data_5JXG
# 
_entry.id   5JXG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5JXG         
WWPDB D_1000221251 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5JXG 
_pdbx_database_status.recvd_initial_deposition_date   2016-05-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dahms, S.O.'     1 
'Arciniega, M.'   2 
'Steinmetzer, T.' 3 
'Huber, R.'       4 
'Than, M.E.'      5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            113 
_citation.language                  ? 
_citation.page_first                11196 
_citation.page_last                 11201 
_citation.title                     
'Structure of the unliganded form of the proprotein convertase furin suggests activation by a substrate-induced mechanism.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1613630113 
_citation.pdbx_database_id_PubMed   27647913 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dahms, S.O.'     1 
primary 'Arciniega, M.'   2 
primary 'Steinmetzer, T.' 3 
primary 'Huber, R.'       4 
primary 'Than, M.E.'      5 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5JXG 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     131.957 
_cell.length_a_esd                 ? 
_cell.length_b                     131.957 
_cell.length_b_esd                 ? 
_cell.length_c                     155.634 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5JXG 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Furin          52388.602 1   3.4.21.75 ? ? ? 
2 non-polymer syn 'CALCIUM ION'  40.078    3   ?         ? ? ? 
3 non-polymer syn 'SODIUM ION'   22.990    8   ?         ? ? ? 
4 non-polymer syn 'CHLORIDE ION' 35.453    1   ?         ? ? ? 
5 water       nat water          18.015    643 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Dibasic-processing enzyme,Paired basic amino acid residue-cleaving enzyme,PACE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTASGSLVPRGSHHHH
HH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTASGSLVPRGSHHHH
HH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   VAL n 
1 3   TYR n 
1 4   GLN n 
1 5   GLU n 
1 6   PRO n 
1 7   THR n 
1 8   ASP n 
1 9   PRO n 
1 10  LYS n 
1 11  PHE n 
1 12  PRO n 
1 13  GLN n 
1 14  GLN n 
1 15  TRP n 
1 16  TYR n 
1 17  LEU n 
1 18  SER n 
1 19  GLY n 
1 20  VAL n 
1 21  THR n 
1 22  GLN n 
1 23  ARG n 
1 24  ASP n 
1 25  LEU n 
1 26  ASN n 
1 27  VAL n 
1 28  LYS n 
1 29  ALA n 
1 30  ALA n 
1 31  TRP n 
1 32  ALA n 
1 33  GLN n 
1 34  GLY n 
1 35  TYR n 
1 36  THR n 
1 37  GLY n 
1 38  HIS n 
1 39  GLY n 
1 40  ILE n 
1 41  VAL n 
1 42  VAL n 
1 43  SER n 
1 44  ILE n 
1 45  LEU n 
1 46  ASP n 
1 47  ASP n 
1 48  GLY n 
1 49  ILE n 
1 50  GLU n 
1 51  LYS n 
1 52  ASN n 
1 53  HIS n 
1 54  PRO n 
1 55  ASP n 
1 56  LEU n 
1 57  ALA n 
1 58  GLY n 
1 59  ASN n 
1 60  TYR n 
1 61  ASP n 
1 62  PRO n 
1 63  GLY n 
1 64  ALA n 
1 65  SER n 
1 66  PHE n 
1 67  ASP n 
1 68  VAL n 
1 69  ASN n 
1 70  ASP n 
1 71  GLN n 
1 72  ASP n 
1 73  PRO n 
1 74  ASP n 
1 75  PRO n 
1 76  GLN n 
1 77  PRO n 
1 78  ARG n 
1 79  TYR n 
1 80  THR n 
1 81  GLN n 
1 82  MET n 
1 83  ASN n 
1 84  ASP n 
1 85  ASN n 
1 86  ARG n 
1 87  HIS n 
1 88  GLY n 
1 89  THR n 
1 90  ARG n 
1 91  CYS n 
1 92  ALA n 
1 93  GLY n 
1 94  GLU n 
1 95  VAL n 
1 96  ALA n 
1 97  ALA n 
1 98  VAL n 
1 99  ALA n 
1 100 ASN n 
1 101 ASN n 
1 102 GLY n 
1 103 VAL n 
1 104 CYS n 
1 105 GLY n 
1 106 VAL n 
1 107 GLY n 
1 108 VAL n 
1 109 ALA n 
1 110 TYR n 
1 111 ASN n 
1 112 ALA n 
1 113 ARG n 
1 114 ILE n 
1 115 GLY n 
1 116 GLY n 
1 117 VAL n 
1 118 ARG n 
1 119 MET n 
1 120 LEU n 
1 121 ASP n 
1 122 GLY n 
1 123 GLU n 
1 124 VAL n 
1 125 THR n 
1 126 ASP n 
1 127 ALA n 
1 128 VAL n 
1 129 GLU n 
1 130 ALA n 
1 131 ARG n 
1 132 SER n 
1 133 LEU n 
1 134 GLY n 
1 135 LEU n 
1 136 ASN n 
1 137 PRO n 
1 138 ASN n 
1 139 HIS n 
1 140 ILE n 
1 141 HIS n 
1 142 ILE n 
1 143 TYR n 
1 144 SER n 
1 145 ALA n 
1 146 SER n 
1 147 TRP n 
1 148 GLY n 
1 149 PRO n 
1 150 GLU n 
1 151 ASP n 
1 152 ASP n 
1 153 GLY n 
1 154 LYS n 
1 155 THR n 
1 156 VAL n 
1 157 ASP n 
1 158 GLY n 
1 159 PRO n 
1 160 ALA n 
1 161 ARG n 
1 162 LEU n 
1 163 ALA n 
1 164 GLU n 
1 165 GLU n 
1 166 ALA n 
1 167 PHE n 
1 168 PHE n 
1 169 ARG n 
1 170 GLY n 
1 171 VAL n 
1 172 SER n 
1 173 GLN n 
1 174 GLY n 
1 175 ARG n 
1 176 GLY n 
1 177 GLY n 
1 178 LEU n 
1 179 GLY n 
1 180 SER n 
1 181 ILE n 
1 182 PHE n 
1 183 VAL n 
1 184 TRP n 
1 185 ALA n 
1 186 SER n 
1 187 GLY n 
1 188 ASN n 
1 189 GLY n 
1 190 GLY n 
1 191 ARG n 
1 192 GLU n 
1 193 HIS n 
1 194 ASP n 
1 195 SER n 
1 196 CYS n 
1 197 ASN n 
1 198 CYS n 
1 199 ASP n 
1 200 GLY n 
1 201 TYR n 
1 202 THR n 
1 203 ASN n 
1 204 SER n 
1 205 ILE n 
1 206 TYR n 
1 207 THR n 
1 208 LEU n 
1 209 SER n 
1 210 ILE n 
1 211 SER n 
1 212 SER n 
1 213 ALA n 
1 214 THR n 
1 215 GLN n 
1 216 PHE n 
1 217 GLY n 
1 218 ASN n 
1 219 VAL n 
1 220 PRO n 
1 221 TRP n 
1 222 TYR n 
1 223 SER n 
1 224 GLU n 
1 225 ALA n 
1 226 CYS n 
1 227 SER n 
1 228 SER n 
1 229 THR n 
1 230 LEU n 
1 231 ALA n 
1 232 THR n 
1 233 THR n 
1 234 TYR n 
1 235 SER n 
1 236 SER n 
1 237 GLY n 
1 238 ASN n 
1 239 GLN n 
1 240 ASN n 
1 241 GLU n 
1 242 LYS n 
1 243 GLN n 
1 244 ILE n 
1 245 VAL n 
1 246 THR n 
1 247 THR n 
1 248 ASP n 
1 249 LEU n 
1 250 ARG n 
1 251 GLN n 
1 252 LYS n 
1 253 CYS n 
1 254 THR n 
1 255 GLU n 
1 256 SER n 
1 257 HIS n 
1 258 THR n 
1 259 GLY n 
1 260 THR n 
1 261 SER n 
1 262 ALA n 
1 263 SER n 
1 264 ALA n 
1 265 PRO n 
1 266 LEU n 
1 267 ALA n 
1 268 ALA n 
1 269 GLY n 
1 270 ILE n 
1 271 ILE n 
1 272 ALA n 
1 273 LEU n 
1 274 THR n 
1 275 LEU n 
1 276 GLU n 
1 277 ALA n 
1 278 ASN n 
1 279 LYS n 
1 280 ASN n 
1 281 LEU n 
1 282 THR n 
1 283 TRP n 
1 284 ARG n 
1 285 ASP n 
1 286 MET n 
1 287 GLN n 
1 288 HIS n 
1 289 LEU n 
1 290 VAL n 
1 291 VAL n 
1 292 GLN n 
1 293 THR n 
1 294 SER n 
1 295 LYS n 
1 296 PRO n 
1 297 ALA n 
1 298 HIS n 
1 299 LEU n 
1 300 ASN n 
1 301 ALA n 
1 302 ASN n 
1 303 ASP n 
1 304 TRP n 
1 305 ALA n 
1 306 THR n 
1 307 ASN n 
1 308 GLY n 
1 309 VAL n 
1 310 GLY n 
1 311 ARG n 
1 312 LYS n 
1 313 VAL n 
1 314 SER n 
1 315 HIS n 
1 316 SER n 
1 317 TYR n 
1 318 GLY n 
1 319 TYR n 
1 320 GLY n 
1 321 LEU n 
1 322 LEU n 
1 323 ASP n 
1 324 ALA n 
1 325 GLY n 
1 326 ALA n 
1 327 MET n 
1 328 VAL n 
1 329 ALA n 
1 330 LEU n 
1 331 ALA n 
1 332 GLN n 
1 333 ASN n 
1 334 TRP n 
1 335 THR n 
1 336 THR n 
1 337 VAL n 
1 338 ALA n 
1 339 PRO n 
1 340 GLN n 
1 341 ARG n 
1 342 LYS n 
1 343 CYS n 
1 344 ILE n 
1 345 ILE n 
1 346 ASP n 
1 347 ILE n 
1 348 LEU n 
1 349 THR n 
1 350 GLU n 
1 351 PRO n 
1 352 LYS n 
1 353 ASP n 
1 354 ILE n 
1 355 GLY n 
1 356 LYS n 
1 357 ARG n 
1 358 LEU n 
1 359 GLU n 
1 360 VAL n 
1 361 ARG n 
1 362 LYS n 
1 363 THR n 
1 364 VAL n 
1 365 THR n 
1 366 ALA n 
1 367 CYS n 
1 368 LEU n 
1 369 GLY n 
1 370 GLU n 
1 371 PRO n 
1 372 ASN n 
1 373 HIS n 
1 374 ILE n 
1 375 THR n 
1 376 ARG n 
1 377 LEU n 
1 378 GLU n 
1 379 HIS n 
1 380 ALA n 
1 381 GLN n 
1 382 ALA n 
1 383 ARG n 
1 384 LEU n 
1 385 THR n 
1 386 LEU n 
1 387 SER n 
1 388 TYR n 
1 389 ASN n 
1 390 ARG n 
1 391 ARG n 
1 392 GLY n 
1 393 ASP n 
1 394 LEU n 
1 395 ALA n 
1 396 ILE n 
1 397 HIS n 
1 398 LEU n 
1 399 VAL n 
1 400 SER n 
1 401 PRO n 
1 402 MET n 
1 403 GLY n 
1 404 THR n 
1 405 ARG n 
1 406 SER n 
1 407 THR n 
1 408 LEU n 
1 409 LEU n 
1 410 ALA n 
1 411 ALA n 
1 412 ARG n 
1 413 PRO n 
1 414 HIS n 
1 415 ASP n 
1 416 TYR n 
1 417 SER n 
1 418 ALA n 
1 419 ASP n 
1 420 GLY n 
1 421 PHE n 
1 422 ASN n 
1 423 ASP n 
1 424 TRP n 
1 425 ALA n 
1 426 PHE n 
1 427 MET n 
1 428 THR n 
1 429 THR n 
1 430 HIS n 
1 431 SER n 
1 432 TRP n 
1 433 ASP n 
1 434 GLU n 
1 435 ASP n 
1 436 PRO n 
1 437 SER n 
1 438 GLY n 
1 439 GLU n 
1 440 TRP n 
1 441 VAL n 
1 442 LEU n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 ASN n 
1 447 THR n 
1 448 SER n 
1 449 GLU n 
1 450 ALA n 
1 451 ASN n 
1 452 ASN n 
1 453 TYR n 
1 454 GLY n 
1 455 THR n 
1 456 LEU n 
1 457 THR n 
1 458 LYS n 
1 459 PHE n 
1 460 THR n 
1 461 LEU n 
1 462 VAL n 
1 463 LEU n 
1 464 TYR n 
1 465 GLY n 
1 466 THR n 
1 467 ALA n 
1 468 SER n 
1 469 GLY n 
1 470 SER n 
1 471 LEU n 
1 472 VAL n 
1 473 PRO n 
1 474 ARG n 
1 475 GLY n 
1 476 SER n 
1 477 HIS n 
1 478 HIS n 
1 479 HIS n 
1 480 HIS n 
1 481 HIS n 
1 482 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   482 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'FURIN, FUR, PACE, PCSK3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293S 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FURIN_HUMAN 
_struct_ref.pdbx_db_accession          P09958 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTA
;
_struct_ref.pdbx_align_begin           108 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5JXG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 467 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P09958 
_struct_ref_seq.db_align_beg                  108 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  574 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       108 
_struct_ref_seq.pdbx_auth_seq_align_end       574 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5JXG SER A 468 ? UNP P09958 ? ? 'expression tag' 575 1  
1 5JXG GLY A 469 ? UNP P09958 ? ? 'expression tag' 576 2  
1 5JXG SER A 470 ? UNP P09958 ? ? 'expression tag' 577 3  
1 5JXG LEU A 471 ? UNP P09958 ? ? 'expression tag' 578 4  
1 5JXG VAL A 472 ? UNP P09958 ? ? 'expression tag' 579 5  
1 5JXG PRO A 473 ? UNP P09958 ? ? 'expression tag' 580 6  
1 5JXG ARG A 474 ? UNP P09958 ? ? 'expression tag' 581 7  
1 5JXG GLY A 475 ? UNP P09958 ? ? 'expression tag' 582 8  
1 5JXG SER A 476 ? UNP P09958 ? ? 'expression tag' 583 9  
1 5JXG HIS A 477 ? UNP P09958 ? ? 'expression tag' 584 10 
1 5JXG HIS A 478 ? UNP P09958 ? ? 'expression tag' 585 11 
1 5JXG HIS A 479 ? UNP P09958 ? ? 'expression tag' 586 12 
1 5JXG HIS A 480 ? UNP P09958 ? ? 'expression tag' 587 13 
1 5JXG HIS A 481 ? UNP P09958 ? ? 'expression tag' 588 14 
1 5JXG HIS A 482 ? UNP P09958 ? ? 'expression tag' 589 15 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5JXG 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.73 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         67.05 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'crystallization solution: 100 mM MES, 200 mM K/NaH2PO4, pH 5.5-6.0, 3-4 M NaCl, 3% DMSO; reservoir solution: 3-4 M NaCl' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-11-25 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918409 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.918409 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_synchrotron_site       BESSY 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5JXG 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.8 
_reflns.d_resolution_low                 46.1 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       73616 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.1 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.096 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.80 
_reflns_shell.d_res_low                   1.91 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             0.623 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5JXG 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.800 
_refine.ls_d_res_low                             46.057 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     73608 
_refine.ls_number_reflns_R_free                  3610 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.17 
_refine.ls_percent_reflns_R_free                 4.90 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1550 
_refine.ls_R_factor_R_free                       0.1733 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1540 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4RYD 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 16.12 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.15 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3608 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             643 
_refine_hist.number_atoms_total               4263 
_refine_hist.d_res_high                       1.800 
_refine_hist.d_res_low                        46.057 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 3802 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.038  ? 5196 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 12.939 ? 1356 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.045  ? 565  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 697  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.8001 1.8238  . . 143 2583 97.00  . . . 0.2673 . 0.2496 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8238 1.8487  . . 157 2618 99.00  . . . 0.2661 . 0.2201 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8487 1.8752  . . 129 2667 99.00  . . . 0.2278 . 0.2094 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8752 1.9032  . . 135 2647 99.00  . . . 0.2258 . 0.1971 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9032 1.9329  . . 148 2643 99.00  . . . 0.2242 . 0.1883 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9329 1.9646  . . 128 2676 99.00  . . . 0.2178 . 0.1792 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9646 1.9985  . . 115 2675 99.00  . . . 0.2262 . 0.1803 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9985 2.0348  . . 136 2649 99.00  . . . 0.1876 . 0.1802 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0348 2.0739  . . 137 2656 99.00  . . . 0.1846 . 0.1680 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0739 2.1163  . . 150 2655 99.00  . . . 0.1965 . 0.1589 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1163 2.1623  . . 133 2660 99.00  . . . 0.1710 . 0.1544 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1623 2.2126  . . 139 2642 99.00  . . . 0.1759 . 0.1475 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2126 2.2679  . . 132 2692 99.00  . . . 0.1773 . 0.1434 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2679 2.3292  . . 123 2672 99.00  . . . 0.1847 . 0.1459 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3292 2.3978  . . 133 2701 99.00  . . . 0.1574 . 0.1427 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3978 2.4752  . . 125 2683 99.00  . . . 0.1649 . 0.1549 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4752 2.5636  . . 134 2690 99.00  . . . 0.1944 . 0.1606 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5636 2.6662  . . 122 2712 100.00 . . . 0.1953 . 0.1582 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6662 2.7876  . . 151 2717 100.00 . . . 0.1503 . 0.1601 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7876 2.9345  . . 147 2700 100.00 . . . 0.1965 . 0.1620 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9345 3.1183  . . 137 2714 100.00 . . . 0.1513 . 0.1549 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1183 3.3590  . . 150 2725 100.00 . . . 0.1749 . 0.1462 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3590 3.6969  . . 152 2717 99.00  . . . 0.1669 . 0.1326 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6969 4.2316  . . 144 2769 100.00 . . . 0.1268 . 0.1198 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2316 5.3301  . . 151 2804 99.00  . . . 0.1303 . 0.1227 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.3301 46.0716 . . 159 2931 98.00  . . . 0.1683 . 0.1672 . . . . . . . . . . 
# 
_struct.entry_id                     5JXG 
_struct.title                        'Structure of the unliganded form of the proprotein convertase furin.' 
_struct.pdbx_descriptor              'Furin (E.C.3.4.21.75)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5JXG 
_struct_keywords.text            'protease, apo-structure, proteolysis, hydrolase' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 10  ? GLN A 14  ? LYS A 117 GLN A 121 5 ? 5  
HELX_P HELX_P2  AA2 ASN A 26  ? GLN A 33  ? ASN A 133 GLN A 140 1 ? 8  
HELX_P HELX_P3  AA3 ASP A 61  ? SER A 65  ? ASP A 168 SER A 172 5 ? 5  
HELX_P HELX_P4  AA4 ARG A 86  ? ALA A 97  ? ARG A 193 ALA A 204 1 ? 12 
HELX_P HELX_P5  AA5 THR A 125 ? GLY A 134 ? THR A 232 GLY A 241 1 ? 10 
HELX_P HELX_P6  AA6 ALA A 160 ? GLY A 174 ? ALA A 267 GLY A 281 1 ? 15 
HELX_P HELX_P7  AA7 ARG A 175 ? LEU A 178 ? ARG A 282 LEU A 285 5 ? 4  
HELX_P HELX_P8  AA8 GLY A 189 ? HIS A 193 ? GLY A 296 HIS A 300 5 ? 5  
HELX_P HELX_P9  AA9 SER A 195 ? ASP A 199 ? SER A 302 ASP A 306 5 ? 5  
HELX_P HELX_P10 AB1 GLY A 259 ? ASN A 278 ? GLY A 366 ASN A 385 1 ? 20 
HELX_P HELX_P11 AB2 THR A 282 ? SER A 294 ? THR A 389 SER A 401 1 ? 13 
HELX_P HELX_P12 AB3 ASP A 323 ? GLN A 332 ? ASP A 430 GLN A 439 1 ? 10 
HELX_P HELX_P13 AB4 ARG A 390 ? GLY A 392 ? ARG A 497 GLY A 499 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 104 SG  ? ? ? 1_555 A CYS 253 SG ? ? A CYS 211 A CYS 360  1_555  ? ? ? ? ? ? ? 2.060 ? 
disulf2  disulf ? ? A CYS 196 SG  ? ? ? 1_555 A CYS 226 SG ? ? A CYS 303 A CYS 333  1_555  ? ? ? ? ? ? ? 2.028 ? 
disulf3  disulf ? ? A CYS 343 SG  ? ? ? 1_555 A CYS 367 SG ? ? A CYS 450 A CYS 474  1_555  ? ? ? ? ? ? ? 2.070 ? 
metalc1  metalc ? ? A ASP 8   OD2 ? ? ? 1_555 C CA  .   CA ? ? A ASP 115 A CA  602  1_555  ? ? ? ? ? ? ? 2.393 ? 
metalc2  metalc ? ? A ASP 55  OD1 ? ? ? 1_555 C CA  .   CA ? ? A ASP 162 A CA  602  1_555  ? ? ? ? ? ? ? 2.411 ? 
metalc3  metalc ? ? A ASP 55  OD2 ? ? ? 1_555 C CA  .   CA ? ? A ASP 162 A CA  602  1_555  ? ? ? ? ? ? ? 2.567 ? 
metalc4  metalc ? ? A ASP 67  OD2 ? ? ? 1_555 B CA  .   CA ? ? A ASP 174 A CA  601  1_555  ? ? ? ? ? ? ? 2.348 ? 
metalc5  metalc ? ? A ASP 72  OD1 ? ? ? 1_555 B CA  .   CA ? ? A ASP 179 A CA  601  1_555  ? ? ? ? ? ? ? 2.549 ? 
metalc6  metalc ? ? A ASP 72  OD2 ? ? ? 1_555 B CA  .   CA ? ? A ASP 179 A CA  601  1_555  ? ? ? ? ? ? ? 2.618 ? 
metalc7  metalc ? ? A ASP 74  O   ? ? ? 1_555 B CA  .   CA ? ? A ASP 181 A CA  601  1_555  ? ? ? ? ? ? ? 2.336 ? 
metalc8  metalc ? ? A VAL 98  O   ? ? ? 1_555 C CA  .   CA ? ? A VAL 205 A CA  602  1_555  ? ? ? ? ? ? ? 2.358 ? 
metalc9  metalc ? ? A ASN 101 OD1 ? ? ? 1_555 C CA  .   CA ? ? A ASN 208 A CA  602  1_555  ? ? ? ? ? ? ? 2.546 ? 
metalc10 metalc ? ? A VAL 103 O   ? ? ? 1_555 C CA  .   CA ? ? A VAL 210 A CA  602  1_555  ? ? ? ? ? ? ? 2.312 ? 
metalc11 metalc ? ? A GLY 105 O   ? ? ? 1_555 C CA  .   CA ? ? A GLY 212 A CA  602  1_555  ? ? ? ? ? ? ? 2.420 ? 
metalc12 metalc ? ? A ASP 151 OD1 ? ? ? 1_555 D CA  .   CA ? ? A ASP 258 A CA  603  1_555  ? ? ? ? ? ? ? 2.382 ? 
metalc13 metalc ? ? A ASP 157 OD1 ? ? ? 1_555 F NA  .   NA ? ? A ASP 264 A NA  605  1_555  ? ? ? ? ? ? ? 2.515 ? 
metalc14 metalc ? ? A ASP 157 OD1 ? ? ? 1_555 K NA  .   NA ? ? A ASP 264 A NA  610  1_555  ? ? ? ? ? ? ? 2.412 ? 
metalc15 metalc ? ? A GLY 158 O   ? ? ? 1_555 F NA  .   NA ? ? A GLY 265 A NA  605  1_555  ? ? ? ? ? ? ? 2.483 ? 
metalc16 metalc ? ? A SER 172 O   ? ? ? 1_555 H NA  .   NA ? ? A SER 279 A NA  607  1_555  ? ? ? ? ? ? ? 2.449 ? 
metalc17 metalc ? ? A GLY 177 O   ? ? ? 1_555 H NA  .   NA ? ? A GLY 284 A NA  607  1_555  ? ? ? ? ? ? ? 2.539 ? 
metalc18 metalc ? ? A ASP 194 OD2 ? ? ? 1_555 D CA  .   CA ? ? A ASP 301 A CA  603  1_555  ? ? ? ? ? ? ? 2.400 ? 
metalc19 metalc ? ? A THR 202 O   ? ? ? 1_555 E NA  .   NA ? ? A THR 309 A NA  604  1_555  ? ? ? ? ? ? ? 2.351 ? 
metalc20 metalc ? ? A SER 204 O   ? ? ? 1_555 E NA  .   NA ? ? A SER 311 A NA  604  1_555  ? ? ? ? ? ? ? 2.487 ? 
metalc21 metalc ? ? A THR 207 O   ? ? ? 1_555 E NA  .   NA ? ? A THR 314 A NA  604  1_555  ? ? ? ? ? ? ? 2.390 ? 
metalc22 metalc ? ? A THR 207 OG1 ? ? ? 1_555 E NA  .   NA ? ? A THR 314 A NA  604  1_555  ? ? ? ? ? ? ? 2.430 ? 
metalc23 metalc ? ? A SER 209 OG  ? ? ? 1_555 E NA  .   NA ? ? A SER 316 A NA  604  1_555  ? ? ? ? ? ? ? 2.507 ? 
metalc24 metalc ? ? A GLU 224 OE1 ? ? ? 1_555 D CA  .   CA ? ? A GLU 331 A CA  603  1_555  ? ? ? ? ? ? ? 2.428 ? 
metalc25 metalc ? ? A GLU 224 OE2 ? ? ? 1_555 D CA  .   CA ? ? A GLU 331 A CA  603  1_555  ? ? ? ? ? ? ? 2.487 ? 
metalc26 metalc ? ? A THR 306 O   ? ? ? 1_555 L NA  .   NA ? ? A THR 413 A NA  611  1_555  ? ? ? ? ? ? ? 2.427 ? 
metalc27 metalc ? ? A SER 437 O   ? ? ? 1_555 I NA  .   NA ? ? A SER 544 A NA  608  1_555  ? ? ? ? ? ? ? 2.187 ? 
metalc28 metalc ? ? A GLU 439 OE2 ? ? ? 1_555 J NA  .   NA ? ? A GLU 546 A NA  609  1_555  ? ? ? ? ? ? ? 2.432 ? 
metalc29 metalc ? ? B CA  .   CA  ? ? ? 1_555 N HOH .   O  ? ? A CA  601 A HOH 786  1_555  ? ? ? ? ? ? ? 2.406 ? 
metalc30 metalc ? ? B CA  .   CA  ? ? ? 1_555 N HOH .   O  ? ? A CA  601 A HOH 1187 1_555  ? ? ? ? ? ? ? 2.440 ? 
metalc31 metalc ? ? B CA  .   CA  ? ? ? 1_555 N HOH .   O  ? ? A CA  601 A HOH 751  1_555  ? ? ? ? ? ? ? 2.480 ? 
metalc32 metalc ? ? D CA  .   CA  ? ? ? 1_555 N HOH .   O  ? ? A CA  603 A HOH 838  1_555  ? ? ? ? ? ? ? 2.406 ? 
metalc33 metalc ? ? D CA  .   CA  ? ? ? 1_555 N HOH .   O  ? ? A CA  603 A HOH 991  1_555  ? ? ? ? ? ? ? 2.480 ? 
metalc34 metalc ? ? D CA  .   CA  ? ? ? 1_555 N HOH .   O  ? ? A CA  603 A HOH 1110 1_555  ? ? ? ? ? ? ? 2.513 ? 
metalc35 metalc ? ? E NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  604 A HOH 871  1_555  ? ? ? ? ? ? ? 2.485 ? 
metalc36 metalc ? ? F NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  605 A HOH 824  1_555  ? ? ? ? ? ? ? 2.389 ? 
metalc37 metalc ? ? F NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  605 A HOH 874  1_555  ? ? ? ? ? ? ? 2.243 ? 
metalc38 metalc ? ? F NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  605 A HOH 1242 1_555  ? ? ? ? ? ? ? 2.532 ? 
metalc39 metalc ? ? F NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  605 A HOH 1175 1_555  ? ? ? ? ? ? ? 2.437 ? 
metalc40 metalc ? ? G NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  606 A HOH 1278 1_555  ? ? ? ? ? ? ? 2.390 ? 
metalc41 metalc ? ? G NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  606 A HOH 928  1_555  ? ? ? ? ? ? ? 2.287 ? 
metalc42 metalc ? ? G NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  606 A HOH 824  1_555  ? ? ? ? ? ? ? 2.551 ? 
metalc43 metalc ? ? G NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  606 A HOH 874  1_555  ? ? ? ? ? ? ? 2.462 ? 
metalc44 metalc ? ? G NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  606 A HOH 1242 1_555  ? ? ? ? ? ? ? 2.418 ? 
metalc45 metalc ? ? G NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  606 A HOH 1304 1_555  ? ? ? ? ? ? ? 2.495 ? 
metalc46 metalc ? ? H NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  607 A HOH 765  1_555  ? ? ? ? ? ? ? 2.466 ? 
metalc47 metalc ? ? H NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  607 A HOH 1008 1_555  ? ? ? ? ? ? ? 2.952 ? 
metalc48 metalc ? ? H NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  607 A HOH 1213 1_555  ? ? ? ? ? ? ? 2.429 ? 
metalc49 metalc ? ? H NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  607 A HOH 1244 1_555  ? ? ? ? ? ? ? 2.426 ? 
metalc50 metalc ? ? I NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  608 A HOH 823  1_555  ? ? ? ? ? ? ? 2.387 ? 
metalc51 metalc ? ? J NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  609 A HOH 1063 1_555  ? ? ? ? ? ? ? 2.396 ? 
metalc52 metalc ? ? J NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  609 A HOH 1177 1_555  ? ? ? ? ? ? ? 2.464 ? 
metalc53 metalc ? ? K NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  610 A HOH 850  1_555  ? ? ? ? ? ? ? 2.479 ? 
metalc54 metalc ? ? K NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  610 A HOH 1239 1_555  ? ? ? ? ? ? ? 2.487 ? 
metalc55 metalc ? ? K NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  610 A HOH 1168 1_555  ? ? ? ? ? ? ? 2.427 ? 
metalc56 metalc ? ? K NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  610 A HOH 1175 1_555  ? ? ? ? ? ? ? 2.611 ? 
metalc57 metalc ? ? L NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  611 A HOH 840  1_555  ? ? ? ? ? ? ? 2.327 ? 
metalc58 metalc ? ? L NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  611 A HOH 1173 1_555  ? ? ? ? ? ? ? 2.284 ? 
metalc59 metalc ? ? L NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  611 A HOH 907  1_555  ? ? ? ? ? ? ? 2.484 ? 
metalc60 metalc ? ? L NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  611 A HOH 947  1_555  ? ? ? ? ? ? ? 2.309 ? 
metalc61 metalc ? ? L NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  611 A HOH 1289 1_555  ? ? ? ? ? ? ? 2.401 ? 
metalc62 metalc ? ? A SER 437 O   ? ? ? 1_555 I NA  .   NA ? ? A SER 544 A NA  608  9_555  ? ? ? ? ? ? ? 2.186 ? 
metalc63 metalc ? ? A GLU 439 OE2 ? ? ? 1_555 J NA  .   NA ? ? A GLU 546 A NA  609  9_555  ? ? ? ? ? ? ? 2.432 ? 
