  
ATOM 1035   H HA   . THR A 1 65  ? 9.684   -14.489 -8.736  1.00 72.15 ? 65  THR A HA   1  
ATOM 1036   H HB   . THR A 1 65  ? 11.961  -14.688 -9.671  1.00 54.12 ? 65  THR A HB   1  
ATOM 1037   H HG1  . THR A 1 65  ? 10.661  -16.898 -10.816 1.00 63.05 ? 65  THR A HG1  1  
ATOM 1038   H HG21 . THR A 1 65  ? 11.818  -17.639 -8.944  1.00 53.13 ? 65  THR A HG21 1  
ATOM 1039   H HG22 . THR A 1 65  ? 12.877  -16.445 -8.188  1.00 30.00 ? 65  THR A HG22 1  
ATOM 1040   H HG23 . THR A 1 65  ? 13.093  -16.866 -9.887  1.00 33.33 ? 65  THR A HG23 1  
ATOM 1041   N N    . ALA A 1 66  ? 8.394   -16.646 -8.949  1.00 1.24  ? 66  ALA A N    1  
ATOM 1042   C CA   . ALA A 1 66  ? 7.490   -17.788 -8.945  1.00 35.10 ? 66  ALA A CA   1  
ATOM 1043   C C    . ALA A 1 66  ? 7.162   -18.128 -10.393 1.00 71.10 ? 66  ALA A C    1  
ATOM 1044   O O    . ALA A 1 66  ? 6.495   -17.342 -11.065 1.00 30.14 ? 66  ALA A O    1  
ATOM 1045   C CB   . ALA A 1 66  ? 6.222   -17.483 -8.137  1.00 13.51 ? 66  ALA A CB   1  
ATOM 1046   H H    . ALA A 1 66  ? 8.220   -15.923 -9.589  1.00 35.12 ? 66  ALA A H    1  
ATOM 1047   H HA   . ALA A 1 66  ? 7.998   -18.637 -8.483  1.00 51.41 ? 66  ALA A HA   1  
ATOM 1048   H HB1  . ALA A 1 66  ? 5.565   -18.342 -8.148  1.00 42.41 ? 66  ALA A HB1  1  
ATOM 1049   H HB2  . ALA A 1 66  ? 5.705   -16.632 -8.569  1.00 54.11 ? 66  ALA A HB2  1  
ATOM 1050   H HB3  . ALA A 1 66  ? 6.488   -17.251 -7.114  1.00 23.21 ? 66  ALA A HB3  1  
ATOM 1051   N N    . SER A 1 67  ? 7.681   -19.263 -10.878 1.00 43.53 ? 67  SER A N    1  
ATOM 1052   C CA   . SER A 1 67  ? 7.480   -19.719 -12.261 1.00 74.31 ? 67  SER A CA   1  
ATOM 1053   C C    . SER A 1 67  ? 7.137   -21.217 -12.281 1.00 2.23  ? 67  SER A C    1  
ATOM 1054   O O    . SER A 1 67  ? 7.863   -22.030 -11.700 1.00 43.02 ? 67  SER A O    1  
ATOM 1055   C CB   . SER A 1 67  ? 8.764   -19.421 -13.085 1.00 61.43 ? 67  SER A CB   1  
ATOM 1056   O OG   . SER A 1 67  ? 9.934   -19.926 -12.443 1.00 42.32 ? 67  SER A OG   1  
ATOM 1057   H H    . SER A 1 67  ? 8.244   -19.811 -10.288 1.00 53.50 ? 67  SER A H    1  
ATOM 1058   H HA   . SER A 1 67  ? 6.645   -19.163 -12.696 1.00 44.33 ? 67  SER A HA   1  
ATOM 1059   H HB2  . SER A 1 67  ? 8.689   -19.868 -14.066 1.00 12.20 ? 67  SER A HB2  1  
ATOM 1060   H HB3  . SER A 1 67  ? 8.877   -18.349 -13.194 1.00 54.34 ? 67  SER A HB3  1  
ATOM 1061   H HG   . SER A 1 67  ? 9.888   -20.887 -12.398 1.00 53.24 ? 67  SER A HG   1  
ATOM 1062   N N    . LEU A 1 68  ? 6.019   -21.574 -12.948 1.00 64.23 ? 68  LEU A N    1  
ATOM 1063   C CA   . LEU A 1 68  ? 5.636   -22.975 -13.173 1.00 51.23 ? 68  LEU A CA   1  
ATOM 1064   C C    . LEU A 1 68  ? 6.267   -23.412 -14.509 1.00 15.31 ? 68  LEU A C    1  
ATOM 1065   O O    . LEU A 1 68  ? 5.628   -23.353 -15.573 1.00 60.44 ? 68  LEU A O    1  
ATOM 1066   C CB   . LEU A 1 68  ? 4.075   -23.140 -13.141 1.00 20.40 ? 68  LEU A CB   1  
ATOM 1067   C CG   . LEU A 1 68  ? 3.479   -24.612 -13.100 1.00 32.53 ? 68  LEU A CG   1  
ATOM 1068   C CD1  . LEU A 1 68  ? 3.410   -25.292 -14.493 1.00 20.51 ? 68  LEU A CD1  1  
ATOM 1069   C CD2  . LEU A 1 68  ? 4.252   -25.502 -12.089 1.00 44.45 ? 68  LEU A CD2  1  
ATOM 1070   H H    . LEU A 1 68  ? 5.437   -20.870 -13.300 1.00 34.30 ? 68  LEU A H    1  
ATOM 1071   H HA   . LEU A 1 68  ? 6.064   -23.576 -12.369 1.00 63.14 ? 68  LEU A HA   1  
ATOM 1072   H HB2  . LEU A 1 68  ? 3.711   -22.615 -12.262 1.00 22.50 ? 68  LEU A HB2  1  
ATOM 1073   H HB3  . LEU A 1 68  ? 3.667   -22.634 -14.012 1.00 43.04 ? 68  LEU A HB3  1  
ATOM 1074   H HG   . LEU A 1 68  ? 2.457   -24.550 -12.745 1.00 2.41  ? 68  LEU A HG   1  
ATOM 1075   H HD11 . LEU A 1 68  ? 2.812   -24.683 -15.159 1.00 51.42 ? 68  LEU A HD11 1  
ATOM 1076   H HD12 . LEU A 1 68  ? 2.957   -26.269 -14.408 1.00 40.42 ? 68  LEU A HD12 1  
ATOM 1077   H HD13 . LEU A 1 68  ? 4.408   -25.392 -14.906 1.00 71.02 ? 68  LEU A HD13 1  
ATOM 1078   H HD21 . LEU A 1 68  ? 4.222   -25.043 -11.108 1.00 64.10 ? 68  LEU A HD21 1  
ATOM 1079   H HD22 . LEU A 1 68  ? 5.283   -25.612 -12.399 1.00 41.42 ? 68  LEU A HD22 1  
ATOM 1080   H HD23 . LEU A 1 68  ? 3.789   -26.478 -12.035 1.00 54.10 ? 68  LEU A HD23 1  
ATOM 1081   N N    . GLY A 1 69  ? 7.579   -23.718 -14.450 1.00 73.11 ? 69  GLY A N    1  
ATOM 1082   C CA   . GLY A 1 69  ? 8.309   -24.275 -15.583 1.00 65.12 ? 69  GLY A CA   1  
ATOM 1083   C C    . GLY A 1 69  ? 8.581   -23.246 -16.673 1.00 32.24 ? 69  GLY A C    1  
ATOM 1084   O O    . GLY A 1 69  ? 9.580   -22.514 -16.626 1.00 23.41 ? 69  GLY A O    1  
ATOM 1085   H H    . GLY A 1 69  ? 8.058   -23.556 -13.612 1.00 44.35 ? 69  GLY A H    1  
ATOM 1086   H HA2  . GLY A 1 69  ? 9.253   -24.665 -15.226 1.00 21.11 ? 69  GLY A HA2  1  
ATOM 1087   H HA3  . GLY A 1 69  ? 7.744   -25.097 -16.003 1.00 23.44 ? 69  GLY A HA3  1  
ATOM 1088   N N    . GLU A 1 70  ? 7.641   -23.174 -17.633 1.00 44.20 ? 70  GLU A N    1  
ATOM 1089   C CA   . GLU A 1 70  ? 7.765   -22.343 -18.846 1.00 2.45  ? 70  GLU A CA   1  
ATOM 1090   C C    . GLU A 1 70  ? 7.154   -20.943 -18.646 1.00 13.52 ? 70  GLU A C    1  
ATOM 1091   O O    . GLU A 1 70  ? 7.560   -19.992 -19.312 1.00 53.11 ? 70  GLU A O    1  
ATOM 1092   C CB   . GLU A 1 70  ? 7.083   -23.052 -20.052 1.00 3.52  ? 70  GLU A CB   1  
ATOM 1093   C CG   . GLU A 1 70  ? 5.568   -23.288 -19.882 1.00 21.10 ? 70  GLU A CG   1  
ATOM 1094   C CD   . GLU A 1 70  ? 4.927   -24.006 -21.079 1.00 63.51 ? 70  GLU A CD   1  
ATOM 1095   O OE1  . GLU A 1 70  ? 4.850   -23.411 -22.167 1.00 33.33 ? 70  GLU A OE1  1  
ATOM 1096   O OE2  . GLU A 1 70  ? 4.494   -25.161 -20.942 1.00 71.02 ? 70  GLU A OE2  1  
ATOM 1097   H H    . GLU A 1 70  ? 6.822   -23.699 -17.510 1.00 13.42 ? 70  GLU A H    1  
ATOM 1098   H HA   . GLU A 1 70  ? 8.822   -22.229 -19.072 1.00 43.12 ? 70  GLU A HA   1  
ATOM 1099   H HB2  . GLU A 1 70  ? 7.237   -22.451 -20.945 1.00 10.54 ? 70  GLU A HB2  1  
ATOM 1100   H HB3  . GLU A 1 70  ? 7.561   -24.015 -20.206 1.00 35.31 ? 70  GLU A HB3  1  
ATOM 1101   H HG2  . GLU A 1 70  ? 5.410   -23.875 -18.982 1.00 24.01 ? 70  GLU A HG2  1  
ATOM 1102   H HG3  . GLU A 1 70  ? 5.079   -22.327 -19.756 1.00 71.34 ? 70  GLU A HG3  1  
ATOM 1103   N N    . GLU A 1 71  ? 6.171   -20.822 -17.736 1.00 72.34 ? 71  GLU A N    1  
ATOM 1104   C CA   . GLU A 1 71  ? 5.446   -19.558 -17.509 1.00 33.42 ? 71  GLU A CA   1  
ATOM 1105   C C    . GLU A 1 71  ? 5.744   -18.997 -16.109 1.00 42.10 ? 71  GLU A C    1  
ATOM 1106   O O    . GLU A 1 71  ? 5.656   -19.722 -15.116 1.00 11.22 ? 71  GLU A O    1  
ATOM 1107   C CB   . GLU A 1 71  ? 3.923   -19.791 -17.693 1.00 25.44 ? 71  GLU A CB   1  
ATOM 1108   C CG   . GLU A 1 71  ? 3.073   -18.518 -17.514 1.00 33.34 ? 71  GLU A CG   1  
ATOM 1109   C CD   . GLU A 1 71  ? 1.583   -18.728 -17.799 1.00 24.45 ? 71  GLU A CD   1  
ATOM 1110   O OE1  . GLU A 1 71  ? 1.181   -18.677 -18.980 1.00 52.14 ? 71  GLU A OE1  1  
ATOM 1111   O OE2  . GLU A 1 71  ? 0.809   -18.967 -16.854 1.00 72.24 ? 71  GLU A OE2  1  
ATOM 1112   H H    . GLU A 1 71  ? 5.913   -21.609 -17.207 1.00 1.42  ? 71  GLU A H    1  
ATOM 1113   H HA   . GLU A 1 71  ? 5.776   -18.830 -18.255 1.00 71.41 ? 71  GLU A HA   1  
ATOM 1114   H HB2  . GLU A 1 71  ? 3.750   -20.182 -18.691 1.00 12.40 ? 71  GLU A HB2  1  
ATOM 1115   H HB3  . GLU A 1 71  ? 3.586   -20.532 -16.971 1.00 70.11 ? 71  GLU A HB3  1  
ATOM 1116   H HG2  . GLU A 1 71  ? 3.190   -18.168 -16.493 1.00 3.02  ? 71  GLU A HG2  1  
ATOM 1117   H HG3  . GLU A 1 71  ? 3.450   -17.747 -18.181 1.00 53.51 ? 71  GLU A HG3  1  
ATOM 1118   N N    . THR A 1 72  ? 6.112   -17.704 -16.052 1.00 64.30 ? 72  THR A N    1  
ATOM 1119   C CA   . THR A 1 72  ? 6.334   -16.980 -14.795 1.00 54.54 ? 72  THR A CA   1  
ATOM 1120   C C    . THR A 1 72  ? 5.018   -16.350 -14.302 1.00 34.24 ? 72  THR A C    1  
ATOM 1121   O O    . THR A 1 72  ? 4.387   -15.578 -15.028 1.00 53.12 ? 72  THR A O    1  
ATOM 1122   C CB   . THR A 1 72  ? 7.415   -15.863 -14.962 1.00 31.31 ? 72  THR A CB   1  
ATOM 1123   O OG1  . THR A 1 72  ? 8.627   -16.444 -15.462 1.00 54.45 ? 72  THR A OG1  1  
ATOM 1124   C CG2  . THR A 1 72  ? 7.697   -15.138 -13.625 1.00 3.21  ? 72  THR A CG2  1  
ATOM 1125   H H    . THR A 1 72  ? 6.230   -17.219 -16.888 1.00 21.21 ? 72  THR A H    1  
ATOM 1126   H HA   . THR A 1 72  ? 6.696   -17.691 -14.051 1.00 51.43 ? 72  THR A HA   1  
ATOM 1127   H HB   . THR A 1 72  ? 7.058   -15.137 -15.686 1.00 5.43  ? 72  THR A HB   1  
ATOM 1128   H HG1  . THR A 1 72  ? 9.006   -15.861 -16.128 1.00 1.10  ? 72  THR A HG1  1  
ATOM 1129   H HG21 . THR A 1 72  ? 8.098   -15.839 -12.904 1.00 42.22 ? 72  THR A HG21 1  
ATOM 1130   H HG22 . THR A 1 72  ? 6.778   -14.716 -13.238 1.00 62.23 ? 72  THR A HG22 1  
ATOM 1131   H HG23 . THR A 1 72  ? 8.404   -14.344 -13.782 1.00 63.35 ? 72  THR A HG23 1  
ATOM 1132   N N    . ALA A 1 73  ? 4.645   -16.677 -13.058 1.00 15.41 ? 73  ALA A N    1  
ATOM 1133   C CA   . ALA A 1 73  ? 3.470   -16.108 -12.377 1.00 22.40 ? 73  ALA A CA   1  
ATOM 1134   C C    . ALA A 1 73  ? 3.726   -14.639 -12.026 1.00 71.13 ? 73  ALA A C    1  
ATOM 1135   O O    . ALA A 1 73  ? 2.981   -13.739 -12.442 1.00 75.45 ? 73  ALA A O    1  
ATOM 1136   C CB   . ALA A 1 73  ? 3.147   -16.924 -11.110 1.00 3.24  ? 73  ALA A CB   1  
ATOM 1137   H H    . ALA A 1 73  ? 5.196   -17.319 -12.574 1.00 14.55 ? 73  ALA A H    1  
ATOM 1138   H HA   . ALA A 1 73  ? 2.619   -16.172 -13.052 1.00 1.13  ? 73  ALA A HA   1  
ATOM 1139   H HB1  . ALA A 1 73  ? 3.029   -17.960 -11.373 1.00 23.14 ? 73  ALA A HB1  1  
ATOM 1140   H HB2  . ALA A 1 73  ? 2.232   -16.564 -10.658 1.00 71.21 ? 73  ALA A HB2  1  
ATOM 1141   H HB3  . ALA A 1 73  ? 3.960   -16.832 -10.396 1.00 34.44 ? 73  ALA A HB3  1  
ATOM 1142   N N    . PHE A 1 74  ? 4.816   -14.426 -11.273 1.00 61.32 ? 74  PHE A N    1  
ATOM 1143   C CA   . PHE A 1 74  ? 5.261   -13.087 -10.858 1.00 41.14 ? 74  PHE A CA   1  
ATOM 1144   C C    . PHE A 1 74  ? 6.769   -13.074 -10.551 1.00 1.04  ? 74  PHE A C    1  
ATOM 1145   O O    . PHE A 1 74  ? 7.381   -14.114 -10.284 1.00 60.21 ? 74  PHE A O    1  
ATOM 1146   C CB   . PHE A 1 74  ? 4.442   -12.565 -9.632  1.00 55.41 ? 74  PHE A CB   1  
ATOM 1147   C CG   . PHE A 1 74  ? 4.553   -13.394 -8.340  1.00 4.23  ? 74  PHE A CG   1  
ATOM 1148   C CD1  . PHE A 1 74  ? 5.554   -13.135 -7.399  1.00 44.21 ? 74  PHE A CD1  1  
ATOM 1149   C CD2  . PHE A 1 74  ? 3.645   -14.416 -8.061  1.00 43.44 ? 74  PHE A CD2  1  
ATOM 1150   C CE1  . PHE A 1 74  ? 5.641   -13.867 -6.228  1.00 21.31 ? 74  PHE A CE1  1  
ATOM 1151   C CE2  . PHE A 1 74  ? 3.734   -15.148 -6.891  1.00 73.35 ? 74  PHE A CE2  1  
ATOM 1152   C CZ   . PHE A 1 74  ? 4.731   -14.875 -5.973  1.00 35.15 ? 74  PHE A CZ   1  
ATOM 1153   H H    . PHE A 1 74  ? 5.344   -15.205 -10.992 1.00 41.14 ? 74  PHE A H    1  
ATOM 1154   H HA   . PHE A 1 74  ? 5.091   -12.416 -11.700 1.00 62.44 ? 74  PHE A HA   1  
ATOM 1155   H HB2  . PHE A 1 74  ? 4.759   -11.554 -9.403  1.00 61.40 ? 74  PHE A HB2  1  
ATOM 1156   H HB3  . PHE A 1 74  ? 3.395   -12.529 -9.914  1.00 43.30 ? 74  PHE A HB3  1  
ATOM 1157   H HD1  . PHE A 1 74  ? 6.271   -12.346 -7.591  1.00 71.43 ? 74  PHE A HD1  1  
ATOM 1158   H HD2  . PHE A 1 74  ? 2.858   -14.638 -8.775  1.00 72.02 ? 74  PHE A HD2  1  
ATOM 1159   H HE1  . PHE A 1 74  ? 6.423   -13.650 -5.511  1.00 51.51 ? 74  PHE A HE1  1  
ATOM 1160   H HE2  . PHE A 1 74  ? 3.021   -15.937 -6.692  1.00 72.24 ? 74  PHE A HE2  1  
ATOM 1161   H HZ   . PHE A 1 74  ? 4.798   -15.450 -5.052  1.00 13.34 ? 74  PHE A HZ   1  
ATOM 1162   N N    . LEU A 1 75  ? 7.333   -11.866 -10.605 1.00 51.10 ? 75  LEU A N    1  
ATOM 1163   C CA   . LEU A 1 75  ? 8.717   -11.556 -10.223 1.00 75.44 ? 75  LEU A CA   1  
ATOM 1164   C C    . LEU A 1 75  ? 8.677   -10.287 -9.362  1.00 1.22  ? 75  LEU A C    1  
ATOM 1165   O O    . LEU A 1 75  ? 8.128   -9.277  -9.781  1.00 64.31 ? 75  LEU A O    1  
ATOM 1166   C CB   . LEU A 1 75  ? 9.590   -11.377 -11.508 1.00 53.40 ? 75  LEU A CB   1  
ATOM 1167   C CG   . LEU A 1 75  ? 11.044  -10.785 -11.354 1.00 72.40 ? 75  LEU A CG   1  
ATOM 1168   C CD1  . LEU A 1 75  ? 11.847  -11.445 -10.212 1.00 34.13 ? 75  LEU A CD1  1  
ATOM 1169   C CD2  . LEU A 1 75  ? 11.812  -10.885 -12.694 1.00 40.21 ? 75  LEU A CD2  1  
ATOM 1170   H H    . LEU A 1 75  ? 6.785   -11.126 -10.938 1.00 53.00 ? 75  LEU A H    1  
ATOM 1171   H HA   . LEU A 1 75  ? 9.110   -12.387 -9.629  1.00 31.33 ? 75  LEU A HA   1  
ATOM 1172   H HB2  . LEU A 1 75  ? 9.680   -12.352 -11.974 1.00 42.34 ? 75  LEU A HB2  1  
ATOM 1173   H HB3  . LEU A 1 75  ? 9.042   -10.735 -12.195 1.00 64.41 ? 75  LEU A HB3  1  
ATOM 1174   H HG   . LEU A 1 75  ? 10.961  -9.733  -11.110 1.00 73.23 ? 75  LEU A HG   1  
ATOM 1175   H HD11 . LEU A 1 75  ? 11.488  -11.067 -9.263  1.00 50.12 ? 75  LEU A HD11 1  
ATOM 1176   H HD12 . LEU A 1 75  ? 12.901  -11.214 -10.306 1.00 34.30 ? 75  LEU A HD12 1  
ATOM 1177   H HD13 . LEU A 1 75  ? 11.711  -12.516 -10.230 1.00 41.45 ? 75  LEU A HD13 1  
ATOM 1178   H HD21 . LEU A 1 75  ? 11.275  -10.338 -13.459 1.00 4.33  ? 75  LEU A HD21 1  
ATOM 1179   H HD22 . LEU A 1 75  ? 11.904  -11.921 -12.993 1.00 73.14 ? 75  LEU A HD22 1  
ATOM 1180   H HD23 . LEU A 1 75  ? 12.800  -10.456 -12.581 1.00 43.31 ? 75  LEU A HD23 1  
ATOM 1181   N N    . CYS A 1 76  ? 9.236   -10.373 -8.152  1.00 55.41 ? 76  CYS A N    1  
ATOM 1182   C CA   . CYS A 1 76  ? 9.189   -9.299  -7.140  1.00 35.42 ? 76  CYS A CA   1  
ATOM 1183   C C    . CYS A 1 76  ? 10.599  -9.082  -6.576  1.00 55.40 ? 76  CYS A C    1  
ATOM 1184   O O    . CYS A 1 76  ? 11.060  -9.843  -5.724  1.00 1.13  ? 76  CYS A O    1  
ATOM 1185   C CB   . CYS A 1 76  ? 8.201   -9.683  -6.012  1.00 50.30 ? 76  CYS A CB   1  
ATOM 1186   S SG   . CYS A 1 76  ? 6.534   -10.047 -6.590  1.00 42.24 ? 76  CYS A SG   1  
ATOM 1187   H H    . CYS A 1 76  ? 9.721   -11.191 -7.935  1.00 21.43 ? 76  CYS A H    1  
ATOM 1188   H HA   . CYS A 1 76  ? 8.845   -8.378  -7.619  1.00 44.20 ? 76  CYS A HA   1  
ATOM 1189   H HB2  . CYS A 1 76  ? 8.560   -10.565 -5.491  1.00 51.51 ? 76  CYS A HB2  1  
ATOM 1190   H HB3  . CYS A 1 76  ? 8.126   -8.865  -5.306  1.00 15.31 ? 76  CYS A HB3  1  
ATOM 1191   H HG   . CYS A 1 76  ? 6.570   -10.117 -7.912  1.00 71.22 ? 76  CYS A HG   1  
ATOM 1192   N N    . GLU A 1 77  ? 11.284  -8.054  -7.069  1.00 15.14 ? 77  GLU A N    1  
ATOM 1193   C CA   . GLU A 1 77  ? 12.702  -7.811  -6.779  1.00 43.13 ? 77  GLU A CA   1  
ATOM 1194   C C    . GLU A 1 77  ? 12.874  -6.417  -6.188  1.00 53.22 ? 77  GLU A C    1  
ATOM 1195   O O    . GLU A 1 77  ? 12.406  -5.433  -6.763  1.00 43.51 ? 77  GLU A O    1  
ATOM 1196   C CB   . GLU A 1 77  ? 13.532  -7.955  -8.073  1.00 21.15 ? 77  GLU A CB   1  
ATOM 1197   C CG   . GLU A 1 77  ? 15.035  -7.688  -7.872  1.00 21.11 ? 77  GLU A CG   1  
ATOM 1198   C CD   . GLU A 1 77  ? 15.834  -7.726  -9.174  1.00 1.12  ? 77  GLU A CD   1  
ATOM 1199   O OE1  . GLU A 1 77  ? 16.276  -6.664  -9.649  1.00 4.51  ? 77  GLU A OE1  1  
ATOM 1200   O OE2  . GLU A 1 77  ? 16.048  -8.826  -9.715  1.00 25.52 ? 77  GLU A OE2  1  
ATOM 1201   H H    . GLU A 1 77  ? 10.813  -7.410  -7.628  1.00 70.20 ? 77  GLU A H    1  
ATOM 1202   H HA   . GLU A 1 77  ? 13.044  -8.549  -6.048  1.00 12.44 ? 77  GLU A HA   1  
ATOM 1203   H HB2  . GLU A 1 77  ? 13.407  -8.964  -8.458  1.00 73.03 ? 77  GLU A HB2  1  
ATOM 1204   H HB3  . GLU A 1 77  ? 13.152  -7.255  -8.815  1.00 60.12 ? 77  GLU A HB3  1  
ATOM 1205   H HG2  . GLU A 1 77  ? 15.157  -6.711  -7.409  1.00 23.31 ? 77  GLU A HG2  1  
ATOM 1206   H HG3  . GLU A 1 77  ? 15.432  -8.441  -7.196  1.00 55.15 ? 77  GLU A HG3  1  
ATOM 1207   N N    . VAL A 1 78  ? 13.540  -6.341  -5.032  1.00 51.14 ? 78  VAL A N    1  
ATOM 1208   C CA   . VAL A 1 78  ? 13.696  -5.102  -4.272  1.00 72.23 ? 78  VAL A CA   1  
ATOM 1209   C C    . VAL A 1 78  ? 15.145  -4.968  -3.791  1.00 43.24 ? 78  VAL A C    1  
ATOM 1210   O O    . VAL A 1 78  ? 15.621  -5.779  -2.985  1.00 31.42 ? 78  VAL A O    1  
ATOM 1211   C CB   . VAL A 1 78  ? 12.677  -5.072  -3.065  1.00 1.30  ? 78  VAL A CB   1  
ATOM 1212   C CG1  . VAL A 1 78  ? 12.994  -3.941  -2.058  1.00 25.21 ? 78  VAL A CG1  1  
ATOM 1213   C CG2  . VAL A 1 78  ? 11.224  -4.959  -3.601  1.00 45.14 ? 78  VAL A CG2  1  
ATOM 1214   H H    . VAL A 1 78  ? 13.946  -7.158  -4.673  1.00 75.03 ? 78  VAL A H    1  
ATOM 1215   H HA   . VAL A 1 78  ? 13.468  -4.258  -4.929  1.00 35.12 ? 78  VAL A HA   1  
ATOM 1216   H HB   . VAL A 1 78  ? 12.758  -6.019  -2.533  1.00 62.45 ? 78  VAL A HB   1  
ATOM 1217   H HG11 . VAL A 1 78  ? 13.962  -4.121  -1.604  1.00 34.15 ? 78  VAL A HG11 1  
ATOM 1218   H HG12 . VAL A 1 78  ? 12.241  -3.913  -1.282  1.00 22.41 ? 78  VAL A HG12 1  
ATOM 1219   H HG13 . VAL A 1 78  ? 13.016  -2.988  -2.569  1.00 43.40 ? 78  VAL A HG13 1  
ATOM 1220   H HG21 . VAL A 1 78  ? 11.049  -3.964  -3.991  1.00 74.12 ? 78  VAL A HG21 1  
ATOM 1221   H HG22 . VAL A 1 78  ? 10.519  -5.172  -2.828  1.00 64.14 ? 78  VAL A HG22 1  
ATOM 1222   H HG23 . VAL A 1 78  ? 11.076  -5.676  -4.398  1.00 5.03  ? 78  VAL A HG23 1  
ATOM 1223   N N    . GLN A 1 79  ? 15.846  -3.954  -4.323  1.00 70.44 ? 79  GLN A N    1  
ATOM 1224   C CA   . GLN A 1 79  ? 17.157  -3.542  -3.832  1.00 5.23  ? 79  GLN A CA   1  
ATOM 1225   C C    . GLN A 1 79  ? 16.950  -2.589  -2.645  1.00 51.31 ? 79  GLN A C    1  
ATOM 1226   O O    . GLN A 1 79  ? 16.890  -1.361  -2.803  1.00 52.04 ? 79  GLN A O    1  
ATOM 1227   C CB   . GLN A 1 79  ? 17.998  -2.882  -4.961  1.00 41.21 ? 79  GLN A CB   1  
ATOM 1228   C CG   . GLN A 1 79  ? 18.526  -3.865  -6.024  1.00 41.35 ? 79  GLN A CG   1  
ATOM 1229   C CD   . GLN A 1 79  ? 19.488  -3.209  -7.021  1.00 3.21  ? 79  GLN A CD   1  
ATOM 1230   O OE1  . GLN A 1 79  ? 20.682  -3.084  -6.750  1.00 31.33 ? 79  GLN A OE1  1  
ATOM 1231   N NE2  . GLN A 1 79  ? 18.997  -2.829  -8.193  1.00 0.43  ? 79  GLN A NE2  1  
ATOM 1232   H H    . GLN A 1 79  ? 15.457  -3.462  -5.078  1.00 51.33 ? 79  GLN A H    1  
ATOM 1233   H HA   . GLN A 1 79  ? 17.681  -4.429  -3.474  1.00 14.44 ? 79  GLN A HA   1  
ATOM 1234   H HB2  . GLN A 1 79  ? 17.383  -2.142  -5.459  1.00 12.44 ? 79  GLN A HB2  1  
ATOM 1235   H HB3  . GLN A 1 79  ? 18.849  -2.377  -4.517  1.00 31.51 ? 79  GLN A HB3  1  
ATOM 1236   H HG2  . GLN A 1 79  ? 19.047  -4.673  -5.524  1.00 42.33 ? 79  GLN A HG2  1  
ATOM 1237   H HG3  . GLN A 1 79  ? 17.681  -4.277  -6.568  1.00 4.41  ? 79  GLN A HG3  1  
ATOM 1238   H HE21 . GLN A 1 79  ? 18.043  -2.988  -8.370  1.00 13.32 ? 79  GLN A HE21 1  
ATOM 1239   H HE22 . GLN A 1 79  ? 19.602  -2.398  -8.831  1.00 33.43 ? 79  GLN A HE22 1  
ATOM 1240   N N    . GLN A 1 80  ? 16.759  -3.200  -1.468  1.00 30.35 ? 80  GLN A N    1  
ATOM 1241   C CA   . GLN A 1 80  ? 16.551  -2.504  -0.203  1.00 11.41 ? 80  GLN A CA   1  
ATOM 1242   C C    . GLN A 1 80  ? 17.901  -1.974  0.299   1.00 21.22 ? 80  GLN A C    1  
ATOM 1243   O O    . GLN A 1 80  ? 18.706  -2.730  0.856   1.00 12.20 ? 80  GLN A O    1  
ATOM 1244   C CB   . GLN A 1 80  ? 15.921  -3.487  0.820   1.00 15.12 ? 80  GLN A CB   1  
ATOM 1245   C CG   . GLN A 1 80  ? 15.490  -2.876  2.168   1.00 71.43 ? 80  GLN A CG   1  
ATOM 1246   C CD   . GLN A 1 80  ? 14.410  -1.807  2.027   1.00 11.33 ? 80  GLN A CD   1  
ATOM 1247   O OE1  . GLN A 1 80  ? 14.697  -0.617  1.972   1.00 12.21 ? 80  GLN A OE1  1  
ATOM 1248   N NE2  . GLN A 1 80  ? 13.158  -2.230  1.910   1.00 71.02 ? 80  GLN A NE2  1  
ATOM 1249   H H    . GLN A 1 80  ? 16.766  -4.182  -1.453  1.00 22.23 ? 80  GLN A H    1  
ATOM 1250   H HA   . GLN A 1 80  ? 15.867  -1.672  -0.368  1.00 24.35 ? 80  GLN A HA   1  
ATOM 1251   H HB2  . GLN A 1 80  ? 15.047  -3.941  0.368   1.00 60.10 ? 80  GLN A HB2  1  
ATOM 1252   H HB3  . GLN A 1 80  ? 16.642  -4.276  1.024   1.00 10.42 ? 80  GLN A HB3  1  
ATOM 1253   H HG2  . GLN A 1 80  ? 15.113  -3.667  2.807   1.00 42.33 ? 80  GLN A HG2  1  
ATOM 1254   H HG3  . GLN A 1 80  ? 16.359  -2.431  2.640   1.00 34.35 ? 80  GLN A HG3  1  
ATOM 1255   H HE21 . GLN A 1 80  ? 12.992  -3.194  1.916   1.00 41.54 ? 80  GLN A HE21 1  
ATOM 1256   H HE22 . GLN A 1 80  ? 12.452  -1.558  1.827   1.00 14.42 ? 80  GLN A HE22 1  
ATOM 1257   N N    . GLY A 1 81  ? 18.163  -0.693  0.028   1.00 2.31  ? 81  GLY A N    1  
ATOM 1258   C CA   . GLY A 1 81  ? 19.395  -0.046  0.451   1.00 0.55  ? 81  GLY A CA   1  
ATOM 1259   C C    . GLY A 1 81  ? 19.281  0.510   1.856   1.00 24.34 ? 81  GLY A C    1  
ATOM 1260   O O    . GLY A 1 81  ? 18.189  0.859   2.313   1.00 33.33 ? 81  GLY A O    1  
ATOM 1261   H H    . GLY A 1 81  ? 17.487  -0.163  -0.444  1.00 25.31 ? 81  GLY A H    1  
ATOM 1262   H HA2  . GLY A 1 81  ? 20.217  -0.756  0.408   1.00 24.34 ? 81  GLY A HA2  1  
ATOM 1263   H HA3  . GLY A 1 81  ? 19.607  0.767   -0.226  1.00 51.52 ? 81  GLY A HA3  1  
ATOM 1264   N N    . GLY A 1 82  ? 20.407  0.553   2.555   1.00 63.01 ? 82  GLY A N    1  
ATOM 1265   C CA   . GLY A 1 82  ? 20.494  1.171   3.861   1.00 41.13 ? 82  GLY A CA   1  
ATOM 1266   C C    . GLY A 1 82  ? 21.824  1.857   4.044   1.00 43.42 ? 82  GLY A C    1  
ATOM 1267   O O    . GLY A 1 82  ? 22.871  1.223   3.891   1.00 64.22 ? 82  GLY A O    1  
ATOM 1268   H H    . GLY A 1 82  ? 21.199  0.124   2.185   1.00 40.44 ? 82  GLY A H    1  
ATOM 1269   H HA2  . GLY A 1 82  ? 19.687  1.895   3.991   1.00 13.22 ? 82  GLY A HA2  1  
ATOM 1270   H HA3  . GLY A 1 82  ? 20.394  0.402   4.616   1.00 40.45 ? 82  GLY A HA3  1  
ATOM 1271   N N    . ILE A 1 83  ? 21.783  3.158   4.329   1.00 74.14 ? 83  ILE A N    1  
ATOM 1272   C CA   . ILE A 1 83  ? 22.969  3.927   4.696   1.00 72.44 ? 83  ILE A CA   1  
ATOM 1273   C C    . ILE A 1 83  ? 23.236  3.694   6.194   1.00 34.34 ? 83  ILE A C    1  
ATOM 1274   O O    . ILE A 1 83  ? 22.316  3.805   7.018   1.00 14.22 ? 83  ILE A O    1  
ATOM 1275   C CB   . ILE A 1 83  ? 22.786  5.465   4.418   1.00 63.11 ? 83  ILE A CB   1  
ATOM 1276   C CG1  . ILE A 1 83  ? 22.250  5.713   2.968   1.00 1.14  ? 83  ILE A CG1  1  
ATOM 1277   C CG2  . ILE A 1 83  ? 24.122  6.215   4.668   1.00 12.21 ? 83  ILE A CG2  1  
ATOM 1278   C CD1  . ILE A 1 83  ? 21.922  7.164   2.643   1.00 23.32 ? 83  ILE A CD1  1  
ATOM 1279   H H    . ILE A 1 83  ? 20.919  3.614   4.300   1.00 32.33 ? 83  ILE A H    1  
ATOM 1280   H HA   . ILE A 1 83  ? 23.815  3.562   4.107   1.00 60.02 ? 83  ILE A HA   1  
ATOM 1281   H HB   . ILE A 1 83  ? 22.055  5.852   5.126   1.00 34.44 ? 83  ILE A HB   1  
ATOM 1282   H HG12 . ILE A 1 83  ? 22.983  5.377   2.246   1.00 15.01 ? 83  ILE A HG12 1  
ATOM 1283   H HG13 . ILE A 1 83  ? 21.340  5.140   2.825   1.00 34.33 ? 83  ILE A HG13 1  
ATOM 1284   H HG21 . ILE A 1 83  ? 24.450  6.050   5.689   1.00 21.30 ? 83  ILE A HG21 1  
ATOM 1285   H HG22 . ILE A 1 83  ? 23.985  7.273   4.515   1.00 31.31 ? 83  ILE A HG22 1  
ATOM 1286   H HG23 . ILE A 1 83  ? 24.884  5.854   3.988   1.00 4.11  ? 83  ILE A HG23 1  
ATOM 1287   H HD11 . ILE A 1 83  ? 21.186  7.534   3.344   1.00 3.13  ? 83  ILE A HD11 1  
ATOM 1288   H HD12 . ILE A 1 83  ? 21.521  7.219   1.643   1.00 22.52 ? 83  ILE A HD12 1  
ATOM 1289   H HD13 . ILE A 1 83  ? 22.815  7.766   2.704   1.00 72.21 ? 83  ILE A HD13 1  
ATOM 1290   N N    . PHE A 1 84  ? 24.484  3.358   6.536   1.00 51.25 ? 84  PHE A N    1  
ATOM 1291   C CA   . PHE A 1 84  ? 24.892  3.035   7.912   1.00 31.35 ? 84  PHE A CA   1  
ATOM 1292   C C    . PHE A 1 84  ? 26.109  3.896   8.284   1.00 4.44  ? 84  PHE A C    1  
ATOM 1293   O O    . PHE A 1 84  ? 27.125  3.888   7.581   1.00 31.52 ? 84  PHE A O    1  
ATOM 1294   C CB   . PHE A 1 84  ? 25.225  1.518   8.043   1.00 15.24 ? 84  PHE A CB   1  
ATOM 1295   C CG   . PHE A 1 84  ? 24.057  0.574   7.705   1.00 64.00 ? 84  PHE A CG   1  
ATOM 1296   C CD1  . PHE A 1 84  ? 24.019  -0.127  6.497   1.00 23.12 ? 84  PHE A CD1  1  
ATOM 1297   C CD2  . PHE A 1 84  ? 22.992  0.397   8.596   1.00 64.41 ? 84  PHE A CD2  1  
ATOM 1298   C CE1  . PHE A 1 84  ? 22.962  -0.972  6.192   1.00 12.10 ? 84  PHE A CE1  1  
ATOM 1299   C CE2  . PHE A 1 84  ? 21.936  -0.451  8.287   1.00 45.12 ? 84  PHE A CE2  1  
ATOM 1300   C CZ   . PHE A 1 84  ? 21.922  -1.132  7.088   1.00 42.13 ? 84  PHE A CZ   1  
ATOM 1301   H H    . PHE A 1 84  ? 25.167  3.341   5.831   1.00 13.15 ? 84  PHE A H    1  
ATOM 1302   H HA   . PHE A 1 84  ? 24.068  3.273   8.592   1.00 42.12 ? 84  PHE A HA   1  
ATOM 1303   H HB2  . PHE A 1 84  ? 26.055  1.281   7.385   1.00 71.31 ? 84  PHE A HB2  1  
ATOM 1304   H HB3  . PHE A 1 84  ? 25.532  1.308   9.065   1.00 63.12 ? 84  PHE A HB3  1  
ATOM 1305   H HD1  . PHE A 1 84  ? 24.831  -0.008  5.785   1.00 54.14 ? 84  PHE A HD1  1  
ATOM 1306   H HD2  . PHE A 1 84  ? 22.993  0.931   9.540   1.00 41.25 ? 84  PHE A HD2  1  
ATOM 1307   H HE1  . PHE A 1 84  ? 22.948  -1.506  5.248   1.00 63.40 ? 84  PHE A HE1  1  
ATOM 1308   H HE2  . PHE A 1 84  ? 21.115  -0.581  8.989   1.00 74.53 ? 84  PHE A HE2  1  
ATOM 1309   H HZ   . PHE A 1 84  ? 21.099  -1.795  6.849   1.00 63.10 ? 84  PHE A HZ   1  
ATOM 1310   N N    . SER A 1 85  ? 25.979  4.672   9.362   1.00 14.12 ? 85  SER A N    1  
ATOM 1311   C CA   . SER A 1 85  ? 27.076  5.459   9.928   1.00 74.14 ? 85  SER A CA   1  
ATOM 1312   C C    . SER A 1 85  ? 27.816  4.591   10.960  1.00 74.32 ? 85  SER A C    1  
ATOM 1313   O O    . SER A 1 85  ? 27.414  4.513   12.130  1.00 74.13 ? 85  SER A O    1  
ATOM 1314   C CB   . SER A 1 85  ? 26.502  6.738   10.572  1.00 14.52 ? 85  SER A CB   1  
ATOM 1315   O OG   . SER A 1 85  ? 25.638  7.406   9.669   1.00 23.30 ? 85  SER A OG   1  
ATOM 1316   H H    . SER A 1 85  ? 25.107  4.714   9.801   1.00 15.32 ? 85  SER A H    1  
ATOM 1317   H HA   . SER A 1 85  ? 27.761  5.741   9.127   1.00 12.24 ? 85  SER A HA   1  
ATOM 1318   H HB2  . SER A 1 85  ? 25.937  6.481   11.460  1.00 34.41 ? 85  SER A HB2  1  
ATOM 1319   H HB3  . SER A 1 85  ? 27.310  7.408   10.840  1.00 54.23 ? 85  SER A HB3  1  
ATOM 1320   H HG   . SER A 1 85  ? 25.577  6.901   8.850   1.00 30.45 ? 85  SER A HG   1  
ATOM 1321   N N    . ILE A 1 86  ? 28.860  3.879   10.495  1.00 42.31 ? 86  ILE A N    1  
ATOM 1322   C CA   . ILE A 1 86  ? 29.620  2.920   11.326  1.00 24.03 ? 86  ILE A CA   1  
ATOM 1323   C C    . ILE A 1 86  ? 31.124  3.244   11.270  1.00 45.42 ? 86  ILE A C    1  
ATOM 1324   O O    . ILE A 1 86  ? 31.597  3.861   10.314  1.00 45.14 ? 86  ILE A O    1  
ATOM 1325   C CB   . ILE A 1 86  ? 29.360  1.399   10.927  1.00 70.31 ? 86  ILE A CB   1  
ATOM 1326   C CG1  . ILE A 1 86  ? 29.974  1.001   9.540   1.00 33.30 ? 86  ILE A CG1  1  
ATOM 1327   C CG2  . ILE A 1 86  ? 27.846  1.068   10.969  1.00 43.03 ? 86  ILE A CG2  1  
ATOM 1328   C CD1  . ILE A 1 86  ? 29.326  1.626   8.317   1.00 73.41 ? 86  ILE A CD1  1  
ATOM 1329   H H    . ILE A 1 86  ? 29.147  4.021   9.567   1.00 21.10 ? 86  ILE A H    1  
ATOM 1330   H HA   . ILE A 1 86  ? 29.297  3.049   12.363  1.00 74.02 ? 86  ILE A HA   1  
ATOM 1331   H HB   . ILE A 1 86  ? 29.834  0.785   11.696  1.00 70.33 ? 86  ILE A HB   1  
ATOM 1332   H HG12 . ILE A 1 86  ? 31.015  1.288   9.523   1.00 64.51 ? 86  ILE A HG12 1  
ATOM 1333   H HG13 . ILE A 1 86  ? 29.919  -0.076  9.421   1.00 12.53 ? 86  ILE A HG13 1  
ATOM 1334   H HG21 . ILE A 1 86  ? 27.690  0.024   10.727  1.00 51.34 ? 86  ILE A HG21 1  
ATOM 1335   H HG22 . ILE A 1 86  ? 27.315  1.683   10.253  1.00 31.30 ? 86  ILE A HG22 1  
ATOM 1336   H HG23 . ILE A 1 86  ? 27.455  1.264   11.961  1.00 53.01 ? 86  ILE A HG23 1  
ATOM 1337   H HD11 . ILE A 1 86  ? 29.841  1.286   7.428   1.00 20.31 ? 86  ILE A HD11 1  
ATOM 1338   H HD12 . ILE A 1 86  ? 29.395  2.702   8.379   1.00 62.10 ? 86  ILE A HD12 1  
ATOM 1339   H HD13 . ILE A 1 86  ? 28.288  1.331   8.263   1.00 32.11 ? 86  ILE A HD13 1  
ATOM 1340   N N    . ALA A 1 87  ? 31.847  2.824   12.313  1.00 61.42 ? 87  ALA A N    1  
ATOM 1341   C CA   . ALA A 1 87  ? 33.300  3.055   12.463  1.00 55.43 ? 87  ALA A CA   1  
ATOM 1342   C C    . ALA A 1 87  ? 33.831  2.223   13.628  1.00 70.41 ? 87  ALA A C    1  
ATOM 1343   O O    . ALA A 1 87  ? 33.046  1.620   14.364  1.00 21.52 ? 87  ALA A O    1  
ATOM 1344   C CB   . ALA A 1 87  ? 33.605  4.550   12.689  1.00 50.25 ? 87  ALA A CB   1  
ATOM 1345   H H    . ALA A 1 87  ? 31.388  2.326   13.022  1.00 52.02 ? 87  ALA A H    1  
ATOM 1346   H HA   . ALA A 1 87  ? 33.796  2.731   11.550  1.00 35.22 ? 87  ALA A HA   1  
ATOM 1347   H HB1  . ALA A 1 87  ? 33.111  4.897   13.589  1.00 41.23 ? 87  ALA A HB1  1  
ATOM 1348   H HB2  . ALA A 1 87  ? 33.247  5.124   11.846  1.00 51.02 ? 87  ALA A HB2  1  
ATOM 1349   H HB3  . ALA A 1 87  ? 34.674  4.697   12.788  1.00 72.41 ? 87  ALA A HB3  1  
ATOM 1350   N N    . GLY A 1 88  ? 35.166  2.178   13.767  1.00 70.14 ? 88  GLY A N    1  
ATOM 1351   C CA   . GLY A 1 88  ? 35.828  1.491   14.885  1.00 4.20  ? 88  GLY A CA   1  
ATOM 1352   C C    . GLY A 1 88  ? 36.234  0.066   14.559  1.00 11.41 ? 88  GLY A C    1  
ATOM 1353   O O    . GLY A 1 88  ? 37.238  -0.437  15.080  1.00 44.04 ? 88  GLY A O    1  
ATOM 1354   H H    . GLY A 1 88  ? 35.717  2.613   13.085  1.00 34.54 ? 88  GLY A H    1  
ATOM 1355   H HA2  . GLY A 1 88  ? 36.711  2.054   15.140  1.00 43.44 ? 88  GLY A HA2  1  
ATOM 1356   H HA3  . GLY A 1 88  ? 35.168  1.474   15.760  1.00 32.33 ? 88  GLY A HA3  1  
ATOM 1357   N N    . ILE A 1 89  ? 35.438  -0.588  13.706  1.00 24.31 ? 89  ILE A N    1  
ATOM 1358   C CA   . ILE A 1 89  ? 35.656  -1.982  13.285  1.00 1.33  ? 89  ILE A CA   1  
ATOM 1359   C C    . ILE A 1 89  ? 36.004  -2.024  11.792  1.00 72.21 ? 89  ILE A C    1  
ATOM 1360   O O    . ILE A 1 89  ? 35.666  -1.098  11.053  1.00 63.34 ? 89  ILE A O    1  
ATOM 1361   C CB   . ILE A 1 89  ? 34.404  -2.911  13.580  1.00 32.55 ? 89  ILE A CB   1  
ATOM 1362   C CG1  . ILE A 1 89  ? 33.148  -2.612  12.673  1.00 74.05 ? 89  ILE A CG1  1  
ATOM 1363   C CG2  . ILE A 1 89  ? 34.026  -2.831  15.080  1.00 44.21 ? 89  ILE A CG2  1  
ATOM 1364   C CD1  . ILE A 1 89  ? 32.475  -1.251  12.865  1.00 65.24 ? 89  ILE A CD1  1  
ATOM 1365   H H    . ILE A 1 89  ? 34.678  -0.110  13.328  1.00 23.32 ? 89  ILE A H    1  
ATOM 1366   H HA   . ILE A 1 89  ? 36.506  -2.380  13.843  1.00 35.53 ? 89  ILE A HA   1  
ATOM 1367   H HB   . ILE A 1 89  ? 34.723  -3.939  13.392  1.00 70.40 ? 89  ILE A HB   1  
ATOM 1368   H HG12 . ILE A 1 89  ? 33.441  -2.676  11.634  1.00 14.40 ? 89  ILE A HG12 1  
ATOM 1369   H HG13 . ILE A 1 89  ? 32.397  -3.371  12.859  1.00 31.22 ? 89  ILE A HG13 1  
ATOM 1370   H HG21 . ILE A 1 89  ? 33.189  -3.486  15.283  1.00 15.41 ? 89  ILE A HG21 1  
ATOM 1371   H HG22 . ILE A 1 89  ? 33.755  -1.814  15.336  1.00 50.32 ? 89  ILE A HG22 1  
ATOM 1372   H HG23 . ILE A 1 89  ? 34.872  -3.134  15.686  1.00 5.43  ? 89  ILE A HG23 1  
ATOM 1373   H HD11 . ILE A 1 89  ? 33.119  -0.470  12.487  1.00 11.54 ? 89  ILE A HD11 1  
ATOM 1374   H HD12 . ILE A 1 89  ? 32.289  -1.080  13.916  1.00 14.52 ? 89  ILE A HD12 1  
ATOM 1375   H HD13 . ILE A 1 89  ? 31.537  -1.235  12.329  1.00 40.31 ? 89  ILE A HD13 1  
ATOM 1376   N N    . GLU A 1 90  ? 36.687  -3.101  11.369  1.00 4.03  ? 90  GLU A N    1  
ATOM 1377   C CA   . GLU A 1 90  ? 37.107  -3.299  9.970   1.00 1.21  ? 90  GLU A CA   1  
ATOM 1378   C C    . GLU A 1 90  ? 37.484  -4.792  9.750   1.00 71.12 ? 90  GLU A C    1  
ATOM 1379   O O    . GLU A 1 90  ? 37.417  -5.604  10.688  1.00 60.31 ? 90  GLU A O    1  
ATOM 1380   C CB   . GLU A 1 90  ? 38.284  -2.341  9.596   1.00 61.30 ? 90  GLU A CB   1  
ATOM 1381   C CG   . GLU A 1 90  ? 38.350  -1.953  8.099   1.00 32.40 ? 90  GLU A CG   1  
ATOM 1382   C CD   . GLU A 1 90  ? 39.449  -0.933  7.781   1.00 62.52 ? 90  GLU A CD   1  
ATOM 1383   O OE1  . GLU A 1 90  ? 40.586  -1.338  7.474   1.00 53.13 ? 90  GLU A OE1  1  
ATOM 1384   O OE2  . GLU A 1 90  ? 39.185  0.279   7.838   1.00 42.23 ? 90  GLU A OE2  1  
ATOM 1385   H H    . GLU A 1 90  ? 36.915  -3.790  12.023  1.00 54.15 ? 90  GLU A H    1  
ATOM 1386   H HA   . GLU A 1 90  ? 36.244  -3.074  9.341   1.00 3.10  ? 90  GLU A HA   1  
ATOM 1387   H HB2  . GLU A 1 90  ? 38.193  -1.431  10.180  1.00 14.23 ? 90  GLU A HB2  1  
ATOM 1388   H HB3  . GLU A 1 90  ? 39.222  -2.821  9.859   1.00 1.11  ? 90  GLU A HB3  1  
ATOM 1389   H HG2  . GLU A 1 90  ? 38.524  -2.855  7.516   1.00 3.52  ? 90  GLU A HG2  1  
ATOM 1390   H HG3  . GLU A 1 90  ? 37.385  -1.540  7.807   1.00 21.41 ? 90  GLU A HG3  1  
ATOM 1391   N N    . GLY A 1 91  ? 37.839  -5.143  8.497   1.00 33.50 ? 91  GLY A N    1  
ATOM 1392   C CA   . GLY A 1 91  ? 38.264  -6.502  8.134   1.00 12.35 ? 91  GLY A CA   1  
ATOM 1393   C C    . GLY A 1 91  ? 37.140  -7.541  8.177   1.00 62.13 ? 91  GLY A C    1  
ATOM 1394   O O    . GLY A 1 91  ? 36.061  -7.312  7.625   1.00 14.13 ? 91  GLY A O    1  
ATOM 1395   H H    . GLY A 1 91  ? 37.829  -4.451  7.805   1.00 20.23 ? 91  GLY A H    1  
ATOM 1396   H HA2  . GLY A 1 91  ? 38.657  -6.476  7.128   1.00 1.02  ? 91  GLY A HA2  1  
ATOM 1397   H HA3  . GLY A 1 91  ? 39.066  -6.809  8.802   1.00 73.42 ? 91  GLY A HA3  1  
ATOM 1398   N N    . THR A 1 92  ? 37.404  -8.676  8.852   1.00 22.45 ? 92  THR A N    1  
ATOM 1399   C CA   . THR A 1 92  ? 36.504  -9.849  8.906   1.00 20.23 ? 92  THR A CA   1  
ATOM 1400   C C    . THR A 1 92  ? 35.318  -9.610  9.861   1.00 42.10 ? 92  THR A C    1  
ATOM 1401   O O    . THR A 1 92  ? 34.194  -10.073 9.605   1.00 41.40 ? 92  THR A O    1  
ATOM 1402   C CB   . THR A 1 92  ? 37.303  -11.112 9.358   1.00 13.44 ? 92  THR A CB   1  
ATOM 1403   O OG1  . THR A 1 92  ? 37.859  -10.890 10.668  1.00 71.20 ? 92  THR A OG1  1  
ATOM 1404   C CG2  . THR A 1 92  ? 38.439  -11.438 8.370   1.00 34.40 ? 92  THR A CG2  1  
ATOM 1405   H H    . THR A 1 92  ? 38.251  -8.730  9.342   1.00 25.31 ? 92  THR A H    1  
ATOM 1406   H HA   . THR A 1 92  ? 36.120  -10.027 7.902   1.00 71.41 ? 92  THR A HA   1  
ATOM 1407   H HB   . THR A 1 92  ? 36.627  -11.959 9.407   1.00 25.12 ? 92  THR A HB   1  
ATOM 1408   H HG1  . THR A 1 92  ? 38.751  -11.256 10.707  1.00 73.43 ? 92  THR A HG1  1  
ATOM 1409   H HG21 . THR A 1 92  ? 39.150  -10.619 8.339   1.00 74.30 ? 92  THR A HG21 1  
ATOM 1410   H HG22 . THR A 1 92  ? 38.032  -11.588 7.376   1.00 23.14 ? 92  THR A HG22 1  
ATOM 1411   H HG23 . THR A 1 92  ? 38.945  -12.341 8.683   1.00 11.13 ? 92  THR A HG23 1  
ATOM 1412   N N    . GLN A 1 93  ? 35.596  -8.883  10.957  1.00 40.40 ? 93  GLN A N    1  
ATOM 1413   C CA   . GLN A 1 93  ? 34.580  -8.444  11.936  1.00 11.11 ? 93  GLN A CA   1  
ATOM 1414   C C    . GLN A 1 93  ? 33.524  -7.563  11.244  1.00 73.21 ? 93  GLN A C    1  
ATOM 1415   O O    . GLN A 1 93  ? 32.311  -7.734  11.445  1.00 31.00 ? 93  GLN A O    1  
ATOM 1416   C CB   . GLN A 1 93  ? 35.280  -7.667  13.088  1.00 21.12 ? 93  GLN A CB   1  
ATOM 1417   C CG   . GLN A 1 93  ? 34.327  -7.003  14.112  1.00 15.44 ? 93  GLN A CG   1  
ATOM 1418   C CD   . GLN A 1 93  ? 35.035  -6.280  15.267  1.00 13.12 ? 93  GLN A CD   1  
ATOM 1419   O OE1  . GLN A 1 93  ? 34.518  -6.206  16.384  1.00 11.55 ? 93  GLN A OE1  1  
ATOM 1420   N NE2  . GLN A 1 93  ? 36.200  -5.695  15.004  1.00 64.20 ? 93  GLN A NE2  1  
ATOM 1421   H H    . GLN A 1 93  ? 36.530  -8.637  11.115  1.00 3.52  ? 93  GLN A H    1  
ATOM 1422   H HA   . GLN A 1 93  ? 34.101  -9.332  12.339  1.00 41.21 ? 93  GLN A HA   1  
ATOM 1423   H HB2  . GLN A 1 93  ? 35.924  -8.354  13.625  1.00 75.43 ? 93  GLN A HB2  1  
ATOM 1424   H HB3  . GLN A 1 93  ? 35.900  -6.890  12.653  1.00 51.34 ? 93  GLN A HB3  1  
ATOM 1425   H HG2  . GLN A 1 93  ? 33.717  -6.275  13.592  1.00 42.52 ? 93  GLN A HG2  1  
ATOM 1426   H HG3  . GLN A 1 93  ? 33.679  -7.767  14.526  1.00 2.55  ? 93  GLN A HG3  1  
ATOM 1427   H HE21 . GLN A 1 93  ? 36.561  -5.747  14.095  1.00 11.42 ? 93  GLN A HE21 1  
ATOM 1428   H HE22 . GLN A 1 93  ? 36.647  -5.222  15.734  1.00 74.10 ? 93  GLN A HE22 1  
ATOM 1429   N N    . MET A 1 94  ? 34.017  -6.646  10.397  1.00 35.10 ? 94  MET A N    1  
ATOM 1430   C CA   . MET A 1 94  ? 33.173  -5.751  9.597   1.00 3.21  ? 94  MET A CA   1  
ATOM 1431   C C    . MET A 1 94  ? 32.487  -6.518  8.463   1.00 12.14 ? 94  MET A C    1  
ATOM 1432   O O    . MET A 1 94  ? 31.343  -6.238  8.149   1.00 31.12 ? 94  MET A O    1  
ATOM 1433   C CB   . MET A 1 94  ? 34.013  -4.600  9.026   1.00 63.52 ? 94  MET A CB   1  
ATOM 1434   C CG   . MET A 1 94  ? 33.234  -3.531  8.266   1.00 54.30 ? 94  MET A CG   1  
ATOM 1435   S SD   . MET A 1 94  ? 34.309  -2.238  7.639   1.00 1.25  ? 94  MET A SD   1  
ATOM 1436   C CE   . MET A 1 94  ? 35.239  -3.043  6.347   1.00 13.02 ? 94  MET A CE   1  
ATOM 1437   H H    . MET A 1 94  ? 34.993  -6.571  10.309  1.00 23.33 ? 94  MET A H    1  
ATOM 1438   H HA   . MET A 1 94  ? 32.412  -5.336  10.253  1.00 14.41 ? 94  MET A HA   1  
ATOM 1439   H HB2  . MET A 1 94  ? 34.524  -4.110  9.846   1.00 71.52 ? 94  MET A HB2  1  
ATOM 1440   H HB3  . MET A 1 94  ? 34.766  -5.007  8.356   1.00 61.32 ? 94  MET A HB3  1  
ATOM 1441   H HG2  . MET A 1 94  ? 32.725  -3.988  7.431   1.00 51.23 ? 94  MET A HG2  1  
ATOM 1442   H HG3  . MET A 1 94  ? 32.503  -3.082  8.928   1.00 42.22 ? 94  MET A HG3  1  
ATOM 1443   H HE1  . MET A 1 94  ? 35.801  -2.292  5.800   1.00 73.13 ? 94  MET A HE1  1  
ATOM 1444   H HE2  . MET A 1 94  ? 34.558  -3.538  5.672   1.00 74.41 ? 94  MET A HE2  1  
ATOM 1445   H HE3  . MET A 1 94  ? 35.919  -3.763  6.777   1.00 50.12 ? 94  MET A HE3  1  
ATOM 1446   N N    . ALA A 1 95  ? 33.191  -7.504  7.880   1.00 33.23 ? 95  ALA A N    1  
ATOM 1447   C CA   . ALA A 1 95  ? 32.641  -8.363  6.810   1.00 11.11 ? 95  ALA A CA   1  
ATOM 1448   C C    . ALA A 1 95  ? 31.399  -9.134  7.307   1.00 55.21 ? 95  ALA A C    1  
ATOM 1449   O O    . ALA A 1 95  ? 30.502  -9.450  6.527   1.00 3.04  ? 95  ALA A O    1  
ATOM 1450   C CB   . ALA A 1 95  ? 33.714  -9.324  6.280   1.00 32.20 ? 95  ALA A CB   1  
ATOM 1451   H H    . ALA A 1 95  ? 34.109  -7.665  8.180   1.00 70.32 ? 95  ALA A H    1  
ATOM 1452   H HA   . ALA A 1 95  ? 32.340  -7.712  5.995   1.00 31.02 ? 95  ALA A HA   1  
ATOM 1453   H HB1  . ALA A 1 95  ? 34.034  -9.987  7.075   1.00 70.11 ? 95  ALA A HB1  1  
ATOM 1454   H HB2  . ALA A 1 95  ? 34.566  -8.757  5.928   1.00 62.43 ? 95  ALA A HB2  1  
ATOM 1455   H HB3  . ALA A 1 95  ? 33.312  -9.910  5.463   1.00 70.41 ? 95  ALA A HB3  1  
ATOM 1456   N N    . HIS A 1 96  ? 31.370  -9.427  8.625   1.00 60.24 ? 96  HIS A N    1  
ATOM 1457   C CA   . HIS A 1 96  ? 30.168  -9.933  9.308   1.00 62.34 ? 96  HIS A CA   1  
ATOM 1458   C C    . HIS A 1 96  ? 29.082  -8.841  9.394   1.00 64.25 ? 96  HIS A C    1  
ATOM 1459   O O    . HIS A 1 96  ? 27.917  -9.114  9.139   1.00 42.53 ? 96  HIS A O    1  
ATOM 1460   C CB   . HIS A 1 96  ? 30.518  -10.458 10.727  1.00 51.22 ? 96  HIS A CB   1  
ATOM 1461   C CG   . HIS A 1 96  ? 29.309  -10.661 11.620  1.00 51.11 ? 96  HIS A CG   1  
ATOM 1462   N ND1  . HIS A 1 96  ? 28.957  -9.760  12.607  1.00 43.35 ? 96  HIS A ND1  1  
ATOM 1463   C CD2  . HIS A 1 96  ? 28.361  -11.630 11.647  1.00 44.52 ? 96  HIS A CD2  1  
ATOM 1464   C CE1  . HIS A 1 96  ? 27.848  -10.164 13.193  1.00 5.15  ? 96  HIS A CE1  1  
ATOM 1465   N NE2  . HIS A 1 96  ? 27.470  -11.294 12.635  1.00 3.32  ? 96  HIS A NE2  1  
ATOM 1466   H H    . HIS A 1 96  ? 32.195  -9.306  9.149   1.00 62.02 ? 96  HIS A H    1  
ATOM 1467   H HA   . HIS A 1 96  ? 29.783  -10.761 8.716   1.00 70.30 ? 96  HIS A HA   1  
ATOM 1468   H HB2  . HIS A 1 96  ? 31.028  -11.409 10.635  1.00 0.42  ? 96  HIS A HB2  1  
ATOM 1469   H HB3  . HIS A 1 96  ? 31.179  -9.755  11.220  1.00 3.35  ? 96  HIS A HB3  1  
ATOM 1470   H HD1  . HIS A 1 96  ? 29.446  -8.947  12.841  1.00 53.10 ? 96  HIS A HD1  1  
ATOM 1471   H HD2  . HIS A 1 96  ? 28.317  -12.509 11.014  1.00 11.21 ? 96  HIS A HD2  1  
ATOM 1472   H HE1  . HIS A 1 96  ? 27.337  -9.658  14.000  1.00 51.11 ? 96  HIS A HE1  1  
ATOM 1473   H HE2  . HIS A 1 96  ? 26.561  -11.663 12.716  1.00 37.65 ? 96  HIS A HE2  1  
ATOM 1474   N N    . CYS A 1 97  ? 29.472  -7.619  9.798   1.00 60.24 ? 97  CYS A N    1  
ATOM 1475   C CA   . CYS A 1 97  ? 28.521  -6.508  9.978   1.00 30.25 ? 97  CYS A CA   1  
ATOM 1476   C C    . CYS A 1 97  ? 27.793  -6.186  8.650   1.00 54.32 ? 97  CYS A C    1  
ATOM 1477   O O    . CYS A 1 97  ? 26.617  -6.455  8.524   1.00 15.43 ? 97  CYS A O    1  
ATOM 1478   C CB   . CYS A 1 97  ? 29.251  -5.262  10.534  1.00 51.24 ? 97  CYS A CB   1  
ATOM 1479   S SG   . CYS A 1 97  ? 30.101  -5.542  12.106  1.00 13.42 ? 97  CYS A SG   1  
ATOM 1480   H H    . CYS A 1 97  ? 30.425  -7.462  9.981   1.00 35.51 ? 97  CYS A H    1  
ATOM 1481   H HA   . CYS A 1 97  ? 27.785  -6.831  10.713  1.00 15.32 ? 97  CYS A HA   1  
ATOM 1482   H HB2  . CYS A 1 97  ? 29.996  -4.934  9.823   1.00 51.41 ? 97  CYS A HB2  1  
ATOM 1483   H HB3  . CYS A 1 97  ? 28.536  -4.465  10.691  1.00 63.23 ? 97  CYS A HB3  1  
ATOM 1484   H HG   . CYS A 1 97  ? 30.421  -4.354  12.605  1.00 41.23 ? 97  CYS A HG   1  
ATOM 1485   N N    . LEU A 1 98  ? 28.536  -5.716  7.639   1.00 14.42 ? 98  LEU A N    1  
ATOM 1486   C CA   . LEU A 1 98  ? 27.969  -5.293  6.336   1.00 4.45  ? 98  LEU A CA   1  
ATOM 1487   C C    . LEU A 1 98  ? 27.518  -6.486  5.455   1.00 23.31 ? 98  LEU A C    1  
ATOM 1488   O O    . LEU A 1 98  ? 26.699  -6.311  4.552   1.00 61.32 ? 98  LEU A O    1  
ATOM 1489   C CB   . LEU A 1 98  ? 28.983  -4.357  5.591   1.00 41.41 ? 98  LEU A CB   1  
ATOM 1490   C CG   . LEU A 1 98  ? 30.475  -4.826  5.470   1.00 43.43 ? 98  LEU A CG   1  
ATOM 1491   C CD1  . LEU A 1 98  ? 30.648  -6.050  4.551   1.00 74.14 ? 98  LEU A CD1  1  
ATOM 1492   C CD2  . LEU A 1 98  ? 31.390  -3.665  5.028   1.00 23.55 ? 98  LEU A CD2  1  
ATOM 1493   H H    . LEU A 1 98  ? 29.496  -5.642  7.774   1.00 73.02 ? 98  LEU A H    1  
ATOM 1494   H HA   . LEU A 1 98  ? 27.075  -4.711  6.556   1.00 64.03 ? 98  LEU A HA   1  
ATOM 1495   H HB2  . LEU A 1 98  ? 28.607  -4.177  4.586   1.00 53.31 ? 98  LEU A HB2  1  
ATOM 1496   H HB3  . LEU A 1 98  ? 28.975  -3.405  6.113   1.00 33.24 ? 98  LEU A HB3  1  
ATOM 1497   H HG   . LEU A 1 98  ? 30.809  -5.131  6.453   1.00 4.20  ? 98  LEU A HG   1  
ATOM 1498   H HD11 . LEU A 1 98  ? 30.069  -6.877  4.937   1.00 61.02 ? 98  LEU A HD11 1  
ATOM 1499   H HD12 . LEU A 1 98  ? 31.690  -6.340  4.522   1.00 65.44 ? 98  LEU A HD12 1  
ATOM 1500   H HD13 . LEU A 1 98  ? 30.311  -5.814  3.549   1.00 21.45 ? 98  LEU A HD13 1  
ATOM 1501   H HD21 . LEU A 1 98  ? 31.100  -3.318  4.044   1.00 4.34  ? 98  LEU A HD21 1  
ATOM 1502   H HD22 . LEU A 1 98  ? 32.418  -4.001  5.002   1.00 23.21 ? 98  LEU A HD22 1  
ATOM 1503   H HD23 . LEU A 1 98  ? 31.306  -2.849  5.734   1.00 21.14 ? 98  LEU A HD23 1  
ATOM 1504   N N    . GLY A 1 99  ? 28.064  -7.689  5.715   1.00 10.30 ? 99  GLY A N    1  
ATOM 1505   C CA   . GLY A 1 99  ? 27.814  -8.869  4.866   1.00 24.03 ? 99  GLY A CA   1  
ATOM 1506   C C    . GLY A 1 99  ? 26.795  -9.833  5.450   1.00 63.41 ? 99  GLY A C    1  
ATOM 1507   O O    . GLY A 1 99  ? 26.431  -10.812 4.788   1.00 44.51 ? 99  GLY A O    1  
ATOM 1508   H H    . GLY A 1 99  ? 28.658  -7.780  6.490   1.00 65.22 ? 99  GLY A H    1  
ATOM 1509   H HA2  . GLY A 1 99  ? 27.470  -8.551  3.888   1.00 22.40 ? 99  GLY A HA2  1  
ATOM 1510   H HA3  . GLY A 1 99  ? 28.752  -9.394  4.738   1.00 54.14 ? 99  GLY A HA3  1  
ATOM 1511   N N    . ALA A 1 100 ? 26.322  -9.559  6.682   1.00 14.44 ? 100 ALA A N    1  
ATOM 1512   C CA   . ALA A 1 100 ? 25.375  -10.446 7.380   1.00 13.40 ? 100 ALA A CA   1  
ATOM 1513   C C    . ALA A 1 100 ? 24.348  -9.646  8.199   1.00 41.25 ? 100 ALA A C    1  
ATOM 1514   O O    . ALA A 1 100 ? 23.151  -9.703  7.903   1.00 34.32 ? 100 ALA A O    1  
ATOM 1515   C CB   . ALA A 1 100 ? 26.140  -11.454 8.251   1.00 21.03 ? 100 ALA A CB   1  
ATOM 1516   H H    . ALA A 1 100 ? 26.624  -8.743  7.134   1.00 14.22 ? 100 ALA A H    1  
ATOM 1517   H HA   . ALA A 1 100 ? 24.829  -11.015 6.626   1.00 53.55 ? 100 ALA A HA   1  
ATOM 1518   H HB1  . ALA A 1 100 ? 26.662  -10.936 9.046   1.00 5.41  ? 100 ALA A HB1  1  
ATOM 1519   H HB2  . ALA A 1 100 ? 26.860  -11.991 7.645   1.00 15.23 ? 100 ALA A HB2  1  
ATOM 1520   H HB3  . ALA A 1 100 ? 25.446  -12.163 8.682   1.00 14.21 ? 100 ALA A HB3  1  
ATOM 1521   N N    . TYR A 1 101 ? 24.827  -8.858  9.177   1.00 74.24 ? 101 TYR A N    1  
ATOM 1522   C CA   . TYR A 1 101 ? 23.957  -8.165  10.153  1.00 34.55 ? 101 TYR A CA   1  
ATOM 1523   C C    . TYR A 1 101 ? 23.157  -7.012  9.500   1.00 15.30 ? 101 TYR A C    1  
ATOM 1524   O O    . TYR A 1 101 ? 21.954  -6.879  9.726   1.00 74.45 ? 101 TYR A O    1  
ATOM 1525   C CB   . TYR A 1 101 ? 24.803  -7.638  11.340  1.00 45.33 ? 101 TYR A CB   1  
ATOM 1526   C CG   . TYR A 1 101 ? 23.975  -6.953  12.441  1.00 45.12 ? 101 TYR A CG   1  
ATOM 1527   C CD1  . TYR A 1 101 ? 23.142  -7.702  13.282  1.00 64.42 ? 101 TYR A CD1  1  
ATOM 1528   C CD2  . TYR A 1 101 ? 24.016  -5.566  12.635  1.00 34.02 ? 101 TYR A CD2  1  
ATOM 1529   C CE1  . TYR A 1 101 ? 22.384  -7.095  14.267  1.00 23.32 ? 101 TYR A CE1  1  
ATOM 1530   C CE2  . TYR A 1 101 ? 23.261  -4.960  13.621  1.00 51.42 ? 101 TYR A CE2  1  
ATOM 1531   C CZ   . TYR A 1 101 ? 22.449  -5.726  14.434  1.00 74.34 ? 101 TYR A CZ   1  
ATOM 1532   O OH   . TYR A 1 101 ? 21.690  -5.115  15.414  1.00 32.21 ? 101 TYR A OH   1  
ATOM 1533   H H    . TYR A 1 101 ? 25.797  -8.739  9.247   1.00 24.34 ? 101 TYR A H    1  
ATOM 1534   H HA   . TYR A 1 101 ? 23.252  -8.904  10.534  1.00 20.33 ? 101 TYR A HA   1  
ATOM 1535   H HB2  . TYR A 1 101 ? 25.335  -8.469  11.795  1.00 10.01 ? 101 TYR A HB2  1  
ATOM 1536   H HB3  . TYR A 1 101 ? 25.534  -6.926  10.968  1.00 55.42 ? 101 TYR A HB3  1  
ATOM 1537   H HD1  . TYR A 1 101 ? 23.090  -8.777  13.153  1.00 3.22  ? 101 TYR A HD1  1  
ATOM 1538   H HD2  . TYR A 1 101 ? 24.650  -4.960  11.994  1.00 72.45 ? 101 TYR A HD2  1  
ATOM 1539   H HE1  . TYR A 1 101 ? 21.747  -7.693  14.904  1.00 24.34 ? 101 TYR A HE1  1  
ATOM 1540   H HE2  . TYR A 1 101 ? 23.311  -3.885  13.753  1.00 51.34 ? 101 TYR A HE2  1  
ATOM 1541   H HH   . TYR A 1 101 ? 21.289  -4.320  15.056  1.00 12.42 ? 101 TYR A HH   1  
ATOM 1542   N N    . CYS A 1 102 ? 23.845  -6.196  8.689   1.00 51.52 ? 102 CYS A N    1  
ATOM 1543   C CA   . CYS A 1 102 ? 23.281  -4.992  8.057   1.00 62.14 ? 102 CYS A CA   1  
ATOM 1544   C C    . CYS A 1 102 ? 22.201  -5.345  6.994   1.00 61.44 ? 102 CYS A C    1  
ATOM 1545   O O    . CYS A 1 102 ? 21.139  -4.715  7.007   1.00 71.23 ? 102 CYS A O    1  
ATOM 1546   C CB   . CYS A 1 102 ? 24.404  -4.103  7.462   1.00 73.22 ? 102 CYS A CB   1  
ATOM 1547   S SG   . CYS A 1 102 ? 25.591  -3.521  8.688   1.00 55.03 ? 102 CYS A SG   1  
ATOM 1548   H H    . CYS A 1 102 ? 24.756  -6.426  8.490   1.00 70.22 ? 102 CYS A H    1  
ATOM 1549   H HA   . CYS A 1 102 ? 22.800  -4.425  8.852   1.00 12.54 ? 102 CYS A HA   1  
ATOM 1550   H HB2  . CYS A 1 102 ? 24.952  -4.657  6.709   1.00 45.15 ? 102 CYS A HB2  1  
ATOM 1551   H HB3  . CYS A 1 102 ? 23.964  -3.228  7.001   1.00 71.31 ? 102 CYS A HB3  1  
ATOM 1552   H HG   . CYS A 1 102 ? 25.316  -2.248  8.924   1.00 61.11 ? 102 CYS A HG   1  
ATOM 1553   N N    . PRO A 1 103 ? 22.421  -6.352  6.058   1.00 60.20 ? 103 PRO A N    1  
ATOM 1554   C CA   . PRO A 1 103 ? 21.329  -6.853  5.184   1.00 12.32 ? 103 PRO A CA   1  
ATOM 1555   C C    . PRO A 1 103 ? 20.202  -7.559  5.984   1.00 45.52 ? 103 PRO A C    1  
ATOM 1556   O O    . PRO A 1 103 ? 19.055  -7.562  5.551   1.00 12.44 ? 103 PRO A O    1  
ATOM 1557   C CB   . PRO A 1 103 ? 22.042  -7.818  4.198   1.00 33.55 ? 103 PRO A CB   1  
ATOM 1558   C CG   . PRO A 1 103 ? 23.313  -8.211  4.879   1.00 31.22 ? 103 PRO A CG   1  
ATOM 1559   C CD   . PRO A 1 103 ? 23.718  -7.014  5.709   1.00 74.24 ? 103 PRO A CD   1  
ATOM 1560   H HA   . PRO A 1 103 ? 20.882  -6.030  4.626   1.00 24.51 ? 103 PRO A HA   1  
ATOM 1561   H HB2  . PRO A 1 103 ? 21.420  -8.689  3.984   1.00 32.30 ? 103 PRO A HB2  1  
ATOM 1562   H HB3  . PRO A 1 103 ? 22.267  -7.302  3.271   1.00 31.42 ? 103 PRO A HB3  1  
ATOM 1563   H HG2  . PRO A 1 103 ? 23.143  -9.082  5.516   1.00 51.24 ? 103 PRO A HG2  1  
ATOM 1564   H HG3  . PRO A 1 103 ? 24.083  -8.437  4.149   1.00 5.34  ? 103 PRO A HG3  1  
ATOM 1565   H HD2  . PRO A 1 103 ? 24.245  -7.329  6.605   1.00 73.55 ? 103 PRO A HD2  1  
ATOM 1566   H HD3  . PRO A 1 103 ? 24.341  -6.338  5.131   1.00 22.24 ? 103 PRO A HD3  1  
ATOM 1567   N N    . ASN A 1 104 ? 20.533  -8.123  7.168   1.00 72.24 ? 104 ASN A N    1  
ATOM 1568   C CA   . ASN A 1 104 ? 19.532  -8.774  8.059   1.00 10.30 ? 104 ASN A CA   1  
ATOM 1569   C C    . ASN A 1 104 ? 18.596  -7.709  8.685   1.00 21.51 ? 104 ASN A C    1  
ATOM 1570   O O    . ASN A 1 104 ? 17.426  -7.980  8.953   1.00 14.41 ? 104 ASN A O    1  
ATOM 1571   C CB   . ASN A 1 104 ? 20.254  -9.616  9.159   1.00 51.05 ? 104 ASN A CB   1  
ATOM 1572   C CG   . ASN A 1 104 ? 19.386  -10.701 9.824   1.00 61.32 ? 104 ASN A CG   1  
ATOM 1573   O OD1  . ASN A 1 104 ? 18.177  -10.560 9.997   1.00 34.52 ? 104 ASN A OD1  1  
ATOM 1574   N ND2  . ASN A 1 104 ? 20.012  -11.813 10.182  1.00 73.34 ? 104 ASN A ND2  1  
ATOM 1575   H H    . ASN A 1 104 ? 21.472  -8.108  7.451   1.00 33.21 ? 104 ASN A H    1  
ATOM 1576   H HA   . ASN A 1 104 ? 18.933  -9.441  7.443   1.00 71.44 ? 104 ASN A HA   1  
ATOM 1577   H HB2  . ASN A 1 104 ? 21.108  -10.107 8.711   1.00 2.24  ? 104 ASN A HB2  1  
ATOM 1578   H HB3  . ASN A 1 104 ? 20.616  -8.953  9.937   1.00 11.22 ? 104 ASN A HB3  1  
ATOM 1579   H HD21 . ASN A 1 104 ? 20.973  -11.878 9.999   1.00 55.24 ? 104 ASN A HD21 1  
ATOM 1580   H HD22 . ASN A 1 104 ? 19.496  -12.508 10.633  1.00 45.12 ? 104 ASN A HD22 1  
ATOM 1581   N N    . ILE A 1 105 ? 19.132  -6.489  8.891   1.00 0.51  ? 105 ILE A N    1  
ATOM 1582   C CA   . ILE A 1 105 ? 18.345  -5.301  9.300   1.00 73.34 ? 105 ILE A CA   1  
ATOM 1583   C C    . ILE A 1 105 ? 17.398  -4.877  8.158   1.00 23.12 ? 105 ILE A C    1  
ATOM 1584   O O    . ILE A 1 105 ? 16.234  -4.522  8.390   1.00 34.22 ? 105 ILE A O    1  
ATOM 1585   C CB   . ILE A 1 105 ? 19.299  -4.097  9.659   1.00 1.13  ? 105 ILE A CB   1  
ATOM 1586   C CG1  . ILE A 1 105 ? 20.196  -4.421  10.902  1.00 74.02 ? 105 ILE A CG1  1  
ATOM 1587   C CG2  . ILE A 1 105 ? 18.535  -2.767  9.869   1.00 21.43 ? 105 ILE A CG2  1  
ATOM 1588   C CD1  . ILE A 1 105 ? 19.441  -4.700  12.203  1.00 3.01  ? 105 ILE A CD1  1  
ATOM 1589   H H    . ILE A 1 105 ? 20.096  -6.380  8.761   1.00 5.32  ? 105 ILE A H    1  
ATOM 1590   H HA   . ILE A 1 105 ? 17.758  -5.562  10.179  1.00 44.14 ? 105 ILE A HA   1  
ATOM 1591   H HB   . ILE A 1 105 ? 19.959  -3.951  8.803   1.00 64.34 ? 105 ILE A HB   1  
ATOM 1592   H HG12 . ILE A 1 105 ? 20.794  -5.294  10.690  1.00 33.10 ? 105 ILE A HG12 1  
ATOM 1593   H HG13 . ILE A 1 105 ? 20.863  -3.586  11.087  1.00 3.53  ? 105 ILE A HG13 1  
ATOM 1594   H HG21 . ILE A 1 105 ? 19.232  -1.954  9.807   1.00 23.12 ? 105 ILE A HG21 1  
ATOM 1595   H HG22 . ILE A 1 105 ? 18.064  -2.755  10.840  1.00 11.32 ? 105 ILE A HG22 1  
ATOM 1596   H HG23 . ILE A 1 105 ? 17.787  -2.614  9.122   1.00 42.34 ? 105 ILE A HG23 1  
ATOM 1597   H HD11 . ILE A 1 105 ? 18.842  -3.842  12.474  1.00 10.24 ? 105 ILE A HD11 1  
ATOM 1598   H HD12 . ILE A 1 105 ? 20.158  -4.893  12.988  1.00 55.44 ? 105 ILE A HD12 1  
ATOM 1599   H HD13 . ILE A 1 105 ? 18.806  -5.565  12.082  1.00 31.30 ? 105 ILE A HD13 1  
ATOM 1600   N N    . LEU A 1 106 ? 17.929  -4.924  6.924   1.00 30.40 ? 106 LEU A N    1  
ATOM 1601   C CA   . LEU A 1 106 ? 17.203  -4.506  5.718   1.00 33.15 ? 106 LEU A CA   1  
ATOM 1602   C C    . LEU A 1 106 ? 16.140  -5.558  5.302   1.00 2.15  ? 106 LEU A C    1  
ATOM 1603   O O    . LEU A 1 106 ? 15.176  -5.232  4.607   1.00 63.03 ? 106 LEU A O    1  
ATOM 1604   C CB   . LEU A 1 106 ? 18.211  -4.292  4.552   1.00 30.22 ? 106 LEU A CB   1  
ATOM 1605   C CG   . LEU A 1 106 ? 19.305  -3.202  4.781   1.00 51.11 ? 106 LEU A CG   1  
ATOM 1606   C CD1  . LEU A 1 106 ? 20.395  -3.247  3.689   1.00 14.04 ? 106 LEU A CD1  1  
ATOM 1607   C CD2  . LEU A 1 106 ? 18.675  -1.801  4.881   1.00 71.51 ? 106 LEU A CD2  1  
ATOM 1608   H H    . LEU A 1 106 ? 18.849  -5.255  6.828   1.00 14.52 ? 106 LEU A H    1  
ATOM 1609   H HA   . LEU A 1 106 ? 16.720  -3.557  5.952   1.00 53.13 ? 106 LEU A HA   1  
ATOM 1610   H HB2  . LEU A 1 106 ? 18.709  -5.241  4.364   1.00 22.40 ? 106 LEU A HB2  1  
ATOM 1611   H HB3  . LEU A 1 106 ? 17.652  -4.027  3.659   1.00 74.11 ? 106 LEU A HB3  1  
ATOM 1612   H HG   . LEU A 1 106 ? 19.799  -3.399  5.727   1.00 60.22 ? 106 LEU A HG   1  
ATOM 1613   H HD11 . LEU A 1 106 ? 19.964  -3.025  2.720   1.00 50.22 ? 106 LEU A HD11 1  
ATOM 1614   H HD12 . LEU A 1 106 ? 20.844  -4.229  3.663   1.00 12.13 ? 106 LEU A HD12 1  
ATOM 1615   H HD13 . LEU A 1 106 ? 21.164  -2.518  3.914   1.00 21.43 ? 106 LEU A HD13 1  
ATOM 1616   H HD21 . LEU A 1 106 ? 18.132  -1.571  3.971   1.00 4.21  ? 106 LEU A HD21 1  
ATOM 1617   H HD22 . LEU A 1 106 ? 19.451  -1.066  5.028   1.00 32.24 ? 106 LEU A HD22 1  
ATOM 1618   H HD23 . LEU A 1 106 ? 18.003  -1.763  5.716   1.00 33.35 ? 106 LEU A HD23 1  
ATOM 1619   N N    . PHE A 1 107 ? 16.340  -6.819  5.758   1.00 14.21 ? 107 PHE A N    1  
ATOM 1620   C CA   . PHE A 1 107 ? 15.554  -7.998  5.323   1.00 50.33 ? 107 PHE A CA   1  
ATOM 1621   C C    . PHE A 1 107 ? 14.038  -7.927  5.687   1.00 3.53  ? 107 PHE A C    1  
ATOM 1622   O O    . PHE A 1 107 ? 13.232  -8.301  4.836   1.00 54.01 ? 107 PHE A O    1  
ATOM 1623   C CB   . PHE A 1 107 ? 16.199  -9.313  5.863   1.00 72.13 ? 107 PHE A CB   1  
ATOM 1624   C CG   . PHE A 1 107 ? 15.542  -10.606 5.363   1.00 24.42 ? 107 PHE A CG   1  
ATOM 1625   C CD1  . PHE A 1 107 ? 15.726  -11.038 4.045   1.00 30.03 ? 107 PHE A CD1  1  
ATOM 1626   C CD2  . PHE A 1 107 ? 14.745  -11.386 6.205   1.00 64.12 ? 107 PHE A CD2  1  
ATOM 1627   C CE1  . PHE A 1 107 ? 15.138  -12.204 3.592   1.00 54.14 ? 107 PHE A CE1  1  
ATOM 1628   C CE2  . PHE A 1 107 ? 14.159  -12.548 5.749   1.00 12.33 ? 107 PHE A CE2  1  
ATOM 1629   C CZ   . PHE A 1 107 ? 14.354  -12.958 4.444   1.00 3.53  ? 107 PHE A CZ   1  
ATOM 1630   H H    . PHE A 1 107 ? 17.063  -6.960  6.406   1.00 74.14 ? 107 PHE A H    1  
ATOM 1631   H HA   . PHE A 1 107 ? 15.628  -8.020  4.239   1.00 33.54 ? 107 PHE A HA   1  
ATOM 1632   H HB2  . PHE A 1 107 ? 17.244  -9.340  5.564   1.00 71.22 ? 107 PHE A HB2  1  
ATOM 1633   H HB3  . PHE A 1 107 ? 16.159  -9.306  6.947   1.00 5.33  ? 107 PHE A HB3  1  
ATOM 1634   H HD1  . PHE A 1 107 ? 16.342  -10.451 3.372   1.00 60.12 ? 107 PHE A HD1  1  
ATOM 1635   H HD2  . PHE A 1 107 ? 14.587  -11.072 7.229   1.00 54.23 ? 107 PHE A HD2  1  
ATOM 1636   H HE1  . PHE A 1 107 ? 15.292  -12.528 2.569   1.00 53.15 ? 107 PHE A HE1  1  
ATOM 1637   H HE2  . PHE A 1 107 ? 13.542  -13.142 6.413   1.00 2.43  ? 107 PHE A HE2  1  
ATOM 1638   H HZ   . PHE A 1 107 ? 13.891  -13.873 4.088   1.00 63.04 ? 107 PHE A HZ   1  
ATOM 1639   N N    . PRO A 1 108 ? 13.598  -7.495  6.929   1.00 64.54 ? 108 PRO A N    1  
ATOM 1640   C CA   . PRO A 1 108 ? 12.150  -7.290  7.226   1.00 42.43 ? 108 PRO A CA   1  
ATOM 1641   C C    . PRO A 1 108 ? 11.483  -6.271  6.275   1.00 44.11 ? 108 PRO A C    1  
ATOM 1642   O O    . PRO A 1 108 ? 10.349  -6.480  5.827   1.00 10.42 ? 108 PRO A O    1  
ATOM 1643   C CB   . PRO A 1 108 ? 12.137  -6.787  8.694   1.00 33.03 ? 108 PRO A CB   1  
ATOM 1644   C CG   . PRO A 1 108 ? 13.423  -7.297  9.275   1.00 1.03  ? 108 PRO A CG   1  
ATOM 1645   C CD   . PRO A 1 108 ? 14.424  -7.249  8.144   1.00 3.42  ? 108 PRO A CD   1  
ATOM 1646   H HA   . PRO A 1 108 ? 11.612  -8.236  7.161   1.00 1.32  ? 108 PRO A HA   1  
ATOM 1647   H HB2  . PRO A 1 108 ? 12.096  -5.695  8.725   1.00 2.34  ? 108 PRO A HB2  1  
ATOM 1648   H HB3  . PRO A 1 108 ? 11.292  -7.202  9.228   1.00 62.55 ? 108 PRO A HB3  1  
ATOM 1649   H HG2  . PRO A 1 108 ? 13.740  -6.663  10.098  1.00 33.43 ? 108 PRO A HG2  1  
ATOM 1650   H HG3  . PRO A 1 108 ? 13.302  -8.320  9.618   1.00 2.10  ? 108 PRO A HG3  1  
ATOM 1651   H HD2  . PRO A 1 108 ? 14.906  -6.276  8.090   1.00 44.33 ? 108 PRO A HD2  1  
ATOM 1652   H HD3  . PRO A 1 108 ? 15.172  -8.026  8.261   1.00 41.43 ? 108 PRO A HD3  1  
ATOM 1653   N N    . TYR A 1 109 ? 12.217  -5.183  5.970   1.00 2.31  ? 109 TYR A N    1  
ATOM 1654   C CA   . TYR A 1 109 ? 11.746  -4.109  5.075   1.00 31.44 ? 109 TYR A CA   1  
ATOM 1655   C C    . TYR A 1 109 ? 11.573  -4.615  3.629   1.00 21.12 ? 109 TYR A C    1  
ATOM 1656   O O    . TYR A 1 109 ? 10.579  -4.298  2.968   1.00 32.44 ? 109 TYR A O    1  
ATOM 1657   C CB   . TYR A 1 109 ? 12.732  -2.921  5.083   1.00 50.13 ? 109 TYR A CB   1  
ATOM 1658   C CG   . TYR A 1 109 ? 12.758  -2.093  6.373   1.00 73.51 ? 109 TYR A CG   1  
ATOM 1659   C CD1  . TYR A 1 109 ? 13.651  -2.383  7.408   1.00 70.31 ? 109 TYR A CD1  1  
ATOM 1660   C CD2  . TYR A 1 109 ? 11.911  -0.989  6.531   1.00 1.00  ? 109 TYR A CD2  1  
ATOM 1661   C CE1  . TYR A 1 109 ? 13.700  -1.603  8.546   1.00 35.45 ? 109 TYR A CE1  1  
ATOM 1662   C CE2  . TYR A 1 109 ? 11.953  -0.214  7.672   1.00 4.34  ? 109 TYR A CE2  1  
ATOM 1663   C CZ   . TYR A 1 109 ? 12.850  -0.521  8.673   1.00 23.22 ? 109 TYR A CZ   1  
ATOM 1664   O OH   . TYR A 1 109 ? 12.910  0.270   9.795   1.00 74.31 ? 109 TYR A OH   1  
ATOM 1665   H H    . TYR A 1 109 ? 13.115  -5.107  6.359   1.00 41.33 ? 109 TYR A H    1  
ATOM 1666   H HA   . TYR A 1 109 ? 10.782  -3.772  5.445   1.00 13.02 ? 109 TYR A HA   1  
ATOM 1667   H HB2  . TYR A 1 109 ? 13.735  -3.298  4.914   1.00 73.03 ? 109 TYR A HB2  1  
ATOM 1668   H HB3  . TYR A 1 109 ? 12.486  -2.247  4.265   1.00 62.35 ? 109 TYR A HB3  1  
ATOM 1669   H HD1  . TYR A 1 109 ? 14.319  -3.232  7.309   1.00 5.33  ? 109 TYR A HD1  1  
ATOM 1670   H HD2  . TYR A 1 109 ? 11.205  -0.749  5.744   1.00 23.32 ? 109 TYR A HD2  1  
ATOM 1671   H HE1  . TYR A 1 109 ? 14.403  -1.843  9.337   1.00 42.53 ? 109 TYR A HE1  1  
ATOM 1672   H HE2  . TYR A 1 109 ? 11.286  0.635   7.772   1.00 0.34  ? 109 TYR A HE2  1  
ATOM 1673   H HH   . TYR A 1 109 ? 13.827  0.492   9.977   1.00 1.12  ? 109 TYR A HH   1  
ATOM 1674   N N    . ALA A 1 110 ? 12.569  -5.384  3.143   1.00 45.15 ? 110 ALA A N    1  
ATOM 1675   C CA   . ALA A 1 110 ? 12.554  -5.962  1.785   1.00 73.40 ? 110 ALA A CA   1  
ATOM 1676   C C    . ALA A 1 110 ? 11.459  -7.025  1.661   1.00 73.41 ? 110 ALA A C    1  
ATOM 1677   O O    . ALA A 1 110 ? 10.765  -7.078  0.642   1.00 1.43  ? 110 ALA A O    1  
ATOM 1678   C CB   . ALA A 1 110 ? 13.916  -6.560  1.436   1.00 62.34 ? 110 ALA A CB   1  
ATOM 1679   H H    . ALA A 1 110 ? 13.338  -5.571  3.721   1.00 21.53 ? 110 ALA A H    1  
ATOM 1680   H HA   . ALA A 1 110 ? 12.349  -5.153  1.081   1.00 54.11 ? 110 ALA A HA   1  
ATOM 1681   H HB1  . ALA A 1 110 ? 13.860  -7.065  0.481   1.00 11.32 ? 110 ALA A HB1  1  
ATOM 1682   H HB2  . ALA A 1 110 ? 14.217  -7.268  2.200   1.00 23.21 ? 110 ALA A HB2  1  
ATOM 1683   H HB3  . ALA A 1 110 ? 14.653  -5.775  1.368   1.00 31.23 ? 110 ALA A HB3  1  
ATOM 1684   N N    . ARG A 1 111 ? 11.320  -7.849  2.731   1.00 2.12  ? 111 ARG A N    1  
ATOM 1685   C CA   . ARG A 1 111 ? 10.251  -8.860  2.869   1.00 4.11  ? 111 ARG A CA   1  
ATOM 1686   C C    . ARG A 1 111 ? 8.888   -8.212  2.605   1.00 34.12 ? 111 ARG A C    1  
ATOM 1687   O O    . ARG A 1 111 ? 8.173   -8.632  1.710   1.00 61.14 ? 111 ARG A O    1  
ATOM 1688   C CB   . ARG A 1 111 ? 10.283  -9.493  4.302   1.00 43.15 ? 111 ARG A CB   1  
ATOM 1689   C CG   . ARG A 1 111 ? 9.022   -10.309 4.707   1.00 34.51 ? 111 ARG A CG   1  
ATOM 1690   C CD   . ARG A 1 111 ? 9.001   -10.693 6.204   1.00 2.54  ? 111 ARG A CD   1  
ATOM 1691   N NE   . ARG A 1 111 ? 9.897   -11.823 6.515   1.00 72.21 ? 111 ARG A NE   1  
ATOM 1692   C CZ   . ARG A 1 111 ? 10.876  -11.838 7.431   1.00 21.12 ? 111 ARG A CZ   1  
ATOM 1693   N NH1  . ARG A 1 111 ? 11.159  -10.764 8.172   1.00 42.53 ? 111 ARG A NH1  1  
ATOM 1694   N NH2  . ARG A 1 111 ? 11.527  -12.972 7.648   1.00 52.30 ? 111 ARG A NH2  1  
ATOM 1695   H H    . ARG A 1 111 ? 11.964  -7.758  3.460   1.00 15.45 ? 111 ARG A H    1  
ATOM 1696   H HA   . ARG A 1 111 ? 10.431  -9.634  2.131   1.00 51.25 ? 111 ARG A HA   1  
ATOM 1697   H HB2  . ARG A 1 111 ? 11.145  -10.148 4.375   1.00 45.31 ? 111 ARG A HB2  1  
ATOM 1698   H HB3  . ARG A 1 111 ? 10.411  -8.690  5.025   1.00 53.02 ? 111 ARG A HB3  1  
ATOM 1699   H HG2  . ARG A 1 111 ? 8.138   -9.714  4.493   1.00 73.52 ? 111 ARG A HG2  1  
ATOM 1700   H HG3  . ARG A 1 111 ? 8.982   -11.214 4.112   1.00 40.42 ? 111 ARG A HG3  1  
ATOM 1701   H HD2  . ARG A 1 111 ? 9.294   -9.830  6.795   1.00 30.20 ? 111 ARG A HD2  1  
ATOM 1702   H HD3  . ARG A 1 111 ? 7.991   -10.973 6.479   1.00 2.21  ? 111 ARG A HD3  1  
ATOM 1703   H HE   . ARG A 1 111 ? 9.747   -12.643 5.994   1.00 53.31 ? 111 ARG A HE   1  
ATOM 1704   H HH11 . ARG A 1 111 ? 10.639  -9.922  8.059   1.00 12.12 ? 111 ARG A HH11 1  
ATOM 1705   H HH12 . ARG A 1 111 ? 11.895  -10.800 8.848   1.00 43.23 ? 111 ARG A HH12 1  
ATOM 1706   H HH21 . ARG A 1 111 ? 11.279  -13.797 7.130   1.00 21.22 ? 111 ARG A HH21 1  
ATOM 1707   H HH22 . ARG A 1 111 ? 12.262  -13.014 8.323   1.00 14.51 ? 111 ARG A HH22 1  
ATOM 1708   N N    . GLU A 1 112 ? 8.610   -7.131  3.356   1.00 42.54 ? 112 GLU A N    1  
ATOM 1709   C CA   . GLU A 1 112 ? 7.329   -6.407  3.315   1.00 12.30 ? 112 GLU A CA   1  
ATOM 1710   C C    . GLU A 1 112 ? 7.114   -5.703  1.968   1.00 21.14 ? 112 GLU A C    1  
ATOM 1711   O O    . GLU A 1 112 ? 6.001   -5.689  1.457   1.00 42.50 ? 112 GLU A O    1  
ATOM 1712   C CB   . GLU A 1 112 ? 7.283   -5.402  4.491   1.00 33.32 ? 112 GLU A CB   1  
ATOM 1713   C CG   . GLU A 1 112 ? 5.984   -4.551  4.624   1.00 52.02 ? 112 GLU A CG   1  
ATOM 1714   C CD   . GLU A 1 112 ? 5.960   -3.256  3.786   1.00 14.45 ? 112 GLU A CD   1  
ATOM 1715   O OE1  . GLU A 1 112 ? 6.844   -2.395  4.000   1.00 13.41 ? 112 GLU A OE1  1  
ATOM 1716   O OE2  . GLU A 1 112 ? 5.079   -3.100  2.904   1.00 53.05 ? 112 GLU A OE2  1  
ATOM 1717   H H    . GLU A 1 112 ? 9.307   -6.806  3.975   1.00 75.43 ? 112 GLU A H    1  
ATOM 1718   H HA   . GLU A 1 112 ? 6.538   -7.144  3.452   1.00 1.44  ? 112 GLU A HA   1  
ATOM 1719   H HB2  . GLU A 1 112 ? 7.409   -5.965  5.411   1.00 31.11 ? 112 GLU A HB2  1  
ATOM 1720   H HB3  . GLU A 1 112 ? 8.127   -4.724  4.401   1.00 21.35 ? 112 GLU A HB3  1  
ATOM 1721   H HG2  . GLU A 1 112 ? 5.139   -5.169  4.341   1.00 70.44 ? 112 GLU A HG2  1  
ATOM 1722   H HG3  . GLU A 1 112 ? 5.868   -4.276  5.664   1.00 1.12  ? 112 GLU A HG3  1  
ATOM 1723   N N    . CYS A 1 113 ? 8.191   -5.128  1.401   1.00 11.55 ? 113 CYS A N    1  
ATOM 1724   C CA   . CYS A 1 113 ? 8.136   -4.414  0.103   1.00 42.42 ? 113 CYS A CA   1  
ATOM 1725   C C    . CYS A 1 113 ? 7.714   -5.369  -1.038  1.00 31.33 ? 113 CYS A C    1  
ATOM 1726   O O    . CYS A 1 113 ? 7.124   -4.941  -2.030  1.00 72.40 ? 113 CYS A O    1  
ATOM 1727   C CB   . CYS A 1 113 ? 9.503   -3.762  -0.203  1.00 43.01 ? 113 CYS A CB   1  
ATOM 1728   S SG   . CYS A 1 113 ? 9.538   -2.733  -1.692  1.00 22.23 ? 113 CYS A SG   1  
ATOM 1729   H H    . CYS A 1 113 ? 9.051   -5.180  1.872   1.00 11.01 ? 113 CYS A H    1  
ATOM 1730   H HA   . CYS A 1 113 ? 7.390   -3.628  0.195   1.00 54.12 ? 113 CYS A HA   1  
ATOM 1731   H HB2  . CYS A 1 113 ? 9.788   -3.130  0.628   1.00 5.44  ? 113 CYS A HB2  1  
ATOM 1732   H HB3  . CYS A 1 113 ? 10.249  -4.537  -0.323  1.00 44.21 ? 113 CYS A HB3  1  
ATOM 1733   H HG   . CYS A 1 113 ? 8.433   -2.964  -2.387  1.00 14.04 ? 113 CYS A HG   1  
ATOM 1734   N N    . ILE A 1 114 ? 8.033   -6.660  -0.848  1.00 34.40 ? 114 ILE A N    1  
ATOM 1735   C CA   . ILE A 1 114 ? 7.668   -7.768  -1.750  1.00 14.42 ? 114 ILE A CA   1  
ATOM 1736   C C    . ILE A 1 114 ? 6.279   -8.338  -1.393  1.00 11.44 ? 114 ILE A C    1  
ATOM 1737   O O    . ILE A 1 114 ? 5.477   -8.627  -2.284  1.00 24.00 ? 114 ILE A O    1  
ATOM 1738   C CB   . ILE A 1 114 ? 8.777   -8.881  -1.652  1.00 2.10  ? 114 ILE A CB   1  
ATOM 1739   C CG1  . ILE A 1 114 ? 10.117  -8.318  -2.239  1.00 64.11 ? 114 ILE A CG1  1  
ATOM 1740   C CG2  . ILE A 1 114 ? 8.360   -10.217 -2.323  1.00 42.24 ? 114 ILE A CG2  1  
ATOM 1741   C CD1  . ILE A 1 114 ? 11.350  -9.146  -1.956  1.00 12.23 ? 114 ILE A CD1  1  
ATOM 1742   H H    . ILE A 1 114 ? 8.559   -6.882  -0.047  1.00 73.15 ? 114 ILE A H    1  
ATOM 1743   H HA   . ILE A 1 114 ? 7.647   -7.390  -2.769  1.00 22.55 ? 114 ILE A HA   1  
ATOM 1744   H HB   . ILE A 1 114 ? 8.933   -9.089  -0.597  1.00 11.35 ? 114 ILE A HB   1  
ATOM 1745   H HG12 . ILE A 1 114 ? 10.030  -8.232  -3.313  1.00 45.43 ? 114 ILE A HG12 1  
ATOM 1746   H HG13 . ILE A 1 114 ? 10.296  -7.329  -1.828  1.00 35.03 ? 114 ILE A HG13 1  
ATOM 1747   H HG21 . ILE A 1 114 ? 9.001   -11.008 -1.973  1.00 43.23 ? 114 ILE A HG21 1  
ATOM 1748   H HG22 . ILE A 1 114 ? 8.451   -10.136 -3.395  1.00 64.20 ? 114 ILE A HG22 1  
ATOM 1749   H HG23 . ILE A 1 114 ? 7.341   -10.468 -2.076  1.00 11.22 ? 114 ILE A HG23 1  
ATOM 1750   H HD11 . ILE A 1 114 ? 12.230  -8.535  -2.112  1.00 51.22 ? 114 ILE A HD11 1  
ATOM 1751   H HD12 . ILE A 1 114 ? 11.380  -9.994  -2.623  1.00 74.14 ? 114 ILE A HD12 1  
ATOM 1752   H HD13 . ILE A 1 114 ? 11.334  -9.490  -0.932  1.00 22.32 ? 114 ILE A HD13 1  
ATOM 1753   N N    . THR A 1 115 ? 6.005   -8.473  -0.081  1.00 1.50  ? 115 THR A N    1  
ATOM 1754   C CA   . THR A 1 115 ? 4.761   -9.073  0.432   1.00 43.43 ? 115 THR A CA   1  
ATOM 1755   C C    . THR A 1 115 ? 3.540   -8.209  0.038   1.00 71.41 ? 115 THR A C    1  
ATOM 1756   O O    . THR A 1 115 ? 2.503   -8.717  -0.409  1.00 72.43 ? 115 THR A O    1  
ATOM 1757   C CB   . THR A 1 115 ? 4.807   -9.219  1.992   1.00 65.11 ? 115 THR A CB   1  
ATOM 1758   O OG1  . THR A 1 115 ? 5.965   -9.960  2.401   1.00 63.32 ? 115 THR A OG1  1  
ATOM 1759   C CG2  . THR A 1 115 ? 3.556   -9.912  2.543   1.00 22.32 ? 115 THR A CG2  1  
ATOM 1760   H H    . THR A 1 115 ? 6.663   -8.146  0.563   1.00 11.44 ? 115 THR A H    1  
ATOM 1761   H HA   . THR A 1 115 ? 4.674   -10.065 -0.015  1.00 43.34 ? 115 THR A HA   1  
ATOM 1762   H HB   . THR A 1 115 ? 4.876   -8.228  2.434   1.00 61.45 ? 115 THR A HB   1  
ATOM 1763   H HG1  . THR A 1 115 ? 6.301   -10.463 1.654   1.00 5.11  ? 115 THR A HG1  1  
ATOM 1764   H HG21 . THR A 1 115 ? 2.672   -9.344  2.281   1.00 1.33  ? 115 THR A HG21 1  
ATOM 1765   H HG22 . THR A 1 115 ? 3.627   -9.984  3.619   1.00 1.15  ? 115 THR A HG22 1  
ATOM 1766   H HG23 . THR A 1 115 ? 3.478   -10.907 2.125   1.00 3.21  ? 115 THR A HG23 1  
ATOM 1767   N N    . SER A 1 116 ? 3.705   -6.892  0.211   1.00 23.24 ? 116 SER A N    1  
ATOM 1768   C CA   . SER A 1 116 ? 2.714   -5.886  -0.176  1.00 21.55 ? 116 SER A CA   1  
ATOM 1769   C C    . SER A 1 116 ? 2.555   -5.868  -1.706  1.00 12.51 ? 116 SER A C    1  
ATOM 1770   O O    . SER A 1 116 ? 1.440   -5.811  -2.209  1.00 51.24 ? 116 SER A O    1  
ATOM 1771   C CB   . SER A 1 116 ? 3.153   -4.497  0.352   1.00 11.14 ? 116 SER A CB   1  
ATOM 1772   O OG   . SER A 1 116 ? 2.208   -3.479  0.049   1.00 32.00 ? 116 SER A OG   1  
ATOM 1773   H H    . SER A 1 116 ? 4.538   -6.584  0.615   1.00 73.35 ? 116 SER A H    1  
ATOM 1774   H HA   . SER A 1 116 ? 1.764   -6.159  0.281   1.00 24.34 ? 116 SER A HA   1  
ATOM 1775   H HB2  . SER A 1 116 ? 3.272   -4.546  1.427   1.00 60.24 ? 116 SER A HB2  1  
ATOM 1776   H HB3  . SER A 1 116 ? 4.106   -4.226  -0.093  1.00 45.45 ? 116 SER A HB3  1  
ATOM 1777   H HG   . SER A 1 116 ? 1.995   -2.989  0.857   1.00 22.51 ? 116 SER A HG   1  
ATOM 1778   N N    . MET A 1 117 ? 3.696   -5.982  -2.419  1.00 55.23 ? 117 MET A N    1  
ATOM 1779   C CA   . MET A 1 117 ? 3.765   -5.943  -3.896  1.00 41.15 ? 117 MET A CA   1  
ATOM 1780   C C    . MET A 1 117 ? 2.925   -7.067  -4.542  1.00 41.45 ? 117 MET A C    1  
ATOM 1781   O O    . MET A 1 117 ? 2.143   -6.806  -5.471  1.00 50.10 ? 117 MET A O    1  
ATOM 1782   C CB   . MET A 1 117 ? 5.242   -6.064  -4.341  1.00 23.44 ? 117 MET A CB   1  
ATOM 1783   C CG   . MET A 1 117 ? 5.481   -5.989  -5.849  1.00 63.02 ? 117 MET A CG   1  
ATOM 1784   S SD   . MET A 1 117 ? 7.167   -6.436  -6.309  1.00 32.11 ? 117 MET A SD   1  
ATOM 1785   C CE   . MET A 1 117 ? 8.130   -5.250  -5.390  1.00 11.43 ? 117 MET A CE   1  
ATOM 1786   H H    . MET A 1 117 ? 4.536   -6.097  -1.924  1.00 30.15 ? 117 MET A H    1  
ATOM 1787   H HA   . MET A 1 117 ? 3.377   -4.980  -4.218  1.00 24.31 ? 117 MET A HA   1  
ATOM 1788   H HB2  . MET A 1 117 ? 5.808   -5.265  -3.875  1.00 52.25 ? 117 MET A HB2  1  
ATOM 1789   H HB3  . MET A 1 117 ? 5.639   -7.009  -3.982  1.00 14.45 ? 117 MET A HB3  1  
ATOM 1790   H HG2  . MET A 1 117 ? 4.804   -6.669  -6.348  1.00 25.33 ? 117 MET A HG2  1  
ATOM 1791   H HG3  . MET A 1 117 ? 5.285   -4.980  -6.192  1.00 31.13 ? 117 MET A HG3  1  
ATOM 1792   H HE1  . MET A 1 117 ? 9.175   -5.371  -5.633  1.00 74.34 ? 117 MET A HE1  1  
ATOM 1793   H HE2  . MET A 1 117 ? 7.988   -5.408  -4.329  1.00 65.32 ? 117 MET A HE2  1  
ATOM 1794   H HE3  . MET A 1 117 ? 7.816   -4.249  -5.650  1.00 65.30 ? 117 MET A HE3  1  
ATOM 1795   N N    . VAL A 1 118 ? 3.080   -8.311  -4.029  1.00 54.12 ? 118 VAL A N    1  
ATOM 1796   C CA   . VAL A 1 118 ? 2.338   -9.479  -4.546  1.00 10.02 ? 118 VAL A CA   1  
ATOM 1797   C C    . VAL A 1 118 ? 0.830   -9.323  -4.264  1.00 52.12 ? 118 VAL A C    1  
ATOM 1798   O O    . VAL A 1 118 ? 0.014   -9.592  -5.135  1.00 34.34 ? 118 VAL A O    1  
ATOM 1799   C CB   . VAL A 1 118 ? 2.882   -10.861 -3.989  1.00 45.35 ? 118 VAL A CB   1  
ATOM 1800   C CG1  . VAL A 1 118 ? 4.385   -11.026 -4.302  1.00 20.10 ? 118 VAL A CG1  1  
ATOM 1801   C CG2  . VAL A 1 118 ? 2.614   -11.061 -2.480  1.00 61.43 ? 118 VAL A CG2  1  
ATOM 1802   H H    . VAL A 1 118 ? 3.710   -8.441  -3.288  1.00 21.22 ? 118 VAL A H    1  
ATOM 1803   H HA   . VAL A 1 118 ? 2.479   -9.485  -5.629  1.00 4.43  ? 118 VAL A HA   1  
ATOM 1804   H HB   . VAL A 1 118 ? 2.357   -11.654 -4.522  1.00 21.53 ? 118 VAL A HB   1  
ATOM 1805   H HG11 . VAL A 1 118 ? 4.734   -11.987 -3.940  1.00 52.31 ? 118 VAL A HG11 1  
ATOM 1806   H HG12 . VAL A 1 118 ? 4.950   -10.238 -3.819  1.00 54.22 ? 118 VAL A HG12 1  
ATOM 1807   H HG13 . VAL A 1 118 ? 4.541   -10.973 -5.371  1.00 63.43 ? 118 VAL A HG13 1  
ATOM 1808   H HG21 . VAL A 1 118 ? 1.550   -11.001 -2.290  1.00 21.24 ? 118 VAL A HG21 1  
ATOM 1809   H HG22 . VAL A 1 118 ? 3.119   -10.289 -1.913  1.00 73.45 ? 118 VAL A HG22 1  
ATOM 1810   H HG23 . VAL A 1 118 ? 2.978   -12.032 -2.165  1.00 3.42  ? 118 VAL A HG23 1  
ATOM 1811   N N    . SER A 1 119 ? 0.494   -8.795  -3.066  1.00 2.13  ? 119 SER A N    1  
ATOM 1812   C CA   . SER A 1 119 ? -0.905  -8.581  -2.633  1.00 1.13  ? 119 SER A CA   1  
ATOM 1813   C C    . SER A 1 119 ? -1.596  -7.485  -3.480  1.00 3.14  ? 119 SER A C    1  
ATOM 1814   O O    . SER A 1 119 ? -2.801  -7.559  -3.747  1.00 52.43 ? 119 SER A O    1  
ATOM 1815   C CB   . SER A 1 119 ? -0.937  -8.219  -1.132  1.00 73.01 ? 119 SER A CB   1  
ATOM 1816   O OG   . SER A 1 119 ? -0.343  -9.243  -0.345  1.00 13.22 ? 119 SER A OG   1  
ATOM 1817   H H    . SER A 1 119 ? 1.216   -8.534  -2.454  1.00 45.03 ? 119 SER A H    1  
ATOM 1818   H HA   . SER A 1 119 ? -1.438  -9.519  -2.776  1.00 51.01 ? 119 SER A HA   1  
ATOM 1819   H HB2  . SER A 1 119 ? -0.389  -7.299  -0.966  1.00 24.02 ? 119 SER A HB2  1  
ATOM 1820   H HB3  . SER A 1 119 ? -1.962  -8.088  -0.810  1.00 3.42  ? 119 SER A HB3  1  
ATOM 1821   H HG   . SER A 1 119 ? 0.457   -9.553  -0.776  1.00 30.02 ? 119 SER A HG   1  
ATOM 1822   N N    . ARG A 1 120 ? -0.795  -6.488  -3.918  1.00 60.21 ? 120 ARG A N    1  
ATOM 1823   C CA   . ARG A 1 120 ? -1.251  -5.413  -4.827  1.00 43.35 ? 120 ARG A CA   1  
ATOM 1824   C C    . ARG A 1 120 ? -1.476  -5.979  -6.242  1.00 14.41 ? 120 ARG A C    1  
ATOM 1825   O O    . ARG A 1 120 ? -2.358  -5.521  -6.971  1.00 31.30 ? 120 ARG A O    1  
ATOM 1826   C CB   . ARG A 1 120 ? -0.213  -4.244  -4.853  1.00 32.35 ? 120 ARG A CB   1  
ATOM 1827   C CG   . ARG A 1 120 ? -0.110  -3.460  -3.518  1.00 2.43  ? 120 ARG A CG   1  
ATOM 1828   C CD   . ARG A 1 120 ? 1.051   -2.444  -3.492  1.00 74.12 ? 120 ARG A CD   1  
ATOM 1829   N NE   . ARG A 1 120 ? 1.140   -1.755  -2.188  1.00 72.12 ? 120 ARG A NE   1  
ATOM 1830   C CZ   . ARG A 1 120 ? 0.658   -0.528  -1.922  1.00 73.34 ? 120 ARG A CZ   1  
ATOM 1831   N NH1  . ARG A 1 120 ? 0.037   0.182   -2.861  1.00 50.11 ? 120 ARG A NH1  1  
ATOM 1832   N NH2  . ARG A 1 120 ? 0.789   -0.013  -0.708  1.00 42.13 ? 120 ARG A NH2  1  
ATOM 1833   H H    . ARG A 1 120 ? 0.138   -6.488  -3.626  1.00 32.20 ? 120 ARG A H    1  
ATOM 1834   H HA   . ARG A 1 120 ? -2.198  -5.037  -4.447  1.00 2.21  ? 120 ARG A HA   1  
ATOM 1835   H HB2  . ARG A 1 120 ? 0.767   -4.652  -5.084  1.00 31.23 ? 120 ARG A HB2  1  
ATOM 1836   H HB3  . ARG A 1 120 ? -0.487  -3.542  -5.634  1.00 51.44 ? 120 ARG A HB3  1  
ATOM 1837   H HG2  . ARG A 1 120 ? -1.037  -2.926  -3.352  1.00 14.14 ? 120 ARG A HG2  1  
ATOM 1838   H HG3  . ARG A 1 120 ? 0.034   -4.169  -2.707  1.00 64.32 ? 120 ARG A HG3  1  
ATOM 1839   H HD2  . ARG A 1 120 ? 1.983   -2.967  -3.670  1.00 32.32 ? 120 ARG A HD2  1  
ATOM 1840   H HD3  . ARG A 1 120 ? 0.901   -1.710  -4.277  1.00 25.55 ? 120 ARG A HD3  1  
ATOM 1841   H HE   . ARG A 1 120 ? 1.578   -2.249  -1.461  1.00 21.45 ? 120 ARG A HE   1  
ATOM 1842   H HH11 . ARG A 1 120 ? -0.085  -0.186  -3.784  1.00 75.15 ? 120 ARG A HH11 1  
ATOM 1843   H HH12 . ARG A 1 120 ? -0.319  1.100   -2.639  1.00 43.22 ? 120 ARG A HH12 1  
ATOM 1844   H HH21 . ARG A 1 120 ? 1.249   -0.532  0.022   1.00 25.32 ? 120 ARG A HH21 1  
ATOM 1845   H HH22 . ARG A 1 120 ? 0.429   0.908   -0.507  1.00 73.05 ? 120 ARG A HH22 1  
ATOM 1846   N N    . GLY A 1 121 ? -0.670  -7.006  -6.596  1.00 34.23 ? 121 GLY A N    1  
ATOM 1847   C CA   . GLY A 1 121 ? -0.781  -7.708  -7.877  1.00 12.21 ? 121 GLY A CA   1  
ATOM 1848   C C    . GLY A 1 121 ? -1.824  -8.820  -7.873  1.00 51.24 ? 121 GLY A C    1  
ATOM 1849   O O    . GLY A 1 121 ? -1.973  -9.527  -8.881  1.00 63.44 ? 121 GLY A O    1  
ATOM 1850   H H    . GLY A 1 121 ? 0.015   -7.299  -5.958  1.00 62.20 ? 121 GLY A H    1  
ATOM 1851   H HA2  . GLY A 1 121 ? -1.033  -7.000  -8.658  1.00 24.42 ? 121 GLY A HA2  1  
ATOM 1852   H HA3  . GLY A 1 121 ? 0.184   -8.141  -8.109  1.00 73.32 ? 121 GLY A HA3  1  
ATOM 1853   N N    . THR A 1 122 ? -2.549  -8.959  -6.733  1.00 24.12 ? 122 THR A N    1  
ATOM 1854   C CA   . THR A 1 122 ? -3.590  -9.985  -6.530  1.00 22.43 ? 122 THR A CA   1  
ATOM 1855   C C    . THR A 1 122 ? -2.981  -11.413 -6.612  1.00 1.52  ? 122 THR A C    1  
ATOM 1856   O O    . THR A 1 122 ? -3.452  -12.318 -7.312  1.00 53.11 ? 122 THR A O    1  
ATOM 1857   C CB   . THR A 1 122 ? -4.788  -9.761  -7.518  1.00 41.10 ? 122 THR A CB   1  
ATOM 1858   O OG1  . THR A 1 122 ? -5.280  -8.424  -7.353  1.00 72.44 ? 122 THR A OG1  1  
ATOM 1859   C CG2  . THR A 1 122 ? -5.958  -10.738 -7.322  1.00 73.34 ? 122 THR A CG2  1  
ATOM 1860   H H    . THR A 1 122 ? -2.373  -8.338  -5.999  1.00 75.11 ? 122 THR A H    1  
ATOM 1861   H HA   . THR A 1 122 ? -3.959  -9.844  -5.519  1.00 4.34  ? 122 THR A HA   1  
ATOM 1862   H HB   . THR A 1 122 ? -4.419  -9.866  -8.535  1.00 1.32  ? 122 THR A HB   1  
ATOM 1863   H HG1  . THR A 1 122 ? -4.647  -7.804  -7.707  1.00 1.10  ? 122 THR A HG1  1  
ATOM 1864   H HG21 . THR A 1 122 ? -5.620  -11.755 -7.476  1.00 13.44 ? 122 THR A HG21 1  
ATOM 1865   H HG22 . THR A 1 122 ? -6.745  -10.512 -8.034  1.00 3.22  ? 122 THR A HG22 1  
ATOM 1866   H HG23 . THR A 1 122 ? -6.338  -10.639 -6.334  1.00 13.50 ? 122 THR A HG23 1  
ATOM 1867   N N    . PHE A 1 123 ? -1.873  -11.569 -5.903  1.00 61.14 ? 123 PHE A N    1  
ATOM 1868   C CA   . PHE A 1 123 ? -1.236  -12.861 -5.644  1.00 1.34  ? 123 PHE A CA   1  
ATOM 1869   C C    . PHE A 1 123 ? -1.282  -13.094 -4.122  1.00 74.35 ? 123 PHE A C    1  
ATOM 1870   O O    . PHE A 1 123 ? -1.062  -12.134 -3.358  1.00 14.41 ? 123 PHE A O    1  
ATOM 1871   C CB   . PHE A 1 123 ? 0.230   -12.861 -6.164  1.00 54.30 ? 123 PHE A CB   1  
ATOM 1872   C CG   . PHE A 1 123 ? 0.344   -12.676 -7.679  1.00 65.52 ? 123 PHE A CG   1  
ATOM 1873   C CD1  . PHE A 1 123 ? 0.064   -13.735 -8.543  1.00 22.03 ? 123 PHE A CD1  1  
ATOM 1874   C CD2  . PHE A 1 123 ? 0.729   -11.457 -8.238  1.00 14.43 ? 123 PHE A CD2  1  
ATOM 1875   C CE1  . PHE A 1 123 ? 0.166   -13.582 -9.911  1.00 43.12 ? 123 PHE A CE1  1  
ATOM 1876   C CE2  . PHE A 1 123 ? 0.828   -11.307 -9.609  1.00 42.23 ? 123 PHE A CE2  1  
ATOM 1877   C CZ   . PHE A 1 123 ? 0.547   -12.368 -10.445 1.00 34.33 ? 123 PHE A CZ   1  
ATOM 1878   H H    . PHE A 1 123 ? -1.465  -10.775 -5.524  1.00 4.22  ? 123 PHE A H    1  
ATOM 1879   H HA   . PHE A 1 123 ? -1.803  -13.646 -6.155  1.00 31.20 ? 123 PHE A HA   1  
ATOM 1880   H HB2  . PHE A 1 123 ? 0.782   -12.059 -5.679  1.00 0.33  ? 123 PHE A HB2  1  
ATOM 1881   H HB3  . PHE A 1 123 ? 0.703   -13.805 -5.908  1.00 24.04 ? 123 PHE A HB3  1  
ATOM 1882   H HD1  . PHE A 1 123 ? -0.239  -14.692 -8.133  1.00 33.31 ? 123 PHE A HD1  1  
ATOM 1883   H HD2  . PHE A 1 123 ? 0.949   -10.617 -7.589  1.00 11.52 ? 123 PHE A HD2  1  
ATOM 1884   H HE1  . PHE A 1 123 ? -0.057  -14.415 -10.568 1.00 23.20 ? 123 PHE A HE1  1  
ATOM 1885   H HE2  . PHE A 1 123 ? 1.128   -10.353 -10.028 1.00 12.21 ? 123 PHE A HE2  1  
ATOM 1886   H HZ   . PHE A 1 123 ? 0.626   -12.248 -11.518 1.00 4.41  ? 123 PHE A HZ   1  
ATOM 1887   N N    . PRO A 1 124 ? -1.607  -14.347 -3.655  1.00 1.10  ? 124 PRO A N    1  
ATOM 1888   C CA   . PRO A 1 124 ? -1.572  -14.715 -2.217  1.00 24.44 ? 124 PRO A CA   1  
ATOM 1889   C C    . PRO A 1 124 ? -0.277  -14.280 -1.496  1.00 72.31 ? 124 PRO A C    1  
ATOM 1890   O O    . PRO A 1 124 ? 0.815   -14.300 -2.089  1.00 3.23  ? 124 PRO A O    1  
ATOM 1891   C CB   . PRO A 1 124 ? -1.710  -16.250 -2.255  1.00 73.33 ? 124 PRO A CB   1  
ATOM 1892   C CG   . PRO A 1 124 ? -2.558  -16.507 -3.465  1.00 65.42 ? 124 PRO A CG   1  
ATOM 1893   C CD   . PRO A 1 124 ? -2.112  -15.478 -4.487  1.00 63.45 ? 124 PRO A CD   1  
ATOM 1894   H HA   . PRO A 1 124 ? -2.426  -14.289 -1.701  1.00 14.52 ? 124 PRO A HA   1  
ATOM 1895   H HB2  . PRO A 1 124 ? -0.726  -16.718 -2.356  1.00 25.53 ? 124 PRO A HB2  1  
ATOM 1896   H HB3  . PRO A 1 124 ? -2.201  -16.614 -1.362  1.00 14.11 ? 124 PRO A HB3  1  
ATOM 1897   H HG2  . PRO A 1 124 ? -2.386  -17.517 -3.829  1.00 34.11 ? 124 PRO A HG2  1  
ATOM 1898   H HG3  . PRO A 1 124 ? -3.610  -16.370 -3.233  1.00 31.44 ? 124 PRO A HG3  1  
ATOM 1899   H HD2  . PRO A 1 124 ? -1.320  -15.876 -5.115  1.00 71.44 ? 124 PRO A HD2  1  
ATOM 1900   H HD3  . PRO A 1 124 ? -2.947  -15.160 -5.102  1.00 24.24 ? 124 PRO A HD3  1  
ATOM 1901   N N    . GLN A 1 125 ? -0.441  -13.887 -0.218  1.00 4.14  ? 125 GLN A N    1  
ATOM 1902   C CA   . GLN A 1 125 ? 0.620   -13.298 0.608   1.00 54.05 ? 125 GLN A CA   1  
ATOM 1903   C C    . GLN A 1 125 ? 1.863   -14.203 0.700   1.00 31.55 ? 125 GLN A C    1  
ATOM 1904   O O    . GLN A 1 125 ? 1.756   -15.404 0.967   1.00 41.14 ? 125 GLN A O    1  
ATOM 1905   C CB   . GLN A 1 125 ? 0.080   -12.978 2.026   1.00 53.55 ? 125 GLN A CB   1  
ATOM 1906   C CG   . GLN A 1 125 ? 1.170   -12.561 3.028   1.00 32.40 ? 125 GLN A CG   1  
ATOM 1907   C CD   . GLN A 1 125 ? 0.621   -12.066 4.350   1.00 40.41 ? 125 GLN A CD   1  
ATOM 1908   O OE1  . GLN A 1 125 ? 0.392   -12.861 5.264   1.00 0.24  ? 125 GLN A OE1  1  
ATOM 1909   N NE2  . GLN A 1 125 ? 0.420   -10.755 4.464   1.00 2.24  ? 125 GLN A NE2  1  
ATOM 1910   H H    . GLN A 1 125 ? -1.324  -14.000 0.183   1.00 71.51 ? 125 GLN A H    1  
ATOM 1911   H HA   . GLN A 1 125 ? 0.903   -12.361 0.135   1.00 62.24 ? 125 GLN A HA   1  
ATOM 1912   H HB2  . GLN A 1 125 ? -0.642  -12.171 1.949   1.00 30.44 ? 125 GLN A HB2  1  
ATOM 1913   H HB3  . GLN A 1 125 ? -0.425  -13.856 2.417   1.00 61.54 ? 125 GLN A HB3  1  
ATOM 1914   H HG2  . GLN A 1 125 ? 1.810   -13.415 3.224   1.00 74.33 ? 125 GLN A HG2  1  
ATOM 1915   H HG3  . GLN A 1 125 ? 1.769   -11.776 2.583   1.00 40.35 ? 125 GLN A HG3  1  
ATOM 1916   H HE21 . GLN A 1 125 ? 0.636   -10.183 3.701   1.00 31.41 ? 125 GLN A HE21 1  
ATOM 1917   H HE22 . GLN A 1 125 ? 0.055   -10.417 5.304   1.00 74.55 ? 125 GLN A HE22 1  
ATOM 1918   N N    . LEU A 1 126 ? 3.034   -13.586 0.486   1.00 72.12 ? 126 LEU A N    1  
ATOM 1919   C CA   . LEU A 1 126 ? 4.330   -14.255 0.549   1.00 33.04 ? 126 LEU A CA   1  
ATOM 1920   C C    . LEU A 1 126 ? 5.188   -13.616 1.647   1.00 14.42 ? 126 LEU A C    1  
ATOM 1921   O O    . LEU A 1 126 ? 5.768   -12.540 1.460   1.00 63.40 ? 126 LEU A O    1  
ATOM 1922   C CB   . LEU A 1 126 ? 5.019   -14.189 -0.836  1.00 52.21 ? 126 LEU A CB   1  
ATOM 1923   C CG   . LEU A 1 126 ? 6.494   -14.710 -0.927  1.00 0.43  ? 126 LEU A CG   1  
ATOM 1924   C CD1  . LEU A 1 126 ? 6.679   -16.113 -0.309  1.00 42.43 ? 126 LEU A CD1  1  
ATOM 1925   C CD2  . LEU A 1 126 ? 6.956   -14.694 -2.385  1.00 63.02 ? 126 LEU A CD2  1  
ATOM 1926   H H    . LEU A 1 126 ? 3.019   -12.630 0.280   1.00 30.42 ? 126 LEU A H    1  
ATOM 1927   H HA   . LEU A 1 126 ? 4.168   -15.303 0.802   1.00 20.02 ? 126 LEU A HA   1  
ATOM 1928   H HB2  . LEU A 1 126 ? 4.413   -14.763 -1.531  1.00 53.10 ? 126 LEU A HB2  1  
ATOM 1929   H HB3  . LEU A 1 126 ? 5.009   -13.154 -1.165  1.00 64.41 ? 126 LEU A HB3  1  
ATOM 1930   H HG   . LEU A 1 126 ? 7.137   -14.035 -0.375  1.00 53.35 ? 126 LEU A HG   1  
ATOM 1931   H HD11 . LEU A 1 126 ? 6.412   -16.087 0.740   1.00 33.11 ? 126 LEU A HD11 1  
ATOM 1932   H HD12 . LEU A 1 126 ? 7.713   -16.418 -0.400  1.00 15.21 ? 126 LEU A HD12 1  
ATOM 1933   H HD13 . LEU A 1 126 ? 6.047   -16.830 -0.820  1.00 14.22 ? 126 LEU A HD13 1  
ATOM 1934   H HD21 . LEU A 1 126 ? 6.320   -15.336 -2.982  1.00 10.25 ? 126 LEU A HD21 1  
ATOM 1935   H HD22 . LEU A 1 126 ? 7.977   -15.045 -2.446  1.00 54.51 ? 126 LEU A HD22 1  
ATOM 1936   H HD23 . LEU A 1 126 ? 6.911   -13.683 -2.775  1.00 42.52 ? 126 LEU A HD23 1  
ATOM 1937   N N    . ASN A 1 127 ? 5.237   -14.292 2.798   1.00 11.20 ? 127 ASN A N    1  
ATOM 1938   C CA   . ASN A 1 127 ? 6.085   -13.916 3.934   1.00 32.40 ? 127 ASN A CA   1  
ATOM 1939   C C    . ASN A 1 127 ? 7.350   -14.771 3.877   1.00 55.33 ? 127 ASN A C    1  
ATOM 1940   O O    . ASN A 1 127 ? 7.293   -15.986 4.110   1.00 25.41 ? 127 ASN A O    1  
ATOM 1941   C CB   . ASN A 1 127 ? 5.328   -14.146 5.273   1.00 45.33 ? 127 ASN A CB   1  
ATOM 1942   C CG   . ASN A 1 127 ? 4.109   -13.240 5.439   1.00 41.44 ? 127 ASN A CG   1  
ATOM 1943   O OD1  . ASN A 1 127 ? 4.094   -12.102 4.976   1.00 74.44 ? 127 ASN A OD1  1  
ATOM 1944   N ND2  . ASN A 1 127 ? 3.077   -13.733 6.103   1.00 31.43 ? 127 ASN A ND2  1  
ATOM 1945   H H    . ASN A 1 127 ? 4.674   -15.090 2.886   1.00 42.23 ? 127 ASN A H    1  
ATOM 1946   H HA   . ASN A 1 127 ? 6.351   -12.862 3.846   1.00 55.33 ? 127 ASN A HA   1  
ATOM 1947   H HB2  . ASN A 1 127 ? 4.999   -15.178 5.319   1.00 74.11 ? 127 ASN A HB2  1  
ATOM 1948   H HB3  . ASN A 1 127 ? 5.999   -13.961 6.112   1.00 44.24 ? 127 ASN A HB3  1  
ATOM 1949   H HD21 . ASN A 1 127 ? 3.143   -14.642 6.455   1.00 22.35 ? 127 ASN A HD21 1  
ATOM 1950   H HD22 . ASN A 1 127 ? 2.287   -13.166 6.203   1.00 14.30 ? 127 ASN A HD22 1  
ATOM 1951   N N    . LEU A 1 128 ? 8.479   -14.139 3.502   1.00 42.15 ? 128 LEU A N    1  
ATOM 1952   C CA   . LEU A 1 128 ? 9.785   -14.811 3.409   1.00 5.02  ? 128 LEU A CA   1  
ATOM 1953   C C    . LEU A 1 128 ? 10.218  -15.306 4.808   1.00 34.53 ? 128 LEU A C    1  
ATOM 1954   O O    . LEU A 1 128 ? 10.004  -14.610 5.811   1.00 13.45 ? 128 LEU A O    1  
ATOM 1955   C CB   . LEU A 1 128 ? 10.865  -13.857 2.794   1.00 44.04 ? 128 LEU A CB   1  
ATOM 1956   C CG   . LEU A 1 128 ? 10.738  -13.504 1.262   1.00 42.20 ? 128 LEU A CG   1  
ATOM 1957   C CD1  . LEU A 1 128 ? 10.680  -14.784 0.389   1.00 63.41 ? 128 LEU A CD1  1  
ATOM 1958   C CD2  . LEU A 1 128 ? 9.542   -12.551 0.967   1.00 51.41 ? 128 LEU A CD2  1  
ATOM 1959   H H    . LEU A 1 128 ? 8.429   -13.188 3.287   1.00 12.32 ? 128 LEU A H    1  
ATOM 1960   H HA   . LEU A 1 128 ? 9.665   -15.673 2.753   1.00 42.52 ? 128 LEU A HA   1  
ATOM 1961   H HB2  . LEU A 1 128 ? 10.847  -12.931 3.357   1.00 54.20 ? 128 LEU A HB2  1  
ATOM 1962   H HB3  . LEU A 1 128 ? 11.844  -14.313 2.948   1.00 74.14 ? 128 LEU A HB3  1  
ATOM 1963   H HG   . LEU A 1 128 ? 11.640  -12.976 0.964   1.00 34.12 ? 128 LEU A HG   1  
ATOM 1964   H HD11 . LEU A 1 128 ? 9.797   -15.360 0.635   1.00 15.34 ? 128 LEU A HD11 1  
ATOM 1965   H HD12 . LEU A 1 128 ? 11.560  -15.386 0.572   1.00 44.32 ? 128 LEU A HD12 1  
ATOM 1966   H HD13 . LEU A 1 128 ? 10.652  -14.512 -0.659  1.00 0.25  ? 128 LEU A HD13 1  
ATOM 1967   H HD21 . LEU A 1 128 ? 8.611   -13.029 1.251   1.00 25.02 ? 128 LEU A HD21 1  
ATOM 1968   H HD22 . LEU A 1 128 ? 9.512   -12.306 -0.086  1.00 42.24 ? 128 LEU A HD22 1  
ATOM 1969   H HD23 . LEU A 1 128 ? 9.660   -11.638 1.538   1.00 1.32  ? 128 LEU A HD23 1  
ATOM 1970   N N    . ALA A 1 129 ? 10.793  -16.519 4.865   1.00 3.15  ? 129 ALA A N    1  
ATOM 1971   C CA   . ALA A 1 129 ? 11.251  -17.129 6.126   1.00 31.41 ? 129 ALA A CA   1  
ATOM 1972   C C    . ALA A 1 129 ? 12.398  -16.298 6.750   1.00 52.35 ? 129 ALA A C    1  
ATOM 1973   O O    . ALA A 1 129 ? 13.182  -15.694 6.006   1.00 43.22 ? 129 ALA A O    1  
ATOM 1974   C CB   . ALA A 1 129 ? 11.696  -18.578 5.870   1.00 50.13 ? 129 ALA A CB   1  
ATOM 1975   H H    . ALA A 1 129 ? 10.919  -17.018 4.033   1.00 21.25 ? 129 ALA A H    1  
ATOM 1976   H HA   . ALA A 1 129 ? 10.407  -17.149 6.813   1.00 43.41 ? 129 ALA A HA   1  
ATOM 1977   H HB1  . ALA A 1 129 ? 12.535  -18.591 5.186   1.00 51.12 ? 129 ALA A HB1  1  
ATOM 1978   H HB2  . ALA A 1 129 ? 10.878  -19.137 5.438   1.00 31.22 ? 129 ALA A HB2  1  
ATOM 1979   H HB3  . ALA A 1 129 ? 11.990  -19.046 6.804   1.00 2.55  ? 129 ALA A HB3  1  
ATOM 1980   N N    . PRO A 1 130 ? 12.492  -16.208 8.120   1.00 14.02 ? 130 PRO A N    1  
ATOM 1981   C CA   . PRO A 1 130 ? 13.607  -15.497 8.787   1.00 51.53 ? 130 PRO A CA   1  
ATOM 1982   C C    . PRO A 1 130 ? 14.967  -16.169 8.477   1.00 51.35 ? 130 PRO A C    1  
ATOM 1983   O O    . PRO A 1 130 ? 15.252  -17.279 8.945   1.00 64.20 ? 130 PRO A O    1  
ATOM 1984   C CB   . PRO A 1 130 ? 13.235  -15.562 10.295  1.00 13.35 ? 130 PRO A CB   1  
ATOM 1985   C CG   . PRO A 1 130 ? 12.310  -16.739 10.412  1.00 64.14 ? 130 PRO A CG   1  
ATOM 1986   C CD   . PRO A 1 130 ? 11.528  -16.769 9.116   1.00 23.24 ? 130 PRO A CD   1  
ATOM 1987   H HA   . PRO A 1 130 ? 13.645  -14.454 8.467   1.00 72.42 ? 130 PRO A HA   1  
ATOM 1988   H HB2  . PRO A 1 130 ? 14.126  -15.692 10.910  1.00 71.10 ? 130 PRO A HB2  1  
ATOM 1989   H HB3  . PRO A 1 130 ? 12.720  -14.657 10.593  1.00 31.21 ? 130 PRO A HB3  1  
ATOM 1990   H HG2  . PRO A 1 130 ? 12.889  -17.654 10.537  1.00 30.13 ? 130 PRO A HG2  1  
ATOM 1991   H HG3  . PRO A 1 130 ? 11.638  -16.611 11.252  1.00 72.43 ? 130 PRO A HG3  1  
ATOM 1992   H HD2  . PRO A 1 130 ? 11.252  -17.787 8.863   1.00 21.12 ? 130 PRO A HD2  1  
ATOM 1993   H HD3  . PRO A 1 130 ? 10.641  -16.148 9.183   1.00 3.23  ? 130 PRO A HD3  1  
ATOM 1994   N N    . VAL A 1 131 ? 15.777  -15.493 7.642   1.00 3.12  ? 131 VAL A N    1  
ATOM 1995   C CA   . VAL A 1 131 ? 17.086  -15.993 7.199   1.00 1.44  ? 131 VAL A CA   1  
ATOM 1996   C C    . VAL A 1 131 ? 18.173  -15.331 8.052   1.00 34.32 ? 131 VAL A C    1  
ATOM 1997   O O    . VAL A 1 131 ? 18.358  -14.109 7.998   1.00 54.24 ? 131 VAL A O    1  
ATOM 1998   C CB   . VAL A 1 131 ? 17.327  -15.680 5.667   1.00 30.53 ? 131 VAL A CB   1  
ATOM 1999   C CG1  . VAL A 1 131 ? 18.746  -16.095 5.212   1.00 30.11 ? 131 VAL A CG1  1  
ATOM 2000   C CG2  . VAL A 1 131 ? 16.242  -16.352 4.789   1.00 20.13 ? 131 VAL A CG2  1  
ATOM 2001   H H    . VAL A 1 131 ? 15.483  -14.625 7.317   1.00 45.44 ? 131 VAL A H    1  
ATOM 2002   H HA   . VAL A 1 131 ? 17.120  -17.073 7.343   1.00 44.41 ? 131 VAL A HA   1  
ATOM 2003   H HB   . VAL A 1 131 ? 17.242  -14.603 5.531   1.00 32.21 ? 131 VAL A HB   1  
ATOM 2004   H HG11 . VAL A 1 131 ? 18.881  -15.855 4.165   1.00 15.05 ? 131 VAL A HG11 1  
ATOM 2005   H HG12 . VAL A 1 131 ? 18.883  -17.159 5.356   1.00 30.42 ? 131 VAL A HG12 1  
ATOM 2006   H HG13 . VAL A 1 131 ? 19.488  -15.560 5.796   1.00 53.43 ? 131 VAL A HG13 1  
ATOM 2007   H HG21 . VAL A 1 131 ? 16.275  -17.427 4.921   1.00 24.14 ? 131 VAL A HG21 1  
ATOM 2008   H HG22 . VAL A 1 131 ? 16.411  -16.114 3.747   1.00 40.25 ? 131 VAL A HG22 1  
ATOM 2009   H HG23 . VAL A 1 131 ? 15.264  -15.988 5.082   1.00 1.33  ? 131 VAL A HG23 1  
ATOM 2010   N N    . ASN A 1 132 ? 18.867  -16.149 8.868   1.00 34.22 ? 132 ASN A N    1  
ATOM 2011   C CA   . ASN A 1 132 ? 19.962  -15.681 9.730   1.00 52.25 ? 132 ASN A CA   1  
ATOM 2012   C C    . ASN A 1 132 ? 21.251  -15.649 8.895   1.00 51.23 ? 132 ASN A C    1  
ATOM 2013   O O    . ASN A 1 132 ? 21.969  -16.653 8.811   1.00 72.31 ? 132 ASN A O    1  
ATOM 2014   C CB   . ASN A 1 132 ? 20.119  -16.603 10.983  1.00 53.12 ? 132 ASN A CB   1  
ATOM 2015   C CG   . ASN A 1 132 ? 20.989  -15.996 12.101  1.00 73.21 ? 132 ASN A CG   1  
ATOM 2016   O OD1  . ASN A 1 132 ? 21.884  -15.194 11.856  1.00 65.21 ? 132 ASN A OD1  1  
ATOM 2017   N ND2  . ASN A 1 132 ? 20.743  -16.404 13.335  1.00 40.40 ? 132 ASN A ND2  1  
ATOM 2018   H H    . ASN A 1 132 ? 18.633  -17.099 8.885   1.00 10.04 ? 132 ASN A H    1  
ATOM 2019   H HA   . ASN A 1 132 ? 19.725  -14.671 10.062  1.00 32.31 ? 132 ASN A HA   1  
ATOM 2020   H HB2  . ASN A 1 132 ? 19.138  -16.810 11.391  1.00 41.44 ? 132 ASN A HB2  1  
ATOM 2021   H HB3  . ASN A 1 132 ? 20.576  -17.546 10.678  1.00 64.54 ? 132 ASN A HB3  1  
ATOM 2022   H HD21 . ASN A 1 132 ? 20.034  -17.062 13.474  1.00 52.13 ? 132 ASN A HD21 1  
ATOM 2023   H HD22 . ASN A 1 132 ? 21.282  -16.021 14.061  1.00 21.22 ? 132 ASN A HD22 1  
ATOM 2024   N N    . PHE A 1 133 ? 21.497  -14.501 8.239   1.00 34.31 ? 133 PHE A N    1  
ATOM 2025   C CA   . PHE A 1 133 ? 22.686  -14.284 7.381   1.00 64.11 ? 133 PHE A CA   1  
ATOM 2026   C C    . PHE A 1 133 ? 23.993  -14.443 8.177   1.00 31.22 ? 133 PHE A C    1  
ATOM 2027   O O    . PHE A 1 133 ? 25.018  -14.831 7.624   1.00 64.32 ? 133 PHE A O    1  
ATOM 2028   C CB   . PHE A 1 133 ? 22.655  -12.869 6.755   1.00 41.41 ? 133 PHE A CB   1  
ATOM 2029   C CG   . PHE A 1 133 ? 21.461  -12.578 5.848   1.00 75.51 ? 133 PHE A CG   1  
ATOM 2030   C CD1  . PHE A 1 133 ? 21.548  -12.758 4.469   1.00 41.55 ? 133 PHE A CD1  1  
ATOM 2031   C CD2  . PHE A 1 133 ? 20.263  -12.101 6.375   1.00 44.01 ? 133 PHE A CD2  1  
ATOM 2032   C CE1  . PHE A 1 133 ? 20.475  -12.469 3.650   1.00 4.44  ? 133 PHE A CE1  1  
ATOM 2033   C CE2  . PHE A 1 133 ? 19.190  -11.819 5.560   1.00 14.13 ? 133 PHE A CE2  1  
ATOM 2034   C CZ   . PHE A 1 133 ? 19.294  -11.999 4.193   1.00 3.34  ? 133 PHE A CZ   1  
ATOM 2035   H H    . PHE A 1 133 ? 20.851  -13.766 8.332   1.00 70.12 ? 133 PHE A H    1  
ATOM 2036   H HA   . PHE A 1 133 ? 22.662  -15.027 6.590   1.00 64.11 ? 133 PHE A HA   1  
ATOM 2037   H HB2  . PHE A 1 133 ? 22.648  -12.133 7.554   1.00 73.32 ? 133 PHE A HB2  1  
ATOM 2038   H HB3  . PHE A 1 133 ? 23.562  -12.723 6.172   1.00 0.10  ? 133 PHE A HB3  1  
ATOM 2039   H HD1  . PHE A 1 133 ? 22.469  -13.131 4.036   1.00 21.12 ? 133 PHE A HD1  1  
ATOM 2040   H HD2  . PHE A 1 133 ? 20.170  -11.960 7.445   1.00 54.03 ? 133 PHE A HD2  1  
ATOM 2041   H HE1  . PHE A 1 133 ? 20.563  -12.611 2.578   1.00 5.02  ? 133 PHE A HE1  1  
ATOM 2042   H HE2  . PHE A 1 133 ? 18.270  -11.448 5.993   1.00 64.02 ? 133 PHE A HE2  1  
ATOM 2043   H HZ   . PHE A 1 133 ? 18.452  -11.769 3.548   1.00 72.34 ? 133 PHE A HZ   1  
ATOM 2044   N N    . ASP A 1 134 ? 23.915  -14.127 9.474   1.00 32.40 ? 134 ASP A N    1  
ATOM 2045   C CA   . ASP A 1 134 ? 25.046  -14.150 10.409  1.00 41.22 ? 134 ASP A CA   1  
ATOM 2046   C C    . ASP A 1 134 ? 25.500  -15.586 10.672  1.00 14.22 ? 134 ASP A C    1  
ATOM 2047   O O    . ASP A 1 134 ? 26.698  -15.877 10.641  1.00 73.23 ? 134 ASP A O    1  
ATOM 2048   C CB   . ASP A 1 134 ? 24.628  -13.455 11.723  1.00 12.44 ? 134 ASP A CB   1  
ATOM 2049   C CG   . ASP A 1 134 ? 24.086  -12.028 11.497  1.00 3.31  ? 134 ASP A CG   1  
ATOM 2050   O OD1  . ASP A 1 134 ? 24.849  -11.057 11.667  1.00 22.11 ? 134 ASP A OD1  1  
ATOM 2051   O OD2  . ASP A 1 134 ? 22.908  -11.887 11.096  1.00 33.32 ? 134 ASP A OD2  1  
ATOM 2052   H H    . ASP A 1 134 ? 23.041  -13.851 9.826   1.00 23.31 ? 134 ASP A H    1  
ATOM 2053   H HA   . ASP A 1 134 ? 25.866  -13.593 9.955   1.00 54.44 ? 134 ASP A HA   1  
ATOM 2054   H HB2  . ASP A 1 134 ? 23.855  -14.045 12.212  1.00 34.31 ? 134 ASP A HB2  1  
ATOM 2055   H HB3  . ASP A 1 134 ? 25.486  -13.404 12.379  1.00 45.35 ? 134 ASP A HB3  1  
ATOM 2056   N N    . ALA A 1 135 ? 24.512  -16.479 10.891  1.00 63.44 ? 135 ALA A N    1  
ATOM 2057   C CA   . ALA A 1 135 ? 24.746  -17.924 11.072  1.00 70.55 ? 135 ALA A CA   1  
ATOM 2058   C C    . ALA A 1 135 ? 25.351  -18.527 9.795   1.00 40.33 ? 135 ALA A C    1  
ATOM 2059   O O    . ALA A 1 135 ? 26.340  -19.264 9.850   1.00 12.35 ? 135 ALA A O    1  
ATOM 2060   C CB   . ALA A 1 135 ? 23.430  -18.633 11.433  1.00 53.42 ? 135 ALA A CB   1  
ATOM 2061   H H    . ALA A 1 135 ? 23.588  -16.147 10.932  1.00 54.04 ? 135 ALA A H    1  
ATOM 2062   H HA   . ALA A 1 135 ? 25.445  -18.050 11.901  1.00 54.13 ? 135 ALA A HA   1  
ATOM 2063   H HB1  . ALA A 1 135 ? 22.980  -18.156 12.296  1.00 3.54  ? 135 ALA A HB1  1  
ATOM 2064   H HB2  . ALA A 1 135 ? 23.618  -19.668 11.661  1.00 42.53 ? 135 ALA A HB2  1  
ATOM 2065   H HB3  . ALA A 1 135 ? 22.742  -18.576 10.599  1.00 45.30 ? 135 ALA A HB3  1  
ATOM 2066   N N    . LEU A 1 136 ? 24.756  -18.146 8.641   1.00 34.22 ? 136 LEU A N    1  
ATOM 2067   C CA   . LEU A 1 136 ? 25.222  -18.560 7.301   1.00 44.31 ? 136 LEU A CA   1  
ATOM 2068   C C    . LEU A 1 136 ? 26.657  -18.078 7.038   1.00 51.04 ? 136 LEU A C    1  
ATOM 2069   O O    . LEU A 1 136 ? 27.464  -18.791 6.421   1.00 3.33  ? 136 LEU A O    1  
ATOM 2070   C CB   . LEU A 1 136 ? 24.286  -17.997 6.202   1.00 1.53  ? 136 LEU A CB   1  
ATOM 2071   C CG   . LEU A 1 136 ? 22.806  -18.470 6.230   1.00 73.11 ? 136 LEU A CG   1  
ATOM 2072   C CD1  . LEU A 1 136 ? 21.981  -17.727 5.159   1.00 14.52 ? 136 LEU A CD1  1  
ATOM 2073   C CD2  . LEU A 1 136 ? 22.711  -20.004 6.064   1.00 23.34 ? 136 LEU A CD2  1  
ATOM 2074   H H    . LEU A 1 136 ? 23.969  -17.557 8.699   1.00 11.12 ? 136 LEU A H    1  
ATOM 2075   H HA   . LEU A 1 136 ? 25.196  -19.644 7.267   1.00 70.33 ? 136 LEU A HA   1  
ATOM 2076   H HB2  . LEU A 1 136 ? 24.296  -16.914 6.279   1.00 72.24 ? 136 LEU A HB2  1  
ATOM 2077   H HB3  . LEU A 1 136 ? 24.703  -18.264 5.232   1.00 32.44 ? 136 LEU A HB3  1  
ATOM 2078   H HG   . LEU A 1 136 ? 22.378  -18.218 7.195   1.00 13.04 ? 136 LEU A HG   1  
ATOM 2079   H HD11 . LEU A 1 136 ? 22.033  -16.656 5.330   1.00 11.25 ? 136 LEU A HD11 1  
ATOM 2080   H HD12 . LEU A 1 136 ? 20.946  -18.039 5.211   1.00 61.01 ? 136 LEU A HD12 1  
ATOM 2081   H HD13 . LEU A 1 136 ? 22.371  -17.948 4.172   1.00 1.42  ? 136 LEU A HD13 1  
ATOM 2082   H HD21 . LEU A 1 136 ? 23.250  -20.489 6.867   1.00 72.14 ? 136 LEU A HD21 1  
ATOM 2083   H HD22 . LEU A 1 136 ? 23.140  -20.302 5.115   1.00 32.44 ? 136 LEU A HD22 1  
ATOM 2084   H HD23 . LEU A 1 136 ? 21.674  -20.311 6.098   1.00 23.21 ? 136 LEU A HD23 1  
ATOM 2085   N N    . PHE A 1 137 ? 26.957  -16.864 7.536   1.00 13.34 ? 137 PHE A N    1  
ATOM 2086   C CA   . PHE A 1 137 ? 28.270  -16.237 7.375   1.00 43.14 ? 137 PHE A CA   1  
ATOM 2087   C C    . PHE A 1 137 ? 29.316  -16.998 8.194   1.00 53.30 ? 137 PHE A C    1  
ATOM 2088   O O    . PHE A 1 137 ? 30.446  -17.110 7.753   1.00 25.13 ? 137 PHE A O    1  
ATOM 2089   C CB   . PHE A 1 137 ? 28.234  -14.732 7.773   1.00 24.15 ? 137 PHE A CB   1  
ATOM 2090   C CG   . PHE A 1 137 ? 29.505  -13.967 7.385   1.00 30.14 ? 137 PHE A CG   1  
ATOM 2091   C CD1  . PHE A 1 137 ? 29.653  -13.435 6.101   1.00 75.44 ? 137 PHE A CD1  1  
ATOM 2092   C CD2  . PHE A 1 137 ? 30.559  -13.808 8.285   1.00 31.13 ? 137 PHE A CD2  1  
ATOM 2093   C CE1  . PHE A 1 137 ? 30.811  -12.774 5.736   1.00 24.32 ? 137 PHE A CE1  1  
ATOM 2094   C CE2  . PHE A 1 137 ? 31.712  -13.147 7.922   1.00 12.42 ? 137 PHE A CE2  1  
ATOM 2095   C CZ   . PHE A 1 137 ? 31.841  -12.631 6.647   1.00 43.53 ? 137 PHE A CZ   1  
ATOM 2096   H H    . PHE A 1 137 ? 26.266  -16.381 8.036   1.00 45.32 ? 137 PHE A H    1  
ATOM 2097   H HA   . PHE A 1 137 ? 28.534  -16.315 6.320   1.00 44.24 ? 137 PHE A HA   1  
ATOM 2098   H HB2  . PHE A 1 137 ? 27.393  -14.258 7.280   1.00 32.23 ? 137 PHE A HB2  1  
ATOM 2099   H HB3  . PHE A 1 137 ? 28.095  -14.644 8.848   1.00 14.11 ? 137 PHE A HB3  1  
ATOM 2100   H HD1  . PHE A 1 137 ? 28.847  -13.543 5.381   1.00 55.21 ? 137 PHE A HD1  1  
ATOM 2101   H HD2  . PHE A 1 137 ? 30.468  -14.210 9.284   1.00 71.43 ? 137 PHE A HD2  1  
ATOM 2102   H HE1  . PHE A 1 137 ? 30.912  -12.365 4.735   1.00 14.43 ? 137 PHE A HE1  1  
ATOM 2103   H HE2  . PHE A 1 137 ? 32.520  -13.041 8.639   1.00 20.52 ? 137 PHE A HE2  1  
ATOM 2104   H HZ   . PHE A 1 137 ? 32.751  -12.114 6.361   1.00 42.13 ? 137 PHE A HZ   1  
ATOM 2105   N N    . MET A 1 138 ? 28.911  -17.536 9.374   1.00 2.05  ? 138 MET A N    1  
ATOM 2106   C CA   . MET A 1 138 ? 29.812  -18.343 10.235  1.00 62.11 ? 138 MET A CA   1  
ATOM 2107   C C    . MET A 1 138 ? 30.286  -19.614 9.505   1.00 12.12 ? 138 MET A C    1  
ATOM 2108   O O    . MET A 1 138 ? 31.436  -20.051 9.673   1.00 0.32  ? 138 MET A O    1  
ATOM 2109   C CB   . MET A 1 138 ? 29.130  -18.733 11.573  1.00 71.53 ? 138 MET A CB   1  
ATOM 2110   C CG   . MET A 1 138 ? 28.738  -17.563 12.499  1.00 45.54 ? 138 MET A CG   1  
ATOM 2111   S SD   . MET A 1 138 ? 30.103  -16.434 12.897  1.00 12.15 ? 138 MET A SD   1  
ATOM 2112   C CE   . MET A 1 138 ? 29.841  -15.089 11.732  1.00 4.35  ? 138 MET A CE   1  
ATOM 2113   H H    . MET A 1 138 ? 27.981  -17.386 9.670   1.00 32.32 ? 138 MET A H    1  
ATOM 2114   H HA   . MET A 1 138 ? 30.683  -17.725 10.451  1.00 65.22 ? 138 MET A HA   1  
ATOM 2115   H HB2  . MET A 1 138 ? 28.226  -19.296 11.352  1.00 34.22 ? 138 MET A HB2  1  
ATOM 2116   H HB3  . MET A 1 138 ? 29.802  -19.379 12.127  1.00 65.45 ? 138 MET A HB3  1  
ATOM 2117   H HG2  . MET A 1 138 ? 27.955  -16.995 12.018  1.00 3.33  ? 138 MET A HG2  1  
ATOM 2118   H HG3  . MET A 1 138 ? 28.351  -17.970 13.423  1.00 74.44 ? 138 MET A HG3  1  
ATOM 2119   H HE1  . MET A 1 138 ? 28.852  -14.677 11.870  1.00 3.11  ? 138 MET A HE1  1  
ATOM 2120   H HE2  . MET A 1 138 ? 29.937  -15.464 10.722  1.00 3.24  ? 138 MET A HE2  1  
ATOM 2121   H HE3  . MET A 1 138 ? 30.579  -14.318 11.899  1.00 61.13 ? 138 MET A HE3  1  
ATOM 2122   N N    . ASN A 1 139 ? 29.385  -20.193 8.680   1.00 74.31 ? 139 ASN A N    1  
ATOM 2123   C CA   . ASN A 1 139 ? 29.694  -21.379 7.853   1.00 43.43 ? 139 ASN A CA   1  
ATOM 2124   C C    . ASN A 1 139 ? 30.742  -21.039 6.774   1.00 12.25 ? 139 ASN A C    1  
ATOM 2125   O O    . ASN A 1 139 ? 31.656  -21.827 6.519   1.00 33.04 ? 139 ASN A O    1  
ATOM 2126   C CB   . ASN A 1 139 ? 28.414  -21.965 7.210   1.00 33.44 ? 139 ASN A CB   1  
ATOM 2127   C CG   . ASN A 1 139 ? 27.397  -22.463 8.242   1.00 44.23 ? 139 ASN A CG   1  
ATOM 2128   O OD1  . ASN A 1 139 ? 27.514  -23.572 8.766   1.00 73.12 ? 139 ASN A OD1  1  
ATOM 2129   N ND2  . ASN A 1 139 ? 26.378  -21.665 8.514   1.00 41.31 ? 139 ASN A ND2  1  
ATOM 2130   H H    . ASN A 1 139 ? 28.480  -19.806 8.632   1.00 3.51  ? 139 ASN A H    1  
ATOM 2131   H HA   . ASN A 1 139 ? 30.121  -22.128 8.518   1.00 53.13 ? 139 ASN A HA   1  
ATOM 2132   H HB2  . ASN A 1 139 ? 27.943  -21.202 6.601   1.00 22.30 ? 139 ASN A HB2  1  
ATOM 2133   H HB3  . ASN A 1 139 ? 28.681  -22.798 6.569   1.00 11.14 ? 139 ASN A HB3  1  
ATOM 2134   H HD21 . ASN A 1 139 ? 26.325  -20.809 8.049   1.00 11.13 ? 139 ASN A HD21 1  
ATOM 2135   H HD22 . ASN A 1 139 ? 25.715  -21.959 9.177   1.00 33.21 ? 139 ASN A HD22 1  
ATOM 2136   N N    . TYR A 1 140 ? 30.611  -19.849 6.170   1.00 23.01 ? 140 TYR A N    1  
ATOM 2137   C CA   . TYR A 1 140 ? 31.578  -19.335 5.176   1.00 44.14 ? 140 TYR A CA   1  
ATOM 2138   C C    . TYR A 1 140 ? 32.899  -18.884 5.861   1.00 32.11 ? 140 TYR A C    1  
ATOM 2139   O O    . TYR A 1 140 ? 33.992  -18.997 5.283   1.00 54.22 ? 140 TYR A O    1  
ATOM 2140   C CB   . TYR A 1 140 ? 30.932  -18.163 4.385   1.00 42.21 ? 140 TYR A CB   1  
ATOM 2141   C CG   . TYR A 1 140 ? 31.851  -17.537 3.321   1.00 54.22 ? 140 TYR A CG   1  
ATOM 2142   C CD1  . TYR A 1 140 ? 32.101  -18.194 2.114   1.00 22.21 ? 140 TYR A CD1  1  
ATOM 2143   C CD2  . TYR A 1 140 ? 32.489  -16.309 3.540   1.00 72.11 ? 140 TYR A CD2  1  
ATOM 2144   C CE1  . TYR A 1 140 ? 32.951  -17.655 1.172   1.00 23.40 ? 140 TYR A CE1  1  
ATOM 2145   C CE2  . TYR A 1 140 ? 33.336  -15.766 2.594   1.00 34.43 ? 140 TYR A CE2  1  
ATOM 2146   C CZ   . TYR A 1 140 ? 33.566  -16.443 1.414   1.00 11.13 ? 140 TYR A CZ   1  
ATOM 2147   O OH   . TYR A 1 140 ? 34.424  -15.913 0.475   1.00 20.11 ? 140 TYR A OH   1  
ATOM 2148   H H    . TYR A 1 140 ? 29.835  -19.294 6.395   1.00 40.15 ? 140 TYR A H    1  
ATOM 2149   H HA   . TYR A 1 140 ? 31.803  -20.143 4.483   1.00 65.24 ? 140 TYR A HA   1  
ATOM 2150   H HB2  . TYR A 1 140 ? 30.043  -18.526 3.879   1.00 13.22 ? 140 TYR A HB2  1  
ATOM 2151   H HB3  . TYR A 1 140 ? 30.635  -17.384 5.081   1.00 52.34 ? 140 TYR A HB3  1  
ATOM 2152   H HD1  . TYR A 1 140 ? 31.619  -19.146 1.920   1.00 50.32 ? 140 TYR A HD1  1  
ATOM 2153   H HD2  . TYR A 1 140 ? 32.308  -15.778 4.468   1.00 63.41 ? 140 TYR A HD2  1  
ATOM 2154   H HE1  . TYR A 1 140 ? 33.129  -18.183 0.242   1.00 63.24 ? 140 TYR A HE1  1  
ATOM 2155   H HE2  . TYR A 1 140 ? 33.818  -14.816 2.783   1.00 50.10 ? 140 TYR A HE2  1  
ATOM 2156   H HH   . TYR A 1 140 ? 34.036  -16.001 -0.401  1.00 43.03 ? 140 TYR A HH   1  
ATOM 2157   N N    . LEU A 1 141 ? 32.757  -18.402 7.105   1.00 41.01 ? 141 LEU A N    1  
ATOM 2158   C CA   . LEU A 1 141 ? 33.831  -17.759 7.890   1.00 40.14 ? 141 LEU A CA   1  
ATOM 2159   C C    . LEU A 1 141 ? 34.932  -18.770 8.249   1.00 73.55 ? 141 LEU A C    1  
ATOM 2160   O O    . LEU A 1 141 ? 36.117  -18.512 8.009   1.00 74.52 ? 141 LEU A O    1  
ATOM 2161   C CB   . LEU A 1 141 ? 33.201  -17.161 9.183   1.00 65.02 ? 141 LEU A CB   1  
ATOM 2162   C CG   . LEU A 1 141 ? 34.107  -16.306 10.126  1.00 11.20 ? 141 LEU A CG   1  
ATOM 2163   C CD1  . LEU A 1 141 ? 34.420  -14.923 9.516   1.00 2.05  ? 141 LEU A CD1  1  
ATOM 2164   C CD2  . LEU A 1 141 ? 33.451  -16.162 11.513  1.00 4.43  ? 141 LEU A CD2  1  
ATOM 2165   H H    . LEU A 1 141 ? 31.876  -18.489 7.526   1.00 44.14 ? 141 LEU A H    1  
ATOM 2166   H HA   . LEU A 1 141 ? 34.255  -16.956 7.296   1.00 14.45 ? 141 LEU A HA   1  
ATOM 2167   H HB2  . LEU A 1 141 ? 32.354  -16.541 8.887   1.00 44.53 ? 141 LEU A HB2  1  
ATOM 2168   H HB3  . LEU A 1 141 ? 32.800  -17.992 9.761   1.00 25.03 ? 141 LEU A HB3  1  
ATOM 2169   H HG   . LEU A 1 141 ? 35.054  -16.816 10.265  1.00 31.54 ? 141 LEU A HG   1  
ATOM 2170   H HD11 . LEU A 1 141 ? 35.077  -14.374 10.179  1.00 12.11 ? 141 LEU A HD11 1  
ATOM 2171   H HD12 . LEU A 1 141 ? 33.504  -14.362 9.382   1.00 43.51 ? 141 LEU A HD12 1  
ATOM 2172   H HD13 . LEU A 1 141 ? 34.908  -15.046 8.557   1.00 42.30 ? 141 LEU A HD13 1  
ATOM 2173   H HD21 . LEU A 1 141 ? 32.556  -15.556 11.438  1.00 74.40 ? 141 LEU A HD21 1  
ATOM 2174   H HD22 . LEU A 1 141 ? 34.142  -15.698 12.199  1.00 71.53 ? 141 LEU A HD22 1  
ATOM 2175   H HD23 . LEU A 1 141 ? 33.185  -17.136 11.889  1.00 33.22 ? 141 LEU A HD23 1  
ATOM 2176   N N    . GLN A 1 142 ? 34.509  -19.936 8.790   1.00 64.53 ? 142 GLN A N    1  
ATOM 2177   C CA   . GLN A 1 142 ? 35.435  -20.975 9.301   1.00 71.22 ? 142 GLN A CA   1  
ATOM 2178   C C    . GLN A 1 142 ? 34.618  -22.244 9.660   1.00 42.31 ? 142 GLN A C    1  
ATOM 2179   O O    . GLN A 1 142 ? 34.976  -22.979 10.574  1.00 51.10 ? 142 GLN A O    1  
ATOM 2180   C CB   . GLN A 1 142 ? 36.244  -20.392 10.528  1.00 74.44 ? 142 GLN A CB   1  
ATOM 2181   C CG   . GLN A 1 142 ? 37.656  -21.004 10.810  1.00 4.05  ? 142 GLN A CG   1  
ATOM 2182   C CD   . GLN A 1 142 ? 37.642  -22.353 11.536  1.00 64.34 ? 142 GLN A CD   1  
ATOM 2183   O OE1  . GLN A 1 142 ? 37.715  -23.419 10.922  1.00 35.12 ? 142 GLN A OE1  1  
ATOM 2184   N NE2  . GLN A 1 142 ? 37.493  -22.318 12.851  1.00 74.02 ? 142 GLN A NE2  1  
ATOM 2185   H H    . GLN A 1 142 ? 33.543  -20.098 8.855   1.00 51.23 ? 142 GLN A H    1  
ATOM 2186   H HA   . GLN A 1 142 ? 36.123  -21.228 8.500   1.00 23.33 ? 142 GLN A HA   1  
ATOM 2187   H HB2  . GLN A 1 142 ? 36.389  -19.329 10.358  1.00 2.24  ? 142 GLN A HB2  1  
ATOM 2188   H HB3  . GLN A 1 142 ? 35.647  -20.499 11.427  1.00 30.11 ? 142 GLN A HB3  1  
ATOM 2189   H HG2  . GLN A 1 142 ? 38.168  -21.129 9.866   1.00 55.10 ? 142 GLN A HG2  1  
ATOM 2190   H HG3  . GLN A 1 142 ? 38.217  -20.297 11.413  1.00 73.11 ? 142 GLN A HG3  1  
ATOM 2191   H HE21 . GLN A 1 142 ? 37.384  -21.442 13.286  1.00 43.34 ? 142 GLN A HE21 1  
ATOM 2192   H HE22 . GLN A 1 142 ? 37.466  -23.166 13.334  1.00 2.01  ? 142 GLN A HE22 1  
ATOM 2193   N N    . GLN A 1 143 ? 33.495  -22.483 8.929   1.00 43.24 ? 143 GLN A N    1  
ATOM 2194   C CA   . GLN A 1 143 ? 32.612  -23.661 9.144   1.00 12.30 ? 143 GLN A CA   1  
ATOM 2195   C C    . GLN A 1 143 ? 32.053  -23.653 10.587  1.00 23.34 ? 143 GLN A C    1  
ATOM 2196   O O    . GLN A 1 143 ? 32.600  -24.324 11.477  1.00 43.51 ? 143 GLN A O    1  
ATOM 2197   C CB   . GLN A 1 143 ? 33.370  -24.988 8.813   1.00 63.14 ? 143 GLN A CB   1  
ATOM 2198   C CG   . GLN A 1 143 ? 32.571  -26.293 9.035   1.00 55.32 ? 143 GLN A CG   1  
ATOM 2199   C CD   . GLN A 1 143 ? 33.454  -27.540 8.949   1.00 41.53 ? 143 GLN A CD   1  
ATOM 2200   O OE1  . GLN A 1 143 ? 33.634  -28.130 7.879   1.00 72.13 ? 143 GLN A OE1  1  
ATOM 2201   N NE2  . GLN A 1 143 ? 34.036  -27.929 10.077  1.00 52.04 ? 143 GLN A NE2  1  
ATOM 2202   H H    . GLN A 1 143 ? 33.262  -21.854 8.217   1.00 21.43 ? 143 GLN A H    1  
ATOM 2203   H HA   . GLN A 1 143 ? 31.779  -23.551 8.454   1.00 20.23 ? 143 GLN A HA   1  
ATOM 2204   H HB2  . GLN A 1 143 ? 33.676  -24.955 7.772   1.00 22.31 ? 143 GLN A HB2  1  
ATOM 2205   H HB3  . GLN A 1 143 ? 34.268  -25.028 9.427   1.00 44.42 ? 143 GLN A HB3  1  
ATOM 2206   H HG2  . GLN A 1 143 ? 32.109  -26.261 10.015  1.00 10.04 ? 143 GLN A HG2  1  
ATOM 2207   H HG3  . GLN A 1 143 ? 31.793  -26.365 8.283   1.00 53.10 ? 143 GLN A HG3  1  
ATOM 2208   H HE21 . GLN A 1 143 ? 33.871  -27.401 10.890  1.00 71.14 ? 143 GLN A HE21 1  
ATOM 2209   H HE22 . GLN A 1 143 ? 34.609  -28.722 10.057  1.00 14.44 ? 143 GLN A HE22 1  
ATOM 2210   N N    . GLN A 1 144 ? 31.015  -22.806 10.807  1.00 71.23 ? 144 GLN A N    1  
ATOM 2211   C CA   . GLN A 1 144 ? 30.355  -22.567 12.121  1.00 5.33  ? 144 GLN A CA   1  
ATOM 2212   C C    . GLN A 1 144 ? 31.220  -21.663 13.042  1.00 70.02 ? 144 GLN A C    1  
ATOM 2213   O O    . GLN A 1 144 ? 30.678  -20.764 13.697  1.00 22.00 ? 144 GLN A O    1  
ATOM 2214   C CB   . GLN A 1 144 ? 29.945  -23.897 12.832  1.00 52.24 ? 144 GLN A CB   1  
ATOM 2215   C CG   . GLN A 1 144 ? 28.920  -24.750 12.042  1.00 72.32 ? 144 GLN A CG   1  
ATOM 2216   C CD   . GLN A 1 144 ? 28.724  -26.169 12.592  1.00 3.22  ? 144 GLN A CD   1  
ATOM 2217   O OE1  . GLN A 1 144 ? 29.640  -26.770 13.156  1.00 42.21 ? 144 GLN A OE1  1  
ATOM 2218   N NE2  . GLN A 1 144 ? 27.544  -26.736 12.393  1.00 52.10 ? 144 GLN A NE2  1  
ATOM 2219   H H    . GLN A 1 144 ? 30.681  -22.304 10.043  1.00 31.43 ? 144 GLN A H    1  
ATOM 2220   H HA   . GLN A 1 144 ? 29.448  -22.018 11.892  1.00 14.21 ? 144 GLN A HA   1  
ATOM 2221   H HB2  . GLN A 1 144 ? 30.836  -24.492 12.991  1.00 40.41 ? 144 GLN A HB2  1  
ATOM 2222   H HB3  . GLN A 1 144 ? 29.513  -23.659 13.796  1.00 0.04  ? 144 GLN A HB3  1  
ATOM 2223   H HG2  . GLN A 1 144 ? 27.967  -24.237 12.060  1.00 61.54 ? 144 GLN A HG2  1  
ATOM 2224   H HG3  . GLN A 1 144 ? 29.251  -24.831 11.012  1.00 63.01 ? 144 GLN A HG3  1  
ATOM 2225   H HE21 . GLN A 1 144 ? 26.860  -26.225 11.909  1.00 13.31 ? 144 GLN A HE21 1  
ATOM 2226   H HE22 . GLN A 1 144 ? 27.404  -27.644 12.732  1.00 71.21 ? 144 GLN A HE22 1  
ATOM 2227   N N    . ALA A 1 145 ? 32.551  -21.938 13.092  1.00 22.11 ? 145 ALA A N    1  
ATOM 2228   C CA   . ALA A 1 145 ? 33.573  -21.111 13.776  1.00 42.43 ? 145 ALA A CA   1  
ATOM 2229   C C    . ALA A 1 145 ? 33.384  -21.139 15.316  1.00 53.15 ? 145 ALA A C    1  
ATOM 2230   O O    . ALA A 1 145 ? 34.090  -21.869 16.030  1.00 12.00 ? 145 ALA A O    1  
ATOM 2231   C CB   . ALA A 1 145 ? 33.618  -19.673 13.197  1.00 10.22 ? 145 ALA A CB   1  
ATOM 2232   H H    . ALA A 1 145 ? 32.860  -22.758 12.667  1.00 24.53 ? 145 ALA A H    1  
ATOM 2233   H HA   . ALA A 1 145 ? 34.528  -21.572 13.553  1.00 32.44 ? 145 ALA A HA   1  
ATOM 2234   H HB1  . ALA A 1 145 ? 33.736  -19.718 12.121  1.00 23.13 ? 145 ALA A HB1  1  
ATOM 2235   H HB2  . ALA A 1 145 ? 34.450  -19.126 13.623  1.00 63.05 ? 145 ALA A HB2  1  
ATOM 2236   H HB3  . ALA A 1 145 ? 32.696  -19.158 13.431  1.00 55.42 ? 145 ALA A HB3  1  
ATOM 2237   N N    . GLY A 1 146 ? 32.398  -20.374 15.803  1.00 14.43 ? 146 GLY A N    1  
ATOM 2238   C CA   . GLY A 1 146 ? 31.992  -20.378 17.206  1.00 62.14 ? 146 GLY A CA   1  
ATOM 2239   C C    . GLY A 1 146 ? 30.484  -20.526 17.319  1.00 73.43 ? 146 GLY A C    1  
ATOM 2240   O O    . GLY A 1 146 ? 29.970  -21.651 17.286  1.00 3.34  ? 146 GLY A O    1  
ATOM 2241   H H    . GLY A 1 146 ? 31.914  -19.788 15.182  1.00 61.14 ? 146 GLY A H    1  
ATOM 2242   H HA2  . GLY A 1 146 ? 32.471  -21.196 17.737  1.00 44.31 ? 146 GLY A HA2  1  
ATOM 2243   H HA3  . GLY A 1 146 ? 32.298  -19.443 17.662  1.00 1.00  ? 146 GLY A HA3  1  
ATOM 2244   N N    . GLU A 1 147 ? 29.798  -19.376 17.414  1.00 14.54 ? 147 GLU A N    1  
ATOM 2245   C CA   . GLU A 1 147 ? 28.320  -19.251 17.479  1.00 10.03 ? 147 GLU A CA   1  
ATOM 2246   C C    . GLU A 1 147 ? 27.741  -19.850 18.790  1.00 65.21 ? 147 GLU A C    1  
ATOM 2247   O O    . GLU A 1 147 ? 28.384  -20.673 19.456  1.00 2.51  ? 147 GLU A O    1  
ATOM 2248   C CB   . GLU A 1 147 ? 27.633  -19.828 16.197  1.00 4.01  ? 147 GLU A CB   1  
ATOM 2249   C CG   . GLU A 1 147 ? 26.182  -19.339 15.961  1.00 61.21 ? 147 GLU A CG   1  
ATOM 2250   C CD   . GLU A 1 147 ? 26.058  -17.795 15.922  1.00 74.22 ? 147 GLU A CD   1  
ATOM 2251   O OE1  . GLU A 1 147 ? 26.256  -17.197 14.843  1.00 33.34 ? 147 GLU A OE1  1  
ATOM 2252   O OE2  . GLU A 1 147 ? 25.772  -17.175 16.978  1.00 41.24 ? 147 GLU A OE2  1  
ATOM 2253   H H    . GLU A 1 147 ? 30.320  -18.551 17.447  1.00 42.54 ? 147 GLU A H    1  
ATOM 2254   H HA   . GLU A 1 147 ? 28.125  -18.181 17.505  1.00 33.14 ? 147 GLU A HA   1  
ATOM 2255   H HB2  . GLU A 1 147 ? 28.223  -19.550 15.331  1.00 45.15 ? 147 GLU A HB2  1  
ATOM 2256   H HB3  . GLU A 1 147 ? 27.622  -20.913 16.267  1.00 21.21 ? 147 GLU A HB3  1  
ATOM 2257   H HG2  . GLU A 1 147 ? 25.825  -19.746 15.020  1.00 45.32 ? 147 GLU A HG2  1  
ATOM 2258   H HG3  . GLU A 1 147 ? 25.559  -19.724 16.762  1.00 40.01 ? 147 GLU A HG3  1  
ATOM 2259   N N    . GLY A 1 148 ? 26.529  -19.397 19.168  1.00 32.54 ? 148 GLY A N    1  
ATOM 2260   C CA   . GLY A 1 148 ? 25.873  -19.852 20.400  1.00 11.53 ? 148 GLY A CA   1  
ATOM 2261   C C    . GLY A 1 148 ? 26.531  -19.288 21.653  1.00 4.12  ? 148 GLY A C    1  
ATOM 2262   O O    . GLY A 1 148 ? 26.530  -19.930 22.711  1.00 21.43 ? 148 GLY A O    1  
ATOM 2263   H H    . GLY A 1 148 ? 26.071  -18.743 18.598  1.00 12.35 ? 148 GLY A H    1  
ATOM 2264   H HA2  . GLY A 1 148 ? 24.842  -19.527 20.370  1.00 53.22 ? 148 GLY A HA2  1  
ATOM 2265   H HA3  . GLY A 1 148 ? 25.892  -20.935 20.440  1.00 62.14 ? 148 GLY A HA3  1  
ATOM 2266   N N    . THR A 1 149 ? 27.065  -18.050 21.532  1.00 15.45 ? 149 THR A N    1  
ATOM 2267   C CA   . THR A 1 149 ? 27.772  -17.344 22.626  1.00 3.22  ? 149 THR A CA   1  
ATOM 2268   C C    . THR A 1 149 ? 26.774  -16.617 23.561  1.00 34.21 ? 149 THR A C    1  
ATOM 2269   O O    . THR A 1 149 ? 27.186  -15.820 24.416  1.00 65.10 ? 149 THR A O    1  
ATOM 2270   C CB   . THR A 1 149 ? 28.826  -16.317 22.050  1.00 31.41 ? 149 THR A CB   1  
ATOM 2271   O OG1  . THR A 1 149 ? 29.682  -15.817 23.098  1.00 44.44 ? 149 THR A OG1  1  
ATOM 2272   C CG2  . THR A 1 149 ? 28.161  -15.117 21.347  1.00 1.24  ? 149 THR A CG2  1  
ATOM 2273   H H    . THR A 1 149 ? 26.963  -17.586 20.675  1.00 34.20 ? 149 THR A H    1  
ATOM 2274   H HA   . THR A 1 149 ? 28.313  -18.083 23.214  1.00 35.44 ? 149 THR A HA   1  
ATOM 2275   H HB   . THR A 1 149 ? 29.448  -16.835 21.324  1.00 62.10 ? 149 THR A HB   1  
ATOM 2276   H HG1  . THR A 1 149 ? 29.148  -15.355 23.755  1.00 62.14 ? 149 THR A HG1  1  
ATOM 2277   H HG21 . THR A 1 149 ? 27.549  -15.465 20.526  1.00 75.43 ? 149 THR A HG21 1  
ATOM 2278   H HG22 . THR A 1 149 ? 28.924  -14.450 20.961  1.00 23.33 ? 149 THR A HG22 1  
ATOM 2279   H HG23 . THR A 1 149 ? 27.545  -14.575 22.053  1.00 43.10 ? 149 THR A HG23 1  
ATOM 2280   N N    . GLU A 1 150 ? 25.468  -16.909 23.378  1.00 24.04 ? 150 GLU A N    1  
ATOM 2281   C CA   . GLU A 1 150 ? 24.375  -16.291 24.135  1.00 64.31 ? 150 GLU A CA   1  
ATOM 2282   C C    . GLU A 1 150 ? 24.514  -16.657 25.633  1.00 52.22 ? 150 GLU A C    1  
ATOM 2283   O O    . GLU A 1 150 ? 24.058  -17.718 26.071  1.00 61.34 ? 150 GLU A O    1  
ATOM 2284   C CB   . GLU A 1 150 ? 22.990  -16.729 23.536  1.00 45.14 ? 150 GLU A CB   1  
ATOM 2285   C CG   . GLU A 1 150 ? 21.885  -15.644 23.550  1.00 40.01 ? 150 GLU A CG   1  
ATOM 2286   C CD   . GLU A 1 150 ? 21.408  -15.223 24.956  1.00 11.43 ? 150 GLU A CD   1  
ATOM 2287   O OE1  . GLU A 1 150 ? 22.062  -14.363 25.589  1.00 44.23 ? 150 GLU A OE1  1  
ATOM 2288   O OE2  . GLU A 1 150 ? 20.362  -15.730 25.420  1.00 73.33 ? 150 GLU A OE2  1  
ATOM 2289   H H    . GLU A 1 150 ? 25.236  -17.574 22.707  1.00 14.04 ? 150 GLU A H    1  
ATOM 2290   H HA   . GLU A 1 150 ? 24.479  -15.215 24.028  1.00 64.14 ? 150 GLU A HA   1  
ATOM 2291   H HB2  . GLU A 1 150 ? 23.139  -17.030 22.503  1.00 65.12 ? 150 GLU A HB2  1  
ATOM 2292   H HB3  . GLU A 1 150 ? 22.623  -17.593 24.082  1.00 25.21 ? 150 GLU A HB3  1  
ATOM 2293   H HG2  . GLU A 1 150 ? 22.262  -14.766 23.038  1.00 64.40 ? 150 GLU A HG2  1  
ATOM 2294   H HG3  . GLU A 1 150 ? 21.033  -16.019 22.993  1.00 61.23 ? 150 GLU A HG3  1  
ATOM 2295   N N    . GLU A 1 151 ? 25.212  -15.771 26.370  1.00 0.03  ? 151 GLU A N    1  
ATOM 2296   C CA   . GLU A 1 151 ? 25.502  -15.907 27.808  1.00 53.21 ? 151 GLU A CA   1  
ATOM 2297   C C    . GLU A 1 151 ? 24.211  -16.053 28.625  1.00 4.12  ? 151 GLU A C    1  
ATOM 2298   O O    . GLU A 1 151 ? 24.164  -16.832 29.586  1.00 31.23 ? 151 GLU A O    1  
ATOM 2299   C CB   . GLU A 1 151 ? 26.308  -14.665 28.268  1.00 73.23 ? 151 GLU A CB   1  
ATOM 2300   C CG   . GLU A 1 151 ? 26.537  -14.559 29.788  1.00 70.14 ? 151 GLU A CG   1  
ATOM 2301   C CD   . GLU A 1 151 ? 27.313  -13.303 30.196  1.00 65.34 ? 151 GLU A CD   1  
ATOM 2302   O OE1  . GLU A 1 151 ? 28.424  -13.422 30.751  1.00 72.14 ? 151 GLU A OE1  1  
ATOM 2303   O OE2  . GLU A 1 151 ? 26.808  -12.186 29.964  1.00 42.11 ? 151 GLU A OE2  1  
ATOM 2304   H H    . GLU A 1 151 ? 25.559  -14.980 25.917  1.00 44.02 ? 151 GLU A H    1  
ATOM 2305   H HA   . GLU A 1 151 ? 26.110  -16.795 27.942  1.00 11.42 ? 151 GLU A HA   1  
ATOM 2306   H HB2  . GLU A 1 151 ? 27.279  -14.686 27.784  1.00 12.24 ? 151 GLU A HB2  1  
ATOM 2307   H HB3  . GLU A 1 151 ? 25.784  -13.770 27.939  1.00 62.41 ? 151 GLU A HB3  1  
ATOM 2308   H HG2  . GLU A 1 151 ? 25.571  -14.538 30.284  1.00 40.23 ? 151 GLU A HG2  1  
ATOM 2309   H HG3  . GLU A 1 151 ? 27.074  -15.439 30.120  1.00 3.25  ? 151 GLU A HG3  1  
ATOM 2310   N N    . HIS A 1 152 ? 23.187  -15.281 28.216  1.00 15.33 ? 152 HIS A N    1  
ATOM 2311   C CA   . HIS A 1 152 ? 21.828  -15.357 28.758  1.00 13.12 ? 152 HIS A CA   1  