metalc64 metalc ? ? H NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  607 A HOH 733  10_555 ? ? ? ? ? ? ? 2.634 ? 
metalc65 metalc ? ? I NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  608 A HOH 823  9_555  ? ? ? ? ? ? ? 2.387 ? 
metalc66 metalc ? ? J NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  609 A HOH 1063 9_555  ? ? ? ? ? ? ? 2.396 ? 
metalc67 metalc ? ? J NA  .   NA  ? ? ? 1_555 N HOH .   O  ? ? A NA  609 A HOH 1177 9_555  ? ? ? ? ? ? ? 2.464 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 66  ? ASP A 67  ? PHE A 173 ASP A 174 
AA1 2 ARG A 113 ? ARG A 118 ? ARG A 220 ARG A 225 
AA1 3 VAL A 41  ? ASP A 46  ? VAL A 148 ASP A 153 
AA1 4 ILE A 142 ? ALA A 145 ? ILE A 249 ALA A 252 
AA1 5 ILE A 181 ? ALA A 185 ? ILE A 288 ALA A 292 
AA1 6 THR A 207 ? ALA A 213 ? THR A 314 ALA A 320 
AA1 7 ALA A 231 ? TYR A 234 ? ALA A 338 TYR A 341 
AA2 1 ILE A 244 ? ASP A 248 ? ILE A 351 ASP A 355 
AA2 2 LYS A 252 ? HIS A 257 ? LYS A 359 HIS A 364 
AA3 1 ALA A 305 ? THR A 306 ? ALA A 412 THR A 413 
AA3 2 LYS A 312 ? VAL A 313 ? LYS A 419 VAL A 420 
AA4 1 ARG A 341 ? ASP A 346 ? ARG A 448 ASP A 453 
AA4 2 GLY A 454 ? THR A 466 ? GLY A 561 THR A 573 
AA4 3 LYS A 352 ? ASP A 353 ? LYS A 459 ASP A 460 
AA5 1 ARG A 341 ? ASP A 346 ? ARG A 448 ASP A 453 
AA5 2 GLY A 454 ? THR A 466 ? GLY A 561 THR A 573 
AA5 3 ARG A 376 ? TYR A 388 ? ARG A 483 TYR A 495 
AA5 4 PHE A 421 ? THR A 428 ? PHE A 528 THR A 535 
AA6 1 ARG A 357 ? VAL A 364 ? ARG A 464 VAL A 471 
AA6 2 GLY A 438 ? ASN A 446 ? GLY A 545 ASN A 553 
AA6 3 LEU A 394 ? VAL A 399 ? LEU A 501 VAL A 506 
AA6 4 ARG A 405 ? LEU A 409 ? ARG A 512 LEU A 516 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A 66  ? N PHE A 173 O ARG A 118 ? O ARG A 225 
AA1 2 3 O VAL A 117 ? O VAL A 224 N ILE A 44  ? N ILE A 151 
AA1 3 4 N LEU A 45  ? N LEU A 152 O SER A 144 ? O SER A 251 
AA1 4 5 N TYR A 143 ? N TYR A 250 O VAL A 183 ? O VAL A 290 
AA1 5 6 N PHE A 182 ? N PHE A 289 O LEU A 208 ? O LEU A 315 
AA1 6 7 N SER A 211 ? N SER A 318 O ALA A 231 ? O ALA A 338 
AA2 1 2 N THR A 246 ? N THR A 353 O THR A 254 ? O THR A 361 
AA3 1 2 N ALA A 305 ? N ALA A 412 O VAL A 313 ? O VAL A 420 
AA4 1 2 N ILE A 345 ? N ILE A 452 O LEU A 461 ? O LEU A 568 
AA4 2 3 O LEU A 456 ? O LEU A 563 N LYS A 352 ? N LYS A 459 
AA5 1 2 N ILE A 345 ? N ILE A 452 O LEU A 461 ? O LEU A 568 
AA5 2 3 O TYR A 464 ? O TYR A 571 N GLU A 378 ? N GLU A 485 
AA5 3 4 N ALA A 380 ? N ALA A 487 O THR A 428 ? O THR A 535 
AA6 1 2 N LEU A 358 ? N LEU A 465 O ILE A 444 ? O ILE A 551 
AA6 2 3 O GLU A 443 ? O GLU A 550 N HIS A 397 ? N HIS A 504 
AA6 3 4 N LEU A 398 ? N LEU A 505 O SER A 406 ? O SER A 513 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA 601 ? 6 'binding site for residue CA A 601' 
AC2 Software A CA 602 ? 6 'binding site for residue CA A 602' 
AC3 Software A CA 603 ? 6 'binding site for residue CA A 603' 
AC4 Software A NA 604 ? 5 'binding site for residue NA A 604' 
AC5 Software A NA 605 ? 8 'binding site for residue NA A 605' 
AC6 Software A NA 606 ? 7 'binding site for residue NA A 606' 
AC7 Software A NA 607 ? 7 'binding site for residue NA A 607' 
AC8 Software A NA 608 ? 4 'binding site for residue NA A 608' 
AC9 Software A NA 609 ? 6 'binding site for residue NA A 609' 
AD1 Software A NA 610 ? 6 'binding site for residue NA A 610' 
AD2 Software A NA 611 ? 6 'binding site for residue NA A 611' 
AD3 Software A CL 612 ? 4 'binding site for residue CL A 612' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 67  ? ASP A 174  . ? 1_555  ? 
2  AC1 6 ASP A 72  ? ASP A 179  . ? 1_555  ? 
3  AC1 6 ASP A 74  ? ASP A 181  . ? 1_555  ? 
4  AC1 6 HOH N .   ? HOH A 751  . ? 1_555  ? 
5  AC1 6 HOH N .   ? HOH A 786  . ? 1_555  ? 
6  AC1 6 HOH N .   ? HOH A 1187 . ? 1_555  ? 
7  AC2 6 ASP A 8   ? ASP A 115  . ? 1_555  ? 
8  AC2 6 ASP A 55  ? ASP A 162  . ? 1_555  ? 
9  AC2 6 VAL A 98  ? VAL A 205  . ? 1_555  ? 
10 AC2 6 ASN A 101 ? ASN A 208  . ? 1_555  ? 
11 AC2 6 VAL A 103 ? VAL A 210  . ? 1_555  ? 
12 AC2 6 GLY A 105 ? GLY A 212  . ? 1_555  ? 
13 AC3 6 ASP A 151 ? ASP A 258  . ? 1_555  ? 
14 AC3 6 ASP A 194 ? ASP A 301  . ? 1_555  ? 
15 AC3 6 GLU A 224 ? GLU A 331  . ? 1_555  ? 
16 AC3 6 HOH N .   ? HOH A 838  . ? 1_555  ? 
17 AC3 6 HOH N .   ? HOH A 991  . ? 1_555  ? 
18 AC3 6 HOH N .   ? HOH A 1110 . ? 1_555  ? 
19 AC4 5 THR A 202 ? THR A 309  . ? 1_555  ? 
20 AC4 5 SER A 204 ? SER A 311  . ? 1_555  ? 
21 AC4 5 THR A 207 ? THR A 314  . ? 1_555  ? 
22 AC4 5 SER A 209 ? SER A 316  . ? 1_555  ? 
23 AC4 5 HOH N .   ? HOH A 871  . ? 1_555  ? 
24 AC5 8 ASP A 157 ? ASP A 264  . ? 1_555  ? 
25 AC5 8 GLY A 158 ? GLY A 265  . ? 1_555  ? 
26 AC5 8 NA  G .   ? NA  A 606  . ? 1_555  ? 
27 AC5 8 NA  K .   ? NA  A 610  . ? 1_555  ? 
28 AC5 8 HOH N .   ? HOH A 824  . ? 1_555  ? 
29 AC5 8 HOH N .   ? HOH A 874  . ? 1_555  ? 
30 AC5 8 HOH N .   ? HOH A 1175 . ? 1_555  ? 
31 AC5 8 HOH N .   ? HOH A 1242 . ? 1_555  ? 
32 AC6 7 NA  F .   ? NA  A 605  . ? 1_555  ? 
33 AC6 7 HOH N .   ? HOH A 824  . ? 1_555  ? 
34 AC6 7 HOH N .   ? HOH A 874  . ? 1_555  ? 
35 AC6 7 HOH N .   ? HOH A 928  . ? 1_555  ? 
36 AC6 7 HOH N .   ? HOH A 1242 . ? 1_555  ? 
37 AC6 7 HOH N .   ? HOH A 1278 . ? 1_555  ? 
38 AC6 7 HOH N .   ? HOH A 1304 . ? 1_555  ? 
39 AC7 7 SER A 172 ? SER A 279  . ? 1_555  ? 
40 AC7 7 GLY A 177 ? GLY A 284  . ? 1_555  ? 
41 AC7 7 HOH N .   ? HOH A 733  . ? 10_555 ? 
42 AC7 7 HOH N .   ? HOH A 765  . ? 1_555  ? 
43 AC7 7 HOH N .   ? HOH A 1008 . ? 1_555  ? 
44 AC7 7 HOH N .   ? HOH A 1213 . ? 1_555  ? 
45 AC7 7 HOH N .   ? HOH A 1244 . ? 1_555  ? 
46 AC8 4 SER A 437 ? SER A 544  . ? 9_555  ? 
47 AC8 4 SER A 437 ? SER A 544  . ? 1_555  ? 
48 AC8 4 HOH N .   ? HOH A 823  . ? 1_555  ? 
49 AC8 4 HOH N .   ? HOH A 823  . ? 9_555  ? 
50 AC9 6 GLU A 439 ? GLU A 546  . ? 9_555  ? 
51 AC9 6 GLU A 439 ? GLU A 546  . ? 1_555  ? 
52 AC9 6 HOH N .   ? HOH A 1063 . ? 1_555  ? 
53 AC9 6 HOH N .   ? HOH A 1063 . ? 9_555  ? 
54 AC9 6 HOH N .   ? HOH A 1177 . ? 9_555  ? 
55 AC9 6 HOH N .   ? HOH A 1177 . ? 1_555  ? 
56 AD1 6 ASP A 157 ? ASP A 264  . ? 1_555  ? 
57 AD1 6 NA  F .   ? NA  A 605  . ? 1_555  ? 
58 AD1 6 HOH N .   ? HOH A 850  . ? 1_555  ? 
59 AD1 6 HOH N .   ? HOH A 1168 . ? 1_555  ? 
60 AD1 6 HOH N .   ? HOH A 1175 . ? 1_555  ? 
61 AD1 6 HOH N .   ? HOH A 1239 . ? 1_555  ? 
62 AD2 6 THR A 306 ? THR A 413  . ? 1_555  ? 
63 AD2 6 HOH N .   ? HOH A 840  . ? 1_555  ? 
64 AD2 6 HOH N .   ? HOH A 907  . ? 1_555  ? 
65 AD2 6 HOH N .   ? HOH A 947  . ? 1_555  ? 
66 AD2 6 HOH N .   ? HOH A 1173 . ? 1_555  ? 
67 AD2 6 HOH N .   ? HOH A 1289 . ? 1_555  ? 
68 AD3 4 ARG A 169 ? ARG A 276  . ? 10_555 ? 
69 AD3 4 TYR A 206 ? TYR A 313  . ? 1_555  ? 
70 AD3 4 LYS A 342 ? LYS A 449  . ? 1_555  ? 
71 AD3 4 TYR A 464 ? TYR A 571  . ? 1_555  ? 
# 
_atom_sites.entry_id                    5JXG 
_atom_sites.fract_transf_matrix[1][1]   0.007578 
_atom_sites.fract_transf_matrix[1][2]   0.004375 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008751 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006425 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 2   ? 5.550  -32.911 -16.686 1.00 65.39 ? 109  VAL A N   1 
ATOM   2    C  CA  . VAL A 1 2   ? 5.940  -31.640 -17.287 1.00 64.06 ? 109  VAL A CA  1 
ATOM   3    C  C   . VAL A 1 2   ? 7.448  -31.597 -17.554 1.00 55.83 ? 109  VAL A C   1 
ATOM   4    O  O   . VAL A 1 2   ? 7.891  -30.987 -18.532 1.00 58.07 ? 109  VAL A O   1 
ATOM   5    C  CB  . VAL A 1 2   ? 5.522  -30.432 -16.390 1.00 67.44 ? 109  VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 2   ? 6.134  -30.538 -14.992 1.00 55.63 ? 109  VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 2   ? 5.886  -29.104 -17.050 1.00 58.46 ? 109  VAL A CG2 1 
ATOM   8    N  N   . TYR A 1 3   ? 8.236  -32.258 -16.705 1.00 56.29 ? 110  TYR A N   1 
ATOM   9    C  CA  . TYR A 1 3   ? 9.688  -32.216 -16.859 1.00 45.84 ? 110  TYR A CA  1 
ATOM   10   C  C   . TYR A 1 3   ? 10.144 -32.942 -18.121 1.00 35.79 ? 110  TYR A C   1 
ATOM   11   O  O   . TYR A 1 3   ? 9.804  -34.104 -18.337 1.00 43.79 ? 110  TYR A O   1 
ATOM   12   C  CB  . TYR A 1 3   ? 10.418 -32.816 -15.645 1.00 39.91 ? 110  TYR A CB  1 
ATOM   13   C  CG  . TYR A 1 3   ? 11.914 -32.799 -15.871 1.00 35.31 ? 110  TYR A CG  1 
ATOM   14   C  CD1 . TYR A 1 3   ? 12.606 -31.598 -15.867 1.00 32.68 ? 110  TYR A CD1 1 
ATOM   15   C  CD2 . TYR A 1 3   ? 12.621 -33.967 -16.148 1.00 31.46 ? 110  TYR A CD2 1 
ATOM   16   C  CE1 . TYR A 1 3   ? 13.961 -31.550 -16.108 1.00 34.16 ? 110  TYR A CE1 1 
ATOM   17   C  CE2 . TYR A 1 3   ? 13.995 -33.930 -16.390 1.00 26.93 ? 110  TYR A CE2 1 
ATOM   18   C  CZ  . TYR A 1 3   ? 14.653 -32.712 -16.371 1.00 26.51 ? 110  TYR A CZ  1 
ATOM   19   O  OH  . TYR A 1 3   ? 16.007 -32.628 -16.612 1.00 27.48 ? 110  TYR A OH  1 
ATOM   20   N  N   . GLN A 1 4   ? 10.924 -32.253 -18.947 1.00 36.85 ? 111  GLN A N   1 
ATOM   21   C  CA  . GLN A 1 4   ? 11.532 -32.887 -20.112 1.00 41.27 ? 111  GLN A CA  1 
ATOM   22   C  C   . GLN A 1 4   ? 13.025 -33.093 -19.877 1.00 30.63 ? 111  GLN A C   1 
ATOM   23   O  O   . GLN A 1 4   ? 13.770 -32.140 -19.654 1.00 28.83 ? 111  GLN A O   1 
ATOM   24   C  CB  . GLN A 1 4   ? 11.294 -32.055 -21.378 1.00 36.27 ? 111  GLN A CB  1 
ATOM   25   C  CG  . GLN A 1 4   ? 9.828  -31.962 -21.786 1.00 47.77 ? 111  GLN A CG  1 
ATOM   26   C  CD  . GLN A 1 4   ? 9.192  -33.327 -21.988 1.00 44.49 ? 111  GLN A CD  1 
ATOM   27   O  OE1 . GLN A 1 4   ? 9.630  -34.111 -22.830 0.00 40.93 ? 111  GLN A OE1 1 
ATOM   28   N  NE2 . GLN A 1 4   ? 8.158  -33.620 -21.207 0.00 43.33 ? 111  GLN A NE2 1 
ATOM   29   N  N   . GLU A 1 5   ? 13.451 -34.348 -19.925 1.00 29.64 ? 112  GLU A N   1 
ATOM   30   C  CA  . GLU A 1 5   ? 14.854 -34.688 -19.730 1.00 34.51 ? 112  GLU A CA  1 
ATOM   31   C  C   . GLU A 1 5   ? 15.698 -34.148 -20.883 1.00 32.07 ? 112  GLU A C   1 
ATOM   32   O  O   . GLU A 1 5   ? 15.180 -33.925 -21.983 1.00 29.49 ? 112  GLU A O   1 
ATOM   33   C  CB  . GLU A 1 5   ? 15.018 -36.201 -19.602 1.00 30.27 ? 112  GLU A CB  1 
ATOM   34   C  CG  . GLU A 1 5   ? 14.906 -36.941 -20.910 1.00 33.93 ? 112  GLU A CG  1 
ATOM   35   C  CD  . GLU A 1 5   ? 14.989 -38.436 -20.722 1.00 40.70 ? 112  GLU A CD  1 
ATOM   36   O  OE1 . GLU A 1 5   ? 14.939 -39.167 -21.735 1.00 46.53 ? 112  GLU A OE1 1 
ATOM   37   O  OE2 . GLU A 1 5   ? 15.101 -38.878 -19.559 1.00 43.06 ? 112  GLU A OE2 1 
ATOM   38   N  N   . PRO A 1 6   ? 17.000 -33.931 -20.634 1.00 26.13 ? 113  PRO A N   1 
ATOM   39   C  CA  . PRO A 1 6   ? 17.897 -33.331 -21.626 1.00 23.50 ? 113  PRO A CA  1 
ATOM   40   C  C   . PRO A 1 6   ? 17.911 -34.072 -22.951 1.00 22.49 ? 113  PRO A C   1 
ATOM   41   O  O   . PRO A 1 6   ? 17.760 -35.293 -22.986 1.00 22.46 ? 113  PRO A O   1 
ATOM   42   C  CB  . PRO A 1 6   ? 19.264 -33.421 -20.951 1.00 23.74 ? 113  PRO A CB  1 
ATOM   43   C  CG  . PRO A 1 6   ? 18.944 -33.338 -19.498 1.00 23.35 ? 113  PRO A CG  1 
ATOM   44   C  CD  . PRO A 1 6   ? 17.698 -34.166 -19.355 1.00 24.69 ? 113  PRO A CD  1 
ATOM   45   N  N   . THR A 1 7   ? 18.113 -33.326 -24.029 1.00 25.43 ? 114  THR A N   1 
ATOM   46   C  CA  . THR A 1 7   ? 18.097 -33.895 -25.366 1.00 24.75 ? 114  THR A CA  1 
ATOM   47   C  C   . THR A 1 7   ? 19.505 -34.038 -25.927 1.00 26.34 ? 114  THR A C   1 
ATOM   48   O  O   . THR A 1 7   ? 19.678 -34.434 -27.073 1.00 24.69 ? 114  THR A O   1 
ATOM   49   C  CB  . THR A 1 7   ? 17.261 -33.023 -26.325 1.00 21.55 ? 114  THR A CB  1 
ATOM   50   O  OG1 . THR A 1 7   ? 17.779 -31.692 -26.315 1.00 26.97 ? 114  THR A OG1 1 
ATOM   51   C  CG2 . THR A 1 7   ? 15.812 -32.980 -25.871 1.00 27.45 ? 114  THR A CG2 1 
ATOM   52   N  N   . ASP A 1 8   ? 20.507 -33.700 -25.117 1.00 20.57 ? 115  ASP A N   1 
ATOM   53   C  CA  . ASP A 1 8   ? 21.905 -33.747 -25.551 1.00 23.12 ? 115  ASP A CA  1 
ATOM   54   C  C   . ASP A 1 8   ? 22.282 -35.091 -26.158 1.00 18.64 ? 115  ASP A C   1 
ATOM   55   O  O   . ASP A 1 8   ? 21.810 -36.137 -25.688 1.00 21.57 ? 115  ASP A O   1 
ATOM   56   C  CB  . ASP A 1 8   ? 22.820 -33.431 -24.365 1.00 19.80 ? 115  ASP A CB  1 
ATOM   57   C  CG  . ASP A 1 8   ? 22.484 -32.107 -23.731 1.00 17.84 ? 115  ASP A CG  1 
ATOM   58   O  OD1 . ASP A 1 8   ? 21.366 -31.988 -23.181 1.00 20.15 ? 115  ASP A OD1 1 
ATOM   59   O  OD2 . ASP A 1 8   ? 23.322 -31.188 -23.786 1.00 20.81 ? 115  ASP A OD2 1 
ATOM   60   N  N   . PRO A 1 9   ? 23.146 -35.072 -27.190 1.00 18.46 ? 116  PRO A N   1 
ATOM   61   C  CA  . PRO A 1 9   ? 23.424 -36.281 -27.975 1.00 21.55 ? 116  PRO A CA  1 
ATOM   62   C  C   . PRO A 1 9   ? 24.005 -37.429 -27.154 1.00 25.44 ? 116  PRO A C   1 
ATOM   63   O  O   . PRO A 1 9   ? 23.679 -38.583 -27.439 1.00 22.60 ? 116  PRO A O   1 
ATOM   64   C  CB  . PRO A 1 9   ? 24.430 -35.799 -29.038 1.00 24.72 ? 116  PRO A CB  1 
ATOM   65   C  CG  . PRO A 1 9   ? 24.957 -34.500 -28.537 1.00 24.98 ? 116  PRO A CG  1 
ATOM   66   C  CD  . PRO A 1 9   ? 23.851 -33.895 -27.724 1.00 20.67 ? 116  PRO A CD  1 
ATOM   67   N  N   . LYS A 1 10  ? 24.816 -37.130 -26.140 1.00 21.86 ? 117  LYS A N   1 
ATOM   68   C  CA  . LYS A 1 10  ? 25.415 -38.193 -25.332 1.00 19.57 ? 117  LYS A CA  1 
ATOM   69   C  C   . LYS A 1 10  ? 24.689 -38.421 -24.014 1.00 20.54 ? 117  LYS A C   1 
ATOM   70   O  O   . LYS A 1 10  ? 25.110 -39.259 -23.224 1.00 22.87 ? 117  LYS A O   1 
ATOM   71   C  CB  . LYS A 1 10  ? 26.888 -37.897 -25.034 1.00 21.75 ? 117  LYS A CB  1 
ATOM   72   C  CG  . LYS A 1 10  ? 27.763 -37.687 -26.254 1.00 24.22 ? 117  LYS A CG  1 
ATOM   73   C  CD  . LYS A 1 10  ? 27.818 -38.905 -27.161 1.00 35.16 ? 117  LYS A CD  1 
ATOM   74   C  CE  . LYS A 1 10  ? 28.851 -38.679 -28.266 1.00 44.58 ? 117  LYS A CE  1 
ATOM   75   N  NZ  . LYS A 1 10  ? 28.686 -39.596 -29.432 1.00 42.39 ? 117  LYS A NZ  1 
ATOM   76   N  N   . PHE A 1 11  ? 23.607 -37.690 -23.761 1.00 19.31 ? 118  PHE A N   1 
ATOM   77   C  CA  . PHE A 1 11  ? 22.864 -37.921 -22.521 1.00 19.52 ? 118  PHE A CA  1 
ATOM   78   C  C   . PHE A 1 11  ? 22.400 -39.378 -22.339 1.00 21.02 ? 118  PHE A C   1 
ATOM   79   O  O   . PHE A 1 11  ? 22.457 -39.897 -21.218 1.00 22.38 ? 118  PHE A O   1 
ATOM   80   C  CB  . PHE A 1 11  ? 21.649 -36.986 -22.403 1.00 20.03 ? 118  PHE A CB  1 
ATOM   81   C  CG  . PHE A 1 11  ? 20.810 -37.264 -21.190 1.00 23.43 ? 118  PHE A CG  1 
ATOM   82   C  CD1 . PHE A 1 11  ? 21.326 -37.054 -19.917 1.00 20.18 ? 118  PHE A CD1 1 
ATOM   83   C  CD2 . PHE A 1 11  ? 19.531 -37.775 -21.314 1.00 21.18 ? 118  PHE A CD2 1 
ATOM   84   C  CE1 . PHE A 1 11  ? 20.573 -37.335 -18.790 1.00 20.73 ? 118  PHE A CE1 1 
ATOM   85   C  CE2 . PHE A 1 11  ? 18.765 -38.056 -20.196 1.00 20.66 ? 118  PHE A CE2 1 
ATOM   86   C  CZ  . PHE A 1 11  ? 19.289 -37.835 -18.926 1.00 25.22 ? 118  PHE A CZ  1 
ATOM   87   N  N   . PRO A 1 12  ? 21.943 -40.050 -23.419 1.00 20.43 ? 119  PRO A N   1 
ATOM   88   C  CA  . PRO A 1 12  ? 21.567 -41.458 -23.237 1.00 20.47 ? 119  PRO A CA  1 
ATOM   89   C  C   . PRO A 1 12  ? 22.722 -42.367 -22.798 1.00 24.67 ? 119  PRO A C   1 
ATOM   90   O  O   . PRO A 1 12  ? 22.462 -43.427 -22.230 1.00 25.62 ? 119  PRO A O   1 
ATOM   91   C  CB  . PRO A 1 12  ? 21.069 -41.867 -24.627 1.00 35.02 ? 119  PRO A CB  1 
ATOM   92   C  CG  . PRO A 1 12  ? 20.597 -40.589 -25.244 1.00 29.72 ? 119  PRO A CG  1 
ATOM   93   C  CD  . PRO A 1 12  ? 21.573 -39.561 -24.764 1.00 26.76 ? 119  PRO A CD  1 
ATOM   94   N  N   . GLN A 1 13  ? 23.960 -41.961 -23.068 1.00 19.79 ? 120  GLN A N   1 
ATOM   95   C  CA  . GLN A 1 13  ? 25.149 -42.712 -22.652 1.00 20.33 ? 120  GLN A CA  1 
ATOM   96   C  C   . GLN A 1 13  ? 25.544 -42.434 -21.202 1.00 20.46 ? 120  GLN A C   1 
ATOM   97   O  O   . GLN A 1 13  ? 26.410 -43.109 -20.644 1.00 17.68 ? 120  GLN A O   1 
ATOM   98   C  CB  . GLN A 1 13  ? 26.338 -42.381 -23.563 1.00 19.87 ? 120  GLN A CB  1 
ATOM   99   C  CG  . GLN A 1 13  ? 26.307 -43.070 -24.925 1.00 28.55 ? 120  GLN A CG  1 
ATOM   100  C  CD  . GLN A 1 13  ? 25.226 -42.531 -25.842 1.00 42.03 ? 120  GLN A CD  1 
ATOM   101  O  OE1 . GLN A 1 13  ? 25.368 -41.455 -26.426 1.00 49.39 ? 120  GLN A OE1 1 
ATOM   102  N  NE2 . GLN A 1 13  ? 24.136 -43.281 -25.975 1.00 55.05 ? 120  GLN A NE2 1 
ATOM   103  N  N   . GLN A 1 14  ? 24.914 -41.436 -20.596 1.00 17.63 ? 121  GLN A N   1 
ATOM   104  C  CA  . GLN A 1 14  ? 25.204 -41.105 -19.198 1.00 16.75 ? 121  GLN A CA  1 
ATOM   105  C  C   . GLN A 1 14  ? 24.357 -41.975 -18.277 1.00 16.21 ? 121  GLN A C   1 
ATOM   106  O  O   . GLN A 1 14  ? 23.451 -41.507 -17.589 1.00 20.38 ? 121  GLN A O   1 
ATOM   107  C  CB  . GLN A 1 14  ? 24.986 -39.613 -18.961 1.00 18.41 ? 121  GLN A CB  1 
ATOM   108  C  CG  . GLN A 1 14  ? 25.931 -38.785 -19.832 1.00 17.18 ? 121  GLN A CG  1 
ATOM   109  C  CD  . GLN A 1 14  ? 25.885 -37.294 -19.556 1.00 20.30 ? 121  GLN A CD  1 
ATOM   110  O  OE1 . GLN A 1 14  ? 24.893 -36.632 -19.841 1.00 17.73 ? 121  GLN A OE1 1 
ATOM   111  N  NE2 . GLN A 1 14  ? 26.972 -36.757 -19.005 1.00 22.02 ? 121  GLN A NE2 1 
ATOM   112  N  N   . TRP A 1 15  ? 24.690 -43.261 -18.284 1.00 15.70 ? 122  TRP A N   1 
ATOM   113  C  CA  . TRP A 1 15  ? 23.947 -44.319 -17.606 1.00 18.00 ? 122  TRP A CA  1 
ATOM   114  C  C   . TRP A 1 15  ? 23.776 -44.115 -16.097 1.00 21.18 ? 122  TRP A C   1 
ATOM   115  O  O   . TRP A 1 15  ? 22.838 -44.634 -15.491 1.00 23.13 ? 122  TRP A O   1 
ATOM   116  C  CB  . TRP A 1 15  ? 24.658 -45.649 -17.857 1.00 19.61 ? 122  TRP A CB  1 
ATOM   117  C  CG  . TRP A 1 15  ? 26.108 -45.639 -17.415 1.00 16.24 ? 122  TRP A CG  1 
ATOM   118  C  CD1 . TRP A 1 15  ? 27.187 -45.195 -18.133 1.00 18.79 ? 122  TRP A CD1 1 
ATOM   119  C  CD2 . TRP A 1 15  ? 26.623 -46.095 -16.159 1.00 14.47 ? 122  TRP A CD2 1 
ATOM   120  N  NE1 . TRP A 1 15  ? 28.344 -45.351 -17.399 1.00 17.45 ? 122  TRP A NE1 1 
ATOM   121  C  CE2 . TRP A 1 15  ? 28.024 -45.904 -16.185 1.00 15.81 ? 122  TRP A CE2 1 
ATOM   122  C  CE3 . TRP A 1 15  ? 26.038 -46.652 -15.013 1.00 18.73 ? 122  TRP A CE3 1 
ATOM   123  C  CZ2 . TRP A 1 15  ? 28.846 -46.249 -15.111 1.00 15.28 ? 122  TRP A CZ2 1 
ATOM   124  C  CZ3 . TRP A 1 15  ? 26.859 -46.995 -13.944 1.00 16.71 ? 122  TRP A CZ3 1 
ATOM   125  C  CH2 . TRP A 1 15  ? 28.249 -46.790 -14.005 1.00 15.62 ? 122  TRP A CH2 1 
ATOM   126  N  N   . TYR A 1 16  ? 24.697 -43.370 -15.500 1.00 17.46 ? 123  TYR A N   1 
ATOM   127  C  CA  . TYR A 1 16  ? 24.730 -43.175 -14.044 1.00 16.69 ? 123  TYR A CA  1 
ATOM   128  C  C   . TYR A 1 16  ? 23.767 -42.068 -13.611 1.00 21.27 ? 123  TYR A C   1 
ATOM   129  O  O   . TYR A 1 16  ? 23.413 -41.958 -12.433 1.00 22.48 ? 123  TYR A O   1 
ATOM   130  C  CB  . TYR A 1 16  ? 26.162 -42.846 -13.587 1.00 17.18 ? 123  TYR A CB  1 
ATOM   131  C  CG  . TYR A 1 16  ? 26.845 -41.926 -14.557 1.00 14.10 ? 123  TYR A CG  1 
ATOM   132  C  CD1 . TYR A 1 16  ? 27.465 -42.431 -15.699 1.00 15.53 ? 123  TYR A CD1 1 
ATOM   133  C  CD2 . TYR A 1 16  ? 26.841 -40.546 -14.362 1.00 13.46 ? 123  TYR A CD2 1 
ATOM   134  C  CE1 . TYR A 1 16  ? 28.057 -41.589 -16.619 1.00 15.23 ? 123  TYR A CE1 1 
ATOM   135  C  CE2 . TYR A 1 16  ? 27.439 -39.696 -15.279 1.00 15.41 ? 123  TYR A CE2 1 
ATOM   136  C  CZ  . TYR A 1 16  ? 28.041 -40.231 -16.407 1.00 15.82 ? 123  TYR A CZ  1 
ATOM   137  O  OH  . TYR A 1 16  ? 28.641 -39.408 -17.322 1.00 15.08 ? 123  TYR A OH  1 
ATOM   138  N  N   . LEU A 1 17  ? 23.350 -41.245 -14.565 1.00 19.83 ? 124  LEU A N   1 
ATOM   139  C  CA  . LEU A 1 17  ? 22.457 -40.136 -14.265 1.00 25.93 ? 124  LEU A CA  1 
ATOM   140  C  C   . LEU A 1 17  ? 21.039 -40.638 -14.239 1.00 35.53 ? 124  LEU A C   1 
ATOM   141  O  O   . LEU A 1 17  ? 20.316 -40.481 -13.247 1.00 34.19 ? 124  LEU A O   1 
ATOM   142  C  CB  . LEU A 1 17  ? 22.600 -39.021 -15.298 1.00 22.06 ? 124  LEU A CB  1 
ATOM   143  C  CG  . LEU A 1 17  ? 23.926 -38.277 -15.226 1.00 20.95 ? 124  LEU A CG  1 
ATOM   144  C  CD1 . LEU A 1 17  ? 23.918 -37.051 -16.135 1.00 19.70 ? 124  LEU A CD1 1 
ATOM   145  C  CD2 . LEU A 1 17  ? 24.201 -37.899 -13.770 1.00 18.00 ? 124  LEU A CD2 1 
ATOM   146  N  N   . SER A 1 18  ? 20.667 -41.253 -15.352 1.00 33.86 ? 125  SER A N   1 
ATOM   147  C  CA  . SER A 1 18  ? 19.331 -41.759 -15.567 1.00 49.21 ? 125  SER A CA  1 
ATOM   148  C  C   . SER A 1 18  ? 19.411 -43.065 -16.344 1.00 41.64 ? 125  SER A C   1 
ATOM   149  O  O   . SER A 1 18  ? 20.032 -43.133 -17.405 1.00 44.00 ? 125  SER A O   1 
ATOM   150  C  CB  . SER A 1 18  ? 18.488 -40.731 -16.326 1.00 40.12 ? 125  SER A CB  1 
ATOM   151  O  OG  . SER A 1 18  ? 17.118 -40.853 -15.994 1.00 57.80 ? 125  SER A OG  1 
ATOM   152  N  N   . GLY A 1 19  ? 18.794 -44.100 -15.793 1.00 50.58 ? 126  GLY A N   1 
ATOM   153  C  CA  . GLY A 1 19  ? 18.651 -45.373 -16.470 1.00 55.26 ? 126  GLY A CA  1 
ATOM   154  C  C   . GLY A 1 19  ? 17.349 -46.018 -16.035 1.00 66.07 ? 126  GLY A C   1 
ATOM   155  O  O   . GLY A 1 19  ? 16.797 -45.681 -14.982 1.00 71.43 ? 126  GLY A O   1 
ATOM   156  N  N   . VAL A 1 20  ? 16.848 -46.943 -16.845 1.00 73.95 ? 127  VAL A N   1 
ATOM   157  C  CA  . VAL A 1 20  ? 15.648 -47.691 -16.488 1.00 70.94 ? 127  VAL A CA  1 
ATOM   158  C  C   . VAL A 1 20  ? 16.017 -48.865 -15.579 1.00 75.78 ? 127  VAL A C   1 
ATOM   159  O  O   . VAL A 1 20  ? 15.154 -49.630 -15.148 1.00 78.51 ? 127  VAL A O   1 
ATOM   160  C  CB  . VAL A 1 20  ? 14.917 -48.215 -17.739 1.00 58.29 ? 127  VAL A CB  1 
ATOM   161  C  CG1 . VAL A 1 20  ? 14.596 -47.067 -18.685 0.00 53.75 ? 127  VAL A CG1 1 
ATOM   162  C  CG2 . VAL A 1 20  ? 15.762 -49.265 -18.444 0.00 54.74 ? 127  VAL A CG2 1 
ATOM   163  N  N   . THR A 1 21  ? 17.310 -48.978 -15.281 1.00 72.93 ? 128  THR A N   1 
ATOM   164  C  CA  . THR A 1 21  ? 17.884 -50.136 -14.601 1.00 56.98 ? 128  THR A CA  1 
ATOM   165  C  C   . THR A 1 21  ? 17.726 -50.092 -13.075 1.00 63.58 ? 128  THR A C   1 
ATOM   166  O  O   . THR A 1 21  ? 17.717 -51.144 -12.428 1.00 69.59 ? 128  THR A O   1 
ATOM   167  C  CB  . THR A 1 21  ? 19.393 -50.270 -14.956 1.00 53.59 ? 128  THR A CB  1 
ATOM   168  O  OG1 . THR A 1 21  ? 19.549 -50.298 -16.380 0.00 52.48 ? 128  THR A OG1 1 
ATOM   169  C  CG2 . THR A 1 21  ? 19.995 -51.537 -14.371 0.00 50.88 ? 128  THR A CG2 1 
ATOM   170  N  N   . GLN A 1 22  ? 17.573 -48.882 -12.528 1.00 63.39 ? 129  GLN A N   1 
ATOM   171  C  CA  . GLN A 1 22  ? 17.646 -48.583 -11.080 1.00 64.78 ? 129  GLN A CA  1 
ATOM   172  C  C   . GLN A 1 22  ? 19.099 -48.546 -10.595 1.00 62.68 ? 129  GLN A C   1 
ATOM   173  O  O   . GLN A 1 22  ? 19.367 -48.332 -9.409  1.00 56.20 ? 129  GLN A O   1 
ATOM   174  C  CB  . GLN A 1 22  ? 16.853 -49.583 -10.226 1.00 52.56 ? 129  GLN A CB  1 
ATOM   175  C  CG  . GLN A 1 22  ? 15.360 -49.613 -10.488 0.00 49.06 ? 129  GLN A CG  1 
ATOM   176  C  CD  . GLN A 1 22  ? 14.665 -50.711 -9.708  0.00 44.62 ? 129  GLN A CD  1 
ATOM   177  O  OE1 . GLN A 1 22  ? 15.272 -51.728 -9.369  0.00 44.76 ? 129  GLN A OE1 1 
ATOM   178  N  NE2 . GLN A 1 22  ? 13.387 -50.509 -9.411  0.00 41.34 ? 129  GLN A NE2 1 
ATOM   179  N  N   . ARG A 1 23  ? 20.037 -48.753 -11.513 1.00 55.84 ? 130  ARG A N   1 
ATOM   180  C  CA  . ARG A 1 23  ? 21.447 -48.603 -11.185 1.00 44.24 ? 130  ARG A CA  1 
ATOM   181  C  C   . ARG A 1 23  ? 21.906 -47.209 -11.613 1.00 34.72 ? 130  ARG A C   1 
ATOM   182  O  O   . ARG A 1 23  ? 22.662 -47.062 -12.581 1.00 31.09 ? 130  ARG A O   1 
ATOM   183  C  CB  . ARG A 1 23  ? 22.301 -49.686 -11.864 1.00 46.74 ? 130  ARG A CB  1 
ATOM   184  C  CG  . ARG A 1 23  ? 21.973 -51.149 -11.502 1.00 54.99 ? 130  ARG A CG  1 
ATOM   185  C  CD  . ARG A 1 23  ? 21.197 -51.322 -10.183 1.00 51.75 ? 130  ARG A CD  1 
ATOM   186  N  NE  . ARG A 1 23  ? 21.142 -52.724 -9.762  1.00 56.27 ? 130  ARG A NE  1 
ATOM   187  C  CZ  . ARG A 1 23  ? 20.278 -53.621 -10.230 1.00 47.50 ? 130  ARG A CZ  1 
ATOM   188  N  NH1 . ARG A 1 23  ? 19.384 -53.273 -11.146 0.00 46.97 ? 130  ARG A NH1 1 
ATOM   189  N  NH2 . ARG A 1 23  ? 20.311 -54.870 -9.786  0.00 42.90 ? 130  ARG A NH2 1 
ATOM   190  N  N   . ASP A 1 24  ? 21.420 -46.181 -10.914 1.00 31.03 ? 131  ASP A N   1 
ATOM   191  C  CA  . ASP A 1 24  ? 21.838 -44.810 -11.197 1.00 25.13 ? 131  ASP A CA  1 
ATOM   192  C  C   . ASP A 1 24  ? 21.747 -43.935 -9.944  1.00 20.38 ? 131  ASP A C   1 
ATOM   193  O  O   . ASP A 1 24  ? 21.376 -44.410 -8.873  1.00 20.51 ? 131  ASP A O   1 
ATOM   194  C  CB  . ASP A 1 24  ? 21.015 -44.205 -12.345 1.00 22.84 ? 131  ASP A CB  1 
ATOM   195  C  CG  . ASP A 1 24  ? 19.522 -44.158 -12.053 1.00 36.95 ? 131  ASP A CG  1 
ATOM   196  O  OD1 . ASP A 1 24  ? 19.123 -43.612 -11.001 1.00 27.78 ? 131  ASP A OD1 1 
ATOM   197  O  OD2 . ASP A 1 24  ? 18.741 -44.658 -12.894 1.00 42.98 ? 131  ASP A OD2 1 
ATOM   198  N  N   . LEU A 1 25  ? 22.093 -42.658 -10.091 1.00 20.63 ? 132  LEU A N   1 
ATOM   199  C  CA  . LEU A 1 25  ? 22.220 -41.754 -8.945  1.00 17.41 ? 132  LEU A CA  1 
ATOM   200  C  C   . LEU A 1 25  ? 20.918 -41.006 -8.659  1.00 20.12 ? 132  LEU A C   1 
ATOM   201  O  O   . LEU A 1 25  ? 20.888 -40.115 -7.809  1.00 18.49 ? 132  LEU A O   1 
ATOM   202  C  CB  . LEU A 1 25  ? 23.363 -40.758 -9.184  1.00 15.76 ? 132  LEU A CB  1 
ATOM   203  C  CG  . LEU A 1 25  ? 24.743 -41.415 -9.290  1.00 17.98 ? 132  LEU A CG  1 
ATOM   204  C  CD1 . LEU A 1 25  ? 25.779 -40.413 -9.784  1.00 18.11 ? 132  LEU A CD1 1 
ATOM   205  C  CD2 . LEU A 1 25  ? 25.149 -41.995 -7.924  1.00 18.63 ? 132  LEU A CD2 1 
ATOM   206  N  N   . ASN A 1 26  ? 19.850 -41.383 -9.366  1.00 18.05 ? 133  ASN A N   1 
ATOM   207  C  CA  . ASN A 1 26  ? 18.514 -40.822 -9.148  1.00 19.50 ? 133  ASN A CA  1 
ATOM   208  C  C   . ASN A 1 26  ? 18.523 -39.303 -9.296  1.00 19.03 ? 133  ASN A C   1 
ATOM   209  O  O   . ASN A 1 26  ? 17.912 -38.575 -8.509  1.00 16.41 ? 133  ASN A O   1 
ATOM   210  C  CB  . ASN A 1 26  ? 17.969 -41.224 -7.766  1.00 22.01 ? 133  ASN A CB  1 
ATOM   211  C  CG  . ASN A 1 26  ? 16.455 -41.068 -7.667  1.00 29.34 ? 133  ASN A CG  1 
ATOM   212  O  OD1 . ASN A 1 26  ? 15.745 -41.196 -8.668  1.00 22.17 ? 133  ASN A OD1 1 
ATOM   213  N  ND2 . ASN A 1 26  ? 15.957 -40.790 -6.460  1.00 20.68 ? 133  ASN A ND2 1 
ATOM   214  N  N   . VAL A 1 27  ? 19.220 -38.827 -10.320 1.00 17.76 ? 134  VAL A N   1 
ATOM   215  C  CA  . VAL A 1 27  ? 19.371 -37.398 -10.528 1.00 15.14 ? 134  VAL A CA  1 
ATOM   216  C  C   . VAL A 1 27  ? 18.152 -36.794 -11.246 1.00 18.84 ? 134  VAL A C   1 
ATOM   217  O  O   . VAL A 1 27  ? 17.750 -35.670 -10.968 1.00 16.95 ? 134  VAL A O   1 
ATOM   218  C  CB  . VAL A 1 27  ? 20.672 -37.111 -11.298 1.00 21.43 ? 134  VAL A CB  1 
ATOM   219  C  CG1 . VAL A 1 27  ? 20.774 -35.662 -11.668 1.00 24.53 ? 134  VAL A CG1 1 
ATOM   220  C  CG2 . VAL A 1 27  ? 21.877 -37.491 -10.431 1.00 18.89 ? 134  VAL A CG2 1 
ATOM   221  N  N   . LYS A 1 28  ? 17.537 -37.557 -12.145 1.00 21.68 ? 135  LYS A N   1 
ATOM   222  C  CA  . LYS A 1 28  ? 16.356 -37.064 -12.857 1.00 20.09 ? 135  LYS A CA  1 
ATOM   223  C  C   . LYS A 1 28  ? 15.224 -36.703 -11.885 1.00 22.63 ? 135  LYS A C   1 
ATOM   224  O  O   . LYS A 1 28  ? 14.503 -35.721 -12.094 1.00 22.41 ? 135  LYS A O   1 
ATOM   225  C  CB  . LYS A 1 28  ? 15.889 -38.110 -13.879 1.00 24.77 ? 135  LYS A CB  1 
ATOM   226  C  CG  . LYS A 1 28  ? 14.892 -37.608 -14.912 1.00 37.01 ? 135  LYS A CG  1 
ATOM   227  C  CD  . LYS A 1 28  ? 14.702 -38.644 -16.022 1.00 39.48 ? 135  LYS A CD  1 
ATOM   228  C  CE  . LYS A 1 28  ? 13.448 -38.387 -16.837 0.00 36.15 ? 135  LYS A CE  1 
ATOM   229  N  NZ  . LYS A 1 28  ? 13.264 -39.436 -17.879 0.00 37.21 ? 135  LYS A NZ  1 
ATOM   230  N  N   . ALA A 1 29  ? 15.087 -37.477 -10.810 1.00 20.57 ? 136  ALA A N   1 
ATOM   231  C  CA  . ALA A 1 29  ? 14.075 -37.196 -9.798  1.00 25.31 ? 136  ALA A CA  1 
ATOM   232  C  C   . ALA A 1 29  ? 14.301 -35.831 -9.154  1.00 24.86 ? 136  ALA A C   1 
ATOM   233  O  O   . ALA A 1 29  ? 13.352 -35.113 -8.850  1.00 23.91 ? 136  ALA A O   1 
ATOM   234  C  CB  . ALA A 1 29  ? 14.055 -38.289 -8.738  1.00 24.01 ? 136  ALA A CB  1 
ATOM   235  N  N   . ALA A 1 30  ? 15.562 -35.470 -8.952  1.00 23.49 ? 137  ALA A N   1 
ATOM   236  C  CA  . ALA A 1 30  ? 15.887 -34.136 -8.447  1.00 24.65 ? 137  ALA A CA  1 
ATOM   237  C  C   . ALA A 1 30  ? 15.541 -33.056 -9.474  1.00 24.31 ? 137  ALA A C   1 
ATOM   238  O  O   . ALA A 1 30  ? 14.955 -32.025 -9.139  1.00 22.76 ? 137  ALA A O   1 
ATOM   239  C  CB  . ALA A 1 30  ? 17.360 -34.063 -8.067  1.00 18.95 ? 137  ALA A CB  1 
ATOM   240  N  N   . TRP A 1 31  ? 15.913 -33.289 -10.728 1.00 17.39 ? 138  TRP A N   1 
ATOM   241  C  CA  . TRP A 1 31  ? 15.614 -32.341 -11.796 1.00 19.70 ? 138  TRP A CA  1 
ATOM   242  C  C   . TRP A 1 31  ? 14.109 -32.098 -11.931 1.00 23.59 ? 138  TRP A C   1 
ATOM   243  O  O   . TRP A 1 31  ? 13.665 -30.975 -12.143 1.00 25.20 ? 138  TRP A O   1 
ATOM   244  C  CB  . TRP A 1 31  ? 16.146 -32.844 -13.135 1.00 18.44 ? 138  TRP A CB  1 
ATOM   245  C  CG  . TRP A 1 31  ? 17.639 -32.945 -13.262 1.00 19.50 ? 138  TRP A CG  1 
ATOM   246  C  CD1 . TRP A 1 31  ? 18.590 -32.327 -12.494 1.00 21.26 ? 138  TRP A CD1 1 
ATOM   247  C  CD2 . TRP A 1 31  ? 18.346 -33.724 -14.228 1.00 18.45 ? 138  TRP A CD2 1 
ATOM   248  N  NE1 . TRP A 1 31  ? 19.849 -32.676 -12.936 1.00 19.74 ? 138  TRP A NE1 1 
ATOM   249  C  CE2 . TRP A 1 31  ? 19.723 -33.532 -13.999 1.00 21.76 ? 138  TRP A CE2 1 
ATOM   250  C  CE3 . TRP A 1 31  ? 17.944 -34.561 -15.276 1.00 17.63 ? 138  TRP A CE3 1 
ATOM   251  C  CZ2 . TRP A 1 31  ? 20.703 -34.150 -14.779 1.00 19.52 ? 138  TRP A CZ2 1 
ATOM   252  C  CZ3 . TRP A 1 31  ? 18.919 -35.175 -16.051 1.00 21.61 ? 138  TRP A CZ3 1 
ATOM   253  C  CH2 . TRP A 1 31  ? 20.281 -34.968 -15.794 1.00 18.55 ? 138  TRP A CH2 1 
ATOM   254  N  N   . ALA A 1 32  ? 13.335 -33.169 -11.821 1.00 24.73 ? 139  ALA A N   1 
ATOM   255  C  CA  . ALA A 1 32  ? 11.882 -33.078 -11.922 1.00 32.40 ? 139  ALA A CA  1 
ATOM   256  C  C   . ALA A 1 32  ? 11.266 -32.333 -10.728 1.00 34.22 ? 139  ALA A C   1 
ATOM   257  O  O   . ALA A 1 32  ? 10.167 -31.798 -10.836 1.00 37.30 ? 139  ALA A O   1 
ATOM   258  C  CB  . ALA A 1 32  ? 11.281 -34.463 -12.043 1.00 24.11 ? 139  ALA A CB  1 
ATOM   259  N  N   . GLN A 1 33  ? 11.969 -32.299 -9.595  1.00 29.97 ? 140  GLN A N   1 
ATOM   260  C  CA  . GLN A 1 33  ? 11.511 -31.521 -8.442  1.00 31.40 ? 140  GLN A CA  1 
ATOM   261  C  C   . GLN A 1 33  ? 11.863 -30.051 -8.657  1.00 30.53 ? 140  GLN A C   1 
ATOM   262  O  O   . GLN A 1 33  ? 11.552 -29.206 -7.824  1.00 37.60 ? 140  GLN A O   1 
ATOM   263  C  CB  . GLN A 1 33  ? 12.131 -32.029 -7.127  1.00 35.88 ? 140  GLN A CB  1 
ATOM   264  C  CG  . GLN A 1 33  ? 11.604 -33.382 -6.611  1.00 36.53 ? 140  GLN A CG  1 
ATOM   265  C  CD  . GLN A 1 33  ? 12.211 -33.796 -5.259  1.00 47.35 ? 140  GLN A CD  1 
ATOM   266  O  OE1 . GLN A 1 33  ? 11.996 -33.137 -4.232  1.00 40.84 ? 140  GLN A OE1 1 
ATOM   267  N  NE2 . GLN A 1 33  ? 12.965 -34.899 -5.257  1.00 36.48 ? 140  GLN A NE2 1 
ATOM   268  N  N   . GLY A 1 34  ? 12.527 -29.757 -9.771  1.00 28.94 ? 141  GLY A N   1 
ATOM   269  C  CA  . GLY A 1 34  ? 12.902 -28.396 -10.114 1.00 26.29 ? 141  GLY A CA  1 
ATOM   270  C  C   . GLY A 1 34  ? 14.285 -27.936 -9.661  1.00 25.58 ? 141  GLY A C   1 
ATOM   271  O  O   . GLY A 1 34  ? 14.563 -26.738 -9.633  1.00 27.71 ? 141  GLY A O   1 
ATOM   272  N  N   . TYR A 1 35  ? 15.163 -28.872 -9.313  1.00 22.00 ? 142  TYR A N   1 
ATOM   273  C  CA  . TYR A 1 35  ? 16.517 -28.503 -8.892  1.00 23.44 ? 142  TYR A CA  1 
ATOM   274  C  C   . TYR A 1 35  ? 17.558 -28.945 -9.909  1.00 21.04 ? 142  TYR A C   1 
ATOM   275  O  O   . TYR A 1 35  ? 17.741 -30.137 -10.145 1.00 18.17 ? 142  TYR A O   1 
ATOM   276  C  CB  . TYR A 1 35  ? 16.834 -29.100 -7.523  1.00 18.94 ? 142  TYR A CB  1 
ATOM   277  C  CG  . TYR A 1 35  ? 15.815 -28.699 -6.490  1.00 20.37 ? 142  TYR A CG  1 
ATOM   278  C  CD1 . TYR A 1 35  ? 15.815 -27.424 -5.948  1.00 20.92 ? 142  TYR A CD1 1 
ATOM   279  C  CD2 . TYR A 1 35  ? 14.828 -29.580 -6.091  1.00 28.04 ? 142  TYR A CD2 1 
ATOM   280  C  CE1 . TYR A 1 35  ? 14.869 -27.052 -5.012  1.00 22.65 ? 142  TYR A CE1 1 
ATOM   281  C  CE2 . TYR A 1 35  ? 13.881 -29.217 -5.149  1.00 30.69 ? 142  TYR A CE2 1 
ATOM   282  C  CZ  . TYR A 1 35  ? 13.908 -27.956 -4.616  1.00 26.45 ? 142  TYR A CZ  1 
ATOM   283  O  OH  . TYR A 1 35  ? 12.958 -27.600 -3.690  1.00 30.40 ? 142  TYR A OH  1 
ATOM   284  N  N   . THR A 1 36  ? 18.241 -27.967 -10.492 1.00 19.78 ? 143  THR A N   1 
ATOM   285  C  CA  . THR A 1 36  ? 19.241 -28.210 -11.521 1.00 17.49 ? 143  THR A CA  1 
ATOM   286  C  C   . THR A 1 36  ? 20.529 -27.456 -11.210 1.00 19.86 ? 143  THR A C   1 
ATOM   287  O  O   . THR A 1 36  ? 21.472 -27.460 -12.003 1.00 18.32 ? 143  THR A O   1 
ATOM   288  C  CB  . THR A 1 36  ? 18.732 -27.799 -12.917 1.00 24.60 ? 143  THR A CB  1 
ATOM   289  O  OG1 . THR A 1 36  ? 18.381 -26.412 -12.903 1.00 34.23 ? 143  THR A OG1 1 
ATOM   290  C  CG2 . THR A 1 36  ? 17.520 -28.626 -13.307 1.00 20.08 ? 143  THR A CG2 1 
ATOM   291  N  N   . GLY A 1 37  ? 20.568 -26.804 -10.051 1.00 20.19 ? 144  GLY A N   1 
ATOM   292  C  CA  . GLY A 1 37  ? 21.783 -26.142 -9.602  1.00 20.09 ? 144  GLY A CA  1 
ATOM   293  C  C   . GLY A 1 37  ? 21.835 -24.629 -9.750  1.00 20.68 ? 144  GLY A C   1 
ATOM   294  O  O   . GLY A 1 37  ? 22.868 -24.020 -9.463  1.00 17.07 ? 144  GLY A O   1 
ATOM   295  N  N   A HIS A 1 38  ? 20.736 -24.018 -10.190 0.50 20.79 ? 145  HIS A N   1 
ATOM   296  N  N   B HIS A 1 38  ? 20.734 -24.025 -10.201 0.50 20.79 ? 145  HIS A N   1 
ATOM   297  C  CA  A HIS A 1 38  ? 20.716 -22.570 -10.375 0.50 20.89 ? 145  HIS A CA  1 
ATOM   298  C  CA  B HIS A 1 38  ? 20.640 -22.570 -10.346 0.50 20.92 ? 145  HIS A CA  1 
ATOM   299  C  C   A HIS A 1 38  ? 21.137 -21.842 -9.104  0.50 21.67 ? 145  HIS A C   1 
ATOM   300  C  C   B HIS A 1 38  ? 21.126 -21.835 -9.089  0.50 21.67 ? 145  HIS A C   1 
ATOM   301  O  O   A HIS A 1 38  ? 20.626 -22.114 -8.020  0.50 19.22 ? 145  HIS A O   1 
ATOM   302  O  O   B HIS A 1 38  ? 20.646 -22.102 -7.990  0.50 19.23 ? 145  HIS A O   1 
ATOM   303  C  CB  A HIS A 1 38  ? 19.334 -22.072 -10.799 0.50 22.97 ? 145  HIS A CB  1 
ATOM   304  C  CB  B HIS A 1 38  ? 19.192 -22.152 -10.654 0.50 22.75 ? 145  HIS A CB  1 
ATOM   305  C  CG  A HIS A 1 38  ? 19.276 -20.589 -11.005 0.50 22.55 ? 145  HIS A CG  1 
ATOM   306  C  CG  B HIS A 1 38  ? 18.838 -22.185 -12.111 0.50 21.99 ? 145  HIS A CG  1 
ATOM   307  N  ND1 A HIS A 1 38  ? 19.720 -19.981 -12.158 0.50 26.22 ? 145  HIS A ND1 1 
ATOM   308  N  ND1 B HIS A 1 38  ? 17.812 -22.960 -12.611 0.50 27.36 ? 145  HIS A ND1 1 
ATOM   309  C  CD2 A HIS A 1 38  ? 18.845 -19.593 -10.194 0.50 30.89 ? 145  HIS A CD2 1 
ATOM   310  C  CD2 B HIS A 1 38  ? 19.355 -21.519 -13.172 0.50 21.02 ? 145  HIS A CD2 1 
ATOM   311  C  CE1 A HIS A 1 38  ? 19.557 -18.673 -12.054 0.50 28.90 ? 145  HIS A CE1 1 
ATOM   312  C  CE1 B HIS A 1 38  ? 17.720 -22.780 -13.916 0.50 23.64 ? 145  HIS A CE1 1 
ATOM   313  N  NE2 A HIS A 1 38  ? 19.030 -18.412 -10.872 0.50 28.25 ? 145  HIS A NE2 1 
ATOM   314  N  NE2 B HIS A 1 38  ? 18.646 -21.910 -14.283 0.50 23.03 ? 145  HIS A NE2 1 
ATOM   315  N  N   . GLY A 1 39  ? 22.079 -20.920 -9.253  1.00 18.48 ? 146  GLY A N   1 
ATOM   316  C  CA  . GLY A 1 39  ? 22.533 -20.113 -8.141  1.00 18.95 ? 146  GLY A CA  1 
ATOM   317  C  C   . GLY A 1 39  ? 23.688 -20.688 -7.342  1.00 21.79 ? 146  GLY A C   1 
ATOM   318  O  O   . GLY A 1 39  ? 24.259 -19.991 -6.510  1.00 19.21 ? 146  GLY A O   1 
ATOM   319  N  N   . ILE A 1 40  ? 24.036 -21.950 -7.587  1.00 17.16 ? 147  ILE A N   1 
ATOM   320  C  CA  . ILE A 1 40  ? 25.129 -22.590 -6.854  1.00 15.14 ? 147  ILE A CA  1 
ATOM   321  C  C   . ILE A 1 40  ? 26.447 -22.509 -7.637  1.00 18.14 ? 147  ILE A C   1 
ATOM   322  O  O   . ILE A 1 40  ? 26.466 -22.597 -8.869  1.00 19.48 ? 147  ILE A O   1 
ATOM   323  C  CB  . ILE A 1 40  ? 24.791 -24.058 -6.531  1.00 16.80 ? 147  ILE A CB  1 
ATOM   324  C  CG1 . ILE A 1 40  ? 23.419 -24.146 -5.853  1.00 19.10 ? 147  ILE A CG1 1 
ATOM   325  C  CG2 . ILE A 1 40  ? 25.870 -24.686 -5.647  1.00 14.01 ? 147  ILE A CG2 1 
ATOM   326  C  CD1 . ILE A 1 40  ? 23.303 -23.316 -4.576  1.00 18.12 ? 147  ILE A CD1 1 
ATOM   327  N  N   . VAL A 1 41  ? 27.543 -22.323 -6.910  1.00 15.17 ? 148  VAL A N   1 
ATOM   328  C  CA  . VAL A 1 41  ? 28.861 -22.153 -7.506  1.00 17.07 ? 148  VAL A CA  1 
ATOM   329  C  C   . VAL A 1 41  ? 29.799 -23.277 -7.069  1.00 15.22 ? 148  VAL A C   1 
ATOM   330  O  O   . VAL A 1 41  ? 30.016 -23.476 -5.876  1.00 14.35 ? 148  VAL A O   1 
ATOM   331  C  CB  . VAL A 1 41  ? 29.487 -20.799 -7.108  1.00 16.02 ? 148  VAL A CB  1 
ATOM   332  C  CG1 . VAL A 1 41  ? 30.858 -20.644 -7.738  1.00 15.56 ? 148  VAL A CG1 1 
ATOM   333  C  CG2 . VAL A 1 41  ? 28.567 -19.644 -7.509  1.00 18.47 ? 148  VAL A CG2 1 
ATOM   334  N  N   . VAL A 1 42  ? 30.357 -23.998 -8.039  1.00 13.81 ? 149  VAL A N   1 
ATOM   335  C  CA  . VAL A 1 42  ? 31.256 -25.112 -7.757  1.00 12.62 ? 149  VAL A CA  1 
ATOM   336  C  C   . VAL A 1 42  ? 32.616 -24.846 -8.384  1.00 16.81 ? 149  VAL A C   1 
ATOM   337  O  O   . VAL A 1 42  ? 32.684 -24.363 -9.514  1.00 16.20 ? 149  VAL A O   1 
ATOM   338  C  CB  . VAL A 1 42  ? 30.708 -26.440 -8.318  1.00 15.35 ? 149  VAL A CB  1 
ATOM   339  C  CG1 . VAL A 1 42  ? 31.653 -27.605 -7.971  1.00 15.95 ? 149  VAL A CG1 1 
ATOM   340  C  CG2 . VAL A 1 42  ? 29.291 -26.702 -7.811  1.00 14.98 ? 149  VAL A CG2 1 
ATOM   341  N  N   . SER A 1 43  ? 33.696 -25.164 -7.670  1.00 14.66 ? 150  SER A N   1 
ATOM   342  C  CA  . SER A 1 43  ? 35.035 -25.018 -8.243  1.00 14.02 ? 150  SER A CA  1 
ATOM   343  C  C   . SER A 1 43  ? 35.806 -26.336 -8.255  1.00 17.64 ? 150  SER A C   1 