ATOM 2312   C C    . HIS A 1 152 ? 21.797  -15.002 30.253  1.00 3.50  ? 152 HIS A C    1  
ATOM 2313   O O    . HIS A 1 152 ? 21.873  -15.882 31.113  1.00 31.25 ? 152 HIS A O    1  
ATOM 2314   C CB   . HIS A 1 152 ? 21.206  -16.759 28.472  1.00 73.23 ? 152 HIS A CB   1  
ATOM 2315   C CG   . HIS A 1 152 ? 19.749  -16.886 28.810  1.00 42.40 ? 152 HIS A CG   1  
ATOM 2316   N ND1  . HIS A 1 152 ? 18.751  -16.513 27.945  1.00 3.42  ? 152 HIS A ND1  1  
ATOM 2317   C CD2  . HIS A 1 152 ? 19.129  -17.344 29.921  1.00 33.50 ? 152 HIS A CD2  1  
ATOM 2318   C CE1  . HIS A 1 152 ? 17.585  -16.737 28.509  1.00 12.30 ? 152 HIS A CE1  1  
ATOM 2319   N NE2  . HIS A 1 152 ? 17.783  -17.238 29.705  1.00 0.34  ? 152 HIS A NE2  1  
ATOM 2320   H H    . HIS A 1 152 ? 23.356  -14.638 27.495  1.00 43.31 ? 152 HIS A H    1  
ATOM 2321   H HA   . HIS A 1 152 ? 21.245  -14.612 28.222  1.00 24.03 ? 152 HIS A HA   1  
ATOM 2322   H HB2  . HIS A 1 152 ? 21.314  -16.981 27.419  1.00 42.31 ? 152 HIS A HB2  1  
ATOM 2323   H HB3  . HIS A 1 152 ? 21.747  -17.511 29.039  1.00 0.43  ? 152 HIS A HB3  1  
ATOM 2324   H HD1  . HIS A 1 152 ? 18.880  -16.156 27.034  1.00 3.03  ? 152 HIS A HD1  1  
ATOM 2325   H HD2  . HIS A 1 152 ? 19.607  -17.718 30.816  1.00 74.04 ? 152 HIS A HD2  1  
ATOM 2326   H HE1  . HIS A 1 152 ? 16.620  -16.536 28.065  1.00 54.13 ? 152 HIS A HE1  1  
ATOM 2327   H HE2  . HIS A 1 152 ? 17.092  -17.334 30.393  1.00 37.65 ? 152 HIS A HE2  1  
ATOM 2328   N N    . GLN A 1 153 ? 21.766  -13.697 30.547  1.00 54.00 ? 153 GLN A N    1  
ATOM 2329   C CA   . GLN A 1 153 ? 21.538  -13.179 31.908  1.00 73.24 ? 153 GLN A CA   1  
ATOM 2330   C C    . GLN A 1 153 ? 20.399  -12.161 31.849  1.00 63.23 ? 153 GLN A C    1  
ATOM 2331   O O    . GLN A 1 153 ? 20.470  -11.203 31.079  1.00 71.33 ? 153 GLN A O    1  
ATOM 2332   C CB   . GLN A 1 153 ? 22.815  -12.515 32.507  1.00 24.30 ? 153 GLN A CB   1  
ATOM 2333   C CG   . GLN A 1 153 ? 24.047  -13.439 32.602  1.00 31.15 ? 153 GLN A CG   1  
ATOM 2334   C CD   . GLN A 1 153 ? 25.180  -12.847 33.448  1.00 54.31 ? 153 GLN A CD   1  
ATOM 2335   O OE1  . GLN A 1 153 ? 25.274  -13.100 34.652  1.00 70.15 ? 153 GLN A OE1  1  
ATOM 2336   N NE2  . GLN A 1 153 ? 26.020  -12.020 32.843  1.00 15.40 ? 153 GLN A NE2  1  
ATOM 2337   H H    . GLN A 1 153 ? 21.897  -13.052 29.822  1.00 54.34 ? 153 GLN A H    1  
ATOM 2338   H HA   . GLN A 1 153 ? 21.233  -14.010 32.552  1.00 12.45 ? 153 GLN A HA   1  
ATOM 2339   H HB2  . GLN A 1 153 ? 23.083  -11.658 31.896  1.00 31.14 ? 153 GLN A HB2  1  
ATOM 2340   H HB3  . GLN A 1 153 ? 22.579  -12.163 33.506  1.00 42.12 ? 153 GLN A HB3  1  
ATOM 2341   H HG2  . GLN A 1 153 ? 23.746  -14.383 33.040  1.00 64.22 ? 153 GLN A HG2  1  
ATOM 2342   H HG3  . GLN A 1 153 ? 24.421  -13.622 31.601  1.00 54.30 ? 153 GLN A HG3  1  
ATOM 2343   H HE21 . GLN A 1 153 ? 25.876  -11.824 31.890  1.00 30.23 ? 153 GLN A HE21 1  
ATOM 2344   H HE22 . GLN A 1 153 ? 26.754  -11.639 33.365  1.00 53.44 ? 153 GLN A HE22 1  
ATOM 2345   N N    . ASP A 1 154 ? 19.344  -12.393 32.646  1.00 74.22 ? 154 ASP A N    1  
ATOM 2346   C CA   . ASP A 1 154 ? 18.199  -11.471 32.755  1.00 32.23 ? 154 ASP A CA   1  
ATOM 2347   C C    . ASP A 1 154 ? 18.574  -10.247 33.599  1.00 15.21 ? 154 ASP A C    1  
ATOM 2348   O O    . ASP A 1 154 ? 19.605  -10.241 34.285  1.00 61.53 ? 154 ASP A O    1  
ATOM 2349   C CB   . ASP A 1 154 ? 16.963  -12.195 33.361  1.00 11.01 ? 154 ASP A CB   1  
ATOM 2350   C CG   . ASP A 1 154 ? 17.157  -12.649 34.823  1.00 70.22 ? 154 ASP A CG   1  
ATOM 2351   O OD1  . ASP A 1 154 ? 16.597  -12.013 35.744  1.00 52.30 ? 154 ASP A OD1  1  
ATOM 2352   O OD2  . ASP A 1 154 ? 17.881  -13.640 35.055  1.00 61.24 ? 154 ASP A OD2  1  
ATOM 2353   H H    . ASP A 1 154 ? 19.340  -13.210 33.187  1.00 4.33  ? 154 ASP A H    1  
ATOM 2354   H HA   . ASP A 1 154 ? 17.950  -11.132 31.755  1.00 33.10 ? 154 ASP A HA   1  
ATOM 2355   H HB2  . ASP A 1 154 ? 16.104  -11.531 33.311  1.00 24.43 ? 154 ASP A HB2  1  
ATOM 2356   H HB3  . ASP A 1 154 ? 16.746  -13.070 32.758  1.00 43.11 ? 154 ASP A HB3  1  
ATOM 2357   N N    . ALA A 1 155 ? 17.737  -9.204  33.529  1.00 12.01 ? 155 ALA A N    1  
ATOM 2358   C CA   . ALA A 1 155 ? 17.889  -8.020  34.372  1.00 42.15 ? 155 ALA A CA   1  
ATOM 2359   C C    . ALA A 1 155 ? 17.299  -8.335  35.770  1.00 4.11  ? 155 ALA A C    1  
ATOM 2360   O O    . ALA A 1 155 ? 16.058  -8.355  35.910  1.00 72.34 ? 155 ALA A O    1  
ATOM 2361   C CB   . ALA A 1 155 ? 17.233  -6.791  33.713  1.00 41.03 ? 155 ALA A CB   1  
ATOM 2362   O OXT  . ALA A 1 155 ? 18.079  -8.596  36.711  1.00 37.65 ? 155 ALA A OXT  1  
ATOM 2363   H H    . ALA A 1 155 ? 16.988  -9.242  32.909  1.00 52.54 ? 155 ALA A H    1  
ATOM 2364   H HA   . ALA A 1 155 ? 18.955  -7.814  34.470  1.00 53.44 ? 155 ALA A HA   1  
ATOM 2365   H HB1  . ALA A 1 155 ? 17.381  -5.915  34.334  1.00 15.01 ? 155 ALA A HB1  1  
ATOM 2366   H HB2  . ALA A 1 155 ? 16.171  -6.963  33.592  1.00 40.23 ? 155 ALA A HB2  1  
ATOM 2367   H HB3  . ALA A 1 155 ? 17.675  -6.619  32.740  1.00 24.21 ? 155 ALA A HB3  1  
ATOM 2368   N N    . MET B 1 1   ? -21.320 -1.668  -41.547 1.00 13.21 ? 1   MET B N    1  
ATOM 2369   C CA   . MET B 1 1   ? -21.110 -0.581  -40.561 1.00 34.14 ? 1   MET B CA   1  
ATOM 2370   C C    . MET B 1 1   ? -21.656 -0.996  -39.177 1.00 74.24 ? 1   MET B C    1  
ATOM 2371   O O    . MET B 1 1   ? -22.197 -2.099  -39.020 1.00 72.43 ? 1   MET B O    1  
ATOM 2372   C CB   . MET B 1 1   ? -21.774 0.739   -41.054 1.00 61.25 ? 1   MET B CB   1  
ATOM 2373   C CG   . MET B 1 1   ? -23.314 0.724   -41.102 1.00 72.23 ? 1   MET B CG   1  
ATOM 2374   S SD   . MET B 1 1   ? -24.004 2.318   -41.602 1.00 53.14 ? 1   MET B SD   1  
ATOM 2375   C CE   . MET B 1 1   ? -25.767 2.047   -41.416 1.00 10.04 ? 1   MET B CE   1  
ATOM 2376   H H1   . MET B 1 1   ? -20.783 -2.511  -41.265 1.00 37.65 ? 1   MET B H1   1  
ATOM 2377   H H2   . MET B 1 1   ? -21.003 -1.371  -42.488 1.00 37.65 ? 1   MET B H2   1  
ATOM 2378   H H3   . MET B 1 1   ? -22.327 -1.919  -41.594 1.00 37.65 ? 1   MET B H3   1  
ATOM 2379   H HA   . MET B 1 1   ? -20.041 -0.425  -40.472 1.00 65.21 ? 1   MET B HA   1  
ATOM 2380   H HB2  . MET B 1 1   ? -21.471 1.548   -40.399 1.00 45.03 ? 1   MET B HB2  1  
ATOM 2381   H HB3  . MET B 1 1   ? -21.409 0.958   -42.051 1.00 24.41 ? 1   MET B HB3  1  
ATOM 2382   H HG2  . MET B 1 1   ? -23.641 -0.029  -41.809 1.00 3.23  ? 1   MET B HG2  1  
ATOM 2383   H HG3  . MET B 1 1   ? -23.692 0.480   -40.118 1.00 1.51  ? 1   MET B HG3  1  
ATOM 2384   H HE1  . MET B 1 1   ? -25.991 1.820   -40.384 1.00 74.42 ? 1   MET B HE1  1  
ATOM 2385   H HE2  . MET B 1 1   ? -26.076 1.223   -42.043 1.00 51.42 ? 1   MET B HE2  1  
ATOM 2386   H HE3  . MET B 1 1   ? -26.298 2.941   -41.709 1.00 54.43 ? 1   MET B HE3  1  
ATOM 2387   N N    . SER B 1 2   ? -21.523 -0.091  -38.185 1.00 41.43 ? 2   SER B N    1  
ATOM 2388   C CA   . SER B 1 2   ? -22.004 -0.314  -36.809 1.00 54.54 ? 2   SER B CA   1  
ATOM 2389   C C    . SER B 1 2   ? -23.539 -0.187  -36.747 1.00 1.35  ? 2   SER B C    1  
ATOM 2390   O O    . SER B 1 2   ? -24.080 0.885   -36.442 1.00 14.02 ? 2   SER B O    1  
ATOM 2391   C CB   . SER B 1 2   ? -21.323 0.684   -35.837 1.00 43.11 ? 2   SER B CB   1  
ATOM 2392   O OG   . SER B 1 2   ? -19.914 0.594   -35.931 1.00 44.43 ? 2   SER B OG   1  
ATOM 2393   H H    . SER B 1 2   ? -21.076 0.756   -38.384 1.00 70.14 ? 2   SER B H    1  
ATOM 2394   H HA   . SER B 1 2   ? -21.725 -1.324  -36.516 1.00 21.33 ? 2   SER B HA   1  
ATOM 2395   H HB2  . SER B 1 2   ? -21.618 1.695   -36.081 1.00 42.30 ? 2   SER B HB2  1  
ATOM 2396   H HB3  . SER B 1 2   ? -21.613 0.461   -34.818 1.00 0.25  ? 2   SER B HB3  1  
ATOM 2397   H HG   . SER B 1 2   ? -19.629 -0.257  -35.574 1.00 63.45 ? 2   SER B HG   1  
ATOM 2398   N N    . GLU B 1 3   ? -24.235 -1.282  -37.094 1.00 31.44 ? 3   GLU B N    1  
ATOM 2399   C CA   . GLU B 1 3   ? -25.708 -1.339  -37.081 1.00 14.43 ? 3   GLU B CA   1  
ATOM 2400   C C    . GLU B 1 3   ? -26.189 -1.954  -35.763 1.00 52.32 ? 3   GLU B C    1  
ATOM 2401   O O    . GLU B 1 3   ? -26.811 -3.023  -35.736 1.00 62.20 ? 3   GLU B O    1  
ATOM 2402   C CB   . GLU B 1 3   ? -26.240 -2.114  -38.318 1.00 51.51 ? 3   GLU B CB   1  
ATOM 2403   C CG   . GLU B 1 3   ? -25.847 -1.475  -39.660 1.00 14.11 ? 3   GLU B CG   1  
ATOM 2404   C CD   . GLU B 1 3   ? -26.586 -2.066  -40.865 1.00 42.13 ? 3   GLU B CD   1  
ATOM 2405   O OE1  . GLU B 1 3   ? -27.821 -1.901  -40.942 1.00 11.32 ? 3   GLU B OE1  1  
ATOM 2406   O OE2  . GLU B 1 3   ? -25.946 -2.678  -41.745 1.00 24.54 ? 3   GLU B OE2  1  
ATOM 2407   H H    . GLU B 1 3   ? -23.736 -2.085  -37.369 1.00 51.14 ? 3   GLU B H    1  
ATOM 2408   H HA   . GLU B 1 3   ? -26.089 -0.320  -37.131 1.00 64.54 ? 3   GLU B HA   1  
ATOM 2409   H HB2  . GLU B 1 3   ? -25.850 -3.125  -38.291 1.00 23.31 ? 3   GLU B HB2  1  
ATOM 2410   H HB3  . GLU B 1 3   ? -27.324 -2.158  -38.264 1.00 70.21 ? 3   GLU B HB3  1  
ATOM 2411   H HG2  . GLU B 1 3   ? -26.061 -0.409  -39.618 1.00 74.11 ? 3   GLU B HG2  1  
ATOM 2412   H HG3  . GLU B 1 3   ? -24.776 -1.603  -39.797 1.00 10.40 ? 3   GLU B HG3  1  
ATOM 2413   N N    . GLN B 1 4   ? -25.833 -1.278  -34.660 1.00 72.14 ? 4   GLN B N    1  
ATOM 2414   C CA   . GLN B 1 4   ? -26.189 -1.684  -33.289 1.00 33.32 ? 4   GLN B CA   1  
ATOM 2415   C C    . GLN B 1 4   ? -26.785 -0.466  -32.564 1.00 2.55  ? 4   GLN B C    1  
ATOM 2416   O O    . GLN B 1 4   ? -26.258 0.650   -32.679 1.00 61.13 ? 4   GLN B O    1  
ATOM 2417   C CB   . GLN B 1 4   ? -24.927 -2.241  -32.556 1.00 70.42 ? 4   GLN B CB   1  
ATOM 2418   C CG   . GLN B 1 4   ? -24.369 -3.544  -33.177 1.00 53.22 ? 4   GLN B CG   1  
ATOM 2419   C CD   . GLN B 1 4   ? -23.051 -4.015  -32.555 1.00 14.51 ? 4   GLN B CD   1  
ATOM 2420   O OE1  . GLN B 1 4   ? -23.031 -4.775  -31.589 1.00 35.55 ? 4   GLN B OE1  1  
ATOM 2421   N NE2  . GLN B 1 4   ? -21.939 -3.569  -33.102 1.00 10.43 ? 4   GLN B NE2  1  
ATOM 2422   H H    . GLN B 1 4   ? -25.300 -0.462  -34.768 1.00 53.42 ? 4   GLN B H    1  
ATOM 2423   H HA   . GLN B 1 4   ? -26.948 -2.468  -33.343 1.00 4.00  ? 4   GLN B HA   1  
ATOM 2424   H HB2  . GLN B 1 4   ? -24.144 -1.487  -32.579 1.00 70.25 ? 4   GLN B HB2  1  
ATOM 2425   H HB3  . GLN B 1 4   ? -25.180 -2.443  -31.520 1.00 64.33 ? 4   GLN B HB3  1  
ATOM 2426   H HG2  . GLN B 1 4   ? -25.106 -4.333  -33.057 1.00 12.14 ? 4   GLN B HG2  1  
ATOM 2427   H HG3  . GLN B 1 4   ? -24.213 -3.378  -34.240 1.00 73.22 ? 4   GLN B HG3  1  
ATOM 2428   H HE21 . GLN B 1 4   ? -21.999 -2.961  -33.870 1.00 41.34 ? 4   GLN B HE21 1  
ATOM 2429   H HE22 . GLN B 1 4   ? -21.090 -3.864  -32.717 1.00 71.43 ? 4   GLN B HE22 1  
ATOM 2430   N N    . ASN B 1 5   ? -27.895 -0.685  -31.840 1.00 61.25 ? 5   ASN B N    1  
ATOM 2431   C CA   . ASN B 1 5   ? -28.652 0.392   -31.149 1.00 41.31 ? 5   ASN B CA   1  
ATOM 2432   C C    . ASN B 1 5   ? -28.927 -0.003  -29.692 1.00 54.24 ? 5   ASN B C    1  
ATOM 2433   O O    . ASN B 1 5   ? -28.414 -1.028  -29.218 1.00 63.01 ? 5   ASN B O    1  
ATOM 2434   C CB   . ASN B 1 5   ? -29.993 0.677   -31.892 1.00 21.11 ? 5   ASN B CB   1  
ATOM 2435   C CG   . ASN B 1 5   ? -30.994 -0.494  -31.861 1.00 14.44 ? 5   ASN B CG   1  
ATOM 2436   O OD1  . ASN B 1 5   ? -30.617 -1.665  -31.856 1.00 33.40 ? 5   ASN B OD1  1  
ATOM 2437   N ND2  . ASN B 1 5   ? -32.283 -0.186  -31.828 1.00 34.12 ? 5   ASN B ND2  1  
ATOM 2438   H H    . ASN B 1 5   ? -28.215 -1.610  -31.750 1.00 22.04 ? 5   ASN B H    1  
ATOM 2439   H HA   . ASN B 1 5   ? -28.051 1.298   -31.147 1.00 33.35 ? 5   ASN B HA   1  
ATOM 2440   H HB2  . ASN B 1 5   ? -30.463 1.542   -31.440 1.00 21.13 ? 5   ASN B HB2  1  
ATOM 2441   H HB3  . ASN B 1 5   ? -29.778 0.906   -32.929 1.00 64.33 ? 5   ASN B HB3  1  
ATOM 2442   H HD21 . ASN B 1 5   ? -32.539 0.763   -31.825 1.00 50.50 ? 5   ASN B HD21 1  
ATOM 2443   H HD22 . ASN B 1 5   ? -32.929 -0.919  -31.821 1.00 44.52 ? 5   ASN B HD22 1  
ATOM 2444   N N    . ASN B 1 6   ? -29.762 0.824   -29.004 1.00 75.43 ? 6   ASN B N    1  
ATOM 2445   C CA   . ASN B 1 6   ? -30.185 0.614   -27.606 1.00 31.24 ? 6   ASN B CA   1  
ATOM 2446   C C    . ASN B 1 6   ? -28.977 0.722   -26.650 1.00 53.20 ? 6   ASN B C    1  
ATOM 2447   O O    . ASN B 1 6   ? -28.132 -0.179  -26.592 1.00 35.20 ? 6   ASN B O    1  
ATOM 2448   C CB   . ASN B 1 6   ? -30.921 -0.754  -27.438 1.00 64.51 ? 6   ASN B CB   1  
ATOM 2449   C CG   . ASN B 1 6   ? -31.355 -1.070  -26.002 1.00 22.42 ? 6   ASN B CG   1  
ATOM 2450   O OD1  . ASN B 1 6   ? -31.689 -0.177  -25.215 1.00 40.00 ? 6   ASN B OD1  1  
ATOM 2451   N ND2  . ASN B 1 6   ? -31.357 -2.347  -25.657 1.00 74.11 ? 6   ASN B ND2  1  
ATOM 2452   H H    . ASN B 1 6   ? -30.107 1.619   -29.469 1.00 1.52  ? 6   ASN B H    1  
ATOM 2453   H HA   . ASN B 1 6   ? -30.883 1.412   -27.371 1.00 72.02 ? 6   ASN B HA   1  
ATOM 2454   H HB2  . ASN B 1 6   ? -31.808 -0.755  -28.059 1.00 1.44  ? 6   ASN B HB2  1  
ATOM 2455   H HB3  . ASN B 1 6   ? -30.260 -1.547  -27.781 1.00 44.44 ? 6   ASN B HB3  1  
ATOM 2456   H HD21 . ASN B 1 6   ? -31.089 -3.009  -26.330 1.00 21.41 ? 6   ASN B HD21 1  
ATOM 2457   H HD22 . ASN B 1 6   ? -31.614 -2.580  -24.744 1.00 12.10 ? 6   ASN B HD22 1  
ATOM 2458   N N    . THR B 1 7   ? -28.903 1.832   -25.905 1.00 34.23 ? 7   THR B N    1  
ATOM 2459   C CA   . THR B 1 7   ? -27.823 2.069   -24.939 1.00 51.43 ? 7   THR B CA   1  
ATOM 2460   C C    . THR B 1 7   ? -28.062 1.259   -23.646 1.00 53.35 ? 7   THR B C    1  
ATOM 2461   O O    . THR B 1 7   ? -28.541 1.780   -22.633 1.00 60.22 ? 7   THR B O    1  
ATOM 2462   C CB   . THR B 1 7   ? -27.659 3.601   -24.646 1.00 11.44 ? 7   THR B CB   1  
ATOM 2463   O OG1  . THR B 1 7   ? -28.921 4.173   -24.257 1.00 62.54 ? 7   THR B OG1  1  
ATOM 2464   C CG2  . THR B 1 7   ? -27.108 4.354   -25.874 1.00 5.41  ? 7   THR B CG2  1  
ATOM 2465   H H    . THR B 1 7   ? -29.599 2.517   -26.007 1.00 4.23  ? 7   THR B H    1  
ATOM 2466   H HA   . THR B 1 7   ? -26.893 1.718   -25.388 1.00 3.43  ? 7   THR B HA   1  
ATOM 2467   H HB   . THR B 1 7   ? -26.958 3.724   -23.825 1.00 41.21 ? 7   THR B HB   1  
ATOM 2468   H HG1  . THR B 1 7   ? -29.435 3.522   -23.766 1.00 65.55 ? 7   THR B HG1  1  
ATOM 2469   H HG21 . THR B 1 7   ? -27.000 5.404   -25.640 1.00 1.00  ? 7   THR B HG21 1  
ATOM 2470   H HG22 . THR B 1 7   ? -27.792 4.244   -26.709 1.00 31.20 ? 7   THR B HG22 1  
ATOM 2471   H HG23 . THR B 1 7   ? -26.142 3.949   -26.151 1.00 4.15  ? 7   THR B HG23 1  
ATOM 2472   N N    . GLU B 1 8   ? -27.775 -0.050  -23.737 1.00 62.31 ? 8   GLU B N    1  
ATOM 2473   C CA   . GLU B 1 8   ? -27.885 -0.996  -22.623 1.00 22.00 ? 8   GLU B CA   1  
ATOM 2474   C C    . GLU B 1 8   ? -26.471 -1.193  -22.064 1.00 13.12 ? 8   GLU B C    1  
ATOM 2475   O O    . GLU B 1 8   ? -26.140 -0.634  -21.014 1.00 12.13 ? 8   GLU B O    1  
ATOM 2476   C CB   . GLU B 1 8   ? -28.538 -2.329  -23.132 1.00 63.11 ? 8   GLU B CB   1  
ATOM 2477   C CG   . GLU B 1 8   ? -29.019 -3.352  -22.056 1.00 23.51 ? 8   GLU B CG   1  
ATOM 2478   C CD   . GLU B 1 8   ? -27.906 -4.091  -21.282 1.00 34.10 ? 8   GLU B CD   1  
ATOM 2479   O OE1  . GLU B 1 8   ? -27.808 -3.939  -20.043 1.00 72.44 ? 8   GLU B OE1  1  
ATOM 2480   O OE2  . GLU B 1 8   ? -27.119 -4.822  -21.917 1.00 40.23 ? 8   GLU B OE2  1  
ATOM 2481   H H    . GLU B 1 8   ? -27.469 -0.393  -24.602 1.00 71.14 ? 8   GLU B H    1  
ATOM 2482   H HA   . GLU B 1 8   ? -28.518 -0.563  -21.851 1.00 55.33 ? 8   GLU B HA   1  
ATOM 2483   H HB2  . GLU B 1 8   ? -29.402 -2.068  -23.741 1.00 50.34 ? 8   GLU B HB2  1  
ATOM 2484   H HB3  . GLU B 1 8   ? -27.827 -2.828  -23.771 1.00 32.41 ? 8   GLU B HB3  1  
ATOM 2485   H HG2  . GLU B 1 8   ? -29.646 -2.825  -21.351 1.00 61.14 ? 8   GLU B HG2  1  
ATOM 2486   H HG3  . GLU B 1 8   ? -29.630 -4.099  -22.558 1.00 13.02 ? 8   GLU B HG3  1  
ATOM 2487   N N    . MET B 1 9   ? -25.635 -1.910  -22.863 1.00 61.42 ? 9   MET B N    1  
ATOM 2488   C CA   . MET B 1 9   ? -24.257 -2.400  -22.544 1.00 22.42 ? 9   MET B CA   1  
ATOM 2489   C C    . MET B 1 9   ? -24.129 -3.099  -21.167 1.00 70.12 ? 9   MET B C    1  
ATOM 2490   O O    . MET B 1 9   ? -24.989 -2.984  -20.294 1.00 34.23 ? 9   MET B O    1  
ATOM 2491   C CB   . MET B 1 9   ? -23.156 -1.301  -22.686 1.00 72.02 ? 9   MET B CB   1  
ATOM 2492   C CG   . MET B 1 9   ? -23.039 -0.273  -21.529 1.00 32.40 ? 9   MET B CG   1  
ATOM 2493   S SD   . MET B 1 9   ? -21.369 0.409   -21.365 1.00 24.21 ? 9   MET B SD   1  
ATOM 2494   C CE   . MET B 1 9   ? -20.430 -1.052  -20.889 1.00 52.02 ? 9   MET B CE   1  
ATOM 2495   H H    . MET B 1 9   ? -25.980 -2.144  -23.751 1.00 63.25 ? 9   MET B H    1  
ATOM 2496   H HA   . MET B 1 9   ? -24.050 -3.161  -23.293 1.00 62.10 ? 9   MET B HA   1  
ATOM 2497   H HB2  . MET B 1 9   ? -22.195 -1.794  -22.782 1.00 42.42 ? 9   MET B HB2  1  
ATOM 2498   H HB3  . MET B 1 9   ? -23.341 -0.755  -23.605 1.00 31.43 ? 9   MET B HB3  1  
ATOM 2499   H HG2  . MET B 1 9   ? -23.723 0.544   -21.707 1.00 53.23 ? 9   MET B HG2  1  
ATOM 2500   H HG3  . MET B 1 9   ? -23.302 -0.757  -20.596 1.00 73.02 ? 9   MET B HG3  1  
ATOM 2501   H HE1  . MET B 1 9   ? -20.797 -1.428  -19.944 1.00 12.40 ? 9   MET B HE1  1  
ATOM 2502   H HE2  . MET B 1 9   ? -19.388 -0.794  -20.793 1.00 44.43 ? 9   MET B HE2  1  
ATOM 2503   H HE3  . MET B 1 9   ? -20.539 -1.814  -21.647 1.00 31.33 ? 9   MET B HE3  1  
ATOM 2504   N N    . THR B 1 10  ? -22.993 -3.781  -20.956 1.00 13.32 ? 10  THR B N    1  
ATOM 2505   C CA   . THR B 1 10  ? -22.723 -4.531  -19.718 1.00 1.12  ? 10  THR B CA   1  
ATOM 2506   C C    . THR B 1 10  ? -21.227 -4.871  -19.644 1.00 44.41 ? 10  THR B C    1  
ATOM 2507   O O    . THR B 1 10  ? -20.629 -5.296  -20.644 1.00 3.32  ? 10  THR B O    1  
ATOM 2508   C CB   . THR B 1 10  ? -23.541 -5.890  -19.621 1.00 64.51 ? 10  THR B CB   1  
ATOM 2509   O OG1  . THR B 1 10  ? -24.958 -5.663  -19.746 1.00 22.12 ? 10  THR B OG1  1  
ATOM 2510   C CG2  . THR B 1 10  ? -23.293 -6.636  -18.290 1.00 73.43 ? 10  THR B CG2  1  
ATOM 2511   H H    . THR B 1 10  ? -22.298 -3.772  -21.652 1.00 74.33 ? 10  THR B H    1  
ATOM 2512   H HA   . THR B 1 10  ? -22.993 -3.903  -18.866 1.00 71.21 ? 10  THR B HA   1  
ATOM 2513   H HB   . THR B 1 10  ? -23.235 -6.536  -20.435 1.00 12.45 ? 10  THR B HB   1  
ATOM 2514   H HG1  . THR B 1 10  ? -25.160 -5.262  -20.598 1.00 55.53 ? 10  THR B HG1  1  
ATOM 2515   H HG21 . THR B 1 10  ? -22.243 -6.875  -18.192 1.00 51.11 ? 10  THR B HG21 1  
ATOM 2516   H HG22 . THR B 1 10  ? -23.870 -7.551  -18.267 1.00 12.14 ? 10  THR B HG22 1  
ATOM 2517   H HG23 . THR B 1 10  ? -23.599 -6.009  -17.457 1.00 13.24 ? 10  THR B HG23 1  
ATOM 2518   N N    . PHE B 1 11  ? -20.628 -4.653  -18.467 1.00 34.24 ? 11  PHE B N    1  
ATOM 2519   C CA   . PHE B 1 11  ? -19.415 -5.360  -18.058 1.00 11.32 ? 11  PHE B CA   1  
ATOM 2520   C C    . PHE B 1 11  ? -19.388 -5.516  -16.550 1.00 51.13 ? 11  PHE B C    1  
ATOM 2521   O O    . PHE B 1 11  ? -20.027 -4.755  -15.809 1.00 52.23 ? 11  PHE B O    1  
ATOM 2522   C CB   . PHE B 1 11  ? -18.073 -4.769  -18.642 1.00 20.14 ? 11  PHE B CB   1  
ATOM 2523   C CG   . PHE B 1 11  ? -17.362 -3.558  -17.993 1.00 64.22 ? 11  PHE B CG   1  
ATOM 2524   C CD1  . PHE B 1 11  ? -17.072 -2.426  -18.751 1.00 72.51 ? 11  PHE B CD1  1  
ATOM 2525   C CD2  . PHE B 1 11  ? -16.877 -3.592  -16.675 1.00 3.23  ? 11  PHE B CD2  1  
ATOM 2526   C CE1  . PHE B 1 11  ? -16.338 -1.397  -18.219 1.00 3.03  ? 11  PHE B CE1  1  
ATOM 2527   C CE2  . PHE B 1 11  ? -16.168 -2.548  -16.144 1.00 52.34 ? 11  PHE B CE2  1  
ATOM 2528   C CZ   . PHE B 1 11  ? -15.890 -1.456  -16.920 1.00 63.25 ? 11  PHE B CZ   1  
ATOM 2529   H H    . PHE B 1 11  ? -21.026 -4.011  -17.843 1.00 61.52 ? 11  PHE B H    1  
ATOM 2530   H HA   . PHE B 1 11  ? -19.519 -6.373  -18.455 1.00 23.22 ? 11  PHE B HA   1  
ATOM 2531   H HB2  . PHE B 1 11  ? -17.342 -5.569  -18.641 1.00 50.03 ? 11  PHE B HB2  1  
ATOM 2532   H HB3  . PHE B 1 11  ? -18.265 -4.521  -19.683 1.00 74.13 ? 11  PHE B HB3  1  
ATOM 2533   H HD1  . PHE B 1 11  ? -17.431 -2.361  -19.776 1.00 4.33  ? 11  PHE B HD1  1  
ATOM 2534   H HD2  . PHE B 1 11  ? -17.097 -4.439  -16.055 1.00 0.14  ? 11  PHE B HD2  1  
ATOM 2535   H HE1  . PHE B 1 11  ? -16.111 -0.524  -18.815 1.00 62.23 ? 11  PHE B HE1  1  
ATOM 2536   H HE2  . PHE B 1 11  ? -15.812 -2.593  -15.122 1.00 15.54 ? 11  PHE B HE2  1  
ATOM 2537   H HZ   . PHE B 1 11  ? -15.308 -0.637  -16.512 1.00 14.00 ? 11  PHE B HZ   1  
ATOM 2538   N N    . GLN B 1 12  ? -18.636 -6.518  -16.102 1.00 22.12 ? 12  GLN B N    1  
ATOM 2539   C CA   . GLN B 1 12  ? -18.371 -6.757  -14.690 1.00 51.25 ? 12  GLN B CA   1  
ATOM 2540   C C    . GLN B 1 12  ? -16.858 -6.833  -14.510 1.00 15.25 ? 12  GLN B C    1  
ATOM 2541   O O    . GLN B 1 12  ? -16.159 -7.449  -15.338 1.00 51.55 ? 12  GLN B O    1  
ATOM 2542   C CB   . GLN B 1 12  ? -19.051 -8.075  -14.204 1.00 52.13 ? 12  GLN B CB   1  
ATOM 2543   C CG   . GLN B 1 12  ? -19.051 -8.250  -12.662 1.00 44.44 ? 12  GLN B CG   1  
ATOM 2544   C CD   . GLN B 1 12  ? -20.136 -7.451  -11.903 1.00 3.13  ? 12  GLN B CD   1  
ATOM 2545   O OE1  . GLN B 1 12  ? -20.524 -7.835  -10.798 1.00 2.53  ? 12  GLN B OE1  1  
ATOM 2546   N NE2  . GLN B 1 12  ? -20.681 -6.372  -12.476 1.00 22.11 ? 12  GLN B NE2  1  
ATOM 2547   H H    . GLN B 1 12  ? -18.232 -7.127  -16.754 1.00 32.41 ? 12  GLN B H    1  
ATOM 2548   H HA   . GLN B 1 12  ? -18.754 -5.917  -14.109 1.00 51.14 ? 12  GLN B HA   1  
ATOM 2549   H HB2  . GLN B 1 12  ? -20.080 -8.077  -14.545 1.00 3.13  ? 12  GLN B HB2  1  
ATOM 2550   H HB3  . GLN B 1 12  ? -18.540 -8.926  -14.652 1.00 4.13  ? 12  GLN B HB3  1  
ATOM 2551   H HG2  . GLN B 1 12  ? -19.196 -9.299  -12.439 1.00 4.23  ? 12  GLN B HG2  1  
ATOM 2552   H HG3  . GLN B 1 12  ? -18.080 -7.951  -12.277 1.00 21.24 ? 12  GLN B HG3  1  
ATOM 2553   H HE21 . GLN B 1 12  ? -20.392 -6.110  -13.370 1.00 40.32 ? 12  GLN B HE21 1  
ATOM 2554   H HE22 . GLN B 1 12  ? -21.358 -5.882  -11.966 1.00 34.24 ? 12  GLN B HE22 1  
ATOM 2555   N N    . ILE B 1 13  ? -16.355 -6.155  -13.463 1.00 32.25 ? 13  ILE B N    1  
ATOM 2556   C CA   . ILE B 1 13  ? -14.944 -6.218  -13.093 1.00 63.31 ? 13  ILE B CA   1  
ATOM 2557   C C    . ILE B 1 13  ? -14.647 -7.624  -12.567 1.00 32.35 ? 13  ILE B C    1  
ATOM 2558   O O    . ILE B 1 13  ? -15.210 -8.050  -11.549 1.00 24.35 ? 13  ILE B O    1  
ATOM 2559   C CB   . ILE B 1 13  ? -14.538 -5.147  -12.015 1.00 75.11 ? 13  ILE B CB   1  
ATOM 2560   C CG1  . ILE B 1 13  ? -14.827 -3.707  -12.537 1.00 23.41 ? 13  ILE B CG1  1  
ATOM 2561   C CG2  . ILE B 1 13  ? -13.045 -5.311  -11.629 1.00 53.50 ? 13  ILE B CG2  1  
ATOM 2562   C CD1  . ILE B 1 13  ? -14.413 -2.575  -11.602 1.00 13.43 ? 13  ILE B CD1  1  
ATOM 2563   H H    . ILE B 1 13  ? -16.959 -5.618  -12.918 1.00 43.02 ? 13  ILE B H    1  
ATOM 2564   H HA   . ILE B 1 13  ? -14.355 -6.036  -13.996 1.00 30.02 ? 13  ILE B HA   1  
ATOM 2565   H HB   . ILE B 1 13  ? -15.132 -5.324  -11.123 1.00 12.45 ? 13  ILE B HB   1  
ATOM 2566   H HG12 . ILE B 1 13  ? -14.303 -3.556  -13.471 1.00 33.21 ? 13  ILE B HG12 1  
ATOM 2567   H HG13 . ILE B 1 13  ? -15.890 -3.605  -12.718 1.00 73.44 ? 13  ILE B HG13 1  
ATOM 2568   H HG21 . ILE B 1 13  ? -12.864 -6.310  -11.249 1.00 72.15 ? 13  ILE B HG21 1  
ATOM 2569   H HG22 . ILE B 1 13  ? -12.789 -4.600  -10.871 1.00 61.21 ? 13  ILE B HG22 1  
ATOM 2570   H HG23 . ILE B 1 13  ? -12.416 -5.139  -12.488 1.00 21.43 ? 13  ILE B HG23 1  
ATOM 2571   H HD11 . ILE B 1 13  ? -13.365 -2.649  -11.380 1.00 72.45 ? 13  ILE B HD11 1  
ATOM 2572   H HD12 . ILE B 1 13  ? -14.969 -2.617  -10.685 1.00 41.31 ? 13  ILE B HD12 1  
ATOM 2573   H HD13 . ILE B 1 13  ? -14.604 -1.631  -12.089 1.00 64.23 ? 13  ILE B HD13 1  
ATOM 2574   N N    . GLN B 1 14  ? -13.786 -8.329  -13.291 1.00 54.33 ? 14  GLN B N    1  
ATOM 2575   C CA   . GLN B 1 14  ? -13.402 -9.709  -12.973 1.00 63.20 ? 14  GLN B CA   1  
ATOM 2576   C C    . GLN B 1 14  ? -12.237 -9.698  -11.991 1.00 65.41 ? 14  GLN B C    1  
ATOM 2577   O O    . GLN B 1 14  ? -12.154 -10.541 -11.080 1.00 35.31 ? 14  GLN B O    1  
ATOM 2578   C CB   . GLN B 1 14  ? -13.010 -10.469 -14.268 1.00 61.51 ? 14  GLN B CB   1  
ATOM 2579   C CG   . GLN B 1 14  ? -14.124 -10.591 -15.337 1.00 1.14  ? 14  GLN B CG   1  
ATOM 2580   C CD   . GLN B 1 14  ? -15.323 -11.467 -14.927 1.00 71.42 ? 14  GLN B CD   1  
ATOM 2581   O OE1  . GLN B 1 14  ? -15.714 -11.535 -13.760 1.00 22.31 ? 14  GLN B OE1  1  
ATOM 2582   N NE2  . GLN B 1 14  ? -15.915 -12.165 -15.889 1.00 64.44 ? 14  GLN B NE2  1  
ATOM 2583   H H    . GLN B 1 14  ? -13.369 -7.889  -14.056 1.00 22.41 ? 14  GLN B H    1  
ATOM 2584   H HA   . GLN B 1 14  ? -14.252 -10.211 -12.509 1.00 63.51 ? 14  GLN B HA   1  
ATOM 2585   H HB2  . GLN B 1 14  ? -12.170 -9.952  -14.723 1.00 43.00 ? 14  GLN B HB2  1  
ATOM 2586   H HB3  . GLN B 1 14  ? -12.687 -11.469 -14.004 1.00 41.01 ? 14  GLN B HB3  1  
ATOM 2587   H HG2  . GLN B 1 14  ? -14.499 -9.599  -15.561 1.00 63.53 ? 14  GLN B HG2  1  
ATOM 2588   H HG3  . GLN B 1 14  ? -13.684 -11.006 -16.239 1.00 1.13  ? 14  GLN B HG3  1  
ATOM 2589   H HE21 . GLN B 1 14  ? -15.567 -12.086 -16.803 1.00 33.14 ? 14  GLN B HE21 1  
ATOM 2590   H HE22 . GLN B 1 14  ? -16.667 -12.742 -15.647 1.00 23.34 ? 14  GLN B HE22 1  
ATOM 2591   N N    . ARG B 1 15  ? -11.345 -8.710  -12.182 1.00 62.33 ? 15  ARG B N    1  
ATOM 2592   C CA   . ARG B 1 15  ? -10.114 -8.591  -11.409 1.00 51.25 ? 15  ARG B CA   1  
ATOM 2593   C C    . ARG B 1 15  ? -9.485  -7.208  -11.645 1.00 62.22 ? 15  ARG B C    1  
ATOM 2594   O O    . ARG B 1 15  ? -9.412  -6.745  -12.779 1.00 20.44 ? 15  ARG B O    1  
ATOM 2595   C CB   . ARG B 1 15  ? -9.127  -9.718  -11.841 1.00 13.45 ? 15  ARG B CB   1  
ATOM 2596   C CG   . ARG B 1 15  ? -7.867  -9.865  -10.969 1.00 15.12 ? 15  ARG B CG   1  
ATOM 2597   C CD   . ARG B 1 15  ? -6.905  -10.938 -11.519 1.00 11.15 ? 15  ARG B CD   1  
ATOM 2598   N NE   . ARG B 1 15  ? -5.740  -11.117 -10.651 1.00 2.11  ? 15  ARG B NE   1  
ATOM 2599   C CZ   . ARG B 1 15  ? -4.671  -11.879 -10.917 1.00 53.24 ? 15  ARG B CZ   1  
ATOM 2600   N NH1  . ARG B 1 15  ? -4.567  -12.549 -12.059 1.00 1.13  ? 15  ARG B NH1  1  
ATOM 2601   N NH2  . ARG B 1 15  ? -3.731  -12.014 -10.000 1.00 31.23 ? 15  ARG B NH2  1  
ATOM 2602   H H    . ARG B 1 15  ? -11.521 -8.043  -12.885 1.00 72.10 ? 15  ARG B H    1  
ATOM 2603   H HA   . ARG B 1 15  ? -10.356 -8.707  -10.353 1.00 2.50  ? 15  ARG B HA   1  
ATOM 2604   H HB2  . ARG B 1 15  ? -9.659  -10.664 -11.818 1.00 34.40 ? 15  ARG B HB2  1  
ATOM 2605   H HB3  . ARG B 1 15  ? -8.812  -9.533  -12.867 1.00 44.53 ? 15  ARG B HB3  1  
ATOM 2606   H HG2  . ARG B 1 15  ? -7.344  -8.914  -10.941 1.00 1.24  ? 15  ARG B HG2  1  
ATOM 2607   H HG3  . ARG B 1 15  ? -8.158  -10.135 -9.959  1.00 72.23 ? 15  ARG B HG3  1  
ATOM 2608   H HD2  . ARG B 1 15  ? -7.433  -11.882 -11.595 1.00 3.42  ? 15  ARG B HD2  1  
ATOM 2609   H HD3  . ARG B 1 15  ? -6.566  -10.636 -12.504 1.00 4.51  ? 15  ARG B HD3  1  
ATOM 2610   H HE   . ARG B 1 15  ? -5.750  -10.621 -9.811  1.00 52.10 ? 15  ARG B HE   1  
ATOM 2611   H HH11 . ARG B 1 15  ? -5.290  -12.496 -12.740 1.00 42.40 ? 15  ARG B HH11 1  
ATOM 2612   H HH12 . ARG B 1 15  ? -3.752  -13.117 -12.237 1.00 0.54  ? 15  ARG B HH12 1  
ATOM 2613   H HH21 . ARG B 1 15  ? -3.824  -11.549 -9.107  1.00 43.05 ? 15  ARG B HH21 1  
ATOM 2614   H HH22 . ARG B 1 15  ? -2.924  -12.581 -10.182 1.00 35.41 ? 15  ARG B HH22 1  
ATOM 2615   N N    . ILE B 1 16  ? -9.070  -6.546  -10.564 1.00 62.05 ? 16  ILE B N    1  
ATOM 2616   C CA   . ILE B 1 16  ? -8.191  -5.361  -10.599 1.00 44.21 ? 16  ILE B CA   1  
ATOM 2617   C C    . ILE B 1 16  ? -6.904  -5.779  -9.904  1.00 41.44 ? 16  ILE B C    1  
ATOM 2618   O O    . ILE B 1 16  ? -6.964  -6.422  -8.854  1.00 45.53 ? 16  ILE B O    1  
ATOM 2619   C CB   . ILE B 1 16  ? -8.810  -4.117  -9.855  1.00 73.22 ? 16  ILE B CB   1  
ATOM 2620   C CG1  . ILE B 1 16  ? -10.060 -3.584  -10.621 1.00 44.22 ? 16  ILE B CG1  1  
ATOM 2621   C CG2  . ILE B 1 16  ? -7.752  -2.996  -9.668  1.00 55.33 ? 16  ILE B CG2  1  
ATOM 2622   C CD1  . ILE B 1 16  ? -10.932 -2.621  -9.835  1.00 52.53 ? 16  ILE B CD1  1  
ATOM 2623   H H    . ILE B 1 16  ? -9.346  -6.877  -9.687  1.00 74.25 ? 16  ILE B H    1  
ATOM 2624   H HA   . ILE B 1 16  ? -7.977  -5.093  -11.639 1.00 43.23 ? 16  ILE B HA   1  
ATOM 2625   H HB   . ILE B 1 16  ? -9.121  -4.444  -8.864  1.00 22.44 ? 16  ILE B HB   1  
ATOM 2626   H HG12 . ILE B 1 16  ? -9.743  -3.074  -11.521 1.00 72.24 ? 16  ILE B HG12 1  
ATOM 2627   H HG13 . ILE B 1 16  ? -10.685 -4.421  -10.904 1.00 3.22  ? 16  ILE B HG13 1  
ATOM 2628   H HG21 . ILE B 1 16  ? -8.125  -2.246  -9.001  1.00 33.14 ? 16  ILE B HG21 1  
ATOM 2629   H HG22 . ILE B 1 16  ? -7.523  -2.541  -10.622 1.00 42.34 ? 16  ILE B HG22 1  
ATOM 2630   H HG23 . ILE B 1 16  ? -6.844  -3.407  -9.250  1.00 74.23 ? 16  ILE B HG23 1  
ATOM 2631   H HD11 . ILE B 1 16  ? -11.635 -2.149  -10.501 1.00 24.32 ? 16  ILE B HD11 1  
ATOM 2632   H HD12 . ILE B 1 16  ? -10.325 -1.864  -9.356  1.00 31.23 ? 16  ILE B HD12 1  
ATOM 2633   H HD13 . ILE B 1 16  ? -11.477 -3.178  -9.090  1.00 32.44 ? 16  ILE B HD13 1  
ATOM 2634   N N    . TYR B 1 17  ? -5.750  -5.435  -10.488 1.00 71.34 ? 17  TYR B N    1  
ATOM 2635   C CA   . TYR B 1 17  ? -4.461  -5.896  -9.973  1.00 63.41 ? 17  TYR B CA   1  
ATOM 2636   C C    . TYR B 1 17  ? -3.305  -5.143  -10.632 1.00 63.33 ? 17  TYR B C    1  
ATOM 2637   O O    . TYR B 1 17  ? -3.391  -4.727  -11.786 1.00 52.05 ? 17  TYR B O    1  
ATOM 2638   C CB   . TYR B 1 17  ? -4.286  -7.422  -10.219 1.00 43.22 ? 17  TYR B CB   1  
ATOM 2639   C CG   . TYR B 1 17  ? -4.311  -7.829  -11.701 1.00 43.32 ? 17  TYR B CG   1  
ATOM 2640   C CD1  . TYR B 1 17  ? -5.490  -7.769  -12.449 1.00 75.11 ? 17  TYR B CD1  1  
ATOM 2641   C CD2  . TYR B 1 17  ? -3.162  -8.251  -12.355 1.00 2.21  ? 17  TYR B CD2  1  
ATOM 2642   C CE1  . TYR B 1 17  ? -5.518  -8.116  -13.775 1.00 31.24 ? 17  TYR B CE1  1  
ATOM 2643   C CE2  . TYR B 1 17  ? -3.197  -8.595  -13.682 1.00 0.13  ? 17  TYR B CE2  1  
ATOM 2644   C CZ   . TYR B 1 17  ? -4.366  -8.528  -14.384 1.00 41.10 ? 17  TYR B CZ   1  
ATOM 2645   O OH   . TYR B 1 17  ? -4.370  -8.885  -15.701 1.00 63.43 ? 17  TYR B OH   1  
ATOM 2646   H H    . TYR B 1 17  ? -5.766  -4.849  -11.278 1.00 55.51 ? 17  TYR B H    1  
ATOM 2647   H HA   . TYR B 1 17  ? -4.451  -5.696  -8.900  1.00 4.42  ? 17  TYR B HA   1  
ATOM 2648   H HB2  . TYR B 1 17  ? -3.338  -7.743  -9.790  1.00 61.43 ? 17  TYR B HB2  1  
ATOM 2649   H HB3  . TYR B 1 17  ? -5.086  -7.959  -9.704  1.00 11.30 ? 17  TYR B HB3  1  
ATOM 2650   H HD1  . TYR B 1 17  ? -6.404  -7.448  -11.962 1.00 71.44 ? 17  TYR B HD1  1  
ATOM 2651   H HD2  . TYR B 1 17  ? -2.229  -8.310  -11.806 1.00 55.34 ? 17  TYR B HD2  1  
ATOM 2652   H HE1  . TYR B 1 17  ? -6.447  -8.056  -14.334 1.00 63.10 ? 17  TYR B HE1  1  
ATOM 2653   H HE2  . TYR B 1 17  ? -2.292  -8.906  -14.173 1.00 45.32 ? 17  TYR B HE2  1  
ATOM 2654   H HH   . TYR B 1 17  ? -4.704  -8.149  -16.218 1.00 20.10 ? 17  TYR B HH   1  
ATOM 2655   N N    . THR B 1 18  ? -2.211  -5.010  -9.897  1.00 75.33 ? 18  THR B N    1  
ATOM 2656   C CA   . THR B 1 18  ? -0.990  -4.415  -10.406 1.00 53.50 ? 18  THR B CA   1  
ATOM 2657   C C    . THR B 1 18  ? -0.198  -5.486  -11.186 1.00 70.52 ? 18  THR B C    1  
ATOM 2658   O O    . THR B 1 18  ? -0.029  -6.607  -10.707 1.00 31.22 ? 18  THR B O    1  
ATOM 2659   C CB   . THR B 1 18  ? -0.142  -3.839  -9.235  1.00 14.33 ? 18  THR B CB   1  
ATOM 2660   O OG1  . THR B 1 18  ? -0.977  -3.027  -8.380  1.00 24.23 ? 18  THR B OG1  1  
ATOM 2661   C CG2  . THR B 1 18  ? 1.035   -2.997  -9.750  1.00 51.00 ? 18  THR B CG2  1  
ATOM 2662   H H    . THR B 1 18  ? -2.224  -5.332  -8.978  1.00 61.24 ? 18  THR B H    1  
ATOM 2663   H HA   . THR B 1 18  ? -1.259  -3.595  -11.077 1.00 5.44  ? 18  THR B HA   1  
ATOM 2664   H HB   . THR B 1 18  ? 0.246   -4.662  -8.642  1.00 14.41 ? 18  THR B HB   1  
ATOM 2665   H HG1  . THR B 1 18  ? -1.251  -3.538  -7.609  1.00 62.50 ? 18  THR B HG1  1  
ATOM 2666   H HG21 . THR B 1 18  ? 0.850   -2.634  -10.746 1.00 54.34 ? 18  THR B HG21 1  
ATOM 2667   H HG22 . THR B 1 18  ? 1.947   -3.579  -9.752  1.00 13.52 ? 18  THR B HG22 1  
ATOM 2668   H HG23 . THR B 1 18  ? 1.181   -2.148  -9.099  1.00 50.21 ? 18  THR B HG23 1  
ATOM 2669   N N    . LYS B 1 19  ? 0.222   -5.153  -12.415 1.00 72.51 ? 19  LYS B N    1  
ATOM 2670   C CA   . LYS B 1 19  ? 1.022   -6.053  -13.272 1.00 62.23 ? 19  LYS B CA   1  
ATOM 2671   C C    . LYS B 1 19  ? 2.505   -5.713  -13.175 1.00 65.25 ? 19  LYS B C    1  
ATOM 2672   O O    . LYS B 1 19  ? 3.360   -6.594  -13.313 1.00 52.14 ? 19  LYS B O    1  
ATOM 2673   C CB   . LYS B 1 19  ? 0.566   -5.946  -14.738 1.00 21.05 ? 19  LYS B CB   1  
ATOM 2674   C CG   . LYS B 1 19  ? -0.928  -6.235  -14.939 1.00 12.24 ? 19  LYS B CG   1  
ATOM 2675   C CD   . LYS B 1 19  ? -1.322  -6.320  -16.425 1.00 2.43  ? 19  LYS B CD   1  
ATOM 2676   C CE   . LYS B 1 19  ? -0.678  -7.508  -17.153 1.00 0.23  ? 19  LYS B CE   1  
ATOM 2677   N NZ   . LYS B 1 19  ? -0.999  -7.493  -18.605 1.00 21.14 ? 19  LYS B NZ   1  
ATOM 2678   H H    . LYS B 1 19  ? -0.016  -4.274  -12.758 1.00 55.21 ? 19  LYS B H    1  
ATOM 2679   H HA   . LYS B 1 19  ? 0.878   -7.077  -12.933 1.00 34.21 ? 19  LYS B HA   1  
ATOM 2680   H HB2  . LYS B 1 19  ? 0.775   -4.943  -15.107 1.00 32.10 ? 19  LYS B HB2  1  
ATOM 2681   H HB3  . LYS B 1 19  ? 1.135   -6.657  -15.331 1.00 2.31  ? 19  LYS B HB3  1  
ATOM 2682   H HG2  . LYS B 1 19  ? -1.170  -7.178  -14.457 1.00 60.54 ? 19  LYS B HG2  1  
ATOM 2683   H HG3  . LYS B 1 19  ? -1.500  -5.442  -14.467 1.00 52.10 ? 19  LYS B HG3  1  
ATOM 2684   H HD2  . LYS B 1 19  ? -2.400  -6.416  -16.494 1.00 61.54 ? 19  LYS B HD2  1  
ATOM 2685   H HD3  . LYS B 1 19  ? -1.021  -5.401  -16.920 1.00 4.02  ? 19  LYS B HD3  1  
ATOM 2686   H HE2  . LYS B 1 19  ? 0.395   -7.457  -17.034 1.00 2.15  ? 19  LYS B HE2  1  
ATOM 2687   H HE3  . LYS B 1 19  ? -1.044  -8.436  -16.719 1.00 33.52 ? 19  LYS B HE3  1  
ATOM 2688   H HZ1  . LYS B 1 19  ? -0.639  -8.347  -19.067 1.00 2.45  ? 19  LYS B HZ1  1  
ATOM 2689   H HZ2  . LYS B 1 19  ? -0.573  -6.662  -19.060 1.00 51.42 ? 19  LYS B HZ2  1  
ATOM 2690   H HZ3  . LYS B 1 19  ? -2.028  -7.447  -18.740 1.00 14.20 ? 19  LYS B HZ3  1  
ATOM 2691   N N    . ASP B 1 20  ? 2.808   -4.431  -12.937 1.00 70.25 ? 20  ASP B N    1  
ATOM 2692   C CA   . ASP B 1 20  ? 4.193   -3.941  -12.913 1.00 12.14 ? 20  ASP B CA   1  
ATOM 2693   C C    . ASP B 1 20  ? 4.346   -2.837  -11.863 1.00 72.24 ? 20  ASP B C    1  
ATOM 2694   O O    . ASP B 1 20  ? 3.466   -1.996  -11.703 1.00 64.11 ? 20  ASP B O    1  
ATOM 2695   C CB   . ASP B 1 20  ? 4.613   -3.427  -14.324 1.00 44.13 ? 20  ASP B CB   1  
ATOM 2696   C CG   . ASP B 1 20  ? 6.132   -3.204  -14.490 1.00 64.42 ? 20  ASP B CG   1  
ATOM 2697   O OD1  . ASP B 1 20  ? 6.807   -4.068  -15.102 1.00 3.12  ? 20  ASP B OD1  1  
ATOM 2698   O OD2  . ASP B 1 20  ? 6.658   -2.174  -14.013 1.00 54.14 ? 20  ASP B OD2  1  
ATOM 2699   H H    . ASP B 1 20  ? 2.081   -3.795  -12.767 1.00 31.11 ? 20  ASP B H    1  
ATOM 2700   H HA   . ASP B 1 20  ? 4.838   -4.776  -12.637 1.00 54.23 ? 20  ASP B HA   1  
ATOM 2701   H HB2  . ASP B 1 20  ? 4.285   -4.147  -15.066 1.00 1.23  ? 20  ASP B HB2  1  
ATOM 2702   H HB3  . ASP B 1 20  ? 4.105   -2.488  -14.526 1.00 72.55 ? 20  ASP B HB3  1  
ATOM 2703   N N    . ILE B 1 21  ? 5.462   -2.881  -11.142 1.00 50.11 ? 21  ILE B N    1  
ATOM 2704   C CA   . ILE B 1 21  ? 5.899   -1.838  -10.200 1.00 13.41 ? 21  ILE B CA   1  
ATOM 2705   C C    . ILE B 1 21  ? 7.357   -1.537  -10.523 1.00 61.21 ? 21  ILE B C    1  
ATOM 2706   O O    . ILE B 1 21  ? 8.141   -2.448  -10.788 1.00 74.33 ? 21  ILE B O    1  
ATOM 2707   C CB   . ILE B 1 21  ? 5.777   -2.274  -8.677  1.00 34.14 ? 21  ILE B CB   1  
ATOM 2708   C CG1  . ILE B 1 21  ? 4.283   -2.450  -8.279  1.00 5.33  ? 21  ILE B CG1  1  
ATOM 2709   C CG2  . ILE B 1 21  ? 6.493   -1.279  -7.704  1.00 10.13 ? 21  ILE B CG2  1  
ATOM 2710   C CD1  . ILE B 1 21  ? 3.461   -1.183  -8.433  1.00 3.21  ? 21  ILE B CD1  1  
ATOM 2711   H H    . ILE B 1 21  ? 6.057   -3.647  -11.273 1.00 20.04 ? 21  ILE B H    1  
ATOM 2712   H HA   . ILE B 1 21  ? 5.300   -0.934  -10.361 1.00 61.14 ? 21  ILE B HA   1  
ATOM 2713   H HB   . ILE B 1 21  ? 6.267   -3.239  -8.579  1.00 32.00 ? 21  ILE B HB   1  
ATOM 2714   H HG12 . ILE B 1 21  ? 3.829   -3.204  -8.914  1.00 15.31 ? 21  ILE B HG12 1  
ATOM 2715   H HG13 . ILE B 1 21  ? 4.201   -2.774  -7.250  1.00 74.01 ? 21  ILE B HG13 1  
ATOM 2716   H HG21 . ILE B 1 21  ? 7.119   -1.831  -7.020  1.00 62.23 ? 21  ILE B HG21 1  
ATOM 2717   H HG22 . ILE B 1 21  ? 5.768   -0.714  -7.131  1.00 54.42 ? 21  ILE B HG22 1  
ATOM 2718   H HG23 . ILE B 1 21  ? 7.107   -0.580  -8.249  1.00 54.11 ? 21  ILE B HG23 1  
ATOM 2719   H HD11 . ILE B 1 21  ? 3.209   -1.050  -9.473  1.00 61.51 ? 21  ILE B HD11 1  
ATOM 2720   H HD12 . ILE B 1 21  ? 4.006   -0.327  -8.108  1.00 44.34 ? 21  ILE B HD12 1  
ATOM 2721   H HD13 . ILE B 1 21  ? 2.553   -1.272  -7.864  1.00 62.54 ? 21  ILE B HD13 1  
ATOM 2722   N N    . SER B 1 22  ? 7.708   -0.264  -10.483 1.00 43.23 ? 22  SER B N    1  
ATOM 2723   C CA   . SER B 1 22  ? 9.059   0.193   -10.751 1.00 44.53 ? 22  SER B CA   1  
ATOM 2724   C C    . SER B 1 22  ? 9.326   1.427   -9.896  1.00 52.11 ? 22  SER B C    1  
ATOM 2725   O O    . SER B 1 22  ? 8.445   2.284   -9.721  1.00 13.01 ? 22  SER B O    1  
ATOM 2726   C CB   . SER B 1 22  ? 9.234   0.496   -12.260 1.00 2.10  ? 22  SER B CB   1  
ATOM 2727   O OG   . SER B 1 22  ? 10.565  0.881   -12.567 1.00 0.43  ? 22  SER B OG   1  
ATOM 2728   H H    . SER B 1 22  ? 7.023   0.408   -10.254 1.00 21.21 ? 22  SER B H    1  
ATOM 2729   H HA   . SER B 1 22  ? 9.757   -0.595  -10.459 1.00 61.42 ? 22  SER B HA   1  
ATOM 2730   H HB2  . SER B 1 22  ? 8.994   -0.388  -12.835 1.00 34.12 ? 22  SER B HB2  1  
ATOM 2731   H HB3  . SER B 1 22  ? 8.566   1.301   -12.550 1.00 72.24 ? 22  SER B HB3  1  
ATOM 2732   H HG   . SER B 1 22  ? 11.034  0.133   -12.957 1.00 4.14  ? 22  SER B HG   1  
ATOM 2733   N N    . PHE B 1 23  ? 10.525  1.483   -9.327  1.00 42.34 ? 23  PHE B N    1  
ATOM 2734   C CA   . PHE B 1 23  ? 11.012  2.628   -8.574  1.00 32.54 ? 23  PHE B CA   1  
ATOM 2735   C C    . PHE B 1 23  ? 12.538  2.607   -8.634  1.00 63.02 ? 23  PHE B C    1  
ATOM 2736   O O    . PHE B 1 23  ? 13.167  1.736   -8.052  1.00 42.43 ? 23  PHE B O    1  
ATOM 2737   C CB   . PHE B 1 23  ? 10.500  2.603   -7.106  1.00 52.14 ? 23  PHE B CB   1  
ATOM 2738   C CG   . PHE B 1 23  ? 10.995  3.781   -6.272  1.00 40.42 ? 23  PHE B CG   1  
ATOM 2739   C CD1  . PHE B 1 23  ? 10.415  5.043   -6.406  1.00 72.44 ? 23  PHE B CD1  1  
ATOM 2740   C CD2  . PHE B 1 23  ? 12.059  3.635   -5.386  1.00 11.12 ? 23  PHE B CD2  1  
ATOM 2741   C CE1  . PHE B 1 23  ? 10.890  6.118   -5.686  1.00 71.31 ? 23  PHE B CE1  1  
ATOM 2742   C CE2  . PHE B 1 23  ? 12.527  4.707   -4.666  1.00 34.55 ? 23  PHE B CE2  1  
ATOM 2743   C CZ   . PHE B 1 23  ? 11.948  5.948   -4.815  1.00 64.23 ? 23  PHE B CZ   1  
ATOM 2744   H H    . PHE B 1 23  ? 11.119  0.706   -9.424  1.00 12.50 ? 23  PHE B H    1  
ATOM 2745   H HA   . PHE B 1 23  ? 10.647  3.534   -9.064  1.00 53.11 ? 23  PHE B HA   1  
ATOM 2746   H HB2  . PHE B 1 23  ? 9.414   2.624   -7.109  1.00 54.20 ? 23  PHE B HB2  1  
ATOM 2747   H HB3  . PHE B 1 23  ? 10.823  1.683   -6.628  1.00 63.41 ? 23  PHE B HB3  1  
ATOM 2748   H HD1  . PHE B 1 23  ? 9.586   5.182   -7.089  1.00 63.00 ? 23  PHE B HD1  1  
ATOM 2749   H HD2  . PHE B 1 23  ? 12.514  2.657   -5.261  1.00 11.42 ? 23  PHE B HD2  1  
ATOM 2750   H HE1  . PHE B 1 23  ? 10.427  7.096   -5.797  1.00 45.35 ? 23  PHE B HE1  1  
ATOM 2751   H HE2  . PHE B 1 23  ? 13.357  4.578   -3.983  1.00 13.32 ? 23  PHE B HE2  1  
ATOM 2752   H HZ   . PHE B 1 23  ? 12.334  6.790   -4.249  1.00 4.23  ? 23  PHE B HZ   1  
ATOM 2753   N N    . GLU B 1 24  ? 13.105  3.566   -9.354  1.00 63.22 ? 24  GLU B N    1  
ATOM 2754   C CA   . GLU B 1 24  ? 14.546  3.723   -9.540  1.00 72.21 ? 24  GLU B CA   1  
ATOM 2755   C C    . GLU B 1 24  ? 14.957  5.073   -8.949  1.00 21.13 ? 24  GLU B C    1  
ATOM 2756   O O    . GLU B 1 24  ? 14.529  6.125   -9.427  1.00 0.32  ? 24  GLU B O    1  
ATOM 2757   C CB   . GLU B 1 24  ? 14.890  3.665   -11.056 1.00 23.23 ? 24  GLU B CB   1  
ATOM 2758   C CG   . GLU B 1 24  ? 14.535  2.328   -11.739 1.00 33.20 ? 24  GLU B CG   1  
ATOM 2759   C CD   . GLU B 1 24  ? 14.821  2.336   -13.249 1.00 42.25 ? 24  GLU B CD   1  
ATOM 2760   O OE1  . GLU B 1 24  ? 13.893  2.605   -14.037 1.00 14.23 ? 24  GLU B OE1  1  
ATOM 2761   O OE2  . GLU B 1 24  ? 15.980  2.101   -13.651 1.00 35.32 ? 24  GLU B OE2  1  
ATOM 2762   H H    . GLU B 1 24  ? 12.526  4.202   -9.794  1.00 21.22 ? 24  GLU B H    1  
ATOM 2763   H HA   . GLU B 1 24  ? 15.066  2.918   -9.016  1.00 53.31 ? 24  GLU B HA   1  
ATOM 2764   H HB2  . GLU B 1 24  ? 14.356  4.462   -11.568 1.00 11.21 ? 24  GLU B HB2  1  
ATOM 2765   H HB3  . GLU B 1 24  ? 15.955  3.835   -11.178 1.00 52.33 ? 24  GLU B HB3  1  
ATOM 2766   H HG2  . GLU B 1 24  ? 15.111  1.530   -11.275 1.00 61.51 ? 24  GLU B HG2  1  
ATOM 2767   H HG3  . GLU B 1 24  ? 13.480  2.127   -11.579 1.00 4.24  ? 24  GLU B HG3  1  
ATOM 2768   N N    . ALA B 1 25  ? 15.759  5.028   -7.889  1.00 43.40 ? 25  ALA B N    1  
ATOM 2769   C CA   . ALA B 1 25  ? 16.326  6.209   -7.239  1.00 13.41 ? 25  ALA B CA   1  
ATOM 2770   C C    . ALA B 1 25  ? 17.855  6.214   -7.485  1.00 63.11 ? 25  ALA B C    1  
ATOM 2771   O O    . ALA B 1 25  ? 18.624  5.709   -6.653  1.00 54.31 ? 25  ALA B O    1  
ATOM 2772   C CB   . ALA B 1 25  ? 15.957  6.203   -5.741  1.00 72.43 ? 25  ALA B CB   1  
ATOM 2773   H H    . ALA B 1 25  ? 15.983  4.155   -7.521  1.00 1.35  ? 25  ALA B H    1  
ATOM 2774   H HA   . ALA B 1 25  ? 15.899  7.106   -7.687  1.00 31.22 ? 25  ALA B HA   1  
ATOM 2775   H HB1  . ALA B 1 25  ? 16.438  5.376   -5.241  1.00 60.32 ? 25  ALA B HB1  1  
ATOM 2776   H HB2  . ALA B 1 25  ? 14.902  6.104   -5.618  1.00 22.53 ? 25  ALA B HB2  1  
ATOM 2777   H HB3  . ALA B 1 25  ? 16.275  7.127   -5.286  1.00 10.52 ? 25  ALA B HB3  1  
ATOM 2778   N N    . PRO B 1 26  ? 18.323  6.742   -8.672  1.00 33.21 ? 26  PRO B N    1  
ATOM 2779   C CA   . PRO B 1 26  ? 19.740  6.616   -9.106  1.00 22.02 ? 26  PRO B CA   1  
ATOM 2780   C C    . PRO B 1 26  ? 20.701  7.519   -8.297  1.00 44.22 ? 26  PRO B C    1  
ATOM 2781   O O    . PRO B 1 26  ? 21.846  7.141   -8.037  1.00 1.14  ? 26  PRO B O    1  
ATOM 2782   C CB   . PRO B 1 26  ? 19.675  7.029   -10.603 1.00 1.32  ? 26  PRO B CB   1  
ATOM 2783   C CG   . PRO B 1 26  ? 18.529  7.993   -10.680 1.00 54.15 ? 26  PRO B CG   1  
ATOM 2784   C CD   . PRO B 1 26  ? 17.505  7.491   -9.681  1.00 64.01 ? 26  PRO B CD   1  
ATOM 2785   H HA   . PRO B 1 26  ? 20.079  5.585   -9.030  1.00 50.14 ? 26  PRO B HA   1  
ATOM 2786   H HB2  . PRO B 1 26  ? 20.610  7.491   -10.919 1.00 13.13 ? 26  PRO B HB2  1  
ATOM 2787   H HB3  . PRO B 1 26  ? 19.473  6.161   -11.219 1.00 63.14 ? 26  PRO B HB3  1  
ATOM 2788   H HG2  . PRO B 1 26  ? 18.870  8.994   -10.411 1.00 33.45 ? 26  PRO B HG2  1  
ATOM 2789   H HG3  . PRO B 1 26  ? 18.102  8.007   -11.678 1.00 60.30 ? 26  PRO B HG3  1  
ATOM 2790   H HD2  . PRO B 1 26  ? 16.981  8.319   -9.217  1.00 5.42  ? 26  PRO B HD2  1  
ATOM 2791   H HD3  . PRO B 1 26  ? 16.797  6.824   -10.161 1.00 2.14  ? 26  PRO B HD3  1  
ATOM 2792   N N    . ASN B 1 27  ? 20.205  8.706   -7.899  1.00 54.15 ? 27  ASN B N    1  
ATOM 2793   C CA   . ASN B 1 27  ? 20.990  9.726   -7.167  1.00 22.12 ? 27  ASN B CA   1  
ATOM 2794   C C    . ASN B 1 27  ? 20.730  9.656   -5.658  1.00 44.42 ? 27  ASN B C    1  
ATOM 2795   O O    . ASN B 1 27  ? 21.385  10.387  -4.900  1.00 53.14 ? 27  ASN B O    1  
ATOM 2796   C CB   . ASN B 1 27  ? 20.616  11.146  -7.663  1.00 22.33 ? 27  ASN B CB   1  
ATOM 2797   C CG   . ASN B 1 27  ? 20.928  11.419  -9.139  1.00 52.11 ? 27  ASN B CG   1  
ATOM 2798   O OD1  . ASN B 1 27  ? 20.903  10.522  -9.981  1.00 50.41 ? 27  ASN B OD1  1  
ATOM 2799   N ND2  . ASN B 1 27  ? 21.207  12.670  -9.461  1.00 43.15 ? 27  ASN B ND2  1  
ATOM 2800   H H    . ASN B 1 27  ? 19.267  8.903   -8.103  1.00 15.40 ? 27  ASN B H    1  
ATOM 2801   H HA   . ASN B 1 27  ? 22.046  9.554   -7.354  1.00 64.22 ? 27  ASN B HA   1  
ATOM 2802   H HB2  . ASN B 1 27  ? 19.553  11.305  -7.516  1.00 12.41 ? 27  ASN B HB2  1  
ATOM 2803   H HB3  . ASN B 1 27  ? 21.156  11.877  -7.063  1.00 1.51  ? 27  ASN B HB3  1  
ATOM 2804   H HD21 . ASN B 1 27  ? 21.203  13.345  -8.747  1.00 34.41 ? 27  ASN B HD21 1  
ATOM 2805   H HD22 . ASN B 1 27  ? 21.401  12.871  -10.395 1.00 15.44 ? 27  ASN B HD22 1  
ATOM 2806   N N    . ALA B 1 28  ? 19.808  8.737   -5.253  1.00 34.24 ? 28  ALA B N    1  
ATOM 2807   C CA   . ALA B 1 28  ? 19.162  8.680   -3.908  1.00 22.44 ? 28  ALA B CA   1  
ATOM 2808   C C    . ALA B 1 28  ? 20.088  9.087   -2.719  1.00 61.54 ? 28  ALA B C    1  
ATOM 2809   O O    . ALA B 1 28  ? 19.819  10.135  -2.123  1.00 51.05 ? 28  ALA B O    1  
ATOM 2810   C CB   . ALA B 1 28  ? 18.509  7.292   -3.683  1.00 52.12 ? 28  ALA B CB   1  
ATOM 2811   H H    . ALA B 1 28  ? 19.547  8.048   -5.902  1.00 23.34 ? 28  ALA B H    1  
ATOM 2812   H HA   . ALA B 1 28  ? 18.350  9.407   -3.951  1.00 15.10 ? 28  ALA B HA   1  
ATOM 2813   H HB1  . ALA B 1 28  ? 18.457  7.063   -2.633  1.00 51.12 ? 28  ALA B HB1  1  
ATOM 2814   H HB2  . ALA B 1 28  ? 19.089  6.525   -4.182  1.00 14.21 ? 28  ALA B HB2  1  
ATOM 2815   H HB3  . ALA B 1 28  ? 17.507  7.287   -4.087  1.00 11.33 ? 28  ALA B HB3  1  
ATOM 2816   N N    . PRO B 1 29  ? 21.229  8.351   -2.413  1.00 10.30 ? 29  PRO B N    1  
ATOM 2817   C CA   . PRO B 1 29  ? 22.060  8.613   -1.196  1.00 2.33  ? 29  PRO B CA   1  
ATOM 2818   C C    . PRO B 1 29  ? 22.547  10.065  -1.079  1.00 60.41 ? 29  PRO B C    1  
ATOM 2819   O O    . PRO B 1 29  ? 22.743  10.584  0.019   1.00 75.00 ? 29  PRO B O    1  
ATOM 2820   C CB   . PRO B 1 29  ? 23.271  7.666   -1.362  1.00 62.00 ? 29  PRO B CB   1  
ATOM 2821   C CG   . PRO B 1 29  ? 22.810  6.596   -2.293  1.00 31.13 ? 29  PRO B CG   1  
ATOM 2822   C CD   . PRO B 1 29  ? 21.815  7.238   -3.220  1.00 54.42 ? 29  PRO B CD   1  
ATOM 2823   H HA   . PRO B 1 29  ? 21.508  8.348   -0.299  1.00 20.15 ? 29  PRO B HA   1  
ATOM 2824   H HB2  . PRO B 1 29  ? 24.128  8.203   -1.782  1.00 41.52 ? 29  PRO B HB2  1  
ATOM 2825   H HB3  . PRO B 1 29  ? 23.547  7.237   -0.407  1.00 45.40 ? 29  PRO B HB3  1  
ATOM 2826   H HG2  . PRO B 1 29  ? 23.653  6.197   -2.852  1.00 62.31 ? 29  PRO B HG2  1  
ATOM 2827   H HG3  . PRO B 1 29  ? 22.329  5.798   -1.733  1.00 72.04 ? 29  PRO B HG3  1  
ATOM 2828   H HD2  . PRO B 1 29  ? 22.296  7.627   -4.115  1.00 43.43 ? 29  PRO B HD2  1  
ATOM 2829   H HD3  . PRO B 1 29  ? 21.037  6.530   -3.498  1.00 53.42 ? 29  PRO B HD3  1  
ATOM 2830   N N    . HIS B 1 30  ? 22.755  10.681  -2.249  1.00 11.24 ? 30  HIS B N    1  
ATOM 2831   C CA   . HIS B 1 30  ? 23.350  12.011  -2.380  1.00 20.32 ? 30  HIS B CA   1  
ATOM 2832   C C    . HIS B 1 30  ? 22.275  13.093  -2.519  1.00 54.35 ? 30  HIS B C    1  
ATOM 2833   O O    . HIS B 1 30  ? 22.441  14.190  -2.007  1.00 10.44 ? 30  HIS B O    1  
ATOM 2834   C CB   . HIS B 1 30  ? 24.297  12.024  -3.599  1.00 35.44 ? 30  HIS B CB   1  
ATOM 2835   C CG   . HIS B 1 30  ? 25.385  10.984  -3.508  1.00 74.51 ? 30  HIS B CG   1  
ATOM 2836   N ND1  . HIS B 1 30  ? 25.249  9.704   -4.009  1.00 43.20 ? 30  HIS B ND1  1  
ATOM 2837   C CD2  . HIS B 1 30  ? 26.600  11.024  -2.923  1.00 34.23 ? 30  HIS B CD2  1  
ATOM 2838   C CE1  . HIS B 1 30  ? 26.332  9.010   -3.734  1.00 31.32 ? 30  HIS B CE1  1  
ATOM 2839   N NE2  . HIS B 1 30  ? 27.169  9.790   -3.080  1.00 62.40 ? 30  HIS B NE2  1  
ATOM 2840   H H    . HIS B 1 30  ? 22.468  10.220  -3.063  1.00 62.34 ? 30  HIS B H    1  
ATOM 2841   H HA   . HIS B 1 30  ? 23.932  12.216  -1.486  1.00 42.34 ? 30  HIS B HA   1  
ATOM 2842   H HB2  . HIS B 1 30  ? 23.729  11.833  -4.504  1.00 74.15 ? 30  HIS B HB2  1  
ATOM 2843   H HB3  . HIS B 1 30  ? 24.768  12.997  -3.678  1.00 22.01 ? 30  HIS B HB3  1  
ATOM 2844   H HD1  . HIS B 1 30  ? 24.480  9.361   -4.514  1.00 62.41 ? 30  HIS B HD1  1  
ATOM 2845   H HD2  . HIS B 1 30  ? 27.046  11.876  -2.429  1.00 44.04 ? 30  HIS B HD2  1  
ATOM 2846   H HE1  . HIS B 1 30  ? 26.508  7.976   -3.997  1.00 62.25 ? 30  HIS B HE1  1  
ATOM 2847   H HE2  . HIS B 1 30  ? 28.122  9.596   -2.950  1.00 37.65 ? 30  HIS B HE2  1  
ATOM 2848   N N    . VAL B 1 31  ? 21.153  12.764  -3.190  1.00 14.13 ? 31  VAL B N    1  
ATOM 2849   C CA   . VAL B 1 31  ? 20.119  13.764  -3.543  1.00 75.32 ? 31  VAL B CA   1  
ATOM 2850   C C    . VAL B 1 31  ? 19.280  14.183  -2.305  1.00 53.01 ? 31  VAL B C    1  
ATOM 2851   O O    . VAL B 1 31  ? 18.648  15.245  -2.309  1.00 14.14 ? 31  VAL B O    1  
ATOM 2852   C CB   . VAL B 1 31  ? 19.193  13.232  -4.704  1.00 65.22 ? 31  VAL B CB   1  
ATOM 2853   C CG1  . VAL B 1 31  ? 18.184  12.176  -4.211  1.00 53.03 ? 31  VAL B CG1  1  
ATOM 2854   C CG2  . VAL B 1 31  ? 18.481  14.383  -5.441  1.00 23.33 ? 31  VAL B CG2  1  
ATOM 2855   H H    . VAL B 1 31  ? 21.008  11.826  -3.448  1.00 72.32 ? 31  VAL B H    1  
ATOM 2856   H HA   . VAL B 1 31  ? 20.642  14.648  -3.911  1.00 23.04 ? 31  VAL B HA   1  
ATOM 2857   H HB   . VAL B 1 31  ? 19.837  12.737  -5.428  1.00 60.40 ? 31  VAL B HB   1  
ATOM 2858   H HG11 . VAL B 1 31  ? 17.491  12.627  -3.513  1.00 70.44 ? 31  VAL B HG11 1  
ATOM 2859   H HG12 . VAL B 1 31  ? 18.714  11.375  -3.716  1.00 14.55 ? 31  VAL B HG12 1  
ATOM 2860   H HG13 . VAL B 1 31  ? 17.633  11.769  -5.052  1.00 52.34 ? 31  VAL B HG13 1  
ATOM 2861   H HG21 . VAL B 1 31  ? 17.849  14.920  -4.751  1.00 52.23 ? 31  VAL B HG21 1  
ATOM 2862   H HG22 . VAL B 1 31  ? 17.874  13.990  -6.244  1.00 3.13  ? 31  VAL B HG22 1  
ATOM 2863   H HG23 . VAL B 1 31  ? 19.212  15.064  -5.848  1.00 74.41 ? 31  VAL B HG23 1  
ATOM 2864   N N    . PHE B 1 32  ? 19.319  13.348  -1.237  1.00 2.55  ? 32  PHE B N    1  
ATOM 2865   C CA   . PHE B 1 32  ? 18.607  13.612  0.040   1.00 14.24 ? 32  PHE B CA   1  
ATOM 2866   C C    . PHE B 1 32  ? 19.142  14.856  0.778   1.00 24.30 ? 32  PHE B C    1  
ATOM 2867   O O    . PHE B 1 32  ? 18.486  15.351  1.706   1.00 72.20 ? 32  PHE B O    1  
ATOM 2868   C CB   . PHE B 1 32  ? 18.685  12.390  0.987   1.00 14.32 ? 32  PHE B CB   1  
ATOM 2869   C CG   . PHE B 1 32  ? 17.956  11.143  0.493   1.00 40.32 ? 32  PHE B CG   1  
ATOM 2870   C CD1  . PHE B 1 32  ? 16.676  11.229  -0.062  1.00 64.20 ? 32  PHE B CD1  1  
ATOM 2871   C CD2  . PHE B 1 32  ? 18.532  9.882   0.616   1.00 15.34 ? 32  PHE B CD2  1  
ATOM 2872   C CE1  . PHE B 1 32  ? 16.008  10.095  -0.479  1.00 1.21  ? 32  PHE B CE1  1  
ATOM 2873   C CE2  . PHE B 1 32  ? 17.862  8.757   0.193   1.00 12.32 ? 32  PHE B CE2  1  
ATOM 2874   C CZ   . PHE B 1 32  ? 16.603  8.859   -0.354  1.00 55.11 ? 32  PHE B CZ   1  
ATOM 2875   H H    . PHE B 1 32  ? 19.844  12.519  -1.316  1.00 31.13 ? 32  PHE B H    1  
ATOM 2876   H HA   . PHE B 1 32  ? 17.565  13.791  -0.207  1.00 23.14 ? 32  PHE B HA   1  
ATOM 2877   H HB2  . PHE B 1 32  ? 19.729  12.137  1.138   1.00 71.24 ? 32  PHE B HB2  1  
ATOM 2878   H HB3  . PHE B 1 32  ? 18.255  12.656  1.950   1.00 52.23 ? 32  PHE B HB3  1  
ATOM 2879   H HD1  . PHE B 1 32  ? 16.203  12.200  -0.169  1.00 5.10  ? 32  PHE B HD1  1  
ATOM 2880   H HD2  . PHE B 1 32  ? 19.524  9.786   1.045   1.00 62.24 ? 32  PHE B HD2  1  
ATOM 2881   H HE1  . PHE B 1 32  ? 15.016  10.176  -0.908  1.00 63.03 ? 32  PHE B HE1  1  
ATOM 2882   H HE2  . PHE B 1 32  ? 18.329  7.790   0.294   1.00 64.02 ? 32  PHE B HE2  1  
ATOM 2883   H HZ   . PHE B 1 32  ? 16.078  7.966   -0.682  1.00 53.05 ? 32  PHE B HZ   1  
ATOM 2884   N N    . GLN B 1 33  ? 20.340  15.332  0.375   1.00 14.30 ? 33  GLN B N    1  
ATOM 2885   C CA   . GLN B 1 33  ? 20.932  16.586  0.887   1.00 51.32 ? 33  GLN B CA   1  
ATOM 2886   C C    . GLN B 1 33  ? 19.974  17.777  0.641   1.00 70.02 ? 33  GLN B C    1  
ATOM 2887   O O    . GLN B 1 33  ? 19.945  18.733  1.414   1.00 64.32 ? 33  GLN B O    1  
ATOM 2888   C CB   . GLN B 1 33  ? 22.318  16.846  0.220   1.00 21.55 ? 33  GLN B CB   1  
ATOM 2889   C CG   . GLN B 1 33  ? 22.254  17.161  -1.296  1.00 70.41 ? 33  GLN B CG   1  
ATOM 2890   C CD   . GLN B 1 33  ? 23.599  17.156  -2.029  1.00 62.12 ? 33  GLN B CD   1  
ATOM 2891   O OE1  . GLN B 1 33  ? 23.804  17.925  -2.965  1.00 73.03 ? 33  GLN B OE1  1  
ATOM 2892   N NE2  . GLN B 1 33  ? 24.488  16.245  -1.670  1.00 10.21 ? 33  GLN B NE2  1  
ATOM 2893   H H    . GLN B 1 33  ? 20.848  14.811  -0.286  1.00 44.45 ? 33  GLN B H    1  
ATOM 2894   H HA   . GLN B 1 33  ? 21.071  16.466  1.958   1.00 25.21 ? 33  GLN B HA   1  
ATOM 2895   H HB2  . GLN B 1 33  ? 22.794  17.682  0.721   1.00 63.12 ? 33  GLN B HB2  1  
ATOM 2896   H HB3  . GLN B 1 33  ? 22.938  15.965  0.358   1.00 52.35 ? 33  GLN B HB3  1  
ATOM 2897   H HG2  . GLN B 1 33  ? 21.625  16.421  -1.773  1.00 52.23 ? 33  GLN B HG2  1  
ATOM 2898   H HG3  . GLN B 1 33  ? 21.796  18.136  -1.423  1.00 44.41 ? 33  GLN B HG3  1  
ATOM 2899   H HE21 . GLN B 1 33  ? 24.247  15.613  -0.959  1.00 50.25 ? 33  GLN B HE21 1  
ATOM 2900   H HE22 . GLN B 1 33  ? 25.349  16.233  -2.133  1.00 55.52 ? 33  GLN B HE22 1  
ATOM 2901   N N    . LYS B 1 34  ? 19.182  17.665  -0.447  1.00 41.24 ? 34  LYS B N    1  
ATOM 2902   C CA   . LYS B 1 34  ? 18.177  18.653  -0.851  1.00 45.32 ? 34  LYS B CA   1  
ATOM 2903   C C    . LYS B 1 34  ? 16.807  18.227  -0.302  1.00 12.35 ? 34  LYS B C    1  
ATOM 2904   O O    . LYS B 1 34  ? 16.158  17.330  -0.846  1.00 23.30 ? 34  LYS B O    1  
ATOM 2905   C CB   . LYS B 1 34  ? 18.138  18.753  -2.401  1.00 74.23 ? 34  LYS B CB   1  
ATOM 2906   C CG   . LYS B 1 34  ? 19.518  19.010  -3.037  1.00 11.21 ? 34  LYS B CG   1  
ATOM 2907   C CD   . LYS B 1 34  ? 19.496  18.934  -4.574  1.00 74.21 ? 34  LYS B CD   1  
ATOM 2908   C CE   . LYS B 1 34  ? 20.898  18.979  -5.187  1.00 52.31 ? 34  LYS B CE   1  
ATOM 2909   N NZ   . LYS B 1 34  ? 20.841  18.956  -6.666  1.00 62.43 ? 34  LYS B NZ   1  
ATOM 2910   H H    . LYS B 1 34  ? 19.274  16.861  -0.999  1.00 4.33  ? 34  LYS B H    1  
ATOM 2911   H HA   . LYS B 1 34  ? 18.450  19.625  -0.439  1.00 31.44 ? 34  LYS B HA   1  
ATOM 2912   H HB2  . LYS B 1 34  ? 17.743  17.823  -2.807  1.00 34.32 ? 34  LYS B HB2  1  
ATOM 2913   H HB3  . LYS B 1 34  ? 17.476  19.563  -2.686  1.00 13.24 ? 34  LYS B HB3  1  
ATOM 2914   H HG2  . LYS B 1 34  ? 19.864  19.996  -2.739  1.00 54.23 ? 34  LYS B HG2  1  
ATOM 2915   H HG3  . LYS B 1 34  ? 20.214  18.266  -2.659  1.00 4.22  ? 34  LYS B HG3  1  
ATOM 2916   H HD2  . LYS B 1 34  ? 19.017  18.007  -4.878  1.00 4.31  ? 34  LYS B HD2  1  
ATOM 2917   H HD3  . LYS B 1 34  ? 18.918  19.769  -4.961  1.00 61.43 ? 34  LYS B HD3  1  
ATOM 2918   H HE2  . LYS B 1 34  ? 21.400  19.886  -4.870  1.00 62.30 ? 34  LYS B HE2  1  
ATOM 2919   H HE3  . LYS B 1 34  ? 21.465  18.119  -4.846  1.00 71.32 ? 34  LYS B HE3  1  
ATOM 2920   H HZ1  . LYS B 1 34  ? 20.472  19.854  -7.031  1.00 25.22 ? 34  LYS B HZ1  1  
ATOM 2921   H HZ2  . LYS B 1 34  ? 20.221  18.188  -6.989  1.00 43.33 ? 34  LYS B HZ2  1  
ATOM 2922   H HZ3  . LYS B 1 34  ? 21.791  18.798  -7.059  1.00 53.54 ? 34  LYS B HZ3  1  
ATOM 2923   N N    . ASP B 1 35  ? 16.415  18.826  0.825   1.00 21.54 ? 35  ASP B N    1  
ATOM 2924   C CA   . ASP B 1 35  ? 15.098  18.607  1.443   1.00 22.50 ? 35  ASP B CA   1  
ATOM 2925   C C    . ASP B 1 35  ? 14.046  19.518  0.767   1.00 12.03 ? 35  ASP B C    1  
ATOM 2926   O O    . ASP B 1 35  ? 13.894  20.690  1.114   1.00 74.15 ? 35  ASP B O    1  
ATOM 2927   C CB   . ASP B 1 35  ? 15.180  18.829  2.987   1.00 5.23  ? 35  ASP B CB   1  
ATOM 2928   C CG   . ASP B 1 35  ? 15.856  20.157  3.399   1.00 53.21 ? 35  ASP B CG   1  
ATOM 2929   O OD1  . ASP B 1 35  ? 15.154  21.137  3.723   1.00 32.31 ? 35  ASP B OD1  1  
ATOM 2930   O OD2  . ASP B 1 35  ? 17.103  20.226  3.388   1.00 44.31 ? 35  ASP B OD2  1  
ATOM 2931   H H    . ASP B 1 35  ? 17.035  19.443  1.258   1.00 73.34 ? 35  ASP B H    1  
ATOM 2932   H HA   . ASP B 1 35  ? 14.817  17.565  1.264   1.00 73.35 ? 35  ASP B HA   1  
ATOM 2933   H HB2  . ASP B 1 35  ? 14.178  18.802  3.399   1.00 70.33 ? 35  ASP B HB2  1  
ATOM 2934   H HB3  . ASP B 1 35  ? 15.745  18.012  3.424   1.00 20.11 ? 35  ASP B HB3  1  
ATOM 2935   N N    . TRP B 1 36  ? 13.376  18.971  -0.252  1.00 32.11 ? 36  TRP B N    1  
ATOM 2936   C CA   . TRP B 1 36  ? 12.346  19.684  -1.034  1.00 43.35 ? 36  TRP B CA   1  
ATOM 2937   C C    . TRP B 1 36  ? 11.499  18.660  -1.817  1.00 63.52 ? 36  TRP B C    1  
ATOM 2938   O O    . TRP B 1 36  ? 11.947  17.538  -2.051  1.00 75.03 ? 36  TRP B O    1  
ATOM 2939   C CB   . TRP B 1 36  ? 13.022  20.732  -1.991  1.00 30.30 ? 36  TRP B CB   1  
ATOM 2940   C CG   . TRP B 1 36  ? 12.087  21.399  -2.989  1.00 74.21 ? 36  TRP B CG   1  
ATOM 2941   C CD1  . TRP B 1 36  ? 12.173  21.343  -4.354  1.00 43.03 ? 36  TRP B CD1  1  
ATOM 2942   C CD2  . TRP B 1 36  ? 10.915  22.191  -2.701  1.00 23.40 ? 36  TRP B CD2  1  
ATOM 2943   N NE1  . TRP B 1 36  ? 11.140  22.041  -4.921  1.00 60.14 ? 36  TRP B NE1  1  
ATOM 2944   C CE2  . TRP B 1 36  ? 10.355  22.566  -3.935  1.00 4.23  ? 36  TRP B CE2  1  
ATOM 2945   C CE3  . TRP B 1 36  ? 10.288  22.615  -1.524  1.00 71.35 ? 36  TRP B CE3  1  
ATOM 2946   C CZ2  . TRP B 1 36  ? 9.200   23.336  -4.029  1.00 21.14 ? 36  TRP B CZ2  1  
ATOM 2947   C CZ3  . TRP B 1 36  ? 9.143   23.382  -1.617  1.00 72.11 ? 36  TRP B CZ3  1  
ATOM 2948   C CH2  . TRP B 1 36  ? 8.608   23.736  -2.862  1.00 55.23 ? 36  TRP B CH2  1  
ATOM 2949   H H    . TRP B 1 36  ? 13.585  18.043  -0.502  1.00 33.53 ? 36  TRP B H    1  
ATOM 2950   H HA   . TRP B 1 36  ? 11.693  20.208  -0.336  1.00 34.33 ? 36  TRP B HA   1  
ATOM 2951   H HB2  . TRP B 1 36  ? 13.468  21.515  -1.389  1.00 1.31  ? 36  TRP B HB2  1  
ATOM 2952   H HB3  . TRP B 1 36  ? 13.811  20.238  -2.547  1.00 74.12 ? 36  TRP B HB3  1  
ATOM 2953   H HD1  . TRP B 1 36  ? 12.951  20.821  -4.895  1.00 62.13 ? 36  TRP B HD1  1  
ATOM 2954   H HE1  . TRP B 1 36  ? 10.984  22.142  -5.881  1.00 65.12 ? 36  TRP B HE1  1  
ATOM 2955   H HE3  . TRP B 1 36  ? 10.687  22.352  -0.553  1.00 71.42 ? 36  TRP B HE3  1  
ATOM 2956   H HZ2  . TRP B 1 36  ? 8.776   23.609  -4.986  1.00 1.00  ? 36  TRP B HZ2  1  
ATOM 2957   H HZ3  . TRP B 1 36  ? 8.644   23.719  -0.714  1.00 11.12 ? 36  TRP B HZ3  1  
ATOM 2958   H HH2  . TRP B 1 36  ? 7.710   24.340  -2.888  1.00 1.35  ? 36  TRP B HH2  1  
ATOM 2959   N N    . GLN B 1 37  ? 10.262  19.060  -2.165  1.00 13.23 ? 37  GLN B N    1  
ATOM 2960   C CA   . GLN B 1 37  ? 9.371   18.321  -3.076  1.00 3.33  ? 37  GLN B CA   1  
ATOM 2961   C C    . GLN B 1 37  ? 9.948   18.315  -4.527  1.00 24.43 ? 37  GLN B C    1  
ATOM 2962   O O    . GLN B 1 37  ? 9.887   19.346  -5.208  1.00 74.45 ? 37  GLN B O    1  
ATOM 2963   C CB   . GLN B 1 37  ? 7.964   18.992  -3.056  1.00 5.42  ? 37  GLN B CB   1  
ATOM 2964   C CG   . GLN B 1 37  ? 7.123   18.746  -1.776  1.00 64.01 ? 37  GLN B CG   1  
ATOM 2965   C CD   . GLN B 1 37  ? 6.235   17.488  -1.817  1.00 22.21 ? 37  GLN B CD   1  
ATOM 2966   O OE1  . GLN B 1 37  ? 5.186   17.444  -1.180  1.00 53.04 ? 37  GLN B OE1  1  
ATOM 2967   N NE2  . GLN B 1 37  ? 6.621   16.457  -2.572  1.00 14.24 ? 37  GLN B NE2  1  
ATOM 2968   H H    . GLN B 1 37  ? 9.928   19.899  -1.786  1.00 12.42 ? 37  GLN B H    1  
ATOM 2969   H HA   . GLN B 1 37  ? 9.287   17.305  -2.711  1.00 63.12 ? 37  GLN B HA   1  
ATOM 2970   H HB2  . GLN B 1 37  ? 8.092   20.062  -3.177  1.00 1.25  ? 37  GLN B HB2  1  
ATOM 2971   H HB3  . GLN B 1 37  ? 7.392   18.628  -3.905  1.00 51.13 ? 37  GLN B HB3  1  
ATOM 2972   H HG2  . GLN B 1 37  ? 7.789   18.658  -0.925  1.00 44.12 ? 37  GLN B HG2  1  
ATOM 2973   H HG3  . GLN B 1 37  ? 6.478   19.606  -1.618  1.00 71.12 ? 37  GLN B HG3  1  
ATOM 2974   H HE21 . GLN B 1 37  ? 7.453   16.525  -3.076  1.00 74.33 ? 37  GLN B HE21 1  
ATOM 2975   H HE22 . GLN B 1 37  ? 6.042   15.669  -2.593  1.00 34.40 ? 37  GLN B HE22 1  
ATOM 2976   N N    . PRO B 1 38  ? 10.520  17.162  -5.020  1.00 62.53 ? 38  PRO B N    1  
ATOM 2977   C CA   . PRO B 1 38  ? 11.163  17.096  -6.359  1.00 44.04 ? 38  PRO B CA   1  
ATOM 2978   C C    . PRO B 1 38  ? 10.144  17.257  -7.499  1.00 33.51 ? 38  PRO B C    1  
ATOM 2979   O O    . PRO B 1 38  ? 9.055   16.666  -7.443  1.00 40.10 ? 38  PRO B O    1  
ATOM 2980   C CB   . PRO B 1 38  ? 11.827  15.700  -6.376  1.00 62.25 ? 38  PRO B CB   1  
ATOM 2981   C CG   . PRO B 1 38  ? 11.060  14.884  -5.383  1.00 33.21 ? 38  PRO B CG   1  
ATOM 2982   C CD   . PRO B 1 38  ? 10.590  15.847  -4.319  1.00 21.15 ? 38  PRO B CD   1  
ATOM 2983   H HA   . PRO B 1 38  ? 11.928  17.863  -6.454  1.00 54.11 ? 38  PRO B HA   1  
ATOM 2984   H HB2  . PRO B 1 38  ? 11.788  15.259  -7.372  1.00 45.12 ? 38  PRO B HB2  1  
ATOM 2985   H HB3  . PRO B 1 38  ? 12.862  15.780  -6.063  1.00 32.20 ? 38  PRO B HB3  1  
ATOM 2986   H HG2  . PRO B 1 38  ? 10.210  14.414  -5.877  1.00 2.31  ? 38  PRO B HG2  1  
ATOM 2987   H HG3  . PRO B 1 38  ? 11.696  14.122  -4.946  1.00 11.50 ? 38  PRO B HG3  1  
ATOM 2988   H HD2  . PRO B 1 38  ? 9.616   15.558  -3.941  1.00 24.42 ? 38  PRO B HD2  1  
ATOM 2989   H HD3  . PRO B 1 38  ? 11.306  15.894  -3.503  1.00 13.40 ? 38  PRO B HD3  1  
ATOM 2990   N N    . GLU B 1 39  ? 10.526  18.050  -8.525  1.00 30.13 ? 39  GLU B N    1  
ATOM 2991   C CA   . GLU B 1 39  ? 9.615   18.492  -9.593  1.00 43.11 ? 39  GLU B CA   1  
ATOM 2992   C C    . GLU B 1 39  ? 9.001   17.306  -10.358 1.00 72.22 ? 39  GLU B C    1  
ATOM 2993   O O    . GLU B 1 39  ? 9.720   16.501  -10.946 1.00 41.53 ? 39  GLU B O    1  
ATOM 2994   C CB   . GLU B 1 39  ? 10.336  19.459  -10.571 1.00 51.31 ? 39  GLU B CB   1  
ATOM 2995   C CG   . GLU B 1 39  ? 9.407   20.103  -11.628 1.00 61.13 ? 39  GLU B CG   1  
ATOM 2996   C CD   . GLU B 1 39  ? 8.186   20.825  -11.007 1.00 53.23 ? 39  GLU B CD   1  
ATOM 2997   O OE1  . GLU B 1 39  ? 7.045   20.296  -11.082 1.00 42.24 ? 39  GLU B OE1  1  
ATOM 2998   O OE2  . GLU B 1 39  ? 8.371   21.908  -10.415 1.00 65.23 ? 39  GLU B OE2  1  
ATOM 2999   H H    . GLU B 1 39  ? 11.458  18.347  -8.556  1.00 65.23 ? 39  GLU B H    1  
ATOM 3000   H HA   . GLU B 1 39  ? 8.816   19.043  -9.107  1.00 55.31 ? 39  GLU B HA   1  
ATOM 3001   H HB2  . GLU B 1 39  ? 10.800  20.251  -9.994  1.00 22.24 ? 39  GLU B HB2  1  
ATOM 3002   H HB3  . GLU B 1 39  ? 11.116  18.909  -11.089 1.00 62.41 ? 39  GLU B HB3  1  
ATOM 3003   H HG2  . GLU B 1 39  ? 9.981   20.825  -12.203 1.00 54.20 ? 39  GLU B HG2  1  
ATOM 3004   H HG3  . GLU B 1 39  ? 9.057   19.326  -12.299 1.00 34.25 ? 39  GLU B HG3  1  
ATOM 3005   N N    . VAL B 1 40  ? 7.658   17.245  -10.346 1.00 73.10 ? 40  VAL B N    1  
ATOM 3006   C CA   . VAL B 1 40  ? 6.882   16.113  -10.875 1.00 61.22 ? 40  VAL B CA   1  
ATOM 3007   C C    . VAL B 1 40  ? 6.648   16.288  -12.384 1.00 42.20 ? 40  VAL B C    1  
ATOM 3008   O O    . VAL B 1 40  ? 6.245   17.362  -12.842 1.00 50.12 ? 40  VAL B O    1  
ATOM 3009   C CB   . VAL B 1 40  ? 5.494   15.981  -10.129 1.00 42.41 ? 40  VAL B CB   1  
ATOM 3010   C CG1  . VAL B 1 40  ? 4.646   14.804  -10.678 1.00 20.20 ? 40  VAL B CG1  1  
ATOM 3011   C CG2  . VAL B 1 40  ? 5.710   15.853  -8.606  1.00 10.44 ? 40  VAL B CG2  1  
ATOM 3012   H H    . VAL B 1 40  ? 7.168   18.009  -9.981  1.00 62.01 ? 40  VAL B H    1  
ATOM 3013   H HA   . VAL B 1 40  ? 7.448   15.199  -10.702 1.00 2.42  ? 40  VAL B HA   1  
ATOM 3014   H HB   . VAL B 1 40  ? 4.931   16.896  -10.304 1.00 1.43  ? 40  VAL B HB   1  
ATOM 3015   H HG11 . VAL B 1 40  ? 3.688   14.773  -10.173 1.00 31.11 ? 40  VAL B HG11 1  
ATOM 3016   H HG12 . VAL B 1 40  ? 5.165   13.869  -10.513 1.00 3.14  ? 40  VAL B HG12 1  
ATOM 3017   H HG13 . VAL B 1 40  ? 4.482   14.936  -11.741 1.00 71.41 ? 40  VAL B HG13 1  
ATOM 3018   H HG21 . VAL B 1 40  ? 6.273   16.708  -8.247  1.00 35.13 ? 40  VAL B HG21 1  
ATOM 3019   H HG22 . VAL B 1 40  ? 6.257   14.948  -8.384  1.00 10.40 ? 40  VAL B HG22 1  
ATOM 3020   H HG23 . VAL B 1 40  ? 4.752   15.827  -8.099  1.00 21.13 ? 40  VAL B HG23 1  
ATOM 3021   N N    . LYS B 1 41  ? 6.902   15.217  -13.134 1.00 72.42 ? 41  LYS B N    1  
ATOM 3022   C CA   . LYS B 1 41  ? 6.694   15.157  -14.581 1.00 22.14 ? 41  LYS B CA   1  
ATOM 3023   C C    . LYS B 1 41  ? 5.931   13.854  -14.852 1.00 74.13 ? 41  LYS B C    1  
ATOM 3024   O O    . LYS B 1 41  ? 6.438   12.770  -14.571 1.00 34.13 ? 41  LYS B O    1  
ATOM 3025   C CB   . LYS B 1 41  ? 8.075   15.223  -15.313 1.00 14.12 ? 41  LYS B CB   1  
ATOM 3026   C CG   . LYS B 1 41  ? 8.016   15.446  -16.850 1.00 53.31 ? 41  LYS B CG   1  
ATOM 3027   C CD   . LYS B 1 41  ? 7.677   14.172  -17.660 1.00 22.13 ? 41  LYS B CD   1  
ATOM 3028   C CE   . LYS B 1 41  ? 7.468   14.448  -19.153 1.00 31.50 ? 41  LYS B CE   1  
ATOM 3029   N NZ   . LYS B 1 41  ? 7.113   13.210  -19.890 1.00 32.50 ? 41  LYS B NZ   1  
ATOM 3030   H H    . LYS B 1 41  ? 7.243   14.417  -12.687 1.00 34.35 ? 41  LYS B H    1  
ATOM 3031   H HA   . LYS B 1 41  ? 6.080   16.006  -14.887 1.00 72.31 ? 41  LYS B HA   1  
ATOM 3032   H HB2  . LYS B 1 41  ? 8.640   16.039  -14.882 1.00 14.14 ? 41  LYS B HB2  1  
ATOM 3033   H HB3  . LYS B 1 41  ? 8.621   14.303  -15.124 1.00 13.13 ? 41  LYS B HB3  1  
ATOM 3034   H HG2  . LYS B 1 41  ? 7.264   16.199  -17.059 1.00 23.44 ? 41  LYS B HG2  1  
ATOM 3035   H HG3  . LYS B 1 41  ? 8.979   15.821  -17.182 1.00 63.31 ? 41  LYS B HG3  1  
ATOM 3036   H HD2  . LYS B 1 41  ? 8.485   13.456  -17.545 1.00 32.04 ? 41  LYS B HD2  1  
ATOM 3037   H HD3  . LYS B 1 41  ? 6.766   13.733  -17.257 1.00 41.01 ? 41  LYS B HD3  1  
ATOM 3038   H HE2  . LYS B 1 41  ? 6.668   15.170  -19.270 1.00 22.33 ? 41  LYS B HE2  1  
ATOM 3039   H HE3  . LYS B 1 41  ? 8.382   14.858  -19.570 1.00 42.30 ? 41  LYS B HE3  1  
ATOM 3040   H HZ1  . LYS B 1 41  ? 6.917   13.423  -20.886 1.00 32.20 ? 41  LYS B HZ1  1  
ATOM 3041   H HZ2  . LYS B 1 41  ? 6.269   12.766  -19.470 1.00 45.41 ? 41  LYS B HZ2  1  
ATOM 3042   H HZ3  . LYS B 1 41  ? 7.898   12.526  -19.844 1.00 22.01 ? 41  LYS B HZ3  1  
ATOM 3043   N N    . LEU B 1 42  ? 4.713   13.976  -15.382 1.00 64.00 ? 42  LEU B N    1  
ATOM 3044   C CA   . LEU B 1 42  ? 3.797   12.834  -15.538 1.00 33.01 ? 42  LEU B CA   1  
ATOM 3045   C C    . LEU B 1 42  ? 3.923   12.207  -16.938 1.00 73.24 ? 42  LEU B C    1  
ATOM 3046   O O    . LEU B 1 42  ? 4.266   12.889  -17.920 1.00 2.22  ? 42  LEU B O    1  
ATOM 3047   C CB   . LEU B 1 42  ? 2.329   13.287  -15.279 1.00 10.21 ? 42  LEU B CB   1  
ATOM 3048   C CG   . LEU B 1 42  ? 1.255   12.149  -15.265 1.00 31.21 ? 42  LEU B CG   1  
ATOM 3049   C CD1  . LEU B 1 42  ? 1.564   11.116  -14.166 1.00 3.34  ? 42  LEU B CD1  1  
ATOM 3050   C CD2  . LEU B 1 42  ? -0.178  12.715  -15.127 1.00 0.24  ? 42  LEU B CD2  1  
ATOM 3051   H H    . LEU B 1 42  ? 4.426   14.856  -15.700 1.00 71.01 ? 42  LEU B H    1  
ATOM 3052   H HA   . LEU B 1 42  ? 4.062   12.078  -14.792 1.00 74.42 ? 42  LEU B HA   1  
ATOM 3053   H HB2  . LEU B 1 42  ? 2.299   13.796  -14.318 1.00 13.14 ? 42  LEU B HB2  1  
ATOM 3054   H HB3  . LEU B 1 42  ? 2.056   14.007  -16.045 1.00 43.21 ? 42  LEU B HB3  1  
ATOM 3055   H HG   . LEU B 1 42  ? 1.303   11.620  -16.211 1.00 74.11 ? 42  LEU B HG   1  
ATOM 3056   H HD11 . LEU B 1 42  ? 2.538   10.673  -14.342 1.00 41.53 ? 42  LEU B HD11 1  
ATOM 3057   H HD12 . LEU B 1 42  ? 0.818   10.334  -14.183 1.00 40.32 ? 42  LEU B HD12 1  
ATOM 3058   H HD13 . LEU B 1 42  ? 1.559   11.593  -13.193 1.00 1.23  ? 42  LEU B HD13 1  
ATOM 3059   H HD21 . LEU B 1 42  ? -0.892  11.902  -15.142 1.00 43.24 ? 42  LEU B HD21 1  
ATOM 3060   H HD22 . LEU B 1 42  ? -0.384  13.381  -15.953 1.00 20.13 ? 42  LEU B HD22 1  
ATOM 3061   H HD23 . LEU B 1 42  ? -0.272  13.259  -14.195 1.00 12.41 ? 42  LEU B HD23 1  
ATOM 3062   N N    . ASP B 1 43  ? 3.654   10.897  -16.995 1.00 3.41  ? 43  ASP B N    1  
ATOM 3063   C CA   . ASP B 1 43  ? 3.533   10.124  -18.237 1.00 52.25 ? 43  ASP B CA   1  
ATOM 3064   C C    . ASP B 1 43  ? 2.375   9.134   -18.059 1.00 63.55 ? 43  ASP B C    1  
ATOM 3065   O O    . ASP B 1 43  ? 2.147   8.630   -16.952 1.00 4.21  ? 43  ASP B O    1  
ATOM 3066   C CB   . ASP B 1 43  ? 4.843   9.373   -18.589 1.00 54.02 ? 43  ASP B CB   1  
ATOM 3067   C CG   . ASP B 1 43  ? 6.009   10.289  -19.012 1.00 10.14 ? 43  ASP B CG   1  
ATOM 3068   O OD1  . ASP B 1 43  ? 6.824   10.705  -18.155 1.00 22.30 ? 43  ASP B OD1  1  
ATOM 3069   O OD2  . ASP B 1 43  ? 6.119   10.597  -20.217 1.00 62.11 ? 43  ASP B OD2  1  
ATOM 3070   H H    . ASP B 1 43  ? 3.505   10.416  -16.139 1.00 54.42 ? 43  ASP B H    1  
ATOM 3071   H HA   . ASP B 1 43  ? 3.281   10.814  -19.039 1.00 41.31 ? 43  ASP B HA   1  
ATOM 3072   H HB2  . ASP B 1 43  ? 5.154   8.804   -17.723 1.00 24.34 ? 43  ASP B HB2  1  
ATOM 3073   H HB3  . ASP B 1 43  ? 4.647   8.671   -19.397 1.00 23.35 ? 43  ASP B HB3  1  
ATOM 3074   N N    . LEU B 1 44  ? 1.618   8.893   -19.132 1.00 73.13 ? 44  LEU B N    1  
ATOM 3075   C CA   . LEU B 1 44  ? 0.450   8.003   -19.102 1.00 24.12 ? 44  LEU B CA   1  
ATOM 3076   C C    . LEU B 1 44  ? 0.401   7.238   -20.442 1.00 60.53 ? 44  LEU B C    1  
ATOM 3077   O O    . LEU B 1 44  ? 0.414   7.855   -21.509 1.00 54.43 ? 44  LEU B O    1  
ATOM 3078   C CB   . LEU B 1 44  ? -0.831  8.882   -18.867 1.00 34.02 ? 44  LEU B CB   1  
ATOM 3079   C CG   . LEU B 1 44  ? -2.066  8.230   -18.174 1.00 4.24  ? 44  LEU B CG   1  
ATOM 3080   C CD1  . LEU B 1 44  ? -2.625  7.037   -18.968 1.00 1.12  ? 44  LEU B CD1  1  
ATOM 3081   C CD2  . LEU B 1 44  ? -1.742  7.853   -16.710 1.00 4.15  ? 44  LEU B CD2  1  
ATOM 3082   H H    . LEU B 1 44  ? 1.847   9.333   -19.978 1.00 22.50 ? 44  LEU B H    1  
ATOM 3083   H HA   . LEU B 1 44  ? 0.558   7.287   -18.272 1.00 63.40 ? 44  LEU B HA   1  
ATOM 3084   H HB2  . LEU B 1 44  ? -0.539  9.737   -18.265 1.00 61.33 ? 44  LEU B HB2  1  
ATOM 3085   H HB3  . LEU B 1 44  ? -1.158  9.274   -19.831 1.00 15.11 ? 44  LEU B HB3  1  
ATOM 3086   H HG   . LEU B 1 44  ? -2.859  8.969   -18.139 1.00 4.24  ? 44  LEU B HG   1  
ATOM 3087   H HD11 . LEU B 1 44  ? -3.519  6.663   -18.491 1.00 13.41 ? 44  LEU B HD11 1  
ATOM 3088   H HD12 . LEU B 1 44  ? -1.884  6.245   -19.016 1.00 50.11 ? 44  LEU B HD12 1  
ATOM 3089   H HD13 . LEU B 1 44  ? -2.862  7.361   -19.974 1.00 22.30 ? 44  LEU B HD13 1  
ATOM 3090   H HD21 . LEU B 1 44  ? -2.629  7.450   -16.234 1.00 4.31  ? 44  LEU B HD21 1  
ATOM 3091   H HD22 . LEU B 1 44  ? -1.424  8.733   -16.168 1.00 54.31 ? 44  LEU B HD22 1  
ATOM 3092   H HD23 . LEU B 1 44  ? -0.954  7.109   -16.680 1.00 61.45 ? 44  LEU B HD23 1  
ATOM 3093   N N    . ASP B 1 45  ? 0.348   5.903   -20.366 1.00 12.13 ? 45  ASP B N    1  
ATOM 3094   C CA   . ASP B 1 45  ? 0.117   5.009   -21.522 1.00 14.31 ? 45  ASP B CA   1  
ATOM 3095   C C    . ASP B 1 45  ? -1.053  4.080   -21.177 1.00 63.00 ? 45  ASP B C    1  
ATOM 3096   O O    . ASP B 1 45  ? -1.266  3.776   -20.000 1.00 51.25 ? 45  ASP B O    1  
ATOM 3097   C CB   . ASP B 1 45  ? 1.373   4.163   -21.853 1.00 61.44 ? 45  ASP B CB   1  
ATOM 3098   C CG   . ASP B 1 45  ? 2.599   5.005   -22.243 1.00 4.40  ? 45  ASP B CG   1  
ATOM 3099   O OD1  . ASP B 1 45  ? 3.411   5.342   -21.356 1.00 44.41 ? 45  ASP B OD1  1  
ATOM 3100   O OD2  . ASP B 1 45  ? 2.774   5.310   -23.444 1.00 42.04 ? 45  ASP B OD2  1  
ATOM 3101   H H    . ASP B 1 45  ? 0.472   5.488   -19.490 1.00 55.34 ? 45  ASP B H    1  
ATOM 3102   H HA   . ASP B 1 45  ? -0.158  5.614   -22.389 1.00 52.12 ? 45  ASP B HA   1  
ATOM 3103   H HB2  . ASP B 1 45  ? 1.630   3.559   -20.984 1.00 60.42 ? 45  ASP B HB2  1  
ATOM 3104   H HB3  . ASP B 1 45  ? 1.142   3.490   -22.672 1.00 23.55 ? 45  ASP B HB3  1  
ATOM 3105   N N    . THR B 1 46  ? -1.822  3.635   -22.184 1.00 21.03 ? 46  THR B N    1  
ATOM 3106   C CA   . THR B 1 46  ? -2.946  2.694   -21.970 1.00 72.30 ? 46  THR B CA   1  
ATOM 3107   C C    . THR B 1 46  ? -2.939  1.583   -23.034 1.00 41.55 ? 46  THR B C    1  
ATOM 3108   O O    . THR B 1 46  ? -2.946  1.856   -24.234 1.00 44.33 ? 46  THR B O    1  
ATOM 3109   C CB   . THR B 1 46  ? -4.337  3.425   -21.939 1.00 64.14 ? 46  THR B CB   1  
ATOM 3110   O OG1  . THR B 1 46  ? -4.475  4.285   -23.078 1.00 3.43  ? 46  THR B OG1  1  
ATOM 3111   C CG2  . THR B 1 46  ? -4.525  4.250   -20.647 1.00 42.31 ? 46  THR B CG2  1  
ATOM 3112   H H    . THR B 1 46  ? -1.634  3.942   -23.099 1.00 53.32 ? 46  THR B H    1  
ATOM 3113   H HA   . THR B 1 46  ? -2.800  2.222   -20.993 1.00 14.24 ? 46  THR B HA   1  
ATOM 3114   H HB   . THR B 1 46  ? -5.125  2.677   -21.982 1.00 2.21  ? 46  THR B HB   1  
ATOM 3115   H HG1  . THR B 1 46  ? -3.808  4.061   -23.737 1.00 32.52 ? 46  THR B HG1  1  
ATOM 3116   H HG21 . THR B 1 46  ? -3.806  5.058   -20.623 1.00 71.11 ? 46  THR B HG21 1  
ATOM 3117   H HG22 . THR B 1 46  ? -4.374  3.614   -19.784 1.00 22.10 ? 46  THR B HG22 1  
ATOM 3118   H HG23 . THR B 1 46  ? -5.527  4.659   -20.609 1.00 61.02 ? 46  THR B HG23 1  
ATOM 3119   N N    . ALA B 1 47  ? -2.913  0.339   -22.551 1.00 45.13 ? 47  ALA B N    1  
ATOM 3120   C CA   . ALA B 1 47  ? -2.919  -0.890  -23.356 1.00 74.50 ? 47  ALA B CA   1  
ATOM 3121   C C    . ALA B 1 47  ? -4.153  -1.732  -22.997 1.00 4.40  ? 47  ALA B C    1  
ATOM 3122   O O    . ALA B 1 47  ? -4.836  -1.446  -22.017 1.00 13.01 ? 47  ALA B O    1  
ATOM 3123   C CB   . ALA B 1 47  ? -1.621  -1.684  -23.114 1.00 4.35  ? 47  ALA B CB   1  
ATOM 3124   H H    . ALA B 1 47  ? -2.905  0.235   -21.582 1.00 33.14 ? 47  ALA B H    1  
ATOM 3125   H HA   . ALA B 1 47  ? -2.968  -0.626  -24.415 1.00 22.24 ? 47  ALA B HA   1  
ATOM 3126   H HB1  . ALA B 1 47  ? -1.624  -2.586  -23.716 1.00 71.34 ? 47  ALA B HB1  1  
ATOM 3127   H HB2  . ALA B 1 47  ? -1.541  -1.954  -22.067 1.00 41.23 ? 47  ALA B HB2  1  
ATOM 3128   H HB3  . ALA B 1 47  ? -0.770  -1.077  -23.389 1.00 51.02 ? 47  ALA B HB3  1  
ATOM 3129   N N    . SER B 1 48  ? -4.476  -2.695  -23.852 1.00 20.44 ? 48  SER B N    1  
ATOM 3130   C CA   . SER B 1 48  ? -5.493  -3.726  -23.599 1.00 14.51 ? 48  SER B CA   1  
ATOM 3131   C C    . SER B 1 48  ? -5.044  -5.048  -24.251 1.00 70.53 ? 48  SER B C    1  
ATOM 3132   O O    . SER B 1 48  ? -4.093  -5.061  -25.048 1.00 30.55 ? 48  SER B O    1  
ATOM 3133   C CB   . SER B 1 48  ? -6.884  -3.269  -24.117 1.00 55.21 ? 48  SER B CB   1  
ATOM 3134   O OG   . SER B 1 48  ? -6.820  -2.812  -25.463 1.00 42.42 ? 48  SER B OG   1  
ATOM 3135   H H    . SER B 1 48  ? -3.986  -2.741  -24.695 1.00 74.04 ? 48  SER B H    1  
ATOM 3136   H HA   . SER B 1 48  ? -5.550  -3.887  -22.517 1.00 74.02 ? 48  SER B HA   1  
ATOM 3137   H HB2  . SER B 1 48  ? -7.576  -4.101  -24.074 1.00 23.12 ? 48  SER B HB2  1  
ATOM 3138   H HB3  . SER B 1 48  ? -7.265  -2.463  -23.489 1.00 52.11 ? 48  SER B HB3  1  
ATOM 3139   H HG   . SER B 1 48  ? -5.917  -2.537  -25.669 1.00 4.00  ? 48  SER B HG   1  
ATOM 3140   N N    . SER B 1 49  ? -5.733  -6.149  -23.924 1.00 34.51 ? 49  SER B N    1  
ATOM 3141   C CA   . SER B 1 49  ? -5.434  -7.482  -24.479 1.00 51.53 ? 49  SER B CA   1  
ATOM 3142   C C    . SER B 1 49  ? -6.714  -8.328  -24.519 1.00 75.42 ? 49  SER B C    1  
ATOM 3143   O O    . SER B 1 49  ? -7.738  -7.947  -23.950 1.00 61.32 ? 49  SER B O    1  
ATOM 3144   C CB   . SER B 1 49  ? -4.332  -8.186  -23.639 1.00 40.42 ? 49  SER B CB   1  
ATOM 3145   O OG   . SER B 1 49  ? -4.764  -8.458  -22.314 1.00 23.25 ? 49  SER B OG   1  
ATOM 3146   H H    . SER B 1 49  ? -6.466  -6.068  -23.279 1.00 71.32 ? 49  SER B H    1  
ATOM 3147   H HA   . SER B 1 49  ? -5.078  -7.355  -25.500 1.00 20.24 ? 49  SER B HA   1  
ATOM 3148   H HB2  . SER B 1 49  ? -4.064  -9.122  -24.107 1.00 30.43 ? 49  SER B HB2  1  
ATOM 3149   H HB3  . SER B 1 49  ? -3.456  -7.550  -23.591 1.00 25.14 ? 49  SER B HB3  1  
ATOM 3150   H HG   . SER B 1 49  ? -4.564  -7.707  -21.740 1.00 62.42 ? 49  SER B HG   1  
ATOM 3151   N N    . GLN B 1 50  ? -6.649  -9.469  -25.214 1.00 61.44 ? 50  GLN B N    1  
ATOM 3152   C CA   . GLN B 1 50  ? -7.768  -10.420 -25.327 1.00 64.14 ? 50  GLN B CA   1  
ATOM 3153   C C    . GLN B 1 50  ? -7.331  -11.736 -24.670 1.00 61.15 ? 50  GLN B C    1  
ATOM 3154   O O    . GLN B 1 50  ? -6.445  -12.420 -25.192 1.00 43.24 ? 50  GLN B O    1  
ATOM 3155   C CB   . GLN B 1 50  ? -8.116  -10.644 -26.828 1.00 51.41 ? 50  GLN B CB   1  
ATOM 3156   C CG   . GLN B 1 50  ? -9.454  -11.374 -27.108 1.00 20.04 ? 50  GLN B CG   1  
ATOM 3157   C CD   . GLN B 1 50  ? -10.685 -10.487 -26.914 1.00 20.40 ? 50  GLN B CD   1  
ATOM 3158   O OE1  . GLN B 1 50  ? -11.077 -9.766  -27.818 1.00 31.41 ? 50  GLN B OE1  1  
ATOM 3159   N NE2  . GLN B 1 50  ? -11.341 -10.577 -25.774 1.00 1.20  ? 50  GLN B NE2  1  
ATOM 3160   H H    . GLN B 1 50  ? -5.808  -9.690  -25.668 1.00 31.10 ? 50  GLN B H    1  
ATOM 3161   H HA   . GLN B 1 50  ? -8.639  -10.023 -24.804 1.00 32.14 ? 50  GLN B HA   1  
ATOM 3162   H HB2  . GLN B 1 50  ? -8.156  -9.677  -27.321 1.00 70.44 ? 50  GLN B HB2  1  
ATOM 3163   H HB3  . GLN B 1 50  ? -7.311  -11.218 -27.287 1.00 54.01 ? 50  GLN B HB3  1  
ATOM 3164   H HG2  . GLN B 1 50  ? -9.452  -11.730 -28.131 1.00 71.33 ? 50  GLN B HG2  1  
ATOM 3165   H HG3  . GLN B 1 50  ? -9.536  -12.228 -26.439 1.00 61.32 ? 50  GLN B HG3  1  
ATOM 3166   H HE21 . GLN B 1 50  ? -11.024 -11.214 -25.105 1.00 22.13 ? 50  GLN B HE21 1  
ATOM 3167   H HE22 . GLN B 1 50  ? -12.113 -9.996  -25.640 1.00 22.40 ? 50  GLN B HE22 1  
ATOM 3168   N N    . LEU B 1 51  ? -7.923  -12.071 -23.518 1.00 4.43  ? 51  LEU B N    1  
ATOM 3169   C CA   . LEU B 1 51  ? -7.600  -13.321 -22.795 1.00 44.41 ? 51  LEU B CA   1  
ATOM 3170   C C    . LEU B 1 51  ? -8.496  -14.441 -23.324 1.00 14.01 ? 51  LEU B C    1  
ATOM 3171   O O    . LEU B 1 51  ? -8.033  -15.484 -23.797 1.00 0.12  ? 51  LEU B O    1  
ATOM 3172   C CB   . LEU B 1 51  ? -7.835  -13.143 -21.271 1.00 1.35  ? 51  LEU B CB   1  
ATOM 3173   C CG   . LEU B 1 51  ? -7.262  -11.848 -20.631 1.00 25.43 ? 51  LEU B CG   1  
ATOM 3174   C CD1  . LEU B 1 51  ? -7.601  -11.788 -19.127 1.00 54.22 ? 51  LEU B CD1  1  
ATOM 3175   C CD2  . LEU B 1 51  ? -5.743  -11.694 -20.895 1.00 73.20 ? 51  LEU B CD2  1  
ATOM 3176   H H    . LEU B 1 51  ? -8.599  -11.467 -23.144 1.00 2.02  ? 51  LEU B H    1  
ATOM 3177   H HA   . LEU B 1 51  ? -6.556  -13.571 -22.973 1.00 42.31 ? 51  LEU B HA   1  
ATOM 3178   H HB2  . LEU B 1 51  ? -8.908  -13.159 -21.087 1.00 32.42 ? 51  LEU B HB2  1  
ATOM 3179   H HB3  . LEU B 1 51  ? -7.397  -13.996 -20.760 1.00 70.23 ? 51  LEU B HB3  1  
ATOM 3180   H HG   . LEU B 1 51  ? -7.751  -10.996 -21.093 1.00 72.22 ? 51  LEU B HG   1  
ATOM 3181   H HD11 . LEU B 1 51  ? -7.251  -12.680 -18.623 1.00 40.11 ? 51  LEU B HD11 1  
ATOM 3182   H HD12 . LEU B 1 51  ? -8.671  -11.709 -19.004 1.00 34.31 ? 51  LEU B HD12 1  
ATOM 3183   H HD13 . LEU B 1 51  ? -7.132  -10.920 -18.683 1.00 13.25 ? 51  LEU B HD13 1  
ATOM 3184   H HD21 . LEU B 1 51  ? -5.399  -10.755 -20.483 1.00 31.10 ? 51  LEU B HD21 1  
ATOM 3185   H HD22 . LEU B 1 51  ? -5.555  -11.700 -21.960 1.00 25.34 ? 51  LEU B HD22 1  
ATOM 3186   H HD23 . LEU B 1 51  ? -5.201  -12.505 -20.432 1.00 30.21 ? 51  LEU B HD23 1  
ATOM 3187   N N    . ALA B 1 52  ? -9.794  -14.160 -23.249 1.00 41.23 ? 52  ALA B N    1  
ATOM 3188   C CA   . ALA B 1 52  ? -10.867 -15.019 -23.752 1.00 42.31 ? 52  ALA B CA   1  
ATOM 3189   C C    . ALA B 1 52  ? -11.915 -14.131 -24.404 1.00 33.13 ? 52  ALA B C    1  
ATOM 3190   O O    . ALA B 1 52  ? -11.767 -12.904 -24.434 1.00 35.52 ? 52  ALA B O    1  
ATOM 3191   C CB   . ALA B 1 52  ? -11.474 -15.857 -22.611 1.00 42.22 ? 52  ALA B CB   1  
ATOM 3192   H H    . ALA B 1 52  ? -10.055 -13.309 -22.836 1.00 3.55  ? 52  ALA B H    1  
ATOM 3193   H HA   . ALA B 1 52  ? -10.464 -15.693 -24.505 1.00 32.33 ? 52  ALA B HA   1  
ATOM 3194   H HB1  . ALA B 1 52  ? -11.561 -15.259 -21.712 1.00 2.24  ? 52  ALA B HB1  1  
ATOM 3195   H HB2  . ALA B 1 52  ? -10.848 -16.705 -22.420 1.00 4.34  ? 52  ALA B HB2  1  
ATOM 3196   H HB3  . ALA B 1 52  ? -12.457 -16.213 -22.895 1.00 13.12 ? 52  ALA B HB3  1  
ATOM 3197   N N    . ASP B 1 53  ? -12.979 -14.752 -24.908 1.00 1.21  ? 53  ASP B N    1  
ATOM 3198   C CA   . ASP B 1 53  ? -14.024 -14.027 -25.654 1.00 63.33 ? 53  ASP B CA   1  
ATOM 3199   C C    . ASP B 1 53  ? -14.872 -13.166 -24.701 1.00 51.23 ? 53  ASP B C    1  
ATOM 3200   O O    . ASP B 1 53  ? -15.300 -13.635 -23.641 1.00 14.14 ? 53  ASP B O    1  
ATOM 3201   C CB   . ASP B 1 53  ? -14.906 -14.986 -26.479 1.00 50.32 ? 53  ASP B CB   1  
ATOM 3202   C CG   . ASP B 1 53  ? -16.061 -14.260 -27.194 1.00 73.02 ? 53  ASP B CG   1  
ATOM 3203   O OD1  . ASP B 1 53  ? -15.791 -13.362 -28.025 1.00 35.44 ? 53  ASP B OD1  1  
ATOM 3204   O OD2  . ASP B 1 53  ? -17.233 -14.575 -26.925 1.00 54.14 ? 53  ASP B OD2  1  
ATOM 3205   H H    . ASP B 1 53  ? -13.073 -15.723 -24.753 1.00 23.04 ? 53  ASP B H    1  
ATOM 3206   H HA   . ASP B 1 53  ? -13.498 -13.355 -26.345 1.00 1.01  ? 53  ASP B HA   1  
ATOM 3207   H HB2  . ASP B 1 53  ? -14.292 -15.470 -27.230 1.00 23.12 ? 53  ASP B HB2  1  
ATOM 3208   H HB3  . ASP B 1 53  ? -15.314 -15.752 -25.823 1.00 33.24 ? 53  ASP B HB3  1  
ATOM 3209   N N    . ASP B 1 54  ? -15.032 -11.880 -25.095 1.00 43.14 ? 54  ASP B N    1  
ATOM 3210   C CA   . ASP B 1 54  ? -15.655 -10.795 -24.297 1.00 53.22 ? 54  ASP B CA   1  
ATOM 3211   C C    . ASP B 1 54  ? -14.828 -10.418 -23.063 1.00 0.51  ? 54  ASP B C    1  
ATOM 3212   O O    . ASP B 1 54  ? -15.168 -9.471  -22.358 1.00 64.23 ? 54  ASP B O    1  
ATOM 3213   C CB   . ASP B 1 54  ? -17.139 -11.088 -23.918 1.00 41.14 ? 54  ASP B CB   1  
ATOM 3214   C CG   . ASP B 1 54  ? -18.077 -11.146 -25.137 1.00 64.21 ? 54  ASP B CG   1  
ATOM 3215   O OD1  . ASP B 1 54  ? -17.973 -10.274 -26.033 1.00 33.31 ? 54  ASP B OD1  1  
ATOM 3216   O OD2  . ASP B 1 54  ? -18.944 -12.045 -25.197 1.00 53.31 ? 54  ASP B OD2  1  
ATOM 3217   H H    . ASP B 1 54  ? -14.711 -11.647 -25.989 1.00 71.22 ? 54  ASP B H    1  
ATOM 3218   H HA   . ASP B 1 54  ? -15.646 -9.921  -24.943 1.00 40.30 ? 54  ASP B HA   1  
ATOM 3219   H HB2  . ASP B 1 54  ? -17.182 -12.038 -23.393 1.00 62.13 ? 54  ASP B HB2  1  
ATOM 3220   H HB3  . ASP B 1 54  ? -17.502 -10.310 -23.251 1.00 61.04 ? 54  ASP B HB3  1  
ATOM 3221   N N    . VAL B 1 55  ? -13.695 -11.108 -22.849 1.00 62.41 ? 55  VAL B N    1  
ATOM 3222   C CA   . VAL B 1 55  ? -12.801 -10.870 -21.725 1.00 41.53 ? 55  VAL B CA   1  
ATOM 3223   C C    . VAL B 1 55  ? -11.587 -10.102 -22.240 1.00 14.04 ? 55  VAL B C    1  
ATOM 3224   O O    . VAL B 1 55  ? -10.706 -10.664 -22.913 1.00 74.31 ? 55  VAL B O    1  
ATOM 3225   C CB   . VAL B 1 55  ? -12.334 -12.208 -21.055 1.00 21.32 ? 55  VAL B CB   1  
ATOM 3226   C CG1  . VAL B 1 55  ? -11.332 -11.922 -19.915 1.00 64.40 ? 55  VAL B CG1  1  
ATOM 3227   C CG2  . VAL B 1 55  ? -13.543 -13.031 -20.546 1.00 31.34 ? 55  VAL B CG2  1  
ATOM 3228   H H    . VAL B 1 55  ? -13.444 -11.799 -23.489 1.00 44.34 ? 55  VAL B H    1  
ATOM 3229   H HA   . VAL B 1 55  ? -13.325 -10.273 -20.971 1.00 32.21 ? 55  VAL B HA   1  
ATOM 3230   H HB   . VAL B 1 55  ? -11.820 -12.804 -21.809 1.00 52.41 ? 55  VAL B HB   1  
ATOM 3231   H HG11 . VAL B 1 55  ? -10.789 -12.810 -19.683 1.00 0.23  ? 55  VAL B HG11 1  
ATOM 3232   H HG12 . VAL B 1 55  ? -11.859 -11.586 -19.032 1.00 42.51 ? 55  VAL B HG12 1  
ATOM 3233   H HG13 . VAL B 1 55  ? -10.628 -11.155 -20.217 1.00 64.43 ? 55  VAL B HG13 1  
ATOM 3234   H HG21 . VAL B 1 55  ? -14.067 -12.473 -19.779 1.00 43.11 ? 55  VAL B HG21 1  
ATOM 3235   H HG22 . VAL B 1 55  ? -13.203 -13.973 -20.131 1.00 15.34 ? 55  VAL B HG22 1  
ATOM 3236   H HG23 . VAL B 1 55  ? -14.222 -13.230 -21.365 1.00 71.01 ? 55  VAL B HG23 1  
ATOM 3237   N N    . TYR B 1 56  ? -11.569 -8.814  -21.942 1.00 1.20  ? 56  TYR B N    1  
ATOM 3238   C CA   . TYR B 1 56  ? -10.493 -7.914  -22.336 1.00 44.43 ? 56  TYR B CA   1  
ATOM 3239   C C    . TYR B 1 56  ? -9.785  -7.440  -21.068 1.00 45.31 ? 56  TYR B C    1  
ATOM 3240   O O    . TYR B 1 56  ? -10.434 -7.146  -20.059 1.00 22.43 ? 56  TYR B O    1  
ATOM 3241   C CB   . TYR B 1 56  ? -11.033 -6.687  -23.125 1.00 71.42 ? 56  TYR B CB   1  
ATOM 3242   C CG   . TYR B 1 56  ? -11.770 -7.007  -24.444 1.00 44.44 ? 56  TYR B CG   1  
ATOM 3243   C CD1  . TYR B 1 56  ? -13.021 -7.626  -24.440 1.00 51.52 ? 56  TYR B CD1  1  
ATOM 3244   C CD2  . TYR B 1 56  ? -11.239 -6.644  -25.687 1.00 21.21 ? 56  TYR B CD2  1  
ATOM 3245   C CE1  . TYR B 1 56  ? -13.714 -7.870  -25.609 1.00 14.41 ? 56  TYR B CE1  1  
ATOM 3246   C CE2  . TYR B 1 56  ? -11.930 -6.894  -26.862 1.00 24.32 ? 56  TYR B CE2  1  
ATOM 3247   C CZ   . TYR B 1 56  ? -13.170 -7.506  -26.814 1.00 25.11 ? 56  TYR B CZ   1  
ATOM 3248   O OH   . TYR B 1 56  ? -13.874 -7.740  -27.978 1.00 12.12 ? 56  TYR B OH   1  
ATOM 3249   H H    . TYR B 1 56  ? -12.301 -8.455  -21.405 1.00 44.43 ? 56  TYR B H    1  
ATOM 3250   H HA   . TYR B 1 56  ? -9.788  -8.475  -22.957 1.00 74.44 ? 56  TYR B HA   1  
ATOM 3251   H HB2  . TYR B 1 56  ? -11.725 -6.146  -22.491 1.00 23.45 ? 56  TYR B HB2  1  
ATOM 3252   H HB3  . TYR B 1 56  ? -10.199 -6.029  -23.357 1.00 52.22 ? 56  TYR B HB3  1  
ATOM 3253   H HD1  . TYR B 1 56  ? -13.458 -7.920  -23.491 1.00 33.50 ? 56  TYR B HD1  1  
ATOM 3254   H HD2  . TYR B 1 56  ? -10.268 -6.164  -25.728 1.00 30.13 ? 56  TYR B HD2  1  
ATOM 3255   H HE1  . TYR B 1 56  ? -14.684 -8.350  -25.572 1.00 54.43 ? 56  TYR B HE1  1  
ATOM 3256   H HE2  . TYR B 1 56  ? -11.497 -6.605  -27.815 1.00 75.11 ? 56  TYR B HE2  1  
ATOM 3257   H HH   . TYR B 1 56  ? -14.801 -7.549  -27.830 1.00 32.13 ? 56  TYR B HH   1  
ATOM 3258   N N    . GLU B 1 57  ? -8.466  -7.342  -21.132 1.00 4.22  ? 57  GLU B N    1  
ATOM 3259   C CA   . GLU B 1 57  ? -7.629  -7.010  -19.982 1.00 25.34 ? 57  GLU B CA   1  
ATOM 3260   C C    . GLU B 1 57  ? -6.869  -5.720  -20.300 1.00 51.31 ? 57  GLU B C    1  
ATOM 3261   O O    . GLU B 1 57  ? -5.935  -5.734  -21.106 1.00 1.50  ? 57  GLU B O    1  
ATOM 3262   C CB   . GLU B 1 57  ? -6.694  -8.219  -19.700 1.00 44.41 ? 57  GLU B CB   1  
ATOM 3263   C CG   . GLU B 1 57  ? -5.857  -8.165  -18.408 1.00 13.33 ? 57  GLU B CG   1  
ATOM 3264   C CD   . GLU B 1 57  ? -4.679  -7.173  -18.433 1.00 64.23 ? 57  GLU B CD   1  
ATOM 3265   O OE1  . GLU B 1 57  ? -3.817  -7.305  -19.327 1.00 53.42 ? 57  GLU B OE1  1  
ATOM 3266   O OE2  . GLU B 1 57  ? -4.593  -6.298  -17.543 1.00 71.42 ? 57  GLU B OE2  1  
ATOM 3267   H H    . GLU B 1 57  ? -8.026  -7.495  -21.993 1.00 35.42 ? 57  GLU B H    1  
ATOM 3268   H HA   . GLU B 1 57  ? -8.267  -6.843  -19.109 1.00 14.44 ? 57  GLU B HA   1  
ATOM 3269   H HB2  . GLU B 1 57  ? -7.313  -9.107  -19.645 1.00 23.43 ? 57  GLU B HB2  1  
ATOM 3270   H HB3  . GLU B 1 57  ? -6.015  -8.342  -20.539 1.00 25.24 ? 57  GLU B HB3  1  
ATOM 3271   H HG2  . GLU B 1 57  ? -6.518  -7.909  -17.587 1.00 3.51  ? 57  GLU B HG2  1  
ATOM 3272   H HG3  . GLU B 1 57  ? -5.454  -9.157  -18.219 1.00 51.12 ? 57  GLU B HG3  1  
ATOM 3273   N N    . VAL B 1 58  ? -7.313  -4.607  -19.695 1.00 11.51 ? 58  VAL B N    1  
ATOM 3274   C CA   . VAL B 1 58  ? -6.709  -3.285  -19.894 1.00 55.53 ? 58  VAL B CA   1  
ATOM 3275   C C    . VAL B 1 58  ? -5.585  -3.051  -18.887 1.00 52.45 ? 58  VAL B C    1  
ATOM 3276   O O    . VAL B 1 58  ? -5.718  -3.377  -17.715 1.00 53.45 ? 58  VAL B O    1  
ATOM 3277   C CB   . VAL B 1 58  ? -7.768  -2.129  -19.751 1.00 50.43 ? 58  VAL B CB   1  
ATOM 3278   C CG1  . VAL B 1 58  ? -7.104  -0.724  -19.792 1.00 62.42 ? 58  VAL B CG1  1  
ATOM 3279   C CG2  . VAL B 1 58  ? -8.845  -2.265  -20.840 1.00 35.14 ? 58  VAL B CG2  1  
ATOM 3280   H H    . VAL B 1 58  ? -8.055  -4.686  -19.069 1.00 73.15 ? 58  VAL B H    1  
ATOM 3281   H HA   . VAL B 1 58  ? -6.294  -3.244  -20.906 1.00 42.44 ? 58  VAL B HA   1  
ATOM 3282   H HB   . VAL B 1 58  ? -8.254  -2.235  -18.783 1.00 41.52 ? 58  VAL B HB   1  
ATOM 3283   H HG11 . VAL B 1 58  ? -7.805  0.016   -19.490 1.00 34.31 ? 58  VAL B HG11 1  
ATOM 3284   H HG12 . VAL B 1 58  ? -6.762  -0.505  -20.794 1.00 74.33 ? 58  VAL B HG12 1  
ATOM 3285   H HG13 . VAL B 1 58  ? -6.261  -0.696  -19.117 1.00 61.31 ? 58  VAL B HG13 1  
ATOM 3286   H HG21 . VAL B 1 58  ? -9.528  -1.437  -20.791 1.00 51.44 ? 58  VAL B HG21 1  
ATOM 3287   H HG22 . VAL B 1 58  ? -9.396  -3.187  -20.700 1.00 54.32 ? 58  VAL B HG22 1  
ATOM 3288   H HG23 . VAL B 1 58  ? -8.381  -2.276  -21.808 1.00 53.34 ? 58  VAL B HG23 1  
ATOM 3289   N N    . VAL B 1 59  ? -4.500  -2.432  -19.365 1.00 44.43 ? 59  VAL B N    1  
ATOM 3290   C CA   . VAL B 1 59  ? -3.350  -2.069  -18.550 1.00 14.40 ? 59  VAL B CA   1  
ATOM 3291   C C    . VAL B 1 59  ? -3.175  -0.548  -18.566 1.00 75.15 ? 59  VAL B C    1  
ATOM 3292   O O    . VAL B 1 59  ? -2.975  0.051   -19.624 1.00 4.30  ? 59  VAL B O    1  
ATOM 3293   C CB   . VAL B 1 59  ? -2.025  -2.750  -19.056 1.00 43.21 ? 59  VAL B CB   1  
ATOM 3294   C CG1  . VAL B 1 59  ? -0.842  -2.460  -18.094 1.00 22.23 ? 59  VAL B CG1  1  
ATOM 3295   C CG2  . VAL B 1 59  ? -2.231  -4.259  -19.289 1.00 72.34 ? 59  VAL B CG2  1  
ATOM 3296   H H    . VAL B 1 59  ? -4.492  -2.188  -20.299 1.00 13.52 ? 59  VAL B H    1  
ATOM 3297   H HA   . VAL B 1 59  ? -3.553  -2.392  -17.530 1.00 43.41 ? 59  VAL B HA   1  
ATOM 3298   H HB   . VAL B 1 59  ? -1.770  -2.305  -20.020 1.00 53.21 ? 59  VAL B HB   1  
ATOM 3299   H HG11 . VAL B 1 59  ? -0.595  -1.408  -18.129 1.00 52.33 ? 59  VAL B HG11 1  
ATOM 3300   H HG12 . VAL B 1 59  ? 0.025   -3.039  -18.386 1.00 43.45 ? 59  VAL B HG12 1  
ATOM 3301   H HG13 . VAL B 1 59  ? -1.123  -2.720  -17.082 1.00 11.11 ? 59  VAL B HG13 1  
ATOM 3302   H HG21 . VAL B 1 59  ? -2.537  -4.734  -18.368 1.00 72.13 ? 59  VAL B HG21 1  
ATOM 3303   H HG22 . VAL B 1 59  ? -1.312  -4.710  -19.637 1.00 43.20 ? 59  VAL B HG22 1  
ATOM 3304   H HG23 . VAL B 1 59  ? -3.003  -4.409  -20.029 1.00 65.53 ? 59  VAL B HG23 1  
ATOM 3305   N N    . LEU B 1 60  ? -3.268  0.054   -17.393 1.00 42.31 ? 60  LEU B N    1  
ATOM 3306   C CA   . LEU B 1 60  ? -3.011  1.474   -17.193 1.00 41.30 ? 60  LEU B CA   1  
ATOM 3307   C C    . LEU B 1 60  ? -1.538  1.615   -16.773 1.00 73.44 ? 60  LEU B C    1  
ATOM 3308   O O    . LEU B 1 60  ? -1.131  1.029   -15.775 1.00 53.43 ? 60  LEU B O    1  
ATOM 3309   C CB   . LEU B 1 60  ? -3.959  2.013   -16.080 1.00 44.30 ? 60  LEU B CB   1  
ATOM 3310   C CG   . LEU B 1 60  ? -4.241  3.555   -15.999 1.00 33.30 ? 60  LEU B CG   1  
ATOM 3311   C CD1  . LEU B 1 60  ? -4.903  3.882   -14.660 1.00 51.25 ? 60  LEU B CD1  1  
ATOM 3312   C CD2  . LEU B 1 60  ? -2.998  4.431   -16.210 1.00 22.44 ? 60  LEU B CD2  1  
ATOM 3313   H H    . LEU B 1 60  ? -3.522  -0.480  -16.619 1.00 40.14 ? 60  LEU B H    1  
ATOM 3314   H HA   . LEU B 1 60  ? -3.190  2.007   -18.126 1.00 23.23 ? 60  LEU B HA   1  
ATOM 3315   H HB2  . LEU B 1 60  ? -4.920  1.520   -16.209 1.00 60.55 ? 60  LEU B HB2  1  
ATOM 3316   H HB3  . LEU B 1 60  ? -3.561  1.688   -15.122 1.00 33.50 ? 60  LEU B HB3  1  
ATOM 3317   H HG   . LEU B 1 60  ? -4.949  3.812   -16.781 1.00 71.33 ? 60  LEU B HG   1  
ATOM 3318   H HD11 . LEU B 1 60  ? -5.151  4.935   -14.617 1.00 44.40 ? 60  LEU B HD11 1  
ATOM 3319   H HD12 . LEU B 1 60  ? -4.235  3.641   -13.843 1.00 33.31 ? 60  LEU B HD12 1  
ATOM 3320   H HD13 . LEU B 1 60  ? -5.816  3.297   -14.559 1.00 23.23 ? 60  LEU B HD13 1  
ATOM 3321   H HD21 . LEU B 1 60  ? -3.231  5.464   -16.013 1.00 62.34 ? 60  LEU B HD21 1  
ATOM 3322   H HD22 . LEU B 1 60  ? -2.658  4.336   -17.232 1.00 72.23 ? 60  LEU B HD22 1  
ATOM 3323   H HD23 . LEU B 1 60  ? -2.204  4.112   -15.543 1.00 1.43  ? 60  LEU B HD23 1  
ATOM 3324   N N    . ARG B 1 61  ? -0.766  2.398   -17.525 1.00 4.12  ? 61  ARG B N    1  
ATOM 3325   C CA   . ARG B 1 61  ? 0.629   2.716   -17.194 1.00 23.10 ? 61  ARG B CA   1  
ATOM 3326   C C    . ARG B 1 61  ? 0.735   4.190   -16.789 1.00 22.21 ? 61  ARG B C    1  
ATOM 3327   O O    . ARG B 1 61  ? 0.335   5.080   -17.541 1.00 65.21 ? 61  ARG B O    1  
ATOM 3328   C CB   . ARG B 1 61  ? 1.553   2.425   -18.407 1.00 24.42 ? 61  ARG B CB   1  
ATOM 3329   C CG   . ARG B 1 61  ? 3.068   2.591   -18.123 1.00 72.11 ? 61  ARG B CG   1  
ATOM 3330   C CD   . ARG B 1 61  ? 3.937   2.380   -19.382 1.00 33.42 ? 61  ARG B CD   1  
ATOM 3331   N NE   . ARG B 1 61  ? 5.333   2.042   -19.057 1.00 33.44 ? 61  ARG B NE   1  
ATOM 3332   C CZ   . ARG B 1 61  ? 6.383   2.172   -19.890 1.00 45.43 ? 61  ARG B CZ   1  
ATOM 3333   N NH1  . ARG B 1 61  ? 6.223   2.651   -21.123 1.00 63.05 ? 61  ARG B NH1  1  
ATOM 3334   N NH2  . ARG B 1 61  ? 7.595   1.819   -19.469 1.00 31.22 ? 61  ARG B NH2  1  
ATOM 3335   H H    . ARG B 1 61  ? -1.153  2.791   -18.325 1.00 52.22 ? 61  ARG B H    1  
ATOM 3336   H HA   . ARG B 1 61  ? 0.932   2.101   -16.350 1.00 61.13 ? 61  ARG B HA   1  
ATOM 3337   H HB2  . ARG B 1 61  ? 1.384   1.402   -18.730 1.00 14.13 ? 61  ARG B HB2  1  
ATOM 3338   H HB3  . ARG B 1 61  ? 1.281   3.090   -19.221 1.00 12.32 ? 61  ARG B HB3  1  
ATOM 3339   H HG2  . ARG B 1 61  ? 3.247   3.592   -17.743 1.00 3.32  ? 61  ARG B HG2  1  
ATOM 3340   H HG3  . ARG B 1 61  ? 3.361   1.872   -17.368 1.00 32.53 ? 61  ARG B HG3  1  
ATOM 3341   H HD2  . ARG B 1 61  ? 3.520   1.574   -19.977 1.00 31.33 ? 61  ARG B HD2  1  
ATOM 3342   H HD3  . ARG B 1 61  ? 3.923   3.293   -19.965 1.00 42.40 ? 61  ARG B HD3  1  
ATOM 3343   H HE   . ARG B 1 61  ? 5.502   1.682   -18.155 1.00 13.52 ? 61  ARG B HE   1  
ATOM 3344   H HH11 . ARG B 1 61  ? 5.312   2.917   -21.446 1.00 34.21 ? 61  ARG B HH11 1  
ATOM 3345   H HH12 . ARG B 1 61  ? 7.013   2.744   -21.735 1.00 22.30 ? 61  ARG B HH12 1  
ATOM 3346   H HH21 . ARG B 1 61  ? 7.714   1.455   -18.534 1.00 32.12 ? 61  ARG B HH21 1  
ATOM 3347   H HH22 . ARG B 1 61  ? 8.392   1.906   -20.070 1.00 1.55  ? 61  ARG B HH22 1  
ATOM 3348   N N    . VAL B 1 62  ? 1.231   4.429   -15.573 1.00 33.20 ? 62  VAL B N    1  
ATOM 3349   C CA   . VAL B 1 62  ? 1.570   5.763   -15.075 1.00 3.21  ? 62  VAL B CA   1  
ATOM 3350   C C    . VAL B 1 62  ? 3.071   5.785   -14.793 1.00 44.13 ? 62  VAL B C    1  
ATOM 3351   O O    . VAL B 1 62  ? 3.584   4.872   -14.143 1.00 72.54 ? 62  VAL B O    1  
ATOM 3352   C CB   . VAL B 1 62  ? 0.810   6.127   -13.742 1.00 4.24  ? 62  VAL B CB   1  
ATOM 3353   C CG1  . VAL B 1 62  ? 0.984   7.628   -13.410 1.00 21.34 ? 62  VAL B CG1  1  
ATOM 3354   C CG2  . VAL B 1 62  ? -0.678  5.722   -13.797 1.00 20.11 ? 62  VAL B CG2  1  
ATOM 3355   H H    . VAL B 1 62  ? 1.384   3.671   -14.983 1.00 41.11 ? 62  VAL B H    1  
ATOM 3356   H HA   . VAL B 1 62  ? 1.329   6.507   -15.837 1.00 3.31  ? 62  VAL B HA   1  
ATOM 3357   H HB   . VAL B 1 62  ? 1.267   5.564   -12.928 1.00 64.33 ? 62  VAL B HB   1  
ATOM 3358   H HG11 . VAL B 1 62  ? 0.570   7.849   -12.442 1.00 43.34 ? 62  VAL B HG11 1  
ATOM 3359   H HG12 . VAL B 1 62  ? 0.480   8.224   -14.142 1.00 13.01 ? 62  VAL B HG12 1  
ATOM 3360   H HG13 . VAL B 1 62  ? 2.037   7.885   -13.408 1.00 52.32 ? 62  VAL B HG13 1  
ATOM 3361   H HG21 . VAL B 1 62  ? -1.195  6.308   -14.538 1.00 32.12 ? 62  VAL B HG21 1  
ATOM 3362   H HG22 . VAL B 1 62  ? -1.144  5.871   -12.833 1.00 31.11 ? 62  VAL B HG22 1  
ATOM 3363   H HG23 . VAL B 1 62  ? -0.753  4.678   -14.073 1.00 14.13 ? 62  VAL B HG23 1  
ATOM 3364   N N    . THR B 1 63  ? 3.771   6.806   -15.276 1.00 13.10 ? 63  THR B N    1  
ATOM 3365   C CA   . THR B 1 63  ? 5.193   6.990   -14.995 1.00 74.52 ? 63  THR B CA   1  
ATOM 3366   C C    . THR B 1 63  ? 5.408   8.404   -14.449 1.00 34.21 ? 63  THR B C    1  
ATOM 3367   O O    . THR B 1 63  ? 4.931   9.383   -15.026 1.00 31.50 ? 63  THR B O    1  
ATOM 3368   C CB   . THR B 1 63  ? 6.055   6.759   -16.274 1.00 22.12 ? 63  THR B CB   1  
ATOM 3369   O OG1  . THR B 1 63  ? 5.665   5.533   -16.919 1.00 74.41 ? 63  THR B OG1  1  
ATOM 3370   C CG2  . THR B 1 63  ? 7.552   6.708   -15.953 1.00 52.22 ? 63  THR B CG2  1  
ATOM 3371   H H    . THR B 1 63  ? 3.323   7.462   -15.844 1.00 54.14 ? 63  THR B H    1  
ATOM 3372   H HA   . THR B 1 63  ? 5.495   6.262   -14.234 1.00 32.30 ? 63  THR B HA   1  
ATOM 3373   H HB   . THR B 1 63  ? 5.878   7.577   -16.964 1.00 12.13 ? 63  THR B HB   1  
ATOM 3374   H HG1  . THR B 1 63  ? 6.389   4.898   -16.870 1.00 43.24 ? 63  THR B HG1  1  
ATOM 3375   H HG21 . THR B 1 63  ? 8.102   6.458   -16.841 1.00 3.34  ? 63  THR B HG21 1  
ATOM 3376   H HG22 . THR B 1 63  ? 7.738   5.954   -15.198 1.00 12.32 ? 63  THR B HG22 1  
ATOM 3377   H HG23 . THR B 1 63  ? 7.886   7.672   -15.584 1.00 3.01  ? 63  THR B HG23 1  
ATOM 3378   N N    . VAL B 1 64  ? 6.121   8.494   -13.327 1.00 22.15 ? 64  VAL B N    1  
ATOM 3379   C CA   . VAL B 1 64  ? 6.390   9.758   -12.635 1.00 64.22 ? 64  VAL B CA   1  
ATOM 3380   C C    . VAL B 1 64  ? 7.902   9.971   -12.566 1.00 54.51 ? 64  VAL B C    1  
ATOM 3381   O O    . VAL B 1 64  ? 8.629   9.186   -11.951 1.00 53.34 ? 64  VAL B O    1  
ATOM 3382   C CB   . VAL B 1 64  ? 5.775   9.801   -11.183 1.00 30.43 ? 64  VAL B CB   1  
ATOM 3383   C CG1  . VAL B 1 64  ? 6.137   11.124  -10.454 1.00 73.24 ? 64  VAL B CG1  1  
ATOM 3384   C CG2  . VAL B 1 64  ? 4.242   9.598   -11.230 1.00 30.11 ? 64  VAL B CG2  1  
ATOM 3385   H H    . VAL B 1 64  ? 6.510   7.676   -12.966 1.00 64.55 ? 64  VAL B H    1  
ATOM 3386   H HA   . VAL B 1 64  ? 5.940   10.571  -13.215 1.00 12.22 ? 64  VAL B HA   1  
ATOM 3387   H HB   . VAL B 1 64  ? 6.200   8.978   -10.610 1.00 31.15 ? 64  VAL B HB   1  
ATOM 3388   H HG11 . VAL B 1 64  ? 7.214   11.243  -10.420 1.00 41.03 ? 64  VAL B HG11 1  
ATOM 3389   H HG12 . VAL B 1 64  ? 5.758   11.103  -9.451  1.00 21.24 ? 64  VAL B HG12 1  
ATOM 3390   H HG13 . VAL B 1 64  ? 5.701   11.961  -10.979 1.00 5.12  ? 64  VAL B HG13 1  
ATOM 3391   H HG21 . VAL B 1 64  ? 3.771   10.439  -11.714 1.00 44.03 ? 64  VAL B HG21 1  
ATOM 3392   H HG22 . VAL B 1 64  ? 3.851   9.497   -10.226 1.00 53.34 ? 64  VAL B HG22 1  
ATOM 3393   H HG23 . VAL B 1 64  ? 4.013   8.699   -11.792 1.00 34.22 ? 64  VAL B HG23 1  
ATOM 3394   N N    . THR B 1 65  ? 8.348   11.028  -13.221 1.00 62.13 ? 65  THR B N    1  
ATOM 3395   C CA   . THR B 1 65  ? 9.731   11.486  -13.201 1.00 24.21 ? 65  THR B CA   1  
ATOM 3396   C C    . THR B 1 65  ? 9.832   12.637  -12.194 1.00 54.14 ? 65  THR B C    1  
ATOM 3397   O O    . THR B 1 65  ? 8.940   13.491  -12.140 1.00 70.12 ? 65  THR B O    1  
ATOM 3398   C CB   . THR B 1 65  ? 10.162  11.969  -14.622 1.00 43.23 ? 65  THR B CB   1  
ATOM 3399   O OG1  . THR B 1 65  ? 10.023  10.891  -15.562 1.00 5.02  ? 65  THR B OG1  1  
ATOM 3400   C CG2  . THR B 1 65  ? 11.606  12.505  -14.654 1.00 64.44 ? 65  THR B CG2  1  
ATOM 3401   H H    . THR B 1 65  ? 7.701   11.551  -13.720 1.00 63.02 ? 65  THR B H    1  
ATOM 3402   H HA   . THR B 1 65  ? 10.379  10.662  -12.894 1.00 71.11 ? 65  THR B HA   1  
ATOM 3403   H HB   . THR B 1 65  ? 9.494   12.767  -14.930 1.00 24.32 ? 65  THR B HB   1  
ATOM 3404   H HG1  . THR B 1 65  ? 9.356   10.273  -15.248 1.00 34.23 ? 65  THR B HG1  1  
ATOM 3405   H HG21 . THR B 1 65  ? 12.299  11.706  -14.435 1.00 31.03 ? 65  THR B HG21 1  
ATOM 3406   H HG22 . THR B 1 65  ? 11.726  13.293  -13.917 1.00 11.14 ? 65  THR B HG22 1  
ATOM 3407   H HG23 . THR B 1 65  ? 11.822  12.903  -15.631 1.00 0.12  ? 65  THR B HG23 1  
ATOM 3408   N N    . ALA B 1 66  ? 10.903  12.656  -11.397 1.00 51.33 ? 66  ALA B N    1  
ATOM 3409   C CA   . ALA B 1 66  ? 11.113  13.696  -10.389 1.00 21.14 ? 66  ALA B CA   1  
ATOM 3410   C C    . ALA B 1 66  ? 12.592  13.982  -10.218 1.00 71.31 ? 66  ALA B C    1  
ATOM 3411   O O    . ALA B 1 66  ? 13.425  13.073  -10.342 1.00 24.44 ? 66  ALA B O    1  
ATOM 3412   C CB   . ALA B 1 66  ? 10.467  13.299  -9.066  1.00 23.12 ? 66  ALA B CB   1  
ATOM 3413   H H    . ALA B 1 66  ? 11.583  11.949  -11.494 1.00 32.12 ? 66  ALA B H    1  
ATOM 3414   H HA   . ALA B 1 66  ? 10.629  14.607  -10.741 1.00 20.35 ? 66  ALA B HA   1  
ATOM 3415   H HB1  . ALA B 1 66  ? 9.409   13.133  -9.213  1.00 31.43 ? 66  ALA B HB1  1  
ATOM 3416   H HB2  . ALA B 1 66  ? 10.605  14.086  -8.333  1.00 61.04 ? 66  ALA B HB2  1  
ATOM 3417   H HB3  . ALA B 1 66  ? 10.921  12.386  -8.695  1.00 2.14  ? 66  ALA B HB3  1  
ATOM 3418   N N    . SER B 1 67  ? 12.902  15.249  -9.911  1.00 33.44 ? 67  SER B N    1  
ATOM 3419   C CA   . SER B 1 67  ? 14.281  15.731  -9.827  1.00 54.11 ? 67  SER B CA   1  
ATOM 3420   C C    . SER B 1 67  ? 14.406  16.899  -8.841  1.00 11.02 ? 67  SER B C    1  
ATOM 3421   O O    . SER B 1 67  ? 13.572  17.813  -8.835  1.00 24.43 ? 67  SER B O    1  
ATOM 3422   C CB   . SER B 1 67  ? 14.767  16.154  -11.239 1.00 72.45 ? 67  SER B CB   1  
ATOM 3423   O OG   . SER B 1 67  ? 13.900  17.117  -11.838 1.00 51.54 ? 67  SER B OG   1  
ATOM 3424   H H    . SER B 1 67  ? 12.172  15.886  -9.749  1.00 33.03 ? 67  SER B H    1  
ATOM 3425   H HA   . SER B 1 67  ? 14.903  14.905  -9.464  1.00 54.23 ? 67  SER B HA   1  
ATOM 3426   H HB2  . SER B 1 67  ? 15.759  16.579  -11.169 1.00 65.23 ? 67  SER B HB2  1  
ATOM 3427   H HB3  . SER B 1 67  ? 14.804  15.282  -11.881 1.00 41.33 ? 67  SER B HB3  1  
ATOM 3428   H HG   . SER B 1 67  ? 13.633  17.770  -11.183 1.00 23.11 ? 67  SER B HG   1  
ATOM 3429   N N    . LEU B 1 68  ? 15.457  16.843  -8.005  1.00 4.11  ? 68  LEU B N    1  
ATOM 3430   C CA   . LEU B 1 68  ? 15.815  17.914  -7.063  1.00 3.43  ? 68  LEU B CA   1  
ATOM 3431   C C    . LEU B 1 68  ? 16.878  18.818  -7.697  1.00 51.44 ? 68  LEU B C    1  
ATOM 3432   O O    . LEU B 1 68  ? 18.038  18.417  -7.884  1.00 23.23 ? 68  LEU B O    1  
ATOM 3433   C CB   . LEU B 1 68  ? 16.291  17.297  -5.725  1.00 2.04  ? 68  LEU B CB   1  
ATOM 3434   C CG   . LEU B 1 68  ? 15.149  16.714  -4.847  1.00 14.42 ? 68  LEU B CG   1  
ATOM 3435   C CD1  . LEU B 1 68  ? 15.682  15.827  -3.711  1.00 52.41 ? 68  LEU B CD1  1  
ATOM 3436   C CD2  . LEU B 1 68  ? 14.265  17.858  -4.309  1.00 62.33 ? 68  LEU B CD2  1  
ATOM 3437   H H    . LEU B 1 68  ? 16.029  16.044  -8.032  1.00 2.24  ? 68  LEU B H    1  
ATOM 3438   H HA   . LEU B 1 68  ? 14.916  18.506  -6.871  1.00 74.24 ? 68  LEU B HA   1  
ATOM 3439   H HB2  . LEU B 1 68  ? 16.998  16.505  -5.951  1.00 52.12 ? 68  LEU B HB2  1  
ATOM 3440   H HB3  . LEU B 1 68  ? 16.814  18.056  -5.145  1.00 10.32 ? 68  LEU B HB3  1  
ATOM 3441   H HG   . LEU B 1 68  ? 14.518  16.087  -5.467  1.00 0.51  ? 68  LEU B HG   1  
ATOM 3442   H HD11 . LEU B 1 68  ? 14.862  15.335  -3.221  1.00 23.13 ? 68  LEU B HD11 1  
ATOM 3443   H HD12 . LEU B 1 68  ? 16.230  16.425  -2.995  1.00 15.44 ? 68  LEU B HD12 1  
ATOM 3444   H HD13 . LEU B 1 68  ? 16.340  15.075  -4.121  1.00 2.32  ? 68  LEU B HD13 1  
ATOM 3445   H HD21 . LEU B 1 68  ? 14.846  18.514  -3.673  1.00 11.34 ? 68  LEU B HD21 1  
ATOM 3446   H HD22 . LEU B 1 68  ? 13.450  17.447  -3.750  1.00 42.35 ? 68  LEU B HD22 1  
ATOM 3447   H HD23 . LEU B 1 68  ? 13.858  18.426  -5.134  1.00 74.52 ? 68  LEU B HD23 1  
ATOM 3448   N N    . GLY B 1 69  ? 16.449  20.043  -8.013  1.00 53.22 ? 69  GLY B N    1  
ATOM 3449   C CA   . GLY B 1 69  ? 17.236  20.972  -8.814  1.00 11.44 ? 69  GLY B CA   1  
ATOM 3450   C C    . GLY B 1 69  ? 17.286  20.553  -10.280 1.00 73.13 ? 69  GLY B C    1  
ATOM 3451   O O    . GLY B 1 69  ? 16.260  20.584  -10.971 1.00 14.02 ? 69  GLY B O    1  
ATOM 3452   H H    . GLY B 1 69  ? 15.573  20.323  -7.670  1.00 44.34 ? 69  GLY B H    1  
ATOM 3453   H HA2  . GLY B 1 69  ? 16.786  21.957  -8.744  1.00 23.22 ? 69  GLY B HA2  1  
ATOM 3454   H HA3  . GLY B 1 69  ? 18.241  21.026  -8.415  1.00 4.10  ? 69  GLY B HA3  1  
ATOM 3455   N N    . GLU B 1 70  ? 18.473  20.129  -10.740 1.00 22.35 ? 70  GLU B N    1  
ATOM 3456   C CA   . GLU B 1 70  ? 18.709  19.696  -12.139 1.00 25.02 ? 70  GLU B CA   1  
ATOM 3457   C C    . GLU B 1 70  ? 19.170  18.215  -12.190 1.00 3.15  ? 70  GLU B C    1  
ATOM 3458   O O    . GLU B 1 70  ? 19.390  17.662  -13.269 1.00 1.32  ? 70  GLU B O    1  
ATOM 3459   C CB   . GLU B 1 70  ? 19.759  20.652  -12.783 1.00 23.32 ? 70  GLU B CB   1  
ATOM 3460   C CG   . GLU B 1 70  ? 20.066  20.416  -14.283 1.00 32.41 ? 70  GLU B CG   1  
ATOM 3461   C CD   . GLU B 1 70  ? 21.064  21.432  -14.854 1.00 73.13 ? 70  GLU B CD   1  
ATOM 3462   O OE1  . GLU B 1 70  ? 20.665  22.302  -15.660 1.00 73.22 ? 70  GLU B OE1  1  
ATOM 3463   O OE2  . GLU B 1 70  ? 22.249  21.381  -14.473 1.00 62.41 ? 70  GLU B OE2  1  
ATOM 3464   H H    . GLU B 1 70  ? 19.225  20.108  -10.117 1.00 63.40 ? 70  GLU B H    1  
ATOM 3465   H HA   . GLU B 1 70  ? 17.775  19.778  -12.690 1.00 32.41 ? 70  GLU B HA   1  
ATOM 3466   H HB2  . GLU B 1 70  ? 19.393  21.667  -12.681 1.00 53.14 ? 70  GLU B HB2  1  
ATOM 3467   H HB3  . GLU B 1 70  ? 20.692  20.571  -12.230 1.00 21.23 ? 70  GLU B HB3  1  
ATOM 3468   H HG2  . GLU B 1 70  ? 20.478  19.416  -14.404 1.00 43.32 ? 70  GLU B HG2  1  
ATOM 3469   H HG3  . GLU B 1 70  ? 19.135  20.475  -14.841 1.00 45.20 ? 70  GLU B HG3  1  
ATOM 3470   N N    . GLU B 1 71  ? 19.234  17.549  -11.023 1.00 32.34 ? 71  GLU B N    1  
ATOM 3471   C CA   . GLU B 1 71  ? 19.640  16.127  -10.938 1.00 31.24 ? 71  GLU B CA   1  
ATOM 3472   C C    . GLU B 1 71  ? 18.433  15.292  -10.498 1.00 75.23 ? 71  GLU B C    1  
ATOM 3473   O O    . GLU B 1 71  ? 17.574  15.795  -9.757  1.00 62.34 ? 71  GLU B O    1  
ATOM 3474   C CB   . GLU B 1 71  ? 20.821  15.934  -9.942  1.00 34.13 ? 71  GLU B CB   1  
ATOM 3475   C CG   . GLU B 1 71  ? 20.467  16.155  -8.452  1.00 10.00 ? 71  GLU B CG   1  
ATOM 3476   C CD   . GLU B 1 71  ? 21.609  15.788  -7.492  1.00 62.41 ? 71  GLU B CD   1  
ATOM 3477   O OE1  . GLU B 1 71  ? 21.660  14.633  -7.037  1.00 64.55 ? 71  GLU B OE1  1  
ATOM 3478   O OE2  . GLU B 1 71  ? 22.459  16.655  -7.200  1.00 24.11 ? 71  GLU B OE2  1  
ATOM 3479   H H    . GLU B 1 71  ? 18.995  18.019  -10.198 1.00 60.34 ? 71  GLU B H    1  
ATOM 3480   H HA   . GLU B 1 71  ? 19.953  15.791  -11.926 1.00 30.21 ? 71  GLU B HA   1  
ATOM 3481   H HB2  . GLU B 1 71  ? 21.207  14.926  -10.058 1.00 52.42 ? 71  GLU B HB2  1  
ATOM 3482   H HB3  . GLU B 1 71  ? 21.610  16.632  -10.208 1.00 70.33 ? 71  GLU B HB3  1  
ATOM 3483   H HG2  . GLU B 1 71  ? 20.208  17.199  -8.311  1.00 45.33 ? 71  GLU B HG2  1  
ATOM 3484   H HG3  . GLU B 1 71  ? 19.594  15.551  -8.205  1.00 51.15 ? 71  GLU B HG3  1  
ATOM 3485   N N    . THR B 1 72  ? 18.372  14.026  -10.957 1.00 1.11  ? 72  THR B N    1  
ATOM 3486   C CA   . THR B 1 72  ? 17.243  13.130  -10.675 1.00 4.40  ? 72  THR B CA   1  
ATOM 3487   C C    . THR B 1 72  ? 17.103  12.883  -9.160  1.00 53.11 ? 72  THR B C    1  
ATOM 3488   O O    . THR B 1 72  ? 18.096  12.764  -8.448  1.00 13.33 ? 72  THR B O    1  
ATOM 3489   C CB   . THR B 1 72  ? 17.400  11.754  -11.405 1.00 52.31 ? 72  THR B CB   1  
ATOM 3490   O OG1  . THR B 1 72  ? 17.664  11.983  -12.798 1.00 35.14 ? 72  THR B OG1  1  
ATOM 3491   C CG2  . THR B 1 72  ? 16.135  10.862  -11.257 1.00 1.50  ? 72  THR B CG2  1  
ATOM 3492   H H    . THR B 1 72  ? 19.112  13.686  -11.502 1.00 32.24 ? 72  THR B H    1  
ATOM 3493   H HA   . THR B 1 72  ? 16.341  13.614  -11.049 1.00 3.11  ? 72  THR B HA   1  
ATOM 3494   H HB   . THR B 1 72  ? 18.250  11.230  -10.977 1.00 73.45 ? 72  THR B HB   1  
ATOM 3495   H HG1  . THR B 1 72  ? 18.094  11.210  -13.173 1.00 43.14 ? 72  THR B HG1  1  
ATOM 3496   H HG21 . THR B 1 72  ? 16.334  9.873   -11.633 1.00 64.21 ? 72  THR B HG21 1  
ATOM 3497   H HG22 . THR B 1 72  ? 15.317  11.282  -11.817 1.00 32.44 ? 72  THR B HG22 1  
ATOM 3498   H HG23 . THR B 1 72  ? 15.853  10.792  -10.213 1.00 74.32 ? 72  THR B HG23 1  
ATOM 3499   N N    . ALA B 1 73  ? 15.864  12.846  -8.688  1.00 35.43 ? 73  ALA B N    1  
ATOM 3500   C CA   . ALA B 1 73  ? 15.534  12.441  -7.324  1.00 63.12 ? 73  ALA B CA   1  
ATOM 3501   C C    . ALA B 1 73  ? 15.113  10.973  -7.365  1.00 15.03 ? 73  ALA B C    1  
ATOM 3502   O O    . ALA B 1 73  ? 15.846  10.087  -6.909  1.00 1.24  ? 73  ALA B O    1  
ATOM 3503   C CB   . ALA B 1 73  ? 14.418  13.332  -6.773  1.00 42.20 ? 73  ALA B CB   1  
ATOM 3504   H H    . ALA B 1 73  ? 15.134  13.081  -9.292  1.00 23.42 ? 73  ALA B H    1  
ATOM 3505   H HA   . ALA B 1 73  ? 16.414  12.555  -6.682  1.00 2.45  ? 73  ALA B HA   1  
ATOM 3506   H HB1  . ALA B 1 73  ? 14.144  13.012  -5.787  1.00 22.44 ? 73  ALA B HB1  1  
ATOM 3507   H HB2  . ALA B 1 73  ? 13.547  13.278  -7.419  1.00 70.43 ? 73  ALA B HB2  1  
ATOM 3508   H HB3  . ALA B 1 73  ? 14.759  14.351  -6.727  1.00 33.12 ? 73  ALA B HB3  1  
ATOM 3509   N N    . PHE B 1 74  ? 13.961  10.731  -8.014  1.00 12.40 ? 74  PHE B N    1  
ATOM 3510   C CA   . PHE B 1 74  ? 13.354  9.403   -8.110  1.00 31.10 ? 74  PHE B CA   1  
ATOM 3511   C C    . PHE B 1 74  ? 12.608  9.268   -9.436  1.00 64.11 ? 74  PHE B C    1  
ATOM 3512   O O    . PHE B 1 74  ? 12.223  10.268  -10.062 1.00 20.23 ? 74  PHE B O    1  
ATOM 3513   C CB   . PHE B 1 74  ? 12.406  9.112   -6.899  1.00 62.34 ? 74  PHE B CB   1  
ATOM 3514   C CG   . PHE B 1 74  ? 11.066  9.877   -6.849  1.00 12.05 ? 74  PHE B CG   1  
ATOM 3515   C CD1  . PHE B 1 74  ? 9.932   9.391   -7.518  1.00 11.05 ? 74  PHE B CD1  1  
ATOM 3516   C CD2  . PHE B 1 74  ? 10.928  11.059  -6.114  1.00 4.11  ? 74  PHE B CD2  1  
ATOM 3517   C CE1  . PHE B 1 74  ? 8.724   10.058  -7.461  1.00 64.50 ? 74  PHE B CE1  1  
ATOM 3518   C CE2  . PHE B 1 74  ? 9.709   11.725  -6.058  1.00 62.22 ? 74  PHE B CE2  1  
ATOM 3519   C CZ   . PHE B 1 74  ? 8.613   11.223  -6.731  1.00 32.04 ? 74  PHE B CZ   1  
ATOM 3520   H H    . PHE B 1 74  ? 13.523  11.473  -8.485  1.00 44.12 ? 74  PHE B H    1  
ATOM 3521   H HA   . PHE B 1 74  ? 14.162  8.670   -8.101  1.00 2.33  ? 74  PHE B HA   1  
ATOM 3522   H HB2  . PHE B 1 74  ? 12.172  8.053   -6.893  1.00 33.15 ? 74  PHE B HB2  1  
ATOM 3523   H HB3  . PHE B 1 74  ? 12.947  9.332   -5.986  1.00 63.43 ? 74  PHE B HB3  1  
ATOM 3524   H HD1  . PHE B 1 74  ? 10.009  8.475   -8.095  1.00 11.05 ? 74  PHE B HD1  1  
ATOM 3525   H HD2  . PHE B 1 74  ? 11.788  11.464  -5.584  1.00 41.03 ? 74  PHE B HD2  1  
ATOM 3526   H HE1  . PHE B 1 74  ? 7.862   9.665   -7.988  1.00 1.10  ? 74  PHE B HE1  1  
ATOM 3527   H HE2  . PHE B 1 74  ? 9.613   12.649  -5.492  1.00 11.53 ? 74  PHE B HE2  1  
ATOM 3528   H HZ   . PHE B 1 74  ? 7.663   11.747  -6.688  1.00 34.32 ? 74  PHE B HZ   1  
ATOM 3529   N N    . LEU B 1 75  ? 12.413  8.017   -9.844  1.00 1.31  ? 75  LEU B N    1  
ATOM 3530   C CA   . LEU B 1 75  ? 11.637  7.639   -11.027 1.00 21.23 ? 75  LEU B CA   1  
ATOM 3531   C C    . LEU B 1 75  ? 10.698  6.507   -10.585 1.00 21.13 ? 75  LEU B C    1  
ATOM 3532   O O    . LEU B 1 75  ? 11.161  5.413   -10.308 1.00 24.12 ? 75  LEU B O    1  
ATOM 3533   C CB   . LEU B 1 75  ? 12.619  7.156   -12.147 1.00 61.31 ? 75  LEU B CB   1  
ATOM 3534   C CG   . LEU B 1 75  ? 13.727  8.172   -12.577 1.00 12.03 ? 75  LEU B CG   1  
ATOM 3535   C CD1  . LEU B 1 75  ? 14.804  7.504   -13.449 1.00 20.35 ? 75  LEU B CD1  1  
ATOM 3536   C CD2  . LEU B 1 75  ? 13.125  9.410   -13.276 1.00 11.33 ? 75  LEU B CD2  1  
ATOM 3537   H H    . LEU B 1 75  ? 12.814  7.295   -9.321  1.00 44.44 ? 75  LEU B H    1  
ATOM 3538   H HA   . LEU B 1 75  ? 11.057  8.493   -11.375 1.00 31.01 ? 75  LEU B HA   1  
ATOM 3539   H HB2  . LEU B 1 75  ? 13.109  6.251   -11.797 1.00 34.22 ? 75  LEU B HB2  1  
ATOM 3540   H HB3  . LEU B 1 75  ? 12.035  6.898   -13.028 1.00 71.11 ? 75  LEU B HB3  1  
ATOM 3541   H HG   . LEU B 1 75  ? 14.227  8.526   -11.681 1.00 70.33 ? 75  LEU B HG   1  
ATOM 3542   H HD11 . LEU B 1 75  ? 15.507  8.248   -13.800 1.00 1.52  ? 75  LEU B HD11 1  
ATOM 3543   H HD12 . LEU B 1 75  ? 14.346  7.013   -14.300 1.00 22.40 ? 75  LEU B HD12 1  
ATOM 3544   H HD13 . LEU B 1 75  ? 15.333  6.775   -12.856 1.00 3.44  ? 75  LEU B HD13 1  
ATOM 3545   H HD21 . LEU B 1 75  ? 12.423  9.898   -12.611 1.00 13.23 ? 75  LEU B HD21 1  
ATOM 3546   H HD22 . LEU B 1 75  ? 12.616  9.117   -14.182 1.00 64.25 ? 75  LEU B HD22 1  
ATOM 3547   H HD23 . LEU B 1 75  ? 13.917  10.107  -13.522 1.00 61.04 ? 75  LEU B HD23 1  
ATOM 3548   N N    . CYS B 1 76  ? 9.389   6.768   -10.496 1.00 11.40 ? 76  CYS B N    1  
ATOM 3549   C CA   . CYS B 1 76  ? 8.409   5.765   -10.028 1.00 45.42 ? 76  CYS B CA   1  
ATOM 3550   C C    . CYS B 1 76  ? 7.362   5.508   -11.114 1.00 42.41 ? 76  CYS B C    1  
ATOM 3551   O O    . CYS B 1 76  ? 6.602   6.406   -11.476 1.00 15.45 ? 76  CYS B O    1  
ATOM 3552   C CB   . CYS B 1 76  ? 7.730   6.227   -8.717  1.00 2.51  ? 76  CYS B CB   1  
ATOM 3553   S SG   . CYS B 1 76  ? 6.673   4.966   -7.958  1.00 50.14 ? 76  CYS B SG   1  
ATOM 3554   H H    . CYS B 1 76  ? 9.068   7.657   -10.746 1.00 54.42 ? 76  CYS B H    1  
ATOM 3555   H HA   . CYS B 1 76  ? 8.939   4.827   -9.827  1.00 11.03 ? 76  CYS B HA   1  
ATOM 3556   H HB2  . CYS B 1 76  ? 8.490   6.487   -7.993  1.00 42.12 ? 76  CYS B HB2  1  
ATOM 3557   H HB3  . CYS B 1 76  ? 7.114   7.101   -8.907  1.00 10.31 ? 76  CYS B HB3  1  
ATOM 3558   H HG   . CYS B 1 76  ? 6.878   3.823   -8.599  1.00 20.20 ? 76  CYS B HG   1  
ATOM 3559   N N    . GLU B 1 77  ? 7.319   4.267   -11.608 1.00 51.11 ? 77  GLU B N    1  
ATOM 3560   C CA   . GLU B 1 77  ? 6.386   3.826   -12.649 1.00 51.21 ? 77  GLU B CA   1  
ATOM 3561   C C    . GLU B 1 77  ? 5.566   2.653   -12.109 1.00 65.11 ? 77  GLU B C    1  
ATOM 3562   O O    . GLU B 1 77  ? 6.119   1.735   -11.510 1.00 24.32 ? 77  GLU B O    1  
ATOM 3563   C CB   . GLU B 1 77  ? 7.163   3.381   -13.914 1.00 13.23 ? 77  GLU B CB   1  
ATOM 3564   C CG   . GLU B 1 77  ? 6.277   2.828   -15.055 1.00 22.30 ? 77  GLU B CG   1  
ATOM 3565   C CD   . GLU B 1 77  ? 7.084   2.352   -16.264 1.00 62.14 ? 77  GLU B CD   1  
ATOM 3566   O OE1  . GLU B 1 77  ? 7.786   3.183   -16.878 1.00 1.43  ? 77  GLU B OE1  1  
ATOM 3567   O OE2  . GLU B 1 77  ? 7.004   1.158   -16.628 1.00 64.43 ? 77  GLU B OE2  1  
ATOM 3568   H H    . GLU B 1 77  ? 7.947   3.607   -11.250 1.00 32.54 ? 77  GLU B H    1  
ATOM 3569   H HA   . GLU B 1 77  ? 5.718   4.653   -12.915 1.00 24.20 ? 77  GLU B HA   1  
ATOM 3570   H HB2  . GLU B 1 77  ? 7.717   4.233   -14.296 1.00 54.32 ? 77  GLU B HB2  1  
ATOM 3571   H HB3  . GLU B 1 77  ? 7.877   2.609   -13.632 1.00 21.34 ? 77  GLU B HB3  1  
ATOM 3572   H HG2  . GLU B 1 77  ? 5.693   1.997   -14.668 1.00 3.43  ? 77  GLU B HG2  1  
ATOM 3573   H HG3  . GLU B 1 77  ? 5.591   3.608   -15.382 1.00 41.54 ? 77  GLU B HG3  1  
ATOM 3574   N N    . VAL B 1 78  ? 4.248   2.703   -12.295 1.00 43.35 ? 78  VAL B N    1  
ATOM 3575   C CA   . VAL B 1 78  ? 3.344   1.600   -11.952 1.00 64.32 ? 78  VAL B CA   1  
ATOM 3576   C C    . VAL B 1 78  ? 2.467   1.279   -13.159 1.00 73.21 ? 78  VAL B C    1  
ATOM 3577   O O    . VAL B 1 78  ? 2.126   2.165   -13.943 1.00 74.01 ? 78  VAL B O    1  
ATOM 3578   C CB   . VAL B 1 78  ? 2.444   1.945   -10.706 1.00 43.22 ? 78  VAL B CB   1  
ATOM 3579   C CG1  . VAL B 1 78  ? 1.367   0.860   -10.446 1.00 72.30 ? 78  VAL B CG1  1  
ATOM 3580   C CG2  . VAL B 1 78  ? 3.337   2.145   -9.461  1.00 3.35  ? 78  VAL B CG2  1  
ATOM 3581   H H    . VAL B 1 78  ? 3.862   3.511   -12.687 1.00 11.05 ? 78  VAL B H    1  
ATOM 3582   H HA   . VAL B 1 78  ? 3.942   0.711   -11.710 1.00 32.21 ? 78  VAL B HA   1  
ATOM 3583   H HB   . VAL B 1 78  ? 1.931   2.883   -10.901 1.00 55.24 ? 78  VAL B HB   1  
ATOM 3584   H HG11 . VAL B 1 78  ? 0.674   1.196   -9.707  1.00 24.52 ? 78  VAL B HG11 1  
ATOM 3585   H HG12 . VAL B 1 78  ? 1.839   -0.049  -10.100 1.00 63.24 ? 78  VAL B HG12 1  
ATOM 3586   H HG13 . VAL B 1 78  ? 0.833   0.647   -11.352 1.00 74.24 ? 78  VAL B HG13 1  
ATOM 3587   H HG21 . VAL B 1 78  ? 2.742   2.155   -8.571  1.00 53.24 ? 78  VAL B HG21 1  
ATOM 3588   H HG22 . VAL B 1 78  ? 3.876   3.081   -9.539  1.00 72.23 ? 78  VAL B HG22 1  