ATOM   344  O  O   . SER A 1 43  ? 35.855 -27.049 -7.254  1.00 14.06 ? 150  SER A O   1 
ATOM   345  C  CB  . SER A 1 43  ? 35.846 -23.961 -7.486  1.00 15.27 ? 150  SER A CB  1 
ATOM   346  O  OG  . SER A 1 43  ? 37.086 -23.722 -8.150  1.00 16.29 ? 150  SER A OG  1 
ATOM   347  N  N   . ILE A 1 44  ? 36.408 -26.642 -9.403  1.00 13.97 ? 151  ILE A N   1 
ATOM   348  C  CA  . ILE A 1 44  ? 37.257 -27.818 -9.568  1.00 15.51 ? 151  ILE A CA  1 
ATOM   349  C  C   . ILE A 1 44  ? 38.714 -27.475 -9.265  1.00 14.04 ? 151  ILE A C   1 
ATOM   350  O  O   . ILE A 1 44  ? 39.333 -26.700 -9.991  1.00 15.55 ? 151  ILE A O   1 
ATOM   351  C  CB  . ILE A 1 44  ? 37.180 -28.381 -11.016 1.00 17.30 ? 151  ILE A CB  1 
ATOM   352  C  CG1 . ILE A 1 44  ? 35.725 -28.627 -11.442 1.00 15.01 ? 151  ILE A CG1 1 
ATOM   353  C  CG2 . ILE A 1 44  ? 38.048 -29.659 -11.145 1.00 15.94 ? 151  ILE A CG2 1 
ATOM   354  C  CD1 . ILE A 1 44  ? 34.956 -29.631 -10.528 1.00 16.09 ? 151  ILE A CD1 1 
ATOM   355  N  N   . LEU A 1 45  ? 39.278 -28.053 -8.208  1.00 12.42 ? 152  LEU A N   1 
ATOM   356  C  CA  . LEU A 1 45  ? 40.673 -27.789 -7.855  1.00 12.62 ? 152  LEU A CA  1 
ATOM   357  C  C   . LEU A 1 45  ? 41.581 -28.827 -8.507  1.00 15.60 ? 152  LEU A C   1 
ATOM   358  O  O   . LEU A 1 45  ? 41.731 -29.933 -7.982  1.00 15.57 ? 152  LEU A O   1 
ATOM   359  C  CB  . LEU A 1 45  ? 40.867 -27.808 -6.326  1.00 10.40 ? 152  LEU A CB  1 
ATOM   360  C  CG  . LEU A 1 45  ? 39.920 -26.935 -5.498  1.00 15.64 ? 152  LEU A CG  1 
ATOM   361  C  CD1 . LEU A 1 45  ? 40.312 -26.921 -4.020  1.00 13.68 ? 152  LEU A CD1 1 
ATOM   362  C  CD2 . LEU A 1 45  ? 39.894 -25.532 -6.041  1.00 18.79 ? 152  LEU A CD2 1 
ATOM   363  N  N   . ASP A 1 46  ? 42.194 -28.481 -9.640  1.00 15.33 ? 153  ASP A N   1 
ATOM   364  C  CA  . ASP A 1 46  ? 42.876 -29.490 -10.446 1.00 15.39 ? 153  ASP A CA  1 
ATOM   365  C  C   . ASP A 1 46  ? 43.918 -28.868 -11.387 1.00 14.72 ? 153  ASP A C   1 
ATOM   366  O  O   . ASP A 1 46  ? 44.688 -28.017 -10.970 1.00 14.52 ? 153  ASP A O   1 
ATOM   367  C  CB  . ASP A 1 46  ? 41.837 -30.302 -11.228 1.00 14.35 ? 153  ASP A CB  1 
ATOM   368  C  CG  . ASP A 1 46  ? 42.320 -31.708 -11.559 1.00 21.59 ? 153  ASP A CG  1 
ATOM   369  O  OD1 . ASP A 1 46  ? 43.111 -31.853 -12.502 1.00 20.75 ? 153  ASP A OD1 1 
ATOM   370  O  OD2 . ASP A 1 46  ? 41.923 -32.670 -10.863 1.00 34.67 ? 153  ASP A OD2 1 
ATOM   371  N  N   . ASP A 1 47  ? 43.942 -29.291 -12.651 1.00 15.12 ? 154  ASP A N   1 
ATOM   372  C  CA  . ASP A 1 47  ? 44.992 -28.851 -13.584 1.00 16.48 ? 154  ASP A CA  1 
ATOM   373  C  C   . ASP A 1 47  ? 44.526 -27.755 -14.545 1.00 17.35 ? 154  ASP A C   1 
ATOM   374  O  O   . ASP A 1 47  ? 45.192 -27.475 -15.543 1.00 18.36 ? 154  ASP A O   1 
ATOM   375  C  CB  . ASP A 1 47  ? 45.535 -30.049 -14.391 1.00 16.16 ? 154  ASP A CB  1 
ATOM   376  C  CG  . ASP A 1 47  ? 44.446 -30.792 -15.174 1.00 19.16 ? 154  ASP A CG  1 
ATOM   377  O  OD1 . ASP A 1 47  ? 43.330 -30.251 -15.335 1.00 17.87 ? 154  ASP A OD1 1 
ATOM   378  O  OD2 . ASP A 1 47  ? 44.705 -31.928 -15.637 1.00 19.45 ? 154  ASP A OD2 1 
ATOM   379  N  N   . GLY A 1 48  ? 43.383 -27.144 -14.249 1.00 14.42 ? 155  GLY A N   1 
ATOM   380  C  CA  . GLY A 1 48  ? 42.840 -26.097 -15.099 1.00 14.55 ? 155  GLY A CA  1 
ATOM   381  C  C   . GLY A 1 48  ? 41.476 -26.447 -15.667 1.00 20.14 ? 155  GLY A C   1 
ATOM   382  O  O   . GLY A 1 48  ? 41.005 -27.574 -15.530 1.00 19.12 ? 155  GLY A O   1 
ATOM   383  N  N   . ILE A 1 49  ? 40.831 -25.481 -16.308 1.00 14.08 ? 156  ILE A N   1 
ATOM   384  C  CA  . ILE A 1 49  ? 39.520 -25.720 -16.902 1.00 12.08 ? 156  ILE A CA  1 
ATOM   385  C  C   . ILE A 1 49  ? 39.446 -24.997 -18.240 1.00 17.50 ? 156  ILE A C   1 
ATOM   386  O  O   . ILE A 1 49  ? 39.823 -23.838 -18.340 1.00 15.68 ? 156  ILE A O   1 
ATOM   387  C  CB  . ILE A 1 49  ? 38.380 -25.252 -15.958 1.00 16.79 ? 156  ILE A CB  1 
ATOM   388  C  CG1 . ILE A 1 49  ? 37.004 -25.478 -16.586 1.00 16.47 ? 156  ILE A CG1 1 
ATOM   389  C  CG2 . ILE A 1 49  ? 38.544 -23.792 -15.593 1.00 17.98 ? 156  ILE A CG2 1 
ATOM   390  C  CD1 . ILE A 1 49  ? 35.858 -24.976 -15.698 1.00 19.47 ? 156  ILE A CD1 1 
ATOM   391  N  N   . GLU A 1 50  ? 39.000 -25.704 -19.271 1.00 16.27 ? 157  GLU A N   1 
ATOM   392  C  CA  . GLU A 1 50  ? 38.861 -25.109 -20.600 1.00 19.35 ? 157  GLU A CA  1 
ATOM   393  C  C   . GLU A 1 50  ? 37.614 -24.233 -20.600 1.00 13.81 ? 157  GLU A C   1 
ATOM   394  O  O   . GLU A 1 50  ? 36.505 -24.706 -20.858 1.00 18.65 ? 157  GLU A O   1 
ATOM   395  C  CB  . GLU A 1 50  ? 38.783 -26.203 -21.662 1.00 17.94 ? 157  GLU A CB  1 
ATOM   396  C  CG  . GLU A 1 50  ? 38.899 -25.701 -23.094 1.00 21.34 ? 157  GLU A CG  1 
ATOM   397  C  CD  . GLU A 1 50  ? 39.131 -26.843 -24.065 1.00 21.60 ? 157  GLU A CD  1 
ATOM   398  O  OE1 . GLU A 1 50  ? 38.153 -27.543 -24.386 1.00 22.93 ? 157  GLU A OE1 1 
ATOM   399  O  OE2 . GLU A 1 50  ? 40.288 -27.045 -24.494 1.00 22.89 ? 157  GLU A OE2 1 
ATOM   400  N  N   . LYS A 1 51  ? 37.790 -22.963 -20.258 1.00 15.07 ? 158  LYS A N   1 
ATOM   401  C  CA  . LYS A 1 51  ? 36.641 -22.106 -19.953 1.00 21.10 ? 158  LYS A CA  1 
ATOM   402  C  C   . LYS A 1 51  ? 35.814 -21.790 -21.192 1.00 24.24 ? 158  LYS A C   1 
ATOM   403  O  O   . LYS A 1 51  ? 34.644 -21.423 -21.077 1.00 23.07 ? 158  LYS A O   1 
ATOM   404  C  CB  . LYS A 1 51  ? 37.091 -20.811 -19.272 1.00 21.42 ? 158  LYS A CB  1 
ATOM   405  C  CG  . LYS A 1 51  ? 37.991 -19.929 -20.104 1.00 28.23 ? 158  LYS A CG  1 
ATOM   406  C  CD  . LYS A 1 51  ? 38.480 -18.731 -19.306 1.00 26.25 ? 158  LYS A CD  1 
ATOM   407  C  CE  . LYS A 1 51  ? 39.291 -17.789 -20.192 1.00 26.70 ? 158  LYS A CE  1 
ATOM   408  N  NZ  . LYS A 1 51  ? 40.571 -18.430 -20.624 1.00 31.99 ? 158  LYS A NZ  1 
ATOM   409  N  N   . ASN A 1 52  ? 36.415 -21.962 -22.367 1.00 16.71 ? 159  ASN A N   1 
ATOM   410  C  CA  . ASN A 1 52  ? 35.712 -21.738 -23.630 1.00 25.39 ? 159  ASN A CA  1 
ATOM   411  C  C   . ASN A 1 52  ? 35.173 -23.014 -24.278 1.00 28.19 ? 159  ASN A C   1 
ATOM   412  O  O   . ASN A 1 52  ? 34.757 -22.993 -25.437 1.00 20.87 ? 159  ASN A O   1 
ATOM   413  C  CB  . ASN A 1 52  ? 36.629 -21.017 -24.624 1.00 25.65 ? 159  ASN A CB  1 
ATOM   414  C  CG  . ASN A 1 52  ? 37.922 -21.777 -24.896 1.00 37.93 ? 159  ASN A CG  1 
ATOM   415  O  OD1 . ASN A 1 52  ? 38.406 -22.545 -24.058 1.00 25.38 ? 159  ASN A OD1 1 
ATOM   416  N  ND2 . ASN A 1 52  ? 38.496 -21.552 -26.073 1.00 37.74 ? 159  ASN A ND2 1 
ATOM   417  N  N   . HIS A 1 53  ? 35.173 -24.125 -23.543 1.00 19.45 ? 160  HIS A N   1 
ATOM   418  C  CA  . HIS A 1 53  ? 34.581 -25.357 -24.064 1.00 15.65 ? 160  HIS A CA  1 
ATOM   419  C  C   . HIS A 1 53  ? 33.101 -25.133 -24.391 1.00 19.36 ? 160  HIS A C   1 
ATOM   420  O  O   . HIS A 1 53  ? 32.374 -24.533 -23.607 1.00 17.50 ? 160  HIS A O   1 
ATOM   421  C  CB  . HIS A 1 53  ? 34.741 -26.509 -23.055 1.00 16.56 ? 160  HIS A CB  1 
ATOM   422  C  CG  . HIS A 1 53  ? 34.458 -27.861 -23.634 1.00 16.74 ? 160  HIS A CG  1 
ATOM   423  N  ND1 . HIS A 1 53  ? 33.196 -28.260 -24.013 1.00 17.06 ? 160  HIS A ND1 1 
ATOM   424  C  CD2 . HIS A 1 53  ? 35.277 -28.910 -23.886 1.00 14.17 ? 160  HIS A CD2 1 
ATOM   425  C  CE1 . HIS A 1 53  ? 33.248 -29.495 -24.482 1.00 17.78 ? 160  HIS A CE1 1 
ATOM   426  N  NE2 . HIS A 1 53  ? 34.500 -29.912 -24.416 1.00 17.33 ? 160  HIS A NE2 1 
ATOM   427  N  N   . PRO A 1 54  ? 32.645 -25.606 -25.564 1.00 18.07 ? 161  PRO A N   1 
ATOM   428  C  CA  . PRO A 1 54  ? 31.247 -25.342 -25.925 1.00 20.46 ? 161  PRO A CA  1 
ATOM   429  C  C   . PRO A 1 54  ? 30.213 -25.916 -24.951 1.00 23.09 ? 161  PRO A C   1 
ATOM   430  O  O   . PRO A 1 54  ? 29.073 -25.450 -24.961 1.00 20.36 ? 161  PRO A O   1 
ATOM   431  C  CB  . PRO A 1 54  ? 31.106 -25.989 -27.315 1.00 25.43 ? 161  PRO A CB  1 
ATOM   432  C  CG  . PRO A 1 54  ? 32.310 -26.841 -27.498 1.00 30.15 ? 161  PRO A CG  1 
ATOM   433  C  CD  . PRO A 1 54  ? 33.392 -26.263 -26.646 1.00 20.83 ? 161  PRO A CD  1 
ATOM   434  N  N   . ASP A 1 55  ? 30.584 -26.883 -24.113 1.00 20.99 ? 162  ASP A N   1 
ATOM   435  C  CA  . ASP A 1 55  ? 29.633 -27.359 -23.116 1.00 20.75 ? 162  ASP A CA  1 
ATOM   436  C  C   . ASP A 1 55  ? 29.896 -26.791 -21.711 1.00 18.12 ? 162  ASP A C   1 
ATOM   437  O  O   . ASP A 1 55  ? 29.182 -27.137 -20.774 1.00 21.57 ? 162  ASP A O   1 
ATOM   438  C  CB  . ASP A 1 55  ? 29.618 -28.892 -23.063 1.00 18.63 ? 162  ASP A CB  1 
ATOM   439  C  CG  . ASP A 1 55  ? 28.203 -29.462 -23.071 1.00 20.64 ? 162  ASP A CG  1 
ATOM   440  O  OD1 . ASP A 1 55  ? 27.277 -28.753 -23.530 1.00 21.88 ? 162  ASP A OD1 1 
ATOM   441  O  OD2 . ASP A 1 55  ? 28.004 -30.617 -22.628 1.00 19.04 ? 162  ASP A OD2 1 
ATOM   442  N  N   . LEU A 1 56  ? 30.900 -25.927 -21.564 1.00 16.51 ? 163  LEU A N   1 
ATOM   443  C  CA  . LEU A 1 56  ? 31.163 -25.283 -20.266 1.00 17.08 ? 163  LEU A CA  1 
ATOM   444  C  C   . LEU A 1 56  ? 30.966 -23.771 -20.278 1.00 18.33 ? 163  LEU A C   1 
ATOM   445  O  O   . LEU A 1 56  ? 30.608 -23.190 -19.260 1.00 19.63 ? 163  LEU A O   1 
ATOM   446  C  CB  . LEU A 1 56  ? 32.584 -25.577 -19.787 1.00 14.83 ? 163  LEU A CB  1 
ATOM   447  C  CG  . LEU A 1 56  ? 32.927 -27.045 -19.560 1.00 16.99 ? 163  LEU A CG  1 
ATOM   448  C  CD1 . LEU A 1 56  ? 34.373 -27.145 -19.144 1.00 20.41 ? 163  LEU A CD1 1 
ATOM   449  C  CD2 . LEU A 1 56  ? 32.009 -27.649 -18.494 1.00 16.12 ? 163  LEU A CD2 1 
ATOM   450  N  N   . ALA A 1 57  ? 31.196 -23.137 -21.428 1.00 17.90 ? 164  ALA A N   1 
ATOM   451  C  CA  . ALA A 1 57  ? 31.225 -21.673 -21.509 1.00 18.72 ? 164  ALA A CA  1 
ATOM   452  C  C   . ALA A 1 57  ? 29.977 -21.011 -20.927 1.00 17.14 ? 164  ALA A C   1 
ATOM   453  O  O   . ALA A 1 57  ? 30.064 -19.971 -20.265 1.00 19.80 ? 164  ALA A O   1 
ATOM   454  C  CB  . ALA A 1 57  ? 31.420 -21.238 -22.958 1.00 21.07 ? 164  ALA A CB  1 
ATOM   455  N  N   . GLY A 1 58  ? 28.827 -21.628 -21.166 1.00 16.90 ? 165  GLY A N   1 
ATOM   456  C  CA  . GLY A 1 58  ? 27.553 -21.085 -20.736 1.00 22.30 ? 165  GLY A CA  1 
ATOM   457  C  C   . GLY A 1 58  ? 27.377 -21.062 -19.228 1.00 23.14 ? 165  GLY A C   1 
ATOM   458  O  O   . GLY A 1 58  ? 26.586 -20.278 -18.709 1.00 19.40 ? 165  GLY A O   1 
ATOM   459  N  N   . ASN A 1 59  ? 28.110 -21.927 -18.528 1.00 18.56 ? 166  ASN A N   1 
ATOM   460  C  CA  . ASN A 1 59  ? 28.038 -21.987 -17.064 1.00 19.20 ? 166  ASN A CA  1 
ATOM   461  C  C   . ASN A 1 59  ? 29.305 -21.485 -16.382 1.00 19.63 ? 166  ASN A C   1 
ATOM   462  O  O   . ASN A 1 59  ? 29.369 -21.419 -15.151 1.00 17.52 ? 166  ASN A O   1 
ATOM   463  C  CB  . ASN A 1 59  ? 27.755 -23.423 -16.598 1.00 18.53 ? 166  ASN A CB  1 
ATOM   464  C  CG  . ASN A 1 59  ? 26.326 -23.852 -16.871 1.00 23.50 ? 166  ASN A CG  1 
ATOM   465  O  OD1 . ASN A 1 59  ? 25.429 -23.015 -16.996 1.00 22.61 ? 166  ASN A OD1 1 
ATOM   466  N  ND2 . ASN A 1 59  ? 26.101 -25.159 -16.939 1.00 16.37 ? 166  ASN A ND2 1 
ATOM   467  N  N   . TYR A 1 60  ? 30.322 -21.145 -17.171 1.00 19.16 ? 167  TYR A N   1 
ATOM   468  C  CA  . TYR A 1 60  ? 31.613 -20.767 -16.598 1.00 20.02 ? 167  TYR A CA  1 
ATOM   469  C  C   . TYR A 1 60  ? 31.555 -19.501 -15.737 1.00 24.84 ? 167  TYR A C   1 
ATOM   470  O  O   . TYR A 1 60  ? 30.913 -18.507 -16.089 1.00 20.26 ? 167  TYR A O   1 
ATOM   471  C  CB  . TYR A 1 60  ? 32.663 -20.577 -17.695 1.00 18.52 ? 167  TYR A CB  1 
ATOM   472  C  CG  . TYR A 1 60  ? 34.006 -20.158 -17.135 1.00 18.45 ? 167  TYR A CG  1 
ATOM   473  C  CD1 . TYR A 1 60  ? 34.804 -21.068 -16.445 1.00 15.34 ? 167  TYR A CD1 1 
ATOM   474  C  CD2 . TYR A 1 60  ? 34.466 -18.855 -17.274 1.00 17.84 ? 167  TYR A CD2 1 
ATOM   475  C  CE1 . TYR A 1 60  ? 36.022 -20.697 -15.924 1.00 18.04 ? 167  TYR A CE1 1 
ATOM   476  C  CE2 . TYR A 1 60  ? 35.688 -18.471 -16.751 1.00 19.60 ? 167  TYR A CE2 1 
ATOM   477  C  CZ  . TYR A 1 60  ? 36.461 -19.395 -16.080 1.00 18.77 ? 167  TYR A CZ  1 
ATOM   478  O  OH  . TYR A 1 60  ? 37.674 -19.016 -15.562 1.00 17.43 ? 167  TYR A OH  1 
ATOM   479  N  N   . ASP A 1 61  ? 32.252 -19.552 -14.607 1.00 18.32 ? 168  ASP A N   1 
ATOM   480  C  CA  . ASP A 1 61  ? 32.272 -18.461 -13.649 1.00 19.31 ? 168  ASP A CA  1 
ATOM   481  C  C   . ASP A 1 61  ? 33.711 -18.094 -13.324 1.00 19.41 ? 168  ASP A C   1 
ATOM   482  O  O   . ASP A 1 61  ? 34.402 -18.828 -12.614 1.00 19.66 ? 168  ASP A O   1 
ATOM   483  C  CB  . ASP A 1 61  ? 31.509 -18.865 -12.381 1.00 21.65 ? 168  ASP A CB  1 
ATOM   484  C  CG  . ASP A 1 61  ? 31.420 -17.745 -11.354 1.00 23.59 ? 168  ASP A CG  1 
ATOM   485  O  OD1 . ASP A 1 61  ? 31.883 -16.616 -11.625 1.00 24.34 ? 168  ASP A OD1 1 
ATOM   486  O  OD2 . ASP A 1 61  ? 30.878 -18.010 -10.267 1.00 25.92 ? 168  ASP A OD2 1 
ATOM   487  N  N   . PRO A 1 62  ? 34.172 -16.944 -13.838 1.00 20.24 ? 169  PRO A N   1 
ATOM   488  C  CA  . PRO A 1 62  ? 35.536 -16.503 -13.534 1.00 15.55 ? 169  PRO A CA  1 
ATOM   489  C  C   . PRO A 1 62  ? 35.735 -16.253 -12.039 1.00 16.60 ? 169  PRO A C   1 
ATOM   490  O  O   . PRO A 1 62  ? 36.868 -16.315 -11.563 1.00 17.65 ? 169  PRO A O   1 
ATOM   491  C  CB  . PRO A 1 62  ? 35.685 -15.201 -14.338 1.00 25.75 ? 169  PRO A CB  1 
ATOM   492  C  CG  . PRO A 1 62  ? 34.282 -14.762 -14.646 1.00 30.75 ? 169  PRO A CG  1 
ATOM   493  C  CD  . PRO A 1 62  ? 33.453 -16.008 -14.723 1.00 26.27 ? 169  PRO A CD  1 
ATOM   494  N  N   . GLY A 1 63  ? 34.647 -15.993 -11.316 1.00 20.55 ? 170  GLY A N   1 
ATOM   495  C  CA  . GLY A 1 63  ? 34.715 -15.766 -9.878  1.00 22.19 ? 170  GLY A CA  1 
ATOM   496  C  C   . GLY A 1 63  ? 34.978 -17.041 -9.089  1.00 21.66 ? 170  GLY A C   1 
ATOM   497  O  O   . GLY A 1 63  ? 35.260 -16.997 -7.889  1.00 22.89 ? 170  GLY A O   1 
ATOM   498  N  N   . ALA A 1 64  ? 34.877 -18.183 -9.762  1.00 18.84 ? 171  ALA A N   1 
ATOM   499  C  CA  . ALA A 1 64  ? 35.127 -19.472 -9.120  1.00 21.09 ? 171  ALA A CA  1 
ATOM   500  C  C   . ALA A 1 64  ? 36.447 -20.053 -9.605  1.00 18.58 ? 171  ALA A C   1 
ATOM   501  O  O   . ALA A 1 64  ? 36.705 -21.247 -9.464  1.00 18.53 ? 171  ALA A O   1 
ATOM   502  C  CB  . ALA A 1 64  ? 33.986 -20.438 -9.405  1.00 19.50 ? 171  ALA A CB  1 
ATOM   503  N  N   . SER A 1 65  ? 37.279 -19.196 -10.188 1.00 17.26 ? 172  SER A N   1 
ATOM   504  C  CA  . SER A 1 65  ? 38.450 -19.658 -10.918 1.00 16.98 ? 172  SER A CA  1 
ATOM   505  C  C   . SER A 1 65  ? 39.692 -18.855 -10.582 1.00 18.50 ? 172  SER A C   1 
ATOM   506  O  O   . SER A 1 65  ? 39.611 -17.682 -10.226 1.00 16.95 ? 172  SER A O   1 
ATOM   507  C  CB  . SER A 1 65  ? 38.188 -19.591 -12.427 1.00 16.56 ? 172  SER A CB  1 
ATOM   508  O  OG  . SER A 1 65  ? 37.051 -20.359 -12.772 1.00 17.93 ? 172  SER A OG  1 
ATOM   509  N  N   . PHE A 1 66  ? 40.842 -19.510 -10.686 1.00 14.45 ? 173  PHE A N   1 
ATOM   510  C  CA  . PHE A 1 66  ? 42.126 -18.848 -10.528 1.00 17.13 ? 173  PHE A CA  1 
ATOM   511  C  C   . PHE A 1 66  ? 43.230 -19.760 -11.037 1.00 20.64 ? 173  PHE A C   1 
ATOM   512  O  O   . PHE A 1 66  ? 43.047 -20.970 -11.148 1.00 17.61 ? 173  PHE A O   1 
ATOM   513  C  CB  . PHE A 1 66  ? 42.390 -18.467 -9.065  1.00 17.01 ? 173  PHE A CB  1 
ATOM   514  C  CG  . PHE A 1 66  ? 43.353 -17.320 -8.909  1.00 19.79 ? 173  PHE A CG  1 
ATOM   515  C  CD1 . PHE A 1 66  ? 42.940 -16.019 -9.161  1.00 18.15 ? 173  PHE A CD1 1 
ATOM   516  C  CD2 . PHE A 1 66  ? 44.662 -17.538 -8.522  1.00 16.09 ? 173  PHE A CD2 1 
ATOM   517  C  CE1 . PHE A 1 66  ? 43.821 -14.954 -9.039  1.00 19.78 ? 173  PHE A CE1 1 
ATOM   518  C  CE2 . PHE A 1 66  ? 45.552 -16.467 -8.393  1.00 26.77 ? 173  PHE A CE2 1 
ATOM   519  C  CZ  . PHE A 1 66  ? 45.121 -15.174 -8.657  1.00 21.95 ? 173  PHE A CZ  1 
ATOM   520  N  N   . ASP A 1 67  ? 44.379 -19.175 -11.344 1.00 16.44 ? 174  ASP A N   1 
ATOM   521  C  CA  . ASP A 1 67  ? 45.543 -19.952 -11.733 1.00 16.09 ? 174  ASP A CA  1 
ATOM   522  C  C   . ASP A 1 67  ? 46.610 -19.723 -10.682 1.00 21.09 ? 174  ASP A C   1 
ATOM   523  O  O   . ASP A 1 67  ? 47.300 -18.702 -10.697 1.00 17.47 ? 174  ASP A O   1 
ATOM   524  C  CB  . ASP A 1 67  ? 46.024 -19.535 -13.127 1.00 17.44 ? 174  ASP A CB  1 
ATOM   525  C  CG  . ASP A 1 67  ? 47.237 -20.323 -13.609 1.00 18.90 ? 174  ASP A CG  1 
ATOM   526  O  OD1 . ASP A 1 67  ? 47.915 -20.994 -12.808 1.00 15.85 ? 174  ASP A OD1 1 
ATOM   527  O  OD2 . ASP A 1 67  ? 47.525 -20.238 -14.816 1.00 16.86 ? 174  ASP A OD2 1 
ATOM   528  N  N   . VAL A 1 68  ? 46.735 -20.673 -9.761  1.00 17.25 ? 175  VAL A N   1 
ATOM   529  C  CA  . VAL A 1 68  ? 47.703 -20.559 -8.684  1.00 16.60 ? 175  VAL A CA  1 
ATOM   530  C  C   . VAL A 1 68  ? 49.100 -20.934 -9.161  1.00 19.25 ? 175  VAL A C   1 
ATOM   531  O  O   . VAL A 1 68  ? 50.085 -20.433 -8.634  1.00 19.90 ? 175  VAL A O   1 
ATOM   532  C  CB  . VAL A 1 68  ? 47.294 -21.439 -7.472  1.00 17.79 ? 175  VAL A CB  1 
ATOM   533  C  CG1 . VAL A 1 68  ? 48.313 -21.330 -6.354  1.00 18.67 ? 175  VAL A CG1 1 
ATOM   534  C  CG2 . VAL A 1 68  ? 45.914 -21.010 -6.974  1.00 16.24 ? 175  VAL A CG2 1 
ATOM   535  N  N   . ASN A 1 69  ? 49.191 -21.796 -10.174 1.00 15.44 ? 176  ASN A N   1 
ATOM   536  C  CA  . ASN A 1 69  ? 50.499 -22.191 -10.695 1.00 21.07 ? 176  ASN A CA  1 
ATOM   537  C  C   . ASN A 1 69  ? 51.245 -21.029 -11.359 1.00 23.21 ? 176  ASN A C   1 
ATOM   538  O  O   . ASN A 1 69  ? 52.448 -20.876 -11.163 1.00 19.77 ? 176  ASN A O   1 
ATOM   539  C  CB  . ASN A 1 69  ? 50.366 -23.345 -11.693 1.00 17.04 ? 176  ASN A CB  1 
ATOM   540  C  CG  . ASN A 1 69  ? 49.911 -24.637 -11.036 1.00 15.84 ? 176  ASN A CG  1 
ATOM   541  O  OD1 . ASN A 1 69  ? 49.021 -25.317 -11.542 1.00 16.12 ? 176  ASN A OD1 1 
ATOM   542  N  ND2 . ASN A 1 69  ? 50.528 -24.983 -9.904  1.00 16.17 ? 176  ASN A ND2 1 
ATOM   543  N  N   . ASP A 1 70  ? 50.532 -20.214 -12.133 1.00 18.77 ? 177  ASP A N   1 
ATOM   544  C  CA  . ASP A 1 70  ? 51.155 -19.070 -12.810 1.00 21.13 ? 177  ASP A CA  1 
ATOM   545  C  C   . ASP A 1 70  ? 50.789 -17.736 -12.163 1.00 26.04 ? 177  ASP A C   1 
ATOM   546  O  O   . ASP A 1 70  ? 51.262 -16.681 -12.591 1.00 22.62 ? 177  ASP A O   1 
ATOM   547  C  CB  . ASP A 1 70  ? 50.759 -19.031 -14.293 1.00 19.73 ? 177  ASP A CB  1 
ATOM   548  C  CG  . ASP A 1 70  ? 51.511 -20.047 -15.133 1.00 24.41 ? 177  ASP A CG  1 
ATOM   549  O  OD1 . ASP A 1 70  ? 52.480 -20.651 -14.631 1.00 36.38 ? 177  ASP A OD1 1 
ATOM   550  O  OD2 . ASP A 1 70  ? 51.136 -20.231 -16.310 1.00 30.05 ? 177  ASP A OD2 1 
ATOM   551  N  N   . GLN A 1 71  ? 49.935 -17.794 -11.147 1.00 20.89 ? 178  GLN A N   1 
ATOM   552  C  CA  . GLN A 1 71  ? 49.484 -16.614 -10.407 1.00 22.35 ? 178  GLN A CA  1 
ATOM   553  C  C   . GLN A 1 71  ? 48.832 -15.580 -11.319 1.00 21.64 ? 178  GLN A C   1 
ATOM   554  O  O   . GLN A 1 71  ? 49.335 -14.471 -11.493 1.00 24.02 ? 178  GLN A O   1 
ATOM   555  C  CB  . GLN A 1 71  ? 50.647 -16.009 -9.617  1.00 25.12 ? 178  GLN A CB  1 
ATOM   556  C  CG  . GLN A 1 71  ? 51.255 -17.040 -8.668  1.00 40.36 ? 178  GLN A CG  1 
ATOM   557  C  CD  . GLN A 1 71  ? 52.232 -16.463 -7.665  1.00 55.20 ? 178  GLN A CD  1 
ATOM   558  O  OE1 . GLN A 1 71  ? 52.340 -15.246 -7.507  1.00 59.83 ? 178  GLN A OE1 1 
ATOM   559  N  NE2 . GLN A 1 71  ? 52.949 -17.346 -6.971  1.00 48.33 ? 178  GLN A NE2 1 
ATOM   560  N  N   . ASP A 1 72  ? 47.699 -15.963 -11.896 1.00 19.43 ? 179  ASP A N   1 
ATOM   561  C  CA  . ASP A 1 72  ? 46.886 -15.065 -12.711 1.00 19.32 ? 179  ASP A CA  1 
ATOM   562  C  C   . ASP A 1 72  ? 45.431 -15.551 -12.598 1.00 21.47 ? 179  ASP A C   1 
ATOM   563  O  O   . ASP A 1 72  ? 45.184 -16.625 -12.038 1.00 21.30 ? 179  ASP A O   1 
ATOM   564  C  CB  . ASP A 1 72  ? 47.396 -15.015 -14.173 1.00 18.83 ? 179  ASP A CB  1 
ATOM   565  C  CG  . ASP A 1 72  ? 47.219 -16.337 -14.925 1.00 23.55 ? 179  ASP A CG  1 
ATOM   566  O  OD1 . ASP A 1 72  ? 46.072 -16.794 -15.080 1.00 21.67 ? 179  ASP A OD1 1 
ATOM   567  O  OD2 . ASP A 1 72  ? 48.229 -16.900 -15.409 1.00 24.65 ? 179  ASP A OD2 1 
ATOM   568  N  N   . PRO A 1 73  ? 44.460 -14.764 -13.091 1.00 19.64 ? 180  PRO A N   1 
ATOM   569  C  CA  . PRO A 1 73  ? 43.069 -15.186 -12.877 1.00 23.22 ? 180  PRO A CA  1 
ATOM   570  C  C   . PRO A 1 73  ? 42.573 -16.270 -13.827 1.00 20.58 ? 180  PRO A C   1 
ATOM   571  O  O   . PRO A 1 73  ? 41.478 -16.769 -13.602 1.00 22.82 ? 180  PRO A O   1 
ATOM   572  C  CB  . PRO A 1 73  ? 42.266 -13.890 -13.111 1.00 28.65 ? 180  PRO A CB  1 
ATOM   573  C  CG  . PRO A 1 73  ? 43.270 -12.783 -13.051 1.00 29.83 ? 180  PRO A CG  1 
ATOM   574  C  CD  . PRO A 1 73  ? 44.528 -13.377 -13.584 1.00 23.34 ? 180  PRO A CD  1 
ATOM   575  N  N   . ASP A 1 74  ? 43.357 -16.618 -14.850 1.00 20.05 ? 181  ASP A N   1 
ATOM   576  C  CA  . ASP A 1 74  ? 42.878 -17.426 -15.974 1.00 18.70 ? 181  ASP A CA  1 
ATOM   577  C  C   . ASP A 1 74  ? 43.343 -18.878 -15.861 1.00 18.26 ? 181  ASP A C   1 
ATOM   578  O  O   . ASP A 1 74  ? 44.520 -19.169 -16.055 1.00 19.54 ? 181  ASP A O   1 
ATOM   579  C  CB  . ASP A 1 74  ? 43.363 -16.794 -17.287 1.00 22.50 ? 181  ASP A CB  1 
ATOM   580  C  CG  . ASP A 1 74  ? 42.918 -17.558 -18.537 1.00 29.71 ? 181  ASP A CG  1 
ATOM   581  O  OD1 . ASP A 1 74  ? 42.165 -18.549 -18.443 1.00 25.47 ? 181  ASP A OD1 1 
ATOM   582  O  OD2 . ASP A 1 74  ? 43.329 -17.136 -19.642 1.00 30.33 ? 181  ASP A OD2 1 
ATOM   583  N  N   . PRO A 1 75  ? 42.404 -19.798 -15.568 1.00 18.24 ? 182  PRO A N   1 
ATOM   584  C  CA  . PRO A 1 75  ? 42.723 -21.207 -15.302 1.00 19.82 ? 182  PRO A CA  1 
ATOM   585  C  C   . PRO A 1 75  ? 42.827 -22.065 -16.558 1.00 19.34 ? 182  PRO A C   1 
ATOM   586  O  O   . PRO A 1 75  ? 42.795 -23.295 -16.455 1.00 16.28 ? 182  PRO A O   1 
ATOM   587  C  CB  . PRO A 1 75  ? 41.535 -21.661 -14.458 1.00 17.69 ? 182  PRO A CB  1 
ATOM   588  C  CG  . PRO A 1 75  ? 40.394 -20.911 -15.095 1.00 17.43 ? 182  PRO A CG  1 
ATOM   589  C  CD  . PRO A 1 75  ? 40.953 -19.553 -15.486 1.00 17.22 ? 182  PRO A CD  1 
ATOM   590  N  N   . GLN A 1 76  ? 42.924 -21.437 -17.727 1.00 17.08 ? 183  GLN A N   1 
ATOM   591  C  CA  . GLN A 1 76  ? 43.024 -22.199 -18.974 1.00 17.79 ? 183  GLN A CA  1 
ATOM   592  C  C   . GLN A 1 76  ? 44.124 -23.247 -18.861 1.00 15.30 ? 183  GLN A C   1 
ATOM   593  O  O   . GLN A 1 76  ? 45.225 -22.937 -18.417 1.00 16.08 ? 183  GLN A O   1 
ATOM   594  C  CB  . GLN A 1 76  ? 43.314 -21.269 -20.158 1.00 18.28 ? 183  GLN A CB  1 
ATOM   595  C  CG  . GLN A 1 76  ? 43.093 -21.924 -21.530 1.00 17.56 ? 183  GLN A CG  1 
ATOM   596  C  CD  . GLN A 1 76  ? 41.624 -22.025 -21.887 1.00 21.14 ? 183  GLN A CD  1 
ATOM   597  O  OE1 . GLN A 1 76  ? 40.797 -21.291 -21.348 1.00 28.10 ? 183  GLN A OE1 1 
ATOM   598  N  NE2 . GLN A 1 76  ? 41.289 -22.931 -22.802 1.00 21.14 ? 183  GLN A NE2 1 
ATOM   599  N  N   . PRO A 1 77  ? 43.833 -24.498 -19.249 1.00 16.02 ? 184  PRO A N   1 
ATOM   600  C  CA  . PRO A 1 77  ? 44.886 -25.513 -19.157 1.00 15.48 ? 184  PRO A CA  1 
ATOM   601  C  C   . PRO A 1 77  ? 46.053 -25.211 -20.094 1.00 24.35 ? 184  PRO A C   1 
ATOM   602  O  O   . PRO A 1 77  ? 45.878 -24.527 -21.111 1.00 20.05 ? 184  PRO A O   1 
ATOM   603  C  CB  . PRO A 1 77  ? 44.178 -26.811 -19.578 1.00 18.99 ? 184  PRO A CB  1 
ATOM   604  C  CG  . PRO A 1 77  ? 42.714 -26.513 -19.501 1.00 22.39 ? 184  PRO A CG  1 
ATOM   605  C  CD  . PRO A 1 77  ? 42.575 -25.043 -19.773 1.00 17.30 ? 184  PRO A CD  1 
ATOM   606  N  N   . ARG A 1 78  ? 47.226 -25.719 -19.735 1.00 18.51 ? 185  ARG A N   1 
ATOM   607  C  CA  . ARG A 1 78  ? 48.395 -25.687 -20.596 1.00 17.32 ? 185  ARG A CA  1 
ATOM   608  C  C   . ARG A 1 78  ? 48.301 -26.823 -21.614 1.00 22.89 ? 185  ARG A C   1 
ATOM   609  O  O   . ARG A 1 78  ? 48.219 -27.995 -21.239 1.00 22.23 ? 185  ARG A O   1 
ATOM   610  C  CB  . ARG A 1 78  ? 49.664 -25.795 -19.744 1.00 15.92 ? 185  ARG A CB  1 
ATOM   611  C  CG  . ARG A 1 78  ? 50.991 -25.841 -20.507 1.00 21.14 ? 185  ARG A CG  1 
ATOM   612  C  CD  . ARG A 1 78  ? 52.155 -25.875 -19.512 1.00 23.21 ? 185  ARG A CD  1 
ATOM   613  N  NE  . ARG A 1 78  ? 52.101 -27.067 -18.659 1.00 23.60 ? 185  ARG A NE  1 
ATOM   614  C  CZ  . ARG A 1 78  ? 52.714 -28.214 -18.932 1.00 26.06 ? 185  ARG A CZ  1 
ATOM   615  N  NH1 . ARG A 1 78  ? 52.598 -29.245 -18.100 1.00 24.07 ? 185  ARG A NH1 1 
ATOM   616  N  NH2 . ARG A 1 78  ? 53.446 -28.331 -20.037 1.00 25.04 ? 185  ARG A NH2 1 
ATOM   617  N  N   . TYR A 1 79  ? 48.293 -26.485 -22.901 1.00 19.74 ? 186  TYR A N   1 
ATOM   618  C  CA  . TYR A 1 79  ? 48.124 -27.508 -23.931 1.00 18.11 ? 186  TYR A CA  1 
ATOM   619  C  C   . TYR A 1 79  ? 49.454 -28.155 -24.282 1.00 26.84 ? 186  TYR A C   1 
ATOM   620  O  O   . TYR A 1 79  ? 50.456 -27.468 -24.475 1.00 26.75 ? 186  TYR A O   1 
ATOM   621  C  CB  . TYR A 1 79  ? 47.466 -26.914 -25.181 1.00 18.12 ? 186  TYR A CB  1 
ATOM   622  C  CG  . TYR A 1 79  ? 46.047 -26.481 -24.918 1.00 18.53 ? 186  TYR A CG  1 
ATOM   623  C  CD1 . TYR A 1 79  ? 45.765 -25.195 -24.476 1.00 22.73 ? 186  TYR A CD1 1 
ATOM   624  C  CD2 . TYR A 1 79  ? 44.989 -27.375 -25.067 1.00 19.85 ? 186  TYR A CD2 1 
ATOM   625  C  CE1 . TYR A 1 79  ? 44.469 -24.799 -24.210 1.00 19.08 ? 186  TYR A CE1 1 
ATOM   626  C  CE2 . TYR A 1 79  ? 43.684 -26.986 -24.812 1.00 22.83 ? 186  TYR A CE2 1 
ATOM   627  C  CZ  . TYR A 1 79  ? 43.434 -25.696 -24.380 1.00 23.79 ? 186  TYR A CZ  1 
ATOM   628  O  OH  . TYR A 1 79  ? 42.142 -25.298 -24.117 1.00 27.03 ? 186  TYR A OH  1 
ATOM   629  N  N   . THR A 1 80  ? 49.454 -29.485 -24.317 1.00 24.01 ? 187  THR A N   1 
ATOM   630  C  CA  . THR A 1 80  ? 50.618 -30.267 -24.722 1.00 30.10 ? 187  THR A CA  1 
ATOM   631  C  C   . THR A 1 80  ? 50.179 -31.395 -25.655 1.00 35.14 ? 187  THR A C   1 
ATOM   632  O  O   . THR A 1 80  ? 48.994 -31.712 -25.728 1.00 26.62 ? 187  THR A O   1 
ATOM   633  C  CB  . THR A 1 80  ? 51.350 -30.876 -23.513 1.00 31.91 ? 187  THR A CB  1 
ATOM   634  O  OG1 . THR A 1 80  ? 50.482 -31.799 -22.839 1.00 34.00 ? 187  THR A OG1 1 
ATOM   635  C  CG2 . THR A 1 80  ? 51.770 -29.786 -22.537 1.00 27.52 ? 187  THR A CG2 1 
ATOM   636  N  N   . GLN A 1 81  ? 51.135 -32.005 -26.354 1.00 27.86 ? 188  GLN A N   1 
ATOM   637  C  CA  . GLN A 1 81  ? 50.840 -33.132 -27.238 1.00 32.86 ? 188  GLN A CA  1 
ATOM   638  C  C   . GLN A 1 81  ? 50.204 -34.302 -26.511 1.00 28.45 ? 188  GLN A C   1 
ATOM   639  O  O   . GLN A 1 81  ? 49.418 -35.049 -27.087 1.00 28.56 ? 188  GLN A O   1 
ATOM   640  C  CB  . GLN A 1 81  ? 52.110 -33.638 -27.913 1.00 39.46 ? 188  GLN A CB  1 
ATOM   641  C  CG  . GLN A 1 81  ? 52.670 -32.760 -28.989 1.00 45.95 ? 188  GLN A CG  1 
ATOM   642  C  CD  . GLN A 1 81  ? 53.788 -33.459 -29.730 1.00 44.62 ? 188  GLN A CD  1 
ATOM   643  O  OE1 . GLN A 1 81  ? 54.860 -33.712 -29.174 1.00 54.02 ? 188  GLN A OE1 1 
ATOM   644  N  NE2 . GLN A 1 81  ? 53.533 -33.801 -30.982 1.00 40.29 ? 188  GLN A NE2 1 
ATOM   645  N  N   . MET A 1 82  ? 50.582 -34.482 -25.252 1.00 28.64 ? 189  MET A N   1 
ATOM   646  C  CA  . MET A 1 82  ? 50.092 -35.610 -24.473 1.00 29.24 ? 189  MET A CA  1 
ATOM   647  C  C   . MET A 1 82  ? 48.713 -35.348 -23.868 1.00 27.55 ? 189  MET A C   1 
ATOM   648  O  O   . MET A 1 82  ? 48.119 -36.242 -23.271 1.00 27.26 ? 189  MET A O   1 
ATOM   649  C  CB  . MET A 1 82  ? 51.087 -35.945 -23.364 1.00 39.28 ? 189  MET A CB  1 
ATOM   650  C  CG  . MET A 1 82  ? 52.537 -35.815 -23.796 1.00 50.87 ? 189  MET A CG  1 
ATOM   651  S  SD  . MET A 1 82  ? 53.702 -36.439 -22.571 1.00 86.34 ? 189  MET A SD  1 
ATOM   652  C  CE  . MET A 1 82  ? 55.250 -36.291 -23.469 1.00 59.54 ? 189  MET A CE  1 
ATOM   653  N  N   . ASN A 1 83  ? 48.220 -34.121 -24.026 1.00 24.50 ? 190  ASN A N   1 
ATOM   654  C  CA  . ASN A 1 83  ? 46.963 -33.694 -23.414 1.00 25.17 ? 190  ASN A CA  1 
ATOM   655  C  C   . ASN A 1 83  ? 46.914 -34.016 -21.925 1.00 25.62 ? 190  ASN A C   1 
ATOM   656  O  O   . ASN A 1 83  ? 45.890 -34.463 -21.415 1.00 24.56 ? 190  ASN A O   1 
ATOM   657  C  CB  . ASN A 1 83  ? 45.777 -34.336 -24.136 1.00 27.77 ? 190  ASN A CB  1 
ATOM   658  C  CG  . ASN A 1 83  ? 45.647 -33.856 -25.570 1.00 33.35 ? 190  ASN A CG  1 
ATOM   659  O  OD1 . ASN A 1 83  ? 45.722 -32.656 -25.842 1.00 27.14 ? 190  ASN A OD1 1 
ATOM   660  N  ND2 . ASN A 1 83  ? 45.458 -34.792 -26.495 1.00 32.31 ? 190  ASN A ND2 1 
ATOM   661  N  N   . ASP A 1 84  ? 48.030 -33.778 -21.239 1.00 23.24 ? 191  ASP A N   1 
ATOM   662  C  CA  . ASP A 1 84  ? 48.181 -34.136 -19.831 1.00 25.64 ? 191  ASP A CA  1 
ATOM   663  C  C   . ASP A 1 84  ? 47.242 -33.358 -18.912 1.00 30.01 ? 191  ASP A C   1 
ATOM   664  O  O   . ASP A 1 84  ? 46.881 -33.835 -17.839 1.00 28.91 ? 191  ASP A O   1 
ATOM   665  C  CB  . ASP A 1 84  ? 49.612 -33.890 -19.354 1.00 32.49 ? 191  ASP A CB  1 
ATOM   666  C  CG  . ASP A 1 84  ? 50.646 -34.515 -20.249 1.00 40.35 ? 191  ASP A CG  1 
ATOM   667  O  OD1 . ASP A 1 84  ? 50.846 -35.743 -20.157 0.00 34.66 ? 191  ASP A OD1 1 
ATOM   668  O  OD2 . ASP A 1 84  ? 51.275 -33.771 -21.031 0.00 33.35 ? 191  ASP A OD2 1 
ATOM   669  N  N   . ASN A 1 85  ? 46.877 -32.152 -19.326 1.00 18.42 ? 192  ASN A N   1 
ATOM   670  C  CA  . ASN A 1 85  ? 46.143 -31.242 -18.454 1.00 15.23 ? 192  ASN A CA  1 
ATOM   671  C  C   . ASN A 1 85  ? 44.664 -31.198 -18.777 1.00 15.58 ? 192  ASN A C   1 
ATOM   672  O  O   . ASN A 1 85  ? 44.043 -30.133 -18.824 1.00 18.60 ? 192  ASN A O   1 
ATOM   673  C  CB  . ASN A 1 85  ? 46.761 -29.849 -18.539 1.00 16.92 ? 192  ASN A CB  1 
ATOM   674  C  CG  . ASN A 1 85  ? 48.166 -29.823 -17.987 1.00 21.69 ? 192  ASN A CG  1 
ATOM   675  O  OD1 . ASN A 1 85  ? 48.393 -30.212 -16.842 1.00 19.73 ? 192  ASN A OD1 1 
ATOM   676  N  ND2 . ASN A 1 85  ? 49.128 -29.397 -18.807 1.00 20.20 ? 192  ASN A ND2 1 
ATOM   677  N  N   . ARG A 1 86  ? 44.098 -32.378 -18.987 1.00 15.05 ? 193  ARG A N   1 
ATOM   678  C  CA  . ARG A 1 86  ? 42.707 -32.498 -19.393 1.00 15.57 ? 193  ARG A CA  1 
ATOM   679  C  C   . ARG A 1 86  ? 41.772 -32.842 -18.235 1.00 16.95 ? 193  ARG A C   1 
ATOM   680  O  O   . ARG A 1 86  ? 40.547 -32.825 -18.390 1.00 12.53 ? 193  ARG A O   1 
ATOM   681  C  CB  . ARG A 1 86  ? 42.580 -33.578 -20.459 1.00 16.03 ? 193  ARG A CB  1 
ATOM   682  C  CG  . ARG A 1 86  ? 42.824 -34.974 -19.904 1.00 18.19 ? 193  ARG A CG  1 
ATOM   683  C  CD  . ARG A 1 86  ? 42.854 -35.983 -21.041 1.00 23.95 ? 193  ARG A CD  1 
ATOM   684  N  NE  . ARG A 1 86  ? 42.981 -37.357 -20.575 1.00 24.20 ? 193  ARG A NE  1 
ATOM   685  C  CZ  . ARG A 1 86  ? 43.087 -38.405 -21.390 1.00 38.67 ? 193  ARG A CZ  1 
ATOM   686  N  NH1 . ARG A 1 86  ? 43.094 -38.228 -22.713 1.00 31.32 ? 193  ARG A NH1 1 
ATOM   687  N  NH2 . ARG A 1 86  ? 43.187 -39.627 -20.885 1.00 29.86 ? 193  ARG A NH2 1 
ATOM   688  N  N   . HIS A 1 87  ? 42.342 -33.169 -17.083 1.00 16.31 ? 194  HIS A N   1 
ATOM   689  C  CA  . HIS A 1 87  ? 41.538 -33.770 -16.020 1.00 15.64 ? 194  HIS A CA  1 
ATOM   690  C  C   . HIS A 1 87  ? 40.510 -32.798 -15.432 1.00 16.35 ? 194  HIS A C   1 
ATOM   691  O  O   . HIS A 1 87  ? 39.365 -33.181 -15.173 1.00 14.50 ? 194  HIS A O   1 
ATOM   692  C  CB  . HIS A 1 87  ? 42.441 -34.313 -14.909 1.00 15.47 ? 194  HIS A CB  1 
ATOM   693  C  CG  . HIS A 1 87  ? 41.724 -35.204 -13.943 1.00 22.65 ? 194  HIS A CG  1 
ATOM   694  N  ND1 . HIS A 1 87  ? 41.386 -34.799 -12.669 1.00 27.18 ? 194  HIS A ND1 1 
ATOM   695  C  CD2 . HIS A 1 87  ? 41.267 -36.474 -14.068 1.00 19.67 ? 194  HIS A CD2 1 
ATOM   696  C  CE1 . HIS A 1 87  ? 40.760 -35.783 -12.047 1.00 21.62 ? 194  HIS A CE1 1 
ATOM   697  N  NE2 . HIS A 1 87  ? 40.672 -36.811 -12.874 1.00 17.41 ? 194  HIS A NE2 1 
ATOM   698  N  N   . GLY A 1 88  ? 40.913 -31.552 -15.218 1.00 14.43 ? 195  GLY A N   1 
ATOM   699  C  CA  . GLY A 1 88  ? 40.022 -30.564 -14.627 1.00 14.07 ? 195  GLY A CA  1 
ATOM   700  C  C   . GLY A 1 88  ? 38.823 -30.274 -15.511 1.00 17.08 ? 195  GLY A C   1 
ATOM   701  O  O   . GLY A 1 88  ? 37.702 -30.073 -15.033 1.00 13.95 ? 195  GLY A O   1 
ATOM   702  N  N   . THR A 1 89  ? 39.058 -30.256 -16.818 1.00 13.27 ? 196  THR A N   1 
ATOM   703  C  CA  . THR A 1 89  ? 37.981 -30.023 -17.772 1.00 13.99 ? 196  THR A CA  1 
ATOM   704  C  C   . THR A 1 89  ? 36.985 -31.179 -17.750 1.00 12.88 ? 196  THR A C   1 
ATOM   705  O  O   . THR A 1 89  ? 35.763 -30.975 -17.782 1.00 13.21 ? 196  THR A O   1 
ATOM   706  C  CB  . THR A 1 89  ? 38.551 -29.818 -19.183 1.00 12.78 ? 196  THR A CB  1 
ATOM   707  O  OG1 . THR A 1 89  ? 39.299 -28.602 -19.189 1.00 17.44 ? 196  THR A OG1 1 
ATOM   708  C  CG2 . THR A 1 89  ? 37.442 -29.721 -20.221 1.00 13.38 ? 196  THR A CG2 1 
ATOM   709  N  N   . ARG A 1 90  ? 37.507 -32.394 -17.675 1.00 11.53 ? 197  ARG A N   1 
ATOM   710  C  CA  . ARG A 1 90  ? 36.649 -33.566 -17.554 1.00 11.55 ? 197  ARG A CA  1 
ATOM   711  C  C   . ARG A 1 90  ? 35.775 -33.495 -16.300 1.00 13.63 ? 197  ARG A C   1 
ATOM   712  O  O   . ARG A 1 90  ? 34.568 -33.763 -16.356 1.00 13.24 ? 197  ARG A O   1 
ATOM   713  C  CB  . ARG A 1 90  ? 37.494 -34.844 -17.549 1.00 13.00 ? 197  ARG A CB  1 
ATOM   714  C  CG  . ARG A 1 90  ? 38.114 -35.130 -18.934 1.00 11.84 ? 197  ARG A CG  1 
ATOM   715  C  CD  . ARG A 1 90  ? 38.938 -36.414 -18.969 1.00 13.77 ? 197  ARG A CD  1 
ATOM   716  N  NE  . ARG A 1 90  ? 39.308 -36.721 -20.351 1.00 14.41 ? 197  ARG A NE  1 
ATOM   717  C  CZ  . ARG A 1 90  ? 39.574 -37.936 -20.814 1.00 21.72 ? 197  ARG A CZ  1 
ATOM   718  N  NH1 . ARG A 1 90  ? 39.882 -38.102 -22.102 1.00 18.22 ? 197  ARG A NH1 1 
ATOM   719  N  NH2 . ARG A 1 90  ? 39.526 -38.982 -20.002 1.00 19.08 ? 197  ARG A NH2 1 
ATOM   720  N  N   . CYS A 1 91  ? 36.383 -33.120 -15.177 1.00 14.38 ? 198  CYS A N   1 
ATOM   721  C  CA  . CYS A 1 91  ? 35.641 -33.054 -13.922 1.00 12.73 ? 198  CYS A CA  1 
ATOM   722  C  C   . CYS A 1 91  ? 34.599 -31.927 -13.941 1.00 13.79 ? 198  CYS A C   1 
ATOM   723  O  O   . CYS A 1 91  ? 33.494 -32.095 -13.418 1.00 14.51 ? 198  CYS A O   1 
ATOM   724  C  CB  . CYS A 1 91  ? 36.605 -32.884 -12.745 1.00 11.91 ? 198  CYS A CB  1 
ATOM   725  S  SG  . CYS A 1 91  ? 37.659 -34.353 -12.487 1.00 17.20 ? 198  CYS A SG  1 
ATOM   726  N  N   . ALA A 1 92  ? 34.940 -30.794 -14.550 1.00 12.71 ? 199  ALA A N   1 
ATOM   727  C  CA  . ALA A 1 92  ? 34.018 -29.656 -14.609 1.00 12.09 ? 199  ALA A CA  1 
ATOM   728  C  C   . ALA A 1 92  ? 32.730 -30.038 -15.340 1.00 15.88 ? 199  ALA A C   1 
ATOM   729  O  O   . ALA A 1 92  ? 31.640 -29.664 -14.916 1.00 14.36 ? 199  ALA A O   1 
ATOM   730  C  CB  . ALA A 1 92  ? 34.681 -28.441 -15.287 1.00 11.91 ? 199  ALA A CB  1 
ATOM   731  N  N   . GLY A 1 93  ? 32.866 -30.795 -16.430 1.00 13.92 ? 200  GLY A N   1 
ATOM   732  C  CA  . GLY A 1 93  ? 31.719 -31.222 -17.218 1.00 11.91 ? 200  GLY A CA  1 
ATOM   733  C  C   . GLY A 1 93  ? 30.797 -32.159 -16.459 1.00 14.60 ? 200  GLY A C   1 
ATOM   734  O  O   . GLY A 1 93  ? 29.584 -32.160 -16.648 1.00 15.58 ? 200  GLY A O   1 
ATOM   735  N  N   . GLU A 1 94  ? 31.372 -32.970 -15.585 1.00 13.21 ? 201  GLU A N   1 
ATOM   736  C  CA  . GLU A 1 94  ? 30.556 -33.848 -14.755 1.00 12.13 ? 201  GLU A CA  1 
ATOM   737  C  C   . GLU A 1 94  ? 29.607 -33.053 -13.878 1.00 11.71 ? 201  GLU A C   1 
ATOM   738  O  O   . GLU A 1 94  ? 28.464 -33.448 -13.652 1.00 13.92 ? 201  GLU A O   1 
ATOM   739  C  CB  . GLU A 1 94  ? 31.430 -34.709 -13.867 1.00 12.60 ? 201  GLU A CB  1 
ATOM   740  C  CG  . GLU A 1 94  ? 32.311 -35.691 -14.605 1.00 15.28 ? 201  GLU A CG  1 
ATOM   741  C  CD  . GLU A 1 94  ? 32.997 -36.592 -13.620 1.00 19.67 ? 201  GLU A CD  1 
ATOM   742  O  OE1 . GLU A 1 94  ? 34.182 -36.339 -13.314 1.00 15.25 ? 201  GLU A OE1 1 
ATOM   743  O  OE2 . GLU A 1 94  ? 32.321 -37.521 -13.120 1.00 16.34 ? 201  GLU A OE2 1 
ATOM   744  N  N   . VAL A 1 95  ? 30.109 -31.943 -13.357 1.00 13.27 ? 202  VAL A N   1 
ATOM   745  C  CA  . VAL A 1 95  ? 29.307 -31.132 -12.451 1.00 11.57 ? 202  VAL A CA  1 
ATOM   746  C  C   . VAL A 1 95  ? 28.280 -30.305 -13.218 1.00 17.03 ? 202  VAL A C   1 
ATOM   747  O  O   . VAL A 1 95  ? 27.098 -30.274 -12.862 1.00 14.75 ? 202  VAL A O   1 
ATOM   748  C  CB  . VAL A 1 95  ? 30.175 -30.169 -11.622 1.00 15.72 ? 202  VAL A CB  1 
ATOM   749  C  CG1 . VAL A 1 95  ? 29.289 -29.339 -10.678 1.00 13.03 ? 202  VAL A CG1 1 
ATOM   750  C  CG2 . VAL A 1 95  ? 31.241 -30.939 -10.829 1.00 12.18 ? 202  VAL A CG2 1 
ATOM   751  N  N   . ALA A 1 96  ? 28.736 -29.628 -14.267 1.00 13.94 ? 203  ALA A N   1 
ATOM   752  C  CA  . ALA A 1 96  ? 27.954 -28.516 -14.791 1.00 14.56 ? 203  ALA A CA  1 
ATOM   753  C  C   . ALA A 1 96  ? 28.018 -28.335 -16.302 1.00 16.78 ? 203  ALA A C   1 
ATOM   754  O  O   . ALA A 1 96  ? 27.900 -27.212 -16.783 1.00 19.13 ? 203  ALA A O   1 
ATOM   755  C  CB  . ALA A 1 96  ? 28.393 -27.221 -14.111 1.00 13.04 ? 203  ALA A CB  1 
ATOM   756  N  N   . ALA A 1 97  ? 28.208 -29.410 -17.057 1.00 15.91 ? 204  ALA A N   1 
ATOM   757  C  CA  . ALA A 1 97  ? 28.090 -29.290 -18.511 1.00 14.56 ? 204  ALA A CA  1 
ATOM   758  C  C   . ALA A 1 97  ? 26.680 -28.810 -18.862 1.00 14.74 ? 204  ALA A C   1 
ATOM   759  O  O   . ALA A 1 97  ? 25.694 -29.238 -18.252 1.00 14.86 ? 204  ALA A O   1 
ATOM   760  C  CB  . ALA A 1 97  ? 28.393 -30.608 -19.199 1.00 15.81 ? 204  ALA A CB  1 
ATOM   761  N  N   . VAL A 1 98  ? 26.602 -27.910 -19.835 1.00 17.85 ? 205  VAL A N   1 
ATOM   762  C  CA  . VAL A 1 98  ? 25.340 -27.282 -20.232 1.00 16.91 ? 205  VAL A CA  1 
ATOM   763  C  C   . VAL A 1 98  ? 24.363 -28.311 -20.805 1.00 20.88 ? 205  VAL A C   1 
ATOM   764  O  O   . VAL A 1 98  ? 24.774 -29.262 -21.467 1.00 19.02 ? 205  VAL A O   1 
ATOM   765  C  CB  . VAL A 1 98  ? 25.615 -26.153 -21.255 1.00 23.83 ? 205  VAL A CB  1 