ATOM 3589   H HG23 . VAL B 1 78  ? 4.041   1.343   -9.396  1.00 62.40 ? 78  VAL B HG23 1  
ATOM 3590   N N    . GLN B 1 79  ? 2.113   0.001   -13.293 1.00 31.31 ? 79  GLN B N    1  
ATOM 3591   C CA   . GLN B 1 79  ? 1.159   -0.468  -14.291 1.00 62.53 ? 79  GLN B CA   1  
ATOM 3592   C C    . GLN B 1 79  ? 0.049   -1.246  -13.593 1.00 1.21  ? 79  GLN B C    1  
ATOM 3593   O O    . GLN B 1 79  ? 0.253   -2.379  -13.160 1.00 11.33 ? 79  GLN B O    1  
ATOM 3594   C CB   . GLN B 1 79  ? 1.843   -1.332  -15.384 1.00 31.12 ? 79  GLN B CB   1  
ATOM 3595   C CG   . GLN B 1 79  ? 2.848   -0.564  -16.271 1.00 41.03 ? 79  GLN B CG   1  
ATOM 3596   C CD   . GLN B 1 79  ? 3.525   -1.399  -17.363 1.00 41.54 ? 79  GLN B CD   1  
ATOM 3597   O OE1  . GLN B 1 79  ? 4.654   -1.113  -17.769 1.00 41.10 ? 79  GLN B OE1  1  
ATOM 3598   N NE2  . GLN B 1 79  ? 2.849   -2.429  -17.865 1.00 45.30 ? 79  GLN B NE2  1  
ATOM 3599   H H    . GLN B 1 79  ? 2.494   -0.647  -12.662 1.00 53.42 ? 79  GLN B H    1  
ATOM 3600   H HA   . GLN B 1 79  ? 0.712   0.409   -14.757 1.00 51.12 ? 79  GLN B HA   1  
ATOM 3601   H HB2  . GLN B 1 79  ? 2.369   -2.148  -14.901 1.00 44.44 ? 79  GLN B HB2  1  
ATOM 3602   H HB3  . GLN B 1 79  ? 1.078   -1.753  -16.030 1.00 42.50 ? 79  GLN B HB3  1  
ATOM 3603   H HG2  . GLN B 1 79  ? 2.327   0.251   -16.756 1.00 21.20 ? 79  GLN B HG2  1  
ATOM 3604   H HG3  . GLN B 1 79  ? 3.619   -0.148  -15.630 1.00 1.32  ? 79  GLN B HG3  1  
ATOM 3605   H HE21 . GLN B 1 79  ? 1.954   -2.614  -17.522 1.00 73.34 ? 79  GLN B HE21 1  
ATOM 3606   H HE22 . GLN B 1 79  ? 3.277   -2.963  -18.567 1.00 41.31 ? 79  GLN B HE22 1  
ATOM 3607   N N    . GLN B 1 80  ? -1.109  -0.592  -13.444 1.00 44.21 ? 80  GLN B N    1  
ATOM 3608   C CA   . GLN B 1 80  ? -2.305  -1.196  -12.867 1.00 15.44 ? 80  GLN B CA   1  
ATOM 3609   C C    . GLN B 1 80  ? -3.129  -1.826  -13.995 1.00 13.23 ? 80  GLN B C    1  
ATOM 3610   O O    . GLN B 1 80  ? -3.750  -1.104  -14.770 1.00 22.25 ? 80  GLN B O    1  
ATOM 3611   C CB   . GLN B 1 80  ? -3.142  -0.116  -12.125 1.00 22.11 ? 80  GLN B CB   1  
ATOM 3612   C CG   . GLN B 1 80  ? -4.302  -0.693  -11.288 1.00 54.22 ? 80  GLN B CG   1  
ATOM 3613   C CD   . GLN B 1 80  ? -3.820  -1.485  -10.074 1.00 31.32 ? 80  GLN B CD   1  
ATOM 3614   O OE1  . GLN B 1 80  ? -4.446  -2.455  -9.662  1.00 13.54 ? 80  GLN B OE1  1  
ATOM 3615   N NE2  . GLN B 1 80  ? -2.757  -1.006  -9.421  1.00 64.25 ? 80  GLN B NE2  1  
ATOM 3616   H H    . GLN B 1 80  ? -1.161  0.337   -13.754 1.00 55.15 ? 80  GLN B H    1  
ATOM 3617   H HA   . GLN B 1 80  ? -2.005  -1.970  -12.158 1.00 14.34 ? 80  GLN B HA   1  
ATOM 3618   H HB2  . GLN B 1 80  ? -2.483  0.430   -11.453 1.00 11.35 ? 80  GLN B HB2  1  
ATOM 3619   H HB3  . GLN B 1 80  ? -3.551  0.594   -12.844 1.00 21.11 ? 80  GLN B HB3  1  
ATOM 3620   H HG2  . GLN B 1 80  ? -4.913  0.127   -10.926 1.00 65.02 ? 80  GLN B HG2  1  
ATOM 3621   H HG3  . GLN B 1 80  ? -4.919  -1.340  -11.920 1.00 64.11 ? 80  GLN B HG3  1  
ATOM 3622   H HE21 . GLN B 1 80  ? -2.348  -0.171  -9.742  1.00 64.32 ? 80  GLN B HE21 1  
ATOM 3623   H HE22 . GLN B 1 80  ? -2.423  -1.514  -8.654  1.00 74.10 ? 80  GLN B HE22 1  
ATOM 3624   N N    . GLY B 1 81  ? -3.097  -3.158  -14.103 1.00 21.14 ? 81  GLY B N    1  
ATOM 3625   C CA   . GLY B 1 81  ? -3.932  -3.870  -15.071 1.00 71.34 ? 81  GLY B CA   1  
ATOM 3626   C C    . GLY B 1 81  ? -5.284  -4.234  -14.475 1.00 32.24 ? 81  GLY B C    1  
ATOM 3627   O O    . GLY B 1 81  ? -5.516  -4.063  -13.266 1.00 5.14  ? 81  GLY B O    1  
ATOM 3628   H H    . GLY B 1 81  ? -2.525  -3.673  -13.494 1.00 23.14 ? 81  GLY B H    1  
ATOM 3629   H HA2  . GLY B 1 81  ? -4.093  -3.249  -15.951 1.00 72.13 ? 81  GLY B HA2  1  
ATOM 3630   H HA3  . GLY B 1 81  ? -3.425  -4.775  -15.380 1.00 33.52 ? 81  GLY B HA3  1  
ATOM 3631   N N    . GLY B 1 82  ? -6.183  -4.718  -15.322 1.00 3.51  ? 82  GLY B N    1  
ATOM 3632   C CA   . GLY B 1 82  ? -7.525  -5.068  -14.892 1.00 54.54 ? 82  GLY B CA   1  
ATOM 3633   C C    . GLY B 1 82  ? -8.269  -5.867  -15.940 1.00 71.45 ? 82  GLY B C    1  
ATOM 3634   O O    . GLY B 1 82  ? -8.298  -5.483  -17.112 1.00 31.42 ? 82  GLY B O    1  
ATOM 3635   H H    . GLY B 1 82  ? -5.935  -4.823  -16.269 1.00 21.13 ? 82  GLY B H    1  
ATOM 3636   H HA2  . GLY B 1 82  ? -7.466  -5.643  -13.970 1.00 74.15 ? 82  GLY B HA2  1  
ATOM 3637   H HA3  . GLY B 1 82  ? -8.079  -4.157  -14.694 1.00 43.13 ? 82  GLY B HA3  1  
ATOM 3638   N N    . ILE B 1 83  ? -8.865  -6.986  -15.516 1.00 52.33 ? 83  ILE B N    1  
ATOM 3639   C CA   . ILE B 1 83  ? -9.715  -7.817  -16.369 1.00 43.22 ? 83  ILE B CA   1  
ATOM 3640   C C    . ILE B 1 83  ? -11.182 -7.329  -16.262 1.00 72.55 ? 83  ILE B C    1  
ATOM 3641   O O    . ILE B 1 83  ? -11.722 -7.195  -15.154 1.00 74.43 ? 83  ILE B O    1  
ATOM 3642   C CB   . ILE B 1 83  ? -9.611  -9.334  -15.963 1.00 15.51 ? 83  ILE B CB   1  
ATOM 3643   C CG1  . ILE B 1 83  ? -8.114  -9.780  -15.859 1.00 40.13 ? 83  ILE B CG1  1  
ATOM 3644   C CG2  . ILE B 1 83  ? -10.392 -10.210 -16.971 1.00 32.23 ? 83  ILE B CG2  1  
ATOM 3645   C CD1  . ILE B 1 83  ? -7.894  -11.193 -15.346 1.00 53.35 ? 83  ILE B CD1  1  
ATOM 3646   H H    . ILE B 1 83  ? -8.726  -7.263  -14.590 1.00 42.53 ? 83  ILE B H    1  
ATOM 3647   H HA   . ILE B 1 83  ? -9.372  -7.712  -17.404 1.00 4.12  ? 83  ILE B HA   1  
ATOM 3648   H HB   . ILE B 1 83  ? -10.078 -9.459  -14.987 1.00 65.52 ? 83  ILE B HB   1  
ATOM 3649   H HG12 . ILE B 1 83  ? -7.648  -9.714  -16.833 1.00 25.43 ? 83  ILE B HG12 1  
ATOM 3650   H HG13 . ILE B 1 83  ? -7.594  -9.112  -15.184 1.00 72.22 ? 83  ILE B HG13 1  
ATOM 3651   H HG21 . ILE B 1 83  ? -11.452 -9.990  -16.905 1.00 2.31  ? 83  ILE B HG21 1  
ATOM 3652   H HG22 . ILE B 1 83  ? -10.234 -11.251 -16.759 1.00 22.43 ? 83  ILE B HG22 1  
ATOM 3653   H HG23 . ILE B 1 83  ? -10.053 -10.004 -17.977 1.00 71.45 ? 83  ILE B HG23 1  
ATOM 3654   H HD11 . ILE B 1 83  ? -6.835  -11.387 -15.283 1.00 34.11 ? 83  ILE B HD11 1  
ATOM 3655   H HD12 . ILE B 1 83  ? -8.349  -11.904 -16.022 1.00 25.13 ? 83  ILE B HD12 1  
ATOM 3656   H HD13 . ILE B 1 83  ? -8.335  -11.295 -14.363 1.00 53.33 ? 83  ILE B HD13 1  
ATOM 3657   N N    . PHE B 1 84  ? -11.800 -7.066  -17.425 1.00 71.44 ? 84  PHE B N    1  
ATOM 3658   C CA   . PHE B 1 84  ? -13.193 -6.577  -17.550 1.00 41.13 ? 84  PHE B CA   1  
ATOM 3659   C C    . PHE B 1 84  ? -13.871 -7.396  -18.670 1.00 45.55 ? 84  PHE B C    1  
ATOM 3660   O O    . PHE B 1 84  ? -13.286 -7.561  -19.749 1.00 4.13  ? 84  PHE B O    1  
ATOM 3661   C CB   . PHE B 1 84  ? -13.228 -5.047  -17.916 1.00 25.11 ? 84  PHE B CB   1  
ATOM 3662   C CG   . PHE B 1 84  ? -12.339 -4.127  -17.054 1.00 62.31 ? 84  PHE B CG   1  
ATOM 3663   C CD1  . PHE B 1 84  ? -11.060 -3.757  -17.487 1.00 63.41 ? 84  PHE B CD1  1  
ATOM 3664   C CD2  . PHE B 1 84  ? -12.774 -3.633  -15.818 1.00 24.13 ? 84  PHE B CD2  1  
ATOM 3665   C CE1  . PHE B 1 84  ? -10.252 -2.931  -16.721 1.00 22.20 ? 84  PHE B CE1  1  
ATOM 3666   C CE2  . PHE B 1 84  ? -11.961 -2.806  -15.054 1.00 24.52 ? 84  PHE B CE2  1  
ATOM 3667   C CZ   . PHE B 1 84  ? -10.700 -2.460  -15.503 1.00 61.02 ? 84  PHE B CZ   1  
ATOM 3668   H H    . PHE B 1 84  ? -11.301 -7.239  -18.247 1.00 65.55 ? 84  PHE B H    1  
ATOM 3669   H HA   . PHE B 1 84  ? -13.719 -6.744  -16.608 1.00 15.12 ? 84  PHE B HA   1  
ATOM 3670   H HB2  . PHE B 1 84  ? -12.917 -4.928  -18.948 1.00 3.25  ? 84  PHE B HB2  1  
ATOM 3671   H HB3  . PHE B 1 84  ? -14.253 -4.688  -17.831 1.00 52.52 ? 84  PHE B HB3  1  
ATOM 3672   H HD1  . PHE B 1 84  ? -10.695 -4.125  -18.440 1.00 20.12 ? 84  PHE B HD1  1  
ATOM 3673   H HD2  . PHE B 1 84  ? -13.766 -3.888  -15.457 1.00 62.51 ? 84  PHE B HD2  1  
ATOM 3674   H HE1  . PHE B 1 84  ? -9.266  -2.655  -17.077 1.00 11.21 ? 84  PHE B HE1  1  
ATOM 3675   H HE2  . PHE B 1 84  ? -12.314 -2.438  -14.098 1.00 74.23 ? 84  PHE B HE2  1  
ATOM 3676   H HZ   . PHE B 1 84  ? -10.058 -1.814  -14.902 1.00 12.55 ? 84  PHE B HZ   1  
ATOM 3677   N N    . SER B 1 85  ? -15.090 -7.903  -18.429 1.00 13.20 ? 85  SER B N    1  
ATOM 3678   C CA   . SER B 1 85  ? -15.835 -8.704  -19.427 1.00 64.35 ? 85  SER B CA   1  
ATOM 3679   C C    . SER B 1 85  ? -16.916 -7.854  -20.111 1.00 22.23 ? 85  SER B C    1  
ATOM 3680   O O    . SER B 1 85  ? -18.060 -7.799  -19.647 1.00 72.55 ? 85  SER B O    1  
ATOM 3681   C CB   . SER B 1 85  ? -16.418 -9.968  -18.759 1.00 24.04 ? 85  SER B CB   1  
ATOM 3682   O OG   . SER B 1 85  ? -15.373 -10.854 -18.410 1.00 50.52 ? 85  SER B OG   1  
ATOM 3683   H H    . SER B 1 85  ? -15.500 -7.744  -17.552 1.00 54.15 ? 85  SER B H    1  
ATOM 3684   H HA   . SER B 1 85  ? -15.131 -9.027  -20.195 1.00 73.41 ? 85  SER B HA   1  
ATOM 3685   H HB2  . SER B 1 85  ? -16.955 -9.695  -17.858 1.00 11.44 ? 85  SER B HB2  1  
ATOM 3686   H HB3  . SER B 1 85  ? -17.090 -10.474 -19.434 1.00 20.50 ? 85  SER B HB3  1  
ATOM 3687   H HG   . SER B 1 85  ? -14.778 -10.951 -19.159 1.00 31.42 ? 85  SER B HG   1  
ATOM 3688   N N    . ILE B 1 86  ? -16.544 -7.215  -21.244 1.00 11.42 ? 86  ILE B N    1  
ATOM 3689   C CA   . ILE B 1 86  ? -17.352 -6.159  -21.887 1.00 32.43 ? 86  ILE B CA   1  
ATOM 3690   C C    . ILE B 1 86  ? -18.230 -6.728  -23.028 1.00 64.44 ? 86  ILE B C    1  
ATOM 3691   O O    . ILE B 1 86  ? -17.835 -7.672  -23.726 1.00 24.05 ? 86  ILE B O    1  
ATOM 3692   C CB   . ILE B 1 86  ? -16.450 -4.973  -22.435 1.00 1.13  ? 86  ILE B CB   1  
ATOM 3693   C CG1  . ILE B 1 86  ? -15.678 -5.369  -23.732 1.00 45.52 ? 86  ILE B CG1  1  
ATOM 3694   C CG2  . ILE B 1 86  ? -15.453 -4.477  -21.352 1.00 41.35 ? 86  ILE B CG2  1  
ATOM 3695   C CD1  . ILE B 1 86  ? -14.974 -4.217  -24.432 1.00 14.34 ? 86  ILE B CD1  1  
ATOM 3696   H H    . ILE B 1 86  ? -15.700 -7.480  -21.671 1.00 45.31 ? 86  ILE B H    1  
ATOM 3697   H HA   . ILE B 1 86  ? -18.016 -5.742  -21.128 1.00 3.12  ? 86  ILE B HA   1  
ATOM 3698   H HB   . ILE B 1 86  ? -17.112 -4.142  -22.667 1.00 65.43 ? 86  ILE B HB   1  
ATOM 3699   H HG12 . ILE B 1 86  ? -14.927 -6.110  -23.491 1.00 0.02  ? 86  ILE B HG12 1  
ATOM 3700   H HG13 . ILE B 1 86  ? -16.372 -5.800  -24.442 1.00 74.23 ? 86  ILE B HG13 1  
ATOM 3701   H HG21 . ILE B 1 86  ? -14.869 -3.650  -21.739 1.00 32.23 ? 86  ILE B HG21 1  
ATOM 3702   H HG22 . ILE B 1 86  ? -14.784 -5.281  -21.070 1.00 2.12  ? 86  ILE B HG22 1  
ATOM 3703   H HG23 . ILE B 1 86  ? -15.997 -4.148  -20.477 1.00 5.52  ? 86  ILE B HG23 1  
ATOM 3704   H HD11 . ILE B 1 86  ? -14.443 -4.596  -25.292 1.00 43.31 ? 86  ILE B HD11 1  
ATOM 3705   H HD12 . ILE B 1 86  ? -14.271 -3.749  -23.755 1.00 52.23 ? 86  ILE B HD12 1  
ATOM 3706   H HD13 . ILE B 1 86  ? -15.704 -3.488  -24.754 1.00 33.04 ? 86  ILE B HD13 1  
ATOM 3707   N N    . ALA B 1 87  ? -19.432 -6.143  -23.177 1.00 24.42 ? 87  ALA B N    1  
ATOM 3708   C CA   . ALA B 1 87  ? -20.392 -6.479  -24.243 1.00 44.44 ? 87  ALA B CA   1  
ATOM 3709   C C    . ALA B 1 87  ? -21.363 -5.305  -24.465 1.00 72.31 ? 87  ALA B C    1  
ATOM 3710   O O    . ALA B 1 87  ? -21.550 -4.463  -23.573 1.00 62.13 ? 87  ALA B O    1  
ATOM 3711   C CB   . ALA B 1 87  ? -21.157 -7.766  -23.889 1.00 71.12 ? 87  ALA B CB   1  
ATOM 3712   H H    . ALA B 1 87  ? -19.688 -5.448  -22.538 1.00 1.53  ? 87  ALA B H    1  
ATOM 3713   H HA   . ALA B 1 87  ? -19.836 -6.648  -25.164 1.00 15.50 ? 87  ALA B HA   1  
ATOM 3714   H HB1  . ALA B 1 87  ? -20.454 -8.578  -23.746 1.00 2.54  ? 87  ALA B HB1  1  
ATOM 3715   H HB2  . ALA B 1 87  ? -21.837 -8.026  -24.689 1.00 64.14 ? 87  ALA B HB2  1  
ATOM 3716   H HB3  . ALA B 1 87  ? -21.721 -7.621  -22.975 1.00 20.03 ? 87  ALA B HB3  1  
ATOM 3717   N N    . GLY B 1 88  ? -21.962 -5.250  -25.668 1.00 64.55 ? 88  GLY B N    1  
ATOM 3718   C CA   . GLY B 1 88  ? -22.989 -4.256  -26.016 1.00 30.42 ? 88  GLY B CA   1  
ATOM 3719   C C    . GLY B 1 88  ? -22.431 -3.015  -26.705 1.00 71.01 ? 88  GLY B C    1  
ATOM 3720   O O    . GLY B 1 88  ? -23.058 -2.472  -27.623 1.00 41.32 ? 88  GLY B O    1  
ATOM 3721   H H    . GLY B 1 88  ? -21.706 -5.912  -26.341 1.00 34.11 ? 88  GLY B H    1  
ATOM 3722   H HA2  . GLY B 1 88  ? -23.695 -4.732  -26.682 1.00 41.33 ? 88  GLY B HA2  1  
ATOM 3723   H HA3  . GLY B 1 88  ? -23.524 -3.950  -25.122 1.00 4.12  ? 88  GLY B HA3  1  
ATOM 3724   N N    . ILE B 1 89  ? -21.260 -2.553  -26.237 1.00 65.40 ? 89  ILE B N    1  
ATOM 3725   C CA   . ILE B 1 89  ? -20.572 -1.376  -26.807 1.00 61.40 ? 89  ILE B CA   1  
ATOM 3726   C C    . ILE B 1 89  ? -19.824 -1.740  -28.098 1.00 51.23 ? 89  ILE B C    1  
ATOM 3727   O O    . ILE B 1 89  ? -19.314 -2.859  -28.229 1.00 54.44 ? 89  ILE B O    1  
ATOM 3728   C CB   . ILE B 1 89  ? -19.551 -0.694  -25.806 1.00 2.34  ? 89  ILE B CB   1  
ATOM 3729   C CG1  . ILE B 1 89  ? -18.370 -1.628  -25.350 1.00 24.01 ? 89  ILE B CG1  1  
ATOM 3730   C CG2  . ILE B 1 89  ? -20.288 -0.117  -24.588 1.00 55.31 ? 89  ILE B CG2  1  
ATOM 3731   C CD1  . ILE B 1 89  ? -18.712 -2.684  -24.309 1.00 41.51 ? 89  ILE B CD1  1  
ATOM 3732   H H    . ILE B 1 89  ? -20.850 -3.018  -25.489 1.00 52.21 ? 89  ILE B H    1  
ATOM 3733   H HA   . ILE B 1 89  ? -21.339 -0.637  -27.052 1.00 40.53 ? 89  ILE B HA   1  
ATOM 3734   H HB   . ILE B 1 89  ? -19.118 0.157   -26.334 1.00 54.01 ? 89  ILE B HB   1  
ATOM 3735   H HG12 . ILE B 1 89  ? -17.972 -2.148  -26.211 1.00 51.31 ? 89  ILE B HG12 1  
ATOM 3736   H HG13 . ILE B 1 89  ? -17.583 -1.012  -24.932 1.00 52.24 ? 89  ILE B HG13 1  
ATOM 3737   H HG21 . ILE B 1 89  ? -19.582 0.381   -23.935 1.00 44.33 ? 89  ILE B HG21 1  
ATOM 3738   H HG22 . ILE B 1 89  ? -20.775 -0.914  -24.041 1.00 32.53 ? 89  ILE B HG22 1  
ATOM 3739   H HG23 . ILE B 1 89  ? -21.035 0.597   -24.913 1.00 35.42 ? 89  ILE B HG23 1  
ATOM 3740   H HD11 . ILE B 1 89  ? -17.826 -3.256  -24.083 1.00 43.02 ? 89  ILE B HD11 1  
ATOM 3741   H HD12 . ILE B 1 89  ? -19.475 -3.344  -24.694 1.00 35.22 ? 89  ILE B HD12 1  
ATOM 3742   H HD13 . ILE B 1 89  ? -19.067 -2.205  -23.408 1.00 44.35 ? 89  ILE B HD13 1  
ATOM 3743   N N    . GLU B 1 90  ? -19.770 -0.771  -29.035 1.00 50.11 ? 90  GLU B N    1  
ATOM 3744   C CA   . GLU B 1 90  ? -18.982 -0.887  -30.278 1.00 25.34 ? 90  GLU B CA   1  
ATOM 3745   C C    . GLU B 1 90  ? -18.792 0.514   -30.901 1.00 50.11 ? 90  GLU B C    1  
ATOM 3746   O O    . GLU B 1 90  ? -19.497 1.461   -30.539 1.00 74.12 ? 90  GLU B O    1  
ATOM 3747   C CB   . GLU B 1 90  ? -19.646 -1.899  -31.271 1.00 14.10 ? 90  GLU B CB   1  
ATOM 3748   C CG   . GLU B 1 90  ? -18.710 -2.461  -32.395 1.00 74.42 ? 90  GLU B CG   1  
ATOM 3749   C CD   . GLU B 1 90  ? -18.910 -1.815  -33.776 1.00 73.13 ? 90  GLU B CD   1  
ATOM 3750   O OE1  . GLU B 1 90  ? -19.878 -2.168  -34.479 1.00 54.40 ? 90  GLU B OE1  1  
ATOM 3751   O OE2  . GLU B 1 90  ? -18.095 -0.963  -34.173 1.00 53.44 ? 90  GLU B OE2  1  
ATOM 3752   H H    . GLU B 1 90  ? -20.285 0.049   -28.886 1.00 15.52 ? 90  GLU B H    1  
ATOM 3753   H HA   . GLU B 1 90  ? -17.996 -1.260  -30.000 1.00 51.25 ? 90  GLU B HA   1  
ATOM 3754   H HB2  . GLU B 1 90  ? -20.014 -2.739  -30.692 1.00 13.24 ? 90  GLU B HB2  1  
ATOM 3755   H HB3  . GLU B 1 90  ? -20.502 -1.423  -31.741 1.00 21.53 ? 90  GLU B HB3  1  
ATOM 3756   H HG2  . GLU B 1 90  ? -17.679 -2.319  -32.090 1.00 20.12 ? 90  GLU B HG2  1  
ATOM 3757   H HG3  . GLU B 1 90  ? -18.879 -3.519  -32.488 1.00 43.14 ? 90  GLU B HG3  1  
ATOM 3758   N N    . GLY B 1 91  ? -17.813 0.624   -31.814 1.00 0.11  ? 91  GLY B N    1  
ATOM 3759   C CA   . GLY B 1 91  ? -17.451 1.901   -32.454 1.00 44.12 ? 91  GLY B CA   1  
ATOM 3760   C C    . GLY B 1 91  ? -16.815 2.908   -31.493 1.00 13.32 ? 91  GLY B C    1  
ATOM 3761   O O    . GLY B 1 91  ? -15.751 2.648   -30.923 1.00 32.13 ? 91  GLY B O    1  
ATOM 3762   H H    . GLY B 1 91  ? -17.354 -0.203  -32.103 1.00 21.01 ? 91  GLY B H    1  
ATOM 3763   H HA2  . GLY B 1 91  ? -16.746 1.692   -33.248 1.00 51.32 ? 91  GLY B HA2  1  
ATOM 3764   H HA3  . GLY B 1 91  ? -18.343 2.334   -32.897 1.00 14.03 ? 91  GLY B HA3  1  
ATOM 3765   N N    . THR B 1 92  ? -17.480 4.057   -31.316 1.00 11.01 ? 92  THR B N    1  
ATOM 3766   C CA   . THR B 1 92  ? -17.050 5.114   -30.385 1.00 41.42 ? 92  THR B CA   1  
ATOM 3767   C C    . THR B 1 92  ? -17.221 4.654   -28.919 1.00 23.11 ? 92  THR B C    1  
ATOM 3768   O O    . THR B 1 92  ? -16.403 4.990   -28.052 1.00 21.32 ? 92  THR B O    1  
ATOM 3769   C CB   . THR B 1 92  ? -17.859 6.429   -30.656 1.00 53.13 ? 92  THR B CB   1  
ATOM 3770   O OG1  . THR B 1 92  ? -17.596 6.873   -31.995 1.00 72.11 ? 92  THR B OG1  1  
ATOM 3771   C CG2  . THR B 1 92  ? -17.522 7.564   -29.664 1.00 34.12 ? 92  THR B CG2  1  
ATOM 3772   H H    . THR B 1 92  ? -18.300 4.198   -31.834 1.00 33.12 ? 92  THR B H    1  
ATOM 3773   H HA   . THR B 1 92  ? -15.996 5.316   -30.573 1.00 23.51 ? 92  THR B HA   1  
ATOM 3774   H HB   . THR B 1 92  ? -18.920 6.206   -30.577 1.00 52.05 ? 92  THR B HB   1  
ATOM 3775   H HG1  . THR B 1 92  ? -17.725 6.139   -32.603 1.00 65.11 ? 92  THR B HG1  1  
ATOM 3776   H HG21 . THR B 1 92  ? -17.858 7.293   -28.671 1.00 11.55 ? 92  THR B HG21 1  
ATOM 3777   H HG22 . THR B 1 92  ? -18.017 8.478   -29.968 1.00 32.04 ? 92  THR B HG22 1  
ATOM 3778   H HG23 . THR B 1 92  ? -16.453 7.728   -29.646 1.00 43.40 ? 92  THR B HG23 1  
ATOM 3779   N N    . GLN B 1 93  ? -18.266 3.836   -28.674 1.00 11.02 ? 93  GLN B N    1  
ATOM 3780   C CA   . GLN B 1 93  ? -18.616 3.353   -27.326 1.00 62.31 ? 93  GLN B CA   1  
ATOM 3781   C C    . GLN B 1 93  ? -17.529 2.405   -26.764 1.00 33.03 ? 93  GLN B C    1  
ATOM 3782   O O    . GLN B 1 93  ? -17.206 2.465   -25.575 1.00 34.44 ? 93  GLN B O    1  
ATOM 3783   C CB   . GLN B 1 93  ? -19.999 2.645   -27.340 1.00 14.41 ? 93  GLN B CB   1  
ATOM 3784   C CG   . GLN B 1 93  ? -21.171 3.515   -27.836 1.00 52.11 ? 93  GLN B CG   1  
ATOM 3785   C CD   . GLN B 1 93  ? -22.518 2.779   -27.810 1.00 30.42 ? 93  GLN B CD   1  
ATOM 3786   O OE1  . GLN B 1 93  ? -22.901 2.120   -28.779 1.00 24.21 ? 93  GLN B OE1  1  
ATOM 3787   N NE2  . GLN B 1 93  ? -23.245 2.888   -26.707 1.00 54.53 ? 93  GLN B NE2  1  
ATOM 3788   H H    . GLN B 1 93  ? -18.822 3.552   -29.434 1.00 20.02 ? 93  GLN B H    1  
ATOM 3789   H HA   . GLN B 1 93  ? -18.680 4.227   -26.680 1.00 50.35 ? 93  GLN B HA   1  
ATOM 3790   H HB2  . GLN B 1 93  ? -19.936 1.768   -27.979 1.00 1.23  ? 93  GLN B HB2  1  
ATOM 3791   H HB3  . GLN B 1 93  ? -20.232 2.314   -26.330 1.00 44.12 ? 93  GLN B HB3  1  
ATOM 3792   H HG2  . GLN B 1 93  ? -21.243 4.397   -27.211 1.00 44.43 ? 93  GLN B HG2  1  
ATOM 3793   H HG3  . GLN B 1 93  ? -20.969 3.825   -28.855 1.00 43.03 ? 93  GLN B HG3  1  
ATOM 3794   H HE21 . GLN B 1 93  ? -22.892 3.430   -25.968 1.00 14.04 ? 93  GLN B HE21 1  
ATOM 3795   H HE22 . GLN B 1 93  ? -24.103 2.421   -26.672 1.00 62.31 ? 93  GLN B HE22 1  
ATOM 3796   N N    . MET B 1 94  ? -16.959 1.540   -27.632 1.00 62.33 ? 94  MET B N    1  
ATOM 3797   C CA   . MET B 1 94  ? -15.903 0.578   -27.219 1.00 52.32 ? 94  MET B CA   1  
ATOM 3798   C C    . MET B 1 94  ? -14.558 1.278   -27.030 1.00 22.43 ? 94  MET B C    1  
ATOM 3799   O O    . MET B 1 94  ? -13.762 0.890   -26.167 1.00 4.00  ? 94  MET B O    1  
ATOM 3800   C CB   . MET B 1 94  ? -15.784 -0.600  -28.221 1.00 75.22 ? 94  MET B CB   1  
ATOM 3801   C CG   . MET B 1 94  ? -15.329 -0.263  -29.657 1.00 24.14 ? 94  MET B CG   1  
ATOM 3802   S SD   . MET B 1 94  ? -13.574 0.140   -29.793 1.00 0.41  ? 94  MET B SD   1  
ATOM 3803   C CE   . MET B 1 94  ? -13.375 0.412   -31.551 1.00 1.22  ? 94  MET B CE   1  
ATOM 3804   H H    . MET B 1 94  ? -17.251 1.553   -28.570 1.00 31.11 ? 94  MET B H    1  
ATOM 3805   H HA   . MET B 1 94  ? -16.203 0.171   -26.254 1.00 50.23 ? 94  MET B HA   1  
ATOM 3806   H HB2  . MET B 1 94  ? -15.078 -1.319  -27.822 1.00 0.55  ? 94  MET B HB2  1  
ATOM 3807   H HB3  . MET B 1 94  ? -16.754 -1.087  -28.283 1.00 2.14  ? 94  MET B HB3  1  
ATOM 3808   H HG2  . MET B 1 94  ? -15.527 -1.116  -30.296 1.00 32.12 ? 94  MET B HG2  1  
ATOM 3809   H HG3  . MET B 1 94  ? -15.906 0.582   -30.013 1.00 12.40 ? 94  MET B HG3  1  
ATOM 3810   H HE1  . MET B 1 94  ? -14.033 1.207   -31.872 1.00 2.14  ? 94  MET B HE1  1  
ATOM 3811   H HE2  . MET B 1 94  ? -13.616 -0.494  -32.084 1.00 4.03  ? 94  MET B HE2  1  
ATOM 3812   H HE3  . MET B 1 94  ? -12.352 0.689   -31.754 1.00 54.21 ? 94  MET B HE3  1  
ATOM 3813   N N    . ALA B 1 95  ? -14.329 2.321   -27.846 1.00 30.13 ? 95  ALA B N    1  
ATOM 3814   C CA   . ALA B 1 95  ? -13.141 3.170   -27.746 1.00 44.12 ? 95  ALA B CA   1  
ATOM 3815   C C    . ALA B 1 95  ? -13.172 3.971   -26.431 1.00 0.40  ? 95  ALA B C    1  
ATOM 3816   O O    . ALA B 1 95  ? -12.136 4.240   -25.829 1.00 41.05 ? 95  ALA B O    1  
ATOM 3817   C CB   . ALA B 1 95  ? -13.048 4.088   -28.969 1.00 1.42  ? 95  ALA B CB   1  
ATOM 3818   H H    . ALA B 1 95  ? -14.983 2.518   -28.552 1.00 62.23 ? 95  ALA B H    1  
ATOM 3819   H HA   . ALA B 1 95  ? -12.268 2.523   -27.741 1.00 4.31  ? 95  ALA B HA   1  
ATOM 3820   H HB1  . ALA B 1 95  ? -13.934 4.710   -29.026 1.00 35.33 ? 95  ALA B HB1  1  
ATOM 3821   H HB2  . ALA B 1 95  ? -12.975 3.494   -29.870 1.00 4.13  ? 95  ALA B HB2  1  
ATOM 3822   H HB3  . ALA B 1 95  ? -12.173 4.721   -28.890 1.00 53.44 ? 95  ALA B HB3  1  
ATOM 3823   N N    . HIS B 1 96  ? -14.392 4.333   -25.997 1.00 12.50 ? 96  HIS B N    1  
ATOM 3824   C CA   . HIS B 1 96  ? -14.643 5.008   -24.713 1.00 63.24 ? 96  HIS B CA   1  
ATOM 3825   C C    . HIS B 1 96  ? -14.452 4.032   -23.540 1.00 23.12 ? 96  HIS B C    1  
ATOM 3826   O O    . HIS B 1 96  ? -13.995 4.432   -22.471 1.00 13.40 ? 96  HIS B O    1  
ATOM 3827   C CB   . HIS B 1 96  ? -16.074 5.592   -24.711 1.00 44.01 ? 96  HIS B CB   1  
ATOM 3828   C CG   . HIS B 1 96  ? -16.504 6.244   -23.417 1.00 52.12 ? 96  HIS B CG   1  
ATOM 3829   N ND1  . HIS B 1 96  ? -17.355 5.631   -22.525 1.00 0.34  ? 96  HIS B ND1  1  
ATOM 3830   C CD2  . HIS B 1 96  ? -16.198 7.446   -22.872 1.00 60.34 ? 96  HIS B CD2  1  
ATOM 3831   C CE1  . HIS B 1 96  ? -17.569 6.426   -21.506 1.00 50.41 ? 96  HIS B CE1  1  
ATOM 3832   N NE2  . HIS B 1 96  ? -16.876 7.532   -21.683 1.00 20.31 ? 96  HIS B NE2  1  
ATOM 3833   H H    . HIS B 1 96  ? -15.160 4.144   -26.576 1.00 62.42 ? 96  HIS B H    1  
ATOM 3834   H HA   . HIS B 1 96  ? -13.927 5.825   -24.620 1.00 71.14 ? 96  HIS B HA   1  
ATOM 3835   H HB2  . HIS B 1 96  ? -16.147 6.339   -25.491 1.00 11.23 ? 96  HIS B HB2  1  
ATOM 3836   H HB3  . HIS B 1 96  ? -16.783 4.799   -24.932 1.00 22.25 ? 96  HIS B HB3  1  
ATOM 3837   H HD1  . HIS B 1 96  ? -17.765 4.753   -22.637 1.00 3.40  ? 96  HIS B HD1  1  
ATOM 3838   H HD2  . HIS B 1 96  ? -15.555 8.201   -23.299 1.00 41.50 ? 96  HIS B HD2  1  
ATOM 3839   H HE1  . HIS B 1 96  ? -18.197 6.205   -20.653 1.00 52.41 ? 96  HIS B HE1  1  
ATOM 3840   H HE2  . HIS B 1 96  ? -16.655 8.159   -20.963 1.00 37.65 ? 96  HIS B HE2  1  
ATOM 3841   N N    . CYS B 1 97  ? -14.817 2.754   -23.761 1.00 64.12 ? 97  CYS B N    1  
ATOM 3842   C CA   . CYS B 1 97  ? -14.747 1.714   -22.721 1.00 43.53 ? 97  CYS B CA   1  
ATOM 3843   C C    . CYS B 1 97  ? -13.286 1.398   -22.362 1.00 12.23 ? 97  CYS B C    1  
ATOM 3844   O O    . CYS B 1 97  ? -12.827 1.749   -21.282 1.00 31.31 ? 97  CYS B O    1  
ATOM 3845   C CB   . CYS B 1 97  ? -15.492 0.434   -23.176 1.00 31.43 ? 97  CYS B CB   1  
ATOM 3846   S SG   . CYS B 1 97  ? -15.509 -0.901  -21.952 1.00 50.23 ? 97  CYS B SG   1  
ATOM 3847   H H    . CYS B 1 97  ? -15.149 2.509   -24.652 1.00 61.20 ? 97  CYS B H    1  
ATOM 3848   H HA   . CYS B 1 97  ? -15.245 2.103   -21.838 1.00 15.31 ? 97  CYS B HA   1  
ATOM 3849   H HB2  . CYS B 1 97  ? -16.523 0.681   -23.392 1.00 14.13 ? 97  CYS B HB2  1  
ATOM 3850   H HB3  . CYS B 1 97  ? -15.028 0.048   -24.075 1.00 22.33 ? 97  CYS B HB3  1  
ATOM 3851   H HG   . CYS B 1 97  ? -14.395 -0.823  -21.235 1.00 22.15 ? 97  CYS B HG   1  
ATOM 3852   N N    . LEU B 1 98  ? -12.542 0.803   -23.306 1.00 3.04  ? 98  LEU B N    1  
ATOM 3853   C CA   . LEU B 1 98  ? -11.168 0.323   -23.043 1.00 61.34 ? 98  LEU B CA   1  
ATOM 3854   C C    . LEU B 1 98  ? -10.132 1.464   -23.138 1.00 44.11 ? 98  LEU B C    1  
ATOM 3855   O O    . LEU B 1 98  ? -9.007  1.323   -22.644 1.00 13.11 ? 98  LEU B O    1  
ATOM 3856   C CB   . LEU B 1 98  ? -10.809 -0.824  -24.031 1.00 34.31 ? 98  LEU B CB   1  
ATOM 3857   C CG   . LEU B 1 98  ? -11.790 -2.046  -24.062 1.00 53.01 ? 98  LEU B CG   1  
ATOM 3858   C CD1  . LEU B 1 98  ? -11.325 -3.117  -25.075 1.00 4.22  ? 98  LEU B CD1  1  
ATOM 3859   C CD2  . LEU B 1 98  ? -11.989 -2.657  -22.656 1.00 2.02  ? 98  LEU B CD2  1  
ATOM 3860   H H    . LEU B 1 98  ? -12.922 0.682   -24.202 1.00 42.43 ? 98  LEU B H    1  
ATOM 3861   H HA   . LEU B 1 98  ? -11.141 -0.074  -22.029 1.00 35.30 ? 98  LEU B HA   1  
ATOM 3862   H HB2  . LEU B 1 98  ? -10.761 -0.403  -25.031 1.00 43.41 ? 98  LEU B HB2  1  
ATOM 3863   H HB3  . LEU B 1 98  ? -9.821  -1.193  -23.774 1.00 60.32 ? 98  LEU B HB3  1  
ATOM 3864   H HG   . LEU B 1 98  ? -12.761 -1.696  -24.398 1.00 42.11 ? 98  LEU B HG   1  
ATOM 3865   H HD11 . LEU B 1 98  ? -12.024 -3.944  -25.080 1.00 63.20 ? 98  LEU B HD11 1  
ATOM 3866   H HD12 . LEU B 1 98  ? -10.341 -3.484  -24.807 1.00 45.51 ? 98  LEU B HD12 1  
ATOM 3867   H HD13 . LEU B 1 98  ? -11.285 -2.685  -26.066 1.00 53.14 ? 98  LEU B HD13 1  
ATOM 3868   H HD21 . LEU B 1 98  ? -11.044 -3.026  -22.277 1.00 0.34  ? 98  LEU B HD21 1  
ATOM 3869   H HD22 . LEU B 1 98  ? -12.697 -3.472  -22.711 1.00 75.31 ? 98  LEU B HD22 1  
ATOM 3870   H HD23 . LEU B 1 98  ? -12.373 -1.901  -21.984 1.00 1.42  ? 98  LEU B HD23 1  
ATOM 3871   N N    . GLY B 1 99  ? -10.527 2.594   -23.758 1.00 0.15  ? 99  GLY B N    1  
ATOM 3872   C CA   . GLY B 1 99  ? -9.613  3.714   -24.018 1.00 70.41 ? 99  GLY B CA   1  
ATOM 3873   C C    . GLY B 1 99  ? -9.677  4.835   -22.990 1.00 52.52 ? 99  GLY B C    1  
ATOM 3874   O O    . GLY B 1 99  ? -8.823  5.732   -23.010 1.00 4.44  ? 99  GLY B O    1  
ATOM 3875   H H    . GLY B 1 99  ? -11.458 2.667   -24.055 1.00 2.50  ? 99  GLY B H    1  
ATOM 3876   H HA2  . GLY B 1 99  ? -8.595  3.347   -24.062 1.00 35.22 ? 99  GLY B HA2  1  
ATOM 3877   H HA3  . GLY B 1 99  ? -9.861  4.127   -24.988 1.00 11.33 ? 99  GLY B HA3  1  
ATOM 3878   N N    . ALA B 1 100 ? -10.675 4.791   -22.087 1.00 15.21 ? 100 ALA B N    1  
ATOM 3879   C CA   . ALA B 1 100 ? -10.923 5.888   -21.129 1.00 33.34 ? 100 ALA B CA   1  
ATOM 3880   C C    . ALA B 1 100 ? -11.464 5.362   -19.789 1.00 13.23 ? 100 ALA B C    1  
ATOM 3881   O O    . ALA B 1 100 ? -10.849 5.575   -18.737 1.00 51.31 ? 100 ALA B O    1  
ATOM 3882   C CB   . ALA B 1 100 ? -11.888 6.913   -21.757 1.00 73.22 ? 100 ALA B CB   1  
ATOM 3883   H H    . ALA B 1 100 ? -11.258 4.004   -22.067 1.00 55.22 ? 100 ALA B H    1  
ATOM 3884   H HA   . ALA B 1 100 ? -9.976  6.396   -20.937 1.00 51.41 ? 100 ALA B HA   1  
ATOM 3885   H HB1  . ALA B 1 100 ? -11.477 7.276   -22.692 1.00 54.11 ? 100 ALA B HB1  1  
ATOM 3886   H HB2  . ALA B 1 100 ? -12.024 7.750   -21.084 1.00 71.23 ? 100 ALA B HB2  1  
ATOM 3887   H HB3  . ALA B 1 100 ? -12.848 6.449   -21.948 1.00 23.43 ? 100 ALA B HB3  1  
ATOM 3888   N N    . TYR B 1 101 ? -12.580 4.625   -19.858 1.00 24.22 ? 101 TYR B N    1  
ATOM 3889   C CA   . TYR B 1 101 ? -13.372 4.225   -18.678 1.00 11.41 ? 101 TYR B CA   1  
ATOM 3890   C C    . TYR B 1 101 ? -12.652 3.150   -17.833 1.00 2.04  ? 101 TYR B C    1  
ATOM 3891   O O    . TYR B 1 101 ? -12.546 3.278   -16.605 1.00 2.04  ? 101 TYR B O    1  
ATOM 3892   C CB   . TYR B 1 101 ? -14.755 3.722   -19.159 1.00 14.30 ? 101 TYR B CB   1  
ATOM 3893   C CG   . TYR B 1 101 ? -15.756 3.413   -18.035 1.00 32.43 ? 101 TYR B CG   1  
ATOM 3894   C CD1  . TYR B 1 101 ? -16.394 4.444   -17.346 1.00 31.13 ? 101 TYR B CD1  1  
ATOM 3895   C CD2  . TYR B 1 101 ? -16.076 2.101   -17.678 1.00 3.51  ? 101 TYR B CD2  1  
ATOM 3896   C CE1  . TYR B 1 101 ? -17.311 4.180   -16.348 1.00 61.02 ? 101 TYR B CE1  1  
ATOM 3897   C CE2  . TYR B 1 101 ? -16.990 1.831   -16.676 1.00 3.45  ? 101 TYR B CE2  1  
ATOM 3898   C CZ   . TYR B 1 101 ? -17.606 2.874   -16.017 1.00 43.22 ? 101 TYR B CZ   1  
ATOM 3899   O OH   . TYR B 1 101 ? -18.529 2.609   -15.030 1.00 71.43 ? 101 TYR B OH   1  
ATOM 3900   H H    . TYR B 1 101 ? -12.889 4.338   -20.740 1.00 43.42 ? 101 TYR B H    1  
ATOM 3901   H HA   . TYR B 1 101 ? -13.517 5.114   -18.067 1.00 22.05 ? 101 TYR B HA   1  
ATOM 3902   H HB2  . TYR B 1 101 ? -15.202 4.483   -19.792 1.00 31.11 ? 101 TYR B HB2  1  
ATOM 3903   H HB3  . TYR B 1 101 ? -14.619 2.822   -19.754 1.00 20.32 ? 101 TYR B HB3  1  
ATOM 3904   H HD1  . TYR B 1 101 ? -16.162 5.472   -17.603 1.00 41.20 ? 101 TYR B HD1  1  
ATOM 3905   H HD2  . TYR B 1 101 ? -15.590 1.281   -18.195 1.00 70.42 ? 101 TYR B HD2  1  
ATOM 3906   H HE1  . TYR B 1 101 ? -17.795 4.999   -15.830 1.00 72.41 ? 101 TYR B HE1  1  
ATOM 3907   H HE2  . TYR B 1 101 ? -17.217 0.793   -16.415 1.00 34.21 ? 101 TYR B HE2  1  
ATOM 3908   H HH   . TYR B 1 101 ? -18.250 1.842   -14.537 1.00 32.12 ? 101 TYR B HH   1  
ATOM 3909   N N    . CYS B 1 102 ? -12.163 2.099   -18.517 1.00 42.50 ? 102 CYS B N    1  
ATOM 3910   C CA   . CYS B 1 102 ? -11.450 0.967   -17.897 1.00 63.23 ? 102 CYS B CA   1  
ATOM 3911   C C    . CYS B 1 102 ? -10.141 1.430   -17.177 1.00 2.14  ? 102 CYS B C    1  
ATOM 3912   O O    . CYS B 1 102 ? -9.930  1.025   -16.028 1.00 1.10  ? 102 CYS B O    1  
ATOM 3913   C CB   . CYS B 1 102 ? -11.187 -0.140  -18.957 1.00 42.11 ? 102 CYS B CB   1  
ATOM 3914   S SG   . CYS B 1 102 ? -12.682 -0.998  -19.511 1.00 62.21 ? 102 CYS B SG   1  
ATOM 3915   H H    . CYS B 1 102 ? -12.274 2.097   -19.480 1.00 22.42 ? 102 CYS B H    1  
ATOM 3916   H HA   . CYS B 1 102 ? -12.125 0.559   -17.144 1.00 75.40 ? 102 CYS B HA   1  
ATOM 3917   H HB2  . CYS B 1 102 ? -10.740 0.312   -19.831 1.00 70.44 ? 102 CYS B HB2  1  
ATOM 3918   H HB3  . CYS B 1 102 ? -10.501 -0.886  -18.568 1.00 1.21  ? 102 CYS B HB3  1  
ATOM 3919   H HG   . CYS B 1 102 ? -13.259 -1.538  -18.449 1.00 32.32 ? 102 CYS B HG   1  
ATOM 3920   N N    . PRO B 1 103 ? -9.245  2.288   -17.815 1.00 70.32 ? 103 PRO B N    1  
ATOM 3921   C CA   . PRO B 1 103 ? -8.126  2.965   -17.087 1.00 34.54 ? 103 PRO B CA   1  
ATOM 3922   C C    . PRO B 1 103 ? -8.596  3.809   -15.873 1.00 50.15 ? 103 PRO B C    1  
ATOM 3923   O O    . PRO B 1 103 ? -7.975  3.774   -14.812 1.00 52.11 ? 103 PRO B O    1  
ATOM 3924   C CB   . PRO B 1 103 ? -7.474  3.865   -18.170 1.00 60.31 ? 103 PRO B CB   1  
ATOM 3925   C CG   . PRO B 1 103 ? -7.788  3.177   -19.462 1.00 23.52 ? 103 PRO B CG   1  
ATOM 3926   C CD   . PRO B 1 103 ? -9.166  2.589   -19.284 1.00 34.42 ? 103 PRO B CD   1  
ATOM 3927   H HA   . PRO B 1 103 ? -7.403  2.226   -16.743 1.00 34.44 ? 103 PRO B HA   1  
ATOM 3928   H HB2  . PRO B 1 103 ? -7.900  4.874   -18.145 1.00 61.12 ? 103 PRO B HB2  1  
ATOM 3929   H HB3  . PRO B 1 103 ? -6.402  3.919   -18.025 1.00 71.44 ? 103 PRO B HB3  1  
ATOM 3930   H HG2  . PRO B 1 103 ? -7.774  3.891   -20.283 1.00 24.15 ? 103 PRO B HG2  1  
ATOM 3931   H HG3  . PRO B 1 103 ? -7.071  2.383   -19.648 1.00 41.43 ? 103 PRO B HG3  1  
ATOM 3932   H HD2  . PRO B 1 103 ? -9.936  3.301   -19.574 1.00 51.32 ? 103 PRO B HD2  1  
ATOM 3933   H HD3  . PRO B 1 103 ? -9.269  1.678   -19.864 1.00 75.23 ? 103 PRO B HD3  1  
ATOM 3934   N N    . ASN B 1 104 ? -9.716  4.540   -16.040 1.00 43.14 ? 104 ASN B N    1  
ATOM 3935   C CA   . ASN B 1 104 ? -10.243 5.484   -15.013 1.00 74.22 ? 104 ASN B CA   1  
ATOM 3936   C C    . ASN B 1 104 ? -10.640 4.749   -13.696 1.00 14.33 ? 104 ASN B C    1  
ATOM 3937   O O    . ASN B 1 104 ? -10.546 5.317   -12.596 1.00 1.24  ? 104 ASN B O    1  
ATOM 3938   C CB   . ASN B 1 104 ? -11.443 6.279   -15.610 1.00 73.34 ? 104 ASN B CB   1  
ATOM 3939   C CG   . ASN B 1 104 ? -11.954 7.437   -14.740 1.00 21.14 ? 104 ASN B CG   1  
ATOM 3940   O OD1  . ASN B 1 104 ? -11.226 8.004   -13.922 1.00 31.05 ? 104 ASN B OD1  1  
ATOM 3941   N ND2  . ASN B 1 104 ? -13.195 7.839   -14.965 1.00 40.11 ? 104 ASN B ND2  1  
ATOM 3942   H H    . ASN B 1 104 ? -10.210 4.447   -16.883 1.00 43.00 ? 104 ASN B H    1  
ATOM 3943   H HA   . ASN B 1 104 ? -9.445  6.184   -14.785 1.00 20.30 ? 104 ASN B HA   1  
ATOM 3944   H HB2  . ASN B 1 104 ? -11.148 6.697   -16.564 1.00 72.42 ? 104 ASN B HB2  1  
ATOM 3945   H HB3  . ASN B 1 104 ? -12.265 5.591   -15.778 1.00 1.13  ? 104 ASN B HB3  1  
ATOM 3946   H HD21 . ASN B 1 104 ? -13.708 7.386   -15.671 1.00 74.32 ? 104 ASN B HD21 1  
ATOM 3947   H HD22 . ASN B 1 104 ? -13.552 8.572   -14.425 1.00 64.23 ? 104 ASN B HD22 1  
ATOM 3948   N N    . ILE B 1 105 ? -11.048 3.469   -13.826 1.00 14.52 ? 105 ILE B N    1  
ATOM 3949   C CA   . ILE B 1 105 ? -11.327 2.569   -12.678 1.00 14.24 ? 105 ILE B CA   1  
ATOM 3950   C C    . ILE B 1 105 ? -10.021 2.197   -11.945 1.00 23.22 ? 105 ILE B C    1  
ATOM 3951   O O    . ILE B 1 105 ? -9.965  2.175   -10.707 1.00 55.42 ? 105 ILE B O    1  
ATOM 3952   C CB   . ILE B 1 105 ? -12.039 1.251   -13.175 1.00 14.24 ? 105 ILE B CB   1  
ATOM 3953   C CG1  . ILE B 1 105 ? -13.403 1.599   -13.849 1.00 4.41  ? 105 ILE B CG1  1  
ATOM 3954   C CG2  . ILE B 1 105 ? -12.233 0.211   -12.034 1.00 74.35 ? 105 ILE B CG2  1  
ATOM 3955   C CD1  . ILE B 1 105 ? -14.145 0.414   -14.436 1.00 61.03 ? 105 ILE B CD1  1  
ATOM 3956   H H    . ILE B 1 105 ? -11.162 3.113   -14.733 1.00 10.11 ? 105 ILE B H    1  
ATOM 3957   H HA   . ILE B 1 105 ? -11.993 3.086   -11.988 1.00 12.44 ? 105 ILE B HA   1  
ATOM 3958   H HB   . ILE B 1 105 ? -11.395 0.794   -13.923 1.00 10.24 ? 105 ILE B HB   1  
ATOM 3959   H HG12 . ILE B 1 105 ? -14.057 2.060   -13.120 1.00 72.40 ? 105 ILE B HG12 1  
ATOM 3960   H HG13 . ILE B 1 105 ? -13.233 2.304   -14.655 1.00 11.12 ? 105 ILE B HG13 1  
ATOM 3961   H HG21 . ILE B 1 105 ? -12.473 -0.751  -12.457 1.00 51.34 ? 105 ILE B HG21 1  
ATOM 3962   H HG22 . ILE B 1 105 ? -13.042 0.521   -11.389 1.00 15.33 ? 105 ILE B HG22 1  
ATOM 3963   H HG23 . ILE B 1 105 ? -11.340 0.111   -11.443 1.00 60.12 ? 105 ILE B HG23 1  
ATOM 3964   H HD11 . ILE B 1 105 ? -15.084 0.752   -14.847 1.00 54.13 ? 105 ILE B HD11 1  
ATOM 3965   H HD12 . ILE B 1 105 ? -14.338 -0.322  -13.666 1.00 73.31 ? 105 ILE B HD12 1  
ATOM 3966   H HD13 . ILE B 1 105 ? -13.554 -0.032  -15.223 1.00 62.30 ? 105 ILE B HD13 1  
ATOM 3967   N N    . LEU B 1 106 ? -8.981  1.924   -12.745 1.00 42.24 ? 106 LEU B N    1  
ATOM 3968   C CA   . LEU B 1 106 ? -7.686  1.408   -12.270 1.00 33.32 ? 106 LEU B CA   1  
ATOM 3969   C C    . LEU B 1 106 ? -6.819  2.512   -11.616 1.00 11.53 ? 106 LEU B C    1  
ATOM 3970   O O    . LEU B 1 106 ? -5.896  2.211   -10.845 1.00 51.15 ? 106 LEU B O    1  
ATOM 3971   C CB   . LEU B 1 106 ? -6.930  0.788   -13.477 1.00 62.12 ? 106 LEU B CB   1  
ATOM 3972   C CG   . LEU B 1 106 ? -7.643  -0.403  -14.185 1.00 50.22 ? 106 LEU B CG   1  
ATOM 3973   C CD1  . LEU B 1 106 ? -6.916  -0.815  -15.483 1.00 12.22 ? 106 LEU B CD1  1  
ATOM 3974   C CD2  . LEU B 1 106 ? -7.801  -1.592  -13.218 1.00 54.13 ? 106 LEU B CD2  1  
ATOM 3975   H H    . LEU B 1 106 ? -9.090  2.084   -13.709 1.00 24.42 ? 106 LEU B H    1  
ATOM 3976   H HA   . LEU B 1 106 ? -7.893  0.627   -11.540 1.00 74.44 ? 106 LEU B HA   1  
ATOM 3977   H HB2  . LEU B 1 106 ? -6.768  1.574   -14.212 1.00 31.24 ? 106 LEU B HB2  1  
ATOM 3978   H HB3  . LEU B 1 106 ? -5.959  0.445   -13.136 1.00 30.31 ? 106 LEU B HB3  1  
ATOM 3979   H HG   . LEU B 1 106 ? -8.642  -0.089  -14.470 1.00 23.44 ? 106 LEU B HG   1  
ATOM 3980   H HD11 . LEU B 1 106 ? -5.942  -1.233  -15.253 1.00 61.22 ? 106 LEU B HD11 1  
ATOM 3981   H HD12 . LEU B 1 106 ? -6.792  0.043   -16.119 1.00 22.22 ? 106 LEU B HD12 1  
ATOM 3982   H HD13 . LEU B 1 106 ? -7.503  -1.544  -16.006 1.00 2.12  ? 106 LEU B HD13 1  
ATOM 3983   H HD21 . LEU B 1 106 ? -8.194  -2.440  -13.745 1.00 73.05 ? 106 LEU B HD21 1  
ATOM 3984   H HD22 . LEU B 1 106 ? -8.480  -1.326  -12.420 1.00 20.31 ? 106 LEU B HD22 1  
ATOM 3985   H HD23 . LEU B 1 106 ? -6.843  -1.853  -12.798 1.00 2.03  ? 106 LEU B HD23 1  
ATOM 3986   N N    . PHE B 1 107 ? -7.151  3.783   -11.931 1.00 35.42 ? 107 PHE B N    1  
ATOM 3987   C CA   . PHE B 1 107 ? -6.335  4.970   -11.586 1.00 74.33 ? 107 PHE B CA   1  
ATOM 3988   C C    . PHE B 1 107 ? -6.030  5.139   -10.057 1.00 25.22 ? 107 PHE B C    1  
ATOM 3989   O O    . PHE B 1 107 ? -4.857  5.371   -9.723  1.00 43.23 ? 107 PHE B O    1  
ATOM 3990   C CB   . PHE B 1 107 ? -6.987  6.255   -12.183 1.00 62.31 ? 107 PHE B CB   1  
ATOM 3991   C CG   . PHE B 1 107 ? -6.208  7.536   -11.900 1.00 73.42 ? 107 PHE B CG   1  
ATOM 3992   C CD1  . PHE B 1 107 ? -4.985  7.771   -12.527 1.00 21.05 ? 107 PHE B CD1  1  
ATOM 3993   C CD2  . PHE B 1 107 ? -6.686  8.491   -10.999 1.00 64.42 ? 107 PHE B CD2  1  
ATOM 3994   C CE1  . PHE B 1 107 ? -4.270  8.920   -12.262 1.00 25.54 ? 107 PHE B CE1  1  
ATOM 3995   C CE2  . PHE B 1 107 ? -5.969  9.634   -10.737 1.00 74.51 ? 107 PHE B CE2  1  
ATOM 3996   C CZ   . PHE B 1 107 ? -4.762  9.851   -11.366 1.00 21.32 ? 107 PHE B CZ   1  
ATOM 3997   H H    . PHE B 1 107 ? -7.981  3.928   -12.436 1.00 63.52 ? 107 PHE B H    1  
ATOM 3998   H HA   . PHE B 1 107 ? -5.383  4.826   -12.091 1.00 61.34 ? 107 PHE B HA   1  
ATOM 3999   H HB2  . PHE B 1 107 ? -7.068  6.146   -13.261 1.00 63.45 ? 107 PHE B HB2  1  
ATOM 4000   H HB3  . PHE B 1 107 ? -7.985  6.362   -11.776 1.00 63.14 ? 107 PHE B HB3  1  
ATOM 4001   H HD1  . PHE B 1 107 ? -4.591  7.038   -13.226 1.00 1.44  ? 107 PHE B HD1  1  
ATOM 4002   H HD2  . PHE B 1 107 ? -7.636  8.327   -10.502 1.00 34.41 ? 107 PHE B HD2  1  
ATOM 4003   H HE1  . PHE B 1 107 ? -3.322  9.094   -12.756 1.00 54.12 ? 107 PHE B HE1  1  
ATOM 4004   H HE2  . PHE B 1 107 ? -6.349  10.367  -10.034 1.00 42.12 ? 107 PHE B HE2  1  
ATOM 4005   H HZ   . PHE B 1 107 ? -4.197  10.753  -11.158 1.00 55.41 ? 107 PHE B HZ   1  
ATOM 4006   N N    . PRO B 1 108 ? -7.036  5.045   -9.107  1.00 21.50 ? 108 PRO B N    1  
ATOM 4007   C CA   . PRO B 1 108 ? -6.769  5.169   -7.639  1.00 13.41 ? 108 PRO B CA   1  
ATOM 4008   C C    . PRO B 1 108 ? -5.713  4.172   -7.110  1.00 10.12 ? 108 PRO B C    1  
ATOM 4009   O O    . PRO B 1 108 ? -4.893  4.515   -6.246  1.00 33.21 ? 108 PRO B O    1  
ATOM 4010   C CB   . PRO B 1 108 ? -8.151  4.896   -7.003  1.00 72.11 ? 108 PRO B CB   1  
ATOM 4011   C CG   . PRO B 1 108 ? -9.129  5.293   -8.061  1.00 45.40 ? 108 PRO B CG   1  
ATOM 4012   C CD   . PRO B 1 108 ? -8.499  4.870   -9.362  1.00 13.32 ? 108 PRO B CD   1  
ATOM 4013   H HA   . PRO B 1 108 ? -6.449  6.180   -7.395  1.00 31.51 ? 108 PRO B HA   1  
ATOM 4014   H HB2  . PRO B 1 108 ? -8.256  3.836   -6.748  1.00 63.41 ? 108 PRO B HB2  1  
ATOM 4015   H HB3  . PRO B 1 108 ? -8.290  5.500   -6.117  1.00 14.45 ? 108 PRO B HB3  1  
ATOM 4016   H HG2  . PRO B 1 108 ? -10.074 4.780   -7.905  1.00 74.20 ? 108 PRO B HG2  1  
ATOM 4017   H HG3  . PRO B 1 108 ? -9.280  6.367   -8.053  1.00 13.15 ? 108 PRO B HG3  1  
ATOM 4018   H HD2  . PRO B 1 108 ? -8.730  3.831   -9.591  1.00 61.33 ? 108 PRO B HD2  1  
ATOM 4019   H HD3  . PRO B 1 108 ? -8.825  5.510   -10.173 1.00 63.42 ? 108 PRO B HD3  1  
ATOM 4020   N N    . TYR B 1 109 ? -5.746  2.942   -7.658  1.00 53.32 ? 109 TYR B N    1  
ATOM 4021   C CA   . TYR B 1 109 ? -4.844  1.849   -7.254  1.00 54.21 ? 109 TYR B CA   1  
ATOM 4022   C C    . TYR B 1 109 ? -3.405  2.130   -7.744  1.00 40.20 ? 109 TYR B C    1  
ATOM 4023   O O    . TYR B 1 109 ? -2.434  1.916   -7.008  1.00 21.12 ? 109 TYR B O    1  
ATOM 4024   C CB   . TYR B 1 109 ? -5.320  0.498   -7.829  1.00 43.25 ? 109 TYR B CB   1  
ATOM 4025   C CG   . TYR B 1 109 ? -6.752  0.051   -7.487  1.00 40.42 ? 109 TYR B CG   1  
ATOM 4026   C CD1  . TYR B 1 109 ? -7.850  0.532   -8.211  1.00 43.14 ? 109 TYR B CD1  1  
ATOM 4027   C CD2  . TYR B 1 109 ? -7.000  -0.890  -6.476  1.00 13.54 ? 109 TYR B CD2  1  
ATOM 4028   C CE1  . TYR B 1 109 ? -9.132  0.104   -7.935  1.00 13.13 ? 109 TYR B CE1  1  
ATOM 4029   C CE2  . TYR B 1 109 ? -8.287  -1.317  -6.197  1.00 41.42 ? 109 TYR B CE2  1  
ATOM 4030   C CZ   . TYR B 1 109 ? -9.345  -0.817  -6.928  1.00 2.14  ? 109 TYR B CZ   1  
ATOM 4031   O OH   . TYR B 1 109 ? -10.620 -1.251  -6.662  1.00 42.11 ? 109 TYR B OH   1  
ATOM 4032   H H    . TYR B 1 109 ? -6.396  2.771   -8.370  1.00 71.31 ? 109 TYR B H    1  
ATOM 4033   H HA   . TYR B 1 109 ? -4.846  1.798   -6.168  1.00 41.05 ? 109 TYR B HA   1  
ATOM 4034   H HB2  . TYR B 1 109 ? -5.254  0.544   -8.911  1.00 51.53 ? 109 TYR B HB2  1  
ATOM 4035   H HB3  . TYR B 1 109 ? -4.640  -0.282  -7.491  1.00 24.53 ? 109 TYR B HB3  1  
ATOM 4036   H HD1  . TYR B 1 109 ? -7.686  1.260   -8.998  1.00 53.42 ? 109 TYR B HD1  1  
ATOM 4037   H HD2  . TYR B 1 109 ? -6.169  -1.282  -5.902  1.00 65.10 ? 109 TYR B HD2  1  
ATOM 4038   H HE1  . TYR B 1 109 ? -9.966  0.479   -8.519  1.00 24.11 ? 109 TYR B HE1  1  
ATOM 4039   H HE2  . TYR B 1 109 ? -8.460  -2.045  -5.407  1.00 35.02 ? 109 TYR B HE2  1  
ATOM 4040   H HH   . TYR B 1 109 ? -10.703 -1.449  -5.726  1.00 11.41 ? 109 TYR B HH   1  
ATOM 4041   N N    . ALA B 1 110 ? -3.293  2.604   -9.008  1.00 30.13 ? 110 ALA B N    1  
ATOM 4042   C CA   . ALA B 1 110 ? -2.008  3.026   -9.615  1.00 74.33 ? 110 ALA B CA   1  
ATOM 4043   C C    . ALA B 1 110 ? -1.366  4.170   -8.799  1.00 42.21 ? 110 ALA B C    1  
ATOM 4044   O O    . ALA B 1 110 ? -0.153  4.177   -8.577  1.00 74.20 ? 110 ALA B O    1  
ATOM 4045   C CB   . ALA B 1 110 ? -2.231  3.471   -11.072 1.00 64.05 ? 110 ALA B CB   1  
ATOM 4046   H H    . ALA B 1 110 ? -4.109  2.674   -9.551  1.00 21.22 ? 110 ALA B H    1  
ATOM 4047   H HA   . ALA B 1 110 ? -1.330  2.165   -9.615  1.00 23.24 ? 110 ALA B HA   1  
ATOM 4048   H HB1  . ALA B 1 110 ? -2.632  2.666   -11.660 1.00 60.53 ? 110 ALA B HB1  1  
ATOM 4049   H HB2  . ALA B 1 110 ? -1.297  3.796   -11.508 1.00 10.22 ? 110 ALA B HB2  1  
ATOM 4050   H HB3  . ALA B 1 110 ? -2.930  4.281   -11.091 1.00 31.34 ? 110 ALA B HB3  1  
ATOM 4051   N N    . ARG B 1 111 ? -2.221  5.114   -8.343  1.00 42.13 ? 111 ARG B N    1  
ATOM 4052   C CA   . ARG B 1 111 ? -1.819  6.264   -7.501  1.00 41.22 ? 111 ARG B CA   1  
ATOM 4053   C C    . ARG B 1 111 ? -1.199  5.790   -6.165  1.00 13.25 ? 111 ARG B C    1  
ATOM 4054   O O    . ARG B 1 111 ? -0.073  6.174   -5.840  1.00 45.33 ? 111 ARG B O    1  
ATOM 4055   C CB   . ARG B 1 111 ? -3.051  7.196   -7.240  1.00 43.03 ? 111 ARG B CB   1  
ATOM 4056   C CG   . ARG B 1 111 ? -2.844  8.300   -6.162  1.00 0.20  ? 111 ARG B CG   1  
ATOM 4057   C CD   . ARG B 1 111 ? -4.106  9.164   -5.924  1.00 14.13 ? 111 ARG B CD   1  
ATOM 4058   N NE   . ARG B 1 111 ? -4.011  9.965   -4.677  1.00 34.14 ? 111 ARG B NE   1  
ATOM 4059   C CZ   . ARG B 1 111 ? -5.021  10.667  -4.119  1.00 34.23 ? 111 ARG B CZ   1  
ATOM 4060   N NH1  . ARG B 1 111 ? -6.229  10.697  -4.686  1.00 12.13 ? 111 ARG B NH1  1  
ATOM 4061   N NH2  . ARG B 1 111 ? -4.821  11.312  -2.970  1.00 35.31 ? 111 ARG B NH2  1  
ATOM 4062   H H    . ARG B 1 111 ? -3.166  5.026   -8.592  1.00 22.54 ? 111 ARG B H    1  
ATOM 4063   H HA   . ARG B 1 111 ? -1.070  6.826   -8.057  1.00 54.32 ? 111 ARG B HA   1  
ATOM 4064   H HB2  . ARG B 1 111 ? -3.320  7.683   -8.171  1.00 53.41 ? 111 ARG B HB2  1  
ATOM 4065   H HB3  . ARG B 1 111 ? -3.888  6.577   -6.929  1.00 64.33 ? 111 ARG B HB3  1  
ATOM 4066   H HG2  . ARG B 1 111 ? -2.570  7.824   -5.227  1.00 34.24 ? 111 ARG B HG2  1  
ATOM 4067   H HG3  . ARG B 1 111 ? -2.029  8.948   -6.475  1.00 62.32 ? 111 ARG B HG3  1  
ATOM 4068   H HD2  . ARG B 1 111 ? -4.235  9.839   -6.764  1.00 2.10  ? 111 ARG B HD2  1  
ATOM 4069   H HD3  . ARG B 1 111 ? -4.977  8.514   -5.857  1.00 4.51  ? 111 ARG B HD3  1  
ATOM 4070   H HE   . ARG B 1 111 ? -3.137  9.972   -4.226  1.00 50.22 ? 111 ARG B HE   1  
ATOM 4071   H HH11 . ARG B 1 111 ? -6.395  10.196  -5.535  1.00 22.01 ? 111 ARG B HH11 1  
ATOM 4072   H HH12 . ARG B 1 111 ? -6.974  11.218  -4.264  1.00 3.30  ? 111 ARG B HH12 1  
ATOM 4073   H HH21 . ARG B 1 111 ? -3.922  11.276  -2.520  1.00 12.40 ? 111 ARG B HH21 1  
ATOM 4074   H HH22 . ARG B 1 111 ? -5.563  11.837  -2.546  1.00 32.12 ? 111 ARG B HH22 1  
ATOM 4075   N N    . GLU B 1 112 ? -1.936  4.918   -5.433  1.00 12.22 ? 112 GLU B N    1  
ATOM 4076   C CA   . GLU B 1 112 ? -1.530  4.428   -4.088  1.00 54.24 ? 112 GLU B CA   1  
ATOM 4077   C C    . GLU B 1 112 ? -0.241  3.579   -4.190  1.00 44.31 ? 112 GLU B C    1  
ATOM 4078   O O    . GLU B 1 112 ? 0.610   3.608   -3.297  1.00 3.41  ? 112 GLU B O    1  
ATOM 4079   C CB   . GLU B 1 112 ? -2.705  3.623   -3.429  1.00 61.31 ? 112 GLU B CB   1  
ATOM 4080   C CG   . GLU B 1 112 ? -2.694  3.535   -1.864  1.00 61.10 ? 112 GLU B CG   1  
ATOM 4081   C CD   . GLU B 1 112 ? -1.857  2.375   -1.256  1.00 45.52 ? 112 GLU B CD   1  
ATOM 4082   O OE1  . GLU B 1 112 ? -0.690  2.597   -0.859  1.00 21.21 ? 112 GLU B OE1  1  
ATOM 4083   O OE2  . GLU B 1 112 ? -2.379  1.237   -1.138  1.00 33.21 ? 112 GLU B OE2  1  
ATOM 4084   H H    . GLU B 1 112 ? -2.783  4.594   -5.810  1.00 14.11 ? 112 GLU B H    1  
ATOM 4085   H HA   . GLU B 1 112 ? -1.322  5.304   -3.479  1.00 12.54 ? 112 GLU B HA   1  
ATOM 4086   H HB2  . GLU B 1 112 ? -3.639  4.090   -3.726  1.00 23.44 ? 112 GLU B HB2  1  
ATOM 4087   H HB3  . GLU B 1 112 ? -2.702  2.612   -3.826  1.00 72.22 ? 112 GLU B HB3  1  
ATOM 4088   H HG2  . GLU B 1 112 ? -2.315  4.472   -1.471  1.00 41.24 ? 112 GLU B HG2  1  
ATOM 4089   H HG3  . GLU B 1 112 ? -3.722  3.426   -1.525  1.00 43.13 ? 112 GLU B HG3  1  
ATOM 4090   N N    . CYS B 1 113 ? -0.101  2.860   -5.319  1.00 11.42 ? 113 CYS B N    1  
ATOM 4091   C CA   . CYS B 1 113 ? 1.080   2.036   -5.624  1.00 24.13 ? 113 CYS B CA   1  
ATOM 4092   C C    . CYS B 1 113 ? 2.338   2.907   -5.865  1.00 63.54 ? 113 CYS B C    1  
ATOM 4093   O O    . CYS B 1 113 ? 3.413   2.568   -5.365  1.00 74.14 ? 113 CYS B O    1  
ATOM 4094   C CB   . CYS B 1 113 ? 0.787   1.090   -6.825  1.00 65.43 ? 113 CYS B CB   1  
ATOM 4095   S SG   . CYS B 1 113 ? 0.706   -0.654  -6.371  1.00 14.35 ? 113 CYS B SG   1  
ATOM 4096   H H    . CYS B 1 113 ? -0.830  2.882   -5.973  1.00 20.22 ? 113 CYS B H    1  
ATOM 4097   H HA   . CYS B 1 113 ? 1.265   1.419   -4.746  1.00 62.25 ? 113 CYS B HA   1  
ATOM 4098   H HB2  . CYS B 1 113 ? -0.164  1.346   -7.274  1.00 63.11 ? 113 CYS B HB2  1  
ATOM 4099   H HB3  . CYS B 1 113 ? 1.559   1.186   -7.581  1.00 1.44  ? 113 CYS B HB3  1  
ATOM 4100   H HG   . CYS B 1 113 ? 1.952   -1.066  -6.177  1.00 73.35 ? 113 CYS B HG   1  
ATOM 4101   N N    . ILE B 1 114 ? 2.191   4.027   -6.620  1.00 40.54 ? 114 ILE B N    1  
ATOM 4102   C CA   . ILE B 1 114 ? 3.297   4.998   -6.848  1.00 23.20 ? 114 ILE B CA   1  
ATOM 4103   C C    . ILE B 1 114 ? 3.760   5.583   -5.505  1.00 11.04 ? 114 ILE B C    1  
ATOM 4104   O O    . ILE B 1 114 ? 4.946   5.516   -5.168  1.00 34.33 ? 114 ILE B O    1  
ATOM 4105   C CB   . ILE B 1 114 ? 2.895   6.168   -7.851  1.00 41.55 ? 114 ILE B CB   1  
ATOM 4106   C CG1  . ILE B 1 114 ? 2.752   5.613   -9.305  1.00 42.44 ? 114 ILE B CG1  1  
ATOM 4107   C CG2  . ILE B 1 114 ? 3.909   7.357   -7.806  1.00 45.02 ? 114 ILE B CG2  1  
ATOM 4108   C CD1  . ILE B 1 114 ? 2.281   6.620   -10.343 1.00 44.20 ? 114 ILE B CD1  1  
ATOM 4109   H H    . ILE B 1 114 ? 1.318   4.206   -7.025  1.00 2.14  ? 114 ILE B H    1  
ATOM 4110   H HA   . ILE B 1 114 ? 4.127   4.443   -7.287  1.00 33.25 ? 114 ILE B HA   1  
ATOM 4111   H HB   . ILE B 1 114 ? 1.931   6.554   -7.532  1.00 5.54  ? 114 ILE B HB   1  
ATOM 4112   H HG12 . ILE B 1 114 ? 3.714   5.245   -9.637  1.00 34.21 ? 114 ILE B HG12 1  
ATOM 4113   H HG13 . ILE B 1 114 ? 2.052   4.781   -9.307  1.00 72.31 ? 114 ILE B HG13 1  
ATOM 4114   H HG21 . ILE B 1 114 ? 4.902   6.999   -8.045  1.00 64.34 ? 114 ILE B HG21 1  
ATOM 4115   H HG22 . ILE B 1 114 ? 3.921   7.791   -6.813  1.00 60.45 ? 114 ILE B HG22 1  
ATOM 4116   H HG23 . ILE B 1 114 ? 3.624   8.123   -8.521  1.00 34.43 ? 114 ILE B HG23 1  
ATOM 4117   H HD11 . ILE B 1 114 ? 2.177   6.130   -11.302 1.00 75.25 ? 114 ILE B HD11 1  
ATOM 4118   H HD12 . ILE B 1 114 ? 3.006   7.414   -10.431 1.00 34.31 ? 114 ILE B HD12 1  
ATOM 4119   H HD13 . ILE B 1 114 ? 1.328   7.039   -10.058 1.00 43.53 ? 114 ILE B HD13 1  
ATOM 4120   N N    . THR B 1 115 ? 2.785   6.085   -4.727  1.00 3.50  ? 115 THR B N    1  
ATOM 4121   C CA   . THR B 1 115 ? 3.024   6.735   -3.434  1.00 11.54 ? 115 THR B CA   1  
ATOM 4122   C C    . THR B 1 115 ? 3.711   5.778   -2.433  1.00 32.23 ? 115 THR B C    1  
ATOM 4123   O O    . THR B 1 115 ? 4.545   6.209   -1.628  1.00 5.05  ? 115 THR B O    1  
ATOM 4124   C CB   . THR B 1 115 ? 1.682   7.249   -2.832  1.00 1.20  ? 115 THR B CB   1  
ATOM 4125   O OG1  . THR B 1 115 ? 0.958   8.005   -3.820  1.00 14.43 ? 115 THR B OG1  1  
ATOM 4126   C CG2  . THR B 1 115 ? 1.915   8.119   -1.586  1.00 22.31 ? 115 THR B CG2  1  
ATOM 4127   H H    . THR B 1 115 ? 1.858   6.014   -5.040  1.00 13.33 ? 115 THR B H    1  
ATOM 4128   H HA   . THR B 1 115 ? 3.673   7.588   -3.613  1.00 30.31 ? 115 THR B HA   1  
ATOM 4129   H HB   . THR B 1 115 ? 1.074   6.394   -2.553  1.00 5.50  ? 115 THR B HB   1  
ATOM 4130   H HG1  . THR B 1 115 ? 1.488   8.748   -4.106  1.00 23.32 ? 115 THR B HG1  1  
ATOM 4131   H HG21 . THR B 1 115 ? 2.448   7.550   -0.833  1.00 23.02 ? 115 THR B HG21 1  
ATOM 4132   H HG22 . THR B 1 115 ? 0.964   8.429   -1.185  1.00 12.10 ? 115 THR B HG22 1  
ATOM 4133   H HG23 . THR B 1 115 ? 2.493   8.995   -1.849  1.00 73.54 ? 115 THR B HG23 1  
ATOM 4134   N N    . SER B 1 116 ? 3.360   4.477   -2.525  1.00 25.23 ? 116 SER B N    1  
ATOM 4135   C CA   . SER B 1 116 ? 3.952   3.421   -1.693  1.00 5.23  ? 116 SER B CA   1  
ATOM 4136   C C    . SER B 1 116 ? 5.467   3.348   -1.933  1.00 31.21 ? 116 SER B C    1  
ATOM 4137   O O    . SER B 1 116 ? 6.243   3.390   -0.992  1.00 13.52 ? 116 SER B O    1  
ATOM 4138   C CB   . SER B 1 116 ? 3.295   2.052   -1.996  1.00 24.22 ? 116 SER B CB   1  
ATOM 4139   O OG   . SER B 1 116 ? 3.761   1.040   -1.112  1.00 54.21 ? 116 SER B OG   1  
ATOM 4140   H H    . SER B 1 116 ? 2.673   4.225   -3.178  1.00 10.12 ? 116 SER B H    1  
ATOM 4141   H HA   . SER B 1 116 ? 3.767   3.678   -0.653  1.00 64.31 ? 116 SER B HA   1  
ATOM 4142   H HB2  . SER B 1 116 ? 2.223   2.134   -1.881  1.00 12.04 ? 116 SER B HB2  1  
ATOM 4143   H HB3  . SER B 1 116 ? 3.522   1.749   -3.019  1.00 31.41 ? 116 SER B HB3  1  
ATOM 4144   H HG   . SER B 1 116 ? 3.432   1.223   -0.220  1.00 34.54 ? 116 SER B HG   1  
ATOM 4145   N N    . MET B 1 117 ? 5.863   3.330   -3.216  1.00 43.51 ? 117 MET B N    1  
ATOM 4146   C CA   . MET B 1 117 ? 7.269   3.118   -3.634  1.00 51.01 ? 117 MET B CA   1  
ATOM 4147   C C    . MET B 1 117 ? 8.127   4.370   -3.384  1.00 42.42 ? 117 MET B C    1  
ATOM 4148   O O    . MET B 1 117 ? 9.323   4.267   -3.087  1.00 63.52 ? 117 MET B O    1  
ATOM 4149   C CB   . MET B 1 117 ? 7.307   2.675   -5.118  1.00 1.40  ? 117 MET B CB   1  
ATOM 4150   C CG   . MET B 1 117 ? 6.369   1.496   -5.393  1.00 25.45 ? 117 MET B CG   1  
ATOM 4151   S SD   . MET B 1 117 ? 6.660   0.112   -4.265  1.00 54.35 ? 117 MET B SD   1  
ATOM 4152   C CE   . MET B 1 117 ? 5.092   -0.749  -4.325  1.00 51.22 ? 117 MET B CE   1  
ATOM 4153   H H    . MET B 1 117 ? 5.185   3.479   -3.914  1.00 2.42  ? 117 MET B H    1  
ATOM 4154   H HA   . MET B 1 117 ? 7.668   2.307   -3.024  1.00 23.24 ? 117 MET B HA   1  
ATOM 4155   H HB2  . MET B 1 117 ? 7.016   3.509   -5.755  1.00 15.25 ? 117 MET B HB2  1  
ATOM 4156   H HB3  . MET B 1 117 ? 8.315   2.375   -5.374  1.00 1.30  ? 117 MET B HB3  1  
ATOM 4157   H HG2  . MET B 1 117 ? 5.352   1.833   -5.263  1.00 70.44 ? 117 MET B HG2  1  
ATOM 4158   H HG3  . MET B 1 117 ? 6.501   1.150   -6.409  1.00 32.53 ? 117 MET B HG3  1  
ATOM 4159   H HE1  . MET B 1 117 ? 4.308   -0.080  -4.020  1.00 24.42 ? 117 MET B HE1  1  
ATOM 4160   H HE2  . MET B 1 117 ? 5.126   -1.597  -3.663  1.00 35.13 ? 117 MET B HE2  1  
ATOM 4161   H HE3  . MET B 1 117 ? 4.903   -1.083  -5.328  1.00 14.55 ? 117 MET B HE3  1  
ATOM 4162   N N    . VAL B 1 118 ? 7.486   5.545   -3.485  1.00 64.04 ? 118 VAL B N    1  
ATOM 4163   C CA   . VAL B 1 118 ? 8.091   6.847   -3.133  1.00 22.51 ? 118 VAL B CA   1  
ATOM 4164   C C    . VAL B 1 118 ? 8.351   6.931   -1.613  1.00 13.51 ? 118 VAL B C    1  
ATOM 4165   O O    . VAL B 1 118 ? 9.397   7.426   -1.172  1.00 21.11 ? 118 VAL B O    1  
ATOM 4166   C CB   . VAL B 1 118 ? 7.159   8.023   -3.616  1.00 51.24 ? 118 VAL B CB   1  
ATOM 4167   C CG1  . VAL B 1 118 ? 7.643   9.410   -3.124  1.00 54.43 ? 118 VAL B CG1  1  
ATOM 4168   C CG2  . VAL B 1 118 ? 7.020   7.991   -5.157  1.00 12.33 ? 118 VAL B CG2  1  
ATOM 4169   H H    . VAL B 1 118 ? 6.566   5.541   -3.818  1.00 43.34 ? 118 VAL B H    1  
ATOM 4170   H HA   . VAL B 1 118 ? 9.043   6.927   -3.657  1.00 70.01 ? 118 VAL B HA   1  
ATOM 4171   H HB   . VAL B 1 118 ? 6.169   7.858   -3.195  1.00 3.42  ? 118 VAL B HB   1  
ATOM 4172   H HG11 . VAL B 1 118 ? 7.494   9.489   -2.054  1.00 21.43 ? 118 VAL B HG11 1  
ATOM 4173   H HG12 . VAL B 1 118 ? 7.090   10.198  -3.618  1.00 53.20 ? 118 VAL B HG12 1  
ATOM 4174   H HG13 . VAL B 1 118 ? 8.697   9.524   -3.337  1.00 55.12 ? 118 VAL B HG13 1  
ATOM 4175   H HG21 . VAL B 1 118 ? 6.562   7.058   -5.461  1.00 31.12 ? 118 VAL B HG21 1  
ATOM 4176   H HG22 . VAL B 1 118 ? 7.998   8.070   -5.614  1.00 60.22 ? 118 VAL B HG22 1  
ATOM 4177   H HG23 . VAL B 1 118 ? 6.407   8.815   -5.492  1.00 11.00 ? 118 VAL B HG23 1  
ATOM 4178   N N    . SER B 1 119 ? 7.397   6.399   -0.836  1.00 4.45  ? 119 SER B N    1  
ATOM 4179   C CA   . SER B 1 119 ? 7.493   6.302   0.629   1.00 52.13 ? 119 SER B CA   1  
ATOM 4180   C C    . SER B 1 119 ? 8.630   5.354   1.047   1.00 33.20 ? 119 SER B C    1  
ATOM 4181   O O    . SER B 1 119 ? 9.373   5.629   2.005   1.00 15.30 ? 119 SER B O    1  
ATOM 4182   C CB   . SER B 1 119 ? 6.156   5.793   1.207   1.00 5.24  ? 119 SER B CB   1  
ATOM 4183   O OG   . SER B 1 119 ? 6.254   5.534   2.594   1.00 75.14 ? 119 SER B OG   1  
ATOM 4184   H H    . SER B 1 119 ? 6.589   6.054   -1.269  1.00 3.12  ? 119 SER B H    1  
ATOM 4185   H HA   . SER B 1 119 ? 7.694   7.299   1.009   1.00 2.24  ? 119 SER B HA   1  
ATOM 4186   H HB2  . SER B 1 119 ? 5.388   6.542   1.056   1.00 65.43 ? 119 SER B HB2  1  
ATOM 4187   H HB3  . SER B 1 119 ? 5.863   4.879   0.703   1.00 61.50 ? 119 SER B HB3  1  
ATOM 4188   H HG   . SER B 1 119 ? 6.311   6.370   3.070   1.00 44.40 ? 119 SER B HG   1  
ATOM 4189   N N    . ARG B 1 120 ? 8.739   4.241   0.303   1.00 3.40  ? 120 ARG B N    1  
ATOM 4190   C CA   . ARG B 1 120 ? 9.772   3.224   0.515   1.00 2.34  ? 120 ARG B CA   1  
ATOM 4191   C C    . ARG B 1 120 ? 11.155  3.803   0.198   1.00 4.33  ? 120 ARG B C    1  
ATOM 4192   O O    . ARG B 1 120 ? 12.124  3.452   0.845   1.00 30.33 ? 120 ARG B O    1  
ATOM 4193   C CB   . ARG B 1 120 ? 9.486   1.980   -0.363  1.00 32.14 ? 120 ARG B CB   1  
ATOM 4194   C CG   . ARG B 1 120 ? 8.181   1.240   -0.010  1.00 50.20 ? 120 ARG B CG   1  
ATOM 4195   C CD   . ARG B 1 120 ? 7.814   0.137   -1.022  1.00 52.14 ? 120 ARG B CD   1  
ATOM 4196   N NE   . ARG B 1 120 ? 6.452   -0.380  -0.811  1.00 4.13  ? 120 ARG B NE   1  
ATOM 4197   C CZ   . ARG B 1 120 ? 6.057   -1.133  0.232   1.00 32.42 ? 120 ARG B CZ   1  
ATOM 4198   N NH1  . ARG B 1 120 ? 6.904   -1.487  1.192   1.00 34.53 ? 120 ARG B NH1  1  
ATOM 4199   N NH2  . ARG B 1 120 ? 4.796   -1.517  0.315   1.00 33.24 ? 120 ARG B NH2  1  
ATOM 4200   H H    . ARG B 1 120 ? 8.098   4.108   -0.426  1.00 23.34 ? 120 ARG B H    1  
ATOM 4201   H HA   . ARG B 1 120 ? 9.741   2.934   1.562   1.00 20.50 ? 120 ARG B HA   1  
ATOM 4202   H HB2  . ARG B 1 120 ? 9.426   2.298   -1.404  1.00 65.24 ? 120 ARG B HB2  1  
ATOM 4203   H HB3  . ARG B 1 120 ? 10.310  1.281   -0.267  1.00 33.55 ? 120 ARG B HB3  1  
ATOM 4204   H HG2  . ARG B 1 120 ? 8.289   0.785   0.970   1.00 44.20 ? 120 ARG B HG2  1  
ATOM 4205   H HG3  . ARG B 1 120 ? 7.369   1.958   0.031   1.00 2.33  ? 120 ARG B HG3  1  
ATOM 4206   H HD2  . ARG B 1 120 ? 7.867   0.546   -2.025  1.00 33.34 ? 120 ARG B HD2  1  
ATOM 4207   H HD3  . ARG B 1 120 ? 8.522   -0.681  -0.937  1.00 72.45 ? 120 ARG B HD3  1  
ATOM 4208   H HE   . ARG B 1 120 ? 5.778   -0.136  -1.487  1.00 23.13 ? 120 ARG B HE   1  
ATOM 4209   H HH11 . ARG B 1 120 ? 7.857   -1.199  1.163   1.00 22.04 ? 120 ARG B HH11 1  
ATOM 4210   H HH12 . ARG B 1 120 ? 6.581   -2.048  1.964   1.00 51.04 ? 120 ARG B HH12 1  
ATOM 4211   H HH21 . ARG B 1 120 ? 4.139   -1.253  -0.392  1.00 2.24  ? 120 ARG B HH21 1  
ATOM 4212   H HH22 . ARG B 1 120 ? 4.489   -2.082  1.097   1.00 21.32 ? 120 ARG B HH22 1  
ATOM 4213   N N    . GLY B 1 121 ? 11.206  4.720   -0.795  1.00 11.34 ? 121 GLY B N    1  
ATOM 4214   C CA   . GLY B 1 121 ? 12.438  5.421   -1.172  1.00 54.53 ? 121 GLY B CA   1  
ATOM 4215   C C    . GLY B 1 121 ? 12.719  6.662   -0.330  1.00 31.01 ? 121 GLY B C    1  
ATOM 4216   O O    . GLY B 1 121 ? 13.645  7.410   -0.647  1.00 50.12 ? 121 GLY B O    1  
ATOM 4217   H H    . GLY B 1 121 ? 10.381  4.925   -1.286  1.00 73.03 ? 121 GLY B H    1  
ATOM 4218   H HA2  . GLY B 1 121 ? 13.281  4.744   -1.089  1.00 72.23 ? 121 GLY B HA2  1  
ATOM 4219   H HA3  . GLY B 1 121 ? 12.344  5.723   -2.204  1.00 20.13 ? 121 GLY B HA3  1  
ATOM 4220   N N    . THR B 1 122 ? 11.902  6.867   0.737   1.00 43.31 ? 122 THR B N    1  
ATOM 4221   C CA   . THR B 1 122 ? 12.018  7.975   1.726   1.00 23.13 ? 122 THR B CA   1  
ATOM 4222   C C    . THR B 1 122 ? 11.994  9.391   1.079   1.00 40.23 ? 122 THR B C    1  
ATOM 4223   O O    . THR B 1 122 ? 12.568  10.346  1.625   1.00 53.23 ? 122 THR B O    1  
ATOM 4224   C CB   . THR B 1 122 ? 13.275  7.811   2.669   1.00 70.12 ? 122 THR B CB   1  
ATOM 4225   O OG1  . THR B 1 122 ? 14.494  7.826   1.919   1.00 73.23 ? 122 THR B OG1  1  
ATOM 4226   C CG2  . THR B 1 122 ? 13.233  6.518   3.505   1.00 15.20 ? 122 THR B CG2  1  
ATOM 4227   H H    . THR B 1 122 ? 11.179  6.229   0.875   1.00 24.14 ? 122 THR B H    1  
ATOM 4228   H HA   . THR B 1 122 ? 11.134  7.906   2.354   1.00 42.24 ? 122 THR B HA   1  
ATOM 4229   H HB   . THR B 1 122 ? 13.296  8.654   3.354   1.00 2.43  ? 122 THR B HB   1  
ATOM 4230   H HG1  . THR B 1 122 ? 14.338  8.208   1.049   1.00 51.52 ? 122 THR B HG1  1  
ATOM 4231   H HG21 . THR B 1 122 ? 13.146  5.661   2.848   1.00 12.54 ? 122 THR B HG21 1  
ATOM 4232   H HG22 . THR B 1 122 ? 12.399  6.535   4.175   1.00 32.30 ? 122 THR B HG22 1  
ATOM 4233   H HG23 . THR B 1 122 ? 14.147  6.428   4.080   1.00 72.11 ? 122 THR B HG23 1  
ATOM 4234   N N    . PHE B 1 123 ? 11.297  9.512   -0.059  1.00 64.23 ? 123 PHE B N    1  
ATOM 4235   C CA   . PHE B 1 123 ? 11.094  10.791  -0.773  1.00 2.21  ? 123 PHE B CA   1  
ATOM 4236   C C    . PHE B 1 123 ? 9.768   11.463  -0.332  1.00 43.13 ? 123 PHE B C    1  
ATOM 4237   O O    . PHE B 1 123 ? 8.864   10.764  0.137   1.00 3.22  ? 123 PHE B O    1  
ATOM 4238   C CB   . PHE B 1 123 ? 11.114  10.553  -2.314  1.00 55.54 ? 123 PHE B CB   1  
ATOM 4239   C CG   . PHE B 1 123 ? 12.522  10.385  -2.879  1.00 72.45 ? 123 PHE B CG   1  
ATOM 4240   C CD1  . PHE B 1 123 ? 13.322  11.508  -3.097  1.00 12.35 ? 123 PHE B CD1  1  
ATOM 4241   C CD2  . PHE B 1 123 ? 13.045  9.133   -3.183  1.00 34.34 ? 123 PHE B CD2  1  
ATOM 4242   C CE1  . PHE B 1 123 ? 14.596  11.381  -3.598  1.00 70.42 ? 123 PHE B CE1  1  
ATOM 4243   C CE2  . PHE B 1 123 ? 14.325  9.006   -3.687  1.00 75.24 ? 123 PHE B CE2  1  
ATOM 4244   C CZ   . PHE B 1 123 ? 15.099  10.131  -3.893  1.00 10.52 ? 123 PHE B CZ   1  
ATOM 4245   H H    . PHE B 1 123 ? 10.895  8.707   -0.436  1.00 34.33 ? 123 PHE B H    1  
ATOM 4246   H HA   . PHE B 1 123 ? 11.918  11.458  -0.511  1.00 3.35  ? 123 PHE B HA   1  
ATOM 4247   H HB2  . PHE B 1 123 ? 10.538  9.665   -2.548  1.00 5.11  ? 123 PHE B HB2  1  
ATOM 4248   H HB3  . PHE B 1 123 ? 10.655  11.401  -2.818  1.00 72.14 ? 123 PHE B HB3  1  
ATOM 4249   H HD1  . PHE B 1 123 ? 12.934  12.494  -2.870  1.00 12.42 ? 123 PHE B HD1  1  
ATOM 4250   H HD2  . PHE B 1 123 ? 12.439  8.247   -3.023  1.00 5.33  ? 123 PHE B HD2  1  
ATOM 4251   H HE1  . PHE B 1 123 ? 15.206  12.261  -3.760  1.00 72.13 ? 123 PHE B HE1  1  
ATOM 4252   H HE2  . PHE B 1 123 ? 14.723  8.023   -3.918  1.00 4.13  ? 123 PHE B HE2  1  
ATOM 4253   H HZ   . PHE B 1 123 ? 16.103  10.035  -4.288  1.00 20.25 ? 123 PHE B HZ   1  
ATOM 4254   N N    . PRO B 1 124 ? 9.654   12.838  -0.455  1.00 15.32 ? 124 PRO B N    1  
ATOM 4255   C CA   . PRO B 1 124 ? 8.421   13.610  -0.096  1.00 3.24  ? 124 PRO B CA   1  
ATOM 4256   C C    . PRO B 1 124 ? 7.109   13.132  -0.777  1.00 23.23 ? 124 PRO B C    1  
ATOM 4257   O O    . PRO B 1 124 ? 7.129   12.389  -1.766  1.00 51.33 ? 124 PRO B O    1  
ATOM 4258   C CB   . PRO B 1 124 ? 8.774   15.054  -0.529  1.00 4.42  ? 124 PRO B CB   1  
ATOM 4259   C CG   . PRO B 1 124 ? 10.266  15.122  -0.433  1.00 71.23 ? 124 PRO B CG   1  
ATOM 4260   C CD   . PRO B 1 124 ? 10.744  13.765  -0.895  1.00 0.31  ? 124 PRO B CD   1  
ATOM 4261   H HA   . PRO B 1 124 ? 8.268   13.590  0.980   1.00 43.33 ? 124 PRO B HA   1  
ATOM 4262   H HB2  . PRO B 1 124 ? 8.442   15.239  -1.554  1.00 14.14 ? 124 PRO B HB2  1  
ATOM 4263   H HB3  . PRO B 1 124 ? 8.320   15.775  0.138   1.00 20.30 ? 124 PRO B HB3  1  
ATOM 4264   H HG2  . PRO B 1 124 ? 10.645  15.910  -1.080  1.00 13.34 ? 124 PRO B HG2  1  
ATOM 4265   H HG3  . PRO B 1 124 ? 10.578  15.299  0.593   1.00 34.25 ? 124 PRO B HG3  1  
ATOM 4266   H HD2  . PRO B 1 124 ? 10.853  13.744  -1.979  1.00 75.34 ? 124 PRO B HD2  1  
ATOM 4267   H HD3  . PRO B 1 124 ? 11.686  13.508  -0.424  1.00 43.52 ? 124 PRO B HD3  1  
ATOM 4268   N N    . GLN B 1 125 ? 5.975   13.622  -0.238  1.00 23.53 ? 125 GLN B N    1  
ATOM 4269   C CA   . GLN B 1 125 ? 4.620   13.122  -0.545  1.00 73.31 ? 125 GLN B CA   1  
ATOM 4270   C C    . GLN B 1 125 ? 4.215   13.327  -2.027  1.00 31.35 ? 125 GLN B C    1  
ATOM 4271   O O    . GLN B 1 125 ? 4.449   14.385  -2.614  1.00 30.11 ? 125 GLN B O    1  
ATOM 4272   C CB   . GLN B 1 125 ? 3.594   13.794  0.412   1.00 25.01 ? 125 GLN B CB   1  
ATOM 4273   C CG   . GLN B 1 125 ? 2.144   13.302  0.236   1.00 61.44 ? 125 GLN B CG   1  
ATOM 4274   C CD   . GLN B 1 125 ? 1.968   11.792  0.467   1.00 31.02 ? 125 GLN B CD   1  
ATOM 4275   O OE1  . GLN B 1 125 ? 2.618   11.190  1.320   1.00 71.31 ? 125 GLN B OE1  1  
ATOM 4276   N NE2  . GLN B 1 125 ? 1.147   11.157  -0.350  1.00 42.31 ? 125 GLN B NE2  1  
ATOM 4277   H H    . GLN B 1 125 ? 6.054   14.356  0.403   1.00 73.50 ? 125 GLN B H    1  
ATOM 4278   H HA   . GLN B 1 125 ? 4.625   12.056  -0.332  1.00 2.44  ? 125 GLN B HA   1  
ATOM 4279   H HB2  . GLN B 1 125 ? 3.898   13.601  1.436   1.00 73.01 ? 125 GLN B HB2  1  
ATOM 4280   H HB3  . GLN B 1 125 ? 3.612   14.868  0.246   1.00 0.14  ? 125 GLN B HB3  1  
ATOM 4281   H HG2  . GLN B 1 125 ? 1.510   13.824  0.944   1.00 3.34  ? 125 GLN B HG2  1  
ATOM 4282   H HG3  . GLN B 1 125 ? 1.817   13.542  -0.770  1.00 61.14 ? 125 GLN B HG3  1  
ATOM 4283   H HE21 . GLN B 1 125 ? 0.708   11.667  -1.059  1.00 51.23 ? 125 GLN B HE21 1  
ATOM 4284   H HE22 . GLN B 1 125 ? 1.000   10.202  -0.205  1.00 13.42 ? 125 GLN B HE22 1  
ATOM 4285   N N    . LEU B 1 126 ? 3.580   12.284  -2.600  1.00 3.13  ? 126 LEU B N    1  
ATOM 4286   C CA   . LEU B 1 126 ? 3.152   12.245  -4.008  1.00 30.21 ? 126 LEU B CA   1  
ATOM 4287   C C    . LEU B 1 126 ? 1.647   11.884  -4.034  1.00 61.14 ? 126 LEU B C    1  
ATOM 4288   O O    . LEU B 1 126 ? 1.277   10.783  -3.637  1.00 5.13  ? 126 LEU B O    1  
ATOM 4289   C CB   . LEU B 1 126 ? 4.020   11.175  -4.781  1.00 3.12  ? 126 LEU B CB   1  
ATOM 4290   C CG   . LEU B 1 126 ? 4.214   11.356  -6.336  1.00 75.43 ? 126 LEU B CG   1  
ATOM 4291   C CD1  . LEU B 1 126 ? 2.890   11.273  -7.141  1.00 75.51 ? 126 LEU B CD1  1  
ATOM 4292   C CD2  . LEU B 1 126 ? 4.990   12.662  -6.646  1.00 42.53 ? 126 LEU B CD2  1  
ATOM 4293   H H    . LEU B 1 126 ? 3.385   11.503  -2.043  1.00 50.54 ? 126 LEU B H    1  
ATOM 4294   H HA   . LEU B 1 126 ? 3.303   13.227  -4.456  1.00 61.51 ? 126 LEU B HA   1  
ATOM 4295   H HB2  . LEU B 1 126 ? 5.008   11.165  -4.330  1.00 4.13  ? 126 LEU B HB2  1  
ATOM 4296   H HB3  . LEU B 1 126 ? 3.586   10.191  -4.611  1.00 42.11 ? 126 LEU B HB3  1  
ATOM 4297   H HG   . LEU B 1 126 ? 4.831   10.536  -6.688  1.00 24.40 ? 126 LEU B HG   1  
ATOM 4298   H HD11 . LEU B 1 126 ? 3.095   11.378  -8.198  1.00 3.21  ? 126 LEU B HD11 1  
ATOM 4299   H HD12 . LEU B 1 126 ? 2.213   12.061  -6.829  1.00 44.10 ? 126 LEU B HD12 1  
ATOM 4300   H HD13 . LEU B 1 126 ? 2.420   10.315  -6.965  1.00 24.30 ? 126 LEU B HD13 1  
ATOM 4301   H HD21 . LEU B 1 126 ? 4.429   13.523  -6.300  1.00 11.23 ? 126 LEU B HD21 1  
ATOM 4302   H HD22 . LEU B 1 126 ? 5.150   12.747  -7.714  1.00 65.55 ? 126 LEU B HD22 1  
ATOM 4303   H HD23 . LEU B 1 126 ? 5.951   12.640  -6.150  1.00 1.32  ? 126 LEU B HD23 1  
ATOM 4304   N N    . ASN B 1 127 ? 0.780   12.830  -4.448  1.00 23.40 ? 127 ASN B N    1  
ATOM 4305   C CA   . ASN B 1 127 ? -0.668  12.566  -4.682  1.00 23.12 ? 127 ASN B CA   1  
ATOM 4306   C C    . ASN B 1 127 ? -1.049  13.120  -6.057  1.00 25.21 ? 127 ASN B C    1  
ATOM 4307   O O    . ASN B 1 127 ? -1.078  14.340  -6.246  1.00 22.44 ? 127 ASN B O    1  
ATOM 4308   C CB   . ASN B 1 127 ? -1.593  13.197  -3.590  1.00 0.45  ? 127 ASN B CB   1  
ATOM 4309   C CG   . ASN B 1 127 ? -1.498  12.512  -2.219  1.00 41.24 ? 127 ASN B CG   1  
ATOM 4310   O OD1  . ASN B 1 127 ? -2.066  11.438  -2.011  1.00 53.54 ? 127 ASN B OD1  1  
ATOM 4311   N ND2  . ASN B 1 127 ? -0.837  13.149  -1.263  1.00 24.05 ? 127 ASN B ND2  1  
ATOM 4312   H H    . ASN B 1 127 ? 1.119   13.735  -4.614  1.00 12.31 ? 127 ASN B H    1  
ATOM 4313   H HA   . ASN B 1 127 ? -0.822  11.485  -4.693  1.00 75.43 ? 127 ASN B HA   1  
ATOM 4314   H HB2  . ASN B 1 127 ? -1.336  14.243  -3.473  1.00 64.40 ? 127 ASN B HB2  1  
ATOM 4315   H HB3  . ASN B 1 127 ? -2.627  13.135  -3.919  1.00 12.14 ? 127 ASN B HB3  1  
ATOM 4316   H HD21 . ASN B 1 127 ? -0.443  14.022  -1.472  1.00 2.44  ? 127 ASN B HD21 1  
ATOM 4317   H HD22 . ASN B 1 127 ? -0.777  12.720  -0.380  1.00 61.10 ? 127 ASN B HD22 1  
ATOM 4318   N N    . LEU B 1 128 ? -1.319  12.220  -7.015  1.00 35.32 ? 128 LEU B N    1  
ATOM 4319   C CA   . LEU B 1 128 ? -1.667  12.606  -8.390  1.00 65.24 ? 128 LEU B CA   1  
ATOM 4320   C C    . LEU B 1 128 ? -3.171  12.954  -8.488  1.00 44.41 ? 128 LEU B C    1  
ATOM 4321   O O    . LEU B 1 128 ? -4.016  12.255  -7.905  1.00 55.14 ? 128 LEU B O    1  
ATOM 4322   C CB   . LEU B 1 128 ? -1.283  11.463  -9.368  1.00 1.33  ? 128 LEU B CB   1  
ATOM 4323   C CG   . LEU B 1 128 ? -1.426  11.779  -10.894 1.00 42.31 ? 128 LEU B CG   1  
ATOM 4324   C CD1  . LEU B 1 128 ? -0.583  13.008  -11.308 1.00 44.53 ? 128 LEU B CD1  1  
ATOM 4325   C CD2  . LEU B 1 128 ? -1.070  10.539  -11.747 1.00 53.40 ? 128 LEU B CD2  1  
ATOM 4326   H H    . LEU B 1 128 ? -1.288  11.272  -6.791  1.00 62.01 ? 128 LEU B H    1  
ATOM 4327   H HA   . LEU B 1 128 ? -1.082  13.492  -8.646  1.00 22.12 ? 128 LEU B HA   1  
ATOM 4328   H HB2  . LEU B 1 128 ? -0.248  11.188  -9.176  1.00 41.42 ? 128 LEU B HB2  1  
ATOM 4329   H HB3  . LEU B 1 128 ? -1.904  10.604  -9.140  1.00 13.14 ? 128 LEU B HB3  1  
ATOM 4330   H HG   . LEU B 1 128 ? -2.461  12.025  -11.100 1.00 55.13 ? 128 LEU B HG   1  
ATOM 4331   H HD11 . LEU B 1 128 ? 0.465   12.828  -11.104 1.00 4.12  ? 128 LEU B HD11 1  
ATOM 4332   H HD12 . LEU B 1 128 ? -0.911  13.877  -10.751 1.00 52.42 ? 128 LEU B HD12 1  
ATOM 4333   H HD13 . LEU B 1 128 ? -0.715  13.199  -12.364 1.00 15.12 ? 128 LEU B HD13 1  
ATOM 4334   H HD21 . LEU B 1 128 ? -1.718  9.716   -11.476 1.00 31.24 ? 128 LEU B HD21 1  
ATOM 4335   H HD22 . LEU B 1 128 ? -0.039  10.253  -11.579 1.00 35.43 ? 128 LEU B HD22 1  
ATOM 4336   H HD23 . LEU B 1 128 ? -1.210  10.767  -12.797 1.00 64.22 ? 128 LEU B HD23 1  
ATOM 4337   N N    . ALA B 1 129 ? -3.474  14.047  -9.220  1.00 63.43 ? 129 ALA B N    1  
ATOM 4338   C CA   . ALA B 1 129 ? -4.840  14.585  -9.380  1.00 35.55 ? 129 ALA B CA   1  
ATOM 4339   C C    . ALA B 1 129 ? -5.719  13.650  -10.256 1.00 54.52 ? 129 ALA B C    1  
ATOM 4340   O O    . ALA B 1 129 ? -5.197  13.032  -11.195 1.00 62.13 ? 129 ALA B O    1  
ATOM 4341   C CB   . ALA B 1 129 ? -4.766  16.001  -9.992  1.00 52.31 ? 129 ALA B CB   1  
ATOM 4342   H H    . ALA B 1 129 ? -2.744  14.508  -9.680  1.00 34.01 ? 129 ALA B H    1  
ATOM 4343   H HA   . ALA B 1 129 ? -5.282  14.672  -8.391  1.00 32.22 ? 129 ALA B HA   1  
ATOM 4344   H HB1  . ALA B 1 129 ? -5.763  16.426  -10.070 1.00 20.43 ? 129 ALA B HB1  1  
ATOM 4345   H HB2  . ALA B 1 129 ? -4.323  15.952  -10.977 1.00 40.13 ? 129 ALA B HB2  1  
ATOM 4346   H HB3  . ALA B 1 129 ? -4.159  16.637  -9.361  1.00 23.34 ? 129 ALA B HB3  1  
ATOM 4347   N N    . PRO B 1 130 ? -7.063  13.525  -9.954  1.00 51.33 ? 130 PRO B N    1  
ATOM 4348   C CA   . PRO B 1 130 ? -7.998  12.692  -10.758 1.00 75.22 ? 130 PRO B CA   1  
ATOM 4349   C C    . PRO B 1 130 ? -8.113  13.184  -12.221 1.00 65.43 ? 130 PRO B C    1  
ATOM 4350   O O    . PRO B 1 130 ? -8.670  14.261  -12.487 1.00 3.02  ? 130 PRO B O    1  
ATOM 4351   C CB   . PRO B 1 130 ? -9.354  12.823  -9.998  1.00 74.20 ? 130 PRO B CB   1  
ATOM 4352   C CG   . PRO B 1 130 ? -9.223  14.089  -9.209  1.00 43.35 ? 130 PRO B CG   1  
ATOM 4353   C CD   . PRO B 1 130 ? -7.770  14.160  -8.802  1.00 63.53 ? 130 PRO B CD   1  
ATOM 4354   H HA   . PRO B 1 130 ? -7.683  11.652  -10.755 1.00 62.11 ? 130 PRO B HA   1  
ATOM 4355   H HB2  . PRO B 1 130 ? -10.190 12.872  -10.697 1.00 0.23  ? 130 PRO B HB2  1  
ATOM 4356   H HB3  . PRO B 1 130 ? -9.495  11.984  -9.329  1.00 1.14  ? 130 PRO B HB3  1  
ATOM 4357   H HG2  . PRO B 1 130 ? -9.495  14.944  -9.829  1.00 44.50 ? 130 PRO B HG2  1  
ATOM 4358   H HG3  . PRO B 1 130 ? -9.856  14.055  -8.332  1.00 23.21 ? 130 PRO B HG3  1  
ATOM 4359   H HD2  . PRO B 1 130 ? -7.461  15.193  -8.672  1.00 71.41 ? 130 PRO B HD2  1  
ATOM 4360   H HD3  . PRO B 1 130 ? -7.597  13.600  -7.890  1.00 51.43 ? 130 PRO B HD3  1  
ATOM 4361   N N    . VAL B 1 131 ? -7.552  12.400  -13.158 1.00 13.41 ? 131 VAL B N    1  
ATOM 4362   C CA   . VAL B 1 131 ? -7.635  12.688  -14.598 1.00 62.44 ? 131 VAL B CA   1  
ATOM 4363   C C    . VAL B 1 131 ? -8.893  12.010  -15.162 1.00 1.40  ? 131 VAL B C    1  
ATOM 4364   O O    . VAL B 1 131 ? -8.974  10.777  -15.196 1.00 73.21 ? 131 VAL B O    1  
ATOM 4365   C CB   . VAL B 1 131 ? -6.357  12.178  -15.373 1.00 22.43 ? 131 VAL B CB   1  
ATOM 4366   C CG1  . VAL B 1 131 ? -6.449  12.497  -16.890 1.00 31.51 ? 131 VAL B CG1  1  
ATOM 4367   C CG2  . VAL B 1 131 ? -5.063  12.756  -14.745 1.00 74.43 ? 131 VAL B CG2  1  
ATOM 4368   H H    . VAL B 1 131 ? -7.070  11.601  -12.869 1.00 35.51 ? 131 VAL B H    1  
ATOM 4369   H HA   . VAL B 1 131 ? -7.714  13.766  -14.735 1.00 45.01 ? 131 VAL B HA   1  
ATOM 4370   H HB   . VAL B 1 131 ? -6.317  11.095  -15.271 1.00 41.23 ? 131 VAL B HB   1  
ATOM 4371   H HG11 . VAL B 1 131 ? -5.568  12.128  -17.399 1.00 12.13 ? 131 VAL B HG11 1  
ATOM 4372   H HG12 . VAL B 1 131 ? -6.526  13.567  -17.039 1.00 31.12 ? 131 VAL B HG12 1  
ATOM 4373   H HG13 . VAL B 1 131 ? -7.327  12.017  -17.310 1.00 3.42  ? 131 VAL B HG13 1  
ATOM 4374   H HG21 . VAL B 1 131 ? -4.196  12.377  -15.272 1.00 55.24 ? 131 VAL B HG21 1  
ATOM 4375   H HG22 . VAL B 1 131 ? -5.002  12.462  -13.705 1.00 64.40 ? 131 VAL B HG22 1  
ATOM 4376   H HG23 . VAL B 1 131 ? -5.075  13.838  -14.807 1.00 43.20 ? 131 VAL B HG23 1  
ATOM 4377   N N    . ASN B 1 132 ? -9.885  12.827  -15.574 1.00 45.42 ? 132 ASN B N    1  
ATOM 4378   C CA   . ASN B 1 132 ? -11.135 12.330  -16.174 1.00 5.32  ? 132 ASN B CA   1  
ATOM 4379   C C    . ASN B 1 132 ? -10.852 11.963  -17.639 1.00 40.55 ? 132 ASN B C    1  
ATOM 4380   O O    . ASN B 1 132 ? -10.976 12.807  -18.539 1.00 21.02 ? 132 ASN B O    1  
ATOM 4381   C CB   . ASN B 1 132 ? -12.275 13.393  -16.055 1.00 14.01 ? 132 ASN B CB   1  
ATOM 4382   C CG   . ASN B 1 132 ? -13.688 12.839  -16.328 1.00 13.02 ? 132 ASN B CG   1  
ATOM 4383   O OD1  . ASN B 1 132 ? -13.883 11.915  -17.121 1.00 14.22 ? 132 ASN B OD1  1  
ATOM 4384   N ND2  . ASN B 1 132 ? -14.688 13.418  -15.678 1.00 22.12 ? 132 ASN B ND2  1  
ATOM 4385   H H    . ASN B 1 132 ? -9.768  13.793  -15.471 1.00 65.44 ? 132 ASN B H    1  
ATOM 4386   H HA   . ASN B 1 132 ? -11.434 11.432  -15.633 1.00 22.10 ? 132 ASN B HA   1  
ATOM 4387   H HB2  . ASN B 1 132 ? -12.262 13.808  -15.055 1.00 42.32 ? 132 ASN B HB2  1  
ATOM 4388   H HB3  . ASN B 1 132 ? -12.088 14.196  -16.767 1.00 32.34 ? 132 ASN B HB3  1  
ATOM 4389   H HD21 . ASN B 1 132 ? -14.482 14.154  -15.069 1.00 31.11 ? 132 ASN B HD21 1  
ATOM 4390   H HD22 . ASN B 1 132 ? -15.593 13.076  -15.829 1.00 72.50 ? 132 ASN B HD22 1  
ATOM 4391   N N    . PHE B 1 133 ? -10.417 10.709  -17.851 1.00 41.11 ? 133 PHE B N    1  
ATOM 4392   C CA   . PHE B 1 133 ? -10.041 10.191  -19.180 1.00 34.12 ? 133 PHE B CA   1  
ATOM 4393   C C    . PHE B 1 133 ? -11.219 10.277  -20.169 1.00 43.43 ? 133 PHE B C    1  
ATOM 4394   O O    . PHE B 1 133 ? -11.029 10.601  -21.333 1.00 4.14  ? 133 PHE B O    1  
ATOM 4395   C CB   . PHE B 1 133 ? -9.543  8.726   -19.061 1.00 51.23 ? 133 PHE B CB   1  
ATOM 4396   C CG   . PHE B 1 133 ? -8.269  8.546   -18.221 1.00 63.22 ? 133 PHE B CG   1  
ATOM 4397   C CD1  . PHE B 1 133 ? -8.328  8.112   -16.891 1.00 41.14 ? 133 PHE B CD1  1  
ATOM 4398   C CD2  . PHE B 1 133 ? -7.012  8.800   -18.770 1.00 54.14 ? 133 PHE B CD2  1  
ATOM 4399   C CE1  . PHE B 1 133 ? -7.173  7.939   -16.143 1.00 33.31 ? 133 PHE B CE1  1  
ATOM 4400   C CE2  . PHE B 1 133 ? -5.862  8.630   -18.019 1.00 73.43 ? 133 PHE B CE2  1  
ATOM 4401   C CZ   . PHE B 1 133 ? -5.941  8.198   -16.708 1.00 61.53 ? 133 PHE B CZ   1  
ATOM 4402   H H    . PHE B 1 133 ? -10.343 10.106  -17.079 1.00 4.00  ? 133 PHE B H    1  
ATOM 4403   H HA   . PHE B 1 133 ? -9.230  10.810  -19.553 1.00 61.52 ? 133 PHE B HA   1  
ATOM 4404   H HB2  . PHE B 1 133 ? -10.330 8.123   -18.615 1.00 40.41 ? 133 PHE B HB2  1  
ATOM 4405   H HB3  . PHE B 1 133 ? -9.344  8.339   -20.057 1.00 51.20 ? 133 PHE B HB3  1  
ATOM 4406   H HD1  . PHE B 1 133 ? -9.291  7.911   -16.439 1.00 32.42 ? 133 PHE B HD1  1  
ATOM 4407   H HD2  . PHE B 1 133 ? -6.937  9.141   -19.796 1.00 54.01 ? 133 PHE B HD2  1  
ATOM 4408   H HE1  . PHE B 1 133 ? -7.236  7.602   -15.114 1.00 50.41 ? 133 PHE B HE1  1  
ATOM 4409   H HE2  . PHE B 1 133 ? -4.893  8.830   -18.462 1.00 23.42 ? 133 PHE B HE2  1  
ATOM 4410   H HZ   . PHE B 1 133 ? -5.036  8.061   -16.124 1.00 64.03 ? 133 PHE B HZ   1  
ATOM 4411   N N    . ASP B 1 134 ? -12.429 10.035  -19.652 1.00 31.03 ? 134 ASP B N    1  
ATOM 4412   C CA   . ASP B 1 134 ? -13.680 9.992   -20.433 1.00 31.53 ? 134 ASP B CA   1  
ATOM 4413   C C    . ASP B 1 134 ? -14.030 11.369  -21.042 1.00 2.34  ? 134 ASP B C    1  
ATOM 4414   O O    . ASP B 1 134 ? -14.457 11.455  -22.204 1.00 11.41 ? 134 ASP B O    1  
ATOM 4415   C CB   . ASP B 1 134 ? -14.829 9.501   -19.518 1.00 64.03 ? 134 ASP B CB   1  
ATOM 4416   C CG   . ASP B 1 134 ? -14.576 8.099   -18.922 1.00 73.25 ? 134 ASP B CG   1  
ATOM 4417   O OD1  . ASP B 1 134 ? -13.825 7.988   -17.930 1.00 15.21 ? 134 ASP B OD1  1  
ATOM 4418   O OD2  . ASP B 1 134 ? -15.129 7.112   -19.447 1.00 4.42  ? 134 ASP B OD2  1  
ATOM 4419   H H    . ASP B 1 134 ? -12.488 9.869   -18.687 1.00 15.33 ? 134 ASP B H    1  
ATOM 4420   H HA   . ASP B 1 134 ? -13.540 9.276   -21.239 1.00 21.14 ? 134 ASP B HA   1  
ATOM 4421   H HB2  . ASP B 1 134 ? -14.960 10.204  -18.699 1.00 42.45 ? 134 ASP B HB2  1  
ATOM 4422   H HB3  . ASP B 1 134 ? -15.745 9.474   -20.094 1.00 45.31 ? 134 ASP B HB3  1  
ATOM 4423   N N    . ALA B 1 135 ? -13.821 12.432  -20.244 1.00 45.11 ? 135 ALA B N    1  
ATOM 4424   C CA   . ALA B 1 135 ? -14.114 13.824  -20.639 1.00 52.54 ? 135 ALA B CA   1  
ATOM 4425   C C    . ALA B 1 135 ? -13.146 14.297  -21.737 1.00 31.55 ? 135 ALA B C    1  
ATOM 4426   O O    . ALA B 1 135 ? -13.566 14.849  -22.762 1.00 62.13 ? 135 ALA B O    1  
ATOM 4427   C CB   . ALA B 1 135 ? -14.015 14.734  -19.402 1.00 15.54 ? 135 ALA B CB   1  
ATOM 4428   H H    . ALA B 1 135 ? -13.449 12.272  -19.349 1.00 60.25 ? 135 ALA B H    1  
ATOM 4429   H HA   . ALA B 1 135 ? -15.139 13.865  -21.019 1.00 33.34 ? 135 ALA B HA   1  
ATOM 4430   H HB1  . ALA B 1 135 ? -14.740 14.423  -18.662 1.00 73.31 ? 135 ALA B HB1  1  
ATOM 4431   H HB2  . ALA B 1 135 ? -14.202 15.761  -19.675 1.00 22.11 ? 135 ALA B HB2  1  
ATOM 4432   H HB3  . ALA B 1 135 ? -13.023 14.657  -18.974 1.00 65.30 ? 135 ALA B HB3  1  
ATOM 4433   N N    . LEU B 1 136 ? -11.847 14.037  -21.515 1.00 44.21 ? 136 LEU B N    1  
ATOM 4434   C CA   . LEU B 1 136 ? -10.768 14.450  -22.436 1.00 52.40 ? 136 LEU B CA   1  
ATOM 4435   C C    . LEU B 1 136 ? -10.745 13.553  -23.695 1.00 43.53 ? 136 LEU B C    1  
ATOM 4436   O O    . LEU B 1 136 ? -10.200 13.948  -24.734 1.00 32.14 ? 136 LEU B O    1  
ATOM 4437   C CB   . LEU B 1 136 ? -9.389  14.445  -21.705 1.00 22.41 ? 136 LEU B CB   1  
ATOM 4438   C CG   . LEU B 1 136 ? -9.096  15.643  -20.727 1.00 5.42  ? 136 LEU B CG   1  
ATOM 4439   C CD1  . LEU B 1 136 ? -10.114 15.753  -19.570 1.00 73.02 ? 136 LEU B CD1  1  
ATOM 4440   C CD2  . LEU B 1 136 ? -7.656  15.560  -20.182 1.00 51.23 ? 136 LEU B CD2  1  
ATOM 4441   H H    . LEU B 1 136 ? -11.603 13.546  -20.699 1.00 14.21 ? 136 LEU B H    1  
ATOM 4442   H HA   . LEU B 1 136 ? -10.987 15.468  -22.754 1.00 40.25 ? 136 LEU B HA   1  
ATOM 4443   H HB2  . LEU B 1 136 ? -9.308  13.519  -21.144 1.00 23.22 ? 136 LEU B HB2  1  
ATOM 4444   H HB3  . LEU B 1 136 ? -8.608  14.440  -22.463 1.00 74.41 ? 136 LEU B HB3  1  
ATOM 4445   H HG   . LEU B 1 136 ? -9.169  16.567  -21.287 1.00 53.20 ? 136 LEU B HG   1  
ATOM 4446   H HD11 . LEU B 1 136 ? -10.075 14.860  -18.957 1.00 42.35 ? 136 LEU B HD11 1  
ATOM 4447   H HD12 . LEU B 1 136 ? -11.112 15.861  -19.974 1.00 74.00 ? 136 LEU B HD12 1  
ATOM 4448   H HD13 . LEU B 1 136 ? -9.886  16.617  -18.960 1.00 43.43 ? 136 LEU B HD13 1  
ATOM 4449   H HD21 . LEU B 1 136 ? -7.459  16.398  -19.528 1.00 74.13 ? 136 LEU B HD21 1  
ATOM 4450   H HD22 . LEU B 1 136 ? -6.956  15.587  -21.009 1.00 50.20 ? 136 LEU B HD22 1  
ATOM 4451   H HD23 . LEU B 1 136 ? -7.521  14.634  -19.633 1.00 53.43 ? 136 LEU B HD23 1  
ATOM 4452   N N    . PHE B 1 137 ? -11.344 12.349  -23.581 1.00 23.24 ? 137 PHE B N    1  
ATOM 4453   C CA   . PHE B 1 137 ? -11.547 11.428  -24.715 1.00 53.33 ? 137 PHE B CA   1  
ATOM 4454   C C    . PHE B 1 137 ? -12.547 12.032  -25.714 1.00 64.43 ? 137 PHE B C    1  
ATOM 4455   O O    . PHE B 1 137 ? -12.320 12.000  -26.918 1.00 21.14 ? 137 PHE B O    1  
ATOM 4456   C CB   . PHE B 1 137 ? -12.049 10.045  -24.209 1.00 52.41 ? 137 PHE B CB   1  
ATOM 4457   C CG   . PHE B 1 137 ? -12.339 9.038   -25.322 1.00 2.12  ? 137 PHE B CG   1  
ATOM 4458   C CD1  . PHE B 1 137 ? -11.297 8.362   -25.962 1.00 53.43 ? 137 PHE B CD1  1  
ATOM 4459   C CD2  . PHE B 1 137 ? -13.646 8.790   -25.745 1.00 61.11 ? 137 PHE B CD2  1  
ATOM 4460   C CE1  . PHE B 1 137 ? -11.557 7.481   -26.989 1.00 71.31 ? 137 PHE B CE1  1  
ATOM 4461   C CE2  . PHE B 1 137 ? -13.901 7.907   -26.765 1.00 74.52 ? 137 PHE B CE2  1  
ATOM 4462   C CZ   . PHE B 1 137 ? -12.859 7.256   -27.388 1.00 51.20 ? 137 PHE B CZ   1  
ATOM 4463   H H    . PHE B 1 137 ? -11.656 12.070  -22.695 1.00 33.30 ? 137 PHE B H    1  
ATOM 4464   H HA   . PHE B 1 137 ? -10.585 11.297  -25.210 1.00 10.42 ? 137 PHE B HA   1  
ATOM 4465   H HB2  . PHE B 1 137 ? -11.296 9.615   -23.558 1.00 1.52  ? 137 PHE B HB2  1  
ATOM 4466   H HB3  . PHE B 1 137 ? -12.958 10.187  -23.631 1.00 15.25 ? 137 PHE B HB3  1  
ATOM 4467   H HD1  . PHE B 1 137 ? -10.274 8.536   -25.650 1.00 60.10 ? 137 PHE B HD1  1  
ATOM 4468   H HD2  . PHE B 1 137 ? -14.469 9.299   -25.258 1.00 73.43 ? 137 PHE B HD2  1  
ATOM 4469   H HE1  . PHE B 1 137 ? -10.743 6.958   -27.481 1.00 64.10 ? 137 PHE B HE1  1  
ATOM 4470   H HE2  . PHE B 1 137 ? -14.921 7.723   -27.085 1.00 74.24 ? 137 PHE B HE2  1  
ATOM 4471   H HZ   . PHE B 1 137 ? -13.064 6.566   -28.197 1.00 24.43 ? 137 PHE B HZ   1  
ATOM 4472   N N    . MET B 1 138 ? -13.643 12.593  -25.176 1.00 44.23 ? 138 MET B N    1  
ATOM 4473   C CA   . MET B 1 138 ? -14.710 13.241  -25.969 1.00 10.51 ? 138 MET B CA   1  
ATOM 4474   C C    . MET B 1 138 ? -14.133 14.407  -26.811 1.00 73.33 ? 138 MET B C    1  
ATOM 4475   O O    . MET B 1 138 ? -14.522 14.615  -27.969 1.00 23.20 ? 138 MET B O    1  
ATOM 4476   C CB   . MET B 1 138 ? -15.817 13.733  -24.987 1.00 44.10 ? 138 MET B CB   1  
ATOM 4477   C CG   . MET B 1 138 ? -17.091 14.325  -25.624 1.00 72.43 ? 138 MET B CG   1  
ATOM 4478   S SD   . MET B 1 138 ? -16.846 15.943  -26.406 1.00 45.14 ? 138 MET B SD   1  
ATOM 4479   C CE   . MET B 1 138 ? -18.492 16.297  -27.037 1.00 55.23 ? 138 MET B CE   1  
ATOM 4480   H H    . MET B 1 138 ? -13.740 12.576  -24.198 1.00 44.34 ? 138 MET B H    1  
ATOM 4481   H HA   . MET B 1 138 ? -15.136 12.492  -26.635 1.00 45.14 ? 138 MET B HA   1  
ATOM 4482   H HB2  . MET B 1 138 ? -16.119 12.892  -24.368 1.00 71.12 ? 138 MET B HB2  1  
ATOM 4483   H HB3  . MET B 1 138 ? -15.388 14.487  -24.335 1.00 22.15 ? 138 MET B HB3  1  
ATOM 4484   H HG2  . MET B 1 138 ? -17.454 13.638  -26.376 1.00 72.41 ? 138 MET B HG2  1  
ATOM 4485   H HG3  . MET B 1 138 ? -17.842 14.431  -24.848 1.00 22.55 ? 138 MET B HG3  1  
ATOM 4486   H HE1  . MET B 1 138 ? -19.193 16.330  -26.216 1.00 20.45 ? 138 MET B HE1  1  
ATOM 4487   H HE2  . MET B 1 138 ? -18.789 15.527  -27.734 1.00 23.10 ? 138 MET B HE2  1  
ATOM 4488   H HE3  . MET B 1 138 ? -18.484 17.253  -27.540 1.00 1.40  ? 138 MET B HE3  1  
ATOM 4489   N N    . ASN B 1 139 ? -13.160 15.118  -26.216 1.00 32.12 ? 139 ASN B N    1  
ATOM 4490   C CA   . ASN B 1 139 ? -12.457 16.245  -26.862 1.00 65.41 ? 139 ASN B CA   1  
ATOM 4491   C C    . ASN B 1 139 ? -11.417 15.748  -27.887 1.00 31.53 ? 139 ASN B C    1  
ATOM 4492   O O    . ASN B 1 139 ? -11.117 16.451  -28.857 1.00 52.13 ? 139 ASN B O    1  
ATOM 4493   C CB   . ASN B 1 139 ? -11.768 17.125  -25.783 1.00 62.10 ? 139 ASN B CB   1  
ATOM 4494   C CG   . ASN B 1 139 ? -12.732 17.707  -24.735 1.00 4.32  ? 139 ASN B CG   1  
ATOM 4495   O OD1  . ASN B 1 139 ? -12.363 17.896  -23.576 1.00 62.34 ? 139 ASN B OD1  1  
ATOM 4496   N ND2  . ASN B 1 139 ? -13.962 18.035  -25.129 1.00 43.15 ? 139 ASN B ND2  1  
ATOM 4497   H H    . ASN B 1 139 ? -12.904 14.873  -25.297 1.00 72.25 ? 139 ASN B H    1  
ATOM 4498   H HA   . ASN B 1 139 ? -13.199 16.844  -27.379 1.00 74.04 ? 139 ASN B HA   1  
ATOM 4499   H HB2  . ASN B 1 139 ? -11.027 16.524  -25.263 1.00 30.13 ? 139 ASN B HB2  1  
ATOM 4500   H HB3  . ASN B 1 139 ? -11.263 17.951  -26.268 1.00 1.40  ? 139 ASN B HB3  1  
ATOM 4501   H HD21 . ASN B 1 139 ? -14.208 17.900  -26.066 1.00 22.53 ? 139 ASN B HD21 1  
ATOM 4502   H HD22 . ASN B 1 139 ? -14.577 18.397  -24.459 1.00 50.04 ? 139 ASN B HD22 1  
ATOM 4503   N N    . TYR B 1 140 ? -10.880 14.533  -27.649 1.00 53.34 ? 140 TYR B N    1  
ATOM 4504   C CA   . TYR B 1 140 ? -9.876  13.881  -28.530 1.00 1.34  ? 140 TYR B CA   1  
ATOM 4505   C C    . TYR B 1 140 ? -10.472 13.550  -29.908 1.00 12.12 ? 140 TYR B C    1  
ATOM 4506   O O    . TYR B 1 140 ? -9.785  13.653  -30.931 1.00 2.02  ? 140 TYR B O    1  
ATOM 4507   C CB   . TYR B 1 140 ? -9.354  12.577  -27.862 1.00 44.14 ? 140 TYR B CB   1  
ATOM 4508   C CG   . TYR B 1 140 ? -8.226  11.849  -28.621 1.00 63.05 ? 140 TYR B CG   1  
ATOM 4509   C CD1  . TYR B 1 140 ? -7.043  12.512  -28.960 1.00 75.00 ? 140 TYR B CD1  1  
ATOM 4510   C CD2  . TYR B 1 140 ? -8.333  10.496  -28.972 1.00 52.43 ? 140 TYR B CD2  1  
ATOM 4511   C CE1  . TYR B 1 140 ? -6.021  11.860  -29.617 1.00 33.25 ? 140 TYR B CE1  1  
ATOM 4512   C CE2  . TYR B 1 140 ? -7.307  9.843   -29.633 1.00 54.34 ? 140 TYR B CE2  1  
ATOM 4513   C CZ   . TYR B 1 140 ? -6.153  10.530  -29.951 1.00 41.43 ? 140 TYR B CZ   1  
ATOM 4514   O OH   . TYR B 1 140 ? -5.121  9.885   -30.607 1.00 24.30 ? 140 TYR B OH   1  
ATOM 4515   H H    . TYR B 1 140 ? -11.165 14.053  -26.843 1.00 22.51 ? 140 TYR B H    1  
ATOM 4516   H HA   . TYR B 1 140 ? -9.046  14.572  -28.655 1.00 32.52 ? 140 TYR B HA   1  
ATOM 4517   H HB2  . TYR B 1 140 ? -8.978  12.814  -26.874 1.00 21.14 ? 140 TYR B HB2  1  
ATOM 4518   H HB3  . TYR B 1 140 ? -10.192 11.882  -27.754 1.00 73.24 ? 140 TYR B HB3  1  
ATOM 4519   H HD1  . TYR B 1 140 ? -6.933  13.559  -28.703 1.00 12.12 ? 140 TYR B HD1  1  
ATOM 4520   H HD2  . TYR B 1 140 ? -9.241  9.958   -28.724 1.00 63.13 ? 140 TYR B HD2  1  
ATOM 4521   H HE1  . TYR B 1 140 ? -5.114  12.397  -29.869 1.00 64.21 ? 140 TYR B HE1  1  
ATOM 4522   H HE2  . TYR B 1 140 ? -7.412  8.798   -29.896 1.00 65.30 ? 140 TYR B HE2  1  
ATOM 4523   H HH   . TYR B 1 140 ? -4.286  10.078  -30.161 1.00 3.13  ? 140 TYR B HH   1  
ATOM 4524   N N    . LEU B 1 141 ? -11.774 13.207  -29.915 1.00 23.20 ? 141 LEU B N    1  
ATOM 4525   C CA   . LEU B 1 141 ? -12.491 12.733  -31.123 1.00 33.11 ? 141 LEU B CA   1  
ATOM 4526   C C    . LEU B 1 141 ? -12.821 13.897  -32.076 1.00 72.12 ? 141 LEU B C    1  
ATOM 4527   O O    . LEU B 1 141 ? -13.378 13.691  -33.158 1.00 71.21 ? 141 LEU B O    1  
ATOM 4528   C CB   . LEU B 1 141 ? -13.803 12.016  -30.704 1.00 2.02  ? 141 LEU B CB   1  
ATOM 4529   C CG   . LEU B 1 141 ? -13.672 10.949  -29.580 1.00 71.34 ? 141 LEU B CG   1  
ATOM 4530   C CD1  . LEU B 1 141 ? -15.026 10.275  -29.284 1.00 3.21  ? 141 LEU B CD1  1  
ATOM 4531   C CD2  . LEU B 1 141 ? -12.553 9.927   -29.889 1.00 42.05 ? 141 LEU B CD2  1  
ATOM 4532   H H    . LEU B 1 141 ? -12.273 13.271  -29.071 1.00 40.44 ? 141 LEU B H    1  
ATOM 4533   H HA   . LEU B 1 141 ? -11.851 12.027  -31.644 1.00 25.11 ? 141 LEU B HA   1  
ATOM 4534   H HB2  . LEU B 1 141 ? -14.510 12.769  -30.369 1.00 70.23 ? 141 LEU B HB2  1  
ATOM 4535   H HB3  . LEU B 1 141 ? -14.220 11.530  -31.582 1.00 0.31  ? 141 LEU B HB3  1  
ATOM 4536   H HG   . LEU B 1 141 ? -13.384 11.462  -28.670 1.00 13.10 ? 141 LEU B HG   1  
ATOM 4537   H HD11 . LEU B 1 141 ? -15.749 11.028  -28.998 1.00 41.33 ? 141 LEU B HD11 1  
ATOM 4538   H HD12 . LEU B 1 141 ? -14.914 9.572   -28.472 1.00 5.04  ? 141 LEU B HD12 1  
ATOM 4539   H HD13 . LEU B 1 141 ? -15.383 9.755   -30.161 1.00 32.43 ? 141 LEU B HD13 1  
ATOM 4540   H HD21 . LEU B 1 141 ? -11.598 10.434  -29.907 1.00 23.24 ? 141 LEU B HD21 1  
ATOM 4541   H HD22 . LEU B 1 141 ? -12.725 9.465   -30.846 1.00 64.41 ? 141 LEU B HD22 1  
ATOM 4542   H HD23 . LEU B 1 141 ? -12.531 9.165   -29.122 1.00 62.11 ? 141 LEU B HD23 1  
ATOM 4543   N N    . GLN B 1 142 ? -12.487 15.121  -31.645 1.00 74.15 ? 142 GLN B N    1  
ATOM 4544   C CA   . GLN B 1 142 ? -12.712 16.356  -32.403 1.00 33.43 ? 142 GLN B CA   1  
ATOM 4545   C C    . GLN B 1 142 ? -11.372 17.084  -32.613 1.00 1.23  ? 142 GLN B C    1  
ATOM 4546   O O    . GLN B 1 142 ? -11.137 17.660  -33.685 1.00 3.13  ? 142 GLN B O    1  
ATOM 4547   C CB   . GLN B 1 142 ? -13.712 17.253  -31.623 1.00 73.44 ? 142 GLN B CB   1  
ATOM 4548   C CG   . GLN B 1 142 ? -15.075 16.593  -31.322 1.00 63.54 ? 142 GLN B CG   1  
ATOM 4549   C CD   . GLN B 1 142 ? -15.946 17.430  -30.382 1.00 73.34 ? 142 GLN B CD   1  
ATOM 4550   O OE1  . GLN B 1 142 ? -16.718 18.284  -30.822 1.00 20.42 ? 142 GLN B OE1  1  
ATOM 4551   N NE2  . GLN B 1 142 ? -15.821 17.195  -29.080 1.00 44.14 ? 142 GLN B NE2  1  
ATOM 4552   H H    . GLN B 1 142 ? -12.069 15.198  -30.768 1.00 25.04 ? 142 GLN B H    1  
ATOM 4553   H HA   . GLN B 1 142 ? -13.136 16.108  -33.372 1.00 12.04 ? 142 GLN B HA   1  
ATOM 4554   H HB2  . GLN B 1 142 ? -13.260 17.542  -30.679 1.00 20.04 ? 142 GLN B HB2  1  
ATOM 4555   H HB3  . GLN B 1 142 ? -13.896 18.153  -32.204 1.00 25.55 ? 142 GLN B HB3  1  
ATOM 4556   H HG2  . GLN B 1 142 ? -15.610 16.443  -32.254 1.00 51.52 ? 142 GLN B HG2  1  
ATOM 4557   H HG3  . GLN B 1 142 ? -14.896 15.626  -30.861 1.00 32.15 ? 142 GLN B HG3  1  
ATOM 4558   H HE21 . GLN B 1 142 ? -15.185 16.504  -28.791 1.00 74.53 ? 142 GLN B HE21 1  
ATOM 4559   H HE22 . GLN B 1 142 ? -16.371 17.716  -28.462 1.00 11.43 ? 142 GLN B HE22 1  
ATOM 4560   N N    . GLN B 1 143 ? -10.501 17.025  -31.574 1.00 74.04 ? 143 GLN B N    1  
ATOM 4561   C CA   . GLN B 1 143 ? -9.198  17.723  -31.524 1.00 44.44 ? 143 GLN B CA   1  
ATOM 4562   C C    . GLN B 1 143 ? -9.375  19.225  -31.868 1.00 53.44 ? 143 GLN B C    1  
ATOM 4563   O O    . GLN B 1 143 ? -8.937  19.710  -32.922 1.00 22.51 ? 143 GLN B O    1  
ATOM 4564   C CB   . GLN B 1 143 ? -8.149  17.002  -32.432 1.00 60.42 ? 143 GLN B CB   1  
ATOM 4565   C CG   . GLN B 1 143 ? -6.719  17.587  -32.390 1.00 11.43 ? 143 GLN B CG   1  
ATOM 4566   C CD   . GLN B 1 143 ? -5.770  16.918  -33.391 1.00 23.31 ? 143 GLN B CD   1  
ATOM 4567   O OE1  . GLN B 1 143 ? -5.684  17.327  -34.550 1.00 1.01  ? 143 GLN B OE1  1  
ATOM 4568   N NE2  . GLN B 1 143 ? -5.048  15.894  -32.956 1.00 53.02 ? 143 GLN B NE2  1  
ATOM 4569   H H    . GLN B 1 143 ? -10.745 16.474  -30.808 1.00 31.44 ? 143 GLN B H    1  
ATOM 4570   H HA   . GLN B 1 143 ? -8.860  17.659  -30.495 1.00 55.23 ? 143 GLN B HA   1  
ATOM 4571   H HB2  . GLN B 1 143 ? -8.095  15.960  -32.133 1.00 33.32 ? 143 GLN B HB2  1  
ATOM 4572   H HB3  . GLN B 1 143 ? -8.503  17.039  -33.461 1.00 43.03 ? 143 GLN B HB3  1  
ATOM 4573   H HG2  . GLN B 1 143 ? -6.768  18.647  -32.618 1.00 51.51 ? 143 GLN B HG2  1  
ATOM 4574   H HG3  . GLN B 1 143 ? -6.321  17.461  -31.390 1.00 13.32 ? 143 GLN B HG3  1  
ATOM 4575   H HE21 . GLN B 1 143 ? -5.156  15.613  -32.024 1.00 61.25 ? 143 GLN B HE21 1  
ATOM 4576   H HE22 . GLN B 1 143 ? -4.437  15.458  -33.588 1.00 4.14  ? 143 GLN B HE22 1  
ATOM 4577   N N    . GLN B 1 144 ? -10.108 19.922  -30.984 1.00 21.22 ? 144 GLN B N    1  
ATOM 4578   C CA   . GLN B 1 144 ? -10.460 21.346  -31.151 1.00 30.10 ? 144 GLN B CA   1  
ATOM 4579   C C    . GLN B 1 144 ? -11.005 21.917  -29.831 1.00 41.51 ? 144 GLN B C    1  
ATOM 4580   O O    . GLN B 1 144 ? -11.419 21.164  -28.935 1.00 3.33  ? 144 GLN B O    1  
ATOM 4581   C CB   . GLN B 1 144 ? -11.511 21.520  -32.286 1.00 51.55 ? 144 GLN B CB   1  
ATOM 4582   C CG   . GLN B 1 144 ? -12.852 20.802  -32.021 1.00 2.55  ? 144 GLN B CG   1  
ATOM 4583   C CD   . GLN B 1 144 ? -13.836 20.853  -33.191 1.00 11.32 ? 144 GLN B CD   1  
ATOM 4584   O OE1  . GLN B 1 144 ? -13.443 20.918  -34.352 1.00 41.44 ? 144 GLN B OE1  1  
ATOM 4585   N NE2  . GLN B 1 144 ? -15.120 20.793  -32.893 1.00 12.22 ? 144 GLN B NE2  1  
ATOM 4586   H H    . GLN B 1 144 ? -10.429 19.461  -30.184 1.00 24.41 ? 144 GLN B H    1  
ATOM 4587   H HA   . GLN B 1 144 ? -9.554  21.891  -31.414 1.00 52.25 ? 144 GLN B HA   1  
ATOM 4588   H HB2  . GLN B 1 144 ? -11.711 22.578  -32.428 1.00 10.35 ? 144 GLN B HB2  1  
ATOM 4589   H HB3  . GLN B 1 144 ? -11.090 21.125  -33.205 1.00 24.44 ? 144 GLN B HB3  1  
ATOM 4590   H HG2  . GLN B 1 144 ? -12.650 19.761  -31.801 1.00 74.42 ? 144 GLN B HG2  1  
ATOM 4591   H HG3  . GLN B 1 144 ? -13.319 21.259  -31.155 1.00 5.22  ? 144 GLN B HG3  1  
ATOM 4592   H HE21 . GLN B 1 144 ? -15.372 20.720  -31.947 1.00 5.11  ? 144 GLN B HE21 1  
ATOM 4593   H HE22 . GLN B 1 144 ? -15.767 20.825  -33.625 1.00 11.21 ? 144 GLN B HE22 1  
ATOM 4594   N N    . ALA B 1 145 ? -11.002 23.253  -29.730 1.00 23.44 ? 145 ALA B N    1  
ATOM 4595   C CA   . ALA B 1 145 ? -11.564 23.981  -28.581 1.00 74.54 ? 145 ALA B CA   1  
ATOM 4596   C C    . ALA B 1 145 ? -13.110 24.009  -28.644 1.00 0.32  ? 145 ALA B C    1  
ATOM 4597   O O    . ALA B 1 145 ? -13.693 23.970  -29.738 1.00 60.41 ? 145 ALA B O    1  
ATOM 4598   C CB   . ALA B 1 145 ? -10.984 25.403  -28.524 1.00 14.11 ? 145 ALA B CB   1  
ATOM 4599   H H    . ALA B 1 145 ? -10.600 23.773  -30.455 1.00 63.02 ? 145 ALA B H    1  
ATOM 4600   H HA   . ALA B 1 145 ? -11.258 23.458  -27.676 1.00 54.21 ? 145 ALA B HA   1  
ATOM 4601   H HB1  . ALA B 1 145 ? -11.371 25.925  -27.658 1.00 12.52 ? 145 ALA B HB1  1  
ATOM 4602   H HB2  . ALA B 1 145 ? -11.252 25.949  -29.421 1.00 25.14 ? 145 ALA B HB2  1  
ATOM 4603   H HB3  . ALA B 1 145 ? -9.903  25.352  -28.453 1.00 23.40 ? 145 ALA B HB3  1  
ATOM 4604   N N    . GLY B 1 146 ? -13.752 24.081  -27.457 1.00 40.40 ? 146 GLY B N    1  
ATOM 4605   C CA   . GLY B 1 146 ? -15.217 24.024  -27.333 1.00 54.12 ? 146 GLY B CA   1  
ATOM 4606   C C    . GLY B 1 146 ? -15.918 25.262  -27.895 1.00 21.41 ? 146 GLY B C    1  
ATOM 4607   O O    . GLY B 1 146 ? -15.449 26.384  -27.690 1.00 34.45 ? 146 GLY B O    1  
ATOM 4608   H H    . GLY B 1 146 ? -13.217 24.198  -26.646 1.00 21.44 ? 146 GLY B H    1  
ATOM 4609   H HA2  . GLY B 1 146 ? -15.578 23.139  -27.842 1.00 5.05  ? 146 GLY B HA2  1  
ATOM 4610   H HA3  . GLY B 1 146 ? -15.467 23.934  -26.282 1.00 33.24 ? 146 GLY B HA3  1  
ATOM 4611   N N    . GLU B 1 147 ? -17.049 25.045  -28.588 1.00 52.33 ? 147 GLU B N    1  
ATOM 4612   C CA   . GLU B 1 147 ? -17.795 26.108  -29.292 1.00 3.10  ? 147 GLU B CA   1  
ATOM 4613   C C    . GLU B 1 147 ? -18.960 26.578  -28.392 1.00 25.23 ? 147 GLU B C    1  
ATOM 4614   O O    . GLU B 1 147 ? -19.934 25.843  -28.204 1.00 74.41 ? 147 GLU B O    1  
ATOM 4615   C CB   . GLU B 1 147 ? -18.315 25.556  -30.673 1.00 23.52 ? 147 GLU B CB   1  
ATOM 4616   C CG   . GLU B 1 147 ? -18.729 26.617  -31.732 1.00 45.21 ? 147 GLU B CG   1  
ATOM 4617   C CD   . GLU B 1 147 ? -19.945 27.479  -31.335 1.00 60.41 ? 147 GLU B CD   1  
ATOM 4618   O OE1  . GLU B 1 147 ? -19.787 28.684  -31.098 1.00 14.20 ? 147 GLU B OE1  1  
ATOM 4619   O OE2  . GLU B 1 147 ? -21.054 26.937  -31.224 1.00 73.33 ? 147 GLU B OE2  1  
ATOM 4620   H H    . GLU B 1 147 ? -17.408 24.137  -28.610 1.00 4.25  ? 147 GLU B H    1  
ATOM 4621   H HA   . GLU B 1 147 ? -17.117 26.945  -29.479 1.00 71.31 ? 147 GLU B HA   1  
ATOM 4622   H HB2  . GLU B 1 147 ? -17.531 24.948  -31.110 1.00 63.45 ? 147 GLU B HB2  1  
ATOM 4623   H HB3  . GLU B 1 147 ? -19.170 24.912  -30.493 1.00 34.14 ? 147 GLU B HB3  1  
ATOM 4624   H HG2  . GLU B 1 147 ? -17.879 27.262  -31.910 1.00 2.21  ? 147 GLU B HG2  1  
ATOM 4625   H HG3  . GLU B 1 147 ? -18.967 26.106  -32.661 1.00 73.25 ? 147 GLU B HG3  1  
ATOM 4626   N N    . GLY B 1 148 ? -18.826 27.789  -27.829 1.00 75.20 ? 148 GLY B N    1  
ATOM 4627   C CA   . GLY B 1 148 ? -19.895 28.448  -27.073 1.00 11.10 ? 148 GLY B CA   1  
ATOM 4628   C C    . GLY B 1 148 ? -19.879 29.955  -27.284 1.00 40.41 ? 148 GLY B C    1  
ATOM 4629   O O    . GLY B 1 148 ? -20.132 30.721  -26.352 1.00 74.42 ? 148 GLY B O    1  
ATOM 4630   H H    . GLY B 1 148 ? -17.971 28.253  -27.927 1.00 61.01 ? 148 GLY B H    1  
ATOM 4631   H HA2  . GLY B 1 148 ? -20.863 28.069  -27.387 1.00 24.41 ? 148 GLY B HA2  1  
ATOM 4632   H HA3  . GLY B 1 148 ? -19.759 28.234  -26.020 1.00 44.35 ? 148 GLY B HA3  1  
ATOM 4633   N N    . THR B 1 149 ? -19.574 30.364  -28.534 1.00 34.21 ? 149 THR B N    1  
ATOM 4634   C CA   . THR B 1 149 ? -19.496 31.780  -28.955 1.00 4.32  ? 149 THR B CA   1  
ATOM 4635   C C    . THR B 1 149 ? -20.842 32.508  -28.703 1.00 61.20 ? 149 THR B C    1  
ATOM 4636   O O    . THR B 1 149 ? -21.827 32.259  -29.406 1.00 32.31 ? 149 THR B O    1  
ATOM 4637   C CB   . THR B 1 149 ? -19.118 31.856  -30.481 1.00 74.25 ? 149 THR B CB   1  
ATOM 4638   O OG1  . THR B 1 149 ? -17.938 31.070  -30.728 1.00 0.42  ? 149 THR B OG1  1  
ATOM 4639   C CG2  . THR B 1 149 ? -18.878 33.296  -30.973 1.00 0.42  ? 149 THR B CG2  1  
ATOM 4640   H H    . THR B 1 149 ? -19.380 29.680  -29.207 1.00 40.33 ? 149 THR B H    1  
ATOM 4641   H HA   . THR B 1 149 ? -18.703 32.259  -28.385 1.00 12.34 ? 149 THR B HA   1  
ATOM 4642   H HB   . THR B 1 149 ? -19.931 31.426  -31.058 1.00 32.22 ? 149 THR B HB   1  
ATOM 4643   H HG1  . THR B 1 149 ? -18.163 30.339  -31.313 1.00 40.04 ? 149 THR B HG1  1  
ATOM 4644   H HG21 . THR B 1 149 ? -18.637 33.284  -32.029 1.00 71.02 ? 149 THR B HG21 1  
ATOM 4645   H HG22 . THR B 1 149 ? -18.056 33.738  -30.427 1.00 62.44 ? 149 THR B HG22 1  
ATOM 4646   H HG23 . THR B 1 149 ? -19.770 33.894  -30.819 1.00 33.45 ? 149 THR B HG23 1  
ATOM 4647   N N    . GLU B 1 150 ? -20.886 33.370  -27.674 1.00 4.34  ? 150 GLU B N    1  
ATOM 4648   C CA   . GLU B 1 150 ? -22.095 34.151  -27.330 1.00 2.12  ? 150 GLU B CA   1  
ATOM 4649   C C    . GLU B 1 150 ? -21.723 35.608  -27.028 1.00 63.13 ? 150 GLU B C    1  
ATOM 4650   O O    . GLU B 1 150 ? -20.538 35.963  -26.975 1.00 1.42  ? 150 GLU B O    1  
ATOM 4651   C CB   . GLU B 1 150 ? -22.870 33.464  -26.154 1.00 64.43 ? 150 GLU B CB   1  
ATOM 4652   C CG   . GLU B 1 150 ? -22.118 33.315  -24.802 1.00 4.52  ? 150 GLU B CG   1  
ATOM 4653   C CD   . GLU B 1 150 ? -22.139 34.587  -23.925 1.00 4.24  ? 150 GLU B CD   1  
ATOM 4654   O OE1  . GLU B 1 150 ? -23.227 34.941  -23.421 1.00 72.34 ? 150 GLU B OE1  1  
ATOM 4655   O OE2  . GLU B 1 150 ? -21.086 35.235  -23.747 1.00 13.30 ? 150 GLU B OE2  1  
ATOM 4656   H H    . GLU B 1 150 ? -20.081 33.487  -27.124 1.00 14.00 ? 150 GLU B H    1  
ATOM 4657   H HA   . GLU B 1 150 ? -22.745 34.161  -28.205 1.00 40.30 ? 150 GLU B HA   1  
ATOM 4658   H HB2  . GLU B 1 150 ? -23.779 34.027  -25.966 1.00 74.30 ? 150 GLU B HB2  1  
ATOM 4659   H HB3  . GLU B 1 150 ? -23.159 32.469  -26.485 1.00 45.13 ? 150 GLU B HB3  1  
ATOM 4660   H HG2  . GLU B 1 150 ? -22.579 32.510  -24.240 1.00 55.22 ? 150 GLU B HG2  1  
ATOM 4661   H HG3  . GLU B 1 150 ? -21.090 33.040  -25.011 1.00 4.24  ? 150 GLU B HG3  1  
ATOM 4662   N N    . GLU B 1 151 ? -22.750 36.440  -26.832 1.00 14.44 ? 151 GLU B N    1  
ATOM 4663   C CA   . GLU B 1 151 ? -22.590 37.872  -26.565 1.00 33.14 ? 151 GLU B CA   1  
ATOM 4664   C C    . GLU B 1 151 ? -23.465 38.262  -25.361 1.00 43.35 ? 151 GLU B C    1  
ATOM 4665   O O    . GLU B 1 151 ? -24.635 38.650  -25.503 1.00 23.15 ? 151 GLU B O    1  
ATOM 4666   C CB   . GLU B 1 151 ? -22.912 38.702  -27.849 1.00 40.51 ? 151 GLU B CB   1  
ATOM 4667   C CG   . GLU B 1 151 ? -24.272 38.377  -28.511 1.00 42.54 ? 151 GLU B CG   1  
ATOM 4668   C CD   . GLU B 1 151 ? -24.570 39.197  -29.771 1.00 3.05  ? 151 GLU B CD   1  
ATOM 4669   O OE1  . GLU B 1 151 ? -24.806 38.606  -30.847 1.00 11.12 ? 151 GLU B OE1  1  
ATOM 4670   O OE2  . GLU B 1 151 ? -24.569 40.432  -29.694 1.00 42.14 ? 151 GLU B OE2  1  
ATOM 4671   H H    . GLU B 1 151 ? -23.658 36.073  -26.858 1.00 1.24  ? 151 GLU B H    1  
ATOM 4672   H HA   . GLU B 1 151 ? -21.548 38.052  -26.285 1.00 2.53  ? 151 GLU B HA   1  
ATOM 4673   H HB2  . GLU B 1 151 ? -22.900 39.757  -27.594 1.00 65.25 ? 151 GLU B HB2  1  
ATOM 4674   H HB3  . GLU B 1 151 ? -22.130 38.517  -28.575 1.00 33.45 ? 151 GLU B HB3  1  
ATOM 4675   H HG2  . GLU B 1 151 ? -24.279 37.322  -28.764 1.00 12.31 ? 151 GLU B HG2  1  
ATOM 4676   H HG3  . GLU B 1 151 ? -25.062 38.560  -27.787 1.00 53.14 ? 151 GLU B HG3  1  
ATOM 4677   N N    . HIS B 1 152 ? -22.907 38.069  -24.157 1.00 33.31 ? 152 HIS B N    1  
ATOM 4678   C CA   . HIS B 1 152 ? -23.550 38.484  -22.908 1.00 14.00 ? 152 HIS B CA   1  
ATOM 4679   C C    . HIS B 1 152 ? -23.588 40.021  -22.828 1.00 32.13 ? 152 HIS B C    1  
ATOM 4680   O O    . HIS B 1 152 ? -24.641 40.604  -22.549 1.00 54.10 ? 152 HIS B O    1  
ATOM 4681   C CB   . HIS B 1 152 ? -22.801 37.876  -21.691 1.00 54.11 ? 152 HIS B CB   1  
ATOM 4682   C CG   . HIS B 1 152 ? -23.465 38.112  -20.367 1.00 34.44 ? 152 HIS B CG   1  
ATOM 4683   N ND1  . HIS B 1 152 ? -22.791 38.531  -19.246 1.00 14.25 ? 152 HIS B ND1  1  
ATOM 4684   C CD2  . HIS B 1 152 ? -24.755 37.958  -19.989 1.00 71.13 ? 152 HIS B CD2  1  
ATOM 4685   C CE1  . HIS B 1 152 ? -23.629 38.617  -18.238 1.00 33.11 ? 152 HIS B CE1  1  
ATOM 4686   N NE2  . HIS B 1 152 ? -24.829 38.278  -18.661 1.00 34.43 ? 152 HIS B NE2  1  
ATOM 4687   H H    . HIS B 1 152 ? -22.040 37.613  -24.112 1.00 64.32 ? 152 HIS B H    1  
ATOM 4688   H HA   . HIS B 1 152 ? -24.573 38.106  -22.919 1.00 75.42 ? 152 HIS B HA   1  
ATOM 4689   H HB2  . HIS B 1 152 ? -22.725 36.800  -21.822 1.00 10.22 ? 152 HIS B HB2  1  
ATOM 4690   H HB3  . HIS B 1 152 ? -21.798 38.288  -21.645 1.00 53.42 ? 152 HIS B HB3  1  
ATOM 4691   H HD1  . HIS B 1 152 ? -21.829 38.723  -19.193 1.00 63.11 ? 152 HIS B HD1  1  
ATOM 4692   H HD2  . HIS B 1 152 ? -25.572 37.628  -20.615 1.00 41.03 ? 152 HIS B HD2  1  
ATOM 4693   H HE1  . HIS B 1 152 ? -23.374 38.908  -17.231 1.00 23.41 ? 152 HIS B HE1  1  
ATOM 4694   H HE2  . HIS B 1 152 ? -25.662 38.427  -18.163 1.00 37.65 ? 152 HIS B HE2  1  
ATOM 4695   N N    . GLN B 1 153 ? -22.429 40.645  -23.140 1.00 45.14 ? 153 GLN B N    1  
ATOM 4696   C CA   . GLN B 1 153 ? -22.219 42.107  -23.112 1.00 53.00 ? 153 GLN B CA   1  
ATOM 4697   C C    . GLN B 1 153 ? -22.681 42.728  -21.774 1.00 60.14 ? 153 GLN B C    1  
ATOM 4698   O O    . GLN B 1 153 ? -23.802 43.228  -21.635 1.00 61.23 ? 153 GLN B O    1  
ATOM 4699   C CB   . GLN B 1 153 ? -22.853 42.805  -24.356 1.00 41.02 ? 153 GLN B CB   1  
ATOM 4700   C CG   . GLN B 1 153 ? -22.659 44.346  -24.418 1.00 40.50 ? 153 GLN B CG   1  
ATOM 4701   C CD   . GLN B 1 153 ? -21.192 44.803  -24.360 1.00 14.12 ? 153 GLN B CD   1  
ATOM 4702   O OE1  . GLN B 1 153 ? -20.280 44.121  -24.839 1.00 22.33 ? 153 GLN B OE1  1  
ATOM 4703   N NE2  . GLN B 1 153 ? -20.951 45.962  -23.762 1.00 23.11 ? 153 GLN B NE2  1  
ATOM 4704   H H    . GLN B 1 153 ? -21.672 40.082  -23.414 1.00 62.14 ? 153 GLN B H    1  
ATOM 4705   H HA   . GLN B 1 153 ? -21.143 42.246  -23.173 1.00 40.53 ? 153 GLN B HA   1  
ATOM 4706   H HB2  . GLN B 1 153 ? -22.416 42.376  -25.249 1.00 31.32 ? 153 GLN B HB2  1  
ATOM 4707   H HB3  . GLN B 1 153 ? -23.921 42.594  -24.365 1.00 53.21 ? 153 GLN B HB3  1  
ATOM 4708   H HG2  . GLN B 1 153 ? -23.086 44.714  -25.343 1.00 11.02 ? 153 GLN B HG2  1  
ATOM 4709   H HG3  . GLN B 1 153 ? -23.196 44.790  -23.585 1.00 25.11 ? 153 GLN B HG3  1  
ATOM 4710   H HE21 . GLN B 1 153 ? -21.712 46.464  -23.394 1.00 64.53 ? 153 GLN B HE21 1  
ATOM 4711   H HE22 . GLN B 1 153 ? -20.022 46.261  -23.700 1.00 71.24 ? 153 GLN B HE22 1  
ATOM 4712   N N    . ASP B 1 154 ? -21.811 42.600  -20.779 1.00 2.23  ? 154 ASP B N    1  
ATOM 4713   C CA   . ASP B 1 154 ? -22.006 43.151  -19.432 1.00 12.04 ? 154 ASP B CA   1  
ATOM 4714   C C    . ASP B 1 154 ? -21.049 44.338  -19.240 1.00 43.25 ? 154 ASP B C    1  
ATOM 4715   O O    . ASP B 1 154 ? -19.830 44.165  -19.180 1.00 14.33 ? 154 ASP B O    1  
ATOM 4716   C CB   . ASP B 1 154 ? -21.784 42.041  -18.362 1.00 44.32 ? 154 ASP B CB   1  
ATOM 4717   C CG   . ASP B 1 154 ? -20.484 41.233  -18.562 1.00 13.50 ? 154 ASP B CG   1  
ATOM 4718   O OD1  . ASP B 1 154 ? -19.485 41.497  -17.867 1.00 34.41 ? 154 ASP B OD1  1  
ATOM 4719   O OD2  . ASP B 1 154 ? -20.461 40.343  -19.441 1.00 14.15 ? 154 ASP B OD2  1  
ATOM 4720   H H    . ASP B 1 154 ? -20.980 42.109  -20.959 1.00 42.55 ? 154 ASP B H    1  
ATOM 4721   H HA   . ASP B 1 154 ? -23.034 43.513  -19.349 1.00 44.15 ? 154 ASP B HA   1  
ATOM 4722   H HB2  . ASP B 1 154 ? -21.766 42.498  -17.379 1.00 34.30 ? 154 ASP B HB2  1  
ATOM 4723   H HB3  . ASP B 1 154 ? -22.622 41.349  -18.398 1.00 73.03 ? 154 ASP B HB3  1  
ATOM 4724   N N    . ALA B 1 155 ? -21.615 45.555  -19.198 1.00 54.35 ? 155 ALA B N    1  
ATOM 4725   C CA   . ALA B 1 155 ? -20.849 46.803  -19.064 1.00 1.25  ? 155 ALA B CA   1  
ATOM 4726   C C    . ALA B 1 155 ? -21.685 47.827  -18.266 1.00 14.45 ? 155 ALA B C    1  
ATOM 4727   O O    . ALA B 1 155 ? -21.454 47.979  -17.055 1.00 53.25 ? 155 ALA B O    1  
ATOM 4728   C CB   . ALA B 1 155 ? -20.453 47.349  -20.452 1.00 63.14 ? 155 ALA B CB   1  
ATOM 4729   O OXT  . ALA B 1 155 ? -22.606 48.435  -18.842 1.00 37.65 ? 155 ALA B OXT  1  
ATOM 4730   H H    . ALA B 1 155 ? -22.594 45.615  -19.248 1.00 1.21  ? 155 ALA B H    1  
ATOM 4731   H HA   . ALA B 1 155 ? -19.929 46.583  -18.513 1.00 63.32 ? 155 ALA B HA   1  
ATOM 4732   H HB1  . ALA B 1 155 ? -19.864 48.251  -20.334 1.00 10.24 ? 155 ALA B HB1  1  
ATOM 4733   H HB2  . ALA B 1 155 ? -21.344 47.580  -21.021 1.00 73.21 ? 155 ALA B HB2  1  
ATOM 4734   H HB3  . ALA B 1 155 ? -19.872 46.610  -20.985 1.00 44.02 ? 155 ALA B HB3  1  
ATOM 4735   N N    . MET C 1 1   ? 20.470  -40.497 18.349  1.00 73.21 ? 1   MET C N    1  
ATOM 4736   C CA   . MET C 1 1   ? 20.053  -41.222 19.580  1.00 14.13 ? 1   MET C CA   1  
ATOM 4737   C C    . MET C 1 1   ? 20.443  -40.425 20.839  1.00 64.23 ? 1   MET C C    1  
ATOM 4738   O O    . MET C 1 1   ? 20.520  -40.979 21.945  1.00 51.42 ? 1   MET C O    1  
ATOM 4739   C CB   . MET C 1 1   ? 20.681  -42.645 19.589  1.00 72.52 ? 1   MET C CB   1  
ATOM 4740   C CG   . MET C 1 1   ? 20.227  -43.540 18.426  1.00 60.24 ? 1   MET C CG   1  
ATOM 4741   S SD   . MET C 1 1   ? 20.922  -45.207 18.504  1.00 22.01 ? 1   MET C SD   1  
ATOM 4742   C CE   . MET C 1 1   ? 20.075  -45.995 17.133  1.00 5.53  ? 1   MET C CE   1  
ATOM 4743   H H1   . MET C 1 1   ? 20.207  -41.038 17.504  1.00 37.65 ? 1   MET C H1   1  
ATOM 4744   H H2   . MET C 1 1   ? 21.498  -40.353 18.348  1.00 37.65 ? 1   MET C H2   1  
ATOM 4745   H H3   . MET C 1 1   ? 20.006  -39.568 18.308  1.00 37.65 ? 1   MET C H3   1  
ATOM 4746   H HA   . MET C 1 1   ? 18.973  -41.308 19.558  1.00 72.14 ? 1   MET C HA   1  
ATOM 4747   H HB2  . MET C 1 1   ? 21.759  -42.553 19.545  1.00 1.42  ? 1   MET C HB2  1  
ATOM 4748   H HB3  . MET C 1 1   ? 20.414  -43.141 20.517  1.00 52.31 ? 1   MET C HB3  1  
ATOM 4749   H HG2  . MET C 1 1   ? 19.148  -43.621 18.446  1.00 73.33 ? 1   MET C HG2  1  
ATOM 4750   H HG3  . MET C 1 1   ? 20.532  -43.084 17.490  1.00 44.52 ? 1   MET C HG3  1  
ATOM 4751   H HE1  . MET C 1 1   ? 20.396  -47.023 17.055  1.00 61.10 ? 1   MET C HE1  1  
ATOM 4752   H HE2  . MET C 1 1   ? 20.308  -45.476 16.214  1.00 5.13  ? 1   MET C HE2  1  
ATOM 4753   H HE3  . MET C 1 1   ? 19.008  -45.965 17.302  1.00 2.10  ? 1   MET C HE3  1  
ATOM 4754   N N    . SER C 1 2   ? 20.650  -39.111 20.660  1.00 1.25  ? 2   SER C N    1  
ATOM 4755   C CA   . SER C 1 2   ? 21.046  -38.189 21.736  1.00 73.10 ? 2   SER C CA   1  
ATOM 4756   C C    . SER C 1 2   ? 20.413  -36.806 21.483  1.00 74.14 ? 2   SER C C    1  
ATOM 4757   O O    . SER C 1 2   ? 20.170  -36.424 20.329  1.00 21.23 ? 2   SER C O    1  
ATOM 4758   C CB   . SER C 1 2   ? 22.589  -38.082 21.797  1.00 55.31 ? 2   SER C CB   1  
ATOM 4759   O OG   . SER C 1 2   ? 23.196  -39.354 21.980  1.00 12.31 ? 2   SER C OG   1  
ATOM 4760   H H    . SER C 1 2   ? 20.522  -38.734 19.765  1.00 24.03 ? 2   SER C H    1  
ATOM 4761   H HA   . SER C 1 2   ? 20.674  -38.579 22.684  1.00 42.05 ? 2   SER C HA   1  
ATOM 4762   H HB2  . SER C 1 2   ? 22.965  -37.658 20.876  1.00 74.04 ? 2   SER C HB2  1  
ATOM 4763   H HB3  . SER C 1 2   ? 22.876  -37.447 22.625  1.00 73.24 ? 2   SER C HB3  1  
ATOM 4764   H HG   . SER C 1 2   ? 22.744  -39.829 22.687  1.00 75.34 ? 2   SER C HG   1  
ATOM 4765   N N    . GLU C 1 3   ? 20.139  -36.074 22.572  1.00 11.05 ? 3   GLU C N    1  
ATOM 4766   C CA   . GLU C 1 3   ? 19.536  -34.729 22.523  1.00 72.42 ? 3   GLU C CA   1  
ATOM 4767   C C    . GLU C 1 3   ? 20.629  -33.697 22.154  1.00 40.43 ? 3   GLU C C    1  
ATOM 4768   O O    . GLU C 1 3   ? 21.297  -33.150 23.035  1.00 64.34 ? 3   GLU C O    1  
ATOM 4769   C CB   . GLU C 1 3   ? 18.890  -34.409 23.903  1.00 71.15 ? 3   GLU C CB   1  
ATOM 4770   C CG   . GLU C 1 3   ? 17.879  -35.470 24.390  1.00 41.10 ? 3   GLU C CG   1  
ATOM 4771   C CD   . GLU C 1 3   ? 17.402  -35.235 25.833  1.00 71.54 ? 3   GLU C CD   1  
ATOM 4772   O OE1  . GLU C 1 3   ? 18.104  -35.666 26.777  1.00 1.32  ? 3   GLU C OE1  1  
ATOM 4773   O OE2  . GLU C 1 3   ? 16.330  -34.626 26.036  1.00 14.35 ? 3   GLU C OE2  1  
ATOM 4774   H H    . GLU C 1 3   ? 20.363  -36.451 23.453  1.00 1.33  ? 3   GLU C H    1  
ATOM 4775   H HA   . GLU C 1 3   ? 18.763  -34.725 21.755  1.00 60.24 ? 3   GLU C HA   1  
ATOM 4776   H HB2  . GLU C 1 3   ? 19.678  -34.324 24.645  1.00 71.24 ? 3   GLU C HB2  1  
ATOM 4777   H HB3  . GLU C 1 3   ? 18.375  -33.456 23.836  1.00 34.34 ? 3   GLU C HB3  1  
ATOM 4778   H HG2  . GLU C 1 3   ? 17.020  -35.466 23.725  1.00 13.31 ? 3   GLU C HG2  1  
ATOM 4779   H HG3  . GLU C 1 3   ? 18.350  -36.449 24.333  1.00 14.22 ? 3   GLU C HG3  1  
ATOM 4780   N N    . GLN C 1 4   ? 20.825  -33.475 20.836  1.00 72.14 ? 4   GLN C N    1  
ATOM 4781   C CA   . GLN C 1 4   ? 21.937  -32.661 20.296  1.00 71.54 ? 4   GLN C CA   1  
ATOM 4782   C C    . GLN C 1 4   ? 21.486  -31.208 20.020  1.00 62.54 ? 4   GLN C C    1  
ATOM 4783   O O    . GLN C 1 4   ? 20.719  -30.965 19.081  1.00 30.45 ? 4   GLN C O    1  
ATOM 4784   C CB   . GLN C 1 4   ? 22.494  -33.320 18.996  1.00 72.25 ? 4   GLN C CB   1  
ATOM 4785   C CG   . GLN C 1 4   ? 23.008  -34.765 19.182  1.00 65.53 ? 4   GLN C CG   1  
ATOM 4786   C CD   . GLN C 1 4   ? 24.134  -34.874 20.212  1.00 21.13 ? 4   GLN C CD   1  
ATOM 4787   O OE1  . GLN C 1 4   ? 23.901  -35.095 21.404  1.00 3.34  ? 4   GLN C OE1  1  
ATOM 4788   N NE2  . GLN C 1 4   ? 25.360  -34.694 19.762  1.00 62.13 ? 4   GLN C NE2  1  
ATOM 4789   H H    . GLN C 1 4   ? 20.192  -33.869 20.202  1.00 42.31 ? 4   GLN C H    1  
ATOM 4790   H HA   . GLN C 1 4   ? 22.734  -32.646 21.038  1.00 32.31 ? 4   GLN C HA   1  
ATOM 4791   H HB2  . GLN C 1 4   ? 21.706  -33.337 18.250  1.00 54.00 ? 4   GLN C HB2  1  
ATOM 4792   H HB3  . GLN C 1 4   ? 23.314  -32.717 18.612  1.00 14.51 ? 4   GLN C HB3  1  
ATOM 4793   H HG2  . GLN C 1 4   ? 22.183  -35.391 19.508  1.00 20.30 ? 4   GLN C HG2  1  
ATOM 4794   H HG3  . GLN C 1 4   ? 23.370  -35.137 18.230  1.00 52.04 ? 4   GLN C HG3  1  
ATOM 4795   H HE21 . GLN C 1 4   ? 25.480  -34.500 18.808  1.00 71.14 ? 4   GLN C HE21 1  
ATOM 4796   H HE22 . GLN C 1 4   ? 26.100  -34.760 20.398  1.00 73.11 ? 4   GLN C HE22 1  
ATOM 4797   N N    . ASN C 1 5   ? 21.971  -30.282 20.873  1.00 62.41 ? 5   ASN C N    1  
ATOM 4798   C CA   . ASN C 1 5   ? 21.778  -28.820 20.752  1.00 41.12 ? 5   ASN C CA   1  
ATOM 4799   C C    . ASN C 1 5   ? 20.279  -28.424 20.717  1.00 60.13 ? 5   ASN C C    1  
ATOM 4800   O O    . ASN C 1 5   ? 19.646  -28.410 19.654  1.00 53.44 ? 5   ASN C O    1  
ATOM 4801   C CB   . ASN C 1 5   ? 22.572  -28.251 19.538  1.00 41.23 ? 5   ASN C CB   1  
ATOM 4802   C CG   . ASN C 1 5   ? 22.460  -26.726 19.393  1.00 53.14 ? 5   ASN C CG   1  
ATOM 4803   O OD1  . ASN C 1 5   ? 23.221  -25.968 19.996  1.00 53.42 ? 5   ASN C OD1  1  
ATOM 4804   N ND2  . ASN C 1 5   ? 21.524  -26.269 18.585  1.00 75.33 ? 5   ASN C ND2  1  
ATOM 4805   H H    . ASN C 1 5   ? 22.501  -30.604 21.634  1.00 53.53 ? 5   ASN C H    1  
ATOM 4806   H HA   . ASN C 1 5   ? 22.209  -28.397 21.654  1.00 1.44  ? 5   ASN C HA   1  
ATOM 4807   H HB2  . ASN C 1 5   ? 23.619  -28.504 19.658  1.00 60.55 ? 5   ASN C HB2  1  
ATOM 4808   H HB3  . ASN C 1 5   ? 22.209  -28.717 18.627  1.00 32.11 ? 5   ASN C HB3  1  
ATOM 4809   H HD21 . ASN C 1 5   ? 20.960  -26.924 18.122  1.00 30.13 ? 5   ASN C HD21 1  
ATOM 4810   H HD22 . ASN C 1 5   ? 21.423  -25.300 18.490  1.00 23.21 ? 5   ASN C HD22 1  
ATOM 4811   N N    . ASN C 1 6   ? 19.731  -28.125 21.907  1.00 43.44 ? 6   ASN C N    1  
ATOM 4812   C CA   . ASN C 1 6   ? 18.321  -27.705 22.090  1.00 4.51  ? 6   ASN C CA   1  
ATOM 4813   C C    . ASN C 1 6   ? 18.026  -26.354 21.402  1.00 43.21 ? 6   ASN C C    1  
ATOM 4814   O O    . ASN C 1 6   ? 16.935  -26.144 20.855  1.00 32.21 ? 6   ASN C O    1  
ATOM 4815   C CB   . ASN C 1 6   ? 17.982  -27.596 23.609  1.00 23.43 ? 6   ASN C CB   1  
ATOM 4816   C CG   . ASN C 1 6   ? 18.810  -26.525 24.350  1.00 42.10 ? 6   ASN C CG   1  
ATOM 4817   O OD1  . ASN C 1 6   ? 20.005  -26.353 24.099  1.00 12.31 ? 6   ASN C OD1  1  
ATOM 4818   N ND2  . ASN C 1 6   ? 18.177  -25.761 25.229  1.00 11.11 ? 6   ASN C ND2  1  
ATOM 4819   H H    . ASN C 1 6   ? 20.300  -28.192 22.703  1.00 0.40  ? 6   ASN C H    1  
ATOM 4820   H HA   . ASN C 1 6   ? 17.691  -28.468 21.649  1.00 60.21 ? 6   ASN C HA   1  
ATOM 4821   H HB2  . ASN C 1 6   ? 16.928  -27.363 23.719  1.00 44.45 ? 6   ASN C HB2  1  
ATOM 4822   H HB3  . ASN C 1 6   ? 18.173  -28.553 24.080  1.00 3.04  ? 6   ASN C HB3  1  
ATOM 4823   H HD21 . ASN C 1 6   ? 17.216  -25.904 25.362  1.00 2.24  ? 6   ASN C HD21 1  
ATOM 4824   H HD22 . ASN C 1 6   ? 18.697  -25.080 25.702  1.00 4.14  ? 6   ASN C HD22 1  
ATOM 4825   N N    . THR C 1 7   ? 19.020  -25.453 21.434  1.00 43.24 ? 7   THR C N    1  
ATOM 4826   C CA   . THR C 1 7   ? 18.861  -24.058 21.006  1.00 11.32 ? 7   THR C CA   1  
ATOM 4827   C C    . THR C 1 7   ? 19.050  -23.928 19.477  1.00 73.52 ? 7   THR C C    1  
ATOM 4828   O O    . THR C 1 7   ? 20.145  -23.620 18.981  1.00 1.25  ? 7   THR C O    1  
ATOM 4829   C CB   . THR C 1 7   ? 19.843  -23.129 21.801  1.00 11.44 ? 7   THR C CB   1  
ATOM 4830   O OG1  . THR C 1 7   ? 19.695  -23.381 23.209  1.00 75.32 ? 7   THR C OG1  1  
ATOM 4831   C CG2  . THR C 1 7   ? 19.597  -21.627 21.528  1.00 63.10 ? 7   THR C CG2  1  
ATOM 4832   H H    . THR C 1 7   ? 19.897  -25.742 21.757  1.00 74.12 ? 7   THR C H    1  
ATOM 4833   H HA   . THR C 1 7   ? 17.847  -23.749 21.253  1.00 11.02 ? 7   THR C HA   1  
ATOM 4834   H HB   . THR C 1 7   ? 20.859  -23.377 21.515  1.00 63.13 ? 7   THR C HB   1  
ATOM 4835   H HG1  . THR C 1 7   ? 20.072  -24.242 23.425  1.00 23.20 ? 7   THR C HG1  1  
ATOM 4836   H HG21 . THR C 1 7   ? 20.289  -21.032 22.111  1.00 33.04 ? 7   THR C HG21 1  
ATOM 4837   H HG22 . THR C 1 7   ? 18.584  -21.363 21.803  1.00 53.13 ? 7   THR C HG22 1  
ATOM 4838   H HG23 . THR C 1 7   ? 19.747  -21.416 20.476  1.00 72.41 ? 7   THR C HG23 1  
ATOM 4839   N N    . GLU C 1 8   ? 17.979  -24.274 18.741  1.00 3.14  ? 8   GLU C N    1  
ATOM 4840   C CA   . GLU C 1 8   ? 17.865  -24.057 17.282  1.00 23.34 ? 8   GLU C CA   1  
ATOM 4841   C C    . GLU C 1 8   ? 16.671  -23.127 16.991  1.00 2.13  ? 8   GLU C C    1  
ATOM 4842   O O    . GLU C 1 8   ? 16.709  -22.352 16.024  1.00 63.21 ? 8   GLU C O    1  
ATOM 4843   C CB   . GLU C 1 8   ? 17.693  -25.409 16.532  1.00 14.54 ? 8   GLU C CB   1  
ATOM 4844   C CG   . GLU C 1 8   ? 18.865  -26.400 16.719  1.00 24.22 ? 8   GLU C CG   1  
ATOM 4845   C CD   . GLU C 1 8   ? 18.738  -27.690 15.888  1.00 55.11 ? 8   GLU C CD   1  
ATOM 4846   O OE1  . GLU C 1 8   ? 18.000  -28.603 16.307  1.00 3.20  ? 8   GLU C OE1  1  
ATOM 4847   O OE2  . GLU C 1 8   ? 19.365  -27.790 14.810  1.00 42.21 ? 8   GLU C OE2  1  
ATOM 4848   H H    . GLU C 1 8   ? 17.233  -24.712 19.196  1.00 54.30 ? 8   GLU C H    1  
ATOM 4849   H HA   . GLU C 1 8   ? 18.777  -23.568 16.928  1.00 2.53  ? 8   GLU C HA   1  
ATOM 4850   H HB2  . GLU C 1 8   ? 16.784  -25.887 16.883  1.00 31.44 ? 8   GLU C HB2  1  
ATOM 4851   H HB3  . GLU C 1 8   ? 17.586  -25.209 15.470  1.00 23.13 ? 8   GLU C HB3  1  
ATOM 4852   H HG2  . GLU C 1 8   ? 19.789  -25.898 16.447  1.00 64.13 ? 8   GLU C HG2  1  
ATOM 4853   H HG3  . GLU C 1 8   ? 18.925  -26.668 17.771  1.00 73.21 ? 8   GLU C HG3  1  
ATOM 4854   N N    . MET C 1 9   ? 15.630  -23.232 17.860  1.00 0.03  ? 9   MET C N    1  
ATOM 4855   C CA   . MET C 1 9   ? 14.374  -22.451 17.788  1.00 51.41 ? 9   MET C CA   1  
ATOM 4856   C C    . MET C 1 9   ? 13.568  -22.768 16.504  1.00 23.00 ? 9   MET C C    1  
ATOM 4857   O O    . MET C 1 9   ? 13.983  -22.434 15.385  1.00 3.53  ? 9   MET C O    1  
ATOM 4858   C CB   . MET C 1 9   ? 14.654  -20.916 17.917  1.00 30.32 ? 9   MET C CB   1  
ATOM 4859   C CG   . MET C 1 9   ? 13.426  -20.007 17.732  1.00 70.55 ? 9   MET C CG   1  
ATOM 4860   S SD   . MET C 1 9   ? 13.804  -18.268 18.068  1.00 73.04 ? 9   MET C SD   1  
ATOM 4861   C CE   . MET C 1 9   ? 12.194  -17.491 17.904  1.00 74.40 ? 9   MET C CE   1  
ATOM 4862   H H    . MET C 1 9   ? 15.713  -23.883 18.587  1.00 0.11  ? 9   MET C H    1  
ATOM 4863   H HA   . MET C 1 9   ? 13.780  -22.760 18.643  1.00 32.42 ? 9   MET C HA   1  
ATOM 4864   H HB2  . MET C 1 9   ? 15.062  -20.725 18.903  1.00 74.25 ? 9   MET C HB2  1  
ATOM 4865   H HB3  . MET C 1 9   ? 15.401  -20.632 17.180  1.00 34.25 ? 9   MET C HB3  1  