ATOM   766  C  CG1 . VAL A 1 98  ? 24.311 -25.569 -21.823 1.00 19.32 ? 205  VAL A CG1 1 
ATOM   767  C  CG2 . VAL A 1 98  ? 26.458 -25.063 -20.606 1.00 19.87 ? 205  VAL A CG2 1 
ATOM   768  N  N   . ALA A 1 99  ? 23.071 -28.148 -20.526 1.00 18.38 ? 206  ALA A N   1 
ATOM   769  C  CA  . ALA A 1 99  ? 22.070 -29.078 -21.040 1.00 16.66 ? 206  ALA A CA  1 
ATOM   770  C  C   . ALA A 1 99  ? 21.321 -28.510 -22.252 1.00 23.09 ? 206  ALA A C   1 
ATOM   771  O  O   . ALA A 1 99  ? 21.235 -27.290 -22.425 1.00 20.65 ? 206  ALA A O   1 
ATOM   772  C  CB  . ALA A 1 99  ? 21.077 -29.444 -19.948 1.00 16.64 ? 206  ALA A CB  1 
ATOM   773  N  N   . ASN A 1 100 ? 20.779 -29.412 -23.067 1.00 24.50 ? 207  ASN A N   1 
ATOM   774  C  CA  . ASN A 1 100 ? 19.891 -29.059 -24.182 1.00 27.13 ? 207  ASN A CA  1 
ATOM   775  C  C   . ASN A 1 100 ? 20.517 -28.107 -25.192 1.00 29.96 ? 207  ASN A C   1 
ATOM   776  O  O   . ASN A 1 100 ? 19.846 -27.214 -25.728 1.00 29.63 ? 207  ASN A O   1 
ATOM   777  C  CB  . ASN A 1 100 ? 18.594 -28.461 -23.631 1.00 19.74 ? 207  ASN A CB  1 
ATOM   778  C  CG  . ASN A 1 100 ? 17.825 -29.449 -22.784 1.00 22.89 ? 207  ASN A CG  1 
ATOM   779  O  OD1 . ASN A 1 100 ? 17.484 -30.540 -23.243 1.00 25.11 ? 207  ASN A OD1 1 
ATOM   780  N  ND2 . ASN A 1 100 ? 17.568 -29.085 -21.528 1.00 23.44 ? 207  ASN A ND2 1 
ATOM   781  N  N   . ASN A 1 101 ? 21.803 -28.304 -25.461 1.00 23.11 ? 208  ASN A N   1 
ATOM   782  C  CA  . ASN A 1 101 ? 22.523 -27.426 -26.365 1.00 22.15 ? 208  ASN A CA  1 
ATOM   783  C  C   . ASN A 1 101 ? 23.174 -28.205 -27.514 1.00 22.48 ? 208  ASN A C   1 
ATOM   784  O  O   . ASN A 1 101 ? 24.022 -27.681 -28.226 1.00 26.44 ? 208  ASN A O   1 
ATOM   785  C  CB  . ASN A 1 101 ? 23.573 -26.615 -25.590 1.00 22.74 ? 208  ASN A CB  1 
ATOM   786  C  CG  . ASN A 1 101 ? 24.737 -27.470 -25.106 1.00 22.66 ? 208  ASN A CG  1 
ATOM   787  O  OD1 . ASN A 1 101 ? 24.599 -28.678 -24.946 1.00 20.65 ? 208  ASN A OD1 1 
ATOM   788  N  ND2 . ASN A 1 101 ? 25.891 -26.845 -24.892 1.00 17.98 ? 208  ASN A ND2 1 
ATOM   789  N  N   . GLY A 1 102 ? 22.777 -29.463 -27.681 1.00 22.59 ? 209  GLY A N   1 
ATOM   790  C  CA  . GLY A 1 102 ? 23.250 -30.272 -28.793 1.00 22.78 ? 209  GLY A CA  1 
ATOM   791  C  C   . GLY A 1 102 ? 24.718 -30.645 -28.735 1.00 28.53 ? 209  GLY A C   1 
ATOM   792  O  O   . GLY A 1 102 ? 25.271 -31.120 -29.720 1.00 22.58 ? 209  GLY A O   1 
ATOM   793  N  N   . VAL A 1 103 ? 25.343 -30.448 -27.574 1.00 19.28 ? 210  VAL A N   1 
ATOM   794  C  CA  . VAL A 1 103 ? 26.759 -30.752 -27.387 1.00 22.27 ? 210  VAL A CA  1 
ATOM   795  C  C   . VAL A 1 103 ? 26.948 -31.773 -26.258 1.00 23.98 ? 210  VAL A C   1 
ATOM   796  O  O   . VAL A 1 103 ? 26.392 -31.604 -25.168 1.00 19.00 ? 210  VAL A O   1 
ATOM   797  C  CB  . VAL A 1 103 ? 27.570 -29.474 -27.052 1.00 21.92 ? 210  VAL A CB  1 
ATOM   798  C  CG1 . VAL A 1 103 ? 29.022 -29.812 -26.730 1.00 20.19 ? 210  VAL A CG1 1 
ATOM   799  C  CG2 . VAL A 1 103 ? 27.478 -28.450 -28.192 1.00 24.30 ? 210  VAL A CG2 1 
ATOM   800  N  N   . CYS A 1 104 ? 27.709 -32.831 -26.536 1.00 18.05 ? 211  CYS A N   1 
ATOM   801  C  CA  . CYS A 1 104 ? 28.098 -33.832 -25.533 1.00 18.88 ? 211  CYS A CA  1 
ATOM   802  C  C   . CYS A 1 104 ? 26.933 -34.311 -24.659 1.00 22.01 ? 211  CYS A C   1 
ATOM   803  O  O   . CYS A 1 104 ? 25.883 -34.702 -25.173 1.00 19.69 ? 211  CYS A O   1 
ATOM   804  C  CB  . CYS A 1 104 ? 29.225 -33.270 -24.651 1.00 23.33 ? 211  CYS A CB  1 
ATOM   805  S  SG  . CYS A 1 104 ? 30.336 -34.547 -23.930 1.00 29.59 ? 211  CYS A SG  1 
ATOM   806  N  N   . GLY A 1 105 ? 27.127 -34.294 -23.336 1.00 19.79 ? 212  GLY A N   1 
ATOM   807  C  CA  . GLY A 1 105 ? 26.091 -34.717 -22.408 1.00 15.89 ? 212  GLY A CA  1 
ATOM   808  C  C   . GLY A 1 105 ? 25.648 -33.562 -21.530 1.00 18.45 ? 212  GLY A C   1 
ATOM   809  O  O   . GLY A 1 105 ? 25.604 -32.418 -21.986 1.00 17.67 ? 212  GLY A O   1 
ATOM   810  N  N   . VAL A 1 106 ? 25.335 -33.852 -20.266 1.00 19.07 ? 213  VAL A N   1 
ATOM   811  C  CA  . VAL A 1 106 ? 24.950 -32.808 -19.312 1.00 15.18 ? 213  VAL A CA  1 
ATOM   812  C  C   . VAL A 1 106 ? 25.643 -33.007 -17.967 1.00 16.18 ? 213  VAL A C   1 
ATOM   813  O  O   . VAL A 1 106 ? 26.046 -34.122 -17.625 1.00 16.76 ? 213  VAL A O   1 
ATOM   814  C  CB  . VAL A 1 106 ? 23.415 -32.764 -19.066 1.00 18.25 ? 213  VAL A CB  1 
ATOM   815  C  CG1 . VAL A 1 106 ? 22.654 -32.689 -20.383 1.00 17.89 ? 213  VAL A CG1 1 
ATOM   816  C  CG2 . VAL A 1 106 ? 22.950 -33.956 -18.233 1.00 17.31 ? 213  VAL A CG2 1 
ATOM   817  N  N   . GLY A 1 107 ? 25.774 -31.923 -17.214 1.00 14.16 ? 214  GLY A N   1 
ATOM   818  C  CA  . GLY A 1 107 ? 26.259 -32.010 -15.843 1.00 14.87 ? 214  GLY A CA  1 
ATOM   819  C  C   . GLY A 1 107 ? 25.153 -32.464 -14.913 1.00 16.69 ? 214  GLY A C   1 
ATOM   820  O  O   . GLY A 1 107 ? 23.975 -32.375 -15.245 1.00 16.41 ? 214  GLY A O   1 
ATOM   821  N  N   . VAL A 1 108 ? 25.527 -32.957 -13.739 1.00 15.63 ? 215  VAL A N   1 
ATOM   822  C  CA  . VAL A 1 108 ? 24.547 -33.279 -12.709 1.00 14.55 ? 215  VAL A CA  1 
ATOM   823  C  C   . VAL A 1 108 ? 23.754 -32.032 -12.341 1.00 13.40 ? 215  VAL A C   1 
ATOM   824  O  O   . VAL A 1 108 ? 22.532 -32.079 -12.175 1.00 15.00 ? 215  VAL A O   1 
ATOM   825  C  CB  . VAL A 1 108 ? 25.226 -33.854 -11.450 1.00 15.28 ? 215  VAL A CB  1 
ATOM   826  C  CG1 . VAL A 1 108 ? 24.226 -33.959 -10.294 1.00 14.53 ? 215  VAL A CG1 1 
ATOM   827  C  CG2 . VAL A 1 108 ? 25.826 -35.212 -11.771 1.00 15.17 ? 215  VAL A CG2 1 
ATOM   828  N  N   . ALA A 1 109 ? 24.471 -30.922 -12.210 1.00 14.53 ? 216  ALA A N   1 
ATOM   829  C  CA  . ALA A 1 109 ? 23.883 -29.624 -11.888 1.00 17.32 ? 216  ALA A CA  1 
ATOM   830  C  C   . ALA A 1 109 ? 24.040 -28.715 -13.088 1.00 14.78 ? 216  ALA A C   1 
ATOM   831  O  O   . ALA A 1 109 ? 24.856 -27.797 -13.068 1.00 15.25 ? 216  ALA A O   1 
ATOM   832  C  CB  . ALA A 1 109 ? 24.561 -29.004 -10.652 1.00 14.42 ? 216  ALA A CB  1 
ATOM   833  N  N   . TYR A 1 110 ? 23.254 -28.959 -14.133 1.00 16.15 ? 217  TYR A N   1 
ATOM   834  C  CA  . TYR A 1 110 ? 23.567 -28.353 -15.419 1.00 19.10 ? 217  TYR A CA  1 
ATOM   835  C  C   . TYR A 1 110 ? 23.205 -26.875 -15.532 1.00 20.06 ? 217  TYR A C   1 
ATOM   836  O  O   . TYR A 1 110 ? 23.445 -26.258 -16.572 1.00 19.57 ? 217  TYR A O   1 
ATOM   837  C  CB  . TYR A 1 110 ? 22.914 -29.152 -16.554 1.00 17.72 ? 217  TYR A CB  1 
ATOM   838  C  CG  . TYR A 1 110 ? 21.424 -29.415 -16.475 1.00 15.75 ? 217  TYR A CG  1 
ATOM   839  C  CD1 . TYR A 1 110 ? 20.495 -28.393 -16.671 1.00 23.65 ? 217  TYR A CD1 1 
ATOM   840  C  CD2 . TYR A 1 110 ? 20.946 -30.708 -16.300 1.00 17.21 ? 217  TYR A CD2 1 
ATOM   841  C  CE1 . TYR A 1 110 ? 19.131 -28.654 -16.647 1.00 20.49 ? 217  TYR A CE1 1 
ATOM   842  C  CE2 . TYR A 1 110 ? 19.583 -30.981 -16.273 1.00 20.30 ? 217  TYR A CE2 1 
ATOM   843  C  CZ  . TYR A 1 110 ? 18.683 -29.950 -16.447 1.00 25.01 ? 217  TYR A CZ  1 
ATOM   844  O  OH  . TYR A 1 110 ? 17.333 -30.228 -16.423 1.00 27.21 ? 217  TYR A OH  1 
ATOM   845  N  N   . ASN A 1 111 ? 22.651 -26.302 -14.469 1.00 18.36 ? 218  ASN A N   1 
ATOM   846  C  CA  . ASN A 1 111 ? 22.445 -24.859 -14.406 1.00 20.36 ? 218  ASN A CA  1 
ATOM   847  C  C   . ASN A 1 111 ? 23.268 -24.195 -13.306 1.00 19.62 ? 218  ASN A C   1 
ATOM   848  O  O   . ASN A 1 111 ? 23.083 -23.017 -13.014 1.00 20.11 ? 218  ASN A O   1 
ATOM   849  C  CB  . ASN A 1 111 ? 20.961 -24.526 -14.199 1.00 20.89 ? 218  ASN A CB  1 
ATOM   850  C  CG  . ASN A 1 111 ? 20.140 -24.745 -15.453 1.00 21.25 ? 218  ASN A CG  1 
ATOM   851  O  OD1 . ASN A 1 111 ? 19.059 -25.325 -15.408 1.00 30.27 ? 218  ASN A OD1 1 
ATOM   852  N  ND2 . ASN A 1 111 ? 20.665 -24.298 -16.583 1.00 21.48 ? 218  ASN A ND2 1 
ATOM   853  N  N   . ALA A 1 112 ? 24.171 -24.948 -12.691 1.00 16.46 ? 219  ALA A N   1 
ATOM   854  C  CA  . ALA A 1 112 ? 25.075 -24.357 -11.701 1.00 17.72 ? 219  ALA A CA  1 
ATOM   855  C  C   . ALA A 1 112 ? 26.162 -23.565 -12.402 1.00 20.60 ? 219  ALA A C   1 
ATOM   856  O  O   . ALA A 1 112 ? 26.339 -23.681 -13.610 1.00 21.67 ? 219  ALA A O   1 
ATOM   857  C  CB  . ALA A 1 112 ? 25.694 -25.431 -10.821 1.00 19.59 ? 219  ALA A CB  1 
ATOM   858  N  N   A ARG A 1 113 ? 26.883 -22.743 -11.652 0.50 17.34 ? 220  ARG A N   1 
ATOM   859  N  N   B ARG A 1 113 ? 26.881 -22.754 -11.635 0.50 17.35 ? 220  ARG A N   1 
ATOM   860  C  CA  A ARG A 1 113 ? 28.045 -22.078 -12.211 0.50 21.70 ? 220  ARG A CA  1 
ATOM   861  C  CA  B ARG A 1 113 ? 28.050 -22.063 -12.147 0.50 21.69 ? 220  ARG A CA  1 
ATOM   862  C  C   A ARG A 1 113 ? 29.290 -22.854 -11.825 0.50 18.69 ? 220  ARG A C   1 
ATOM   863  C  C   B ARG A 1 113 ? 29.288 -22.883 -11.822 0.50 18.68 ? 220  ARG A C   1 
ATOM   864  O  O   A ARG A 1 113 ? 29.390 -23.381 -10.715 0.50 18.39 ? 220  ARG A O   1 
ATOM   865  O  O   B ARG A 1 113 ? 29.383 -23.471 -10.743 0.50 18.38 ? 220  ARG A O   1 
ATOM   866  C  CB  A ARG A 1 113 ? 28.124 -20.630 -11.746 0.50 22.90 ? 220  ARG A CB  1 
ATOM   867  C  CB  B ARG A 1 113 ? 28.151 -20.661 -11.557 0.50 22.60 ? 220  ARG A CB  1 
ATOM   868  C  CG  A ARG A 1 113 ? 27.009 -19.780 -12.328 0.50 26.43 ? 220  ARG A CG  1 
ATOM   869  C  CG  B ARG A 1 113 ? 26.891 -19.843 -11.776 0.50 28.04 ? 220  ARG A CG  1 
ATOM   870  C  CD  A ARG A 1 113 ? 26.507 -18.797 -11.297 0.50 32.09 ? 220  ARG A CD  1 
ATOM   871  C  CD  B ARG A 1 113 ? 27.216 -18.380 -11.970 0.50 29.80 ? 220  ARG A CD  1 
ATOM   872  N  NE  A ARG A 1 113 ? 27.374 -17.632 -11.211 0.50 28.26 ? 220  ARG A NE  1 
ATOM   873  N  NE  B ARG A 1 113 ? 27.888 -18.135 -13.240 0.50 30.56 ? 220  ARG A NE  1 
ATOM   874  C  CZ  A ARG A 1 113 ? 27.311 -16.729 -10.242 0.50 29.14 ? 220  ARG A CZ  1 
ATOM   875  C  CZ  B ARG A 1 113 ? 28.444 -16.974 -13.564 0.50 28.99 ? 220  ARG A CZ  1 
ATOM   876  N  NH1 A ARG A 1 113 ? 28.137 -15.697 -10.254 0.50 30.62 ? 220  ARG A NH1 1 
ATOM   877  N  NH1 B ARG A 1 113 ? 29.039 -16.822 -14.737 0.50 29.70 ? 220  ARG A NH1 1 
ATOM   878  N  NH2 A ARG A 1 113 ? 26.428 -16.863 -9.260  0.50 31.59 ? 220  ARG A NH2 1 
ATOM   879  N  NH2 B ARG A 1 113 ? 28.406 -15.965 -12.703 0.50 32.80 ? 220  ARG A NH2 1 
ATOM   880  N  N   . ILE A 1 114 ? 30.227 -22.928 -12.759 1.00 16.49 ? 221  ILE A N   1 
ATOM   881  C  CA  . ILE A 1 114 ? 31.383 -23.801 -12.624 1.00 14.79 ? 221  ILE A CA  1 
ATOM   882  C  C   . ILE A 1 114 ? 32.668 -23.035 -12.884 1.00 20.61 ? 221  ILE A C   1 
ATOM   883  O  O   . ILE A 1 114 ? 32.775 -22.250 -13.840 1.00 16.96 ? 221  ILE A O   1 
ATOM   884  C  CB  . ILE A 1 114 ? 31.264 -25.033 -13.589 1.00 16.06 ? 221  ILE A CB  1 
ATOM   885  C  CG1 . ILE A 1 114 ? 32.358 -26.066 -13.306 1.00 12.44 ? 221  ILE A CG1 1 
ATOM   886  C  CG2 . ILE A 1 114 ? 31.243 -24.608 -15.072 1.00 17.76 ? 221  ILE A CG2 1 
ATOM   887  C  CD1 . ILE A 1 114 ? 32.190 -26.753 -11.933 1.00 14.41 ? 221  ILE A CD1 1 
ATOM   888  N  N   . GLY A 1 115 ? 33.639 -23.241 -12.003 1.00 17.29 ? 222  GLY A N   1 
ATOM   889  C  CA  . GLY A 1 115 ? 34.957 -22.667 -12.178 1.00 14.45 ? 222  GLY A CA  1 
ATOM   890  C  C   . GLY A 1 115 ? 36.026 -23.716 -11.945 1.00 14.94 ? 222  GLY A C   1 
ATOM   891  O  O   . GLY A 1 115 ? 35.726 -24.863 -11.606 1.00 14.81 ? 222  GLY A O   1 
ATOM   892  N  N   . GLY A 1 116 ? 37.279 -23.328 -12.136 1.00 14.60 ? 223  GLY A N   1 
ATOM   893  C  CA  . GLY A 1 116 ? 38.380 -24.225 -11.857 1.00 16.58 ? 223  GLY A CA  1 
ATOM   894  C  C   . GLY A 1 116 ? 39.595 -23.488 -11.344 1.00 18.13 ? 223  GLY A C   1 
ATOM   895  O  O   . GLY A 1 116 ? 39.845 -22.344 -11.717 1.00 17.72 ? 223  GLY A O   1 
ATOM   896  N  N   . VAL A 1 117 ? 40.350 -24.141 -10.471 1.00 14.16 ? 224  VAL A N   1 
ATOM   897  C  CA  . VAL A 1 117 ? 41.619 -23.597 -10.043 1.00 14.71 ? 224  VAL A CA  1 
ATOM   898  C  C   . VAL A 1 117 ? 42.725 -24.412 -10.687 1.00 17.29 ? 224  VAL A C   1 
ATOM   899  O  O   . VAL A 1 117 ? 42.780 -25.627 -10.532 1.00 15.60 ? 224  VAL A O   1 
ATOM   900  C  CB  . VAL A 1 117 ? 41.772 -23.605 -8.513  1.00 18.04 ? 224  VAL A CB  1 
ATOM   901  C  CG1 . VAL A 1 117 ? 43.127 -23.045 -8.120  1.00 15.04 ? 224  VAL A CG1 1 
ATOM   902  C  CG2 . VAL A 1 117 ? 40.653 -22.788 -7.879  1.00 15.52 ? 224  VAL A CG2 1 
ATOM   903  N  N   . ARG A 1 118 ? 43.576 -23.745 -11.458 1.00 14.16 ? 225  ARG A N   1 
ATOM   904  C  CA  . ARG A 1 118 ? 44.753 -24.392 -12.006 1.00 13.82 ? 225  ARG A CA  1 
ATOM   905  C  C   . ARG A 1 118 ? 45.815 -24.401 -10.924 1.00 13.68 ? 225  ARG A C   1 
ATOM   906  O  O   . ARG A 1 118 ? 46.429 -23.375 -10.640 1.00 15.84 ? 225  ARG A O   1 
ATOM   907  C  CB  . ARG A 1 118 ? 45.237 -23.663 -13.274 1.00 13.35 ? 225  ARG A CB  1 
ATOM   908  C  CG  . ARG A 1 118 ? 46.459 -24.284 -13.944 1.00 14.11 ? 225  ARG A CG  1 
ATOM   909  C  CD  . ARG A 1 118 ? 46.727 -23.657 -15.339 1.00 14.19 ? 225  ARG A CD  1 
ATOM   910  N  NE  . ARG A 1 118 ? 47.942 -24.234 -15.911 1.00 16.91 ? 225  ARG A NE  1 
ATOM   911  C  CZ  . ARG A 1 118 ? 49.146 -23.672 -15.855 1.00 20.59 ? 225  ARG A CZ  1 
ATOM   912  N  NH1 . ARG A 1 118 ? 50.192 -24.296 -16.376 1.00 18.26 ? 225  ARG A NH1 1 
ATOM   913  N  NH2 . ARG A 1 118 ? 49.307 -22.480 -15.294 1.00 22.94 ? 225  ARG A NH2 1 
ATOM   914  N  N   . MET A 1 119 ? 46.016 -25.555 -10.290 1.00 13.83 ? 226  MET A N   1 
ATOM   915  C  CA  . MET A 1 119 ? 46.970 -25.621 -9.196  1.00 13.28 ? 226  MET A CA  1 
ATOM   916  C  C   . MET A 1 119 ? 47.821 -26.894 -9.167  1.00 14.00 ? 226  MET A C   1 
ATOM   917  O  O   . MET A 1 119 ? 48.775 -26.971 -8.401  1.00 16.64 ? 226  MET A O   1 
ATOM   918  C  CB  . MET A 1 119 ? 46.234 -25.448 -7.852  1.00 16.43 ? 226  MET A CB  1 
ATOM   919  C  CG  . MET A 1 119 ? 44.915 -26.182 -7.731  1.00 16.81 ? 226  MET A CG  1 
ATOM   920  S  SD  . MET A 1 119 ? 45.122 -27.902 -7.225  1.00 20.15 ? 226  MET A SD  1 
ATOM   921  C  CE  . MET A 1 119 ? 45.985 -27.697 -5.652  1.00 17.65 ? 226  MET A CE  1 
ATOM   922  N  N   . LEU A 1 120 ? 47.519 -27.869 -10.015 1.00 13.89 ? 227  LEU A N   1 
ATOM   923  C  CA  . LEU A 1 120 ? 48.318 -29.098 -10.027 1.00 12.92 ? 227  LEU A CA  1 
ATOM   924  C  C   . LEU A 1 120 ? 49.445 -29.073 -11.066 1.00 20.02 ? 227  LEU A C   1 
ATOM   925  O  O   . LEU A 1 120 ? 50.326 -29.940 -11.059 1.00 16.38 ? 227  LEU A O   1 
ATOM   926  C  CB  . LEU A 1 120 ? 47.425 -30.308 -10.296 1.00 14.74 ? 227  LEU A CB  1 
ATOM   927  C  CG  . LEU A 1 120 ? 46.430 -30.694 -9.194  1.00 15.23 ? 227  LEU A CG  1 
ATOM   928  C  CD1 . LEU A 1 120 ? 45.632 -31.913 -9.636  1.00 18.79 ? 227  LEU A CD1 1 
ATOM   929  C  CD2 . LEU A 1 120 ? 47.146 -30.946 -7.872  1.00 14.74 ? 227  LEU A CD2 1 
ATOM   930  N  N   . ASP A 1 121 ? 49.406 -28.097 -11.967 1.00 15.43 ? 228  ASP A N   1 
ATOM   931  C  CA  . ASP A 1 121 ? 50.368 -28.058 -13.069 1.00 17.53 ? 228  ASP A CA  1 
ATOM   932  C  C   . ASP A 1 121 ? 51.604 -27.256 -12.674 1.00 20.97 ? 228  ASP A C   1 
ATOM   933  O  O   . ASP A 1 121 ? 51.848 -26.171 -13.182 1.00 20.13 ? 228  ASP A O   1 
ATOM   934  C  CB  . ASP A 1 121 ? 49.715 -27.481 -14.321 1.00 15.11 ? 228  ASP A CB  1 
ATOM   935  C  CG  . ASP A 1 121 ? 50.547 -27.713 -15.580 1.00 20.37 ? 228  ASP A CG  1 
ATOM   936  O  OD1 . ASP A 1 121 ? 51.555 -28.451 -15.521 1.00 19.53 ? 228  ASP A OD1 1 
ATOM   937  O  OD2 . ASP A 1 121 ? 50.179 -27.162 -16.628 1.00 18.60 ? 228  ASP A OD2 1 
ATOM   938  N  N   . GLY A 1 122 ? 52.379 -27.814 -11.753 1.00 18.00 ? 229  GLY A N   1 
ATOM   939  C  CA  . GLY A 1 122 ? 53.522 -27.127 -11.186 1.00 23.61 ? 229  GLY A CA  1 
ATOM   940  C  C   . GLY A 1 122 ? 53.828 -27.751 -9.845  1.00 24.79 ? 229  GLY A C   1 
ATOM   941  O  O   . GLY A 1 122 ? 53.275 -28.800 -9.511  1.00 21.58 ? 229  GLY A O   1 
ATOM   942  N  N   . GLU A 1 123 ? 54.696 -27.112 -9.069  1.00 22.02 ? 230  GLU A N   1 
ATOM   943  C  CA  . GLU A 1 123 ? 55.043 -27.630 -7.757  1.00 24.33 ? 230  GLU A CA  1 
ATOM   944  C  C   . GLU A 1 123 ? 53.917 -27.350 -6.762  1.00 20.45 ? 230  GLU A C   1 
ATOM   945  O  O   . GLU A 1 123 ? 53.580 -26.192 -6.500  1.00 22.38 ? 230  GLU A O   1 
ATOM   946  C  CB  . GLU A 1 123 ? 56.354 -27.018 -7.268  1.00 28.89 ? 230  GLU A CB  1 
ATOM   947  C  CG  . GLU A 1 123 ? 56.823 -27.578 -5.941  1.00 38.98 ? 230  GLU A CG  1 
ATOM   948  C  CD  . GLU A 1 123 ? 58.104 -26.925 -5.451  1.00 51.46 ? 230  GLU A CD  1 
ATOM   949  O  OE1 . GLU A 1 123 ? 58.754 -26.213 -6.248  1.00 63.22 ? 230  GLU A OE1 1 
ATOM   950  O  OE2 . GLU A 1 123 ? 58.457 -27.122 -4.268  1.00 59.00 ? 230  GLU A OE2 1 
ATOM   951  N  N   . VAL A 1 124 ? 53.339 -28.414 -6.219  1.00 18.14 ? 231  VAL A N   1 
ATOM   952  C  CA  . VAL A 1 124 ? 52.200 -28.284 -5.325  1.00 18.98 ? 231  VAL A CA  1 
ATOM   953  C  C   . VAL A 1 124 ? 52.671 -28.264 -3.881  1.00 19.86 ? 231  VAL A C   1 
ATOM   954  O  O   . VAL A 1 124 ? 52.819 -29.306 -3.230  1.00 17.65 ? 231  VAL A O   1 
ATOM   955  C  CB  . VAL A 1 124 ? 51.180 -29.417 -5.519  1.00 18.95 ? 231  VAL A CB  1 
ATOM   956  C  CG1 . VAL A 1 124 ? 49.947 -29.160 -4.665  1.00 16.11 ? 231  VAL A CG1 1 
ATOM   957  C  CG2 . VAL A 1 124 ? 50.788 -29.527 -6.989  1.00 17.57 ? 231  VAL A CG2 1 
ATOM   958  N  N   . THR A 1 125 ? 52.898 -27.053 -3.393  1.00 15.03 ? 232  THR A N   1 
ATOM   959  C  CA  . THR A 1 125 ? 53.326 -26.823 -2.023  1.00 15.07 ? 232  THR A CA  1 
ATOM   960  C  C   . THR A 1 125 ? 52.130 -26.671 -1.095  1.00 13.46 ? 232  THR A C   1 
ATOM   961  O  O   . THR A 1 125 ? 50.995 -26.517 -1.550  1.00 14.63 ? 232  THR A O   1 
ATOM   962  C  CB  . THR A 1 125 ? 54.153 -25.543 -1.925  1.00 16.75 ? 232  THR A CB  1 
ATOM   963  O  OG1 . THR A 1 125 ? 53.327 -24.449 -2.352  1.00 16.12 ? 232  THR A OG1 1 
ATOM   964  C  CG2 . THR A 1 125 ? 55.406 -25.624 -2.821  1.00 18.18 ? 232  THR A CG2 1 
ATOM   965  N  N   . ASP A 1 126 ? 52.404 -26.660 0.203   1.00 13.54 ? 233  ASP A N   1 
ATOM   966  C  CA  . ASP A 1 126 ? 51.406 -26.329 1.221   1.00 16.20 ? 233  ASP A CA  1 
ATOM   967  C  C   . ASP A 1 126 ? 50.716 -24.987 0.904   1.00 13.91 ? 233  ASP A C   1 
ATOM   968  O  O   . ASP A 1 126 ? 49.486 -24.873 0.974   1.00 14.94 ? 233  ASP A O   1 
ATOM   969  C  CB  . ASP A 1 126 ? 52.092 -26.307 2.591   1.00 12.22 ? 233  ASP A CB  1 
ATOM   970  C  CG  . ASP A 1 126 ? 51.142 -26.011 3.755   1.00 14.66 ? 233  ASP A CG  1 
ATOM   971  O  OD1 . ASP A 1 126 ? 49.984 -26.492 3.767   1.00 14.77 ? 233  ASP A OD1 1 
ATOM   972  O  OD2 . ASP A 1 126 ? 51.591 -25.312 4.696   1.00 15.40 ? 233  ASP A OD2 1 
ATOM   973  N  N   . ALA A 1 127 ? 51.499 -23.980 0.529   1.00 13.39 ? 234  ALA A N   1 
ATOM   974  C  CA  . ALA A 1 127 ? 50.943 -22.666 0.197   1.00 12.84 ? 234  ALA A CA  1 
ATOM   975  C  C   . ALA A 1 127 ? 50.017 -22.719 -1.026  1.00 13.55 ? 234  ALA A C   1 
ATOM   976  O  O   . ALA A 1 127 ? 48.970 -22.079 -1.041  1.00 12.50 ? 234  ALA A O   1 
ATOM   977  C  CB  . ALA A 1 127 ? 52.061 -21.660 -0.037  1.00 14.45 ? 234  ALA A CB  1 