ATOM 4866   H HG2  . MET C 1 9   ? 13.076  -20.092 16.710  1.00 22.42 ? 9   MET C HG2  1  
ATOM 4867   H HG3  . MET C 1 9   ? 12.642  -20.329 18.407  1.00 73.13 ? 9   MET C HG3  1  
ATOM 4868   H HE1  . MET C 1 9   ? 12.289  -16.430 18.082  1.00 74.02 ? 9   MET C HE1  1  
ATOM 4869   H HE2  . MET C 1 9   ? 11.513  -17.917 18.626  1.00 30.15 ? 9   MET C HE2  1  
ATOM 4870   H HE3  . MET C 1 9   ? 11.811  -17.656 16.907  1.00 61.12 ? 9   MET C HE3  1  
ATOM 4871   N N    . THR C 1 10  ? 12.398  -23.400 16.682  1.00 25.14 ? 10  THR C N    1  
ATOM 4872   C CA   . THR C 1 10  ? 11.457  -23.672 15.593  1.00 51.11 ? 10  THR C CA   1  
ATOM 4873   C C    . THR C 1 10  ? 10.522  -22.467 15.442  1.00 72.42 ? 10  THR C C    1  
ATOM 4874   O O    . THR C 1 10  ? 9.525   -22.369 16.143  1.00 63.14 ? 10  THR C O    1  
ATOM 4875   C CB   . THR C 1 10  ? 10.633  -24.979 15.867  1.00 55.04 ? 10  THR C CB   1  
ATOM 4876   O OG1  . THR C 1 10  ? 11.529  -26.071 16.130  1.00 42.41 ? 10  THR C OG1  1  
ATOM 4877   C CG2  . THR C 1 10  ? 9.715   -25.344 14.682  1.00 53.52 ? 10  THR C CG2  1  
ATOM 4878   H H    . THR C 1 10  ? 12.161  -23.697 17.581  1.00 20.23 ? 10  THR C H    1  
ATOM 4879   H HA   . THR C 1 10  ? 12.019  -23.808 14.669  1.00 23.11 ? 10  THR C HA   1  
ATOM 4880   H HB   . THR C 1 10  ? 10.016  -24.827 16.751  1.00 25.33 ? 10  THR C HB   1  
ATOM 4881   H HG1  . THR C 1 10  ? 12.365  -25.915 15.675  1.00 32.15 ? 10  THR C HG1  1  
ATOM 4882   H HG21 . THR C 1 10  ? 9.017   -24.536 14.494  1.00 14.34 ? 10  THR C HG21 1  
ATOM 4883   H HG22 . THR C 1 10  ? 9.161   -26.242 14.916  1.00 34.55 ? 10  THR C HG22 1  
ATOM 4884   H HG23 . THR C 1 10  ? 10.312  -25.514 13.795  1.00 31.24 ? 10  THR C HG23 1  
ATOM 4885   N N    . PHE C 1 11  ? 10.903  -21.512 14.585  1.00 75.53 ? 11  PHE C N    1  
ATOM 4886   C CA   . PHE C 1 11  ? 10.072  -20.335 14.278  1.00 21.04 ? 11  PHE C CA   1  
ATOM 4887   C C    . PHE C 1 11  ? 9.669   -20.387 12.802  1.00 64.42 ? 11  PHE C C    1  
ATOM 4888   O O    . PHE C 1 11  ? 10.529  -20.497 11.922  1.00 41.31 ? 11  PHE C O    1  
ATOM 4889   C CB   . PHE C 1 11  ? 10.835  -19.020 14.582  1.00 42.11 ? 11  PHE C CB   1  
ATOM 4890   C CG   . PHE C 1 11  ? 9.981   -17.750 14.442  1.00 42.10 ? 11  PHE C CG   1  
ATOM 4891   C CD1  . PHE C 1 11  ? 9.228   -17.276 15.520  1.00 64.42 ? 11  PHE C CD1  1  
ATOM 4892   C CD2  . PHE C 1 11  ? 9.941   -17.025 13.244  1.00 34.33 ? 11  PHE C CD2  1  
ATOM 4893   C CE1  . PHE C 1 11  ? 8.476   -16.126 15.403  1.00 51.24 ? 11  PHE C CE1  1  
ATOM 4894   C CE2  . PHE C 1 11  ? 9.182   -15.877 13.128  1.00 64.40 ? 11  PHE C CE2  1  
ATOM 4895   C CZ   . PHE C 1 11  ? 8.453   -15.427 14.209  1.00 64.33 ? 11  PHE C CZ   1  
ATOM 4896   H H    . PHE C 1 11  ? 11.773  -21.598 14.142  1.00 13.33 ? 11  PHE C H    1  
ATOM 4897   H HA   . PHE C 1 11  ? 9.171   -20.371 14.894  1.00 73.42 ? 11  PHE C HA   1  
ATOM 4898   H HB2  . PHE C 1 11  ? 11.209  -19.059 15.600  1.00 1.33  ? 11  PHE C HB2  1  
ATOM 4899   H HB3  . PHE C 1 11  ? 11.684  -18.932 13.912  1.00 65.35 ? 11  PHE C HB3  1  
ATOM 4900   H HD1  . PHE C 1 11  ? 9.241   -17.816 16.460  1.00 12.30 ? 11  PHE C HD1  1  
ATOM 4901   H HD2  . PHE C 1 11  ? 10.511  -17.379 12.394  1.00 63.44 ? 11  PHE C HD2  1  
ATOM 4902   H HE1  . PHE C 1 11  ? 7.895   -15.770 16.248  1.00 25.02 ? 11  PHE C HE1  1  
ATOM 4903   H HE2  . PHE C 1 11  ? 9.160   -15.328 12.190  1.00 32.11 ? 11  PHE C HE2  1  
ATOM 4904   H HZ   . PHE C 1 11  ? 7.858   -14.524 14.122  1.00 2.24  ? 11  PHE C HZ   1  
ATOM 4905   N N    . GLN C 1 12  ? 8.363   -20.295 12.549  1.00 63.11 ? 12  GLN C N    1  
ATOM 4906   C CA   . GLN C 1 12  ? 7.805   -20.247 11.198  1.00 52.34 ? 12  GLN C CA   1  
ATOM 4907   C C    . GLN C 1 12  ? 6.648   -19.248 11.176  1.00 31.24 ? 12  GLN C C    1  
ATOM 4908   O O    . GLN C 1 12  ? 5.713   -19.358 11.988  1.00 22.51 ? 12  GLN C O    1  
ATOM 4909   C CB   . GLN C 1 12  ? 7.308   -21.652 10.763  1.00 71.14 ? 12  GLN C CB   1  
ATOM 4910   C CG   . GLN C 1 12  ? 6.671   -21.699 9.354   1.00 54.04 ? 12  GLN C CG   1  
ATOM 4911   C CD   . GLN C 1 12  ? 6.116   -23.074 8.969   1.00 23.21 ? 12  GLN C CD   1  
ATOM 4912   O OE1  . GLN C 1 12  ? 6.627   -24.113 9.392   1.00 62.23 ? 12  GLN C OE1  1  
ATOM 4913   N NE2  . GLN C 1 12  ? 5.060   -23.090 8.168   1.00 42.53 ? 12  GLN C NE2  1  
ATOM 4914   H H    . GLN C 1 12  ? 7.745   -20.258 13.307  1.00 12.12 ? 12  GLN C H    1  
ATOM 4915   H HA   . GLN C 1 12  ? 8.579   -19.911 10.509  1.00 32.04 ? 12  GLN C HA   1  
ATOM 4916   H HB2  . GLN C 1 12  ? 8.150   -22.338 10.781  1.00 51.51 ? 12  GLN C HB2  1  
ATOM 4917   H HB3  . GLN C 1 12  ? 6.572   -21.998 11.482  1.00 55.24 ? 12  GLN C HB3  1  
ATOM 4918   H HG2  . GLN C 1 12  ? 5.857   -20.982 9.324   1.00 34.40 ? 12  GLN C HG2  1  
ATOM 4919   H HG3  . GLN C 1 12  ? 7.417   -21.413 8.622   1.00 61.53 ? 12  GLN C HG3  1  
ATOM 4920   H HE21 . GLN C 1 12  ? 4.695   -22.232 7.864   1.00 11.12 ? 12  GLN C HE21 1  
ATOM 4921   H HE22 . GLN C 1 12  ? 4.684   -23.958 7.917   1.00 3.21  ? 12  GLN C HE22 1  
ATOM 4922   N N    . ILE C 1 13  ? 6.724   -18.271 10.254  1.00 2.41  ? 13  ILE C N    1  
ATOM 4923   C CA   . ILE C 1 13  ? 5.620   -17.349 9.993   1.00 44.13 ? 13  ILE C CA   1  
ATOM 4924   C C    . ILE C 1 13  ? 4.448   -18.138 9.387   1.00 3.10  ? 13  ILE C C    1  
ATOM 4925   O O    . ILE C 1 13  ? 4.618   -18.842 8.382   1.00 73.45 ? 13  ILE C O    1  
ATOM 4926   C CB   . ILE C 1 13  ? 6.023   -16.171 9.025   1.00 33.31 ? 13  ILE C CB   1  
ATOM 4927   C CG1  . ILE C 1 13  ? 7.217   -15.343 9.612   1.00 10.34 ? 13  ILE C CG1  1  
ATOM 4928   C CG2  . ILE C 1 13  ? 4.796   -15.264 8.739   1.00 22.41 ? 13  ILE C CG2  1  
ATOM 4929   C CD1  . ILE C 1 13  ? 7.663   -14.156 8.760   1.00 50.33 ? 13  ILE C CD1  1  
ATOM 4930   H H    . ILE C 1 13  ? 7.542   -18.182 9.728   1.00 61.43 ? 13  ILE C H    1  
ATOM 4931   H HA   . ILE C 1 13  ? 5.312   -16.919 10.947  1.00 43.31 ? 13  ILE C HA   1  
ATOM 4932   H HB   . ILE C 1 13  ? 6.335   -16.608 8.079   1.00 43.13 ? 13  ILE C HB   1  
ATOM 4933   H HG12 . ILE C 1 13  ? 6.939   -14.956 10.584  1.00 62.23 ? 13  ILE C HG12 1  
ATOM 4934   H HG13 . ILE C 1 13  ? 8.072   -15.996 9.732   1.00 3.51  ? 13  ILE C HG13 1  
ATOM 4935   H HG21 . ILE C 1 13  ? 3.968   -15.862 8.375   1.00 13.50 ? 13  ILE C HG21 1  
ATOM 4936   H HG22 . ILE C 1 13  ? 5.049   -14.531 7.991   1.00 61.24 ? 13  ILE C HG22 1  
ATOM 4937   H HG23 . ILE C 1 13  ? 4.497   -14.754 9.640   1.00 64.02 ? 13  ILE C HG23 1  
ATOM 4938   H HD11 . ILE C 1 13  ? 8.079   -14.512 7.828   1.00 53.03 ? 13  ILE C HD11 1  
ATOM 4939   H HD12 . ILE C 1 13  ? 8.401   -13.585 9.292   1.00 11.23 ? 13  ILE C HD12 1  
ATOM 4940   H HD13 . ILE C 1 13  ? 6.823   -13.516 8.557   1.00 71.32 ? 13  ILE C HD13 1  
ATOM 4941   N N    . GLN C 1 14  ? 3.283   -18.045 10.033  1.00 54.35 ? 14  GLN C N    1  
ATOM 4942   C CA   . GLN C 1 14  ? 2.052   -18.696 9.565   1.00 71.32 ? 14  GLN C CA   1  
ATOM 4943   C C    . GLN C 1 14  ? 1.305   -17.744 8.631   1.00 14.31 ? 14  GLN C C    1  
ATOM 4944   O O    . GLN C 1 14  ? 0.917   -18.128 7.514   1.00 12.31 ? 14  GLN C O    1  
ATOM 4945   C CB   . GLN C 1 14  ? 1.154   -19.096 10.767  1.00 44.22 ? 14  GLN C CB   1  
ATOM 4946   C CG   . GLN C 1 14  ? 1.832   -20.016 11.801  1.00 61.00 ? 14  GLN C CG   1  
ATOM 4947   C CD   . GLN C 1 14  ? 2.218   -21.378 11.232  1.00 1.21  ? 14  GLN C CD   1  
ATOM 4948   O OE1  . GLN C 1 14  ? 1.441   -22.329 11.284  1.00 70.24 ? 14  GLN C OE1  1  
ATOM 4949   N NE2  . GLN C 1 14  ? 3.424   -21.487 10.686  1.00 24.43 ? 14  GLN C NE2  1  
ATOM 4950   H H    . GLN C 1 14  ? 3.248   -17.500 10.847  1.00 53.34 ? 14  GLN C H    1  
ATOM 4951   H HA   . GLN C 1 14  ? 2.322   -19.596 9.011   1.00 2.42  ? 14  GLN C HA   1  
ATOM 4952   H HB2  . GLN C 1 14  ? 0.839   -18.192 11.278  1.00 22.32 ? 14  GLN C HB2  1  
ATOM 4953   H HB3  . GLN C 1 14  ? 0.269   -19.601 10.392  1.00 33.21 ? 14  GLN C HB3  1  
ATOM 4954   H HG2  . GLN C 1 14  ? 2.730   -19.526 12.168  1.00 3.23  ? 14  GLN C HG2  1  
ATOM 4955   H HG3  . GLN C 1 14  ? 1.157   -20.168 12.639  1.00 14.53 ? 14  GLN C HG3  1  
ATOM 4956   H HE21 . GLN C 1 14  ? 4.003   -20.697 10.677  1.00 11.51 ? 14  GLN C HE21 1  
ATOM 4957   H HE22 . GLN C 1 14  ? 3.685   -22.357 10.315  1.00 35.15 ? 14  GLN C HE22 1  
ATOM 4958   N N    . ARG C 1 15  ? 1.141   -16.480 9.093   1.00 63.10 ? 15  ARG C N    1  
ATOM 4959   C CA   . ARG C 1 15  ? 0.325   -15.474 8.397   1.00 2.11  ? 15  ARG C CA   1  
ATOM 4960   C C    . ARG C 1 15  ? 0.451   -14.105 9.093   1.00 2.13  ? 15  ARG C C    1  
ATOM 4961   O O    . ARG C 1 15  ? 0.205   -13.997 10.288  1.00 4.11  ? 15  ARG C O    1  
ATOM 4962   C CB   . ARG C 1 15  ? -1.159  -15.949 8.374   1.00 33.35 ? 15  ARG C CB   1  
ATOM 4963   C CG   . ARG C 1 15  ? -2.105  -15.135 7.469   1.00 40.21 ? 15  ARG C CG   1  
ATOM 4964   C CD   . ARG C 1 15  ? -3.458  -15.844 7.298   1.00 43.25 ? 15  ARG C CD   1  
ATOM 4965   N NE   . ARG C 1 15  ? -4.369  -15.103 6.427   1.00 30.31 ? 15  ARG C NE   1  
ATOM 4966   C CZ   . ARG C 1 15  ? -5.389  -15.628 5.734   1.00 74.13 ? 15  ARG C CZ   1  
ATOM 4967   N NH1  . ARG C 1 15  ? -5.662  -16.934 5.772   1.00 63.21 ? 15  ARG C NH1  1  
ATOM 4968   N NH2  . ARG C 1 15  ? -6.168  -14.833 5.039   1.00 41.43 ? 15  ARG C NH2  1  
ATOM 4969   H H    . ARG C 1 15  ? 1.588   -16.224 9.931   1.00 40.14 ? 15  ARG C H    1  
ATOM 4970   H HA   . ARG C 1 15  ? 0.690   -15.396 7.375   1.00 60.13 ? 15  ARG C HA   1  
ATOM 4971   H HB2  . ARG C 1 15  ? -1.176  -16.979 8.030   1.00 34.21 ? 15  ARG C HB2  1  
ATOM 4972   H HB3  . ARG C 1 15  ? -1.555  -15.927 9.388   1.00 13.51 ? 15  ARG C HB3  1  
ATOM 4973   H HG2  . ARG C 1 15  ? -2.268  -14.158 7.912   1.00 72.03 ? 15  ARG C HG2  1  
ATOM 4974   H HG3  . ARG C 1 15  ? -1.645  -15.012 6.492   1.00 35.54 ? 15  ARG C HG3  1  
ATOM 4975   H HD2  . ARG C 1 15  ? -3.291  -16.830 6.879   1.00 70.23 ? 15  ARG C HD2  1  
ATOM 4976   H HD3  . ARG C 1 15  ? -3.924  -15.947 8.274   1.00 71.33 ? 15  ARG C HD3  1  
ATOM 4977   H HE   . ARG C 1 15  ? -4.212  -14.138 6.353   1.00 32.35 ? 15  ARG C HE   1  
ATOM 4978   H HH11 . ARG C 1 15  ? -5.109  -17.550 6.326   1.00 2.41  ? 15  ARG C HH11 1  
ATOM 4979   H HH12 . ARG C 1 15  ? -6.438  -17.298 5.242   1.00 72.01 ? 15  ARG C HH12 1  
ATOM 4980   H HH21 . ARG C 1 15  ? -5.997  -13.845 5.022   1.00 51.24 ? 15  ARG C HH21 1  
ATOM 4981   H HH22 . ARG C 1 15  ? -6.933  -15.210 4.513   1.00 1.04  ? 15  ARG C HH22 1  
ATOM 4982   N N    . ILE C 1 16  ? 0.818   -13.071 8.325   1.00 34.10 ? 16  ILE C N    1  
ATOM 4983   C CA   . ILE C 1 16  ? 0.942   -11.672 8.804   1.00 63.12 ? 16  ILE C CA   1  
ATOM 4984   C C    . ILE C 1 16  ? -0.201  -10.860 8.188   1.00 30.55 ? 16  ILE C C    1  
ATOM 4985   O O    . ILE C 1 16  ? -0.577  -11.118 7.057   1.00 42.10 ? 16  ILE C O    1  
ATOM 4986   C CB   . ILE C 1 16  ? 2.329   -11.054 8.387   1.00 4.24  ? 16  ILE C CB   1  
ATOM 4987   C CG1  . ILE C 1 16  ? 3.490   -11.798 9.116   1.00 35.12 ? 16  ILE C CG1  1  
ATOM 4988   C CG2  . ILE C 1 16  ? 2.383   -9.528  8.664   1.00 51.43 ? 16  ILE C CG2  1  
ATOM 4989   C CD1  . ILE C 1 16  ? 4.883   -11.423 8.643   1.00 22.02 ? 16  ILE C CD1  1  
ATOM 4990   H H    . ILE C 1 16  ? 0.982   -13.241 7.377   1.00 42.20 ? 16  ILE C H    1  
ATOM 4991   H HA   . ILE C 1 16  ? 0.855   -11.651 9.896   1.00 73.33 ? 16  ILE C HA   1  
ATOM 4992   H HB   . ILE C 1 16  ? 2.445   -11.196 7.316   1.00 44.30 ? 16  ILE C HB   1  
ATOM 4993   H HG12 . ILE C 1 16  ? 3.443   -11.591 10.177  1.00 72.10 ? 16  ILE C HG12 1  
ATOM 4994   H HG13 . ILE C 1 16  ? 3.378   -12.866 8.967   1.00 3.52  ? 16  ILE C HG13 1  
ATOM 4995   H HG21 . ILE C 1 16  ? 3.267   -9.107  8.223   1.00 51.24 ? 16  ILE C HG21 1  
ATOM 4996   H HG22 . ILE C 1 16  ? 2.396   -9.346  9.728   1.00 73.01 ? 16  ILE C HG22 1  
ATOM 4997   H HG23 . ILE C 1 16  ? 1.522   -9.044  8.235   1.00 30.21 ? 16  ILE C HG23 1  
ATOM 4998   H HD11 . ILE C 1 16  ? 5.609   -11.819 9.326   1.00 21.13 ? 16  ILE C HD11 1  
ATOM 4999   H HD12 . ILE C 1 16  ? 4.989   -10.348 8.595   1.00 14.43 ? 16  ILE C HD12 1  
ATOM 5000   H HD13 . ILE C 1 16  ? 5.061   -11.848 7.672   1.00 12.12 ? 16  ILE C HD13 1  
ATOM 5001   N N    . TYR C 1 17  ? -0.770  -9.902  8.938   1.00 21.21 ? 17  TYR C N    1  
ATOM 5002   C CA   . TYR C 1 17  ? -1.960  -9.156  8.491   1.00 3.24  ? 17  TYR C CA   1  
ATOM 5003   C C    . TYR C 1 17  ? -2.336  -8.066  9.500   1.00 53.23 ? 17  TYR C C    1  
ATOM 5004   O O    . TYR C 1 17  ? -1.837  -8.034  10.627  1.00 52.31 ? 17  TYR C O    1  
ATOM 5005   C CB   . TYR C 1 17  ? -3.171  -10.128 8.294   1.00 52.44 ? 17  TYR C CB   1  
ATOM 5006   C CG   . TYR C 1 17  ? -3.544  -10.931 9.552   1.00 12.13 ? 17  TYR C CG   1  
ATOM 5007   C CD1  . TYR C 1 17  ? -2.796  -12.051 9.968   1.00 22.43 ? 17  TYR C CD1  1  
ATOM 5008   C CD2  . TYR C 1 17  ? -4.613  -10.552 10.340  1.00 1.12  ? 17  TYR C CD2  1  
ATOM 5009   C CE1  . TYR C 1 17  ? -3.111  -12.740 11.117  1.00 44.40 ? 17  TYR C CE1  1  
ATOM 5010   C CE2  . TYR C 1 17  ? -4.926  -11.246 11.471  1.00 70.03 ? 17  TYR C CE2  1  
ATOM 5011   C CZ   . TYR C 1 17  ? -4.180  -12.327 11.866  1.00 33.45 ? 17  TYR C CZ   1  
ATOM 5012   O OH   . TYR C 1 17  ? -4.524  -12.988 13.019  1.00 62.14 ? 17  TYR C OH   1  
ATOM 5013   H H    . TYR C 1 17  ? -0.377  -9.683  9.813   1.00 34.41 ? 17  TYR C H    1  
ATOM 5014   H HA   . TYR C 1 17  ? -1.713  -8.681  7.537   1.00 30.40 ? 17  TYR C HA   1  
ATOM 5015   H HB2  . TYR C 1 17  ? -4.042  -9.556  7.976   1.00 52.44 ? 17  TYR C HB2  1  
ATOM 5016   H HB3  . TYR C 1 17  ? -2.926  -10.833 7.509   1.00 0.41  ? 17  TYR C HB3  1  
ATOM 5017   H HD1  . TYR C 1 17  ? -1.952  -12.374 9.370   1.00 62.32 ? 17  TYR C HD1  1  
ATOM 5018   H HD2  . TYR C 1 17  ? -5.214  -9.698  10.046  1.00 74.04 ? 17  TYR C HD2  1  
ATOM 5019   H HE1  . TYR C 1 17  ? -2.522  -13.600 11.427  1.00 50.32 ? 17  TYR C HE1  1  
ATOM 5020   H HE2  . TYR C 1 17  ? -5.759  -10.923 12.076  1.00 23.11 ? 17  TYR C HE2  1  
ATOM 5021   H HH   . TYR C 1 17  ? -3.761  -13.053 13.601  1.00 61.31 ? 17  TYR C HH   1  
ATOM 5022   N N    . THR C 1 18  ? -3.260  -7.201  9.086   1.00 34.01 ? 18  THR C N    1  
ATOM 5023   C CA   . THR C 1 18  ? -3.788  -6.124  9.920   1.00 11.12 ? 18  THR C CA   1  
ATOM 5024   C C    . THR C 1 18  ? -5.065  -6.607  10.639  1.00 44.23 ? 18  THR C C    1  
ATOM 5025   O O    . THR C 1 18  ? -6.069  -6.930  9.990   1.00 51.44 ? 18  THR C O    1  
ATOM 5026   C CB   . THR C 1 18  ? -4.077  -4.861  9.037   1.00 61.14 ? 18  THR C CB   1  
ATOM 5027   O OG1  . THR C 1 18  ? -5.054  -5.161  8.025   1.00 5.33  ? 18  THR C OG1  1  
ATOM 5028   C CG2  . THR C 1 18  ? -2.795  -4.345  8.350   1.00 20.54 ? 18  THR C CG2  1  
ATOM 5029   H H    . THR C 1 18  ? -3.612  -7.293  8.174   1.00 61.44 ? 18  THR C H    1  
ATOM 5030   H HA   . THR C 1 18  ? -3.038  -5.855  10.663  1.00 21.54 ? 18  THR C HA   1  
ATOM 5031   H HB   . THR C 1 18  ? -4.467  -4.073  9.673   1.00 23.24 ? 18  THR C HB   1  
ATOM 5032   H HG1  . THR C 1 18  ? -5.936  -5.001  8.376   1.00 60.32 ? 18  THR C HG1  1  
ATOM 5033   H HG21 . THR C 1 18  ? -3.047  -3.572  7.647   1.00 42.35 ? 18  THR C HG21 1  
ATOM 5034   H HG22 . THR C 1 18  ? -2.310  -5.152  7.818   1.00 1.50  ? 18  THR C HG22 1  
ATOM 5035   H HG23 . THR C 1 18  ? -2.116  -3.946  9.093   1.00 32.23 ? 18  THR C HG23 1  
ATOM 5036   N N    . LYS C 1 19  ? -4.996  -6.700  11.988  1.00 63.25 ? 19  LYS C N    1  
ATOM 5037   C CA   . LYS C 1 19  ? -6.171  -7.047  12.833  1.00 62.44 ? 19  LYS C CA   1  
ATOM 5038   C C    . LYS C 1 19  ? -7.175  -5.892  12.781  1.00 22.55 ? 19  LYS C C    1  
ATOM 5039   O O    . LYS C 1 19  ? -8.386  -6.089  12.842  1.00 72.33 ? 19  LYS C O    1  
ATOM 5040   C CB   . LYS C 1 19  ? -5.788  -7.286  14.332  1.00 23.32 ? 19  LYS C CB   1  
ATOM 5041   C CG   . LYS C 1 19  ? -4.436  -7.962  14.573  1.00 44.12 ? 19  LYS C CG   1  
ATOM 5042   C CD   . LYS C 1 19  ? -4.390  -9.433  14.100  1.00 5.42  ? 19  LYS C CD   1  
ATOM 5043   C CE   . LYS C 1 19  ? -4.484  -10.465 15.226  1.00 22.14 ? 19  LYS C CE   1  
ATOM 5044   N NZ   . LYS C 1 19  ? -5.851  -10.622 15.787  1.00 1.22  ? 19  LYS C NZ   1  
ATOM 5045   H H    . LYS C 1 19  ? -4.141  -6.513  12.423  1.00 54.33 ? 19  LYS C H    1  
ATOM 5046   H HA   . LYS C 1 19  ? -6.630  -7.945  12.424  1.00 13.10 ? 19  LYS C HA   1  
ATOM 5047   H HB2  . LYS C 1 19  ? -5.779  -6.335  14.863  1.00 71.41 ? 19  LYS C HB2  1  
ATOM 5048   H HB3  . LYS C 1 19  ? -6.559  -7.917  14.772  1.00 74.02 ? 19  LYS C HB3  1  
ATOM 5049   H HG2  . LYS C 1 19  ? -3.676  -7.398  14.041  1.00 0.13  ? 19  LYS C HG2  1  
ATOM 5050   H HG3  . LYS C 1 19  ? -4.212  -7.922  15.634  1.00 23.03 ? 19  LYS C HG3  1  
ATOM 5051   H HD2  . LYS C 1 19  ? -5.208  -9.616  13.411  1.00 62.51 ? 19  LYS C HD2  1  
ATOM 5052   H HD3  . LYS C 1 19  ? -3.461  -9.596  13.560  1.00 11.50 ? 19  LYS C HD3  1  
ATOM 5053   H HE2  . LYS C 1 19  ? -4.165  -11.428 14.846  1.00 14.15 ? 19  LYS C HE2  1  
ATOM 5054   H HE3  . LYS C 1 19  ? -3.812  -10.173 16.028  1.00 23.43 ? 19  LYS C HE3  1  
ATOM 5055   H HZ1  . LYS C 1 19  ? -6.205  -9.715  16.145  1.00 12.41 ? 19  LYS C HZ1  1  
ATOM 5056   H HZ2  . LYS C 1 19  ? -5.833  -11.308 16.573  1.00 65.41 ? 19  LYS C HZ2  1  
ATOM 5057   H HZ3  . LYS C 1 19  ? -6.502  -10.973 15.058  1.00 52.11 ? 19  LYS C HZ3  1  
ATOM 5058   N N    . ASP C 1 20  ? -6.607  -4.681  12.685  1.00 33.03 ? 20  ASP C N    1  
ATOM 5059   C CA   . ASP C 1 20  ? -7.337  -3.420  12.772  1.00 14.33 ? 20  ASP C CA   1  
ATOM 5060   C C    . ASP C 1 20  ? -6.571  -2.328  12.014  1.00 54.40 ? 20  ASP C C    1  
ATOM 5061   O O    . ASP C 1 20  ? -5.332  -2.338  11.954  1.00 21.00 ? 20  ASP C O    1  
ATOM 5062   C CB   . ASP C 1 20  ? -7.522  -3.027  14.265  1.00 75.12 ? 20  ASP C CB   1  
ATOM 5063   C CG   . ASP C 1 20  ? -8.223  -1.674  14.491  1.00 2.35  ? 20  ASP C CG   1  
ATOM 5064   O OD1  . ASP C 1 20  ? -7.556  -0.696  14.908  1.00 1.14  ? 20  ASP C OD1  1  
ATOM 5065   O OD2  . ASP C 1 20  ? -9.447  -1.592  14.261  1.00 21.10 ? 20  ASP C OD2  1  
ATOM 5066   H H    . ASP C 1 20  ? -5.638  -4.637  12.548  1.00 20.11 ? 20  ASP C H    1  
ATOM 5067   H HA   . ASP C 1 20  ? -8.314  -3.555  12.313  1.00 54.15 ? 20  ASP C HA   1  
ATOM 5068   H HB2  . ASP C 1 20  ? -8.111  -3.796  14.757  1.00 42.25 ? 20  ASP C HB2  1  
ATOM 5069   H HB3  . ASP C 1 20  ? -6.544  -3.000  14.740  1.00 14.11 ? 20  ASP C HB3  1  
ATOM 5070   N N    . ILE C 1 21  ? -7.337  -1.415  11.420  1.00 24.11 ? 21  ILE C N    1  
ATOM 5071   C CA   . ILE C 1 21  ? -6.855  -0.225  10.717  1.00 54.40 ? 21  ILE C CA   1  
ATOM 5072   C C    . ILE C 1 21  ? -7.815  0.915   11.065  1.00 64.41 ? 21  ILE C C    1  
ATOM 5073   O O    . ILE C 1 21  ? -9.030  0.697   11.187  1.00 3.32  ? 21  ILE C O    1  
ATOM 5074   C CB   . ILE C 1 21  ? -6.823  -0.416  9.147   1.00 73.14 ? 21  ILE C CB   1  
ATOM 5075   C CG1  . ILE C 1 21  ? -5.805  -1.529  8.737   1.00 13.21 ? 21  ILE C CG1  1  
ATOM 5076   C CG2  . ILE C 1 21  ? -6.517  0.918   8.413   1.00 41.12 ? 21  ILE C CG2  1  
ATOM 5077   C CD1  . ILE C 1 21  ? -5.778  -1.861  7.256   1.00 12.53 ? 21  ILE C CD1  1  
ATOM 5078   H H    . ILE C 1 21  ? -8.306  -1.534  11.480  1.00 2.34  ? 21  ILE C H    1  
ATOM 5079   H HA   . ILE C 1 21  ? -5.850  0.021   11.072  1.00 62.22 ? 21  ILE C HA   1  
ATOM 5080   H HB   . ILE C 1 21  ? -7.813  -0.728  8.838   1.00 35.35 ? 21  ILE C HB   1  
ATOM 5081   H HG12 . ILE C 1 21  ? -4.810  -1.222  9.019   1.00 60.25 ? 21  ILE C HG12 1  
ATOM 5082   H HG13 . ILE C 1 21  ? -6.050  -2.443  9.268   1.00 5.14  ? 21  ILE C HG13 1  
ATOM 5083   H HG21 . ILE C 1 21  ? -6.683  0.801   7.360   1.00 71.43 ? 21  ILE C HG21 1  
ATOM 5084   H HG22 . ILE C 1 21  ? -5.487  1.203   8.582   1.00 2.22  ? 21  ILE C HG22 1  
ATOM 5085   H HG23 . ILE C 1 21  ? -7.163  1.707   8.778   1.00 63.02 ? 21  ILE C HG23 1  
ATOM 5086   H HD11 . ILE C 1 21  ? -5.521  -0.984  6.686   1.00 21.53 ? 21  ILE C HD11 1  
ATOM 5087   H HD12 . ILE C 1 21  ? -6.749  -2.211  6.947   1.00 73.32 ? 21  ILE C HD12 1  
ATOM 5088   H HD13 . ILE C 1 21  ? -5.047  -2.633  7.076   1.00 61.24 ? 21  ILE C HD13 1  
ATOM 5089   N N    . SER C 1 22  ? -7.273  2.123   11.194  1.00 2.41  ? 22  SER C N    1  
ATOM 5090   C CA   . SER C 1 22  ? -8.054  3.315   11.480  1.00 63.42 ? 22  SER C CA   1  
ATOM 5091   C C    . SER C 1 22  ? -7.332  4.557   10.951  1.00 65.23 ? 22  SER C C    1  
ATOM 5092   O O    . SER C 1 22  ? -6.094  4.605   10.876  1.00 51.25 ? 22  SER C O    1  
ATOM 5093   C CB   . SER C 1 22  ? -8.321  3.445   13.006  1.00 30.00 ? 22  SER C CB   1  
ATOM 5094   O OG   . SER C 1 22  ? -9.109  4.592   13.305  1.00 43.50 ? 22  SER C OG   1  
ATOM 5095   H H    . SER C 1 22  ? -6.307  2.217   11.084  1.00 13.33 ? 22  SER C H    1  
ATOM 5096   H HA   . SER C 1 22  ? -9.002  3.216   10.951  1.00 53.14 ? 22  SER C HA   1  
ATOM 5097   H HB2  . SER C 1 22  ? -8.851  2.570   13.355  1.00 73.00 ? 22  SER C HB2  1  
ATOM 5098   H HB3  . SER C 1 22  ? -7.378  3.525   13.539  1.00 42.22 ? 22  SER C HB3  1  
ATOM 5099   H HG   . SER C 1 22  ? -8.740  5.048   14.074  1.00 25.12 ? 22  SER C HG   1  
ATOM 5100   N N    . PHE C 1 23  ? -8.138  5.546   10.568  1.00 1.42  ? 23  PHE C N    1  
ATOM 5101   C CA   . PHE C 1 23  ? -7.690  6.887   10.200  1.00 23.25 ? 23  PHE C CA   1  
ATOM 5102   C C    . PHE C 1 23  ? -8.848  7.838   10.472  1.00 2.31  ? 23  PHE C C    1  
ATOM 5103   O O    . PHE C 1 23  ? -9.950  7.629   9.963   1.00 5.23  ? 23  PHE C O    1  
ATOM 5104   C CB   . PHE C 1 23  ? -7.268  6.967   8.708   1.00 4.01  ? 23  PHE C CB   1  
ATOM 5105   C CG   . PHE C 1 23  ? -6.753  8.349   8.307   1.00 1.43  ? 23  PHE C CG   1  
ATOM 5106   C CD1  . PHE C 1 23  ? -7.598  9.298   7.727   1.00 4.13  ? 23  PHE C CD1  1  
ATOM 5107   C CD2  . PHE C 1 23  ? -5.430  8.710   8.556   1.00 31.04 ? 23  PHE C CD2  1  
ATOM 5108   C CE1  . PHE C 1 23  ? -7.138  10.554  7.416   1.00 41.52 ? 23  PHE C CE1  1  
ATOM 5109   C CE2  . PHE C 1 23  ? -4.969  9.966   8.231   1.00 21.42 ? 23  PHE C CE2  1  
ATOM 5110   C CZ   . PHE C 1 23  ? -5.826  10.889  7.664   1.00 10.31 ? 23  PHE C CZ   1  
ATOM 5111   H H    . PHE C 1 23  ? -9.105  5.366   10.541  1.00 41.41 ? 23  PHE C H    1  
ATOM 5112   H HA   . PHE C 1 23  ? -6.841  7.153   10.836  1.00 23.21 ? 23  PHE C HA   1  
ATOM 5113   H HB2  . PHE C 1 23  ? -6.482  6.244   8.525   1.00 1.52  ? 23  PHE C HB2  1  
ATOM 5114   H HB3  . PHE C 1 23  ? -8.118  6.721   8.077   1.00 52.11 ? 23  PHE C HB3  1  
ATOM 5115   H HD1  . PHE C 1 23  ? -8.631  9.039   7.528   1.00 14.22 ? 23  PHE C HD1  1  
ATOM 5116   H HD2  . PHE C 1 23  ? -4.754  7.989   9.002   1.00 14.02 ? 23  PHE C HD2  1  
ATOM 5117   H HE1  . PHE C 1 23  ? -7.806  11.280  6.965   1.00 31.55 ? 23  PHE C HE1  1  
ATOM 5118   H HE2  . PHE C 1 23  ? -3.930  10.229  8.422   1.00 71.55 ? 23  PHE C HE2  1  
ATOM 5119   H HZ   . PHE C 1 23  ? -5.473  11.886  7.421   1.00 12.50 ? 23  PHE C HZ   1  
ATOM 5120   N N    . GLU C 1 24  ? -8.597  8.878   11.266  1.00 21.53 ? 24  GLU C N    1  
ATOM 5121   C CA   . GLU C 1 24  ? -9.629  9.825   11.692  1.00 12.12 ? 24  GLU C CA   1  
ATOM 5122   C C    . GLU C 1 24  ? -9.127  11.265  11.491  1.00 44.52 ? 24  GLU C C    1  
ATOM 5123   O O    . GLU C 1 24  ? -8.226  11.721  12.194  1.00 1.43  ? 24  GLU C O    1  
ATOM 5124   C CB   . GLU C 1 24  ? -9.975  9.550   13.186  1.00 0.33  ? 24  GLU C CB   1  
ATOM 5125   C CG   . GLU C 1 24  ? -10.565 8.139   13.455  1.00 52.51 ? 24  GLU C CG   1  
ATOM 5126   C CD   . GLU C 1 24  ? -10.681 7.796   14.951  1.00 3.33  ? 24  GLU C CD   1  
ATOM 5127   O OE1  . GLU C 1 24  ? -11.737 8.074   15.557  1.00 22.11 ? 24  GLU C OE1  1  
ATOM 5128   O OE2  . GLU C 1 24  ? -9.708  7.256   15.531  1.00 62.04 ? 24  GLU C OE2  1  
ATOM 5129   H H    . GLU C 1 24  ? -7.684  9.014   11.583  1.00 12.22 ? 24  GLU C H    1  
ATOM 5130   H HA   . GLU C 1 24  ? -10.527 9.673   11.086  1.00 31.25 ? 24  GLU C HA   1  
ATOM 5131   H HB2  . GLU C 1 24  ? -9.071  9.659   13.777  1.00 54.53 ? 24  GLU C HB2  1  
ATOM 5132   H HB3  . GLU C 1 24  ? -10.697 10.289  13.523  1.00 23.55 ? 24  GLU C HB3  1  
ATOM 5133   H HG2  . GLU C 1 24  ? -11.552 8.081   13.001  1.00 31.14 ? 24  GLU C HG2  1  
ATOM 5134   H HG3  . GLU C 1 24  ? -9.927  7.403   12.977  1.00 34.53 ? 24  GLU C HG3  1  
ATOM 5135   N N    . ALA C 1 25  ? -9.724  11.954  10.514  1.00 52.31 ? 25  ALA C N    1  
ATOM 5136   C CA   . ALA C 1 25  ? -9.578  13.402  10.297  1.00 53.13 ? 25  ALA C CA   1  
ATOM 5137   C C    . ALA C 1 25  ? -11.007 13.979  10.170  1.00 51.24 ? 25  ALA C C    1  
ATOM 5138   O O    . ALA C 1 25  ? -11.515 14.156  9.052   1.00 13.33 ? 25  ALA C O    1  
ATOM 5139   C CB   . ALA C 1 25  ? -8.705  13.698  9.045   1.00 43.11 ? 25  ALA C CB   1  
ATOM 5140   H H    . ALA C 1 25  ? -10.298 11.460  9.897   1.00 63.03 ? 25  ALA C H    1  
ATOM 5141   H HA   . ALA C 1 25  ? -9.098  13.849  11.167  1.00 62.44 ? 25  ALA C HA   1  
ATOM 5142   H HB1  . ALA C 1 25  ? -8.813  14.729  8.754   1.00 65.35 ? 25  ALA C HB1  1  
ATOM 5143   H HB2  . ALA C 1 25  ? -9.010  13.065  8.225   1.00 2.12  ? 25  ALA C HB2  1  
ATOM 5144   H HB3  . ALA C 1 25  ? -7.668  13.517  9.264   1.00 52.13 ? 25  ALA C HB3  1  
ATOM 5145   N N    . PRO C 1 26  ? -11.720 14.199  11.330  1.00 42.43 ? 26  PRO C N    1  
ATOM 5146   C CA   . PRO C 1 26  ? -13.127 14.688  11.331  1.00 3.43  ? 26  PRO C CA   1  
ATOM 5147   C C    . PRO C 1 26  ? -13.229 16.154  10.867  1.00 2.15  ? 26  PRO C C    1  
ATOM 5148   O O    . PRO C 1 26  ? -14.256 16.592  10.343  1.00 24.01 ? 26  PRO C O    1  
ATOM 5149   C CB   . PRO C 1 26  ? -13.551 14.521  12.813  1.00 71.51 ? 26  PRO C CB   1  
ATOM 5150   C CG   . PRO C 1 26  ? -12.274 14.654  13.588  1.00 5.41  ? 26  PRO C CG   1  
ATOM 5151   C CD   . PRO C 1 26  ? -11.213 14.000  12.727  1.00 55.00 ? 26  PRO C CD   1  
ATOM 5152   H HA   . PRO C 1 26  ? -13.758 14.076  10.696  1.00 13.20 ? 26  PRO C HA   1  
ATOM 5153   H HB2  . PRO C 1 26  ? -14.273 15.285  13.101  1.00 42.34 ? 26  PRO C HB2  1  
ATOM 5154   H HB3  . PRO C 1 26  ? -13.979 13.539  12.970  1.00 45.53 ? 26  PRO C HB3  1  
ATOM 5155   H HG2  . PRO C 1 26  ? -12.045 15.708  13.752  1.00 72.35 ? 26  PRO C HG2  1  
ATOM 5156   H HG3  . PRO C 1 26  ? -12.353 14.141  14.538  1.00 51.42 ? 26  PRO C HG3  1  
ATOM 5157   H HD2  . PRO C 1 26  ? -10.251 14.488  12.869  1.00 40.42 ? 26  PRO C HD2  1  
ATOM 5158   H HD3  . PRO C 1 26  ? -11.132 12.944  12.953  1.00 2.01  ? 26  PRO C HD3  1  
ATOM 5159   N N    . ASN C 1 27  ? -12.123 16.880  11.055  1.00 12.34 ? 27  ASN C N    1  
ATOM 5160   C CA   . ASN C 1 27  ? -11.983 18.310  10.739  1.00 71.50 ? 27  ASN C CA   1  
ATOM 5161   C C    . ASN C 1 27  ? -11.129 18.512  9.483   1.00 42.01 ? 27  ASN C C    1  
ATOM 5162   O O    . ASN C 1 27  ? -10.672 19.628  9.244   1.00 30.25 ? 27  ASN C O    1  
ATOM 5163   C CB   . ASN C 1 27  ? -11.302 19.033  11.939  1.00 72.42 ? 27  ASN C CB   1  
ATOM 5164   C CG   . ASN C 1 27  ? -9.918  18.463  12.305  1.00 35.03 ? 27  ASN C CG   1  
ATOM 5165   O OD1  . ASN C 1 27  ? -9.634  17.275  12.142  1.00 23.34 ? 27  ASN C OD1  1  
ATOM 5166   N ND2  . ASN C 1 27  ? -9.045  19.302  12.798  1.00 34.41 ? 27  ASN C ND2  1  
ATOM 5167   H H    . ASN C 1 27  ? -11.342 16.417  11.433  1.00 63.22 ? 27  ASN C H    1  
ATOM 5168   H HA   . ASN C 1 27  ? -12.966 18.741  10.571  1.00 4.50  ? 27  ASN C HA   1  
ATOM 5169   H HB2  . ASN C 1 27  ? -11.185 20.083  11.695  1.00 12.22 ? 27  ASN C HB2  1  
ATOM 5170   H HB3  . ASN C 1 27  ? -11.937 18.959  12.806  1.00 43.30 ? 27  ASN C HB3  1  
ATOM 5171   H HD21 . ASN C 1 27  ? -9.308  20.237  12.910  1.00 53.25 ? 27  ASN C HD21 1  
ATOM 5172   H HD22 . ASN C 1 27  ? -8.164  18.958  13.040  1.00 13.21 ? 27  ASN C HD22 1  
ATOM 5173   N N    . ALA C 1 28  ? -10.963 17.431  8.681   1.00 4.13  ? 28  ALA C N    1  
ATOM 5174   C CA   . ALA C 1 28  ? -9.973  17.353  7.580   1.00 14.14 ? 28  ALA C CA   1  
ATOM 5175   C C    . ALA C 1 28  ? -9.870  18.644  6.692   1.00 15.15 ? 28  ALA C C    1  
ATOM 5176   O O    . ALA C 1 28  ? -8.793  19.233  6.672   1.00 2.23  ? 28  ALA C O    1  
ATOM 5177   C CB   . ALA C 1 28  ? -10.188 16.076  6.741   1.00 13.13 ? 28  ALA C CB   1  
ATOM 5178   H H    . ALA C 1 28  ? -11.521 16.639  8.851   1.00 0.35  ? 28  ALA C H    1  
ATOM 5179   H HA   . ALA C 1 28  ? -9.011  17.230  8.077   1.00 21.11 ? 28  ALA C HA   1  
ATOM 5180   H HB1  . ALA C 1 28  ? -9.295  15.851  6.182   1.00 10.22 ? 28  ALA C HB1  1  
ATOM 5181   H HB2  . ALA C 1 28  ? -11.016 16.216  6.056   1.00 52.12 ? 28  ALA C HB2  1  
ATOM 5182   H HB3  . ALA C 1 28  ? -10.405 15.245  7.390   1.00 12.43 ? 28  ALA C HB3  1  
ATOM 5183   N N    . PRO C 1 29  ? -10.967 19.171  6.019   1.00 32.21 ? 29  PRO C N    1  
ATOM 5184   C CA   . PRO C 1 29  ? -10.856 20.394  5.161   1.00 4.30  ? 29  PRO C CA   1  
ATOM 5185   C C    . PRO C 1 29  ? -10.425 21.649  5.967   1.00 14.12 ? 29  PRO C C    1  
ATOM 5186   O O    . PRO C 1 29  ? -9.650  22.482  5.472   1.00 52.22 ? 29  PRO C O    1  
ATOM 5187   C CB   . PRO C 1 29  ? -12.278 20.548  4.556   1.00 73.21 ? 29  PRO C CB   1  
ATOM 5188   C CG   . PRO C 1 29  ? -13.182 19.819  5.507   1.00 74.34 ? 29  PRO C CG   1  
ATOM 5189   C CD   . PRO C 1 29  ? -12.370 18.658  6.028   1.00 0.42  ? 29  PRO C CD   1  
ATOM 5190   H HA   . PRO C 1 29  ? -10.137 20.232  4.360   1.00 74.11 ? 29  PRO C HA   1  
ATOM 5191   H HB2  . PRO C 1 29  ? -12.554 21.599  4.472   1.00 11.32 ? 29  PRO C HB2  1  
ATOM 5192   H HB3  . PRO C 1 29  ? -12.319 20.083  3.578   1.00 74.11 ? 29  PRO C HB3  1  
ATOM 5193   H HG2  . PRO C 1 29  ? -13.473 20.481  6.324   1.00 22.42 ? 29  PRO C HG2  1  
ATOM 5194   H HG3  . PRO C 1 29  ? -14.067 19.457  4.994   1.00 31.20 ? 29  PRO C HG3  1  
ATOM 5195   H HD2  . PRO C 1 29  ? -12.680 18.391  7.036   1.00 54.22 ? 29  PRO C HD2  1  
ATOM 5196   H HD3  . PRO C 1 29  ? -12.461 17.798  5.374   1.00 33.13 ? 29  PRO C HD3  1  
ATOM 5197   N N    . HIS C 1 30  ? -10.921 21.751  7.221   1.00 21.20 ? 30  HIS C N    1  
ATOM 5198   C CA   . HIS C 1 30  ? -10.603 22.868  8.134   1.00 41.22 ? 30  HIS C CA   1  
ATOM 5199   C C    . HIS C 1 30  ? -9.129  22.823  8.598   1.00 74.12 ? 30  HIS C C    1  
ATOM 5200   O O    . HIS C 1 30  ? -8.481  23.865  8.774   1.00 64.23 ? 30  HIS C O    1  
ATOM 5201   C CB   . HIS C 1 30  ? -11.561 22.848  9.356   1.00 43.54 ? 30  HIS C CB   1  
ATOM 5202   C CG   . HIS C 1 30  ? -11.264 23.878  10.427  1.00 50.13 ? 30  HIS C CG   1  
ATOM 5203   N ND1  . HIS C 1 30  ? -11.488 25.224  10.254  1.00 31.32 ? 30  HIS C ND1  1  
ATOM 5204   C CD2  . HIS C 1 30  ? -10.715 23.755  11.659  1.00 63.20 ? 30  HIS C CD2  1  
ATOM 5205   C CE1  . HIS C 1 30  ? -11.113 25.876  11.336  1.00 13.41 ? 30  HIS C CE1  1  
ATOM 5206   N NE2  . HIS C 1 30  ? -10.635 25.009  12.204  1.00 24.24 ? 30  HIS C NE2  1  
ATOM 5207   H H    . HIS C 1 30  ? -11.510 21.036  7.546   1.00 23.22 ? 30  HIS C H    1  
ATOM 5208   H HA   . HIS C 1 30  ? -10.762 23.793  7.585   1.00 21.00 ? 30  HIS C HA   1  
ATOM 5209   H HB2  . HIS C 1 30  ? -12.576 23.024  9.016   1.00 33.15 ? 30  HIS C HB2  1  
ATOM 5210   H HB3  . HIS C 1 30  ? -11.521 21.867  9.821   1.00 31.11 ? 30  HIS C HB3  1  
ATOM 5211   H HD1  . HIS C 1 30  ? -11.887 25.642  9.460   1.00 61.22 ? 30  HIS C HD1  1  
ATOM 5212   H HD2  . HIS C 1 30  ? -10.410 22.835  12.135  1.00 3.22  ? 30  HIS C HD2  1  
ATOM 5213   H HE1  . HIS C 1 30  ? -11.178 26.946  11.480  1.00 53.41 ? 30  HIS C HE1  1  
ATOM 5214   H HE2  . HIS C 1 30  ? -10.519 25.198  13.162  1.00 37.65 ? 30  HIS C HE2  1  
ATOM 5215   N N    . VAL C 1 31  ? -8.624  21.615  8.860   1.00 52.20 ? 31  VAL C N    1  
ATOM 5216   C CA   . VAL C 1 31  ? -7.243  21.431  9.334   1.00 14.22 ? 31  VAL C CA   1  
ATOM 5217   C C    . VAL C 1 31  ? -6.203  21.515  8.179   1.00 51.23 ? 31  VAL C C    1  
ATOM 5218   O O    . VAL C 1 31  ? -5.010  21.733  8.423   1.00 21.23 ? 31  VAL C O    1  
ATOM 5219   C CB   . VAL C 1 31  ? -7.106  20.096  10.149  1.00 63.42 ? 31  VAL C CB   1  
ATOM 5220   C CG1  . VAL C 1 31  ? -6.966  18.837  9.257   1.00 24.44 ? 31  VAL C CG1  1  
ATOM 5221   C CG2  . VAL C 1 31  ? -5.959  20.199  11.154  1.00 13.44 ? 31  VAL C CG2  1  
ATOM 5222   H H    . VAL C 1 31  ? -9.197  20.824  8.753   1.00 15.33 ? 31  VAL C H    1  
ATOM 5223   H HA   . VAL C 1 31  ? -7.031  22.259  10.021  1.00 40.50 ? 31  VAL C HA   1  
ATOM 5224   H HB   . VAL C 1 31  ? -8.022  19.974  10.722  1.00 24.21 ? 31  VAL C HB   1  
ATOM 5225   H HG11 . VAL C 1 31  ? -6.798  17.972  9.872   1.00 62.41 ? 31  VAL C HG11 1  
ATOM 5226   H HG12 . VAL C 1 31  ? -6.132  18.955  8.583   1.00 14.41 ? 31  VAL C HG12 1  
ATOM 5227   H HG13 . VAL C 1 31  ? -7.870  18.684  8.682   1.00 34.41 ? 31  VAL C HG13 1  
ATOM 5228   H HG21 . VAL C 1 31  ? -6.025  19.392  11.865  1.00 22.53 ? 31  VAL C HG21 1  
ATOM 5229   H HG22 . VAL C 1 31  ? -6.016  21.141  11.688  1.00 22.52 ? 31  VAL C HG22 1  
ATOM 5230   H HG23 . VAL C 1 31  ? -5.009  20.141  10.637  1.00 3.04  ? 31  VAL C HG23 1  
ATOM 5231   N N    . PHE C 1 32  ? -6.659  21.305  6.933   1.00 11.14 ? 32  PHE C N    1  
ATOM 5232   C CA   . PHE C 1 32  ? -5.812  21.489  5.718   1.00 74.33 ? 32  PHE C CA   1  
ATOM 5233   C C    . PHE C 1 32  ? -5.442  22.970  5.472   1.00 51.35 ? 32  PHE C C    1  
ATOM 5234   O O    . PHE C 1 32  ? -4.366  23.257  4.932   1.00 61.21 ? 32  PHE C O    1  
ATOM 5235   C CB   . PHE C 1 32  ? -6.498  20.906  4.455   1.00 25.21 ? 32  PHE C CB   1  
ATOM 5236   C CG   . PHE C 1 32  ? -6.676  19.387  4.448   1.00 31.33 ? 32  PHE C CG   1  
ATOM 5237   C CD1  . PHE C 1 32  ? -5.760  18.544  5.083   1.00 31.31 ? 32  PHE C CD1  1  
ATOM 5238   C CD2  . PHE C 1 32  ? -7.760  18.801  3.797   1.00 53.53 ? 32  PHE C CD2  1  
ATOM 5239   C CE1  . PHE C 1 32  ? -5.934  17.176  5.072   1.00 2.45  ? 32  PHE C CE1  1  
ATOM 5240   C CE2  . PHE C 1 32  ? -7.926  17.435  3.790   1.00 34.33 ? 32  PHE C CE2  1  
ATOM 5241   C CZ   . PHE C 1 32  ? -7.020  16.622  4.427   1.00 20.42 ? 32  PHE C CZ   1  
ATOM 5242   H H    . PHE C 1 32  ? -7.570  20.961  6.830   1.00 74.54 ? 32  PHE C H    1  
ATOM 5243   H HA   . PHE C 1 32  ? -4.891  20.940  5.889   1.00 34.23 ? 32  PHE C HA   1  
ATOM 5244   H HB2  . PHE C 1 32  ? -7.481  21.362  4.353   1.00 51.44 ? 32  PHE C HB2  1  
ATOM 5245   H HB3  . PHE C 1 32  ? -5.910  21.165  3.579   1.00 54.43 ? 32  PHE C HB3  1  
ATOM 5246   H HD1  . PHE C 1 32  ? -4.905  18.969  5.598   1.00 73.13 ? 32  PHE C HD1  1  
ATOM 5247   H HD2  . PHE C 1 32  ? -8.485  19.430  3.292   1.00 10.45 ? 32  PHE C HD2  1  
ATOM 5248   H HE1  . PHE C 1 32  ? -5.216  16.534  5.565   1.00 14.25 ? 32  PHE C HE1  1  
ATOM 5249   H HE2  . PHE C 1 32  ? -8.776  16.998  3.285   1.00 53.53 ? 32  PHE C HE2  1  
ATOM 5250   H HZ   . PHE C 1 32  ? -7.161  15.544  4.425   1.00 23.32 ? 32  PHE C HZ   1  
ATOM 5251   N N    . GLN C 1 33  ? -6.339  23.900  5.855   1.00 55.41 ? 33  GLN C N    1  
ATOM 5252   C CA   . GLN C 1 33  ? -6.092  25.360  5.727   1.00 14.42 ? 33  GLN C CA   1  
ATOM 5253   C C    . GLN C 1 33  ? -5.376  25.919  6.991   1.00 12.33 ? 33  GLN C C    1  
ATOM 5254   O O    . GLN C 1 33  ? -5.300  27.135  7.187   1.00 62.43 ? 33  GLN C O    1  
ATOM 5255   C CB   . GLN C 1 33  ? -7.441  26.106  5.456   1.00 1.20  ? 33  GLN C CB   1  
ATOM 5256   C CG   . GLN C 1 33  ? -8.501  25.940  6.561   1.00 33.41 ? 33  GLN C CG   1  
ATOM 5257   C CD   . GLN C 1 33  ? -9.852  26.597  6.253   1.00 73.54 ? 33  GLN C CD   1  
ATOM 5258   O OE1  . GLN C 1 33  ? -10.738 25.979  5.665   1.00 52.20 ? 33  GLN C OE1  1  
ATOM 5259   N NE2  . GLN C 1 33  ? -10.030 27.846  6.671   1.00 71.51 ? 33  GLN C NE2  1  
ATOM 5260   H H    . GLN C 1 33  ? -7.191  23.597  6.234   1.00 41.45 ? 33  GLN C H    1  
ATOM 5261   H HA   . GLN C 1 33  ? -5.434  25.520  4.877   1.00 1.22  ? 33  GLN C HA   1  
ATOM 5262   H HB2  . GLN C 1 33  ? -7.238  27.165  5.337   1.00 21.10 ? 33  GLN C HB2  1  
ATOM 5263   H HB3  . GLN C 1 33  ? -7.860  25.733  4.527   1.00 31.35 ? 33  GLN C HB3  1  
ATOM 5264   H HG2  . GLN C 1 33  ? -8.671  24.881  6.716   1.00 75.14 ? 33  GLN C HG2  1  
ATOM 5265   H HG3  . GLN C 1 33  ? -8.111  26.367  7.479   1.00 11.14 ? 33  GLN C HG3  1  
ATOM 5266   H HE21 . GLN C 1 33  ? -9.290  28.284  7.144   1.00 74.55 ? 33  GLN C HE21 1  
ATOM 5267   H HE22 . GLN C 1 33  ? -10.889 28.276  6.486   1.00 31.45 ? 33  GLN C HE22 1  
ATOM 5268   N N    . LYS C 1 34  ? -4.817  25.010  7.820   1.00 40.34 ? 34  LYS C N    1  
ATOM 5269   C CA   . LYS C 1 34  ? -4.154  25.354  9.097   1.00 3.44  ? 34  LYS C CA   1  
ATOM 5270   C C    . LYS C 1 34  ? -2.624  25.441  8.907   1.00 43.51 ? 34  LYS C C    1  
ATOM 5271   O O    . LYS C 1 34  ? -2.083  24.911  7.929   1.00 35.13 ? 34  LYS C O    1  
ATOM 5272   C CB   . LYS C 1 34  ? -4.509  24.263  10.158  1.00 32.23 ? 34  LYS C CB   1  
ATOM 5273   C CG   . LYS C 1 34  ? -4.257  24.639  11.639  1.00 24.31 ? 34  LYS C CG   1  
ATOM 5274   C CD   . LYS C 1 34  ? -5.123  25.833  12.123  1.00 41.13 ? 34  LYS C CD   1  
ATOM 5275   C CE   . LYS C 1 34  ? -6.621  25.679  11.788  1.00 71.33 ? 34  LYS C CE   1  
ATOM 5276   N NZ   . LYS C 1 34  ? -7.134  24.326  12.111  1.00 41.45 ? 34  LYS C NZ   1  
ATOM 5277   H H    . LYS C 1 34  ? -4.836  24.072  7.557   1.00 12.32 ? 34  LYS C H    1  
ATOM 5278   H HA   . LYS C 1 34  ? -4.525  26.319  9.436   1.00 14.11 ? 34  LYS C HA   1  
ATOM 5279   H HB2  . LYS C 1 34  ? -5.562  24.020  10.059  1.00 5.53  ? 34  LYS C HB2  1  
ATOM 5280   H HB3  . LYS C 1 34  ? -3.942  23.357  9.942   1.00 1.51  ? 34  LYS C HB3  1  
ATOM 5281   H HG2  . LYS C 1 34  ? -4.485  23.779  12.262  1.00 43.35 ? 34  LYS C HG2  1  
ATOM 5282   H HG3  . LYS C 1 34  ? -3.209  24.892  11.760  1.00 61.25 ? 34  LYS C HG3  1  
ATOM 5283   H HD2  . LYS C 1 34  ? -5.017  25.920  13.197  1.00 72.54 ? 34  LYS C HD2  1  
ATOM 5284   H HD3  . LYS C 1 34  ? -4.748  26.742  11.660  1.00 62.00 ? 34  LYS C HD3  1  
ATOM 5285   H HE2  . LYS C 1 34  ? -7.190  26.405  12.356  1.00 41.10 ? 34  LYS C HE2  1  
ATOM 5286   H HE3  . LYS C 1 34  ? -6.770  25.864  10.731  1.00 2.10  ? 34  LYS C HE3  1  
ATOM 5287   H HZ1  . LYS C 1 34  ? -6.833  24.050  13.065  1.00 33.55 ? 34  LYS C HZ1  1  
ATOM 5288   H HZ2  . LYS C 1 34  ? -6.769  23.628  11.434  1.00 24.23 ? 34  LYS C HZ2  1  
ATOM 5289   H HZ3  . LYS C 1 34  ? -8.172  24.315  12.078  1.00 71.44 ? 34  LYS C HZ3  1  
ATOM 5290   N N    . ASP C 1 35  ? -1.948  26.111  9.859   1.00 62.22 ? 35  ASP C N    1  
ATOM 5291   C CA   . ASP C 1 35  ? -0.477  26.202  9.905   1.00 42.23 ? 35  ASP C CA   1  
ATOM 5292   C C    . ASP C 1 35  ? 0.121   24.826  10.271  1.00 63.10 ? 35  ASP C C    1  
ATOM 5293   O O    . ASP C 1 35  ? -0.277  24.208  11.270  1.00 41.31 ? 35  ASP C O    1  
ATOM 5294   C CB   . ASP C 1 35  ? -0.041  27.283  10.938  1.00 24.43 ? 35  ASP C CB   1  
ATOM 5295   C CG   . ASP C 1 35  ? 1.487   27.449  11.050  1.00 20.33 ? 35  ASP C CG   1  
ATOM 5296   O OD1  . ASP C 1 35  ? 2.086   28.153  10.205  1.00 40.30 ? 35  ASP C OD1  1  
ATOM 5297   O OD2  . ASP C 1 35  ? 2.100   26.888  11.985  1.00 21.24 ? 35  ASP C OD2  1  
ATOM 5298   H H    . ASP C 1 35  ? -2.460  26.560  10.559  1.00 43.41 ? 35  ASP C H    1  
ATOM 5299   H HA   . ASP C 1 35  ? -0.129  26.494  8.918   1.00 13.30 ? 35  ASP C HA   1  
ATOM 5300   H HB2  . ASP C 1 35  ? -0.469  28.237  10.647  1.00 73.40 ? 35  ASP C HB2  1  
ATOM 5301   H HB3  . ASP C 1 35  ? -0.437  27.018  11.914  1.00 12.43 ? 35  ASP C HB3  1  
ATOM 5302   N N    . TRP C 1 36  ? 1.059   24.359  9.429   1.00 74.32 ? 36  TRP C N    1  
ATOM 5303   C CA   . TRP C 1 36  ? 1.754   23.078  9.614   1.00 72.24 ? 36  TRP C CA   1  
ATOM 5304   C C    . TRP C 1 36  ? 2.817   23.214  10.726  1.00 64.52 ? 36  TRP C C    1  
ATOM 5305   O O    . TRP C 1 36  ? 3.836   23.883  10.532  1.00 61.32 ? 36  TRP C O    1  
ATOM 5306   C CB   . TRP C 1 36  ? 2.404   22.630  8.269   1.00 2.14  ? 36  TRP C CB   1  
ATOM 5307   C CG   . TRP C 1 36  ? 3.153   21.304  8.337   1.00 12.22 ? 36  TRP C CG   1  
ATOM 5308   C CD1  . TRP C 1 36  ? 2.610   20.050  8.439   1.00 41.33 ? 36  TRP C CD1  1  
ATOM 5309   C CD2  . TRP C 1 36  ? 4.584   21.110  8.309   1.00 60.24 ? 36  TRP C CD2  1  
ATOM 5310   N NE1  . TRP C 1 36  ? 3.605   19.103  8.481   1.00 11.24 ? 36  TRP C NE1  1  
ATOM 5311   C CE2  . TRP C 1 36  ? 4.821   19.727  8.399   1.00 63.54 ? 36  TRP C CE2  1  
ATOM 5312   C CE3  . TRP C 1 36  ? 5.681   21.974  8.210   1.00 65.20 ? 36  TRP C CE3  1  
ATOM 5313   C CZ2  . TRP C 1 36  ? 6.105   19.188  8.390   1.00 31.34 ? 36  TRP C CZ2  1  
ATOM 5314   C CZ3  . TRP C 1 36  ? 6.955   21.436  8.210   1.00 61.50 ? 36  TRP C CZ3  1  
ATOM 5315   C CH2  . TRP C 1 36  ? 7.159   20.054  8.297   1.00 40.22 ? 36  TRP C CH2  1  
ATOM 5316   H H    . TRP C 1 36  ? 1.296   24.908  8.653   1.00 72.01 ? 36  TRP C H    1  
ATOM 5317   H HA   . TRP C 1 36  ? 1.016   22.333  9.909   1.00 32.25 ? 36  TRP C HA   1  
ATOM 5318   H HB2  . TRP C 1 36  ? 1.631   22.535  7.517   1.00 4.52  ? 36  TRP C HB2  1  
ATOM 5319   H HB3  . TRP C 1 36  ? 3.105   23.394  7.943   1.00 14.21 ? 36  TRP C HB3  1  
ATOM 5320   H HD1  . TRP C 1 36  ? 1.549   19.849  8.491   1.00 22.33 ? 36  TRP C HD1  1  
ATOM 5321   H HE1  . TRP C 1 36  ? 3.469   18.137  8.557   1.00 11.31 ? 36  TRP C HE1  1  
ATOM 5322   H HE3  . TRP C 1 36  ? 5.544   23.047  8.146   1.00 21.51 ? 36  TRP C HE3  1  
ATOM 5323   H HZ2  . TRP C 1 36  ? 6.276   18.124  8.457   1.00 14.15 ? 36  TRP C HZ2  1  
ATOM 5324   H HZ3  . TRP C 1 36  ? 7.816   22.092  8.138   1.00 44.24 ? 36  TRP C HZ3  1  
ATOM 5325   H HH2  . TRP C 1 36  ? 8.174   19.677  8.292   1.00 2.34  ? 36  TRP C HH2  1  
ATOM 5326   N N    . GLN C 1 37  ? 2.530   22.613  11.894  1.00 35.51 ? 37  GLN C N    1  
ATOM 5327   C CA   . GLN C 1 37  ? 3.479   22.507  13.026  1.00 24.51 ? 37  GLN C CA   1  
ATOM 5328   C C    . GLN C 1 37  ? 2.977   21.358  13.945  1.00 3.53  ? 37  GLN C C    1  
ATOM 5329   O O    . GLN C 1 37  ? 2.384   21.615  14.999  1.00 54.04 ? 37  GLN C O    1  
ATOM 5330   C CB   . GLN C 1 37  ? 3.603   23.895  13.767  1.00 41.01 ? 37  GLN C CB   1  
ATOM 5331   C CG   . GLN C 1 37  ? 4.864   24.098  14.659  1.00 31.23 ? 37  GLN C CG   1  
ATOM 5332   C CD   . GLN C 1 37  ? 4.855   23.313  15.973  1.00 10.04 ? 37  GLN C CD   1  
ATOM 5333   O OE1  . GLN C 1 37  ? 4.387   23.801  17.006  1.00 11.15 ? 37  GLN C OE1  1  
ATOM 5334   N NE2  . GLN C 1 37  ? 5.364   22.091  15.947  1.00 11.51 ? 37  GLN C NE2  1  
ATOM 5335   H H    . GLN C 1 37  ? 1.638   22.228  12.004  1.00 42.43 ? 37  GLN C H    1  
ATOM 5336   H HA   . GLN C 1 37  ? 4.449   22.224  12.624  1.00 22.14 ? 37  GLN C HA   1  
ATOM 5337   H HB2  . GLN C 1 37  ? 3.614   24.676  13.016  1.00 11.35 ? 37  GLN C HB2  1  
ATOM 5338   H HB3  . GLN C 1 37  ? 2.723   24.040  14.384  1.00 43.55 ? 37  GLN C HB3  1  
ATOM 5339   H HG2  . GLN C 1 37  ? 5.734   23.805  14.090  1.00 64.52 ? 37  GLN C HG2  1  
ATOM 5340   H HG3  . GLN C 1 37  ? 4.946   25.151  14.897  1.00 2.31  ? 37  GLN C HG3  1  
ATOM 5341   H HE21 . GLN C 1 37  ? 5.706   21.755  15.097  1.00 53.21 ? 37  GLN C HE21 1  
ATOM 5342   H HE22 . GLN C 1 37  ? 5.357   21.570  16.767  1.00 53.03 ? 37  GLN C HE22 1  
ATOM 5343   N N    . PRO C 1 38  ? 3.132   20.058  13.507  1.00 2.54  ? 38  PRO C N    1  
ATOM 5344   C CA   . PRO C 1 38  ? 2.591   18.888  14.238  1.00 12.51 ? 38  PRO C CA   1  
ATOM 5345   C C    . PRO C 1 38  ? 3.479   18.417  15.415  1.00 53.11 ? 38  PRO C C    1  
ATOM 5346   O O    . PRO C 1 38  ? 4.695   18.256  15.275  1.00 22.21 ? 38  PRO C O    1  
ATOM 5347   C CB   . PRO C 1 38  ? 2.492   17.780  13.131  1.00 20.23 ? 38  PRO C CB   1  
ATOM 5348   C CG   . PRO C 1 38  ? 2.995   18.414  11.853  1.00 43.13 ? 38  PRO C CG   1  
ATOM 5349   C CD   . PRO C 1 38  ? 3.821   19.607  12.272  1.00 64.24 ? 38  PRO C CD   1  
ATOM 5350   H HA   . PRO C 1 38  ? 1.590   19.105  14.611  1.00 10.14 ? 38  PRO C HA   1  
ATOM 5351   H HB2  . PRO C 1 38  ? 3.100   16.912  13.397  1.00 33.24 ? 38  PRO C HB2  1  
ATOM 5352   H HB3  . PRO C 1 38  ? 1.462   17.465  13.009  1.00 25.45 ? 38  PRO C HB3  1  
ATOM 5353   H HG2  . PRO C 1 38  ? 3.607   17.704  11.299  1.00 15.15 ? 38  PRO C HG2  1  
ATOM 5354   H HG3  . PRO C 1 38  ? 2.162   18.739  11.236  1.00 13.21 ? 38  PRO C HG3  1  
ATOM 5355   H HD2  . PRO C 1 38  ? 4.849   19.315  12.482  1.00 11.13 ? 38  PRO C HD2  1  
ATOM 5356   H HD3  . PRO C 1 38  ? 3.802   20.375  11.505  1.00 44.04 ? 38  PRO C HD3  1  
ATOM 5357   N N    . GLU C 1 39  ? 2.828   18.161  16.555  1.00 12.22 ? 39  GLU C N    1  
ATOM 5358   C CA   . GLU C 1 39  ? 3.414   17.489  17.712  1.00 71.11 ? 39  GLU C CA   1  
ATOM 5359   C C    . GLU C 1 39  ? 3.217   15.993  17.485  1.00 73.45 ? 39  GLU C C    1  
ATOM 5360   O O    . GLU C 1 39  ? 2.121   15.460  17.725  1.00 33.51 ? 39  GLU C O    1  
ATOM 5361   C CB   . GLU C 1 39  ? 2.717   17.931  19.035  1.00 63.41 ? 39  GLU C CB   1  
ATOM 5362   C CG   . GLU C 1 39  ? 2.772   19.441  19.332  1.00 74.24 ? 39  GLU C CG   1  
ATOM 5363   C CD   . GLU C 1 39  ? 4.200   19.996  19.466  1.00 23.53 ? 39  GLU C CD   1  
ATOM 5364   O OE1  . GLU C 1 39  ? 4.651   20.753  18.585  1.00 61.43 ? 39  GLU C OE1  1  
ATOM 5365   O OE2  . GLU C 1 39  ? 4.875   19.681  20.465  1.00 4.50  ? 39  GLU C OE2  1  
ATOM 5366   H H    . GLU C 1 39  ? 1.909   18.423  16.611  1.00 75.43 ? 39  GLU C H    1  
ATOM 5367   H HA   . GLU C 1 39  ? 4.478   17.718  17.762  1.00 22.33 ? 39  GLU C HA   1  
ATOM 5368   H HB2  . GLU C 1 39  ? 1.669   17.644  18.982  1.00 5.40  ? 39  GLU C HB2  1  
ATOM 5369   H HB3  . GLU C 1 39  ? 3.170   17.403  19.867  1.00 75.21 ? 39  GLU C HB3  1  
ATOM 5370   H HG2  . GLU C 1 39  ? 2.261   19.963  18.528  1.00 2.43  ? 39  GLU C HG2  1  
ATOM 5371   H HG3  . GLU C 1 39  ? 2.237   19.633  20.258  1.00 54.22 ? 39  GLU C HG3  1  
ATOM 5372   N N    . VAL C 1 40  ? 4.245   15.343  16.926  1.00 5.23  ? 40  VAL C N    1  
ATOM 5373   C CA   . VAL C 1 40  ? 4.182   13.923  16.578  1.00 33.12 ? 40  VAL C CA   1  
ATOM 5374   C C    . VAL C 1 40  ? 4.311   13.065  17.855  1.00 44.10 ? 40  VAL C C    1  
ATOM 5375   O O    . VAL C 1 40  ? 5.408   12.807  18.371  1.00 73.21 ? 40  VAL C O    1  
ATOM 5376   C CB   . VAL C 1 40  ? 5.262   13.547  15.483  1.00 31.24 ? 40  VAL C CB   1  
ATOM 5377   C CG1  . VAL C 1 40  ? 4.889   14.170  14.118  1.00 15.22 ? 40  VAL C CG1  1  
ATOM 5378   C CG2  . VAL C 1 40  ? 6.686   13.987  15.896  1.00 53.05 ? 40  VAL C CG2  1  
ATOM 5379   H H    . VAL C 1 40  ? 5.073   15.836  16.757  1.00 32.55 ? 40  VAL C H    1  
ATOM 5380   H HA   . VAL C 1 40  ? 3.196   13.734  16.141  1.00 60.14 ? 40  VAL C HA   1  
ATOM 5381   H HB   . VAL C 1 40  ? 5.264   12.463  15.362  1.00 13.10 ? 40  VAL C HB   1  
ATOM 5382   H HG11 . VAL C 1 40  ? 3.919   13.808  13.804  1.00 70.43 ? 40  VAL C HG11 1  
ATOM 5383   H HG12 . VAL C 1 40  ? 5.626   13.896  13.374  1.00 33.13 ? 40  VAL C HG12 1  
ATOM 5384   H HG13 . VAL C 1 40  ? 4.855   15.252  14.205  1.00 25.21 ? 40  VAL C HG13 1  
ATOM 5385   H HG21 . VAL C 1 40  ? 6.967   13.487  16.815  1.00 35.12 ? 40  VAL C HG21 1  
ATOM 5386   H HG22 . VAL C 1 40  ? 6.708   15.058  16.057  1.00 51.34 ? 40  VAL C HG22 1  
ATOM 5387   H HG23 . VAL C 1 40  ? 7.396   13.727  15.120  1.00 20.31 ? 40  VAL C HG23 1  
ATOM 5388   N N    . LYS C 1 41  ? 3.145   12.666  18.378  1.00 35.32 ? 41  LYS C N    1  
ATOM 5389   C CA   . LYS C 1 41  ? 3.033   11.770  19.526  1.00 20.32 ? 41  LYS C CA   1  
ATOM 5390   C C    . LYS C 1 41  ? 2.716   10.369  19.005  1.00 30.53 ? 41  LYS C C    1  
ATOM 5391   O O    . LYS C 1 41  ? 1.592   10.086  18.580  1.00 5.23  ? 41  LYS C O    1  
ATOM 5392   C CB   . LYS C 1 41  ? 1.924   12.261  20.506  1.00 31.32 ? 41  LYS C CB   1  
ATOM 5393   C CG   . LYS C 1 41  ? 1.785   11.406  21.798  1.00 0.04  ? 41  LYS C CG   1  
ATOM 5394   C CD   . LYS C 1 41  ? 0.617   11.857  22.713  1.00 30.50 ? 41  LYS C CD   1  
ATOM 5395   C CE   . LYS C 1 41  ? 0.720   13.332  23.143  1.00 51.31 ? 41  LYS C CE   1  
ATOM 5396   N NZ   . LYS C 1 41  ? -0.343  13.708  24.115  1.00 64.01 ? 41  LYS C NZ   1  
ATOM 5397   H H    . LYS C 1 41  ? 2.325   13.003  17.972  1.00 71.34 ? 41  LYS C H    1  
ATOM 5398   H HA   . LYS C 1 41  ? 3.990   11.752  20.055  1.00 60.21 ? 41  LYS C HA   1  
ATOM 5399   H HB2  . LYS C 1 41  ? 2.151   13.282  20.798  1.00 32.11 ? 41  LYS C HB2  1  
ATOM 5400   H HB3  . LYS C 1 41  ? 0.967   12.259  19.988  1.00 72.30 ? 41  LYS C HB3  1  
ATOM 5401   H HG2  . LYS C 1 41  ? 1.620   10.371  21.514  1.00 32.12 ? 41  LYS C HG2  1  
ATOM 5402   H HG3  . LYS C 1 41  ? 2.713   11.468  22.359  1.00 4.31  ? 41  LYS C HG3  1  
ATOM 5403   H HD2  . LYS C 1 41  ? -0.319  11.718  22.184  1.00 41.52 ? 41  LYS C HD2  1  
ATOM 5404   H HD3  . LYS C 1 41  ? 0.609   11.237  23.604  1.00 20.53 ? 41  LYS C HD3  1  
ATOM 5405   H HE2  . LYS C 1 41  ? 1.686   13.498  23.605  1.00 55.23 ? 41  LYS C HE2  1  
ATOM 5406   H HE3  . LYS C 1 41  ? 0.633   13.964  22.267  1.00 75.44 ? 41  LYS C HE3  1  
ATOM 5407   H HZ1  . LYS C 1 41  ? -1.282  13.483  23.730  1.00 70.32 ? 41  LYS C HZ1  1  
ATOM 5408   H HZ2  . LYS C 1 41  ? -0.303  14.727  24.317  1.00 52.21 ? 41  LYS C HZ2  1  
ATOM 5409   H HZ3  . LYS C 1 41  ? -0.215  13.189  25.007  1.00 51.21 ? 41  LYS C HZ3  1  
ATOM 5410   N N    . LEU C 1 42  ? 3.733   9.515   18.993  1.00 61.52 ? 42  LEU C N    1  
ATOM 5411   C CA   . LEU C 1 42  ? 3.590   8.108   18.630  1.00 41.30 ? 42  LEU C CA   1  
ATOM 5412   C C    . LEU C 1 42  ? 3.239   7.330   19.902  1.00 63.33 ? 42  LEU C C    1  
ATOM 5413   O O    . LEU C 1 42  ? 3.886   7.517   20.945  1.00 33.44 ? 42  LEU C O    1  
ATOM 5414   C CB   . LEU C 1 42  ? 4.903   7.536   18.023  1.00 44.41 ? 42  LEU C CB   1  
ATOM 5415   C CG   . LEU C 1 42  ? 5.375   8.130   16.653  1.00 63.42 ? 42  LEU C CG   1  
ATOM 5416   C CD1  . LEU C 1 42  ? 5.910   9.577   16.779  1.00 30.44 ? 42  LEU C CD1  1  
ATOM 5417   C CD2  . LEU C 1 42  ? 6.415   7.203   16.010  1.00 25.14 ? 42  LEU C CD2  1  
ATOM 5418   H H    . LEU C 1 42  ? 4.618   9.840   19.250  1.00 35.34 ? 42  LEU C H    1  
ATOM 5419   H HA   . LEU C 1 42  ? 2.780   8.011   17.882  1.00 11.54 ? 42  LEU C HA   1  
ATOM 5420   H HB2  . LEU C 1 42  ? 5.703   7.679   18.748  1.00 30.24 ? 42  LEU C HB2  1  
ATOM 5421   H HB3  . LEU C 1 42  ? 4.765   6.465   17.894  1.00 72.44 ? 42  LEU C HB3  1  
ATOM 5422   H HG   . LEU C 1 42  ? 4.525   8.170   15.982  1.00 4.43  ? 42  LEU C HG   1  
ATOM 5423   H HD11 . LEU C 1 42  ? 6.770   9.595   17.438  1.00 13.44 ? 42  LEU C HD11 1  
ATOM 5424   H HD12 . LEU C 1 42  ? 5.137   10.215  17.185  1.00 32.51 ? 42  LEU C HD12 1  
ATOM 5425   H HD13 . LEU C 1 42  ? 6.196   9.947   15.803  1.00 42.31 ? 42  LEU C HD13 1  
ATOM 5426   H HD21 . LEU C 1 42  ? 5.968   6.231   15.828  1.00 44.02 ? 42  LEU C HD21 1  
ATOM 5427   H HD22 . LEU C 1 42  ? 7.262   7.085   16.668  1.00 43.12 ? 42  LEU C HD22 1  
ATOM 5428   H HD23 . LEU C 1 42  ? 6.746   7.618   15.070  1.00 23.30 ? 42  LEU C HD23 1  
ATOM 5429   N N    . ASP C 1 43  ? 2.226   6.470   19.820  1.00 73.31 ? 43  ASP C N    1  
ATOM 5430   C CA   . ASP C 1 43  ? 1.859   5.559   20.912  1.00 40.12 ? 43  ASP C CA   1  
ATOM 5431   C C    . ASP C 1 43  ? 2.039   4.133   20.399  1.00 71.13 ? 43  ASP C C    1  
ATOM 5432   O O    . ASP C 1 43  ? 1.259   3.649   19.569  1.00 42.24 ? 43  ASP C O    1  
ATOM 5433   C CB   . ASP C 1 43  ? 0.400   5.808   21.384  1.00 32.23 ? 43  ASP C CB   1  
ATOM 5434   C CG   . ASP C 1 43  ? -0.007  4.927   22.590  1.00 51.54 ? 43  ASP C CG   1  
ATOM 5435   O OD1  . ASP C 1 43  ? 0.276   5.314   23.744  1.00 52.44 ? 43  ASP C OD1  1  
ATOM 5436   O OD2  . ASP C 1 43  ? -0.608  3.847   22.396  1.00 32.52 ? 43  ASP C OD2  1  
ATOM 5437   H H    . ASP C 1 43  ? 1.703   6.444   19.001  1.00 24.12 ? 43  ASP C H    1  
ATOM 5438   H HA   . ASP C 1 43  ? 2.540   5.723   21.752  1.00 75.43 ? 43  ASP C HA   1  
ATOM 5439   H HB2  . ASP C 1 43  ? 0.298   6.851   21.668  1.00 43.54 ? 43  ASP C HB2  1  
ATOM 5440   H HB3  . ASP C 1 43  ? -0.279  5.615   20.560  1.00 0.31  ? 43  ASP C HB3  1  
ATOM 5441   N N    . LEU C 1 44  ? 3.120   3.495   20.854  1.00 4.51  ? 44  LEU C N    1  
ATOM 5442   C CA   . LEU C 1 44  ? 3.473   2.127   20.470  1.00 3.52  ? 44  LEU C CA   1  
ATOM 5443   C C    . LEU C 1 44  ? 2.944   1.156   21.524  1.00 11.30 ? 44  LEU C C    1  
ATOM 5444   O O    . LEU C 1 44  ? 2.940   1.462   22.721  1.00 31.24 ? 44  LEU C O    1  
ATOM 5445   C CB   . LEU C 1 44  ? 5.014   1.988   20.306  1.00 60.42 ? 44  LEU C CB   1  
ATOM 5446   C CG   . LEU C 1 44  ? 5.659   2.888   19.201  1.00 60.33 ? 44  LEU C CG   1  
ATOM 5447   C CD1  . LEU C 1 44  ? 7.177   2.651   19.096  1.00 2.12  ? 44  LEU C CD1  1  
ATOM 5448   C CD2  . LEU C 1 44  ? 4.974   2.675   17.837  1.00 12.45 ? 44  LEU C CD2  1  
ATOM 5449   H H    . LEU C 1 44  ? 3.696   3.959   21.493  1.00 21.04 ? 44  LEU C H    1  
ATOM 5450   H HA   . LEU C 1 44  ? 2.996   1.903   19.512  1.00 62.13 ? 44  LEU C HA   1  
ATOM 5451   H HB2  . LEU C 1 44  ? 5.479   2.227   21.257  1.00 31.23 ? 44  LEU C HB2  1  
ATOM 5452   H HB3  . LEU C 1 44  ? 5.242   0.951   20.071  1.00 42.21 ? 44  LEU C HB3  1  
ATOM 5453   H HG   . LEU C 1 44  ? 5.516   3.929   19.474  1.00 11.21 ? 44  LEU C HG   1  
ATOM 5454   H HD11 . LEU C 1 44  ? 7.596   3.296   18.333  1.00 21.51 ? 44  LEU C HD11 1  
ATOM 5455   H HD12 . LEU C 1 44  ? 7.376   1.617   18.838  1.00 5.43  ? 44  LEU C HD12 1  
ATOM 5456   H HD13 . LEU C 1 44  ? 7.644   2.878   20.045  1.00 72.54 ? 44  LEU C HD13 1  
ATOM 5457   H HD21 . LEU C 1 44  ? 5.450   3.298   17.090  1.00 1.43  ? 44  LEU C HD21 1  
ATOM 5458   H HD22 . LEU C 1 44  ? 3.931   2.950   17.907  1.00 53.42 ? 44  LEU C HD22 1  
ATOM 5459   H HD23 . LEU C 1 44  ? 5.052   1.636   17.542  1.00 12.21 ? 44  LEU C HD23 1  
ATOM 5460   N N    . ASP C 1 45  ? 2.491   -0.001  21.059  1.00 64.21 ? 45  ASP C N    1  
ATOM 5461   C CA   . ASP C 1 45  ? 1.950   -1.069  21.905  1.00 31.44 ? 45  ASP C CA   1  
ATOM 5462   C C    . ASP C 1 45  ? 2.260   -2.416  21.261  1.00 13.20 ? 45  ASP C C    1  
ATOM 5463   O O    . ASP C 1 45  ? 2.276   -2.523  20.036  1.00 33.10 ? 45  ASP C O    1  
ATOM 5464   C CB   . ASP C 1 45  ? 0.419   -0.871  22.118  1.00 41.35 ? 45  ASP C CB   1  
ATOM 5465   C CG   . ASP C 1 45  ? -0.293  -2.081  22.768  1.00 50.41 ? 45  ASP C CG   1  
ATOM 5466   O OD1  . ASP C 1 45  ? -0.126  -2.296  23.988  1.00 65.24 ? 45  ASP C OD1  1  
ATOM 5467   O OD2  . ASP C 1 45  ? -1.020  -2.818  22.057  1.00 44.12 ? 45  ASP C OD2  1  
ATOM 5468   H H    . ASP C 1 45  ? 2.516   -0.153  20.092  1.00 24.54 ? 45  ASP C H    1  
ATOM 5469   H HA   . ASP C 1 45  ? 2.452   -1.023  22.871  1.00 60.42 ? 45  ASP C HA   1  
ATOM 5470   H HB2  . ASP C 1 45  ? 0.264   -0.005  22.754  1.00 75.15 ? 45  ASP C HB2  1  
ATOM 5471   H HB3  . ASP C 1 45  ? -0.041  -0.665  21.160  1.00 24.33 ? 45  ASP C HB3  1  
ATOM 5472   N N    . THR C 1 46  ? 2.538   -3.424  22.089  1.00 13.41 ? 46  THR C N    1  
ATOM 5473   C CA   . THR C 1 46  ? 2.692   -4.804  21.630  1.00 33.05 ? 46  THR C CA   1  
ATOM 5474   C C    . THR C 1 46  ? 1.995   -5.736  22.633  1.00 64.42 ? 46  THR C C    1  
ATOM 5475   O O    . THR C 1 46  ? 2.251   -5.685  23.845  1.00 5.00  ? 46  THR C O    1  
ATOM 5476   C CB   . THR C 1 46  ? 4.196   -5.204  21.395  1.00 32.51 ? 46  THR C CB   1  
ATOM 5477   O OG1  . THR C 1 46  ? 4.262   -6.497  20.763  1.00 11.01 ? 46  THR C OG1  1  
ATOM 5478   C CG2  . THR C 1 46  ? 5.037   -5.227  22.691  1.00 64.41 ? 46  THR C CG2  1  
ATOM 5479   H H    . THR C 1 46  ? 2.622   -3.236  23.051  1.00 74.25 ? 46  THR C H    1  
ATOM 5480   H HA   . THR C 1 46  ? 2.173   -4.892  20.669  1.00 10.02 ? 46  THR C HA   1  
ATOM 5481   H HB   . THR C 1 46  ? 4.632   -4.477  20.714  1.00 41.10 ? 46  THR C HB   1  
ATOM 5482   H HG1  . THR C 1 46  ? 3.612   -6.543  20.053  1.00 12.33 ? 46  THR C HG1  1  
ATOM 5483   H HG21 . THR C 1 46  ? 4.850   -4.329  23.264  1.00 24.52 ? 46  THR C HG21 1  
ATOM 5484   H HG22 . THR C 1 46  ? 6.089   -5.279  22.443  1.00 70.01 ? 46  THR C HG22 1  
ATOM 5485   H HG23 . THR C 1 46  ? 4.770   -6.092  23.286  1.00 71.22 ? 46  THR C HG23 1  
ATOM 5486   N N    . ALA C 1 47  ? 1.078   -6.547  22.119  1.00 70.42 ? 47  ALA C N    1  
ATOM 5487   C CA   . ALA C 1 47  ? 0.284   -7.478  22.918  1.00 61.04 ? 47  ALA C CA   1  
ATOM 5488   C C    . ALA C 1 47  ? 0.228   -8.821  22.196  1.00 62.14 ? 47  ALA C C    1  
ATOM 5489   O O    . ALA C 1 47  ? 0.192   -8.864  20.963  1.00 23.32 ? 47  ALA C O    1  
ATOM 5490   C CB   . ALA C 1 47  ? -1.127  -6.904  23.158  1.00 34.33 ? 47  ALA C CB   1  
ATOM 5491   H H    . ALA C 1 47  ? 0.928   -6.525  21.151  1.00 54.35 ? 47  ALA C H    1  
ATOM 5492   H HA   . ALA C 1 47  ? 0.775   -7.610  23.884  1.00 21.21 ? 47  ALA C HA   1  
ATOM 5493   H HB1  . ALA C 1 47  ? -1.734  -7.628  23.687  1.00 60.55 ? 47  ALA C HB1  1  
ATOM 5494   H HB2  . ALA C 1 47  ? -1.596  -6.667  22.211  1.00 22.44 ? 47  ALA C HB2  1  
ATOM 5495   H HB3  . ALA C 1 47  ? -1.049  -6.008  23.751  1.00 55.55 ? 47  ALA C HB3  1  
ATOM 5496   N N    . SER C 1 48  ? 0.217   -9.908  22.965  1.00 13.14 ? 48  SER C N    1  
ATOM 5497   C CA   . SER C 1 48  ? 0.245   -11.274 22.421  1.00 1.31  ? 48  SER C CA   1  
ATOM 5498   C C    . SER C 1 48  ? -0.856  -12.144 23.051  1.00 4.35  ? 48  SER C C    1  
ATOM 5499   O O    . SER C 1 48  ? -1.317  -11.882 24.171  1.00 63.31 ? 48  SER C O    1  
ATOM 5500   C CB   . SER C 1 48  ? 1.646   -11.896 22.623  1.00 45.30 ? 48  SER C CB   1  
ATOM 5501   O OG   . SER C 1 48  ? 2.043   -11.833 23.980  1.00 32.30 ? 48  SER C OG   1  
ATOM 5502   H H    . SER C 1 48  ? 0.180   -9.791  23.938  1.00 65.12 ? 48  SER C H    1  
ATOM 5503   H HA   . SER C 1 48  ? 0.048   -11.216 21.345  1.00 12.12 ? 48  SER C HA   1  
ATOM 5504   H HB2  . SER C 1 48  ? 1.631   -12.935 22.317  1.00 74.01 ? 48  SER C HB2  1  
ATOM 5505   H HB3  . SER C 1 48  ? 2.375   -11.365 22.018  1.00 72.00 ? 48  SER C HB3  1  
ATOM 5506   H HG   . SER C 1 48  ? 2.612   -12.576 24.179  1.00 41.22 ? 48  SER C HG   1  
ATOM 5507   N N    . SER C 1 49  ? -1.248  -13.192 22.314  1.00 10.00 ? 49  SER C N    1  
ATOM 5508   C CA   . SER C 1 49  ? -2.370  -14.072 22.657  1.00 73.45 ? 49  SER C CA   1  
ATOM 5509   C C    . SER C 1 49  ? -2.047  -15.506 22.229  1.00 75.03 ? 49  SER C C    1  
ATOM 5510   O O    . SER C 1 49  ? -1.457  -15.726 21.168  1.00 45.34 ? 49  SER C O    1  
ATOM 5511   C CB   . SER C 1 49  ? -3.648  -13.573 21.941  1.00 4.22  ? 49  SER C CB   1  
ATOM 5512   O OG   . SER C 1 49  ? -4.749  -14.451 22.132  1.00 21.43 ? 49  SER C OG   1  
ATOM 5513   H H    . SER C 1 49  ? -0.760  -13.383 21.484  1.00 62.51 ? 49  SER C H    1  
ATOM 5514   H HA   . SER C 1 49  ? -2.523  -14.043 23.736  1.00 54.24 ? 49  SER C HA   1  
ATOM 5515   H HB2  . SER C 1 49  ? -3.922  -12.600 22.326  1.00 64.03 ? 49  SER C HB2  1  
ATOM 5516   H HB3  . SER C 1 49  ? -3.456  -13.491 20.877  1.00 22.42 ? 49  SER C HB3  1  
ATOM 5517   H HG   . SER C 1 49  ? -5.007  -14.827 21.281  1.00 53.42 ? 49  SER C HG   1  
ATOM 5518   N N    . GLN C 1 50  ? -2.415  -16.478 23.070  1.00 23.31 ? 50  GLN C N    1  
ATOM 5519   C CA   . GLN C 1 50  ? -2.260  -17.904 22.752  1.00 1.42  ? 50  GLN C CA   1  
ATOM 5520   C C    . GLN C 1 50  ? -3.533  -18.369 22.026  1.00 24.33 ? 50  GLN C C    1  
ATOM 5521   O O    . GLN C 1 50  ? -4.631  -18.273 22.583  1.00 53.43 ? 50  GLN C O    1  
ATOM 5522   C CB   . GLN C 1 50  ? -2.028  -18.725 24.056  1.00 71.34 ? 50  GLN C CB   1  
ATOM 5523   C CG   . GLN C 1 50  ? -1.371  -20.110 23.848  1.00 51.11 ? 50  GLN C CG   1  
ATOM 5524   C CD   . GLN C 1 50  ? 0.110   -20.026 23.463  1.00 33.15 ? 50  GLN C CD   1  
ATOM 5525   O OE1  . GLN C 1 50  ? 0.816   -19.097 23.833  1.00 51.22 ? 50  GLN C OE1  1  
ATOM 5526   N NE2  . GLN C 1 50  ? 0.598   -21.008 22.743  1.00 24.10 ? 50  GLN C NE2  1  
ATOM 5527   H H    . GLN C 1 50  ? -2.815  -16.232 23.929  1.00 52.44 ? 50  GLN C H    1  
ATOM 5528   H HA   . GLN C 1 50  ? -1.401  -18.026 22.090  1.00 42.21 ? 50  GLN C HA   1  
ATOM 5529   H HB2  . GLN C 1 50  ? -1.384  -18.151 24.718  1.00 60.42 ? 50  GLN C HB2  1  
ATOM 5530   H HB3  . GLN C 1 50  ? -2.980  -18.869 24.556  1.00 11.33 ? 50  GLN C HB3  1  
ATOM 5531   H HG2  . GLN C 1 50  ? -1.450  -20.682 24.766  1.00 53.44 ? 50  GLN C HG2  1  
ATOM 5532   H HG3  . GLN C 1 50  ? -1.905  -20.631 23.057  1.00 41.41 ? 50  GLN C HG3  1  
ATOM 5533   H HE21 . GLN C 1 50  ? -0.002  -21.737 22.490  1.00 22.32 ? 50  GLN C HE21 1  
ATOM 5534   H HE22 . GLN C 1 50  ? 1.538   -20.967 22.489  1.00 14.14 ? 50  GLN C HE22 1  
ATOM 5535   N N    . LEU C 1 51  ? -3.393  -18.822 20.776  1.00 65.31 ? 51  LEU C N    1  
ATOM 5536   C CA   . LEU C 1 51  ? -4.541  -19.294 19.962  1.00 14.04 ? 51  LEU C CA   1  
ATOM 5537   C C    . LEU C 1 51  ? -4.742  -20.792 20.190  1.00 25.04 ? 51  LEU C C    1  
ATOM 5538   O O    . LEU C 1 51  ? -5.854  -21.269 20.443  1.00 72.03 ? 51  LEU C O    1  
ATOM 5539   C CB   . LEU C 1 51  ? -4.283  -18.992 18.467  1.00 71.11 ? 51  LEU C CB   1  
ATOM 5540   C CG   . LEU C 1 51  ? -3.954  -17.505 18.153  1.00 52.31 ? 51  LEU C CG   1  
ATOM 5541   C CD1  . LEU C 1 51  ? -3.600  -17.299 16.674  1.00 35.12 ? 51  LEU C CD1  1  
ATOM 5542   C CD2  . LEU C 1 51  ? -5.103  -16.563 18.589  1.00 62.41 ? 51  LEU C CD2  1  
ATOM 5543   H H    . LEU C 1 51  ? -2.491  -18.841 20.385  1.00 11.34 ? 51  LEU C H    1  
ATOM 5544   H HA   . LEU C 1 51  ? -5.434  -18.763 20.283  1.00 62.14 ? 51  LEU C HA   1  
ATOM 5545   H HB2  . LEU C 1 51  ? -3.448  -19.607 18.133  1.00 61.15 ? 51  LEU C HB2  1  
ATOM 5546   H HB3  . LEU C 1 51  ? -5.162  -19.277 17.897  1.00 41.31 ? 51  LEU C HB3  1  
ATOM 5547   H HG   . LEU C 1 51  ? -3.078  -17.220 18.726  1.00 32.41 ? 51  LEU C HG   1  
ATOM 5548   H HD11 . LEU C 1 51  ? -2.929  -18.071 16.333  1.00 21.42 ? 51  LEU C HD11 1  
ATOM 5549   H HD12 . LEU C 1 51  ? -3.103  -16.348 16.570  1.00 3.11  ? 51  LEU C HD12 1  
ATOM 5550   H HD13 . LEU C 1 51  ? -4.488  -17.294 16.065  1.00 3.43  ? 51  LEU C HD13 1  
ATOM 5551   H HD21 . LEU C 1 51  ? -5.268  -16.659 19.654  1.00 12.25 ? 51  LEU C HD21 1  
ATOM 5552   H HD22 . LEU C 1 51  ? -6.013  -16.821 18.061  1.00 65.22 ? 51  LEU C HD22 1  
ATOM 5553   H HD23 . LEU C 1 51  ? -4.838  -15.540 18.364  1.00 12.12 ? 51  LEU C HD23 1  
ATOM 5554   N N    . ALA C 1 52  ? -3.627  -21.510 20.083  1.00 11.05 ? 52  ALA C N    1  
ATOM 5555   C CA   . ALA C 1 52  ? -3.513  -22.925 20.447  1.00 45.21 ? 52  ALA C CA   1  
ATOM 5556   C C    . ALA C 1 52  ? -2.134  -23.161 21.038  1.00 20.51 ? 52  ALA C C    1  
ATOM 5557   O O    . ALA C 1 52  ? -1.339  -22.224 21.154  1.00 14.13 ? 52  ALA C O    1  
ATOM 5558   C CB   . ALA C 1 52  ? -3.764  -23.839 19.233  1.00 50.01 ? 52  ALA C CB   1  
ATOM 5559   H H    . ALA C 1 52  ? -2.824  -21.063 19.741  1.00 41.25 ? 52  ALA C H    1  
ATOM 5560   H HA   . ALA C 1 52  ? -4.245  -23.151 21.212  1.00 51.43 ? 52  ALA C HA   1  
ATOM 5561   H HB1  . ALA C 1 52  ? -3.489  -24.859 19.474  1.00 5.03  ? 52  ALA C HB1  1  
ATOM 5562   H HB2  . ALA C 1 52  ? -3.180  -23.502 18.385  1.00 55.35 ? 52  ALA C HB2  1  
ATOM 5563   H HB3  . ALA C 1 52  ? -4.806  -23.813 18.979  1.00 53.23 ? 52  ALA C HB3  1  
ATOM 5564   N N    . ASP C 1 53  ? -1.866  -24.429 21.379  1.00 44.51 ? 53  ASP C N    1  
ATOM 5565   C CA   . ASP C 1 53  ? -0.612  -24.853 22.032  1.00 62.22 ? 53  ASP C CA   1  
ATOM 5566   C C    . ASP C 1 53  ? 0.609   -24.505 21.149  1.00 2.11  ? 53  ASP C C    1  
ATOM 5567   O O    . ASP C 1 53  ? 0.768   -25.054 20.053  1.00 10.33 ? 53  ASP C O    1  
ATOM 5568   C CB   . ASP C 1 53  ? -0.667  -26.370 22.349  1.00 5.30  ? 53  ASP C CB   1  
ATOM 5569   C CG   . ASP C 1 53  ? 0.592   -26.885 23.064  1.00 72.14 ? 53  ASP C CG   1  
ATOM 5570   O OD1  . ASP C 1 53  ? 0.718   -26.671 24.283  1.00 15.31 ? 53  ASP C OD1  1  
ATOM 5571   O OD2  . ASP C 1 53  ? 1.456   -27.511 22.412  1.00 4.12  ? 53  ASP C OD2  1  
ATOM 5572   H H    . ASP C 1 53  ? -2.544  -25.117 21.172  1.00 3.32  ? 53  ASP C H    1  
ATOM 5573   H HA   . ASP C 1 53  ? -0.538  -24.305 22.970  1.00 2.43  ? 53  ASP C HA   1  
ATOM 5574   H HB2  . ASP C 1 53  ? -1.525  -26.566 22.985  1.00 75.10 ? 53  ASP C HB2  1  
ATOM 5575   H HB3  . ASP C 1 53  ? -0.800  -26.922 21.421  1.00 74.15 ? 53  ASP C HB3  1  
ATOM 5576   N N    . ASP C 1 54  ? 1.407   -23.522 21.633  1.00 53.33 ? 54  ASP C N    1  
ATOM 5577   C CA   . ASP C 1 54  ? 2.637   -23.010 20.975  1.00 64.22 ? 54  ASP C CA   1  
ATOM 5578   C C    . ASP C 1 54  ? 2.356   -22.238 19.667  1.00 10.25 ? 54  ASP C C    1  
ATOM 5579   O O    . ASP C 1 54  ? 3.287   -21.888 18.929  1.00 1.45  ? 54  ASP C O    1  
ATOM 5580   C CB   . ASP C 1 54  ? 3.676   -24.152 20.759  1.00 51.43 ? 54  ASP C CB   1  
ATOM 5581   C CG   . ASP C 1 54  ? 4.159   -24.832 22.053  1.00 11.52 ? 54  ASP C CG   1  
ATOM 5582   O OD1  . ASP C 1 54  ? 3.676   -24.504 23.163  1.00 71.04 ? 54  ASP C OD1  1  
ATOM 5583   O OD2  . ASP C 1 54  ? 5.024   -25.726 21.973  1.00 33.22 ? 54  ASP C OD2  1  
ATOM 5584   H H    . ASP C 1 54  ? 1.167   -23.136 22.498  1.00 63.21 ? 54  ASP C H    1  
ATOM 5585   H HA   . ASP C 1 54  ? 3.067   -22.294 21.666  1.00 54.42 ? 54  ASP C HA   1  
ATOM 5586   H HB2  . ASP C 1 54  ? 3.228   -24.913 20.132  1.00 62.55 ? 54  ASP C HB2  1  
ATOM 5587   H HB3  . ASP C 1 54  ? 4.542   -23.746 20.246  1.00 55.11 ? 54  ASP C HB3  1  
ATOM 5588   N N    . VAL C 1 55  ? 1.069   -21.960 19.394  1.00 40.42 ? 55  VAL C N    1  
ATOM 5589   C CA   . VAL C 1 55  ? 0.646   -21.096 18.284  1.00 0.42  ? 55  VAL C CA   1  
ATOM 5590   C C    . VAL C 1 55  ? 0.504   -19.675 18.844  1.00 11.23 ? 55  VAL C C    1  
ATOM 5591   O O    . VAL C 1 55  ? -0.426  -19.365 19.605  1.00 4.00  ? 55  VAL C O    1  
ATOM 5592   C CB   . VAL C 1 55  ? -0.693  -21.592 17.625  1.00 40.14 ? 55  VAL C CB   1  
ATOM 5593   C CG1  . VAL C 1 55  ? -1.169  -20.628 16.504  1.00 2.53  ? 55  VAL C CG1  1  
ATOM 5594   C CG2  . VAL C 1 55  ? -0.519  -23.029 17.079  1.00 72.00 ? 55  VAL C CG2  1  
ATOM 5595   H H    . VAL C 1 55  ? 0.382   -22.347 19.964  1.00 14.24 ? 55  VAL C H    1  
ATOM 5596   H HA   . VAL C 1 55  ? 1.430   -21.112 17.520  1.00 30.12 ? 55  VAL C HA   1  
ATOM 5597   H HB   . VAL C 1 55  ? -1.461  -21.615 18.392  1.00 2.30  ? 55  VAL C HB   1  
ATOM 5598   H HG11 . VAL C 1 55  ? -1.256  -19.625 16.894  1.00 41.03 ? 55  VAL C HG11 1  
ATOM 5599   H HG12 . VAL C 1 55  ? -2.135  -20.947 16.132  1.00 5.12  ? 55  VAL C HG12 1  
ATOM 5600   H HG13 . VAL C 1 55  ? -0.458  -20.629 15.690  1.00 64.10 ? 55  VAL C HG13 1  
ATOM 5601   H HG21 . VAL C 1 55  ? 0.132   -23.016 16.213  1.00 24.03 ? 55  VAL C HG21 1  
ATOM 5602   H HG22 . VAL C 1 55  ? -1.481  -23.438 16.799  1.00 72.15 ? 55  VAL C HG22 1  
ATOM 5603   H HG23 . VAL C 1 55  ? -0.072  -23.655 17.842  1.00 45.54 ? 55  VAL C HG23 1  
ATOM 5604   N N    . TYR C 1 56  ? 1.457   -18.843 18.457  1.00 65.11 ? 56  TYR C N    1  
ATOM 5605   C CA   . TYR C 1 56  ? 1.747   -17.556 19.084  1.00 44.11 ? 56  TYR C CA   1  
ATOM 5606   C C    . TYR C 1 56  ? 1.150   -16.451 18.202  1.00 62.34 ? 56  TYR C C    1  
ATOM 5607   O O    . TYR C 1 56  ? 1.488   -16.356 17.022  1.00 74.15 ? 56  TYR C O    1  
ATOM 5608   C CB   . TYR C 1 56  ? 3.308   -17.446 19.138  1.00 12.23 ? 56  TYR C CB   1  
ATOM 5609   C CG   . TYR C 1 56  ? 3.961   -16.563 20.216  1.00 71.54 ? 56  TYR C CG   1  
ATOM 5610   C CD1  . TYR C 1 56  ? 4.732   -17.138 21.230  1.00 12.42 ? 56  TYR C CD1  1  
ATOM 5611   C CD2  . TYR C 1 56  ? 3.876   -15.179 20.194  1.00 41.10 ? 56  TYR C CD2  1  
ATOM 5612   C CE1  . TYR C 1 56  ? 5.383   -16.380 22.167  1.00 41.13 ? 56  TYR C CE1  1  
ATOM 5613   C CE2  . TYR C 1 56  ? 4.525   -14.409 21.151  1.00 4.11  ? 56  TYR C CE2  1  
ATOM 5614   C CZ   . TYR C 1 56  ? 5.279   -15.021 22.126  1.00 50.34 ? 56  TYR C CZ   1  
ATOM 5615   O OH   . TYR C 1 56  ? 5.935   -14.272 23.064  1.00 2.42  ? 56  TYR C OH   1  
ATOM 5616   H H    . TYR C 1 56  ? 2.007   -19.104 17.694  1.00 61.34 ? 56  TYR C H    1  
ATOM 5617   H HA   . TYR C 1 56  ? 1.324   -17.531 20.092  1.00 43.31 ? 56  TYR C HA   1  
ATOM 5618   H HB2  . TYR C 1 56  ? 3.707   -18.444 19.274  1.00 15.43 ? 56  TYR C HB2  1  
ATOM 5619   H HB3  . TYR C 1 56  ? 3.665   -17.093 18.172  1.00 34.12 ? 56  TYR C HB3  1  
ATOM 5620   H HD1  . TYR C 1 56  ? 4.813   -18.216 21.274  1.00 73.23 ? 56  TYR C HD1  1  
ATOM 5621   H HD2  . TYR C 1 56  ? 3.281   -14.695 19.425  1.00 34.11 ? 56  TYR C HD2  1  
ATOM 5622   H HE1  . TYR C 1 56  ? 5.974   -16.863 22.938  1.00 21.03 ? 56  TYR C HE1  1  
ATOM 5623   H HE2  . TYR C 1 56  ? 4.444   -13.328 21.120  1.00 74.13 ? 56  TYR C HE2  1  
ATOM 5624   H HH   . TYR C 1 56  ? 6.813   -14.628 23.200  1.00 14.52 ? 56  TYR C HH   1  
ATOM 5625   N N    . GLU C 1 57  ? 0.271   -15.629 18.759  1.00 75.44 ? 57  GLU C N    1  
ATOM 5626   C CA   . GLU C 1 57  ? -0.268  -14.449 18.067  1.00 72.54 ? 57  GLU C CA   1  
ATOM 5627   C C    . GLU C 1 57  ? 0.401   -13.213 18.656  1.00 42.34 ? 57  GLU C C    1  
ATOM 5628   O O    . GLU C 1 57  ? 0.369   -13.018 19.861  1.00 74.32 ? 57  GLU C O    1  
ATOM 5629   C CB   . GLU C 1 57  ? -1.811  -14.372 18.215  1.00 11.04 ? 57  GLU C CB   1  
ATOM 5630   C CG   . GLU C 1 57  ? -2.447  -13.065 17.695  1.00 32.23 ? 57  GLU C CG   1  
ATOM 5631   C CD   . GLU C 1 57  ? -3.983  -13.092 17.726  1.00 53.13 ? 57  GLU C CD   1  
ATOM 5632   O OE1  . GLU C 1 57  ? -4.570  -12.911 18.805  1.00 34.32 ? 57  GLU C OE1  1  
ATOM 5633   O OE2  . GLU C 1 57  ? -4.605  -13.291 16.669  1.00 3.35  ? 57  GLU C OE2  1  
ATOM 5634   H H    . GLU C 1 57  ? -0.034  -15.814 19.670  1.00 33.41 ? 57  GLU C H    1  
ATOM 5635   H HA   . GLU C 1 57  ? -0.022  -14.522 17.003  1.00 61.32 ? 57  GLU C HA   1  
ATOM 5636   H HB2  . GLU C 1 57  ? -2.247  -15.200 17.665  1.00 2.31  ? 57  GLU C HB2  1  
ATOM 5637   H HB3  . GLU C 1 57  ? -2.073  -14.488 19.262  1.00 35.12 ? 57  GLU C HB3  1  
ATOM 5638   H HG2  . GLU C 1 57  ? -2.102  -12.241 18.314  1.00 15.21 ? 57  GLU C HG2  1  
ATOM 5639   H HG3  . GLU C 1 57  ? -2.113  -12.895 16.676  1.00 4.33  ? 57  GLU C HG3  1  
ATOM 5640   N N    . VAL C 1 58  ? 1.056   -12.422 17.808  1.00 22.01 ? 58  VAL C N    1  
ATOM 5641   C CA   . VAL C 1 58  ? 1.643   -11.133 18.192  1.00 0.30  ? 58  VAL C CA   1  
ATOM 5642   C C    . VAL C 1 58  ? 0.916   -10.031 17.445  1.00 34.52 ? 58  VAL C C    1  
ATOM 5643   O O    . VAL C 1 58  ? 0.564   -10.202 16.284  1.00 54.11 ? 58  VAL C O    1  
ATOM 5644   C CB   . VAL C 1 58  ? 3.176   -11.076 17.852  1.00 14.32 ? 58  VAL C CB   1  
ATOM 5645   C CG1  . VAL C 1 58  ? 3.775   -9.660  18.068  1.00 43.43 ? 58  VAL C CG1  1  
ATOM 5646   C CG2  . VAL C 1 58  ? 3.939   -12.116 18.678  1.00 73.13 ? 58  VAL C CG2  1  
ATOM 5647   H H    . VAL C 1 58  ? 1.145   -12.709 16.877  1.00 33.51 ? 58  VAL C H    1  
ATOM 5648   H HA   . VAL C 1 58  ? 1.517   -10.978 19.270  1.00 23.15 ? 58  VAL C HA   1  
ATOM 5649   H HB   . VAL C 1 58  ? 3.294   -11.331 16.801  1.00 71.34 ? 58  VAL C HB   1  
ATOM 5650   H HG11 . VAL C 1 58  ? 3.905   -9.462  19.123  1.00 42.22 ? 58  VAL C HG11 1  
ATOM 5651   H HG12 . VAL C 1 58  ? 3.116   -8.924  17.648  1.00 44.03 ? 58  VAL C HG12 1  
ATOM 5652   H HG13 . VAL C 1 58  ? 4.717   -9.580  17.561  1.00 43.13 ? 58  VAL C HG13 1  
ATOM 5653   H HG21 . VAL C 1 58  ? 3.992   -11.805 19.707  1.00 32.34 ? 58  VAL C HG21 1  
ATOM 5654   H HG22 . VAL C 1 58  ? 4.939   -12.234 18.293  1.00 31.50 ? 58  VAL C HG22 1  
ATOM 5655   H HG23 . VAL C 1 58  ? 3.430   -13.071 18.630  1.00 33.14 ? 58  VAL C HG23 1  
ATOM 5656   N N    . VAL C 1 59  ? 0.683   -8.914  18.129  1.00 63.53 ? 59  VAL C N    1  
ATOM 5657   C CA   . VAL C 1 59  ? 0.111   -7.714  17.535  1.00 13.05 ? 59  VAL C CA   1  
ATOM 5658   C C    . VAL C 1 59  ? 0.995   -6.519  17.890  1.00 43.51 ? 59  VAL C C    1  
ATOM 5659   O O    . VAL C 1 59  ? 1.500   -6.419  19.018  1.00 1.25  ? 59  VAL C O    1  
ATOM 5660   C CB   . VAL C 1 59  ? -1.364  -7.460  18.018  1.00 43.42 ? 59  VAL C CB   1  
ATOM 5661   C CG1  . VAL C 1 59  ? -1.940  -6.150  17.423  1.00 13.55 ? 59  VAL C CG1  1  
ATOM 5662   C CG2  . VAL C 1 59  ? -2.260  -8.677  17.686  1.00 15.35 ? 59  VAL C CG2  1  
ATOM 5663   H H    . VAL C 1 59  ? 0.921   -8.892  19.077  1.00 1.53  ? 59  VAL C H    1  
ATOM 5664   H HA   . VAL C 1 59  ? 0.112   -7.838  16.448  1.00 44.45 ? 59  VAL C HA   1  
ATOM 5665   H HB   . VAL C 1 59  ? -1.349  -7.347  19.102  1.00 22.41 ? 59  VAL C HB   1  
ATOM 5666   H HG11 . VAL C 1 59  ? -2.853  -5.891  17.927  1.00 33.22 ? 59  VAL C HG11 1  
ATOM 5667   H HG12 . VAL C 1 59  ? -2.138  -6.282  16.366  1.00 51.40 ? 59  VAL C HG12 1  
ATOM 5668   H HG13 . VAL C 1 59  ? -1.227  -5.345  17.550  1.00 10.42 ? 59  VAL C HG13 1  
ATOM 5669   H HG21 . VAL C 1 59  ? -3.283  -8.471  17.945  1.00 34.33 ? 59  VAL C HG21 1  
ATOM 5670   H HG22 . VAL C 1 59  ? -1.922  -9.541  18.245  1.00 11.31 ? 59  VAL C HG22 1  
ATOM 5671   H HG23 . VAL C 1 59  ? -2.198  -8.898  16.625  1.00 2.40  ? 59  VAL C HG23 1  
ATOM 5672   N N    . LEU C 1 60  ? 1.183   -5.637  16.913  1.00 61.21 ? 60  LEU C N    1  
ATOM 5673   C CA   . LEU C 1 60  ? 1.931   -4.405  17.068  1.00 50.15 ? 60  LEU C CA   1  
ATOM 5674   C C    . LEU C 1 60  ? 0.980   -3.240  16.735  1.00 35.22 ? 60  LEU C C    1  
ATOM 5675   O O    . LEU C 1 60  ? 0.662   -3.004  15.565  1.00 73.42 ? 60  LEU C O    1  
ATOM 5676   C CB   . LEU C 1 60  ? 3.170   -4.423  16.114  1.00 4.50  ? 60  LEU C CB   1  
ATOM 5677   C CG   . LEU C 1 60  ? 4.406   -3.503  16.460  1.00 3.20  ? 60  LEU C CG   1  
ATOM 5678   C CD1  . LEU C 1 60  ? 5.188   -3.157  15.173  1.00 44.44 ? 60  LEU C CD1  1  
ATOM 5679   C CD2  . LEU C 1 60  ? 4.037   -2.231  17.263  1.00 60.24 ? 60  LEU C CD2  1  
ATOM 5680   H H    . LEU C 1 60  ? 0.802   -5.831  16.038  1.00 52.11 ? 60  LEU C H    1  
ATOM 5681   H HA   . LEU C 1 60  ? 2.258   -4.323  18.107  1.00 61.42 ? 60  LEU C HA   1  
ATOM 5682   H HB2  . LEU C 1 60  ? 3.532   -5.447  16.072  1.00 12.25 ? 60  LEU C HB2  1  
ATOM 5683   H HB3  . LEU C 1 60  ? 2.819   -4.170  15.117  1.00 75.44 ? 60  LEU C HB3  1  
ATOM 5684   H HG   . LEU C 1 60  ? 5.083   -4.078  17.080  1.00 63.23 ? 60  LEU C HG   1  
ATOM 5685   H HD11 . LEU C 1 60  ? 5.685   -4.045  14.805  1.00 53.52 ? 60  LEU C HD11 1  
ATOM 5686   H HD12 . LEU C 1 60  ? 5.925   -2.402  15.376  1.00 35.34 ? 60  LEU C HD12 1  
ATOM 5687   H HD13 . LEU C 1 60  ? 4.511   -2.790  14.415  1.00 25.53 ? 60  LEU C HD13 1  
ATOM 5688   H HD21 . LEU C 1 60  ? 4.924   -1.691  17.525  1.00 12.52 ? 60  LEU C HD21 1  
ATOM 5689   H HD22 . LEU C 1 60  ? 3.521   -2.514  18.168  1.00 64.22 ? 60  LEU C HD22 1  
ATOM 5690   H HD23 . LEU C 1 60  ? 3.390   -1.596  16.671  1.00 14.24 ? 60  LEU C HD23 1  
ATOM 5691   N N    . ARG C 1 61  ? 0.542   -2.529  17.768  1.00 14.22 ? 61  ARG C N    1  
ATOM 5692   C CA   . ARG C 1 61  ? -0.342  -1.369  17.631  1.00 4.44  ? 61  ARG C CA   1  
ATOM 5693   C C    . ARG C 1 61  ? 0.519   -0.103  17.568  1.00 4.40  ? 61  ARG C C    1  
ATOM 5694   O O    . ARG C 1 61  ? 1.144   0.292   18.560  1.00 20.24 ? 61  ARG C O    1  
ATOM 5695   C CB   . ARG C 1 61  ? -1.334  -1.292  18.820  1.00 23.14 ? 61  ARG C CB   1  
ATOM 5696   C CG   . ARG C 1 61  ? -2.217  -0.021  18.837  1.00 72.31 ? 61  ARG C CG   1  
ATOM 5697   C CD   . ARG C 1 61  ? -2.913  0.213   20.188  1.00 71.11 ? 61  ARG C CD   1  
ATOM 5698   N NE   . ARG C 1 61  ? -3.813  -0.884  20.584  1.00 22.12 ? 61  ARG C NE   1  
ATOM 5699   C CZ   . ARG C 1 61  ? -5.159  -0.817  20.615  1.00 21.21 ? 61  ARG C CZ   1  
ATOM 5700   N NH1  . ARG C 1 61  ? -5.811  0.298   20.264  1.00 72.31 ? 61  ARG C NH1  1  
ATOM 5701   N NH2  . ARG C 1 61  ? -5.849  -1.884  20.990  1.00 30.04 ? 61  ARG C NH2  1  
ATOM 5702   H H    . ARG C 1 61  ? 0.866   -2.763  18.658  1.00 61.32 ? 61  ARG C H    1  
ATOM 5703   H HA   . ARG C 1 61  ? -0.903  -1.467  16.701  1.00 23.44 ? 61  ARG C HA   1  
ATOM 5704   H HB2  . ARG C 1 61  ? -1.987  -2.159  18.781  1.00 51.30 ? 61  ARG C HB2  1  
ATOM 5705   H HB3  . ARG C 1 61  ? -0.768  -1.333  19.742  1.00 1.35  ? 61  ARG C HB3  1  
ATOM 5706   H HG2  . ARG C 1 61  ? -1.594  0.841   18.619  1.00 42.21 ? 61  ARG C HG2  1  
ATOM 5707   H HG3  . ARG C 1 61  ? -2.973  -0.108  18.063  1.00 62.12 ? 61  ARG C HG3  1  
ATOM 5708   H HD2  . ARG C 1 61  ? -2.154  0.321   20.953  1.00 13.15 ? 61  ARG C HD2  1  
ATOM 5709   H HD3  . ARG C 1 61  ? -3.480  1.138   20.130  1.00 1.20  ? 61  ARG C HD3  1  
ATOM 5710   H HE   . ARG C 1 61  ? -3.384  -1.726  20.865  1.00 55.33 ? 61  ARG C HE   1  
ATOM 5711   H HH11 . ARG C 1 61  ? -5.300  1.111   19.966  1.00 5.50  ? 61  ARG C HH11 1  
ATOM 5712   H HH12 . ARG C 1 61  ? -6.814  0.328   20.293  1.00 22.04 ? 61  ARG C HH12 1  
ATOM 5713   H HH21 . ARG C 1 61  ? -5.373  -2.730  21.247  1.00 32.42 ? 61  ARG C HH21 1  
ATOM 5714   H HH22 . ARG C 1 61  ? -6.850  -1.852  21.019  1.00 1.22  ? 61  ARG C HH22 1  
ATOM 5715   N N    . VAL C 1 62  ? 0.598   0.487   16.375  1.00 13.42 ? 62  VAL C N    1  
ATOM 5716   C CA   . VAL C 1 62  ? 1.283   1.756   16.146  1.00 23.34 ? 62  VAL C CA   1  
ATOM 5717   C C    . VAL C 1 62  ? 0.229   2.840   15.916  1.00 52.31 ? 62  VAL C C    1  
ATOM 5718   O O    . VAL C 1 62  ? -0.581  2.736   14.984  1.00 14.41 ? 62  VAL C O    1  
ATOM 5719   C CB   . VAL C 1 62  ? 2.234   1.696   14.899  1.00 74.34 ? 62  VAL C CB   1  
ATOM 5720   C CG1  . VAL C 1 62  ? 3.080   2.993   14.780  1.00 22.25 ? 62  VAL C CG1  1  
ATOM 5721   C CG2  . VAL C 1 62  ? 3.121   0.433   14.918  1.00 73.54 ? 62  VAL C CG2  1  
ATOM 5722   H H    . VAL C 1 62  ? 0.170   0.051   15.614  1.00 53.44 ? 62  VAL C H    1  
ATOM 5723   H HA   . VAL C 1 62  ? 1.878   2.008   17.026  1.00 70.30 ? 62  VAL C HA   1  
ATOM 5724   H HB   . VAL C 1 62  ? 1.606   1.636   14.010  1.00 41.12 ? 62  VAL C HB   1  
ATOM 5725   H HG11 . VAL C 1 62  ? 3.419   3.106   13.767  1.00 54.15 ? 62  VAL C HG11 1  
ATOM 5726   H HG12 . VAL C 1 62  ? 3.927   2.944   15.411  1.00 53.32 ? 62  VAL C HG12 1  
ATOM 5727   H HG13 . VAL C 1 62  ? 2.484   3.859   15.047  1.00 33.34 ? 62  VAL C HG13 1  
ATOM 5728   H HG21 . VAL C 1 62  ? 3.702   0.407   15.823  1.00 24.40 ? 62  VAL C HG21 1  
ATOM 5729   H HG22 . VAL C 1 62  ? 3.787   0.430   14.063  1.00 42.22 ? 62  VAL C HG22 1  
ATOM 5730   H HG23 . VAL C 1 62  ? 2.492   -0.447  14.882  1.00 54.20 ? 62  VAL C HG23 1  
ATOM 5731   N N    . THR C 1 63  ? 0.235   3.864   16.765  1.00 45.40 ? 63  THR C N    1  
ATOM 5732   C CA   . THR C 1 63  ? -0.676  5.007   16.644  1.00 33.20 ? 63  THR C CA   1  
ATOM 5733   C C    . THR C 1 63  ? 0.138   6.276   16.415  1.00 2.45  ? 63  THR C C    1  
ATOM 5734   O O    . THR C 1 63  ? 1.121   6.531   17.110  1.00 13.03 ? 63  THR C O    1  
ATOM 5735   C CB   . THR C 1 63  ? -1.573  5.179   17.914  1.00 20.30 ? 63  THR C CB   1  
ATOM 5736   O OG1  . THR C 1 63  ? -2.268  3.954   18.181  1.00 2.20  ? 63  THR C OG1  1  
ATOM 5737   C CG2  . THR C 1 63  ? -2.590  6.333   17.761  1.00 33.32 ? 63  THR C CG2  1  
ATOM 5738   H H    . THR C 1 63  ? 0.884   3.861   17.496  1.00 32.31 ? 63  THR C H    1  
ATOM 5739   H HA   . THR C 1 63  ? -1.327  4.844   15.778  1.00 12.43 ? 63  THR C HA   1  
ATOM 5740   H HB   . THR C 1 63  ? -0.931  5.397   18.762  1.00 65.12 ? 63  THR C HB   1  
ATOM 5741   H HG1  . THR C 1 63  ? -3.173  4.013   17.855  1.00 61.24 ? 63  THR C HG1  1  
ATOM 5742   H HG21 . THR C 1 63  ? -3.269  6.349   18.603  1.00 51.24 ? 63  THR C HG21 1  
ATOM 5743   H HG22 . THR C 1 63  ? -3.161  6.200   16.852  1.00 31.34 ? 63  THR C HG22 1  
ATOM 5744   H HG23 . THR C 1 63  ? -2.063  7.280   17.711  1.00 65.44 ? 63  THR C HG23 1  
ATOM 5745   N N    . VAL C 1 64  ? -0.270  7.048   15.417  1.00 43.45 ? 64  VAL C N    1  
ATOM 5746   C CA   . VAL C 1 64  ? 0.307   8.355   15.128  1.00 0.32  ? 64  VAL C CA   1  
ATOM 5747   C C    . VAL C 1 64  ? -0.699  9.436   15.508  1.00 14.12 ? 64  VAL C C    1  
ATOM 5748   O O    . VAL C 1 64  ? -1.849  9.410   15.042  1.00 41.11 ? 64  VAL C O    1  
ATOM 5749   C CB   . VAL C 1 64  ? 0.671   8.497   13.613  1.00 54.03 ? 64  VAL C CB   1  
ATOM 5750   C CG1  . VAL C 1 64  ? 1.285   9.886   13.333  1.00 11.51 ? 64  VAL C CG1  1  
ATOM 5751   C CG2  . VAL C 1 64  ? 1.604   7.352   13.157  1.00 32.33 ? 64  VAL C CG2  1  
ATOM 5752   H H    . VAL C 1 64  ? -0.999  6.727   14.851  1.00 22.30 ? 64  VAL C H    1  
ATOM 5753   H HA   . VAL C 1 64  ? 1.217   8.479   15.718  1.00 71.42 ? 64  VAL C HA   1  
ATOM 5754   H HB   . VAL C 1 64  ? -0.251  8.422   13.036  1.00 72.21 ? 64  VAL C HB   1  
ATOM 5755   H HG11 . VAL C 1 64  ? 0.609   10.657  13.676  1.00 24.03 ? 64  VAL C HG11 1  
ATOM 5756   H HG12 . VAL C 1 64  ? 1.456   10.005  12.273  1.00 65.21 ? 64  VAL C HG12 1  
ATOM 5757   H HG13 . VAL C 1 64  ? 2.223   9.982   13.861  1.00 43.25 ? 64  VAL C HG13 1  
ATOM 5758   H HG21 . VAL C 1 64  ? 1.263   6.413   13.577  1.00 60.31 ? 64  VAL C HG21 1  
ATOM 5759   H HG22 . VAL C 1 64  ? 2.605   7.530   13.477  1.00 11.11 ? 64  VAL C HG22 1  
ATOM 5760   H HG23 . VAL C 1 64  ? 1.589   7.280   12.081  1.00 43.35 ? 64  VAL C HG23 1  
ATOM 5761   N N    . THR C 1 65  ? -0.268  10.374  16.351  1.00 33.44 ? 65  THR C N    1  
ATOM 5762   C CA   . THR C 1 65  ? -1.061  11.544  16.701  1.00 2.02  ? 65  THR C CA   1  
ATOM 5763   C C    . THR C 1 65  ? -0.303  12.797  16.253  1.00 43.15 ? 65  THR C C    1  
ATOM 5764   O O    . THR C 1 65  ? 0.855   12.987  16.619  1.00 32.10 ? 65  THR C O    1  
ATOM 5765   C CB   . THR C 1 65  ? -1.356  11.606  18.233  1.00 72.12 ? 65  THR C CB   1  
ATOM 5766   O OG1  . THR C 1 65  ? -1.753  10.300  18.707  1.00 43.51 ? 65  THR C OG1  1  
ATOM 5767   C CG2  . THR C 1 65  ? -2.467  12.642  18.554  1.00 43.25 ? 65  THR C CG2  1  
ATOM 5768   H H    . THR C 1 65  ? 0.621   10.280  16.744  1.00 44.25 ? 65  THR C H    1  
ATOM 5769   H HA   . THR C 1 65  ? -2.011  11.487  16.166  1.00 21.01 ? 65  THR C HA   1  
ATOM 5770   H HB   . THR C 1 65  ? -0.447  11.893  18.757  1.00 4.52  ? 65  THR C HB   1  
ATOM 5771   H HG1  . THR C 1 65  ? -1.248  9.623   18.248  1.00 60.42 ? 65  THR C HG1  1  
ATOM 5772   H HG21 . THR C 1 65  ? -2.983  12.352  19.454  1.00 23.53 ? 65  THR C HG21 1  
ATOM 5773   H HG22 . THR C 1 65  ? -3.180  12.686  17.741  1.00 40.14 ? 65  THR C HG22 1  
ATOM 5774   H HG23 . THR C 1 65  ? -2.027  13.622  18.694  1.00 2.45  ? 65  THR C HG23 1  
ATOM 5775   N N    . ALA C 1 66  ? -0.951  13.622  15.434  1.00 62.13 ? 66  ALA C N    1  
ATOM 5776   C CA   . ALA C 1 66  ? -0.374  14.870  14.920  1.00 21.32 ? 66  ALA C CA   1  
ATOM 5777   C C    . ALA C 1 66  ? -1.221  16.015  15.446  1.00 10.15 ? 66  ALA C C    1  
ATOM 5778   O O    . ALA C 1 66  ? -2.312  16.238  14.941  1.00 23.25 ? 66  ALA C O    1  
ATOM 5779   C CB   . ALA C 1 66  ? -0.354  14.842  13.378  1.00 54.52 ? 66  ALA C CB   1  
ATOM 5780   H H    . ALA C 1 66  ? -1.875  13.395  15.176  1.00 62.24 ? 66  ALA C H    1  
ATOM 5781   H HA   . ALA C 1 66  ? 0.653   14.981  15.281  1.00 12.34 ? 66  ALA C HA   1  
ATOM 5782   H HB1  . ALA C 1 66  ? -0.077  15.815  12.990  1.00 64.43 ? 66  ALA C HB1  1  
ATOM 5783   H HB2  . ALA C 1 66  ? -1.338  14.580  13.004  1.00 12.44 ? 66  ALA C HB2  1  
ATOM 5784   H HB3  . ALA C 1 66  ? 0.360   14.105  13.038  1.00 44.21 ? 66  ALA C HB3  1  
ATOM 5785   N N    . SER C 1 67  ? -0.769  16.690  16.513  1.00 43.21 ? 67  SER C N    1  
ATOM 5786   C CA   . SER C 1 67  ? -1.490  17.848  17.063  1.00 13.53 ? 67  SER C CA   1  
ATOM 5787   C C    . SER C 1 67  ? -0.716  19.140  16.745  1.00 24.33 ? 67  SER C C    1  
ATOM 5788   O O    . SER C 1 67  ? 0.393   19.326  17.190  1.00 72.50 ? 67  SER C O    1  
ATOM 5789   C CB   . SER C 1 67  ? -1.681  17.668  18.588  1.00 42.13 ? 67  SER C CB   1  
ATOM 5790   O OG   . SER C 1 67  ? -2.369  16.458  18.878  1.00 71.33 ? 67  SER C OG   1  
ATOM 5791   H H    . SER C 1 67  ? 0.066   16.399  16.946  1.00 61.03 ? 67  SER C H    1  
ATOM 5792   H HA   . SER C 1 67  ? -2.478  17.903  16.597  1.00 32.44 ? 67  SER C HA   1  
ATOM 5793   H HB2  . SER C 1 67  ? -0.717  17.637  19.080  1.00 4.43  ? 67  SER C HB2  1  
ATOM 5794   H HB3  . SER C 1 67  ? -2.256  18.494  18.985  1.00 51.42 ? 67  SER C HB3  1  
ATOM 5795   H HG   . SER C 1 67  ? -3.082  16.329  18.243  1.00 52.03 ? 67  SER C HG   1  
ATOM 5796   N N    . LEU C 1 68  ? -1.357  20.053  16.033  1.00 14.03 ? 68  LEU C N    1  
ATOM 5797   C CA   . LEU C 1 68  ? -0.810  21.363  15.644  1.00 75.43 ? 68  LEU C CA   1  
ATOM 5798   C C    . LEU C 1 68  ? -1.034  22.381  16.791  1.00 23.41 ? 68  LEU C C    1  
ATOM 5799   O O    . LEU C 1 68  ? -1.515  23.491  16.571  1.00 44.11 ? 68  LEU C O    1  
ATOM 5800   C CB   . LEU C 1 68  ? -1.547  21.787  14.337  1.00 42.15 ? 68  LEU C CB   1  
ATOM 5801   C CG   . LEU C 1 68  ? -1.603  20.684  13.219  1.00 43.40 ? 68  LEU C CG   1  
ATOM 5802   C CD1  . LEU C 1 68  ? -2.765  20.912  12.248  1.00 12.53 ? 68  LEU C CD1  1  
ATOM 5803   C CD2  . LEU C 1 68  ? -0.273  20.568  12.453  1.00 5.03  ? 68  LEU C CD2  1  
ATOM 5804   H H    . LEU C 1 68  ? -2.235  19.821  15.705  1.00 60.13 ? 68  LEU C H    1  
ATOM 5805   H HA   . LEU C 1 68  ? 0.255   21.262  15.450  1.00 24.55 ? 68  LEU C HA   1  
ATOM 5806   H HB2  . LEU C 1 68  ? -2.565  22.062  14.604  1.00 4.11  ? 68  LEU C HB2  1  
ATOM 5807   H HB3  . LEU C 1 68  ? -1.058  22.669  13.931  1.00 73.34 ? 68  LEU C HB3  1  
ATOM 5808   H HG   . LEU C 1 68  ? -1.779  19.724  13.694  1.00 42.35 ? 68  LEU C HG   1  
ATOM 5809   H HD11 . LEU C 1 68  ? -3.684  21.055  12.804  1.00 1.32  ? 68  LEU C HD11 1  
ATOM 5810   H HD12 . LEU C 1 68  ? -2.878  20.040  11.619  1.00 32.43 ? 68  LEU C HD12 1  
ATOM 5811   H HD13 . LEU C 1 68  ? -2.586  21.762  11.630  1.00 54.42 ? 68  LEU C HD13 1  
ATOM 5812   H HD21 . LEU C 1 68  ? -0.347  19.784  11.712  1.00 25.43 ? 68  LEU C HD21 1  
ATOM 5813   H HD22 . LEU C 1 68  ? 0.521   20.324  13.144  1.00 41.01 ? 68  LEU C HD22 1  
ATOM 5814   H HD23 . LEU C 1 68  ? -0.044  21.507  11.963  1.00 45.43 ? 68  LEU C HD23 1  
ATOM 5815   N N    . GLY C 1 69  ? -0.660  21.976  18.023  1.00 12.33 ? 69  GLY C N    1  
ATOM 5816   C CA   . GLY C 1 69  ? -0.911  22.762  19.231  1.00 43.22 ? 69  GLY C CA   1  
ATOM 5817   C C    . GLY C 1 69  ? -2.102  22.202  19.995  1.00 50.22 ? 69  GLY C C    1  
ATOM 5818   O O    . GLY C 1 69  ? -1.978  21.205  20.718  1.00 32.23 ? 69  GLY C O    1  
ATOM 5819   H H    . GLY C 1 69  ? -0.179  21.126  18.111  1.00 11.43 ? 69  GLY C H    1  
ATOM 5820   H HA2  . GLY C 1 69  ? -0.030  22.707  19.862  1.00 64.53 ? 69  GLY C HA2  1  
ATOM 5821   H HA3  . GLY C 1 69  ? -1.091  23.804  18.982  1.00 73.03 ? 69  GLY C HA3  1  
ATOM 5822   N N    . GLU C 1 70  ? -3.269  22.834  19.800  1.00 53.34 ? 70  GLU C N    1  
ATOM 5823   C CA   . GLU C 1 70  ? -4.560  22.393  20.367  1.00 41.01 ? 70  GLU C CA   1  
ATOM 5824   C C    . GLU C 1 70  ? -5.364  21.623  19.306  1.00 51.35 ? 70  GLU C C    1  
ATOM 5825   O O    . GLU C 1 70  ? -6.165  20.753  19.632  1.00 3.20  ? 70  GLU C O    1  
ATOM 5826   C CB   . GLU C 1 70  ? -5.389  23.614  20.846  1.00 61.23 ? 70  GLU C CB   1  
ATOM 5827   C CG   . GLU C 1 70  ? -4.672  24.527  21.858  1.00 54.11 ? 70  GLU C CG   1  
ATOM 5828   C CD   . GLU C 1 70  ? -5.550  25.701  22.322  1.00 33.35 ? 70  GLU C CD   1  
ATOM 5829   O OE1  . GLU C 1 70  ? -6.034  25.689  23.475  1.00 34.22 ? 70  GLU C OE1  1  
ATOM 5830   O OE2  . GLU C 1 70  ? -5.786  26.624  21.521  1.00 21.23 ? 70  GLU C OE2  1  
ATOM 5831   H H    . GLU C 1 70  ? -3.265  23.636  19.249  1.00 11.12 ? 70  GLU C H    1  
ATOM 5832   H HA   . GLU C 1 70  ? -4.368  21.736  21.212  1.00 64.11 ? 70  GLU C HA   1  
ATOM 5833   H HB2  . GLU C 1 70  ? -5.656  24.218  19.981  1.00 51.34 ? 70  GLU C HB2  1  
ATOM 5834   H HB3  . GLU C 1 70  ? -6.306  23.254  21.305  1.00 72.15 ? 70  GLU C HB3  1  
ATOM 5835   H HG2  . GLU C 1 70  ? -4.377  23.932  22.721  1.00 64.54 ? 70  GLU C HG2  1  
ATOM 5836   H HG3  . GLU C 1 70  ? -3.776  24.927  21.394  1.00 40.45 ? 70  GLU C HG3  1  
ATOM 5837   N N    . GLU C 1 71  ? -5.149  21.999  18.042  1.00 73.50 ? 71  GLU C N    1  
ATOM 5838   C CA   . GLU C 1 71  ? -5.829  21.418  16.878  1.00 65.33 ? 71  GLU C CA   1  
ATOM 5839   C C    . GLU C 1 71  ? -5.186  20.080  16.490  1.00 41.03 ? 71  GLU C C    1  
ATOM 5840   O O    . GLU C 1 71  ? -4.016  20.060  16.197  1.00 22.11 ? 71  GLU C O    1  
ATOM 5841   C CB   . GLU C 1 71  ? -5.733  22.410  15.681  1.00 30.31 ? 71  GLU C CB   1  
ATOM 5842   C CG   . GLU C 1 71  ? -6.272  21.874  14.335  1.00 2.50  ? 71  GLU C CG   1  
ATOM 5843   C CD   . GLU C 1 71  ? -7.806  21.701  14.267  1.00 53.22 ? 71  GLU C CD   1  
ATOM 5844   O OE1  . GLU C 1 71  ? -8.399  21.000  15.114  1.00 32.00 ? 71  GLU C OE1  1  
ATOM 5845   O OE2  . GLU C 1 71  ? -8.431  22.239  13.330  1.00 2.43  ? 71  GLU C OE2  1  
ATOM 5846   H H    . GLU C 1 71  ? -4.490  22.700  17.883  1.00 24.20 ? 71  GLU C H    1  
ATOM 5847   H HA   . GLU C 1 71  ? -6.881  21.262  17.123  1.00 35.21 ? 71  GLU C HA   1  
ATOM 5848   H HB2  . GLU C 1 71  ? -6.287  23.308  15.929  1.00 21.00 ? 71  GLU C HB2  1  
ATOM 5849   H HB3  . GLU C 1 71  ? -4.687  22.684  15.542  1.00 64.51 ? 71  GLU C HB3  1  
ATOM 5850   H HG2  . GLU C 1 71  ? -5.960  22.558  13.552  1.00 42.31 ? 71  GLU C HG2  1  
ATOM 5851   H HG3  . GLU C 1 71  ? -5.814  20.909  14.144  1.00 32.35 ? 71  GLU C HG3  1  
ATOM 5852   N N    . THR C 1 72  ? -5.937  18.969  16.501  1.00 14.42 ? 72  THR C N    1  
ATOM 5853   C CA   . THR C 1 72  ? -5.430  17.690  15.975  1.00 62.24 ? 72  THR C CA   1  
ATOM 5854   C C    . THR C 1 72  ? -5.662  17.624  14.448  1.00 13.30 ? 72  THR C C    1  
ATOM 5855   O O    . THR C 1 72  ? -6.778  17.846  13.970  1.00 3.31  ? 72  THR C O    1  
ATOM 5856   C CB   . THR C 1 72  ? -6.089  16.456  16.671  1.00 23.03 ? 72  THR C CB   1  
ATOM 5857   O OG1  . THR C 1 72  ? -5.849  16.517  18.087  1.00 72.33 ? 72  THR C OG1  1  
ATOM 5858   C CG2  . THR C 1 72  ? -5.540  15.120  16.118  1.00 34.02 ? 72  THR C CG2  1  
ATOM 5859   H H    . THR C 1 72  ? -6.847  19.010  16.843  1.00 33.23 ? 72  THR C H    1  
ATOM 5860   H HA   . THR C 1 72  ? -4.353  17.650  16.171  1.00 22.01 ? 72  THR C HA   1  
ATOM 5861   H HB   . THR C 1 72  ? -7.157  16.492  16.499  1.00 34.44 ? 72  THR C HB   1  
ATOM 5862   H HG1  . THR C 1 72  ? -6.520  15.995  18.547  1.00 55.41 ? 72  THR C HG1  1  
ATOM 5863   H HG21 . THR C 1 72  ? -5.764  15.043  15.059  1.00 32.01 ? 72  THR C HG21 1  
ATOM 5864   H HG22 . THR C 1 72  ? -5.997  14.296  16.634  1.00 13.32 ? 72  THR C HG22 1  
ATOM 5865   H HG23 . THR C 1 72  ? -4.467  15.075  16.258  1.00 33.15 ? 72  THR C HG23 1  
ATOM 5866   N N    . ALA C 1 73  ? -4.576  17.340  13.713  1.00 31.41 ? 73  ALA C N    1  
ATOM 5867   C CA   . ALA C 1 73  ? -4.580  17.147  12.253  1.00 31.22 ? 73  ALA C CA   1  
ATOM 5868   C C    . ALA C 1 73  ? -5.250  15.822  11.901  1.00 33.24 ? 73  ALA C C    1  
ATOM 5869   O O    . ALA C 1 73  ? -6.228  15.789  11.139  1.00 61.41 ? 73  ALA C O    1  
ATOM 5870   C CB   . ALA C 1 73  ? -3.140  17.224  11.704  1.00 70.53 ? 73  ALA C CB   1  
ATOM 5871   H H    . ALA C 1 73  ? -3.738  17.244  14.180  1.00 53.42 ? 73  ALA C H    1  
ATOM 5872   H HA   . ALA C 1 73  ? -5.149  17.951  11.810  1.00 43.50 ? 73  ALA C HA   1  
ATOM 5873   H HB1  . ALA C 1 73  ? -2.507  16.541  12.226  1.00 2.22  ? 73  ALA C HB1  1  
ATOM 5874   H HB2  . ALA C 1 73  ? -2.755  18.207  11.855  1.00 1.42  ? 73  ALA C HB2  1  
ATOM 5875   H HB3  . ALA C 1 73  ? -3.127  16.992  10.647  1.00 72.42 ? 73  ALA C HB3  1  
ATOM 5876   N N    . PHE C 1 74  ? -4.710  14.739  12.472  1.00 21.44 ? 74  PHE C N    1  
ATOM 5877   C CA   . PHE C 1 74  ? -5.305  13.395  12.338  1.00 3.10  ? 74  PHE C CA   1  
ATOM 5878   C C    . PHE C 1 74  ? -4.876  12.452  13.473  1.00 2.12  ? 74  PHE C C    1  
ATOM 5879   O O    . PHE C 1 74  ? -3.907  12.711  14.206  1.00 3.25  ? 74  PHE C O    1  
ATOM 5880   C CB   . PHE C 1 74  ? -4.969  12.760  10.956  1.00 52.42 ? 74  PHE C CB   1  
ATOM 5881   C CG   . PHE C 1 74  ? -3.484  12.459  10.717  1.00 53.11 ? 74  PHE C CG   1  
ATOM 5882   C CD1  . PHE C 1 74  ? -2.981  11.161  10.850  1.00 31.31 ? 74  PHE C CD1  1  
ATOM 5883   C CD2  . PHE C 1 74  ? -2.599  13.470  10.350  1.00 50.34 ? 74  PHE C CD2  1  
ATOM 5884   C CE1  . PHE C 1 74  ? -1.650  10.892  10.623  1.00 54.30 ? 74  PHE C CE1  1  
ATOM 5885   C CE2  . PHE C 1 74  ? -1.267  13.198  10.125  1.00 75.04 ? 74  PHE C CE2  1  
ATOM 5886   C CZ   . PHE C 1 74  ? -0.795  11.910  10.260  1.00 70.33 ? 74  PHE C CZ   1  
ATOM 5887   H H    . PHE C 1 74  ? -3.878  14.849  12.980  1.00 51.24 ? 74  PHE C H    1  
ATOM 5888   H HA   . PHE C 1 74  ? -6.384  13.514  12.401  1.00 1.40  ? 74  PHE C HA   1  
ATOM 5889   H HB2  . PHE C 1 74  ? -5.524  11.833  10.846  1.00 60.20 ? 74  PHE C HB2  1  
ATOM 5890   H HB3  . PHE C 1 74  ? -5.297  13.440  10.177  1.00 1.53  ? 74  PHE C HB3  1  
ATOM 5891   H HD1  . PHE C 1 74  ? -3.652  10.357  11.132  1.00 35.52 ? 74  PHE C HD1  1  
ATOM 5892   H HD2  . PHE C 1 74  ? -2.964  14.485  10.241  1.00 44.02 ? 74  PHE C HD2  1  
ATOM 5893   H HE1  . PHE C 1 74  ? -1.274  9.880   10.730  1.00 3.23  ? 74  PHE C HE1  1  
ATOM 5894   H HE2  . PHE C 1 74  ? -0.591  13.996  9.839   1.00 0.45  ? 74  PHE C HE2  1  
ATOM 5895   H HZ   . PHE C 1 74  ? 0.249   11.697  10.081  1.00 11.55 ? 74  PHE C HZ   1  
ATOM 5896   N N    . LEU C 1 75  ? -5.630  11.348  13.581  1.00 61.43 ? 75  LEU C N    1  
ATOM 5897   C CA   . LEU C 1 75  ? -5.349  10.222  14.472  1.00 51.21 ? 75  LEU C CA   1  
ATOM 5898   C C    . LEU C 1 75  ? -5.393  8.953   13.605  1.00 73.33 ? 75  LEU C C    1  
ATOM 5899   O O    . LEU C 1 75  ? -6.471  8.518   13.190  1.00 34.12 ? 75  LEU C O    1  
ATOM 5900   C CB   . LEU C 1 75  ? -6.404  10.172  15.633  1.00 23.50 ? 75  LEU C CB   1  
ATOM 5901   C CG   . LEU C 1 75  ? -6.028  9.347   16.926  1.00 31.21 ? 75  LEU C CG   1  
ATOM 5902   C CD1  . LEU C 1 75  ? -6.018  7.813   16.702  1.00 23.00 ? 75  LEU C CD1  1  
ATOM 5903   C CD2  . LEU C 1 75  ? -4.684  9.844   17.510  1.00 11.11 ? 75  LEU C CD2  1  
ATOM 5904   H H    . LEU C 1 75  ? -6.432  11.290  13.027  1.00 14.05 ? 75  LEU C H    1  
ATOM 5905   H HA   . LEU C 1 75  ? -4.351  10.343  14.893  1.00 51.42 ? 75  LEU C HA   1  
ATOM 5906   H HB2  . LEU C 1 75  ? -6.600  11.195  15.942  1.00 62.50 ? 75  LEU C HB2  1  
ATOM 5907   H HB3  . LEU C 1 75  ? -7.336  9.773   15.239  1.00 43.34 ? 75  LEU C HB3  1  
ATOM 5908   H HG   . LEU C 1 75  ? -6.787  9.538   17.676  1.00 24.41 ? 75  LEU C HG   1  
ATOM 5909   H HD11 . LEU C 1 75  ? -5.294  7.554   15.936  1.00 54.43 ? 75  LEU C HD11 1  
ATOM 5910   H HD12 . LEU C 1 75  ? -6.997  7.489   16.383  1.00 64.22 ? 75  LEU C HD12 1  
ATOM 5911   H HD13 . LEU C 1 75  ? -5.763  7.307   17.622  1.00 44.12 ? 75  LEU C HD13 1  
ATOM 5912   H HD21 . LEU C 1 75  ? -3.864  9.555   16.863  1.00 52.10 ? 75  LEU C HD21 1  
ATOM 5913   H HD22 . LEU C 1 75  ? -4.526  9.429   18.497  1.00 11.45 ? 75  LEU C HD22 1  
ATOM 5914   H HD23 . LEU C 1 75  ? -4.700  10.920  17.595  1.00 63.53 ? 75  LEU C HD23 1  
ATOM 5915   N N    . CYS C 1 76  ? -4.223  8.391   13.302  1.00 72.31 ? 76  CYS C N    1  
ATOM 5916   C CA   . CYS C 1 76  ? -4.104  7.141   12.531  1.00 4.21  ? 76  CYS C CA   1  
ATOM 5917   C C    . CYS C 1 76  ? -3.630  6.024   13.464  1.00 74.24 ? 76  CYS C C    1  
ATOM 5918   O O    . CYS C 1 76  ? -2.893  6.287   14.419  1.00 55.22 ? 76  CYS C O    1  
ATOM 5919   C CB   . CYS C 1 76  ? -3.123  7.320   11.351  1.00 20.12 ? 76  CYS C CB   1  
ATOM 5920   S SG   . CYS C 1 76  ? -2.940  5.852   10.310  1.00 32.43 ? 76  CYS C SG   1  
ATOM 5921   H H    . CYS C 1 76  ? -3.402  8.819   13.622  1.00 2.51  ? 76  CYS C H    1  
ATOM 5922   H HA   . CYS C 1 76  ? -5.085  6.872   12.136  1.00 40.34 ? 76  CYS C HA   1  
ATOM 5923   H HB2  . CYS C 1 76  ? -3.479  8.120   10.716  1.00 4.12  ? 76  CYS C HB2  1  
ATOM 5924   H HB3  . CYS C 1 76  ? -2.141  7.583   11.729  1.00 34.24 ? 76  CYS C HB3  1  
ATOM 5925   H HG   . CYS C 1 76  ? -4.106  5.223   10.276  1.00 1.00  ? 76  CYS C HG   1  
ATOM 5926   N N    . GLU C 1 77  ? -4.055  4.784   13.187  1.00 44.44 ? 77  GLU C N    1  
ATOM 5927   C CA   . GLU C 1 77  ? -3.691  3.614   13.994  1.00 12.20 ? 77  GLU C CA   1  
ATOM 5928   C C    . GLU C 1 77  ? -3.814  2.358   13.147  1.00 71.22 ? 77  GLU C C    1  
ATOM 5929   O O    . GLU C 1 77  ? -4.765  2.201   12.388  1.00 44.54 ? 77  GLU C O    1  
ATOM 5930   C CB   . GLU C 1 77  ? -4.582  3.471   15.266  1.00 33.30 ? 77  GLU C CB   1  
ATOM 5931   C CG   . GLU C 1 77  ? -4.240  2.240   16.150  1.00 54.20 ? 77  GLU C CG   1  
ATOM 5932   C CD   . GLU C 1 77  ? -5.190  2.053   17.341  1.00 43.11 ? 77  GLU C CD   1  
ATOM 5933   O OE1  . GLU C 1 77  ? -6.241  1.409   17.172  1.00 1.54  ? 77  GLU C OE1  1  
ATOM 5934   O OE2  . GLU C 1 77  ? -4.896  2.555   18.449  1.00 12.23 ? 77  GLU C OE2  1  
ATOM 5935   H H    . GLU C 1 77  ? -4.614  4.638   12.394  1.00 11.44 ? 77  GLU C H    1  
ATOM 5936   H HA   . GLU C 1 77  ? -2.647  3.726   14.294  1.00 73.22 ? 77  GLU C HA   1  
ATOM 5937   H HB2  . GLU C 1 77  ? -4.471  4.367   15.869  1.00 71.41 ? 77  GLU C HB2  1  
ATOM 5938   H HB3  . GLU C 1 77  ? -5.623  3.393   14.959  1.00 2.11  ? 77  GLU C HB3  1  
ATOM 5939   H HG2  . GLU C 1 77  ? -4.279  1.345   15.532  1.00 33.24 ? 77  GLU C HG2  1  
ATOM 5940   H HG3  . GLU C 1 77  ? -3.225  2.355   16.520  1.00 62.31 ? 77  GLU C HG3  1  
ATOM 5941   N N    . VAL C 1 78  ? -2.818  1.486   13.281  1.00 14.22 ? 78  VAL C N    1  
ATOM 5942   C CA   . VAL C 1 78  ? -2.794  0.158   12.677  1.00 63.13 ? 78  VAL C CA   1  
ATOM 5943   C C    . VAL C 1 78  ? -2.344  -0.832  13.742  1.00 32.33 ? 78  VAL C C    1  
ATOM 5944   O O    . VAL C 1 78  ? -1.378  -0.571  14.465  1.00 45.21 ? 78  VAL C O    1  
ATOM 5945   C CB   . VAL C 1 78  ? -1.807  0.089   11.456  1.00 1.34  ? 78  VAL C CB   1  
ATOM 5946   C CG1  . VAL C 1 78  ? -1.671  -1.368  10.913  1.00 32.25 ? 78  VAL C CG1  1  
ATOM 5947   C CG2  . VAL C 1 78  ? -2.253  1.079   10.344  1.00 70.24 ? 78  VAL C CG2  1  
ATOM 5948   H H    . VAL C 1 78  ? -2.052  1.748   13.834  1.00 41.01 ? 78  VAL C H    1  
ATOM 5949   H HA   . VAL C 1 78  ? -3.801  -0.101  12.338  1.00 31.14 ? 78  VAL C HA   1  
ATOM 5950   H HB   . VAL C 1 78  ? -0.823  0.406   11.803  1.00 20.15 ? 78  VAL C HB   1  
ATOM 5951   H HG11 . VAL C 1 78  ? -2.495  -1.598  10.249  1.00 54.41 ? 78  VAL C HG11 1  
ATOM 5952   H HG12 . VAL C 1 78  ? -1.678  -2.072  11.735  1.00 3.02  ? 78  VAL C HG12 1  
ATOM 5953   H HG13 . VAL C 1 78  ? -0.745  -1.476  10.390  1.00 3.34  ? 78  VAL C HG13 1  
ATOM 5954   H HG21 . VAL C 1 78  ? -3.024  0.630   9.730   1.00 15.23 ? 78  VAL C HG21 1  
ATOM 5955   H HG22 . VAL C 1 78  ? -1.414  1.352   9.736   1.00 72.23 ? 78  VAL C HG22 1  
ATOM 5956   H HG23 . VAL C 1 78  ? -2.643  1.979   10.790  1.00 33.23 ? 78  VAL C HG23 1  
ATOM 5957   N N    . GLN C 1 79  ? -3.038  -1.962  13.825  1.00 51.15 ? 79  GLN C N    1  
ATOM 5958   C CA   . GLN C 1 79  ? -2.675  -3.061  14.713  1.00 65.02 ? 79  GLN C CA   1  
ATOM 5959   C C    . GLN C 1 79  ? -2.217  -4.232  13.849  1.00 35.13 ? 79  GLN C C    1  
ATOM 5960   O O    . GLN C 1 79  ? -3.028  -5.048  13.397  1.00 43.00 ? 79  GLN C O    1  
ATOM 5961   C CB   . GLN C 1 79  ? -3.867  -3.421  15.641  1.00 33.12 ? 79  GLN C CB   1  
ATOM 5962   C CG   . GLN C 1 79  ? -4.383  -2.223  16.472  1.00 1.33  ? 79  GLN C CG   1  
ATOM 5963   C CD   . GLN C 1 79  ? -5.498  -2.576  17.457  1.00 11.11 ? 79  GLN C CD   1  
ATOM 5964   O OE1  . GLN C 1 79  ? -5.548  -3.680  18.000  1.00 21.44 ? 79  GLN C OE1  1  
ATOM 5965   N NE2  . GLN C 1 79  ? -6.412  -1.646  17.682  1.00 52.11 ? 79  GLN C NE2  1  
ATOM 5966   H H    . GLN C 1 79  ? -3.822  -2.064  13.251  1.00 44.13 ? 79  GLN C H    1  
ATOM 5967   H HA   . GLN C 1 79  ? -1.830  -2.741  15.322  1.00 2.52  ? 79  GLN C HA   1  
ATOM 5968   H HB2  . GLN C 1 79  ? -4.687  -3.793  15.033  1.00 11.25 ? 79  GLN C HB2  1  
ATOM 5969   H HB3  . GLN C 1 79  ? -3.559  -4.204  16.325  1.00 1.14  ? 79  GLN C HB3  1  
ATOM 5970   H HG2  . GLN C 1 79  ? -3.557  -1.806  17.033  1.00 63.32 ? 79  GLN C HG2  1  
ATOM 5971   H HG3  . GLN C 1 79  ? -4.754  -1.468  15.784  1.00 51.43 ? 79  GLN C HG3  1  
ATOM 5972   H HE21 . GLN C 1 79  ? -6.328  -0.785  17.206  1.00 31.10 ? 79  GLN C HE21 1  
ATOM 5973   H HE22 . GLN C 1 79  ? -7.134  -1.846  18.310  1.00 11.25 ? 79  GLN C HE22 1  
ATOM 5974   N N    . GLN C 1 80  ? -0.907  -4.248  13.562  1.00 4.33  ? 80  GLN C N    1  
ATOM 5975   C CA   . GLN C 1 80  ? -0.287  -5.240  12.696  1.00 3.24  ? 80  GLN C CA   1  
ATOM 5976   C C    . GLN C 1 80  ? -0.073  -6.546  13.464  1.00 32.52 ? 80  GLN C C    1  
ATOM 5977   O O    . GLN C 1 80  ? 0.866   -6.668  14.255  1.00 71.33 ? 80  GLN C O    1  
ATOM 5978   C CB   . GLN C 1 80  ? 1.065   -4.725  12.132  1.00 40.01 ? 80  GLN C CB   1  
ATOM 5979   C CG   . GLN C 1 80  ? 1.643   -5.658  11.052  1.00 13.20 ? 80  GLN C CG   1  
ATOM 5980   C CD   . GLN C 1 80  ? 0.801   -5.672  9.775   1.00 74.50 ? 80  GLN C CD   1  
ATOM 5981   O OE1  . GLN C 1 80  ? 0.634   -6.707  9.133   1.00 42.44 ? 80  GLN C OE1  1  
ATOM 5982   N NE2  . GLN C 1 80  ? 0.386   -4.490  9.322   1.00 52.01 ? 80  GLN C NE2  1  
ATOM 5983   H H    . GLN C 1 80  ? -0.339  -3.557  13.951  1.00 0.53  ? 80  GLN C H    1  
ATOM 5984   H HA   . GLN C 1 80  ? -0.965  -5.426  11.859  1.00 13.44 ? 80  GLN C HA   1  
ATOM 5985   H HB2  . GLN C 1 80  ? 0.909   -3.745  11.689  1.00 24.00 ? 80  GLN C HB2  1  
ATOM 5986   H HB3  . GLN C 1 80  ? 1.799   -4.624  12.938  1.00 14.34 ? 80  GLN C HB3  1  
ATOM 5987   H HG2  . GLN C 1 80  ? 2.641   -5.319  10.793  1.00 73.45 ? 80  GLN C HG2  1  
ATOM 5988   H HG3  . GLN C 1 80  ? 1.706   -6.667  11.450  1.00 32.40 ? 80  GLN C HG3  1  
ATOM 5989   H HE21 . GLN C 1 80  ? 0.644   -3.681  9.822   1.00 31.22 ? 80  GLN C HE21 1  
ATOM 5990   H HE22 . GLN C 1 80  ? -0.154  -4.477  8.508   1.00 31.41 ? 80  GLN C HE22 1  
ATOM 5991   N N    . GLY C 1 81  ? -0.972  -7.499  13.243  1.00 21.30 ? 81  GLY C N    1  
ATOM 5992   C CA   . GLY C 1 81  ? -0.864  -8.814  13.843  1.00 30.33 ? 81  GLY C CA   1  
ATOM 5993   C C    . GLY C 1 81  ? -0.067  -9.782  12.995  1.00 71.11 ? 81  GLY C C    1  
ATOM 5994   O O    . GLY C 1 81  ? 0.233   -9.513  11.820  1.00 23.14 ? 81  GLY C O    1  
ATOM 5995   H H    . GLY C 1 81  ? -1.718  -7.312  12.635  1.00 64.34 ? 81  GLY C H    1  
ATOM 5996   H HA2  . GLY C 1 81  ? -0.403  -8.738  14.826  1.00 25.41 ? 81  GLY C HA2  1  
ATOM 5997   H HA3  . GLY C 1 81  ? -1.855  -9.208  13.967  1.00 1.25  ? 81  GLY C HA3  1  
ATOM 5998   N N    . GLY C 1 82  ? 0.255   -10.923 13.594  1.00 41.22 ? 82  GLY C N    1  
ATOM 5999   C CA   . GLY C 1 82  ? 1.044   -11.945 12.935  1.00 13.33 ? 82  GLY C CA   1  
ATOM 6000   C C    . GLY C 1 82  ? 1.023   -13.246 13.712  1.00 2.31  ? 82  GLY C C    1  
ATOM 6001   O O    . GLY C 1 82  ? 1.429   -13.279 14.879  1.00 12.14 ? 82  GLY C O    1  
ATOM 6002   H H    . GLY C 1 82  ? -0.044  -11.066 14.522  1.00 73.43 ? 82  GLY C H    1  
ATOM 6003   H HA2  . GLY C 1 82  ? 0.653   -12.110 11.934  1.00 14.45 ? 82  GLY C HA2  1  
ATOM 6004   H HA3  . GLY C 1 82  ? 2.072   -11.603 12.857  1.00 53.43 ? 82  GLY C HA3  1  
ATOM 6005   N N    . ILE C 1 83  ? 0.503   -14.302 13.083  1.00 35.40 ? 83  ILE C N    1  
ATOM 6006   C CA   . ILE C 1 83  ? 0.500   -15.648 13.648  1.00 44.40 ? 83  ILE C CA   1  
ATOM 6007   C C    . ILE C 1 83  ? 1.843   -16.312 13.347  1.00 4.14  ? 83  ILE C C    1  
ATOM 6008   O O    . ILE C 1 83  ? 2.323   -16.262 12.201  1.00 42.42 ? 83  ILE C O    1  
ATOM 6009   C CB   . ILE C 1 83  ? -0.646  -16.543 13.055  1.00 51.41 ? 83  ILE C CB   1  
ATOM 6010   C CG1  . ILE C 1 83  ? -2.006  -15.774 13.019  1.00 61.43 ? 83  ILE C CG1  1  
ATOM 6011   C CG2  . ILE C 1 83  ? -0.767  -17.876 13.845  1.00 2.32  ? 83  ILE C CG2  1  
ATOM 6012   C CD1  . ILE C 1 83  ? -2.395  -15.075 14.314  1.00 5.45  ? 83  ILE C CD1  1  
ATOM 6013   H H    . ILE C 1 83  ? 0.095   -14.166 12.212  1.00 41.22 ? 83  ILE C H    1  
ATOM 6014   H HA   . ILE C 1 83  ? 0.364   -15.571 14.731  1.00 65.22 ? 83  ILE C HA   1  
ATOM 6015   H HB   . ILE C 1 83  ? -0.372  -16.797 12.030  1.00 25.54 ? 83  ILE C HB   1  
ATOM 6016   H HG12 . ILE C 1 83  ? -1.956  -15.012 12.251  1.00 73.31 ? 83  ILE C HG12 1  
ATOM 6017   H HG13 . ILE C 1 83  ? -2.804  -16.463 12.764  1.00 23.30 ? 83  ILE C HG13 1  
ATOM 6018   H HG21 . ILE C 1 83  ? -1.282  -18.603 13.243  1.00 4.22  ? 83  ILE C HG21 1  
ATOM 6019   H HG22 . ILE C 1 83  ? -1.317  -17.719 14.763  1.00 4.52  ? 83  ILE C HG22 1  
ATOM 6020   H HG23 . ILE C 1 83  ? 0.220   -18.258 14.085  1.00 42.30 ? 83  ILE C HG23 1  
ATOM 6021   H HD11 . ILE C 1 83  ? -3.431  -14.787 14.264  1.00 51.51 ? 83  ILE C HD11 1  
ATOM 6022   H HD12 . ILE C 1 83  ? -1.791  -14.196 14.448  1.00 31.42 ? 83  ILE C HD12 1  
ATOM 6023   H HD13 . ILE C 1 83  ? -2.252  -15.734 15.149  1.00 33.21 ? 83  ILE C HD13 1  
ATOM 6024   N N    . PHE C 1 84  ? 2.435   -16.937 14.369  1.00 71.43 ? 84  PHE C N    1  
ATOM 6025   C CA   . PHE C 1 84  ? 3.749   -17.574 14.278  1.00 61.32 ? 84  PHE C CA   1  
ATOM 6026   C C    . PHE C 1 84  ? 3.736   -18.889 15.084  1.00 14.14 ? 84  PHE C C    1  
ATOM 6027   O O    . PHE C 1 84  ? 3.426   -18.873 16.273  1.00 23.40 ? 84  PHE C O    1  
ATOM 6028   C CB   . PHE C 1 84  ? 4.852   -16.623 14.848  1.00 22.01 ? 84  PHE C CB   1  
ATOM 6029   C CG   . PHE C 1 84  ? 4.883   -15.190 14.275  1.00 45.21 ? 84  PHE C CG   1  
ATOM 6030   C CD1  . PHE C 1 84  ? 4.599   -14.072 15.074  1.00 54.41 ? 84  PHE C CD1  1  
ATOM 6031   C CD2  . PHE C 1 84  ? 5.215   -14.963 12.936  1.00 51.11 ? 84  PHE C CD2  1  
ATOM 6032   C CE1  . PHE C 1 84  ? 4.647   -12.791 14.546  1.00 20.22 ? 84  PHE C CE1  1  
ATOM 6033   C CE2  . PHE C 1 84  ? 5.259   -13.679 12.417  1.00 72.23 ? 84  PHE C CE2  1  
ATOM 6034   C CZ   . PHE C 1 84  ? 4.980   -12.597 13.221  1.00 0.32  ? 84  PHE C CZ   1  
ATOM 6035   H H    . PHE C 1 84  ? 1.965   -16.971 15.225  1.00 14.02 ? 84  PHE C H    1  
ATOM 6036   H HA   . PHE C 1 84  ? 3.955   -17.797 13.229  1.00 54.34 ? 84  PHE C HA   1  
ATOM 6037   H HB2  . PHE C 1 84  ? 4.724   -16.545 15.923  1.00 65.14 ? 84  PHE C HB2  1  
ATOM 6038   H HB3  . PHE C 1 84  ? 5.823   -17.069 14.658  1.00 20.20 ? 84  PHE C HB3  1  
ATOM 6039   H HD1  . PHE C 1 84  ? 4.339   -14.210 16.123  1.00 34.31 ? 84  PHE C HD1  1  
ATOM 6040   H HD2  . PHE C 1 84  ? 5.437   -15.806 12.295  1.00 35.34 ? 84  PHE C HD2  1  
ATOM 6041   H HE1  . PHE C 1 84  ? 4.424   -11.934 15.176  1.00 11.42 ? 84  PHE C HE1  1  
ATOM 6042   H HE2  . PHE C 1 84  ? 5.521   -13.522 11.375  1.00 1.52  ? 84  PHE C HE2  1  
ATOM 6043   H HZ   . PHE C 1 84  ? 5.018   -11.595 12.814  1.00 60.41 ? 84  PHE C HZ   1  
ATOM 6044   N N    . SER C 1 85  ? 4.046   -20.021 14.434  1.00 62.12 ? 85  SER C N    1  
ATOM 6045   C CA   . SER C 1 85  ? 4.262   -21.300 15.139  1.00 32.44 ? 85  SER C CA   1  
ATOM 6046   C C    . SER C 1 85  ? 5.687   -21.289 15.724  1.00 44.52 ? 85  SER C C    1  
ATOM 6047   O O    . SER C 1 85  ? 6.652   -21.021 14.990  1.00 61.11 ? 85  SER C O    1  
ATOM 6048   C CB   . SER C 1 85  ? 4.065   -22.487 14.170  1.00 41.33 ? 85  SER C CB   1  
ATOM 6049   O OG   . SER C 1 85  ? 4.889   -22.381 13.013  1.00 54.14 ? 85  SER C OG   1  
ATOM 6050   H H    . SER C 1 85  ? 4.148   -19.993 13.457  1.00 63.23 ? 85  SER C H    1  
ATOM 6051   H HA   . SER C 1 85  ? 3.531   -21.377 15.952  1.00 63.13 ? 85  SER C HA   1  
ATOM 6052   H HB2  . SER C 1 85  ? 4.303   -23.414 14.675  1.00 32.31 ? 85  SER C HB2  1  
ATOM 6053   H HB3  . SER C 1 85  ? 3.031   -22.519 13.849  1.00 60.41 ? 85  SER C HB3  1  
ATOM 6054   H HG   . SER C 1 85  ? 5.539   -21.685 13.141  1.00 74.40 ? 85  SER C HG   1  
ATOM 6055   N N    . ILE C 1 86  ? 5.816   -21.560 17.033  1.00 5.44  ? 86  ILE C N    1  
ATOM 6056   C CA   . ILE C 1 86  ? 7.089   -21.389 17.760  1.00 54.02 ? 86  ILE C CA   1  
ATOM 6057   C C    . ILE C 1 86  ? 7.310   -22.513 18.799  1.00 1.03  ? 86  ILE C C    1  
ATOM 6058   O O    . ILE C 1 86  ? 6.367   -22.983 19.436  1.00 42.04 ? 86  ILE C O    1  
ATOM 6059   C CB   . ILE C 1 86  ? 7.145   -19.980 18.454  1.00 21.51 ? 86  ILE C CB   1  
ATOM 6060   C CG1  . ILE C 1 86  ? 8.524   -19.720 19.147  1.00 11.04 ? 86  ILE C CG1  1  
ATOM 6061   C CG2  . ILE C 1 86  ? 5.980   -19.830 19.446  1.00 3.35  ? 86  ILE C CG2  1  
ATOM 6062   C CD1  . ILE C 1 86  ? 8.635   -18.386 19.872  1.00 23.40 ? 86  ILE C CD1  1  
ATOM 6063   H H    . ILE C 1 86  ? 5.034   -21.882 17.529  1.00 1.03  ? 86  ILE C H    1  
ATOM 6064   H HA   . ILE C 1 86  ? 7.896   -21.434 17.033  1.00 30.41 ? 86  ILE C HA   1  
ATOM 6065   H HB   . ILE C 1 86  ? 7.004   -19.231 17.675  1.00 65.21 ? 86  ILE C HB   1  
ATOM 6066   H HG12 . ILE C 1 86  ? 8.712   -20.499 19.874  1.00 5.34  ? 86  ILE C HG12 1  
ATOM 6067   H HG13 . ILE C 1 86  ? 9.308   -19.749 18.399  1.00 20.02 ? 86  ILE C HG13 1  
ATOM 6068   H HG21 . ILE C 1 86  ? 6.000   -18.843 19.885  1.00 64.24 ? 86  ILE C HG21 1  
ATOM 6069   H HG22 . ILE C 1 86  ? 6.068   -20.570 20.231  1.00 20.44 ? 86  ILE C HG22 1  
ATOM 6070   H HG23 . ILE C 1 86  ? 5.037   -19.970 18.930  1.00 32.13 ? 86  ILE C HG23 1  
ATOM 6071   H HD11 . ILE C 1 86  ? 7.903   -18.339 20.670  1.00 44.20 ? 86  ILE C HD11 1  
ATOM 6072   H HD12 . ILE C 1 86  ? 8.461   -17.577 19.177  1.00 34.43 ? 86  ILE C HD12 1  
ATOM 6073   H HD13 . ILE C 1 86  ? 9.624   -18.290 20.291  1.00 51.34 ? 86  ILE C HD13 1  
ATOM 6074   N N    . ALA C 1 87  ? 8.580   -22.930 18.937  1.00 42.01 ? 87  ALA C N    1  
ATOM 6075   C CA   . ALA C 1 87  ? 9.030   -23.903 19.947  1.00 24.41 ? 87  ALA C CA   1  
ATOM 6076   C C    . ALA C 1 87  ? 10.549  -23.768 20.155  1.00 52.03 ? 87  ALA C C    1  
ATOM 6077   O O    . ALA C 1 87  ? 11.229  -23.060 19.398  1.00 1.44  ? 87  ALA C O    1  
ATOM 6078   C CB   . ALA C 1 87  ? 8.655   -25.342 19.526  1.00 64.44 ? 87  ALA C CB   1  
ATOM 6079   H H    . ALA C 1 87  ? 9.251   -22.564 18.325  1.00 53.21 ? 87  ALA C H    1  
ATOM 6080   H HA   . ALA C 1 87  ? 8.531   -23.675 20.887  1.00 42.44 ? 87  ALA C HA   1  
ATOM 6081   H HB1  . ALA C 1 87  ? 7.582   -25.414 19.395  1.00 3.31  ? 87  ALA C HB1  1  
ATOM 6082   H HB2  . ALA C 1 87  ? 8.964   -26.042 20.291  1.00 43.43 ? 87  ALA C HB2  1  
ATOM 6083   H HB3  . ALA C 1 87  ? 9.145   -25.593 18.592  1.00 60.04 ? 87  ALA C HB3  1  
ATOM 6084   N N    . GLY C 1 88  ? 11.071  -24.429 21.202  1.00 32.22 ? 88  GLY C N    1  
ATOM 6085   C CA   . GLY C 1 88  ? 12.520  -24.546 21.428  1.00 74.24 ? 88  GLY C CA   1  
ATOM 6086   C C    . GLY C 1 88  ? 13.045  -23.653 22.552  1.00 62.13 ? 88  GLY C C    1  
ATOM 6087   O O    . GLY C 1 88  ? 13.825  -24.109 23.398  1.00 5.25  ? 88  GLY C O    1  
ATOM 6088   H H    . GLY C 1 88  ? 10.460  -24.851 21.838  1.00 32.50 ? 88  GLY C H    1  
ATOM 6089   H HA2  . GLY C 1 88  ? 12.730  -25.575 21.677  1.00 34.13 ? 88  GLY C HA2  1  
ATOM 6090   H HA3  . GLY C 1 88  ? 13.058  -24.306 20.514  1.00 24.35 ? 88  GLY C HA3  1  
ATOM 6091   N N    . ILE C 1 89  ? 12.629  -22.373 22.559  1.00 50.41 ? 89  ILE C N    1  
ATOM 6092   C CA   . ILE C 1 89  ? 13.120  -21.366 23.544  1.00 65.25 ? 89  ILE C CA   1  
ATOM 6093   C C    . ILE C 1 89  ? 11.974  -20.932 24.479  1.00 15.41 ? 89  ILE C C    1  
ATOM 6094   O O    . ILE C 1 89  ? 10.818  -20.854 24.052  1.00 45.41 ? 89  ILE C O    1  
ATOM 6095   C CB   . ILE C 1 89  ? 13.780  -20.094 22.856  1.00 50.33 ? 89  ILE C CB   1  
ATOM 6096   C CG1  . ILE C 1 89  ? 12.745  -19.130 22.166  1.00 52.53 ? 89  ILE C CG1  1  
ATOM 6097   C CG2  . ILE C 1 89  ? 14.887  -20.517 21.856  1.00 53.03 ? 89  ILE C CG2  1  
ATOM 6098   C CD1  . ILE C 1 89  ? 11.937  -19.722 21.021  1.00 75.25 ? 89  ILE C CD1  1  
ATOM 6099   H H    . ILE C 1 89  ? 11.962  -22.096 21.898  1.00 24.11 ? 89  ILE C H    1  
ATOM 6100   H HA   . ILE C 1 89  ? 13.886  -21.845 24.157  1.00 42.24 ? 89  ILE C HA   1  
ATOM 6101   H HB   . ILE C 1 89  ? 14.276  -19.537 23.650  1.00 22.45 ? 89  ILE C HB   1  
ATOM 6102   H HG12 . ILE C 1 89  ? 12.038  -18.782 22.906  1.00 40.34 ? 89  ILE C HG12 1  
ATOM 6103   H HG13 . ILE C 1 89  ? 13.275  -18.269 21.774  1.00 60.21 ? 89  ILE C HG13 1  
ATOM 6104   H HG21 . ILE C 1 89  ? 14.455  -21.115 21.062  1.00 44.01 ? 89  ILE C HG21 1  
ATOM 6105   H HG22 . ILE C 1 89  ? 15.644  -21.099 22.367  1.00 4.44  ? 89  ILE C HG22 1  
ATOM 6106   H HG23 . ILE C 1 89  ? 15.348  -19.636 21.429  1.00 43.31 ? 89  ILE C HG23 1  
ATOM 6107   H HD11 . ILE C 1 89  ? 11.320  -20.530 21.388  1.00 43.32 ? 89  ILE C HD11 1  
ATOM 6108   H HD12 . ILE C 1 89  ? 12.607  -20.096 20.262  1.00 4.01  ? 89  ILE C HD12 1  
ATOM 6109   H HD13 . ILE C 1 89  ? 11.309  -18.954 20.595  1.00 20.11 ? 89  ILE C HD13 1  
ATOM 6110   N N    . GLU C 1 90  ? 12.309  -20.628 25.744  1.00 3.14  ? 90  GLU C N    1  
ATOM 6111   C CA   . GLU C 1 90  ? 11.306  -20.320 26.786  1.00 63.30 ? 90  GLU C CA   1  
ATOM 6112   C C    . GLU C 1 90  ? 11.851  -19.276 27.789  1.00 72.25 ? 90  GLU C C    1  
ATOM 6113   O O    . GLU C 1 90  ? 12.972  -18.769 27.626  1.00 12.14 ? 90  GLU C O    1  
ATOM 6114   C CB   . GLU C 1 90  ? 10.890  -21.634 27.515  1.00 32.32 ? 90  GLU C CB   1  
ATOM 6115   C CG   . GLU C 1 90  ? 12.018  -22.295 28.335  1.00 73.11 ? 90  GLU C CG   1  
ATOM 6116   C CD   . GLU C 1 90  ? 11.572  -23.581 29.052  1.00 33.43 ? 90  GLU C CD   1  
ATOM 6117   O OE1  . GLU C 1 90  ? 10.895  -23.488 30.098  1.00 44.04 ? 90  GLU C OE1  1  
ATOM 6118   O OE2  . GLU C 1 90  ? 11.895  -24.690 28.574  1.00 34.22 ? 90  GLU C OE2  1  
ATOM 6119   H H    . GLU C 1 90  ? 13.256  -20.604 25.986  1.00 11.05 ? 90  GLU C H    1  
ATOM 6120   H HA   . GLU C 1 90  ? 10.429  -19.892 26.301  1.00 72.32 ? 90  GLU C HA   1  
ATOM 6121   H HB2  . GLU C 1 90  ? 10.066  -21.414 28.188  1.00 3.32  ? 90  GLU C HB2  1  
ATOM 6122   H HB3  . GLU C 1 90  ? 10.544  -22.348 26.775  1.00 1.03  ? 90  GLU C HB3  1  
ATOM 6123   H HG2  . GLU C 1 90  ? 12.845  -22.524 27.667  1.00 45.55 ? 90  GLU C HG2  1  
ATOM 6124   H HG3  . GLU C 1 90  ? 12.359  -21.579 29.077  1.00 11.33 ? 90  GLU C HG3  1  
ATOM 6125   N N    . GLY C 1 91  ? 11.027  -18.957 28.809  1.00 61.42 ? 91  GLY C N    1  
ATOM 6126   C CA   . GLY C 1 91  ? 11.397  -18.018 29.876  1.00 42.21 ? 91  GLY C CA   1  
ATOM 6127   C C    . GLY C 1 91  ? 11.480  -16.573 29.398  1.00 11.52 ? 91  GLY C C    1  
ATOM 6128   O O    . GLY C 1 91  ? 10.507  -16.037 28.853  1.00 4.23  ? 91  GLY C O    1  
ATOM 6129   H H    . GLY C 1 91  ? 10.149  -19.389 28.849  1.00 63.33 ? 91  GLY C H    1  
ATOM 6130   H HA2  . GLY C 1 91  ? 10.649  -18.080 30.656  1.00 10.04 ? 91  GLY C HA2  1  
ATOM 6131   H HA3  . GLY C 1 91  ? 12.350  -18.319 30.297  1.00 3.12  ? 91  GLY C HA3  1  
ATOM 6132   N N    . THR C 1 92  ? 12.655  -15.956 29.587  1.00 62.34 ? 92  THR C N    1  
ATOM 6133   C CA   . THR C 1 92  ? 12.925  -14.574 29.165  1.00 24.53 ? 92  THR C CA   1  
ATOM 6134   C C    . THR C 1 92  ? 13.011  -14.474 27.628  1.00 15.42 ? 92  THR C C    1  
ATOM 6135   O O    . THR C 1 92  ? 12.788  -13.405 27.055  1.00 34.12 ? 92  THR C O    1  
ATOM 6136   C CB   . THR C 1 92  ? 14.245  -14.055 29.816  1.00 35.43 ? 92  THR C CB   1  
ATOM 6137   O OG1  . THR C 1 92  ? 15.347  -14.878 29.411  1.00 62.12 ? 92  THR C OG1  1  
ATOM 6138   C CG2  . THR C 1 92  ? 14.165  -14.061 31.349  1.00 20.34 ? 92  THR C CG2  1  
ATOM 6139   H H    . THR C 1 92  ? 13.378  -16.451 30.031  1.00 23.32 ? 92  THR C H    1  
ATOM 6140   H HA   . THR C 1 92  ? 12.103  -13.952 29.510  1.00 11.30 ? 92  THR C HA   1  
ATOM 6141   H HB   . THR C 1 92  ? 14.425  -13.037 29.482  1.00 4.04  ? 92  THR C HB   1  
ATOM 6142   H HG1  . THR C 1 92  ? 15.705  -14.544 28.584  1.00 53.32 ? 92  THR C HG1  1  