ATOM   978  N  N   . VAL A 1 128 ? 50.403 -23.480 -2.044  1.00 12.37 ? 235  VAL A N   1 
ATOM   979  C  CA  . VAL A 1 128 ? 49.573 -23.634 -3.239  1.00 11.94 ? 235  VAL A CA  1 
ATOM   980  C  C   . VAL A 1 128 ? 48.236 -24.274 -2.860  1.00 10.32 ? 235  VAL A C   1 
ATOM   981  O  O   . VAL A 1 128 ? 47.168 -23.814 -3.275  1.00 14.31 ? 235  VAL A O   1 
ATOM   982  C  CB  . VAL A 1 128 ? 50.302 -24.480 -4.318  1.00 12.01 ? 235  VAL A CB  1 
ATOM   983  C  CG1 . VAL A 1 128 ? 49.334 -25.003 -5.366  1.00 15.32 ? 235  VAL A CG1 1 
ATOM   984  C  CG2 . VAL A 1 128 ? 51.414 -23.651 -4.971  1.00 17.43 ? 235  VAL A CG2 1 
ATOM   985  N  N   . GLU A 1 129 ? 48.298 -25.325 -2.053  1.00 12.10 ? 236  GLU A N   1 
ATOM   986  C  CA  . GLU A 1 129 ? 47.076 -25.988 -1.610  1.00 11.92 ? 236  GLU A CA  1 
ATOM   987  C  C   . GLU A 1 129 ? 46.184 -25.026 -0.841  1.00 12.91 ? 236  GLU A C   1 
ATOM   988  O  O   . GLU A 1 129 ? 44.971 -24.981 -1.064  1.00 12.54 ? 236  GLU A O   1 
ATOM   989  C  CB  . GLU A 1 129 ? 47.404 -27.208 -0.746  1.00 12.93 ? 236  GLU A CB  1 
ATOM   990  C  CG  . GLU A 1 129 ? 48.162 -28.276 -1.522  1.00 12.91 ? 236  GLU A CG  1 
ATOM   991  C  CD  . GLU A 1 129 ? 48.505 -29.493 -0.685  1.00 15.58 ? 236  GLU A CD  1 
ATOM   992  O  OE1 . GLU A 1 129 ? 48.153 -29.514 0.511   1.00 14.07 ? 236  GLU A OE1 1 
ATOM   993  O  OE2 . GLU A 1 129 ? 49.118 -30.437 -1.237  1.00 17.08 ? 236  GLU A OE2 1 
ATOM   994  N  N   . ALA A 1 130 ? 46.792 -24.249 0.055   1.00 10.60 ? 237  ALA A N   1 
ATOM   995  C  CA  . ALA A 1 130 ? 46.031 -23.362 0.930   1.00 12.34 ? 237  ALA A CA  1 
ATOM   996  C  C   . ALA A 1 130 ? 45.341 -22.258 0.144   1.00 12.25 ? 237  ALA A C   1 
ATOM   997  O  O   . ALA A 1 130 ? 44.203 -21.895 0.434   1.00 11.62 ? 237  ALA A O   1 
ATOM   998  C  CB  . ALA A 1 130 ? 46.935 -22.758 1.998   1.00 12.46 ? 237  ALA A CB  1 
ATOM   999  N  N   . ARG A 1 131 ? 46.027 -21.715 -0.857  1.00 14.18 ? 238  ARG A N   1 
ATOM   1000 C  CA  . ARG A 1 131 ? 45.435 -20.631 -1.631  1.00 13.94 ? 238  ARG A CA  1 
ATOM   1001 C  C   . ARG A 1 131 ? 44.323 -21.149 -2.542  1.00 16.29 ? 238  ARG A C   1 
ATOM   1002 O  O   . ARG A 1 131 ? 43.422 -20.399 -2.915  1.00 16.11 ? 238  ARG A O   1 
ATOM   1003 C  CB  . ARG A 1 131 ? 46.516 -19.899 -2.434  1.00 14.45 ? 238  ARG A CB  1 
ATOM   1004 C  CG  . ARG A 1 131 ? 47.525 -19.202 -1.522  1.00 16.87 ? 238  ARG A CG  1 
ATOM   1005 C  CD  . ARG A 1 131 ? 48.023 -17.893 -2.090  1.00 28.10 ? 238  ARG A CD  1 
ATOM   1006 N  NE  . ARG A 1 131 ? 48.623 -18.084 -3.392  1.00 33.42 ? 238  ARG A NE  1 
ATOM   1007 C  CZ  . ARG A 1 131 ? 49.850 -18.553 -3.564  1.00 49.14 ? 238  ARG A CZ  1 
ATOM   1008 N  NH1 . ARG A 1 131 ? 50.338 -18.709 -4.789  1.00 48.76 ? 238  ARG A NH1 1 
ATOM   1009 N  NH2 . ARG A 1 131 ? 50.594 -18.867 -2.505  1.00 43.15 ? 238  ARG A NH2 1 
ATOM   1010 N  N   . SER A 1 132 ? 44.373 -22.438 -2.880  1.00 13.33 ? 239  SER A N   1 
ATOM   1011 C  CA  . SER A 1 132 ? 43.331 -23.043 -3.704  1.00 11.05 ? 239  SER A CA  1 
ATOM   1012 C  C   . SER A 1 132 ? 42.072 -23.355 -2.875  1.00 14.11 ? 239  SER A C   1 
ATOM   1013 O  O   . SER A 1 132 ? 40.949 -23.036 -3.273  1.00 13.52 ? 239  SER A O   1 
ATOM   1014 C  CB  . SER A 1 132 ? 43.859 -24.318 -4.379  1.00 13.21 ? 239  SER A CB  1 
ATOM   1015 O  OG  . SER A 1 132 ? 45.049 -24.039 -5.116  1.00 15.33 ? 239  SER A OG  1 
ATOM   1016 N  N   . LEU A 1 133 ? 42.272 -23.998 -1.731  1.00 10.98 ? 240  LEU A N   1 
ATOM   1017 C  CA  . LEU A 1 133 ? 41.186 -24.299 -0.805  1.00 12.14 ? 240  LEU A CA  1 
ATOM   1018 C  C   . LEU A 1 133 ? 40.508 -23.018 -0.317  1.00 15.49 ? 240  LEU A C   1 
ATOM   1019 O  O   . LEU A 1 133 ? 39.294 -22.989 -0.083  1.00 15.26 ? 240  LEU A O   1 
ATOM   1020 C  CB  . LEU A 1 133 ? 41.724 -25.102 0.390   1.00 10.98 ? 240  LEU A CB  1 
ATOM   1021 C  CG  . LEU A 1 133 ? 42.269 -26.506 0.079   1.00 12.60 ? 240  LEU A CG  1 
ATOM   1022 C  CD1 . LEU A 1 133 ? 43.023 -27.089 1.269   1.00 14.73 ? 240  LEU A CD1 1 
ATOM   1023 C  CD2 . LEU A 1 133 ? 41.136 -27.436 -0.322  1.00 13.39 ? 240  LEU A CD2 1 
ATOM   1024 N  N   . GLY A 1 134 ? 41.308 -21.967 -0.171  1.00 15.30 ? 241  GLY A N   1 
ATOM   1025 C  CA  . GLY A 1 134 ? 40.838 -20.703 0.367   1.00 14.88 ? 241  GLY A CA  1 
ATOM   1026 C  C   . GLY A 1 134 ? 40.407 -19.694 -0.687  1.00 17.95 ? 241  GLY A C   1 
ATOM   1027 O  O   . GLY A 1 134 ? 40.239 -18.514 -0.376  1.00 17.06 ? 241  GLY A O   1 
ATOM   1028 N  N   . LEU A 1 135 ? 40.218 -20.141 -1.929  1.00 16.32 ? 242  LEU A N   1 
ATOM   1029 C  CA  . LEU A 1 135 ? 39.835 -19.220 -2.999  1.00 16.38 ? 242  LEU A CA  1 
ATOM   1030 C  C   . LEU A 1 135 ? 38.389 -18.732 -2.859  1.00 17.05 ? 242  LEU A C   1 
ATOM   1031 O  O   . LEU A 1 135 ? 37.465 -19.539 -2.775  1.00 16.20 ? 242  LEU A O   1 
ATOM   1032 C  CB  . LEU A 1 135 ? 40.012 -19.871 -4.372  1.00 15.39 ? 242  LEU A CB  1 
ATOM   1033 C  CG  . LEU A 1 135 ? 39.564 -18.951 -5.514  1.00 20.28 ? 242  LEU A CG  1 
ATOM   1034 C  CD1 . LEU A 1 135 ? 40.554 -17.800 -5.690  1.00 19.58 ? 242  LEU A CD1 1 
ATOM   1035 C  CD2 . LEU A 1 135 ? 39.377 -19.721 -6.812  1.00 15.22 ? 242  LEU A CD2 1 
ATOM   1036 N  N   . ASN A 1 136 ? 38.218 -17.408 -2.844  1.00 15.94 ? 243  ASN A N   1 
ATOM   1037 C  CA  . ASN A 1 136 ? 36.901 -16.757 -2.888  1.00 16.40 ? 243  ASN A CA  1 
ATOM   1038 C  C   . ASN A 1 136 ? 35.796 -17.480 -2.113  1.00 15.78 ? 243  ASN A C   1 
ATOM   1039 O  O   . ASN A 1 136 ? 34.770 -17.836 -2.697  1.00 16.86 ? 243  ASN A O   1 
ATOM   1040 C  CB  . ASN A 1 136 ? 36.452 -16.600 -4.346  1.00 14.80 ? 243  ASN A CB  1 
ATOM   1041 C  CG  . ASN A 1 136 ? 37.505 -15.925 -5.217  1.00 25.22 ? 243  ASN A CG  1 
ATOM   1042 O  OD1 . ASN A 1 136 ? 38.424 -15.284 -4.711  1.00 25.37 ? 243  ASN A OD1 1 
ATOM   1043 N  ND2 . ASN A 1 136 ? 37.365 -16.061 -6.537  1.00 26.65 ? 243  ASN A ND2 1 
ATOM   1044 N  N   . PRO A 1 137 ? 36.005 -17.708 -0.802  1.00 17.83 ? 244  PRO A N   1 
ATOM   1045 C  CA  . PRO A 1 137 ? 35.144 -18.622 -0.042  1.00 16.33 ? 244  PRO A CA  1 
ATOM   1046 C  C   . PRO A 1 137 ? 33.783 -18.043 0.300   1.00 18.62 ? 244  PRO A C   1 
ATOM   1047 O  O   . PRO A 1 137 ? 32.957 -18.754 0.877   1.00 16.93 ? 244  PRO A O   1 
ATOM   1048 C  CB  . PRO A 1 137 ? 35.950 -18.880 1.235   1.00 18.28 ? 244  PRO A CB  1 
ATOM   1049 C  CG  . PRO A 1 137 ? 36.736 -17.621 1.422   1.00 22.68 ? 244  PRO A CG  1 
ATOM   1050 C  CD  . PRO A 1 137 ? 37.084 -17.146 0.032   1.00 16.44 ? 244  PRO A CD  1 
ATOM   1051 N  N   . ASN A 1 138 ? 33.554 -16.775 -0.026  1.00 18.30 ? 245  ASN A N   1 
ATOM   1052 C  CA  . ASN A 1 138 ? 32.215 -16.219 0.097   1.00 19.48 ? 245  ASN A CA  1 
ATOM   1053 C  C   . ASN A 1 138 ? 31.509 -16.152 -1.249  1.00 23.39 ? 245  ASN A C   1 
ATOM   1054 O  O   . ASN A 1 138 ? 30.427 -15.583 -1.366  1.00 24.07 ? 245  ASN A O   1 
ATOM   1055 C  CB  . ASN A 1 138 ? 32.272 -14.840 0.744   1.00 21.31 ? 245  ASN A CB  1 
ATOM   1056 C  CG  . ASN A 1 138 ? 32.688 -14.918 2.193   1.00 33.11 ? 245  ASN A CG  1 
ATOM   1057 O  OD1 . ASN A 1 138 ? 32.150 -15.725 2.963   1.00 39.50 ? 245  ASN A OD1 1 
ATOM   1058 N  ND2 . ASN A 1 138 ? 33.666 -14.109 2.570   1.00 40.76 ? 245  ASN A ND2 1 
ATOM   1059 N  N   . HIS A 1 139 ? 32.128 -16.738 -2.267  1.00 16.21 ? 246  HIS A N   1 
ATOM   1060 C  CA  . HIS A 1 139 ? 31.491 -16.826 -3.573  1.00 15.85 ? 246  HIS A CA  1 
ATOM   1061 C  C   . HIS A 1 139 ? 31.310 -18.283 -3.986  1.00 19.31 ? 246  HIS A C   1 
ATOM   1062 O  O   . HIS A 1 139 ? 30.239 -18.684 -4.432  1.00 20.31 ? 246  HIS A O   1 
ATOM   1063 C  CB  . HIS A 1 139 ? 32.300 -16.085 -4.637  1.00 17.80 ? 246  HIS A CB  1 
ATOM   1064 C  CG  . HIS A 1 139 ? 31.680 -16.149 -5.996  1.00 19.92 ? 246  HIS A CG  1 
ATOM   1065 N  ND1 . HIS A 1 139 ? 30.514 -15.484 -6.307  1.00 21.25 ? 246  HIS A ND1 1 
ATOM   1066 C  CD2 . HIS A 1 139 ? 32.040 -16.827 -7.111  1.00 26.00 ? 246  HIS A CD2 1 
ATOM   1067 C  CE1 . HIS A 1 139 ? 30.189 -15.739 -7.565  1.00 30.20 ? 246  HIS A CE1 1 
ATOM   1068 N  NE2 . HIS A 1 139 ? 31.102 -16.548 -8.076  1.00 24.54 ? 246  HIS A NE2 1 
ATOM   1069 N  N   . ILE A 1 140 ? 32.373 -19.068 -3.845  1.00 18.72 ? 247  ILE A N   1 
ATOM   1070 C  CA  . ILE A 1 140 ? 32.324 -20.494 -4.164  1.00 15.68 ? 247  ILE A CA  1 
ATOM   1071 C  C   . ILE A 1 140 ? 31.604 -21.243 -3.040  1.00 15.86 ? 247  ILE A C   1 
ATOM   1072 O  O   . ILE A 1 140 ? 31.887 -21.001 -1.882  1.00 16.02 ? 247  ILE A O   1 
ATOM   1073 C  CB  . ILE A 1 140 ? 33.750 -21.064 -4.347  1.00 15.11 ? 247  ILE A CB  1 
ATOM   1074 C  CG1 . ILE A 1 140 ? 34.442 -20.369 -5.527  1.00 19.03 ? 247  ILE A CG1 1 
ATOM   1075 C  CG2 . ILE A 1 140 ? 33.707 -22.586 -4.537  1.00 14.34 ? 247  ILE A CG2 1 
ATOM   1076 C  CD1 . ILE A 1 140 ? 35.939 -20.633 -5.617  1.00 14.32 ? 247  ILE A CD1 1 
ATOM   1077 N  N   . HIS A 1 141 ? 30.673 -22.131 -3.379  1.00 13.44 ? 248  HIS A N   1 
ATOM   1078 C  CA  . HIS A 1 141 ? 29.945 -22.889 -2.370  1.00 12.69 ? 248  HIS A CA  1 
ATOM   1079 C  C   . HIS A 1 141 ? 30.594 -24.238 -2.102  1.00 13.72 ? 248  HIS A C   1 
ATOM   1080 O  O   . HIS A 1 141 ? 30.713 -24.671 -0.962  1.00 13.83 ? 248  HIS A O   1 
ATOM   1081 C  CB  . HIS A 1 141 ? 28.497 -23.124 -2.799  1.00 15.74 ? 248  HIS A CB  1 
ATOM   1082 C  CG  . HIS A 1 141 ? 27.707 -21.866 -2.975  1.00 16.61 ? 248  HIS A CG  1 
ATOM   1083 N  ND1 . HIS A 1 141 ? 27.197 -21.480 -4.195  1.00 18.06 ? 248  HIS A ND1 1 
ATOM   1084 C  CD2 . HIS A 1 141 ? 27.338 -20.909 -2.092  1.00 32.64 ? 248  HIS A CD2 1 
ATOM   1085 C  CE1 . HIS A 1 141 ? 26.549 -20.335 -4.057  1.00 22.25 ? 248  HIS A CE1 1 
ATOM   1086 N  NE2 . HIS A 1 141 ? 26.619 -19.968 -2.791  1.00 28.22 ? 248  HIS A NE2 1 
ATOM   1087 N  N   . ILE A 1 142 ? 30.989 -24.893 -3.180  1.00 12.67 ? 249  ILE A N   1 
ATOM   1088 C  CA  . ILE A 1 142 ? 31.437 -26.277 -3.158  1.00 10.09 ? 249  ILE A CA  1 
ATOM   1089 C  C   . ILE A 1 142 ? 32.751 -26.417 -3.896  1.00 13.77 ? 249  ILE A C   1 
ATOM   1090 O  O   . ILE A 1 142 ? 32.877 -25.913 -5.016  1.00 14.34 ? 249  ILE A O   1 
ATOM   1091 C  CB  . ILE A 1 142 ? 30.401 -27.183 -3.817  1.00 10.85 ? 249  ILE A CB  1 
ATOM   1092 C  CG1 . ILE A 1 142 ? 29.071 -27.108 -3.055  1.00 12.56 ? 249  ILE A CG1 1 
ATOM   1093 C  CG2 . ILE A 1 142 ? 30.920 -28.628 -3.939  1.00 12.70 ? 249  ILE A CG2 1 
ATOM   1094 C  CD1 . ILE A 1 142 ? 27.866 -27.489 -3.934  1.00 15.72 ? 249  ILE A CD1 1 
ATOM   1095 N  N   . TYR A 1 143 ? 33.712 -27.098 -3.275  1.00 11.87 ? 250  TYR A N   1 
ATOM   1096 C  CA  . TYR A 1 143 ? 35.012 -27.368 -3.890  1.00 11.32 ? 250  TYR A CA  1 
ATOM   1097 C  C   . TYR A 1 143 ? 35.116 -28.853 -4.160  1.00 14.40 ? 250  TYR A C   1 
ATOM   1098 O  O   . TYR A 1 143 ? 34.659 -29.665 -3.354  1.00 14.82 ? 250  TYR A O   1 
ATOM   1099 C  CB  . TYR A 1 143 ? 36.166 -26.944 -2.984  1.00 11.24 ? 250  TYR A CB  1 
ATOM   1100 C  CG  . TYR A 1 143 ? 36.161 -25.491 -2.593  1.00 15.70 ? 250  TYR A CG  1 
ATOM   1101 C  CD1 . TYR A 1 143 ? 35.324 -25.034 -1.584  1.00 14.01 ? 250  TYR A CD1 1 
ATOM   1102 C  CD2 . TYR A 1 143 ? 37.003 -24.572 -3.224  1.00 16.74 ? 250  TYR A CD2 1 
ATOM   1103 C  CE1 . TYR A 1 143 ? 35.315 -23.708 -1.212  1.00 11.71 ? 250  TYR A CE1 1 
ATOM   1104 C  CE2 . TYR A 1 143 ? 37.010 -23.233 -2.848  1.00 14.12 ? 250  TYR A CE2 1 
ATOM   1105 C  CZ  . TYR A 1 143 ? 36.153 -22.810 -1.847  1.00 15.79 ? 250  TYR A CZ  1 
ATOM   1106 O  OH  . TYR A 1 143 ? 36.138 -21.488 -1.455  1.00 16.58 ? 250  TYR A OH  1 
ATOM   1107 N  N   . SER A 1 144 ? 35.727 -29.218 -5.281  1.00 12.63 ? 251  SER A N   1 
ATOM   1108 C  CA  . SER A 1 144 ? 35.878 -30.630 -5.614  1.00 13.97 ? 251  SER A CA  1 
ATOM   1109 C  C   . SER A 1 144 ? 37.346 -30.915 -5.879  1.00 15.94 ? 251  SER A C   1 
ATOM   1110 O  O   . SER A 1 144 ? 37.977 -30.202 -6.658  1.00 13.18 ? 251  SER A O   1 
ATOM   1111 C  CB  . SER A 1 144 ? 35.033 -30.992 -6.843  1.00 16.87 ? 251  SER A CB  1 
ATOM   1112 O  OG  . SER A 1 144 ? 35.155 -32.368 -7.144  1.00 19.80 ? 251  SER A OG  1 
ATOM   1113 N  N   . ALA A 1 145 ? 37.889 -31.947 -5.238  1.00 14.80 ? 252  ALA A N   1 
ATOM   1114 C  CA  . ALA A 1 145 ? 39.319 -32.252 -5.378  1.00 12.47 ? 252  ALA A CA  1 
ATOM   1115 C  C   . ALA A 1 145 ? 39.611 -33.741 -5.240  1.00 14.37 ? 252  ALA A C   1 
ATOM   1116 O  O   . ALA A 1 145 ? 38.878 -34.465 -4.560  1.00 12.24 ? 252  ALA A O   1 
ATOM   1117 C  CB  . ALA A 1 145 ? 40.130 -31.472 -4.335  1.00 14.63 ? 252  ALA A CB  1 
ATOM   1118 N  N   . SER A 1 146 ? 40.703 -34.189 -5.857  1.00 15.72 ? 253  SER A N   1 
ATOM   1119 C  CA  . SER A 1 146 ? 41.129 -35.586 -5.722  1.00 15.48 ? 253  SER A CA  1 
ATOM   1120 C  C   . SER A 1 146 ? 42.632 -35.718 -5.464  1.00 20.80 ? 253  SER A C   1 
ATOM   1121 O  O   . SER A 1 146 ? 43.182 -36.813 -5.539  1.00 17.46 ? 253  SER A O   1 
ATOM   1122 C  CB  . SER A 1 146 ? 40.744 -36.391 -6.971  1.00 18.91 ? 253  SER A CB  1 
ATOM   1123 O  OG  . SER A 1 146 ? 41.340 -35.847 -8.136  1.00 19.84 ? 253  SER A OG  1 
ATOM   1124 N  N   . TRP A 1 147 ? 43.303 -34.617 -5.150  1.00 15.22 ? 254  TRP A N   1 
ATOM   1125 C  CA  . TRP A 1 147 ? 44.740 -34.704 -4.938  1.00 17.08 ? 254  TRP A CA  1 
ATOM   1126 C  C   . TRP A 1 147 ? 45.077 -35.043 -3.488  1.00 20.44 ? 254  TRP A C   1 
ATOM   1127 O  O   . TRP A 1 147 ? 44.193 -35.228 -2.658  1.00 18.15 ? 254  TRP A O   1 
ATOM   1128 C  CB  . TRP A 1 147 ? 45.443 -33.414 -5.366  1.00 16.65 ? 254  TRP A CB  1 
ATOM   1129 C  CG  . TRP A 1 147 ? 44.670 -32.151 -5.147  1.00 17.93 ? 254  TRP A CG  1 
ATOM   1130 C  CD1 . TRP A 1 147 ? 43.796 -31.562 -6.019  1.00 19.11 ? 254  TRP A CD1 1 
ATOM   1131 C  CD2 . TRP A 1 147 ? 44.730 -31.299 -4.002  1.00 16.97 ? 254  TRP A CD2 1 
ATOM   1132 N  NE1 . TRP A 1 147 ? 43.298 -30.403 -5.478  1.00 17.00 ? 254  TRP A NE1 1 
ATOM   1133 C  CE2 . TRP A 1 147 ? 43.853 -30.218 -4.237  1.00 16.37 ? 254  TRP A CE2 1 
ATOM   1134 C  CE3 . TRP A 1 147 ? 45.432 -31.349 -2.791  1.00 18.76 ? 254  TRP A CE3 1 
ATOM   1135 C  CZ2 . TRP A 1 147 ? 43.662 -29.190 -3.311  1.00 16.10 ? 254  TRP A CZ2 1 
ATOM   1136 C  CZ3 . TRP A 1 147 ? 45.239 -30.334 -1.866  1.00 16.62 ? 254  TRP A CZ3 1 
ATOM   1137 C  CH2 . TRP A 1 147 ? 44.363 -29.263 -2.131  1.00 17.92 ? 254  TRP A CH2 1 
ATOM   1138 N  N   . GLY A 1 148 ? 46.369 -35.127 -3.196  1.00 19.24 ? 255  GLY A N   1 
ATOM   1139 C  CA  . GLY A 1 148 ? 46.827 -35.639 -1.916  1.00 16.79 ? 255  GLY A CA  1 
ATOM   1140 C  C   . GLY A 1 148 ? 48.017 -36.552 -2.125  1.00 17.51 ? 255  GLY A C   1 
ATOM   1141 O  O   . GLY A 1 148 ? 48.595 -36.571 -3.208  1.00 16.00 ? 255  GLY A O   1 
ATOM   1142 N  N   . PRO A 1 149 ? 48.385 -37.320 -1.093  1.00 16.39 ? 256  PRO A N   1 
ATOM   1143 C  CA  . PRO A 1 149 ? 49.602 -38.134 -1.157  1.00 13.38 ? 256  PRO A CA  1 
ATOM   1144 C  C   . PRO A 1 149 ? 49.545 -39.186 -2.248  1.00 18.04 ? 256  PRO A C   1 
ATOM   1145 O  O   . PRO A 1 149 ? 48.464 -39.658 -2.614  1.00 12.90 ? 256  PRO A O   1 
ATOM   1146 C  CB  . PRO A 1 149 ? 49.672 -38.795 0.224   1.00 15.02 ? 256  PRO A CB  1 
ATOM   1147 C  CG  . PRO A 1 149 ? 48.306 -38.618 0.827   1.00 13.61 ? 256  PRO A CG  1 
ATOM   1148 C  CD  . PRO A 1 149 ? 47.766 -37.353 0.242   1.00 13.64 ? 256  PRO A CD  1 
ATOM   1149 N  N   . GLU A 1 150 ? 50.719 -39.544 -2.754  1.00 16.80 ? 257  GLU A N   1 
ATOM   1150 C  CA  . GLU A 1 150 ? 50.827 -40.565 -3.791  1.00 18.14 ? 257  GLU A CA  1 
ATOM   1151 C  C   . GLU A 1 150 ? 50.110 -41.847 -3.370  1.00 14.96 ? 257  GLU A C   1 
ATOM   1152 O  O   . GLU A 1 150 ? 50.259 -42.302 -2.241  1.00 14.87 ? 257  GLU A O   1 
ATOM   1153 C  CB  . GLU A 1 150 ? 52.301 -40.859 -4.090  1.00 17.84 ? 257  GLU A CB  1 
ATOM   1154 C  CG  . GLU A 1 150 ? 52.500 -41.837 -5.234  1.00 25.51 ? 257  GLU A CG  1 
ATOM   1155 C  CD  . GLU A 1 150 ? 53.930 -41.855 -5.749  1.00 48.14 ? 257  GLU A CD  1 
ATOM   1156 O  OE1 . GLU A 1 150 ? 54.228 -42.667 -6.654  1.00 50.71 ? 257  GLU A OE1 1 
ATOM   1157 O  OE2 . GLU A 1 150 ? 54.755 -41.058 -5.250  1.00 48.58 ? 257  GLU A OE2 1 
ATOM   1158 N  N   . ASP A 1 151 ? 49.333 -42.419 -4.284  1.00 14.97 ? 258  ASP A N   1 
ATOM   1159 C  CA  . ASP A 1 151 ? 48.627 -43.661 -4.002  1.00 14.45 ? 258  ASP A CA  1 
ATOM   1160 C  C   . ASP A 1 151 ? 49.517 -44.882 -4.242  1.00 17.35 ? 258  ASP A C   1 
ATOM   1161 O  O   . ASP A 1 151 ? 49.125 -45.807 -4.961  1.00 17.38 ? 258  ASP A O   1 
ATOM   1162 C  CB  . ASP A 1 151 ? 47.363 -43.752 -4.861  1.00 17.51 ? 258  ASP A CB  1 
ATOM   1163 C  CG  . ASP A 1 151 ? 46.306 -42.724 -4.470  1.00 15.65 ? 258  ASP A CG  1 
ATOM   1164 O  OD1 . ASP A 1 151 ? 46.210 -42.387 -3.274  1.00 13.81 ? 258  ASP A OD1 1 
ATOM   1165 O  OD2 . ASP A 1 151 ? 45.545 -42.274 -5.357  1.00 16.12 ? 258  ASP A OD2 1 
ATOM   1166 N  N   . ASP A 1 152 ? 50.704 -44.898 -3.634  1.00 15.25 ? 259  ASP A N   1 
ATOM   1167 C  CA  . ASP A 1 152 ? 51.630 -46.014 -3.833  1.00 18.17 ? 259  ASP A CA  1 
ATOM   1168 C  C   . ASP A 1 152 ? 51.500 -47.081 -2.747  1.00 16.23 ? 259  ASP A C   1 
ATOM   1169 O  O   . ASP A 1 152 ? 52.219 -48.080 -2.764  1.00 17.15 ? 259  ASP A O   1 
ATOM   1170 C  CB  . ASP A 1 152 ? 53.084 -45.519 -3.908  1.00 19.27 ? 259  ASP A CB  1 
ATOM   1171 C  CG  . ASP A 1 152 ? 53.496 -44.667 -2.710  1.00 21.38 ? 259  ASP A CG  1 
ATOM   1172 O  OD1 . ASP A 1 152 ? 52.760 -44.602 -1.701  1.00 15.47 ? 259  ASP A OD1 1 
ATOM   1173 O  OD2 . ASP A 1 152 ? 54.588 -44.059 -2.773  1.00 19.37 ? 259  ASP A OD2 1 
ATOM   1174 N  N   . GLY A 1 153 ? 50.582 -46.874 -1.809  1.00 14.50 ? 260  GLY A N   1 
ATOM   1175 C  CA  . GLY A 1 153 ? 50.373 -47.826 -0.730  1.00 13.50 ? 260  GLY A CA  1 
ATOM   1176 C  C   . GLY A 1 153 ? 51.497 -47.848 0.296   1.00 15.78 ? 260  GLY A C   1 
ATOM   1177 O  O   . GLY A 1 153 ? 51.583 -48.778 1.108   1.00 13.69 ? 260  GLY A O   1 
ATOM   1178 N  N   . LYS A 1 154 ? 52.361 -46.833 0.285   1.00 14.43 ? 261  LYS A N   1 
ATOM   1179 C  CA  . LYS A 1 154 ? 53.378 -46.763 1.337   1.00 14.49 ? 261  LYS A CA  1 
ATOM   1180 C  C   . LYS A 1 154 ? 53.539 -45.374 1.947   1.00 20.40 ? 261  LYS A C   1 
ATOM   1181 O  O   . LYS A 1 154 ? 54.398 -45.165 2.802   1.00 21.39 ? 261  LYS A O   1 
ATOM   1182 C  CB  . LYS A 1 154 ? 54.730 -47.262 0.811   1.00 19.99 ? 261  LYS A CB  1 
ATOM   1183 C  CG  . LYS A 1 154 ? 55.218 -46.595 -0.451  1.00 24.32 ? 261  LYS A CG  1 
ATOM   1184 C  CD  . LYS A 1 154 ? 56.365 -47.393 -1.071  1.00 26.71 ? 261  LYS A CD  1 
ATOM   1185 C  CE  . LYS A 1 154 ? 56.919 -46.687 -2.298  1.00 35.13 ? 261  LYS A CE  1 
ATOM   1186 N  NZ  . LYS A 1 154 ? 57.953 -47.494 -3.000  0.00 34.97 ? 261  LYS A NZ  1 
ATOM   1187 N  N   . THR A 1 155 ? 52.689 -44.442 1.540   1.00 13.81 ? 262  THR A N   1 
ATOM   1188 C  CA  . THR A 1 155 ? 52.815 -43.063 1.996   1.00 13.56 ? 262  THR A CA  1 