ATOM 6143   H HG21 . THR C 1 92  ? 15.095  -13.700 31.767  1.00 60.43 ? 92  THR C HG21 1  
ATOM 6144   H HG22 . THR C 1 92  ? 13.983  -15.069 31.702  1.00 23.15 ? 92  THR C HG22 1  
ATOM 6145   H HG23 . THR C 1 92  ? 13.355  -13.419 31.675  1.00 15.13 ? 92  THR C HG23 1  
ATOM 6146   N N    . GLN C 1 93  ? 13.330  -15.612 26.979  1.00 61.23 ? 93  GLN C N    1  
ATOM 6147   C CA   . GLN C 1 93  ? 13.382  -15.728 25.510  1.00 72.01 ? 93  GLN C CA   1  
ATOM 6148   C C    . GLN C 1 93  ? 11.961  -15.745 24.913  1.00 54.41 ? 93  GLN C C    1  
ATOM 6149   O O    . GLN C 1 93  ? 11.744  -15.236 23.806  1.00 5.55  ? 93  GLN C O    1  
ATOM 6150   C CB   . GLN C 1 93  ? 14.166  -17.005 25.111  1.00 22.42 ? 93  GLN C CB   1  
ATOM 6151   C CG   . GLN C 1 93  ? 15.649  -16.994 25.548  1.00 35.50 ? 93  GLN C CG   1  
ATOM 6152   C CD   . GLN C 1 93  ? 16.376  -18.335 25.382  1.00 33.23 ? 93  GLN C CD   1  
ATOM 6153   O OE1  . GLN C 1 93  ? 17.572  -18.377 25.090  1.00 23.31 ? 93  GLN C OE1  1  
ATOM 6154   N NE2  . GLN C 1 93  ? 15.686  -19.440 25.642  1.00 61.13 ? 93  GLN C NE2  1  
ATOM 6155   H H    . GLN C 1 93  ? 13.535  -16.408 27.514  1.00 54.32 ? 93  GLN C H    1  
ATOM 6156   H HA   . GLN C 1 93  ? 13.909  -14.857 25.125  1.00 4.42  ? 93  GLN C HA   1  
ATOM 6157   H HB2  . GLN C 1 93  ? 13.682  -17.867 25.562  1.00 42.20 ? 93  GLN C HB2  1  
ATOM 6158   H HB3  . GLN C 1 93  ? 14.134  -17.118 24.032  1.00 63.34 ? 93  GLN C HB3  1  
ATOM 6159   H HG2  . GLN C 1 93  ? 16.173  -16.244 24.969  1.00 2.15  ? 93  GLN C HG2  1  
ATOM 6160   H HG3  . GLN C 1 93  ? 15.699  -16.714 26.597  1.00 42.44 ? 93  GLN C HG3  1  
ATOM 6161   H HE21 . GLN C 1 93  ? 14.755  -19.351 25.928  1.00 41.11 ? 93  GLN C HE21 1  
ATOM 6162   H HE22 . GLN C 1 93  ? 16.143  -20.300 25.540  1.00 61.35 ? 93  GLN C HE22 1  
ATOM 6163   N N    . MET C 1 94  ? 10.994  -16.313 25.673  1.00 70.25 ? 94  MET C N    1  
ATOM 6164   C CA   . MET C 1 94  ? 9.558   -16.270 25.306  1.00 64.15 ? 94  MET C CA   1  
ATOM 6165   C C    . MET C 1 94  ? 9.061   -14.814 25.386  1.00 0.42  ? 94  MET C C    1  
ATOM 6166   O O    . MET C 1 94  ? 8.328   -14.347 24.516  1.00 63.02 ? 94  MET C O    1  
ATOM 6167   C CB   . MET C 1 94  ? 8.702   -17.185 26.232  1.00 53.41 ? 94  MET C CB   1  
ATOM 6168   C CG   . MET C 1 94  ? 7.197   -17.235 25.877  1.00 24.42 ? 94  MET C CG   1  
ATOM 6169   S SD   . MET C 1 94  ? 6.203   -18.142 27.089  1.00 43.03 ? 94  MET C SD   1  
ATOM 6170   C CE   . MET C 1 94  ? 6.375   -17.118 28.559  1.00 71.12 ? 94  MET C CE   1  
ATOM 6171   H H    . MET C 1 94  ? 11.253  -16.761 26.506  1.00 51.44 ? 94  MET C H    1  
ATOM 6172   H HA   . MET C 1 94  ? 9.470   -16.618 24.280  1.00 74.12 ? 94  MET C HA   1  
ATOM 6173   H HB2  . MET C 1 94  ? 9.091   -18.194 26.179  1.00 70.31 ? 94  MET C HB2  1  
ATOM 6174   H HB3  . MET C 1 94  ? 8.798   -16.837 27.255  1.00 1.43  ? 94  MET C HB3  1  
ATOM 6175   H HG2  . MET C 1 94  ? 6.813   -16.224 25.813  1.00 0.10  ? 94  MET C HG2  1  
ATOM 6176   H HG3  . MET C 1 94  ? 7.082   -17.715 24.913  1.00 30.44 ? 94  MET C HG3  1  
ATOM 6177   H HE1  . MET C 1 94  ? 5.996   -16.127 28.358  1.00 45.10 ? 94  MET C HE1  1  
ATOM 6178   H HE2  . MET C 1 94  ? 7.417   -17.057 28.839  1.00 2.21  ? 94  MET C HE2  1  
ATOM 6179   H HE3  . MET C 1 94  ? 5.813   -17.560 29.369  1.00 30.11 ? 94  MET C HE3  1  
ATOM 6180   N N    . ALA C 1 95  ? 9.518   -14.101 26.432  1.00 33.42 ? 95  ALA C N    1  
ATOM 6181   C CA   . ALA C 1 95  ? 9.224   -12.673 26.626  1.00 73.05 ? 95  ALA C CA   1  
ATOM 6182   C C    . ALA C 1 95  ? 9.853   -11.818 25.521  1.00 64.43 ? 95  ALA C C    1  
ATOM 6183   O O    . ALA C 1 95  ? 9.277   -10.825 25.101  1.00 34.43 ? 95  ALA C O    1  
ATOM 6184   C CB   . ALA C 1 95  ? 9.723   -12.203 27.991  1.00 64.13 ? 95  ALA C CB   1  
ATOM 6185   H H    . ALA C 1 95  ? 10.070  -14.561 27.105  1.00 40.24 ? 95  ALA C H    1  
ATOM 6186   H HA   . ALA C 1 95  ? 8.144   -12.550 26.598  1.00 72.30 ? 95  ALA C HA   1  
ATOM 6187   H HB1  . ALA C 1 95  ? 9.323   -12.839 28.757  1.00 61.24 ? 95  ALA C HB1  1  
ATOM 6188   H HB2  . ALA C 1 95  ? 9.400   -11.186 28.171  1.00 73.44 ? 95  ALA C HB2  1  
ATOM 6189   H HB3  . ALA C 1 95  ? 10.805  -12.247 28.026  1.00 25.00 ? 95  ALA C HB3  1  
ATOM 6190   N N    . HIS C 1 96  ? 11.052  -12.207 25.064  1.00 22.04 ? 96  HIS C N    1  
ATOM 6191   C CA   . HIS C 1 96  ? 11.775  -11.475 24.002  1.00 22.30 ? 96  HIS C CA   1  
ATOM 6192   C C    . HIS C 1 96  ? 11.183  -11.767 22.606  1.00 10.23 ? 96  HIS C C    1  
ATOM 6193   O O    . HIS C 1 96  ? 11.373  -10.971 21.671  1.00 2.13  ? 96  HIS C O    1  
ATOM 6194   C CB   . HIS C 1 96  ? 13.293  -11.784 24.048  1.00 74.14 ? 96  HIS C CB   1  
ATOM 6195   C CG   . HIS C 1 96  ? 14.120  -10.907 23.129  1.00 73.32 ? 96  HIS C CG   1  
ATOM 6196   N ND1  . HIS C 1 96  ? 15.103  -11.388 22.301  1.00 11.21 ? 96  HIS C ND1  1  
ATOM 6197   C CD2  . HIS C 1 96  ? 14.050  -9.571  22.884  1.00 34.02 ? 96  HIS C CD2  1  
ATOM 6198   C CE1  . HIS C 1 96  ? 15.620  -10.395 21.611  1.00 5.43  ? 96  HIS C CE1  1  
ATOM 6199   N NE2  . HIS C 1 96  ? 14.996  -9.282  21.934  1.00 1.55  ? 96  HIS C NE2  1  
ATOM 6200   H H    . HIS C 1 96  ? 11.474  -12.996 25.473  1.00 25.01 ? 96  HIS C H    1  
ATOM 6201   H HA   . HIS C 1 96  ? 11.636  -10.410 24.202  1.00 53.43 ? 96  HIS C HA   1  
ATOM 6202   H HB2  . HIS C 1 96  ? 13.655  -11.623 25.057  1.00 23.41 ? 96  HIS C HB2  1  
ATOM 6203   H HB3  . HIS C 1 96  ? 13.462  -12.822 23.777  1.00 13.21 ? 96  HIS C HB3  1  
ATOM 6204   H HD1  . HIS C 1 96  ? 15.408  -12.317 22.252  1.00 34.10 ? 96  HIS C HD1  1  
ATOM 6205   H HD2  . HIS C 1 96  ? 13.360  -8.850  23.363  1.00 74.12 ? 96  HIS C HD2  1  
ATOM 6206   H HE1  . HIS C 1 96  ? 16.408  -10.484 20.876  1.00 50.12 ? 96  HIS C HE1  1  
ATOM 6207   H HE2  . HIS C 1 96  ? 14.993  -8.479  21.377  1.00 37.65 ? 96  HIS C HE2  1  
ATOM 6208   N N    . CYS C 1 97  ? 10.462  -12.894 22.479  1.00 12.42 ? 97  CYS C N    1  
ATOM 6209   C CA   . CYS C 1 97  ? 9.721   -13.230 21.248  1.00 12.21 ? 97  CYS C CA   1  
ATOM 6210   C C    . CYS C 1 97  ? 8.651   -12.155 20.963  1.00 35.15 ? 97  CYS C C    1  
ATOM 6211   O O    . CYS C 1 97  ? 8.646   -11.543 19.891  1.00 34.42 ? 97  CYS C O    1  
ATOM 6212   C CB   . CYS C 1 97  ? 9.080   -14.628 21.360  1.00 33.33 ? 97  CYS C CB   1  
ATOM 6213   S SG   . CYS C 1 97  ? 8.112   -15.119 19.915  1.00 30.30 ? 97  CYS C SG   1  
ATOM 6214   H H    . CYS C 1 97  ? 10.435  -13.525 23.233  1.00 65.31 ? 97  CYS C H    1  
ATOM 6215   H HA   . CYS C 1 97  ? 10.435  -13.238 20.431  1.00 72.43 ? 97  CYS C HA   1  
ATOM 6216   H HB2  . CYS C 1 97  ? 9.858   -15.368 21.494  1.00 55.53 ? 97  CYS C HB2  1  
ATOM 6217   H HB3  . CYS C 1 97  ? 8.420   -14.655 22.219  1.00 22.01 ? 97  CYS C HB3  1  
ATOM 6218   H HG   . CYS C 1 97  ? 8.436   -14.316 18.913  1.00 54.10 ? 97  CYS C HG   1  
ATOM 6219   N N    . LEU C 1 98  ? 7.782   -11.901 21.964  1.00 11.14 ? 98  LEU C N    1  
ATOM 6220   C CA   . LEU C 1 98  ? 6.777   -10.820 21.905  1.00 62.04 ? 98  LEU C CA   1  
ATOM 6221   C C    . LEU C 1 98  ? 7.430   -9.440  22.129  1.00 32.33 ? 98  LEU C C    1  
ATOM 6222   O O    . LEU C 1 98  ? 6.855   -8.418  21.761  1.00 4.22  ? 98  LEU C O    1  
ATOM 6223   C CB   . LEU C 1 98  ? 5.626   -11.091 22.940  1.00 75.12 ? 98  LEU C CB   1  
ATOM 6224   C CG   . LEU C 1 98  ? 6.024   -11.238 24.469  1.00 22.33 ? 98  LEU C CG   1  
ATOM 6225   C CD1  . LEU C 1 98  ? 6.254   -9.880  25.161  1.00 2.30  ? 98  LEU C CD1  1  
ATOM 6226   C CD2  . LEU C 1 98  ? 4.993   -12.073 25.260  1.00 61.31 ? 98  LEU C CD2  1  
ATOM 6227   H H    . LEU C 1 98  ? 7.811   -12.469 22.762  1.00 21.41 ? 98  LEU C H    1  
ATOM 6228   H HA   . LEU C 1 98  ? 6.350   -10.827 20.904  1.00 53.40 ? 98  LEU C HA   1  
ATOM 6229   H HB2  . LEU C 1 98  ? 4.898   -10.293 22.853  1.00 41.42 ? 98  LEU C HB2  1  
ATOM 6230   H HB3  . LEU C 1 98  ? 5.137   -12.012 22.633  1.00 21.21 ? 98  LEU C HB3  1  
ATOM 6231   H HG   . LEU C 1 98  ? 6.966   -11.773 24.520  1.00 72.12 ? 98  LEU C HG   1  
ATOM 6232   H HD11 . LEU C 1 98  ? 7.093   -9.379  24.699  1.00 10.15 ? 98  LEU C HD11 1  
ATOM 6233   H HD12 . LEU C 1 98  ? 6.470   -10.032 26.210  1.00 71.34 ? 98  LEU C HD12 1  
ATOM 6234   H HD13 . LEU C 1 98  ? 5.371   -9.262  25.062  1.00 51.34 ? 98  LEU C HD13 1  
ATOM 6235   H HD21 . LEU C 1 98  ? 4.022   -11.592 25.228  1.00 44.42 ? 98  LEU C HD21 1  
ATOM 6236   H HD22 . LEU C 1 98  ? 5.311   -12.175 26.288  1.00 3.23  ? 98  LEU C HD22 1  
ATOM 6237   H HD23 . LEU C 1 98  ? 4.913   -13.059 24.818  1.00 60.33 ? 98  LEU C HD23 1  
ATOM 6238   N N    . GLY C 1 99  ? 8.618   -9.431  22.777  1.00 15.33 ? 99  GLY C N    1  
ATOM 6239   C CA   . GLY C 1 99  ? 9.279   -8.196  23.181  1.00 34.43 ? 99  GLY C CA   1  
ATOM 6240   C C    . GLY C 1 99  ? 9.945   -7.435  22.059  1.00 13.10 ? 99  GLY C C    1  
ATOM 6241   O O    . GLY C 1 99  ? 10.106  -6.208  22.155  1.00 33.15 ? 99  GLY C O    1  
ATOM 6242   H H    . GLY C 1 99  ? 9.035   -10.287 23.017  1.00 71.43 ? 99  GLY C H    1  
ATOM 6243   H HA2  . GLY C 1 99  ? 8.548   -7.547  23.651  1.00 14.41 ? 99  GLY C HA2  1  
ATOM 6244   H HA3  . GLY C 1 99  ? 10.054  -8.453  23.926  1.00 12.21 ? 99  GLY C HA3  1  
ATOM 6245   N N    . ALA C 1 100 ? 10.346  -8.153  20.998  1.00 52.51 ? 100 ALA C N    1  
ATOM 6246   C CA   . ALA C 1 100 ? 11.171  -7.572  19.938  1.00 55.33 ? 100 ALA C CA   1  
ATOM 6247   C C    . ALA C 1 100 ? 11.076  -8.350  18.634  1.00 71.03 ? 100 ALA C C    1  
ATOM 6248   O O    . ALA C 1 100 ? 10.618  -7.808  17.639  1.00 72.01 ? 100 ALA C O    1  
ATOM 6249   C CB   . ALA C 1 100 ? 12.616  -7.500  20.411  1.00 63.32 ? 100 ALA C CB   1  
ATOM 6250   H H    . ALA C 1 100 ? 10.072  -9.088  20.930  1.00 33.12 ? 100 ALA C H    1  
ATOM 6251   H HA   . ALA C 1 100 ? 10.830  -6.554  19.758  1.00 0.44  ? 100 ALA C HA   1  
ATOM 6252   H HB1  . ALA C 1 100 ? 13.000  -8.497  20.586  1.00 53.40 ? 100 ALA C HB1  1  
ATOM 6253   H HB2  . ALA C 1 100 ? 12.674  -6.932  21.334  1.00 22.21 ? 100 ALA C HB2  1  
ATOM 6254   H HB3  . ALA C 1 100 ? 13.226  -7.008  19.660  1.00 31.53 ? 100 ALA C HB3  1  
ATOM 6255   N N    . TYR C 1 101 ? 11.463  -9.636  18.682  1.00 2.22  ? 101 TYR C N    1  
ATOM 6256   C CA   . TYR C 1 101 ? 11.699  -10.474 17.482  1.00 11.41 ? 101 TYR C CA   1  
ATOM 6257   C C    . TYR C 1 101 ? 10.493  -10.468 16.503  1.00 73.12 ? 101 TYR C C    1  
ATOM 6258   O O    . TYR C 1 101 ? 10.660  -10.247 15.295  1.00 54.15 ? 101 TYR C O    1  
ATOM 6259   C CB   . TYR C 1 101 ? 12.034  -11.921 17.936  1.00 2.44  ? 101 TYR C CB   1  
ATOM 6260   C CG   . TYR C 1 101 ? 12.418  -12.873 16.795  1.00 61.51 ? 101 TYR C CG   1  
ATOM 6261   C CD1  . TYR C 1 101 ? 13.639  -12.740 16.125  1.00 71.35 ? 101 TYR C CD1  1  
ATOM 6262   C CD2  . TYR C 1 101 ? 11.571  -13.904 16.392  1.00 40.02 ? 101 TYR C CD2  1  
ATOM 6263   C CE1  . TYR C 1 101 ? 13.995  -13.597 15.104  1.00 53.41 ? 101 TYR C CE1  1  
ATOM 6264   C CE2  . TYR C 1 101 ? 11.927  -14.759 15.371  1.00 21.44 ? 101 TYR C CE2  1  
ATOM 6265   C CZ   . TYR C 1 101 ? 13.136  -14.605 14.731  1.00 73.04 ? 101 TYR C CZ   1  
ATOM 6266   O OH   . TYR C 1 101 ? 13.489  -15.469 13.715  1.00 44.53 ? 101 TYR C OH   1  
ATOM 6267   H H    . TYR C 1 101 ? 11.602  -10.045 19.568  1.00 32.05 ? 101 TYR C H    1  
ATOM 6268   H HA   . TYR C 1 101 ? 12.561  -10.057 16.966  1.00 40.33 ? 101 TYR C HA   1  
ATOM 6269   H HB2  . TYR C 1 101 ? 12.868  -11.891 18.630  1.00 12.51 ? 101 TYR C HB2  1  
ATOM 6270   H HB3  . TYR C 1 101 ? 11.175  -12.339 18.454  1.00 75.45 ? 101 TYR C HB3  1  
ATOM 6271   H HD1  . TYR C 1 101 ? 14.314  -11.948 16.418  1.00 73.03 ? 101 TYR C HD1  1  
ATOM 6272   H HD2  . TYR C 1 101 ? 10.616  -14.033 16.891  1.00 33.02 ? 101 TYR C HD2  1  
ATOM 6273   H HE1  . TYR C 1 101 ? 14.946  -13.474 14.602  1.00 31.23 ? 101 TYR C HE1  1  
ATOM 6274   H HE2  . TYR C 1 101 ? 11.253  -15.551 15.077  1.00 1.41  ? 101 TYR C HE2  1  
ATOM 6275   H HH   . TYR C 1 101 ? 12.717  -15.671 13.184  1.00 51.04 ? 101 TYR C HH   1  
ATOM 6276   N N    . CYS C 1 102 ? 9.286   -10.673 17.055  1.00 52.44 ? 102 CYS C N    1  
ATOM 6277   C CA   . CYS C 1 102 ? 8.034   -10.720 16.280  1.00 33.34 ? 102 CYS C CA   1  
ATOM 6278   C C    . CYS C 1 102 ? 7.519   -9.298  15.894  1.00 33.44 ? 102 CYS C C    1  
ATOM 6279   O O    . CYS C 1 102 ? 7.192   -9.104  14.721  1.00 63.51 ? 102 CYS C O    1  
ATOM 6280   C CB   . CYS C 1 102 ? 6.974   -11.531 17.042  1.00 53.30 ? 102 CYS C CB   1  
ATOM 6281   S SG   . CYS C 1 102 ? 7.404   -13.271 17.254  1.00 1.04  ? 102 CYS C SG   1  
ATOM 6282   H H    . CYS C 1 102 ? 9.233   -10.780 18.027  1.00 21.15 ? 102 CYS C H    1  
ATOM 6283   H HA   . CYS C 1 102 ? 8.258   -11.258 15.360  1.00 51.54 ? 102 CYS C HA   1  
ATOM 6284   H HB2  . CYS C 1 102 ? 6.839   -11.111 18.028  1.00 35.02 ? 102 CYS C HB2  1  
ATOM 6285   H HB3  . CYS C 1 102 ? 6.021   -11.488 16.515  1.00 71.30 ? 102 CYS C HB3  1  
ATOM 6286   H HG   . CYS C 1 102 ? 6.923   -13.927 16.214  1.00 31.41 ? 102 CYS C HG   1  
ATOM 6287   N N    . PRO C 1 103 ? 7.428   -8.271  16.845  1.00 34.03 ? 103 PRO C N    1  
ATOM 6288   C CA   . PRO C 1 103 ? 7.129   -6.857  16.464  1.00 33.41 ? 103 PRO C CA   1  
ATOM 6289   C C    . PRO C 1 103 ? 8.053   -6.305  15.341  1.00 13.34 ? 103 PRO C C    1  
ATOM 6290   O O    . PRO C 1 103 ? 7.618   -5.495  14.532  1.00 15.14 ? 103 PRO C O    1  
ATOM 6291   C CB   . PRO C 1 103 ? 7.333   -6.053  17.775  1.00 4.44  ? 103 PRO C CB   1  
ATOM 6292   C CG   . PRO C 1 103 ? 7.134   -7.042  18.885  1.00 62.03 ? 103 PRO C CG   1  
ATOM 6293   C CD   . PRO C 1 103 ? 7.513   -8.408  18.334  1.00 41.05 ? 103 PRO C CD   1  
ATOM 6294   H HA   . PRO C 1 103 ? 6.088   -6.771  16.138  1.00 65.23 ? 103 PRO C HA   1  
ATOM 6295   H HB2  . PRO C 1 103 ? 8.341   -5.623  17.811  1.00 63.10 ? 103 PRO C HB2  1  
ATOM 6296   H HB3  . PRO C 1 103 ? 6.603   -5.259  17.845  1.00 21.13 ? 103 PRO C HB3  1  
ATOM 6297   H HG2  . PRO C 1 103 ? 7.770   -6.782  19.729  1.00 22.53 ? 103 PRO C HG2  1  
ATOM 6298   H HG3  . PRO C 1 103 ? 6.099   -7.048  19.206  1.00 33.50 ? 103 PRO C HG3  1  
ATOM 6299   H HD2  . PRO C 1 103 ? 8.524   -8.674  18.631  1.00 41.10 ? 103 PRO C HD2  1  
ATOM 6300   H HD3  . PRO C 1 103 ? 6.821   -9.166  18.683  1.00 71.54 ? 103 PRO C HD3  1  
ATOM 6301   N N    . ASN C 1 104 ? 9.324   -6.779  15.318  1.00 43.12 ? 104 ASN C N    1  
ATOM 6302   C CA   . ASN C 1 104 ? 10.348  -6.388  14.307  1.00 13.25 ? 104 ASN C CA   1  
ATOM 6303   C C    . ASN C 1 104 ? 9.974   -6.891  12.908  1.00 64.43 ? 104 ASN C C    1  
ATOM 6304   O O    . ASN C 1 104 ? 10.205  -6.195  11.906  1.00 4.13  ? 104 ASN C O    1  
ATOM 6305   C CB   . ASN C 1 104 ? 11.764  -6.926  14.711  1.00 24.00 ? 104 ASN C CB   1  
ATOM 6306   C CG   . ASN C 1 104 ? 12.470  -6.084  15.781  1.00 34.54 ? 104 ASN C CG   1  
ATOM 6307   O OD1  . ASN C 1 104 ? 11.836  -5.434  16.602  1.00 34.34 ? 104 ASN C OD1  1  
ATOM 6308   N ND2  . ASN C 1 104 ? 13.788  -6.105  15.787  1.00 55.25 ? 104 ASN C ND2  1  
ATOM 6309   H H    . ASN C 1 104 ? 9.582   -7.420  16.009  1.00 23.31 ? 104 ASN C H    1  
ATOM 6310   H HA   . ASN C 1 104 ? 10.376  -5.303  14.278  1.00 24.33 ? 104 ASN C HA   1  
ATOM 6311   H HB2  . ASN C 1 104 ? 11.664  -7.933  15.098  1.00 63.41 ? 104 ASN C HB2  1  
ATOM 6312   H HB3  . ASN C 1 104 ? 12.406  -6.963  13.836  1.00 51.42 ? 104 ASN C HB3  1  
ATOM 6313   H HD21 . ASN C 1 104 ? 14.248  -6.645  15.112  1.00 0.13  ? 104 ASN C HD21 1  
ATOM 6314   H HD22 . ASN C 1 104 ? 14.257  -5.605  16.483  1.00 4.00  ? 104 ASN C HD22 1  
ATOM 6315   N N    . ILE C 1 105 ? 9.407   -8.107  12.850  1.00 41.22 ? 105 ILE C N    1  
ATOM 6316   C CA   . ILE C 1 105 ? 8.871   -8.677  11.607  1.00 12.35 ? 105 ILE C CA   1  
ATOM 6317   C C    . ILE C 1 105 ? 7.682   -7.827  11.123  1.00 60.32 ? 105 ILE C C    1  
ATOM 6318   O O    . ILE C 1 105 ? 7.609   -7.448  9.954   1.00 10.13 ? 105 ILE C O    1  
ATOM 6319   C CB   . ILE C 1 105 ? 8.407   -10.173 11.810  1.00 23.01 ? 105 ILE C CB   1  
ATOM 6320   C CG1  . ILE C 1 105 ? 9.593   -11.102 12.224  1.00 65.02 ? 105 ILE C CG1  1  
ATOM 6321   C CG2  . ILE C 1 105 ? 7.704   -10.731 10.555  1.00 5.01  ? 105 ILE C CG2  1  
ATOM 6322   C CD1  . ILE C 1 105 ? 10.795  -11.059 11.284  1.00 21.14 ? 105 ILE C CD1  1  
ATOM 6323   H H    . ILE C 1 105 ? 9.333   -8.630  13.677  1.00 4.15  ? 105 ILE C H    1  
ATOM 6324   H HA   . ILE C 1 105 ? 9.660   -8.653  10.856  1.00 52.31 ? 105 ILE C HA   1  
ATOM 6325   H HB   . ILE C 1 105 ? 7.675   -10.175 12.616  1.00 42.31 ? 105 ILE C HB   1  
ATOM 6326   H HG12 . ILE C 1 105 ? 9.941   -10.820 13.208  1.00 53.02 ? 105 ILE C HG12 1  
ATOM 6327   H HG13 . ILE C 1 105 ? 9.243   -12.131 12.257  1.00 52.54 ? 105 ILE C HG13 1  
ATOM 6328   H HG21 . ILE C 1 105 ? 7.219   -11.663 10.798  1.00 34.51 ? 105 ILE C HG21 1  
ATOM 6329   H HG22 . ILE C 1 105 ? 8.426   -10.898 9.767   1.00 44.31 ? 105 ILE C HG22 1  
ATOM 6330   H HG23 . ILE C 1 105 ? 6.955   -10.036 10.205  1.00 71.20 ? 105 ILE C HG23 1  
ATOM 6331   H HD11 . ILE C 1 105 ? 11.512  -11.797 11.582  1.00 22.34 ? 105 ILE C HD11 1  
ATOM 6332   H HD12 . ILE C 1 105 ? 11.255  -10.083 11.326  1.00 33.42 ? 105 ILE C HD12 1  
ATOM 6333   H HD13 . ILE C 1 105 ? 10.474  -11.263 10.272  1.00 42.21 ? 105 ILE C HD13 1  
ATOM 6334   N N    . LEU C 1 106 ? 6.798   -7.495  12.074  1.00 62.44 ? 106 LEU C N    1  
ATOM 6335   C CA   . LEU C 1 106 ? 5.516   -6.828  11.808  1.00 61.13 ? 106 LEU C CA   1  
ATOM 6336   C C    . LEU C 1 106 ? 5.679   -5.307  11.562  1.00 20.22 ? 106 LEU C C    1  
ATOM 6337   O O    . LEU C 1 106 ? 4.792   -4.669  10.996  1.00 21.32 ? 106 LEU C O    1  
ATOM 6338   C CB   . LEU C 1 106 ? 4.581   -7.071  13.021  1.00 11.44 ? 106 LEU C CB   1  
ATOM 6339   C CG   . LEU C 1 106 ? 4.286   -8.565  13.348  1.00 41.40 ? 106 LEU C CG   1  
ATOM 6340   C CD1  . LEU C 1 106 ? 3.516   -8.706  14.674  1.00 50.43 ? 106 LEU C CD1  1  
ATOM 6341   C CD2  . LEU C 1 106 ? 3.557   -9.255  12.179  1.00 64.41 ? 106 LEU C CD2  1  
ATOM 6342   H H    . LEU C 1 106 ? 7.023   -7.708  13.006  1.00 50.01 ? 106 LEU C H    1  
ATOM 6343   H HA   . LEU C 1 106 ? 5.082   -7.299  10.926  1.00 70.25 ? 106 LEU C HA   1  
ATOM 6344   H HB2  . LEU C 1 106 ? 5.036   -6.609  13.895  1.00 72.31 ? 106 LEU C HB2  1  
ATOM 6345   H HB3  . LEU C 1 106 ? 3.634   -6.570  12.834  1.00 1.23  ? 106 LEU C HB3  1  
ATOM 6346   H HG   . LEU C 1 106 ? 5.233   -9.080  13.481  1.00 2.13  ? 106 LEU C HG   1  
ATOM 6347   H HD11 . LEU C 1 106 ? 2.642   -8.085  14.674  1.00 40.13 ? 106 LEU C HD11 1  
ATOM 6348   H HD12 . LEU C 1 106 ? 4.153   -8.401  15.488  1.00 53.22 ? 106 LEU C HD12 1  
ATOM 6349   H HD13 . LEU C 1 106 ? 3.224   -9.739  14.826  1.00 71.01 ? 106 LEU C HD13 1  
ATOM 6350   H HD21 . LEU C 1 106 ? 3.396   -10.298 12.411  1.00 54.53 ? 106 LEU C HD21 1  
ATOM 6351   H HD22 . LEU C 1 106 ? 4.161   -9.192  11.288  1.00 31.12 ? 106 LEU C HD22 1  
ATOM 6352   H HD23 . LEU C 1 106 ? 2.602   -8.774  12.001  1.00 13.44 ? 106 LEU C HD23 1  
ATOM 6353   N N    . PHE C 1 107 ? 6.832   -4.757  11.996  1.00 33.53 ? 107 PHE C N    1  
ATOM 6354   C CA   . PHE C 1 107 ? 7.108   -3.302  12.025  1.00 71.54 ? 107 PHE C CA   1  
ATOM 6355   C C    . PHE C 1 107 ? 7.017   -2.605  10.632  1.00 34.34 ? 107 PHE C C    1  
ATOM 6356   O O    . PHE C 1 107 ? 6.331   -1.579  10.537  1.00 25.54 ? 107 PHE C O    1  
ATOM 6357   C CB   . PHE C 1 107 ? 8.486   -3.034  12.707  1.00 11.31 ? 107 PHE C CB   1  
ATOM 6358   C CG   . PHE C 1 107 ? 8.936   -1.575  12.696  1.00 25.23 ? 107 PHE C CG   1  
ATOM 6359   C CD1  . PHE C 1 107 ? 8.304   -0.630  13.504  1.00 2.31  ? 107 PHE C CD1  1  
ATOM 6360   C CD2  . PHE C 1 107 ? 9.987   -1.152  11.875  1.00 55.33 ? 107 PHE C CD2  1  
ATOM 6361   C CE1  . PHE C 1 107 ? 8.714   0.689   13.491  1.00 42.12 ? 107 PHE C CE1  1  
ATOM 6362   C CE2  . PHE C 1 107 ? 10.389  0.166   11.864  1.00 51.00 ? 107 PHE C CE2  1  
ATOM 6363   C CZ   . PHE C 1 107 ? 9.754   1.086   12.671  1.00 3.24  ? 107 PHE C CZ   1  
ATOM 6364   H H    . PHE C 1 107 ? 7.529   -5.363  12.327  1.00 15.22 ? 107 PHE C H    1  
ATOM 6365   H HA   . PHE C 1 107 ? 6.340   -2.864  12.657  1.00 53.24 ? 107 PHE C HA   1  
ATOM 6366   H HB2  . PHE C 1 107 ? 8.431   -3.354  13.745  1.00 3.03  ? 107 PHE C HB2  1  
ATOM 6367   H HB3  . PHE C 1 107 ? 9.244   -3.630  12.210  1.00 41.22 ? 107 PHE C HB3  1  
ATOM 6368   H HD1  . PHE C 1 107 ? 7.478   -0.935  14.143  1.00 32.32 ? 107 PHE C HD1  1  
ATOM 6369   H HD2  . PHE C 1 107 ? 10.486  -1.874  11.234  1.00 3.10  ? 107 PHE C HD2  1  
ATOM 6370   H HE1  . PHE C 1 107 ? 8.219   1.415   14.124  1.00 74.30 ? 107 PHE C HE1  1  
ATOM 6371   H HE2  . PHE C 1 107 ? 11.202  0.482   11.223  1.00 62.24 ? 107 PHE C HE2  1  
ATOM 6372   H HZ   . PHE C 1 107 ? 10.071  2.125   12.664  1.00 24.23 ? 107 PHE C HZ   1  
ATOM 6373   N N    . PRO C 1 108 ? 7.696   -3.105  9.539   1.00 72.33 ? 108 PRO C N    1  
ATOM 6374   C CA   . PRO C 1 108 ? 7.614   -2.457  8.201   1.00 41.23 ? 108 PRO C CA   1  
ATOM 6375   C C    . PRO C 1 108 ? 6.182   -2.483  7.617   1.00 24.31 ? 108 PRO C C    1  
ATOM 6376   O O    . PRO C 1 108 ? 5.773   -1.541  6.925   1.00 61.24 ? 108 PRO C O    1  
ATOM 6377   C CB   . PRO C 1 108 ? 8.615   -3.270  7.341   1.00 1.12  ? 108 PRO C CB   1  
ATOM 6378   C CG   . PRO C 1 108 ? 8.739   -4.592  8.040   1.00 43.14 ? 108 PRO C CG   1  
ATOM 6379   C CD   . PRO C 1 108 ? 8.607   -4.290  9.506   1.00 74.14 ? 108 PRO C CD   1  
ATOM 6380   H HA   . PRO C 1 108 ? 7.945   -1.419  8.257   1.00 14.22 ? 108 PRO C HA   1  
ATOM 6381   H HB2  . PRO C 1 108 ? 8.245   -3.391  6.322   1.00 31.40 ? 108 PRO C HB2  1  
ATOM 6382   H HB3  . PRO C 1 108 ? 9.577   -2.773  7.320   1.00 71.12 ? 108 PRO C HB3  1  
ATOM 6383   H HG2  . PRO C 1 108 ? 7.944   -5.263  7.711   1.00 5.05  ? 108 PRO C HG2  1  
ATOM 6384   H HG3  . PRO C 1 108 ? 9.704   -5.038  7.840   1.00 65.40 ? 108 PRO C HG3  1  
ATOM 6385   H HD2  . PRO C 1 108 ? 8.164   -5.132  10.030  1.00 2.42  ? 108 PRO C HD2  1  
ATOM 6386   H HD3  . PRO C 1 108 ? 9.568   -4.043  9.943   1.00 23.14 ? 108 PRO C HD3  1  
ATOM 6387   N N    . TYR C 1 109 ? 5.419   -3.556  7.941   1.00 53.02 ? 109 TYR C N    1  
ATOM 6388   C CA   . TYR C 1 109 ? 4.010   -3.704  7.517   1.00 70.34 ? 109 TYR C CA   1  
ATOM 6389   C C    . TYR C 1 109 ? 3.130   -2.652  8.219   1.00 54.32 ? 109 TYR C C    1  
ATOM 6390   O O    . TYR C 1 109 ? 2.268   -2.022  7.591   1.00 14.20 ? 109 TYR C O    1  
ATOM 6391   C CB   . TYR C 1 109 ? 3.462   -5.104  7.861   1.00 12.10 ? 109 TYR C CB   1  
ATOM 6392   C CG   . TYR C 1 109 ? 4.157   -6.331  7.254   1.00 23.23 ? 109 TYR C CG   1  
ATOM 6393   C CD1  . TYR C 1 109 ? 5.288   -6.888  7.851   1.00 4.33  ? 109 TYR C CD1  1  
ATOM 6394   C CD2  . TYR C 1 109 ? 3.634   -6.978  6.128   1.00 43.03 ? 109 TYR C CD2  1  
ATOM 6395   C CE1  . TYR C 1 109 ? 5.869   -8.034  7.353   1.00 50.41 ? 109 TYR C CE1  1  
ATOM 6396   C CE2  . TYR C 1 109 ? 4.227   -8.121  5.621   1.00 70.53 ? 109 TYR C CE2  1  
ATOM 6397   C CZ   . TYR C 1 109 ? 5.342   -8.646  6.238   1.00 22.31 ? 109 TYR C CZ   1  
ATOM 6398   O OH   . TYR C 1 109 ? 5.910   -9.815  5.772   1.00 40.14 ? 109 TYR C OH   1  
ATOM 6399   H H    . TYR C 1 109 ? 5.820   -4.263  8.486   1.00 51.44 ? 109 TYR C H    1  
ATOM 6400   H HA   . TYR C 1 109 ? 3.964   -3.551  6.442   1.00 74.31 ? 109 TYR C HA   1  
ATOM 6401   H HB2  . TYR C 1 109 ? 3.498   -5.229  8.938   1.00 12.02 ? 109 TYR C HB2  1  
ATOM 6402   H HB3  . TYR C 1 109 ? 2.414   -5.143  7.565   1.00 34.14 ? 109 TYR C HB3  1  
ATOM 6403   H HD1  . TYR C 1 109 ? 5.714   -6.408  8.725   1.00 74.21 ? 109 TYR C HD1  1  
ATOM 6404   H HD2  . TYR C 1 109 ? 2.758   -6.568  5.639   1.00 70.40 ? 109 TYR C HD2  1  
ATOM 6405   H HE1  . TYR C 1 109 ? 6.738   -8.451  7.838   1.00 62.02 ? 109 TYR C HE1  1  
ATOM 6406   H HE2  . TYR C 1 109 ? 3.810   -8.601  4.746   1.00 51.31 ? 109 TYR C HE2  1  
ATOM 6407   H HH   . TYR C 1 109 ? 5.626   -9.983  4.874   1.00 15.13 ? 109 TYR C HH   1  
ATOM 6408   N N    . ALA C 1 110 ? 3.356   -2.502  9.542   1.00 33.32 ? 110 ALA C N    1  
ATOM 6409   C CA   . ALA C 1 110 ? 2.667   -1.512  10.386  1.00 14.34 ? 110 ALA C CA   1  
ATOM 6410   C C    . ALA C 1 110 ? 2.908   -0.087  9.853   1.00 45.34 ? 110 ALA C C    1  
ATOM 6411   O O    . ALA C 1 110 ? 1.967   0.700   9.718   1.00 41.20 ? 110 ALA C O    1  
ATOM 6412   C CB   . ALA C 1 110 ? 3.154   -1.619  11.842  1.00 41.01 ? 110 ALA C CB   1  
ATOM 6413   H H    . ALA C 1 110 ? 4.022   -3.084  9.964   1.00 22.12 ? 110 ALA C H    1  
ATOM 6414   H HA   . ALA C 1 110 ? 1.601   -1.737  10.359  1.00 15.02 ? 110 ALA C HA   1  
ATOM 6415   H HB1  . ALA C 1 110 ? 2.959   -2.600  12.242  1.00 10.44 ? 110 ALA C HB1  1  
ATOM 6416   H HB2  . ALA C 1 110 ? 2.653   -0.880  12.452  1.00 74.12 ? 110 ALA C HB2  1  
ATOM 6417   H HB3  . ALA C 1 110 ? 4.211   -1.445  11.872  1.00 35.20 ? 110 ALA C HB3  1  
ATOM 6418   N N    . ARG C 1 111 ? 4.187   0.184   9.516   1.00 4.01  ? 111 ARG C N    1  
ATOM 6419   C CA   . ARG C 1 111 ? 4.655   1.471   8.972   1.00 51.24 ? 111 ARG C CA   1  
ATOM 6420   C C    . ARG C 1 111 ? 3.902   1.833   7.675   1.00 72.14 ? 111 ARG C C    1  
ATOM 6421   O O    . ARG C 1 111 ? 3.275   2.887   7.604   1.00 33.15 ? 111 ARG C O    1  
ATOM 6422   C CB   . ARG C 1 111 ? 6.198   1.397   8.717   1.00 51.44 ? 111 ARG C CB   1  
ATOM 6423   C CG   . ARG C 1 111 ? 6.805   2.572   7.901   1.00 55.33 ? 111 ARG C CG   1  
ATOM 6424   C CD   . ARG C 1 111 ? 8.305   2.383   7.587   1.00 62.12 ? 111 ARG C CD   1  
ATOM 6425   N NE   . ARG C 1 111 ? 8.774   3.334   6.555   1.00 11.25 ? 111 ARG C NE   1  
ATOM 6426   C CZ   . ARG C 1 111 ? 10.055  3.621   6.265   1.00 54.33 ? 111 ARG C CZ   1  
ATOM 6427   N NH1  . ARG C 1 111 ? 11.066  3.043   6.928   1.00 35.43 ? 111 ARG C NH1  1  
ATOM 6428   N NH2  . ARG C 1 111 ? 10.316  4.497   5.293   1.00 25.51 ? 111 ARG C NH2  1  
ATOM 6429   H H    . ARG C 1 111 ? 4.846   -0.530  9.637   1.00 3.25  ? 111 ARG C H    1  
ATOM 6430   H HA   . ARG C 1 111 ? 4.455   2.234   9.725   1.00 42.44 ? 111 ARG C HA   1  
ATOM 6431   H HB2  . ARG C 1 111 ? 6.705   1.359   9.673   1.00 4.22  ? 111 ARG C HB2  1  
ATOM 6432   H HB3  . ARG C 1 111 ? 6.411   0.474   8.183   1.00 21.54 ? 111 ARG C HB3  1  
ATOM 6433   H HG2  . ARG C 1 111 ? 6.265   2.659   6.962   1.00 1.11  ? 111 ARG C HG2  1  
ATOM 6434   H HG3  . ARG C 1 111 ? 6.676   3.492   8.462   1.00 33.42 ? 111 ARG C HG3  1  
ATOM 6435   H HD2  . ARG C 1 111 ? 8.881   2.528   8.498   1.00 41.30 ? 111 ARG C HD2  1  
ATOM 6436   H HD3  . ARG C 1 111 ? 8.469   1.370   7.225   1.00 1.14  ? 111 ARG C HD3  1  
ATOM 6437   H HE   . ARG C 1 111 ? 8.070   3.792   6.036   1.00 33.33 ? 111 ARG C HE   1  
ATOM 6438   H HH11 . ARG C 1 111 ? 10.873  2.382   7.658   1.00 50.43 ? 111 ARG C HH11 1  
ATOM 6439   H HH12 . ARG C 1 111 ? 12.014  3.268   6.699   1.00 12.51 ? 111 ARG C HH12 1  
ATOM 6440   H HH21 . ARG C 1 111 ? 9.556   4.921   4.788   1.00 43.11 ? 111 ARG C HH21 1  
ATOM 6441   H HH22 . ARG C 1 111 ? 11.257  4.732   5.050   1.00 70.02 ? 111 ARG C HH22 1  
ATOM 6442   N N    . GLU C 1 112 ? 3.926   0.909   6.690   1.00 54.41 ? 112 GLU C N    1  
ATOM 6443   C CA   . GLU C 1 112 ? 3.376   1.150   5.334   1.00 40.44 ? 112 GLU C CA   1  
ATOM 6444   C C    . GLU C 1 112 ? 1.841   1.301   5.382   1.00 3.13  ? 112 GLU C C    1  
ATOM 6445   O O    . GLU C 1 112 ? 1.270   2.084   4.625   1.00 13.23 ? 112 GLU C O    1  
ATOM 6446   C CB   . GLU C 1 112 ? 3.814   0.002   4.368   1.00 42.34 ? 112 GLU C CB   1  
ATOM 6447   C CG   . GLU C 1 112 ? 3.731   0.313   2.835   1.00 64.03 ? 112 GLU C CG   1  
ATOM 6448   C CD   . GLU C 1 112 ? 2.346   0.080   2.175   1.00 21.22 ? 112 GLU C CD   1  
ATOM 6449   O OE1  . GLU C 1 112 ? 1.621   1.057   1.880   1.00 13.22 ? 112 GLU C OE1  1  
ATOM 6450   O OE2  . GLU C 1 112 ? 1.985   -1.092  1.922   1.00 71.44 ? 112 GLU C OE2  1  
ATOM 6451   H H    . GLU C 1 112 ? 4.325   0.032   6.880   1.00 1.33  ? 112 GLU C H    1  
ATOM 6452   H HA   . GLU C 1 112 ? 3.804   2.087   4.978   1.00 2.02  ? 112 GLU C HA   1  
ATOM 6453   H HB2  . GLU C 1 112 ? 4.843   -0.252  4.597   1.00 53.02 ? 112 GLU C HB2  1  
ATOM 6454   H HB3  . GLU C 1 112 ? 3.205   -0.874  4.571   1.00 12.24 ? 112 GLU C HB3  1  
ATOM 6455   H HG2  . GLU C 1 112 ? 4.018   1.347   2.680   1.00 32.04 ? 112 GLU C HG2  1  
ATOM 6456   H HG3  . GLU C 1 112 ? 4.457   -0.314  2.325   1.00 53.42 ? 112 GLU C HG3  1  
ATOM 6457   N N    . CYS C 1 113 ? 1.189   0.573   6.315   1.00 50.52 ? 113 CYS C N    1  
ATOM 6458   C CA   . CYS C 1 113 ? -0.279  0.610   6.480   1.00 53.14 ? 113 CYS C CA   1  
ATOM 6459   C C    . CYS C 1 113 ? -0.738  1.977   7.045   1.00 11.10 ? 113 CYS C C    1  
ATOM 6460   O O    . CYS C 1 113 ? -1.832  2.458   6.713   1.00 11.10 ? 113 CYS C O    1  
ATOM 6461   C CB   . CYS C 1 113 ? -0.747  -0.555  7.379   1.00 41.23 ? 113 CYS C CB   1  
ATOM 6462   S SG   . CYS C 1 113 ? -2.512  -0.929  7.250   1.00 11.52 ? 113 CYS C SG   1  
ATOM 6463   H H    . CYS C 1 113 ? 1.715   -0.008  6.905   1.00 12.42 ? 113 CYS C H    1  
ATOM 6464   H HA   . CYS C 1 113 ? -0.717  0.482   5.496   1.00 42.20 ? 113 CYS C HA   1  
ATOM 6465   H HB2  . CYS C 1 113 ? -0.209  -1.453  7.111   1.00 51.13 ? 113 CYS C HB2  1  
ATOM 6466   H HB3  . CYS C 1 113 ? -0.542  -0.319  8.421   1.00 12.24 ? 113 CYS C HB3  1  
ATOM 6467   H HG   . CYS C 1 113 ? -3.198  0.163   7.556   1.00 51.24 ? 113 CYS C HG   1  
ATOM 6468   N N    . ILE C 1 114 ? 0.122   2.600   7.888   1.00 22.14 ? 114 ILE C N    1  
ATOM 6469   C CA   . ILE C 1 114 ? -0.105  3.970   8.392   1.00 32.31 ? 114 ILE C CA   1  
ATOM 6470   C C    . ILE C 1 114 ? 0.103   4.972   7.261   1.00 14.43 ? 114 ILE C C    1  
ATOM 6471   O O    . ILE C 1 114 ? -0.782  5.766   6.977   1.00 31.51 ? 114 ILE C O    1  
ATOM 6472   C CB   . ILE C 1 114 ? 0.845   4.364   9.590   1.00 2.13  ? 114 ILE C CB   1  
ATOM 6473   C CG1  . ILE C 1 114 ? 0.594   3.437   10.815  1.00 51.15 ? 114 ILE C CG1  1  
ATOM 6474   C CG2  . ILE C 1 114 ? 0.672   5.867   9.976   1.00 14.51 ? 114 ILE C CG2  1  
ATOM 6475   C CD1  . ILE C 1 114 ? 1.495   3.714   11.999  1.00 51.42 ? 114 ILE C CD1  1  
ATOM 6476   H H    . ILE C 1 114 ? 0.933   2.122   8.166   1.00 3.41  ? 114 ILE C H    1  
ATOM 6477   H HA   . ILE C 1 114 ? -1.135  4.031   8.737   1.00 32.02 ? 114 ILE C HA   1  
ATOM 6478   H HB   . ILE C 1 114 ? 1.872   4.226   9.260   1.00 4.41  ? 114 ILE C HB   1  
ATOM 6479   H HG12 . ILE C 1 114 ? -0.427  3.550   11.152  1.00 33.11 ? 114 ILE C HG12 1  
ATOM 6480   H HG13 . ILE C 1 114 ? 0.752   2.405   10.523  1.00 41.51 ? 114 ILE C HG13 1  
ATOM 6481   H HG21 . ILE C 1 114 ? 1.282   6.110   10.823  1.00 41.41 ? 114 ILE C HG21 1  
ATOM 6482   H HG22 . ILE C 1 114 ? -0.360  6.068   10.216  1.00 62.13 ? 114 ILE C HG22 1  
ATOM 6483   H HG23 . ILE C 1 114 ? 0.972   6.499   9.155   1.00 54.21 ? 114 ILE C HG23 1  
ATOM 6484   H HD11 . ILE C 1 114 ? 1.251   3.034   12.797  1.00 64.34 ? 114 ILE C HD11 1  
ATOM 6485   H HD12 . ILE C 1 114 ? 1.357   4.727   12.346  1.00 25.51 ? 114 ILE C HD12 1  
ATOM 6486   H HD13 . ILE C 1 114 ? 2.535   3.567   11.730  1.00 44.24 ? 114 ILE C HD13 1  
ATOM 6487   N N    . THR C 1 115 ? 1.277   4.886   6.605   1.00 41.41 ? 115 THR C N    1  
ATOM 6488   C CA   . THR C 1 115 ? 1.715   5.850   5.585   1.00 70.25 ? 115 THR C CA   1  
ATOM 6489   C C    . THR C 1 115 ? 0.735   5.887   4.388   1.00 3.52  ? 115 THR C C    1  
ATOM 6490   O O    . THR C 1 115 ? 0.550   6.932   3.747   1.00 43.44 ? 115 THR C O    1  
ATOM 6491   C CB   . THR C 1 115 ? 3.158   5.507   5.100   1.00 51.01 ? 115 THR C CB   1  
ATOM 6492   O OG1  . THR C 1 115 ? 4.014   5.282   6.240   1.00 32.52 ? 115 THR C OG1  1  
ATOM 6493   C CG2  . THR C 1 115 ? 3.748   6.633   4.230   1.00 54.04 ? 115 THR C CG2  1  
ATOM 6494   H H    . THR C 1 115 ? 1.877   4.137   6.816   1.00 75.33 ? 115 THR C H    1  
ATOM 6495   H HA   . THR C 1 115 ? 1.731   6.829   6.062   1.00 72.20 ? 115 THR C HA   1  
ATOM 6496   H HB   . THR C 1 115 ? 3.126   4.590   4.516   1.00 2.41  ? 115 THR C HB   1  
ATOM 6497   H HG1  . THR C 1 115 ? 4.507   6.081   6.436   1.00 51.10 ? 115 THR C HG1  1  
ATOM 6498   H HG21 . THR C 1 115 ? 4.753   6.370   3.931   1.00 1.33  ? 115 THR C HG21 1  
ATOM 6499   H HG22 . THR C 1 115 ? 3.774   7.558   4.788   1.00 45.22 ? 115 THR C HG22 1  
ATOM 6500   H HG23 . THR C 1 115 ? 3.139   6.768   3.342   1.00 74.35 ? 115 THR C HG23 1  
ATOM 6501   N N    . SER C 1 116 ? 0.089   4.732   4.139   1.00 72.31 ? 116 SER C N    1  
ATOM 6502   C CA   . SER C 1 116 ? -1.003  4.603   3.173   1.00 62.41 ? 116 SER C CA   1  
ATOM 6503   C C    . SER C 1 116 ? -2.175  5.504   3.611   1.00 62.24 ? 116 SER C C    1  
ATOM 6504   O O    . SER C 1 116 ? -2.580  6.384   2.866   1.00 34.32 ? 116 SER C O    1  
ATOM 6505   C CB   . SER C 1 116 ? -1.449  3.124   3.065   1.00 12.32 ? 116 SER C CB   1  
ATOM 6506   O OG   . SER C 1 116 ? -2.437  2.936   2.062   1.00 12.44 ? 116 SER C OG   1  
ATOM 6507   H H    . SER C 1 116 ? 0.365   3.932   4.636   1.00 72.32 ? 116 SER C H    1  
ATOM 6508   H HA   . SER C 1 116 ? -0.632  4.935   2.209   1.00 23.32 ? 116 SER C HA   1  
ATOM 6509   H HB2  . SER C 1 116 ? -0.597  2.509   2.818   1.00 1.41  ? 116 SER C HB2  1  
ATOM 6510   H HB3  . SER C 1 116 ? -1.856  2.798   4.019   1.00 61.54 ? 116 SER C HB3  1  
ATOM 6511   H HG   . SER C 1 116 ? -2.004  2.891   1.198   1.00 45.32 ? 116 SER C HG   1  
ATOM 6512   N N    . MET C 1 117 ? -2.632  5.311   4.868   1.00 72.01 ? 117 MET C N    1  
ATOM 6513   C CA   . MET C 1 117 ? -3.749  6.072   5.492   1.00 22.11 ? 117 MET C CA   1  
ATOM 6514   C C    . MET C 1 117 ? -3.477  7.589   5.559   1.00 23.23 ? 117 MET C C    1  
ATOM 6515   O O    . MET C 1 117 ? -4.400  8.392   5.359   1.00 33.21 ? 117 MET C O    1  
ATOM 6516   C CB   . MET C 1 117 ? -4.055  5.500   6.917   1.00 13.02 ? 117 MET C CB   1  
ATOM 6517   C CG   . MET C 1 117 ? -5.082  4.364   6.911   1.00 65.32 ? 117 MET C CG   1  
ATOM 6518   S SD   . MET C 1 117 ? -4.748  3.119   5.641   1.00 45.51 ? 117 MET C SD   1  
ATOM 6519   C CE   . MET C 1 117 ? -6.406  2.573   5.232   1.00 4.21  ? 117 MET C CE   1  
ATOM 6520   H H    . MET C 1 117 ? -2.193  4.617   5.412   1.00 13.33 ? 117 MET C H    1  
ATOM 6521   H HA   . MET C 1 117 ? -4.617  5.922   4.858   1.00 75.55 ? 117 MET C HA   1  
ATOM 6522   H HB2  . MET C 1 117 ? -3.135  5.123   7.357   1.00 21.32 ? 117 MET C HB2  1  
ATOM 6523   H HB3  . MET C 1 117 ? -4.435  6.295   7.556   1.00 53.45 ? 117 MET C HB3  1  
ATOM 6524   H HG2  . MET C 1 117 ? -5.073  3.874   7.878   1.00 61.14 ? 117 MET C HG2  1  
ATOM 6525   H HG3  . MET C 1 117 ? -6.064  4.786   6.738   1.00 72.44 ? 117 MET C HG3  1  
ATOM 6526   H HE1  . MET C 1 117 ? -7.081  2.819   6.034   1.00 10.12 ? 117 MET C HE1  1  
ATOM 6527   H HE2  . MET C 1 117 ? -6.412  1.512   5.065   1.00 71.12 ? 117 MET C HE2  1  
ATOM 6528   H HE3  . MET C 1 117 ? -6.744  3.076   4.352   1.00 13.42 ? 117 MET C HE3  1  
ATOM 6529   N N    . VAL C 1 118 ? -2.217  7.962   5.829   1.00 4.31  ? 118 VAL C N    1  
ATOM 6530   C CA   . VAL C 1 118 ? -1.776  9.366   5.879   1.00 23.34 ? 118 VAL C CA   1  
ATOM 6531   C C    . VAL C 1 118 ? -1.913  10.007  4.482   1.00 53.42 ? 118 VAL C C    1  
ATOM 6532   O O    . VAL C 1 118 ? -2.460  11.104  4.337   1.00 21.10 ? 118 VAL C O    1  
ATOM 6533   C CB   . VAL C 1 118 ? -0.279  9.468   6.356   1.00 73.32 ? 118 VAL C CB   1  
ATOM 6534   C CG1  . VAL C 1 118 ? 0.219   10.927  6.352   1.00 65.22 ? 118 VAL C CG1  1  
ATOM 6535   C CG2  . VAL C 1 118 ? -0.080  8.819   7.752   1.00 0.32  ? 118 VAL C CG2  1  
ATOM 6536   H H    . VAL C 1 118 ? -1.552  7.264   5.987   1.00 61.02 ? 118 VAL C H    1  
ATOM 6537   H HA   . VAL C 1 118 ? -2.409  9.898   6.586   1.00 63.31 ? 118 VAL C HA   1  
ATOM 6538   H HB   . VAL C 1 118 ? 0.333   8.911   5.645   1.00 61.11 ? 118 VAL C HB   1  
ATOM 6539   H HG11 . VAL C 1 118 ? 1.293   10.946  6.419   1.00 25.21 ? 118 VAL C HG11 1  
ATOM 6540   H HG12 . VAL C 1 118 ? -0.201  11.467  7.191   1.00 22.55 ? 118 VAL C HG12 1  
ATOM 6541   H HG13 . VAL C 1 118 ? -0.080  11.419  5.432   1.00 42.52 ? 118 VAL C HG13 1  
ATOM 6542   H HG21 . VAL C 1 118 ? -0.534  9.423   8.525   1.00 33.12 ? 118 VAL C HG21 1  
ATOM 6543   H HG22 . VAL C 1 118 ? 0.976   8.710   7.961   1.00 10.13 ? 118 VAL C HG22 1  
ATOM 6544   H HG23 . VAL C 1 118 ? -0.543  7.840   7.761   1.00 21.11 ? 118 VAL C HG23 1  
ATOM 6545   N N    . SER C 1 119 ? -1.429  9.268   3.468   1.00 50.10 ? 119 SER C N    1  
ATOM 6546   C CA   . SER C 1 119 ? -1.479  9.684   2.060   1.00 12.35 ? 119 SER C CA   1  
ATOM 6547   C C    . SER C 1 119 ? -2.932  9.749   1.541   1.00 14.01 ? 119 SER C C    1  
ATOM 6548   O O    . SER C 1 119 ? -3.260  10.586  0.689   1.00 3.42  ? 119 SER C O    1  
ATOM 6549   C CB   . SER C 1 119 ? -0.664  8.702   1.198   1.00 2.35  ? 119 SER C CB   1  
ATOM 6550   O OG   . SER C 1 119 ? -0.773  9.014   -0.182  1.00 21.50 ? 119 SER C OG   1  
ATOM 6551   H H    . SER C 1 119 ? -1.018  8.403   3.680   1.00 74.22 ? 119 SER C H    1  
ATOM 6552   H HA   . SER C 1 119 ? -1.028  10.672  1.998   1.00 34.25 ? 119 SER C HA   1  
ATOM 6553   H HB2  . SER C 1 119 ? 0.381   8.755   1.481   1.00 51.33 ? 119 SER C HB2  1  
ATOM 6554   H HB3  . SER C 1 119 ? -1.023  7.690   1.356   1.00 21.14 ? 119 SER C HB3  1  
ATOM 6555   H HG   . SER C 1 119 ? -1.489  8.508   -0.573  1.00 21.32 ? 119 SER C HG   1  
ATOM 6556   N N    . ARG C 1 120 ? -3.787  8.854   2.072   1.00 25.02 ? 120 ARG C N    1  
ATOM 6557   C CA   . ARG C 1 120 ? -5.223  8.811   1.745   1.00 50.41 ? 120 ARG C CA   1  
ATOM 6558   C C    . ARG C 1 120 ? -5.905  10.076  2.273   1.00 3.13  ? 120 ARG C C    1  
ATOM 6559   O O    . ARG C 1 120 ? -6.717  10.680  1.582   1.00 1.42  ? 120 ARG C O    1  
ATOM 6560   C CB   . ARG C 1 120 ? -5.877  7.538   2.350   1.00 71.33 ? 120 ARG C CB   1  
ATOM 6561   C CG   . ARG C 1 120 ? -5.418  6.222   1.690   1.00 11.42 ? 120 ARG C CG   1  
ATOM 6562   C CD   . ARG C 1 120 ? -5.874  4.955   2.446   1.00 1.21  ? 120 ARG C CD   1  
ATOM 6563   N NE   . ARG C 1 120 ? -5.274  3.749   1.863   1.00 40.22 ? 120 ARG C NE   1  
ATOM 6564   C CZ   . ARG C 1 120 ? -5.553  3.243   0.650   1.00 25.15 ? 120 ARG C CZ   1  
ATOM 6565   N NH1  . ARG C 1 120 ? -6.443  3.817   -0.160  1.00 43.54 ? 120 ARG C NH1  1  
ATOM 6566   N NH2  . ARG C 1 120 ? -4.904  2.175   0.230   1.00 61.12 ? 120 ARG C NH2  1  
ATOM 6567   H H    . ARG C 1 120 ? -3.439  8.212   2.723   1.00 10.23 ? 120 ARG C H    1  
ATOM 6568   H HA   . ARG C 1 120 ? -5.315  8.782   0.664   1.00 41.43 ? 120 ARG C HA   1  
ATOM 6569   H HB2  . ARG C 1 120 ? -5.629  7.492   3.410   1.00 71.23 ? 120 ARG C HB2  1  
ATOM 6570   H HB3  . ARG C 1 120 ? -6.951  7.611   2.253   1.00 14.41 ? 120 ARG C HB3  1  
ATOM 6571   H HG2  . ARG C 1 120 ? -5.816  6.179   0.682   1.00 52.13 ? 120 ARG C HG2  1  
ATOM 6572   H HG3  . ARG C 1 120 ? -4.334  6.217   1.634   1.00 41.55 ? 120 ARG C HG3  1  
ATOM 6573   H HD2  . ARG C 1 120 ? -5.557  5.028   3.479   1.00 4.31  ? 120 ARG C HD2  1  
ATOM 6574   H HD3  . ARG C 1 120 ? -6.957  4.870   2.415   1.00 72.32 ? 120 ARG C HD3  1  
ATOM 6575   H HE   . ARG C 1 120 ? -4.589  3.291   2.408   1.00 22.20 ? 120 ARG C HE   1  
ATOM 6576   H HH11 . ARG C 1 120 ? -6.925  4.640   0.118   1.00 3.12  ? 120 ARG C HH11 1  
ATOM 6577   H HH12 . ARG C 1 120 ? -6.626  3.417   -1.067  1.00 11.34 ? 120 ARG C HH12 1  
ATOM 6578   H HH21 . ARG C 1 120 ? -4.217  1.744   0.804   1.00 31.41 ? 120 ARG C HH21 1  
ATOM 6579   H HH22 . ARG C 1 120 ? -5.103  1.794   -0.679  1.00 20.20 ? 120 ARG C HH22 1  
ATOM 6580   N N    . GLY C 1 121 ? -5.511  10.486  3.496   1.00 14.24 ? 121 GLY C N    1  
ATOM 6581   C CA   . GLY C 1 121 ? -5.962  11.745  4.088   1.00 13.34 ? 121 GLY C CA   1  
ATOM 6582   C C    . GLY C 1 121 ? -5.165  12.948  3.605   1.00 14.55 ? 121 GLY C C    1  
ATOM 6583   O O    . GLY C 1 121 ? -5.340  14.042  4.128   1.00 75.22 ? 121 GLY C O    1  
ATOM 6584   H H    . GLY C 1 121 ? -4.891  9.921   4.004   1.00 53.12 ? 121 GLY C H    1  
ATOM 6585   H HA2  . GLY C 1 121 ? -7.008  11.906  3.849   1.00 31.41 ? 121 GLY C HA2  1  
ATOM 6586   H HA3  . GLY C 1 121 ? -5.861  11.672  5.160   1.00 71.32 ? 121 GLY C HA3  1  
ATOM 6587   N N    . THR C 1 122 ? -4.286  12.721  2.598   1.00 70.20 ? 122 THR C N    1  
ATOM 6588   C CA   . THR C 1 122 ? -3.536  13.756  1.850   1.00 64.11 ? 122 THR C CA   1  
ATOM 6589   C C    . THR C 1 122 ? -2.648  14.658  2.753   1.00 22.50 ? 122 THR C C    1  
ATOM 6590   O O    . THR C 1 122 ? -2.436  15.845  2.460   1.00 53.14 ? 122 THR C O    1  
ATOM 6591   C CB   . THR C 1 122 ? -4.493  14.602  0.925   1.00 65.51 ? 122 THR C CB   1  
ATOM 6592   O OG1  . THR C 1 122 ? -5.482  15.301  1.699   1.00 14.41 ? 122 THR C OG1  1  
ATOM 6593   C CG2  . THR C 1 122 ? -5.206  13.734  -0.141  1.00 74.05 ? 122 THR C CG2  1  
ATOM 6594   H H    . THR C 1 122 ? -4.132  11.794  2.342   1.00 32.03 ? 122 THR C H    1  
ATOM 6595   H HA   . THR C 1 122 ? -2.859  13.212  1.198   1.00 45.32 ? 122 THR C HA   1  
ATOM 6596   H HB   . THR C 1 122 ? -3.898  15.346  0.411   1.00 44.30 ? 122 THR C HB   1  
ATOM 6597   H HG1  . THR C 1 122 ? -6.038  14.666  2.156   1.00 71.41 ? 122 THR C HG1  1  
ATOM 6598   H HG21 . THR C 1 122 ? -4.540  13.541  -0.975  1.00 71.21 ? 122 THR C HG21 1  
ATOM 6599   H HG22 . THR C 1 122 ? -6.093  14.239  -0.493  1.00 5.35  ? 122 THR C HG22 1  
ATOM 6600   H HG23 . THR C 1 122 ? -5.516  12.797  0.288   1.00 75.20 ? 122 THR C HG23 1  
ATOM 6601   N N    . PHE C 1 123 ? -2.114  14.059  3.830   1.00 52.42 ? 123 PHE C N    1  
ATOM 6602   C CA   . PHE C 1 123 ? -1.075  14.666  4.690   1.00 22.14 ? 123 PHE C CA   1  
ATOM 6603   C C    . PHE C 1 123 ? 0.334   14.256  4.147   1.00 51.23 ? 123 PHE C C    1  
ATOM 6604   O O    . PHE C 1 123 ? 0.417   13.310  3.347   1.00 42.34 ? 123 PHE C O    1  
ATOM 6605   C CB   . PHE C 1 123 ? -1.282  14.191  6.163   1.00 2.25  ? 123 PHE C CB   1  
ATOM 6606   C CG   . PHE C 1 123 ? -2.569  14.699  6.828   1.00 13.14 ? 123 PHE C CG   1  
ATOM 6607   C CD1  . PHE C 1 123 ? -2.618  15.972  7.404   1.00 33.43 ? 123 PHE C CD1  1  
ATOM 6608   C CD2  . PHE C 1 123 ? -3.719  13.910  6.889   1.00 21.04 ? 123 PHE C CD2  1  
ATOM 6609   C CE1  . PHE C 1 123 ? -3.771  16.434  8.017   1.00 31.52 ? 123 PHE C CE1  1  
ATOM 6610   C CE2  . PHE C 1 123 ? -4.871  14.377  7.500   1.00 51.55 ? 123 PHE C CE2  1  
ATOM 6611   C CZ   . PHE C 1 123 ? -4.897  15.636  8.064   1.00 61.22 ? 123 PHE C CZ   1  
ATOM 6612   H H    . PHE C 1 123 ? -2.417  13.161  4.054   1.00 14.02 ? 123 PHE C H    1  
ATOM 6613   H HA   . PHE C 1 123 ? -1.168  15.752  4.645   1.00 44.34 ? 123 PHE C HA   1  
ATOM 6614   H HB2  . PHE C 1 123 ? -1.298  13.108  6.183   1.00 51.24 ? 123 PHE C HB2  1  
ATOM 6615   H HB3  . PHE C 1 123 ? -0.443  14.528  6.765   1.00 53.44 ? 123 PHE C HB3  1  
ATOM 6616   H HD1  . PHE C 1 123 ? -1.740  16.606  7.373   1.00 32.53 ? 123 PHE C HD1  1  
ATOM 6617   H HD2  . PHE C 1 123 ? -3.711  12.918  6.450   1.00 52.22 ? 123 PHE C HD2  1  
ATOM 6618   H HE1  . PHE C 1 123 ? -3.792  17.424  8.458   1.00 25.42 ? 123 PHE C HE1  1  
ATOM 6619   H HE2  . PHE C 1 123 ? -5.756  13.751  7.538   1.00 32.31 ? 123 PHE C HE2  1  
ATOM 6620   H HZ   . PHE C 1 123 ? -5.800  15.999  8.540   1.00 61.21 ? 123 PHE C HZ   1  
ATOM 6621   N N    . PRO C 1 124 ? 1.463   14.961  4.547   1.00 22.24 ? 124 PRO C N    1  
ATOM 6622   C CA   . PRO C 1 124 ? 2.845   14.629  4.069   1.00 41.53 ? 124 PRO C CA   1  
ATOM 6623   C C    . PRO C 1 124 ? 3.323   13.210  4.472   1.00 32.54 ? 124 PRO C C    1  
ATOM 6624   O O    . PRO C 1 124 ? 2.639   12.494  5.198   1.00 45.41 ? 124 PRO C O    1  
ATOM 6625   C CB   . PRO C 1 124 ? 3.728   15.737  4.723   1.00 12.41 ? 124 PRO C CB   1  
ATOM 6626   C CG   . PRO C 1 124 ? 2.932   16.212  5.902   1.00 60.10 ? 124 PRO C CG   1  
ATOM 6627   C CD   . PRO C 1 124 ? 1.488   16.146  5.455   1.00 33.30 ? 124 PRO C CD   1  
ATOM 6628   H HA   . PRO C 1 124 ? 2.905   14.716  2.986   1.00 54.10 ? 124 PRO C HA   1  
ATOM 6629   H HB2  . PRO C 1 124 ? 4.694   15.336  5.033   1.00 61.31 ? 124 PRO C HB2  1  
ATOM 6630   H HB3  . PRO C 1 124 ? 3.882   16.552  4.028   1.00 11.10 ? 124 PRO C HB3  1  
ATOM 6631   H HG2  . PRO C 1 124 ? 3.105   15.556  6.756   1.00 43.05 ? 124 PRO C HG2  1  
ATOM 6632   H HG3  . PRO C 1 124 ? 3.200   17.231  6.158   1.00 30.41 ? 124 PRO C HG3  1  
ATOM 6633   H HD2  . PRO C 1 124 ? 0.833   15.998  6.309   1.00 13.55 ? 124 PRO C HD2  1  
ATOM 6634   H HD3  . PRO C 1 124 ? 1.203   17.042  4.918   1.00 55.01 ? 124 PRO C HD3  1  
ATOM 6635   N N    . GLN C 1 125 ? 4.491   12.806  3.942   1.00 23.13 ? 125 GLN C N    1  
ATOM 6636   C CA   . GLN C 1 125 ? 5.155   11.526  4.282   1.00 21.51 ? 125 GLN C CA   1  
ATOM 6637   C C    . GLN C 1 125 ? 5.555   11.440  5.772   1.00 32.51 ? 125 GLN C C    1  
ATOM 6638   O O    . GLN C 1 125 ? 6.417   12.193  6.239   1.00 75.25 ? 125 GLN C O    1  
ATOM 6639   C CB   . GLN C 1 125 ? 6.399   11.302  3.359   1.00 1.24  ? 125 GLN C CB   1  
ATOM 6640   C CG   . GLN C 1 125 ? 6.042   10.770  1.956   1.00 44.41 ? 125 GLN C CG   1  
ATOM 6641   C CD   . GLN C 1 125 ? 5.511   9.333   1.979   1.00 73.21 ? 125 GLN C CD   1  
ATOM 6642   O OE1  . GLN C 1 125 ? 5.924   8.527   2.817   1.00 34.32 ? 125 GLN C OE1  1  
ATOM 6643   N NE2  . GLN C 1 125 ? 4.585   9.001   1.081   1.00 23.21 ? 125 GLN C NE2  1  
ATOM 6644   H H    . GLN C 1 125 ? 4.922   13.389  3.288   1.00 52.33 ? 125 GLN C H    1  
ATOM 6645   H HA   . GLN C 1 125 ? 4.436   10.736  4.079   1.00 15.20 ? 125 GLN C HA   1  
ATOM 6646   H HB2  . GLN C 1 125 ? 6.922   12.247  3.243   1.00 2.43  ? 125 GLN C HB2  1  
ATOM 6647   H HB3  . GLN C 1 125 ? 7.080   10.593  3.827   1.00 23.31 ? 125 GLN C HB3  1  
ATOM 6648   H HG2  . GLN C 1 125 ? 5.287   11.416  1.521   1.00 43.24 ? 125 GLN C HG2  1  
ATOM 6649   H HG3  . GLN C 1 125 ? 6.928   10.797  1.332   1.00 20.23 ? 125 GLN C HG3  1  
ATOM 6650   H HE21 . GLN C 1 125 ? 4.281   9.687   0.449   1.00 12.33 ? 125 GLN C HE21 1  
ATOM 6651   H HE22 . GLN C 1 125 ? 4.237   8.086   1.094   1.00 74.54 ? 125 GLN C HE22 1  
ATOM 6652   N N    . LEU C 1 126 ? 4.891   10.529  6.506   1.00 14.40 ? 126 LEU C N    1  
ATOM 6653   C CA   . LEU C 1 126 ? 5.272   10.136  7.875   1.00 64.20 ? 126 LEU C CA   1  
ATOM 6654   C C    . LEU C 1 126 ? 5.789   8.691   7.839   1.00 31.00 ? 126 LEU C C    1  
ATOM 6655   O O    . LEU C 1 126 ? 5.017   7.766   7.567   1.00 41.34 ? 126 LEU C O    1  
ATOM 6656   C CB   . LEU C 1 126 ? 4.076   10.256  8.877   1.00 62.04 ? 126 LEU C CB   1  
ATOM 6657   C CG   . LEU C 1 126 ? 3.694   11.700  9.342   1.00 53.33 ? 126 LEU C CG   1  
ATOM 6658   C CD1  . LEU C 1 126 ? 3.085   12.546  8.219   1.00 42.31 ? 126 LEU C CD1  1  
ATOM 6659   C CD2  . LEU C 1 126 ? 2.760   11.662  10.561  1.00 12.42 ? 126 LEU C CD2  1  
ATOM 6660   H H    . LEU C 1 126 ? 4.105   10.102  6.109   1.00 53.03 ? 126 LEU C H    1  
ATOM 6661   H HA   . LEU C 1 126 ? 6.077   10.790  8.215   1.00 61.23 ? 126 LEU C HA   1  
ATOM 6662   H HB2  . LEU C 1 126 ? 3.201   9.800   8.420   1.00 30.52 ? 126 LEU C HB2  1  
ATOM 6663   H HB3  . LEU C 1 126 ? 4.322   9.676   9.766   1.00 62.33 ? 126 LEU C HB3  1  
ATOM 6664   H HG   . LEU C 1 126 ? 4.598   12.206  9.655   1.00 32.00 ? 126 LEU C HG   1  
ATOM 6665   H HD11 . LEU C 1 126 ? 2.852   13.536  8.589   1.00 11.12 ? 126 LEU C HD11 1  
ATOM 6666   H HD12 . LEU C 1 126 ? 2.181   12.079  7.850   1.00 62.34 ? 126 LEU C HD12 1  
ATOM 6667   H HD13 . LEU C 1 126 ? 3.796   12.633  7.406   1.00 21.44 ? 126 LEU C HD13 1  
ATOM 6668   H HD21 . LEU C 1 126 ? 2.549   12.670  10.889  1.00 64.33 ? 126 LEU C HD21 1  
ATOM 6669   H HD22 . LEU C 1 126 ? 3.238   11.123  11.366  1.00 2.32  ? 126 LEU C HD22 1  
ATOM 6670   H HD23 . LEU C 1 126 ? 1.833   11.166  10.301  1.00 44.55 ? 126 LEU C HD23 1  
ATOM 6671   N N    . ASN C 1 127 ? 7.094   8.504   8.087   1.00 30.14 ? 127 ASN C N    1  
ATOM 6672   C CA   . ASN C 1 127 ? 7.736   7.168   8.128   1.00 23.41 ? 127 ASN C CA   1  
ATOM 6673   C C    . ASN C 1 127 ? 8.445   6.990   9.475   1.00 44.10 ? 127 ASN C C    1  
ATOM 6674   O O    . ASN C 1 127 ? 9.180   7.885   9.909   1.00 40.24 ? 127 ASN C O    1  
ATOM 6675   C CB   . ASN C 1 127 ? 8.750   6.979   6.969   1.00 53.04 ? 127 ASN C CB   1  
ATOM 6676   C CG   . ASN C 1 127 ? 8.090   6.918   5.582   1.00 5.30  ? 127 ASN C CG   1  
ATOM 6677   O OD1  . ASN C 1 127 ? 7.555   5.882   5.186   1.00 34.40 ? 127 ASN C OD1  1  
ATOM 6678   N ND2  . ASN C 1 127 ? 8.211   7.984   4.812   1.00 51.22 ? 127 ASN C ND2  1  
ATOM 6679   H H    . ASN C 1 127 ? 7.653   9.292   8.259   1.00 32.32 ? 127 ASN C H    1  
ATOM 6680   H HA   . ASN C 1 127 ? 6.955   6.410   8.045   1.00 11.44 ? 127 ASN C HA   1  
ATOM 6681   H HB2  . ASN C 1 127 ? 9.458   7.798   6.979   1.00 70.30 ? 127 ASN C HB2  1  
ATOM 6682   H HB3  . ASN C 1 127 ? 9.297   6.052   7.120   1.00 53.02 ? 127 ASN C HB3  1  
ATOM 6683   H HD21 . ASN C 1 127 ? 8.723   8.738   5.157   1.00 73.41 ? 127 ASN C HD21 1  
ATOM 6684   H HD22 . ASN C 1 127 ? 7.767   7.980   3.936   1.00 34.41 ? 127 ASN C HD22 1  
ATOM 6685   N N    . LEU C 1 128 ? 8.204   5.842   10.135  1.00 5.22  ? 128 LEU C N    1  
ATOM 6686   C CA   . LEU C 1 128 ? 8.790   5.535   11.450  1.00 44.50 ? 128 LEU C CA   1  
ATOM 6687   C C    . LEU C 1 128 ? 10.247  5.060   11.262  1.00 32.14 ? 128 LEU C C    1  
ATOM 6688   O O    . LEU C 1 128 ? 10.522  4.203   10.404  1.00 10.14 ? 128 LEU C O    1  
ATOM 6689   C CB   . LEU C 1 128 ? 7.908   4.481   12.204  1.00 33.12 ? 128 LEU C CB   1  
ATOM 6690   C CG   . LEU C 1 128 ? 7.815   4.628   13.768  1.00 65.31 ? 128 LEU C CG   1  
ATOM 6691   C CD1  . LEU C 1 128 ? 6.737   3.695   14.360  1.00 10.14 ? 128 LEU C CD1  1  
ATOM 6692   C CD2  . LEU C 1 128 ? 9.167   4.412   14.480  1.00 31.40 ? 128 LEU C CD2  1  
ATOM 6693   H H    . LEU C 1 128 ? 7.618   5.180   9.723   1.00 45.50 ? 128 LEU C H    1  
ATOM 6694   H HA   . LEU C 1 128 ? 8.795   6.460   12.028  1.00 22.24 ? 128 LEU C HA   1  
ATOM 6695   H HB2  . LEU C 1 128 ? 6.901   4.550   11.808  1.00 72.53 ? 128 LEU C HB2  1  
ATOM 6696   H HB3  . LEU C 1 128 ? 8.282   3.486   11.977  1.00 32.34 ? 128 LEU C HB3  1  
ATOM 6697   H HG   . LEU C 1 128 ? 7.500   5.640   13.989  1.00 31.11 ? 128 LEU C HG   1  
ATOM 6698   H HD11 . LEU C 1 128 ? 5.779   3.924   13.914  1.00 32.43 ? 128 LEU C HD11 1  
ATOM 6699   H HD12 . LEU C 1 128 ? 6.674   3.848   15.428  1.00 34.14 ? 128 LEU C HD12 1  
ATOM 6700   H HD13 . LEU C 1 128 ? 6.990   2.661   14.159  1.00 53.13 ? 128 LEU C HD13 1  
ATOM 6701   H HD21 . LEU C 1 128 ? 9.045   4.550   15.545  1.00 11.33 ? 128 LEU C HD21 1  
ATOM 6702   H HD22 . LEU C 1 128 ? 9.890   5.129   14.112  1.00 33.41 ? 128 LEU C HD22 1  
ATOM 6703   H HD23 . LEU C 1 128 ? 9.533   3.409   14.287  1.00 42.22 ? 128 LEU C HD23 1  
ATOM 6704   N N    . ALA C 1 129 ? 11.160  5.654   12.055  1.00 50.14 ? 129 ALA C N    1  
ATOM 6705   C CA   . ALA C 1 129 ? 12.601  5.342   12.039  1.00 51.15 ? 129 ALA C CA   1  
ATOM 6706   C C    . ALA C 1 129 ? 12.870  3.877   12.484  1.00 20.00 ? 129 ALA C C    1  
ATOM 6707   O O    . ALA C 1 129 ? 12.076  3.320   13.254  1.00 14.23 ? 129 ALA C O    1  
ATOM 6708   C CB   . ALA C 1 129 ? 13.341  6.341   12.954  1.00 4.03  ? 129 ALA C CB   1  
ATOM 6709   H H    . ALA C 1 129 ? 10.847  6.333   12.686  1.00 54.14 ? 129 ALA C H    1  
ATOM 6710   H HA   . ALA C 1 129 ? 12.960  5.482   11.025  1.00 70.11 ? 129 ALA C HA   1  
ATOM 6711   H HB1  . ALA C 1 129 ? 12.986  6.237   13.971  1.00 15.35 ? 129 ALA C HB1  1  
ATOM 6712   H HB2  . ALA C 1 129 ? 13.152  7.349   12.613  1.00 43.34 ? 129 ALA C HB2  1  
ATOM 6713   H HB3  . ALA C 1 129 ? 14.408  6.149   12.924  1.00 63.50 ? 129 ALA C HB3  1  
ATOM 6714   N N    . PRO C 1 130 ? 13.976  3.218   11.984  1.00 43.12 ? 130 PRO C N    1  
ATOM 6715   C CA   . PRO C 1 130 ? 14.342  1.843   12.409  1.00 0.45  ? 130 PRO C CA   1  
ATOM 6716   C C    . PRO C 1 130 ? 14.591  1.740   13.931  1.00 33.45 ? 130 PRO C C    1  
ATOM 6717   O O    . PRO C 1 130 ? 15.629  2.186   14.441  1.00 73.11 ? 130 PRO C O    1  
ATOM 6718   C CB   . PRO C 1 130 ? 15.623  1.521   11.589  1.00 70.53 ? 130 PRO C CB   1  
ATOM 6719   C CG   . PRO C 1 130 ? 16.140  2.853   11.124  1.00 61.21 ? 130 PRO C CG   1  
ATOM 6720   C CD   . PRO C 1 130 ? 14.919  3.729   10.946  1.00 30.14 ? 130 PRO C CD   1  
ATOM 6721   H HA   . PRO C 1 130 ? 13.555  1.141   12.134  1.00 40.22 ? 130 PRO C HA   1  
ATOM 6722   H HB2  . PRO C 1 130 ? 16.360  1.001   12.203  1.00 10.00 ? 130 PRO C HB2  1  
ATOM 6723   H HB3  . PRO C 1 130 ? 15.372  0.906   10.734  1.00 24.43 ? 130 PRO C HB3  1  
ATOM 6724   H HG2  . PRO C 1 130 ? 16.811  3.272   11.873  1.00 24.44 ? 130 PRO C HG2  1  
ATOM 6725   H HG3  . PRO C 1 130 ? 16.661  2.742   10.179  1.00 0.02  ? 130 PRO C HG3  1  
ATOM 6726   H HD2  . PRO C 1 130 ? 15.170  4.770   11.122  1.00 62.00 ? 130 PRO C HD2  1  
ATOM 6727   H HD3  . PRO C 1 130 ? 14.498  3.609   9.954   1.00 51.12 ? 130 PRO C HD3  1  
ATOM 6728   N N    . VAL C 1 131 ? 13.602  1.180   14.641  1.00 43.32 ? 131 VAL C N    1  
ATOM 6729   C CA   . VAL C 1 131 ? 13.685  0.930   16.081  1.00 14.53 ? 131 VAL C CA   1  
ATOM 6730   C C    . VAL C 1 131 ? 14.099  -0.533  16.303  1.00 13.24 ? 131 VAL C C    1  
ATOM 6731   O O    . VAL C 1 131 ? 13.336  -1.458  15.994  1.00 62.21 ? 131 VAL C O    1  
ATOM 6732   C CB   . VAL C 1 131 ? 12.306  1.213   16.792  1.00 25.25 ? 131 VAL C CB   1  
ATOM 6733   C CG1  . VAL C 1 131 ? 12.372  0.880   18.299  1.00 75.42 ? 131 VAL C CG1  1  
ATOM 6734   C CG2  . VAL C 1 131 ? 11.853  2.674   16.560  1.00 63.43 ? 131 VAL C CG2  1  
ATOM 6735   H H    . VAL C 1 131 ? 12.781  0.932   14.174  1.00 3.21  ? 131 VAL C H    1  
ATOM 6736   H HA   . VAL C 1 131 ? 14.437  1.588   16.513  1.00 72.34 ? 131 VAL C HA   1  
ATOM 6737   H HB   . VAL C 1 131 ? 11.559  0.560   16.344  1.00 53.31 ? 131 VAL C HB   1  
ATOM 6738   H HG11 . VAL C 1 131 ? 13.117  1.502   18.782  1.00 1.12  ? 131 VAL C HG11 1  
ATOM 6739   H HG12 . VAL C 1 131 ? 12.639  -0.161  18.433  1.00 42.23 ? 131 VAL C HG12 1  
ATOM 6740   H HG13 . VAL C 1 131 ? 11.406  1.056   18.756  1.00 2.24  ? 131 VAL C HG13 1  
ATOM 6741   H HG21 . VAL C 1 131 ? 10.888  2.839   17.024  1.00 20.10 ? 131 VAL C HG21 1  
ATOM 6742   H HG22 . VAL C 1 131 ? 11.771  2.866   15.497  1.00 4.41  ? 131 VAL C HG22 1  
ATOM 6743   H HG23 . VAL C 1 131 ? 12.578  3.357   16.988  1.00 71.45 ? 131 VAL C HG23 1  
ATOM 6744   N N    . ASN C 1 132 ? 15.331  -0.734  16.813  1.00 14.11 ? 132 ASN C N    1  
ATOM 6745   C CA   . ASN C 1 132 ? 15.847  -2.068  17.143  1.00 44.33 ? 132 ASN C CA   1  
ATOM 6746   C C    . ASN C 1 132 ? 15.326  -2.448  18.535  1.00 70.04 ? 132 ASN C C    1  
ATOM 6747   O O    . ASN C 1 132 ? 15.999  -2.205  19.546  1.00 53.55 ? 132 ASN C O    1  
ATOM 6748   C CB   . ASN C 1 132 ? 17.406  -2.095  17.095  1.00 74.44 ? 132 ASN C CB   1  
ATOM 6749   C CG   . ASN C 1 132 ? 17.985  -3.520  17.154  1.00 41.34 ? 132 ASN C CG   1  
ATOM 6750   O OD1  . ASN C 1 132 ? 18.183  -4.088  18.214  1.00 44.23 ? 132 ASN C OD1  1  
ATOM 6751   N ND2  . ASN C 1 132 ? 18.292  -4.092  16.013  1.00 51.12 ? 132 ASN C ND2  1  
ATOM 6752   H H    . ASN C 1 132 ? 15.901  0.043   16.981  1.00 35.42 ? 132 ASN C H    1  
ATOM 6753   H HA   . ASN C 1 132 ? 15.457  -2.777  16.412  1.00 31.33 ? 132 ASN C HA   1  
ATOM 6754   H HB2  . ASN C 1 132 ? 17.741  -1.625  16.180  1.00 64.04 ? 132 ASN C HB2  1  
ATOM 6755   H HB3  . ASN C 1 132 ? 17.801  -1.530  17.935  1.00 72.51 ? 132 ASN C HB3  1  
ATOM 6756   H HD21 . ASN C 1 132 ? 18.139  -3.593  15.194  1.00 35.54 ? 132 ASN C HD21 1  
ATOM 6757   H HD22 . ASN C 1 132 ? 18.663  -4.996  16.045  1.00 42.12 ? 132 ASN C HD22 1  
ATOM 6758   N N    . PHE C 1 133 ? 14.086  -2.982  18.578  1.00 24.10 ? 133 PHE C N    1  
ATOM 6759   C CA   . PHE C 1 133 ? 13.412  -3.360  19.840  1.00 33.30 ? 133 PHE C CA   1  
ATOM 6760   C C    . PHE C 1 133 ? 14.221  -4.419  20.632  1.00 41.04 ? 133 PHE C C    1  
ATOM 6761   O O    . PHE C 1 133 ? 14.043  -4.538  21.840  1.00 3.22  ? 133 PHE C O    1  
ATOM 6762   C CB   . PHE C 1 133 ? 11.971  -3.887  19.568  1.00 73.41 ? 133 PHE C CB   1  
ATOM 6763   C CG   . PHE C 1 133 ? 10.965  -2.858  19.018  1.00 1.12  ? 133 PHE C CG   1  
ATOM 6764   C CD1  . PHE C 1 133 ? 10.179  -2.082  19.881  1.00 51.25 ? 133 PHE C CD1  1  
ATOM 6765   C CD2  . PHE C 1 133 ? 10.782  -2.687  17.641  1.00 34.22 ? 133 PHE C CD2  1  
ATOM 6766   C CE1  . PHE C 1 133 ? 9.252   -1.179  19.382  1.00 72.40 ? 133 PHE C CE1  1  
ATOM 6767   C CE2  . PHE C 1 133 ? 9.858   -1.780  17.146  1.00 51.41 ? 133 PHE C CE2  1  
ATOM 6768   C CZ   . PHE C 1 133 ? 9.093   -1.028  18.017  1.00 61.34 ? 133 PHE C CZ   1  
ATOM 6769   H H    . PHE C 1 133 ? 13.602  -3.112  17.735  1.00 43.44 ? 133 PHE C H    1  
ATOM 6770   H HA   . PHE C 1 133 ? 13.346  -2.462  20.447  1.00 62.12 ? 133 PHE C HA   1  
ATOM 6771   H HB2  . PHE C 1 133 ? 12.029  -4.702  18.853  1.00 64.32 ? 133 PHE C HB2  1  
ATOM 6772   H HB3  . PHE C 1 133 ? 11.564  -4.285  20.494  1.00 50.01 ? 133 PHE C HB3  1  
ATOM 6773   H HD1  . PHE C 1 133 ? 10.294  -2.189  20.955  1.00 11.41 ? 133 PHE C HD1  1  
ATOM 6774   H HD2  . PHE C 1 133 ? 11.378  -3.269  16.950  1.00 60.42 ? 133 PHE C HD2  1  
ATOM 6775   H HE1  . PHE C 1 133 ? 8.650   -0.588  20.063  1.00 33.50 ? 133 PHE C HE1  1  
ATOM 6776   H HE2  . PHE C 1 133 ? 9.731   -1.663  16.075  1.00 52.34 ? 133 PHE C HE2  1  
ATOM 6777   H HZ   . PHE C 1 133 ? 8.368   -0.320  17.629  1.00 62.13 ? 133 PHE C HZ   1  
ATOM 6778   N N    . ASP C 1 134 ? 15.101  -5.178  19.930  1.00 44.12 ? 134 ASP C N    1  
ATOM 6779   C CA   . ASP C 1 134 ? 15.967  -6.213  20.544  1.00 21.30 ? 134 ASP C CA   1  
ATOM 6780   C C    . ASP C 1 134 ? 16.941  -5.586  21.540  1.00 41.12 ? 134 ASP C C    1  
ATOM 6781   O O    . ASP C 1 134 ? 16.958  -5.949  22.720  1.00 24.23 ? 134 ASP C O    1  
ATOM 6782   C CB   . ASP C 1 134 ? 16.778  -6.991  19.469  1.00 42.33 ? 134 ASP C CB   1  
ATOM 6783   C CG   . ASP C 1 134 ? 15.901  -7.716  18.437  1.00 14.15 ? 134 ASP C CG   1  
ATOM 6784   O OD1  . ASP C 1 134 ? 15.849  -7.276  17.269  1.00 43.01 ? 134 ASP C OD1  1  
ATOM 6785   O OD2  . ASP C 1 134 ? 15.256  -8.725  18.802  1.00 64.44 ? 134 ASP C OD2  1  
ATOM 6786   H H    . ASP C 1 134 ? 15.159  -5.040  18.963  1.00 21.44 ? 134 ASP C H    1  
ATOM 6787   H HA   . ASP C 1 134 ? 15.321  -6.911  21.075  1.00 12.41 ? 134 ASP C HA   1  
ATOM 6788   H HB2  . ASP C 1 134 ? 17.431  -6.295  18.948  1.00 74.10 ? 134 ASP C HB2  1  
ATOM 6789   H HB3  . ASP C 1 134 ? 17.397  -7.733  19.965  1.00 1.01  ? 134 ASP C HB3  1  
ATOM 6790   N N    . ALA C 1 135 ? 17.715  -4.617  21.027  1.00 34.44 ? 135 ALA C N    1  
ATOM 6791   C CA   . ALA C 1 135 ? 18.744  -3.879  21.777  1.00 71.43 ? 135 ALA C CA   1  
ATOM 6792   C C    . ALA C 1 135 ? 18.122  -3.156  22.982  1.00 55.22 ? 135 ALA C C    1  
ATOM 6793   O O    . ALA C 1 135 ? 18.695  -3.119  24.076  1.00 33.34 ? 135 ALA C O    1  
ATOM 6794   C CB   . ALA C 1 135 ? 19.426  -2.886  20.816  1.00 34.14 ? 135 ALA C CB   1  
ATOM 6795   H H    . ALA C 1 135 ? 17.575  -4.375  20.086  1.00 32.23 ? 135 ALA C H    1  
ATOM 6796   H HA   . ALA C 1 135 ? 19.487  -4.592  22.128  1.00 1.31  ? 135 ALA C HA   1  
ATOM 6797   H HB1  . ALA C 1 135 ? 20.043  -3.431  20.125  1.00 53.15 ? 135 ALA C HB1  1  
ATOM 6798   H HB2  . ALA C 1 135 ? 20.036  -2.181  21.365  1.00 4.22  ? 135 ALA C HB2  1  
ATOM 6799   H HB3  . ALA C 1 135 ? 18.672  -2.347  20.241  1.00 33.20 ? 135 ALA C HB3  1  
ATOM 6800   N N    . LEU C 1 136 ? 16.921  -2.626  22.749  1.00 2.04  ? 136 LEU C N    1  
ATOM 6801   C CA   . LEU C 1 136 ? 16.133  -1.913  23.764  1.00 21.21 ? 136 LEU C CA   1  
ATOM 6802   C C    . LEU C 1 136 ? 15.514  -2.885  24.792  1.00 63.43 ? 136 LEU C C    1  
ATOM 6803   O O    . LEU C 1 136 ? 15.296  -2.511  25.944  1.00 60.40 ? 136 LEU C O    1  
ATOM 6804   C CB   . LEU C 1 136 ? 15.033  -1.083  23.059  1.00 60.54 ? 136 LEU C CB   1  
ATOM 6805   C CG   . LEU C 1 136 ? 15.539  -0.084  21.974  1.00 52.02 ? 136 LEU C CG   1  
ATOM 6806   C CD1  . LEU C 1 136 ? 14.366  0.642   21.297  1.00 51.21 ? 136 LEU C CD1  1  
ATOM 6807   C CD2  . LEU C 1 136 ? 16.564  0.907   22.564  1.00 50.12 ? 136 LEU C CD2  1  
ATOM 6808   H H    . LEU C 1 136 ? 16.554  -2.710  21.841  1.00 15.44 ? 136 LEU C H    1  
ATOM 6809   H HA   . LEU C 1 136 ? 16.802  -1.233  24.287  1.00 53.12 ? 136 LEU C HA   1  
ATOM 6810   H HB2  . LEU C 1 136 ? 14.334  -1.773  22.591  1.00 34.14 ? 136 LEU C HB2  1  
ATOM 6811   H HB3  . LEU C 1 136 ? 14.493  -0.519  23.814  1.00 12.40 ? 136 LEU C HB3  1  
ATOM 6812   H HG   . LEU C 1 136 ? 16.049  -0.649  21.200  1.00 31.32 ? 136 LEU C HG   1  
ATOM 6813   H HD11 . LEU C 1 136 ? 13.813  1.216   22.030  1.00 71.40 ? 136 LEU C HD11 1  
ATOM 6814   H HD12 . LEU C 1 136 ? 13.705  -0.083  20.840  1.00 61.45 ? 136 LEU C HD12 1  
ATOM 6815   H HD13 . LEU C 1 136 ? 14.740  1.308   20.529  1.00 30.42 ? 136 LEU C HD13 1  
ATOM 6816   H HD21 . LEU C 1 136 ? 16.114  1.465   23.376  1.00 63.25 ? 136 LEU C HD21 1  
ATOM 6817   H HD22 . LEU C 1 136 ? 16.892  1.595   21.796  1.00 13.23 ? 136 LEU C HD22 1  
ATOM 6818   H HD23 . LEU C 1 136 ? 17.422  0.363   22.936  1.00 32.51 ? 136 LEU C HD23 1  
ATOM 6819   N N    . PHE C 1 137 ? 15.220  -4.131  24.368  1.00 33.22 ? 137 PHE C N    1  
ATOM 6820   C CA   . PHE C 1 137 ? 14.623  -5.154  25.266  1.00 14.22 ? 137 PHE C CA   1  
ATOM 6821   C C    . PHE C 1 137 ? 15.688  -5.704  26.221  1.00 33.04 ? 137 PHE C C    1  
ATOM 6822   O O    . PHE C 1 137 ? 15.365  -6.102  27.325  1.00 53.03 ? 137 PHE C O    1  
ATOM 6823   C CB   . PHE C 1 137 ? 13.963  -6.322  24.467  1.00 62.51 ? 137 PHE C CB   1  
ATOM 6824   C CG   . PHE C 1 137 ? 12.920  -7.133  25.268  1.00 75.22 ? 137 PHE C CG   1  
ATOM 6825   C CD1  . PHE C 1 137 ? 13.205  -8.359  25.856  1.00 41.51 ? 137 PHE C CD1  1  
ATOM 6826   C CD2  . PHE C 1 137 ? 11.648  -6.646  25.421  1.00 64.03 ? 137 PHE C CD2  1  
ATOM 6827   C CE1  . PHE C 1 137 ? 12.246  -9.058  26.567  1.00 4.43  ? 137 PHE C CE1  1  
ATOM 6828   C CE2  . PHE C 1 137 ? 10.687  -7.339  26.127  1.00 73.04 ? 137 PHE C CE2  1  
ATOM 6829   C CZ   . PHE C 1 137 ? 10.986  -8.548  26.705  1.00 74.34 ? 137 PHE C CZ   1  
ATOM 6830   H H    . PHE C 1 137 ? 15.403  -4.368  23.433  1.00 73.33 ? 137 PHE C H    1  
ATOM 6831   H HA   . PHE C 1 137 ? 13.855  -4.654  25.857  1.00 34.42 ? 137 PHE C HA   1  
ATOM 6832   H HB2  . PHE C 1 137 ? 13.460  -5.908  23.599  1.00 73.40 ? 137 PHE C HB2  1  
ATOM 6833   H HB3  . PHE C 1 137 ? 14.731  -7.007  24.116  1.00 65.22 ? 137 PHE C HB3  1  
ATOM 6834   H HD1  . PHE C 1 137 ? 14.180  -8.774  25.744  1.00 74.01 ? 137 PHE C HD1  1  
ATOM 6835   H HD2  . PHE C 1 137 ? 11.399  -5.711  24.961  1.00 2.34  ? 137 PHE C HD2  1  
ATOM 6836   H HE1  . PHE C 1 137 ? 12.480  -10.018 26.994  1.00 41.40 ? 137 PHE C HE1  1  
ATOM 6837   H HE2  . PHE C 1 137 ? 9.698   -6.933  26.218  1.00 43.22 ? 137 PHE C HE2  1  
ATOM 6838   H HZ   . PHE C 1 137 ? 10.229  -9.101  27.261  1.00 52.05 ? 137 PHE C HZ   1  
ATOM 6839   N N    . MET C 1 138 ? 16.958  -5.697  25.774  1.00 4.43  ? 138 MET C N    1  
ATOM 6840   C CA   . MET C 1 138 ? 18.090  -6.260  26.540  1.00 40.02 ? 138 MET C CA   1  
ATOM 6841   C C    . MET C 1 138 ? 18.327  -5.497  27.860  1.00 43.25 ? 138 MET C C    1  
ATOM 6842   O O    . MET C 1 138 ? 18.725  -6.104  28.864  1.00 50.24 ? 138 MET C O    1  
ATOM 6843   C CB   . MET C 1 138 ? 19.380  -6.270  25.677  1.00 14.32 ? 138 MET C CB   1  
ATOM 6844   C CG   . MET C 1 138 ? 19.314  -7.180  24.442  1.00 35.40 ? 138 MET C CG   1  
ATOM 6845   S SD   . MET C 1 138 ? 20.721  -6.961  23.332  1.00 11.10 ? 138 MET C SD   1  
ATOM 6846   C CE   . MET C 1 138 ? 20.190  -7.908  21.904  1.00 50.50 ? 138 MET C CE   1  
ATOM 6847   H H    . MET C 1 138 ? 17.139  -5.296  24.897  1.00 31.43 ? 138 MET C H    1  
ATOM 6848   H HA   . MET C 1 138 ? 17.824  -7.285  26.782  1.00 34.14 ? 138 MET C HA   1  
ATOM 6849   H HB2  . MET C 1 138 ? 19.579  -5.262  25.335  1.00 4.33  ? 138 MET C HB2  1  
ATOM 6850   H HB3  . MET C 1 138 ? 20.215  -6.597  26.288  1.00 63.01 ? 138 MET C HB3  1  
ATOM 6851   H HG2  . MET C 1 138 ? 19.292  -8.215  24.766  1.00 53.50 ? 138 MET C HG2  1  
ATOM 6852   H HG3  . MET C 1 138 ? 18.407  -6.963  23.894  1.00 41.41 ? 138 MET C HG3  1  
ATOM 6853   H HE1  . MET C 1 138 ? 19.268  -7.495  21.517  1.00 61.53 ? 138 MET C HE1  1  
ATOM 6854   H HE2  . MET C 1 138 ? 20.030  -8.938  22.191  1.00 42.20 ? 138 MET C HE2  1  
ATOM 6855   H HE3  . MET C 1 138 ? 20.951  -7.864  21.141  1.00 63.13 ? 138 MET C HE3  1  
ATOM 6856   N N    . ASN C 1 139 ? 18.097  -4.165  27.843  1.00 41.53 ? 139 ASN C N    1  
ATOM 6857   C CA   . ASN C 1 139 ? 18.173  -3.335  29.067  1.00 14.00 ? 139 ASN C CA   1  
ATOM 6858   C C    . ASN C 1 139 ? 16.971  -3.630  29.993  1.00 14.42 ? 139 ASN C C    1  
ATOM 6859   O O    . ASN C 1 139 ? 17.108  -3.636  31.214  1.00 64.01 ? 139 ASN C O    1  
ATOM 6860   C CB   . ASN C 1 139 ? 18.323  -1.815  28.726  1.00 72.43 ? 139 ASN C CB   1  
ATOM 6861   C CG   . ASN C 1 139 ? 17.131  -1.137  28.019  1.00 32.13 ? 139 ASN C CG   1  
ATOM 6862   O OD1  . ASN C 1 139 ? 15.973  -1.289  28.406  1.00 21.34 ? 139 ASN C OD1  1  
ATOM 6863   N ND2  . ASN C 1 139 ? 17.405  -0.380  26.965  1.00 21.31 ? 139 ASN C ND2  1  
ATOM 6864   H H    . ASN C 1 139 ? 17.868  -3.735  26.989  1.00 73.04 ? 139 ASN C H    1  
ATOM 6865   H HA   . ASN C 1 139 ? 19.072  -3.648  29.594  1.00 15.31 ? 139 ASN C HA   1  
ATOM 6866   H HB2  . ASN C 1 139 ? 18.495  -1.270  29.643  1.00 53.20 ? 139 ASN C HB2  1  
ATOM 6867   H HB3  . ASN C 1 139 ? 19.202  -1.700  28.098  1.00 32.01 ? 139 ASN C HB3  1  
ATOM 6868   H HD21 . ASN C 1 139 ? 18.341  -0.285  26.687  1.00 30.04 ? 139 ASN C HD21 1  
ATOM 6869   H HD22 . ASN C 1 139 ? 16.657  0.059   26.508  1.00 53.31 ? 139 ASN C HD22 1  
ATOM 6870   N N    . TYR C 1 140 ? 15.797  -3.863  29.372  1.00 52.33 ? 140 TYR C N    1  
ATOM 6871   C CA   . TYR C 1 140 ? 14.544  -4.238  30.061  1.00 3.54  ? 140 TYR C CA   1  
ATOM 6872   C C    . TYR C 1 140 ? 14.682  -5.650  30.684  1.00 24.53 ? 140 TYR C C    1  
ATOM 6873   O O    . TYR C 1 140 ? 14.907  -5.773  31.888  1.00 33.23 ? 140 TYR C O    1  
ATOM 6874   C CB   . TYR C 1 140 ? 13.325  -4.124  29.092  1.00 61.34 ? 140 TYR C CB   1  
ATOM 6875   C CG   . TYR C 1 140 ? 11.983  -4.612  29.677  1.00 65.54 ? 140 TYR C CG   1  
ATOM 6876   C CD1  . TYR C 1 140 ? 11.397  -3.992  30.784  1.00 60.11 ? 140 TYR C CD1  1  
ATOM 6877   C CD2  . TYR C 1 140 ? 11.308  -5.699  29.118  1.00 21.41 ? 140 TYR C CD2  1  
ATOM 6878   C CE1  . TYR C 1 140 ? 10.200  -4.445  31.305  1.00 5.41  ? 140 TYR C CE1  1  
ATOM 6879   C CE2  . TYR C 1 140 ? 10.111  -6.148  29.635  1.00 14.04 ? 140 TYR C CE2  1  
ATOM 6880   C CZ   . TYR C 1 140 ? 9.561   -5.520  30.727  1.00 0.53  ? 140 TYR C CZ   1  
ATOM 6881   O OH   . TYR C 1 140 ? 8.367   -5.970  31.254  1.00 71.43 ? 140 TYR C OH   1  
ATOM 6882   H H    . TYR C 1 140 ? 15.775  -3.775  28.395  1.00 1.43  ? 140 TYR C H    1  
ATOM 6883   H HA   . TYR C 1 140 ? 14.398  -3.524  30.872  1.00 42.12 ? 140 TYR C HA   1  
ATOM 6884   H HB2  . TYR C 1 140 ? 13.195  -3.084  28.810  1.00 72.15 ? 140 TYR C HB2  1  
ATOM 6885   H HB3  . TYR C 1 140 ? 13.534  -4.697  28.195  1.00 33.21 ? 140 TYR C HB3  1  
ATOM 6886   H HD1  . TYR C 1 140 ? 11.892  -3.145  31.240  1.00 13.34 ? 140 TYR C HD1  1  
ATOM 6887   H HD2  . TYR C 1 140 ? 11.738  -6.195  28.256  1.00 71.12 ? 140 TYR C HD2  1  
ATOM 6888   H HE1  . TYR C 1 140 ? 9.763   -3.951  32.164  1.00 44.11 ? 140 TYR C HE1  1  
ATOM 6889   H HE2  . TYR C 1 140 ? 9.612   -6.997  29.180  1.00 22.22 ? 140 TYR C HE2  1  
ATOM 6890   H HH   . TYR C 1 140 ? 8.391   -6.931  31.320  1.00 75.33 ? 140 TYR C HH   1  
ATOM 6891   N N    . LEU C 1 141 ? 14.491  -6.704  29.867  1.00 50.44 ? 141 LEU C N    1  
ATOM 6892   C CA   . LEU C 1 141 ? 14.626  -8.108  30.301  1.00 34.32 ? 141 LEU C CA   1  
ATOM 6893   C C    . LEU C 1 141 ? 15.593  -8.866  29.366  1.00 14.21 ? 141 LEU C C    1  
ATOM 6894   O O    . LEU C 1 141 ? 15.497  -8.751  28.140  1.00 44.23 ? 141 LEU C O    1  
ATOM 6895   C CB   . LEU C 1 141 ? 13.239  -8.803  30.308  1.00 44.13 ? 141 LEU C CB   1  
ATOM 6896   C CG   . LEU C 1 141 ? 13.225  -10.269 30.839  1.00 62.14 ? 141 LEU C CG   1  
ATOM 6897   C CD1  . LEU C 1 141 ? 13.652  -10.328 32.319  1.00 43.55 ? 141 LEU C CD1  1  
ATOM 6898   C CD2  . LEU C 1 141 ? 11.853  -10.929 30.618  1.00 1.44  ? 141 LEU C CD2  1  
ATOM 6899   H H    . LEU C 1 141 ? 14.260  -6.535  28.932  1.00 15.24 ? 141 LEU C H    1  
ATOM 6900   H HA   . LEU C 1 141 ? 15.030  -8.121  31.315  1.00 74.43 ? 141 LEU C HA   1  
ATOM 6901   H HB2  . LEU C 1 141 ? 12.567  -8.209  30.922  1.00 3.34  ? 141 LEU C HB2  1  
ATOM 6902   H HB3  . LEU C 1 141 ? 12.857  -8.801  29.294  1.00 21.14 ? 141 LEU C HB3  1  
ATOM 6903   H HG   . LEU C 1 141 ? 13.952  -10.849 30.281  1.00 62.20 ? 141 LEU C HG   1  
ATOM 6904   H HD11 . LEU C 1 141 ? 12.976  -9.734  32.923  1.00 43.52 ? 141 LEU C HD11 1  
ATOM 6905   H HD12 . LEU C 1 141 ? 14.656  -9.944  32.421  1.00 61.32 ? 141 LEU C HD12 1  
ATOM 6906   H HD13 . LEU C 1 141 ? 13.630  -11.354 32.663  1.00 65.14 ? 141 LEU C HD13 1  
ATOM 6907   H HD21 . LEU C 1 141 ? 11.087  -10.389 31.163  1.00 0.43  ? 141 LEU C HD21 1  
ATOM 6908   H HD22 . LEU C 1 141 ? 11.881  -11.954 30.963  1.00 74.31 ? 141 LEU C HD22 1  
ATOM 6909   H HD23 . LEU C 1 141 ? 11.614  -10.920 29.563  1.00 73.45 ? 141 LEU C HD23 1  
ATOM 6910   N N    . GLN C 1 142 ? 16.498  -9.656  29.984  1.00 22.22 ? 142 GLN C N    1  
ATOM 6911   C CA   . GLN C 1 142 ? 17.494  -10.508 29.299  1.00 73.25 ? 142 GLN C CA   1  
ATOM 6912   C C    . GLN C 1 142 ? 18.530  -9.683  28.511  1.00 11.44 ? 142 GLN C C    1  
ATOM 6913   O O    . GLN C 1 142 ? 18.299  -9.322  27.349  1.00 23.30 ? 142 GLN C O    1  
ATOM 6914   C CB   . GLN C 1 142 ? 16.846  -11.589 28.371  1.00 3.51  ? 142 GLN C CB   1  
ATOM 6915   C CG   . GLN C 1 142 ? 17.869  -12.578 27.741  1.00 31.12 ? 142 GLN C CG   1  
ATOM 6916   C CD   . GLN C 1 142 ? 17.283  -13.493 26.659  1.00 2.31  ? 142 GLN C CD   1  
ATOM 6917   O OE1  . GLN C 1 142 ? 16.102  -13.822 26.674  1.00 24.10 ? 142 GLN C OE1  1  
ATOM 6918   N NE2  . GLN C 1 142 ? 18.114  -13.937 25.730  1.00 12.11 ? 142 GLN C NE2  1  
ATOM 6919   H H    . GLN C 1 142 ? 16.495  -9.661  30.963  1.00 23.31 ? 142 GLN C H    1  
ATOM 6920   H HA   . GLN C 1 142 ? 18.022  -11.029 30.092  1.00 24.31 ? 142 GLN C HA   1  
ATOM 6921   H HB2  . GLN C 1 142 ? 16.127  -12.160 28.950  1.00 32.14 ? 142 GLN C HB2  1  
ATOM 6922   H HB3  . GLN C 1 142 ? 16.314  -11.085 27.568  1.00 4.31  ? 142 GLN C HB3  1  
ATOM 6923   H HG2  . GLN C 1 142 ? 18.675  -12.003 27.298  1.00 4.44  ? 142 GLN C HG2  1  
ATOM 6924   H HG3  . GLN C 1 142 ? 18.277  -13.199 28.530  1.00 40.31 ? 142 GLN C HG3  1  
ATOM 6925   H HE21 . GLN C 1 142 ? 19.058  -13.668 25.778  1.00 0.21  ? 142 GLN C HE21 1  
ATOM 6926   H HE22 . GLN C 1 142 ? 17.753  -14.517 25.029  1.00 65.42 ? 142 GLN C HE22 1  
ATOM 6927   N N    . GLN C 1 143 ? 19.671  -9.394  29.159  1.00 73.31 ? 143 GLN C N    1  
ATOM 6928   C CA   . GLN C 1 143 ? 20.861  -8.877  28.484  1.00 62.41 ? 143 GLN C CA   1  
ATOM 6929   C C    . GLN C 1 143 ? 21.446  -10.003 27.603  1.00 24.44 ? 143 GLN C C    1  
ATOM 6930   O O    . GLN C 1 143 ? 22.254  -10.830 28.056  1.00 2.43  ? 143 GLN C O    1  
ATOM 6931   C CB   . GLN C 1 143 ? 21.911  -8.368  29.506  1.00 22.22 ? 143 GLN C CB   1  
ATOM 6932   C CG   . GLN C 1 143 ? 23.108  -7.646  28.853  1.00 24.15 ? 143 GLN C CG   1  
ATOM 6933   C CD   . GLN C 1 143 ? 24.180  -7.197  29.847  1.00 74.34 ? 143 GLN C CD   1  
ATOM 6934   O OE1  . GLN C 1 143 ? 24.420  -7.848  30.864  1.00 51.24 ? 143 GLN C OE1  1  
ATOM 6935   N NE2  . GLN C 1 143 ? 24.821  -6.070  29.565  1.00 3.43  ? 143 GLN C NE2  1  
ATOM 6936   H H    . GLN C 1 143 ? 19.708  -9.539  30.124  1.00 64.31 ? 143 GLN C H    1  
ATOM 6937   H HA   . GLN C 1 143 ? 20.555  -8.046  27.848  1.00 30.10 ? 143 GLN C HA   1  
ATOM 6938   H HB2  . GLN C 1 143 ? 21.423  -7.676  30.187  1.00 72.22 ? 143 GLN C HB2  1  
ATOM 6939   H HB3  . GLN C 1 143 ? 22.283  -9.211  30.077  1.00 2.55  ? 143 GLN C HB3  1  
ATOM 6940   H HG2  . GLN C 1 143 ? 23.573  -8.318  28.140  1.00 61.23 ? 143 GLN C HG2  1  
ATOM 6941   H HG3  . GLN C 1 143 ? 22.735  -6.777  28.323  1.00 12.50 ? 143 GLN C HG3  1  
ATOM 6942   H HE21 . GLN C 1 143 ? 24.576  -5.592  28.744  1.00 75.42 ? 143 GLN C HE21 1  
ATOM 6943   H HE22 . GLN C 1 143 ? 25.508  -5.758  30.186  1.00 13.55 ? 143 GLN C HE22 1  
ATOM 6944   N N    . GLN C 1 144 ? 20.938  -10.060 26.369  1.00 52.43 ? 144 GLN C N    1  
ATOM 6945   C CA   . GLN C 1 144 ? 21.292  -11.084 25.380  1.00 34.32 ? 144 GLN C CA   1  
ATOM 6946   C C    . GLN C 1 144 ? 22.667  -10.777 24.756  1.00 12.04 ? 144 GLN C C    1  
ATOM 6947   O O    . GLN C 1 144 ? 22.960  -9.621  24.444  1.00 10.42 ? 144 GLN C O    1  
ATOM 6948   C CB   . GLN C 1 144 ? 20.185  -11.150 24.288  1.00 22.30 ? 144 GLN C CB   1  
ATOM 6949   C CG   . GLN C 1 144 ? 20.452  -12.172 23.166  1.00 50.32 ? 144 GLN C CG   1  
ATOM 6950   C CD   . GLN C 1 144 ? 19.350  -12.262 22.115  1.00 74.52 ? 144 GLN C CD   1  
ATOM 6951   O OE1  . GLN C 1 144 ? 18.173  -12.040 22.400  1.00 34.31 ? 144 GLN C OE1  1  
ATOM 6952   N NE2  . GLN C 1 144 ? 19.725  -12.609 20.895  1.00 23.42 ? 144 GLN C NE2  1  
ATOM 6953   H H    . GLN C 1 144 ? 20.286  -9.379  26.111  1.00 11.34 ? 144 GLN C H    1  
ATOM 6954   H HA   . GLN C 1 144 ? 21.334  -12.045 25.891  1.00 31.13 ? 144 GLN C HA   1  
ATOM 6955   H HB2  . GLN C 1 144 ? 19.243  -11.406 24.763  1.00 5.51  ? 144 GLN C HB2  1  
ATOM 6956   H HB3  . GLN C 1 144 ? 20.083  -10.167 23.836  1.00 44.20 ? 144 GLN C HB3  1  
ATOM 6957   H HG2  . GLN C 1 144 ? 21.379  -11.903 22.672  1.00 25.31 ? 144 GLN C HG2  1  
ATOM 6958   H HG3  . GLN C 1 144 ? 20.572  -13.151 23.615  1.00 40.01 ? 144 GLN C HG3  1  
ATOM 6959   H HE21 . GLN C 1 144 ? 20.678  -12.790 20.736  1.00 75.11 ? 144 GLN C HE21 1  
ATOM 6960   H HE22 . GLN C 1 144 ? 19.042  -12.660 20.197  1.00 64.44 ? 144 GLN C HE22 1  
ATOM 6961   N N    . ALA C 1 145 ? 23.506  -11.819 24.604  1.00 31.11 ? 145 ALA C N    1  
ATOM 6962   C CA   . ALA C 1 145 ? 24.813  -11.710 23.921  1.00 44.05 ? 145 ALA C CA   1  
ATOM 6963   C C    . ALA C 1 145 ? 24.637  -11.852 22.394  1.00 63.51 ? 145 ALA C C    1  
ATOM 6964   O O    . ALA C 1 145 ? 23.618  -12.382 21.929  1.00 71.35 ? 145 ALA C O    1  
ATOM 6965   C CB   . ALA C 1 145 ? 25.794  -12.752 24.478  1.00 32.03 ? 145 ALA C CB   1  
ATOM 6966   H H    . ALA C 1 145 ? 23.233  -12.694 24.955  1.00 55.42 ? 145 ALA C H    1  
ATOM 6967   H HA   . ALA C 1 145 ? 25.223  -10.720 24.128  1.00 10.14 ? 145 ALA C HA   1  
ATOM 6968   H HB1  . ALA C 1 145 ? 26.761  -12.642 24.006  1.00 3.51  ? 145 ALA C HB1  1  
ATOM 6969   H HB2  . ALA C 1 145 ? 25.417  -13.752 24.290  1.00 31.43 ? 145 ALA C HB2  1  
ATOM 6970   H HB3  . ALA C 1 145 ? 25.903  -12.615 25.548  1.00 23.22 ? 145 ALA C HB3  1  
ATOM 6971   N N    . GLY C 1 146 ? 25.632  -11.368 21.625  1.00 74.02 ? 146 GLY C N    1  
ATOM 6972   C CA   . GLY C 1 146 ? 25.555  -11.326 20.157  1.00 35.31 ? 146 GLY C CA   1  
ATOM 6973   C C    . GLY C 1 146 ? 25.829  -12.668 19.474  1.00 70.42 ? 146 GLY C C    1  
ATOM 6974   O O    . GLY C 1 146 ? 25.546  -13.739 20.028  1.00 22.41 ? 146 GLY C O    1  
ATOM 6975   H H    . GLY C 1 146 ? 26.434  -11.015 22.065  1.00 11.23 ? 146 GLY C H    1  
ATOM 6976   H HA2  . GLY C 1 146 ? 24.568  -10.981 19.863  1.00 52.23 ? 146 GLY C HA2  1  
ATOM 6977   H HA3  . GLY C 1 146 ? 26.281  -10.608 19.807  1.00 32.05 ? 146 GLY C HA3  1  
ATOM 6978   N N    . GLU C 1 147 ? 26.345  -12.596 18.234  1.00 11.21 ? 147 GLU C N    1  
ATOM 6979   C CA   . GLU C 1 147 ? 26.763  -13.784 17.461  1.00 11.34 ? 147 GLU C CA   1  
ATOM 6980   C C    . GLU C 1 147 ? 28.166  -14.215 17.902  1.00 44.43 ? 147 GLU C C    1  
ATOM 6981   O O    . GLU C 1 147 ? 28.968  -13.378 18.353  1.00 61.22 ? 147 GLU C O    1  
ATOM 6982   C CB   . GLU C 1 147 ? 26.768  -13.510 15.928  1.00 50.31 ? 147 GLU C CB   1  
ATOM 6983   C CG   . GLU C 1 147 ? 25.402  -13.161 15.300  1.00 1.43  ? 147 GLU C CG   1  
ATOM 6984   C CD   . GLU C 1 147 ? 24.839  -11.792 15.724  1.00 43.04 ? 147 GLU C CD   1  
ATOM 6985   O OE1  . GLU C 1 147 ? 23.904  -11.745 16.559  1.00 1.15  ? 147 GLU C OE1  1  
ATOM 6986   O OE2  . GLU C 1 147 ? 25.362  -10.758 15.253  1.00 22.14 ? 147 GLU C OE2  1  
ATOM 6987   H H    . GLU C 1 147 ? 26.449  -11.711 17.823  1.00 35.22 ? 147 GLU C H    1  
ATOM 6988   H HA   . GLU C 1 147 ? 26.066  -14.592 17.670  1.00 64.55 ? 147 GLU C HA   1  
ATOM 6989   H HB2  . GLU C 1 147 ? 27.448  -12.689 15.724  1.00 60.43 ? 147 GLU C HB2  1  
ATOM 6990   H HB3  . GLU C 1 147 ? 27.149  -14.397 15.422  1.00 22.13 ? 147 GLU C HB3  1  
ATOM 6991   H HG2  . GLU C 1 147 ? 25.512  -13.164 14.222  1.00 3.33  ? 147 GLU C HG2  1  
ATOM 6992   H HG3  . GLU C 1 147 ? 24.695  -13.939 15.573  1.00 14.32 ? 147 GLU C HG3  1  
ATOM 6993   N N    . GLY C 1 148 ? 28.464  -15.517 17.766  1.00 70.00 ? 148 GLY C N    1  
ATOM 6994   C CA   . GLY C 1 148 ? 29.790  -16.052 18.091  1.00 11.11 ? 148 GLY C CA   1  
ATOM 6995   C C    . GLY C 1 148 ? 30.757  -15.901 16.931  1.00 24.24 ? 148 GLY C C    1  
ATOM 6996   O O    . GLY C 1 148 ? 31.256  -16.890 16.374  1.00 41.20 ? 148 GLY C O    1  
ATOM 6997   H H    . GLY C 1 148 ? 27.771  -16.127 17.427  1.00 50.14 ? 148 GLY C H    1  
ATOM 6998   H HA2  . GLY C 1 148 ? 30.190  -15.536 18.958  1.00 41.21 ? 148 GLY C HA2  1  
ATOM 6999   H HA3  . GLY C 1 148 ? 29.690  -17.100 18.334  1.00 1.02  ? 148 GLY C HA3  1  
ATOM 7000   N N    . THR C 1 149 ? 31.009  -14.639 16.583  1.00 14.03 ? 149 THR C N    1  
ATOM 7001   C CA   . THR C 1 149 ? 31.798  -14.250 15.417  1.00 60.12 ? 149 THR C CA   1  
ATOM 7002   C C    . THR C 1 149 ? 33.297  -14.396 15.690  1.00 4.22  ? 149 THR C C    1  
ATOM 7003   O O    . THR C 1 149 ? 33.849  -13.685 16.526  1.00 73.34 ? 149 THR C O    1  
ATOM 7004   C CB   . THR C 1 149 ? 31.465  -12.774 15.036  1.00 2.22  ? 149 THR C CB   1  
ATOM 7005   O OG1  . THR C 1 149 ? 31.696  -11.904 16.157  1.00 52.22 ? 149 THR C OG1  1  
ATOM 7006   C CG2  . THR C 1 149 ? 30.008  -12.632 14.614  1.00 22.11 ? 149 THR C CG2  1  
ATOM 7007   H H    . THR C 1 149 ? 30.639  -13.927 17.143  1.00 61.43 ? 149 THR C H    1  
ATOM 7008   H HA   . THR C 1 149 ? 31.517  -14.891 14.580  1.00 61.33 ? 149 THR C HA   1  
ATOM 7009   H HB   . THR C 1 149 ? 32.101  -12.466 14.212  1.00 32.35 ? 149 THR C HB   1  
ATOM 7010   H HG1  . THR C 1 149 ? 32.040  -12.415 16.902  1.00 12.34 ? 149 THR C HG1  1  
ATOM 7011   H HG21 . THR C 1 149 ? 29.804  -11.603 14.356  1.00 42.20 ? 149 THR C HG21 1  
ATOM 7012   H HG22 . THR C 1 149 ? 29.359  -12.931 15.428  1.00 31.31 ? 149 THR C HG22 1  
ATOM 7013   H HG23 . THR C 1 149 ? 29.809  -13.260 13.753  1.00 21.12 ? 149 THR C HG23 1  
ATOM 7014   N N    . GLU C 1 150 ? 33.931  -15.339 14.995  1.00 50.14 ? 150 GLU C N    1  
ATOM 7015   C CA   . GLU C 1 150 ? 35.385  -15.560 15.072  1.00 31.34 ? 150 GLU C CA   1  
ATOM 7016   C C    . GLU C 1 150 ? 36.102  -14.689 14.013  1.00 62.00 ? 150 GLU C C    1  
ATOM 7017   O O    . GLU C 1 150 ? 35.479  -14.235 13.045  1.00 33.22 ? 150 GLU C O    1  
ATOM 7018   C CB   . GLU C 1 150 ? 35.673  -17.068 14.847  1.00 55.44 ? 150 GLU C CB   1  
ATOM 7019   C CG   . GLU C 1 150 ? 37.131  -17.492 15.094  1.00 14.13 ? 150 GLU C CG   1  
ATOM 7020   C CD   . GLU C 1 150 ? 37.375  -18.981 14.845  1.00 11.31 ? 150 GLU C CD   1  
ATOM 7021   O OE1  . GLU C 1 150 ? 37.339  -19.780 15.805  1.00 21.33 ? 150 GLU C OE1  1  
ATOM 7022   O OE2  . GLU C 1 150 ? 37.597  -19.359 13.684  1.00 15.12 ? 150 GLU C OE2  1  
ATOM 7023   H H    . GLU C 1 150 ? 33.407  -15.908 14.394  1.00 74.14 ? 150 GLU C H    1  
ATOM 7024   H HA   . GLU C 1 150 ? 35.731  -15.274 16.068  1.00 54.34 ? 150 GLU C HA   1  
ATOM 7025   H HB2  . GLU C 1 150 ? 35.039  -17.644 15.516  1.00 65.23 ? 150 GLU C HB2  1  
ATOM 7026   H HB3  . GLU C 1 150 ? 35.408  -17.327 13.824  1.00 11.22 ? 150 GLU C HB3  1  
ATOM 7027   H HG2  . GLU C 1 150 ? 37.777  -16.914 14.434  1.00 0.04  ? 150 GLU C HG2  1  
ATOM 7028   H HG3  . GLU C 1 150 ? 37.395  -17.255 16.119  1.00 64.01 ? 150 GLU C HG3  1  
ATOM 7029   N N    . GLU C 1 151 ? 37.399  -14.433 14.217  1.00 22.25 ? 151 GLU C N    1  
ATOM 7030   C CA   . GLU C 1 151 ? 38.235  -13.743 13.229  1.00 62.21 ? 151 GLU C CA   1  
ATOM 7031   C C    . GLU C 1 151 ? 38.896  -14.820 12.348  1.00 40.12 ? 151 GLU C C    1  
ATOM 7032   O O    . GLU C 1 151 ? 39.783  -15.540 12.825  1.00 22.53 ? 151 GLU C O    1  
ATOM 7033   C CB   . GLU C 1 151 ? 39.298  -12.850 13.952  1.00 63.53 ? 151 GLU C CB   1  
ATOM 7034   C CG   . GLU C 1 151 ? 40.037  -11.813 13.062  1.00 72.44 ? 151 GLU C CG   1  
ATOM 7035   C CD   . GLU C 1 151 ? 40.985  -12.419 12.008  1.00 41.12 ? 151 GLU C CD   1  
ATOM 7036   O OE1  . GLU C 1 151 ? 40.638  -12.438 10.806  1.00 64.43 ? 151 GLU C OE1  1  
ATOM 7037   O OE2  . GLU C 1 151 ? 42.066  -12.914 12.386  1.00 23.23 ? 151 GLU C OE2  1  
ATOM 7038   H H    . GLU C 1 151 ? 37.812  -14.733 15.050  1.00 73.52 ? 151 GLU C H    1  
ATOM 7039   H HA   . GLU C 1 151 ? 37.596  -13.107 12.610  1.00 75.32 ? 151 GLU C HA   1  
ATOM 7040   H HB2  . GLU C 1 151 ? 38.793  -12.303 14.744  1.00 62.30 ? 151 GLU C HB2  1  
ATOM 7041   H HB3  . GLU C 1 151 ? 40.041  -13.491 14.415  1.00 1.40  ? 151 GLU C HB3  1  
ATOM 7042   H HG2  . GLU C 1 151 ? 39.290  -11.211 12.560  1.00 42.23 ? 151 GLU C HG2  1  
ATOM 7043   H HG3  . GLU C 1 151 ? 40.619  -11.161 13.707  1.00 5.12  ? 151 GLU C HG3  1  
ATOM 7044   N N    . HIS C 1 152 ? 38.425  -14.946 11.086  1.00 32.25 ? 152 HIS C N    1  
ATOM 7045   C CA   . HIS C 1 152 ? 39.071  -15.789 10.060  1.00 1.53  ? 152 HIS C CA   1  
ATOM 7046   C C    . HIS C 1 152 ? 38.435  -15.556 8.680   1.00 24.24 ? 152 HIS C C    1  
ATOM 7047   O O    . HIS C 1 152 ? 37.220  -15.574 8.548   1.00 33.02 ? 152 HIS C O    1  
ATOM 7048   C CB   . HIS C 1 152 ? 38.995  -17.305 10.405  1.00 21.53 ? 152 HIS C CB   1  
ATOM 7049   C CG   . HIS C 1 152 ? 39.689  -18.186 9.393   1.00 53.03 ? 152 HIS C CG   1  
ATOM 7050   N ND1  . HIS C 1 152 ? 39.042  -18.729 8.302   1.00 34.34 ? 152 HIS C ND1  1  
ATOM 7051   C CD2  . HIS C 1 152 ? 40.982  -18.565 9.277   1.00 41.01 ? 152 HIS C CD2  1  
ATOM 7052   C CE1  . HIS C 1 152 ? 39.903  -19.399 7.571   1.00 2.25  ? 152 HIS C CE1  1  
ATOM 7053   N NE2  . HIS C 1 152 ? 41.085  -19.317 8.140   1.00 11.35 ? 152 HIS C NE2  1  
ATOM 7054   H H    . HIS C 1 152 ? 37.612  -14.450 10.838  1.00 74.33 ? 152 HIS C H    1  
ATOM 7055   H HA   . HIS C 1 152 ? 40.120  -15.490 10.014  1.00 55.31 ? 152 HIS C HA   1  
ATOM 7056   H HB2  . HIS C 1 152 ? 39.461  -17.469 11.366  1.00 24.33 ? 152 HIS C HB2  1  
ATOM 7057   H HB3  . HIS C 1 152 ? 37.958  -17.616 10.465  1.00 45.20 ? 152 HIS C HB3  1  
ATOM 7058   H HD1  . HIS C 1 152 ? 38.089  -18.640 8.093   1.00 24.03 ? 152 HIS C HD1  1  
ATOM 7059   H HD2  . HIS C 1 152 ? 41.785  -18.332 9.966   1.00 23.31 ? 152 HIS C HD2  1  
ATOM 7060   H HE1  . HIS C 1 152 ? 39.681  -19.925 6.654   1.00 21.25 ? 152 HIS C HE1  1  
ATOM 7061   H HE2  . HIS C 1 152 ? 41.853  -19.884 7.910   1.00 37.65 ? 152 HIS C HE2  1  
ATOM 7062   N N    . GLN C 1 153 ? 39.277  -15.381 7.651   1.00 53.01 ? 153 GLN C N    1  
ATOM 7063   C CA   . GLN C 1 153 ? 38.840  -15.349 6.245   1.00 61.14 ? 153 GLN C CA   1  
ATOM 7064   C C    . GLN C 1 153 ? 40.027  -15.707 5.342   1.00 24.12 ? 153 GLN C C    1  
ATOM 7065   O O    . GLN C 1 153 ? 41.124  -15.153 5.497   1.00 11.12 ? 153 GLN C O    1  
ATOM 7066   C CB   . GLN C 1 153 ? 38.260  -13.963 5.858   1.00 30.10 ? 153 GLN C CB   1  
ATOM 7067   C CG   . GLN C 1 153 ? 37.661  -13.888 4.434   1.00 74.12 ? 153 GLN C CG   1  
ATOM 7068   C CD   . GLN C 1 153 ? 37.164  -12.484 4.070   1.00 54.05 ? 153 GLN C CD   1  
ATOM 7069   O OE1  . GLN C 1 153 ? 37.912  -11.669 3.527   1.00 63.44 ? 153 GLN C OE1  1  
ATOM 7070   N NE2  . GLN C 1 153 ? 35.907  -12.186 4.382   1.00 25.35 ? 153 GLN C NE2  1  
ATOM 7071   H H    . GLN C 1 153 ? 40.234  -15.271 7.840   1.00 3.54  ? 153 GLN C H    1  
ATOM 7072   H HA   . GLN C 1 153 ? 38.068  -16.108 6.123   1.00 64.13 ? 153 GLN C HA   1  
ATOM 7073   H HB2  . GLN C 1 153 ? 37.478  -13.716 6.567   1.00 3.20  ? 153 GLN C HB2  1  
ATOM 7074   H HB3  . GLN C 1 153 ? 39.044  -13.214 5.942   1.00 33.25 ? 153 GLN C HB3  1  
ATOM 7075   H HG2  . GLN C 1 153 ? 38.423  -14.180 3.718   1.00 12.45 ? 153 GLN C HG2  1  
ATOM 7076   H HG3  . GLN C 1 153 ? 36.831  -14.583 4.367   1.00 30.34 ? 153 GLN C HG3  1  
ATOM 7077   H HE21 . GLN C 1 153 ? 35.365  -12.872 4.823   1.00 40.34 ? 153 GLN C HE21 1  
ATOM 7078   H HE22 . GLN C 1 153 ? 35.575  -11.293 4.155   1.00 51.20 ? 153 GLN C HE22 1  
ATOM 7079   N N    . ASP C 1 154 ? 39.793  -16.623 4.401   1.00 53.23 ? 154 ASP C N    1  
ATOM 7080   C CA   . ASP C 1 154 ? 40.808  -17.085 3.441   1.00 32.21 ? 154 ASP C CA   1  
ATOM 7081   C C    . ASP C 1 154 ? 40.163  -17.219 2.057   1.00 64.21 ? 154 ASP C C    1  
ATOM 7082   O O    . ASP C 1 154 ? 39.072  -17.785 1.931   1.00 34.20 ? 154 ASP C O    1  
ATOM 7083   C CB   . ASP C 1 154 ? 41.413  -18.430 3.922   1.00 53.10 ? 154 ASP C CB   1  
ATOM 7084   C CG   . ASP C 1 154 ? 42.424  -19.049 2.936   1.00 50.31 ? 154 ASP C CG   1  
ATOM 7085   O OD1  . ASP C 1 154 ? 43.524  -18.490 2.764   1.00 34.33 ? 154 ASP C OD1  1  
ATOM 7086   O OD2  . ASP C 1 154 ? 42.128  -20.101 2.335   1.00 73.32 ? 154 ASP C OD2  1  
ATOM 7087   H H    . ASP C 1 154 ? 38.893  -17.005 4.338   1.00 43.44 ? 154 ASP C H    1  
ATOM 7088   H HA   . ASP C 1 154 ? 41.602  -16.334 3.390   1.00 44.23 ? 154 ASP C HA   1  
ATOM 7089   H HB2  . ASP C 1 154 ? 41.922  -18.265 4.869   1.00 53.10 ? 154 ASP C HB2  1  
ATOM 7090   H HB3  . ASP C 1 154 ? 40.608  -19.136 4.095   1.00 22.12 ? 154 ASP C HB3  1  
ATOM 7091   N N    . ALA C 1 155 ? 40.848  -16.689 1.034   1.00 52.23 ? 155 ALA C N    1  
ATOM 7092   C CA   . ALA C 1 155 ? 40.348  -16.664 -0.349  1.00 1.44  ? 155 ALA C CA   1  
ATOM 7093   C C    . ALA C 1 155 ? 41.553  -16.667 -1.317  1.00 21.43 ? 155 ALA C C    1  
ATOM 7094   O O    . ALA C 1 155 ? 42.106  -15.585 -1.607  1.00 72.03 ? 155 ALA C O    1  
ATOM 7095   C CB   . ALA C 1 155 ? 39.423  -15.441 -0.569  1.00 32.11 ? 155 ALA C CB   1  
ATOM 7096   O OXT  . ALA C 1 155 ? 41.975  -17.756 -1.751  1.00 37.65 ? 155 ALA C OXT  1  
ATOM 7097   H H    . ALA C 1 155 ? 41.736  -16.314 1.216   1.00 20.53 ? 155 ALA C H    1  
ATOM 7098   H HA   . ALA C 1 155 ? 39.758  -17.568 -0.514  1.00 51.31 ? 155 ALA C HA   1  
ATOM 7099   H HB1  . ALA C 1 155 ? 38.585  -15.490 0.115   1.00 14.53 ? 155 ALA C HB1  1  
ATOM 7100   H HB2  . ALA C 1 155 ? 39.054  -15.441 -1.585  1.00 23.53 ? 155 ALA C HB2  1  
ATOM 7101   H HB3  . ALA C 1 155 ? 39.976  -14.526 -0.390  1.00 44.41 ? 155 ALA C HB3  1  
ATOM 7102   N N    . MET D 1 1   ? -17.446 37.118  -1.326  1.00 12.42 ? 1   MET D N    1  
ATOM 7103   C CA   . MET D 1 1   ? -18.244 35.913  -1.644  1.00 41.14 ? 1   MET D CA   1  
ATOM 7104   C C    . MET D 1 1   ? -18.200 35.645  -3.159  1.00 63.34 ? 1   MET D C    1  
ATOM 7105   O O    . MET D 1 1   ? -18.863 36.342  -3.934  1.00 5.44  ? 1   MET D O    1  
ATOM 7106   C CB   . MET D 1 1   ? -19.712 36.077  -1.148  1.00 55.54 ? 1   MET D CB   1  
ATOM 7107   C CG   . MET D 1 1   ? -19.868 36.153  0.385   1.00 51.33 ? 1   MET D CG   1  
ATOM 7108   S SD   . MET D 1 1   ? -19.054 37.591  1.126   1.00 65.44 ? 1   MET D SD   1  
ATOM 7109   C CE   . MET D 1 1   ? -19.973 38.952  0.404   1.00 71.23 ? 1   MET D CE   1  
ATOM 7110   H H1   . MET D 1 1   ? -17.853 37.950  -1.795  1.00 37.65 ? 1   MET D H1   1  
ATOM 7111   H H2   . MET D 1 1   ? -16.468 36.997  -1.656  1.00 37.65 ? 1   MET D H2   1  
ATOM 7112   H H3   . MET D 1 1   ? -17.435 37.282  -0.300  1.00 37.65 ? 1   MET D H3   1  
ATOM 7113   H HA   . MET D 1 1   ? -17.791 35.074  -1.124  1.00 34.50 ? 1   MET D HA   1  
ATOM 7114   H HB2  . MET D 1 1   ? -20.128 36.984  -1.575  1.00 65.20 ? 1   MET D HB2  1  
ATOM 7115   H HB3  . MET D 1 1   ? -20.298 35.232  -1.503  1.00 21.05 ? 1   MET D HB3  1  
ATOM 7116   H HG2  . MET D 1 1   ? -20.922 36.195  0.626   1.00 13.14 ? 1   MET D HG2  1  
ATOM 7117   H HG3  . MET D 1 1   ? -19.443 35.257  0.822   1.00 14.02 ? 1   MET D HG3  1  
ATOM 7118   H HE1  . MET D 1 1   ? -19.572 39.888  0.767   1.00 1.32  ? 1   MET D HE1  1  
ATOM 7119   H HE2  . MET D 1 1   ? -21.014 38.874  0.683   1.00 14.43 ? 1   MET D HE2  1  
ATOM 7120   H HE3  . MET D 1 1   ? -19.884 38.917  -0.670  1.00 23.20 ? 1   MET D HE3  1  
ATOM 7121   N N    . SER D 1 2   ? -17.390 34.647  -3.576  1.00 71.20 ? 2   SER D N    1  
ATOM 7122   C CA   . SER D 1 2   ? -17.251 34.242  -4.989  1.00 12.44 ? 2   SER D CA   1  
ATOM 7123   C C    . SER D 1 2   ? -18.377 33.253  -5.359  1.00 71.42 ? 2   SER D C    1  
ATOM 7124   O O    . SER D 1 2   ? -18.153 32.050  -5.556  1.00 53.24 ? 2   SER D O    1  
ATOM 7125   C CB   . SER D 1 2   ? -15.849 33.631  -5.226  1.00 21.23 ? 2   SER D CB   1  
ATOM 7126   O OG   . SER D 1 2   ? -14.821 34.541  -4.860  1.00 4.40  ? 2   SER D OG   1  
ATOM 7127   H H    . SER D 1 2   ? -16.876 34.161  -2.908  1.00 42.44 ? 2   SER D H    1  
ATOM 7128   H HA   . SER D 1 2   ? -17.349 35.132  -5.610  1.00 11.11 ? 2   SER D HA   1  
ATOM 7129   H HB2  . SER D 1 2   ? -15.738 32.735  -4.630  1.00 42.44 ? 2   SER D HB2  1  
ATOM 7130   H HB3  . SER D 1 2   ? -15.733 33.379  -6.274  1.00 33.14 ? 2   SER D HB3  1  
ATOM 7131   H HG   . SER D 1 2   ? -15.142 35.127  -4.166  1.00 75.10 ? 2   SER D HG   1  
ATOM 7132   N N    . GLU D 1 3   ? -19.600 33.798  -5.400  1.00 71.33 ? 3   GLU D N    1  
ATOM 7133   C CA   . GLU D 1 3   ? -20.848 33.030  -5.581  1.00 25.32 ? 3   GLU D CA   1  
ATOM 7134   C C    . GLU D 1 3   ? -21.327 33.096  -7.048  1.00 65.35 ? 3   GLU D C    1  
ATOM 7135   O O    . GLU D 1 3   ? -21.192 34.144  -7.701  1.00 22.12 ? 3   GLU D O    1  
ATOM 7136   C CB   . GLU D 1 3   ? -21.932 33.604  -4.621  1.00 3.24  ? 3   GLU D CB   1  
ATOM 7137   C CG   . GLU D 1 3   ? -22.186 35.126  -4.785  1.00 15.24 ? 3   GLU D CG   1  
ATOM 7138   C CD   . GLU D 1 3   ? -23.274 35.682  -3.857  1.00 62.14 ? 3   GLU D CD   1  
ATOM 7139   O OE1  . GLU D 1 3   ? -24.473 35.476  -4.145  1.00 20.24 ? 3   GLU D OE1  1  
ATOM 7140   O OE2  . GLU D 1 3   ? -22.941 36.321  -2.836  1.00 71.45 ? 3   GLU D OE2  1  
ATOM 7141   H H    . GLU D 1 3   ? -19.671 34.775  -5.307  1.00 41.43 ? 3   GLU D H    1  
ATOM 7142   H HA   . GLU D 1 3   ? -20.658 31.990  -5.311  1.00 23.02 ? 3   GLU D HA   1  
ATOM 7143   H HB2  . GLU D 1 3   ? -22.869 33.078  -4.788  1.00 45.31 ? 3   GLU D HB2  1  
ATOM 7144   H HB3  . GLU D 1 3   ? -21.616 33.422  -3.601  1.00 1.25  ? 3   GLU D HB3  1  
ATOM 7145   H HG2  . GLU D 1 3   ? -21.254 35.651  -4.589  1.00 24.04 ? 3   GLU D HG2  1  
ATOM 7146   H HG3  . GLU D 1 3   ? -22.474 35.318  -5.815  1.00 33.20 ? 3   GLU D HG3  1  
ATOM 7147   N N    . GLN D 1 4   ? -21.879 31.961  -7.531  1.00 5.24  ? 4   GLN D N    1  
ATOM 7148   C CA   . GLN D 1 4   ? -22.519 31.821  -8.855  1.00 34.41 ? 4   GLN D CA   1  
ATOM 7149   C C    . GLN D 1 4   ? -21.588 32.301  -9.999  1.00 35.22 ? 4   GLN D C    1  
ATOM 7150   O O    . GLN D 1 4   ? -21.770 33.392  -10.569 1.00 0.10  ? 4   GLN D O    1  
ATOM 7151   C CB   . GLN D 1 4   ? -23.899 32.542  -8.848  1.00 40.13 ? 4   GLN D CB   1  
ATOM 7152   C CG   . GLN D 1 4   ? -24.775 32.333  -10.099 1.00 63.32 ? 4   GLN D CG   1  
ATOM 7153   C CD   . GLN D 1 4   ? -26.111 33.075  -9.992  1.00 34.22 ? 4   GLN D CD   1  
ATOM 7154   O OE1  . GLN D 1 4   ? -27.116 32.522  -9.545  1.00 4.02  ? 4   GLN D OE1  1  
ATOM 7155   N NE2  . GLN D 1 4   ? -26.115 34.349  -10.344 1.00 75.34 ? 4   GLN D NE2  1  
ATOM 7156   H H    . GLN D 1 4   ? -21.846 31.164  -6.962  1.00 12.45 ? 4   GLN D H    1  
ATOM 7157   H HA   . GLN D 1 4   ? -22.695 30.758  -8.998  1.00 54.23 ? 4   GLN D HA   1  
ATOM 7158   H HB2  . GLN D 1 4   ? -24.460 32.199  -7.984  1.00 15.24 ? 4   GLN D HB2  1  
ATOM 7159   H HB3  . GLN D 1 4   ? -23.721 33.609  -8.733  1.00 40.34 ? 4   GLN D HB3  1  
ATOM 7160   H HG2  . GLN D 1 4   ? -24.240 32.697  -10.971 1.00 61.44 ? 4   GLN D HG2  1  
ATOM 7161   H HG3  . GLN D 1 4   ? -24.972 31.275  -10.219 1.00 10.24 ? 4   GLN D HG3  1  
ATOM 7162   H HE21 . GLN D 1 4   ? -25.274 34.747  -10.652 1.00 15.12 ? 4   GLN D HE21 1  
ATOM 7163   H HE22 . GLN D 1 4   ? -26.955 34.846  -10.275 1.00 72.22 ? 4   GLN D HE22 1  
ATOM 7164   N N    . ASN D 1 5   ? -20.538 31.505  -10.254 1.00 13.40 ? 5   ASN D N    1  
ATOM 7165   C CA   . ASN D 1 5   ? -19.581 31.744  -11.347 1.00 75.52 ? 5   ASN D CA   1  
ATOM 7166   C C    . ASN D 1 5   ? -20.272 31.487  -12.700 1.00 33.12 ? 5   ASN D C    1  
ATOM 7167   O O    . ASN D 1 5   ? -20.592 30.341  -13.044 1.00 1.14  ? 5   ASN D O    1  
ATOM 7168   C CB   . ASN D 1 5   ? -18.324 30.846  -11.170 1.00 53.34 ? 5   ASN D CB   1  
ATOM 7169   C CG   . ASN D 1 5   ? -17.341 30.932  -12.342 1.00 73.13 ? 5   ASN D CG   1  
ATOM 7170   O OD1  . ASN D 1 5   ? -17.431 30.167  -13.304 1.00 21.24 ? 5   ASN D OD1  1  
ATOM 7171   N ND2  . ASN D 1 5   ? -16.415 31.872  -12.286 1.00 72.03 ? 5   ASN D ND2  1  
ATOM 7172   H H    . ASN D 1 5   ? -20.400 30.727  -9.673  1.00 60.34 ? 5   ASN D H    1  
ATOM 7173   H HA   . ASN D 1 5   ? -19.273 32.789  -11.294 1.00 52.02 ? 5   ASN D HA   1  
ATOM 7174   H HB2  . ASN D 1 5   ? -17.802 31.143  -10.266 1.00 22.11 ? 5   ASN D HB2  1  
ATOM 7175   H HB3  . ASN D 1 5   ? -18.636 29.817  -11.060 1.00 51.12 ? 5   ASN D HB3  1  
ATOM 7176   H HD21 . ASN D 1 5   ? -16.406 32.465  -11.506 1.00 14.20 ? 5   ASN D HD21 1  
ATOM 7177   H HD22 . ASN D 1 5   ? -15.772 31.932  -13.020 1.00 5.54  ? 5   ASN D HD22 1  
ATOM 7178   N N    . ASN D 1 6   ? -20.524 32.571  -13.445 1.00 24.55 ? 6   ASN D N    1  
ATOM 7179   C CA   . ASN D 1 6   ? -21.248 32.526  -14.722 1.00 40.21 ? 6   ASN D CA   1  
ATOM 7180   C C    . ASN D 1 6   ? -20.284 32.869  -15.877 1.00 42.23 ? 6   ASN D C    1  
ATOM 7181   O O    . ASN D 1 6   ? -20.204 34.020  -16.325 1.00 24.41 ? 6   ASN D O    1  
ATOM 7182   C CB   . ASN D 1 6   ? -22.452 33.500  -14.666 1.00 63.42 ? 6   ASN D CB   1  
ATOM 7183   C CG   . ASN D 1 6   ? -23.387 33.370  -15.867 1.00 1.24  ? 6   ASN D CG   1  
ATOM 7184   O OD1  . ASN D 1 6   ? -23.194 34.019  -16.895 1.00 62.23 ? 6   ASN D OD1  1  
ATOM 7185   N ND2  . ASN D 1 6   ? -24.405 32.532  -15.748 1.00 61.51 ? 6   ASN D ND2  1  
ATOM 7186   H H    . ASN D 1 6   ? -20.210 33.442  -13.119 1.00 1.45  ? 6   ASN D H    1  
ATOM 7187   H HA   . ASN D 1 6   ? -21.626 31.514  -14.876 1.00 33.14 ? 6   ASN D HA   1  
ATOM 7188   H HB2  . ASN D 1 6   ? -23.023 33.306  -13.762 1.00 54.00 ? 6   ASN D HB2  1  
ATOM 7189   H HB3  . ASN D 1 6   ? -22.086 34.517  -14.625 1.00 70.34 ? 6   ASN D HB3  1  
ATOM 7190   H HD21 . ASN D 1 6   ? -24.509 32.041  -14.904 1.00 63.25 ? 6   ASN D HD21 1  
ATOM 7191   H HD22 . ASN D 1 6   ? -25.010 32.436  -16.508 1.00 62.35 ? 6   ASN D HD22 1  
ATOM 7192   N N    . THR D 1 7   ? -19.484 31.867  -16.267 1.00 23.31 ? 7   THR D N    1  
ATOM 7193   C CA   . THR D 1 7   ? -18.546 31.949  -17.395 1.00 14.31 ? 7   THR D CA   1  
ATOM 7194   C C    . THR D 1 7   ? -18.294 30.510  -17.892 1.00 72.13 ? 7   THR D C    1  
ATOM 7195   O O    . THR D 1 7   ? -17.190 29.953  -17.762 1.00 52.21 ? 7   THR D O    1  
ATOM 7196   C CB   . THR D 1 7   ? -17.222 32.720  -16.999 1.00 74.44 ? 7   THR D CB   1  
ATOM 7197   O OG1  . THR D 1 7   ? -16.276 32.697  -18.075 1.00 23.32 ? 7   THR D OG1  1  
ATOM 7198   C CG2  . THR D 1 7   ? -16.556 32.178  -15.720 1.00 54.34 ? 7   THR D CG2  1  
ATOM 7199   H H    . THR D 1 7   ? -19.515 31.028  -15.759 1.00 13.20 ? 7   THR D H    1  
ATOM 7200   H HA   . THR D 1 7   ? -19.033 32.501  -18.199 1.00 14.01 ? 7   THR D HA   1  
ATOM 7201   H HB   . THR D 1 7   ? -17.490 33.757  -16.820 1.00 54.54 ? 7   THR D HB   1  
ATOM 7202   H HG1  . THR D 1 7   ? -15.873 31.823  -18.121 1.00 23.52 ? 7   THR D HG1  1  
ATOM 7203   H HG21 . THR D 1 7   ? -17.254 32.227  -14.890 1.00 42.24 ? 7   THR D HG21 1  
ATOM 7204   H HG22 . THR D 1 7   ? -15.683 32.773  -15.481 1.00 12.24 ? 7   THR D HG22 1  
ATOM 7205   H HG23 . THR D 1 7   ? -16.254 31.151  -15.872 1.00 43.30 ? 7   THR D HG23 1  
ATOM 7206   N N    . GLU D 1 8   ? -19.386 29.916  -18.441 1.00 50.11 ? 8   GLU D N    1  
ATOM 7207   C CA   . GLU D 1 8   ? -19.510 28.472  -18.772 1.00 73.04 ? 8   GLU D CA   1  
ATOM 7208   C C    . GLU D 1 8   ? -19.515 27.608  -17.482 1.00 44.45 ? 8   GLU D C    1  
ATOM 7209   O O    . GLU D 1 8   ? -18.949 28.009  -16.454 1.00 61.31 ? 8   GLU D O    1  
ATOM 7210   C CB   . GLU D 1 8   ? -18.418 27.962  -19.775 1.00 34.20 ? 8   GLU D CB   1  
ATOM 7211   C CG   . GLU D 1 8   ? -18.504 28.532  -21.218 1.00 60.32 ? 8   GLU D CG   1  
ATOM 7212   C CD   . GLU D 1 8   ? -18.193 30.041  -21.332 1.00 15.21 ? 8   GLU D CD   1  
ATOM 7213   O OE1  . GLU D 1 8   ? -16.999 30.409  -21.304 1.00 21.20 ? 8   GLU D OE1  1  
ATOM 7214   O OE2  . GLU D 1 8   ? -19.133 30.858  -21.443 1.00 71.42 ? 8   GLU D OE2  1  
ATOM 7215   H H    . GLU D 1 8   ? -20.159 30.487  -18.633 1.00 3.32  ? 8   GLU D H    1  
ATOM 7216   H HA   . GLU D 1 8   ? -20.482 28.358  -19.242 1.00 41.34 ? 8   GLU D HA   1  
ATOM 7217   H HB2  . GLU D 1 8   ? -17.439 28.207  -19.377 1.00 45.42 ? 8   GLU D HB2  1  
ATOM 7218   H HB3  . GLU D 1 8   ? -18.494 26.880  -19.844 1.00 44.51 ? 8   GLU D HB3  1  
ATOM 7219   H HG2  . GLU D 1 8   ? -17.798 27.992  -21.843 1.00 42.51 ? 8   GLU D HG2  1  
ATOM 7220   H HG3  . GLU D 1 8   ? -19.504 28.346  -21.593 1.00 33.11 ? 8   GLU D HG3  1  
ATOM 7221   N N    . MET D 1 9   ? -20.261 26.480  -17.532 1.00 52.24 ? 9   MET D N    1  
ATOM 7222   C CA   . MET D 1 9   ? -20.264 25.414  -16.491 1.00 25.24 ? 9   MET D CA   1  
ATOM 7223   C C    . MET D 1 9   ? -18.877 25.218  -15.835 1.00 65.23 ? 9   MET D C    1  
ATOM 7224   O O    . MET D 1 9   ? -17.878 24.999  -16.540 1.00 4.33  ? 9   MET D O    1  
ATOM 7225   C CB   . MET D 1 9   ? -20.746 24.056  -17.081 1.00 22.45 ? 9   MET D CB   1  
ATOM 7226   C CG   . MET D 1 9   ? -21.007 22.948  -16.024 1.00 31.31 ? 9   MET D CG   1  
ATOM 7227   S SD   . MET D 1 9   ? -20.449 21.309  -16.555 1.00 44.53 ? 9   MET D SD   1  
ATOM 7228   C CE   . MET D 1 9   ? -18.659 21.476  -16.426 1.00 1.44  ? 9   MET D CE   1  
ATOM 7229   H H    . MET D 1 9   ? -20.834 26.352  -18.310 1.00 65.31 ? 9   MET D H    1  
ATOM 7230   H HA   . MET D 1 9   ? -20.971 25.729  -15.732 1.00 0.24  ? 9   MET D HA   1  
ATOM 7231   H HB2  . MET D 1 9   ? -21.666 24.226  -17.631 1.00 31.23 ? 9   MET D HB2  1  
ATOM 7232   H HB3  . MET D 1 9   ? -19.999 23.692  -17.780 1.00 43.03 ? 9   MET D HB3  1  
ATOM 7233   H HG2  . MET D 1 9   ? -20.491 23.195  -15.104 1.00 44.43 ? 9   MET D HG2  1  
ATOM 7234   H HG3  . MET D 1 9   ? -22.071 22.895  -15.822 1.00 74.44 ? 9   MET D HG3  1  
ATOM 7235   H HE1  . MET D 1 9   ? -18.193 20.543  -16.700 1.00 14.50 ? 9   MET D HE1  1  
ATOM 7236   H HE2  . MET D 1 9   ? -18.389 21.728  -15.410 1.00 53.22 ? 9   MET D HE2  1  
ATOM 7237   H HE3  . MET D 1 9   ? -18.319 22.255  -17.092 1.00 14.12 ? 9   MET D HE3  1  
ATOM 7238   N N    . THR D 1 10  ? -18.822 25.302  -14.505 1.00 12.14 ? 10  THR D N    1  
ATOM 7239   C CA   . THR D 1 10  ? -17.596 25.064  -13.740 1.00 11.11 ? 10  THR D CA   1  
ATOM 7240   C C    . THR D 1 10  ? -17.760 23.819  -12.859 1.00 3.21  ? 10  THR D C    1  
ATOM 7241   O O    . THR D 1 10  ? -18.821 23.599  -12.258 1.00 62.13 ? 10  THR D O    1  
ATOM 7242   C CB   . THR D 1 10  ? -17.215 26.306  -12.869 1.00 44.42 ? 10  THR D CB   1  
ATOM 7243   O OG1  . THR D 1 10  ? -17.056 27.452  -13.722 1.00 33.33 ? 10  THR D OG1  1  
ATOM 7244   C CG2  . THR D 1 10  ? -15.915 26.081  -12.071 1.00 35.13 ? 10  THR D CG2  1  
ATOM 7245   H H    . THR D 1 10  ? -19.630 25.534  -14.018 1.00 1.22  ? 10  THR D H    1  
ATOM 7246   H HA   . THR D 1 10  ? -16.781 24.888  -14.448 1.00 41.03 ? 10  THR D HA   1  
ATOM 7247   H HB   . THR D 1 10  ? -18.021 26.507  -12.169 1.00 64.01 ? 10  THR D HB   1  
ATOM 7248   H HG1  . THR D 1 10  ? -17.876 27.956  -13.749 1.00 11.13 ? 10  THR D HG1  1  
ATOM 7249   H HG21 . THR D 1 10  ? -16.040 25.245  -11.395 1.00 54.42 ? 10  THR D HG21 1  
ATOM 7250   H HG22 . THR D 1 10  ? -15.681 26.961  -11.504 1.00 72.44 ? 10  THR D HG22 1  
ATOM 7251   H HG23 . THR D 1 10  ? -15.097 25.870  -12.749 1.00 33.12 ? 10  THR D HG23 1  
ATOM 7252   N N    . PHE D 1 11  ? -16.684 23.034  -12.800 1.00 24.21 ? 11  PHE D N    1  
ATOM 7253   C CA   . PHE D 1 11  ? -16.580 21.829  -11.984 1.00 70.33 ? 11  PHE D CA   1  
ATOM 7254   C C    . PHE D 1 11  ? -15.093 21.480  -11.899 1.00 1.31  ? 11  PHE D C    1  
ATOM 7255   O O    . PHE D 1 11  ? -14.548 20.804  -12.778 1.00 23.24 ? 11  PHE D O    1  
ATOM 7256   C CB   . PHE D 1 11  ? -17.419 20.650  -12.562 1.00 61.34 ? 11  PHE D CB   1  
ATOM 7257   C CG   . PHE D 1 11  ? -17.543 19.465  -11.595 1.00 23.24 ? 11  PHE D CG   1  
ATOM 7258   C CD1  . PHE D 1 11  ? -16.601 18.432  -11.580 1.00 53.32 ? 11  PHE D CD1  1  
ATOM 7259   C CD2  . PHE D 1 11  ? -18.594 19.406  -10.679 1.00 74.05 ? 11  PHE D CD2  1  
ATOM 7260   C CE1  . PHE D 1 11  ? -16.710 17.389  -10.686 1.00 63.44 ? 11  PHE D CE1  1  
ATOM 7261   C CE2  . PHE D 1 11  ? -18.702 18.356  -9.790  1.00 73.21 ? 11  PHE D CE2  1  
ATOM 7262   C CZ   . PHE D 1 11  ? -17.761 17.349  -9.792  1.00 22.33 ? 11  PHE D CZ   1  
ATOM 7263   H H    . PHE D 1 11  ? -15.894 23.308  -13.315 1.00 12.35 ? 11  PHE D H    1  
ATOM 7264   H HA   . PHE D 1 11  ? -16.941 22.071  -10.984 1.00 61.40 ? 11  PHE D HA   1  
ATOM 7265   H HB2  . PHE D 1 11  ? -18.416 21.010  -12.790 1.00 64.03 ? 11  PHE D HB2  1  
ATOM 7266   H HB3  . PHE D 1 11  ? -16.963 20.297  -13.481 1.00 24.33 ? 11  PHE D HB3  1  
ATOM 7267   H HD1  . PHE D 1 11  ? -15.773 18.455  -12.280 1.00 55.10 ? 11  PHE D HD1  1  
ATOM 7268   H HD2  . PHE D 1 11  ? -19.336 20.195  -10.669 1.00 51.14 ? 11  PHE D HD2  1  
ATOM 7269   H HE1  . PHE D 1 11  ? -15.971 16.595  -10.688 1.00 22.31 ? 11  PHE D HE1  1  
ATOM 7270   H HE2  . PHE D 1 11  ? -19.527 18.322  -9.087  1.00 71.03 ? 11  PHE D HE2  1  
ATOM 7271   H HZ   . PHE D 1 11  ? -17.844 16.525  -9.090  1.00 55.12 ? 11  PHE D HZ   1  
ATOM 7272   N N    . GLN D 1 12  ? -14.430 22.001  -10.865 1.00 4.41  ? 12  GLN D N    1  
ATOM 7273   C CA   . GLN D 1 12  ? -12.988 21.811  -10.661 1.00 2.14  ? 12  GLN D CA   1  
ATOM 7274   C C    . GLN D 1 12  ? -12.800 20.953  -9.407  1.00 40.00 ? 12  GLN D C    1  
ATOM 7275   O O    . GLN D 1 12  ? -13.150 21.388  -8.305  1.00 2.24  ? 12  GLN D O    1  
ATOM 7276   C CB   . GLN D 1 12  ? -12.282 23.193  -10.497 1.00 25.20 ? 12  GLN D CB   1  
ATOM 7277   C CG   . GLN D 1 12  ? -12.437 24.146  -11.704 1.00 13.30 ? 12  GLN D CG   1  
ATOM 7278   C CD   . GLN D 1 12  ? -11.779 25.516  -11.476 1.00 13.14 ? 12  GLN D CD   1  
ATOM 7279   O OE1  . GLN D 1 12  ? -10.599 25.713  -11.771 1.00 42.54 ? 12  GLN D OE1  1  
ATOM 7280   N NE2  . GLN D 1 12  ? -12.537 26.470  -10.944 1.00 71.01 ? 12  GLN D NE2  1  
ATOM 7281   H H    . GLN D 1 12  ? -14.931 22.520  -10.204 1.00 1.14  ? 12  GLN D H    1  
ATOM 7282   H HA   . GLN D 1 12  ? -12.568 21.289  -11.525 1.00 11.42 ? 12  GLN D HA   1  
ATOM 7283   H HB2  . GLN D 1 12  ? -12.688 23.691  -9.622  1.00 2.22  ? 12  GLN D HB2  1  
ATOM 7284   H HB3  . GLN D 1 12  ? -11.221 23.027  -10.335 1.00 51.13 ? 12  GLN D HB3  1  
ATOM 7285   H HG2  . GLN D 1 12  ? -11.989 23.685  -12.577 1.00 32.52 ? 12  GLN D HG2  1  
ATOM 7286   H HG3  . GLN D 1 12  ? -13.495 24.295  -11.892 1.00 44.44 ? 12  GLN D HG3  1  
ATOM 7287   H HE21 . GLN D 1 12  ? -13.466 26.258  -10.724 1.00 74.25 ? 12  GLN D HE21 1  
ATOM 7288   H HE22 . GLN D 1 12  ? -12.132 27.350  -10.789 1.00 63.52 ? 12  GLN D HE22 1  
ATOM 7289   N N    . ILE D 1 13  ? -12.274 19.731  -9.579  1.00 4.34  ? 13  ILE D N    1  
ATOM 7290   C CA   . ILE D 1 13  ? -12.016 18.828  -8.455  1.00 64.44 ? 13  ILE D CA   1  
ATOM 7291   C C    . ILE D 1 13  ? -10.761 19.313  -7.712  1.00 32.13 ? 13  ILE D C    1  
ATOM 7292   O O    . ILE D 1 13  ? -9.638  19.173  -8.220  1.00 32.35 ? 13  ILE D O    1  
ATOM 7293   C CB   . ILE D 1 13  ? -11.811 17.335  -8.901  1.00 11.15 ? 13  ILE D CB   1  
ATOM 7294   C CG1  . ILE D 1 13  ? -12.951 16.850  -9.850  1.00 43.24 ? 13  ILE D CG1  1  
ATOM 7295   C CG2  . ILE D 1 13  ? -11.707 16.425  -7.661  1.00 2.25  ? 13  ILE D CG2  1  
ATOM 7296   C CD1  . ILE D 1 13  ? -12.827 15.392  -10.295 1.00 0.13  ? 13  ILE D CD1  1  
ATOM 7297   H H    . ILE D 1 13  ? -12.046 19.434  -10.486 1.00 53.43 ? 13  ILE D H    1  
ATOM 7298   H HA   . ILE D 1 13  ? -12.873 18.871  -7.781  1.00 43.34 ? 13  ILE D HA   1  
ATOM 7299   H HB   . ILE D 1 13  ? -10.865 17.273  -9.435  1.00 15.24 ? 13  ILE D HB   1  
ATOM 7300   H HG12 . ILE D 1 13  ? -13.905 16.957  -9.350  1.00 14.32 ? 13  ILE D HG12 1  
ATOM 7301   H HG13 . ILE D 1 13  ? -12.954 17.463  -10.741 1.00 20.41 ? 13  ILE D HG13 1  
ATOM 7302   H HG21 . ILE D 1 13  ? -12.632 16.448  -7.103  1.00 1.30  ? 13  ILE D HG21 1  
ATOM 7303   H HG22 . ILE D 1 13  ? -10.898 16.751  -7.015  1.00 70.12 ? 13  ILE D HG22 1  
ATOM 7304   H HG23 . ILE D 1 13  ? -11.509 15.407  -7.974  1.00 62.02 ? 13  ILE D HG23 1  
ATOM 7305   H HD11 . ILE D 1 13  ? -13.049 14.735  -9.465  1.00 51.34 ? 13  ILE D HD11 1  
ATOM 7306   H HD12 . ILE D 1 13  ? -11.820 15.192  -10.638 1.00 75.44 ? 13  ILE D HD12 1  
ATOM 7307   H HD13 . ILE D 1 13  ? -13.525 15.205  -11.097 1.00 70.13 ? 13  ILE D HD13 1  
ATOM 7308   N N    . GLN D 1 14  ? -10.967 19.914  -6.540  1.00 52.04 ? 14  GLN D N    1  
ATOM 7309   C CA   . GLN D 1 14  ? -9.880  20.493  -5.745  1.00 63.11 ? 14  GLN D CA   1  
ATOM 7310   C C    . GLN D 1 14  ? -9.079  19.414  -4.997  1.00 14.45 ? 14  GLN D C    1  
ATOM 7311   O O    . GLN D 1 14  ? -7.843  19.519  -4.907  1.00 31.42 ? 14  GLN D O    1  
ATOM 7312   C CB   . GLN D 1 14  ? -10.445 21.550  -4.761  1.00 42.43 ? 14  GLN D CB   1  
ATOM 7313   C CG   . GLN D 1 14  ? -10.974 22.833  -5.438  1.00 1.34  ? 14  GLN D CG   1  
ATOM 7314   C CD   . GLN D 1 14  ? -11.364 23.920  -4.428  1.00 23.01 ? 14  GLN D CD   1  
ATOM 7315   O OE1  . GLN D 1 14  ? -10.530 24.722  -4.006  1.00 32.41 ? 14  GLN D OE1  1  
ATOM 7316   N NE2  . GLN D 1 14  ? -12.628 23.973  -4.052  1.00 2.23  ? 14  GLN D NE2  1  
ATOM 7317   H H    . GLN D 1 14  ? -11.881 19.971  -6.198  1.00 31.24 ? 14  GLN D H    1  
ATOM 7318   H HA   . GLN D 1 14  ? -9.202  20.997  -6.433  1.00 43.13 ? 14  GLN D HA   1  
ATOM 7319   H HB2  . GLN D 1 14  ? -11.258 21.102  -4.199  1.00 14.42 ? 14  GLN D HB2  1  
ATOM 7320   H HB3  . GLN D 1 14  ? -9.664  21.836  -4.063  1.00 43.31 ? 14  GLN D HB3  1  
ATOM 7321   H HG2  . GLN D 1 14  ? -10.209 23.229  -6.096  1.00 10.22 ? 14  GLN D HG2  1  
ATOM 7322   H HG3  . GLN D 1 14  ? -11.847 22.578  -6.034  1.00 14.12 ? 14  GLN D HG3  1  
ATOM 7323   H HE21 . GLN D 1 14  ? -13.254 23.321  -4.431  1.00 31.31 ? 14  GLN D HE21 1  
ATOM 7324   H HE22 . GLN D 1 14  ? -12.891 24.673  -3.423  1.00 2.41  ? 14  GLN D HE22 1  
ATOM 7325   N N    . ARG D 1 15  ? -9.765  18.365  -4.484  1.00 31.23 ? 15  ARG D N    1  
ATOM 7326   C CA   . ARG D 1 15  ? -9.114  17.388  -3.579  1.00 53.34 ? 15  ARG D CA   1  
ATOM 7327   C C    . ARG D 1 15  ? -9.971  16.114  -3.398  1.00 71.44 ? 15  ARG D C    1  
ATOM 7328   O O    . ARG D 1 15  ? -11.199 16.190  -3.381  1.00 1.41  ? 15  ARG D O    1  
ATOM 7329   C CB   . ARG D 1 15  ? -8.853  18.087  -2.202  1.00 43.13 ? 15  ARG D CB   1  
ATOM 7330   C CG   . ARG D 1 15  ? -7.760  17.448  -1.316  1.00 51.53 ? 15  ARG D CG   1  
ATOM 7331   C CD   . ARG D 1 15  ? -7.406  18.347  -0.112  1.00 4.42  ? 15  ARG D CD   1  
ATOM 7332   N NE   . ARG D 1 15  ? -6.242  17.853  0.640   1.00 22.41 ? 15  ARG D NE   1  
ATOM 7333   C CZ   . ARG D 1 15  ? -5.288  18.623  1.203   1.00 54.32 ? 15  ARG D CZ   1  
ATOM 7334   N NH1  . ARG D 1 15  ? -5.333  19.952  1.112   1.00 35.05 ? 15  ARG D NH1  1  
ATOM 7335   N NH2  . ARG D 1 15  ? -4.306  18.053  1.894   1.00 15.11 ? 15  ARG D NH2  1  
ATOM 7336   H H    . ARG D 1 15  ? -10.710 18.245  -4.720  1.00 40.42 ? 15  ARG D H    1  
ATOM 7337   H HA   . ARG D 1 15  ? -8.158  17.112  -4.020  1.00 65.44 ? 15  ARG D HA   1  
ATOM 7338   H HB2  . ARG D 1 15  ? -8.558  19.114  -2.394  1.00 45.43 ? 15  ARG D HB2  1  
ATOM 7339   H HB3  . ARG D 1 15  ? -9.781  18.110  -1.632  1.00 52.11 ? 15  ARG D HB3  1  
ATOM 7340   H HG2  . ARG D 1 15  ? -8.118  16.492  -0.948  1.00 74.30 ? 15  ARG D HG2  1  
ATOM 7341   H HG3  . ARG D 1 15  ? -6.867  17.285  -1.911  1.00 53.51 ? 15  ARG D HG3  1  
ATOM 7342   H HD2  . ARG D 1 15  ? -7.194  19.350  -0.470  1.00 32.14 ? 15  ARG D HD2  1  
ATOM 7343   H HD3  . ARG D 1 15  ? -8.257  18.384  0.559   1.00 4.14  ? 15  ARG D HD3  1  
ATOM 7344   H HE   . ARG D 1 15  ? -6.164  16.884  0.733   1.00 44.34 ? 15  ARG D HE   1  
ATOM 7345   H HH11 . ARG D 1 15  ? -6.082  20.401  0.621   1.00 15.32 ? 15  ARG D HH11 1  
ATOM 7346   H HH12 . ARG D 1 15  ? -4.614  20.511  1.537   1.00 13.15 ? 15  ARG D HH12 1  
ATOM 7347   H HH21 . ARG D 1 15  ? -4.273  17.052  1.996   1.00 4.33  ? 15  ARG D HH21 1  
ATOM 7348   H HH22 . ARG D 1 15  ? -3.592  18.616  2.316   1.00 24.01 ? 15  ARG D HH22 1  
ATOM 7349   N N    . ILE D 1 16  ? -9.300  14.943  -3.284  1.00 52.41 ? 16  ILE D N    1  
ATOM 7350   C CA   . ILE D 1 16  ? -9.909  13.664  -2.836  1.00 61.43 ? 16  ILE D CA   1  
ATOM 7351   C C    . ILE D 1 16  ? -9.116  13.227  -1.614  1.00 62.00 ? 16  ILE D C    1  
ATOM 7352   O O    . ILE D 1 16  ? -7.881  13.247  -1.651  1.00 22.51 ? 16  ILE D O    1  
ATOM 7353   C CB   . ILE D 1 16  ? -9.884  12.482  -3.923  1.00 62.14 ? 16  ILE D CB   1  
ATOM 7354   C CG1  . ILE D 1 16  ? -11.082 12.577  -4.924  1.00 2.00  ? 16  ILE D CG1  1  
ATOM 7355   C CG2  . ILE D 1 16  ? -9.880  11.077  -3.256  1.00 24.40 ? 16  ILE D CG2  1  
ATOM 7356   C CD1  . ILE D 1 16  ? -10.993 13.688  -5.928  1.00 3.50  ? 16  ILE D CD1  1  
ATOM 7357   H H    . ILE D 1 16  ? -8.329  14.940  -3.464  1.00 60.31 ? 16  ILE D H    1  
ATOM 7358   H HA   . ILE D 1 16  ? -10.943 13.851  -2.543  1.00 22.12 ? 16  ILE D HA   1  
ATOM 7359   H HB   . ILE D 1 16  ? -8.958  12.575  -4.485  1.00 53.13 ? 16  ILE D HB   1  
ATOM 7360   H HG12 . ILE D 1 16  ? -11.164 11.653  -5.483  1.00 4.25  ? 16  ILE D HG12 1  
ATOM 7361   H HG13 . ILE D 1 16  ? -11.995 12.724  -4.363  1.00 74.34 ? 16  ILE D HG13 1  
ATOM 7362   H HG21 . ILE D 1 16  ? -9.832  10.313  -4.010  1.00 75.33 ? 16  ILE D HG21 1  
ATOM 7363   H HG22 . ILE D 1 16  ? -10.783 10.944  -2.676  1.00 3.41  ? 16  ILE D HG22 1  
ATOM 7364   H HG23 . ILE D 1 16  ? -9.021  10.979  -2.603  1.00 42.35 ? 16  ILE D HG23 1  
ATOM 7365   H HD11 . ILE D 1 16  ? -10.821 14.627  -5.423  1.00 70.21 ? 16  ILE D HD11 1  
ATOM 7366   H HD12 . ILE D 1 16  ? -11.922 13.746  -6.473  1.00 12.21 ? 16  ILE D HD12 1  
ATOM 7367   H HD13 . ILE D 1 16  ? -10.190 13.501  -6.627  1.00 64.33 ? 16  ILE D HD13 1  
ATOM 7368   N N    . TYR D 1 17  ? -9.819  12.812  -0.556  1.00 24.30 ? 17  TYR D N    1  
ATOM 7369   C CA   . TYR D 1 17  ? -9.181  12.321  0.658   1.00 73.40 ? 17  TYR D CA   1  
ATOM 7370   C C    . TYR D 1 17  ? -10.148 11.507  1.506   1.00 41.31 ? 17  TYR D C    1  
ATOM 7371   O O    . TYR D 1 17  ? -11.372 11.574  1.347   1.00 55.44 ? 17  TYR D O    1  
ATOM 7372   C CB   . TYR D 1 17  ? -8.577  13.487  1.493   1.00 53.14 ? 17  TYR D CB   1  
ATOM 7373   C CG   . TYR D 1 17  ? -9.570  14.606  1.850   1.00 74.13 ? 17  TYR D CG   1  
ATOM 7374   C CD1  . TYR D 1 17  ? -9.871  15.613  0.933   1.00 45.13 ? 17  TYR D CD1  1  
ATOM 7375   C CD2  . TYR D 1 17  ? -10.178 14.674  3.100   1.00 22.20 ? 17  TYR D CD2  1  
ATOM 7376   C CE1  . TYR D 1 17  ? -10.729 16.638  1.249   1.00 60.14 ? 17  TYR D CE1  1  
ATOM 7377   C CE2  . TYR D 1 17  ? -11.047 15.701  3.412   1.00 23.02 ? 17  TYR D CE2  1  
ATOM 7378   C CZ   . TYR D 1 17  ? -11.315 16.678  2.489   1.00 2.23  ? 17  TYR D CZ   1  
ATOM 7379   O OH   . TYR D 1 17  ? -12.145 17.715  2.826   1.00 61.43 ? 17  TYR D OH   1  
ATOM 7380   H H    . TYR D 1 17  ? -10.797 12.828  -0.598  1.00 73.22 ? 17  TYR D H    1  
ATOM 7381   H HA   . TYR D 1 17  ? -8.374  11.655  0.349   1.00 33.50 ? 17  TYR D HA   1  
ATOM 7382   H HB2  . TYR D 1 17  ? -8.164  13.089  2.417   1.00 45.21 ? 17  TYR D HB2  1  
ATOM 7383   H HB3  . TYR D 1 17  ? -7.765  13.929  0.929   1.00 61.30 ? 17  TYR D HB3  1  
ATOM 7384   H HD1  . TYR D 1 17  ? -9.411  15.586  -0.049  1.00 62.24 ? 17  TYR D HD1  1  
ATOM 7385   H HD2  . TYR D 1 17  ? -9.969  13.903  3.836   1.00 11.53 ? 17  TYR D HD2  1  
ATOM 7386   H HE1  . TYR D 1 17  ? -10.944 17.408  0.517   1.00 72.10 ? 17  TYR D HE1  1  
ATOM 7387   H HE2  . TYR D 1 17  ? -11.509 15.732  4.388   1.00 54.11 ? 17  TYR D HE2  1  
ATOM 7388   H HH   . TYR D 1 17  ? -12.967 17.649  2.330   1.00 23.33 ? 17  TYR D HH   1  
ATOM 7389   N N    . THR D 1 18  ? -9.563  10.749  2.424   1.00 20.42 ? 18  THR D N    1  
ATOM 7390   C CA   . THR D 1 18  ? -10.305 9.982   3.419   1.00 21.34 ? 18  THR D CA   1  
ATOM 7391   C C    . THR D 1 18  ? -10.404 10.804  4.707   1.00 55.45 ? 18  THR D C    1  
ATOM 7392   O O    . THR D 1 18  ? -9.386  11.201  5.278   1.00 24.24 ? 18  THR D O    1  
ATOM 7393   C CB   . THR D 1 18  ? -9.620  8.606   3.692   1.00 22.55 ? 18  THR D CB   1  
ATOM 7394   O OG1  . THR D 1 18  ? -8.259  8.785   4.128   1.00 42.21 ? 18  THR D OG1  1  
ATOM 7395   C CG2  . THR D 1 18  ? -9.636  7.715   2.435   1.00 31.23 ? 18  THR D CG2  1  
ATOM 7396   H H    . THR D 1 18  ? -8.579  10.711  2.434   1.00 31.42 ? 18  THR D H    1  
ATOM 7397   H HA   . THR D 1 18  ? -11.311 9.792   3.034   1.00 40.51 ? 18  THR D HA   1  
ATOM 7398   H HB   . THR D 1 18  ? -10.167 8.095   4.479   1.00 13.41 ? 18  THR D HB   1  
ATOM 7399   H HG1  . THR D 1 18  ? -8.193  9.574   4.672   1.00 41.31 ? 18  THR D HG1  1  
ATOM 7400   H HG21 . THR D 1 18  ? -10.655 7.554   2.114   1.00 51.32 ? 18  THR D HG21 1  
ATOM 7401   H HG22 . THR D 1 18  ? -9.180  6.758   2.658   1.00 22.01 ? 18  THR D HG22 1  
ATOM 7402   H HG23 . THR D 1 18  ? -9.083  8.194   1.637   1.00 31.13 ? 18  THR D HG23 1  
ATOM 7403   N N    . LYS D 1 19  ? -11.634 11.103  5.122   1.00 51.14 ? 19  LYS D N    1  
ATOM 7404   C CA   . LYS D 1 19  ? -11.904 11.828  6.375   1.00 51.55 ? 19  LYS D CA   1  
ATOM 7405   C C    . LYS D 1 19  ? -12.037 10.828  7.528   1.00 4.24  ? 19  LYS D C    1  
ATOM 7406   O O    . LYS D 1 19  ? -11.872 11.177  8.698   1.00 3.01  ? 19  LYS D O    1  
ATOM 7407   C CB   . LYS D 1 19  ? -13.201 12.666  6.243   1.00 31.21 ? 19  LYS D CB   1  
ATOM 7408   C CG   . LYS D 1 19  ? -13.313 13.431  4.912   1.00 70.11 ? 19  LYS D CG   1  
ATOM 7409   C CD   . LYS D 1 19  ? -14.490 14.422  4.876   1.00 45.32 ? 19  LYS D CD   1  
ATOM 7410   C CE   . LYS D 1 19  ? -14.366 15.530  5.931   1.00 11.03 ? 19  LYS D CE   1  
ATOM 7411   N NZ   . LYS D 1 19  ? -15.443 16.541  5.791   1.00 44.44 ? 19  LYS D NZ   1  
ATOM 7412   H H    . LYS D 1 19  ? -12.390 10.817  4.574   1.00 24.01 ? 19  LYS D H    1  
ATOM 7413   H HA   . LYS D 1 19  ? -11.067 12.498  6.578   1.00 42.34 ? 19  LYS D HA   1  
ATOM 7414   H HB2  . LYS D 1 19  ? -14.065 12.010  6.334   1.00 64.44 ? 19  LYS D HB2  1  
ATOM 7415   H HB3  . LYS D 1 19  ? -13.224 13.387  7.054   1.00 12.21 ? 19  LYS D HB3  1  
ATOM 7416   H HG2  . LYS D 1 19  ? -12.391 13.980  4.748   1.00 73.13 ? 19  LYS D HG2  1  
ATOM 7417   H HG3  . LYS D 1 19  ? -13.436 12.709  4.110   1.00 64.23 ? 19  LYS D HG3  1  
ATOM 7418   H HD2  . LYS D 1 19  ? -14.526 14.882  3.895   1.00 44.53 ? 19  LYS D HD2  1  
ATOM 7419   H HD3  . LYS D 1 19  ? -15.414 13.877  5.043   1.00 21.10 ? 19  LYS D HD3  1  
ATOM 7420   H HE2  . LYS D 1 19  ? -14.427 15.091  6.918   1.00 4.20  ? 19  LYS D HE2  1  
ATOM 7421   H HE3  . LYS D 1 19  ? -13.409 16.025  5.816   1.00 73.35 ? 19  LYS D HE3  1  
ATOM 7422   H HZ1  . LYS D 1 19  ? -16.327 16.188  6.202   1.00 3.33  ? 19  LYS D HZ1  1  
ATOM 7423   H HZ2  . LYS D 1 19  ? -15.608 16.742  4.789   1.00 53.41 ? 19  LYS D HZ2  1  
ATOM 7424   H HZ3  . LYS D 1 19  ? -15.176 17.425  6.253   1.00 33.10 ? 19  LYS D HZ3  1  
ATOM 7425   N N    . ASP D 1 20  ? -12.356 9.579   7.159   1.00 64.22 ? 20  ASP D N    1  
ATOM 7426   C CA   . ASP D 1 20  ? -12.562 8.475   8.095   1.00 62.22 ? 20  ASP D CA   1  
ATOM 7427   C C    . ASP D 1 20  ? -12.311 7.143   7.388   1.00 55.45 ? 20  ASP D C    1  
ATOM 7428   O O    . ASP D 1 20  ? -12.691 6.963   6.224   1.00 31.14 ? 20  ASP D O    1  
ATOM 7429   C CB   . ASP D 1 20  ? -14.000 8.518   8.671   1.00 45.33 ? 20  ASP D CB   1  
ATOM 7430   C CG   . ASP D 1 20  ? -14.369 7.297   9.534   1.00 10.03 ? 20  ASP D CG   1  
ATOM 7431   O OD1  . ASP D 1 20  ? -15.249 6.504   9.124   1.00 2.22  ? 20  ASP D OD1  1  
ATOM 7432   O OD2  . ASP D 1 20  ? -13.773 7.130   10.618  1.00 14.11 ? 20  ASP D OD2  1  
ATOM 7433   H H    . ASP D 1 20  ? -12.462 9.393   6.204   1.00 2.32  ? 20  ASP D H    1  
ATOM 7434   H HA   . ASP D 1 20  ? -11.849 8.584   8.912   1.00 14.14 ? 20  ASP D HA   1  
ATOM 7435   H HB2  . ASP D 1 20  ? -14.104 9.408   9.280   1.00 25.44 ? 20  ASP D HB2  1  
ATOM 7436   H HB3  . ASP D 1 20  ? -14.704 8.590   7.847   1.00 63.31 ? 20  ASP D HB3  1  
ATOM 7437   N N    . ILE D 1 21  ? -11.650 6.232   8.111   1.00 1.32  ? 21  ILE D N    1  
ATOM 7438   C CA   . ILE D 1 21  ? -11.400 4.852   7.694   1.00 11.05 ? 21  ILE D CA   1  
ATOM 7439   C C    . ILE D 1 21  ? -11.497 3.963   8.948   1.00 33.34 ? 21  ILE D C    1  
ATOM 7440   O O    . ILE D 1 21  ? -10.968 4.323   10.010  1.00 61.33 ? 21  ILE D O    1  
ATOM 7441   C CB   . ILE D 1 21  ? -9.976  4.636   7.034   1.00 5.11  ? 21  ILE D CB   1  
ATOM 7442   C CG1  . ILE D 1 21  ? -9.733  5.571   5.813   1.00 45.41 ? 21  ILE D CG1  1  
ATOM 7443   C CG2  . ILE D 1 21  ? -9.810  3.165   6.615   1.00 72.43 ? 21  ILE D CG2  1  
ATOM 7444   C CD1  . ILE D 1 21  ? -8.323  5.492   5.256   1.00 74.42 ? 21  ILE D CD1  1  
ATOM 7445   H H    . ILE D 1 21  ? -11.334 6.499   8.998   1.00 14.21 ? 21  ILE D H    1  
ATOM 7446   H HA   . ILE D 1 21  ? -12.173 4.555   6.976   1.00 34.31 ? 21  ILE D HA   1  
ATOM 7447   H HB   . ILE D 1 21  ? -9.210  4.842   7.778   1.00 65.45 ? 21  ILE D HB   1  
ATOM 7448   H HG12 . ILE D 1 21  ? -10.419 5.315   5.015   1.00 35.15 ? 21  ILE D HG12 1  
ATOM 7449   H HG13 . ILE D 1 21  ? -9.909  6.596   6.110   1.00 41.03 ? 21  ILE D HG13 1  
ATOM 7450   H HG21 . ILE D 1 21  ? -10.592 2.894   5.919   1.00 25.41 ? 21  ILE D HG21 1  
ATOM 7451   H HG22 . ILE D 1 21  ? -9.877  2.525   7.479   1.00 34.01 ? 21  ILE D HG22 1  
ATOM 7452   H HG23 . ILE D 1 21  ? -8.849  3.020   6.144   1.00 34.53 ? 21  ILE D HG23 1  
ATOM 7453   H HD11 . ILE D 1 21  ? -8.255  6.049   4.350   1.00 3.14  ? 21  ILE D HD11 1  
ATOM 7454   H HD12 . ILE D 1 21  ? -8.067  4.466   5.051   1.00 64.15 ? 21  ILE D HD12 1  
ATOM 7455   H HD13 . ILE D 1 21  ? -7.628  5.898   5.977   1.00 31.44 ? 21  ILE D HD13 1  
ATOM 7456   N N    . SER D 1 22  ? -12.162 2.811   8.814   1.00 1.12  ? 22  SER D N    1  
ATOM 7457   C CA   . SER D 1 22  ? -12.258 1.800   9.870   1.00 24.23 ? 22  SER D CA   1  
ATOM 7458   C C    . SER D 1 22  ? -12.303 0.409   9.221   1.00 63.20 ? 22  SER D C    1  
ATOM 7459   O O    . SER D 1 22  ? -13.276 0.070   8.552   1.00 43.03 ? 22  SER D O    1  
ATOM 7460   C CB   . SER D 1 22  ? -13.519 2.046   10.741  1.00 10.21 ? 22  SER D CB   1  
ATOM 7461   O OG   . SER D 1 22  ? -13.666 1.065   11.757  1.00 31.11 ? 22  SER D OG   1  
ATOM 7462   H H    . SER D 1 22  ? -12.620 2.634   7.970   1.00 64.34 ? 22  SER D H    1  
ATOM 7463   H HA   . SER D 1 22  ? -11.371 1.867   10.497  1.00 73.41 ? 22  SER D HA   1  
ATOM 7464   H HB2  . SER D 1 22  ? -13.443 3.014   11.215  1.00 10.14 ? 22  SER D HB2  1  
ATOM 7465   H HB3  . SER D 1 22  ? -14.404 2.028   10.116  1.00 61.14 ? 22  SER D HB3  1  
ATOM 7466   H HG   . SER D 1 22  ? -13.301 1.402   12.583  1.00 11.24 ? 22  SER D HG   1  
ATOM 7467   N N    . PHE D 1 23  ? -11.217 -0.368  9.367   1.00 54.12 ? 23  PHE D N    1  
ATOM 7468   C CA   . PHE D 1 23  ? -11.194 -1.801  9.024   1.00 1.40  ? 23  PHE D CA   1  
ATOM 7469   C C    . PHE D 1 23  ? -10.997 -2.593  10.317  1.00 63.24 ? 23  PHE D C    1  
ATOM 7470   O O    . PHE D 1 23  ? -10.083 -2.301  11.087  1.00 33.21 ? 23  PHE D O    1  
ATOM 7471   C CB   . PHE D 1 23  ? -10.071 -2.139  7.998   1.00 12.42 ? 23  PHE D CB   1  
ATOM 7472   C CG   . PHE D 1 23  ? -9.972  -3.634  7.640   1.00 34.14 ? 23  PHE D CG   1  
ATOM 7473   C CD1  . PHE D 1 23  ? -10.803 -4.190  6.664   1.00 12.22 ? 23  PHE D CD1  1  
ATOM 7474   C CD2  . PHE D 1 23  ? -9.062  -4.483  8.290   1.00 23.31 ? 23  PHE D CD2  1  
ATOM 7475   C CE1  . PHE D 1 23  ? -10.729 -5.536  6.352   1.00 73.34 ? 23  PHE D CE1  1  
ATOM 7476   C CE2  . PHE D 1 23  ? -8.992  -5.826  7.976   1.00 20.35 ? 23  PHE D CE2  1  
ATOM 7477   C CZ   . PHE D 1 23  ? -9.826  -6.353  7.008   1.00 73.41 ? 23  PHE D CZ   1  
ATOM 7478   H H    . PHE D 1 23  ? -10.402 0.031   9.733   1.00 43.10 ? 23  PHE D H    1  
ATOM 7479   H HA   . PHE D 1 23  ? -12.161 -2.066  8.589   1.00 44.04 ? 23  PHE D HA   1  
ATOM 7480   H HB2  . PHE D 1 23  ? -10.258 -1.589  7.084   1.00 74.11 ? 23  PHE D HB2  1  
ATOM 7481   H HB3  . PHE D 1 23  ? -9.112  -1.825  8.395   1.00 43.01 ? 23  PHE D HB3  1  
ATOM 7482   H HD1  . PHE D 1 23  ? -11.517 -3.557  6.146   1.00 3.12  ? 23  PHE D HD1  1  
ATOM 7483   H HD2  . PHE D 1 23  ? -8.408  -4.075  9.052   1.00 64.33 ? 23  PHE D HD2  1  
ATOM 7484   H HE1  . PHE D 1 23  ? -11.381 -5.953  5.592   1.00 14.05 ? 23  PHE D HE1  1  
ATOM 7485   H HE2  . PHE D 1 23  ? -8.286  -6.470  8.490   1.00 3.53  ? 23  PHE D HE2  1  
ATOM 7486   H HZ   . PHE D 1 23  ? -9.768  -7.409  6.762   1.00 20.32 ? 23  PHE D HZ   1  
ATOM 7487   N N    . GLU D 1 24  ? -11.865 -3.575  10.555  1.00 21.53 ? 24  GLU D N    1  
ATOM 7488   C CA   . GLU D 1 24  ? -11.749 -4.503  11.687  1.00 73.43 ? 24  GLU D CA   1  
ATOM 7489   C C    . GLU D 1 24  ? -11.857 -5.938  11.177  1.00 22.33 ? 24  GLU D C    1  
ATOM 7490   O O    . GLU D 1 24  ? -12.801 -6.280  10.481  1.00 34.11 ? 24  GLU D O    1  
ATOM 7491   C CB   . GLU D 1 24  ? -12.871 -4.248  12.724  1.00 4.33  ? 24  GLU D CB   1  
ATOM 7492   C CG   . GLU D 1 24  ? -12.827 -2.866  13.396  1.00 74.15 ? 24  GLU D CG   1  
ATOM 7493   C CD   . GLU D 1 24  ? -14.019 -2.640  14.335  1.00 75.11 ? 24  GLU D CD   1  
ATOM 7494   O OE1  . GLU D 1 24  ? -15.038 -2.058  13.899  1.00 1.40  ? 24  GLU D OE1  1  
ATOM 7495   O OE2  . GLU D 1 24  ? -13.948 -3.057  15.511  1.00 30.22 ? 24  GLU D OE2  1  
ATOM 7496   H H    . GLU D 1 24  ? -12.628 -3.678  9.950   1.00 73.52 ? 24  GLU D H    1  
ATOM 7497   H HA   . GLU D 1 24  ? -10.777 -4.361  12.163  1.00 64.23 ? 24  GLU D HA   1  
ATOM 7498   H HB2  . GLU D 1 24  ? -13.832 -4.352  12.228  1.00 52.31 ? 24  GLU D HB2  1  
ATOM 7499   H HB3  . GLU D 1 24  ? -12.806 -5.003  13.504  1.00 52.01 ? 24  GLU D HB3  1  
ATOM 7500   H HG2  . GLU D 1 24  ? -11.902 -2.776  13.962  1.00 23.14 ? 24  GLU D HG2  1  
ATOM 7501   H HG3  . GLU D 1 24  ? -12.834 -2.102  12.623  1.00 35.04 ? 24  GLU D HG3  1  
ATOM 7502   N N    . ALA D 1 25  ? -10.884 -6.765  11.529  1.00 32.33 ? 25  ALA D N    1  
ATOM 7503   C CA   . ALA D 1 25  ? -10.975 -8.218  11.396  1.00 54.35 ? 25  ALA D CA   1  
ATOM 7504   C C    . ALA D 1 25  ? -11.190 -8.774  12.810  1.00 53.23 ? 25  ALA D C    1  
ATOM 7505   O O    . ALA D 1 25  ? -10.211 -9.062  13.513  1.00 31.23 ? 25  ALA D O    1  
ATOM 7506   C CB   . ALA D 1 25  ? -9.705  -8.775  10.728  1.00 62.22 ? 25  ALA D CB   1  
ATOM 7507   H H    . ALA D 1 25  ? -10.067 -6.385  11.899  1.00 63.55 ? 25  ALA D H    1  
ATOM 7508   H HA   . ALA D 1 25  ? -11.835 -8.474  10.772  1.00 40.21 ? 25  ALA D HA   1  
ATOM 7509   H HB1  . ALA D 1 25  ? -8.837  -8.546  11.335  1.00 11.34 ? 25  ALA D HB1  1  
ATOM 7510   H HB2  . ALA D 1 25  ? -9.582  -8.339  9.765   1.00 44.01 ? 25  ALA D HB2  1  
ATOM 7511   H HB3  . ALA D 1 25  ? -9.788  -9.845  10.616  1.00 64.54 ? 25  ALA D HB3  1  
ATOM 7512   N N    . PRO D 1 26  ? -12.482 -8.871  13.284  1.00 35.32 ? 26  PRO D N    1  
ATOM 7513   C CA   . PRO D 1 26  ? -12.785 -9.103  14.720  1.00 65.33 ? 26  PRO D CA   1  
ATOM 7514   C C    . PRO D 1 26  ? -12.285 -10.473 15.214  1.00 71.40 ? 26  PRO D C    1  
ATOM 7515   O O    . PRO D 1 26  ? -11.717 -10.587 16.301  1.00 21.53 ? 26  PRO D O    1  
ATOM 7516   C CB   . PRO D 1 26  ? -14.334 -8.997  14.777  1.00 40.31 ? 26  PRO D CB   1  
ATOM 7517   C CG   . PRO D 1 26  ? -14.798 -9.330  13.392  1.00 72.42 ? 26  PRO D CG   1  
ATOM 7518   C CD   . PRO D 1 26  ? -13.735 -8.776  12.466  1.00 25.45 ? 26  PRO D CD   1  
ATOM 7519   H HA   . PRO D 1 26  ? -12.344 -8.325  15.338  1.00 70.04 ? 26  PRO D HA   1  
ATOM 7520   H HB2  . PRO D 1 26  ? -14.746 -9.688  15.513  1.00 63.31 ? 26  PRO D HB2  1  
ATOM 7521   H HB3  . PRO D 1 26  ? -14.626 -7.985  15.032  1.00 13.34 ? 26  PRO D HB3  1  
ATOM 7522   H HG2  . PRO D 1 26  ? -14.883 -10.412 13.280  1.00 21.32 ? 26  PRO D HG2  1  
ATOM 7523   H HG3  . PRO D 1 26  ? -15.754 -8.862  13.187  1.00 22.30 ? 26  PRO D HG3  1  
ATOM 7524   H HD2  . PRO D 1 26  ? -13.662 -9.376  11.565  1.00 73.40 ? 26  PRO D HD2  1  
ATOM 7525   H HD3  . PRO D 1 26  ? -13.943 -7.743  12.213  1.00 25.42 ? 26  PRO D HD3  1  
ATOM 7526   N N    . ASN D 1 27  ? -12.481 -11.498 14.375  1.00 45.45 ? 27  ASN D N    1  
ATOM 7527   C CA   . ASN D 1 27  ? -12.177 -12.907 14.702  1.00 52.41 ? 27  ASN D CA   1  
ATOM 7528   C C    . ASN D 1 27  ? -10.986 -13.395 13.864  1.00 75.24 ? 27  ASN D C    1  
ATOM 7529   O O    . ASN D 1 27  ? -10.741 -14.602 13.799  1.00 61.31 ? 27  ASN D O    1  
ATOM 7530   C CB   . ASN D 1 27  ? -13.435 -13.775 14.411  1.00 1.44  ? 27  ASN D CB   1  
ATOM 7531   C CG   . ASN D 1 27  ? -14.721 -13.232 15.044  1.00 22.50 ? 27  ASN D CG   1  
ATOM 7532   O OD1  . ASN D 1 27  ? -14.709 -12.673 16.140  1.00 52.23 ? 27  ASN D OD1  1  
ATOM 7533   N ND2  . ASN D 1 27  ? -15.838 -13.386 14.345  1.00 51.12 ? 27  ASN D ND2  1  
ATOM 7534   H H    . ASN D 1 27  ? -12.839 -11.301 13.481  1.00 53.01 ? 27  ASN D H    1  
ATOM 7535   H HA   . ASN D 1 27  ? -11.919 -12.982 15.750  1.00 75.10 ? 27  ASN D HA   1  
ATOM 7536   H HB2  . ASN D 1 27  ? -13.588 -13.834 13.334  1.00 52.11 ? 27  ASN D HB2  1  
ATOM 7537   H HB3  . ASN D 1 27  ? -13.281 -14.786 14.794  1.00 40.02 ? 27  ASN D HB3  1  
ATOM 7538   H HD21 . ASN D 1 27  ? -15.776 -13.825 13.468  1.00 10.14 ? 27  ASN D HD21 1  
ATOM 7539   H HD22 . ASN D 1 27  ? -16.674 -13.062 14.729  1.00 35.44 ? 27  ASN D HD22 1  
ATOM 7540   N N    . ALA D 1 28  ? -10.256 -12.415 13.262  1.00 43.42 ? 28  ALA D N    1  
ATOM 7541   C CA   . ALA D 1 28  ? -9.220  -12.586 12.220  1.00 74.35 ? 28  ALA D CA   1  
ATOM 7542   C C    . ALA D 1 28  ? -8.597  -14.008 12.059  1.00 64.23 ? 28  ALA D C    1  
ATOM 7543   O O    . ALA D 1 28  ? -8.927  -14.658 11.071  1.00 43.12 ? 28  ALA D O    1  
ATOM 7544   C CB   . ALA D 1 28  ? -8.168  -11.468 12.357  1.00 73.55 ? 28  ALA D CB   1  
ATOM 7545   H H    . ALA D 1 28  ? -10.450 -11.486 13.517  1.00 31.55 ? 28  ALA D H    1  
ATOM 7546   H HA   . ALA D 1 28  ? -9.741  -12.382 11.292  1.00 42.05 ? 28  ALA D HA   1  
ATOM 7547   H HB1  . ALA D 1 28  ? -7.584  -11.378 11.457  1.00 11.10 ? 28  ALA D HB1  1  
ATOM 7548   H HB2  . ALA D 1 28  ? -7.501  -11.679 13.171  1.00 34.12 ? 28  ALA D HB2  1  
ATOM 7549   H HB3  . ALA D 1 28  ? -8.671  -10.528 12.535  1.00 11.32 ? 28  ALA D HB3  1  
ATOM 7550   N N    . PRO D 1 29  ? -7.750  -14.589 12.984  1.00 34.22 ? 29  PRO D N    1  
ATOM 7551   C CA   . PRO D 1 29  ? -7.104  -15.890 12.672  1.00 14.22 ? 29  PRO D CA   1  
ATOM 7552   C C    . PRO D 1 29  ? -8.043  -17.101 12.822  1.00 74.13 ? 29  PRO D C    1  
ATOM 7553   O O    . PRO D 1 29  ? -7.833  -18.146 12.187  1.00 55.13 ? 29  PRO D O    1  
ATOM 7554   C CB   . PRO D 1 29  ? -5.942  -15.928 13.666  1.00 14.11 ? 29  PRO D CB   1  
ATOM 7555   C CG   . PRO D 1 29  ? -6.480  -15.231 14.880  1.00 5.45  ? 29  PRO D CG   1  
ATOM 7556   C CD   . PRO D 1 29  ? -7.361  -14.105 14.355  1.00 63.21 ? 29  PRO D CD   1  
ATOM 7557   H HA   . PRO D 1 29  ? -6.733  -15.882 11.656  1.00 70.33 ? 29  PRO D HA   1  
ATOM 7558   H HB2  . PRO D 1 29  ? -5.650  -16.953 13.884  1.00 45.41 ? 29  PRO D HB2  1  
ATOM 7559   H HB3  . PRO D 1 29  ? -5.095  -15.374 13.264  1.00 41.14 ? 29  PRO D HB3  1  
ATOM 7560   H HG2  . PRO D 1 29  ? -7.065  -15.934 15.477  1.00 45.33 ? 29  PRO D HG2  1  
ATOM 7561   H HG3  . PRO D 1 29  ? -5.667  -14.831 15.474  1.00 53.02 ? 29  PRO D HG3  1  
ATOM 7562   H HD2  . PRO D 1 29  ? -8.237  -13.970 14.984  1.00 12.21 ? 29  PRO D HD2  1  
ATOM 7563   H HD3  . PRO D 1 29  ? -6.801  -13.175 14.292  1.00 23.25 ? 29  PRO D HD3  1  
ATOM 7564   N N    . HIS D 1 30  ? -9.082  -16.929 13.642  1.00 61.32 ? 30  HIS D N    1  
ATOM 7565   C CA   . HIS D 1 30  ? -10.107 -17.952 13.881  1.00 54.20 ? 30  HIS D CA   1  
ATOM 7566   C C    . HIS D 1 30  ? -11.006 -18.065 12.643  1.00 60.13 ? 30  HIS D C    1  
ATOM 7567   O O    . HIS D 1 30  ? -11.435 -19.159 12.262  1.00 5.22  ? 30  HIS D O    1  
ATOM 7568   C CB   . HIS D 1 30  ? -10.913 -17.568 15.158  1.00 52.12 ? 30  HIS D CB   1  
ATOM 7569   C CG   . HIS D 1 30  ? -12.193 -18.339 15.411  1.00 0.33  ? 30  HIS D CG   1  
ATOM 7570   N ND1  . HIS D 1 30  ? -13.263 -17.790 16.070  1.00 2.22  ? 30  HIS D ND1  1  
ATOM 7571   C CD2  . HIS D 1 30  ? -12.566 -19.614 15.107  1.00 70.44 ? 30  HIS D CD2  1  
ATOM 7572   C CE1  . HIS D 1 30  ? -14.222 -18.678 16.167  1.00 74.44 ? 30  HIS D CE1  1  
ATOM 7573   N NE2  . HIS D 1 30  ? -13.832 -19.795 15.588  1.00 71.24 ? 30  HIS D NE2  1  
ATOM 7574   H H    . HIS D 1 30  ? -9.187  -16.056 14.074  1.00 4.35  ? 30  HIS D H    1  
ATOM 7575   H HA   . HIS D 1 30  ? -9.607  -18.903 14.049  1.00 54.14 ? 30  HIS D HA   1  
ATOM 7576   H HB2  . HIS D 1 30  ? -10.284 -17.713 16.023  1.00 75.11 ? 30  HIS D HB2  1  
ATOM 7577   H HB3  . HIS D 1 30  ? -11.173 -16.515 15.100  1.00 63.20 ? 30  HIS D HB3  1  
ATOM 7578   H HD1  . HIS D 1 30  ? -13.327 -16.865 16.395  1.00 64.14 ? 30  HIS D HD1  1  
ATOM 7579   H HD2  . HIS D 1 30  ? -11.988 -20.328 14.539  1.00 2.43  ? 30  HIS D HD2  1  
ATOM 7580   H HE1  . HIS D 1 30  ? -15.189 -18.499 16.606  1.00 62.35 ? 30  HIS D HE1  1  
ATOM 7581   H HE2  . HIS D 1 30  ? -14.422 -20.544 15.359  1.00 37.65 ? 30  HIS D HE2  1  
ATOM 7582   N N    . VAL D 1 31  ? -11.263 -16.924 12.010  1.00 13.20 ? 31  VAL D N    1  
ATOM 7583   C CA   . VAL D 1 31  ? -12.162 -16.851 10.857  1.00 31.33 ? 31  VAL D CA   1  
ATOM 7584   C C    . VAL D 1 31  ? -11.410 -17.232 9.548   1.00 52.02 ? 31  VAL D C    1  
ATOM 7585   O O    . VAL D 1 31  ? -12.044 -17.591 8.549   1.00 62.13 ? 31  VAL D O    1  
ATOM 7586   C CB   . VAL D 1 31  ? -12.817 -15.419 10.774  1.00 23.34 ? 31  VAL D CB   1  
ATOM 7587   C CG1  . VAL D 1 31  ? -11.820 -14.353 10.274  1.00 1.22  ? 31  VAL D CG1  1  
ATOM 7588   C CG2  . VAL D 1 31  ? -14.117 -15.434 9.958   1.00 5.40  ? 31  VAL D CG2  1  
ATOM 7589   H H    . VAL D 1 31  ? -10.825 -16.100 12.322  1.00 40.44 ? 31  VAL D H    1  
ATOM 7590   H HA   . VAL D 1 31  ? -12.959 -17.584 11.017  1.00 11.34 ? 31  VAL D HA   1  
ATOM 7591   H HB   . VAL D 1 31  ? -13.086 -15.135 11.791  1.00 75.01 ? 31  VAL D HB   1  
ATOM 7592   H HG11 . VAL D 1 31  ? -11.026 -14.263 10.986  1.00 32.13 ? 31  VAL D HG11 1  
ATOM 7593   H HG12 . VAL D 1 31  ? -12.299 -13.389 10.161  1.00 14.55 ? 31  VAL D HG12 1  
ATOM 7594   H HG13 . VAL D 1 31  ? -11.381 -14.653 9.336   1.00 25.43 ? 31  VAL D HG13 1  
ATOM 7595   H HG21 . VAL D 1 31  ? -14.789 -16.184 10.360  1.00 60.35 ? 31  VAL D HG21 1  
ATOM 7596   H HG22 . VAL D 1 31  ? -13.898 -15.671 8.932   1.00 25.40 ? 31  VAL D HG22 1  
ATOM 7597   H HG23 . VAL D 1 31  ? -14.597 -14.468 10.012  1.00 53.43 ? 31  VAL D HG23 1  
ATOM 7598   N N    . PHE D 1 32  ? -10.045 -17.169 9.576   1.00 22.32 ? 32  PHE D N    1  
ATOM 7599   C CA   . PHE D 1 32  ? -9.192  -17.593 8.428   1.00 75.42 ? 32  PHE D CA   1  
ATOM 7600   C C    . PHE D 1 32  ? -9.216  -19.117 8.227   1.00 60.52 ? 32  PHE D C    1  
ATOM 7601   O O    . PHE D 1 32  ? -8.819  -19.607 7.161   1.00 75.22 ? 32  PHE D O    1  
ATOM 7602   C CB   . PHE D 1 32  ? -7.712  -17.156 8.587   1.00 70.54 ? 32  PHE D CB   1  
ATOM 7603   C CG   . PHE D 1 32  ? -7.448  -15.656 8.590   1.00 24.14 ? 32  PHE D CG   1  
ATOM 7604   C CD1  . PHE D 1 32  ? -8.244  -14.762 7.872   1.00 52.42 ? 32  PHE D CD1  1  
ATOM 7605   C CD2  . PHE D 1 32  ? -6.380  -15.144 9.314   1.00 44.02 ? 32  PHE D CD2  1  
ATOM 7606   C CE1  . PHE D 1 32  ? -7.978  -13.408 7.901   1.00 10.42 ? 32  PHE D CE1  1  
ATOM 7607   C CE2  . PHE D 1 32  ? -6.121  -13.802 9.337   1.00 73.43 ? 32  PHE D CE2  1  
ATOM 7608   C CZ   . PHE D 1 32  ? -6.916  -12.927 8.639   1.00 15.21 ? 32  PHE D CZ   1  
ATOM 7609   H H    . PHE D 1 32  ? -9.610  -16.820 10.384  1.00 54.33 ? 32  PHE D H    1  
ATOM 7610   H HA   . PHE D 1 32  ? -9.600  -17.118 7.547   1.00 64.42 ? 32  PHE D HA   1  
ATOM 7611   H HB2  . PHE D 1 32  ? -7.334  -17.561 9.521   1.00 54.41 ? 32  PHE D HB2  1  
ATOM 7612   H HB3  . PHE D 1 32  ? -7.131  -17.579 7.771   1.00 3.35  ? 32  PHE D HB3  1  
ATOM 7613   H HD1  . PHE D 1 32  ? -9.087  -15.133 7.297   1.00 75.21 ? 32  PHE D HD1  1  
ATOM 7614   H HD2  . PHE D 1 32  ? -5.741  -15.821 9.872   1.00 44.15 ? 32  PHE D HD2  1  
ATOM 7615   H HE1  . PHE D 1 32  ? -8.596  -12.721 7.338   1.00 55.40 ? 32  PHE D HE1  1  
ATOM 7616   H HE2  . PHE D 1 32  ? -5.290  -13.430 9.918   1.00 54.11 ? 32  PHE D HE2  1  
ATOM 7617   H HZ   . PHE D 1 32  ? -6.712  -11.860 8.682   1.00 4.52  ? 32  PHE D HZ   1  
ATOM 7618   N N    . GLN D 1 33  ? -9.631  -19.852 9.286   1.00 32.30 ? 33  GLN D N    1  
ATOM 7619   C CA   . GLN D 1 33  ? -9.863  -21.316 9.219   1.00 61.22 ? 33  GLN D CA   1  
ATOM 7620   C C    . GLN D 1 33  ? -10.860 -21.642 8.092   1.00 31.22 ? 33  GLN D C    1  
ATOM 7621   O O    . GLN D 1 33  ? -10.744 -22.660 7.407   1.00 64.14 ? 33  GLN D O    1  
ATOM 7622   C CB   . GLN D 1 33  ? -10.393 -21.834 10.582  1.00 22.52 ? 33  GLN D CB   1  
ATOM 7623   C CG   . GLN D 1 33  ? -9.398  -21.661 11.755  1.00 44.52 ? 33  GLN D CG   1  
ATOM 7624   C CD   . GLN D 1 33  ? -10.027 -21.902 13.132  1.00 14.22 ? 33  GLN D CD   1  
ATOM 7625   O OE1  . GLN D 1 33  ? -10.974 -22.676 13.277  1.00 63.00 ? 33  GLN D OE1  1  
ATOM 7626   N NE2  . GLN D 1 33  ? -9.508  -21.234 14.156  1.00 23.34 ? 33  GLN D NE2  1  
ATOM 7627   H H    . GLN D 1 33  ? -9.787  -19.393 10.139  1.00 75.41 ? 33  GLN D H    1  
ATOM 7628   H HA   . GLN D 1 33  ? -8.916  -21.792 8.997   1.00 52.03 ? 33  GLN D HA   1  
ATOM 7629   H HB2  . GLN D 1 33  ? -11.307 -21.299 10.827  1.00 0.41  ? 33  GLN D HB2  1  
ATOM 7630   H HB3  . GLN D 1 33  ? -10.629 -22.891 10.492  1.00 22.35 ? 33  GLN D HB3  1  
ATOM 7631   H HG2  . GLN D 1 33  ? -8.581  -22.362 11.628  1.00 73.25 ? 33  GLN D HG2  1  
ATOM 7632   H HG3  . GLN D 1 33  ? -9.002  -20.650 11.727  1.00 74.30 ? 33  GLN D HG3  1  
ATOM 7633   H HE21 . GLN D 1 33  ? -8.758  -20.625 13.981  1.00 0.42  ? 33  GLN D HE21 1  
ATOM 7634   H HE22 . GLN D 1 33  ? -9.897  -21.372 15.042  1.00 20.25 ? 33  GLN D HE22 1  
ATOM 7635   N N    . LYS D 1 34  ? -11.810 -20.716 7.903   1.00 72.51 ? 34  LYS D N    1  
ATOM 7636   C CA   . LYS D 1 34  ? -12.714 -20.682 6.757   1.00 24.03 ? 34  LYS D CA   1  
ATOM 7637   C C    . LYS D 1 34  ? -12.096 -19.804 5.654   1.00 13.35 ? 34  LYS D C    1  
ATOM 7638   O O    . LYS D 1 34  ? -12.428 -18.622 5.522   1.00 4.02  ? 34  LYS D O    1  
ATOM 7639   C CB   . LYS D 1 34  ? -14.098 -20.146 7.224   1.00 12.41 ? 34  LYS D CB   1  
ATOM 7640   C CG   . LYS D 1 34  ? -14.917 -21.173 8.043   1.00 75.10 ? 34  LYS D CG   1  
ATOM 7641   C CD   . LYS D 1 34  ? -16.081 -20.532 8.833   1.00 75.33 ? 34  LYS D CD   1  
ATOM 7642   C CE   . LYS D 1 34  ? -15.603 -19.749 10.064  1.00 41.12 ? 34  LYS D CE   1  
ATOM 7643   N NZ   . LYS D 1 34  ? -16.740 -19.242 10.882  1.00 23.01 ? 34  LYS D NZ   1  
ATOM 7644   H H    . LYS D 1 34  ? -11.890 -20.003 8.569   1.00 71.34 ? 34  LYS D H    1  
ATOM 7645   H HA   . LYS D 1 34  ? -12.832 -21.693 6.373   1.00 30.13 ? 34  LYS D HA   1  
ATOM 7646   H HB2  . LYS D 1 34  ? -13.938 -19.261 7.838   1.00 41.42 ? 34  LYS D HB2  1  
ATOM 7647   H HB3  . LYS D 1 34  ? -14.682 -19.854 6.357   1.00 22.24 ? 34  LYS D HB3  1  
ATOM 7648   H HG2  . LYS D 1 34  ? -15.320 -21.916 7.365   1.00 13.42 ? 34  LYS D HG2  1  
ATOM 7649   H HG3  . LYS D 1 34  ? -14.251 -21.673 8.747   1.00 63.40 ? 34  LYS D HG3  1  
ATOM 7650   H HD2  . LYS D 1 34  ? -16.622 -19.854 8.181   1.00 25.31 ? 34  LYS D HD2  1  
ATOM 7651   H HD3  . LYS D 1 34  ? -16.756 -21.312 9.157   1.00 31.34 ? 34  LYS D HD3  1  
ATOM 7652   H HE2  . LYS D 1 34  ? -14.997 -20.402 10.683  1.00 54.40 ? 34  LYS D HE2  1  
ATOM 7653   H HE3  . LYS D 1 34  ? -15.000 -18.909 9.741   1.00 20.31 ? 34  LYS D HE3  1  
ATOM 7654   H HZ1  . LYS D 1 34  ? -17.251 -18.507 10.370  1.00 75.52 ? 34  LYS D HZ1  1  
ATOM 7655   H HZ2  . LYS D 1 34  ? -16.392 -18.837 11.766  1.00 64.12 ? 34  LYS D HZ2  1  
ATOM 7656   H HZ3  . LYS D 1 34  ? -17.398 -20.005 11.112  1.00 41.02 ? 34  LYS D HZ3  1  
ATOM 7657   N N    . ASP D 1 35  ? -11.120 -20.379 4.926   1.00 23.32 ? 35  ASP D N    1  
ATOM 7658   C CA   . ASP D 1 35  ? -10.461 -19.710 3.786   1.00 43.42 ? 35  ASP D CA   1  
ATOM 7659   C C    . ASP D 1 35  ? -11.392 -19.752 2.556   1.00 70.43 ? 35  ASP D C    1  
ATOM 7660   O O    . ASP D 1 35  ? -11.313 -20.652 1.706   1.00 1.45  ? 35  ASP D O    1  
ATOM 7661   C CB   . ASP D 1 35  ? -9.074  -20.363 3.501   1.00 14.03 ? 35  ASP D CB   1  
ATOM 7662   C CG   . ASP D 1 35  ? -8.362  -19.807 2.247   1.00 3.14  ? 35  ASP D CG   1  
ATOM 7663   O OD1  . ASP D 1 35  ? -8.010  -18.613 2.221   1.00 21.24 ? 35  ASP D OD1  1  
ATOM 7664   O OD2  . ASP D 1 35  ? -8.139  -20.571 1.284   1.00 73.14 ? 35  ASP D OD2  1  
ATOM 7665   H H    . ASP D 1 35  ? -10.833 -21.283 5.166   1.00 3.53  ? 35  ASP D H    1  
ATOM 7666   H HA   . ASP D 1 35  ? -10.296 -18.667 4.063   1.00 74.30 ? 35  ASP D HA   1  
ATOM 7667   H HB2  . ASP D 1 35  ? -8.429  -20.200 4.359   1.00 42.03 ? 35  ASP D HB2  1  
ATOM 7668   H HB3  . ASP D 1 35  ? -9.212  -21.432 3.382   1.00 3.14  ? 35  ASP D HB3  1  
ATOM 7669   N N    . TRP D 1 36  ? -12.331 -18.801 2.538   1.00 51.23 ? 36  TRP D N    1  
ATOM 7670   C CA   . TRP D 1 36  ? -13.334 -18.647 1.477   1.00 51.43 ? 36  TRP D CA   1  
ATOM 7671   C C    . TRP D 1 36  ? -13.666 -17.146 1.320   1.00 71.21 ? 36  TRP D C    1  
ATOM 7672   O O    . TRP D 1 36  ? -13.418 -16.356 2.240   1.00 52.51 ? 36  TRP D O    1  
ATOM 7673   C CB   . TRP D 1 36  ? -14.602 -19.498 1.830   1.00 11.14 ? 36  TRP D CB   1  
ATOM 7674   C CG   . TRP D 1 36  ? -15.772 -19.309 0.883   1.00 73.35 ? 36  TRP D CG   1  
ATOM 7675   C CD1  . TRP D 1 36  ? -15.772 -19.480 -0.474  1.00 54.51 ? 36  TRP D CD1  1  
ATOM 7676   C CD2  . TRP D 1 36  ? -17.108 -18.902 1.231   1.00 50.40 ? 36  TRP D CD2  1  
ATOM 7677   N NE1  . TRP D 1 36  ? -17.001 -19.169 -0.984  1.00 33.55 ? 36  TRP D NE1  1  
ATOM 7678   C CE2  . TRP D 1 36  ? -17.841 -18.828 0.037   1.00 33.43 ? 36  TRP D CE2  1  
ATOM 7679   C CE3  . TRP D 1 36  ? -17.748 -18.585 2.434   1.00 21.11 ? 36  TRP D CE3  1  
ATOM 7680   C CZ2  . TRP D 1 36  ? -19.177 -18.454 0.006   1.00 74.40 ? 36  TRP D CZ2  1  
ATOM 7681   C CZ3  . TRP D 1 36  ? -19.078 -18.220 2.403   1.00 34.42 ? 36  TRP D CZ3  1  
ATOM 7682   C CH2  . TRP D 1 36  ? -19.779 -18.155 1.195   1.00 4.23  ? 36  TRP D CH2  1  
ATOM 7683   H H    . TRP D 1 36  ? -12.361 -18.165 3.286   1.00 53.35 ? 36  TRP D H    1  
ATOM 7684   H HA   . TRP D 1 36  ? -12.911 -19.007 0.543   1.00 5.11  ? 36  TRP D HA   1  
ATOM 7685   H HB2  . TRP D 1 36  ? -14.332 -20.549 1.816   1.00 42.02 ? 36  TRP D HB2  1  
ATOM 7686   H HB3  . TRP D 1 36  ? -14.932 -19.244 2.830   1.00 50.33 ? 36  TRP D HB3  1  
ATOM 7687   H HD1  . TRP D 1 36  ? -14.909 -19.785 -1.051  1.00 1.42  ? 36  TRP D HD1  1  
ATOM 7688   H HE1  . TRP D 1 36  ? -17.246 -19.201 -1.927  1.00 60.50 ? 36  TRP D HE1  1  
ATOM 7689   H HE3  . TRP D 1 36  ? -17.221 -18.630 3.379   1.00 24.20 ? 36  TRP D HE3  1  
ATOM 7690   H HZ2  . TRP D 1 36  ? -19.732 -18.398 -0.919  1.00 54.32 ? 36  TRP D HZ2  1  
ATOM 7691   H HZ3  . TRP D 1 36  ? -19.592 -17.974 3.327   1.00 11.44 ? 36  TRP D HZ3  1  
ATOM 7692   H HH2  . TRP D 1 36  ? -20.821 -17.863 1.217   1.00 12.54 ? 36  TRP D HH2  1  
ATOM 7693   N N    . GLN D 1 37  ? -14.192 -16.768 0.131   1.00 43.41 ? 37  GLN D N    1  
ATOM 7694   C CA   . GLN D 1 37  ? -14.715 -15.421 -0.150  1.00 12.33 ? 37  GLN D CA   1  
ATOM 7695   C C    . GLN D 1 37  ? -15.936 -15.155 0.762   1.00 64.23 ? 37  GLN D C    1  
ATOM 7696   O O    . GLN D 1 37  ? -16.991 -15.756 0.548   1.00 0.14  ? 37  GLN D O    1  
ATOM 7697   C CB   . GLN D 1 37  ? -15.092 -15.312 -1.664  1.00 12.11 ? 37  GLN D CB   1  
ATOM 7698   C CG   . GLN D 1 37  ? -15.495 -13.899 -2.159  1.00 45.13 ? 37  GLN D CG   1  
ATOM 7699   C CD   . GLN D 1 37  ? -14.369 -12.859 -2.075  1.00 74.31 ? 37  GLN D CD   1  
ATOM 7700   O OE1  . GLN D 1 37  ? -13.565 -12.724 -2.996  1.00 54.52 ? 37  GLN D OE1  1  
ATOM 7701   N NE2  . GLN D 1 37  ? -14.324 -12.095 -0.991  1.00 63.45 ? 37  GLN D NE2  1  
ATOM 7702   H H    . GLN D 1 37  ? -14.231 -17.429 -0.585  1.00 60.24 ? 37  GLN D H    1  
ATOM 7703   H HA   . GLN D 1 37  ? -13.934 -14.705 0.072   1.00 41.33 ? 37  GLN D HA   1  
ATOM 7704   H HB2  . GLN D 1 37  ? -14.242 -15.637 -2.252  1.00 64.51 ? 37  GLN D HB2  1  
ATOM 7705   H HB3  . GLN D 1 37  ? -15.918 -15.990 -1.862  1.00 74.11 ? 37  GLN D HB3  1  
ATOM 7706   H HG2  . GLN D 1 37  ? -15.814 -13.971 -3.194  1.00 54.20 ? 37  GLN D HG2  1  
ATOM 7707   H HG3  . GLN D 1 37  ? -16.333 -13.555 -1.563  1.00 53.12 ? 37  GLN D HG3  1  
ATOM 7708   H HE21 . GLN D 1 37  ? -15.008 -12.226 -0.303  1.00 42.25 ? 37  GLN D HE21 1  
ATOM 7709   H HE22 . GLN D 1 37  ? -13.602 -11.433 -0.925  1.00 52.45 ? 37  GLN D HE22 1  
ATOM 7710   N N    . PRO D 1 38  ? -15.802 -14.284 1.819   1.00 22.41 ? 38  PRO D N    1  
ATOM 7711   C CA   . PRO D 1 38  ? -16.859 -14.093 2.839   1.00 62.45 ? 38  PRO D CA   1  
ATOM 7712   C C    . PRO D 1 38  ? -18.120 -13.463 2.252   1.00 5.22  ? 38  PRO D C    1  
ATOM 7713   O O    . PRO D 1 38  ? -18.024 -12.638 1.336   1.00 4.20  ? 38  PRO D O    1  
ATOM 7714   C CB   . PRO D 1 38  ? -16.200 -13.154 3.887   1.00 11.33 ? 38  PRO D CB   1  
ATOM 7715   C CG   . PRO D 1 38  ? -14.727 -13.225 3.596   1.00 50.23 ? 38  PRO D CG   1  
ATOM 7716   C CD   . PRO D 1 38  ? -14.638 -13.407 2.106   1.00 55.22 ? 38  PRO D CD   1  
ATOM 7717   H HA   . PRO D 1 38  ? -17.115 -15.042 3.308   1.00 73.11 ? 38  PRO D HA   1  
ATOM 7718   H HB2  . PRO D 1 38  ? -16.568 -12.131 3.781   1.00 71.51 ? 38  PRO D HB2  1  
ATOM 7719   H HB3  . PRO D 1 38  ? -16.399 -13.510 4.891   1.00 62.44 ? 38  PRO D HB3  1  
ATOM 7720   H HG2  . PRO D 1 38  ? -14.241 -12.303 3.906   1.00 22.30 ? 38  PRO D HG2  1  
ATOM 7721   H HG3  . PRO D 1 38  ? -14.279 -14.072 4.106   1.00 41.40 ? 38  PRO D HG3  1  
ATOM 7722   H HD2  . PRO D 1 38  ? -14.732 -12.457 1.586   1.00 24.34 ? 38  PRO D HD2  1  
ATOM 7723   H HD3  . PRO D 1 38  ? -13.707 -13.892 1.837   1.00 71.32 ? 38  PRO D HD3  1  
ATOM 7724   N N    . GLU D 1 39  ? -19.282 -13.863 2.789   1.00 63.04 ? 39  GLU D N    1  
ATOM 7725   C CA   . GLU D 1 39  ? -20.583 -13.318 2.382   1.00 51.14 ? 39  GLU D CA   1  
ATOM 7726   C C    . GLU D 1 39  ? -20.605 -11.820 2.729   1.00 13.33 ? 39  GLU D C    1  
ATOM 7727   O O    . GLU D 1 39  ? -20.607 -11.464 3.909   1.00 15.23 ? 39  GLU D O    1  
ATOM 7728   C CB   . GLU D 1 39  ? -21.721 -14.074 3.135   1.00 11.21 ? 39  GLU D CB   1  
ATOM 7729   C CG   . GLU D 1 39  ? -21.640 -15.605 2.991   1.00 50.11 ? 39  GLU D CG   1  
ATOM 7730   C CD   . GLU D 1 39  ? -22.650 -16.381 3.859   1.00 41.04 ? 39  GLU D CD   1  
ATOM 7731   O OE1  . GLU D 1 39  ? -23.739 -16.734 3.364   1.00 74.02 ? 39  GLU D OE1  1  
ATOM 7732   O OE2  . GLU D 1 39  ? -22.349 -16.652 5.043   1.00 34.12 ? 39  GLU D OE2  1  
ATOM 7733   H H    . GLU D 1 39  ? -19.257 -14.542 3.494   1.00 61.40 ? 39  GLU D H    1  
ATOM 7734   H HA   . GLU D 1 39  ? -20.696 -13.456 1.311   1.00 32.32 ? 39  GLU D HA   1  
ATOM 7735   H HB2  . GLU D 1 39  ? -21.668 -13.826 4.194   1.00 13.23 ? 39  GLU D HB2  1  
ATOM 7736   H HB3  . GLU D 1 39  ? -22.679 -13.742 2.750   1.00 42.13 ? 39  GLU D HB3  1  
ATOM 7737   H HG2  . GLU D 1 39  ? -21.807 -15.864 1.949   1.00 51.12 ? 39  GLU D HG2  1  
ATOM 7738   H HG3  . GLU D 1 39  ? -20.636 -15.922 3.261   1.00 4.03  ? 39  GLU D HG3  1  
ATOM 7739   N N    . VAL D 1 40  ? -20.595 -10.956 1.700   1.00 72.25 ? 40  VAL D N    1  
ATOM 7740   C CA   . VAL D 1 40  ? -20.477 -9.492  1.881   1.00 45.44 ? 40  VAL D CA   1  
ATOM 7741   C C    . VAL D 1 40  ? -21.837 -8.797  1.699   1.00 3.10  ? 40  VAL D C    1  
ATOM 7742   O O    . VAL D 1 40  ? -22.685 -9.234  0.909   1.00 74.15 ? 40  VAL D O    1  
ATOM 7743   C CB   . VAL D 1 40  ? -19.405 -8.840  0.911   1.00 31.44 ? 40  VAL D CB   1  
ATOM 7744   C CG1  . VAL D 1 40  ? -17.977 -9.360  1.210   1.00 12.35 ? 40  VAL D CG1  1  
ATOM 7745   C CG2  . VAL D 1 40  ? -19.772 -9.045  -0.579  1.00 2.22  ? 40  VAL D CG2  1  
ATOM 7746   H H    . VAL D 1 40  ? -20.683 -11.311 0.788   1.00 12.10 ? 40  VAL D H    1  
ATOM 7747   H HA   . VAL D 1 40  ? -20.139 -9.312  2.908   1.00 35.04 ? 40  VAL D HA   1  
ATOM 7748   H HB   . VAL D 1 40  ? -19.399 -7.766  1.103   1.00 30.45 ? 40  VAL D HB   1  
ATOM 7749   H HG11 . VAL D 1 40  ? -17.722 -9.144  2.239   1.00 41.22 ? 40  VAL D HG11 1  
ATOM 7750   H HG12 . VAL D 1 40  ? -17.264 -8.870  0.560   1.00 1.53  ? 40  VAL D HG12 1  
ATOM 7751   H HG13 . VAL D 1 40  ? -17.933 -10.430 1.048   1.00 14.23 ? 40  VAL D HG13 1  
ATOM 7752   H HG21 . VAL D 1 40  ? -19.032 -8.566  -1.211  1.00 24.13 ? 40  VAL D HG21 1  
ATOM 7753   H HG22 . VAL D 1 40  ? -20.741 -8.607  -0.778  1.00 31.12 ? 40  VAL D HG22 1  
ATOM 7754   H HG23 . VAL D 1 40  ? -19.807 -10.104 -0.808  1.00 2.24  ? 40  VAL D HG23 1  
ATOM 7755   N N    . LYS D 1 41  ? -22.024 -7.727  2.471   1.00 70.42 ? 41  LYS D N    1  
ATOM 7756   C CA   . LYS D 1 41  ? -23.154 -6.820  2.374   1.00 52.45 ? 41  LYS D CA   1  
ATOM 7757   C C    . LYS D 1 41  ? -22.544 -5.415  2.310   1.00 43.10 ? 41  LYS D C    1  
ATOM 7758   O O    . LYS D 1 41  ? -21.850 -5.000  3.246   1.00 32.10 ? 41  LYS D O    1  
ATOM 7759   C CB   . LYS D 1 41  ? -24.109 -6.993  3.606   1.00 23.32 ? 41  LYS D CB   1  
ATOM 7760   C CG   . LYS D 1 41  ? -25.567 -6.494  3.398   1.00 52.21 ? 41  LYS D CG   1  
ATOM 7761   C CD   . LYS D 1 41  ? -25.683 -4.979  3.152   1.00 1.21  ? 41  LYS D CD   1  
ATOM 7762   C CE   . LYS D 1 41  ? -27.101 -4.512  2.816   1.00 23.02 ? 41  LYS D CE   1  
ATOM 7763   N NZ   . LYS D 1 41  ? -27.122 -3.070  2.441   1.00 1.13  ? 41  LYS D NZ   1  
ATOM 7764   H H    . LYS D 1 41  ? -21.346 -7.525  3.140   1.00 22.21 ? 41  LYS D H    1  
ATOM 7765   H HA   . LYS D 1 41  ? -23.701 -7.022  1.448   1.00 13.01 ? 41  LYS D HA   1  
ATOM 7766   H HB2  . LYS D 1 41  ? -24.153 -8.047  3.855   1.00 15.35 ? 41  LYS D HB2  1  
ATOM 7767   H HB3  . LYS D 1 41  ? -23.692 -6.467  4.462   1.00 62.42 ? 41  LYS D HB3  1  
ATOM 7768   H HG2  . LYS D 1 41  ? -25.984 -7.017  2.547   1.00 23.31 ? 41  LYS D HG2  1  
ATOM 7769   H HG3  . LYS D 1 41  ? -26.149 -6.752  4.280   1.00 32.24 ? 41  LYS D HG3  1  
ATOM 7770   H HD2  . LYS D 1 41  ? -25.341 -4.446  4.034   1.00 71.24 ? 41  LYS D HD2  1  
ATOM 7771   H HD3  . LYS D 1 41  ? -25.029 -4.716  2.320   1.00 13.04 ? 41  LYS D HD3  1  
ATOM 7772   H HE2  . LYS D 1 41  ? -27.474 -5.095  1.983   1.00 73.32 ? 41  LYS D HE2  1  
ATOM 7773   H HE3  . LYS D 1 41  ? -27.741 -4.661  3.675   1.00 21.24 ? 41  LYS D HE3  1  
ATOM 7774   H HZ1  . LYS D 1 41  ? -26.709 -2.497  3.203   1.00 31.34 ? 41  LYS D HZ1  1  
ATOM 7775   H HZ2  . LYS D 1 41  ? -28.096 -2.750  2.282   1.00 73.44 ? 41  LYS D HZ2  1  
ATOM 7776   H HZ3  . LYS D 1 41  ? -26.567 -2.911  1.573   1.00 13.21 ? 41  LYS D HZ3  1  
ATOM 7777   N N    . LEU D 1 42  ? -22.791 -4.698  1.218   1.00 55.43 ? 42  LEU D N    1  
ATOM 7778   C CA   . LEU D 1 42  ? -22.296 -3.328  1.037   1.00 5.14  ? 42  LEU D CA   1  
ATOM 7779   C C    . LEU D 1 42  ? -23.410 -2.349  1.427   1.00 35.33 ? 42  LEU D C    1  
ATOM 7780   O O    . LEU D 1 42  ? -24.598 -2.633  1.232   1.00 23.41 ? 42  LEU D O    1  
ATOM 7781   C CB   . LEU D 1 42  ? -21.815 -3.126  -0.438  1.00 20.45 ? 42  LEU D CB   1  
ATOM 7782   C CG   . LEU D 1 42  ? -22.884 -3.327  -1.584  1.00 30.01 ? 42  LEU D CG   1  
ATOM 7783   C CD1  . LEU D 1 42  ? -23.701 -2.043  -1.868  1.00 75.42 ? 42  LEU D CD1  1  
ATOM 7784   C CD2  . LEU D 1 42  ? -22.245 -3.854  -2.883  1.00 75.43 ? 42  LEU D CD2  1  
ATOM 7785   H H    . LEU D 1 42  ? -23.348 -5.089  0.512   1.00 14.12 ? 42  LEU D H    1  
ATOM 7786   H HA   . LEU D 1 42  ? -21.440 -3.174  1.707   1.00 71.14 ? 42  LEU D HA   1  
ATOM 7787   H HB2  . LEU D 1 42  ? -21.404 -2.122  -0.526  1.00 52.11 ? 42  LEU D HB2  1  
ATOM 7788   H HB3  . LEU D 1 42  ? -21.004 -3.824  -0.605  1.00 71.03 ? 42  LEU D HB3  1  
ATOM 7789   H HG   . LEU D 1 42  ? -23.595 -4.079  -1.256  1.00 11.24 ? 42  LEU D HG   1  
ATOM 7790   H HD11 . LEU D 1 42  ? -24.216 -1.734  -0.969  1.00 65.24 ? 42  LEU D HD11 1  
ATOM 7791   H HD12 . LEU D 1 42  ? -24.431 -2.241  -2.640  1.00 0.12  ? 42  LEU D HD12 1  
ATOM 7792   H HD13 . LEU D 1 42  ? -23.041 -1.246  -2.194  1.00 0.13  ? 42  LEU D HD13 1  
ATOM 7793   H HD21 . LEU D 1 42  ? -21.532 -3.132  -3.263  1.00 32.44 ? 42  LEU D HD21 1  
ATOM 7794   H HD22 . LEU D 1 42  ? -23.013 -4.027  -3.622  1.00 71.21 ? 42  LEU D HD22 1  
ATOM 7795   H HD23 . LEU D 1 42  ? -21.734 -4.787  -2.680  1.00 42.03 ? 42  LEU D HD23 1  
ATOM 7796   N N    . ASP D 1 43  ? -23.039 -1.214  2.003   1.00 21.15 ? 43  ASP D N    1  
ATOM 7797   C CA   . ASP D 1 43  ? -23.976 -0.112  2.280   1.00 71.33 ? 43  ASP D CA   1  
ATOM 7798   C C    . ASP D 1 43  ? -23.395 1.181   1.734   1.00 74.25 ? 43  ASP D C    1  
ATOM 7799   O O    . ASP D 1 43  ? -22.181 1.395   1.767   1.00 55.13 ? 43  ASP D O    1  
ATOM 7800   C CB   . ASP D 1 43  ? -24.272 0.038   3.798   1.00 14.34 ? 43  ASP D CB   1  
ATOM 7801   C CG   . ASP D 1 43  ? -25.086 -1.125  4.377   1.00 31.53 ? 43  ASP D CG   1  
ATOM 7802   O OD1  . ASP D 1 43  ? -24.499 -2.154  4.746   1.00 61.13 ? 43  ASP D OD1  1  
ATOM 7803   O OD2  . ASP D 1 43  ? -26.327 -1.019  4.463   1.00 21.40 ? 43  ASP D OD2  1  
ATOM 7804   H H    . ASP D 1 43  ? -22.100 -1.099  2.250   1.00 44.12 ? 43  ASP D H    1  
ATOM 7805   H HA   . ASP D 1 43  ? -24.913 -0.316  1.754   1.00 31.14 ? 43  ASP D HA   1  
ATOM 7806   H HB2  . ASP D 1 43  ? -23.332 0.104   4.336   1.00 41.51 ? 43  ASP D HB2  1  
ATOM 7807   H HB3  . ASP D 1 43  ? -24.822 0.964   3.967   1.00 13.41 ? 43  ASP D HB3  1  
ATOM 7808   N N    . LEU D 1 44  ? -24.274 2.031   1.211   1.00 14.13 ? 44  LEU D N    1  
ATOM 7809   C CA   . LEU D 1 44  ? -23.926 3.379   0.757   1.00 52.23 ? 44  LEU D CA   1  
ATOM 7810   C C    . LEU D 1 44  ? -24.736 4.380   1.571   1.00 41.50 ? 44  LEU D C    1  
ATOM 7811   O O    . LEU D 1 44  ? -25.924 4.162   1.840   1.00 34.21 ? 44  LEU D O    1  
ATOM 7812   C CB   . LEU D 1 44  ? -24.193 3.538   -0.767  1.00 53.51 ? 44  LEU D CB   1  
ATOM 7813   C CG   . LEU D 1 44  ? -23.339 2.620   -1.696  1.00 53.34 ? 44  LEU D CG   1  
ATOM 7814   C CD1  . LEU D 1 44  ? -23.757 2.784   -3.161  1.00 3.21  ? 44  LEU D CD1  1  
ATOM 7815   C CD2  . LEU D 1 44  ? -21.822 2.876   -1.512  1.00 71.12 ? 44  LEU D CD2  1  
ATOM 7816   H H    . LEU D 1 44  ? -25.208 1.749   1.140   1.00 22.43 ? 44  LEU D H    1  
ATOM 7817   H HA   . LEU D 1 44  ? -22.865 3.548   0.948   1.00 0.11  ? 44  LEU D HA   1  
ATOM 7818   H HB2  . LEU D 1 44  ? -25.245 3.334   -0.955  1.00 23.54 ? 44  LEU D HB2  1  
ATOM 7819   H HB3  . LEU D 1 44  ? -23.998 4.571   -1.048  1.00 42.35 ? 44  LEU D HB3  1  
ATOM 7820   H HG   . LEU D 1 44  ? -23.526 1.584   -1.425  1.00 45.05 ? 44  LEU D HG   1  
ATOM 7821   H HD11 . LEU D 1 44  ? -23.602 3.810   -3.479  1.00 41.54 ? 44  LEU D HD11 1  
ATOM 7822   H HD12 . LEU D 1 44  ? -24.803 2.531   -3.269  1.00 51.11 ? 44  LEU D HD12 1  
ATOM 7823   H HD13 . LEU D 1 44  ? -23.170 2.124   -3.785  1.00 64.00 ? 44  LEU D HD13 1  
ATOM 7824   H HD21 . LEU D 1 44  ? -21.539 2.667   -0.489  1.00 62.22 ? 44  LEU D HD21 1  
ATOM 7825   H HD22 . LEU D 1 44  ? -21.588 3.908   -1.744  1.00 25.31 ? 44  LEU D HD22 1  
ATOM 7826   H HD23 . LEU D 1 44  ? -21.261 2.226   -2.172  1.00 72.41 ? 44  LEU D HD23 1  
ATOM 7827   N N    . ASP D 1 45  ? -24.061 5.441   2.000   1.00 63.21 ? 45  ASP D N    1  
ATOM 7828   C CA   . ASP D 1 45  ? -24.668 6.575   2.695   1.00 11.13 ? 45  ASP D CA   1  
ATOM 7829   C C    . ASP D 1 45  ? -24.034 7.838   2.137   1.00 44.10 ? 45  ASP D C    1  
ATOM 7830   O O    . ASP D 1 45  ? -22.807 7.911   2.021   1.00 44.21 ? 45  ASP D O    1  
ATOM 7831   C CB   . ASP D 1 45  ? -24.449 6.469   4.227   1.00 12.14 ? 45  ASP D CB   1  
ATOM 7832   C CG   . ASP D 1 45  ? -25.157 7.580   5.016   1.00 70.14 ? 45  ASP D CG   1  
ATOM 7833   O OD1  . ASP D 1 45  ? -26.407 7.621   5.002   1.00 42.21 ? 45  ASP D OD1  1  
ATOM 7834   O OD2  . ASP D 1 45  ? -24.475 8.401   5.659   1.00 22.40 ? 45  ASP D OD2  1  
ATOM 7835   H H    . ASP D 1 45  ? -23.096 5.468   1.839   1.00 14.42 ? 45  ASP D H    1  
ATOM 7836   H HA   . ASP D 1 45  ? -25.741 6.584   2.480   1.00 42.35 ? 45  ASP D HA   1  
ATOM 7837   H HB2  . ASP D 1 45  ? -24.826 5.512   4.573   1.00 62.31 ? 45  ASP D HB2  1  
ATOM 7838   H HB3  . ASP D 1 45  ? -23.381 6.511   4.442   1.00 53.04 ? 45  ASP D HB3  1  
ATOM 7839   N N    . THR D 1 46  ? -24.854 8.820   1.773   1.00 61.32 ? 46  THR D N    1  
ATOM 7840   C CA   . THR D 1 46  ? -24.365 10.055  1.154   1.00 62.41 ? 46  THR D CA   1  
ATOM 7841   C C    . THR D 1 46  ? -24.389 11.190  2.184   1.00 61.21 ? 46  THR D C    1  
ATOM 7842   O O    . THR D 1 46  ? -25.226 11.209  3.102   1.00 20.52 ? 46  THR D O    1  
ATOM 7843   C CB   . THR D 1 46  ? -25.206 10.444  -0.115  1.00 10.23 ? 46  THR D CB   1  
ATOM 7844   O OG1  . THR D 1 46  ? -24.531 11.483  -0.848  1.00 62.44 ? 46  THR D OG1  1  
ATOM 7845   C CG2  . THR D 1 46  ? -26.639 10.914  0.231   1.00 21.41 ? 46  THR D CG2  1  
ATOM 7846   H H    . THR D 1 46  ? -25.818 8.721   1.937   1.00 4.05  ? 46  THR D H    1  
ATOM 7847   H HA   . THR D 1 46  ? -23.330 9.896   0.832   1.00 25.21 ? 46  THR D HA   1  
ATOM 7848   H HB   . THR D 1 46  ? -25.276 9.567   -0.754  1.00 60.33 ? 46  THR D HB   1  
ATOM 7849   H HG1  . THR D 1 46  ? -24.712 11.385  -1.787  1.00 61.21 ? 46  THR D HG1  1  
ATOM 7850   H HG21 . THR D 1 46  ? -26.605 11.900  0.680   1.00 24.22 ? 46  THR D HG21 1  
ATOM 7851   H HG22 . THR D 1 46  ? -27.088 10.229  0.935   1.00 22.31 ? 46  THR D HG22 1  
ATOM 7852   H HG23 . THR D 1 46  ? -27.242 10.949  -0.668  1.00 22.44 ? 46  THR D HG23 1  
ATOM 7853   N N    . ALA D 1 47  ? -23.439 12.100  2.033   1.00 51.53 ? 47  ALA D N    1  
ATOM 7854   C CA   . ALA D 1 47  ? -23.351 13.329  2.813   1.00 11.45 ? 47  ALA D CA   1  
ATOM 7855   C C    . ALA D 1 47  ? -22.679 14.399  1.958   1.00 0.23  ? 47  ALA D C    1  
ATOM 7856   O O    . ALA D 1 47  ? -22.067 14.083  0.927   1.00 31.21 ? 47  ALA D O    1  
ATOM 7857   C CB   . ALA D 1 47  ? -22.570 13.103  4.121   1.00 53.31 ? 47  ALA D CB   1  
ATOM 7858   H H    . ALA D 1 47  ? -22.754 11.941  1.349   1.00 13.31 ? 47  ALA D H    1  
ATOM 7859   H HA   . ALA D 1 47  ? -24.365 13.652  3.058   1.00 41.52 ? 47  ALA D HA   1  
ATOM 7860   H HB1  . ALA D 1 47  ? -23.073 12.351  4.714   1.00 12.02 ? 47  ALA D HB1  1  
ATOM 7861   H HB2  . ALA D 1 47  ? -22.522 14.025  4.689   1.00 34.22 ? 47  ALA D HB2  1  
ATOM 7862   H HB3  . ALA D 1 47  ? -21.565 12.767  3.898   1.00 73.13 ? 47  ALA D HB3  1  
ATOM 7863   N N    . SER D 1 48  ? -22.788 15.655  2.397   1.00 62.41 ? 48  SER D N    1  
ATOM 7864   C CA   . SER D 1 48  ? -22.196 16.802  1.702   1.00 43.22 ? 48  SER D CA   1  
ATOM 7865   C C    . SER D 1 48  ? -22.167 18.027  2.631   1.00 52.10 ? 48  SER D C    1  
ATOM 7866   O O    . SER D 1 48  ? -22.968 18.117  3.574   1.00 33.54 ? 48  SER D O    1  
ATOM 7867   C CB   . SER D 1 48  ? -22.966 17.079  0.379   1.00 23.53 ? 48  SER D CB   1  
ATOM 7868   O OG   . SER D 1 48  ? -24.367 17.197  0.589   1.00 51.21 ? 48  SER D OG   1  
ATOM 7869   H H    . SER D 1 48  ? -23.299 15.825  3.219   1.00 12.02 ? 48  SER D H    1  
ATOM 7870   H HA   . SER D 1 48  ? -21.164 16.541  1.459   1.00 22.31 ? 48  SER D HA   1  
ATOM 7871   H HB2  . SER D 1 48  ? -22.607 17.998  -0.066  1.00 33.40 ? 48  SER D HB2  1  
ATOM 7872   H HB3  . SER D 1 48  ? -22.784 16.255  -0.311  1.00 24.01 ? 48  SER D HB3  1  
ATOM 7873   H HG   . SER D 1 48  ? -24.536 17.826  1.292   1.00 52.41 ? 48  SER D HG   1  
ATOM 7874   N N    . SER D 1 49  ? -21.244 18.969  2.353   1.00 42.01 ? 49  SER D N    1  
ATOM 7875   C CA   . SER D 1 49  ? -20.953 20.109  3.247   1.00 55.23 ? 49  SER D CA   1  
ATOM 7876   C C    . SER D 1 49  ? -20.449 21.316  2.439   1.00 71.35 ? 49  SER D C    1  
ATOM 7877   O O    . SER D 1 49  ? -19.466 21.204  1.703   1.00 63.24 ? 49  SER D O    1  
ATOM 7878   C CB   . SER D 1 49  ? -19.881 19.681  4.274   1.00 42.32 ? 49  SER D CB   1  
ATOM 7879   O OG   . SER D 1 49  ? -19.467 20.760  5.099   1.00 63.45 ? 49  SER D OG   1  
ATOM 7880   H H    . SER D 1 49  ? -20.732 18.895  1.521   1.00 31.33 ? 49  SER D H    1  
ATOM 7881   H HA   . SER D 1 49  ? -21.867 20.384  3.775   1.00 5.10  ? 49  SER D HA   1  
ATOM 7882   H HB2  . SER D 1 49  ? -20.284 18.905  4.911   1.00 10.53 ? 49  SER D HB2  1  
ATOM 7883   H HB3  . SER D 1 49  ? -19.013 19.292  3.752   1.00 64.22 ? 49  SER D HB3  1  
ATOM 7884   H HG   . SER D 1 49  ? -18.558 20.994  4.884   1.00 11.43 ? 49  SER D HG   1  
ATOM 7885   N N    . GLN D 1 50  ? -21.132 22.469  2.584   1.00 31.31 ? 50  GLN D N    1  
ATOM 7886   C CA   . GLN D 1 50  ? -20.711 23.730  1.949   1.00 63.12 ? 50  GLN D CA   1  
ATOM 7887   C C    . GLN D 1 50  ? -19.477 24.259  2.703   1.00 41.11 ? 50  GLN D C    1  
ATOM 7888   O O    . GLN D 1 50  ? -19.561 24.552  3.900   1.00 32.33 ? 50  GLN D O    1  
ATOM 7889   C CB   . GLN D 1 50  ? -21.864 24.778  2.003   1.00 4.34  ? 50  GLN D CB   1  
ATOM 7890   C CG   . GLN D 1 50  ? -21.691 26.001  1.056   1.00 13.43 ? 50  GLN D CG   1  
ATOM 7891   C CD   . GLN D 1 50  ? -22.069 25.702  -0.402  1.00 41.14 ? 50  GLN D CD   1  
ATOM 7892   O OE1  . GLN D 1 50  ? -22.934 24.878  -0.671  1.00 14.05 ? 50  GLN D OE1  1  
ATOM 7893   N NE2  . GLN D 1 50  ? -21.461 26.394  -1.352  1.00 72.02 ? 50  GLN D NE2  1  
ATOM 7894   H H    . GLN D 1 50  ? -21.938 22.474  3.148   1.00 34.12 ? 50  GLN D H    1  
ATOM 7895   H HA   . GLN D 1 50  ? -20.450 23.526  0.913   1.00 30.51 ? 50  GLN D HA   1  
ATOM 7896   H HB2  . GLN D 1 50  ? -22.794 24.281  1.740   1.00 23.01 ? 50  GLN D HB2  1  
ATOM 7897   H HB3  . GLN D 1 50  ? -21.959 25.144  3.022   1.00 54.42 ? 50  GLN D HB3  1  
ATOM 7898   H HG2  . GLN D 1 50  ? -22.325 26.808  1.404   1.00 14.13 ? 50  GLN D HG2  1  
ATOM 7899   H HG3  . GLN D 1 50  ? -20.655 26.327  1.091   1.00 55.22 ? 50  GLN D HG3  1  
ATOM 7900   H HE21 . GLN D 1 50  ? -20.806 27.066  -1.089  1.00 5.45  ? 50  GLN D HE21 1  
ATOM 7901   H HE22 . GLN D 1 50  ? -21.692 26.197  -2.279  1.00 1.02  ? 50  GLN D HE22 1  
ATOM 7902   N N    . LEU D 1 51  ? -18.335 24.345  2.014   1.00 75.51 ? 51  LEU D N    1  
ATOM 7903   C CA   . LEU D 1 51  ? -17.064 24.792  2.625   1.00 33.33 ? 51  LEU D CA   1  
ATOM 7904   C C    . LEU D 1 51  ? -16.902 26.309  2.456   1.00 74.33 ? 51  LEU D C    1  
ATOM 7905   O O    . LEU D 1 51  ? -16.469 27.015  3.374   1.00 54.15 ? 51  LEU D O    1  
ATOM 7906   C CB   . LEU D 1 51  ? -15.878 24.041  1.969   1.00 30.10 ? 51  LEU D CB   1  
ATOM 7907   C CG   . LEU D 1 51  ? -15.976 22.482  1.952   1.00 34.44 ? 51  LEU D CG   1  
ATOM 7908   C CD1  . LEU D 1 51  ? -14.753 21.868  1.251   1.00 3.52  ? 51  LEU D CD1  1  
ATOM 7909   C CD2  . LEU D 1 51  ? -16.168 21.894  3.371   1.00 11.11 ? 51  LEU D CD2  1  
ATOM 7910   H H    . LEU D 1 51  ? -18.344 24.102  1.063   1.00 74.14 ? 51  LEU D H    1  
ATOM 7911   H HA   . LEU D 1 51  ? -17.087 24.559  3.687   1.00 1.20  ? 51  LEU D HA   1  
ATOM 7912   H HB2  . LEU D 1 51  ? -15.787 24.385  0.939   1.00 53.21 ? 51  LEU D HB2  1  
ATOM 7913   H HB3  . LEU D 1 51  ? -14.969 24.317  2.494   1.00 42.31 ? 51  LEU D HB3  1  
ATOM 7914   H HG   . LEU D 1 51  ? -16.847 22.200  1.368   1.00 21.34 ? 51  LEU D HG   1  
ATOM 7915   H HD11 . LEU D 1 51  ? -14.731 22.189  0.218   1.00 11.44 ? 51  LEU D HD11 1  
ATOM 7916   H HD12 . LEU D 1 51  ? -14.814 20.788  1.280   1.00 21.31 ? 51  LEU D HD12 1  
ATOM 7917   H HD13 . LEU D 1 51  ? -13.841 22.188  1.739   1.00 64.42 ? 51  LEU D HD13 1  
ATOM 7918   H HD21 . LEU D 1 51  ? -17.087 22.274  3.798   1.00 51.23 ? 51  LEU D HD21 1  
ATOM 7919   H HD22 . LEU D 1 51  ? -15.336 22.174  4.006   1.00 22.41 ? 51  LEU D HD22 1  
ATOM 7920   H HD23 . LEU D 1 51  ? -16.226 20.815  3.312   1.00 72.32 ? 51  LEU D HD23 1  
ATOM 7921   N N    . ALA D 1 52  ? -17.271 26.775  1.258   1.00 12.41 ? 52  ALA D N    1  
ATOM 7922   C CA   . ALA D 1 52  ? -17.243 28.195  0.877   1.00 22.21 ? 52  ALA D CA   1  
ATOM 7923   C C    . ALA D 1 52  ? -18.238 28.432  -0.259  1.00 1.22  ? 52  ALA D C    1  
ATOM 7924   O O    . ALA D 1 52  ? -18.952 27.510  -0.663  1.00 35.04 ? 52  ALA D O    1  
ATOM 7925   C CB   . ALA D 1 52  ? -15.823 28.614  0.451   1.00 41.32 ? 52  ALA D CB   1  
ATOM 7926   H H    . ALA D 1 52  ? -17.588 26.130  0.592   1.00 11.22 ? 52  ALA D H    1  
ATOM 7927   H HA   . ALA D 1 52  ? -17.540 28.793  1.733   1.00 31.44 ? 52  ALA D HA   1  
ATOM 7928   H HB1  . ALA D 1 52  ? -15.853 29.594  -0.012  1.00 23.14 ? 52  ALA D HB1  1  
ATOM 7929   H HB2  . ALA D 1 52  ? -15.417 27.896  -0.249  1.00 41.15 ? 52  ALA D HB2  1  
ATOM 7930   H HB3  . ALA D 1 52  ? -15.193 28.661  1.318   1.00 22.03 ? 52  ALA D HB3  1  
ATOM 7931   N N    . ASP D 1 53  ? -18.249 29.668  -0.783  1.00 53.45 ? 53  ASP D N    1  
ATOM 7932   C CA   . ASP D 1 53  ? -19.112 30.056  -1.929  1.00 74.50 ? 53  ASP D CA   1  
ATOM 7933   C C    . ASP D 1 53  ? -18.661 29.299  -3.188  1.00 1.43  ? 53  ASP D C    1  
ATOM 7934   O O    . ASP D 1 53  ? -17.471 29.323  -3.512  1.00 25.13 ? 53  ASP D O    1  
ATOM 7935   C CB   . ASP D 1 53  ? -19.051 31.583  -2.181  1.00 73.21 ? 53  ASP D CB   1  
ATOM 7936   C CG   . ASP D 1 53  ? -19.471 32.405  -0.959  1.00 33.54 ? 53  ASP D CG   1  
ATOM 7937   O OD1  . ASP D 1 53  ? -18.591 32.774  -0.144  1.00 64.43 ? 53  ASP D OD1  1  
ATOM 7938   O OD2  . ASP D 1 53  ? -20.678 32.677  -0.800  1.00 33.22 ? 53  ASP D OD2  1  
ATOM 7939   H H    . ASP D 1 53  ? -17.640 30.343  -0.395  1.00 23.01 ? 53  ASP D H    1  
ATOM 7940   H HA   . ASP D 1 53  ? -20.135 29.772  -1.683  1.00 51.42 ? 53  ASP D HA   1  
ATOM 7941   H HB2  . ASP D 1 53  ? -18.039 31.858  -2.460  1.00 2.21  ? 53  ASP D HB2  1  
ATOM 7942   H HB3  . ASP D 1 53  ? -19.710 31.835  -3.010  1.00 71.01 ? 53  ASP D HB3  1  
ATOM 7943   N N    . ASP D 1 54  ? -19.607 28.573  -3.831  1.00 22.53 ? 54  ASP D N    1  
ATOM 7944   C CA   . ASP D 1 54  ? -19.351 27.689  -5.007  1.00 0.52  ? 54  ASP D CA   1  
ATOM 7945   C C    . ASP D 1 54  ? -18.424 26.499  -4.702  1.00 50.11 ? 54  ASP D C    1  
ATOM 7946   O O    . ASP D 1 54  ? -18.136 25.705  -5.595  1.00 20.35 ? 54  ASP D O    1  
ATOM 7947   C CB   . ASP D 1 54  ? -18.805 28.484  -6.240  1.00 14.34 ? 54  ASP D CB   1  
ATOM 7948   C CG   . ASP D 1 54  ? -19.839 29.363  -6.951  1.00 23.14 ? 54  ASP D CG   1  
ATOM 7949   O OD1  . ASP D 1 54  ? -19.440 30.115  -7.866  1.00 21.05 ? 54  ASP D OD1  1  
ATOM 7950   O OD2  . ASP D 1 54  ? -21.049 29.297  -6.622  1.00 12.34 ? 54  ASP D OD2  1  
ATOM 7951   H H    . ASP D 1 54  ? -20.530 28.650  -3.512  1.00 24.11 ? 54  ASP D H    1  
ATOM 7952   H HA   . ASP D 1 54  ? -20.315 27.271  -5.281  1.00 44.32 ? 54  ASP D HA   1  
ATOM 7953   H HB2  . ASP D 1 54  ? -17.995 29.123  -5.907  1.00 74.21 ? 54  ASP D HB2  1  
ATOM 7954   H HB3  . ASP D 1 54  ? -18.407 27.780  -6.970  1.00 33.21 ? 54  ASP D HB3  1  
ATOM 7955   N N    . VAL D 1 55  ? -17.960 26.366  -3.450  1.00 44.32 ? 55  VAL D N    1  
ATOM 7956   C CA   . VAL D 1 55  ? -17.087 25.270  -3.037  1.00 61.44 ? 55  VAL D CA   1  
ATOM 7957   C C    . VAL D 1 55  ? -17.900 24.338  -2.157  1.00 15.44 ? 55  VAL D C    1  
ATOM 7958   O O    . VAL D 1 55  ? -18.321 24.707  -1.047  1.00 14.42 ? 55  VAL D O    1  
ATOM 7959   C CB   . VAL D 1 55  ? -15.808 25.765  -2.279  1.00 5.33  ? 55  VAL D CB   1  
ATOM 7960   C CG1  . VAL D 1 55  ? -14.961 24.555  -1.814  1.00 33.43 ? 55  VAL D CG1  1  
ATOM 7961   C CG2  . VAL D 1 55  ? -14.982 26.736  -3.158  1.00 31.54 ? 55  VAL D CG2  1  
ATOM 7962   H H    . VAL D 1 55  ? -18.227 27.020  -2.778  1.00 44.33 ? 55  VAL D H    1  
ATOM 7963   H HA   . VAL D 1 55  ? -16.759 24.728  -3.933  1.00 24.43 ? 55  VAL D HA   1  
ATOM 7964   H HB   . VAL D 1 55  ? -16.127 26.309  -1.389  1.00 51.24 ? 55  VAL D HB   1  
ATOM 7965   H HG11 . VAL D 1 55  ? -15.477 24.026  -1.022  1.00 25.14 ? 55  VAL D HG11 1  
ATOM 7966   H HG12 . VAL D 1 55  ? -14.010 24.890  -1.458  1.00 43.15 ? 55  VAL D HG12 1  
ATOM 7967   H HG13 . VAL D 1 55  ? -14.803 23.878  -2.643  1.00 24.25 ? 55  VAL D HG13 1  
ATOM 7968   H HG21 . VAL D 1 55  ? -14.654 26.227  -4.057  1.00 72.41 ? 55  VAL D HG21 1  
ATOM 7969   H HG22 . VAL D 1 55  ? -14.116 27.086  -2.611  1.00 54.23 ? 55  VAL D HG22 1  
ATOM 7970   H HG23 . VAL D 1 55  ? -15.594 27.587  -3.435  1.00 3.15  ? 55  VAL D HG23 1  
ATOM 7971   N N    . TYR D 1 56  ? -18.109 23.134  -2.660  1.00 5.11  ? 56  TYR D N    1  
ATOM 7972   C CA   . TYR D 1 56  ? -19.016 22.173  -2.061  1.00 4.15  ? 56  TYR D CA   1  
ATOM 7973   C C    . TYR D 1 56  ? -18.306 20.819  -2.001  1.00 22.15 ? 56  TYR D C    1  
ATOM 7974   O O    . TYR D 1 56  ? -17.764 20.335  -3.000  1.00 13.42 ? 56  TYR D O    1  
ATOM 7975   C CB   . TYR D 1 56  ? -20.341 22.087  -2.896  1.00 24.11 ? 56  TYR D CB   1  
ATOM 7976   C CG   . TYR D 1 56  ? -21.605 21.775  -2.073  1.00 41.50 ? 56  TYR D CG   1  
ATOM 7977   C CD1  . TYR D 1 56  ? -21.566 20.932  -0.964  1.00 51.11 ? 56  TYR D CD1  1  
ATOM 7978   C CD2  . TYR D 1 56  ? -22.839 22.340  -2.405  1.00 52.15 ? 56  TYR D CD2  1  
ATOM 7979   C CE1  . TYR D 1 56  ? -22.690 20.669  -0.221  1.00 24.30 ? 56  TYR D CE1  1  
ATOM 7980   C CE2  . TYR D 1 56  ? -23.970 22.073  -1.660  1.00 25.21 ? 56  TYR D CE2  1  
ATOM 7981   C CZ   . TYR D 1 56  ? -23.886 21.237  -0.567  1.00 75.14 ? 56  TYR D CZ   1  
ATOM 7982   O OH   . TYR D 1 56  ? -25.005 20.972  0.188   1.00 1.04  ? 56  TYR D OH   1  
ATOM 7983   H H    . TYR D 1 56  ? -17.604 22.870  -3.455  1.00 33.22 ? 56  TYR D H    1  
ATOM 7984   H HA   . TYR D 1 56  ? -19.252 22.501  -1.044  1.00 41.52 ? 56  TYR D HA   1  
ATOM 7985   H HB2  . TYR D 1 56  ? -20.501 23.039  -3.394  1.00 5.40  ? 56  TYR D HB2  1  
ATOM 7986   H HB3  . TYR D 1 56  ? -20.246 21.320  -3.661  1.00 11.12 ? 56  TYR D HB3  1  
ATOM 7987   H HD1  . TYR D 1 56  ? -20.624 20.478  -0.680  1.00 24.34 ? 56  TYR D HD1  1  
ATOM 7988   H HD2  . TYR D 1 56  ? -22.905 22.998  -3.263  1.00 25.24 ? 56  TYR D HD2  1  
ATOM 7989   H HE1  . TYR D 1 56  ? -22.625 20.006  0.636   1.00 63.21 ? 56  TYR D HE1  1  
ATOM 7990   H HE2  . TYR D 1 56  ? -24.917 22.523  -1.933  1.00 44.50 ? 56  TYR D HE2  1  
ATOM 7991   H HH   . TYR D 1 56  ? -25.731 20.719  -0.383  1.00 61.22 ? 56  TYR D HH   1  
ATOM 7992   N N    . GLU D 1 57  ? -18.329 20.224  -0.822  1.00 53.24 ? 57  GLU D N    1  
ATOM 7993   C CA   . GLU D 1 57  ? -17.764 18.911  -0.555  1.00 33.42 ? 57  GLU D CA   1  
ATOM 7994   C C    . GLU D 1 57  ? -18.878 17.871  -0.555  1.00 30.30 ? 57  GLU D C    1  
ATOM 7995   O O    . GLU D 1 57  ? -20.017 18.173  -0.214  1.00 20.45 ? 57  GLU D O    1  
ATOM 7996   C CB   . GLU D 1 57  ? -17.047 18.948  0.815   1.00 40.32 ? 57  GLU D CB   1  
ATOM 7997   C CG   . GLU D 1 57  ? -16.566 17.591  1.359   1.00 21.33 ? 57  GLU D CG   1  
ATOM 7998   C CD   . GLU D 1 57  ? -16.098 17.681  2.811   1.00 42.43 ? 57  GLU D CD   1  
ATOM 7999   O OE1  . GLU D 1 57  ? -14.899 17.543  3.080   1.00 23.13 ? 57  GLU D OE1  1  
ATOM 8000   O OE2  . GLU D 1 57  ? -16.947 17.897  3.703   1.00 32.21 ? 57  GLU D OE2  1  
ATOM 8001   H H    . GLU D 1 57  ? -18.765 20.688  -0.082  1.00 0.32  ? 57  GLU D H    1  
ATOM 8002   H HA   . GLU D 1 57  ? -17.050 18.656  -1.340  1.00 51.31 ? 57  GLU D HA   1  
ATOM 8003   H HB2  . GLU D 1 57  ? -16.179 19.597  0.729   1.00 31.33 ? 57  GLU D HB2  1  
ATOM 8004   H HB3  . GLU D 1 57  ? -17.724 19.387  1.546   1.00 52.13 ? 57  GLU D HB3  1  
ATOM 8005   H HG2  . GLU D 1 57  ? -17.389 16.883  1.307   1.00 24.21 ? 57  GLU D HG2  1  
ATOM 8006   H HG3  . GLU D 1 57  ? -15.753 17.226  0.739   1.00 43.01 ? 57  GLU D HG3  1  
ATOM 8007   N N    . VAL D 1 58  ? -18.536 16.661  -0.991  1.00 14.14 ? 58  VAL D N    1  
ATOM 8008   C CA   . VAL D 1 58  ? -19.390 15.482  -0.897  1.00 41.13 ? 58  VAL D CA   1  
ATOM 8009   C C    . VAL D 1 58  ? -18.604 14.408  -0.148  1.00 34.22 ? 58  VAL D C    1  
ATOM 8010   O O    . VAL D 1 58  ? -17.456 14.138  -0.497  1.00 20.53 ? 58  VAL D O    1  
ATOM 8011   C CB   . VAL D 1 58  ? -19.794 14.960  -2.321  1.00 62.33 ? 58  VAL D CB   1  
ATOM 8012   C CG1  . VAL D 1 58  ? -20.722 13.733  -2.216  1.00 22.43 ? 58  VAL D CG1  1  
ATOM 8013   C CG2  . VAL D 1 58  ? -20.437 16.089  -3.153  1.00 72.41 ? 58  VAL D CG2  1  
ATOM 8014   H H    . VAL D 1 58  ? -17.651 16.549  -1.399  1.00 2.10  ? 58  VAL D H    1  
ATOM 8015   H HA   . VAL D 1 58  ? -20.298 15.731  -0.336  1.00 52.44 ? 58  VAL D HA   1  
ATOM 8016   H HB   . VAL D 1 58  ? -18.884 14.646  -2.836  1.00 23.13 ? 58  VAL D HB   1  
ATOM 8017   H HG11 . VAL D 1 58  ? -20.211 12.935  -1.704  1.00 64.40 ? 58  VAL D HG11 1  
ATOM 8018   H HG12 . VAL D 1 58  ? -21.012 13.397  -3.202  1.00 61.03 ? 58  VAL D HG12 1  
ATOM 8019   H HG13 . VAL D 1 58  ? -21.597 13.995  -1.655  1.00 61.24 ? 58  VAL D HG13 1  
ATOM 8020   H HG21 . VAL D 1 58  ? -21.426 16.318  -2.771  1.00 32.42 ? 58  VAL D HG21 1  
ATOM 8021   H HG22 . VAL D 1 58  ? -20.510 15.788  -4.180  1.00 5.45  ? 58  VAL D HG22 1  
ATOM 8022   H HG23 . VAL D 1 58  ? -19.826 16.981  -3.103  1.00 40.12 ? 58  VAL D HG23 1  
ATOM 8023   N N    . VAL D 1 59  ? -19.191 13.840  0.906   1.00 45.23 ? 59  VAL D N    1  
ATOM 8024   C CA   . VAL D 1 59  ? -18.571 12.756  1.671   1.00 25.00 ? 59  VAL D CA   1  
ATOM 8025   C C    . VAL D 1 59  ? -19.337 11.453  1.402   1.00 73.22 ? 59  VAL D C    1  
ATOM 8026   O O    . VAL D 1 59  ? -20.499 11.317  1.804   1.00 51.01 ? 59  VAL D O    1  
ATOM 8027   C CB   . VAL D 1 59  ? -18.544 13.080  3.210   1.00 23.43 ? 59  VAL D CB   1  
ATOM 8028   C CG1  . VAL D 1 59  ? -17.855 11.945  4.005   1.00 63.13 ? 59  VAL D CG1  1  
ATOM 8029   C CG2  . VAL D 1 59  ? -17.879 14.454  3.475   1.00 44.35 ? 59  VAL D CG2  1  
ATOM 8030   H H    . VAL D 1 59  ? -20.074 14.154  1.176   1.00 75.22 ? 59  VAL D H    1  
ATOM 8031   H HA   . VAL D 1 59  ? -17.540 12.637  1.326   1.00 41.22 ? 59  VAL D HA   1  
ATOM 8032   H HB   . VAL D 1 59  ? -19.575 13.142  3.559   1.00 1.32  ? 59  VAL D HB   1  
ATOM 8033   H HG11 . VAL D 1 59  ? -16.874 11.751  3.591   1.00 4.22  ? 59  VAL D HG11 1  
ATOM 8034   H HG12 . VAL D 1 59  ? -18.448 11.043  3.944   1.00 42.10 ? 59  VAL D HG12 1  
ATOM 8035   H HG13 . VAL D 1 59  ? -17.754 12.232  5.044   1.00 41.30 ? 59  VAL D HG13 1  
ATOM 8036   H HG21 . VAL D 1 59  ? -17.813 14.630  4.535   1.00 63.14 ? 59  VAL D HG21 1  
ATOM 8037   H HG22 . VAL D 1 59  ? -18.471 15.238  3.022   1.00 21.11 ? 59  VAL D HG22 1  
ATOM 8038   H HG23 . VAL D 1 59  ? -16.881 14.476  3.051   1.00 2.13  ? 59  VAL D HG23 1  
ATOM 8039   N N    . LEU D 1 60  ? -18.693 10.525  0.678   1.00 43.21 ? 60  LEU D N    1  
ATOM 8040   C CA   . LEU D 1 60  ? -19.280 9.218   0.360   1.00 30.45 ? 60  LEU D CA   1  
ATOM 8041   C C    . LEU D 1 60  ? -18.886 8.213   1.466   1.00 34.10 ? 60  LEU D C    1  
ATOM 8042   O O    . LEU D 1 60  ? -17.699 7.939   1.663   1.00 11.32 ? 60  LEU D O    1  
ATOM 8043   C CB   . LEU D 1 60  ? -18.795 8.705   -1.044  1.00 74.21 ? 60  LEU D CB   1  
ATOM 8044   C CG   . LEU D 1 60  ? -19.819 7.872   -1.909  1.00 22.21 ? 60  LEU D CG   1  
ATOM 8045   C CD1  . LEU D 1 60  ? -19.091 7.022   -2.978  1.00 31.40 ? 60  LEU D CD1  1  
ATOM 8046   C CD2  . LEU D 1 60  ? -20.769 6.996   -1.050  1.00 43.43 ? 60  LEU D CD2  1  
ATOM 8047   H H    . LEU D 1 60  ? -17.797 10.728  0.344   1.00 13.12 ? 60  LEU D H    1  
ATOM 8048   H HA   . LEU D 1 60  ? -20.363 9.330   0.347   1.00 62.34 ? 60  LEU D HA   1  
ATOM 8049   H HB2  . LEU D 1 60  ? -18.508 9.573   -1.631  1.00 22.12 ? 60  LEU D HB2  1  
ATOM 8050   H HB3  . LEU D 1 60  ? -17.900 8.106   -0.902  1.00 51.53 ? 60  LEU D HB3  1  
ATOM 8051   H HG   . LEU D 1 60  ? -20.442 8.576   -2.450  1.00 52.25 ? 60  LEU D HG   1  
ATOM 8052   H HD11 . LEU D 1 60  ? -18.460 6.285   -2.501  1.00 0.52  ? 60  LEU D HD11 1  
ATOM 8053   H HD12 . LEU D 1 60  ? -18.485 7.659   -3.603  1.00 22.25 ? 60  LEU D HD12 1  
ATOM 8054   H HD13 . LEU D 1 60  ? -19.817 6.523   -3.599  1.00 34.04 ? 60  LEU D HD13 1  
ATOM 8055   H HD21 . LEU D 1 60  ? -21.385 7.634   -0.432  1.00 43.13 ? 60  LEU D HD21 1  
ATOM 8056   H HD22 . LEU D 1 60  ? -20.188 6.341   -0.412  1.00 35.44 ? 60  LEU D HD22 1  
ATOM 8057   H HD23 . LEU D 1 60  ? -21.400 6.401   -1.682  1.00 45.11 ? 60  LEU D HD23 1  
ATOM 8058   N N    . ARG D 1 61  ? -19.887 7.658   2.152   1.00 63.13 ? 61  ARG D N    1  
ATOM 8059   C CA   . ARG D 1 61  ? -19.686 6.622   3.173   1.00 62.13 ? 61  ARG D CA   1  
ATOM 8060   C C    . ARG D 1 61  ? -19.967 5.262   2.525   1.00 44.43 ? 61  ARG D C    1  
ATOM 8061   O O    . ARG D 1 61  ? -21.109 4.963   2.152   1.00 23.32 ? 61  ARG D O    1  
ATOM 8062   C CB   . ARG D 1 61  ? -20.627 6.846   4.381   1.00 73.55 ? 61  ARG D CB   1  
ATOM 8063   C CG   . ARG D 1 61  ? -20.458 5.806   5.510   1.00 11.21 ? 61  ARG D CG   1  
ATOM 8064   C CD   . ARG D 1 61  ? -21.585 5.868   6.553   1.00 53.22 ? 61  ARG D CD   1  
ATOM 8065   N NE   . ARG D 1 61  ? -21.813 7.228   7.054   1.00 34.51 ? 61  ARG D NE   1  
ATOM 8066   C CZ   . ARG D 1 61  ? -21.140 7.816   8.053   1.00 43.21 ? 61  ARG D CZ   1  
ATOM 8067   N NH1  . ARG D 1 61  ? -20.163 7.187   8.711   1.00 2.35  ? 61  ARG D NH1  1  
ATOM 8068   N NH2  . ARG D 1 61  ? -21.431 9.064   8.356   1.00 54.13 ? 61  ARG D NH2  1  
ATOM 8069   H H    . ARG D 1 61  ? -20.804 7.922   1.929   1.00 14.43 ? 61  ARG D H    1  
ATOM 8070   H HA   . ARG D 1 61  ? -18.649 6.658   3.515   1.00 51.35 ? 61  ARG D HA   1  
ATOM 8071   H HB2  . ARG D 1 61  ? -20.432 7.831   4.794   1.00 51.14 ? 61  ARG D HB2  1  
ATOM 8072   H HB3  . ARG D 1 61  ? -21.656 6.816   4.033   1.00 1.31  ? 61  ARG D HB3  1  
ATOM 8073   H HG2  . ARG D 1 61  ? -20.444 4.812   5.075   1.00 5.01  ? 61  ARG D HG2  1  
ATOM 8074   H HG3  . ARG D 1 61  ? -19.509 5.982   6.008   1.00 64.54 ? 61  ARG D HG3  1  
ATOM 8075   H HD2  . ARG D 1 61  ? -22.499 5.513   6.096   1.00 50.45 ? 61  ARG D HD2  1  
ATOM 8076   H HD3  . ARG D 1 61  ? -21.333 5.219   7.387   1.00 20.32 ? 61  ARG D HD3  1  
ATOM 8077   H HE   . ARG D 1 61  ? -22.535 7.740   6.619   1.00 15.04 ? 61  ARG D HE   1  
ATOM 8078   H HH11 . ARG D 1 61  ? -19.911 6.245   8.468   1.00 61.31 ? 61  ARG D HH11 1  
ATOM 8079   H HH12 . ARG D 1 61  ? -19.674 7.653   9.456   1.00 11.10 ? 61  ARG D HH12 1  
ATOM 8080   H HH21 . ARG D 1 61  ? -22.141 9.543   7.841   1.00 25.05 ? 61  ARG D HH21 1  
ATOM 8081   H HH22 . ARG D 1 61  ? -20.947 9.535   9.094   1.00 62.25 ? 61  ARG D HH22 1  
ATOM 8082   N N    . VAL D 1 62  ? -18.909 4.468   2.333   1.00 33.53 ? 62  VAL D N    1  
ATOM 8083   C CA   . VAL D 1 62  ? -18.994 3.145   1.697   1.00 31.41 ? 62  VAL D CA   1  
ATOM 8084   C C    . VAL D 1 62  ? -18.617 2.075   2.730   1.00 25.51 ? 62  VAL D C    1  
ATOM 8085   O O    . VAL D 1 62  ? -17.493 2.063   3.243   1.00 70.41 ? 62  VAL D O    1  
ATOM 8086   C CB   . VAL D 1 62  ? -18.059 3.064   0.438   1.00 72.51 ? 62  VAL D CB   1  
ATOM 8087   C CG1  . VAL D 1 62  ? -18.233 1.729   -0.319  1.00 23.34 ? 62  VAL D CG1  1  
ATOM 8088   C CG2  . VAL D 1 62  ? -18.300 4.269   -0.499  1.00 4.31  ? 62  VAL D CG2  1  
ATOM 8089   H H    . VAL D 1 62  ? -18.032 4.781   2.628   1.00 64.10 ? 62  VAL D H    1  
ATOM 8090   H HA   . VAL D 1 62  ? -20.026 2.976   1.368   1.00 10.23 ? 62  VAL D HA   1  
ATOM 8091   H HB   . VAL D 1 62  ? -17.027 3.114   0.780   1.00 55.31 ? 62  VAL D HB   1  
ATOM 8092   H HG11 . VAL D 1 62  ? -18.215 0.900   0.379   1.00 23.43 ? 62  VAL D HG11 1  
ATOM 8093   H HG12 . VAL D 1 62  ? -17.428 1.605   -1.023  1.00 14.22 ? 62  VAL D HG12 1  
ATOM 8094   H HG13 . VAL D 1 62  ? -19.155 1.728   -0.847  1.00 14.22 ? 62  VAL D HG13 1  
ATOM 8095   H HG21 . VAL D 1 62  ? -18.118 5.196   0.035   1.00 61.33 ? 62  VAL D HG21 1  
ATOM 8096   H HG22 . VAL D 1 62  ? -19.302 4.269   -0.870  1.00 11.52 ? 62  VAL D HG22 1  
ATOM 8097   H HG23 . VAL D 1 62  ? -17.633 4.215   -1.340  1.00 62.02 ? 62  VAL D HG23 1  
ATOM 8098   N N    . THR D 1 63  ? -19.567 1.188   3.011   1.00 4.42  ? 63  THR D N    1  
ATOM 8099   C CA   . THR D 1 63  ? -19.482 0.190   4.087   1.00 11.41 ? 63  THR D CA   1  
ATOM 8100   C C    . THR D 1 63  ? -19.470 -1.218  3.476   1.00 33.53 ? 63  THR D C    1  
ATOM 8101   O O    . THR D 1 63  ? -20.115 -1.453  2.450   1.00 74.53 ? 63  THR D O    1  
ATOM 8102   C CB   . THR D 1 63  ? -20.711 0.323   5.053   1.00 31.34 ? 63  THR D CB   1  
ATOM 8103   O OG1  . THR D 1 63  ? -20.908 1.703   5.411   1.00 71.51 ? 63  THR D OG1  1  
ATOM 8104   C CG2  . THR D 1 63  ? -20.546 -0.526  6.332   1.00 21.51 ? 63  THR D CG2  1  
ATOM 8105   H H    . THR D 1 63  ? -20.360 1.182   2.449   1.00 11.24 ? 63  THR D H    1  
ATOM 8106   H HA   . THR D 1 63  ? -18.565 0.355   4.656   1.00 31.42 ? 63  THR D HA   1  
ATOM 8107   H HB   . THR D 1 63  ? -21.601 -0.014  4.530   1.00 34.24 ? 63  THR D HB   1  
ATOM 8108   H HG1  . THR D 1 63  ? -20.707 1.826   6.339   1.00 1.50  ? 63  THR D HG1  1  
ATOM 8109   H HG21 . THR D 1 63  ? -21.458 -0.496  6.909   1.00 63.13 ? 63  THR D HG21 1  
ATOM 8110   H HG22 . THR D 1 63  ? -19.733 -0.133  6.929   1.00 64.23 ? 63  THR D HG22 1  
ATOM 8111   H HG23 . THR D 1 63  ? -20.326 -1.556  6.067   1.00 22.45 ? 63  THR D HG23 1  
ATOM 8112   N N    . VAL D 1 64  ? -18.710 -2.135  4.093   1.00 72.04 ? 64  VAL D N    1  
ATOM 8113   C CA   . VAL D 1 64  ? -18.691 -3.559  3.744   1.00 42.00 ? 64  VAL D CA   1  
ATOM 8114   C C    . VAL D 1 64  ? -18.645 -4.389  5.038   1.00 54.03 ? 64  VAL D C    1  
ATOM 8115   O O    . VAL D 1 64  ? -17.605 -4.459  5.708   1.00 51.13 ? 64  VAL D O    1  
ATOM 8116   C CB   . VAL D 1 64  ? -17.464 -3.964  2.833   1.00 11.31 ? 64  VAL D CB   1  
ATOM 8117   C CG1  . VAL D 1 64  ? -17.513 -5.482  2.495   1.00 33.04 ? 64  VAL D CG1  1  
ATOM 8118   C CG2  . VAL D 1 64  ? -17.386 -3.098  1.549   1.00 41.22 ? 64  VAL D CG2  1  
ATOM 8119   H H    . VAL D 1 64  ? -18.152 -1.843  4.825   1.00 31.04 ? 64  VAL D H    1  
ATOM 8120   H HA   . VAL D 1 64  ? -19.612 -3.791  3.207   1.00 62.11 ? 64  VAL D HA   1  
ATOM 8121   H HB   . VAL D 1 64  ? -16.551 -3.786  3.402   1.00 63.25 ? 64  VAL D HB   1  
ATOM 8122   H HG11 . VAL D 1 64  ? -17.373 -6.060  3.403   1.00 22.13 ? 64  VAL D HG11 1  
ATOM 8123   H HG12 . VAL D 1 64  ? -16.729 -5.731  1.796   1.00 20.12 ? 64  VAL D HG12 1  
ATOM 8124   H HG13 . VAL D 1 64  ? -18.472 -5.732  2.063   1.00 15.01 ? 64  VAL D HG13 1  
ATOM 8125   H HG21 . VAL D 1 64  ? -16.543 -3.400  0.954   1.00 74.10 ? 64  VAL D HG21 1  
ATOM 8126   H HG22 . VAL D 1 64  ? -17.274 -2.053  1.818   1.00 12.33 ? 64  VAL D HG22 1  
ATOM 8127   H HG23 . VAL D 1 64  ? -18.285 -3.212  0.973   1.00 41.45 ? 64  VAL D HG23 1  
ATOM 8128   N N    . THR D 1 65  ? -19.791 -4.969  5.404   1.00 41.32 ? 65  THR D N    1  
ATOM 8129   C CA   . THR D 1 65  ? -19.892 -5.954  6.484   1.00 63.44 ? 65  THR D CA   1  
ATOM 8130   C C    . THR D 1 65  ? -19.876 -7.356  5.859   1.00 64.51 ? 65  THR D C    1  
ATOM 8131   O O    . THR D 1 65  ? -20.728 -7.676  5.032   1.00 13.42 ? 65  THR D O    1  
ATOM 8132   C CB   . THR D 1 65  ? -21.199 -5.738  7.307   1.00 71.51 ? 65  THR D CB   1  
ATOM 8133   O OG1  . THR D 1 65  ? -21.168 -4.429  7.905   1.00 13.44 ? 65  THR D OG1  1  
ATOM 8134   C CG2  . THR D 1 65  ? -21.402 -6.810  8.400   1.00 71.42 ? 65  THR D CG2  1  
ATOM 8135   H H    . THR D 1 65  ? -20.608 -4.726  4.926   1.00 71.11 ? 65  THR D H    1  
ATOM 8136   H HA   . THR D 1 65  ? -19.035 -5.836  7.153   1.00 52.42 ? 65  THR D HA   1  
ATOM 8137   H HB   . THR D 1 65  ? -22.043 -5.777  6.625   1.00 3.42  ? 65  THR D HB   1  
ATOM 8138   H HG1  . THR D 1 65  ? -22.025 -4.011  7.805   1.00 24.23 ? 65  THR D HG1  1  
ATOM 8139   H HG21 . THR D 1 65  ? -22.307 -6.601  8.949   1.00 30.13 ? 65  THR D HG21 1  
ATOM 8140   H HG22 . THR D 1 65  ? -20.564 -6.807  9.082   1.00 75.42 ? 65  THR D HG22 1  
ATOM 8141   H HG23 . THR D 1 65  ? -21.483 -7.791  7.943   1.00 30.43 ? 65  THR D HG23 1  
ATOM 8142   N N    . ALA D 1 66  ? -18.888 -8.166  6.238   1.00 65.31 ? 66  ALA D N    1  
ATOM 8143   C CA   . ALA D 1 66  ? -18.686 -9.524  5.690   1.00 41.25 ? 66  ALA D CA   1  
ATOM 8144   C C    . ALA D 1 66  ? -18.705 -10.566 6.799   1.00 12.15 ? 66  ALA D C    1  
ATOM 8145   O O    . ALA D 1 66  ? -18.359 -10.245 7.938   1.00 72.40 ? 66  ALA D O    1  
ATOM 8146   C CB   . ALA D 1 66  ? -17.359 -9.599  4.951   1.00 65.04 ? 66  ALA D CB   1  
ATOM 8147   H H    . ALA D 1 66  ? -18.269 -7.845  6.928   1.00 50.42 ? 66  ALA D H    1  
ATOM 8148   H HA   . ALA D 1 66  ? -19.484 -9.744  4.978   1.00 2.35  ? 66  ALA D HA   1  
ATOM 8149   H HB1  . ALA D 1 66  ? -17.299 -8.812  4.223   1.00 24.34 ? 66  ALA D HB1  1  
ATOM 8150   H HB2  . ALA D 1 66  ? -17.266 -10.553 4.449   1.00 74.02 ? 66  ALA D HB2  1  
ATOM 8151   H HB3  . ALA D 1 66  ? -16.536 -9.487  5.654   1.00 74.34 ? 66  ALA D HB3  1  
ATOM 8152   N N    . SER D 1 67  ? -19.052 -11.823 6.451   1.00 41.41 ? 67  SER D N    1  
ATOM 8153   C CA   . SER D 1 67  ? -19.116 -12.930 7.423   1.00 55.22 ? 67  SER D CA   1  
ATOM 8154   C C    . SER D 1 67  ? -18.814 -14.293 6.771   1.00 22.40 ? 67  SER D C    1  
ATOM 8155   O O    . SER D 1 67  ? -19.226 -14.562 5.640   1.00 23.25 ? 67  SER D O    1  
ATOM 8156   C CB   . SER D 1 67  ? -20.500 -12.960 8.112   1.00 4.14  ? 67  SER D CB   1  
ATOM 8157   O OG   . SER D 1 67  ? -20.764 -11.756 8.812   1.00 70.12 ? 67  SER D OG   1  
ATOM 8158   H H    . SER D 1 67  ? -19.287 -12.011 5.518   1.00 73.11 ? 67  SER D H    1  
ATOM 8159   H HA   . SER D 1 67  ? -18.348 -12.745 8.179   1.00 40.11 ? 67  SER D HA   1  
ATOM 8160   H HB2  . SER D 1 67  ? -21.272 -13.092 7.365   1.00 71.20 ? 67  SER D HB2  1  
ATOM 8161   H HB3  . SER D 1 67  ? -20.542 -13.782 8.817   1.00 71.02 ? 67  SER D HB3  1  
ATOM 8162   H HG   . SER D 1 67  ? -21.677 -11.762 9.118   1.00 2.53  ? 67  SER D HG   1  
ATOM 8163   N N    . LEU D 1 68  ? -18.053 -15.119 7.512   1.00 64.12 ? 68  LEU D N    1  
ATOM 8164   C CA   . LEU D 1 68  ? -17.778 -16.536 7.192   1.00 35.01 ? 68  LEU D CA   1  
ATOM 8165   C C    . LEU D 1 68  ? -18.495 -17.429 8.219   1.00 60.02 ? 68  LEU D C    1  
ATOM 8166   O O    . LEU D 1 68  ? -18.246 -17.307 9.423   1.00 10.44 ? 68  LEU D O    1  
ATOM 8167   C CB   . LEU D 1 68  ? -16.241 -16.787 7.242   1.00 2.44  ? 68  LEU D CB   1  
ATOM 8168   C CG   . LEU D 1 68  ? -15.426 -16.222 6.032   1.00 63.20 ? 68  LEU D CG   1  
ATOM 8169   C CD1  . LEU D 1 68  ? -13.979 -15.859 6.409   1.00 24.43 ? 68  LEU D CD1  1  
ATOM 8170   C CD2  . LEU D 1 68  ? -15.453 -17.190 4.835   1.00 51.54 ? 68  LEU D CD2  1  
ATOM 8171   H H    . LEU D 1 68  ? -17.647 -14.751 8.325   1.00 41.43 ? 68  LEU D H    1  
ATOM 8172   H HA   . LEU D 1 68  ? -18.149 -16.753 6.190   1.00 74.43 ? 68  LEU D HA   1  
ATOM 8173   H HB2  . LEU D 1 68  ? -15.865 -16.336 8.156   1.00 40.15 ? 68  LEU D HB2  1  
ATOM 8174   H HB3  . LEU D 1 68  ? -16.060 -17.863 7.309   1.00 71.10 ? 68  LEU D HB3  1  
ATOM 8175   H HG   . LEU D 1 68  ? -15.893 -15.301 5.702   1.00 1.31  ? 68  LEU D HG   1  
ATOM 8176   H HD11 . LEU D 1 68  ? -13.491 -16.686 6.911   1.00 23.14 ? 68  LEU D HD11 1  
ATOM 8177   H HD12 . LEU D 1 68  ? -13.993 -15.014 7.075   1.00 53.21 ? 68  LEU D HD12 1  
ATOM 8178   H HD13 . LEU D 1 68  ? -13.418 -15.597 5.521   1.00 74.52 ? 68  LEU D HD13 1  
ATOM 8179   H HD21 . LEU D 1 68  ? -14.995 -18.133 5.109   1.00 23.14 ? 68  LEU D HD21 1  
ATOM 8180   H HD22 . LEU D 1 68  ? -14.910 -16.753 4.009   1.00 52.32 ? 68  LEU D HD22 1  
ATOM 8181   H HD23 . LEU D 1 68  ? -16.474 -17.361 4.530   1.00 42.20 ? 68  LEU D HD23 1  
ATOM 8182   N N    . GLY D 1 69  ? -19.386 -18.307 7.736   1.00 72.11 ? 69  GLY D N    1  
ATOM 8183   C CA   . GLY D 1 69  ? -20.047 -19.300 8.580   1.00 35.31 ? 69  GLY D CA   1  
ATOM 8184   C C    . GLY D 1 69  ? -21.098 -18.689 9.492   1.00 44.01 ? 69  GLY D C    1  
ATOM 8185   O O    . GLY D 1 69  ? -22.116 -18.174 9.019   1.00 24.25 ? 69  GLY D O    1  
ATOM 8186   H H    . GLY D 1 69  ? -19.604 -18.276 6.781   1.00 30.25 ? 69  GLY D H    1  
ATOM 8187   H HA2  . GLY D 1 69  ? -20.524 -20.031 7.938   1.00 25.32 ? 69  GLY D HA2  1  
ATOM 8188   H HA3  . GLY D 1 69  ? -19.296 -19.809 9.179   1.00 34.50 ? 69  GLY D HA3  1  
ATOM 8189   N N    . GLU D 1 70  ? -20.831 -18.731 10.802  1.00 64.34 ? 70  GLU D N    1  
ATOM 8190   C CA   . GLU D 1 70  ? -21.730 -18.204 11.847  1.00 34.43 ? 70  GLU D CA   1  
ATOM 8191   C C    . GLU D 1 70  ? -21.111 -16.970 12.534  1.00 60.42 ? 70  GLU D C    1  
ATOM 8192   O O    . GLU D 1 70  ? -21.681 -16.445 13.493  1.00 30.22 ? 70  GLU D O    1  
ATOM 8193   C CB   . GLU D 1 70  ? -22.060 -19.336 12.885  1.00 13.11 ? 70  GLU D CB   1  
ATOM 8194   C CG   . GLU D 1 70  ? -20.904 -20.318 13.217  1.00 4.25  ? 70  GLU D CG   1  
ATOM 8195   C CD   . GLU D 1 70  ? -19.632 -19.653 13.781  1.00 63.21 ? 70  GLU D CD   1  
ATOM 8196   O OE1  . GLU D 1 70  ? -19.611 -19.329 14.982  1.00 21.30 ? 70  GLU D OE1  1  
ATOM 8197   O OE2  . GLU D 1 70  ? -18.658 -19.445 13.018  1.00 74.11 ? 70  GLU D OE2  1  
ATOM 8198   H H    . GLU D 1 70  ? -19.977 -19.118 11.086  1.00 50.22 ? 70  GLU D H    1  
ATOM 8199   H HA   . GLU D 1 70  ? -22.659 -17.887 11.374  1.00 74.11 ? 70  GLU D HA   1  
ATOM 8200   H HB2  . GLU D 1 70  ? -22.387 -18.883 13.817  1.00 53.43 ? 70  GLU D HB2  1  
ATOM 8201   H HB3  . GLU D 1 70  ? -22.886 -19.921 12.491  1.00 20.12 ? 70  GLU D HB3  1  
ATOM 8202   H HG2  . GLU D 1 70  ? -21.265 -21.039 13.944  1.00 4.44  ? 70  GLU D HG2  1  
ATOM 8203   H HG3  . GLU D 1 70  ? -20.648 -20.855 12.307  1.00 11.11 ? 70  GLU D HG3  1  
ATOM 8204   N N    . GLU D 1 71  ? -19.956 -16.499 12.021  1.00 34.43 ? 71  GLU D N    1  
ATOM 8205   C CA   . GLU D 1 71  ? -19.194 -15.398 12.642  1.00 62.20 ? 71  GLU D CA   1  
ATOM 8206   C C    . GLU D 1 71  ? -18.800 -14.352 11.589  1.00 63.23 ? 71  GLU D C    1  
ATOM 8207   O O    . GLU D 1 71  ? -18.761 -14.653 10.388  1.00 63.22 ? 71  GLU D O    1  
ATOM 8208   C CB   . GLU D 1 71  ? -17.935 -15.950 13.368  1.00 53.05 ? 71  GLU D CB   1  
ATOM 8209   C CG   . GLU D 1 71  ? -16.784 -16.421 12.447  1.00 13.34 ? 71  GLU D CG   1  
ATOM 8210   C CD   . GLU D 1 71  ? -15.565 -16.983 13.207  1.00 10.45 ? 71  GLU D CD   1  
ATOM 8211   O OE1  . GLU D 1 71  ? -14.987 -18.007 12.797  1.00 41.33 ? 71  GLU D OE1  1  
ATOM 8212   O OE2  . GLU D 1 71  ? -15.181 -16.399 14.215  1.00 24.35 ? 71  GLU D OE2  1  
ATOM 8213   H H    . GLU D 1 71  ? -19.614 -16.897 11.195  1.00 40.03 ? 71  GLU D H    1  
ATOM 8214   H HA   . GLU D 1 71  ? -19.834 -14.915 13.376  1.00 33.31 ? 71  GLU D HA   1  
ATOM 8215   H HB2  . GLU D 1 71  ? -17.546 -15.177 14.026  1.00 13.51 ? 71  GLU D HB2  1  
ATOM 8216   H HB3  . GLU D 1 71  ? -18.237 -16.797 13.980  1.00 14.33 ? 71  GLU D HB3  1  
ATOM 8217   H HG2  . GLU D 1 71  ? -17.175 -17.187 11.786  1.00 34.52 ? 71  GLU D HG2  1  
ATOM 8218   H HG3  . GLU D 1 71  ? -16.453 -15.579 11.847  1.00 23.34 ? 71  GLU D HG3  1  
ATOM 8219   N N    . THR D 1 72  ? -18.509 -13.123 12.056  1.00 32.22 ? 72  THR D N    1  
ATOM 8220   C CA   . THR D 1 72  ? -18.080 -12.026 11.184  1.00 41.32 ? 72  THR D CA   1  
ATOM 8221   C C    . THR D 1 72  ? -16.649 -12.272 10.667  1.00 11.20 ? 72  THR D C    1  
ATOM 8222   O O    . THR D 1 72  ? -15.761 -12.693 11.426  1.00 31.12 ? 72  THR D O    1  
ATOM 8223   C CB   . THR D 1 72  ? -18.138 -10.644 11.907  1.00 14.35 ? 72  THR D CB   1  
ATOM 8224   O OG1  . THR D 1 72  ? -19.468 -10.415 12.399  1.00 24.23 ? 72  THR D OG1  1  
ATOM 8225   C CG2  . THR D 1 72  ? -17.720 -9.484  10.967  1.00 0.32  ? 72  THR D CG2  1  
ATOM 8226   H H    . THR D 1 72  ? -18.593 -12.951 13.015  1.00 3.11  ? 72  THR D H    1  
ATOM 8227   H HA   . THR D 1 72  ? -18.768 -11.993 10.338  1.00 34.05 ? 72  THR D HA   1  
ATOM 8228   H HB   . THR D 1 72  ? -17.459 -10.666 12.754  1.00 52.24 ? 72  THR D HB   1  
ATOM 8229   H HG1  . THR D 1 72  ? -19.421 -9.846  13.173  1.00 42.01 ? 72  THR D HG1  1  
ATOM 8230   H HG21 . THR D 1 72  ? -17.727 -8.551  11.501  1.00 71.52 ? 72  THR D HG21 1  
ATOM 8231   H HG22 . THR D 1 72  ? -18.407 -9.418  10.133  1.00 5.01  ? 72  THR D HG22 1  
ATOM 8232   H HG23 . THR D 1 72  ? -16.722 -9.665  10.585  1.00 74.00 ? 72  THR D HG23 1  
ATOM 8233   N N    . ALA D 1 73  ? -16.445 -11.975 9.380   1.00 43.24 ? 73  ALA D N    1  
ATOM 8234   C CA   . ALA D 1 73  ? -15.161 -12.118 8.707   1.00 34.03 ? 73  ALA D CA   1  
ATOM 8235   C C    . ALA D 1 73  ? -14.380 -10.811 8.810   1.00 15.42 ? 73  ALA D C    1  
ATOM 8236   O O    . ALA D 1 73  ? -13.394 -10.724 9.553   1.00 10.23 ? 73  ALA D O    1  
ATOM 8237   C CB   . ALA D 1 73  ? -15.390 -12.521 7.251   1.00 23.04 ? 73  ALA D CB   1  
ATOM 8238   H H    . ALA D 1 73  ? -17.197 -11.622 8.868   1.00 13.44 ? 73  ALA D H    1  
ATOM 8239   H HA   . ALA D 1 73  ? -14.596 -12.914 9.191   1.00 64.51 ? 73  ALA D HA   1  
ATOM 8240   H HB1  . ALA D 1 73  ? -14.455 -12.747 6.780   1.00 35.32 ? 73  ALA D HB1  1  
ATOM 8241   H HB2  . ALA D 1 73  ? -15.881 -11.714 6.709   1.00 45.13 ? 73  ALA D HB2  1  
ATOM 8242   H HB3  . ALA D 1 73  ? -16.015 -13.400 7.212   1.00 71.54 ? 73  ALA D HB3  1  
ATOM 8243   N N    . PHE D 1 74  ? -14.877 -9.773  8.112   1.00 21.14 ? 74  PHE D N    1  
ATOM 8244   C CA   . PHE D 1 74  ? -14.211 -8.473  8.051   1.00 62.05 ? 74  PHE D CA   1  
ATOM 8245   C C    . PHE D 1 74  ? -15.245 -7.353  7.967   1.00 63.45 ? 74  PHE D C    1  
ATOM 8246   O O    . PHE D 1 74  ? -16.316 -7.507  7.377   1.00 72.04 ? 74  PHE D O    1  
ATOM 8247   C CB   . PHE D 1 74  ? -13.160 -8.393  6.888   1.00 63.34 ? 74  PHE D CB   1  
ATOM 8248   C CG   . PHE D 1 74  ? -13.678 -8.407  5.429   1.00 5.24  ? 74  PHE D CG   1  
ATOM 8249   C CD1  . PHE D 1 74  ? -13.994 -7.215  4.763   1.00 43.12 ? 74  PHE D CD1  1  
ATOM 8250   C CD2  . PHE D 1 74  ? -13.808 -9.604  4.710   1.00 31.44 ? 74  PHE D CD2  1  
ATOM 8251   C CE1  . PHE D 1 74  ? -14.422 -7.221  3.446   1.00 34.22 ? 74  PHE D CE1  1  
ATOM 8252   C CE2  . PHE D 1 74  ? -14.243 -9.604  3.385   1.00 30.44 ? 74  PHE D CE2  1  
ATOM 8253   C CZ   . PHE D 1 74  ? -14.549 -8.413  2.761   1.00 74.21 ? 74  PHE D CZ   1  
ATOM 8254   H H    . PHE D 1 74  ? -15.752 -9.872  7.666   1.00 52.31 ? 74  PHE D H    1  
ATOM 8255   H HA   . PHE D 1 74  ? -13.676 -8.351  8.996   1.00 33.52 ? 74  PHE D HA   1  
ATOM 8256   H HB2  . PHE D 1 74  ? -12.584 -7.483  7.013   1.00 52.24 ? 74  PHE D HB2  1  
ATOM 8257   H HB3  . PHE D 1 74  ? -12.477 -9.228  6.999   1.00 23.32 ? 74  PHE D HB3  1  
ATOM 8258   H HD1  . PHE D 1 74  ? -13.902 -6.272  5.291   1.00 41.00 ? 74  PHE D HD1  1  
ATOM 8259   H HD2  . PHE D 1 74  ? -13.569 -10.544 5.194   1.00 61.35 ? 74  PHE D HD2  1  
ATOM 8260   H HE1  . PHE D 1 74  ? -14.661 -6.287  2.951   1.00 23.24 ? 74  PHE D HE1  1  
ATOM 8261   H HE2  . PHE D 1 74  ? -14.356 -10.544 2.839   1.00 53.33 ? 74  PHE D HE2  1  
ATOM 8262   H HZ   . PHE D 1 74  ? -14.886 -8.411  1.729   1.00 21.24 ? 74  PHE D HZ   1  
ATOM 8263   N N    . LEU D 1 75  ? -14.893 -6.239  8.586   1.00 44.43 ? 75  LEU D N    1  
ATOM 8264   C CA   . LEU D 1 75  ? -15.683 -5.015  8.648   1.00 42.31 ? 75  LEU D CA   1  
ATOM 8265   C C    . LEU D 1 75  ? -14.845 -3.913  8.014   1.00 24.02 ? 75  LEU D C    1  
ATOM 8266   O O    . LEU D 1 75  ? -13.626 -3.880  8.199   1.00 44.33 ? 75  LEU D O    1  
ATOM 8267   C CB   . LEU D 1 75  ? -16.024 -4.668  10.126  1.00 60.55 ? 75  LEU D CB   1  
ATOM 8268   C CG   . LEU D 1 75  ? -16.913 -5.705  10.872  1.00 11.24 ? 75  LEU D CG   1  
ATOM 8269   C CD1  . LEU D 1 75  ? -17.094 -5.337  12.359  1.00 74.22 ? 75  LEU D CD1  1  
ATOM 8270   C CD2  . LEU D 1 75  ? -18.275 -5.886  10.164  1.00 2.41  ? 75  LEU D CD2  1  
ATOM 8271   H H    . LEU D 1 75  ? -14.024 -6.221  9.011   1.00 30.21 ? 75  LEU D H    1  
ATOM 8272   H HA   . LEU D 1 75  ? -16.603 -5.149  8.078   1.00 65.13 ? 75  LEU D HA   1  
ATOM 8273   H HB2  . LEU D 1 75  ? -15.090 -4.564  10.674  1.00 42.13 ? 75  LEU D HB2  1  
ATOM 8274   H HB3  . LEU D 1 75  ? -16.532 -3.707  10.148  1.00 72.50 ? 75  LEU D HB3  1  
ATOM 8275   H HG   . LEU D 1 75  ? -16.412 -6.666  10.847  1.00 45.13 ? 75  LEU D HG   1  
ATOM 8276   H HD11 . LEU D 1 75  ? -17.597 -4.379  12.448  1.00 33.12 ? 75  LEU D HD11 1  
ATOM 8277   H HD12 . LEU D 1 75  ? -16.126 -5.277  12.836  1.00 52.24 ? 75  LEU D HD12 1  
ATOM 8278   H HD13 . LEU D 1 75  ? -17.684 -6.098  12.853  1.00 74.33 ? 75  LEU D HD13 1  
ATOM 8279   H HD21 . LEU D 1 75  ? -18.800 -4.941  10.109  1.00 73.32 ? 75  LEU D HD21 1  
ATOM 8280   H HD22 . LEU D 1 75  ? -18.879 -6.597  10.713  1.00 24.53 ? 75  LEU D HD22 1  
ATOM 8281   H HD23 . LEU D 1 75  ? -18.116 -6.266  9.163   1.00 13.00 ? 75  LEU D HD23 1  
ATOM 8282   N N    . CYS D 1 76  ? -15.493 -3.037  7.260   1.00 61.10 ? 76  CYS D N    1  
ATOM 8283   C CA   . CYS D 1 76  ? -14.825 -1.946  6.556   1.00 3.31  ? 76  CYS D CA   1  
ATOM 8284   C C    . CYS D 1 76  ? -15.807 -0.798  6.344   1.00 72.43 ? 76  CYS D C    1  
ATOM 8285   O O    . CYS D 1 76  ? -16.976 -1.041  6.065   1.00 23.01 ? 76  CYS D O    1  
ATOM 8286   C CB   . CYS D 1 76  ? -14.274 -2.439  5.201   1.00 54.42 ? 76  CYS D CB   1  
ATOM 8287   S SG   . CYS D 1 76  ? -13.480 -1.144  4.242   1.00 61.44 ? 76  CYS D SG   1  
ATOM 8288   H H    . CYS D 1 76  ? -16.465 -3.130  7.162   1.00 34.40 ? 76  CYS D H    1  
ATOM 8289   H HA   . CYS D 1 76  ? -13.994 -1.591  7.170   1.00 20.24 ? 76  CYS D HA   1  
ATOM 8290   H HB2  . CYS D 1 76  ? -13.537 -3.212  5.373   1.00 13.01 ? 76  CYS D HB2  1  
ATOM 8291   H HB3  . CYS D 1 76  ? -15.081 -2.843  4.599   1.00 72.44 ? 76  CYS D HB3  1  
ATOM 8292   H HG   . CYS D 1 76  ? -13.787 0.021   4.791   1.00 40.34 ? 76  CYS D HG   1  
ATOM 8293   N N    . GLU D 1 77  ? -15.343 0.443   6.528   1.00 14.31 ? 77  GLU D N    1  
ATOM 8294   C CA   . GLU D 1 77  ? -16.113 1.638   6.177   1.00 52.53 ? 77  GLU D CA   1  
ATOM 8295   C C    . GLU D 1 77  ? -15.161 2.808   5.959   1.00 44.22 ? 77  GLU D C    1  
ATOM 8296   O O    . GLU D 1 77  ? -14.258 3.036   6.768   1.00 74.12 ? 77  GLU D O    1  
ATOM 8297   C CB   . GLU D 1 77  ? -17.168 1.977   7.261   1.00 2.21  ? 77  GLU D CB   1  
ATOM 8298   C CG   . GLU D 1 77  ? -18.144 3.103   6.862   1.00 73.21 ? 77  GLU D CG   1  
ATOM 8299   C CD   . GLU D 1 77  ? -19.148 3.453   7.969   1.00 3.21  ? 77  GLU D CD   1  
ATOM 8300   O OE1  . GLU D 1 77  ? -20.124 2.706   8.166   1.00 75.33 ? 77  GLU D OE1  1  
ATOM 8301   O OE2  . GLU D 1 77  ? -18.968 4.481   8.644   1.00 62.44 ? 77  GLU D OE2  1  
ATOM 8302   H H    . GLU D 1 77  ? -14.447 0.562   6.915   1.00 61.44 ? 77  GLU D H    1  
ATOM 8303   H HA   . GLU D 1 77  ? -16.619 1.434   5.231   1.00 42.23 ? 77  GLU D HA   1  
ATOM 8304   H HB2  . GLU D 1 77  ? -17.744 1.083   7.473   1.00 73.15 ? 77  GLU D HB2  1  
ATOM 8305   H HB3  . GLU D 1 77  ? -16.652 2.276   8.170   1.00 34.52 ? 77  GLU D HB3  1  
ATOM 8306   H HG2  . GLU D 1 77  ? -17.566 3.989   6.609   1.00 5.43  ? 77  GLU D HG2  1  
ATOM 8307   H HG3  . GLU D 1 77  ? -18.694 2.789   5.976   1.00 4.33  ? 77  GLU D HG3  1  
ATOM 8308   N N    . VAL D 1 78  ? -15.359 3.524   4.849   1.00 11.43 ? 78  VAL D N    1  
ATOM 8309   C CA   . VAL D 1 78  ? -14.521 4.655   4.451   1.00 75.21 ? 78  VAL D CA   1  
ATOM 8310   C C    . VAL D 1 78  ? -15.415 5.844   4.090   1.00 72.22 ? 78  VAL D C    1  
ATOM 8311   O O    . VAL D 1 78  ? -16.254 5.736   3.186   1.00 51.10 ? 78  VAL D O    1  
ATOM 8312   C CB   . VAL D 1 78  ? -13.615 4.285   3.215   1.00 3.40  ? 78  VAL D CB   1  
ATOM 8313   C CG1  . VAL D 1 78  ? -12.746 5.491   2.782   1.00 15.02 ? 78  VAL D CG1  1  
ATOM 8314   C CG2  . VAL D 1 78  ? -12.749 3.034   3.515   1.00 1.40  ? 78  VAL D CG2  1  
ATOM 8315   H H    . VAL D 1 78  ? -16.113 3.285   4.270   1.00 64.32 ? 78  VAL D H    1  
ATOM 8316   H HA   . VAL D 1 78  ? -13.872 4.930   5.287   1.00 35.21 ? 78  VAL D HA   1  
ATOM 8317   H HB   . VAL D 1 78  ? -14.270 4.036   2.382   1.00 1.35  ? 78  VAL D HB   1  
ATOM 8318   H HG11 . VAL D 1 78  ? -13.385 6.294   2.439   1.00 72.32 ? 78  VAL D HG11 1  
ATOM 8319   H HG12 . VAL D 1 78  ? -12.078 5.203   1.981   1.00 24.22 ? 78  VAL D HG12 1  
ATOM 8320   H HG13 . VAL D 1 78  ? -12.166 5.845   3.624   1.00 12.54 ? 78  VAL D HG13 1  
ATOM 8321   H HG21 . VAL D 1 78  ? -11.936 3.292   4.190   1.00 33.40 ? 78  VAL D HG21 1  
ATOM 8322   H HG22 . VAL D 1 78  ? -12.350 2.632   2.601   1.00 32.01 ? 78  VAL D HG22 1  
ATOM 8323   H HG23 . VAL D 1 78  ? -13.362 2.272   3.983   1.00 51.52 ? 78  VAL D HG23 1  
ATOM 8324   N N    . GLN D 1 79  ? -15.247 6.964   4.808   1.00 22.13 ? 79  GLN D N    1  
ATOM 8325   C CA   . GLN D 1 79  ? -15.856 8.241   4.437   1.00 41.11 ? 79  GLN D CA   1  
ATOM 8326   C C    . GLN D 1 79  ? -14.890 8.995   3.509   1.00 72.31 ? 79  GLN D C    1  
ATOM 8327   O O    . GLN D 1 79  ? -14.031 9.762   3.960   1.00 41.21 ? 79  GLN D O    1  
ATOM 8328   C CB   . GLN D 1 79  ? -16.237 9.068   5.695   1.00 33.13 ? 79  GLN D CB   1  
ATOM 8329   C CG   . GLN D 1 79  ? -17.425 8.487   6.496   1.00 50.31 ? 79  GLN D CG   1  
ATOM 8330   C CD   . GLN D 1 79  ? -17.868 9.389   7.657   1.00 72.22 ? 79  GLN D CD   1  
ATOM 8331   O OE1  . GLN D 1 79  ? -18.705 10.279  7.485   1.00 45.12 ? 79  GLN D OE1  1  
ATOM 8332   N NE2  . GLN D 1 79  ? -17.339 9.151   8.848   1.00 71.02 ? 79  GLN D NE2  1  
ATOM 8333   H H    . GLN D 1 79  ? -14.692 6.927   5.616   1.00 25.52 ? 79  GLN D H    1  
ATOM 8334   H HA   . GLN D 1 79  ? -16.763 8.026   3.873   1.00 75.34 ? 79  GLN D HA   1  
ATOM 8335   H HB2  . GLN D 1 79  ? -15.375 9.116   6.353   1.00 3.25  ? 79  GLN D HB2  1  
ATOM 8336   H HB3  . GLN D 1 79  ? -16.494 10.077  5.392   1.00 44.40 ? 79  GLN D HB3  1  
ATOM 8337   H HG2  . GLN D 1 79  ? -18.266 8.352   5.825   1.00 52.40 ? 79  GLN D HG2  1  
ATOM 8338   H HG3  . GLN D 1 79  ? -17.138 7.519   6.894   1.00 12.11 ? 79  GLN D HG3  1  
ATOM 8339   H HE21 . GLN D 1 79  ? -16.699 8.413   8.932   1.00 71.34 ? 79  GLN D HE21 1  
ATOM 8340   H HE22 . GLN D 1 79  ? -17.605 9.726   9.596   1.00 33.21 ? 79  GLN D HE22 1  
ATOM 8341   N N    . GLN D 1 80  ? -15.011 8.691   2.207   1.00 63.12 ? 80  GLN D N    1  
ATOM 8342   C CA   . GLN D 1 80  ? -14.206 9.285   1.140   1.00 53.13 ? 80  GLN D CA   1  
ATOM 8343   C C    . GLN D 1 80  ? -14.783 10.675  0.792   1.00 41.44 ? 80  GLN D C    1  
ATOM 8344   O O    . GLN D 1 80  ? -15.752 10.780  0.030   1.00 12.13 ? 80  GLN D O    1  
ATOM 8345   C CB   . GLN D 1 80  ? -14.223 8.342   -0.109  1.00 11.42 ? 80  GLN D CB   1  
ATOM 8346   C CG   . GLN D 1 80  ? -13.142 8.653   -1.167  1.00 14.05 ? 80  GLN D CG   1  
ATOM 8347   C CD   . GLN D 1 80  ? -11.729 8.215   -0.758  1.00 34.11 ? 80  GLN D CD   1  
ATOM 8348   O OE1  . GLN D 1 80  ? -10.745 8.876   -1.074  1.00 40.14 ? 80  GLN D OE1  1  
ATOM 8349   N NE2  . GLN D 1 80  ? -11.601 7.051   -0.122  1.00 2.31  ? 80  GLN D NE2  1  
ATOM 8350   H H    . GLN D 1 80  ? -15.684 8.028   1.954   1.00 65.34 ? 80  GLN D H    1  
ATOM 8351   H HA   . GLN D 1 80  ? -13.181 9.397   1.495   1.00 33.14 ? 80  GLN D HA   1  
ATOM 8352   H HB2  . GLN D 1 80  ? -14.080 7.320   0.225   1.00 21.51 ? 80  GLN D HB2  1  
ATOM 8353   H HB3  . GLN D 1 80  ? -15.198 8.404   -0.588  1.00 53.44 ? 80  GLN D HB3  1  
ATOM 8354   H HG2  . GLN D 1 80  ? -13.394 8.134   -2.085  1.00 41.12 ? 80  GLN D HG2  1  
ATOM 8355   H HG3  . GLN D 1 80  ? -13.136 9.719   -1.357  1.00 51.35 ? 80  GLN D HG3  1  
ATOM 8356   H HE21 . GLN D 1 80  ? -12.405 6.526   0.060   1.00 51.02 ? 80  GLN D HE21 1  
ATOM 8357   H HE22 . GLN D 1 80  ? -10.701 6.764   0.125   1.00 73.14 ? 80  GLN D HE22 1  
ATOM 8358   N N    . GLY D 1 81  ? -14.224 11.727  1.414   1.00 1.31  ? 81  GLY D N    1  
ATOM 8359   C CA   . GLY D 1 81  ? -14.658 13.105  1.170   1.00 1.52  ? 81  GLY D CA   1  
ATOM 8360   C C    . GLY D 1 81  ? -13.911 13.739  0.000   1.00 11.52 ? 81  GLY D C    1  
ATOM 8361   O O    . GLY D 1 81  ? -12.710 13.507  -0.177  1.00 34.40 ? 81  GLY D O    1  
ATOM 8362   H H    . GLY D 1 81  ? -13.483 11.565  2.033   1.00 3.20  ? 81  GLY D H    1  
ATOM 8363   H HA2  . GLY D 1 81  ? -15.730 13.125  0.972   1.00 70.04 ? 81  GLY D HA2  1  
ATOM 8364   H HA3  . GLY D 1 81  ? -14.468 13.687  2.060   1.00 34.13 ? 81  GLY D HA3  1  
ATOM 8365   N N    . GLY D 1 82  ? -14.621 14.562  -0.781  1.00 54.31 ? 82  GLY D N    1  
ATOM 8366   C CA   . GLY D 1 82  ? -14.065 15.194  -1.975  1.00 64.13 ? 82  GLY D CA   1  
ATOM 8367   C C    . GLY D 1 82  ? -14.539 16.625  -2.124  1.00 50.34 ? 82  GLY D C    1  
ATOM 8368   O O    . GLY D 1 82  ? -15.736 16.889  -2.017  1.00 54.40 ? 82  GLY D O    1  
ATOM 8369   H H    . GLY D 1 82  ? -15.554 14.738  -0.545  1.00 55.22 ? 82  GLY D H    1  
ATOM 8370   H HA2  . GLY D 1 82  ? -12.976 15.172  -1.941  1.00 33.32 ? 82  GLY D HA2  1  
ATOM 8371   H HA3  . GLY D 1 82  ? -14.395 14.632  -2.841  1.00 34.31 ? 82  GLY D HA3  1  
ATOM 8372   N N    . ILE D 1 83  ? -13.598 17.544  -2.372  1.00 61.52 ? 83  ILE D N    1  
ATOM 8373   C CA   . ILE D 1 83  ? -13.881 18.978  -2.540  1.00 73.23 ? 83  ILE D CA   1  
ATOM 8374   C C    . ILE D 1 83  ? -14.043 19.298  -4.044  1.00 4.51  ? 83  ILE D C    1  
ATOM 8375   O O    . ILE D 1 83  ? -13.155 18.988  -4.846  1.00 73.01 ? 83  ILE D O    1  
ATOM 8376   C CB   . ILE D 1 83  ? -12.731 19.845  -1.901  1.00 3.41  ? 83  ILE D CB   1  
ATOM 8377   C CG1  . ILE D 1 83  ? -12.517 19.433  -0.405  1.00 1.42  ? 83  ILE D CG1  1  
ATOM 8378   C CG2  . ILE D 1 83  ? -13.037 21.357  -2.035  1.00 31.51 ? 83  ILE D CG2  1  
ATOM 8379   C CD1  . ILE D 1 83  ? -11.388 20.154  0.315   1.00 62.51 ? 83  ILE D CD1  1  
ATOM 8380   H H    . ILE D 1 83  ? -12.670 17.242  -2.450  1.00 30.14 ? 83  ILE D H    1  
ATOM 8381   H HA   . ILE D 1 83  ? -14.814 19.211  -2.021  1.00 12.23 ? 83  ILE D HA   1  
ATOM 8382   H HB   . ILE D 1 83  ? -11.812 19.646  -2.448  1.00 53.42 ? 83  ILE D HB   1  
ATOM 8383   H HG12 . ILE D 1 83  ? -13.424 19.619  0.154   1.00 71.42 ? 83  ILE D HG12 1  
ATOM 8384   H HG13 . ILE D 1 83  ? -12.298 18.370  -0.358  1.00 51.24 ? 83  ILE D HG13 1  
ATOM 8385   H HG21 . ILE D 1 83  ? -13.144 21.620  -3.083  1.00 12.14 ? 83  ILE D HG21 1  
ATOM 8386   H HG22 . ILE D 1 83  ? -12.232 21.936  -1.612  1.00 54.31 ? 83  ILE D HG22 1  
ATOM 8387   H HG23 . ILE D 1 83  ? -13.954 21.596  -1.516  1.00 52.43 ? 83  ILE D HG23 1  
ATOM 8388   H HD11 . ILE D 1 83  ? -11.326 19.787  1.328   1.00 12.52 ? 83  ILE D HD11 1  
ATOM 8389   H HD12 . ILE D 1 83  ? -11.581 21.218  0.329   1.00 72.31 ? 83  ILE D HD12 1  
ATOM 8390   H HD13 . ILE D 1 83  ? -10.453 19.962  -0.191  1.00 32.21 ? 83  ILE D HD13 1  
ATOM 8391   N N    . PHE D 1 84  ? -15.191 19.907  -4.410  1.00 51.12 ? 84  PHE D N    1  
ATOM 8392   C CA   . PHE D 1 84  ? -15.558 20.213  -5.815  1.00 71.34 ? 84  PHE D CA   1  
ATOM 8393   C C    . PHE D 1 84  ? -16.044 21.678  -5.921  1.00 54.24 ? 84  PHE D C    1  
ATOM 8394   O O    . PHE D 1 84  ? -16.965 22.078  -5.203  1.00 53.54 ? 84  PHE D O    1  
ATOM 8395   C CB   . PHE D 1 84  ? -16.697 19.259  -6.305  1.00 55.32 ? 84  PHE D CB   1  
ATOM 8396   C CG   . PHE D 1 84  ? -16.458 17.755  -6.080  1.00 60.41 ? 84  PHE D CG   1  
ATOM 8397   C CD1  . PHE D 1 84  ? -17.083 17.080  -5.028  1.00 32.15 ? 84  PHE D CD1  1  
ATOM 8398   C CD2  . PHE D 1 84  ? -15.625 17.018  -6.927  1.00 70.40 ? 84  PHE D CD2  1  
ATOM 8399   C CE1  . PHE D 1 84  ? -16.888 15.722  -4.833  1.00 61.43 ? 84  PHE D CE1  1  
ATOM 8400   C CE2  . PHE D 1 84  ? -15.430 15.657  -6.726  1.00 11.42 ? 84  PHE D CE2  1  
ATOM 8401   C CZ   . PHE D 1 84  ? -16.063 15.012  -5.680  1.00 51.42 ? 84  PHE D CZ   1  
ATOM 8402   H H    . PHE D 1 84  ? -15.820 20.163  -3.702  1.00 50.22 ? 84  PHE D H    1  
ATOM 8403   H HA   . PHE D 1 84  ? -14.680 20.078  -6.449  1.00 35.11 ? 84  PHE D HA   1  
ATOM 8404   H HB2  . PHE D 1 84  ? -17.621 19.525  -5.799  1.00 4.42  ? 84  PHE D HB2  1  
ATOM 8405   H HB3  . PHE D 1 84  ? -16.846 19.411  -7.371  1.00 11.44 ? 84  PHE D HB3  1  
ATOM 8406   H HD1  . PHE D 1 84  ? -17.733 17.628  -4.356  1.00 10.33 ? 84  PHE D HD1  1  
ATOM 8407   H HD2  . PHE D 1 84  ? -15.121 17.515  -7.749  1.00 35.13 ? 84  PHE D HD2  1  
ATOM 8408   H HE1  . PHE D 1 84  ? -17.381 15.217  -4.010  1.00 33.55 ? 84  PHE D HE1  1  
ATOM 8409   H HE2  . PHE D 1 84  ? -14.784 15.095  -7.395  1.00 53.13 ? 84  PHE D HE2  1  
ATOM 8410   H HZ   . PHE D 1 84  ? -15.917 13.948  -5.525  1.00 32.14 ? 84  PHE D HZ   1  
ATOM 8411   N N    . SER D 1 85  ? -15.427 22.470  -6.811  1.00 72.54 ? 85  SER D N    1  
ATOM 8412   C CA   . SER D 1 85  ? -15.871 23.842  -7.107  1.00 72.22 ? 85  SER D CA   1  
ATOM 8413   C C    . SER D 1 85  ? -16.936 23.810  -8.226  1.00 1.04  ? 85  SER D C    1  
ATOM 8414   O O    . SER D 1 85  ? -16.606 23.628  -9.400  1.00 44.12 ? 85  SER D O    1  
ATOM 8415   C CB   . SER D 1 85  ? -14.665 24.705  -7.527  1.00 43.11 ? 85  SER D CB   1  
ATOM 8416   O OG   . SER D 1 85  ? -13.669 24.693  -6.526  1.00 0.32  ? 85  SER D OG   1  
ATOM 8417   H H    . SER D 1 85  ? -14.644 22.127  -7.277  1.00 40.11 ? 85  SER D H    1  
ATOM 8418   H HA   . SER D 1 85  ? -16.308 24.268  -6.194  1.00 61.51 ? 85  SER D HA   1  
ATOM 8419   H HB2  . SER D 1 85  ? -14.235 24.314  -8.443  1.00 3.20  ? 85  SER D HB2  1  
ATOM 8420   H HB3  . SER D 1 85  ? -14.984 25.725  -7.685  1.00 50.51 ? 85  SER D HB3  1  
ATOM 8421   H HG   . SER D 1 85  ? -13.178 25.523  -6.546  1.00 52.31 ? 85  SER D HG   1  
ATOM 8422   N N    . ILE D 1 86  ? -18.208 23.991  -7.847  1.00 22.13 ? 86  ILE D N    1  
ATOM 8423   C CA   . ILE D 1 86  ? -19.369 23.840  -8.753  1.00 45.23 ? 86  ILE D CA   1  
ATOM 8424   C C    . ILE D 1 86  ? -19.973 25.221  -9.108  1.00 52.22 ? 86  ILE D C    1  
ATOM 8425   O O    . ILE D 1 86  ? -20.017 26.123  -8.262  1.00 2.51  ? 86  ILE D O    1  
ATOM 8426   C CB   . ILE D 1 86  ? -20.477 22.933  -8.081  1.00 63.43 ? 86  ILE D CB   1  
ATOM 8427   C CG1  . ILE D 1 86  ? -20.986 23.566  -6.741  1.00 54.44 ? 86  ILE D CG1  1  
ATOM 8428   C CG2  . ILE D 1 86  ? -19.946 21.495  -7.842  1.00 1.02  ? 86  ILE D CG2  1  
ATOM 8429   C CD1  . ILE D 1 86  ? -22.121 22.825  -6.063  1.00 11.23 ? 86  ILE D CD1  1  
ATOM 8430   H H    . ILE D 1 86  ? -18.379 24.236  -6.914  1.00 51.02 ? 86  ILE D H    1  
ATOM 8431   H HA   . ILE D 1 86  ? -19.038 23.354  -9.673  1.00 73.01 ? 86  ILE D HA   1  
ATOM 8432   H HB   . ILE D 1 86  ? -21.314 22.860  -8.773  1.00 75.53 ? 86  ILE D HB   1  
ATOM 8433   H HG12 . ILE D 1 86  ? -20.167 23.614  -6.034  1.00 42.10 ? 86  ILE D HG12 1  
ATOM 8434   H HG13 . ILE D 1 86  ? -21.330 24.575  -6.935  1.00 22.44 ? 86  ILE D HG13 1  
ATOM 8435   H HG21 . ILE D 1 86  ? -19.635 21.057  -8.782  1.00 23.34 ? 86  ILE D HG21 1  
ATOM 8436   H HG22 . ILE D 1 86  ? -20.728 20.881  -7.409  1.00 11.22 ? 86  ILE D HG22 1  
ATOM 8437   H HG23 . ILE D 1 86  ? -19.101 21.523  -7.164  1.00 21.11 ? 86  ILE D HG23 1  
ATOM 8438   H HD11 . ILE D 1 86  ? -21.802 21.827  -5.796  1.00 62.41 ? 86  ILE D HD11 1  
ATOM 8439   H HD12 . ILE D 1 86  ? -22.967 22.768  -6.732  1.00 42.32 ? 86  ILE D HD12 1  
ATOM 8440   H HD13 . ILE D 1 86  ? -22.408 23.359  -5.170  1.00 35.11 ? 86  ILE D HD13 1  
ATOM 8441   N N    . ALA D 1 87  ? -20.395 25.378  -10.379 1.00 63.30 ? 87  ALA D N    1  
ATOM 8442   C CA   . ALA D 1 87  ? -21.126 26.572  -10.868 1.00 25.01 ? 87  ALA D CA   1  
ATOM 8443   C C    . ALA D 1 87  ? -21.693 26.329  -12.270 1.00 50.11 ? 87  ALA D C    1  
ATOM 8444   O O    . ALA D 1 87  ? -21.320 25.361  -12.944 1.00 75.33 ? 87  ALA D O    1  
ATOM 8445   C CB   . ALA D 1 87  ? -20.241 27.822  -10.874 1.00 52.33 ? 87  ALA D CB   1  
ATOM 8446   H H    . ALA D 1 87  ? -20.207 24.657  -11.019 1.00 4.21  ? 87  ALA D H    1  
ATOM 8447   H HA   . ALA D 1 87  ? -21.959 26.746  -10.190 1.00 34.53 ? 87  ALA D HA   1  
ATOM 8448   H HB1  . ALA D 1 87  ? -19.399 27.679  -11.544 1.00 74.03 ? 87  ALA D HB1  1  
ATOM 8449   H HB2  . ALA D 1 87  ? -19.868 28.011  -9.876  1.00 62.02 ? 87  ALA D HB2  1  
ATOM 8450   H HB3  . ALA D 1 87  ? -20.814 28.681  -11.204 1.00 11.41 ? 87  ALA D HB3  1  
ATOM 8451   N N    . GLY D 1 88  ? -22.615 27.214  -12.701 1.00 71.13 ? 88  GLY D N    1  
ATOM 8452   C CA   . GLY D 1 88  ? -23.271 27.095  -14.010 1.00 64.32 ? 88  GLY D CA   1  
ATOM 8453   C C    . GLY D 1 88  ? -24.485 26.163  -13.986 1.00 61.14 ? 88  GLY D C    1  
ATOM 8454   O O    . GLY D 1 88  ? -25.326 26.224  -14.880 1.00 21.34 ? 88  GLY D O    1  
ATOM 8455   H H    . GLY D 1 88  ? -22.857 27.961  -12.115 1.00 4.11  ? 88  GLY D H    1  
ATOM 8456   H HA2  . GLY D 1 88  ? -23.597 28.080  -14.316 1.00 73.34 ? 88  GLY D HA2  1  
ATOM 8457   H HA3  . GLY D 1 88  ? -22.559 26.729  -14.744 1.00 70.24 ? 88  GLY D HA3  1  
ATOM 8458   N N    . ILE D 1 89  ? -24.556 25.288  -12.961 1.00 2.10  ? 89  ILE D N    1  
ATOM 8459   C CA   . ILE D 1 89  ? -25.680 24.357  -12.745 1.00 64.30 ? 89  ILE D CA   1  
ATOM 8460   C C    . ILE D 1 89  ? -26.327 24.673  -11.389 1.00 52.31 ? 89  ILE D C    1  
ATOM 8461   O O    . ILE D 1 89  ? -25.641 25.145  -10.465 1.00 71.24 ? 89  ILE D O    1  
ATOM 8462   C CB   . ILE D 1 89  ? -25.245 22.831  -12.814 1.00 14.03 ? 89  ILE D CB   1  
ATOM 8463   C CG1  . ILE D 1 89  ? -24.350 22.361  -11.606 1.00 4.04  ? 89  ILE D CG1  1  
ATOM 8464   C CG2  . ILE D 1 89  ? -24.547 22.524  -14.160 1.00 1.42  ? 89  ILE D CG2  1  
ATOM 8465   C CD1  . ILE D 1 89  ? -22.924 22.906  -11.551 1.00 13.21 ? 89  ILE D CD1  1  
ATOM 8466   H H    . ILE D 1 89  ? -23.829 25.282  -12.311 1.00 60.12 ? 89  ILE D H    1  
ATOM 8467   H HA   . ILE D 1 89  ? -26.430 24.535  -13.522 1.00 53.03 ? 89  ILE D HA   1  
ATOM 8468   H HB   . ILE D 1 89  ? -26.166 22.247  -12.798 1.00 33.41 ? 89  ILE D HB   1  
ATOM 8469   H HG12 . ILE D 1 89  ? -24.831 22.651  -10.684 1.00 3.43  ? 89  ILE D HG12 1  
ATOM 8470   H HG13 . ILE D 1 89  ? -24.281 21.279  -11.623 1.00 40.43 ? 89  ILE D HG13 1  
ATOM 8471   H HG21 . ILE D 1 89  ? -25.222 22.745  -14.980 1.00 30.25 ? 89  ILE D HG21 1  
ATOM 8472   H HG22 . ILE D 1 89  ? -24.273 21.479  -14.200 1.00 21.32 ? 89  ILE D HG22 1  
ATOM 8473   H HG23 . ILE D 1 89  ? -23.658 23.133  -14.258 1.00 31.41 ? 89  ILE D HG23 1  
ATOM 8474   H HD11 . ILE D 1 89  ? -22.435 22.536  -10.658 1.00 10.03 ? 89  ILE D HD11 1  
ATOM 8475   H HD12 . ILE D 1 89  ? -22.943 23.986  -11.524 1.00 71.35 ? 89  ILE D HD12 1  
ATOM 8476   H HD13 . ILE D 1 89  ? -22.375 22.574  -12.419 1.00 53.01 ? 89  ILE D HD13 1  
ATOM 8477   N N    . GLU D 1 90  ? -27.642 24.422  -11.277 1.00 24.12 ? 90  GLU D N    1  
ATOM 8478   C CA   . GLU D 1 90  ? -28.430 24.830  -10.096 1.00 34.35 ? 90  GLU D CA   1  
ATOM 8479   C C    . GLU D 1 90  ? -29.670 23.941  -9.884  1.00 63.20 ? 90  GLU D C    1  
ATOM 8480   O O    . GLU D 1 90  ? -30.119 23.243  -10.805 1.00 73.42 ? 90  GLU D O    1  
ATOM 8481   C CB   . GLU D 1 90  ? -28.835 26.319  -10.221 1.00 71.52 ? 90  GLU D CB   1  
ATOM 8482   C CG   . GLU D 1 90  ? -29.479 26.704  -11.569 1.00 1.30  ? 90  GLU D CG   1  
ATOM 8483   C CD   . GLU D 1 90  ? -29.947 28.164  -11.626 1.00 45.02 ? 90  GLU D CD   1  
ATOM 8484   O OE1  . GLU D 1 90  ? -29.132 29.052  -11.959 1.00 24.44 ? 90  GLU D OE1  1  
ATOM 8485   O OE2  . GLU D 1 90  ? -31.129 28.436  -11.323 1.00 41.45 ? 90  GLU D OE2  1  
ATOM 8486   H H    . GLU D 1 90  ? -28.097 23.953  -12.009 1.00 72.20 ? 90  GLU D H    1  
ATOM 8487   H HA   . GLU D 1 90  ? -27.788 24.715  -9.219  1.00 32.13 ? 90  GLU D HA   1  
ATOM 8488   H HB2  . GLU D 1 90  ? -29.537 26.563  -9.430  1.00 41.30 ? 90  GLU D HB2  1  
ATOM 8489   H HB3  . GLU D 1 90  ? -27.947 26.932  -10.085 1.00 45.51 ? 90  GLU D HB3  1  
ATOM 8490   H HG2  . GLU D 1 90  ? -28.749 26.536  -12.358 1.00 54.44 ? 90  GLU D HG2  1  
ATOM 8491   H HG3  . GLU D 1 90  ? -30.322 26.049  -11.747 1.00 51.41 ? 90  GLU D HG3  1  
ATOM 8492   N N    . GLY D 1 91  ? -30.185 23.974  -8.632  1.00 74.12 ? 91  GLY D N    1  
ATOM 8493   C CA   . GLY D 1 91  ? -31.418 23.282  -8.252  1.00 2.32  ? 91  GLY D CA   1  
ATOM 8494   C C    . GLY D 1 91  ? -31.337 21.769  -8.404  1.00 62.01 ? 91  GLY D C    1  
ATOM 8495   O O    . GLY D 1 91  ? -30.457 21.131  -7.813  1.00 42.05 ? 91  GLY D O    1  
ATOM 8496   H H    . GLY D 1 91  ? -29.707 24.489  -7.947  1.00 54.21 ? 91  GLY D H    1  
ATOM 8497   H HA2  . GLY D 1 91  ? -31.630 23.509  -7.214  1.00 34.21 ? 91  GLY D HA2  1  
ATOM 8498   H HA3  . GLY D 1 91  ? -32.234 23.666  -8.857  1.00 32.32 ? 91  GLY D HA3  1  
ATOM 8499   N N    . THR D 1 92  ? -32.239 21.210  -9.227  1.00 20.21 ? 92  THR D N    1  
ATOM 8500   C CA   . THR D 1 92  ? -32.347 19.765  -9.463  1.00 43.24 ? 92  THR D CA   1  
ATOM 8501   C C    . THR D 1 92  ? -31.159 19.238  -10.292 1.00 42.35 ? 92  THR D C    1  
ATOM 8502   O O    . THR D 1 92  ? -30.728 18.096  -10.094 1.00 62.34 ? 92  THR D O    1  
ATOM 8503   C CB   . THR D 1 92  ? -33.693 19.423  -10.179 1.00 41.13 ? 92  THR D CB   1  
ATOM 8504   O OG1  . THR D 1 92  ? -33.804 20.179  -11.401 1.00 30.52 ? 92  THR D OG1  1  
ATOM 8505   C CG2  . THR D 1 92  ? -34.910 19.720  -9.280  1.00 72.33 ? 92  THR D CG2  1  
ATOM 8506   H H    . THR D 1 92  ? -32.861 21.797  -9.699  1.00 70.11 ? 92  THR D H    1  
ATOM 8507   H HA   . THR D 1 92  ? -32.341 19.268  -8.493  1.00 44.15 ? 92  THR D HA   1  
ATOM 8508   H HB   . THR D 1 92  ? -33.697 18.366  -10.427 1.00 54.13 ? 92  THR D HB   1  
ATOM 8509   H HG1  . THR D 1 92  ? -34.503 20.837  -11.314 1.00 43.33 ? 92  THR D HG1  1  
ATOM 8510   H HG21 . THR D 1 92  ? -34.922 20.770  -9.013  1.00 54.54 ? 92  THR D HG21 1  
ATOM 8511   H HG22 . THR D 1 92  ? -34.853 19.124  -8.378  1.00 61.11 ? 92  THR D HG22 1  
ATOM 8512   H HG23 . THR D 1 92  ? -35.821 19.475  -9.810  1.00 52.44 ? 92  THR D HG23 1  
ATOM 8513   N N    . GLN D 1 93  ? -30.621 20.086  -11.200 1.00 50.14 ? 93  GLN D N    1  
ATOM 8514   C CA   . GLN D 1 93  ? -29.478 19.715  -12.063 1.00 70.31 ? 93  GLN D CA   1  
ATOM 8515   C C    . GLN D 1 93  ? -28.199 19.587  -11.220 1.00 70.33 ? 93  GLN D C    1  
ATOM 8516   O O    . GLN D 1 93  ? -27.393 18.666  -11.421 1.00 34.54 ? 93  GLN D O    1  
ATOM 8517   C CB   . GLN D 1 93  ? -29.258 20.750  -13.205 1.00 52.24 ? 93  GLN D CB   1  
ATOM 8518   C CG   . GLN D 1 93  ? -28.194 20.314  -14.249 1.00 63.14 ? 93  GLN D CG   1  
ATOM 8519   C CD   . GLN D 1 93  ? -27.890 21.358  -15.325 1.00 31.21 ? 93  GLN D CD   1  
ATOM 8520   O OE1  . GLN D 1 93  ? -27.935 22.553  -15.079 1.00 55.42 ? 93  GLN D OE1  1  
ATOM 8521   N NE2  . GLN D 1 93  ? -27.580 20.918  -16.531 1.00 30.32 ? 93  GLN D NE2  1  
ATOM 8522   H H    . GLN D 1 93  ? -31.004 20.985  -11.285 1.00 20.14 ? 93  GLN D H    1  
ATOM 8523   H HA   . GLN D 1 93  ? -29.707 18.746  -12.506 1.00 13.52 ? 93  GLN D HA   1  
ATOM 8524   H HB2  . GLN D 1 93  ? -30.200 20.901  -13.723 1.00 74.52 ? 93  GLN D HB2  1  
ATOM 8525   H HB3  . GLN D 1 93  ? -28.950 21.697  -12.773 1.00 25.42 ? 93  GLN D HB3  1  
ATOM 8526   H HG2  . GLN D 1 93  ? -27.266 20.097  -13.731 1.00 3.04  ? 93  GLN D HG2  1  
ATOM 8527   H HG3  . GLN D 1 93  ? -28.542 19.407  -14.733 1.00 73.31 ? 93  GLN D HG3  1  
ATOM 8528   H HE21 . GLN D 1 93  ? -27.562 19.951  -16.683 1.00 12.42 ? 93  GLN D HE21 1  
ATOM 8529   H HE22 . GLN D 1 93  ? -27.380 21.581  -17.224 1.00 63.42 ? 93  GLN D HE22 1  
ATOM 8530   N N    . MET D 1 94  ? -28.043 20.521  -10.262 1.00 62.11 ? 94  MET D N    1  
ATOM 8531   C CA   . MET D 1 94  ? -26.891 20.539  -9.343  1.00 43.34 ? 94  MET D CA   1  
ATOM 8532   C C    . MET D 1 94  ? -27.020 19.395  -8.325  1.00 53.33 ? 94  MET D C    1  
ATOM 8533   O O    . MET D 1 94  ? -26.029 18.770  -7.984  1.00 43.43 ? 94  MET D O    1  
ATOM 8534   C CB   . MET D 1 94  ? -26.767 21.916  -8.632  1.00 24.34 ? 94  MET D CB   1  
ATOM 8535   C CG   . MET D 1 94  ? -25.375 22.226  -8.029  1.00 64.11 ? 94  MET D CG   1  
ATOM 8536   S SD   . MET D 1 94  ? -24.875 21.110  -6.702  1.00 25.04 ? 94  MET D SD   1  
ATOM 8537   C CE   . MET D 1 94  ? -26.130 21.453  -5.486  1.00 13.01 ? 94  MET D CE   1  
ATOM 8538   H H    . MET D 1 94  ? -28.729 21.218  -10.173 1.00 13.33 ? 94  MET D H    1  
ATOM 8539   H HA   . MET D 1 94  ? -25.997 20.373  -9.944  1.00 71.13 ? 94  MET D HA   1  
ATOM 8540   H HB2  . MET D 1 94  ? -26.991 22.693  -9.354  1.00 23.31 ? 94  MET D HB2  1  
ATOM 8541   H HB3  . MET D 1 94  ? -27.502 21.975  -7.837  1.00 42.42 ? 94  MET D HB3  1  
ATOM 8542   H HG2  . MET D 1 94  ? -24.635 22.160  -8.815  1.00 14.21 ? 94  MET D HG2  1  
ATOM 8543   H HG3  . MET D 1 94  ? -25.379 23.239  -7.641  1.00 63.15 ? 94  MET D HG3  1  
ATOM 8544   H HE1  . MET D 1 94  ? -27.101 21.216  -5.893  1.00 62.02 ? 94  MET D HE1  1  
ATOM 8545   H HE2  . MET D 1 94  ? -26.098 22.499  -5.216  1.00 34.20 ? 94  MET D HE2  1  
ATOM 8546   H HE3  . MET D 1 94  ? -25.952 20.848  -4.611  1.00 31.24 ? 94  MET D HE3  1  
ATOM 8547   N N    . ALA D 1 95  ? -28.259 19.118  -7.871  1.00 2.20  ? 95  ALA D N    1  
ATOM 8548   C CA   . ALA D 1 95  ? -28.548 17.999  -6.942  1.00 70.34 ? 95  ALA D CA   1  
ATOM 8549   C C    . ALA D 1 95  ? -28.292 16.630  -7.608  1.00 23.21 ? 95  ALA D C    1  
ATOM 8550   O O    . ALA D 1 95  ? -27.923 15.660  -6.940  1.00 52.52 ? 95  ALA D O    1  
ATOM 8551   C CB   . ALA D 1 95  ? -29.994 18.090  -6.435  1.00 11.44 ? 95  ALA D CB   1  
ATOM 8552   H H    . ALA D 1 95  ? -29.005 19.687  -8.164  1.00 34.22 ? 95  ALA D H    1  
ATOM 8553   H HA   . ALA D 1 95  ? -27.881 18.104  -6.087  1.00 72.34 ? 95  ALA D HA   1  
ATOM 8554   H HB1  . ALA D 1 95  ? -30.164 19.067  -5.996  1.00 31.40 ? 95  ALA D HB1  1  
ATOM 8555   H HB2  . ALA D 1 95  ? -30.168 17.330  -5.685  1.00 24.21 ? 95  ALA D HB2  1  
ATOM 8556   H HB3  . ALA D 1 95  ? -30.683 17.948  -7.259  1.00 3.12  ? 95  ALA D HB3  1  
ATOM 8557   N N    . HIS D 1 96  ? -28.497 16.586  -8.936  1.00 51.11 ? 96  HIS D N    1  
ATOM 8558   C CA   . HIS D 1 96  ? -28.215 15.409  -9.778  1.00 63.23 ? 96  HIS D CA   1  
ATOM 8559   C C    . HIS D 1 96  ? -26.697 15.183  -9.882  1.00 51.31 ? 96  HIS D C    1  
ATOM 8560   O O    . HIS D 1 96  ? -26.226 14.047  -9.860  1.00 12.13 ? 96  HIS D O    1  
ATOM 8561   C CB   . HIS D 1 96  ? -28.838 15.621  -11.180 1.00 10.53 ? 96  HIS D CB   1  
ATOM 8562   C CG   . HIS D 1 96  ? -28.667 14.485  -12.159 1.00 42.51 ? 96  HIS D CG   1  
ATOM 8563   N ND1  . HIS D 1 96  ? -28.540 14.693  -13.510 1.00 24.03 ? 96  HIS D ND1  1  
ATOM 8564   C CD2  . HIS D 1 96  ? -28.663 13.139  -11.992 1.00 41.43 ? 96  HIS D CD2  1  
ATOM 8565   C CE1  . HIS D 1 96  ? -28.490 13.541  -14.128 1.00 21.22 ? 96  HIS D CE1  1  
ATOM 8566   N NE2  . HIS D 1 96  ? -28.558 12.577  -13.233 1.00 40.00 ? 96  HIS D NE2  1  
ATOM 8567   H H    . HIS D 1 96  ? -28.859 17.389  -9.371  1.00 72.13 ? 96  HIS D H    1  
ATOM 8568   H HA   . HIS D 1 96  ? -28.676 14.542  -9.309  1.00 51.43 ? 96  HIS D HA   1  
ATOM 8569   H HB2  . HIS D 1 96  ? -29.904 15.781  -11.069 1.00 61.33 ? 96  HIS D HB2  1  
ATOM 8570   H HB3  . HIS D 1 96  ? -28.406 16.513  -11.626 1.00 12.22 ? 96  HIS D HB3  1  
ATOM 8571   H HD1  . HIS D 1 96  ? -28.504 15.564  -13.952 1.00 52.12 ? 96  HIS D HD1  1  
ATOM 8572   H HD2  . HIS D 1 96  ? -28.733 12.606  -11.055 1.00 25.23 ? 96  HIS D HD2  1  
ATOM 8573   H HE1  . HIS D 1 96  ? -28.388 13.401  -15.197 1.00 1.12  ? 96  HIS D HE1  1  
ATOM 8574   H HE2  . HIS D 1 96  ? -28.310 11.646  -13.403 1.00 37.65 ? 96  HIS D HE2  1  
ATOM 8575   N N    . CYS D 1 97  ? -25.949 16.289  -9.997  1.00 25.40 ? 97  CYS D N    1  
ATOM 8576   C CA   . CYS D 1 97  ? -24.481 16.257  -10.038 1.00 74.22 ? 97  CYS D CA   1  
ATOM 8577   C C    . CYS D 1 97  ? -23.914 15.839  -8.669  1.00 21.42 ? 97  CYS D C    1  
ATOM 8578   O O    . CYS D 1 97  ? -23.146 14.897  -8.573  1.00 13.11 ? 97  CYS D O    1  
ATOM 8579   C CB   . CYS D 1 97  ? -23.926 17.642  -10.447 1.00 22.02 ? 97  CYS D CB   1  
ATOM 8580   S SG   . CYS D 1 97  ? -22.122 17.725  -10.541 1.00 2.11  ? 97  CYS D SG   1  
ATOM 8581   H H    . CYS D 1 97  ? -26.401 17.158  -10.059 1.00 43.02 ? 97  CYS D H    1  
ATOM 8582   H HA   . CYS D 1 97  ? -24.181 15.527  -10.785 1.00 54.05 ? 97  CYS D HA   1  
ATOM 8583   H HB2  . CYS D 1 97  ? -24.312 17.907  -11.421 1.00 24.02 ? 97  CYS D HB2  1  
ATOM 8584   H HB3  . CYS D 1 97  ? -24.251 18.387  -9.728  1.00 1.02  ? 97  CYS D HB3  1  
ATOM 8585   H HG   . CYS D 1 97  ? -21.634 17.360  -9.364  1.00 72.11 ? 97  CYS D HG   1  
ATOM 8586   N N    . LEU D 1 98  ? -24.383 16.505  -7.613  1.00 53.21 ? 98  LEU D N    1  
ATOM 8587   C CA   . LEU D 1 98  ? -23.785 16.424  -6.266  1.00 70.04 ? 98  LEU D CA   1  
ATOM 8588   C C    . LEU D 1 98  ? -24.204 15.126  -5.532  1.00 12.11 ? 98  LEU D C    1  
ATOM 8589   O O    . LEU D 1 98  ? -23.490 14.652  -4.642  1.00 73.12 ? 98  LEU D O    1  
ATOM 8590   C CB   . LEU D 1 98  ? -24.215 17.669  -5.434  1.00 72.53 ? 98  LEU D CB   1  
ATOM 8591   C CG   . LEU D 1 98  ? -23.221 18.098  -4.307  1.00 21.22 ? 98  LEU D CG   1  
ATOM 8592   C CD1  . LEU D 1 98  ? -22.028 18.905  -4.873  1.00 31.05 ? 98  LEU D CD1  1  
ATOM 8593   C CD2  . LEU D 1 98  ? -23.931 18.855  -3.180  1.00 2.24  ? 98  LEU D CD2  1  
ATOM 8594   H H    . LEU D 1 98  ? -25.168 17.066  -7.735  1.00 74.45 ? 98  LEU D H    1  
ATOM 8595   H HA   . LEU D 1 98  ? -22.699 16.429  -6.374  1.00 2.23  ? 98  LEU D HA   1  
ATOM 8596   H HB2  . LEU D 1 98  ? -24.346 18.509  -6.115  1.00 34.13 ? 98  LEU D HB2  1  
ATOM 8597   H HB3  . LEU D 1 98  ? -25.183 17.462  -4.985  1.00 5.01  ? 98  LEU D HB3  1  
ATOM 8598   H HG   . LEU D 1 98  ? -22.801 17.204  -3.863  1.00 25.11 ? 98  LEU D HG   1  
ATOM 8599   H HD11 . LEU D 1 98  ? -22.384 19.812  -5.348  1.00 0.41  ? 98  LEU D HD11 1  
ATOM 8600   H HD12 . LEU D 1 98  ? -21.493 18.306  -5.600  1.00 3.22  ? 98  LEU D HD12 1  
ATOM 8601   H HD13 . LEU D 1 98  ? -21.353 19.165  -4.068  1.00 72.23 ? 98  LEU D HD13 1  
ATOM 8602   H HD21 . LEU D 1 98  ? -24.373 19.765  -3.564  1.00 32.22 ? 98  LEU D HD21 1  
ATOM 8603   H HD22 . LEU D 1 98  ? -23.220 19.101  -2.403  1.00 32.02 ? 98  LEU D HD22 1  
ATOM 8604   H HD23 . LEU D 1 98  ? -24.708 18.230  -2.759  1.00 63.14 ? 98  LEU D HD23 1  
ATOM 8605   N N    . GLY D 1 99  ? -25.371 14.568  -5.921  1.00 14.34 ? 99  GLY D N    1  
ATOM 8606   C CA   . GLY D 1 99  ? -25.951 13.381  -5.270  1.00 0.33  ? 99  GLY D CA   1  
ATOM 8607   C C    . GLY D 1 99  ? -25.870 12.118  -6.122  1.00 42.43 ? 99  GLY D C    1  
ATOM 8608   O O    . GLY D 1 99  ? -26.497 11.108  -5.779  1.00 35.21 ? 99  GLY D O    1  
ATOM 8609   H H    . GLY D 1 99  ? -25.858 14.976  -6.666  1.00 73.23 ? 99  GLY D H    1  
ATOM 8610   H HA2  . GLY D 1 99  ? -25.452 13.192  -4.325  1.00 33.53 ? 99  GLY D HA2  1  
ATOM 8611   H HA3  . GLY D 1 99  ? -26.993 13.591  -5.067  1.00 74.30 ? 99  GLY D HA3  1  
ATOM 8612   N N    . ALA D 1 100 ? -25.095 12.168  -7.228  1.00 2.23  ? 100 ALA D N    1  
ATOM 8613   C CA   . ALA D 1 100 ? -24.921 11.012  -8.134  1.00 74.21 ? 100 ALA D CA   1  
ATOM 8614   C C    . ALA D 1 100 ? -23.531 11.028  -8.798  1.00 42.24 ? 100 ALA D C    1  
ATOM 8615   O O    . ALA D 1 100 ? -22.748 10.090  -8.613  1.00 62.45 ? 100 ALA D O    1  
ATOM 8616   C CB   . ALA D 1 100 ? -26.046 10.978  -9.182  1.00 15.22 ? 100 ALA D CB   1  
ATOM 8617   H H    . ALA D 1 100 ? -24.632 13.006  -7.438  1.00 51.25 ? 100 ALA D H    1  
ATOM 8618   H HA   . ALA D 1 100 ? -24.997 10.100  -7.534  1.00 14.21 ? 100 ALA D HA   1  
ATOM 8619   H HB1  . ALA D 1 100 ? -25.978 11.847  -9.825  1.00 72.33 ? 100 ALA D HB1  1  
ATOM 8620   H HB2  . ALA D 1 100 ? -27.008 10.982  -8.684  1.00 31.15 ? 100 ALA D HB2  1  
ATOM 8621   H HB3  . ALA D 1 100 ? -25.962 10.081  -9.779  1.00 61.22 ? 100 ALA D HB3  1  
ATOM 8622   N N    . TYR D 1 101 ? -23.217 12.118  -9.525  1.00 64.53 ? 101 TYR D N    1  
ATOM 8623   C CA   . TYR D 1 101 ? -21.968 12.237  -10.314 1.00 22.15 ? 101 TYR D CA   1  
ATOM 8624   C C    . TYR D 1 101 ? -20.725 12.385  -9.400  1.00 44.22 ? 101 TYR D C    1  
ATOM 8625   O O    . TYR D 1 101 ? -19.711 11.710  -9.604  1.00 62.34 ? 101 TYR D O    1  
ATOM 8626   C CB   . TYR D 1 101 ? -22.082 13.436  -11.294 1.00 64.40 ? 101 TYR D CB   1  
ATOM 8627   C CG   . TYR D 1 101 ? -20.798 13.763  -12.073 1.00 50.13 ? 101 TYR D CG   1  
ATOM 8628   C CD1  . TYR D 1 101 ? -20.201 12.823  -12.918 1.00 42.55 ? 101 TYR D CD1  1  
ATOM 8629   C CD2  . TYR D 1 101 ? -20.176 15.011  -11.949 1.00 3.14  ? 101 TYR D CD2  1  
ATOM 8630   C CE1  . TYR D 1 101 ? -19.037 13.114  -13.603 1.00 12.43 ? 101 TYR D CE1  1  
ATOM 8631   C CE2  . TYR D 1 101 ? -19.019 15.305  -12.636 1.00 5.40  ? 101 TYR D CE2  1  
ATOM 8632   C CZ   . TYR D 1 101 ? -18.451 14.356  -13.459 1.00 51.14 ? 101 TYR D CZ   1  
ATOM 8633   O OH   . TYR D 1 101 ? -17.284 14.646  -14.132 1.00 32.54 ? 101 TYR D OH   1  
ATOM 8634   H H    . TYR D 1 101 ? -23.847 12.874  -9.529  1.00 14.35 ? 101 TYR D H    1  
ATOM 8635   H HA   . TYR D 1 101 ? -21.865 11.323  -10.896 1.00 62.25 ? 101 TYR D HA   1  
ATOM 8636   H HB2  . TYR D 1 101 ? -22.860 13.230  -12.021 1.00 13.34 ? 101 TYR D HB2  1  
ATOM 8637   H HB3  . TYR D 1 101 ? -22.366 14.320  -10.726 1.00 2.54  ? 101 TYR D HB3  1  
ATOM 8638   H HD1  . TYR D 1 101 ? -20.660 11.846  -13.031 1.00 3.31  ? 101 TYR D HD1  1  
ATOM 8639   H HD2  . TYR D 1 101 ? -20.620 15.759  -11.300 1.00 21.34 ? 101 TYR D HD2  1  
ATOM 8640   H HE1  . TYR D 1 101 ? -18.593 12.372  -14.254 1.00 2.24  ? 101 TYR D HE1  1  
ATOM 8641   H HE2  . TYR D 1 101 ? -18.558 16.280  -12.522 1.00 21.31 ? 101 TYR D HE2  1  
ATOM 8642   H HH   . TYR D 1 101 ? -17.325 14.262  -15.006 1.00 20.50 ? 101 TYR D HH   1  
ATOM 8643   N N    . CYS D 1 102 ? -20.821 13.276  -8.400  1.00 31.30 ? 102 CYS D N    1  
ATOM 8644   C CA   . CYS D 1 102 ? -19.722 13.565  -7.463  1.00 52.22 ? 102 CYS D CA   1  
ATOM 8645   C C    . CYS D 1 102 ? -19.412 12.344  -6.544  1.00 14.44 ? 102 CYS D C    1  
ATOM 8646   O O    . CYS D 1 102 ? -18.230 12.031  -6.357  1.00 5.25  ? 102 CYS D O    1  
ATOM 8647   C CB   . CYS D 1 102 ? -20.031 14.840  -6.644  1.00 71.10 ? 102 CYS D CB   1  
ATOM 8648   S SG   . CYS D 1 102 ? -20.435 16.269  -7.663  1.00 62.12 ? 102 CYS D SG   1  
ATOM 8649   H H    . CYS D 1 102 ? -21.659 13.744  -8.282  1.00 44.05 ? 102 CYS D H    1  
ATOM 8650   H HA   . CYS D 1 102 ? -18.842 13.765  -8.072  1.00 64.40 ? 102 CYS D HA   1  
ATOM 8651   H HB2  . CYS D 1 102 ? -20.871 14.660  -5.984  1.00 33.21 ? 102 CYS D HB2  1  
ATOM 8652   H HB3  . CYS D 1 102 ? -19.167 15.104  -6.049  1.00 52.53 ? 102 CYS D HB3  1  
ATOM 8653   H HG   . CYS D 1 102 ? -19.350 17.017  -7.724  1.00 50.12 ? 102 CYS D HG   1  
ATOM 8654   N N    . PRO D 1 103 ? -20.449 11.624  -5.954  1.00 1.24  ? 103 PRO D N    1  
ATOM 8655   C CA   . PRO D 1 103 ? -20.240 10.283  -5.327  1.00 10.21 ? 103 PRO D CA   1  
ATOM 8656   C C    . PRO D 1 103 ? -19.622 9.242   -6.292  1.00 63.13 ? 103 PRO D C    1  
ATOM 8657   O O    . PRO D 1 103 ? -18.865 8.377   -5.863  1.00 61.35 ? 103 PRO D O    1  
ATOM 8658   C CB   . PRO D 1 103 ? -21.664 9.854   -4.888  1.00 25.35 ? 103 PRO D CB   1  
ATOM 8659   C CG   . PRO D 1 103 ? -22.385 11.147  -4.675  1.00 10.04 ? 103 PRO D CG   1  
ATOM 8660   C CD   . PRO D 1 103 ? -21.860 12.073  -5.748  1.00 22.22 ? 103 PRO D CD   1  
ATOM 8661   H HA   . PRO D 1 103 ? -19.601 10.371  -4.453  1.00 65.40 ? 103 PRO D HA   1  
ATOM 8662   H HB2  . PRO D 1 103 ? -22.148 9.257   -5.670  1.00 45.24 ? 103 PRO D HB2  1  
ATOM 8663   H HB3  . PRO D 1 103 ? -21.624 9.288   -3.968  1.00 60.32 ? 103 PRO D HB3  1  
ATOM 8664   H HG2  . PRO D 1 103 ? -23.458 11.003  -4.780  1.00 31.03 ? 103 PRO D HG2  1  
ATOM 8665   H HG3  . PRO D 1 103 ? -22.155 11.549  -3.694  1.00 23.44 ? 103 PRO D HG3  1  
ATOM 8666   H HD2  . PRO D 1 103 ? -22.435 11.973  -6.665  1.00 1.30  ? 103 PRO D HD2  1  
ATOM 8667   H HD3  . PRO D 1 103 ? -21.883 13.102  -5.407  1.00 74.35 ? 103 PRO D HD3  1  
ATOM 8668   N N    . ASN D 1 104 ? -19.952 9.340   -7.597  1.00 21.12 ? 104 ASN D N    1  
ATOM 8669   C CA   . ASN D 1 104 ? -19.420 8.420   -8.639  1.00 13.14 ? 104 ASN D CA   1  
ATOM 8670   C C    . ASN D 1 104 ? -17.915 8.692   -8.914  1.00 20.12 ? 104 ASN D C    1  
ATOM 8671   O O    . ASN D 1 104 ? -17.193 7.798   -9.351  1.00 54.02 ? 104 ASN D O    1  
ATOM 8672   C CB   . ASN D 1 104 ? -20.267 8.542   -9.943  1.00 33.14 ? 104 ASN D CB   1  
ATOM 8673   C CG   . ASN D 1 104 ? -19.857 7.563   -11.057 1.00 72.32 ? 104 ASN D CG   1  
ATOM 8674   O OD1  . ASN D 1 104 ? -19.054 7.892   -11.928 1.00 61.02 ? 104 ASN D OD1  1  
ATOM 8675   N ND2  . ASN D 1 104 ? -20.392 6.347   -11.029 1.00 41.44 ? 104 ASN D ND2  1  
ATOM 8676   H H    . ASN D 1 104 ? -20.567 10.050  -7.871  1.00 65.33 ? 104 ASN D H    1  
ATOM 8677   H HA   . ASN D 1 104 ? -19.521 7.407   -8.258  1.00 41.15 ? 104 ASN D HA   1  
ATOM 8678   H HB2  . ASN D 1 104 ? -21.308 8.364   -9.705  1.00 63.55 ? 104 ASN D HB2  1  
ATOM 8679   H HB3  . ASN D 1 104 ? -20.174 9.554   -10.329 1.00 21.03 ? 104 ASN D HB3  1  
ATOM 8680   H HD21 . ASN D 1 104 ? -21.014 6.126   -10.310 1.00 70.02 ? 104 ASN D HD21 1  
ATOM 8681   H HD22 . ASN D 1 104 ? -20.137 5.718   -11.736 1.00 63.12 ? 104 ASN D HD22 1  
ATOM 8682   N N    . ILE D 1 105 ? -17.459 9.937   -8.644  1.00 75.23 ? 105 ILE D N    1  
ATOM 8683   C CA   . ILE D 1 105 ? -16.021 10.322  -8.686  1.00 35.41 ? 105 ILE D CA   1  
ATOM 8684   C C    . ILE D 1 105 ? -15.297 9.813   -7.420  1.00 25.31 ? 105 ILE D C    1  
ATOM 8685   O O    . ILE D 1 105 ? -14.126 9.407   -7.465  1.00 15.34 ? 105 ILE D O    1  
ATOM 8686   C CB   . ILE D 1 105 ? -15.868 11.894  -8.837  1.00 62.24 ? 105 ILE D CB   1  
ATOM 8687   C CG1  . ILE D 1 105 ? -16.388 12.339  -10.243 1.00 11.51 ? 105 ILE D CG1  1  
ATOM 8688   C CG2  . ILE D 1 105 ? -14.411 12.384  -8.594  1.00 71.44 ? 105 ILE D CG2  1  
ATOM 8689   C CD1  . ILE D 1 105 ? -16.322 13.830  -10.534 1.00 72.23 ? 105 ILE D CD1  1  
ATOM 8690   H H    . ILE D 1 105 ? -18.113 10.627  -8.410  1.00 33.32 ? 105 ILE D H    1  
ATOM 8691   H HA   . ILE D 1 105 ? -15.569 9.846   -9.557  1.00 71.32 ? 105 ILE D HA   1  
ATOM 8692   H HB   . ILE D 1 105 ? -16.493 12.361  -8.078  1.00 60.02 ? 105 ILE D HB   1  
ATOM 8693   H HG12 . ILE D 1 105 ? -15.814 11.839  -11.010 1.00 73.33 ? 105 ILE D HG12 1  
ATOM 8694   H HG13 . ILE D 1 105 ? -17.426 12.041  -10.342 1.00 34.01 ? 105 ILE D HG13 1  
ATOM 8695   H HG21 . ILE D 1 105 ? -14.066 12.051  -7.621  1.00 1.35  ? 105 ILE D HG21 1  
ATOM 8696   H HG22 . ILE D 1 105 ? -14.380 13.466  -8.622  1.00 42.42 ? 105 ILE D HG22 1  
ATOM 8697   H HG23 . ILE D 1 105 ? -13.755 11.994  -9.360  1.00 62.11 ? 105 ILE D HG23 1  
ATOM 8698   H HD11 . ILE D 1 105 ? -16.429 13.987  -11.596 1.00 10.23 ? 105 ILE D HD11 1  
ATOM 8699   H HD12 . ILE D 1 105 ? -15.379 14.240  -10.203 1.00 33.11 ? 105 ILE D HD12 1  
ATOM 8700   H HD13 . ILE D 1 105 ? -17.132 14.331  -10.027 1.00 0.30  ? 105 ILE D HD13 1  
ATOM 8701   N N    . LEU D 1 106 ? -16.027 9.814   -6.297  1.00 3.04  ? 106 LEU D N    1  
ATOM 8702   C CA   . LEU D 1 106 ? -15.527 9.326   -5.001  1.00 50.42 ? 106 LEU D CA   1  
ATOM 8703   C C    . LEU D 1 106 ? -15.511 7.788   -4.939  1.00 43.23 ? 106 LEU D C    1  
ATOM 8704   O O    . LEU D 1 106 ? -14.753 7.216   -4.167  1.00 4.34  ? 106 LEU D O    1  
ATOM 8705   C CB   . LEU D 1 106 ? -16.415 9.893   -3.870  1.00 21.44 ? 106 LEU D CB   1  
ATOM 8706   C CG   . LEU D 1 106 ? -16.379 11.441  -3.704  1.00 62.25 ? 106 LEU D CG   1  
ATOM 8707   C CD1  . LEU D 1 106 ? -17.423 11.912  -2.675  1.00 73.51 ? 106 LEU D CD1  1  
ATOM 8708   C CD2  . LEU D 1 106 ? -14.959 11.924  -3.345  1.00 50.42 ? 106 LEU D CD2  1  
ATOM 8709   H H    . LEU D 1 106 ? -16.946 10.161  -6.345  1.00 75.35 ? 106 LEU D H    1  
ATOM 8710   H HA   . LEU D 1 106 ? -14.513 9.696   -4.873  1.00 5.31  ? 106 LEU D HA   1  
ATOM 8711   H HB2  . LEU D 1 106 ? -17.443 9.595   -4.073  1.00 71.40 ? 106 LEU D HB2  1  
ATOM 8712   H HB3  . LEU D 1 106 ? -16.120 9.439   -2.929  1.00 24.03 ? 106 LEU D HB3  1  
ATOM 8713   H HG   . LEU D 1 106 ? -16.644 11.900  -4.652  1.00 61.33 ? 106 LEU D HG   1  
ATOM 8714   H HD11 . LEU D 1 106 ? -17.432 12.991  -2.612  1.00 73.34 ? 106 LEU D HD11 1  
ATOM 8715   H HD12 . LEU D 1 106 ? -17.200 11.499  -1.699  1.00 3.14  ? 106 LEU D HD12 1  
ATOM 8716   H HD13 . LEU D 1 106 ? -18.397 11.581  -2.981  1.00 72.42 ? 106 LEU D HD13 1  
ATOM 8717   H HD21 . LEU D 1 106 ? -14.641 11.483  -2.405  1.00 24.31 ? 106 LEU D HD21 1  
ATOM 8718   H HD22 . LEU D 1 106 ? -14.959 12.999  -3.254  1.00 71.14 ? 106 LEU D HD22 1  
ATOM 8719   H HD23 . LEU D 1 106 ? -14.269 11.641  -4.127  1.00 22.11 ? 106 LEU D HD23 1  
ATOM 8720   N N    . PHE D 1 107 ? -16.342 7.144   -5.784  1.00 42.35 ? 107 PHE D N    1  
ATOM 8721   C CA   . PHE D 1 107 ? -16.611 5.690   -5.736  1.00 25.23 ? 107 PHE D CA   1  
ATOM 8722   C C    . PHE D 1 107 ? -15.378 4.803   -6.115  1.00 14.21 ? 107 PHE D C    1  
ATOM 8723   O O    . PHE D 1 107 ? -15.177 3.777   -5.455  1.00 73.24 ? 107 PHE D O    1  
ATOM 8724   C CB   . PHE D 1 107 ? -17.840 5.346   -6.627  1.00 40.31 ? 107 PHE D CB   1  
ATOM 8725   C CG   . PHE D 1 107 ? -18.443 3.965   -6.375  1.00 44.14 ? 107 PHE D CG   1  
ATOM 8726   C CD1  . PHE D 1 107 ? -19.073 3.686   -5.157  1.00 42.32 ? 107 PHE D CD1  1  
ATOM 8727   C CD2  . PHE D 1 107 ? -18.402 2.958   -7.346  1.00 74.11 ? 107 PHE D CD2  1  
ATOM 8728   C CE1  . PHE D 1 107 ? -19.640 2.451   -4.921  1.00 15.33 ? 107 PHE D CE1  1  
ATOM 8729   C CE2  . PHE D 1 107 ? -18.968 1.721   -7.106  1.00 55.33 ? 107 PHE D CE2  1  
ATOM 8730   C CZ   . PHE D 1 107 ? -19.588 1.468   -5.896  1.00 13.43 ? 107 PHE D CZ   1  
ATOM 8731   H H    . PHE D 1 107 ? -16.809 7.677   -6.464  1.00 63.25 ? 107 PHE D H    1  
ATOM 8732   H HA   . PHE D 1 107 ? -16.872 5.466   -4.704  1.00 51.02 ? 107 PHE D HA   1  
ATOM 8733   H HB2  . PHE D 1 107 ? -18.622 6.079   -6.445  1.00 21.24 ? 107 PHE D HB2  1  
ATOM 8734   H HB3  . PHE D 1 107 ? -17.554 5.411   -7.672  1.00 1.34  ? 107 PHE D HB3  1  
ATOM 8735   H HD1  . PHE D 1 107 ? -19.117 4.458   -4.390  1.00 65.24 ? 107 PHE D HD1  1  
ATOM 8736   H HD2  . PHE D 1 107 ? -17.916 3.152   -8.295  1.00 33.23 ? 107 PHE D HD2  1  
ATOM 8737   H HE1  . PHE D 1 107 ? -20.124 2.248   -3.972  1.00 65.54 ? 107 PHE D HE1  1  
ATOM 8738   H HE2  . PHE D 1 107 ? -18.930 0.950   -7.866  1.00 41.12 ? 107 PHE D HE2  1  
ATOM 8739   H HZ   . PHE D 1 107 ? -20.034 0.498   -5.709  1.00 51.25 ? 107 PHE D HZ   1  
ATOM 8740   N N    . PRO D 1 108 ? -14.547 5.130   -7.175  1.00 32.53 ? 108 PRO D N    1  
ATOM 8741   C CA   . PRO D 1 108 ? -13.293 4.379   -7.458  1.00 51.33 ? 108 PRO D CA   1  
ATOM 8742   C C    . PRO D 1 108 ? -12.288 4.435   -6.288  1.00 12.51 ? 108 PRO D C    1  
ATOM 8743   O O    . PRO D 1 108 ? -11.647 3.430   -5.966  1.00 44.53 ? 108 PRO D O    1  
ATOM 8744   C CB   . PRO D 1 108 ? -12.724 5.068   -8.727  1.00 31.45 ? 108 PRO D CB   1  
ATOM 8745   C CG   . PRO D 1 108 ? -13.908 5.728   -9.362  1.00 0.01  ? 108 PRO D CG   1  
ATOM 8746   C CD   . PRO D 1 108 ? -14.773 6.176   -8.211  1.00 60.21 ? 108 PRO D CD   1  
ATOM 8747   H HA   . PRO D 1 108 ? -13.516 3.335   -7.681  1.00 31.41 ? 108 PRO D HA   1  
ATOM 8748   H HB2  . PRO D 1 108 ? -11.964 5.805   -8.454  1.00 22.23 ? 108 PRO D HB2  1  
ATOM 8749   H HB3  . PRO D 1 108 ? -12.297 4.334   -9.397  1.00 43.44 ? 108 PRO D HB3  1  
ATOM 8750   H HG2  . PRO D 1 108 ? -13.590 6.578   -9.959  1.00 12.51 ? 108 PRO D HG2  1  
ATOM 8751   H HG3  . PRO D 1 108 ? -14.451 5.018   -9.978  1.00 74.11 ? 108 PRO D HG3  1  
ATOM 8752   H HD2  . PRO D 1 108 ? -14.464 7.152   -7.845  1.00 2.13  ? 108 PRO D HD2  1  
ATOM 8753   H HD3  . PRO D 1 108 ? -15.816 6.204   -8.505  1.00 24.33 ? 108 PRO D HD3  1  
ATOM 8754   N N    . TYR D 1 109 ? -12.174 5.627   -5.664  1.00 33.33 ? 109 TYR D N    1  
ATOM 8755   C CA   . TYR D 1 109 ? -11.272 5.867   -4.518  1.00 1.25  ? 109 TYR D CA   1  
ATOM 8756   C C    . TYR D 1 109 ? -11.804 5.204   -3.231  1.00 72.33 ? 109 TYR D C    1  
ATOM 8757   O O    . TYR D 1 109 ? -11.020 4.756   -2.383  1.00 13.41 ? 109 TYR D O    1  
ATOM 8758   C CB   . TYR D 1 109 ? -11.086 7.383   -4.283  1.00 42.31 ? 109 TYR D CB   1  
ATOM 8759   C CG   . TYR D 1 109 ? -10.280 8.105   -5.374  1.00 21.23 ? 109 TYR D CG   1  
ATOM 8760   C CD1  . TYR D 1 109 ? -10.906 8.823   -6.398  1.00 44.03 ? 109 TYR D CD1  1  
ATOM 8761   C CD2  . TYR D 1 109 ? -8.881  8.080   -5.359  1.00 61.10 ? 109 TYR D CD2  1  
ATOM 8762   C CE1  . TYR D 1 109 ? -10.167 9.488   -7.360  1.00 24.03 ? 109 TYR D CE1  1  
ATOM 8763   C CE2  . TYR D 1 109 ? -8.145  8.736   -6.321  1.00 71.42 ? 109 TYR D CE2  1  
ATOM 8764   C CZ   . TYR D 1 109 ? -8.786  9.439   -7.315  1.00 52.14 ? 109 TYR D CZ   1  
ATOM 8765   O OH   . TYR D 1 109 ? -8.037  10.103  -8.259  1.00 61.05 ? 109 TYR D OH   1  
ATOM 8766   H H    . TYR D 1 109 ? -12.726 6.372   -5.988  1.00 23.30 ? 109 TYR D H    1  
ATOM 8767   H HA   . TYR D 1 109 ? -10.307 5.425   -4.759  1.00 44.54 ? 109 TYR D HA   1  
ATOM 8768   H HB2  . TYR D 1 109 ? -12.061 7.856   -4.220  1.00 22.42 ? 109 TYR D HB2  1  
ATOM 8769   H HB3  . TYR D 1 109 ? -10.572 7.541   -3.337  1.00 73.13 ? 109 TYR D HB3  1  
ATOM 8770   H HD1  . TYR D 1 109 ? -11.989 8.860   -6.432  1.00 63.32 ? 109 TYR D HD1  1  
ATOM 8771   H HD2  . TYR D 1 109 ? -8.370  7.531   -4.577  1.00 71.24 ? 109 TYR D HD2  1  
ATOM 8772   H HE1  . TYR D 1 109 ? -10.672 10.041  -8.145  1.00 1.23  ? 109 TYR D HE1  1  
ATOM 8773   H HE2  . TYR D 1 109 ? -7.062  8.697   -6.288  1.00 2.54  ? 109 TYR D HE2  1  
ATOM 8774   H HH   . TYR D 1 109 ? -8.350  11.005  -8.341  1.00 75.54 ? 109 TYR D HH   1  
ATOM 8775   N N    . ALA D 1 110 ? -13.146 5.164   -3.096  1.00 23.51 ? 110 ALA D N    1  
ATOM 8776   C CA   . ALA D 1 110 ? -13.833 4.510   -1.971  1.00 54.41 ? 110 ALA D CA   1  
ATOM 8777   C C    . ALA D 1 110 ? -13.543 3.010   -1.998  1.00 75.20 ? 110 ALA D C    1  
ATOM 8778   O O    . ALA D 1 110 ? -13.083 2.436   -1.004  1.00 51.34 ? 110 ALA D O    1  
ATOM 8779   C CB   . ALA D 1 110 ? -15.349 4.735   -2.048  1.00 64.00 ? 110 ALA D CB   1  
ATOM 8780   H H    . ALA D 1 110 ? -13.690 5.583   -3.790  1.00 41.31 ? 110 ALA D H    1  
ATOM 8781   H HA   . ALA D 1 110 ? -13.464 4.942   -1.042  1.00 3.24  ? 110 ALA D HA   1  
ATOM 8782   H HB1  . ALA D 1 110 ? -15.836 4.125   -1.298  1.00 21.15 ? 110 ALA D HB1  1  
ATOM 8783   H HB2  . ALA D 1 110 ? -15.721 4.451   -3.022  1.00 3.23  ? 110 ALA D HB2  1  
ATOM 8784   H HB3  . ALA D 1 110 ? -15.614 5.763   -1.859  1.00 33.35 ? 110 ALA D HB3  1  
ATOM 8785   N N    . ARG D 1 111 ? -13.815 2.411   -3.182  1.00 31.01 ? 111 ARG D N    1  
ATOM 8786   C CA   . ARG D 1 111 ? -13.571 0.994   -3.466  1.00 34.34 ? 111 ARG D CA   1  
ATOM 8787   C C    . ARG D 1 111 ? -12.109 0.631   -3.181  1.00 72.04 ? 111 ARG D C    1  
ATOM 8788   O O    . ARG D 1 111 ? -11.857 -0.309  -2.458  1.00 33.05 ? 111 ARG D O    1  
ATOM 8789   C CB   . ARG D 1 111 ? -13.936 0.665   -4.946  1.00 73.41 ? 111 ARG D CB   1  
ATOM 8790   C CG   . ARG D 1 111 ? -13.527 -0.754  -5.419  1.00 53.33 ? 111 ARG D CG   1  
ATOM 8791   C CD   . ARG D 1 111 ? -13.834 -1.011  -6.903  1.00 12.32 ? 111 ARG D CD   1  
ATOM 8792   N NE   . ARG D 1 111 ? -13.369 0.085   -7.783  1.00 51.42 ? 111 ARG D NE   1  
ATOM 8793   C CZ   . ARG D 1 111 ? -14.113 0.684   -8.736  1.00 43.23 ? 111 ARG D CZ   1  
ATOM 8794   N NH1  . ARG D 1 111 ? -15.376 0.302   -8.967  1.00 31.32 ? 111 ARG D NH1  1  
ATOM 8795   N NH2  . ARG D 1 111 ? -13.595 1.674   -9.453  1.00 75.01 ? 111 ARG D NH2  1  
ATOM 8796   H H    . ARG D 1 111 ? -14.193 2.966   -3.895  1.00 71.41 ? 111 ARG D H    1  
ATOM 8797   H HA   . ARG D 1 111 ? -14.214 0.417   -2.808  1.00 31.33 ? 111 ARG D HA   1  
ATOM 8798   H HB2  . ARG D 1 111 ? -15.009 0.768   -5.071  1.00 71.21 ? 111 ARG D HB2  1  
ATOM 8799   H HB3  . ARG D 1 111 ? -13.448 1.392   -5.593  1.00 63.41 ? 111 ARG D HB3  1  
ATOM 8800   H HG2  . ARG D 1 111 ? -12.457 -0.878  -5.264  1.00 41.42 ? 111 ARG D HG2  1  
ATOM 8801   H HG3  . ARG D 1 111 ? -14.053 -1.488  -4.815  1.00 0.23  ? 111 ARG D HG3  1  
ATOM 8802   H HD2  . ARG D 1 111 ? -13.337 -1.924  -7.208  1.00 54.41 ? 111 ARG D HD2  1  
ATOM 8803   H HD3  . ARG D 1 111 ? -14.905 -1.145  -7.027  1.00 72.45 ? 111 ARG D HD3  1  
ATOM 8804   H HE   . ARG D 1 111 ? -12.437 0.377   -7.663  1.00 12.24 ? 111 ARG D HE   1  
ATOM 8805   H HH11 . ARG D 1 111 ? -15.782 -0.439  -8.425  1.00 21.13 ? 111 ARG D HH11 1  
ATOM 8806   H HH12 . ARG D 1 111 ? -15.921 0.755   -9.675  1.00 2.33  ? 111 ARG D HH12 1  
ATOM 8807   H HH21 . ARG D 1 111 ? -12.651 1.974   -9.291  1.00 62.31 ? 111 ARG D HH21 1  
ATOM 8808   H HH22 . ARG D 1 111 ? -14.140 2.123   -10.160 1.00 73.41 ? 111 ARG D HH22 1  
ATOM 8809   N N    . GLU D 1 112 ? -11.178 1.455   -3.704  1.00 3.11  ? 112 GLU D N    1  
ATOM 8810   C CA   . GLU D 1 112 ? -9.721  1.218   -3.612  1.00 63.22 ? 112 GLU D CA   1  
ATOM 8811   C C    . GLU D 1 112 ? -9.246  1.166   -2.151  1.00 15.41 ? 112 GLU D C    1  
ATOM 8812   O O    . GLU D 1 112 ? -8.495  0.258   -1.776  1.00 71.32 ? 112 GLU D O    1  
ATOM 8813   C CB   . GLU D 1 112 ? -8.968  2.320   -4.407  1.00 54.11 ? 112 GLU D CB   1  
ATOM 8814   C CG   . GLU D 1 112 ? -7.417  2.181   -4.495  1.00 24.01 ? 112 GLU D CG   1  
ATOM 8815   C CD   . GLU D 1 112 ? -6.635  2.764   -3.298  1.00 72.31 ? 112 GLU D CD   1  
ATOM 8816   O OE1  . GLU D 1 112 ? -6.039  1.990   -2.507  1.00 65.05 ? 112 GLU D OE1  1  
ATOM 8817   O OE2  . GLU D 1 112 ? -6.649  4.004   -3.127  1.00 22.12 ? 112 GLU D OE2  1  
ATOM 8818   H H    . GLU D 1 112 ? -11.485 2.264   -4.173  1.00 33.45 ? 112 GLU D H    1  
ATOM 8819   H HA   . GLU D 1 112 ? -9.524  0.250   -4.077  1.00 53.12 ? 112 GLU D HA   1  
ATOM 8820   H HB2  . GLU D 1 112 ? -9.363  2.321   -5.420  1.00 71.00 ? 112 GLU D HB2  1  
ATOM 8821   H HB3  . GLU D 1 112 ? -9.202  3.283   -3.962  1.00 71.54 ? 112 GLU D HB3  1  
ATOM 8822   H HG2  . GLU D 1 112 ? -7.172  1.130   -4.594  1.00 14.30 ? 112 GLU D HG2  1  
ATOM 8823   H HG3  . GLU D 1 112 ? -7.082  2.689   -5.394  1.00 41.30 ? 112 GLU D HG3  1  
ATOM 8824   N N    . CYS D 1 113 ? -9.705  2.143   -1.341  1.00 73.10 ? 113 CYS D N    1  
ATOM 8825   C CA   . CYS D 1 113 ? -9.338  2.248   0.083   1.00 50.05 ? 113 CYS D CA   1  
ATOM 8826   C C    . CYS D 1 113 ? -9.772  0.984   0.853   1.00 65.11 ? 113 CYS D C    1  
ATOM 8827   O O    . CYS D 1 113 ? -9.012  0.458   1.676   1.00 33.12 ? 113 CYS D O    1  
ATOM 8828   C CB   . CYS D 1 113 ? -9.965  3.509   0.714   1.00 52.12 ? 113 CYS D CB   1  
ATOM 8829   S SG   . CYS D 1 113 ? -9.434  3.832   2.413   1.00 71.33 ? 113 CYS D SG   1  
ATOM 8830   H H    . CYS D 1 113 ? -10.305 2.824   -1.723  1.00 55.12 ? 113 CYS D H    1  
ATOM 8831   H HA   . CYS D 1 113 ? -8.254  2.337   0.133   1.00 24.20 ? 113 CYS D HA   1  
ATOM 8832   H HB2  . CYS D 1 113 ? -9.699  4.376   0.123   1.00 41.24 ? 113 CYS D HB2  1  
ATOM 8833   H HB3  . CYS D 1 113 ? -11.042 3.406   0.722   1.00 23.32 ? 113 CYS D HB3  1  
ATOM 8834   H HG   . CYS D 1 113 ? -9.210  2.669   3.007   1.00 2.34  ? 113 CYS D HG   1  
ATOM 8835   N N    . ILE D 1 114 ? -10.994 0.508   0.538   1.00 41.21 ? 114 ILE D N    1  
ATOM 8836   C CA   . ILE D 1 114 ? -11.550 -0.745  1.076   1.00 41.00 ? 114 ILE D CA   1  
ATOM 8837   C C    . ILE D 1 114 ? -10.720 -1.963  0.612   1.00 11.33 ? 114 ILE D C    1  
ATOM 8838   O O    . ILE D 1 114 ? -10.269 -2.757  1.443   1.00 45.35 ? 114 ILE D O    1  
ATOM 8839   C CB   . ILE D 1 114 ? -13.059 -0.928  0.648   1.00 34.33 ? 114 ILE D CB   1  
ATOM 8840   C CG1  . ILE D 1 114 ? -13.939 0.244   1.200   1.00 3.25  ? 114 ILE D CG1  1  
ATOM 8841   C CG2  . ILE D 1 114 ? -13.615 -2.299  1.098   1.00 33.11 ? 114 ILE D CG2  1  
ATOM 8842   C CD1  . ILE D 1 114 ? -15.406 0.187   0.802   1.00 72.23 ? 114 ILE D CD1  1  
ATOM 8843   H H    . ILE D 1 114 ? -11.546 1.032   -0.084  1.00 43.44 ? 114 ILE D H    1  
ATOM 8844   H HA   . ILE D 1 114 ? -11.509 -0.683  2.161   1.00 62.21 ? 114 ILE D HA   1  
ATOM 8845   H HB   . ILE D 1 114 ? -13.096 -0.903  -0.440  1.00 52.42 ? 114 ILE D HB   1  
ATOM 8846   H HG12 . ILE D 1 114 ? -13.896 0.247   2.280   1.00 13.31 ? 114 ILE D HG12 1  
ATOM 8847   H HG13 . ILE D 1 114 ? -13.541 1.184   0.837   1.00 43.11 ? 114 ILE D HG13 1  
ATOM 8848   H HG21 . ILE D 1 114 ? -14.577 -2.470  0.637   1.00 21.11 ? 114 ILE D HG21 1  
ATOM 8849   H HG22 . ILE D 1 114 ? -13.732 -2.321  2.171   1.00 72.44 ? 114 ILE D HG22 1  
ATOM 8850   H HG23 . ILE D 1 114 ? -12.943 -3.093  0.800   1.00 74.00 ? 114 ILE D HG23 1  
ATOM 8851   H HD11 . ILE D 1 114 ? -15.941 0.998   1.278   1.00 43.44 ? 114 ILE D HD11 1  
ATOM 8852   H HD12 . ILE D 1 114 ? -15.846 -0.756  1.105   1.00 74.45 ? 114 ILE D HD12 1  
ATOM 8853   H HD13 . ILE D 1 114 ? -15.493 0.296   -0.270  1.00 11.54 ? 114 ILE D HD13 1  
ATOM 8854   N N    . THR D 1 115 ? -10.479 -2.043  -0.718  1.00 52.33 ? 115 THR D N    1  
ATOM 8855   C CA   . THR D 1 115 ? -9.835  -3.190  -1.391  1.00 25.24 ? 115 THR D CA   1  
ATOM 8856   C C    . THR D 1 115 ? -8.442  -3.467  -0.790  1.00 34.31 ? 115 THR D C    1  
ATOM 8857   O O    . THR D 1 115 ? -8.066  -4.622  -0.529  1.00 41.32 ? 115 THR D O    1  
ATOM 8858   C CB   . THR D 1 115 ? -9.677  -2.903  -2.933  1.00 74.34 ? 115 THR D CB   1  
ATOM 8859   O OG1  . THR D 1 115 ? -10.940 -2.554  -3.520  1.00 35.44 ? 115 THR D OG1  1  
ATOM 8860   C CG2  . THR D 1 115 ? -9.086  -4.093  -3.707  1.00 3.42  ? 115 THR D CG2  1  
ATOM 8861   H H    . THR D 1 115 ? -10.728 -1.279  -1.270  1.00 20.33 ? 115 THR D H    1  
ATOM 8862   H HA   . THR D 1 115 ? -10.479 -4.057  -1.255  1.00 3.33  ? 115 THR D HA   1  
ATOM 8863   H HB   . THR D 1 115 ? -9.015  -2.052  -3.055  1.00 43.04 ? 115 THR D HB   1  
ATOM 8864   H HG1  . THR D 1 115 ? -11.623 -3.126  -3.167  1.00 60.15 ? 115 THR D HG1  1  
ATOM 8865   H HG21 . THR D 1 115 ? -8.945  -3.818  -4.741  1.00 30.43 ? 115 THR D HG21 1  
ATOM 8866   H HG22 . THR D 1 115 ? -9.762  -4.928  -3.659  1.00 3.12  ? 115 THR D HG22 1  
ATOM 8867   H HG23 . THR D 1 115 ? -8.132  -4.378  -3.278  1.00 0.24  ? 115 THR D HG23 1  
ATOM 8868   N N    . SER D 1 116 ? -7.715  -2.364  -0.551  1.00 1.42  ? 116 SER D N    1  
ATOM 8869   C CA   . SER D 1 116 ? -6.362  -2.377  -0.002  1.00 11.30 ? 116 SER D CA   1  
ATOM 8870   C C    . SER D 1 116 ? -6.371  -2.923  1.439   1.00 74.25 ? 116 SER D C    1  
ATOM 8871   O O    . SER D 1 116 ? -5.529  -3.733  1.792   1.00 62.53 ? 116 SER D O    1  
ATOM 8872   C CB   . SER D 1 116 ? -5.772  -0.947  -0.066  1.00 4.22  ? 116 SER D CB   1  
ATOM 8873   O OG   . SER D 1 116 ? -4.400  -0.901  0.314   1.00 71.25 ? 116 SER D OG   1  
ATOM 8874   H H    . SER D 1 116 ? -8.121  -1.490  -0.756  1.00 34.23 ? 116 SER D H    1  
ATOM 8875   H HA   . SER D 1 116 ? -5.762  -3.042  -0.626  1.00 30.30 ? 116 SER D HA   1  
ATOM 8876   H HB2  . SER D 1 116 ? -5.856  -0.571  -1.077  1.00 15.12 ? 116 SER D HB2  1  
ATOM 8877   H HB3  . SER D 1 116 ? -6.334  -0.295  0.596   1.00 23.01 ? 116 SER D HB3  1  
ATOM 8878   H HG   . SER D 1 116 ? -3.885  -0.484  -0.395  1.00 4.11  ? 116 SER D HG   1  
ATOM 8879   N N    . MET D 1 117 ? -7.368  -2.514  2.247   1.00 30.33 ? 117 MET D N    1  
ATOM 8880   C CA   . MET D 1 117 ? -7.494  -2.964  3.656   1.00 52.33 ? 117 MET D CA   1  
ATOM 8881   C C    . MET D 1 117 ? -7.926  -4.432  3.759   1.00 1.02  ? 117 MET D C    1  
ATOM 8882   O O    . MET D 1 117 ? -7.561  -5.120  4.715   1.00 13.42 ? 117 MET D O    1  
ATOM 8883   C CB   . MET D 1 117 ? -8.488  -2.073  4.423   1.00 10.52 ? 117 MET D CB   1  
ATOM 8884   C CG   . MET D 1 117 ? -8.023  -0.633  4.600   1.00 33.41 ? 117 MET D CG   1  
ATOM 8885   S SD   . MET D 1 117 ? -9.165  0.322   5.600   1.00 14.25 ? 117 MET D SD   1  
ATOM 8886   C CE   . MET D 1 117 ? -10.648 0.274   4.595   1.00 31.14 ? 117 MET D CE   1  
ATOM 8887   H H    . MET D 1 117 ? -8.045  -1.898  1.885   1.00 44.20 ? 117 MET D H    1  
ATOM 8888   H HA   . MET D 1 117 ? -6.511  -2.870  4.116   1.00 14.21 ? 117 MET D HA   1  
ATOM 8889   H HB2  . MET D 1 117 ? -9.436  -2.057  3.892   1.00 55.12 ? 117 MET D HB2  1  
ATOM 8890   H HB3  . MET D 1 117 ? -8.656  -2.492  5.410   1.00 55.21 ? 117 MET D HB3  1  
ATOM 8891   H HG2  . MET D 1 117 ? -7.055  -0.628  5.087   1.00 45.43 ? 117 MET D HG2  1  
ATOM 8892   H HG3  . MET D 1 117 ? -7.933  -0.161  3.630   1.00 32.15 ? 117 MET D HG3  1  
ATOM 8893   H HE1  . MET D 1 117 ? -11.404 0.907   5.032   1.00 54.12 ? 117 MET D HE1  1  
ATOM 8894   H HE2  . MET D 1 117 ? -11.020 -0.740  4.540   1.00 2.42  ? 117 MET D HE2  1  
ATOM 8895   H HE3  . MET D 1 117 ? -10.423 0.629   3.601   1.00 25.42 ? 117 MET D HE3  1  
ATOM 8896   N N    . VAL D 1 118 ? -8.711  -4.890  2.776   1.00 62.01 ? 118 VAL D N    1  
ATOM 8897   C CA   . VAL D 1 118 ? -9.122  -6.295  2.660   1.00 63.43 ? 118 VAL D CA   1  
ATOM 8898   C C    . VAL D 1 118 ? -7.889  -7.180  2.375   1.00 64.52 ? 118 VAL D C    1  
ATOM 8899   O O    . VAL D 1 118 ? -7.720  -8.236  2.993   1.00 71.50 ? 118 VAL D O    1  
ATOM 8900   C CB   . VAL D 1 118 ? -10.224 -6.458  1.543   1.00 71.53 ? 118 VAL D CB   1  
ATOM 8901   C CG1  . VAL D 1 118 ? -10.552 -7.939  1.247   1.00 74.42 ? 118 VAL D CG1  1  
ATOM 8902   C CG2  . VAL D 1 118 ? -11.506 -5.675  1.928   1.00 3.43  ? 118 VAL D CG2  1  
ATOM 8903   H H    . VAL D 1 118 ? -9.028  -4.257  2.099   1.00 75.25 ? 118 VAL D H    1  
ATOM 8904   H HA   . VAL D 1 118 ? -9.554  -6.595  3.615   1.00 61.15 ? 118 VAL D HA   1  
ATOM 8905   H HB   . VAL D 1 118 ? -9.836  -6.019  0.625   1.00 2.11  ? 118 VAL D HB   1  
ATOM 8906   H HG11 . VAL D 1 118 ? -9.686  -8.423  0.811   1.00 23.34 ? 118 VAL D HG11 1  
ATOM 8907   H HG12 . VAL D 1 118 ? -11.381 -8.007  0.555   1.00 25.24 ? 118 VAL D HG12 1  
ATOM 8908   H HG13 . VAL D 1 118 ? -10.812 -8.447  2.167   1.00 72.42 ? 118 VAL D HG13 1  
ATOM 8909   H HG21 . VAL D 1 118 ? -11.920 -6.077  2.845   1.00 40.03 ? 118 VAL D HG21 1  
ATOM 8910   H HG22 . VAL D 1 118 ? -12.243 -5.758  1.139   1.00 55.23 ? 118 VAL D HG22 1  
ATOM 8911   H HG23 . VAL D 1 118 ? -11.265 -4.630  2.076   1.00 14.20 ? 118 VAL D HG23 1  
ATOM 8912   N N    . SER D 1 119 ? -7.000  -6.698  1.486   1.00 0.42  ? 119 SER D N    1  
ATOM 8913   C CA   . SER D 1 119 ? -5.771  -7.420  1.112   1.00 41.15 ? 119 SER D CA   1  
ATOM 8914   C C    . SER D 1 119 ? -4.690  -7.315  2.219   1.00 43.41 ? 119 SER D C    1  
ATOM 8915   O O    . SER D 1 119 ? -3.847  -8.207  2.355   1.00 14.13 ? 119 SER D O    1  
ATOM 8916   C CB   . SER D 1 119 ? -5.239  -6.894  -0.244  1.00 54.02 ? 119 SER D CB   1  
ATOM 8917   O OG   . SER D 1 119 ? -4.910  -5.516  -0.192  1.00 0.24  ? 119 SER D OG   1  
ATOM 8918   H H    . SER D 1 119 ? -7.178  -5.829  1.063   1.00 11.53 ? 119 SER D H    1  
ATOM 8919   H HA   . SER D 1 119 ? -6.039  -8.469  0.994   1.00 1.41  ? 119 SER D HA   1  
ATOM 8920   H HB2  . SER D 1 119 ? -4.357  -7.446  -0.533  1.00 2.45  ? 119 SER D HB2  1  
ATOM 8921   H HB3  . SER D 1 119 ? -6.002  -7.024  -0.998  1.00 45.10 ? 119 SER D HB3  1  
ATOM 8922   H HG   . SER D 1 119 ? -4.491  -5.310  0.647   1.00 72.14 ? 119 SER D HG   1  
ATOM 8923   N N    . ARG D 1 120 ? -4.739  -6.221  3.014   1.00 14.12 ? 120 ARG D N    1  
ATOM 8924   C CA   . ARG D 1 120 ? -3.833  -6.023  4.175   1.00 33.21 ? 120 ARG D CA   1  
ATOM 8925   C C    . ARG D 1 120 ? -4.281  -6.910  5.352   1.00 10.31 ? 120 ARG D C    1  
ATOM 8926   O O    . ARG D 1 120 ? -3.450  -7.413  6.110   1.00 23.42 ? 120 ARG D O    1  
ATOM 8927   C CB   . ARG D 1 120 ? -3.781  -4.523  4.600   1.00 21.35 ? 120 ARG D CB   1  
ATOM 8928   C CG   . ARG D 1 120 ? -3.078  -3.592  3.579   1.00 14.31 ? 120 ARG D CG   1  
ATOM 8929   C CD   . ARG D 1 120 ? -3.192  -2.094  3.936   1.00 62.11 ? 120 ARG D CD   1  
ATOM 8930   N NE   . ARG D 1 120 ? -2.772  -1.238  2.802   1.00 50.23 ? 120 ARG D NE   1  
ATOM 8931   C CZ   . ARG D 1 120 ? -1.549  -0.703  2.626   1.00 72.15 ? 120 ARG D CZ   1  
ATOM 8932   N NH1  . ARG D 1 120 ? -0.579  -0.921  3.509   1.00 51.12 ? 120 ARG D NH1  1  
ATOM 8933   N NH2  . ARG D 1 120 ? -1.288  0.039   1.549   1.00 41.13 ? 120 ARG D NH2  1  
ATOM 8934   H H    . ARG D 1 120 ? -5.412  -5.536  2.820   1.00 62.44 ? 120 ARG D H    1  
ATOM 8935   H HA   . ARG D 1 120 ? -2.838  -6.334  3.868   1.00 2.32  ? 120 ARG D HA   1  
ATOM 8936   H HB2  . ARG D 1 120 ? -4.799  -4.169  4.738   1.00 65.21 ? 120 ARG D HB2  1  
ATOM 8937   H HB3  . ARG D 1 120 ? -3.258  -4.442  5.547   1.00 24.23 ? 120 ARG D HB3  1  
ATOM 8938   H HG2  . ARG D 1 120 ? -2.026  -3.854  3.530   1.00 21.25 ? 120 ARG D HG2  1  
ATOM 8939   H HG3  . ARG D 1 120 ? -3.520  -3.751  2.601   1.00 4.15  ? 120 ARG D HG3  1  
ATOM 8940   H HD2  . ARG D 1 120 ? -4.223  -1.865  4.180   1.00 65.44 ? 120 ARG D HD2  1  
ATOM 8941   H HD3  . ARG D 1 120 ? -2.567  -1.883  4.801   1.00 74.24 ? 120 ARG D HD3  1  
ATOM 8942   H HE   . ARG D 1 120 ? -3.454  -1.061  2.118   1.00 64.05 ? 120 ARG D HE   1  
ATOM 8943   H HH11 . ARG D 1 120 ? -0.748  -1.487  4.315   1.00 31.13 ? 120 ARG D HH11 1  
ATOM 8944   H HH12 . ARG D 1 120 ? 0.334   -0.517  3.363   1.00 54.51 ? 120 ARG D HH12 1  
ATOM 8945   H HH21 . ARG D 1 120 ? -1.998  0.211   0.858   1.00 2.02  ? 120 ARG D HH21 1  
ATOM 8946   H HH22 . ARG D 1 120 ? -0.370  0.436   1.426   1.00 64.31 ? 120 ARG D HH22 1  
ATOM 8947   N N    . GLY D 1 121 ? -5.614  -7.101  5.476   1.00 20.22 ? 121 GLY D N    1  
ATOM 8948   C CA   . GLY D 1 121 ? -6.200  -8.062  6.422   1.00 53.02 ? 121 GLY D CA   1  
ATOM 8949   C C    . GLY D 1 121 ? -6.179  -9.489  5.874   1.00 45.14 ? 121 GLY D C    1  
ATOM 8950   O O    . GLY D 1 121 ? -6.639  -10.416 6.541   1.00 52.32 ? 121 GLY D O    1  
ATOM 8951   H H    . GLY D 1 121 ? -6.211  -6.586  4.902   1.00 0.24  ? 121 GLY D H    1  
ATOM 8952   H HA2  . GLY D 1 121 ? -5.649  -8.032  7.355   1.00 31.34 ? 121 GLY D HA2  1  
ATOM 8953   H HA3  . GLY D 1 121 ? -7.225  -7.777  6.615   1.00 43.32 ? 121 GLY D HA3  1  
ATOM 8954   N N    . THR D 1 122 ? -5.650  -9.620  4.631   1.00 23.42 ? 122 THR D N    1  
ATOM 8955   C CA   . THR D 1 122 ? -5.379  -10.880 3.903   1.00 35.43 ? 122 THR D CA   1  
ATOM 8956   C C    . THR D 1 122 ? -6.646  -11.703 3.573   1.00 14.30 ? 122 THR D C    1  
ATOM 8957   O O    . THR D 1 122 ? -6.551  -12.891 3.244   1.00 41.14 ? 122 THR D O    1  
ATOM 8958   C CB   . THR D 1 122 ? -4.276  -11.768 4.595   1.00 11.22 ? 122 THR D CB   1  
ATOM 8959   O OG1  . THR D 1 122 ? -4.739  -12.294 5.852   1.00 62.14 ? 122 THR D OG1  1  
ATOM 8960   C CG2  . THR D 1 122 ? -2.962  -10.989 4.825   1.00 21.33 ? 122 THR D CG2  1  
ATOM 8961   H H    . THR D 1 122 ? -5.422  -8.796  4.163   1.00 64.41 ? 122 THR D H    1  
ATOM 8962   H HA   . THR D 1 122 ? -4.971  -10.565 2.944   1.00 75.11 ? 122 THR D HA   1  
ATOM 8963   H HB   . THR D 1 122 ? -4.061  -12.608 3.946   1.00 40.45 ? 122 THR D HB   1  
ATOM 8964   H HG1  . THR D 1 122 ? -4.959  -11.572 6.446   1.00 64.34 ? 122 THR D HG1  1  
ATOM 8965   H HG21 . THR D 1 122 ? -3.128  -10.206 5.555   1.00 2.43  ? 122 THR D HG21 1  
ATOM 8966   H HG22 . THR D 1 122 ? -2.617  -10.541 3.907   1.00 32.04 ? 122 THR D HG22 1  
ATOM 8967   H HG23 . THR D 1 122 ? -2.203  -11.663 5.202   1.00 23.11 ? 122 THR D HG23 1  
ATOM 8968   N N    . PHE D 1 123 ? -7.815  -11.052 3.594   1.00 71.13 ? 123 PHE D N    1  
ATOM 8969   C CA   . PHE D 1 123 ? -9.070  -11.644 3.099   1.00 42.43 ? 123 PHE D CA   1  
ATOM 8970   C C    . PHE D 1 123 ? -9.076  -11.564 1.550   1.00 23.41 ? 123 PHE D C    1  
ATOM 8971   O O    . PHE D 1 123 ? -8.465  -10.639 0.991   1.00 64.41 ? 123 PHE D O    1  
ATOM 8972   C CB   . PHE D 1 123 ? -10.300 -10.895 3.682   1.00 44.25 ? 123 PHE D CB   1  
ATOM 8973   C CG   . PHE D 1 123 ? -10.487 -11.079 5.188   1.00 55.32 ? 123 PHE D CG   1  
ATOM 8974   C CD1  . PHE D 1 123 ? -11.265 -12.131 5.693   1.00 64.41 ? 123 PHE D CD1  1  
ATOM 8975   C CD2  . PHE D 1 123 ? -9.884  -10.210 6.096   1.00 23.35 ? 123 PHE D CD2  1  
ATOM 8976   C CE1  . PHE D 1 123 ? -11.427 -12.298 7.053   1.00 53.14 ? 123 PHE D CE1  1  
ATOM 8977   C CE2  . PHE D 1 123 ? -10.050 -10.380 7.454   1.00 13.51 ? 123 PHE D CE2  1  
ATOM 8978   C CZ   . PHE D 1 123 ? -10.818 -11.422 7.934   1.00 44.30 ? 123 PHE D CZ   1  
ATOM 8979   H H    . PHE D 1 123 ? -7.834  -10.140 3.939   1.00 72.04 ? 123 PHE D H    1  
ATOM 8980   H HA   . PHE D 1 123 ? -9.103  -12.690 3.407   1.00 10.01 ? 123 PHE D HA   1  
ATOM 8981   H HB2  . PHE D 1 123 ? -10.193 -9.834  3.481   1.00 5.14  ? 123 PHE D HB2  1  
ATOM 8982   H HB3  . PHE D 1 123 ? -11.200 -11.248 3.187   1.00 72.54 ? 123 PHE D HB3  1  
ATOM 8983   H HD1  . PHE D 1 123 ? -11.750 -12.820 5.006   1.00 33.52 ? 123 PHE D HD1  1  
ATOM 8984   H HD2  . PHE D 1 123 ? -9.281  -9.387  5.729   1.00 42.33 ? 123 PHE D HD2  1  
ATOM 8985   H HE1  . PHE D 1 123 ? -12.032 -13.116 7.432   1.00 12.12 ? 123 PHE D HE1  1  
ATOM 8986   H HE2  . PHE D 1 123 ? -9.575  -9.696  8.147   1.00 43.22 ? 123 PHE D HE2  1  
ATOM 8987   H HZ   . PHE D 1 123 ? -10.943 -11.557 9.002   1.00 63.43 ? 123 PHE D HZ   1  
ATOM 8988   N N    . PRO D 1 124 ? -9.739  -12.538 0.835   1.00 52.24 ? 124 PRO D N    1  
ATOM 8989   C CA   . PRO D 1 124 ? -9.805  -12.543 -0.653  1.00 4.01  ? 124 PRO D CA   1  
ATOM 8990   C C    . PRO D 1 124 ? -10.353 -11.208 -1.217  1.00 20.45 ? 124 PRO D C    1  
ATOM 8991   O O    . PRO D 1 124 ? -11.332 -10.657 -0.685  1.00 71.55 ? 124 PRO D O    1  
ATOM 8992   C CB   . PRO D 1 124 ? -10.723 -13.750 -0.985  1.00 60.12 ? 124 PRO D CB   1  
ATOM 8993   C CG   . PRO D 1 124 ? -11.405 -14.096 0.308   1.00 23.41 ? 124 PRO D CG   1  
ATOM 8994   C CD   . PRO D 1 124 ? -10.456 -13.704 1.412   1.00 12.24 ? 124 PRO D CD   1  
ATOM 8995   H HA   . PRO D 1 124 ? -8.816  -12.718 -1.069  1.00 50.25 ? 124 PRO D HA   1  
ATOM 8996   H HB2  . PRO D 1 124 ? -11.446 -13.487 -1.758  1.00 4.45  ? 124 PRO D HB2  1  
ATOM 8997   H HB3  . PRO D 1 124 ? -10.128 -14.589 -1.321  1.00 34.12 ? 124 PRO D HB3  1  
ATOM 8998   H HG2  . PRO D 1 124 ? -12.337 -13.534 0.391   1.00 35.43 ? 124 PRO D HG2  1  
ATOM 8999   H HG3  . PRO D 1 124 ? -11.616 -15.157 0.357   1.00 43.31 ? 124 PRO D HG3  1  
ATOM 9000   H HD2  . PRO D 1 124 ? -11.007 -13.422 2.306   1.00 31.03 ? 124 PRO D HD2  1  
ATOM 9001   H HD3  . PRO D 1 124 ? -9.765  -14.505 1.640   1.00 31.54 ? 124 PRO D HD3  1  
ATOM 9002   N N    . GLN D 1 125 ? -9.697  -10.731 -2.299  1.00 32.33 ? 125 GLN D N    1  
ATOM 9003   C CA   . GLN D 1 125 ? -9.806  -9.350  -2.809  1.00 43.41 ? 125 GLN D CA   1  
ATOM 9004   C C    . GLN D 1 125 ? -11.255 -8.927  -3.113  1.00 53.24 ? 125 GLN D C    1  
ATOM 9005   O O    . GLN D 1 125 ? -12.076 -9.737  -3.559  1.00 51.21 ? 125 GLN D O    1  
ATOM 9006   C CB   . GLN D 1 125 ? -8.929  -9.178  -4.078  1.00 71.20 ? 125 GLN D CB   1  
ATOM 9007   C CG   . GLN D 1 125 ? -8.836  -7.724  -4.585  1.00 2.14  ? 125 GLN D CG   1  
ATOM 9008   C CD   . GLN D 1 125 ? -8.033  -7.560  -5.867  1.00 62.04 ? 125 GLN D CD   1  
ATOM 9009   O OE1  . GLN D 1 125 ? -8.056  -8.431  -6.731  1.00 5.24  ? 125 GLN D OE1  1  
ATOM 9010   N NE2  . GLN D 1 125 ? -7.321  -6.453  -6.001  1.00 45.50 ? 125 GLN D NE2  1  
ATOM 9011   H H    . GLN D 1 125 ? -9.110  -11.346 -2.778  1.00 31.53 ? 125 GLN D H    1  
ATOM 9012   H HA   . GLN D 1 125 ? -9.410  -8.703  -2.035  1.00 52.13 ? 125 GLN D HA   1  
ATOM 9013   H HB2  . GLN D 1 125 ? -7.923  -9.521  -3.854  1.00 60.03 ? 125 GLN D HB2  1  
ATOM 9014   H HB3  . GLN D 1 125 ? -9.333  -9.796  -4.874  1.00 1.00  ? 125 GLN D HB3  1  
ATOM 9015   H HG2  . GLN D 1 125 ? -9.841  -7.361  -4.775  1.00 35.25 ? 125 GLN D HG2  1  
ATOM 9016   H HG3  . GLN D 1 125 ? -8.394  -7.117  -3.810  1.00 11.15 ? 125 GLN D HG3  1  
ATOM 9017   H HE21 . GLN D 1 125 ? -7.341  -5.797  -5.277  1.00 32.51 ? 125 GLN D HE21 1  
ATOM 9018   H HE22 . GLN D 1 125 ? -6.801  -6.340  -6.821  1.00 33.22 ? 125 GLN D HE22 1  
ATOM 9019   N N    . LEU D 1 126 ? -11.533 -7.634  -2.888  1.00 13.40 ? 126 LEU D N    1  
ATOM 9020   C CA   . LEU D 1 126 ? -12.861 -7.051  -3.045  1.00 63.20 ? 126 LEU D CA   1  
ATOM 9021   C C    . LEU D 1 126 ? -12.825 -5.996  -4.165  1.00 40.34 ? 126 LEU D C    1  
ATOM 9022   O O    . LEU D 1 126 ? -12.454 -4.843  -3.939  1.00 70.11 ? 126 LEU D O    1  
ATOM 9023   C CB   . LEU D 1 126 ? -13.293 -6.447  -1.681  1.00 10.45 ? 126 LEU D CB   1  
ATOM 9024   C CG   . LEU D 1 126 ? -14.686 -5.741  -1.611  1.00 34.32 ? 126 LEU D CG   1  
ATOM 9025   C CD1  . LEU D 1 126 ? -15.823 -6.644  -2.097  1.00 71.13 ? 126 LEU D CD1  1  
ATOM 9026   C CD2  . LEU D 1 126 ? -14.958 -5.259  -0.184  1.00 23.45 ? 126 LEU D CD2  1  
ATOM 9027   H H    . LEU D 1 126 ? -10.799 -7.044  -2.619  1.00 14.12 ? 126 LEU D H    1  
ATOM 9028   H HA   . LEU D 1 126 ? -13.563 -7.836  -3.323  1.00 75.42 ? 126 LEU D HA   1  
ATOM 9029   H HB2  . LEU D 1 126 ? -13.286 -7.248  -0.948  1.00 10.20 ? 126 LEU D HB2  1  
ATOM 9030   H HB3  . LEU D 1 126 ? -12.538 -5.723  -1.384  1.00 2.53  ? 126 LEU D HB3  1  
ATOM 9031   H HG   . LEU D 1 126 ? -14.672 -4.869  -2.252  1.00 71.24 ? 126 LEU D HG   1  
ATOM 9032   H HD11 . LEU D 1 126 ? -15.634 -6.948  -3.118  1.00 52.35 ? 126 LEU D HD11 1  
ATOM 9033   H HD12 . LEU D 1 126 ? -16.759 -6.104  -2.060  1.00 2.31  ? 126 LEU D HD12 1  
ATOM 9034   H HD13 . LEU D 1 126 ? -15.892 -7.525  -1.469  1.00 74.13 ? 126 LEU D HD13 1  
ATOM 9035   H HD21 . LEU D 1 126 ? -15.017 -6.106  0.490   1.00 62.13 ? 126 LEU D HD21 1  
ATOM 9036   H HD22 . LEU D 1 126 ? -15.891 -4.713  -0.155  1.00 73.25 ? 126 LEU D HD22 1  
ATOM 9037   H HD23 . LEU D 1 126 ? -14.159 -4.607  0.135   1.00 50.22 ? 126 LEU D HD23 1  
ATOM 9038   N N    . ASN D 1 127 ? -13.174 -6.425  -5.387  1.00 61.52 ? 127 ASN D N    1  
ATOM 9039   C CA   . ASN D 1 127 ? -13.273 -5.541  -6.565  1.00 4.30  ? 127 ASN D CA   1  
ATOM 9040   C C    . ASN D 1 127 ? -14.750 -5.293  -6.864  1.00 74.23 ? 127 ASN D C    1  
ATOM 9041   O O    . ASN D 1 127 ? -15.404 -6.089  -7.550  1.00 53.24 ? 127 ASN D O    1  
ATOM 9042   C CB   . ASN D 1 127 ? -12.557 -6.165  -7.792  1.00 64.11 ? 127 ASN D CB   1  
ATOM 9043   C CG   . ASN D 1 127 ? -11.053 -6.348  -7.582  1.00 20.22 ? 127 ASN D CG   1  
ATOM 9044   O OD1  . ASN D 1 127 ? -10.389 -5.511  -6.971  1.00 74.52 ? 127 ASN D OD1  1  
ATOM 9045   N ND2  . ASN D 1 127 ? -10.506 -7.457  -8.062  1.00 25.40 ? 127 ASN D ND2  1  
ATOM 9046   H H    . ASN D 1 127 ? -13.372 -7.379  -5.504  1.00 73.33 ? 127 ASN D H    1  
ATOM 9047   H HA   . ASN D 1 127 ? -12.799 -4.587  -6.330  1.00 30.15 ? 127 ASN D HA   1  
ATOM 9048   H HB2  . ASN D 1 127 ? -12.999 -7.130  -8.010  1.00 63.34 ? 127 ASN D HB2  1  
ATOM 9049   H HB3  . ASN D 1 127 ? -12.701 -5.511  -8.649  1.00 63.11 ? 127 ASN D HB3  1  
ATOM 9050   H HD21 . ASN D 1 127 ? -11.083 -8.097  -8.526  1.00 45.52 ? 127 ASN D HD21 1  
ATOM 9051   H HD22 . ASN D 1 127 ? -9.545  -7.601  -7.906  1.00 72.41 ? 127 ASN D HD22 1  
ATOM 9052   N N    . LEU D 1 128 ? -15.281 -4.216  -6.277  1.00 54.21 ? 128 LEU D N    1  
ATOM 9053   C CA   . LEU D 1 128 ? -16.689 -3.840  -6.421  1.00 44.24 ? 128 LEU D CA   1  
ATOM 9054   C C    . LEU D 1 128 ? -16.948 -3.261  -7.829  1.00 13.34 ? 128 LEU D C    1  
ATOM 9055   O O    . LEU D 1 128 ? -16.179 -2.430  -8.323  1.00 10.05 ? 128 LEU D O    1  
ATOM 9056   C CB   . LEU D 1 128 ? -17.074 -2.835  -5.300  1.00 74.45 ? 128 LEU D CB   1  
ATOM 9057   C CG   . LEU D 1 128 ? -18.574 -2.392  -5.233  1.00 63.34 ? 128 LEU D CG   1  
ATOM 9058   C CD1  . LEU D 1 128 ? -19.528 -3.608  -5.234  1.00 4.01  ? 128 LEU D CD1  1  
ATOM 9059   C CD2  . LEU D 1 128 ? -18.822 -1.486  -4.000  1.00 75.11 ? 128 LEU D CD2  1  
ATOM 9060   H H    . LEU D 1 128 ? -14.702 -3.651  -5.730  1.00 62.31 ? 128 LEU D H    1  
ATOM 9061   H HA   . LEU D 1 128 ? -17.287 -4.745  -6.294  1.00 1.15  ? 128 LEU D HA   1  
ATOM 9062   H HB2  . LEU D 1 128 ? -16.811 -3.283  -4.345  1.00 63.21 ? 128 LEU D HB2  1  
ATOM 9063   H HB3  . LEU D 1 128 ? -16.466 -1.945  -5.427  1.00 13.03 ? 128 LEU D HB3  1  
ATOM 9064   H HG   . LEU D 1 128 ? -18.804 -1.808  -6.116  1.00 60.31 ? 128 LEU D HG   1  
ATOM 9065   H HD11 . LEU D 1 128 ? -19.323 -4.242  -4.380  1.00 5.04  ? 128 LEU D HD11 1  
ATOM 9066   H HD12 . LEU D 1 128 ? -19.389 -4.177  -6.144  1.00 3.54  ? 128 LEU D HD12 1  
ATOM 9067   H HD13 . LEU D 1 128 ? -20.553 -3.265  -5.189  1.00 53.45 ? 128 LEU D HD13 1  
ATOM 9068   H HD21 . LEU D 1 128 ? -18.593 -2.028  -3.090  1.00 31.52 ? 128 LEU D HD21 1  
ATOM 9069   H HD22 . LEU D 1 128 ? -19.857 -1.173  -3.978  1.00 41.53 ? 128 LEU D HD22 1  
ATOM 9070   H HD23 . LEU D 1 128 ? -18.190 -0.609  -4.063  1.00 64.40 ? 128 LEU D HD23 1  
ATOM 9071   N N    . ALA D 1 129 ? -18.028 -3.728  -8.468  1.00 44.22 ? 129 ALA D N    1  
ATOM 9072   C CA   . ALA D 1 129 ? -18.418 -3.306  -9.821  1.00 11.23 ? 129 ALA D CA   1  
ATOM 9073   C C    . ALA D 1 129 ? -18.808 -1.804  -9.849  1.00 21.20 ? 129 ALA D C    1  
ATOM 9074   O O    . ALA D 1 129 ? -19.356 -1.290  -8.863  1.00 5.52  ? 129 ALA D O    1  
ATOM 9075   C CB   . ALA D 1 129 ? -19.582 -4.186  -10.306 1.00 55.34 ? 129 ALA D CB   1  
ATOM 9076   H H    . ALA D 1 129 ? -18.593 -4.380  -8.006  1.00 24.30 ? 129 ALA D H    1  
ATOM 9077   H HA   . ALA D 1 129 ? -17.560 -3.468  -10.483 1.00 62.21 ? 129 ALA D HA   1  
ATOM 9078   H HB1  . ALA D 1 129 ? -19.852 -3.919  -11.322 1.00 12.34 ? 129 ALA D HB1  1  
ATOM 9079   H HB2  . ALA D 1 129 ? -20.440 -4.048  -9.661  1.00 73.44 ? 129 ALA D HB2  1  
ATOM 9080   H HB3  . ALA D 1 129 ? -19.281 -5.224  -10.281 1.00 52.14 ? 129 ALA D HB3  1  
ATOM 9081   N N    . PRO D 1 130 ? -18.519 -1.073  -10.976 1.00 54.33 ? 130 PRO D N    1  
ATOM 9082   C CA   . PRO D 1 130 ? -18.813 0.361   -11.078 1.00 23.15 ? 130 PRO D CA   1  
ATOM 9083   C C    . PRO D 1 130 ? -20.282 0.598   -11.492 1.00 64.33 ? 130 PRO D C    1  
ATOM 9084   O O    . PRO D 1 130 ? -20.752 0.083   -12.518 1.00 14.54 ? 130 PRO D O    1  
ATOM 9085   C CB   . PRO D 1 130 ? -17.792 0.831   -12.139 1.00 14.11 ? 130 PRO D CB   1  
ATOM 9086   C CG   . PRO D 1 130 ? -17.620 -0.345  -13.066 1.00 74.44 ? 130 PRO D CG   1  
ATOM 9087   C CD   . PRO D 1 130 ? -17.917 -1.592  -12.243 1.00 61.40 ? 130 PRO D CD   1  
ATOM 9088   H HA   . PRO D 1 130 ? -18.616 0.871   -10.136 1.00 20.34 ? 130 PRO D HA   1  
ATOM 9089   H HB2  . PRO D 1 130 ? -18.165 1.708   -12.669 1.00 0.24  ? 130 PRO D HB2  1  
ATOM 9090   H HB3  . PRO D 1 130 ? -16.848 1.068   -11.665 1.00 54.43 ? 130 PRO D HB3  1  
ATOM 9091   H HG2  . PRO D 1 130 ? -18.318 -0.260  -13.898 1.00 53.11 ? 130 PRO D HG2  1  
ATOM 9092   H HG3  . PRO D 1 130 ? -16.606 -0.380  -13.446 1.00 61.52 ? 130 PRO D HG3  1  
ATOM 9093   H HD2  . PRO D 1 130 ? -18.619 -2.237  -12.761 1.00 33.12 ? 130 PRO D HD2  1  
ATOM 9094   H HD3  . PRO D 1 130 ? -17.004 -2.139  -12.036 1.00 12.45 ? 130 PRO D HD3  1  
ATOM 9095   N N    . VAL D 1 131 ? -21.006 1.372   -10.673 1.00 52.22 ? 131 VAL D N    1  
ATOM 9096   C CA   . VAL D 1 131 ? -22.443 1.616   -10.864 1.00 33.50 ? 131 VAL D CA   1  
ATOM 9097   C C    . VAL D 1 131 ? -22.659 3.048   -11.363 1.00 13.22 ? 131 VAL D C    1  
ATOM 9098   O O    . VAL D 1 131 ? -22.063 3.995   -10.838 1.00 73.41 ? 131 VAL D O    1  
ATOM 9099   C CB   . VAL D 1 131 ? -23.242 1.394   -9.524  1.00 52.52 ? 131 VAL D CB   1  
ATOM 9100   C CG1  . VAL D 1 131 ? -24.746 1.735   -9.696  1.00 35.32 ? 131 VAL D CG1  1  
ATOM 9101   C CG2  . VAL D 1 131 ? -23.048 -0.053  -9.000  1.00 25.14 ? 131 VAL D CG2  1  
ATOM 9102   H H    . VAL D 1 131 ? -20.560 1.797   -9.919  1.00 54.33 ? 131 VAL D H    1  
ATOM 9103   H HA   . VAL D 1 131 ? -22.824 0.918   -11.610 1.00 74.42 ? 131 VAL D HA   1  
ATOM 9104   H HB   . VAL D 1 131 ? -22.838 2.074   -8.776  1.00 33.33 ? 131 VAL D HB   1  
ATOM 9105   H HG11 . VAL D 1 131 ? -25.183 1.101   -10.457 1.00 54.41 ? 131 VAL D HG11 1  
ATOM 9106   H HG12 . VAL D 1 131 ? -24.852 2.771   -9.994  1.00 62.41 ? 131 VAL D HG12 1  
ATOM 9107   H HG13 . VAL D 1 131 ? -25.265 1.584   -8.760  1.00 41.44 ? 131 VAL D HG13 1  
ATOM 9108   H HG21 . VAL D 1 131 ? -23.588 -0.180  -8.069  1.00 31.52 ? 131 VAL D HG21 1  
ATOM 9109   H HG22 . VAL D 1 131 ? -21.995 -0.238  -8.826  1.00 23.15 ? 131 VAL D HG22 1  
ATOM 9110   H HG23 . VAL D 1 131 ? -23.419 -0.764  -9.728  1.00 74.23 ? 131 VAL D HG23 1  
ATOM 9111   N N    . ASN D 1 132 ? -23.503 3.183   -12.404 1.00 14.23 ? 132 ASN D N    1  
ATOM 9112   C CA   . ASN D 1 132 ? -23.917 4.480   -12.942 1.00 11.20 ? 132 ASN D CA   1  
ATOM 9113   C C    . ASN D 1 132 ? -25.017 5.069   -12.040 1.00 35.15 ? 132 ASN D C    1  
ATOM 9114   O O    . ASN D 1 132 ? -26.219 4.816   -12.230 1.00 72.23 ? 132 ASN D O    1  
ATOM 9115   C CB   . ASN D 1 132 ? -24.392 4.340   -14.416 1.00 35.44 ? 132 ASN D CB   1  
ATOM 9116   C CG   . ASN D 1 132 ? -24.769 5.676   -15.076 1.00 44.41 ? 132 ASN D CG   1  
ATOM 9117   O OD1  . ASN D 1 132 ? -24.271 6.737   -14.704 1.00 23.25 ? 132 ASN D OD1  1  
ATOM 9118   N ND2  . ASN D 1 132 ? -25.635 5.626   -16.074 1.00 50.23 ? 132 ASN D ND2  1  
ATOM 9119   H H    . ASN D 1 132 ? -23.863 2.372   -12.820 1.00 25.33 ? 132 ASN D H    1  
ATOM 9120   H HA   . ASN D 1 132 ? -23.055 5.142   -12.918 1.00 31.03 ? 132 ASN D HA   1  
ATOM 9121   H HB2  . ASN D 1 132 ? -23.596 3.894   -14.999 1.00 72.43 ? 132 ASN D HB2  1  
ATOM 9122   H HB3  . ASN D 1 132 ? -25.255 3.682   -14.444 1.00 31.42 ? 132 ASN D HB3  1  
ATOM 9123   H HD21 . ASN D 1 132 ? -25.987 4.753   -16.340 1.00 22.11 ? 132 ASN D HD21 1  
ATOM 9124   H HD22 . ASN D 1 132 ? -25.877 6.469   -16.516 1.00 33.45 ? 132 ASN D HD22 1  
ATOM 9125   N N    . PHE D 1 133 ? -24.567 5.812   -11.017 1.00 44.10 ? 133 PHE D N    1  
ATOM 9126   C CA   . PHE D 1 133 ? -25.447 6.476   -10.035 1.00 72.24 ? 133 PHE D CA   1  
ATOM 9127   C C    . PHE D 1 133 ? -26.303 7.568   -10.695 1.00 21.42 ? 133 PHE D C    1  
ATOM 9128   O O    . PHE D 1 133 ? -27.375 7.892   -10.200 1.00 42.13 ? 133 PHE D O    1  
ATOM 9129   C CB   . PHE D 1 133 ? -24.605 7.086   -8.883  1.00 55.32 ? 133 PHE D CB   1  
ATOM 9130   C CG   . PHE D 1 133 ? -23.851 6.047   -8.057  1.00 34.13 ? 133 PHE D CG   1  
ATOM 9131   C CD1  . PHE D 1 133 ? -22.494 5.803   -8.263  1.00 25.13 ? 133 PHE D CD1  1  
ATOM 9132   C CD2  . PHE D 1 133 ? -24.512 5.298   -7.088  1.00 15.30 ? 133 PHE D CD2  1  
ATOM 9133   C CE1  . PHE D 1 133 ? -21.829 4.845   -7.531  1.00 13.35 ? 133 PHE D CE1  1  
ATOM 9134   C CE2  . PHE D 1 133 ? -23.844 4.345   -6.354  1.00 24.45 ? 133 PHE D CE2  1  
ATOM 9135   C CZ   . PHE D 1 133 ? -22.504 4.115   -6.576  1.00 3.13  ? 133 PHE D CZ   1  
ATOM 9136   H H    . PHE D 1 133 ? -23.598 5.916   -10.916 1.00 14.14 ? 133 PHE D H    1  
ATOM 9137   H HA   . PHE D 1 133 ? -26.110 5.717   -9.625  1.00 11.21 ? 133 PHE D HA   1  
ATOM 9138   H HB2  . PHE D 1 133 ? -23.881 7.781   -9.301  1.00 52.31 ? 133 PHE D HB2  1  
ATOM 9139   H HB3  . PHE D 1 133 ? -25.259 7.635   -8.213  1.00 73.22 ? 133 PHE D HB3  1  
ATOM 9140   H HD1  . PHE D 1 133 ? -21.958 6.372   -9.013  1.00 0.43  ? 133 PHE D HD1  1  
ATOM 9141   H HD2  . PHE D 1 133 ? -25.567 5.477   -6.898  1.00 51.03 ? 133 PHE D HD2  1  
ATOM 9142   H HE1  . PHE D 1 133 ? -20.771 4.666   -7.700  1.00 62.34 ? 133 PHE D HE1  1  
ATOM 9143   H HE2  . PHE D 1 133 ? -24.374 3.772   -5.603  1.00 52.03 ? 133 PHE D HE2  1  
ATOM 9144   H HZ   . PHE D 1 133 ? -21.980 3.360   -5.999  1.00 4.25  ? 133 PHE D HZ   1  
ATOM 9145   N N    . ASP D 1 134 ? -25.811 8.109   -11.822 1.00 32.35 ? 134 ASP D N    1  
ATOM 9146   C CA   . ASP D 1 134 ? -26.452 9.219   -12.548 1.00 14.05 ? 134 ASP D CA   1  
ATOM 9147   C C    . ASP D 1 134 ? -27.847 8.806   -13.045 1.00 71.53 ? 134 ASP D C    1  
ATOM 9148   O O    . ASP D 1 134 ? -28.845 9.479   -12.759 1.00 64.40 ? 134 ASP D O    1  
ATOM 9149   C CB   . ASP D 1 134 ? -25.555 9.663   -13.742 1.00 24.13 ? 134 ASP D CB   1  
ATOM 9150   C CG   . ASP D 1 134 ? -25.827 11.101  -14.196 1.00 41.51 ? 134 ASP D CG   1  
ATOM 9151   O OD1  . ASP D 1 134 ? -25.562 12.034  -13.410 1.00 61.04 ? 134 ASP D OD1  1  
ATOM 9152   O OD2  . ASP D 1 134 ? -26.311 11.305  -15.330 1.00 32.44 ? 134 ASP D OD2  1  
ATOM 9153   H H    . ASP D 1 134 ? -24.977 7.747   -12.179 1.00 64.41 ? 134 ASP D H    1  
ATOM 9154   H HA   . ASP D 1 134 ? -26.556 10.048  -11.853 1.00 61.35 ? 134 ASP D HA   1  
ATOM 9155   H HB2  . ASP D 1 134 ? -24.510 9.589   -13.455 1.00 64.25 ? 134 ASP D HB2  1  
ATOM 9156   H HB3  . ASP D 1 134 ? -25.728 8.994   -14.588 1.00 51.22 ? 134 ASP D HB3  1  
ATOM 9157   N N    . ALA D 1 135 ? -27.890 7.666   -13.760 1.00 2.35  ? 135 ALA D N    1  
ATOM 9158   C CA   . ALA D 1 135 ? -29.123 7.115   -14.352 1.00 54.13 ? 135 ALA D CA   1  
ATOM 9159   C C    . ALA D 1 135 ? -30.046 6.516   -13.285 1.00 54.32 ? 135 ALA D C    1  
ATOM 9160   O O    . ALA D 1 135 ? -31.274 6.632   -13.372 1.00 60.23 ? 135 ALA D O    1  
ATOM 9161   C CB   . ALA D 1 135 ? -28.764 6.060   -15.395 1.00 51.01 ? 135 ALA D CB   1  
ATOM 9162   H H    . ALA D 1 135 ? -27.052 7.172   -13.893 1.00 2.41  ? 135 ALA D H    1  
ATOM 9163   H HA   . ALA D 1 135 ? -29.644 7.925   -14.859 1.00 33.40 ? 135 ALA D HA   1  
ATOM 9164   H HB1  . ALA D 1 135 ? -28.093 6.486   -16.126 1.00 62.14 ? 135 ALA D HB1  1  
ATOM 9165   H HB2  . ALA D 1 135 ? -29.657 5.705   -15.893 1.00 54.30 ? 135 ALA D HB2  1  
ATOM 9166   H HB3  . ALA D 1 135 ? -28.269 5.232   -14.913 1.00 53.43 ? 135 ALA D HB3  1  
ATOM 9167   N N    . LEU D 1 136 ? -29.430 5.870   -12.280 1.00 75.42 ? 136 LEU D N    1  
ATOM 9168   C CA   . LEU D 1 136 ? -30.155 5.234   -11.157 1.00 65.55 ? 136 LEU D CA   1  
ATOM 9169   C C    . LEU D 1 136 ? -30.859 6.316   -10.293 1.00 42.22 ? 136 LEU D C    1  
ATOM 9170   O O    . LEU D 1 136 ? -31.929 6.068   -9.745  1.00 14.33 ? 136 LEU D O    1  
ATOM 9171   C CB   . LEU D 1 136 ? -29.171 4.347   -10.315 1.00 61.24 ? 136 LEU D CB   1  
ATOM 9172   C CG   . LEU D 1 136 ? -29.736 2.997   -9.726  1.00 73.34 ? 136 LEU D CG   1  
ATOM 9173   C CD1  . LEU D 1 136 ? -28.625 2.175   -9.045  1.00 63.21 ? 136 LEU D CD1  1  
ATOM 9174   C CD2  . LEU D 1 136 ? -30.936 3.205   -8.768  1.00 11.31 ? 136 LEU D CD2  1  
ATOM 9175   H H    . LEU D 1 136 ? -28.450 5.805   -12.301 1.00 3.43  ? 136 LEU D H    1  
ATOM 9176   H HA   . LEU D 1 136 ? -30.918 4.593   -11.594 1.00 62.33 ? 136 LEU D HA   1  
ATOM 9177   H HB2  . LEU D 1 136 ? -28.328 4.094   -10.949 1.00 64.30 ? 136 LEU D HB2  1  
ATOM 9178   H HB3  . LEU D 1 136 ? -28.787 4.941   -9.489  1.00 11.12 ? 136 LEU D HB3  1  
ATOM 9179   H HG   . LEU D 1 136 ? -30.096 2.398   -10.556 1.00 32.15 ? 136 LEU D HG   1  
ATOM 9180   H HD11 . LEU D 1 136 ? -27.850 1.949   -9.766  1.00 10.40 ? 136 LEU D HD11 1  
ATOM 9181   H HD12 . LEU D 1 136 ? -29.035 1.247   -8.670  1.00 50.15 ? 136 LEU D HD12 1  
ATOM 9182   H HD13 . LEU D 1 136 ? -28.196 2.736   -8.223  1.00 42.41 ? 136 LEU D HD13 1  
ATOM 9183   H HD21 . LEU D 1 136 ? -30.641 3.836   -7.937  1.00 11.15 ? 136 LEU D HD21 1  
ATOM 9184   H HD22 . LEU D 1 136 ? -31.275 2.250   -8.389  1.00 14.14 ? 136 LEU D HD22 1  
ATOM 9185   H HD23 . LEU D 1 136 ? -31.747 3.679   -9.304  1.00 71.34 ? 136 LEU D HD23 1  
ATOM 9186   N N    . PHE D 1 137 ? -30.252 7.521   -10.222 1.00 3.43  ? 137 PHE D N    1  
ATOM 9187   C CA   . PHE D 1 137 ? -30.819 8.691   -9.504  1.00 4.04  ? 137 PHE D CA   1  
ATOM 9188   C C    . PHE D 1 137 ? -32.138 9.138   -10.153 1.00 2.22  ? 137 PHE D C    1  
ATOM 9189   O O    . PHE D 1 137 ? -33.095 9.470   -9.457  1.00 3.32  ? 137 PHE D O    1  
ATOM 9190   C CB   . PHE D 1 137 ? -29.788 9.858   -9.497  1.00 0.53  ? 137 PHE D CB   1  
ATOM 9191   C CG   . PHE D 1 137 ? -30.221 11.122  -8.744  1.00 44.30 ? 137 PHE D CG   1  
ATOM 9192   C CD1  . PHE D 1 137 ? -30.113 11.202  -7.354  1.00 35.42 ? 137 PHE D CD1  1  
ATOM 9193   C CD2  . PHE D 1 137 ? -30.729 12.229  -9.427  1.00 34.03 ? 137 PHE D CD2  1  
ATOM 9194   C CE1  . PHE D 1 137 ? -30.500 12.349  -6.679  1.00 63.44 ? 137 PHE D CE1  1  
ATOM 9195   C CE2  . PHE D 1 137 ? -31.112 13.370  -8.754  1.00 43.03 ? 137 PHE D CE2  1  
ATOM 9196   C CZ   . PHE D 1 137 ? -31.000 13.433  -7.382  1.00 23.21 ? 137 PHE D CZ   1  
ATOM 9197   H H    . PHE D 1 137 ? -29.387 7.629   -10.670 1.00 1.15  ? 137 PHE D H    1  
ATOM 9198   H HA   . PHE D 1 137 ? -31.015 8.382   -8.480  1.00 34.33 ? 137 PHE D HA   1  
ATOM 9199   H HB2  . PHE D 1 137 ? -28.871 9.504   -9.040  1.00 61.15 ? 137 PHE D HB2  1  
ATOM 9200   H HB3  . PHE D 1 137 ? -29.565 10.134  -10.524 1.00 13.31 ? 137 PHE D HB3  1  
ATOM 9201   H HD1  . PHE D 1 137 ? -29.720 10.359  -6.798  1.00 64.31 ? 137 PHE D HD1  1  
ATOM 9202   H HD2  . PHE D 1 137 ? -30.820 12.190  -10.505 1.00 11.20 ? 137 PHE D HD2  1  
ATOM 9203   H HE1  . PHE D 1 137 ? -30.415 12.396  -5.600  1.00 71.04 ? 137 PHE D HE1  1  
ATOM 9204   H HE2  . PHE D 1 137 ? -31.502 14.218  -9.305  1.00 75.10 ? 137 PHE D HE2  1  
ATOM 9205   H HZ   . PHE D 1 137 ? -31.312 14.329  -6.857  1.00 74.00 ? 137 PHE D HZ   1  
ATOM 9206   N N    . MET D 1 138 ? -32.172 9.107   -11.494 1.00 21.41 ? 138 MET D N    1  
ATOM 9207   C CA   . MET D 1 138 ? -33.361 9.492   -12.283 1.00 72.23 ? 138 MET D CA   1  
ATOM 9208   C C    . MET D 1 138 ? -34.525 8.529   -11.973 1.00 52.03 ? 138 MET D C    1  
ATOM 9209   O O    . MET D 1 138 ? -35.654 8.956   -11.697 1.00 52.23 ? 138 MET D O    1  
ATOM 9210   C CB   . MET D 1 138 ? -33.025 9.455   -13.804 1.00 51.41 ? 138 MET D CB   1  
ATOM 9211   C CG   . MET D 1 138 ? -31.772 10.252  -14.201 1.00 33.34 ? 138 MET D CG   1  
ATOM 9212   S SD   . MET D 1 138 ? -31.140 9.789   -15.833 1.00 2.24  ? 138 MET D SD   1  
ATOM 9213   C CE   . MET D 1 138 ? -29.499 10.513  -15.803 1.00 32.53 ? 138 MET D CE   1  
ATOM 9214   H H    . MET D 1 138 ? -31.368 8.803   -11.972 1.00 72.12 ? 138 MET D H    1  
ATOM 9215   H HA   . MET D 1 138 ? -33.641 10.503  -11.994 1.00 43.23 ? 138 MET D HA   1  
ATOM 9216   H HB2  . MET D 1 138 ? -32.869 8.424   -14.103 1.00 75.12 ? 138 MET D HB2  1  
ATOM 9217   H HB3  . MET D 1 138 ? -33.867 9.850   -14.361 1.00 45.34 ? 138 MET D HB3  1  
ATOM 9218   H HG2  . MET D 1 138 ? -32.009 11.309  -14.210 1.00 0.11  ? 138 MET D HG2  1  
ATOM 9219   H HG3  . MET D 1 138 ? -30.995 10.068  -13.468 1.00 23.22 ? 138 MET D HG3  1  
ATOM 9220   H HE1  . MET D 1 138 ? -29.066 10.370  -14.819 1.00 64.14 ? 138 MET D HE1  1  
ATOM 9221   H HE2  . MET D 1 138 ? -29.553 11.565  -16.027 1.00 54.44 ? 138 MET D HE2  1  
ATOM 9222   H HE3  . MET D 1 138 ? -28.861 10.017  -16.524 1.00 21.42 ? 138 MET D HE3  1  
ATOM 9223   N N    . ASN D 1 139 ? -34.201 7.219   -11.971 1.00 60.10 ? 139 ASN D N    1  
ATOM 9224   C CA   . ASN D 1 139 ? -35.174 6.142   -11.703 1.00 24.54 ? 139 ASN D CA   1  
ATOM 9225   C C    . ASN D 1 139 ? -35.542 6.067   -10.211 1.00 14.33 ? 139 ASN D C    1  
ATOM 9226   O O    . ASN D 1 139 ? -36.590 5.530   -9.868  1.00 43.51 ? 139 ASN D O    1  
ATOM 9227   C CB   . ASN D 1 139 ? -34.643 4.776   -12.219 1.00 24.33 ? 139 ASN D CB   1  
ATOM 9228   C CG   . ASN D 1 139 ? -34.411 4.758   -13.738 1.00 23.25 ? 139 ASN D CG   1  
ATOM 9229   O OD1  . ASN D 1 139 ? -35.006 5.543   -14.485 1.00 34.21 ? 139 ASN D OD1  1  
ATOM 9230   N ND2  . ASN D 1 139 ? -33.587 3.842   -14.213 1.00 52.45 ? 139 ASN D ND2  1  
ATOM 9231   H H    . ASN D 1 139 ? -33.268 6.971   -12.156 1.00 54.20 ? 139 ASN D H    1  
ATOM 9232   H HA   . ASN D 1 139 ? -36.079 6.385   -12.252 1.00 2.31  ? 139 ASN D HA   1  
ATOM 9233   H HB2  . ASN D 1 139 ? -33.702 4.551   -11.725 1.00 72.11 ? 139 ASN D HB2  1  
ATOM 9234   H HB3  . ASN D 1 139 ? -35.358 3.994   -11.979 1.00 30.04 ? 139 ASN D HB3  1  
ATOM 9235   H HD21 . ASN D 1 139 ? -33.171 3.221   -13.580 1.00 24.52 ? 139 ASN D HD21 1  
ATOM 9236   H HD22 . ASN D 1 139 ? -33.423 3.822   -15.176 1.00 10.10 ? 139 ASN D HD22 1  
ATOM 9237   N N    . TYR D 1 140 ? -34.678 6.622   -9.350  1.00 34.15 ? 140 TYR D N    1  
ATOM 9238   C CA   . TYR D 1 140 ? -34.927 6.750   -7.901  1.00 55.43 ? 140 TYR D CA   1  
ATOM 9239   C C    . TYR D 1 140 ? -35.976 7.853   -7.634  1.00 74.42 ? 140 TYR D C    1  
ATOM 9240   O O    . TYR D 1 140 ? -36.841 7.701   -6.764  1.00 52.24 ? 140 TYR D O    1  
ATOM 9241   C CB   . TYR D 1 140 ? -33.582 7.058   -7.173  1.00 15.14 ? 140 TYR D CB   1  
ATOM 9242   C CG   . TYR D 1 140 ? -33.702 7.448   -5.691  1.00 12.01 ? 140 TYR D CG   1  
ATOM 9243   C CD1  . TYR D 1 140 ? -33.938 6.484   -4.711  1.00 63.42 ? 140 TYR D CD1  1  
ATOM 9244   C CD2  . TYR D 1 140 ? -33.586 8.782   -5.279  1.00 15.02 ? 140 TYR D CD2  1  
ATOM 9245   C CE1  . TYR D 1 140 ? -34.060 6.833   -3.383  1.00 51.41 ? 140 TYR D CE1  1  
ATOM 9246   C CE2  . TYR D 1 140 ? -33.704 9.134   -3.950  1.00 54.44 ? 140 TYR D CE2  1  
ATOM 9247   C CZ   . TYR D 1 140 ? -33.943 8.157   -3.005  1.00 73.43 ? 140 TYR D CZ   1  
ATOM 9248   O OH   . TYR D 1 140 ? -34.083 8.505   -1.679  1.00 34.21 ? 140 TYR D OH   1  
ATOM 9249   H H    . TYR D 1 140 ? -33.832 6.963   -9.703  1.00 24.41 ? 140 TYR D H    1  
ATOM 9250   H HA   . TYR D 1 140 ? -35.317 5.800   -7.541  1.00 62.13 ? 140 TYR D HA   1  
ATOM 9251   H HB2  . TYR D 1 140 ? -32.952 6.180   -7.226  1.00 32.33 ? 140 TYR D HB2  1  
ATOM 9252   H HB3  . TYR D 1 140 ? -33.079 7.867   -7.696  1.00 3.53  ? 140 TYR D HB3  1  
ATOM 9253   H HD1  . TYR D 1 140 ? -34.034 5.446   -5.005  1.00 11.14 ? 140 TYR D HD1  1  
ATOM 9254   H HD2  . TYR D 1 140 ? -33.398 9.551   -6.025  1.00 73.34 ? 140 TYR D HD2  1  
ATOM 9255   H HE1  . TYR D 1 140 ? -34.241 6.067   -2.641  1.00 23.20 ? 140 TYR D HE1  1  
ATOM 9256   H HE2  . TYR D 1 140 ? -33.611 10.173  -3.656  1.00 52.20 ? 140 TYR D HE2  1  
ATOM 9257   H HH   . TYR D 1 140 ? -33.512 7.956   -1.140  1.00 30.54 ? 140 TYR D HH   1  
ATOM 9258   N N    . LEU D 1 141 ? -35.872 8.961   -8.394  1.00 50.04 ? 141 LEU D N    1  
ATOM 9259   C CA   . LEU D 1 141 ? -36.766 10.132  -8.251  1.00 74.42 ? 141 LEU D CA   1  
ATOM 9260   C C    . LEU D 1 141 ? -38.220 9.790   -8.624  1.00 61.11 ? 141 LEU D C    1  
ATOM 9261   O O    . LEU D 1 141 ? -39.155 10.242  -7.956  1.00 34.14 ? 141 LEU D O    1  
ATOM 9262   C CB   . LEU D 1 141 ? -36.230 11.353  -9.088  1.00 61.15 ? 141 LEU D CB   1  
ATOM 9263   C CG   . LEU D 1 141 ? -35.349 12.390  -8.307  1.00 44.31 ? 141 LEU D CG   1  
ATOM 9264   C CD1  . LEU D 1 141 ? -34.199 11.714  -7.544  1.00 42.22 ? 141 LEU D CD1  1  
ATOM 9265   C CD2  . LEU D 1 141 ? -34.818 13.499  -9.249  1.00 1.03  ? 141 LEU D CD2  1  
ATOM 9266   H H    . LEU D 1 141 ? -35.165 8.993   -9.073  1.00 71.22 ? 141 LEU D H    1  
ATOM 9267   H HA   . LEU D 1 141 ? -36.752 10.407  -7.200  1.00 63.22 ? 141 LEU D HA   1  
ATOM 9268   H HB2  . LEU D 1 141 ? -35.644 10.964  -9.917  1.00 11.11 ? 141 LEU D HB2  1  
ATOM 9269   H HB3  . LEU D 1 141 ? -37.076 11.890  -9.509  1.00 55.24 ? 141 LEU D HB3  1  
ATOM 9270   H HG   . LEU D 1 141 ? -35.971 12.871  -7.563  1.00 75.42 ? 141 LEU D HG   1  
ATOM 9271   H HD11 . LEU D 1 141 ? -34.585 10.916  -6.930  1.00 75.43 ? 141 LEU D HD11 1  
ATOM 9272   H HD12 . LEU D 1 141 ? -33.708 12.440  -6.910  1.00 62.34 ? 141 LEU D HD12 1  
ATOM 9273   H HD13 . LEU D 1 141 ? -33.478 11.308  -8.243  1.00 32.51 ? 141 LEU D HD13 1  
ATOM 9274   H HD21 . LEU D 1 141 ? -34.259 13.055  -10.065 1.00 33.12 ? 141 LEU D HD21 1  
ATOM 9275   H HD22 . LEU D 1 141 ? -34.169 14.169  -8.699  1.00 10.43 ? 141 LEU D HD22 1  
ATOM 9276   H HD23 . LEU D 1 141 ? -35.645 14.063  -9.645  1.00 25.15 ? 141 LEU D HD23 1  
ATOM 9277   N N    . GLN D 1 142 ? -38.401 8.955   -9.662  1.00 51.41 ? 142 GLN D N    1  
ATOM 9278   C CA   . GLN D 1 142 ? -39.742 8.632   -10.211 1.00 70.22 ? 142 GLN D CA   1  
ATOM 9279   C C    . GLN D 1 142 ? -40.422 7.445   -9.468  1.00 1.14  ? 142 GLN D C    1  
ATOM 9280   O O    . GLN D 1 142 ? -41.229 6.714   -10.060 1.00 4.52  ? 142 GLN D O    1  
ATOM 9281   C CB   . GLN D 1 142 ? -39.633 8.353   -11.737 1.00 61.21 ? 142 GLN D CB   1  
ATOM 9282   C CG   . GLN D 1 142 ? -38.756 7.138   -12.130 1.00 54.35 ? 142 GLN D CG   1  
ATOM 9283   C CD   . GLN D 1 142 ? -38.914 6.723   -13.599 1.00 75.31 ? 142 GLN D CD   1  
ATOM 9284   O OE1  . GLN D 1 142 ? -39.977 6.897   -14.195 1.00 73.52 ? 142 GLN D OE1  1  
ATOM 9285   N NE2  . GLN D 1 142 ? -37.873 6.164   -14.194 1.00 75.10 ? 142 GLN D NE2  1  
ATOM 9286   H H    . GLN D 1 142 ? -37.612 8.542   -10.076 1.00 23.41 ? 142 GLN D H    1  
ATOM 9287   H HA   . GLN D 1 142 ? -40.375 9.504   -10.073 1.00 11.35 ? 142 GLN D HA   1  
ATOM 9288   H HB2  . GLN D 1 142 ? -40.633 8.193   -12.128 1.00 21.42 ? 142 GLN D HB2  1  
ATOM 9289   H HB3  . GLN D 1 142 ? -39.221 9.236   -12.221 1.00 64.32 ? 142 GLN D HB3  1  
ATOM 9290   H HG2  . GLN D 1 142 ? -37.718 7.387   -11.944 1.00 14.43 ? 142 GLN D HG2  1  
ATOM 9291   H HG3  . GLN D 1 142 ? -39.030 6.292   -11.508 1.00 24.51 ? 142 GLN D HG3  1  
ATOM 9292   H HE21 . GLN D 1 142 ? -37.051 6.039   -13.678 1.00 75.41 ? 142 GLN D HE21 1  
ATOM 9293   H HE22 . GLN D 1 142 ? -37.972 5.881   -15.126 1.00 52.42 ? 142 GLN D HE22 1  
ATOM 9294   N N    . GLN D 1 143 ? -40.166 7.308   -8.155  1.00 10.43 ? 143 GLN D N    1  
ATOM 9295   C CA   . GLN D 1 143 ? -40.699 6.197   -7.334  1.00 12.13 ? 143 GLN D CA   1  
ATOM 9296   C C    . GLN D 1 143 ? -41.583 6.745   -6.204  1.00 74.02 ? 143 GLN D C    1  
ATOM 9297   O O    . GLN D 1 143 ? -41.092 7.103   -5.128  1.00 61.41 ? 143 GLN D O    1  
ATOM 9298   C CB   . GLN D 1 143 ? -39.539 5.328   -6.759  1.00 0.11  ? 143 GLN D CB   1  
ATOM 9299   C CG   . GLN D 1 143 ? -38.690 4.584   -7.813  1.00 50.30 ? 143 GLN D CG   1  
ATOM 9300   C CD   . GLN D 1 143 ? -39.399 3.426   -8.536  1.00 75.52 ? 143 GLN D CD   1  
ATOM 9301   O OE1  . GLN D 1 143 ? -40.621 3.400   -8.702  1.00 40.44 ? 143 GLN D OE1  1  
ATOM 9302   N NE2  . GLN D 1 143 ? -38.622 2.471   -9.015  1.00 51.25 ? 143 GLN D NE2  1  
ATOM 9303   H H    . GLN D 1 143 ? -39.605 7.978   -7.715  1.00 10.53 ? 143 GLN D H    1  
ATOM 9304   H HA   . GLN D 1 143 ? -41.319 5.563   -7.973  1.00 32.50 ? 143 GLN D HA   1  
ATOM 9305   H HB2  . GLN D 1 143 ? -38.875 5.976   -6.191  1.00 62.14 ? 143 GLN D HB2  1  
ATOM 9306   H HB3  . GLN D 1 143 ? -39.956 4.592   -6.080  1.00 50.32 ? 143 GLN D HB3  1  
ATOM 9307   H HG2  . GLN D 1 143 ? -38.378 5.299   -8.564  1.00 1.40  ? 143 GLN D HG2  1  
ATOM 9308   H HG3  . GLN D 1 143 ? -37.806 4.192   -7.322  1.00 1.44  ? 143 GLN D HG3  1  
ATOM 9309   H HE21 . GLN D 1 143 ? -37.652 2.555   -8.888  1.00 13.45 ? 143 GLN D HE21 1  
ATOM 9310   H HE22 . GLN D 1 143 ? -39.043 1.717   -9.472  1.00 54.33 ? 143 GLN D HE22 1  
ATOM 9311   N N    . GLN D 1 144 ? -42.889 6.853   -6.495  1.00 42.22 ? 144 GLN D N    1  
ATOM 9312   C CA   . GLN D 1 144 ? -43.919 7.250   -5.525  1.00 31.11 ? 144 GLN D CA   1  
ATOM 9313   C C    . GLN D 1 144 ? -45.233 6.531   -5.885  1.00 43.55 ? 144 GLN D C    1  
ATOM 9314   O O    . GLN D 1 144 ? -46.067 7.048   -6.634  1.00 71.32 ? 144 GLN D O    1  
ATOM 9315   C CB   . GLN D 1 144 ? -44.082 8.801   -5.496  1.00 52.54 ? 144 GLN D CB   1  
ATOM 9316   C CG   . GLN D 1 144 ? -45.175 9.326   -4.532  1.00 33.42 ? 144 GLN D CG   1  
ATOM 9317   C CD   . GLN D 1 144 ? -45.235 10.855  -4.414  1.00 3.22  ? 144 GLN D CD   1  
ATOM 9318   O OE1  . GLN D 1 144 ? -46.310 11.434  -4.226  1.00 62.41 ? 144 GLN D OE1  1  
ATOM 9319   N NE2  . GLN D 1 144 ? -44.083 11.520  -4.458  1.00 14.24 ? 144 GLN D NE2  1  
ATOM 9320   H H    . GLN D 1 144 ? -43.175 6.648   -7.410  1.00 24.03 ? 144 GLN D H    1  
ATOM 9321   H HA   . GLN D 1 144 ? -43.604 6.909   -4.537  1.00 43.02 ? 144 GLN D HA   1  
ATOM 9322   H HB2  . GLN D 1 144 ? -43.132 9.234   -5.198  1.00 44.44 ? 144 GLN D HB2  1  
ATOM 9323   H HB3  . GLN D 1 144 ? -44.314 9.149   -6.499  1.00 32.10 ? 144 GLN D HB3  1  
ATOM 9324   H HG2  . GLN D 1 144 ? -46.139 8.972   -4.878  1.00 54.51 ? 144 GLN D HG2  1  
ATOM 9325   H HG3  . GLN D 1 144 ? -44.990 8.917   -3.546  1.00 71.11 ? 144 GLN D HG3  1  
ATOM 9326   H HE21 . GLN D 1 144 ? -43.247 11.012  -4.560  1.00 13.44 ? 144 GLN D HE21 1  
ATOM 9327   H HE22 . GLN D 1 144 ? -44.114 12.494  -4.386  1.00 72.33 ? 144 GLN D HE22 1  
ATOM 9328   N N    . ALA D 1 145 ? -45.373 5.297   -5.383  1.00 12.02 ? 145 ALA D N    1  
ATOM 9329   C CA   . ALA D 1 145 ? -46.523 4.428   -5.687  1.00 23.20 ? 145 ALA D CA   1  
ATOM 9330   C C    . ALA D 1 145 ? -46.723 3.402   -4.564  1.00 33.11 ? 145 ALA D C    1  
ATOM 9331   O O    . ALA D 1 145 ? -45.748 2.888   -4.011  1.00 54.45 ? 145 ALA D O    1  
ATOM 9332   C CB   . ALA D 1 145 ? -46.319 3.735   -7.048  1.00 3.22  ? 145 ALA D CB   1  
ATOM 9333   H H    . ALA D 1 145 ? -44.679 4.951   -4.784  1.00 34.25 ? 145 ALA D H    1  
ATOM 9334   H HA   . ALA D 1 145 ? -47.413 5.053   -5.753  1.00 54.33 ? 145 ALA D HA   1  
ATOM 9335   H HB1  . ALA D 1 145 ? -46.188 4.483   -7.820  1.00 5.23  ? 145 ALA D HB1  1  
ATOM 9336   H HB2  . ALA D 1 145 ? -47.182 3.128   -7.285  1.00 21.12 ? 145 ALA D HB2  1  
ATOM 9337   H HB3  . ALA D 1 145 ? -45.438 3.104   -7.011  1.00 61.11 ? 145 ALA D HB3  1  
ATOM 9338   N N    . GLY D 1 146 ? -47.995 3.115   -4.229  1.00 2.41  ? 146 GLY D N    1  
ATOM 9339   C CA   . GLY D 1 146 ? -48.339 2.186   -3.142  1.00 72.30 ? 146 GLY D CA   1  
ATOM 9340   C C    . GLY D 1 146 ? -49.079 0.941   -3.613  1.00 33.21 ? 146 GLY D C    1  
ATOM 9341   O O    . GLY D 1 146 ? -49.540 0.152   -2.783  1.00 51.24 ? 146 GLY D O    1  
ATOM 9342   H H    . GLY D 1 146 ? -48.718 3.546   -4.727  1.00 23.54 ? 146 GLY D H    1  
ATOM 9343   H HA2  . GLY D 1 146 ? -47.439 1.872   -2.623  1.00 60.01 ? 146 GLY D HA2  1  
ATOM 9344   H HA3  . GLY D 1 146 ? -48.968 2.715   -2.439  1.00 44.41 ? 146 GLY D HA3  1  
ATOM 9345   N N    . GLU D 1 147 ? -49.177 0.760   -4.947  1.00 34.34 ? 147 GLU D N    1  
ATOM 9346   C CA   . GLU D 1 147 ? -49.922 -0.357  -5.568  1.00 61.15 ? 147 GLU D CA   1  
ATOM 9347   C C    . GLU D 1 147 ? -49.046 -1.621  -5.651  1.00 41.03 ? 147 GLU D C    1  
ATOM 9348   O O    . GLU D 1 147 ? -47.820 -1.524  -5.772  1.00 25.44 ? 147 GLU D O    1  
ATOM 9349   C CB   . GLU D 1 147 ? -50.413 0.054   -6.989  1.00 12.33 ? 147 GLU D CB   1  
ATOM 9350   C CG   . GLU D 1 147 ? -51.272 1.337   -7.019  1.00 0.43  ? 147 GLU D CG   1  
ATOM 9351   C CD   . GLU D 1 147 ? -51.852 1.666   -8.409  1.00 64.03 ? 147 GLU D CD   1  
ATOM 9352   O OE1  . GLU D 1 147 ? -51.094 2.102   -9.292  1.00 24.32 ? 147 GLU D OE1  1  
ATOM 9353   O OE2  . GLU D 1 147 ? -53.071 1.485   -8.622  1.00 34.22 ? 147 GLU D OE2  1  
ATOM 9354   H H    . GLU D 1 147 ? -48.717 1.390   -5.533  1.00 12.23 ? 147 GLU D H    1  
ATOM 9355   H HA   . GLU D 1 147 ? -50.791 -0.571  -4.945  1.00 12.35 ? 147 GLU D HA   1  
ATOM 9356   H HB2  . GLU D 1 147 ? -49.551 0.209   -7.632  1.00 73.25 ? 147 GLU D HB2  1  
ATOM 9357   H HB3  . GLU D 1 147 ? -51.005 -0.760  -7.400  1.00 24.41 ? 147 GLU D HB3  1  
ATOM 9358   H HG2  . GLU D 1 147 ? -52.087 1.222   -6.311  1.00 3.53  ? 147 GLU D HG2  1  
ATOM 9359   H HG3  . GLU D 1 147 ? -50.657 2.169   -6.698  1.00 15.31 ? 147 GLU D HG3  1  
ATOM 9360   N N    . GLY D 1 148 ? -49.686 -2.801  -5.586  1.00 31.02 ? 148 GLY D N    1  
ATOM 9361   C CA   . GLY D 1 148 ? -48.994 -4.085  -5.728  1.00 61.05 ? 148 GLY D CA   1  
ATOM 9362   C C    . GLY D 1 148 ? -48.827 -4.803  -4.398  1.00 11.24 ? 148 GLY D C    1  
ATOM 9363   O O    . GLY D 1 148 ? -47.833 -4.589  -3.700  1.00 30.01 ? 148 GLY D O    1  
ATOM 9364   H H    . GLY D 1 148 ? -50.654 -2.799  -5.435  1.00 43.31 ? 148 GLY D H    1  
ATOM 9365   H HA2  . GLY D 1 148 ? -49.573 -4.709  -6.396  1.00 23.34 ? 148 GLY D HA2  1  
ATOM 9366   H HA3  . GLY D 1 148 ? -48.012 -3.934  -6.173  1.00 51.44 ? 148 GLY D HA3  1  
ATOM 9367   N N    . THR D 1 149 ? -49.821 -5.640  -4.039  1.00 74.21 ? 149 THR D N    1  
ATOM 9368   C CA   . THR D 1 149 ? -49.807 -6.439  -2.803  1.00 33.24 ? 149 THR D CA   1  
ATOM 9369   C C    . THR D 1 149 ? -48.716 -7.535  -2.874  1.00 33.21 ? 149 THR D C    1  
ATOM 9370   O O    . THR D 1 149 ? -48.914 -8.578  -3.509  1.00 52.14 ? 149 THR D O    1  
ATOM 9371   C CB   . THR D 1 149 ? -51.203 -7.100  -2.542  1.00 3.14  ? 149 THR D CB   1  
ATOM 9372   O OG1  . THR D 1 149 ? -52.228 -6.098  -2.608  1.00 35.04 ? 149 THR D OG1  1  
ATOM 9373   C CG2  . THR D 1 149 ? -51.266 -7.806  -1.170  1.00 73.21 ? 149 THR D CG2  1  
ATOM 9374   H H    . THR D 1 149 ? -50.594 -5.720  -4.631  1.00 74.54 ? 149 THR D H    1  
ATOM 9375   H HA   . THR D 1 149 ? -49.588 -5.767  -1.973  1.00 4.14  ? 149 THR D HA   1  
ATOM 9376   H HB   . THR D 1 149 ? -51.396 -7.833  -3.322  1.00 3.53  ? 149 THR D HB   1  
ATOM 9377   H HG1  . THR D 1 149 ? -51.826 -5.225  -2.529  1.00 1.33  ? 149 THR D HG1  1  
ATOM 9378   H HG21 . THR D 1 149 ? -52.242 -8.250  -1.036  1.00 35.13 ? 149 THR D HG21 1  
ATOM 9379   H HG22 . THR D 1 149 ? -51.090 -7.089  -0.376  1.00 61.44 ? 149 THR D HG22 1  
ATOM 9380   H HG23 . THR D 1 149 ? -50.512 -8.583  -1.120  1.00 41.02 ? 149 THR D HG23 1  
ATOM 9381   N N    . GLU D 1 150 ? -47.561 -7.259  -2.250  1.00 1.41  ? 150 GLU D N    1  
ATOM 9382   C CA   . GLU D 1 150 ? -46.435 -8.203  -2.175  1.00 13.54 ? 150 GLU D CA   1  
ATOM 9383   C C    . GLU D 1 150 ? -46.692 -9.222  -1.049  1.00 64.40 ? 150 GLU D C    1  
ATOM 9384   O O    . GLU D 1 150 ? -46.472 -8.934  0.132   1.00 32.41 ? 150 GLU D O    1  
ATOM 9385   C CB   . GLU D 1 150 ? -45.107 -7.427  -1.967  1.00 52.14 ? 150 GLU D CB   1  
ATOM 9386   C CG   . GLU D 1 150 ? -44.801 -6.421  -3.097  1.00 71.33 ? 150 GLU D CG   1  
ATOM 9387   C CD   . GLU D 1 150 ? -43.479 -5.671  -2.894  1.00 53.20 ? 150 GLU D CD   1  
ATOM 9388   O OE1  . GLU D 1 150 ? -43.434 -4.743  -2.074  1.00 35.50 ? 150 GLU D OE1  1  
ATOM 9389   O OE2  . GLU D 1 150 ? -42.470 -6.020  -3.537  1.00 11.41 ? 150 GLU D OE2  1  
ATOM 9390   H H    . GLU D 1 150 ? -47.464 -6.383  -1.826  1.00 35.21 ? 150 GLU D H    1  
ATOM 9391   H HA   . GLU D 1 150 ? -46.380 -8.738  -3.125  1.00 64.45 ? 150 GLU D HA   1  
ATOM 9392   H HB2  . GLU D 1 150 ? -45.160 -6.884  -1.026  1.00 13.53 ? 150 GLU D HB2  1  
ATOM 9393   H HB3  . GLU D 1 150 ? -44.285 -8.136  -1.909  1.00 51.35 ? 150 GLU D HB3  1  
ATOM 9394   H HG2  . GLU D 1 150 ? -44.766 -6.959  -4.040  1.00 60.20 ? 150 GLU D HG2  1  
ATOM 9395   H HG3  . GLU D 1 150 ? -45.611 -5.697  -3.146  1.00 1.42  ? 150 GLU D HG3  1  
ATOM 9396   N N    . GLU D 1 151 ? -47.205 -10.398 -1.444  1.00 10.23 ? 151 GLU D N    1  
ATOM 9397   C CA   . GLU D 1 151 ? -47.693 -11.435 -0.521  1.00 20.33 ? 151 GLU D CA   1  
ATOM 9398   C C    . GLU D 1 151 ? -46.554 -12.379 -0.104  1.00 22.10 ? 151 GLU D C    1  
ATOM 9399   O O    . GLU D 1 151 ? -46.120 -12.345 1.056   1.00 4.43  ? 151 GLU D O    1  
ATOM 9400   C CB   . GLU D 1 151 ? -48.842 -12.225 -1.202  1.00 62.24 ? 151 GLU D CB   1  
ATOM 9401   C CG   . GLU D 1 151 ? -50.000 -11.333 -1.694  1.00 13.44 ? 151 GLU D CG   1  
ATOM 9402   C CD   . GLU D 1 151 ? -51.034 -12.092 -2.527  1.00 14.24 ? 151 GLU D CD   1  
ATOM 9403   O OE1  . GLU D 1 151 ? -50.758 -12.371 -3.709  1.00 33.33 ? 151 GLU D OE1  1  
ATOM 9404   O OE2  . GLU D 1 151 ? -52.123 -12.420 -2.010  1.00 15.52 ? 151 GLU D OE2  1  
ATOM 9405   H H    . GLU D 1 151 ? -47.251 -10.576 -2.405  1.00 21.32 ? 151 GLU D H    1  
ATOM 9406   H HA   . GLU D 1 151 ? -48.089 -10.947 0.368   1.00 21.34 ? 151 GLU D HA   1  
ATOM 9407   H HB2  . GLU D 1 151 ? -48.438 -12.764 -2.052  1.00 54.23 ? 151 GLU D HB2  1  
ATOM 9408   H HB3  . GLU D 1 151 ? -49.245 -12.945 -0.494  1.00 0.24  ? 151 GLU D HB3  1  
ATOM 9409   H HG2  . GLU D 1 151 ? -50.488 -10.894 -0.829  1.00 74.14 ? 151 GLU D HG2  1  
ATOM 9410   H HG3  . GLU D 1 151 ? -49.590 -10.528 -2.299  1.00 21.41 ? 151 GLU D HG3  1  
ATOM 9411   N N    . HIS D 1 152 ? -46.055 -13.181 -1.082  1.00 55.15 ? 152 HIS D N    1  
ATOM 9412   C CA   . HIS D 1 152 ? -45.061 -14.258 -0.854  1.00 72.52 ? 152 HIS D CA   1  
ATOM 9413   C C    . HIS D 1 152 ? -45.623 -15.319 0.119   1.00 43.23 ? 152 HIS D C    1  
ATOM 9414   O O    . HIS D 1 152 ? -45.633 -15.124 1.339   1.00 63.30 ? 152 HIS D O    1  
ATOM 9415   C CB   . HIS D 1 152 ? -43.688 -13.688 -0.378  1.00 52.21 ? 152 HIS D CB   1  
ATOM 9416   C CG   . HIS D 1 152 ? -42.716 -14.705 0.175   1.00 55.11 ? 152 HIS D CG   1  
ATOM 9417   N ND1  . HIS D 1 152 ? -42.305 -14.695 1.485   1.00 14.21 ? 152 HIS D ND1  1  
ATOM 9418   C CD2  . HIS D 1 152 ? -42.097 -15.760 -0.401  1.00 41.13 ? 152 HIS D CD2  1  
ATOM 9419   C CE1  . HIS D 1 152 ? -41.475 -15.690 1.692   1.00 62.12 ? 152 HIS D CE1  1  
ATOM 9420   N NE2  . HIS D 1 152 ? -41.332 -16.353 0.564   1.00 34.32 ? 152 HIS D NE2  1  
ATOM 9421   H H    . HIS D 1 152 ? -46.376 -13.042 -1.999  1.00 34.04 ? 152 HIS D H    1  
ATOM 9422   H HA   . HIS D 1 152 ? -44.914 -14.736 -1.819  1.00 73.04 ? 152 HIS D HA   1  
ATOM 9423   H HB2  . HIS D 1 152 ? -43.203 -13.202 -1.213  1.00 34.44 ? 152 HIS D HB2  1  
ATOM 9424   H HB3  . HIS D 1 152 ? -43.862 -12.947 0.394   1.00 1.04  ? 152 HIS D HB3  1  
ATOM 9425   H HD1  . HIS D 1 152 ? -42.553 -14.024 2.158   1.00 1.21  ? 152 HIS D HD1  1  
ATOM 9426   H HD2  . HIS D 1 152 ? -42.187 -16.074 -1.432  1.00 14.25 ? 152 HIS D HD2  1  
ATOM 9427   H HE1  . HIS D 1 152 ? -40.989 -15.922 2.629   1.00 61.00 ? 152 HIS D HE1  1  
ATOM 9428   H HE2  . HIS D 1 152 ? -40.904 -17.236 0.484   1.00 37.65 ? 152 HIS D HE2  1  
ATOM 9429   N N    . GLN D 1 153 ? -46.107 -16.435 -0.447  1.00 21.45 ? 153 GLN D N    1  
ATOM 9430   C CA   . GLN D 1 153 ? -46.713 -17.541 0.308   1.00 1.04  ? 153 GLN D CA   1  
ATOM 9431   C C    . GLN D 1 153 ? -46.054 -18.861 -0.122  1.00 42.10 ? 153 GLN D C    1  
ATOM 9432   O O    . GLN D 1 153 ? -46.352 -19.377 -1.207  1.00 51.14 ? 153 GLN D O    1  
ATOM 9433   C CB   . GLN D 1 153 ? -48.249 -17.610 0.057   1.00 44.34 ? 153 GLN D CB   1  
ATOM 9434   C CG   . GLN D 1 153 ? -49.037 -16.325 0.392   1.00 74.42 ? 153 GLN D CG   1  
ATOM 9435   C CD   . GLN D 1 153 ? -50.551 -16.435 0.145   1.00 43.45 ? 153 GLN D CD   1  
ATOM 9436   O OE1  . GLN D 1 153 ? -51.200 -15.459 -0.237  1.00 14.31 ? 153 GLN D OE1  1  
ATOM 9437   N NE2  . GLN D 1 153 ? -51.138 -17.603 0.387   1.00 70.12 ? 153 GLN D NE2  1  
ATOM 9438   H H    . GLN D 1 153 ? -46.045 -16.523 -1.418  1.00 70.22 ? 153 GLN D H    1  
ATOM 9439   H HA   . GLN D 1 153 ? -46.533 -17.388 1.373   1.00 62.30 ? 153 GLN D HA   1  
ATOM 9440   H HB2  . GLN D 1 153 ? -48.422 -17.842 -0.989  1.00 54.32 ? 153 GLN D HB2  1  
ATOM 9441   H HB3  . GLN D 1 153 ? -48.657 -18.418 0.657   1.00 33.31 ? 153 GLN D HB3  1  
ATOM 9442   H HG2  . GLN D 1 153 ? -48.885 -16.084 1.437   1.00 63.14 ? 153 GLN D HG2  1  
ATOM 9443   H HG3  . GLN D 1 153 ? -48.646 -15.516 -0.215  1.00 41.23 ? 153 GLN D HG3  1  
ATOM 9444   H HE21 . GLN D 1 153 ? -50.589 -18.348 0.715   1.00 43.21 ? 153 GLN D HE21 1  
ATOM 9445   H HE22 . GLN D 1 153 ? -52.101 -17.674 0.234   1.00 62.01 ? 153 GLN D HE22 1  
ATOM 9446   N N    . ASP D 1 154 ? -45.120 -19.369 0.703   1.00 41.35 ? 154 ASP D N    1  
ATOM 9447   C CA   . ASP D 1 154 ? -44.521 -20.705 0.489   1.00 52.25 ? 154 ASP D CA   1  
ATOM 9448   C C    . ASP D 1 154 ? -45.481 -21.792 0.991   1.00 74.14 ? 154 ASP D C    1  
ATOM 9449   O O    . ASP D 1 154 ? -46.316 -21.537 1.868   1.00 71.44 ? 154 ASP D O    1  
ATOM 9450   C CB   . ASP D 1 154 ? -43.141 -20.842 1.199   1.00 24.00 ? 154 ASP D CB   1  
ATOM 9451   C CG   . ASP D 1 154 ? -42.062 -19.924 0.604   1.00 52.50 ? 154 ASP D CG   1  
ATOM 9452   O OD1  . ASP D 1 154 ? -41.854 -19.975 -0.625  1.00 14.53 ? 154 ASP D OD1  1  
ATOM 9453   O OD2  . ASP D 1 154 ? -41.410 -19.164 1.353   1.00 22.31 ? 154 ASP D OD2  1  
ATOM 9454   H H    . ASP D 1 154 ? -44.837 -18.842 1.479   1.00 71.50 ? 154 ASP D H    1  
ATOM 9455   H HA   . ASP D 1 154 ? -44.378 -20.839 -0.583  1.00 64.12 ? 154 ASP D HA   1  
ATOM 9456   H HB2  . ASP D 1 154 ? -43.262 -20.617 2.255   1.00 73.25 ? 154 ASP D HB2  1  
ATOM 9457   H HB3  . ASP D 1 154 ? -42.795 -21.870 1.106   1.00 21.20 ? 154 ASP D HB3  1  
ATOM 9458   N N    . ALA D 1 155 ? -45.342 -22.999 0.433   1.00 22.14 ? 155 ALA D N    1  
ATOM 9459   C CA   . ALA D 1 155 ? -46.183 -24.157 0.765   1.00 63.24 ? 155 ALA D CA   1  
ATOM 9460   C C    . ALA D 1 155 ? -45.326 -25.438 0.626   1.00 25.23 ? 155 ALA D C    1  
ATOM 9461   O O    . ALA D 1 155 ? -45.123 -25.912 -0.510  1.00 72.20 ? 155 ALA D O    1  
ATOM 9462   C CB   . ALA D 1 155 ? -47.441 -24.185 -0.139  1.00 40.03 ? 155 ALA D CB   1  
ATOM 9463   O OXT  . ALA D 1 155 ? -44.818 -25.943 1.648   1.00 37.65 ? 155 ALA D OXT  1  
ATOM 9464   H H    . ALA D 1 155 ? -44.634 -23.123 -0.235  1.00 73.44 ? 155 ALA D H    1  
ATOM 9465   H HA   . ALA D 1 155 ? -46.512 -24.058 1.804   1.00 13.32 ? 155 ALA D HA   1  
ATOM 9466   H HB1  . ALA D 1 155 ? -48.007 -23.273 0.000   1.00 63.11 ? 155 ALA D HB1  1  
ATOM 9467   H HB2  . ALA D 1 155 ? -48.065 -25.031 0.121   1.00 53.51 ? 155 ALA D HB2  1  
ATOM 9468   H HB3  . ALA D 1 155 ? -47.147 -24.266 -1.179  1.00 43.31 ? 155 ALA D HB3  1  
ATOM 9469   N N    . ASN E 2 1   ? 38.320  4.679   9.349   1.00 4.05  ? 450 ASN E N    1  
ATOM 9470   C CA   . ASN E 2 1   ? 37.962  3.944   8.109   1.00 41.23 ? 450 ASN E CA   1  
ATOM 9471   C C    . ASN E 2 1   ? 37.144  2.692   8.454   1.00 11.13 ? 450 ASN E C    1  
ATOM 9472   O O    . ASN E 2 1   ? 37.241  2.170   9.572   1.00 32.12 ? 450 ASN E O    1  
ATOM 9473   C CB   . ASN E 2 1   ? 39.239  3.584   7.309   1.00 35.41 ? 450 ASN E CB   1  
ATOM 9474   C CG   . ASN E 2 1   ? 40.019  4.810   6.829   1.00 44.45 ? 450 ASN E CG   1  
ATOM 9475   O OD1  . ASN E 2 1   ? 39.437  5.852   6.523   1.00 3.43  ? 450 ASN E OD1  1  
ATOM 9476   N ND2  . ASN E 2 1   ? 41.341  4.701   6.761   1.00 54.35 ? 450 ASN E ND2  1  
ATOM 9477   H H1   . ASN E 2 1   ? 38.915  5.498   9.123   1.00 37.65 ? 450 ASN E H1   1  
ATOM 9478   H H2   . ASN E 2 1   ? 38.834  4.054   10.001  1.00 37.65 ? 450 ASN E H2   1  
ATOM 9479   H H3   . ASN E 2 1   ? 37.455  5.014   9.822   1.00 37.65 ? 450 ASN E H3   1  
ATOM 9480   H HA   . ASN E 2 1   ? 37.343  4.607   7.514   1.00 5.35  ? 450 ASN E HA   1  
ATOM 9481   H HB2  . ASN E 2 1   ? 39.889  2.987   7.938   1.00 4.55  ? 450 ASN E HB2  1  
ATOM 9482   H HB3  . ASN E 2 1   ? 38.966  2.999   6.438   1.00 65.34 ? 450 ASN E HB3  1  
ATOM 9483   H HD21 . ASN E 2 1   ? 41.753  3.848   7.020   1.00 41.45 ? 450 ASN E HD21 1  
ATOM 9484   H HD22 . ASN E 2 1   ? 41.856  5.481   6.463   1.00 20.22 ? 450 ASN E HD22 1  
ATOM 9485   N N    . VAL E 2 2   ? 36.360  2.216   7.467   1.00 25.14 ? 451 VAL E N    1  
ATOM 9486   C CA   . VAL E 2 2   ? 35.422  1.088   7.641   1.00 10.32 ? 451 VAL E CA   1  
ATOM 9487   C C    . VAL E 2 2   ? 34.928  0.632   6.232   1.00 30.33 ? 451 VAL E C    1  
ATOM 9488   O O    . VAL E 2 2   ? 33.830  0.084   6.050   1.00 12.40 ? 451 VAL E O    1  
ATOM 9489   C CB   . VAL E 2 2   ? 34.218  1.538   8.585   1.00 54.51 ? 451 VAL E CB   1  
ATOM 9490   C CG1  . VAL E 2 2   ? 33.241  2.497   7.867   1.00 21.23 ? 451 VAL E CG1  1  
ATOM 9491   C CG2  . VAL E 2 2   ? 33.481  0.340   9.214   1.00 0.51  ? 451 VAL E CG2  1  
ATOM 9492   H H    . VAL E 2 2   ? 36.419  2.636   6.588   1.00 22.31 ? 451 VAL E H    1  
ATOM 9493   H HA   . VAL E 2 2   ? 35.959  0.268   8.112   1.00 4.30  ? 451 VAL E HA   1  
ATOM 9494   H HB   . VAL E 2 2   ? 34.657  2.104   9.408   1.00 25.43 ? 451 VAL E HB   1  
ATOM 9495   H HG11 . VAL E 2 2   ? 33.785  3.352   7.486   1.00 53.53 ? 451 VAL E HG11 1  
ATOM 9496   H HG12 . VAL E 2 2   ? 32.485  2.840   8.560   1.00 44.03 ? 451 VAL E HG12 1  
ATOM 9497   H HG13 . VAL E 2 2   ? 32.761  1.984   7.042   1.00 12.54 ? 451 VAL E HG13 1  
ATOM 9498   H HG21 . VAL E 2 2   ? 32.996  -0.239  8.437   1.00 41.25 ? 451 VAL E HG21 1  
ATOM 9499   H HG22 . VAL E 2 2   ? 32.741  0.689   9.919   1.00 33.10 ? 451 VAL E HG22 1  
ATOM 9500   H HG23 . VAL E 2 2   ? 34.193  -0.292  9.730   1.00 62.21 ? 451 VAL E HG23 1  
ATOM 9501   N N    . VAL E 2 3   ? 35.802  0.840   5.225   1.00 22.50 ? 452 VAL E N    1  
ATOM 9502   C CA   . VAL E 2 3   ? 35.414  0.838   3.795   1.00 33.30 ? 452 VAL E CA   1  
ATOM 9503   C C    . VAL E 2 3   ? 36.376  -0.024  2.941   1.00 10.41 ? 452 VAL E C    1  
ATOM 9504   O O    . VAL E 2 3   ? 37.202  -0.758  3.485   1.00 34.44 ? 452 VAL E O    1  
ATOM 9505   C CB   . VAL E 2 3   ? 35.378  2.331   3.268   1.00 4.34  ? 452 VAL E CB   1  
ATOM 9506   C CG1  . VAL E 2 3   ? 34.376  3.198   4.083   1.00 64.24 ? 452 VAL E CG1  1  
ATOM 9507   C CG2  . VAL E 2 3   ? 36.789  2.982   3.269   1.00 64.31 ? 452 VAL E CG2  1  
ATOM 9508   H H    . VAL E 2 3   ? 36.745  0.979   5.449   1.00 72.53 ? 452 VAL E H    1  
ATOM 9509   H HA   . VAL E 2 3   ? 34.414  0.417   3.704   1.00 62.53 ? 452 VAL E HA   1  
ATOM 9510   H HB   . VAL E 2 3   ? 35.021  2.309   2.241   1.00 33.31 ? 452 VAL E HB   1  
ATOM 9511   H HG11 . VAL E 2 3   ? 34.313  4.191   3.662   1.00 71.12 ? 452 VAL E HG11 1  
ATOM 9512   H HG12 . VAL E 2 3   ? 34.703  3.261   5.115   1.00 43.44 ? 452 VAL E HG12 1  
ATOM 9513   H HG13 . VAL E 2 3   ? 33.397  2.734   4.059   1.00 63.24 ? 452 VAL E HG13 1  
ATOM 9514   H HG21 . VAL E 2 3   ? 37.455  2.396   2.645   1.00 53.30 ? 452 VAL E HG21 1  
ATOM 9515   H HG22 . VAL E 2 3   ? 37.183  3.018   4.274   1.00 11.34 ? 452 VAL E HG22 1  
ATOM 9516   H HG23 . VAL E 2 3   ? 36.731  3.990   2.870   1.00 43.04 ? 452 VAL E HG23 1  
ATOM 9517   N N    . GLY E 2 4   ? 36.220  0.041   1.597   1.00 32.02 ? 453 GLY E N    1  
ATOM 9518   C CA   . GLY E 2 4   ? 37.183  -0.560  0.657   1.00 12.02 ? 453 GLY E CA   1  
ATOM 9519   C C    . GLY E 2 4   ? 36.757  -1.915  0.101   1.00 12.05 ? 453 GLY E C    1  
ATOM 9520   O O    . GLY E 2 4   ? 37.606  -2.690  -0.355  1.00 43.35 ? 453 GLY E O    1  
ATOM 9521   H H    . GLY E 2 4   ? 35.433  0.504   1.239   1.00 2.45  ? 453 GLY E H    1  
ATOM 9522   H HA2  . GLY E 2 4   ? 37.310  0.118   -0.174  1.00 41.15 ? 453 GLY E HA2  1  
ATOM 9523   H HA3  . GLY E 2 4   ? 38.148  -0.672  1.147   1.00 14.22 ? 453 GLY E HA3  1  
ATOM 9524   N N    . LEU E 2 5   ? 35.442  -2.216  0.134   1.00 2.33  ? 454 LEU E N    1  
ATOM 9525   C CA   . LEU E 2 5   ? 34.886  -3.468  -0.434  1.00 74.43 ? 454 LEU E CA   1  
ATOM 9526   C C    . LEU E 2 5   ? 34.286  -3.224  -1.825  1.00 31.44 ? 454 LEU E C    1  
ATOM 9527   O O    . LEU E 2 5   ? 34.377  -2.124  -2.367  1.00 31.54 ? 454 LEU E O    1  
ATOM 9528   C CB   . LEU E 2 5   ? 33.823  -4.110  0.508   1.00 63.35 ? 454 LEU E CB   1  
ATOM 9529   C CG   . LEU E 2 5   ? 34.354  -4.650  1.872   1.00 61.44 ? 454 LEU E CG   1  
ATOM 9530   C CD1  . LEU E 2 5   ? 34.607  -3.518  2.883   1.00 12.23 ? 454 LEU E CD1  1  
ATOM 9531   C CD2  . LEU E 2 5   ? 33.418  -5.726  2.445   1.00 53.42 ? 454 LEU E CD2  1  
ATOM 9532   H H    . LEU E 2 5   ? 34.825  -1.584  0.560   1.00 42.15 ? 454 LEU E H    1  
ATOM 9533   H HA   . LEU E 2 5   ? 35.703  -4.179  -0.551  1.00 31.54 ? 454 LEU E HA   1  
ATOM 9534   H HB2  . LEU E 2 5   ? 33.047  -3.372  0.703   1.00 13.55 ? 454 LEU E HB2  1  
ATOM 9535   H HB3  . LEU E 2 5   ? 33.363  -4.937  -0.027  1.00 42.31 ? 454 LEU E HB3  1  
ATOM 9536   H HG   . LEU E 2 5   ? 35.311  -5.128  1.701   1.00 32.01 ? 454 LEU E HG   1  
ATOM 9537   H HD11 . LEU E 2 5   ? 34.981  -3.934  3.808   1.00 74.34 ? 454 LEU E HD11 1  
ATOM 9538   H HD12 . LEU E 2 5   ? 33.684  -2.982  3.080   1.00 33.12 ? 454 LEU E HD12 1  
ATOM 9539   H HD13 . LEU E 2 5   ? 35.339  -2.830  2.482   1.00 54.33 ? 454 LEU E HD13 1  
ATOM 9540   H HD21 . LEU E 2 5   ? 33.814  -6.095  3.381   1.00 73.43 ? 454 LEU E HD21 1  
ATOM 9541   H HD22 . LEU E 2 5   ? 33.342  -6.548  1.746   1.00 65.40 ? 454 LEU E HD22 1  
ATOM 9542   H HD23 . LEU E 2 5   ? 32.432  -5.305  2.611   1.00 34.11 ? 454 LEU E HD23 1  
ATOM 9543   N N    . THR E 2 6   ? 33.680  -4.280  -2.386  1.00 11.23 ? 455 THR E N    1  
ATOM 9544   C CA   . THR E 2 6   ? 33.039  -4.252  -3.707  1.00 71.14 ? 455 THR E CA   1  
ATOM 9545   C C    . THR E 2 6   ? 31.747  -5.091  -3.666  1.00 0.44  ? 455 THR E C    1  
ATOM 9546   O O    . THR E 2 6   ? 31.400  -5.675  -2.625  1.00 4.03  ? 455 THR E O    1  
ATOM 9547   C CB   . THR E 2 6   ? 34.025  -4.779  -4.811  1.00 14.54 ? 455 THR E CB   1  
ATOM 9548   O OG1  . THR E 2 6   ? 33.453  -4.624  -6.121  1.00 35.55 ? 455 THR E OG1  1  
ATOM 9549   C CG2  . THR E 2 6   ? 34.411  -6.258  -4.591  1.00 62.43 ? 455 THR E CG2  1  
ATOM 9550   H H    . THR E 2 6   ? 33.652  -5.124  -1.885  1.00 1.34  ? 455 THR E H    1  
ATOM 9551   H HA   . THR E 2 6   ? 32.772  -3.226  -3.940  1.00 42.21 ? 455 THR E HA   1  
ATOM 9552   H HB   . THR E 2 6   ? 34.930  -4.181  -4.769  1.00 64.14 ? 455 THR E HB   1  
ATOM 9553   H HG1  . THR E 2 6   ? 34.016  -5.064  -6.769  1.00 43.24 ? 455 THR E HG1  1  
ATOM 9554   H HG21 . THR E 2 6   ? 35.093  -6.575  -5.369  1.00 21.01 ? 455 THR E HG21 1  
ATOM 9555   H HG22 . THR E 2 6   ? 33.524  -6.877  -4.625  1.00 12.31 ? 455 THR E HG22 1  
ATOM 9556   H HG23 . THR E 2 6   ? 34.890  -6.372  -3.626  1.00 64.51 ? 455 THR E HG23 1  
ATOM 9557   N N    . ASP E 2 7   ? 31.044  -5.133  -4.801  1.00 41.05 ? 456 ASP E N    1  
ATOM 9558   C CA   . ASP E 2 7   ? 29.801  -5.907  -4.971  1.00 14.14 ? 456 ASP E CA   1  
ATOM 9559   C C    . ASP E 2 7   ? 30.140  -7.382  -5.268  1.00 21.23 ? 456 ASP E C    1  
ATOM 9560   O O    . ASP E 2 7   ? 31.285  -7.700  -5.607  1.00 25.10 ? 456 ASP E O    1  
ATOM 9561   C CB   . ASP E 2 7   ? 28.971  -5.300  -6.134  1.00 11.24 ? 456 ASP E CB   1  
ATOM 9562   C CG   . ASP E 2 7   ? 28.866  -3.766  -6.056  1.00 62.11 ? 456 ASP E CG   1  
ATOM 9563   O OD1  . ASP E 2 7   ? 29.674  -3.068  -6.707  1.00 1.12  ? 456 ASP E OD1  1  
ATOM 9564   O OD2  . ASP E 2 7   ? 28.008  -3.254  -5.321  1.00 25.33 ? 456 ASP E OD2  1  
ATOM 9565   H H    . ASP E 2 7   ? 31.368  -4.617  -5.565  1.00 74.43 ? 456 ASP E H    1  
ATOM 9566   H HA   . ASP E 2 7   ? 29.229  -5.847  -4.049  1.00 5.00  ? 456 ASP E HA   1  
ATOM 9567   H HB2  . ASP E 2 7   ? 29.430  -5.568  -7.082  1.00 22.33 ? 456 ASP E HB2  1  
ATOM 9568   H HB3  . ASP E 2 7   ? 27.969  -5.719  -6.109  1.00 54.34 ? 456 ASP E HB3  1  
ATOM 9569   N N    . GLN E 2 8   ? 29.140  -8.273  -5.154  1.00 70.14 ? 457 GLN E N    1  
ATOM 9570   C CA   . GLN E 2 8   ? 29.285  -9.699  -5.516  1.00 45.45 ? 457 GLN E CA   1  
ATOM 9571   C C    . GLN E 2 8   ? 27.916  -10.287 -5.897  1.00 70.45 ? 457 GLN E C    1  
ATOM 9572   O O    . GLN E 2 8   ? 26.935  -10.080 -5.179  1.00 50.14 ? 457 GLN E O    1  
ATOM 9573   C CB   . GLN E 2 8   ? 29.951  -10.513 -4.362  1.00 40.14 ? 457 GLN E CB   1  
ATOM 9574   C CG   . GLN E 2 8   ? 29.238  -10.437 -2.997  1.00 20.35 ? 457 GLN E CG   1  
ATOM 9575   C CD   . GLN E 2 8   ? 29.900  -11.317 -1.934  1.00 33.01 ? 457 GLN E CD   1  
ATOM 9576   O OE1  . GLN E 2 8   ? 30.785  -10.876 -1.200  1.00 33.34 ? 457 GLN E OE1  1  
ATOM 9577   N NE2  . GLN E 2 8   ? 29.496  -12.574 -1.863  1.00 63.14 ? 457 GLN E NE2  1  
ATOM 9578   H H    . GLN E 2 8   ? 28.270  -7.968  -4.808  1.00 75.13 ? 457 GLN E H    1  
ATOM 9579   H HA   . GLN E 2 8   ? 29.931  -9.754  -6.393  1.00 14.33 ? 457 GLN E HA   1  
ATOM 9580   H HB2  . GLN E 2 8   ? 30.004  -11.558 -4.660  1.00 0.33  ? 457 GLN E HB2  1  
ATOM 9581   H HB3  . GLN E 2 8   ? 30.967  -10.149 -4.232  1.00 15.41 ? 457 GLN E HB3  1  
ATOM 9582   H HG2  . GLN E 2 8   ? 29.253  -9.407  -2.656  1.00 63.51 ? 457 GLN E HG2  1  
ATOM 9583   H HG3  . GLN E 2 8   ? 28.206  -10.749 -3.121  1.00 65.24 ? 457 GLN E HG3  1  
ATOM 9584   H HE21 . GLN E 2 8   ? 28.804  -12.873 -2.486  1.00 50.23 ? 457 GLN E HE21 1  
ATOM 9585   H HE22 . GLN E 2 8   ? 29.908  -13.156 -1.194  1.00 31.21 ? 457 GLN E HE22 1  
ATOM 9586   N N    . THR E 2 9   ? 27.869  -11.000 -7.042  1.00 25.35 ? 458 THR E N    1  
ATOM 9587   C CA   . THR E 2 9   ? 26.656  -11.661 -7.544  1.00 51.15 ? 458 THR E CA   1  
ATOM 9588   C C    . THR E 2 9   ? 26.302  -12.859 -6.624  1.00 2.20  ? 458 THR E C    1  
ATOM 9589   O O    . THR E 2 9   ? 26.879  -13.952 -6.762  1.00 61.50 ? 458 THR E O    1  
ATOM 9590   C CB   . THR E 2 9   ? 26.856  -12.121 -9.035  1.00 62.01 ? 458 THR E CB   1  
ATOM 9591   O OG1  . THR E 2 9   ? 28.012  -12.971 -9.135  1.00 12.30 ? 458 THR E OG1  1  
ATOM 9592   C CG2  . THR E 2 9   ? 27.036  -10.923 -9.993  1.00 31.34 ? 458 THR E CG2  1  
ATOM 9593   H H    . THR E 2 9   ? 28.691  -11.087 -7.569  1.00 41.10 ? 458 THR E H    1  
ATOM 9594   H HA   . THR E 2 9   ? 25.844  -10.936 -7.517  1.00 32.24 ? 458 THR E HA   1  
ATOM 9595   H HB   . THR E 2 9   ? 25.980  -12.684 -9.349  1.00 23.12 ? 458 THR E HB   1  
ATOM 9596   H HG1  . THR E 2 9   ? 27.836  -13.806 -8.689  1.00 32.30 ? 458 THR E HG1  1  
ATOM 9597   H HG21 . THR E 2 9   ? 26.161  -10.284 -9.952  1.00 64.20 ? 458 THR E HG21 1  
ATOM 9598   H HG22 . THR E 2 9   ? 27.164  -11.281 -11.006 1.00 12.22 ? 458 THR E HG22 1  
ATOM 9599   H HG23 . THR E 2 9   ? 27.911  -10.354 -9.705  1.00 50.45 ? 458 THR E HG23 1  
ATOM 9600   N N    . ASP E 2 10  ? 25.400  -12.590 -5.647  1.00 3.54  ? 459 ASP E N    1  
ATOM 9601   C CA   . ASP E 2 10  ? 25.025  -13.511 -4.548  1.00 63.44 ? 459 ASP E CA   1  
ATOM 9602   C C    . ASP E 2 10  ? 26.145  -13.619 -3.490  1.00 54.33 ? 459 ASP E C    1  
ATOM 9603   O O    . ASP E 2 10  ? 27.336  -13.524 -3.804  1.00 64.21 ? 459 ASP E O    1  
ATOM 9604   C CB   . ASP E 2 10  ? 24.577  -14.932 -5.055  1.00 22.31 ? 459 ASP E CB   1  
ATOM 9605   C CG   . ASP E 2 10  ? 24.523  -16.012 -3.945  1.00 53.30 ? 459 ASP E CG   1  
ATOM 9606   O OD1  . ASP E 2 10  ? 23.700  -15.897 -3.012  1.00 44.33 ? 459 ASP E OD1  1  
ATOM 9607   O OD2  . ASP E 2 10  ? 25.319  -16.975 -3.990  1.00 54.11 ? 459 ASP E OD2  1  
ATOM 9608   H H    . ASP E 2 10  ? 24.968  -11.710 -5.666  1.00 13.44 ? 459 ASP E H    1  
ATOM 9609   H HA   . ASP E 2 10  ? 24.167  -13.041 -4.067  1.00 25.42 ? 459 ASP E HA   1  
ATOM 9610   H HB2  . ASP E 2 10  ? 23.590  -14.851 -5.496  1.00 54.53 ? 459 ASP E HB2  1  
ATOM 9611   H HB3  . ASP E 2 10  ? 25.266  -15.257 -5.828  1.00 3.01  ? 459 ASP E HB3  1  
ATOM 9612   N N    . LEU E 2 11  ? 25.731  -13.800 -2.220  1.00 71.34 ? 460 LEU E N    1  
ATOM 9613   C CA   . LEU E 2 11  ? 26.648  -14.115 -1.118  1.00 70.44 ? 460 LEU E CA   1  
ATOM 9614   C C    . LEU E 2 11  ? 27.094  -15.586 -1.229  1.00 42.34 ? 460 LEU E C    1  
ATOM 9615   O O    . LEU E 2 11  ? 28.233  -15.871 -1.609  1.00 3.20  ? 460 LEU E O    1  
ATOM 9616   C CB   . LEU E 2 11  ? 25.975  -13.842 0.265   1.00 0.41  ? 460 LEU E CB   1  
ATOM 9617   C CG   . LEU E 2 11  ? 25.628  -12.358 0.585   1.00 1.32  ? 460 LEU E CG   1  
ATOM 9618   C CD1  . LEU E 2 11  ? 24.880  -12.235 1.935   1.00 11.11 ? 460 LEU E CD1  1  
ATOM 9619   C CD2  . LEU E 2 11  ? 26.900  -11.477 0.563   1.00 52.13 ? 460 LEU E CD2  1  
ATOM 9620   H H    . LEU E 2 11  ? 24.767  -13.739 -2.035  1.00 44.01 ? 460 LEU E H    1  
ATOM 9621   H HA   . LEU E 2 11  ? 27.520  -13.482 -1.216  1.00 63.00 ? 460 LEU E HA   1  
ATOM 9622   H HB2  . LEU E 2 11  ? 25.058  -14.425 0.316   1.00 23.53 ? 460 LEU E HB2  1  
ATOM 9623   H HB3  . LEU E 2 11  ? 26.640  -14.208 1.044   1.00 74.43 ? 460 LEU E HB3  1  
ATOM 9624   H HG   . LEU E 2 11  ? 24.962  -11.983 -0.183  1.00 43.35 ? 460 LEU E HG   1  
ATOM 9625   H HD11 . LEU E 2 11  ? 25.513  -12.584 2.743   1.00 33.45 ? 460 LEU E HD11 1  
ATOM 9626   H HD12 . LEU E 2 11  ? 23.980  -12.834 1.906   1.00 71.15 ? 460 LEU E HD12 1  
ATOM 9627   H HD13 . LEU E 2 11  ? 24.610  -11.202 2.110   1.00 62.14 ? 460 LEU E HD13 1  
ATOM 9628   H HD21 . LEU E 2 11  ? 26.636  -10.451 0.785   1.00 74.34 ? 460 LEU E HD21 1  
ATOM 9629   H HD22 . LEU E 2 11  ? 27.351  -11.516 -0.421  1.00 22.51 ? 460 LEU E HD22 1  
ATOM 9630   H HD23 . LEU E 2 11  ? 27.612  -11.832 1.297   1.00 50.43 ? 460 LEU E HD23 1  
ATOM 9631   N N    . PHE E 2 12  ? 26.153  -16.506 -0.927  1.00 53.23 ? 461 PHE E N    1  
ATOM 9632   C CA   . PHE E 2 12  ? 26.427  -17.957 -0.799  1.00 13.23 ? 461 PHE E CA   1  
ATOM 9633   C C    . PHE E 2 12  ? 25.128  -18.760 -0.560  1.00 43.11 ? 461 PHE E C    1  
ATOM 9634   O O    . PHE E 2 12  ? 25.192  -19.920 -0.130  1.00 64.41 ? 461 PHE E O    1  
ATOM 9635   C CB   . PHE E 2 12  ? 27.483  -18.240 0.348   1.00 71.35 ? 461 PHE E CB   1  
ATOM 9636   C CG   . PHE E 2 12  ? 27.367  -17.360 1.607   1.00 0.51  ? 461 PHE E CG   1  
ATOM 9637   C CD1  . PHE E 2 12  ? 26.215  -17.358 2.393   1.00 24.34 ? 461 PHE E CD1  1  
ATOM 9638   C CD2  . PHE E 2 12  ? 28.418  -16.515 1.981   1.00 22.31 ? 461 PHE E CD2  1  
ATOM 9639   C CE1  . PHE E 2 12  ? 26.118  -16.539 3.501   1.00 61.44 ? 461 PHE E CE1  1  
ATOM 9640   C CE2  . PHE E 2 12  ? 28.320  -15.703 3.093   1.00 25.23 ? 461 PHE E CE2  1  
ATOM 9641   C CZ   . PHE E 2 12  ? 27.168  -15.713 3.851   1.00 65.23 ? 461 PHE E CZ   1  
ATOM 9642   H H    . PHE E 2 12  ? 25.228  -16.199 -0.806  1.00 42.44 ? 461 PHE E H    1  
ATOM 9643   H HA   . PHE E 2 12  ? 26.842  -18.292 -1.743  1.00 51.33 ? 461 PHE E HA   1  
ATOM 9644   H HB2  . PHE E 2 12  ? 27.403  -19.271 0.669   1.00 32.32 ? 461 PHE E HB2  1  
ATOM 9645   H HB3  . PHE E 2 12  ? 28.475  -18.097 -0.067  1.00 33.41 ? 461 PHE E HB3  1  
ATOM 9646   H HD1  . PHE E 2 12  ? 25.386  -18.001 2.126   1.00 74.21 ? 461 PHE E HD1  1  
ATOM 9647   H HD2  . PHE E 2 12  ? 29.327  -16.502 1.389   1.00 5.22  ? 461 PHE E HD2  1  
ATOM 9648   H HE1  . PHE E 2 12  ? 25.218  -16.549 4.101   1.00 51.50 ? 461 PHE E HE1  1  
ATOM 9649   H HE2  . PHE E 2 12  ? 29.146  -15.056 3.370   1.00 1.31  ? 461 PHE E HE2  1  
ATOM 9650   H HZ   . PHE E 2 12  ? 27.088  -15.076 4.727   1.00 65.24 ? 461 PHE E HZ   1  
ATOM 9651   N N    . TYR E 2 13  ? 23.955  -18.166 -0.882  1.00 23.21 ? 462 TYR E N    1  
ATOM 9652   C CA   . TYR E 2 13  ? 22.650  -18.730 -0.467  1.00 32.11 ? 462 TYR E CA   1  
ATOM 9653   C C    . TYR E 2 13  ? 21.488  -18.151 -1.301  1.00 42.54 ? 462 TYR E C    1  
ATOM 9654   O O    . TYR E 2 13  ? 21.379  -16.936 -1.463  1.00 55.24 ? 462 TYR E O    1  
ATOM 9655   C CB   . TYR E 2 13  ? 22.442  -18.447 1.052   1.00 13.51 ? 462 TYR E CB   1  
ATOM 9656   C CG   . TYR E 2 13  ? 21.221  -19.127 1.698   1.00 33.30 ? 462 TYR E CG   1  
ATOM 9657   C CD1  . TYR E 2 13  ? 21.163  -20.515 1.849   1.00 24.11 ? 462 TYR E CD1  1  
ATOM 9658   C CD2  . TYR E 2 13  ? 20.147  -18.381 2.183   1.00 44.51 ? 462 TYR E CD2  1  
ATOM 9659   C CE1  . TYR E 2 13  ? 20.080  -21.124 2.454   1.00 10.13 ? 462 TYR E CE1  1  
ATOM 9660   C CE2  . TYR E 2 13  ? 19.067  -18.985 2.787   1.00 10.41 ? 462 TYR E CE2  1  
ATOM 9661   C CZ   . TYR E 2 13  ? 19.035  -20.354 2.922   1.00 15.10 ? 462 TYR E CZ   1  
ATOM 9662   O OH   . TYR E 2 13  ? 17.950  -20.958 3.525   1.00 64.33 ? 462 TYR E OH   1  
ATOM 9663   H H    . TYR E 2 13  ? 23.967  -17.354 -1.431  1.00 75.42 ? 462 TYR E H    1  
ATOM 9664   H HA   . TYR E 2 13  ? 22.689  -19.808 -0.623  1.00 51.03 ? 462 TYR E HA   1  
ATOM 9665   H HB2  . TYR E 2 13  ? 23.318  -18.790 1.590   1.00 4.44  ? 462 TYR E HB2  1  
ATOM 9666   H HB3  . TYR E 2 13  ? 22.355  -17.371 1.204   1.00 72.21 ? 462 TYR E HB3  1  
ATOM 9667   H HD1  . TYR E 2 13  ? 21.983  -21.123 1.481   1.00 13.03 ? 462 TYR E HD1  1  
ATOM 9668   H HD2  . TYR E 2 13  ? 20.169  -17.302 2.080   1.00 34.13 ? 462 TYR E HD2  1  
ATOM 9669   H HE1  . TYR E 2 13  ? 20.057  -22.201 2.560   1.00 2.42  ? 462 TYR E HE1  1  
ATOM 9670   H HE2  . TYR E 2 13  ? 18.245  -18.380 3.152   1.00 35.23 ? 462 TYR E HE2  1  
ATOM 9671   H HH   . TYR E 2 13  ? 18.260  -21.599 4.172   1.00 2.34  ? 462 TYR E HH   1  
ATOM 9672   N N    . THR E 2 14  ? 20.622  -19.044 -1.821  1.00 53.44 ? 463 THR E N    1  
ATOM 9673   C CA   . THR E 2 14  ? 19.399  -18.670 -2.568  1.00 23.54 ? 463 THR E CA   1  
ATOM 9674   C C    . THR E 2 14  ? 18.171  -18.655 -1.635  1.00 2.51  ? 463 THR E C    1  
ATOM 9675   O O    . THR E 2 14  ? 17.545  -17.597 -1.464  1.00 30.32 ? 463 THR E O    1  
ATOM 9676   C CB   . THR E 2 14  ? 19.141  -19.667 -3.761  1.00 44.11 ? 463 THR E CB   1  
ATOM 9677   O OG1  . THR E 2 14  ? 19.407  -21.012 -3.332  1.00 53.31 ? 463 THR E OG1  1  
ATOM 9678   C CG2  . THR E 2 14  ? 19.992  -19.357 -4.998  1.00 2.11  ? 463 THR E CG2  1  
ATOM 9679   H H    . THR E 2 14  ? 20.813  -19.996 -1.700  1.00 73.14 ? 463 THR E H    1  
ATOM 9680   H HA   . THR E 2 14  ? 19.535  -17.670 -2.977  1.00 40.10 ? 463 THR E HA   1  
ATOM 9681   H HB   . THR E 2 14  ? 18.092  -19.603 -4.051  1.00 41.35 ? 463 THR E HB   1  
ATOM 9682   H HG1  . THR E 2 14  ? 20.358  -21.166 -3.349  1.00 3.40  ? 463 THR E HG1  1  
ATOM 9683   H HG21 . THR E 2 14  ? 21.041  -19.446 -4.750  1.00 42.10 ? 463 THR E HG21 1  
ATOM 9684   H HG22 . THR E 2 14  ? 19.789  -18.354 -5.342  1.00 65.24 ? 463 THR E HG22 1  
ATOM 9685   H HG23 . THR E 2 14  ? 19.751  -20.059 -5.789  1.00 44.50 ? 463 THR E HG23 1  
ATOM 9686   N N    . MET E 2 15  ? 17.884  -19.847 -1.032  1.00 75.41 ? 464 MET E N    1  
ATOM 9687   C CA   . MET E 2 15  ? 16.654  -20.175 -0.256  1.00 2.24  ? 464 MET E CA   1  
ATOM 9688   C C    . MET E 2 15  ? 15.511  -20.563 -1.222  1.00 53.52 ? 464 MET E C    1  
ATOM 9689   O O    . MET E 2 15  ? 15.197  -19.830 -2.158  1.00 33.11 ? 464 MET E O    1  
ATOM 9690   C CB   . MET E 2 15  ? 16.208  -19.036 0.726   1.00 14.22 ? 464 MET E CB   1  
ATOM 9691   C CG   . MET E 2 15  ? 15.214  -19.451 1.830   1.00 44.41 ? 464 MET E CG   1  
ATOM 9692   S SD   . MET E 2 15  ? 13.573  -19.897 1.214   1.00 31.32 ? 464 MET E SD   1  
ATOM 9693   C CE   . MET E 2 15  ? 12.740  -20.372 2.731   1.00 21.44 ? 464 MET E CE   1  
ATOM 9694   H H    . MET E 2 15  ? 18.547  -20.563 -1.131  1.00 70.12 ? 464 MET E H    1  
ATOM 9695   H HA   . MET E 2 15  ? 16.908  -21.050 0.332   1.00 1.30  ? 464 MET E HA   1  
ATOM 9696   H HB2  . MET E 2 15  ? 17.093  -18.643 1.212   1.00 5.40  ? 464 MET E HB2  1  
ATOM 9697   H HB3  . MET E 2 15  ? 15.760  -18.233 0.150   1.00 53.13 ? 464 MET E HB3  1  
ATOM 9698   H HG2  . MET E 2 15  ? 15.622  -20.302 2.354   1.00 4.20  ? 464 MET E HG2  1  
ATOM 9699   H HG3  . MET E 2 15  ? 15.106  -18.625 2.524   1.00 71.02 ? 464 MET E HG3  1  
ATOM 9700   H HE1  . MET E 2 15  ? 12.729  -19.535 3.413   1.00 64.42 ? 464 MET E HE1  1  
ATOM 9701   H HE2  . MET E 2 15  ? 13.260  -21.203 3.185   1.00 74.43 ? 464 MET E HE2  1  
ATOM 9702   H HE3  . MET E 2 15  ? 11.725  -20.664 2.504   1.00 71.43 ? 464 MET E HE3  1  
ATOM 9703   N N    . LYS E 2 16  ? 14.912  -21.746 -1.005  1.00 1.41  ? 465 LYS E N    1  
ATOM 9704   C CA   . LYS E 2 16  ? 13.790  -22.259 -1.819  1.00 41.44 ? 465 LYS E CA   1  
ATOM 9705   C C    . LYS E 2 16  ? 12.525  -22.293 -0.944  1.00 62.42 ? 465 LYS E C    1  
ATOM 9706   O O    . LYS E 2 16  ? 12.349  -23.212 -0.139  1.00 31.22 ? 465 LYS E O    1  
ATOM 9707   C CB   . LYS E 2 16  ? 14.090  -23.685 -2.387  1.00 54.40 ? 465 LYS E CB   1  
ATOM 9708   C CG   . LYS E 2 16  ? 15.269  -23.776 -3.395  1.00 73.22 ? 465 LYS E CG   1  
ATOM 9709   C CD   . LYS E 2 16  ? 16.667  -23.695 -2.734  1.00 34.40 ? 465 LYS E CD   1  
ATOM 9710   C CE   . LYS E 2 16  ? 17.814  -23.703 -3.757  1.00 31.54 ? 465 LYS E CE   1  
ATOM 9711   N NZ   . LYS E 2 16  ? 17.797  -24.911 -4.620  1.00 54.14 ? 465 LYS E NZ   1  
ATOM 9712   H H    . LYS E 2 16  ? 15.231  -22.295 -0.262  1.00 74.22 ? 465 LYS E H    1  
ATOM 9713   H HA   . LYS E 2 16  ? 13.622  -21.576 -2.653  1.00 23.22 ? 465 LYS E HA   1  
ATOM 9714   H HB2  . LYS E 2 16  ? 14.307  -24.351 -1.560  1.00 14.03 ? 465 LYS E HB2  1  
ATOM 9715   H HB3  . LYS E 2 16  ? 13.195  -24.048 -2.889  1.00 3.34  ? 465 LYS E HB3  1  
ATOM 9716   H HG2  . LYS E 2 16  ? 15.196  -24.721 -3.924  1.00 75.41 ? 465 LYS E HG2  1  
ATOM 9717   H HG3  . LYS E 2 16  ? 15.170  -22.968 -4.116  1.00 34.22 ? 465 LYS E HG3  1  
ATOM 9718   H HD2  . LYS E 2 16  ? 16.728  -22.780 -2.153  1.00 31.43 ? 465 LYS E HD2  1  
ATOM 9719   H HD3  . LYS E 2 16  ? 16.787  -24.541 -2.065  1.00 64.41 ? 465 LYS E HD3  1  
ATOM 9720   H HE2  . LYS E 2 16  ? 17.732  -22.826 -4.387  1.00 64.02 ? 465 LYS E HE2  1  
ATOM 9721   H HE3  . LYS E 2 16  ? 18.757  -23.670 -3.228  1.00 50.50 ? 465 LYS E HE3  1  
ATOM 9722   H HZ1  . LYS E 2 16  ? 16.889  -24.977 -5.128  1.00 33.41 ? 465 LYS E HZ1  1  
ATOM 9723   H HZ2  . LYS E 2 16  ? 17.921  -25.768 -4.048  1.00 24.45 ? 465 LYS E HZ2  1  
ATOM 9724   H HZ3  . LYS E 2 16  ? 18.564  -24.864 -5.318  1.00 42.43 ? 465 LYS E HZ3  1  
ATOM 9725   N N    . ALA E 2 17  ? 11.673  -21.262 -1.079  1.00 3.22  ? 466 ALA E N    1  
ATOM 9726   C CA   . ALA E 2 17  ? 10.419  -21.146 -0.305  1.00 11.34 ? 466 ALA E CA   1  
ATOM 9727   C C    . ALA E 2 17  ? 9.302   -21.996 -0.940  1.00 34.22 ? 466 ALA E C    1  
ATOM 9728   O O    . ALA E 2 17  ? 9.309   -22.255 -2.149  1.00 43.23 ? 466 ALA E O    1  
ATOM 9729   C CB   . ALA E 2 17  ? 9.998   -19.667 -0.193  1.00 13.21 ? 466 ALA E CB   1  
ATOM 9730   H H    . ALA E 2 17  ? 11.889  -20.557 -1.719  1.00 70.14 ? 466 ALA E H    1  
ATOM 9731   H HA   . ALA E 2 17  ? 10.609  -21.517 0.704   1.00 34.53 ? 466 ALA E HA   1  
ATOM 9732   H HB1  . ALA E 2 17  ? 9.810   -19.259 -1.179  1.00 60.41 ? 466 ALA E HB1  1  
ATOM 9733   H HB2  . ALA E 2 17  ? 10.788  -19.098 0.279   1.00 13.11 ? 466 ALA E HB2  1  
ATOM 9734   H HB3  . ALA E 2 17  ? 9.098   -19.582 0.406   1.00 11.21 ? 466 ALA E HB3  1  
ATOM 9735   N N    . ALA E 2 18  ? 8.352   -22.442 -0.107  1.00 54.14 ? 467 ALA E N    1  
ATOM 9736   C CA   . ALA E 2 18  ? 7.188   -23.212 -0.562  1.00 25.31 ? 467 ALA E CA   1  
ATOM 9737   C C    . ALA E 2 18  ? 6.070   -23.112 0.483   1.00 20.15 ? 467 ALA E C    1  
ATOM 9738   O O    . ALA E 2 18  ? 6.053   -23.847 1.475   1.00 4.13  ? 467 ALA E O    1  
ATOM 9739   C CB   . ALA E 2 18  ? 7.577   -24.678 -0.855  1.00 43.02 ? 467 ALA E CB   1  
ATOM 9740   H H    . ALA E 2 18  ? 8.441   -22.251 0.852   1.00 55.01 ? 467 ALA E H    1  
ATOM 9741   H HA   . ALA E 2 18  ? 6.829   -22.767 -1.491  1.00 54.53 ? 467 ALA E HA   1  
ATOM 9742   H HB1  . ALA E 2 18  ? 6.720   -25.218 -1.236  1.00 71.25 ? 467 ALA E HB1  1  
ATOM 9743   H HB2  . ALA E 2 18  ? 7.928   -25.155 0.050   1.00 4.02  ? 467 ALA E HB2  1  
ATOM 9744   H HB3  . ALA E 2 18  ? 8.367   -24.697 -1.596  1.00 2.14  ? 467 ALA E HB3  1  
ATOM 9745   N N    . LEU E 2 19  ? 5.169   -22.143 0.274   1.00 1.43  ? 468 LEU E N    1  
ATOM 9746   C CA   . LEU E 2 19  ? 3.981   -21.957 1.124   1.00 72.14 ? 468 LEU E CA   1  
ATOM 9747   C C    . LEU E 2 19  ? 2.862   -22.913 0.667   1.00 2.03  ? 468 LEU E C    1  
ATOM 9748   O O    . LEU E 2 19  ? 3.041   -23.671 -0.302  1.00 4.51  ? 468 LEU E O    1  
ATOM 9749   C CB   . LEU E 2 19  ? 3.497   -20.485 1.039   1.00 61.13 ? 468 LEU E CB   1  
ATOM 9750   C CG   . LEU E 2 19  ? 4.538   -19.387 1.413   1.00 33.30 ? 468 LEU E CG   1  
ATOM 9751   C CD1  . LEU E 2 19  ? 3.941   -17.983 1.191   1.00 35.13 ? 468 LEU E CD1  1  
ATOM 9752   C CD2  . LEU E 2 19  ? 5.065   -19.561 2.857   1.00 61.11 ? 468 LEU E CD2  1  
ATOM 9753   H H    . LEU E 2 19  ? 5.297   -21.544 -0.488  1.00 72.35 ? 468 LEU E H    1  
ATOM 9754   H HA   . LEU E 2 19  ? 4.246   -22.187 2.152   1.00 14.41 ? 468 LEU E HA   1  
ATOM 9755   H HB2  . LEU E 2 19  ? 3.169   -20.301 0.021   1.00 2.11  ? 468 LEU E HB2  1  
ATOM 9756   H HB3  . LEU E 2 19  ? 2.637   -20.371 1.693   1.00 73.45 ? 468 LEU E HB3  1  
ATOM 9757   H HG   . LEU E 2 19  ? 5.390   -19.477 0.747   1.00 71.22 ? 468 LEU E HG   1  
ATOM 9758   H HD11 . LEU E 2 19  ? 4.668   -17.231 1.462   1.00 23.15 ? 468 LEU E HD11 1  
ATOM 9759   H HD12 . LEU E 2 19  ? 3.050   -17.854 1.794   1.00 14.44 ? 468 LEU E HD12 1  
ATOM 9760   H HD13 . LEU E 2 19  ? 3.685   -17.862 0.143   1.00 1.31  ? 468 LEU E HD13 1  
ATOM 9761   H HD21 . LEU E 2 19  ? 5.545   -20.526 2.951   1.00 74.05 ? 468 LEU E HD21 1  
ATOM 9762   H HD22 . LEU E 2 19  ? 4.245   -19.499 3.562   1.00 15.00 ? 468 LEU E HD22 1  
ATOM 9763   H HD23 . LEU E 2 19  ? 5.785   -18.784 3.076   1.00 71.20 ? 468 LEU E HD23 1  
ATOM 9764   N N    . GLY E 2 20  ? 1.704   -22.862 1.350   1.00 10.32 ? 469 GLY E N    1  
ATOM 9765   C CA   . GLY E 2 20  ? 0.516   -23.618 0.932   1.00 63.34 ? 469 GLY E CA   1  
ATOM 9766   C C    . GLY E 2 20  ? -0.262  -22.890 -0.166  1.00 13.13 ? 469 GLY E C    1  
ATOM 9767   O O    . GLY E 2 20  ? -1.463  -22.619 -0.021  1.00 42.52 ? 469 GLY E O    1  
ATOM 9768   H H    . GLY E 2 20  ? 1.655   -22.304 2.157   1.00 31.43 ? 469 GLY E H    1  
ATOM 9769   H HA2  . GLY E 2 20  ? 0.812   -24.598 0.568   1.00 33.53 ? 469 GLY E HA2  1  
ATOM 9770   H HA3  . GLY E 2 20  ? -0.126  -23.749 1.789   1.00 51.14 ? 469 GLY E HA3  1  
ATOM 9771   N N    . LEU E 2 21  ? 0.440   -22.572 -1.274  1.00 72.01 ? 470 LEU E N    1  
ATOM 9772   C CA   . LEU E 2 21  ? -0.116  -21.795 -2.389  1.00 1.14  ? 470 LEU E CA   1  
ATOM 9773   C C    . LEU E 2 21  ? -0.860  -22.734 -3.350  1.00 52.42 ? 470 LEU E C    1  
ATOM 9774   O O    . LEU E 2 21  ? -0.281  -23.275 -4.300  1.00 41.23 ? 470 LEU E O    1  
ATOM 9775   C CB   . LEU E 2 21  ? 0.998   -20.984 -3.116  1.00 13.42 ? 470 LEU E CB   1  
ATOM 9776   C CG   . LEU E 2 21  ? 1.768   -19.938 -2.246  1.00 34.02 ? 470 LEU E CG   1  
ATOM 9777   C CD1  . LEU E 2 21  ? 2.754   -19.111 -3.095  1.00 64.32 ? 470 LEU E CD1  1  
ATOM 9778   C CD2  . LEU E 2 21  ? 0.802   -19.020 -1.464  1.00 4.10  ? 470 LEU E CD2  1  
ATOM 9779   H H    . LEU E 2 21  ? 1.359   -22.894 -1.350  1.00 5.34  ? 470 LEU E H    1  
ATOM 9780   H HA   . LEU E 2 21  ? -0.836  -21.092 -1.977  1.00 33.12 ? 470 LEU E HA   1  
ATOM 9781   H HB2  . LEU E 2 21  ? 1.721   -21.687 -3.520  1.00 53.41 ? 470 LEU E HB2  1  
ATOM 9782   H HB3  . LEU E 2 21  ? 0.542   -20.457 -3.951  1.00 33.35 ? 470 LEU E HB3  1  
ATOM 9783   H HG   . LEU E 2 21  ? 2.360   -20.475 -1.514  1.00 0.43  ? 470 LEU E HG   1  
ATOM 9784   H HD11 . LEU E 2 21  ? 3.304   -18.428 -2.460  1.00 41.21 ? 470 LEU E HD11 1  
ATOM 9785   H HD12 . LEU E 2 21  ? 2.214   -18.544 -3.846  1.00 32.01 ? 470 LEU E HD12 1  
ATOM 9786   H HD13 . LEU E 2 21  ? 3.451   -19.776 -3.588  1.00 64.33 ? 470 LEU E HD13 1  
ATOM 9787   H HD21 . LEU E 2 21  ? 0.187   -19.620 -0.808  1.00 52.14 ? 470 LEU E HD21 1  
ATOM 9788   H HD22 . LEU E 2 21  ? 0.166   -18.478 -2.153  1.00 70.22 ? 470 LEU E HD22 1  
ATOM 9789   H HD23 . LEU E 2 21  ? 1.368   -18.314 -0.869  1.00 62.30 ? 470 LEU E HD23 1  
ATOM 9790   N N    . LYS E 2 22  ? -2.144  -22.960 -3.032  1.00 74.23 ? 471 LYS E N    1  
ATOM 9791   C CA   . LYS E 2 22  ? -3.039  -23.849 -3.782  1.00 14.52 ? 471 LYS E CA   1  
ATOM 9792   C C    . LYS E 2 22  ? -4.382  -23.117 -4.008  1.00 21.01 ? 471 LYS E C    1  
ATOM 9793   O O    . LYS E 2 22  ? -5.103  -22.879 -3.019  1.00 54.12 ? 471 LYS E O    1  
ATOM 9794   C CB   . LYS E 2 22  ? -3.255  -25.186 -3.004  1.00 74.22 ? 471 LYS E CB   1  
ATOM 9795   C CG   . LYS E 2 22  ? -1.973  -26.031 -2.790  1.00 73.24 ? 471 LYS E CG   1  
ATOM 9796   C CD   . LYS E 2 22  ? -2.220  -27.303 -1.940  1.00 44.43 ? 471 LYS E CD   1  
ATOM 9797   C CE   . LYS E 2 22  ? -3.222  -28.282 -2.579  1.00 1.33  ? 471 LYS E CE   1  
ATOM 9798   N NZ   . LYS E 2 22  ? -3.409  -29.506 -1.744  1.00 53.12 ? 471 LYS E NZ   1  
ATOM 9799   O OXT  . LYS E 2 22  ? -4.713  -22.781 -5.163  1.00 37.65 ? 471 LYS E OXT  1  
ATOM 9800   H H    . LYS E 2 22  ? -2.514  -22.497 -2.254  1.00 75.11 ? 471 LYS E H    1  
ATOM 9801   H HA   . LYS E 2 22  ? -2.584  -24.067 -4.747  1.00 55.34 ? 471 LYS E HA   1  
ATOM 9802   H HB2  . LYS E 2 22  ? -3.676  -24.955 -2.030  1.00 61.32 ? 471 LYS E HB2  1  
ATOM 9803   H HB3  . LYS E 2 22  ? -3.974  -25.790 -3.551  1.00 12.33 ? 471 LYS E HB3  1  
ATOM 9804   H HG2  . LYS E 2 22  ? -1.583  -26.329 -3.759  1.00 31.12 ? 471 LYS E HG2  1  
ATOM 9805   H HG3  . LYS E 2 22  ? -1.234  -25.412 -2.290  1.00 73.32 ? 471 LYS E HG3  1  
ATOM 9806   H HD2  . LYS E 2 22  ? -1.276  -27.818 -1.805  1.00 51.51 ? 471 LYS E HD2  1  
ATOM 9807   H HD3  . LYS E 2 22  ? -2.596  -27.003 -0.965  1.00 61.34 ? 471 LYS E HD3  1  
ATOM 9808   H HE2  . LYS E 2 22  ? -4.179  -27.790 -2.692  1.00 24.45 ? 471 LYS E HE2  1  
ATOM 9809   H HE3  . LYS E 2 22  ? -2.855  -28.578 -3.554  1.00 70.12 ? 471 LYS E HE3  1  
ATOM 9810   H HZ1  . LYS E 2 22  ? -3.760  -29.247 -0.799  1.00 61.25 ? 471 LYS E HZ1  1  
ATOM 9811   H HZ2  . LYS E 2 22  ? -2.504  -30.009 -1.634  1.00 41.33 ? 471 LYS E HZ2  1  
ATOM 9812   H HZ3  . LYS E 2 22  ? -4.095  -30.146 -2.190  1.00 1.21  ? 471 LYS E HZ3  1  
ATOM 9813   N N    . ASN F 2 1   ? -12.623 -9.225  -29.929 1.00 65.11 ? 450 ASN F N    1  
ATOM 9814   C CA   . ASN F 2 1   ? -13.325 -10.094 -30.896 1.00 71.52 ? 450 ASN F CA   1  
ATOM 9815   C C    . ASN F 2 1   ? -14.581 -9.377  -31.416 1.00 11.42 ? 450 ASN F C    1  
ATOM 9816   O O    . ASN F 2 1   ? -14.696 -9.138  -32.620 1.00 41.52 ? 450 ASN F O    1  
ATOM 9817   C CB   . ASN F 2 1   ? -13.692 -11.455 -30.254 1.00 62.52 ? 450 ASN F CB   1  
ATOM 9818   C CG   . ASN F 2 1   ? -12.491 -12.191 -29.645 1.00 35.22 ? 450 ASN F CG   1  
ATOM 9819   O OD1  . ASN F 2 1   ? -11.350 -12.016 -30.076 1.00 63.13 ? 450 ASN F OD1  1  
ATOM 9820   N ND2  . ASN F 2 1   ? -12.738 -13.029 -28.647 1.00 44.32 ? 450 ASN F ND2  1  
ATOM 9821   H H1   . ASN F 2 1   ? -11.730 -9.668  -29.631 1.00 37.65 ? 450 ASN F H1   1  
ATOM 9822   H H2   . ASN F 2 1   ? -13.211 -9.075  -29.092 1.00 37.65 ? 450 ASN F H2   1  
ATOM 9823   H H3   . ASN F 2 1   ? -12.411 -8.301  -30.359 1.00 37.65 ? 450 ASN F H3   1  
ATOM 9824   H HA   . ASN F 2 1   ? -12.647 -10.263 -31.729 1.00 62.01 ? 450 ASN F HA   1  
ATOM 9825   H HB2  . ASN F 2 1   ? -14.422 -11.290 -29.471 1.00 4.35  ? 450 ASN F HB2  1  
ATOM 9826   H HB3  . ASN F 2 1   ? -14.133 -12.100 -31.008 1.00 20.21 ? 450 ASN F HB3  1  
ATOM 9827   H HD21 . ASN F 2 1   ? -13.669 -13.139 -28.355 1.00 33.04 ? 450 ASN F HD21 1  
ATOM 9828   H HD22 . ASN F 2 1   ? -11.985 -13.502 -28.239 1.00 13.33 ? 450 ASN F HD22 1  
ATOM 9829   N N    . VAL F 2 2   ? -15.533 -9.036  -30.503 1.00 3.10  ? 451 VAL F N    1  
ATOM 9830   C CA   . VAL F 2 2   ? -16.700 -8.185  -30.863 1.00 43.12 ? 451 VAL F CA   1  
ATOM 9831   C C    . VAL F 2 2   ? -16.249 -6.751  -31.174 1.00 55.30 ? 451 VAL F C    1  
ATOM 9832   O O    . VAL F 2 2   ? -16.880 -6.053  -31.966 1.00 31.15 ? 451 VAL F O    1  
ATOM 9833   C CB   . VAL F 2 2   ? -17.828 -8.152  -29.750 1.00 42.10 ? 451 VAL F CB   1  
ATOM 9834   C CG1  . VAL F 2 2   ? -18.471 -9.538  -29.574 1.00 21.42 ? 451 VAL F CG1  1  
ATOM 9835   C CG2  . VAL F 2 2   ? -17.308 -7.601  -28.397 1.00 23.34 ? 451 VAL F CG2  1  
ATOM 9836   H H    . VAL F 2 2   ? -15.457 -9.375  -29.587 1.00 24.21 ? 451 VAL F H    1  
ATOM 9837   H HA   . VAL F 2 2   ? -17.137 -8.605  -31.767 1.00 12.53 ? 451 VAL F HA   1  
ATOM 9838   H HB   . VAL F 2 2   ? -18.613 -7.478  -30.097 1.00 40.30 ? 451 VAL F HB   1  
ATOM 9839   H HG11 . VAL F 2 2   ? -17.723 -10.252 -29.248 1.00 62.23 ? 451 VAL F HG11 1  
ATOM 9840   H HG12 . VAL F 2 2   ? -18.886 -9.867  -30.519 1.00 11.21 ? 451 VAL F HG12 1  
ATOM 9841   H HG13 . VAL F 2 2   ? -19.264 -9.488  -28.838 1.00 35.34 ? 451 VAL F HG13 1  
ATOM 9842   H HG21 . VAL F 2 2   ? -16.934 -6.595  -28.535 1.00 34.23 ? 451 VAL F HG21 1  
ATOM 9843   H HG22 . VAL F 2 2   ? -16.508 -8.230  -28.029 1.00 44.21 ? 451 VAL F HG22 1  
ATOM 9844   H HG23 . VAL F 2 2   ? -18.113 -7.586  -27.671 1.00 11.10 ? 451 VAL F HG23 1  
ATOM 9845   N N    . VAL F 2 3   ? -15.153 -6.331  -30.509 1.00 42.21 ? 452 VAL F N    1  
ATOM 9846   C CA   . VAL F 2 3   ? -14.537 -5.000  -30.664 1.00 65.20 ? 452 VAL F CA   1  
ATOM 9847   C C    . VAL F 2 3   ? -13.001 -5.140  -30.676 1.00 73.31 ? 452 VAL F C    1  
ATOM 9848   O O    . VAL F 2 3   ? -12.469 -6.224  -30.389 1.00 75.40 ? 452 VAL F O    1  
ATOM 9849   C CB   . VAL F 2 3   ? -14.982 -4.005  -29.523 1.00 43.02 ? 452 VAL F CB   1  
ATOM 9850   C CG1  . VAL F 2 3   ? -16.520 -3.848  -29.476 1.00 64.02 ? 452 VAL F CG1  1  
ATOM 9851   C CG2  . VAL F 2 3   ? -14.429 -4.407  -28.135 1.00 34.11 ? 452 VAL F CG2  1  
ATOM 9852   H H    . VAL F 2 3   ? -14.729 -6.956  -29.890 1.00 55.25 ? 452 VAL F H    1  
ATOM 9853   H HA   . VAL F 2 3   ? -14.848 -4.585  -31.623 1.00 53.11 ? 452 VAL F HA   1  
ATOM 9854   H HB   . VAL F 2 3   ? -14.571 -3.027  -29.766 1.00 61.32 ? 452 VAL F HB   1  
ATOM 9855   H HG11 . VAL F 2 3   ? -16.797 -3.148  -28.698 1.00 23.12 ? 452 VAL F HG11 1  
ATOM 9856   H HG12 . VAL F 2 3   ? -16.983 -4.806  -29.273 1.00 75.24 ? 452 VAL F HG12 1  
ATOM 9857   H HG13 . VAL F 2 3   ? -16.877 -3.478  -30.430 1.00 63.11 ? 452 VAL F HG13 1  
ATOM 9858   H HG21 . VAL F 2 3   ? -13.347 -4.437  -28.170 1.00 32.32 ? 452 VAL F HG21 1  
ATOM 9859   H HG22 . VAL F 2 3   ? -14.801 -5.385  -27.858 1.00 4.12  ? 452 VAL F HG22 1  
ATOM 9860   H HG23 . VAL F 2 3   ? -14.739 -3.683  -27.388 1.00 32.24 ? 452 VAL F HG23 1  
ATOM 9861   N N    . GLY F 2 4   ? -12.311 -4.036  -31.010 1.00 32.45 ? 453 GLY F N    1  
ATOM 9862   C CA   . GLY F 2 4   ? -10.853 -3.995  -31.016 1.00 45.42 ? 453 GLY F CA   1  
ATOM 9863   C C    . GLY F 2 4   ? -10.338 -2.588  -31.302 1.00 42.25 ? 453 GLY F C    1  
ATOM 9864   O O    . GLY F 2 4   ? -10.622 -2.034  -32.370 1.00 31.34 ? 453 GLY F O    1  
ATOM 9865   H H    . GLY F 2 4   ? -12.808 -3.233  -31.278 1.00 52.45 ? 453 GLY F H    1  
ATOM 9866   H HA2  . GLY F 2 4   ? -10.481 -4.330  -30.053 1.00 33.12 ? 453 GLY F HA2  1  
ATOM 9867   H HA3  . GLY F 2 4   ? -10.484 -4.663  -31.784 1.00 63.30 ? 453 GLY F HA3  1  
ATOM 9868   N N    . LEU F 2 5   ? -9.602  -2.004  -30.341 1.00 22.12 ? 454 LEU F N    1  
ATOM 9869   C CA   . LEU F 2 5   ? -9.040  -0.639  -30.457 1.00 5.42  ? 454 LEU F CA   1  
ATOM 9870   C C    . LEU F 2 5   ? -7.668  -0.664  -31.163 1.00 45.22 ? 454 LEU F C    1  
ATOM 9871   O O    . LEU F 2 5   ? -7.050  -1.723  -31.313 1.00 3.12  ? 454 LEU F O    1  
ATOM 9872   C CB   . LEU F 2 5   ? -8.891  0.027   -29.047 1.00 3.44  ? 454 LEU F CB   1  
ATOM 9873   C CG   . LEU F 2 5   ? -10.207 0.473   -28.319 1.00 65.14 ? 454 LEU F CG   1  
ATOM 9874   C CD1  . LEU F 2 5   ? -11.087 -0.720  -27.896 1.00 35.43 ? 454 LEU F CD1  1  
ATOM 9875   C CD2  . LEU F 2 5   ? -9.886  1.383   -27.111 1.00 43.41 ? 454 LEU F CD2  1  
ATOM 9876   H H    . LEU F 2 5   ? -9.426  -2.507  -29.524 1.00 74.11 ? 454 LEU F H    1  
ATOM 9877   H HA   . LEU F 2 5   ? -9.723  -0.039  -31.052 1.00 42.04 ? 454 LEU F HA   1  
ATOM 9878   H HB2  . LEU F 2 5   ? -8.365  -0.669  -28.401 1.00 21.44 ? 454 LEU F HB2  1  
ATOM 9879   H HB3  . LEU F 2 5   ? -8.262  0.908   -29.160 1.00 33.42 ? 454 LEU F HB3  1  
ATOM 9880   H HG   . LEU F 2 5   ? -10.798 1.062   -29.011 1.00 52.41 ? 454 LEU F HG   1  
ATOM 9881   H HD11 . LEU F 2 5   ? -11.987 -0.357  -27.417 1.00 14.41 ? 454 LEU F HD11 1  
ATOM 9882   H HD12 . LEU F 2 5   ? -10.544 -1.352  -27.204 1.00 52.35 ? 454 LEU F HD12 1  
ATOM 9883   H HD13 . LEU F 2 5   ? -11.358 -1.298  -28.770 1.00 22.11 ? 454 LEU F HD13 1  
ATOM 9884   H HD21 . LEU F 2 5   ? -10.807 1.696   -26.636 1.00 71.43 ? 454 LEU F HD21 1  
ATOM 9885   H HD22 . LEU F 2 5   ? -9.351  2.260   -27.451 1.00 42.34 ? 454 LEU F HD22 1  
ATOM 9886   H HD23 . LEU F 2 5   ? -9.276  0.847   -26.394 1.00 11.24 ? 454 LEU F HD23 1  
ATOM 9887   N N    . THR F 2 6   ? -7.190  0.534   -31.557 1.00 73.32 ? 455 THR F N    1  
ATOM 9888   C CA   . THR F 2 6   ? -5.838  0.736   -32.127 1.00 54.13 ? 455 THR F CA   1  
ATOM 9889   C C    . THR F 2 6   ? -4.751  0.559   -31.028 1.00 32.34 ? 455 THR F C    1  
ATOM 9890   O O    . THR F 2 6   ? -3.558  0.399   -31.337 1.00 12.35 ? 455 THR F O    1  
ATOM 9891   C CB   . THR F 2 6   ? -5.736  2.170   -32.758 1.00 41.22 ? 455 THR F CB   1  
ATOM 9892   O OG1  . THR F 2 6   ? -6.923  2.442   -33.523 1.00 25.05 ? 455 THR F OG1  1  
ATOM 9893   C CG2  . THR F 2 6   ? -4.497  2.328   -33.663 1.00 42.45 ? 455 THR F CG2  1  
ATOM 9894   H H    . THR F 2 6   ? -7.770  1.316   -31.467 1.00 35.05 ? 455 THR F H    1  
ATOM 9895   H HA   . THR F 2 6   ? -5.683  -0.006  -32.908 1.00 3.13  ? 455 THR F HA   1  
ATOM 9896   H HB   . THR F 2 6   ? -5.677  2.900   -31.956 1.00 31.10 ? 455 THR F HB   1  
ATOM 9897   H HG1  . THR F 2 6   ? -6.937  3.370   -33.782 1.00 73.42 ? 455 THR F HG1  1  
ATOM 9898   H HG21 . THR F 2 6   ? -4.545  1.613   -34.476 1.00 1.23  ? 455 THR F HG21 1  
ATOM 9899   H HG22 . THR F 2 6   ? -3.597  2.150   -33.088 1.00 24.45 ? 455 THR F HG22 1  
ATOM 9900   H HG23 . THR F 2 6   ? -4.467  3.329   -34.073 1.00 10.20 ? 455 THR F HG23 1  
ATOM 9901   N N    . ASP F 2 7   ? -5.215  0.602   -29.750 1.00 12.31 ? 456 ASP F N    1  
ATOM 9902   C CA   . ASP F 2 7   ? -4.403  0.414   -28.532 1.00 33.13 ? 456 ASP F CA   1  
ATOM 9903   C C    . ASP F 2 7   ? -3.553  1.676   -28.302 1.00 4.52  ? 456 ASP F C    1  
ATOM 9904   O O    . ASP F 2 7   ? -2.327  1.676   -28.488 1.00 72.31 ? 456 ASP F O    1  
ATOM 9905   C CB   . ASP F 2 7   ? -3.546  -0.890  -28.598 1.00 73.53 ? 456 ASP F CB   1  
ATOM 9906   C CG   . ASP F 2 7   ? -3.115  -1.410  -27.221 1.00 44.50 ? 456 ASP F CG   1  
ATOM 9907   O OD1  . ASP F 2 7   ? -3.882  -2.183  -26.626 1.00 62.03 ? 456 ASP F OD1  1  
ATOM 9908   O OD2  . ASP F 2 7   ? -2.014  -1.068  -26.742 1.00 75.13 ? 456 ASP F OD2  1  
ATOM 9909   H H    . ASP F 2 7   ? -6.168  0.781   -29.627 1.00 0.41  ? 456 ASP F H    1  
ATOM 9910   H HA   . ASP F 2 7   ? -5.113  0.331   -27.712 1.00 73.04 ? 456 ASP F HA   1  
ATOM 9911   H HB2  . ASP F 2 7   ? -4.125  -1.665  -29.097 1.00 22.22 ? 456 ASP F HB2  1  
ATOM 9912   H HB3  . ASP F 2 7   ? -2.658  -0.707  -29.198 1.00 11.42 ? 456 ASP F HB3  1  
ATOM 9913   N N    . GLN F 2 8   ? -4.268  2.762   -27.953 1.00 64.53 ? 457 GLN F N    1  
ATOM 9914   C CA   . GLN F 2 8   ? -3.717  4.123   -27.847 1.00 33.12 ? 457 GLN F CA   1  
ATOM 9915   C C    . GLN F 2 8   ? -2.559  4.202   -26.821 1.00 61.11 ? 457 GLN F C    1  
ATOM 9916   O O    . GLN F 2 8   ? -2.755  4.330   -25.608 1.00 1.45  ? 457 GLN F O    1  
ATOM 9917   C CB   . GLN F 2 8   ? -4.847  5.180   -27.557 1.00 12.45 ? 457 GLN F CB   1  
ATOM 9918   C CG   . GLN F 2 8   ? -5.625  5.046   -26.217 1.00 13.10 ? 457 GLN F CG   1  
ATOM 9919   C CD   . GLN F 2 8   ? -6.481  3.776   -26.094 1.00 22.34 ? 457 GLN F CD   1  
ATOM 9920   O OE1  . GLN F 2 8   ? -7.032  3.276   -27.079 1.00 22.52 ? 457 GLN F OE1  1  
ATOM 9921   N NE2  . GLN F 2 8   ? -6.566  3.221   -24.900 1.00 52.35 ? 457 GLN F NE2  1  
ATOM 9922   H H    . GLN F 2 8   ? -5.219  2.633   -27.769 1.00 50.40 ? 457 GLN F H    1  
ATOM 9923   H HA   . GLN F 2 8   ? -3.301  4.358   -28.831 1.00 12.42 ? 457 GLN F HA   1  
ATOM 9924   H HB2  . GLN F 2 8   ? -4.403  6.167   -27.580 1.00 11.10 ? 457 GLN F HB2  1  
ATOM 9925   H HB3  . GLN F 2 8   ? -5.570  5.124   -28.364 1.00 71.31 ? 457 GLN F HB3  1  
ATOM 9926   H HG2  . GLN F 2 8   ? -4.908  5.062   -25.403 1.00 34.00 ? 457 GLN F HG2  1  
ATOM 9927   H HG3  . GLN F 2 8   ? -6.280  5.902   -26.118 1.00 74.03 ? 457 GLN F HG3  1  
ATOM 9928   H HE21 . GLN F 2 8   ? -6.080  3.640   -24.160 1.00 72.42 ? 457 GLN F HE21 1  
ATOM 9929   H HE22 . GLN F 2 8   ? -7.120  2.422   -24.799 1.00 21.31 ? 457 GLN F HE22 1  
ATOM 9930   N N    . THR F 2 9   ? -1.336  4.054   -27.348 1.00 54.44 ? 458 THR F N    1  
ATOM 9931   C CA   . THR F 2 9   ? -0.096  4.271   -26.598 1.00 34.23 ? 458 THR F CA   1  
ATOM 9932   C C    . THR F 2 9   ? 0.025   5.761   -26.249 1.00 20.12 ? 458 THR F C    1  
ATOM 9933   O O    . THR F 2 9   ? 0.345   6.122   -25.121 1.00 41.22 ? 458 THR F O    1  
ATOM 9934   C CB   . THR F 2 9   ? 1.137   3.803   -27.444 1.00 73.24 ? 458 THR F CB   1  
ATOM 9935   O OG1  . THR F 2 9   ? 0.929   2.452   -27.892 1.00 11.24 ? 458 THR F OG1  1  
ATOM 9936   C CG2  . THR F 2 9   ? 2.469   3.883   -26.665 1.00 51.31 ? 458 THR F CG2  1  
ATOM 9937   H H    . THR F 2 9   ? -1.269  3.780   -28.287 1.00 52.34 ? 458 THR F H    1  
ATOM 9938   H HA   . THR F 2 9   ? -0.141  3.683   -25.684 1.00 43.31 ? 458 THR F HA   1  
ATOM 9939   H HB   . THR F 2 9   ? 1.213   4.437   -28.325 1.00 54.23 ? 458 THR F HB   1  
ATOM 9940   H HG1  . THR F 2 9   ? 0.204   2.060   -27.397 1.00 52.42 ? 458 THR F HG1  1  
ATOM 9941   H HG21 . THR F 2 9   ? 2.432   3.236   -25.800 1.00 32.52 ? 458 THR F HG21 1  
ATOM 9942   H HG22 . THR F 2 9   ? 2.646   4.903   -26.343 1.00 43.53 ? 458 THR F HG22 1  
ATOM 9943   H HG23 . THR F 2 9   ? 3.281   3.571   -27.308 1.00 52.32 ? 458 THR F HG23 1  
ATOM 9944   N N    . ASP F 2 10  ? -0.276  6.602   -27.256 1.00 73.00 ? 459 ASP F N    1  
ATOM 9945   C CA   . ASP F 2 10  ? -0.277  8.065   -27.143 1.00 31.33 ? 459 ASP F CA   1  
ATOM 9946   C C    . ASP F 2 10  ? -1.658  8.546   -26.655 1.00 73.04 ? 459 ASP F C    1  
ATOM 9947   O O    . ASP F 2 10  ? -2.669  8.363   -27.342 1.00 45.54 ? 459 ASP F O    1  
ATOM 9948   C CB   . ASP F 2 10  ? 0.076   8.695   -28.517 1.00 2.04  ? 459 ASP F CB   1  
ATOM 9949   C CG   . ASP F 2 10  ? 0.119   10.238  -28.497 1.00 42.43 ? 459 ASP F CG   1  
ATOM 9950   O OD1  . ASP F 2 10  ? -0.816  10.886  -29.011 1.00 24.11 ? 459 ASP F OD1  1  
ATOM 9951   O OD2  . ASP F 2 10  ? 1.092   10.806  -27.962 1.00 44.44 ? 459 ASP F OD2  1  
ATOM 9952   H H    . ASP F 2 10  ? -0.526  6.207   -28.119 1.00 53.34 ? 459 ASP F H    1  
ATOM 9953   H HA   . ASP F 2 10  ? 0.484   8.352   -26.416 1.00 61.22 ? 459 ASP F HA   1  
ATOM 9954   H HB2  . ASP F 2 10  ? 1.050   8.330   -28.829 1.00 13.10 ? 459 ASP F HB2  1  
ATOM 9955   H HB3  . ASP F 2 10  ? -0.655  8.371   -29.255 1.00 21.54 ? 459 ASP F HB3  1  
ATOM 9956   N N    . LEU F 2 11  ? -1.683  9.139   -25.450 1.00 72.30 ? 460 LEU F N    1  
ATOM 9957   C CA   . LEU F 2 11  ? -2.920  9.626   -24.801 1.00 45.13 ? 460 LEU F CA   1  
ATOM 9958   C C    . LEU F 2 11  ? -3.182  11.113  -25.120 1.00 35.45 ? 460 LEU F C    1  
ATOM 9959   O O    . LEU F 2 11  ? -2.510  11.719  -25.958 1.00 31.32 ? 460 LEU F O    1  
ATOM 9960   C CB   . LEU F 2 11  ? -2.861  9.372   -23.254 1.00 2.11  ? 460 LEU F CB   1  
ATOM 9961   C CG   . LEU F 2 11  ? -3.301  7.954   -22.754 1.00 15.40 ? 460 LEU F CG   1  
ATOM 9962   C CD1  . LEU F 2 11  ? -4.794  7.676   -23.072 1.00 54.40 ? 460 LEU F CD1  1  
ATOM 9963   C CD2  . LEU F 2 11  ? -2.390  6.845   -23.317 1.00 31.01 ? 460 LEU F CD2  1  
ATOM 9964   H H    . LEU F 2 11  ? -0.836  9.253   -24.974 1.00 40.12 ? 460 LEU F H    1  
ATOM 9965   H HA   . LEU F 2 11  ? -3.754  9.057   -25.206 1.00 75.33 ? 460 LEU F HA   1  
ATOM 9966   H HB2  . LEU F 2 11  ? -1.842  9.548   -22.922 1.00 15.34 ? 460 LEU F HB2  1  
ATOM 9967   H HB3  . LEU F 2 11  ? -3.494  10.106  -22.757 1.00 30.40 ? 460 LEU F HB3  1  
ATOM 9968   H HG   . LEU F 2 11  ? -3.204  7.929   -21.673 1.00 0.01  ? 460 LEU F HG   1  
ATOM 9969   H HD11 . LEU F 2 11  ? -5.078  6.710   -22.671 1.00 43.34 ? 460 LEU F HD11 1  
ATOM 9970   H HD12 . LEU F 2 11  ? -4.955  7.675   -24.143 1.00 13.31 ? 460 LEU F HD12 1  
ATOM 9971   H HD13 . LEU F 2 11  ? -5.412  8.441   -22.619 1.00 62.33 ? 460 LEU F HD13 1  
ATOM 9972   H HD21 . LEU F 2 11  ? -2.687  5.883   -22.912 1.00 32.21 ? 460 LEU F HD21 1  
ATOM 9973   H HD22 . LEU F 2 11  ? -1.364  7.039   -23.033 1.00 71.01 ? 460 LEU F HD22 1  
ATOM 9974   H HD23 . LEU F 2 11  ? -2.460  6.813   -24.398 1.00 14.22 ? 460 LEU F HD23 1  
ATOM 9975   N N    . PHE F 2 12  ? -4.158  11.689  -24.403 1.00 75.32 ? 461 PHE F N    1  
ATOM 9976   C CA   . PHE F 2 12  ? -4.741  13.016  -24.690 1.00 75.32 ? 461 PHE F CA   1  
ATOM 9977   C C    . PHE F 2 12  ? -4.868  13.872  -23.406 1.00 23.55 ? 461 PHE F C    1  
ATOM 9978   O O    . PHE F 2 12  ? -5.561  14.900  -23.411 1.00 10.33 ? 461 PHE F O    1  
ATOM 9979   C CB   . PHE F 2 12  ? -6.138  12.791  -25.358 1.00 13.24 ? 461 PHE F CB   1  
ATOM 9980   C CG   . PHE F 2 12  ? -6.939  11.624  -24.745 1.00 32.21 ? 461 PHE F CG   1  
ATOM 9981   C CD1  . PHE F 2 12  ? -7.058  10.405  -25.422 1.00 52.25 ? 461 PHE F CD1  1  
ATOM 9982   C CD2  . PHE F 2 12  ? -7.526  11.732  -23.485 1.00 4.13  ? 461 PHE F CD2  1  
ATOM 9983   C CE1  . PHE F 2 12  ? -7.737  9.343   -24.859 1.00 60.54 ? 461 PHE F CE1  1  
ATOM 9984   C CE2  . PHE F 2 12  ? -8.208  10.669  -22.925 1.00 5.00  ? 461 PHE F CE2  1  
ATOM 9985   C CZ   . PHE F 2 12  ? -8.314  9.474   -23.610 1.00 41.23 ? 461 PHE F CZ   1  
ATOM 9986   H H    . PHE F 2 12  ? -4.531  11.190  -23.647 1.00 63.31 ? 461 PHE F H    1  
ATOM 9987   H HA   . PHE F 2 12  ? -4.094  13.543  -25.388 1.00 52.10 ? 461 PHE F HA   1  
ATOM 9988   H HB2  . PHE F 2 12  ? -6.733  13.692  -25.268 1.00 64.21 ? 461 PHE F HB2  1  
ATOM 9989   H HB3  . PHE F 2 12  ? -5.990  12.583  -26.413 1.00 1.34  ? 461 PHE F HB3  1  
ATOM 9990   H HD1  . PHE F 2 12  ? -6.609  10.295  -26.402 1.00 45.11 ? 461 PHE F HD1  1  
ATOM 9991   H HD2  . PHE F 2 12  ? -7.448  12.665  -22.941 1.00 45.32 ? 461 PHE F HD2  1  
ATOM 9992   H HE1  . PHE F 2 12  ? -7.822  8.405   -25.398 1.00 3.41  ? 461 PHE F HE1  1  
ATOM 9993   H HE2  . PHE F 2 12  ? -8.663  10.774  -21.946 1.00 22.31 ? 461 PHE F HE2  1  
ATOM 9994   H HZ   . PHE F 2 12  ? -8.850  8.641   -23.171 1.00 14.13 ? 461 PHE F HZ   1  
ATOM 9995   N N    . TYR F 2 13  ? -4.192  13.444  -22.320 1.00 15.14 ? 462 TYR F N    1  
ATOM 9996   C CA   . TYR F 2 13  ? -4.323  14.086  -20.996 1.00 63.10 ? 462 TYR F CA   1  
ATOM 9997   C C    . TYR F 2 13  ? -3.601  15.462  -20.978 1.00 65.31 ? 462 TYR F C    1  
ATOM 9998   O O    . TYR F 2 13  ? -2.379  15.548  -21.113 1.00 61.54 ? 462 TYR F O    1  
ATOM 9999   C CB   . TYR F 2 13  ? -3.821  13.137  -19.861 1.00 70.43 ? 462 TYR F CB   1  
ATOM 10000  C CG   . TYR F 2 13  ? -2.311  12.823  -19.877 1.00 25.52 ? 462 TYR F CG   1  
ATOM 10001  C CD1  . TYR F 2 13  ? -1.767  11.931  -20.801 1.00 11.11 ? 462 TYR F CD1  1  
ATOM 10002  C CD2  . TYR F 2 13  ? -1.434  13.435  -18.972 1.00 12.10 ? 462 TYR F CD2  1  
ATOM 10003  C CE1  . TYR F 2 13  ? -0.415  11.667  -20.828 1.00 40.22 ? 462 TYR F CE1  1  
ATOM 10004  C CE2  . TYR F 2 13  ? -0.083  13.167  -18.996 1.00 30.32 ? 462 TYR F CE2  1  
ATOM 10005  C CZ   . TYR F 2 13  ? 0.421   12.288  -19.924 1.00 1.52  ? 462 TYR F CZ   1  
ATOM 10006  O OH   . TYR F 2 13  ? 1.765   12.036  -19.953 1.00 62.30 ? 462 TYR F OH   1  
ATOM 10007  H H    . TYR F 2 13  ? -3.574  12.694  -22.418 1.00 54.42 ? 462 TYR F H    1  
ATOM 10008  H HA   . TYR F 2 13  ? -5.387  14.258  -20.836 1.00 55.13 ? 462 TYR F HA   1  
ATOM 10009  H HB2  . TYR F 2 13  ? -4.060  13.585  -18.902 1.00 55.14 ? 462 TYR F HB2  1  
ATOM 10010  H HB3  . TYR F 2 13  ? -4.354  12.197  -19.935 1.00 4.00  ? 462 TYR F HB3  1  
ATOM 10011  H HD1  . TYR F 2 13  ? -2.421  11.444  -21.514 1.00 34.44 ? 462 TYR F HD1  1  
ATOM 10012  H HD2  . TYR F 2 13  ? -1.829  14.128  -18.239 1.00 51.30 ? 462 TYR F HD2  1  
ATOM 10013  H HE1  . TYR F 2 13  ? -0.018  10.958  -21.548 1.00 24.34 ? 462 TYR F HE1  1  
ATOM 10014  H HE2  . TYR F 2 13  ? 0.577   13.653  -18.287 1.00 11.20 ? 462 TYR F HE2  1  
ATOM 10015  H HH   . TYR F 2 13  ? 2.081   12.087  -20.857 1.00 64.31 ? 462 TYR F HH   1  
ATOM 10016  N N    . THR F 2 14  ? -4.391  16.536  -20.863 1.00 11.23 ? 463 THR F N    1  
ATOM 10017  C CA   . THR F 2 14  ? -3.902  17.925  -20.824 1.00 53.22 ? 463 THR F CA   1  
ATOM 10018  C C    . THR F 2 14  ? -4.454  18.632  -19.567 1.00 51.02 ? 463 THR F C    1  
ATOM 10019  O O    . THR F 2 14  ? -5.631  18.457  -19.218 1.00 13.21 ? 463 THR F O    1  
ATOM 10020  C CB   . THR F 2 14  ? -4.336  18.687  -22.124 1.00 12.21 ? 463 THR F CB   1  
ATOM 10021  O OG1  . THR F 2 14  ? -5.740  18.472  -22.369 1.00 42.25 ? 463 THR F OG1  1  
ATOM 10022  C CG2  . THR F 2 14  ? -3.530  18.245  -23.364 1.00 34.53 ? 463 THR F CG2  1  
ATOM 10023  H H    . THR F 2 14  ? -5.352  16.395  -20.809 1.00 53.55 ? 463 THR F H    1  
ATOM 10024  H HA   . THR F 2 14  ? -2.813  17.915  -20.772 1.00 44.12 ? 463 THR F HA   1  
ATOM 10025  H HB   . THR F 2 14  ? -4.175  19.752  -21.976 1.00 5.25  ? 463 THR F HB   1  
ATOM 10026  H HG1  . THR F 2 14  ? -5.875  17.565  -22.674 1.00 31.03 ? 463 THR F HG1  1  
ATOM 10027  H HG21 . THR F 2 14  ? -3.855  18.808  -24.230 1.00 63.05 ? 463 THR F HG21 1  
ATOM 10028  H HG22 . THR F 2 14  ? -3.688  17.190  -23.546 1.00 34.53 ? 463 THR F HG22 1  
ATOM 10029  H HG23 . THR F 2 14  ? -2.475  18.424  -23.199 1.00 13.42 ? 463 THR F HG23 1  
ATOM 10030  N N    . MET F 2 15  ? -3.590  19.416  -18.895 1.00 63.12 ? 464 MET F N    1  
ATOM 10031  C CA   . MET F 2 15  ? -3.929  20.118  -17.642 1.00 75.01 ? 464 MET F CA   1  
ATOM 10032  C C    . MET F 2 15  ? -3.087  21.400  -17.523 1.00 42.15 ? 464 MET F C    1  
ATOM 10033  O O    . MET F 2 15  ? -1.852  21.338  -17.557 1.00 15.12 ? 464 MET F O    1  
ATOM 10034  C CB   . MET F 2 15  ? -3.661  19.189  -16.417 1.00 13.51 ? 464 MET F CB   1  
ATOM 10035  C CG   . MET F 2 15  ? -4.002  19.803  -15.045 1.00 20.14 ? 464 MET F CG   1  
ATOM 10036  S SD   . MET F 2 15  ? -3.568  18.733  -13.649 1.00 40.23 ? 464 MET F SD   1  
ATOM 10037  C CE   . MET F 2 15  ? -4.576  17.273  -13.945 1.00 23.35 ? 464 MET F CE   1  
ATOM 10038  H H    . MET F 2 15  ? -2.686  19.526  -19.254 1.00 32.11 ? 464 MET F H    1  
ATOM 10039  H HA   . MET F 2 15  ? -4.984  20.384  -17.669 1.00 42.21 ? 464 MET F HA   1  
ATOM 10040  H HB2  . MET F 2 15  ? -4.251  18.289  -16.535 1.00 32.34 ? 464 MET F HB2  1  
ATOM 10041  H HB3  . MET F 2 15  ? -2.612  18.909  -16.410 1.00 42.14 ? 464 MET F HB3  1  
ATOM 10042  H HG2  . MET F 2 15  ? -3.461  20.736  -14.933 1.00 23.03 ? 464 MET F HG2  1  
ATOM 10043  H HG3  . MET F 2 15  ? -5.066  20.010  -15.005 1.00 43.31 ? 464 MET F HG3  1  
ATOM 10044  H HE1  . MET F 2 15  ? -4.413  16.560  -13.151 1.00 34.22 ? 464 MET F HE1  1  
ATOM 10045  H HE2  . MET F 2 15  ? -4.299  16.827  -14.889 1.00 14.12 ? 464 MET F HE2  1  
ATOM 10046  H HE3  . MET F 2 15  ? -5.619  17.551  -13.969 1.00 73.44 ? 464 MET F HE3  1  
ATOM 10047  N N    . LYS F 2 16  ? -3.761  22.559  -17.402 1.00 61.10 ? 465 LYS F N    1  
ATOM 10048  C CA   . LYS F 2 16  ? -3.105  23.840  -17.100 1.00 61.45 ? 465 LYS F CA   1  
ATOM 10049  C C    . LYS F 2 16  ? -2.950  23.961  -15.566 1.00 54.24 ? 465 LYS F C    1  
ATOM 10050  O O    . LYS F 2 16  ? -3.699  24.692  -14.899 1.00 64.15 ? 465 LYS F O    1  
ATOM 10051  C CB   . LYS F 2 16  ? -3.912  25.037  -17.696 1.00 11.01 ? 465 LYS F CB   1  
ATOM 10052  C CG   . LYS F 2 16  ? -3.252  26.419  -17.476 1.00 43.51 ? 465 LYS F CG   1  
ATOM 10053  C CD   . LYS F 2 16  ? -4.152  27.602  -17.892 1.00 41.43 ? 465 LYS F CD   1  
ATOM 10054  C CE   . LYS F 2 16  ? -3.491  28.955  -17.587 1.00 30.12 ? 465 LYS F CE   1  
ATOM 10055  N NZ   . LYS F 2 16  ? -4.361  30.104  -17.945 1.00 43.44 ? 465 LYS F NZ   1  
ATOM 10056  H H    . LYS F 2 16  ? -4.732  22.546  -17.508 1.00 23.23 ? 465 LYS F H    1  
ATOM 10057  H HA   . LYS F 2 16  ? -2.112  23.830  -17.550 1.00 33.41 ? 465 LYS F HA   1  
ATOM 10058  H HB2  . LYS F 2 16  ? -4.029  24.882  -18.766 1.00 74.43 ? 465 LYS F HB2  1  
ATOM 10059  H HB3  . LYS F 2 16  ? -4.897  25.051  -17.243 1.00 62.02 ? 465 LYS F HB3  1  
ATOM 10060  H HG2  . LYS F 2 16  ? -3.011  26.522  -16.420 1.00 54.04 ? 465 LYS F HG2  1  
ATOM 10061  H HG3  . LYS F 2 16  ? -2.329  26.459  -18.047 1.00 32.10 ? 465 LYS F HG3  1  
ATOM 10062  H HD2  . LYS F 2 16  ? -4.355  27.541  -18.957 1.00 1.40  ? 465 LYS F HD2  1  
ATOM 10063  H HD3  . LYS F 2 16  ? -5.090  27.540  -17.348 1.00 14.35 ? 465 LYS F HD3  1  
ATOM 10064  H HE2  . LYS F 2 16  ? -3.270  29.011  -16.529 1.00 60.43 ? 465 LYS F HE2  1  
ATOM 10065  H HE3  . LYS F 2 16  ? -2.567  29.033  -18.148 1.00 33.52 ? 465 LYS F HE3  1  
ATOM 10066  H HZ1  . LYS F 2 16  ? -4.582  30.083  -18.963 1.00 3.24  ? 465 LYS F HZ1  1  
ATOM 10067  H HZ2  . LYS F 2 16  ? -3.883  31.001  -17.727 1.00 75.05 ? 465 LYS F HZ2  1  
ATOM 10068  H HZ3  . LYS F 2 16  ? -5.253  30.061  -17.412 1.00 72.44 ? 465 LYS F HZ3  1  
ATOM 10069  N N    . ALA F 2 17  ? -2.011  23.159  -15.027 1.00 43.20 ? 466 ALA F N    1  
ATOM 10070  C CA   . ALA F 2 17  ? -1.689  23.086  -13.586 1.00 1.53  ? 466 ALA F CA   1  
ATOM 10071  C C    . ALA F 2 17  ? -0.569  22.056  -13.354 1.00 2.51  ? 466 ALA F C    1  
ATOM 10072  O O    . ALA F 2 17  ? -0.046  21.455  -14.305 1.00 61.43 ? 466 ALA F O    1  
ATOM 10073  C CB   . ALA F 2 17  ? -2.930  22.722  -12.727 1.00 74.50 ? 466 ALA F CB   1  
ATOM 10074  H H    . ALA F 2 17  ? -1.503  22.577  -15.634 1.00 22.33 ? 466 ALA F H    1  
ATOM 10075  H HA   . ALA F 2 17  ? -1.328  24.064  -13.275 1.00 2.15  ? 466 ALA F HA   1  
ATOM 10076  H HB1  . ALA F 2 17  ? -3.705  23.460  -12.883 1.00 44.41 ? 466 ALA F HB1  1  
ATOM 10077  H HB2  . ALA F 2 17  ? -2.662  22.705  -11.680 1.00 30.51 ? 466 ALA F HB2  1  
ATOM 10078  H HB3  . ALA F 2 17  ? -3.306  21.746  -13.016 1.00 2.13  ? 466 ALA F HB3  1  
ATOM 10079  N N    . ALA F 2 18  ? -0.210  21.874  -12.077 1.00 22.01 ? 467 ALA F N    1  
ATOM 10080  C CA   . ALA F 2 18  ? 0.748   20.853  -11.624 1.00 62.12 ? 467 ALA F CA   1  
ATOM 10081  C C    . ALA F 2 18  ? 0.174   20.127  -10.392 1.00 22.11 ? 467 ALA F C    1  
ATOM 10082  O O    . ALA F 2 18  ? -1.013  20.291  -10.076 1.00 34.03 ? 467 ALA F O    1  
ATOM 10083  C CB   . ALA F 2 18  ? 2.103   21.520  -11.330 1.00 15.42 ? 467 ALA F CB   1  
ATOM 10084  H H    . ALA F 2 18  ? -0.609  22.458  -11.398 1.00 40.10 ? 467 ALA F H    1  
ATOM 10085  H HA   . ALA F 2 18  ? 0.888   20.119  -12.419 1.00 21.13 ? 467 ALA F HA   1  
ATOM 10086  H HB1  . ALA F 2 18  ? 2.811   20.774  -10.988 1.00 53.42 ? 467 ALA F HB1  1  
ATOM 10087  H HB2  . ALA F 2 18  ? 1.985   22.276  -10.560 1.00 44.42 ? 467 ALA F HB2  1  
ATOM 10088  H HB3  . ALA F 2 18  ? 2.484   21.987  -12.228 1.00 12.25 ? 467 ALA F HB3  1  
ATOM 10089  N N    . LEU F 2 19  ? 1.012   19.311  -9.714  1.00 25.25 ? 468 LEU F N    1  
ATOM 10090  C CA   . LEU F 2 19  ? 0.604   18.571  -8.494  1.00 54.10 ? 468 LEU F CA   1  
ATOM 10091  C C    . LEU F 2 19  ? 0.289   19.560  -7.349  1.00 50.33 ? 468 LEU F C    1  
ATOM 10092  O O    . LEU F 2 19  ? -0.637  19.337  -6.557  1.00 4.34  ? 468 LEU F O    1  
ATOM 10093  C CB   . LEU F 2 19  ? 1.720   17.546  -8.086  1.00 23.13 ? 468 LEU F CB   1  
ATOM 10094  C CG   . LEU F 2 19  ? 1.352   16.464  -6.989  1.00 62.14 ? 468 LEU F CG   1  
ATOM 10095  C CD1  . LEU F 2 19  ? 2.215   15.194  -7.143  1.00 13.44 ? 468 LEU F CD1  1  
ATOM 10096  C CD2  . LEU F 2 19  ? 1.471   17.002  -5.536  1.00 23.30 ? 468 LEU F CD2  1  
ATOM 10097  H H    . LEU F 2 19  ? 1.928   19.203  -10.044 1.00 32.04 ? 468 LEU F H    1  
ATOM 10098  H HA   . LEU F 2 19  ? -0.302  18.020  -8.737  1.00 51.55 ? 468 LEU F HA   1  
ATOM 10099  H HB2  . LEU F 2 19  ? 2.015   17.023  -8.990  1.00 41.02 ? 468 LEU F HB2  1  
ATOM 10100  H HB3  . LEU F 2 19  ? 2.584   18.106  -7.738  1.00 74.53 ? 468 LEU F HB3  1  
ATOM 10101  H HG   . LEU F 2 19  ? 0.320   16.161  -7.134  1.00 11.11 ? 468 LEU F HG   1  
ATOM 10102  H HD11 . LEU F 2 19  ? 3.263   15.439  -7.003  1.00 53.44 ? 468 LEU F HD11 1  
ATOM 10103  H HD12 . LEU F 2 19  ? 2.078   14.784  -8.135  1.00 53.44 ? 468 LEU F HD12 1  
ATOM 10104  H HD13 . LEU F 2 19  ? 1.917   14.454  -6.413  1.00 12.33 ? 468 LEU F HD13 1  
ATOM 10105  H HD21 . LEU F 2 19  ? 2.488   17.327  -5.345  1.00 5.41  ? 468 LEU F HD21 1  
ATOM 10106  H HD22 . LEU F 2 19  ? 1.207   16.224  -4.831  1.00 51.22 ? 468 LEU F HD22 1  
ATOM 10107  H HD23 . LEU F 2 19  ? 0.800   17.839  -5.403  1.00 45.43 ? 468 LEU F HD23 1  
ATOM 10108  N N    . GLY F 2 20  ? 1.062   20.660  -7.301  1.00 72.10 ? 469 GLY F N    1  
ATOM 10109  C CA   . GLY F 2 20  ? 0.972   21.648  -6.225  1.00 62.24 ? 469 GLY F CA   1  
ATOM 10110  C C    . GLY F 2 20  ? 1.951   21.323  -5.112  1.00 31.45 ? 469 GLY F C    1  
ATOM 10111  O O    . GLY F 2 20  ? 1.563   21.185  -3.943  1.00 52.32 ? 469 GLY F O    1  
ATOM 10112  H H    . GLY F 2 20  ? 1.713   20.801  -8.017  1.00 2.12  ? 469 GLY F H    1  
ATOM 10113  H HA2  . GLY F 2 20  ? 1.210   22.622  -6.631  1.00 3.33  ? 469 GLY F HA2  1  
ATOM 10114  H HA3  . GLY F 2 20  ? -0.037  21.677  -5.823  1.00 44.42 ? 469 GLY F HA3  1  
ATOM 10115  N N    . LEU F 2 21  ? 3.235   21.183  -5.506  1.00 34.33 ? 470 LEU F N    1  
ATOM 10116  C CA   . LEU F 2 21  ? 4.338   20.836  -4.598  1.00 51.30 ? 470 LEU F CA   1  
ATOM 10117  C C    . LEU F 2 21  ? 4.606   21.976  -3.602  1.00 44.40 ? 470 LEU F C    1  
ATOM 10118  O O    . LEU F 2 21  ? 5.282   22.963  -3.924  1.00 74.50 ? 470 LEU F O    1  
ATOM 10119  C CB   . LEU F 2 21  ? 5.625   20.504  -5.399  1.00 41.24 ? 470 LEU F CB   1  
ATOM 10120  C CG   . LEU F 2 21  ? 5.584   19.231  -6.302  1.00 63.31 ? 470 LEU F CG   1  
ATOM 10121  C CD1  . LEU F 2 21  ? 6.939   19.021  -7.005  1.00 14.42 ? 470 LEU F CD1  1  
ATOM 10122  C CD2  . LEU F 2 21  ? 5.173   17.976  -5.496  1.00 70.25 ? 470 LEU F CD2  1  
ATOM 10123  H H    . LEU F 2 21  ? 3.443   21.329  -6.449  1.00 72.44 ? 470 LEU F H    1  
ATOM 10124  H HA   . LEU F 2 21  ? 4.040   19.950  -4.044  1.00 11.44 ? 470 LEU F HA   1  
ATOM 10125  H HB2  . LEU F 2 21  ? 5.851   21.356  -6.034  1.00 11.05 ? 470 LEU F HB2  1  
ATOM 10126  H HB3  . LEU F 2 21  ? 6.444   20.389  -4.697  1.00 22.21 ? 470 LEU F HB3  1  
ATOM 10127  H HG   . LEU F 2 21  ? 4.840   19.377  -7.077  1.00 11.03 ? 470 LEU F HG   1  
ATOM 10128  H HD11 . LEU F 2 21  ? 7.721   18.862  -6.265  1.00 2.14  ? 470 LEU F HD11 1  
ATOM 10129  H HD12 . LEU F 2 21  ? 7.183   19.893  -7.596  1.00 5.40  ? 470 LEU F HD12 1  
ATOM 10130  H HD13 . LEU F 2 21  ? 6.886   18.154  -7.653  1.00 72.23 ? 470 LEU F HD13 1  
ATOM 10131  H HD21 . LEU F 2 21  ? 5.874   17.809  -4.685  1.00 51.13 ? 470 LEU F HD21 1  
ATOM 10132  H HD22 . LEU F 2 21  ? 5.167   17.111  -6.145  1.00 12.53 ? 470 LEU F HD22 1  
ATOM 10133  H HD23 . LEU F 2 21  ? 4.181   18.115  -5.088  1.00 50.03 ? 470 LEU F HD23 1  
ATOM 10134  N N    . LYS F 2 22  ? 4.010   21.847  -2.417  1.00 73.30 ? 471 LYS F N    1  
ATOM 10135  C CA   . LYS F 2 22  ? 4.205   22.768  -1.297  1.00 40.13 ? 471 LYS F CA   1  
ATOM 10136  C C    . LYS F 2 22  ? 5.137   22.083  -0.261  1.00 33.23 ? 471 LYS F C    1  
ATOM 10137  O O    . LYS F 2 22  ? 4.644   21.329  0.605   1.00 12.12 ? 471 LYS F O    1  
ATOM 10138  C CB   . LYS F 2 22  ? 2.814   23.138  -0.704  1.00 74.45 ? 471 LYS F CB   1  
ATOM 10139  C CG   . LYS F 2 22  ? 2.854   24.142  0.474   1.00 1.53  ? 471 LYS F CG   1  
ATOM 10140  C CD   . LYS F 2 22  ? 1.445   24.434  1.041   1.00 22.42 ? 471 LYS F CD   1  
ATOM 10141  C CE   . LYS F 2 22  ? 1.471   25.323  2.294   1.00 60.20 ? 471 LYS F CE   1  
ATOM 10142  N NZ   . LYS F 2 22  ? 0.098   25.585  2.802   1.00 4.32  ? 471 LYS F NZ   1  
ATOM 10143  O OXT  . LYS F 2 22  ? 6.365   22.263  -0.354  1.00 37.65 ? 471 LYS F OXT  1  
ATOM 10144  H H    . LYS F 2 22  ? 3.401   21.091  -2.287  1.00 44.22 ? 471 LYS F H    1  
ATOM 10145  H HA   . LYS F 2 22  ? 4.681   23.676  -1.667  1.00 63.04 ? 471 LYS F HA   1  
ATOM 10146  H HB2  . LYS F 2 22  ? 2.204   23.564  -1.496  1.00 42.13 ? 471 LYS F HB2  1  
ATOM 10147  H HB3  . LYS F 2 22  ? 2.337   22.227  -0.359  1.00 13.54 ? 471 LYS F HB3  1  
ATOM 10148  H HG2  . LYS F 2 22  ? 3.475   23.724  1.263   1.00 40.23 ? 471 LYS F HG2  1  
ATOM 10149  H HG3  . LYS F 2 22  ? 3.301   25.072  0.132   1.00 70.25 ? 471 LYS F HG3  1  
ATOM 10150  H HD2  . LYS F 2 22  ? 0.853   24.931  0.279   1.00 73.44 ? 471 LYS F HD2  1  
ATOM 10151  H HD3  . LYS F 2 22  ? 0.966   23.491  1.296   1.00 10.40 ? 471 LYS F HD3  1  
ATOM 10152  H HE2  . LYS F 2 22  ? 2.043   24.831  3.069   1.00 73.12 ? 471 LYS F HE2  1  
ATOM 10153  H HE3  . LYS F 2 22  ? 1.936   26.271  2.052   1.00 11.23 ? 471 LYS F HE3  1  
ATOM 10154  H HZ1  . LYS F 2 22  ? -0.455  26.106  2.093   1.00 14.12 ? 471 LYS F HZ1  1  
ATOM 10155  H HZ2  . LYS F 2 22  ? 0.138   26.149  3.674   1.00 11.30 ? 471 LYS F HZ2  1  
ATOM 10156  H HZ3  . LYS F 2 22  ? -0.389  24.690  3.009   1.00 60.34 ? 471 LYS F HZ3  1  
ATOM 10157  N N    . ASN G 2 1   ? 3.547   -27.133 24.297  1.00 21.42 ? 450 ASN G N    1  
ATOM 10158  C CA   . ASN G 2 1   ? 4.519   -27.753 25.219  1.00 75.14 ? 450 ASN G CA   1  
ATOM 10159  C C    . ASN G 2 1   ? 5.433   -26.679 25.827  1.00 73.12 ? 450 ASN G C    1  
ATOM 10160  O O    . ASN G 2 1   ? 5.843   -26.790 26.984  1.00 61.44 ? 450 ASN G O    1  
ATOM 10161  C CB   . ASN G 2 1   ? 5.369   -28.829 24.483  1.00 53.14 ? 450 ASN G CB   1  
ATOM 10162  C CG   . ASN G 2 1   ? 4.531   -29.943 23.835  1.00 42.25 ? 450 ASN G CG   1  
ATOM 10163  O OD1  . ASN G 2 1   ? 3.424   -29.714 23.347  1.00 60.32 ? 450 ASN G OD1  1  
ATOM 10164  N ND2  . ASN G 2 1   ? 5.048   -31.165 23.835  1.00 44.11 ? 450 ASN G ND2  1  
ATOM 10165  H H1   . ASN G 2 1   ? 4.043   -26.665 23.518  1.00 37.65 ? 450 ASN G H1   1  
ATOM 10166  H H2   . ASN G 2 1   ? 2.982   -26.423 24.798  1.00 37.65 ? 450 ASN G H2   1  
ATOM 10167  H H3   . ASN G 2 1   ? 2.901   -27.847 23.904  1.00 37.65 ? 450 ASN G H3   1  
ATOM 10168  H HA   . ASN G 2 1   ? 3.958   -28.228 26.019  1.00 21.20 ? 450 ASN G HA   1  
ATOM 10169  H HB2  . ASN G 2 1   ? 5.945   -28.352 23.697  1.00 51.23 ? 450 ASN G HB2  1  
ATOM 10170  H HB3  . ASN G 2 1   ? 6.057   -29.283 25.191  1.00 72.44 ? 450 ASN G HB3  1  
ATOM 10171  H HD21 . ASN G 2 1   ? 5.925   -31.297 24.250  1.00 51.15 ? 450 ASN G HD21 1  
ATOM 10172  H HD22 . ASN G 2 1   ? 4.529   -31.886 23.419  1.00 61.10 ? 450 ASN G HD22 1  
ATOM 10173  N N    . VAL G 2 2   ? 5.743   -25.641 25.031  1.00 44.13 ? 451 VAL G N    1  
ATOM 10174  C CA   . VAL G 2 2   ? 6.699   -24.581 25.396  1.00 0.44  ? 451 VAL G CA   1  
ATOM 10175  C C    . VAL G 2 2   ? 5.965   -23.319 25.904  1.00 14.53 ? 451 VAL G C    1  
ATOM 10176  O O    . VAL G 2 2   ? 6.100   -22.936 27.073  1.00 14.50 ? 451 VAL G O    1  
ATOM 10177  C CB   . VAL G 2 2   ? 7.609   -24.219 24.151  1.00 54.41 ? 451 VAL G CB   1  
ATOM 10178  C CG1  . VAL G 2 2   ? 8.655   -23.133 24.491  1.00 24.33 ? 451 VAL G CG1  1  
ATOM 10179  C CG2  . VAL G 2 2   ? 8.284   -25.487 23.573  1.00 62.32 ? 451 VAL G CG2  1  
ATOM 10180  H H    . VAL G 2 2   ? 5.311   -25.580 24.156  1.00 42.14 ? 451 VAL G H    1  
ATOM 10181  H HA   . VAL G 2 2   ? 7.347   -24.954 26.193  1.00 14.31 ? 451 VAL G HA   1  
ATOM 10182  H HB   . VAL G 2 2   ? 6.963   -23.814 23.372  1.00 74.43 ? 451 VAL G HB   1  
ATOM 10183  H HG11 . VAL G 2 2   ? 9.309   -23.482 25.282  1.00 63.34 ? 451 VAL G HG11 1  
ATOM 10184  H HG12 . VAL G 2 2   ? 8.154   -22.229 24.816  1.00 51.11 ? 451 VAL G HG12 1  
ATOM 10185  H HG13 . VAL G 2 2   ? 9.247   -22.909 23.612  1.00 43.14 ? 451 VAL G HG13 1  
ATOM 10186  H HG21 . VAL G 2 2   ? 7.523   -26.200 23.277  1.00 63.24 ? 451 VAL G HG21 1  
ATOM 10187  H HG22 . VAL G 2 2   ? 8.921   -25.940 24.323  1.00 4.23  ? 451 VAL G HG22 1  
ATOM 10188  H HG23 . VAL G 2 2   ? 8.882   -25.226 22.708  1.00 11.22 ? 451 VAL G HG23 1  
ATOM 10189  N N    . VAL G 2 3   ? 5.178   -22.701 25.010  1.00 5.15  ? 452 VAL G N    1  
ATOM 10190  C CA   . VAL G 2 3   ? 4.621   -21.352 25.212  1.00 31.04 ? 452 VAL G CA   1  
ATOM 10191  C C    . VAL G 2 3   ? 3.199   -21.391 25.810  1.00 32.44 ? 452 VAL G C    1  
ATOM 10192  O O    . VAL G 2 3   ? 2.323   -22.106 25.312  1.00 71.04 ? 452 VAL G O    1  
ATOM 10193  C CB   . VAL G 2 3   ? 4.588   -20.566 23.852  1.00 73.42 ? 452 VAL G CB   1  
ATOM 10194  C CG1  . VAL G 2 3   ? 4.060   -19.129 24.048  1.00 65.41 ? 452 VAL G CG1  1  
ATOM 10195  C CG2  . VAL G 2 3   ? 5.982   -20.571 23.167  1.00 30.12 ? 452 VAL G CG2  1  
ATOM 10196  H H    . VAL G 2 3   ? 4.954   -23.171 24.182  1.00 1.24  ? 452 VAL G H    1  
ATOM 10197  H HA   . VAL G 2 3   ? 5.278   -20.809 25.895  1.00 13.03 ? 452 VAL G HA   1  
ATOM 10198  H HB   . VAL G 2 3   ? 3.896   -21.079 23.186  1.00 42.14 ? 452 VAL G HB   1  
ATOM 10199  H HG11 . VAL G 2 3   ? 4.737   -18.565 24.678  1.00 60.34 ? 452 VAL G HG11 1  
ATOM 10200  H HG12 . VAL G 2 3   ? 3.083   -19.157 24.516  1.00 25.11 ? 452 VAL G HG12 1  
ATOM 10201  H HG13 . VAL G 2 3   ? 3.972   -18.638 23.089  1.00 34.52 ? 452 VAL G HG13 1  
ATOM 10202  H HG21 . VAL G 2 3   ? 5.929   -20.054 22.218  1.00 71.54 ? 452 VAL G HG21 1  
ATOM 10203  H HG22 . VAL G 2 3   ? 6.297   -21.594 22.994  1.00 41.42 ? 452 VAL G HG22 1  
ATOM 10204  H HG23 . VAL G 2 3   ? 6.709   -20.080 23.803  1.00 52.32 ? 452 VAL G HG23 1  
ATOM 10205  N N    . GLY G 2 4   ? 2.988   -20.578 26.864  1.00 63.03 ? 453 GLY G N    1  
ATOM 10206  C CA   . GLY G 2 4   ? 1.673   -20.364 27.469  1.00 50.34 ? 453 GLY G CA   1  
ATOM 10207  C C    . GLY G 2 4   ? 1.436   -18.882 27.745  1.00 22.30 ? 453 GLY G C    1  
ATOM 10208  O O    . GLY G 2 4   ? 1.618   -18.420 28.879  1.00 3.21  ? 453 GLY G O    1  
ATOM 10209  H H    . GLY G 2 4   ? 3.760   -20.106 27.245  1.00 23.10 ? 453 GLY G H    1  
ATOM 10210  H HA2  . GLY G 2 4   ? 0.894   -20.732 26.807  1.00 33.21 ? 453 GLY G HA2  1  
ATOM 10211  H HA3  . GLY G 2 4   ? 1.623   -20.912 28.401  1.00 30.21 ? 453 GLY G HA3  1  
ATOM 10212  N N    . LEU G 2 5   ? 1.062   -18.136 26.682  1.00 33.53 ? 454 LEU G N    1  
ATOM 10213  C CA   . LEU G 2 5   ? 0.826   -16.672 26.748  1.00 44.43 ? 454 LEU G CA   1  
ATOM 10214  C C    . LEU G 2 5   ? -0.395  -16.319 27.611  1.00 55.51 ? 454 LEU G C    1  
ATOM 10215  O O    . LEU G 2 5   ? -1.475  -16.894 27.439  1.00 5.20  ? 454 LEU G O    1  
ATOM 10216  C CB   . LEU G 2 5   ? 0.623   -16.087 25.320  1.00 42.44 ? 454 LEU G CB   1  
ATOM 10217  C CG   . LEU G 2 5   ? 1.877   -16.074 24.406  1.00 64.11 ? 454 LEU G CG   1  
ATOM 10218  C CD1  . LEU G 2 5   ? 1.507   -15.657 22.969  1.00 71.11 ? 454 LEU G CD1  1  
ATOM 10219  C CD2  . LEU G 2 5   ? 2.987   -15.176 24.999  1.00 30.31 ? 454 LEU G CD2  1  
ATOM 10220  H H    . LEU G 2 5   ? 0.941   -18.586 25.822  1.00 55.05 ? 454 LEU G H    1  
ATOM 10221  H HA   . LEU G 2 5   ? 1.711   -16.219 27.184  1.00 41.24 ? 454 LEU G HA   1  
ATOM 10222  H HB2  . LEU G 2 5   ? -0.150  -16.669 24.826  1.00 43.11 ? 454 LEU G HB2  1  
ATOM 10223  H HB3  . LEU G 2 5   ? 0.263   -15.062 25.407  1.00 64.20 ? 454 LEU G HB3  1  
ATOM 10224  H HG   . LEU G 2 5   ? 2.275   -17.081 24.347  1.00 74.50 ? 454 LEU G HG   1  
ATOM 10225  H HD11 . LEU G 2 5   ? 0.785   -16.355 22.565  1.00 42.34 ? 454 LEU G HD11 1  
ATOM 10226  H HD12 . LEU G 2 5   ? 2.391   -15.671 22.351  1.00 53.04 ? 454 LEU G HD12 1  
ATOM 10227  H HD13 . LEU G 2 5   ? 1.082   -14.660 22.966  1.00 42.32 ? 454 LEU G HD13 1  
ATOM 10228  H HD21 . LEU G 2 5   ? 3.260   -15.538 25.981  1.00 13.33 ? 454 LEU G HD21 1  
ATOM 10229  H HD22 . LEU G 2 5   ? 2.637   -14.152 25.078  1.00 41.20 ? 454 LEU G HD22 1  
ATOM 10230  H HD23 . LEU G 2 5   ? 3.856   -15.205 24.358  1.00 14.33 ? 454 LEU G HD23 1  
ATOM 10231  N N    . THR G 2 6   ? -0.203  -15.363 28.529  1.00 22.41 ? 455 THR G N    1  
ATOM 10232  C CA   . THR G 2 6   ? -1.282  -14.765 29.321  1.00 24.50 ? 455 THR G CA   1  
ATOM 10233  C C    . THR G 2 6   ? -1.662  -13.395 28.710  1.00 53.02 ? 455 THR G C    1  
ATOM 10234  O O    . THR G 2 6   ? -2.692  -13.277 28.024  1.00 52.54 ? 455 THR G O    1  
ATOM 10235  C CB   . THR G 2 6   ? -0.850  -14.634 30.824  1.00 5.04  ? 455 THR G CB   1  
ATOM 10236  O OG1  . THR G 2 6   ? 0.421   -13.955 30.916  1.00 21.10 ? 455 THR G OG1  1  
ATOM 10237  C CG2  . THR G 2 6   ? -0.740  -16.007 31.515  1.00 35.50 ? 455 THR G CG2  1  
ATOM 10238  H H    . THR G 2 6   ? 0.711   -15.048 28.688  1.00 74.25 ? 455 THR G H    1  
ATOM 10239  H HA   . THR G 2 6   ? -2.157  -15.419 29.274  1.00 52.20 ? 455 THR G HA   1  
ATOM 10240  H HB   . THR G 2 6   ? -1.596  -14.045 31.349  1.00 62.31 ? 455 THR G HB   1  
ATOM 10241  H HG1  . THR G 2 6   ? 0.479   -13.497 31.762  1.00 75.41 ? 455 THR G HG1  1  
ATOM 10242  H HG21 . THR G 2 6   ? -0.431  -15.876 32.545  1.00 23.31 ? 455 THR G HG21 1  
ATOM 10243  H HG22 . THR G 2 6   ? -0.009  -16.618 31.000  1.00 23.32 ? 455 THR G HG22 1  
ATOM 10244  H HG23 . THR G 2 6   ? -1.701  -16.508 31.494  1.00 50.52 ? 455 THR G HG23 1  
ATOM 10245  N N    . ASP G 2 7   ? -0.783  -12.384 28.899  1.00 43.14 ? 456 ASP G N    1  
ATOM 10246  C CA   . ASP G 2 7   ? -1.023  -10.995 28.445  1.00 12.14 ? 456 ASP G CA   1  
ATOM 10247  C C    . ASP G 2 7   ? 0.297   -10.177 28.528  1.00 44.43 ? 456 ASP G C    1  
ATOM 10248  O O    . ASP G 2 7   ? 1.308   -10.679 29.034  1.00 70.33 ? 456 ASP G O    1  
ATOM 10249  C CB   . ASP G 2 7   ? -2.168  -10.343 29.293  1.00 72.23 ? 456 ASP G CB   1  
ATOM 10250  C CG   . ASP G 2 7   ? -2.714  -9.032  28.693  1.00 53.22 ? 456 ASP G CG   1  
ATOM 10251  O OD1  . ASP G 2 7   ? -3.438  -9.098  27.682  1.00 22.01 ? 456 ASP G OD1  1  
ATOM 10252  O OD2  . ASP G 2 7   ? -2.409  -7.937  29.215  1.00 51.45 ? 456 ASP G OD2  1  
ATOM 10253  H H    . ASP G 2 7   ? 0.066   -12.578 29.355  1.00 52.11 ? 456 ASP G H    1  
ATOM 10254  H HA   . ASP G 2 7   ? -1.329  -11.040 27.405  1.00 71.10 ? 456 ASP G HA   1  
ATOM 10255  H HB2  . ASP G 2 7   ? -2.993  -11.047 29.370  1.00 3.50  ? 456 ASP G HB2  1  
ATOM 10256  H HB3  . ASP G 2 7   ? -1.800  -10.148 30.296  1.00 11.51 ? 456 ASP G HB3  1  
ATOM 10257  N N    . GLN G 2 8   ? 0.279   -8.928  28.021  1.00 1.24  ? 457 GLN G N    1  
ATOM 10258  C CA   . GLN G 2 8   ? 1.455   -8.029  27.994  1.00 22.51 ? 457 GLN G CA   1  
ATOM 10259  C C    . GLN G 2 8   ? 0.938   -6.585  28.184  1.00 0.22  ? 457 GLN G C    1  
ATOM 10260  O O    . GLN G 2 8   ? 0.035   -6.175  27.457  1.00 40.42 ? 457 GLN G O    1  
ATOM 10261  C CB   . GLN G 2 8   ? 2.203   -8.197  26.626  1.00 54.40 ? 457 GLN G CB   1  
ATOM 10262  C CG   . GLN G 2 8   ? 3.721   -7.908  26.644  1.00 21.12 ? 457 GLN G CG   1  
ATOM 10263  C CD   . GLN G 2 8   ? 4.113   -6.510  27.109  1.00 14.34 ? 457 GLN G CD   1  
ATOM 10264  O OE1  . GLN G 2 8   ? 4.397   -6.291  28.288  1.00 2.42  ? 457 GLN G OE1  1  
ATOM 10265  N NE2  . GLN G 2 8   ? 4.094   -5.550  26.194  1.00 23.02 ? 457 GLN G NE2  1  
ATOM 10266  H H    . GLN G 2 8   ? -0.557  -8.591  27.634  1.00 33.02 ? 457 GLN G H    1  
ATOM 10267  H HA   . GLN G 2 8   ? 2.120   -8.288  28.817  1.00 62.11 ? 457 GLN G HA   1  
ATOM 10268  H HB2  . GLN G 2 8   ? 2.075   -9.224  26.292  1.00 3.22  ? 457 GLN G HB2  1  
ATOM 10269  H HB3  . GLN G 2 8   ? 1.747   -7.551  25.880  1.00 21.10 ? 457 GLN G HB3  1  
ATOM 10270  H HG2  . GLN G 2 8   ? 4.195   -8.626  27.303  1.00 54.01 ? 457 GLN G HG2  1  
ATOM 10271  H HG3  . GLN G 2 8   ? 4.110   -8.055  25.645  1.00 12.03 ? 457 GLN G HG3  1  
ATOM 10272  H HE21 . GLN G 2 8   ? 3.824   -5.785  25.278  1.00 11.50 ? 457 GLN G HE21 1  
ATOM 10273  H HE22 . GLN G 2 8   ? 4.351   -4.649  26.465  1.00 54.20 ? 457 GLN G HE22 1  
ATOM 10274  N N    . THR G 2 9   ? 1.506   -5.825  29.153  1.00 24.32 ? 458 THR G N    1  
ATOM 10275  C CA   . THR G 2 9   ? 1.013   -4.466  29.525  1.00 55.42 ? 458 THR G CA   1  
ATOM 10276  C C    . THR G 2 9   ? 2.153   -3.423  29.692  1.00 4.24  ? 458 THR G C    1  
ATOM 10277  O O    . THR G 2 9   ? 1.899   -2.318  30.201  1.00 75.04 ? 458 THR G O    1  
ATOM 10278  C CB   . THR G 2 9   ? 0.170   -4.520  30.861  1.00 22.32 ? 458 THR G CB   1  
ATOM 10279  O OG1  . THR G 2 9   ? 0.896   -5.246  31.872  1.00 43.04 ? 458 THR G OG1  1  
ATOM 10280  C CG2  . THR G 2 9   ? -1.217  -5.159  30.672  1.00 75.30 ? 458 THR G CG2  1  
ATOM 10281  H H    . THR G 2 9   ? 2.278   -6.188  29.637  1.00 10.33 ? 458 THR G H    1  
ATOM 10282  H HA   . THR G 2 9   ? 0.361   -4.107  28.734  1.00 33.23 ? 458 THR G HA   1  
ATOM 10283  H HB   . THR G 2 9   ? 0.023   -3.503  31.218  1.00 1.23  ? 458 THR G HB   1  
ATOM 10284  H HG1  . THR G 2 9   ? 1.480   -4.645  32.348  1.00 35.15 ? 458 THR G HG1  1  
ATOM 10285  H HG21 . THR G 2 9   ? -1.103  -6.183  30.339  1.00 35.32 ? 458 THR G HG21 1  
ATOM 10286  H HG22 . THR G 2 9   ? -1.779  -4.604  29.932  1.00 53.20 ? 458 THR G HG22 1  
ATOM 10287  H HG23 . THR G 2 9   ? -1.754  -5.147  31.611  1.00 12.55 ? 458 THR G HG23 1  
ATOM 10288  N N    . ASP G 2 10  ? 3.387   -3.749  29.266  1.00 61.42 ? 459 ASP G N    1  
ATOM 10289  C CA   . ASP G 2 10  ? 4.570   -2.865  29.486  1.00 40.34 ? 459 ASP G CA   1  
ATOM 10290  C C    . ASP G 2 10  ? 5.225   -2.463  28.153  1.00 33.12 ? 459 ASP G C    1  
ATOM 10291  O O    . ASP G 2 10  ? 5.625   -3.319  27.362  1.00 61.35 ? 459 ASP G O    1  
ATOM 10292  C CB   . ASP G 2 10  ? 5.631   -3.559  30.389  1.00 43.41 ? 459 ASP G CB   1  
ATOM 10293  C CG   . ASP G 2 10  ? 6.827   -2.628  30.725  1.00 54.45 ? 459 ASP G CG   1  
ATOM 10294  O OD1  . ASP G 2 10  ? 6.767   -1.912  31.749  1.00 53.55 ? 459 ASP G OD1  1  
ATOM 10295  O OD2  . ASP G 2 10  ? 7.818   -2.579  29.954  1.00 43.25 ? 459 ASP G OD2  1  
ATOM 10296  H H    . ASP G 2 10  ? 3.510   -4.581  28.776  1.00 30.22 ? 459 ASP G H    1  
ATOM 10297  H HA   . ASP G 2 10  ? 4.229   -1.957  29.993  1.00 75.32 ? 459 ASP G HA   1  
ATOM 10298  H HB2  . ASP G 2 10  ? 5.156   -3.867  31.317  1.00 1.34  ? 459 ASP G HB2  1  
ATOM 10299  H HB3  . ASP G 2 10  ? 6.007   -4.448  29.888  1.00 24.12 ? 459 ASP G HB3  1  
ATOM 10300  N N    . LEU G 2 11  ? 5.320   -1.140  27.915  1.00 11.41 ? 460 LEU G N    1  
ATOM 10301  C CA   . LEU G 2 11  ? 6.151   -0.559  26.837  1.00 4.34  ? 460 LEU G CA   1  
ATOM 10302  C C    . LEU G 2 11  ? 7.238   0.329   27.470  1.00 43.24 ? 460 LEU G C    1  
ATOM 10303  O O    . LEU G 2 11  ? 7.040   1.528   27.688  1.00 40.32 ? 460 LEU G O    1  
ATOM 10304  C CB   . LEU G 2 11  ? 5.308   0.235   25.782  1.00 20.51 ? 460 LEU G CB   1  
ATOM 10305  C CG   . LEU G 2 11  ? 4.616   -0.611  24.659  1.00 62.05 ? 460 LEU G CG   1  
ATOM 10306  C CD1  . LEU G 2 11  ? 5.653   -1.409  23.822  1.00 61.12 ? 460 LEU G CD1  1  
ATOM 10307  C CD2  . LEU G 2 11  ? 3.507   -1.528  25.226  1.00 32.14 ? 460 LEU G CD2  1  
ATOM 10308  H H    . LEU G 2 11  ? 4.816   -0.529  28.493  1.00 61.42 ? 460 LEU G H    1  
ATOM 10309  H HA   . LEU G 2 11  ? 6.653   -1.381  26.324  1.00 0.32  ? 460 LEU G HA   1  
ATOM 10310  H HB2  . LEU G 2 11  ? 4.543   0.797   26.310  1.00 65.43 ? 460 LEU G HB2  1  
ATOM 10311  H HB3  . LEU G 2 11  ? 5.960   0.955   25.293  1.00 43.13 ? 460 LEU G HB3  1  
ATOM 10312  H HG   . LEU G 2 11  ? 4.133   0.074   23.972  1.00 24.03 ? 460 LEU G HG   1  
ATOM 10313  H HD11 . LEU G 2 11  ? 5.146   -1.945  23.031  1.00 11.41 ? 460 LEU G HD11 1  
ATOM 10314  H HD12 . LEU G 2 11  ? 6.177   -2.119  24.453  1.00 15.43 ? 460 LEU G HD12 1  
ATOM 10315  H HD13 . LEU G 2 11  ? 6.370   -0.726  23.385  1.00 4.25  ? 460 LEU G HD13 1  
ATOM 10316  H HD21 . LEU G 2 11  ? 3.009   -2.045  24.417  1.00 15.03 ? 460 LEU G HD21 1  
ATOM 10317  H HD22 . LEU G 2 11  ? 2.782   -0.931  25.762  1.00 32.42 ? 460 LEU G HD22 1  
ATOM 10318  H HD23 . LEU G 2 11  ? 3.937   -2.257  25.904  1.00 64.34 ? 460 LEU G HD23 1  
ATOM 10319  N N    . PHE G 2 12  ? 8.344   -0.324  27.842  1.00 60.24 ? 461 PHE G N    1  
ATOM 10320  C CA   . PHE G 2 12  ? 9.596   0.318   28.307  1.00 51.30 ? 461 PHE G CA   1  
ATOM 10321  C C    . PHE G 2 12  ? 10.105  1.414   27.331  1.00 60.10 ? 461 PHE G C    1  
ATOM 10322  O O    . PHE G 2 12  ? 10.703  2.408   27.750  1.00 42.12 ? 461 PHE G O    1  
ATOM 10323  C CB   . PHE G 2 12  ? 10.684  -0.776  28.508  1.00 34.34 ? 461 PHE G CB   1  
ATOM 10324  C CG   . PHE G 2 12  ? 10.945  -1.626  27.256  1.00 34.33 ? 461 PHE G CG   1  
ATOM 10325  C CD1  . PHE G 2 12  ? 11.967  -1.302  26.364  1.00 41.40 ? 461 PHE G CD1  1  
ATOM 10326  C CD2  . PHE G 2 12  ? 10.131  -2.720  26.953  1.00 12.21 ? 461 PHE G CD2  1  
ATOM 10327  C CE1  . PHE G 2 12  ? 12.161  -2.038  25.218  1.00 22.20 ? 461 PHE G CE1  1  
ATOM 10328  C CE2  . PHE G 2 12  ? 10.335  -3.458  25.809  1.00 25.42 ? 461 PHE G CE2  1  
ATOM 10329  C CZ   . PHE G 2 12  ? 11.350  -3.115  24.938  1.00 34.53 ? 461 PHE G CZ   1  
ATOM 10330  H H    . PHE G 2 12  ? 8.311   -1.304  27.841  1.00 30.33 ? 461 PHE G H    1  
ATOM 10331  H HA   . PHE G 2 12  ? 9.388   0.780   29.263  1.00 73.21 ? 461 PHE G HA   1  
ATOM 10332  H HB2  . PHE G 2 12  ? 11.616  -0.306  28.807  1.00 2.13  ? 461 PHE G HB2  1  
ATOM 10333  H HB3  . PHE G 2 12  ? 10.366  -1.440  29.304  1.00 55.21 ? 461 PHE G HB3  1  
ATOM 10334  H HD1  . PHE G 2 12  ? 12.612  -0.459  26.577  1.00 3.31  ? 461 PHE G HD1  1  
ATOM 10335  H HD2  . PHE G 2 12  ? 9.332   -2.996  27.633  1.00 13.11 ? 461 PHE G HD2  1  
ATOM 10336  H HE1  . PHE G 2 12  ? 12.959  -1.773  24.538  1.00 0.14  ? 461 PHE G HE1  1  
ATOM 10337  H HE2  . PHE G 2 12  ? 9.698   -4.308  25.588  1.00 71.31 ? 461 PHE G HE2  1  
ATOM 10338  H HZ   . PHE G 2 12  ? 11.508  -3.692  24.033  1.00 62.31 ? 461 PHE G HZ   1  
ATOM 10339  N N    . TYR G 2 13  ? 9.875   1.202   26.025  1.00 41.40 ? 462 TYR G N    1  
ATOM 10340  C CA   . TYR G 2 13  ? 10.253  2.158   24.978  1.00 45.42 ? 462 TYR G CA   1  
ATOM 10341  C C    . TYR G 2 13  ? 9.225   3.308   24.939  1.00 25.11 ? 462 TYR G C    1  
ATOM 10342  O O    . TYR G 2 13  ? 8.109   3.145   24.427  1.00 44.14 ? 462 TYR G O    1  
ATOM 10343  C CB   . TYR G 2 13  ? 10.361  1.435   23.607  1.00 31.40 ? 462 TYR G CB   1  
ATOM 10344  C CG   . TYR G 2 13  ? 10.813  2.336   22.444  1.00 25.05 ? 462 TYR G CG   1  
ATOM 10345  C CD1  . TYR G 2 13  ? 12.006  3.058   22.514  1.00 0.01  ? 462 TYR G CD1  1  
ATOM 10346  C CD2  . TYR G 2 13  ? 10.055  2.460   21.280  1.00 3.32  ? 462 TYR G CD2  1  
ATOM 10347  C CE1  . TYR G 2 13  ? 12.421  3.863   21.472  1.00 31.34 ? 462 TYR G CE1  1  
ATOM 10348  C CE2  . TYR G 2 13  ? 10.471  3.268   20.237  1.00 52.24 ? 462 TYR G CE2  1  
ATOM 10349  C CZ   . TYR G 2 13  ? 11.652  3.965   20.339  1.00 2.03  ? 462 TYR G CZ   1  
ATOM 10350  O OH   . TYR G 2 13  ? 12.067  4.778   19.304  1.00 33.34 ? 462 TYR G OH   1  
ATOM 10351  H H    . TYR G 2 13  ? 9.434   0.369   25.760  1.00 64.12 ? 462 TYR G H    1  
ATOM 10352  H HA   . TYR G 2 13  ? 11.231  2.567   25.236  1.00 41.31 ? 462 TYR G HA   1  
ATOM 10353  H HB2  . TYR G 2 13  ? 11.077  0.625   23.692  1.00 44.22 ? 462 TYR G HB2  1  
ATOM 10354  H HB3  . TYR G 2 13  ? 9.392   1.013   23.357  1.00 4.54  ? 462 TYR G HB3  1  
ATOM 10355  H HD1  . TYR G 2 13  ? 12.619  2.982   23.403  1.00 22.31 ? 462 TYR G HD1  1  
ATOM 10356  H HD2  . TYR G 2 13  ? 9.126   1.910   21.194  1.00 43.41 ? 462 TYR G HD2  1  
ATOM 10357  H HE1  . TYR G 2 13  ? 13.350  4.415   21.551  1.00 25.33 ? 462 TYR G HE1  1  
ATOM 10358  H HE2  . TYR G 2 13  ? 9.863   3.350   19.342  1.00 10.34 ? 462 TYR G HE2  1  
ATOM 10359  H HH   . TYR G 2 13  ? 11.337  5.337   19.021  1.00 55.14 ? 462 TYR G HH   1  
ATOM 10360  N N    . THR G 2 14  ? 9.615   4.452   25.522  1.00 21.14 ? 463 THR G N    1  
ATOM 10361  C CA   . THR G 2 14  ? 8.770   5.653   25.636  1.00 53.13 ? 463 THR G CA   1  
ATOM 10362  C C    . THR G 2 14  ? 8.865   6.551   24.371  1.00 42.25 ? 463 THR G C    1  
ATOM 10363  O O    . THR G 2 14  ? 8.139   7.549   24.275  1.00 74.32 ? 463 THR G O    1  
ATOM 10364  C CB   . THR G 2 14  ? 9.160   6.465   26.920  1.00 13.31 ? 463 THR G CB   1  
ATOM 10365  O OG1  . THR G 2 14  ? 10.529  6.892   26.836  1.00 61.42 ? 463 THR G OG1  1  
ATOM 10366  C CG2  . THR G 2 14  ? 8.975   5.632   28.206  1.00 0.55  ? 463 THR G CG2  1  
ATOM 10367  H H    . THR G 2 14  ? 10.513  4.492   25.905  1.00 20.11 ? 463 THR G H    1  
ATOM 10368  H HA   . THR G 2 14  ? 7.733   5.333   25.746  1.00 1.52  ? 463 THR G HA   1  
ATOM 10369  H HB   . THR G 2 14  ? 8.527   7.345   26.985  1.00 13.02 ? 463 THR G HB   1  
ATOM 10370  H HG1  . THR G 2 14  ? 11.084  6.305   27.360  1.00 12.43 ? 463 THR G HG1  1  
ATOM 10371  H HG21 . THR G 2 14  ? 9.616   4.758   28.170  1.00 72.44 ? 463 THR G HG21 1  
ATOM 10372  H HG22 . THR G 2 14  ? 7.945   5.315   28.294  1.00 31.41 ? 463 THR G HG22 1  
ATOM 10373  H HG23 . THR G 2 14  ? 9.240   6.230   29.067  1.00 52.45 ? 463 THR G HG23 1  
ATOM 10374  N N    . MET G 2 15  ? 9.784   6.180   23.433  1.00 25.24 ? 464 MET G N    1  
ATOM 10375  C CA   . MET G 2 15  ? 9.964   6.816   22.096  1.00 73.14 ? 464 MET G CA   1  
ATOM 10376  C C    . MET G 2 15  ? 10.664  8.196   22.224  1.00 54.21 ? 464 MET G C    1  
ATOM 10377  O O    . MET G 2 15  ? 10.174  9.080   22.928  1.00 40.03 ? 464 MET G O    1  
ATOM 10378  C CB   . MET G 2 15  ? 8.608   6.910   21.293  1.00 32.32 ? 464 MET G CB   1  
ATOM 10379  C CG   . MET G 2 15  ? 8.723   6.602   19.787  1.00 5.23  ? 464 MET G CG   1  
ATOM 10380  S SD   . MET G 2 15  ? 10.086  7.475   18.989  1.00 74.14 ? 464 MET G SD   1  
ATOM 10381  C CE   . MET G 2 15  ? 9.990   6.850   17.310  1.00 42.32 ? 464 MET G CE   1  
ATOM 10382  H H    . MET G 2 15  ? 10.385  5.444   23.663  1.00 12.33 ? 464 MET G H    1  
ATOM 10383  H HA   . MET G 2 15  ? 10.636  6.158   21.556  1.00 43.51 ? 464 MET G HA   1  
ATOM 10384  H HB2  . MET G 2 15  ? 7.900   6.204   21.721  1.00 51.15 ? 464 MET G HB2  1  
ATOM 10385  H HB3  . MET G 2 15  ? 8.190   7.906   21.405  1.00 31.21 ? 464 MET G HB3  1  
ATOM 10386  H HG2  . MET G 2 15  ? 8.879   5.539   19.656  1.00 54.11 ? 464 MET G HG2  1  
ATOM 10387  H HG3  . MET G 2 15  ? 7.799   6.889   19.300  1.00 43.11 ? 464 MET G HG3  1  
ATOM 10388  H HE1  . MET G 2 15  ? 9.039   7.116   16.878  1.00 32.40 ? 464 MET G HE1  1  
ATOM 10389  H HE2  . MET G 2 15  ? 10.098  5.776   17.316  1.00 52.22 ? 464 MET G HE2  1  
ATOM 10390  H HE3  . MET G 2 15  ? 10.784  7.288   16.724  1.00 64.13 ? 464 MET G HE3  1  
ATOM 10391  N N    . LYS G 2 16  ? 11.809  8.375   21.528  1.00 32.42 ? 465 LYS G N    1  
ATOM 10392  C CA   . LYS G 2 16  ? 12.653  9.597   21.640  1.00 32.11 ? 465 LYS G CA   1  
ATOM 10393  C C    . LYS G 2 16  ? 13.022  10.137  20.230  1.00 35.32 ? 465 LYS G C    1  
ATOM 10394  O O    . LYS G 2 16  ? 14.013  10.859  20.054  1.00 4.13  ? 465 LYS G O    1  
ATOM 10395  C CB   . LYS G 2 16  ? 13.925  9.258   22.498  1.00 44.21 ? 465 LYS G CB   1  
ATOM 10396  C CG   . LYS G 2 16  ? 14.775  10.469  22.964  1.00 43.31 ? 465 LYS G CG   1  
ATOM 10397  C CD   . LYS G 2 16  ? 13.983  11.481  23.828  1.00 71.40 ? 465 LYS G CD   1  
ATOM 10398  C CE   . LYS G 2 16  ? 14.799  12.742  24.164  1.00 32.30 ? 465 LYS G CE   1  
ATOM 10399  N NZ   . LYS G 2 16  ? 14.027  13.710  24.996  1.00 42.12 ? 465 LYS G NZ   1  
ATOM 10400  H H    . LYS G 2 16  ? 12.101  7.667   20.918  1.00 31.11 ? 465 LYS G H    1  
ATOM 10401  H HA   . LYS G 2 16  ? 12.079  10.365  22.151  1.00 22.14 ? 465 LYS G HA   1  
ATOM 10402  H HB2  . LYS G 2 16  ? 13.608  8.720   23.386  1.00 53.03 ? 465 LYS G HB2  1  
ATOM 10403  H HB3  . LYS G 2 16  ? 14.565  8.597   21.919  1.00 72.54 ? 465 LYS G HB3  1  
ATOM 10404  H HG2  . LYS G 2 16  ? 15.614  10.103  23.545  1.00 71.02 ? 465 LYS G HG2  1  
ATOM 10405  H HG3  . LYS G 2 16  ? 15.156  10.982  22.084  1.00 21.40 ? 465 LYS G HG3  1  
ATOM 10406  H HD2  . LYS G 2 16  ? 13.092  11.782  23.288  1.00 43.13 ? 465 LYS G HD2  1  
ATOM 10407  H HD3  . LYS G 2 16  ? 13.684  10.997  24.755  1.00 15.44 ? 465 LYS G HD3  1  
ATOM 10408  H HE2  . LYS G 2 16  ? 15.692  12.452  24.709  1.00 71.15 ? 465 LYS G HE2  1  
ATOM 10409  H HE3  . LYS G 2 16  ? 15.090  13.230  23.242  1.00 3.43  ? 465 LYS G HE3  1  
ATOM 10410  H HZ1  . LYS G 2 16  ? 13.808  13.292  25.923  1.00 10.23 ? 465 LYS G HZ1  1  
ATOM 10411  H HZ2  . LYS G 2 16  ? 13.135  13.961  24.528  1.00 0.33  ? 465 LYS G HZ2  1  
ATOM 10412  H HZ3  . LYS G 2 16  ? 14.578  14.577  25.145  1.00 34.53 ? 465 LYS G HZ3  1  
ATOM 10413  N N    . ALA G 2 17  ? 12.186  9.824   19.229  1.00 44.54 ? 466 ALA G N    1  
ATOM 10414  C CA   . ALA G 2 17  ? 12.405  10.260  17.829  1.00 51.40 ? 466 ALA G CA   1  
ATOM 10415  C C    . ALA G 2 17  ? 11.086  10.711  17.180  1.00 1.33  ? 466 ALA G C    1  
ATOM 10416  O O    . ALA G 2 17  ? 9.996   10.276  17.577  1.00 63.23 ? 466 ALA G O    1  
ATOM 10417  C CB   . ALA G 2 17  ? 13.071  9.133   17.007  1.00 42.40 ? 466 ALA G CB   1  
ATOM 10418  H H    . ALA G 2 17  ? 11.387  9.296   19.432  1.00 2.55  ? 466 ALA G H    1  
ATOM 10419  H HA   . ALA G 2 17  ? 13.086  11.113  17.840  1.00 32.53 ? 466 ALA G HA   1  
ATOM 10420  H HB1  . ALA G 2 17  ? 13.271  9.484   16.002  1.00 21.11 ? 466 ALA G HB1  1  
ATOM 10421  H HB2  . ALA G 2 17  ? 12.417  8.271   16.961  1.00 63.00 ? 466 ALA G HB2  1  
ATOM 10422  H HB3  . ALA G 2 17  ? 14.004  8.846   17.475  1.00 24.13 ? 466 ALA G HB3  1  
ATOM 10423  N N    . ALA G 2 18  ? 11.215  11.589  16.174  1.00 51.55 ? 467 ALA G N    1  
ATOM 10424  C CA   . ALA G 2 18  ? 10.082  12.122  15.401  1.00 0.24  ? 467 ALA G CA   1  
ATOM 10425  C C    . ALA G 2 18  ? 9.981   11.420  14.031  1.00 3.12  ? 467 ALA G C    1  
ATOM 10426  O O    . ALA G 2 18  ? 10.847  10.614  13.665  1.00 33.04 ? 467 ALA G O    1  
ATOM 10427  C CB   . ALA G 2 18  ? 10.240  13.646  15.243  1.00 72.52 ? 467 ALA G CB   1  
ATOM 10428  H H    . ALA G 2 18  ? 12.116  11.888  15.937  1.00 22.11 ? 467 ALA G H    1  
ATOM 10429  H HA   . ALA G 2 18  ? 9.163   11.936  15.957  1.00 33.40 ? 467 ALA G HA   1  
ATOM 10430  H HB1  . ALA G 2 18  ? 10.269  14.114  16.220  1.00 31.10 ? 467 ALA G HB1  1  
ATOM 10431  H HB2  . ALA G 2 18  ? 9.403   14.047  14.683  1.00 71.44 ? 467 ALA G HB2  1  
ATOM 10432  H HB3  . ALA G 2 18  ? 11.159  13.865  14.718  1.00 2.43  ? 467 ALA G HB3  1  
ATOM 10433  N N    . LEU G 2 19  ? 8.920   11.757  13.271  1.00 71.25 ? 468 LEU G N    1  
ATOM 10434  C CA   . LEU G 2 19  ? 8.607   11.136  11.957  1.00 43.34 ? 468 LEU G CA   1  
ATOM 10435  C C    . LEU G 2 19  ? 9.119   11.989  10.785  1.00 73.34 ? 468 LEU G C    1  
ATOM 10436  O O    . LEU G 2 19  ? 8.612   11.883  9.657   1.00 63.42 ? 468 LEU G O    1  
ATOM 10437  C CB   . LEU G 2 19  ? 7.069   10.918  11.867  1.00 5.32  ? 468 LEU G CB   1  
ATOM 10438  C CG   . LEU G 2 19  ? 6.491   9.894   12.891  1.00 61.11 ? 468 LEU G CG   1  
ATOM 10439  C CD1  . LEU G 2 19  ? 4.955   9.832   12.842  1.00 3.11  ? 468 LEU G CD1  1  
ATOM 10440  C CD2  . LEU G 2 19  ? 7.111   8.505   12.664  1.00 22.21 ? 468 LEU G CD2  1  
ATOM 10441  H H    . LEU G 2 19  ? 8.318   12.454  13.604  1.00 73.52 ? 468 LEU G H    1  
ATOM 10442  H HA   . LEU G 2 19  ? 9.099   10.169  11.906  1.00 63.40 ? 468 LEU G HA   1  
ATOM 10443  H HB2  . LEU G 2 19  ? 6.579   11.875  12.020  1.00 71.40 ? 468 LEU G HB2  1  
ATOM 10444  H HB3  . LEU G 2 19  ? 6.821   10.570  10.866  1.00 23.05 ? 468 LEU G HB3  1  
ATOM 10445  H HG   . LEU G 2 19  ? 6.764   10.210  13.892  1.00 53.13 ? 468 LEU G HG   1  
ATOM 10446  H HD11 . LEU G 2 19  ? 4.546   10.813  13.050  1.00 11.34 ? 468 LEU G HD11 1  
ATOM 10447  H HD12 . LEU G 2 19  ? 4.593   9.135   13.585  1.00 14.43 ? 468 LEU G HD12 1  
ATOM 10448  H HD13 . LEU G 2 19  ? 4.627   9.511   11.859  1.00 53.30 ? 468 LEU G HD13 1  
ATOM 10449  H HD21 . LEU G 2 19  ? 8.182   8.555   12.821  1.00 41.43 ? 468 LEU G HD21 1  
ATOM 10450  H HD22 . LEU G 2 19  ? 6.915   8.170   11.653  1.00 41.54 ? 468 LEU G HD22 1  
ATOM 10451  H HD23 . LEU G 2 19  ? 6.688   7.796   13.363  1.00 74.13 ? 468 LEU G HD23 1  
ATOM 10452  N N    . GLY G 2 20  ? 10.149  12.812  11.055  1.00 32.12 ? 469 GLY G N    1  
ATOM 10453  C CA   . GLY G 2 20  ? 10.703  13.733  10.059  1.00 0.03  ? 469 GLY G CA   1  
ATOM 10454  C C    . GLY G 2 20  ? 9.957   15.062  9.999   1.00 2.22  ? 469 GLY G C    1  
ATOM 10455  O O    . GLY G 2 20  ? 10.398  15.984  9.312   1.00 20.03 ? 469 GLY G O    1  
ATOM 10456  H H    . GLY G 2 20  ? 10.545  12.792  11.949  1.00 75.04 ? 469 GLY G H    1  
ATOM 10457  H HA2  . GLY G 2 20  ? 11.734  13.929  10.316  1.00 53.01 ? 469 GLY G HA2  1  
ATOM 10458  H HA3  . GLY G 2 20  ? 10.677  13.270  9.077   1.00 70.13 ? 469 GLY G HA3  1  
ATOM 10459  N N    . LEU G 2 21  ? 8.815   15.159  10.717  1.00 63.44 ? 470 LEU G N    1  
ATOM 10460  C CA   . LEU G 2 21  ? 8.012   16.390  10.774  1.00 10.41 ? 470 LEU G CA   1  
ATOM 10461  C C    . LEU G 2 21  ? 8.585   17.359  11.818  1.00 72.22 ? 470 LEU G C    1  
ATOM 10462  O O    . LEU G 2 21  ? 9.250   16.942  12.773  1.00 1.20  ? 470 LEU G O    1  
ATOM 10463  C CB   . LEU G 2 21  ? 6.530   16.091  11.134  1.00 42.35 ? 470 LEU G CB   1  
ATOM 10464  C CG   . LEU G 2 21  ? 5.739   15.134  10.191  1.00 4.31  ? 470 LEU G CG   1  
ATOM 10465  C CD1  . LEU G 2 21  ? 4.246   15.115  10.585  1.00 20.04 ? 470 LEU G CD1  1  
ATOM 10466  C CD2  . LEU G 2 21  ? 5.922   15.489  8.698   1.00 71.40 ? 470 LEU G CD2  1  
ATOM 10467  H H    . LEU G 2 21  ? 8.515   14.383  11.224  1.00 61.14 ? 470 LEU G H    1  
ATOM 10468  H HA   . LEU G 2 21  ? 8.049   16.864  9.793   1.00 23.50 ? 470 LEU G HA   1  
ATOM 10469  H HB2  . LEU G 2 21  ? 6.510   15.660  12.133  1.00 11.41 ? 470 LEU G HB2  1  
ATOM 10470  H HB3  . LEU G 2 21  ? 5.999   17.038  11.171  1.00 74.14 ? 470 LEU G HB3  1  
ATOM 10471  H HG   . LEU G 2 21  ? 6.116   14.125  10.330  1.00 62.41 ? 470 LEU G HG   1  
ATOM 10472  H HD11 . LEU G 2 21  ? 3.703   14.460  9.921   1.00 70.33 ? 470 LEU G HD11 1  
ATOM 10473  H HD12 . LEU G 2 21  ? 3.828   16.112  10.522  1.00 40.12 ? 470 LEU G HD12 1  
ATOM 10474  H HD13 . LEU G 2 21  ? 4.145   14.749  11.597  1.00 10.30 ? 470 LEU G HD13 1  
ATOM 10475  H HD21 . LEU G 2 21  ? 5.360   14.793  8.087   1.00 2.04  ? 470 LEU G HD21 1  
ATOM 10476  H HD22 . LEU G 2 21  ? 6.968   15.421  8.436   1.00 72.45 ? 470 LEU G HD22 1  
ATOM 10477  H HD23 . LEU G 2 21  ? 5.570   16.497  8.511   1.00 5.23  ? 470 LEU G HD23 1  
ATOM 10478  N N    . LYS G 2 22  ? 8.281   18.643  11.625  1.00 45.42 ? 471 LYS G N    1  
ATOM 10479  C CA   . LYS G 2 22  ? 8.591   19.726  12.576  1.00 21.12 ? 471 LYS G CA   1  
ATOM 10480  C C    . LYS G 2 22  ? 7.402   20.714  12.618  1.00 74.35 ? 471 LYS G C    1  
ATOM 10481  O O    . LYS G 2 22  ? 6.743   20.906  11.578  1.00 1.12  ? 471 LYS G O    1  
ATOM 10482  C CB   . LYS G 2 22  ? 9.903   20.467  12.196  1.00 13.51 ? 471 LYS G CB   1  
ATOM 10483  C CG   . LYS G 2 22  ? 9.944   21.015  10.746  1.00 72.42 ? 471 LYS G CG   1  
ATOM 10484  C CD   . LYS G 2 22  ? 11.059  22.067  10.535  1.00 54.44 ? 471 LYS G CD   1  
ATOM 10485  C CE   . LYS G 2 22  ? 10.866  23.321  11.412  1.00 71.32 ? 471 LYS G CE   1  
ATOM 10486  N NZ   . LYS G 2 22  ? 11.864  24.386  11.104  1.00 53.11 ? 471 LYS G NZ   1  
ATOM 10487  O OXT  . LYS G 2 22  ? 7.149   21.312  13.675  1.00 37.65 ? 471 LYS G OXT  1  
ATOM 10488  H H    . LYS G 2 22  ? 7.801   18.887  10.805  1.00 45.43 ? 471 LYS G H    1  
ATOM 10489  H HA   . LYS G 2 22  ? 8.709   19.281  13.568  1.00 1.03  ? 471 LYS G HA   1  
ATOM 10490  H HB2  . LYS G 2 22  ? 10.038  21.297  12.885  1.00 21.15 ? 471 LYS G HB2  1  
ATOM 10491  H HB3  . LYS G 2 22  ? 10.737  19.784  12.324  1.00 23.43 ? 471 LYS G HB3  1  
ATOM 10492  H HG2  . LYS G 2 22  ? 10.113  20.186  10.069  1.00 72.24 ? 471 LYS G HG2  1  
ATOM 10493  H HG3  . LYS G 2 22  ? 8.982   21.468  10.509  1.00 33.02 ? 471 LYS G HG3  1  
ATOM 10494  H HD2  . LYS G 2 22  ? 12.014  21.617  10.778  1.00 55.42 ? 471 LYS G HD2  1  
ATOM 10495  H HD3  . LYS G 2 22  ? 11.063  22.363  9.493   1.00 51.33 ? 471 LYS G HD3  1  
ATOM 10496  H HE2  . LYS G 2 22  ? 9.871   23.723  11.249  1.00 62.13 ? 471 LYS G HE2  1  
ATOM 10497  H HE3  . LYS G 2 22  ? 10.967  23.043  12.453  1.00 21.20 ? 471 LYS G HE3  1  
ATOM 10498  H HZ1  . LYS G 2 22  ? 11.743  24.720  10.124  1.00 41.11 ? 471 LYS G HZ1  1  
ATOM 10499  H HZ2  . LYS G 2 22  ? 12.830  24.014  11.212  1.00 21.51 ? 471 LYS G HZ2  1  
ATOM 10500  H HZ3  . LYS G 2 22  ? 11.743  25.189  11.748  1.00 0.22  ? 471 LYS G HZ3  1  
ATOM 10501  N N    . ASN H 2 1   ? -29.257 30.629  -9.455  1.00 22.12 ? 450 ASN H N    1  
ATOM 10502  C CA   . ASN H 2 1   ? -29.074 29.883  -8.188  1.00 10.30 ? 450 ASN H CA   1  
ATOM 10503  C C    . ASN H 2 1   ? -27.769 29.066  -8.261  1.00 55.43 ? 450 ASN H C    1  
ATOM 10504  O O    . ASN H 2 1   ? -27.083 29.075  -9.293  1.00 10.01 ? 450 ASN H O    1  
ATOM 10505  C CB   . ASN H 2 1   ? -30.301 28.954  -7.924  1.00 1.12  ? 450 ASN H CB   1  
ATOM 10506  C CG   . ASN H 2 1   ? -31.660 29.679  -7.935  1.00 11.14 ? 450 ASN H CG   1  
ATOM 10507  O OD1  . ASN H 2 1   ? -31.844 30.682  -8.622  1.00 62.13 ? 450 ASN H OD1  1  
ATOM 10508  N ND2  . ASN H 2 1   ? -32.630 29.165  -7.197  1.00 43.11 ? 450 ASN H ND2  1  
ATOM 10509  H H1   . ASN H 2 1   ? -29.355 29.970  -10.243 1.00 37.65 ? 450 ASN H H1   1  
ATOM 10510  H H2   . ASN H 2 1   ? -28.434 31.227  -9.635  1.00 37.65 ? 450 ASN H H2   1  
ATOM 10511  H H3   . ASN H 2 1   ? -30.109 31.225  -9.404  1.00 37.65 ? 450 ASN H H3   1  
ATOM 10512  H HA   . ASN H 2 1   ? -28.988 30.605  -7.387  1.00 2.54  ? 450 ASN H HA   1  
ATOM 10513  H HB2  . ASN H 2 1   ? -30.334 28.185  -8.687  1.00 53.20 ? 450 ASN H HB2  1  
ATOM 10514  H HB3  . ASN H 2 1   ? -30.173 28.478  -6.956  1.00 3.24  ? 450 ASN H HB3  1  
ATOM 10515  H HD21 . ASN H 2 1   ? -32.440 28.355  -6.679  1.00 5.24  ? 450 ASN H HD21 1  
ATOM 10516  H HD22 . ASN H 2 1   ? -33.503 29.612  -7.201  1.00 53.33 ? 450 ASN H HD22 1  
ATOM 10517  N N    . VAL H 2 2   ? -27.417 28.376  -7.155  1.00 44.40 ? 451 VAL H N    1  
ATOM 10518  C CA   . VAL H 2 2   ? -26.243 27.465  -7.095  1.00 51.33 ? 451 VAL H CA   1  
ATOM 10519  C C    . VAL H 2 2   ? -26.690 26.100  -6.530  1.00 61.42 ? 451 VAL H C    1  
ATOM 10520  O O    . VAL H 2 2   ? -26.683 25.089  -7.237  1.00 2.02  ? 451 VAL H O    1  
ATOM 10521  C CB   . VAL H 2 2   ? -25.060 28.050  -6.209  1.00 13.23 ? 451 VAL H CB   1  
ATOM 10522  C CG1  . VAL H 2 2   ? -23.825 27.102  -6.200  1.00 42.13 ? 451 VAL H CG1  1  
ATOM 10523  C CG2  . VAL H 2 2   ? -24.662 29.480  -6.659  1.00 52.24 ? 451 VAL H CG2  1  
ATOM 10524  H H    . VAL H 2 2   ? -27.963 28.479  -6.354  1.00 15.42 ? 451 VAL H H    1  
ATOM 10525  H HA   . VAL H 2 2   ? -25.870 27.312  -8.108  1.00 74.05 ? 451 VAL H HA   1  
ATOM 10526  H HB   . VAL H 2 2   ? -25.420 28.121  -5.185  1.00 52.21 ? 451 VAL H HB   1  
ATOM 10527  H HG11 . VAL H 2 2   ? -23.040 27.530  -5.587  1.00 24.44 ? 451 VAL H HG11 1  
ATOM 10528  H HG12 . VAL H 2 2   ? -23.452 26.966  -7.208  1.00 63.34 ? 451 VAL H HG12 1  
ATOM 10529  H HG13 . VAL H 2 2   ? -24.106 26.138  -5.793  1.00 62.12 ? 451 VAL H HG13 1  
ATOM 10530  H HG21 . VAL H 2 2   ? -24.312 29.461  -7.685  1.00 10.01 ? 451 VAL H HG21 1  
ATOM 10531  H HG22 . VAL H 2 2   ? -23.876 29.866  -6.022  1.00 52.21 ? 451 VAL H HG22 1  
ATOM 10532  H HG23 . VAL H 2 2   ? -25.524 30.134  -6.592  1.00 23.14 ? 451 VAL H HG23 1  
ATOM 10533  N N    . VAL H 2 3   ? -27.111 26.094  -5.250  1.00 65.35 ? 452 VAL H N    1  
ATOM 10534  C CA   . VAL H 2 3   ? -27.477 24.858  -4.523  1.00 1.02  ? 452 VAL H CA   1  
ATOM 10535  C C    . VAL H 2 3   ? -28.966 24.487  -4.744  1.00 0.32  ? 452 VAL H C    1  
ATOM 10536  O O    . VAL H 2 3   ? -29.669 25.143  -5.524  1.00 12.51 ? 452 VAL H O    1  
ATOM 10537  C CB   . VAL H 2 3   ? -27.140 24.996  -2.988  1.00 35.34 ? 452 VAL H CB   1  
ATOM 10538  C CG1  . VAL H 2 3   ? -25.623 25.239  -2.778  1.00 70.22 ? 452 VAL H CG1  1  
ATOM 10539  C CG2  . VAL H 2 3   ? -27.991 26.103  -2.310  1.00 51.10 ? 452 VAL H CG2  1  
ATOM 10540  H H    . VAL H 2 3   ? -27.186 26.949  -4.780  1.00 41.44 ? 452 VAL H H    1  
ATOM 10541  H HA   . VAL H 2 3   ? -26.874 24.043  -4.922  1.00 11.31 ? 452 VAL H HA   1  
ATOM 10542  H HB   . VAL H 2 3   ? -27.384 24.049  -2.510  1.00 41.25 ? 452 VAL H HB   1  
ATOM 10543  H HG11 . VAL H 2 3   ? -25.322 26.161  -3.263  1.00 14.53 ? 452 VAL H HG11 1  
ATOM 10544  H HG12 . VAL H 2 3   ? -25.060 24.417  -3.204  1.00 60.11 ? 452 VAL H HG12 1  
ATOM 10545  H HG13 . VAL H 2 3   ? -25.403 25.302  -1.719  1.00 4.05  ? 452 VAL H HG13 1  
ATOM 10546  H HG21 . VAL H 2 3   ? -29.043 25.869  -2.419  1.00 42.22 ? 452 VAL H HG21 1  
ATOM 10547  H HG22 . VAL H 2 3   ? -27.790 27.061  -2.771  1.00 55.14 ? 452 VAL H HG22 1  
ATOM 10548  H HG23 . VAL H 2 3   ? -27.749 26.158  -1.254  1.00 53.53 ? 452 VAL H HG23 1  
ATOM 10549  N N    . GLY H 2 4   ? -29.421 23.409  -4.071  1.00 21.03 ? 453 GLY H N    1  
ATOM 10550  C CA   . GLY H 2 4   ? -30.805 22.932  -4.182  1.00 63.52 ? 453 GLY H CA   1  
ATOM 10551  C C    . GLY H 2 4   ? -30.904 21.435  -3.921  1.00 1.11  ? 453 GLY H C    1  
ATOM 10552  O O    . GLY H 2 4   ? -31.391 20.679  -4.765  1.00 14.14 ? 453 GLY H O    1  
ATOM 10553  H H    . GLY H 2 4   ? -28.806 22.932  -3.479  1.00 33.12 ? 453 GLY H H    1  
ATOM 10554  H HA2  . GLY H 2 4   ? -31.413 23.459  -3.460  1.00 73.11 ? 453 GLY H HA2  1  
ATOM 10555  H HA3  . GLY H 2 4   ? -31.182 23.144  -5.178  1.00 32.31 ? 453 GLY H HA3  1  
ATOM 10556  N N    . LEU H 2 5   ? -30.432 21.013  -2.731  1.00 25.43 ? 454 LEU H N    1  
ATOM 10557  C CA   . LEU H 2 5   ? -30.339 19.584  -2.344  1.00 72.23 ? 454 LEU H CA   1  
ATOM 10558  C C    . LEU H 2 5   ? -31.614 19.099  -1.642  1.00 51.32 ? 454 LEU H C    1  
ATOM 10559  O O    . LEU H 2 5   ? -32.393 19.894  -1.103  1.00 50.34 ? 454 LEU H O    1  
ATOM 10560  C CB   . LEU H 2 5   ? -29.119 19.324  -1.402  1.00 52.13 ? 454 LEU H CB   1  
ATOM 10561  C CG   . LEU H 2 5   ? -27.698 19.487  -2.021  1.00 4.31  ? 454 LEU H CG   1  
ATOM 10562  C CD1  . LEU H 2 5   ? -27.542 18.627  -3.298  1.00 54.34 ? 454 LEU H CD1  1  
ATOM 10563  C CD2  . LEU H 2 5   ? -27.353 20.973  -2.273  1.00 21.24 ? 454 LEU H CD2  1  
ATOM 10564  H H    . LEU H 2 5   ? -30.148 21.685  -2.082  1.00 53.30 ? 454 LEU H H    1  
ATOM 10565  H HA   . LEU H 2 5   ? -30.203 18.998  -3.249  1.00 63.45 ? 454 LEU H HA   1  
ATOM 10566  H HB2  . LEU H 2 5   ? -29.198 19.994  -0.549  1.00 1.51  ? 454 LEU H HB2  1  
ATOM 10567  H HB3  . LEU H 2 5   ? -29.195 18.306  -1.024  1.00 44.25 ? 454 LEU H HB3  1  
ATOM 10568  H HG   . LEU H 2 5   ? -26.972 19.112  -1.307  1.00 50.55 ? 454 LEU H HG   1  
ATOM 10569  H HD11 . LEU H 2 5   ? -28.245 18.952  -4.056  1.00 70.31 ? 454 LEU H HD11 1  
ATOM 10570  H HD12 . LEU H 2 5   ? -27.726 17.588  -3.062  1.00 22.21 ? 454 LEU H HD12 1  
ATOM 10571  H HD13 . LEU H 2 5   ? -26.534 18.725  -3.682  1.00 50.31 ? 454 LEU H HD13 1  
ATOM 10572  H HD21 . LEU H 2 5   ? -27.395 21.518  -1.338  1.00 51.51 ? 454 LEU H HD21 1  
ATOM 10573  H HD22 . LEU H 2 5   ? -28.059 21.408  -2.970  1.00 65.51 ? 454 LEU H HD22 1  
ATOM 10574  H HD23 . LEU H 2 5   ? -26.352 21.053  -2.683  1.00 42.21 ? 454 LEU H HD23 1  
ATOM 10575  N N    . THR H 2 6   ? -31.769 17.764  -1.637  1.00 52.54 ? 455 THR H N    1  
ATOM 10576  C CA   . THR H 2 6   ? -32.841 17.060  -0.934  1.00 71.30 ? 455 THR H CA   1  
ATOM 10577  C C    . THR H 2 6   ? -32.400 15.585  -0.722  1.00 11.23 ? 455 THR H C    1  
ATOM 10578  O O    . THR H 2 6   ? -32.826 14.665  -1.430  1.00 65.31 ? 455 THR H O    1  
ATOM 10579  C CB   . THR H 2 6   ? -34.227 17.206  -1.687  1.00 71.03 ? 455 THR H CB   1  
ATOM 10580  O OG1  . THR H 2 6   ? -35.243 16.420  -1.045  1.00 11.43 ? 455 THR H OG1  1  
ATOM 10581  C CG2  . THR H 2 6   ? -34.141 16.833  -3.184  1.00 22.44 ? 455 THR H CG2  1  
ATOM 10582  H H    . THR H 2 6   ? -31.123 17.226  -2.138  1.00 2.42  ? 455 THR H H    1  
ATOM 10583  H HA   . THR H 2 6   ? -32.943 17.522  0.050   1.00 14.44 ? 455 THR H HA   1  
ATOM 10584  H HB   . THR H 2 6   ? -34.527 18.250  -1.619  1.00 3.44  ? 455 THR H HB   1  
ATOM 10585  H HG1  . THR H 2 6   ? -35.192 16.544  -0.090  1.00 4.31  ? 455 THR H HG1  1  
ATOM 10586  H HG21 . THR H 2 6   ? -33.855 15.795  -3.284  1.00 21.44 ? 455 THR H HG21 1  
ATOM 10587  H HG22 . THR H 2 6   ? -33.403 17.455  -3.677  1.00 72.42 ? 455 THR H HG22 1  
ATOM 10588  H HG23 . THR H 2 6   ? -35.104 16.983  -3.655  1.00 62.22 ? 455 THR H HG23 1  
ATOM 10589  N N    . ASP H 2 7   ? -31.473 15.399  0.243   1.00 50.41 ? 456 ASP H N    1  
ATOM 10590  C CA   . ASP H 2 7   ? -30.804 14.095  0.504   1.00 41.35 ? 456 ASP H CA   1  
ATOM 10591  C C    . ASP H 2 7   ? -31.628 13.213  1.459   1.00 54.12 ? 456 ASP H C    1  
ATOM 10592  O O    . ASP H 2 7   ? -32.367 13.720  2.309   1.00 0.44  ? 456 ASP H O    1  
ATOM 10593  C CB   . ASP H 2 7   ? -29.375 14.313  1.092   1.00 35.51 ? 456 ASP H CB   1  
ATOM 10594  C CG   . ASP H 2 7   ? -29.364 14.996  2.479   1.00 61.34 ? 456 ASP H CG   1  
ATOM 10595  O OD1  . ASP H 2 7   ? -29.541 16.229  2.541   1.00 55.34 ? 456 ASP H OD1  1  
ATOM 10596  O OD2  . ASP H 2 7   ? -29.180 14.305  3.512   1.00 43.12 ? 456 ASP H OD2  1  
ATOM 10597  H H    . ASP H 2 7   ? -31.240 16.162  0.817   1.00 62.30 ? 456 ASP H H    1  
ATOM 10598  H HA   . ASP H 2 7   ? -30.707 13.579  -0.449  1.00 52.32 ? 456 ASP H HA   1  
ATOM 10599  H HB2  . ASP H 2 7   ? -28.876 13.351  1.171   1.00 53.14 ? 456 ASP H HB2  1  
ATOM 10600  H HB3  . ASP H 2 7   ? -28.803 14.930  0.403   1.00 24.12 ? 456 ASP H HB3  1  
ATOM 10601  N N    . GLN H 2 8   ? -31.483 11.885  1.297   1.00 53.31 ? 457 GLN H N    1  
ATOM 10602  C CA   . GLN H 2 8   ? -32.114 10.861  2.160   1.00 65.55 ? 457 GLN H CA   1  
ATOM 10603  C C    . GLN H 2 8   ? -31.066 9.789   2.512   1.00 21.23 ? 457 GLN H C    1  
ATOM 10604  O O    . GLN H 2 8   ? -30.084 9.608   1.772   1.00 61.14 ? 457 GLN H O    1  
ATOM 10605  C CB   . GLN H 2 8   ? -33.331 10.205  1.439   1.00 11.23 ? 457 GLN H CB   1  
ATOM 10606  C CG   . GLN H 2 8   ? -34.469 11.191  1.076   1.00 63.01 ? 457 GLN H CG   1  
ATOM 10607  C CD   . GLN H 2 8   ? -35.676 10.556  0.371   1.00 2.12  ? 457 GLN H CD   1  
ATOM 10608  O OE1  . GLN H 2 8   ? -36.316 11.189  -0.467  1.00 54.52 ? 457 GLN H OE1  1  
ATOM 10609  N NE2  . GLN H 2 8   ? -36.032 9.327   0.728   1.00 14.23 ? 457 GLN H NE2  1  
ATOM 10610  H H    . GLN H 2 8   ? -30.915 11.571  0.564   1.00 32.03 ? 457 GLN H H    1  
ATOM 10611  H HA   . GLN H 2 8   ? -32.450 11.336  3.079   1.00 52.15 ? 457 GLN H HA   1  
ATOM 10612  H HB2  . GLN H 2 8   ? -32.984 9.737   0.521   1.00 12.24 ? 457 GLN H HB2  1  
ATOM 10613  H HB3  . GLN H 2 8   ? -33.742 9.436   2.083   1.00 11.22 ? 457 GLN H HB3  1  
ATOM 10614  H HG2  . GLN H 2 8   ? -34.825 11.655  1.987   1.00 51.45 ? 457 GLN H HG2  1  
ATOM 10615  H HG3  . GLN H 2 8   ? -34.060 11.961  0.432   1.00 21.23 ? 457 GLN H HG3  1  
ATOM 10616  H HE21 . GLN H 2 8   ? -35.516 8.873   1.426   1.00 53.30 ? 457 GLN H HE21 1  
ATOM 10617  H HE22 . GLN H 2 8   ? -36.799 8.925   0.274   1.00 21.00 ? 457 GLN H HE22 1  
ATOM 10618  N N    . THR H 2 9   ? -31.287 9.073   3.628   1.00 54.12 ? 458 THR H N    1  
ATOM 10619  C CA   . THR H 2 9   ? -30.373 8.009   4.093   1.00 24.41 ? 458 THR H CA   1  
ATOM 10620  C C    . THR H 2 9   ? -30.485 6.762   3.200   1.00 32.11 ? 458 THR H C    1  
ATOM 10621  O O    . THR H 2 9   ? -29.532 5.990   3.078   1.00 73.23 ? 458 THR H O    1  
ATOM 10622  C CB   . THR H 2 9   ? -30.658 7.631   5.579   1.00 21.44 ? 458 THR H CB   1  
ATOM 10623  O OG1  . THR H 2 9   ? -32.020 7.190   5.719   1.00 21.12 ? 458 THR H OG1  1  
ATOM 10624  C CG2  . THR H 2 9   ? -30.414 8.823   6.521   1.00 71.32 ? 458 THR H CG2  1  
ATOM 10625  H H    . THR H 2 9   ? -32.093 9.259   4.157   1.00 60.12 ? 458 THR H H    1  
ATOM 10626  H HA   . THR H 2 9   ? -29.356 8.393   4.026   1.00 21.32 ? 458 THR H HA   1  
ATOM 10627  H HB   . THR H 2 9   ? -29.995 6.820   5.869   1.00 22.13 ? 458 THR H HB   1  
ATOM 10628  H HG1  . THR H 2 9   ? -32.029 6.253   5.942   1.00 62.35 ? 458 THR H HG1  1  
ATOM 10629  H HG21 . THR H 2 9   ? -29.385 9.153   6.440   1.00 22.52 ? 458 THR H HG21 1  
ATOM 10630  H HG22 . THR H 2 9   ? -30.612 8.525   7.541   1.00 54.40 ? 458 THR H HG22 1  
ATOM 10631  H HG23 . THR H 2 9   ? -31.073 9.641   6.254   1.00 70.24 ? 458 THR H HG23 1  
ATOM 10632  N N    . ASP H 2 10  ? -31.671 6.566   2.595   1.00 42.50 ? 459 ASP H N    1  
ATOM 10633  C CA   . ASP H 2 10  ? -31.892 5.518   1.586   1.00 41.24 ? 459 ASP H CA   1  
ATOM 10634  C C    . ASP H 2 10  ? -31.576 6.103   0.207   1.00 41.23 ? 459 ASP H C    1  
ATOM 10635  O O    . ASP H 2 10  ? -32.011 7.212   -0.107  1.00 53.23 ? 459 ASP H O    1  
ATOM 10636  C CB   . ASP H 2 10  ? -33.347 4.997   1.638   1.00 43.40 ? 459 ASP H CB   1  
ATOM 10637  C CG   . ASP H 2 10  ? -33.709 4.426   3.017   1.00 45.21 ? 459 ASP H CG   1  
ATOM 10638  O OD1  . ASP H 2 10  ? -33.370 3.260   3.299   1.00 43.31 ? 459 ASP H OD1  1  
ATOM 10639  O OD2  . ASP H 2 10  ? -34.315 5.152   3.834   1.00 61.15 ? 459 ASP H OD2  1  
ATOM 10640  H H    . ASP H 2 10  ? -32.420 7.151   2.835   1.00 20.25 ? 459 ASP H H    1  
ATOM 10641  H HA   . ASP H 2 10  ? -31.211 4.693   1.790   1.00 42.32 ? 459 ASP H HA   1  
ATOM 10642  H HB2  . ASP H 2 10  ? -34.029 5.812   1.402   1.00 34.32 ? 459 ASP H HB2  1  
ATOM 10643  H HB3  . ASP H 2 10  ? -33.476 4.216   0.893   1.00 30.04 ? 459 ASP H HB3  1  
ATOM 10644  N N    . LEU H 2 11  ? -30.794 5.367   -0.597  1.00 13.35 ? 460 LEU H N    1  
ATOM 10645  C CA   . LEU H 2 11  ? -30.370 5.817   -1.929  1.00 30.10 ? 460 LEU H CA   1  
ATOM 10646  C C    . LEU H 2 11  ? -29.984 4.604   -2.792  1.00 64.50 ? 460 LEU H C    1  
ATOM 10647  O O    . LEU H 2 11  ? -29.306 3.682   -2.318  1.00 5.03  ? 460 LEU H O    1  
ATOM 10648  C CB   . LEU H 2 11  ? -29.175 6.834   -1.859  1.00 11.40 ? 460 LEU H CB   1  
ATOM 10649  C CG   . LEU H 2 11  ? -27.817 6.330   -1.223  1.00 44.13 ? 460 LEU H CG   1  
ATOM 10650  C CD1  . LEU H 2 11  ? -26.624 7.230   -1.624  1.00 62.53 ? 460 LEU H CD1  1  
ATOM 10651  C CD2  . LEU H 2 11  ? -27.904 6.221   0.315   1.00 2.21  ? 460 LEU H CD2  1  
ATOM 10652  H H    . LEU H 2 11  ? -30.488 4.489   -0.284  1.00 25.43 ? 460 LEU H H    1  
ATOM 10653  H HA   . LEU H 2 11  ? -31.223 6.315   -2.397  1.00 1.32  ? 460 LEU H HA   1  
ATOM 10654  H HB2  . LEU H 2 11  ? -28.970 7.164   -2.875  1.00 50.14 ? 460 LEU H HB2  1  
ATOM 10655  H HB3  . LEU H 2 11  ? -29.511 7.699   -1.299  1.00 50.11 ? 460 LEU H HB3  1  
ATOM 10656  H HG   . LEU H 2 11  ? -27.608 5.337   -1.606  1.00 45.32 ? 460 LEU H HG   1  
ATOM 10657  H HD11 . LEU H 2 11  ? -26.800 8.248   -1.294  1.00 12.04 ? 460 LEU H HD11 1  
ATOM 10658  H HD12 . LEU H 2 11  ? -26.509 7.219   -2.702  1.00 54.25 ? 460 LEU H HD12 1  
ATOM 10659  H HD13 . LEU H 2 11  ? -25.715 6.857   -1.171  1.00 51.10 ? 460 LEU H HD13 1  
ATOM 10660  H HD21 . LEU H 2 11  ? -28.684 5.522   0.588   1.00 64.21 ? 460 LEU H HD21 1  
ATOM 10661  H HD22 . LEU H 2 11  ? -28.128 7.189   0.746   1.00 71.30 ? 460 LEU H HD22 1  
ATOM 10662  H HD23 . LEU H 2 11  ? -26.960 5.866   0.708   1.00 53.41 ? 460 LEU H HD23 1  
ATOM 10663  N N    . PHE H 2 12  ? -30.468 4.627   -4.049  1.00 21.44 ? 461 PHE H N    1  
ATOM 10664  C CA   . PHE H 2 12  ? -30.058 3.714   -5.135  1.00 75.35 ? 461 PHE H CA   1  
ATOM 10665  C C    . PHE H 2 12  ? -30.422 2.224   -4.871  1.00 64.41 ? 461 PHE H C    1  
ATOM 10666  O O    . PHE H 2 12  ? -31.436 1.740   -5.381  1.00 72.32 ? 461 PHE H O    1  
ATOM 10667  C CB   . PHE H 2 12  ? -28.543 3.889   -5.469  1.00 52.42 ? 461 PHE H CB   1  
ATOM 10668  C CG   . PHE H 2 12  ? -28.153 5.323   -5.835  1.00 1.30  ? 461 PHE H CG   1  
ATOM 10669  C CD1  . PHE H 2 12  ? -27.339 6.089   -5.004  1.00 51.24 ? 461 PHE H CD1  1  
ATOM 10670  C CD2  . PHE H 2 12  ? -28.633 5.912   -6.997  1.00 14.13 ? 461 PHE H CD2  1  
ATOM 10671  C CE1  . PHE H 2 12  ? -27.018 7.394   -5.325  1.00 54.13 ? 461 PHE H CE1  1  
ATOM 10672  C CE2  . PHE H 2 12  ? -28.307 7.213   -7.316  1.00 44.12 ? 461 PHE H CE2  1  
ATOM 10673  C CZ   . PHE H 2 12  ? -27.501 7.956   -6.482  1.00 74.35 ? 461 PHE H CZ   1  
ATOM 10674  H H    . PHE H 2 12  ? -31.145 5.301   -4.260  1.00 60.42 ? 461 PHE H H    1  
ATOM 10675  H HA   . PHE H 2 12  ? -30.621 4.036   -6.006  1.00 32.32 ? 461 PHE H HA   1  
ATOM 10676  H HB2  . PHE H 2 12  ? -27.955 3.579   -4.608  1.00 74.54 ? 461 PHE H HB2  1  
ATOM 10677  H HB3  . PHE H 2 12  ? -28.288 3.250   -6.307  1.00 31.51 ? 461 PHE H HB3  1  
ATOM 10678  H HD1  . PHE H 2 12  ? -26.952 5.651   -4.091  1.00 53.12 ? 461 PHE H HD1  1  
ATOM 10679  H HD2  . PHE H 2 12  ? -29.268 5.340   -7.666  1.00 41.11 ? 461 PHE H HD2  1  
ATOM 10680  H HE1  . PHE H 2 12  ? -26.383 7.975   -4.664  1.00 50.50 ? 461 PHE H HE1  1  
ATOM 10681  H HE2  . PHE H 2 12  ? -28.686 7.653   -8.229  1.00 41.44 ? 461 PHE H HE2  1  
ATOM 10682  H HZ   . PHE H 2 12  ? -27.252 8.980   -6.737  1.00 75.03 ? 461 PHE H HZ   1  
ATOM 10683  N N    . TYR H 2 13  ? -29.596 1.519   -4.064  1.00 1.34  ? 462 TYR H N    1  
ATOM 10684  C CA   . TYR H 2 13  ? -29.719 0.054   -3.832  1.00 20.32 ? 462 TYR H CA   1  
ATOM 10685  C C    . TYR H 2 13  ? -29.151 -0.340  -2.449  1.00 24.13 ? 462 TYR H C    1  
ATOM 10686  O O    . TYR H 2 13  ? -28.615 0.506   -1.722  1.00 33.30 ? 462 TYR H O    1  
ATOM 10687  C CB   . TYR H 2 13  ? -29.000 -0.738  -4.970  1.00 45.55 ? 462 TYR H CB   1  
ATOM 10688  C CG   . TYR H 2 13  ? -27.519 -0.347  -5.198  1.00 13.35 ? 462 TYR H CG   1  
ATOM 10689  C CD1  . TYR H 2 13  ? -27.176 0.691   -6.064  1.00 22.25 ? 462 TYR H CD1  1  
ATOM 10690  C CD2  . TYR H 2 13  ? -26.473 -1.008  -4.549  1.00 65.54 ? 462 TYR H CD2  1  
ATOM 10691  C CE1  . TYR H 2 13  ? -25.861 1.053   -6.273  1.00 72.24 ? 462 TYR H CE1  1  
ATOM 10692  C CE2  . TYR H 2 13  ? -25.157 -0.647  -4.762  1.00 21.03 ? 462 TYR H CE2  1  
ATOM 10693  C CZ   . TYR H 2 13  ? -24.856 0.380   -5.621  1.00 53.02 ? 462 TYR H CZ   1  
ATOM 10694  O OH   . TYR H 2 13  ? -23.539 0.739   -5.825  1.00 11.34 ? 462 TYR H OH   1  
ATOM 10695  H H    . TYR H 2 13  ? -28.878 2.001   -3.598  1.00 24.41 ? 462 TYR H H    1  
ATOM 10696  H HA   . TYR H 2 13  ? -30.777 -0.197  -3.844  1.00 42.30 ? 462 TYR H HA   1  
ATOM 10697  H HB2  . TYR H 2 13  ? -29.037 -1.799  -4.741  1.00 70.25 ? 462 TYR H HB2  1  
ATOM 10698  H HB3  . TYR H 2 13  ? -29.536 -0.574  -5.898  1.00 63.41 ? 462 TYR H HB3  1  
ATOM 10699  H HD1  . TYR H 2 13  ? -27.963 1.224   -6.585  1.00 20.20 ? 462 TYR H HD1  1  
ATOM 10700  H HD2  . TYR H 2 13  ? -26.703 -1.821  -3.871  1.00 64.15 ? 462 TYR H HD2  1  
ATOM 10701  H HE1  . TYR H 2 13  ? -25.625 1.864   -6.951  1.00 20.44 ? 462 TYR H HE1  1  
ATOM 10702  H HE2  . TYR H 2 13  ? -24.364 -1.175  -4.249  1.00 65.00 ? 462 TYR H HE2  1  
ATOM 10703  H HH   . TYR H 2 13  ? -23.453 1.692   -5.769  1.00 33.33 ? 462 TYR H HH   1  
ATOM 10704  N N    . THR H 2 14  ? -29.272 -1.642  -2.110  1.00 34.03 ? 463 THR H N    1  
ATOM 10705  C CA   . THR H 2 14  ? -28.805 -2.206  -0.827  1.00 34.12 ? 463 THR H CA   1  
ATOM 10706  C C    . THR H 2 14  ? -27.726 -3.296  -1.059  1.00 21.34 ? 463 THR H C    1  
ATOM 10707  O O    . THR H 2 14  ? -26.618 -3.181  -0.536  1.00 32.44 ? 463 THR H O    1  
ATOM 10708  C CB   . THR H 2 14  ? -30.013 -2.795  -0.015  1.00 12.02 ? 463 THR H CB   1  
ATOM 10709  O OG1  . THR H 2 14  ? -30.725 -3.755  -0.817  1.00 2.34  ? 463 THR H OG1  1  
ATOM 10710  C CG2  . THR H 2 14  ? -30.993 -1.703  0.455   1.00 2.00  ? 463 THR H CG2  1  
ATOM 10711  H H    . THR H 2 14  ? -29.703 -2.247  -2.743  1.00 3.34  ? 463 THR H H    1  
ATOM 10712  H HA   . THR H 2 14  ? -28.363 -1.403  -0.236  1.00 22.31 ? 463 THR H HA   1  
ATOM 10713  H HB   . THR H 2 14  ? -29.625 -3.306  0.863   1.00 3.40  ? 463 THR H HB   1  
ATOM 10714  H HG1  . THR H 2 14  ? -30.947 -4.518  -0.277  1.00 74.45 ? 463 THR H HG1  1  
ATOM 10715  H HG21 . THR H 2 14  ? -31.408 -1.189  -0.404  1.00 23.21 ? 463 THR H HG21 1  
ATOM 10716  H HG22 . THR H 2 14  ? -30.477 -0.991  1.083   1.00 14.45 ? 463 THR H HG22 1  
ATOM 10717  H HG23 . THR H 2 14  ? -31.800 -2.156  1.023   1.00 34.53 ? 463 THR H HG23 1  
ATOM 10718  N N    . MET H 2 15  ? -28.086 -4.346  -1.840  1.00 21.20 ? 464 MET H N    1  
ATOM 10719  C CA   . MET H 2 15  ? -27.211 -5.502  -2.191  1.00 64.11 ? 464 MET H CA   1  
ATOM 10720  C C    . MET H 2 15  ? -26.706 -6.287  -0.951  1.00 63.42 ? 464 MET H C    1  
ATOM 10721  O O    . MET H 2 15  ? -25.789 -5.848  -0.242  1.00 45.35 ? 464 MET H O    1  
ATOM 10722  C CB   . MET H 2 15  ? -26.001 -5.083  -3.086  1.00 50.45 ? 464 MET H CB   1  
ATOM 10723  C CG   . MET H 2 15  ? -26.353 -4.642  -4.514  1.00 52.51 ? 464 MET H CG   1  
ATOM 10724  S SD   . MET H 2 15  ? -24.873 -4.302  -5.497  1.00 63.44 ? 464 MET H SD   1  
ATOM 10725  C CE   . MET H 2 15  ? -25.573 -3.854  -7.085  1.00 1.30  ? 464 MET H CE   1  
ATOM 10726  H H    . MET H 2 15  ? -28.998 -4.346  -2.199  1.00 22.43 ? 464 MET H H    1  
ATOM 10727  H HA   . MET H 2 15  ? -27.833 -6.171  -2.774  1.00 25.11 ? 464 MET H HA   1  
ATOM 10728  H HB2  . MET H 2 15  ? -25.486 -4.262  -2.604  1.00 45.43 ? 464 MET H HB2  1  
ATOM 10729  H HB3  . MET H 2 15  ? -25.309 -5.918  -3.162  1.00 10.51 ? 464 MET H HB3  1  
ATOM 10730  H HG2  . MET H 2 15  ? -26.919 -5.428  -4.997  1.00 43.11 ? 464 MET H HG2  1  
ATOM 10731  H HG3  . MET H 2 15  ? -26.955 -3.741  -4.469  1.00 2.10  ? 464 MET H HG3  1  
ATOM 10732  H HE1  . MET H 2 15  ? -24.775 -3.619  -7.775  1.00 20.41 ? 464 MET H HE1  1  
ATOM 10733  H HE2  . MET H 2 15  ? -26.212 -2.989  -6.969  1.00 63.34 ? 464 MET H HE2  1  
ATOM 10734  H HE3  . MET H 2 15  ? -26.151 -4.680  -7.472  1.00 63.34 ? 464 MET H HE3  1  
ATOM 10735  N N    . LYS H 2 16  ? -27.308 -7.469  -0.715  1.00 54.24 ? 465 LYS H N    1  
ATOM 10736  C CA   . LYS H 2 16  ? -26.883 -8.409  0.342   1.00 33.22 ? 465 LYS H CA   1  
ATOM 10737  C C    . LYS H 2 16  ? -26.346 -9.688  -0.327  1.00 74.21 ? 465 LYS H C    1  
ATOM 10738  O O    . LYS H 2 16  ? -26.898 -10.787 -0.167  1.00 42.50 ? 465 LYS H O    1  
ATOM 10739  C CB   . LYS H 2 16  ? -28.075 -8.699  1.304   1.00 21.21 ? 465 LYS H CB   1  
ATOM 10740  C CG   . LYS H 2 16  ? -27.724 -9.546  2.552   1.00 43.33 ? 465 LYS H CG   1  
ATOM 10741  C CD   . LYS H 2 16  ? -28.927 -9.742  3.504   1.00 30.22 ? 465 LYS H CD   1  
ATOM 10742  C CE   . LYS H 2 16  ? -29.462 -8.416  4.071   1.00 65.34 ? 465 LYS H CE   1  
ATOM 10743  N NZ   . LYS H 2 16  ? -30.602 -8.624  5.006   1.00 21.40 ? 465 LYS H NZ   1  
ATOM 10744  H H    . LYS H 2 16  ? -28.062 -7.723  -1.280  1.00 20.15 ? 465 LYS H H    1  
ATOM 10745  H HA   . LYS H 2 16  ? -26.075 -7.953  0.910   1.00 60.40 ? 465 LYS H HA   1  
ATOM 10746  H HB2  . LYS H 2 16  ? -28.475 -7.750  1.644   1.00 34.43 ? 465 LYS H HB2  1  
ATOM 10747  H HB3  . LYS H 2 16  ? -28.851 -9.215  0.748   1.00 22.34 ? 465 LYS H HB3  1  
ATOM 10748  H HG2  . LYS H 2 16  ? -27.374 -10.520 2.225   1.00 51.24 ? 465 LYS H HG2  1  
ATOM 10749  H HG3  . LYS H 2 16  ? -26.922 -9.054  3.096   1.00 31.31 ? 465 LYS H HG3  1  
ATOM 10750  H HD2  . LYS H 2 16  ? -29.726 -10.239 2.965   1.00 34.31 ? 465 LYS H HD2  1  
ATOM 10751  H HD3  . LYS H 2 16  ? -28.618 -10.375 4.330   1.00 34.32 ? 465 LYS H HD3  1  
ATOM 10752  H HE2  . LYS H 2 16  ? -28.665 -7.913  4.605   1.00 3.44  ? 465 LYS H HE2  1  
ATOM 10753  H HE3  . LYS H 2 16  ? -29.793 -7.787  3.253   1.00 62.22 ? 465 LYS H HE3  1  
ATOM 10754  H HZ1  . LYS H 2 16  ? -31.379 -9.121  4.525   1.00 14.42 ? 465 LYS H HZ1  1  
ATOM 10755  H HZ2  . LYS H 2 16  ? -30.958 -7.713  5.355   1.00 10.31 ? 465 LYS H HZ2  1  
ATOM 10756  H HZ3  . LYS H 2 16  ? -30.296 -9.199  5.821   1.00 1.55  ? 465 LYS H HZ3  1  
ATOM 10757  N N    . ALA H 2 17  ? -25.301 -9.495  -1.150  1.00 42.13 ? 466 ALA H N    1  
ATOM 10758  C CA   . ALA H 2 17  ? -24.598 -10.575 -1.866  1.00 40.55 ? 466 ALA H CA   1  
ATOM 10759  C C    . ALA H 2 17  ? -23.413 -9.970  -2.625  1.00 52.55 ? 466 ALA H C    1  
ATOM 10760  O O    . ALA H 2 17  ? -22.266 -10.108 -2.190  1.00 3.41  ? 466 ALA H O    1  
ATOM 10761  C CB   . ALA H 2 17  ? -25.524 -11.363 -2.829  1.00 52.33 ? 466 ALA H CB   1  
ATOM 10762  H H    . ALA H 2 17  ? -24.971 -8.581  -1.268  1.00 24.22 ? 466 ALA H H    1  
ATOM 10763  H HA   . ALA H 2 17  ? -24.214 -11.268 -1.118  1.00 72.50 ? 466 ALA H HA   1  
ATOM 10764  H HB1  . ALA H 2 17  ? -26.345 -11.792 -2.267  1.00 53.22 ? 466 ALA H HB1  1  
ATOM 10765  H HB2  . ALA H 2 17  ? -24.966 -12.161 -3.302  1.00 41.44 ? 466 ALA H HB2  1  
ATOM 10766  H HB3  . ALA H 2 17  ? -25.919 -10.702 -3.589  1.00 53.03 ? 466 ALA H HB3  1  
ATOM 10767  N N    . ALA H 2 18  ? -23.722 -9.281  -3.760  1.00 32.11 ? 467 ALA H N    1  
ATOM 10768  C CA   . ALA H 2 18  ? -22.718 -8.673  -4.669  1.00 72.30 ? 467 ALA H CA   1  
ATOM 10769  C C    . ALA H 2 18  ? -21.689 -9.708  -5.183  1.00 20.13 ? 467 ALA H C    1  
ATOM 10770  O O    . ALA H 2 18  ? -21.858 -10.913 -4.959  1.00 70.21 ? 467 ALA H O    1  
ATOM 10771  C CB   . ALA H 2 18  ? -22.027 -7.468  -3.989  1.00 31.13 ? 467 ALA H CB   1  
ATOM 10772  H H    . ALA H 2 18  ? -24.664 -9.180  -3.998  1.00 1.14  ? 467 ALA H H    1  
ATOM 10773  H HA   . ALA H 2 18  ? -23.261 -8.298  -5.530  1.00 15.55 ? 467 ALA H HA   1  
ATOM 10774  H HB1  . ALA H 2 18  ? -21.365 -6.979  -4.694  1.00 42.13 ? 467 ALA H HB1  1  
ATOM 10775  H HB2  . ALA H 2 18  ? -21.451 -7.806  -3.135  1.00 15.43 ? 467 ALA H HB2  1  
ATOM 10776  H HB3  . ALA H 2 18  ? -22.775 -6.762  -3.656  1.00 41.40 ? 467 ALA H HB3  1  
ATOM 10777  N N    . LEU H 2 19  ? -20.667 -9.209  -5.918  1.00 22.53 ? 468 LEU H N    1  
ATOM 10778  C CA   . LEU H 2 19  ? -19.488 -9.982  -6.383  1.00 32.44 ? 468 LEU H CA   1  
ATOM 10779  C C    . LEU H 2 19  ? -19.859 -11.234 -7.222  1.00 65.00 ? 468 LEU H C    1  
ATOM 10780  O O    . LEU H 2 19  ? -19.847 -11.202 -8.461  1.00 65.53 ? 468 LEU H O    1  
ATOM 10781  C CB   . LEU H 2 19  ? -18.567 -10.408 -5.191  1.00 23.10 ? 468 LEU H CB   1  
ATOM 10782  C CG   . LEU H 2 19  ? -17.992 -9.270  -4.296  1.00 55.21 ? 468 LEU H CG   1  
ATOM 10783  C CD1  . LEU H 2 19  ? -17.123 -9.866  -3.158  1.00 52.33 ? 468 LEU H CD1  1  
ATOM 10784  C CD2  . LEU H 2 19  ? -17.211 -8.239  -5.152  1.00 55.01 ? 468 LEU H CD2  1  
ATOM 10785  H H    . LEU H 2 19  ? -20.707 -8.261  -6.167  1.00 53.40 ? 468 LEU H H    1  
ATOM 10786  H HA   . LEU H 2 19  ? -18.923 -9.310  -7.017  1.00 20.03 ? 468 LEU H HA   1  
ATOM 10787  H HB2  . LEU H 2 19  ? -19.139 -11.077 -4.556  1.00 53.04 ? 468 LEU H HB2  1  
ATOM 10788  H HB3  . LEU H 2 19  ? -17.728 -10.971 -5.596  1.00 12.10 ? 468 LEU H HB3  1  
ATOM 10789  H HG   . LEU H 2 19  ? -18.816 -8.744  -3.824  1.00 4.13  ? 468 LEU H HG   1  
ATOM 10790  H HD11 . LEU H 2 19  ? -16.269 -10.388 -3.574  1.00 31.24 ? 468 LEU H HD11 1  
ATOM 10791  H HD12 . LEU H 2 19  ? -17.717 -10.561 -2.578  1.00 50.24 ? 468 LEU H HD12 1  
ATOM 10792  H HD13 . LEU H 2 19  ? -16.780 -9.076  -2.510  1.00 42.22 ? 468 LEU H HD13 1  
ATOM 10793  H HD21 . LEU H 2 19  ? -17.862 -7.835  -5.916  1.00 31.40 ? 468 LEU H HD21 1  
ATOM 10794  H HD22 . LEU H 2 19  ? -16.360 -8.714  -5.624  1.00 21.44 ? 468 LEU H HD22 1  
ATOM 10795  H HD23 . LEU H 2 19  ? -16.864 -7.431  -4.525  1.00 21.10 ? 468 LEU H HD23 1  
ATOM 10796  N N    . GLY H 2 20  ? -20.205 -12.314 -6.499  1.00 51.23 ? 469 GLY H N    1  
ATOM 10797  C CA   . GLY H 2 20  ? -20.349 -13.655 -7.035  1.00 51.34 ? 469 GLY H CA   1  
ATOM 10798  C C    . GLY H 2 20  ? -19.656 -14.629 -6.101  1.00 62.34 ? 469 GLY H C    1  
ATOM 10799  O O    . GLY H 2 20  ? -18.552 -15.088 -6.402  1.00 3.21  ? 469 GLY H O    1  
ATOM 10800  H H    . GLY H 2 20  ? -20.380 -12.185 -5.542  1.00 73.42 ? 469 GLY H H    1  
ATOM 10801  H HA2  . GLY H 2 20  ? -21.403 -13.897 -7.105  1.00 72.13 ? 469 GLY H HA2  1  
ATOM 10802  H HA3  . GLY H 2 20  ? -19.903 -13.728 -8.024  1.00 5.35  ? 469 GLY H HA3  1  
ATOM 10803  N N    . LEU H 2 21  ? -20.273 -14.864 -4.918  1.00 23.45 ? 470 LEU H N    1  
ATOM 10804  C CA   . LEU H 2 21  ? -19.752 -15.792 -3.895  1.00 23.13 ? 470 LEU H CA   1  
ATOM 10805  C C    . LEU H 2 21  ? -19.758 -17.231 -4.463  1.00 60.34 ? 470 LEU H C    1  
ATOM 10806  O O    . LEU H 2 21  ? -20.827 -17.768 -4.780  1.00 25.12 ? 470 LEU H O    1  
ATOM 10807  C CB   . LEU H 2 21  ? -20.594 -15.724 -2.570  1.00 53.23 ? 470 LEU H CB   1  
ATOM 10808  C CG   . LEU H 2 21  ? -20.464 -14.435 -1.670  1.00 23.41 ? 470 LEU H CG   1  
ATOM 10809  C CD1  . LEU H 2 21  ? -18.999 -14.109 -1.345  1.00 24.52 ? 470 LEU H CD1  1  
ATOM 10810  C CD2  . LEU H 2 21  ? -21.180 -13.209 -2.274  1.00 61.01 ? 470 LEU H CD2  1  
ATOM 10811  H H    . LEU H 2 21  ? -21.119 -14.410 -4.742  1.00 61.22 ? 470 LEU H H    1  
ATOM 10812  H HA   . LEU H 2 21  ? -18.724 -15.498 -3.675  1.00 53.14 ? 470 LEU H HA   1  
ATOM 10813  H HB2  . LEU H 2 21  ? -21.638 -15.841 -2.837  1.00 20.15 ? 470 LEU H HB2  1  
ATOM 10814  H HB3  . LEU H 2 21  ? -20.318 -16.580 -1.955  1.00 74.23 ? 470 LEU H HB3  1  
ATOM 10815  H HG   . LEU H 2 21  ? -20.945 -14.643 -0.721  1.00 51.43 ? 470 LEU H HG   1  
ATOM 10816  H HD11 . LEU H 2 21  ? -18.462 -13.853 -2.248  1.00 51.34 ? 470 LEU H HD11 1  
ATOM 10817  H HD12 . LEU H 2 21  ? -18.529 -14.971 -0.885  1.00 11.22 ? 470 LEU H HD12 1  
ATOM 10818  H HD13 . LEU H 2 21  ? -18.949 -13.274 -0.648  1.00 50.20 ? 470 LEU H HD13 1  
ATOM 10819  H HD21 . LEU H 2 21  ? -22.228 -13.441 -2.417  1.00 74.23 ? 470 LEU H HD21 1  
ATOM 10820  H HD22 . LEU H 2 21  ? -20.740 -12.955 -3.230  1.00 74.55 ? 470 LEU H HD22 1  
ATOM 10821  H HD23 . LEU H 2 21  ? -21.095 -12.361 -1.603  1.00 22.41 ? 470 LEU H HD23 1  
ATOM 10822  N N    . LYS H 2 22  ? -18.552 -17.815 -4.609  1.00 1.25  ? 471 LYS H N    1  
ATOM 10823  C CA   . LYS H 2 22  ? -18.353 -19.172 -5.173  1.00 31.34 ? 471 LYS H CA   1  
ATOM 10824  C C    . LYS H 2 22  ? -18.983 -20.241 -4.248  1.00 43.05 ? 471 LYS H C    1  
ATOM 10825  O O    . LYS H 2 22  ? -19.868 -20.994 -4.683  1.00 61.01 ? 471 LYS H O    1  
ATOM 10826  C CB   . LYS H 2 22  ? -16.831 -19.473 -5.416  1.00 15.10 ? 471 LYS H CB   1  
ATOM 10827  C CG   . LYS H 2 22  ? -16.218 -18.814 -6.683  1.00 30.52 ? 471 LYS H CG   1  
ATOM 10828  C CD   . LYS H 2 22  ? -16.194 -17.272 -6.634  1.00 62.24 ? 471 LYS H CD   1  
ATOM 10829  C CE   . LYS H 2 22  ? -15.687 -16.636 -7.940  1.00 65.11 ? 471 LYS H CE   1  
ATOM 10830  N NZ   . LYS H 2 22  ? -15.831 -15.153 -7.928  1.00 3.43  ? 471 LYS H NZ   1  
ATOM 10831  O OXT  . LYS H 2 22  ? -18.619 -20.288 -3.074  1.00 37.65 ? 471 LYS H OXT  1  
ATOM 10832  H H    . LYS H 2 22  ? -17.764 -17.319 -4.317  1.00 10.52 ? 471 LYS H H    1  
ATOM 10833  H HA   . LYS H 2 22  ? -18.864 -19.194 -6.136  1.00 3.34  ? 471 LYS H HA   1  
ATOM 10834  H HB2  . LYS H 2 22  ? -16.263 -19.134 -4.554  1.00 50.21 ? 471 LYS H HB2  1  
ATOM 10835  H HB3  . LYS H 2 22  ? -16.697 -20.548 -5.507  1.00 35.32 ? 471 LYS H HB3  1  
ATOM 10836  H HG2  . LYS H 2 22  ? -15.203 -19.171 -6.804  1.00 3.34  ? 471 LYS H HG2  1  
ATOM 10837  H HG3  . LYS H 2 22  ? -16.803 -19.128 -7.545  1.00 43.21 ? 471 LYS H HG3  1  
ATOM 10838  H HD2  . LYS H 2 22  ? -17.202 -16.913 -6.449  1.00 13.13 ? 471 LYS H HD2  1  
ATOM 10839  H HD3  . LYS H 2 22  ? -15.555 -16.953 -5.817  1.00 32.35 ? 471 LYS H HD3  1  
ATOM 10840  H HE2  . LYS H 2 22  ? -14.640 -16.886 -8.076  1.00 62.23 ? 471 LYS H HE2  1  
ATOM 10841  H HE3  . LYS H 2 22  ? -16.257 -17.035 -8.774  1.00 12.35 ? 471 LYS H HE3  1  
ATOM 10842  H HZ1  . LYS H 2 22  ? -16.828 -14.893 -7.770  1.00 53.41 ? 471 LYS H HZ1  1  
ATOM 10843  H HZ2  . LYS H 2 22  ? -15.523 -14.752 -8.835  1.00 4.20  ? 471 LYS H HZ2  1  
ATOM 10844  H HZ3  . LYS H 2 22  ? -15.257 -14.741 -7.168  1.00 51.42 ? 471 LYS H HZ3  1  
ATOM 10845  N N    . MET A 1 1   ? 18.287  4.540   14.537  1.00 72.53 ? 1   MET A N    2  
ATOM 10846  C CA   . MET A 1 1   ? 17.894  5.312   15.745  1.00 53.15 ? 1   MET A CA   2  
ATOM 10847  C C    . MET A 1 1   ? 18.431  4.593   16.992  1.00 50.13 ? 1   MET A C    2  
ATOM 10848  O O    . MET A 1 1   ? 18.340  3.359   17.061  1.00 72.02 ? 1   MET A O    2  
ATOM 10849  C CB   . MET A 1 1   ? 16.349  5.481   15.814  1.00 54.40 ? 1   MET A CB   2  
ATOM 10850  C CG   . MET A 1 1   ? 15.862  6.499   16.856  1.00 13.51 ? 1   MET A CG   2  
ATOM 10851  S SD   . MET A 1 1   ? 16.321  8.200   16.436  1.00 12.45 ? 1   MET A SD   2  
ATOM 10852  C CE   . MET A 1 1   ? 15.569  9.134   17.778  1.00 62.40 ? 1   MET A CE   2  
ATOM 10853  H H1   . MET A 1 1   ? 17.897  3.574   14.590  1.00 37.56 ? 1   MET A H1   2  
ATOM 10854  H H2   . MET A 1 1   ? 19.322  4.481   14.479  1.00 37.56 ? 1   MET A H2   2  
ATOM 10855  H H3   . MET A 1 1   ? 17.927  5.001   13.681  1.00 37.56 ? 1   MET A H3   2  
ATOM 10856  H HA   . MET A 1 1   ? 18.364  6.287   15.670  1.00 74.32 ? 1   MET A HA   2  
ATOM 10857  H HB2  . MET A 1 1   ? 15.990  5.802   14.842  1.00 14.31 ? 1   MET A HB2  2  
ATOM 10858  H HB3  . MET A 1 1   ? 15.897  4.518   16.040  1.00 43.31 ? 1   MET A HB3  2  
ATOM 10859  H HG2  . MET A 1 1   ? 14.782  6.443   16.928  1.00 52.41 ? 1   MET A HG2  2  
ATOM 10860  H HG3  . MET A 1 1   ? 16.295  6.251   17.817  1.00 33.10 ? 1   MET A HG3  2  
ATOM 10861  H HE1  . MET A 1 1   ? 15.999  8.823   18.720  1.00 31.55 ? 1   MET A HE1  2  
ATOM 10862  H HE2  . MET A 1 1   ? 14.503  8.954   17.793  1.00 73.11 ? 1   MET A HE2  2  
ATOM 10863  H HE3  . MET A 1 1   ? 15.752  10.188  17.630  1.00 35.40 ? 1   MET A HE3  2  
ATOM 10864  N N    . SER A 1 2   ? 18.997  5.383   17.945  1.00 2.33  ? 2   SER A N    2  
ATOM 10865  C CA   . SER A 1 2   ? 19.622  4.907   19.209  1.00 61.13 ? 2   SER A CA   2  
ATOM 10866  C C    . SER A 1 2   ? 20.760  3.886   18.959  1.00 34.41 ? 2   SER A C    2  
ATOM 10867  O O    . SER A 1 2   ? 20.505  2.691   18.750  1.00 62.31 ? 2   SER A O    2  
ATOM 10868  C CB   . SER A 1 2   ? 18.560  4.381   20.228  1.00 63.21 ? 2   SER A CB   2  
ATOM 10869  O OG   . SER A 1 2   ? 17.776  3.325   19.700  1.00 14.23 ? 2   SER A OG   2  
ATOM 10870  H H    . SER A 1 2   ? 19.001  6.349   17.783  1.00 51.50 ? 2   SER A H    2  
ATOM 10871  H HA   . SER A 1 2   ? 20.078  5.788   19.651  1.00 70.11 ? 2   SER A HA   2  
ATOM 10872  H HB2  . SER A 1 2   ? 19.057  4.020   21.117  1.00 44.22 ? 2   SER A HB2  2  
ATOM 10873  H HB3  . SER A 1 2   ? 17.896  5.193   20.505  1.00 31.42 ? 2   SER A HB3  2  
ATOM 10874  H HG   . SER A 1 2   ? 18.347  2.726   19.213  1.00 62.32 ? 2   SER A HG   2  
ATOM 10875  N N    . GLU A 1 3   ? 22.019  4.384   18.956  1.00 71.35 ? 3   GLU A N    2  
ATOM 10876  C CA   . GLU A 1 3   ? 23.214  3.540   18.749  1.00 25.14 ? 3   GLU A CA   2  
ATOM 10877  C C    . GLU A 1 3   ? 23.660  2.911   20.075  1.00 71.14 ? 3   GLU A C    2  
ATOM 10878  O O    . GLU A 1 3   ? 23.470  3.496   21.145  1.00 21.12 ? 3   GLU A O    2  
ATOM 10879  C CB   . GLU A 1 3   ? 24.397  4.343   18.119  1.00 73.52 ? 3   GLU A CB   2  
ATOM 10880  C CG   . GLU A 1 3   ? 25.131  5.347   19.038  1.00 22.50 ? 3   GLU A CG   2  
ATOM 10881  C CD   . GLU A 1 3   ? 24.304  6.592   19.391  1.00 1.54  ? 3   GLU A CD   2  
ATOM 10882  O OE1  . GLU A 1 3   ? 23.536  6.560   20.380  1.00 11.35 ? 3   GLU A OE1  2  
ATOM 10883  O OE2  . GLU A 1 3   ? 24.417  7.605   18.679  1.00 4.51  ? 3   GLU A OE2  2  
ATOM 10884  H H    . GLU A 1 3   ? 22.146  5.345   19.116  1.00 34.11 ? 3   GLU A H    2  
ATOM 10885  H HA   . GLU A 1 3   ? 22.940  2.744   18.065  1.00 44.42 ? 3   GLU A HA   2  
ATOM 10886  H HB2  . GLU A 1 3   ? 25.133  3.633   17.749  1.00 43.20 ? 3   GLU A HB2  2  
ATOM 10887  H HB3  . GLU A 1 3   ? 24.013  4.889   17.266  1.00 11.11 ? 3   GLU A HB3  2  
ATOM 10888  H HG2  . GLU A 1 3   ? 25.410  4.840   19.956  1.00 20.14 ? 3   GLU A HG2  2  
ATOM 10889  H HG3  . GLU A 1 3   ? 26.044  5.664   18.540  1.00 44.04 ? 3   GLU A HG3  2  
ATOM 10890  N N    . GLN A 1 4   ? 24.260  1.717   19.995  1.00 4.12  ? 4   GLN A N    2  
ATOM 10891  C CA   . GLN A 1 4   ? 24.795  1.005   21.170  1.00 23.32 ? 4   GLN A CA   2  
ATOM 10892  C C    . GLN A 1 4   ? 26.305  1.218   21.227  1.00 4.13  ? 4   GLN A C    2  
ATOM 10893  O O    . GLN A 1 4   ? 27.089  0.253   21.226  1.00 53.43 ? 4   GLN A O    2  
ATOM 10894  C CB   . GLN A 1 4   ? 24.430  -0.518  21.134  1.00 41.23 ? 4   GLN A CB   2  
ATOM 10895  C CG   . GLN A 1 4   ? 22.913  -0.806  21.107  1.00 21.01 ? 4   GLN A CG   2  
ATOM 10896  C CD   . GLN A 1 4   ? 22.247  -0.410  19.785  1.00 0.21  ? 4   GLN A CD   2  
ATOM 10897  O OE1  . GLN A 1 4   ? 22.832  -0.542  18.707  1.00 22.22 ? 4   GLN A OE1  2  
ATOM 10898  N NE2  . GLN A 1 4   ? 21.070  0.153   19.870  1.00 53.33 ? 4   GLN A NE2  2  
ATOM 10899  H H    . GLN A 1 4   ? 24.329  1.289   19.114  1.00 42.45 ? 4   GLN A H    2  
ATOM 10900  H HA   . GLN A 1 4   ? 24.358  1.441   22.069  1.00 54.25 ? 4   GLN A HA   2  
ATOM 10901  H HB2  . GLN A 1 4   ? 24.881  -0.973  20.258  1.00 40.01 ? 4   GLN A HB2  2  
ATOM 10902  H HB3  . GLN A 1 4   ? 24.846  -0.995  22.018  1.00 33.31 ? 4   GLN A HB3  2  
ATOM 10903  H HG2  . GLN A 1 4   ? 22.753  -1.862  21.260  1.00 52.22 ? 4   GLN A HG2  2  
ATOM 10904  H HG3  . GLN A 1 4   ? 22.447  -0.255  21.919  1.00 51.53 ? 4   GLN A HG3  2  
ATOM 10905  H HE21 . GLN A 1 4   ? 20.692  0.290   20.760  1.00 15.34 ? 4   GLN A HE21 2  
ATOM 10906  H HE22 . GLN A 1 4   ? 20.645  0.458   19.046  1.00 63.44 ? 4   GLN A HE22 2  
ATOM 10907  N N    . ASN A 1 5   ? 26.705  2.504   21.249  1.00 24.14 ? 5   ASN A N    2  
ATOM 10908  C CA   . ASN A 1 5   ? 28.116  2.879   21.347  1.00 3.05  ? 5   ASN A CA   2  
ATOM 10909  C C    . ASN A 1 5   ? 28.652  2.469   22.720  1.00 1.11  ? 5   ASN A C    2  
ATOM 10910  O O    . ASN A 1 5   ? 28.301  3.086   23.732  1.00 31.44 ? 5   ASN A O    2  
ATOM 10911  C CB   . ASN A 1 5   ? 28.331  4.395   21.095  1.00 54.32 ? 5   ASN A CB   2  
ATOM 10912  C CG   . ASN A 1 5   ? 29.810  4.815   21.225  1.00 31.21 ? 5   ASN A CG   2  
ATOM 10913  O OD1  . ASN A 1 5   ? 30.583  4.746   20.272  1.00 43.43 ? 5   ASN A OD1  2  
ATOM 10914  N ND2  . ASN A 1 5   ? 30.211  5.251   22.406  1.00 2.01  ? 5   ASN A ND2  2  
ATOM 10915  H H    . ASN A 1 5   ? 26.029  3.214   21.212  1.00 52.24 ? 5   ASN A H    2  
ATOM 10916  H HA   . ASN A 1 5   ? 28.649  2.324   20.580  1.00 74.12 ? 5   ASN A HA   2  
ATOM 10917  H HB2  . ASN A 1 5   ? 27.991  4.643   20.092  1.00 21.34 ? 5   ASN A HB2  2  
ATOM 10918  H HB3  . ASN A 1 5   ? 27.741  4.963   21.809  1.00 0.44  ? 5   ASN A HB3  2  
ATOM 10919  H HD21 . ASN A 1 5   ? 29.554  5.293   23.134  1.00 12.11 ? 5   ASN A HD21 2  
ATOM 10920  H HD22 . ASN A 1 5   ? 31.149  5.513   22.506  1.00 32.44 ? 5   ASN A HD22 2  
ATOM 10921  N N    . ASN A 1 6   ? 29.459  1.393   22.740  1.00 55.32 ? 6   ASN A N    2  
ATOM 10922  C CA   . ASN A 1 6   ? 30.055  0.875   23.969  1.00 45.20 ? 6   ASN A CA   2  
ATOM 10923  C C    . ASN A 1 6   ? 31.104  1.881   24.473  1.00 64.31 ? 6   ASN A C    2  
ATOM 10924  O O    . ASN A 1 6   ? 30.814  2.687   25.361  1.00 0.14  ? 6   ASN A O    2  
ATOM 10925  C CB   . ASN A 1 6   ? 30.658  -0.539  23.730  1.00 25.44 ? 6   ASN A CB   2  
ATOM 10926  C CG   . ASN A 1 6   ? 31.116  -1.214  25.026  1.00 65.24 ? 6   ASN A CG   2  
ATOM 10927  O OD1  . ASN A 1 6   ? 30.348  -1.927  25.670  1.00 21.24 ? 6   ASN A OD1  2  
ATOM 10928  N ND2  . ASN A 1 6   ? 32.356  -0.984  25.423  1.00 41.23 ? 6   ASN A ND2  2  
ATOM 10929  H H    . ASN A 1 6   ? 29.657  0.939   21.892  1.00 71.12 ? 6   ASN A H    2  
ATOM 10930  H HA   . ASN A 1 6   ? 29.265  0.797   24.712  1.00 25.22 ? 6   ASN A HA   2  
ATOM 10931  H HB2  . ASN A 1 6   ? 29.908  -1.170  23.263  1.00 43.04 ? 6   ASN A HB2  2  
ATOM 10932  H HB3  . ASN A 1 6   ? 31.507  -0.459  23.057  1.00 31.44 ? 6   ASN A HB3  2  
ATOM 10933  H HD21 . ASN A 1 6   ? 32.925  -0.407  24.867  1.00 15.14 ? 6   ASN A HD21 2  
ATOM 10934  H HD22 . ASN A 1 6   ? 32.649  -1.385  26.264  1.00 51.03 ? 6   ASN A HD22 2  
ATOM 10935  N N    . THR A 1 7   ? 32.303  1.861   23.867  1.00 42.22 ? 7   THR A N    2  
ATOM 10936  C CA   . THR A 1 7   ? 33.399  2.788   24.216  1.00 11.21 ? 7   THR A CA   2  
ATOM 10937  C C    . THR A 1 7   ? 34.235  3.148   22.969  1.00 0.42  ? 7   THR A C    2  
ATOM 10938  O O    . THR A 1 7   ? 35.178  3.931   23.069  1.00 62.43 ? 7   THR A O    2  
ATOM 10939  C CB   . THR A 1 7   ? 34.333  2.178   25.332  1.00 31.52 ? 7   THR A CB   2  
ATOM 10940  O OG1  . THR A 1 7   ? 34.619  0.807   25.025  1.00 72.50 ? 7   THR A OG1  2  
ATOM 10941  C CG2  . THR A 1 7   ? 33.721  2.257   26.740  1.00 24.15 ? 7   THR A CG2  2  
ATOM 10942  H H    . THR A 1 7   ? 32.465  1.196   23.167  1.00 1.33  ? 7   THR A H    2  
ATOM 10943  H HA   . THR A 1 7   ? 32.962  3.710   24.599  1.00 54.31 ? 7   THR A HA   2  
ATOM 10944  H HB   . THR A 1 7   ? 35.274  2.725   25.342  1.00 65.50 ? 7   THR A HB   2  
ATOM 10945  H HG1  . THR A 1 7   ? 35.116  0.760   24.205  1.00 73.12 ? 7   THR A HG1  2  
ATOM 10946  H HG21 . THR A 1 7   ? 32.790  1.703   26.765  1.00 4.35  ? 7   THR A HG21 2  
ATOM 10947  H HG22 . THR A 1 7   ? 33.526  3.291   26.995  1.00 61.42 ? 7   THR A HG22 2  
ATOM 10948  H HG23 . THR A 1 7   ? 34.407  1.834   27.461  1.00 50.41 ? 7   THR A HG23 2  
ATOM 10949  N N    . GLU A 1 8   ? 33.860  2.599   21.797  1.00 3.32  ? 8   GLU A N    2  
ATOM 10950  C CA   . GLU A 1 8   ? 34.634  2.756   20.547  1.00 3.12  ? 8   GLU A CA   2  
ATOM 10951  C C    . GLU A 1 8   ? 33.745  2.463   19.326  1.00 65.23 ? 8   GLU A C    2  
ATOM 10952  O O    . GLU A 1 8   ? 33.768  3.200   18.333  1.00 74.33 ? 8   GLU A O    2  
ATOM 10953  C CB   . GLU A 1 8   ? 35.897  1.821   20.529  1.00 24.15 ? 8   GLU A CB   2  
ATOM 10954  C CG   . GLU A 1 8   ? 35.615  0.295   20.485  1.00 32.41 ? 8   GLU A CG   2  
ATOM 10955  C CD   . GLU A 1 8   ? 34.902  -0.253  21.745  1.00 14.15 ? 8   GLU A CD   2  
ATOM 10956  O OE1  . GLU A 1 8   ? 33.651  -0.260  21.819  1.00 30.43 ? 8   GLU A OE1  2  
ATOM 10957  O OE2  . GLU A 1 8   ? 35.596  -0.667  22.677  1.00 33.33 ? 8   GLU A OE2  2  
ATOM 10958  H H    . GLU A 1 8   ? 33.036  2.075   21.770  1.00 0.35  ? 8   GLU A H    2  
ATOM 10959  H HA   . GLU A 1 8   ? 34.960  3.790   20.497  1.00 3.04  ? 8   GLU A HA   2  
ATOM 10960  H HB2  . GLU A 1 8   ? 36.508  2.071   19.664  1.00 50.44 ? 8   GLU A HB2  2  
ATOM 10961  H HB3  . GLU A 1 8   ? 36.485  2.022   21.416  1.00 20.24 ? 8   GLU A HB3  2  
ATOM 10962  H HG2  . GLU A 1 8   ? 35.001  0.087   19.614  1.00 40.31 ? 8   GLU A HG2  2  
ATOM 10963  H HG3  . GLU A 1 8   ? 36.559  -0.222  20.365  1.00 2.40  ? 8   GLU A HG3  2  
ATOM 10964  N N    . MET A 1 9   ? 32.973  1.365   19.408  1.00 70.13 ? 9   MET A N    2  
ATOM 10965  C CA   . MET A 1 9   ? 32.158  0.879   18.300  1.00 11.41 ? 9   MET A CA   2  
ATOM 10966  C C    . MET A 1 9   ? 30.823  1.592   18.292  1.00 32.53 ? 9   MET A C    2  
ATOM 10967  O O    . MET A 1 9   ? 30.269  1.897   19.345  1.00 1.12  ? 9   MET A O    2  
ATOM 10968  C CB   . MET A 1 9   ? 31.971  -0.664  18.348  1.00 3.33  ? 9   MET A CB   2  
ATOM 10969  C CG   . MET A 1 9   ? 31.254  -1.208  19.594  1.00 30.10 ? 9   MET A CG   2  
ATOM 10970  S SD   . MET A 1 9   ? 30.914  -2.985  19.500  1.00 20.30 ? 9   MET A SD   2  
ATOM 10971  C CE   . MET A 1 9   ? 32.557  -3.688  19.299  1.00 44.14 ? 9   MET A CE   2  
ATOM 10972  H H    . MET A 1 9   ? 32.954  0.871   20.247  1.00 73.50 ? 9   MET A H    2  
ATOM 10973  H HA   . MET A 1 9   ? 32.683  1.128   17.378  1.00 44.31 ? 9   MET A HA   2  
ATOM 10974  H HB2  . MET A 1 9   ? 31.402  -0.973  17.478  1.00 24.30 ? 9   MET A HB2  2  
ATOM 10975  H HB3  . MET A 1 9   ? 32.947  -1.127  18.291  1.00 73.23 ? 9   MET A HB3  2  
ATOM 10976  H HG2  . MET A 1 9   ? 31.867  -1.020  20.467  1.00 42.44 ? 9   MET A HG2  2  
ATOM 10977  H HG3  . MET A 1 9   ? 30.319  -0.685  19.704  1.00 53.31 ? 9   MET A HG3  2  
ATOM 10978  H HE1  . MET A 1 9   ? 32.485  -4.766  19.266  1.00 24.52 ? 9   MET A HE1  2  
ATOM 10979  H HE2  . MET A 1 9   ? 33.179  -3.397  20.132  1.00 60.24 ? 9   MET A HE2  2  
ATOM 10980  H HE3  . MET A 1 9   ? 32.996  -3.330  18.379  1.00 2.10  ? 9   MET A HE3  2  
ATOM 10981  N N    . THR A 1 10  ? 30.317  1.854   17.095  1.00 11.44 ? 10  THR A N    2  
ATOM 10982  C CA   . THR A 1 10  ? 29.078  2.598   16.890  1.00 33.22 ? 10  THR A CA   2  
ATOM 10983  C C    . THR A 1 10  ? 28.307  1.958   15.741  1.00 24.31 ? 10  THR A C    2  
ATOM 10984  O O    . THR A 1 10  ? 28.895  1.616   14.706  1.00 42.42 ? 10  THR A O    2  
ATOM 10985  C CB   . THR A 1 10  ? 29.368  4.103   16.550  1.00 33.33 ? 10  THR A CB   2  
ATOM 10986  O OG1  . THR A 1 10  ? 30.290  4.650   17.508  1.00 44.10 ? 10  THR A OG1  2  
ATOM 10987  C CG2  . THR A 1 10  ? 28.084  4.957   16.535  1.00 61.52 ? 10  THR A CG2  2  
ATOM 10988  H H    . THR A 1 10  ? 30.797  1.524   16.305  1.00 71.13 ? 10  THR A H    2  
ATOM 10989  H HA   . THR A 1 10  ? 28.481  2.550   17.803  1.00 70.14 ? 10  THR A HA   2  
ATOM 10990  H HB   . THR A 1 10  ? 29.834  4.160   15.566  1.00 52.02 ? 10  THR A HB   2  
ATOM 10991  H HG1  . THR A 1 10  ? 30.310  4.093   18.294  1.00 21.44 ? 10  THR A HG1  2  
ATOM 10992  H HG21 . THR A 1 10  ? 28.326  5.972   16.262  1.00 4.12  ? 10  THR A HG21 2  
ATOM 10993  H HG22 . THR A 1 10  ? 27.632  4.954   17.519  1.00 15.12 ? 10  THR A HG22 2  
ATOM 10994  H HG23 . THR A 1 10  ? 27.384  4.551   15.818  1.00 5.41  ? 10  THR A HG23 2  
ATOM 10995  N N    . PHE A 1 11  ? 27.005  1.769   15.951  1.00 32.44 ? 11  PHE A N    2  
ATOM 10996  C CA   . PHE A 1 11  ? 26.084  1.352   14.905  1.00 71.24 ? 11  PHE A CA   2  
ATOM 10997  C C    . PHE A 1 11  ? 24.823  2.186   15.020  1.00 0.13  ? 11  PHE A C    2  
ATOM 10998  O O    . PHE A 1 11  ? 24.045  2.023   15.968  1.00 23.30 ? 11  PHE A O    2  
ATOM 10999  C CB   . PHE A 1 11  ? 25.734  -0.154  14.984  1.00 55.24 ? 11  PHE A CB   2  
ATOM 11000  C CG   . PHE A 1 11  ? 24.685  -0.567  13.951  1.00 24.20 ? 11  PHE A CG   2  
ATOM 11001  C CD1  . PHE A 1 11  ? 23.490  -1.178  14.319  1.00 42.10 ? 11  PHE A CD1  2  
ATOM 11002  C CD2  . PHE A 1 11  ? 24.891  -0.310  12.601  1.00 41.01 ? 11  PHE A CD2  2  
ATOM 11003  C CE1  . PHE A 1 11  ? 22.551  -1.520  13.360  1.00 31.43 ? 11  PHE A CE1  2  
ATOM 11004  C CE2  . PHE A 1 11  ? 23.948  -0.660  11.670  1.00 52.33 ? 11  PHE A CE2  2  
ATOM 11005  C CZ   . PHE A 1 11  ? 22.785  -1.263  12.046  1.00 13.23 ? 11  PHE A CZ   2  
ATOM 11006  H H    . PHE A 1 11  ? 26.644  1.956   16.843  1.00 73.34 ? 11  PHE A H    2  
ATOM 11007  H HA   . PHE A 1 11  ? 26.550  1.550   13.937  1.00 62.22 ? 11  PHE A HA   2  
ATOM 11008  H HB2  . PHE A 1 11  ? 26.632  -0.741  14.805  1.00 53.11 ? 11  PHE A HB2  2  
ATOM 11009  H HB3  . PHE A 1 11  ? 25.358  -0.387  15.975  1.00 62.33 ? 11  PHE A HB3  2  
ATOM 11010  H HD1  . PHE A 1 11  ? 23.299  -1.387  15.364  1.00 15.42 ? 11  PHE A HD1  2  
ATOM 11011  H HD2  . PHE A 1 11  ? 25.800  0.182   12.283  1.00 2.00  ? 11  PHE A HD2  2  
ATOM 11012  H HE1  . PHE A 1 11  ? 21.646  -2.006  13.639  1.00 74.35 ? 11  PHE A HE1  2  
ATOM 11013  H HE2  . PHE A 1 11  ? 24.113  -0.463  10.639  1.00 20.12 ? 11  PHE A HE2  2  
ATOM 11014  H HZ   . PHE A 1 11  ? 22.048  -1.531  11.299  1.00 74.13 ? 11  PHE A HZ   2  
ATOM 11015  N N    . GLN A 1 12  ? 24.612  3.036   14.031  1.00 31.52 ? 12  GLN A N    2  
ATOM 11016  C CA   . GLN A 1 12  ? 23.459  3.912   13.958  1.00 24.40 ? 12  GLN A CA   2  
ATOM 11017  C C    . GLN A 1 12  ? 22.926  3.892   12.535  1.00 10.43 ? 12  GLN A C    2  
ATOM 11018  O O    . GLN A 1 12  ? 23.670  4.121   11.582  1.00 24.11 ? 12  GLN A O    2  
ATOM 11019  C CB   . GLN A 1 12  ? 23.851  5.349   14.401  1.00 0.14  ? 12  GLN A CB   2  
ATOM 11020  C CG   . GLN A 1 12  ? 22.832  6.456   14.059  1.00 15.42 ? 12  GLN A CG   2  
ATOM 11021  C CD   . GLN A 1 12  ? 21.452  6.322   14.717  1.00 33.34 ? 12  GLN A CD   2  
ATOM 11022  O OE1  . GLN A 1 12  ? 21.296  5.752   15.797  1.00 41.32 ? 12  GLN A OE1  2  
ATOM 11023  N NE2  . GLN A 1 12  ? 20.441  6.887   14.068  1.00 35.21 ? 12  GLN A NE2  2  
ATOM 11024  H H    . GLN A 1 12  ? 25.274  3.082   13.304  1.00 34.43 ? 12  GLN A H    2  
ATOM 11025  H HA   . GLN A 1 12  ? 22.694  3.527   14.627  1.00 32.33 ? 12  GLN A HA   2  
ATOM 11026  H HB2  . GLN A 1 12  ? 23.997  5.350   15.476  1.00 24.22 ? 12  GLN A HB2  2  
ATOM 11027  H HB3  . GLN A 1 12  ? 24.796  5.608   13.931  1.00 61.44 ? 12  GLN A HB3  2  
ATOM 11028  H HG2  . GLN A 1 12  ? 23.246  7.406   14.363  1.00 4.14  ? 12  GLN A HG2  2  
ATOM 11029  H HG3  . GLN A 1 12  ? 22.699  6.469   12.982  1.00 44.10 ? 12  GLN A HG3  2  
ATOM 11030  H HE21 . GLN A 1 12  ? 20.637  7.343   13.217  1.00 51.34 ? 12  GLN A HE21 2  
ATOM 11031  H HE22 . GLN A 1 12  ? 19.559  6.867   14.470  1.00 0.43  ? 12  GLN A HE22 2  
ATOM 11032  N N    . ILE A 1 13  ? 21.642  3.564   12.397  1.00 65.23 ? 13  ILE A N    2  
ATOM 11033  C CA   . ILE A 1 13  ? 20.959  3.654   11.120  1.00 40.13 ? 13  ILE A CA   2  
ATOM 11034  C C    . ILE A 1 13  ? 20.360  5.049   10.981  1.00 11.13 ? 13  ILE A C    2  
ATOM 11035  O O    . ILE A 1 13  ? 19.439  5.422   11.735  1.00 4.03  ? 13  ILE A O    2  
ATOM 11036  C CB   . ILE A 1 13  ? 19.849  2.575   10.964  1.00 73.14 ? 13  ILE A CB   2  
ATOM 11037  C CG1  . ILE A 1 13  ? 20.443  1.159   11.184  1.00 62.22 ? 13  ILE A CG1  2  
ATOM 11038  C CG2  . ILE A 1 13  ? 19.186  2.690   9.566   1.00 24.44 ? 13  ILE A CG2  2  
ATOM 11039  C CD1  . ILE A 1 13  ? 19.445  0.029   11.048  1.00 51.01 ? 13  ILE A CD1  2  
ATOM 11040  H H    . ILE A 1 13  ? 21.149  3.246   13.179  1.00 10.43 ? 13  ILE A H    2  
ATOM 11041  H HA   . ILE A 1 13  ? 21.697  3.495   10.322  1.00 23.25 ? 13  ILE A HA   2  
ATOM 11042  H HB   . ILE A 1 13  ? 19.084  2.759   11.717  1.00 25.12 ? 13  ILE A HB   2  
ATOM 11043  H HG12 . ILE A 1 13  ? 21.217  0.987   10.450  1.00 21.33 ? 13  ILE A HG12 2  
ATOM 11044  H HG13 . ILE A 1 13  ? 20.891  1.093   12.169  1.00 63.33 ? 13  ILE A HG13 2  
ATOM 11045  H HG21 . ILE A 1 13  ? 18.614  1.799   9.356   1.00 35.21 ? 13  ILE A HG21 2  
ATOM 11046  H HG22 . ILE A 1 13  ? 19.942  2.810   8.801   1.00 54.24 ? 13  ILE A HG22 2  
ATOM 11047  H HG23 . ILE A 1 13  ? 18.515  3.540   9.542   1.00 11.23 ? 13  ILE A HG23 2  
ATOM 11048  H HD11 . ILE A 1 13  ? 19.101  -0.019  10.024  1.00 34.34 ? 13  ILE A HD11 2  
ATOM 11049  H HD12 . ILE A 1 13  ? 18.596  0.181   11.696  1.00 0.43  ? 13  ILE A HD12 2  
ATOM 11050  H HD13 . ILE A 1 13  ? 19.927  -0.905  11.297  1.00 75.15 ? 13  ILE A HD13 2  
ATOM 11051  N N    . GLN A 1 14  ? 20.919  5.810   10.043  1.00 23.01 ? 14  GLN A N    2  
ATOM 11052  C CA   . GLN A 1 14  ? 20.472  7.166   9.737   1.00 65.41 ? 14  GLN A CA   2  
ATOM 11053  C C    . GLN A 1 14  ? 19.143  7.107   8.961   1.00 31.12 ? 14  GLN A C    2  
ATOM 11054  O O    . GLN A 1 14  ? 18.232  7.906   9.200   1.00 33.22 ? 14  GLN A O    2  
ATOM 11055  C CB   . GLN A 1 14  ? 21.562  7.893   8.899   1.00 2.20  ? 14  GLN A CB   2  
ATOM 11056  C CG   . GLN A 1 14  ? 21.280  9.386   8.618   1.00 52.13 ? 14  GLN A CG   2  
ATOM 11057  C CD   . GLN A 1 14  ? 22.293  10.044  7.669   1.00 3.30  ? 14  GLN A CD   2  
ATOM 11058  O OE1  . GLN A 1 14  ? 22.831  9.404   6.765   1.00 35.44 ? 14  GLN A OE1  2  
ATOM 11059  N NE2  . GLN A 1 14  ? 22.568  11.317  7.877   1.00 22.15 ? 14  GLN A NE2  2  
ATOM 11060  H H    . GLN A 1 14  ? 21.668  5.438   9.525   1.00 62.54 ? 14  GLN A H    2  
ATOM 11061  H HA   . GLN A 1 14  ? 20.322  7.700   10.672  1.00 53.05 ? 14  GLN A HA   2  
ATOM 11062  H HB2  . GLN A 1 14  ? 22.508  7.822   9.428   1.00 24.43 ? 14  GLN A HB2  2  
ATOM 11063  H HB3  . GLN A 1 14  ? 21.667  7.379   7.948   1.00 50.11 ? 14  GLN A HB3  2  
ATOM 11064  H HG2  . GLN A 1 14  ? 20.297  9.475   8.172   1.00 2.32  ? 14  GLN A HG2  2  
ATOM 11065  H HG3  . GLN A 1 14  ? 21.289  9.916   9.564   1.00 52.33 ? 14  GLN A HG3  2  
ATOM 11066  H HE21 . GLN A 1 14  ? 22.118  11.775  8.620   1.00 11.14 ? 14  GLN A HE21 2  
ATOM 11067  H HE22 . GLN A 1 14  ? 23.214  11.753  7.286   1.00 14.31 ? 14  GLN A HE22 2  
ATOM 11068  N N    . ARG A 1 15  ? 19.036  6.114   8.052   1.00 30.41 ? 15  ARG A N    2  
ATOM 11069  C CA   . ARG A 1 15  ? 17.941  6.053   7.072   1.00 22.14 ? 15  ARG A CA   2  
ATOM 11070  C C    . ARG A 1 15  ? 17.897  4.668   6.394   1.00 33.41 ? 15  ARG A C    2  
ATOM 11071  O O    . ARG A 1 15  ? 18.940  4.085   6.133   1.00 25.45 ? 15  ARG A O    2  
ATOM 11072  C CB   . ARG A 1 15  ? 18.173  7.185   6.024   1.00 55.21 ? 15  ARG A CB   2  
ATOM 11073  C CG   . ARG A 1 15  ? 16.965  7.563   5.160   1.00 43.54 ? 15  ARG A CG   2  
ATOM 11074  C CD   . ARG A 1 15  ? 17.244  8.839   4.345   1.00 52.33 ? 15  ARG A CD   2  
ATOM 11075  N NE   . ARG A 1 15  ? 16.043  9.344   3.680   1.00 70.04 ? 15  ARG A NE   2  
ATOM 11076  C CZ   . ARG A 1 15  ? 15.691  10.634  3.581   1.00 54.14 ? 15  ARG A CZ   2  
ATOM 11077  N NH1  . ARG A 1 15  ? 16.446  11.594  4.110   1.00 64.14 ? 15  ARG A NH1  2  
ATOM 11078  N NH2  . ARG A 1 15  ? 14.599  10.966  2.922   1.00 73.01 ? 15  ARG A NH2  2  
ATOM 11079  H H    . ARG A 1 15  ? 19.708  5.398   8.051   1.00 72.13 ? 15  ARG A H    2  
ATOM 11080  H HA   . ARG A 1 15  ? 17.004  6.230   7.592   1.00 44.04 ? 15  ARG A HA   2  
ATOM 11081  H HB2  . ARG A 1 15  ? 18.479  8.075   6.564   1.00 54.52 ? 15  ARG A HB2  2  
ATOM 11082  H HB3  . ARG A 1 15  ? 18.988  6.893   5.369   1.00 30.20 ? 15  ARG A HB3  2  
ATOM 11083  H HG2  . ARG A 1 15  ? 16.743  6.750   4.476   1.00 1.33  ? 15  ARG A HG2  2  
ATOM 11084  H HG3  . ARG A 1 15  ? 16.110  7.738   5.800   1.00 72.01 ? 15  ARG A HG3  2  
ATOM 11085  H HD2  . ARG A 1 15  ? 17.636  9.604   5.011   1.00 3.35  ? 15  ARG A HD2  2  
ATOM 11086  H HD3  . ARG A 1 15  ? 17.991  8.616   3.591   1.00 60.02 ? 15  ARG A HD3  2  
ATOM 11087  H HE   . ARG A 1 15  ? 15.453  8.673   3.279   1.00 14.40 ? 15  ARG A HE   2  
ATOM 11088  H HH11 . ARG A 1 15  ? 17.294  11.368  4.595   1.00 32.22 ? 15  ARG A HH11 2  
ATOM 11089  H HH12 . ARG A 1 15  ? 16.164  12.557  4.020   1.00 0.13  ? 15  ARG A HH12 2  
ATOM 11090  H HH21 . ARG A 1 15  ? 14.025  10.259  2.493   1.00 73.11 ? 15  ARG A HH21 2  
ATOM 11091  H HH22 . ARG A 1 15  ? 14.336  11.934  2.844   1.00 43.21 ? 15  ARG A HH22 2  
ATOM 11092  N N    . ILE A 1 16  ? 16.682  4.142   6.156   1.00 20.53 ? 16  ILE A N    2  
ATOM 11093  C CA   . ILE A 1 16  ? 16.456  2.903   5.367   1.00 23.43 ? 16  ILE A CA   2  
ATOM 11094  C C    . ILE A 1 16  ? 15.408  3.206   4.301   1.00 32.41 ? 16  ILE A C    2  
ATOM 11095  O O    . ILE A 1 16  ? 14.381  3.834   4.599   1.00 73.41 ? 16  ILE A O    2  
ATOM 11096  C CB   . ILE A 1 16  ? 15.977  1.686   6.261   1.00 33.02 ? 16  ILE A CB   2  
ATOM 11097  C CG1  . ILE A 1 16  ? 17.137  1.197   7.172   1.00 1.32  ? 16  ILE A CG1  2  
ATOM 11098  C CG2  . ILE A 1 16  ? 15.433  0.505   5.401   1.00 41.53 ? 16  ILE A CG2  2  
ATOM 11099  C CD1  . ILE A 1 16  ? 16.715  0.269   8.287   1.00 62.22 ? 16  ILE A CD1  2  
ATOM 11100  H H    . ILE A 1 16  ? 15.899  4.608   6.507   1.00 54.40 ? 16  ILE A H    2  
ATOM 11101  H HA   . ILE A 1 16  ? 17.391  2.628   4.875   1.00 34.03 ? 16  ILE A HA   2  
ATOM 11102  H HB   . ILE A 1 16  ? 15.162  2.040   6.892   1.00 41.54 ? 16  ILE A HB   2  
ATOM 11103  H HG12 . ILE A 1 16  ? 17.876  0.678   6.576   1.00 64.33 ? 16  ILE A HG12 2  
ATOM 11104  H HG13 . ILE A 1 16  ? 17.607  2.056   7.634   1.00 52.32 ? 16  ILE A HG13 2  
ATOM 11105  H HG21 . ILE A 1 16  ? 15.041  -0.267  6.043   1.00 4.54  ? 16  ILE A HG21 2  
ATOM 11106  H HG22 . ILE A 1 16  ? 16.230  0.093   4.798   1.00 71.33 ? 16  ILE A HG22 2  
ATOM 11107  H HG23 . ILE A 1 16  ? 14.644  0.853   4.749   1.00 5.33  ? 16  ILE A HG23 2  
ATOM 11108  H HD11 . ILE A 1 16  ? 17.585  -0.080  8.807   1.00 53.43 ? 16  ILE A HD11 2  
ATOM 11109  H HD12 . ILE A 1 16  ? 16.161  -0.572  7.893   1.00 1.41  ? 16  ILE A HD12 2  
ATOM 11110  H HD13 . ILE A 1 16  ? 16.099  0.822   8.982   1.00 21.24 ? 16  ILE A HD13 2  
ATOM 11111  N N    . TYR A 1 17  ? 15.680  2.748   3.072   1.00 45.35 ? 17  TYR A N    2  
ATOM 11112  C CA   . TYR A 1 17  ? 14.834  3.002   1.909   1.00 74.34 ? 17  TYR A CA   2  
ATOM 11113  C C    . TYR A 1 17  ? 15.174  2.018   0.779   1.00 43.33 ? 17  TYR A C    2  
ATOM 11114  O O    . TYR A 1 17  ? 16.319  1.577   0.654   1.00 62.22 ? 17  TYR A O    2  
ATOM 11115  C CB   . TYR A 1 17  ? 15.015  4.474   1.411   1.00 22.52 ? 17  TYR A CB   2  
ATOM 11116  C CG   . TYR A 1 17  ? 16.468  4.846   1.073   1.00 3.13  ? 17  TYR A CG   2  
ATOM 11117  C CD1  . TYR A 1 17  ? 17.364  5.207   2.080   1.00 3.45  ? 17  TYR A CD1  2  
ATOM 11118  C CD2  . TYR A 1 17  ? 16.955  4.784   -0.236  1.00 73.32 ? 17  TYR A CD2  2  
ATOM 11119  C CE1  . TYR A 1 17  ? 18.685  5.488   1.799   1.00 54.03 ? 17  TYR A CE1  2  
ATOM 11120  C CE2  . TYR A 1 17  ? 18.270  5.074   -0.516  1.00 15.12 ? 17  TYR A CE2  2  
ATOM 11121  C CZ   . TYR A 1 17  ? 19.131  5.418   0.498   1.00 20.00 ? 17  TYR A CZ   2  
ATOM 11122  O OH   . TYR A 1 17  ? 20.439  5.697   0.204   1.00 53.23 ? 17  TYR A OH   2  
ATOM 11123  H H    . TYR A 1 17  ? 16.488  2.204   2.944   1.00 3.34  ? 17  TYR A H    2  
ATOM 11124  H HA   . TYR A 1 17  ? 13.800  2.845   2.212   1.00 71.42 ? 17  TYR A HA   2  
ATOM 11125  H HB2  . TYR A 1 17  ? 14.406  4.632   0.527   1.00 43.40 ? 17  TYR A HB2  2  
ATOM 11126  H HB3  . TYR A 1 17  ? 14.668  5.153   2.187   1.00 42.04 ? 17  TYR A HB3  2  
ATOM 11127  H HD1  . TYR A 1 17  ? 17.001  5.268   3.105   1.00 13.22 ? 17  TYR A HD1  2  
ATOM 11128  H HD2  . TYR A 1 17  ? 16.280  4.514   -1.042  1.00 43.35 ? 17  TYR A HD2  2  
ATOM 11129  H HE1  . TYR A 1 17  ? 19.361  5.763   2.598   1.00 51.22 ? 17  TYR A HE1  2  
ATOM 11130  H HE2  . TYR A 1 17  ? 18.625  5.019   -1.536  1.00 45.35 ? 17  TYR A HE2  2  
ATOM 11131  H HH   . TYR A 1 17  ? 21.020  5.068   0.650   1.00 3.13  ? 17  TYR A HH   2  
ATOM 11132  N N    . THR A 1 18  ? 14.186  1.706   -0.063  1.00 62.11 ? 18  THR A N    2  
ATOM 11133  C CA   . THR A 1 18  ? 14.403  0.909   -1.268  1.00 74.15 ? 18  THR A CA   2  
ATOM 11134  C C    . THR A 1 18  ? 15.103  1.782   -2.321  1.00 24.01 ? 18  THR A C    2  
ATOM 11135  O O    . THR A 1 18  ? 14.600  2.856   -2.679  1.00 51.30 ? 18  THR A O    2  
ATOM 11136  C CB   . THR A 1 18  ? 13.055  0.367   -1.838  1.00 62.11 ? 18  THR A CB   2  
ATOM 11137  O OG1  . THR A 1 18  ? 12.167  1.461   -2.150  1.00 0.22  ? 18  THR A OG1  2  
ATOM 11138  C CG2  . THR A 1 18  ? 12.347  -0.567  -0.845  1.00 4.30  ? 18  THR A CG2  2  
ATOM 11139  H H    . THR A 1 18  ? 13.284  2.028   0.130   1.00 73.41 ? 18  THR A H    2  
ATOM 11140  H HA   . THR A 1 18  ? 15.038  0.058   -1.015  1.00 32.33 ? 18  THR A HA   2  
ATOM 11141  H HB   . THR A 1 18  ? 13.258  -0.192  -2.750  1.00 74.41 ? 18  THR A HB   2  
ATOM 11142  H HG1  . THR A 1 18  ? 12.637  2.134   -2.650  1.00 13.44 ? 18  THR A HG1  2  
ATOM 11143  H HG21 . THR A 1 18  ? 12.033  -0.007  0.025   1.00 20.14 ? 18  THR A HG21 2  
ATOM 11144  H HG22 . THR A 1 18  ? 13.017  -1.353  -0.536  1.00 64.44 ? 18  THR A HG22 2  
ATOM 11145  H HG23 . THR A 1 18  ? 11.484  -1.011  -1.315  1.00 33.12 ? 18  THR A HG23 2  
ATOM 11146  N N    . LYS A 1 19  ? 16.280  1.345   -2.780  1.00 62.31 ? 19  LYS A N    2  
ATOM 11147  C CA   . LYS A 1 19  ? 17.030  2.066   -3.819  1.00 61.11 ? 19  LYS A CA   2  
ATOM 11148  C C    . LYS A 1 19  ? 16.479  1.705   -5.196  1.00 31.43 ? 19  LYS A C    2  
ATOM 11149  O O    . LYS A 1 19  ? 16.474  2.533   -6.112  1.00 55.23 ? 19  LYS A O    2  
ATOM 11150  C CB   . LYS A 1 19  ? 18.534  1.735   -3.733  1.00 61.13 ? 19  LYS A CB   2  
ATOM 11151  C CG   . LYS A 1 19  ? 19.154  2.006   -2.340  1.00 72.54 ? 19  LYS A CG   2  
ATOM 11152  C CD   . LYS A 1 19  ? 20.667  2.284   -2.403  1.00 54.22 ? 19  LYS A CD   2  
ATOM 11153  C CE   . LYS A 1 19  ? 20.977  3.573   -3.180  1.00 33.04 ? 19  LYS A CE   2  
ATOM 11154  N NZ   . LYS A 1 19  ? 22.430  3.846   -3.273  1.00 50.52 ? 19  LYS A NZ   2  
ATOM 11155  H H    . LYS A 1 19  ? 16.650  0.507   -2.422  1.00 62.12 ? 19  LYS A H    2  
ATOM 11156  H HA   . LYS A 1 19  ? 16.898  3.134   -3.657  1.00 10.51 ? 19  LYS A HA   2  
ATOM 11157  H HB2  . LYS A 1 19  ? 18.676  0.683   -3.973  1.00 2.22  ? 19  LYS A HB2  2  
ATOM 11158  H HB3  . LYS A 1 19  ? 19.064  2.328   -4.471  1.00 52.13 ? 19  LYS A HB3  2  
ATOM 11159  H HG2  . LYS A 1 19  ? 18.663  2.863   -1.889  1.00 24.12 ? 19  LYS A HG2  2  
ATOM 11160  H HG3  . LYS A 1 19  ? 18.984  1.140   -1.707  1.00 64.14 ? 19  LYS A HG3  2  
ATOM 11161  H HD2  . LYS A 1 19  ? 21.051  2.387   -1.391  1.00 43.42 ? 19  LYS A HD2  2  
ATOM 11162  H HD3  . LYS A 1 19  ? 21.164  1.449   -2.887  1.00 71.12 ? 19  LYS A HD3  2  
ATOM 11163  H HE2  . LYS A 1 19  ? 20.582  3.486   -4.183  1.00 14.21 ? 19  LYS A HE2  2  
ATOM 11164  H HE3  . LYS A 1 19  ? 20.499  4.411   -2.685  1.00 22.53 ? 19  LYS A HE3  2  
ATOM 11165  H HZ1  . LYS A 1 19  ? 22.598  4.698   -3.840  1.00 14.02 ? 19  LYS A HZ1  2  
ATOM 11166  H HZ2  . LYS A 1 19  ? 22.923  3.045   -3.713  1.00 3.12  ? 19  LYS A HZ2  2  
ATOM 11167  H HZ3  . LYS A 1 19  ? 22.822  3.995   -2.322  1.00 23.10 ? 19  LYS A HZ3  2  
ATOM 11168  N N    . ASP A 1 20  ? 16.012  0.456   -5.310  1.00 52.45 ? 20  ASP A N    2  
ATOM 11169  C CA   . ASP A 1 20  ? 15.428  -0.080  -6.539  1.00 73.31 ? 20  ASP A CA   2  
ATOM 11170  C C    . ASP A 1 20  ? 14.336  -1.101  -6.184  1.00 44.24 ? 20  ASP A C    2  
ATOM 11171  O O    . ASP A 1 20  ? 14.464  -1.859  -5.214  1.00 71.20 ? 20  ASP A O    2  
ATOM 11172  C CB   . ASP A 1 20  ? 16.530  -0.706  -7.434  1.00 72.35 ? 20  ASP A CB   2  
ATOM 11173  C CG   . ASP A 1 20  ? 15.990  -1.379  -8.710  1.00 14.14 ? 20  ASP A CG   2  
ATOM 11174  O OD1  . ASP A 1 20  ? 15.701  -0.663  -9.695  1.00 43.53 ? 20  ASP A OD1  2  
ATOM 11175  O OD2  . ASP A 1 20  ? 15.848  -2.624  -8.729  1.00 1.35  ? 20  ASP A OD2  2  
ATOM 11176  H H    . ASP A 1 20  ? 16.049  -0.130  -4.523  1.00 12.45 ? 20  ASP A H    2  
ATOM 11177  H HA   . ASP A 1 20  ? 14.964  0.745   -7.073  1.00 60.30 ? 20  ASP A HA   2  
ATOM 11178  H HB2  . ASP A 1 20  ? 17.222  0.076   -7.727  1.00 73.50 ? 20  ASP A HB2  2  
ATOM 11179  H HB3  . ASP A 1 20  ? 17.076  -1.442  -6.855  1.00 1.12  ? 20  ASP A HB3  2  
ATOM 11180  N N    . ILE A 1 21  ? 13.253  -1.075  -6.971  1.00 32.21 ? 21  ILE A N    2  
ATOM 11181  C CA   . ILE A 1 21  ? 12.103  -1.982  -6.857  1.00 41.32 ? 21  ILE A CA   2  
ATOM 11182  C C    . ILE A 1 21  ? 11.721  -2.419  -8.270  1.00 22.43 ? 21  ILE A C    2  
ATOM 11183  O O    . ILE A 1 21  ? 11.858  -1.639  -9.222  1.00 31.33 ? 21  ILE A O    2  
ATOM 11184  C CB   . ILE A 1 21  ? 10.840  -1.291  -6.194  1.00 51.54 ? 21  ILE A CB   2  
ATOM 11185  C CG1  . ILE A 1 21  ? 11.167  -0.760  -4.770  1.00 51.13 ? 21  ILE A CG1  2  
ATOM 11186  C CG2  . ILE A 1 21  ? 9.606   -2.241  -6.165  1.00 53.13 ? 21  ILE A CG2  2  
ATOM 11187  C CD1  . ILE A 1 21  ? 10.028  -0.024  -4.095  1.00 22.21 ? 21  ILE A CD1  2  
ATOM 11188  H H    . ILE A 1 21  ? 13.241  -0.423  -7.700  1.00 14.21 ? 21  ILE A H    2  
ATOM 11189  H HA   . ILE A 1 21  ? 12.386  -2.853  -6.269  1.00 21.12 ? 21  ILE A HA   2  
ATOM 11190  H HB   . ILE A 1 21  ? 10.571  -0.437  -6.817  1.00 65.44 ? 21  ILE A HB   2  
ATOM 11191  H HG12 . ILE A 1 21  ? 11.447  -1.587  -4.126  1.00 33.13 ? 21  ILE A HG12 2  
ATOM 11192  H HG13 . ILE A 1 21  ? 12.002  -0.072  -4.831  1.00 15.41 ? 21  ILE A HG13 2  
ATOM 11193  H HG21 . ILE A 1 21  ? 8.720   -1.690  -5.891  1.00 1.55  ? 21  ILE A HG21 2  
ATOM 11194  H HG22 . ILE A 1 21  ? 9.764   -3.035  -5.447  1.00 53.54 ? 21  ILE A HG22 2  
ATOM 11195  H HG23 . ILE A 1 21  ? 9.455   -2.678  -7.144  1.00 71.12 ? 21  ILE A HG23 2  
ATOM 11196  H HD11 . ILE A 1 21  ? 9.210   -0.703  -3.922  1.00 65.41 ? 21  ILE A HD11 2  
ATOM 11197  H HD12 . ILE A 1 21  ? 9.690   0.785   -4.726  1.00 4.14  ? 21  ILE A HD12 2  
ATOM 11198  H HD13 . ILE A 1 21  ? 10.368  0.375   -3.152  1.00 11.13 ? 21  ILE A HD13 2  
ATOM 11199  N N    . SER A 1 22  ? 11.223  -3.646  -8.391  1.00 4.54  ? 22  SER A N    2  
ATOM 11200  C CA   . SER A 1 22  ? 10.672  -4.165  -9.632  1.00 24.43 ? 22  SER A CA   2  
ATOM 11201  C C    . SER A 1 22  ? 9.709   -5.313  -9.328  1.00 11.35 ? 22  SER A C    2  
ATOM 11202  O O    . SER A 1 22  ? 9.856   -6.022  -8.326  1.00 11.34 ? 22  SER A O    2  
ATOM 11203  C CB   . SER A 1 22  ? 11.792  -4.615  -10.605 1.00 4.23  ? 22  SER A CB   2  
ATOM 11204  O OG   . SER A 1 22  ? 11.262  -5.095  -11.837 1.00 44.22 ? 22  SER A OG   2  
ATOM 11205  H H    . SER A 1 22  ? 11.208  -4.228  -7.594  1.00 12.34 ? 22  SER A H    2  
ATOM 11206  H HA   . SER A 1 22  ? 10.105  -3.356  -10.090 1.00 14.35 ? 22  SER A HA   2  
ATOM 11207  H HB2  . SER A 1 22  ? 12.438  -3.773  -10.822 1.00 21.51 ? 22  SER A HB2  2  
ATOM 11208  H HB3  . SER A 1 22  ? 12.381  -5.402  -10.150 1.00 44.34 ? 22  SER A HB3  2  
ATOM 11209  H HG   . SER A 1 22  ? 10.642  -4.446  -12.198 1.00 75.24 ? 22  SER A HG   2  
ATOM 11210  N N    . PHE A 1 23  ? 8.711   -5.449  -10.191 1.00 2.13  ? 23  PHE A N    2  
ATOM 11211  C CA   . PHE A 1 23  ? 7.704   -6.503  -10.139 1.00 71.31 ? 23  PHE A CA   2  
ATOM 11212  C C    . PHE A 1 23  ? 7.248   -6.733  -11.576 1.00 61.11 ? 23  PHE A C    2  
ATOM 11213  O O    . PHE A 1 23  ? 6.880   -5.778  -12.251 1.00 35.41 ? 23  PHE A O    2  
ATOM 11214  C CB   . PHE A 1 23  ? 6.523   -6.066  -9.229  1.00 62.23 ? 23  PHE A CB   2  
ATOM 11215  C CG   . PHE A 1 23  ? 5.404   -7.099  -9.051  1.00 55.43 ? 23  PHE A CG   2  
ATOM 11216  C CD1  . PHE A 1 23  ? 5.569   -8.188  -8.195  1.00 61.00 ? 23  PHE A CD1  2  
ATOM 11217  C CD2  . PHE A 1 23  ? 4.188   -6.976  -9.726  1.00 71.43 ? 23  PHE A CD2  2  
ATOM 11218  C CE1  . PHE A 1 23  ? 4.562   -9.116  -8.019  1.00 21.34 ? 23  PHE A CE1  2  
ATOM 11219  C CE2  . PHE A 1 23  ? 3.181   -7.909  -9.550  1.00 42.13 ? 23  PHE A CE2  2  
ATOM 11220  C CZ   . PHE A 1 23  ? 3.369   -8.977  -8.696  1.00 14.32 ? 23  PHE A CZ   2  
ATOM 11221  H H    . PHE A 1 23  ? 8.649   -4.797  -10.921 1.00 44.44 ? 23  PHE A H    2  
ATOM 11222  H HA   . PHE A 1 23  ? 8.160   -7.414  -9.745  1.00 15.45 ? 23  PHE A HA   2  
ATOM 11223  H HB2  . PHE A 1 23  ? 6.915   -5.836  -8.245  1.00 75.22 ? 23  PHE A HB2  2  
ATOM 11224  H HB3  . PHE A 1 23  ? 6.085   -5.157  -9.637  1.00 75.40 ? 23  PHE A HB3  2  
ATOM 11225  H HD1  . PHE A 1 23  ? 6.504   -8.303  -7.659  1.00 32.33 ? 23  PHE A HD1  2  
ATOM 11226  H HD2  . PHE A 1 23  ? 4.031   -6.141  -10.401 1.00 4.43  ? 23  PHE A HD2  2  
ATOM 11227  H HE1  . PHE A 1 23  ? 4.711   -9.956  -7.349  1.00 72.01 ? 23  PHE A HE1  2  
ATOM 11228  H HE2  . PHE A 1 23  ? 2.244   -7.803  -10.082 1.00 42.01 ? 23  PHE A HE2  2  
ATOM 11229  H HZ   . PHE A 1 23  ? 2.581   -9.704  -8.556  1.00 54.31 ? 23  PHE A HZ   2  
ATOM 11230  N N    . GLU A 1 24  ? 7.336   -7.972  -12.063 1.00 63.41 ? 24  GLU A N    2  
ATOM 11231  C CA   . GLU A 1 24  ? 6.919   -8.321  -13.431 1.00 2.11  ? 24  GLU A CA   2  
ATOM 11232  C C    . GLU A 1 24  ? 5.985   -9.529  -13.399 1.00 33.05 ? 24  GLU A C    2  
ATOM 11233  O O    . GLU A 1 24  ? 6.397   -10.634 -13.052 1.00 20.24 ? 24  GLU A O    2  
ATOM 11234  C CB   . GLU A 1 24  ? 8.137   -8.630  -14.333 1.00 31.42 ? 24  GLU A CB   2  
ATOM 11235  C CG   . GLU A 1 24  ? 9.056   -7.428  -14.620 1.00 71.33 ? 24  GLU A CG   2  
ATOM 11236  C CD   . GLU A 1 24  ? 10.099  -7.733  -15.702 1.00 52.43 ? 24  GLU A CD   2  
ATOM 11237  O OE1  . GLU A 1 24  ? 9.707   -7.849  -16.885 1.00 61.24 ? 24  GLU A OE1  2  
ATOM 11238  O OE2  . GLU A 1 24  ? 11.297  -7.888  -15.384 1.00 2.12  ? 24  GLU A OE2  2  
ATOM 11239  H H    . GLU A 1 24  ? 7.699   -8.674  -11.491 1.00 54.24 ? 24  GLU A H    2  
ATOM 11240  H HA   . GLU A 1 24  ? 6.378   -7.471  -13.858 1.00 55.51 ? 24  GLU A HA   2  
ATOM 11241  H HB2  . GLU A 1 24  ? 8.734   -9.404  -13.857 1.00 12.43 ? 24  GLU A HB2  2  
ATOM 11242  H HB3  . GLU A 1 24  ? 7.777   -9.013  -15.283 1.00 1.13  ? 24  GLU A HB3  2  
ATOM 11243  H HG2  . GLU A 1 24  ? 8.451   -6.587  -14.951 1.00 2.24  ? 24  GLU A HG2  2  
ATOM 11244  H HG3  . GLU A 1 24  ? 9.564   -7.153  -13.703 1.00 2.02  ? 24  GLU A HG3  2  
ATOM 11245  N N    . ALA A 1 25  ? 4.732   -9.309  -13.784 1.00 14.44 ? 25  ALA A N    2  
ATOM 11246  C CA   . ALA A 1 25  ? 3.733   -10.360 -13.922 1.00 15.51 ? 25  ALA A CA   2  
ATOM 11247  C C    . ALA A 1 25  ? 3.018   -10.162 -15.266 1.00 53.43 ? 25  ALA A C    2  
ATOM 11248  O O    . ALA A 1 25  ? 1.915   -9.600  -15.323 1.00 23.43 ? 25  ALA A O    2  
ATOM 11249  C CB   . ALA A 1 25  ? 2.764   -10.355 -12.725 1.00 12.42 ? 25  ALA A CB   2  
ATOM 11250  H H    . ALA A 1 25  ? 4.470   -8.391  -14.008 1.00 32.11 ? 25  ALA A H    2  
ATOM 11251  H HA   . ALA A 1 25  ? 4.237   -11.3