ATOM   1189 C  C   . THR A 1 155 ? 51.810 -42.751 3.102   1.00 12.91 ? 262  THR A C   1 
ATOM   1190 O  O   . THR A 1 155 ? 50.669 -43.212 3.061   1.00 12.62 ? 262  THR A O   1 
ATOM   1191 C  CB  . THR A 1 155 ? 52.627 -42.084 0.816   1.00 13.54 ? 262  THR A CB  1 
ATOM   1192 O  OG1 . THR A 1 155 ? 53.599 -42.383 -0.204  1.00 16.60 ? 262  THR A OG1 1 
ATOM   1193 C  CG2 . THR A 1 155 ? 52.806 -40.617 1.264   1.00 13.84 ? 262  THR A CG2 1 
ATOM   1194 N  N   . VAL A 1 156 ? 52.245 -41.990 4.102   1.00 11.38 ? 263  VAL A N   1 
ATOM   1195 C  CA  . VAL A 1 156 ? 51.323 -41.402 5.077   1.00 11.25 ? 263  VAL A CA  1 
ATOM   1196 C  C   . VAL A 1 156 ? 51.541 -39.898 5.078   1.00 16.31 ? 263  VAL A C   1 
ATOM   1197 O  O   . VAL A 1 156 ? 52.611 -39.422 5.452   1.00 16.44 ? 263  VAL A O   1 
ATOM   1198 C  CB  . VAL A 1 156 ? 51.522 -41.944 6.505   1.00 12.01 ? 263  VAL A CB  1 
ATOM   1199 C  CG1 . VAL A 1 156 ? 50.519 -41.273 7.474   1.00 14.16 ? 263  VAL A CG1 1 
ATOM   1200 C  CG2 . VAL A 1 156 ? 51.376 -43.465 6.540   1.00 13.64 ? 263  VAL A CG2 1 
ATOM   1201 N  N   . ASP A 1 157 ? 50.543 -39.145 4.638   1.00 14.13 ? 264  ASP A N   1 
ATOM   1202 C  CA  . ASP A 1 157 ? 50.716 -37.699 4.523   1.00 13.75 ? 264  ASP A CA  1 
ATOM   1203 C  C   . ASP A 1 157 ? 49.364 -37.031 4.523   1.00 14.96 ? 264  ASP A C   1 
ATOM   1204 O  O   . ASP A 1 157 ? 48.366 -37.645 4.148   1.00 14.08 ? 264  ASP A O   1 
ATOM   1205 C  CB  . ASP A 1 157 ? 51.479 -37.346 3.243   1.00 12.49 ? 264  ASP A CB  1 
ATOM   1206 C  CG  . ASP A 1 157 ? 52.249 -36.023 3.340   1.00 21.56 ? 264  ASP A CG  1 
ATOM   1207 O  OD1 . ASP A 1 157 ? 52.011 -35.231 4.272   1.00 17.33 ? 264  ASP A OD1 1 
ATOM   1208 O  OD2 . ASP A 1 157 ? 53.115 -35.782 2.472   1.00 28.66 ? 264  ASP A OD2 1 
ATOM   1209 N  N   . GLY A 1 158 ? 49.333 -35.771 4.936   1.00 13.17 ? 265  GLY A N   1 
ATOM   1210 C  CA  . GLY A 1 158 ? 48.100 -35.005 4.960   1.00 13.64 ? 265  GLY A CA  1 
ATOM   1211 C  C   . GLY A 1 158 ? 48.404 -33.526 4.862   1.00 15.35 ? 265  GLY A C   1 
ATOM   1212 O  O   . GLY A 1 158 ? 49.560 -33.134 4.685   1.00 12.89 ? 265  GLY A O   1 
ATOM   1213 N  N   . PRO A 1 159 ? 47.372 -32.689 4.992   1.00 14.84 ? 266  PRO A N   1 
ATOM   1214 C  CA  . PRO A 1 159 ? 47.592 -31.243 4.883   1.00 12.86 ? 266  PRO A CA  1 
ATOM   1215 C  C   . PRO A 1 159 ? 48.573 -30.727 5.933   1.00 15.52 ? 266  PRO A C   1 
ATOM   1216 O  O   . PRO A 1 159 ? 48.481 -31.076 7.115   1.00 13.37 ? 266  PRO A O   1 
ATOM   1217 C  CB  . PRO A 1 159 ? 46.189 -30.651 5.099   1.00 12.69 ? 266  PRO A CB  1 
ATOM   1218 C  CG  . PRO A 1 159 ? 45.404 -31.750 5.777   1.00 13.85 ? 266  PRO A CG  1 
ATOM   1219 C  CD  . PRO A 1 159 ? 45.956 -33.027 5.216   1.00 10.04 ? 266  PRO A CD  1 
ATOM   1220 N  N   . ALA A 1 160 ? 49.508 -29.898 5.491   1.00 12.45 ? 267  ALA A N   1 
ATOM   1221 C  CA  . ALA A 1 160 ? 50.407 -29.207 6.411   1.00 13.75 ? 267  ALA A CA  1 
ATOM   1222 C  C   . ALA A 1 160 ? 49.691 -27.964 6.932   1.00 15.89 ? 267  ALA A C   1 
ATOM   1223 O  O   . ALA A 1 160 ? 48.488 -27.812 6.738   1.00 12.17 ? 267  ALA A O   1 
ATOM   1224 C  CB  . ALA A 1 160 ? 51.712 -28.844 5.728   1.00 16.71 ? 267  ALA A CB  1 
ATOM   1225 N  N   . ARG A 1 161 ? 50.422 -27.073 7.592   1.00 14.01 ? 268  ARG A N   1 
ATOM   1226 C  CA  . ARG A 1 161 ? 49.761 -26.051 8.399   1.00 14.97 ? 268  ARG A CA  1 
ATOM   1227 C  C   . ARG A 1 161 ? 48.877 -25.091 7.601   1.00 14.23 ? 268  ARG A C   1 
ATOM   1228 O  O   . ARG A 1 161 ? 47.747 -24.820 8.007   1.00 13.36 ? 268  ARG A O   1 
ATOM   1229 C  CB  . ARG A 1 161 ? 50.791 -25.251 9.178   1.00 13.93 ? 268  ARG A CB  1 
ATOM   1230 C  CG  . ARG A 1 161 ? 50.155 -24.248 10.097  1.00 15.23 ? 268  ARG A CG  1 
ATOM   1231 C  CD  . ARG A 1 161 ? 51.208 -23.582 10.952  1.00 18.92 ? 268  ARG A CD  1 
ATOM   1232 N  NE  . ARG A 1 161 ? 50.655 -22.478 11.724  1.00 20.52 ? 268  ARG A NE  1 
ATOM   1233 C  CZ  . ARG A 1 161 ? 51.334 -21.827 12.661  1.00 21.66 ? 268  ARG A CZ  1 
ATOM   1234 N  NH1 . ARG A 1 161 ? 52.575 -22.190 12.931  1.00 17.04 ? 268  ARG A NH1 1 
ATOM   1235 N  NH2 . ARG A 1 161 ? 50.776 -20.823 13.320  1.00 21.31 ? 268  ARG A NH2 1 
ATOM   1236 N  N   . LEU A 1 162 ? 49.375 -24.569 6.483   1.00 12.40 ? 269  LEU A N   1 
ATOM   1237 C  CA  . LEU A 1 162 ? 48.570 -23.613 5.713   1.00 12.40 ? 269  LEU A CA  1 
ATOM   1238 C  C   . LEU A 1 162 ? 47.306 -24.268 5.162   1.00 11.71 ? 269  LEU A C   1 
ATOM   1239 O  O   . LEU A 1 162 ? 46.225 -23.680 5.201   1.00 10.96 ? 269  LEU A O   1 
ATOM   1240 C  CB  . LEU A 1 162 ? 49.388 -23.002 4.572   1.00 9.87  ? 269  LEU A CB  1 
ATOM   1241 C  CG  . LEU A 1 162 ? 50.566 -22.141 5.040   1.00 12.28 ? 269  LEU A CG  1 
ATOM   1242 C  CD1 . LEU A 1 162 ? 51.551 -21.918 3.885   1.00 13.39 ? 269  LEU A CD1 1 
ATOM   1243 C  CD2 . LEU A 1 162 ? 50.063 -20.815 5.575   1.00 16.80 ? 269  LEU A CD2 1 
ATOM   1244 N  N   . ALA A 1 163 ? 47.440 -25.487 4.644   1.00 11.47 ? 270  ALA A N   1 
ATOM   1245 C  CA  . ALA A 1 163 ? 46.278 -26.182 4.101   1.00 10.79 ? 270  ALA A CA  1 
ATOM   1246 C  C   . ALA A 1 163 ? 45.270 -26.536 5.201   1.00 11.09 ? 270  ALA A C   1 
ATOM   1247 O  O   . ALA A 1 163 ? 44.056 -26.399 5.012   1.00 11.30 ? 270  ALA A O   1 
ATOM   1248 C  CB  . ALA A 1 163 ? 46.719 -27.434 3.331   1.00 12.43 ? 270  ALA A CB  1 
ATOM   1249 N  N   . GLU A 1 164 ? 45.756 -26.981 6.354   1.00 11.17 ? 271  GLU A N   1 
ATOM   1250 C  CA  . GLU A 1 164 ? 44.844 -27.298 7.450   1.00 12.26 ? 271  GLU A CA  1 
ATOM   1251 C  C   . GLU A 1 164 ? 44.135 -26.026 7.928   1.00 12.24 ? 271  GLU A C   1 
ATOM   1252 O  O   . GLU A 1 164 ? 42.938 -26.040 8.226   1.00 11.81 ? 271  GLU A O   1 
ATOM   1253 C  CB  . GLU A 1 164 ? 45.591 -27.965 8.611   1.00 12.55 ? 271  GLU A CB  1 
ATOM   1254 C  CG  . GLU A 1 164 ? 44.704 -28.266 9.836   1.00 16.15 ? 271  GLU A CG  1 
ATOM   1255 C  CD  . GLU A 1 164 ? 43.753 -29.449 9.634   1.00 23.95 ? 271  GLU A CD  1 
ATOM   1256 O  OE1 . GLU A 1 164 ? 43.600 -29.937 8.499   1.00 21.71 ? 271  GLU A OE1 1 
ATOM   1257 O  OE2 . GLU A 1 164 ? 43.157 -29.910 10.633  1.00 36.68 ? 271  GLU A OE2 1 
ATOM   1258 N  N   . GLU A 1 165 ? 44.876 -24.922 7.984   1.00 9.46  ? 272  GLU A N   1 
ATOM   1259 C  CA  . GLU A 1 165 ? 44.269 -23.639 8.329   1.00 11.40 ? 272  GLU A CA  1 
ATOM   1260 C  C   . GLU A 1 165 ? 43.214 -23.233 7.290   1.00 12.38 ? 272  GLU A C   1 
ATOM   1261 O  O   . GLU A 1 165 ? 42.177 -22.664 7.641   1.00 12.51 ? 272  GLU A O   1 
ATOM   1262 C  CB  . GLU A 1 165 ? 45.351 -22.559 8.470   1.00 13.35 ? 272  GLU A CB  1 
ATOM   1263 C  CG  . GLU A 1 165 ? 46.175 -22.717 9.747   1.00 12.85 ? 272  GLU A CG  1 
ATOM   1264 C  CD  . GLU A 1 165 ? 47.431 -21.854 9.775   1.00 17.99 ? 272  GLU A CD  1 
ATOM   1265 O  OE1 . GLU A 1 165 ? 47.995 -21.698 10.871  1.00 17.27 ? 272  GLU A OE1 1 
ATOM   1266 O  OE2 . GLU A 1 165 ? 47.875 -21.357 8.713   1.00 16.56 ? 272  GLU A OE2 1 
ATOM   1267 N  N   . ALA A 1 166 ? 43.460 -23.534 6.015   1.00 11.11 ? 273  ALA A N   1 
ATOM   1268 C  CA  . ALA A 1 166 ? 42.465 -23.236 4.977   1.00 11.13 ? 273  ALA A CA  1 
ATOM   1269 C  C   . ALA A 1 166 ? 41.184 -24.055 5.189   1.00 13.98 ? 273  ALA A C   1 
ATOM   1270 O  O   . ALA A 1 166 ? 40.080 -23.535 5.026   1.00 10.93 ? 273  ALA A O   1 
ATOM   1271 C  CB  . ALA A 1 166 ? 43.046 -23.491 3.557   1.00 10.43 ? 273  ALA A CB  1 
ATOM   1272 N  N   . PHE A 1 167 ? 41.325 -25.327 5.561   1.00 10.89 ? 274  PHE A N   1 
ATOM   1273 C  CA  . PHE A 1 167 ? 40.156 -26.140 5.877   1.00 10.52 ? 274  PHE A CA  1 
ATOM   1274 C  C   . PHE A 1 167 ? 39.371 -25.532 7.046   1.00 12.07 ? 274  PHE A C   1 
ATOM   1275 O  O   . PHE A 1 167 ? 38.149 -25.419 6.971   1.00 13.23 ? 274  PHE A O   1 
ATOM   1276 C  CB  . PHE A 1 167 ? 40.549 -27.575 6.226   1.00 11.58 ? 274  PHE A CB  1 
ATOM   1277 C  CG  . PHE A 1 167 ? 40.821 -28.455 5.038   1.00 11.91 ? 274  PHE A CG  1 
ATOM   1278 C  CD1 . PHE A 1 167 ? 39.933 -28.518 3.969   1.00 13.04 ? 274  PHE A CD1 1 
ATOM   1279 C  CD2 . PHE A 1 167 ? 41.957 -29.249 5.001   1.00 13.26 ? 274  PHE A CD2 1 
ATOM   1280 C  CE1 . PHE A 1 167 ? 40.175 -29.358 2.874   1.00 10.57 ? 274  PHE A CE1 1 
ATOM   1281 C  CE2 . PHE A 1 167 ? 42.206 -30.093 3.901   1.00 14.26 ? 274  PHE A CE2 1 
ATOM   1282 C  CZ  . PHE A 1 167 ? 41.313 -30.142 2.842   1.00 12.37 ? 274  PHE A CZ  1 
ATOM   1283 N  N   A PHE A 1 168 ? 40.042 -25.125 8.119   0.50 12.55 ? 275  PHE A N   1 
ATOM   1284 N  N   B PHE A 1 168 ? 40.095 -25.182 8.112   0.50 12.55 ? 275  PHE A N   1 
ATOM   1285 C  CA  A PHE A 1 168 ? 39.287 -24.617 9.266   0.50 12.15 ? 275  PHE A CA  1 
ATOM   1286 C  CA  B PHE A 1 168 ? 39.527 -24.532 9.298   0.50 12.44 ? 275  PHE A CA  1 
ATOM   1287 C  C   A PHE A 1 168 ? 38.666 -23.250 8.973   0.50 12.77 ? 275  PHE A C   1 
ATOM   1288 C  C   B PHE A 1 168 ? 38.703 -23.315 8.914   0.50 12.75 ? 275  PHE A C   1 
ATOM   1289 O  O   A PHE A 1 168 ? 37.543 -22.991 9.405   0.50 14.05 ? 275  PHE A O   1 
ATOM   1290 O  O   B PHE A 1 168 ? 37.517 -23.210 9.237   0.50 14.44 ? 275  PHE A O   1 
ATOM   1291 C  CB  A PHE A 1 168 ? 40.149 -24.539 10.531  0.50 12.51 ? 275  PHE A CB  1 
ATOM   1292 C  CB  B PHE A 1 168 ? 40.623 -24.058 10.263  0.50 13.16 ? 275  PHE A CB  1 
ATOM   1293 C  CG  A PHE A 1 168 ? 39.341 -24.567 11.815  0.50 14.93 ? 275  PHE A CG  1 
ATOM   1294 C  CG  B PHE A 1 168 ? 41.315 -25.151 11.033  0.50 17.71 ? 275  PHE A CG  1 
ATOM   1295 C  CD1 A PHE A 1 168 ? 39.014 -25.774 12.423  0.50 19.80 ? 275  PHE A CD1 1 
ATOM   1296 C  CD1 B PHE A 1 168 ? 40.973 -26.484 10.882  0.50 20.74 ? 275  PHE A CD1 1 
ATOM   1297 C  CD2 A PHE A 1 168 ? 38.896 -23.391 12.403  0.50 21.44 ? 275  PHE A CD2 1 
ATOM   1298 C  CD2 B PHE A 1 168 ? 42.321 -24.819 11.932  0.50 19.61 ? 275  PHE A CD2 1 
ATOM   1299 C  CE1 A PHE A 1 168 ? 38.264 -25.809 13.606  0.50 19.82 ? 275  PHE A CE1 1 
ATOM   1300 C  CE1 B PHE A 1 168 ? 41.630 -27.468 11.611  0.50 18.96 ? 275  PHE A CE1 1 
ATOM   1301 C  CE2 A PHE A 1 168 ? 38.149 -23.420 13.580  0.50 18.96 ? 275  PHE A CE2 1 
ATOM   1302 C  CE2 B PHE A 1 168 ? 42.978 -25.792 12.661  0.50 20.04 ? 275  PHE A CE2 1 
ATOM   1303 C  CZ  A PHE A 1 168 ? 37.833 -24.637 14.178  0.50 18.17 ? 275  PHE A CZ  1 
ATOM   1304 C  CZ  B PHE A 1 168 ? 42.631 -27.121 12.497  0.50 16.77 ? 275  PHE A CZ  1 
ATOM   1305 N  N   . ARG A 1 169 ? 39.380 -22.379 8.255   1.00 11.38 ? 276  ARG A N   1 
ATOM   1306 C  CA  . ARG A 1 169 ? 38.800 -21.094 7.849   1.00 15.59 ? 276  ARG A CA  1 
ATOM   1307 C  C   . ARG A 1 169 ? 37.607 -21.309 6.929   1.00 12.63 ? 276  ARG A C   1 
ATOM   1308 O  O   . ARG A 1 169 ? 36.601 -20.603 7.017   1.00 12.36 ? 276  ARG A O   1 
ATOM   1309 C  CB  . ARG A 1 169 ? 39.840 -20.209 7.134   1.00 13.44 ? 276  ARG A CB  1 
ATOM   1310 C  CG  . ARG A 1 169 ? 41.028 -19.798 8.006   1.00 16.33 ? 276  ARG A CG  1 
ATOM   1311 C  CD  . ARG A 1 169 ? 42.079 -19.035 7.173   1.00 16.80 ? 276  ARG A CD  1 
ATOM   1312 N  NE  . ARG A 1 169 ? 41.563 -17.734 6.744   1.00 17.08 ? 276  ARG A NE  1 
ATOM   1313 C  CZ  . ARG A 1 169 ? 41.641 -16.634 7.486   1.00 18.33 ? 276  ARG A CZ  1 
ATOM   1314 N  NH1 . ARG A 1 169 ? 41.146 -15.491 7.037   1.00 18.35 ? 276  ARG A NH1 1 
ATOM   1315 N  NH2 . ARG A 1 169 ? 42.223 -16.678 8.676   1.00 16.39 ? 276  ARG A NH2 1 
ATOM   1316 N  N   . GLY A 1 170 ? 37.730 -22.289 6.042   1.00 12.95 ? 277  GLY A N   1 
ATOM   1317 C  CA  . GLY A 1 170 ? 36.663 -22.594 5.108   1.00 11.25 ? 277  GLY A CA  1 
ATOM   1318 C  C   . GLY A 1 170 ? 35.380 -23.032 5.799   1.00 11.34 ? 277  GLY A C   1 
ATOM   1319 O  O   . GLY A 1 170 ? 34.315 -22.475 5.541   1.00 12.51 ? 277  GLY A O   1 
ATOM   1320 N  N   . VAL A 1 171 ? 35.463 -24.024 6.681   1.00 11.84 ? 278  VAL A N   1 
ATOM   1321 C  CA  . VAL A 1 171 ? 34.243 -24.535 7.290   1.00 11.87 ? 278  VAL A CA  1 
ATOM   1322 C  C   . VAL A 1 171 ? 33.704 -23.581 8.365   1.00 12.80 ? 278  VAL A C   1 
ATOM   1323 O  O   . VAL A 1 171 ? 32.515 -23.610 8.664   1.00 12.83 ? 278  VAL A O   1 
ATOM   1324 C  CB  . VAL A 1 171 ? 34.436 -25.955 7.889   1.00 12.91 ? 278  VAL A CB  1 
ATOM   1325 C  CG1 . VAL A 1 171 ? 34.858 -26.946 6.787   1.00 11.84 ? 278  VAL A CG1 1 
ATOM   1326 C  CG2 . VAL A 1 171 ? 35.421 -25.952 9.064   1.00 13.49 ? 278  VAL A CG2 1 
ATOM   1327 N  N   . SER A 1 172 ? 34.559 -22.713 8.903   1.00 12.01 ? 279  SER A N   1 
ATOM   1328 C  CA  . SER A 1 172 ? 34.138 -21.776 9.950   1.00 15.28 ? 279  SER A CA  1 
ATOM   1329 C  C   . SER A 1 172 ? 33.530 -20.498 9.396   1.00 17.26 ? 279  SER A C   1 
ATOM   1330 O  O   . SER A 1 172 ? 32.457 -20.081 9.822   1.00 17.01 ? 279  SER A O   1 
ATOM   1331 C  CB  . SER A 1 172 ? 35.317 -21.403 10.862  1.00 17.23 ? 279  SER A CB  1 
ATOM   1332 O  OG  . SER A 1 172 ? 35.826 -22.540 11.525  1.00 23.03 ? 279  SER A OG  1 
ATOM   1333 N  N   . GLN A 1 173 ? 34.217 -19.874 8.445   1.00 18.35 ? 280  GLN A N   1 
ATOM   1334 C  CA  . GLN A 1 173 ? 33.802 -18.563 7.959   1.00 18.39 ? 280  GLN A CA  1 
ATOM   1335 C  C   . GLN A 1 173 ? 33.319 -18.584 6.507   1.00 18.53 ? 280  GLN A C   1 
ATOM   1336 O  O   . GLN A 1 173 ? 32.606 -17.673 6.071   1.00 19.61 ? 280  GLN A O   1 
ATOM   1337 C  CB  . GLN A 1 173 ? 34.958 -17.561 8.128   1.00 22.51 ? 280  GLN A CB  1 
ATOM   1338 C  CG  . GLN A 1 173 ? 35.174 -17.072 9.578   1.00 26.26 ? 280  GLN A CG  1 
ATOM   1339 C  CD  . GLN A 1 173 ? 36.153 -17.928 10.405  1.00 46.62 ? 280  GLN A CD  1 
ATOM   1340 O  OE1 . GLN A 1 173 ? 35.909 -18.208 11.587  1.00 41.80 ? 280  GLN A OE1 1 
ATOM   1341 N  NE2 . GLN A 1 173 ? 37.275 -18.312 9.797   1.00 33.21 ? 280  GLN A NE2 1 
ATOM   1342 N  N   . GLY A 1 174 ? 33.682 -19.625 5.758   1.00 17.48 ? 281  GLY A N   1 
ATOM   1343 C  CA  . GLY A 1 174 ? 33.238 -19.743 4.378   1.00 16.20 ? 281  GLY A CA  1 
ATOM   1344 C  C   . GLY A 1 174 ? 31.722 -19.778 4.245   1.00 15.25 ? 281  GLY A C   1 
ATOM   1345 O  O   . GLY A 1 174 ? 31.021 -20.134 5.196   1.00 16.58 ? 281  GLY A O   1 
ATOM   1346 N  N   . ARG A 1 175 ? 31.217 -19.394 3.073   1.00 14.90 ? 282  ARG A N   1 
ATOM   1347 C  CA  . ARG A 1 175 ? 29.776 -19.415 2.785   1.00 18.39 ? 282  ARG A CA  1 
ATOM   1348 C  C   . ARG A 1 175 ? 28.941 -18.708 3.855   1.00 17.80 ? 282  ARG A C   1 
ATOM   1349 O  O   . ARG A 1 175 ? 27.934 -19.245 4.318   1.00 18.36 ? 282  ARG A O   1 
ATOM   1350 C  CB  . ARG A 1 175 ? 29.260 -20.864 2.625   1.00 20.67 ? 282  ARG A CB  1 
ATOM   1351 C  CG  . ARG A 1 175 ? 29.027 -21.291 1.186   1.00 28.34 ? 282  ARG A CG  1 
ATOM   1352 C  CD  . ARG A 1 175 ? 28.089 -22.497 1.038   1.00 19.90 ? 282  ARG A CD  1 
ATOM   1353 N  NE  . ARG A 1 175 ? 28.219 -23.473 2.107   1.00 26.50 ? 282  ARG A NE  1 
ATOM   1354 C  CZ  . ARG A 1 175 ? 27.189 -23.958 2.795   1.00 19.15 ? 282  ARG A CZ  1 
ATOM   1355 N  NH1 . ARG A 1 175 ? 25.948 -23.568 2.511   1.00 15.17 ? 282  ARG A NH1 1 
ATOM   1356 N  NH2 . ARG A 1 175 ? 27.398 -24.832 3.769   1.00 14.92 ? 282  ARG A NH2 1 
ATOM   1357 N  N   . GLY A 1 176 ? 29.351 -17.508 4.245   1.00 16.84 ? 283  GLY A N   1 
ATOM   1358 C  CA  . GLY A 1 176 ? 28.575 -16.731 5.198   1.00 24.10 ? 283  GLY A CA  1 
ATOM   1359 C  C   . GLY A 1 176 ? 28.551 -17.335 6.588   1.00 23.75 ? 283  GLY A C   1 
ATOM   1360 O  O   . GLY A 1 176 ? 27.644 -17.069 7.372   1.00 24.00 ? 283  GLY A O   1 
ATOM   1361 N  N   . GLY A 1 177 ? 29.546 -18.161 6.898   1.00 16.89 ? 284  GLY A N   1 
ATOM   1362 C  CA  . GLY A 1 177 ? 29.605 -18.816 8.191   1.00 17.81 ? 284  GLY A CA  1 
ATOM   1363 C  C   . GLY A 1 177 ? 28.994 -20.204 8.205   1.00 17.80 ? 284  GLY A C   1 
ATOM   1364 O  O   . GLY A 1 177 ? 29.110 -20.919 9.197   1.00 17.29 ? 284  GLY A O   1 
ATOM   1365 N  N   . LEU A 1 178 ? 28.339 -20.589 7.113   1.00 15.06 ? 285  LEU A N   1 
ATOM   1366 C  CA  . LEU A 1 178 ? 27.759 -21.930 7.012   1.00 17.78 ? 285  LEU A CA  1 
ATOM   1367 C  C   . LEU A 1 178 ? 28.820 -22.990 6.715   1.00 15.51 ? 285  LEU A C   1 
ATOM   1368 O  O   . LEU A 1 178 ? 28.639 -24.176 7.021   1.00 14.82 ? 285  LEU A O   1 
ATOM   1369 C  CB  . LEU A 1 178 ? 26.682 -21.969 5.927   1.00 13.77 ? 285  LEU A CB  1 
ATOM   1370 C  CG  . LEU A 1 178 ? 25.498 -21.019 6.134   1.00 19.89 ? 285  LEU A CG  1 
ATOM   1371 C  CD1 . LEU A 1 178 ? 24.538 -21.127 4.966   1.00 19.58 ? 285  LEU A CD1 1 
ATOM   1372 C  CD2 . LEU A 1 178 ? 24.797 -21.319 7.443   1.00 20.58 ? 285  LEU A CD2 1 
ATOM   1373 N  N   . GLY A 1 179 ? 29.909 -22.561 6.087   1.00 12.41 ? 286  GLY A N   1 
ATOM   1374 C  CA  . GLY A 1 179 ? 31.037 -23.442 5.847   1.00 12.33 ? 286  GLY A CA  1 
ATOM   1375 C  C   . GLY A 1 179 ? 31.179 -23.921 4.418   1.00 13.09 ? 286  GLY A C   1 
ATOM   1376 O  O   . GLY A 1 179 ? 30.226 -24.407 3.808   1.00 13.71 ? 286  GLY A O   1 
ATOM   1377 N  N   . SER A 1 180 ? 32.381 -23.765 3.875   1.00 11.98 ? 287  SER A N   1 
ATOM   1378 C  CA  . SER A 1 180 ? 32.719 -24.340 2.574   1.00 11.79 ? 287  SER A CA  1 
ATOM   1379 C  C   . SER A 1 180 ? 32.468 -25.843 2.571   1.00 13.61 ? 287  SER A C   1 
ATOM   1380 O  O   . SER A 1 180 ? 32.756 -26.535 3.563   1.00 12.64 ? 287  SER A O   1 
ATOM   1381 C  CB  . SER A 1 180 ? 34.186 -24.066 2.243   1.00 11.56 ? 287  SER A CB  1 
ATOM   1382 O  OG  . SER A 1 180 ? 34.463 -22.682 2.185   1.00 12.07 ? 287  SER A OG  1 
ATOM   1383 N  N   A ILE A 1 181 ? 31.929 -26.346 1.459   0.50 12.61 ? 288  ILE A N   1 
ATOM   1384 N  N   B ILE A 1 181 ? 31.939 -26.367 1.465   0.50 12.63 ? 288  ILE A N   1 
ATOM   1385 C  CA  A ILE A 1 181 ? 31.781 -27.779 1.267   0.50 10.87 ? 288  ILE A CA  1 
ATOM   1386 C  CA  B ILE A 1 181 ? 31.779 -27.807 1.346   0.50 10.95 ? 288  ILE A CA  1 
ATOM   1387 C  C   A ILE A 1 181 ? 32.961 -28.283 0.456   0.50 14.17 ? 288  ILE A C   1 
ATOM   1388 C  C   B ILE A 1 181 ? 32.887 -28.361 0.463   0.50 14.17 ? 288  ILE A C   1 
ATOM   1389 O  O   A ILE A 1 181 ? 33.112 -27.923 -0.711  0.50 13.17 ? 288  ILE A O   1 
ATOM   1390 O  O   B ILE A 1 181 ? 32.917 -28.110 -0.741  0.50 13.60 ? 288  ILE A O   1 
ATOM   1391 C  CB  A ILE A 1 181 ? 30.469 -28.137 0.543   0.50 12.53 ? 288  ILE A CB  1 
ATOM   1392 C  CB  B ILE A 1 181 ? 30.398 -28.188 0.778   0.50 12.30 ? 288  ILE A CB  1 
ATOM   1393 C  CG1 A ILE A 1 181 ? 29.284 -27.446 1.210   0.50 15.74 ? 288  ILE A CG1 1 
ATOM   1394 C  CG1 B ILE A 1 181 ? 29.291 -27.687 1.708   0.50 14.89 ? 288  ILE A CG1 1 
ATOM   1395 C  CG2 A ILE A 1 181 ? 30.263 -29.650 0.521   0.50 13.21 ? 288  ILE A CG2 1 
ATOM   1396 C  CG2 B ILE A 1 181 ? 30.292 -29.698 0.589   0.50 13.23 ? 288  ILE A CG2 1 
ATOM   1397 C  CD1 A ILE A 1 181 ? 29.008 -27.957 2.591   0.50 12.53 ? 288  ILE A CD1 1 
ATOM   1398 C  CD1 B ILE A 1 181 ? 27.888 -27.883 1.163   0.50 12.96 ? 288  ILE A CD1 1 
ATOM   1399 N  N   . PHE A 1 182 ? 33.814 -29.090 1.080   1.00 13.78 ? 289  PHE A N   1 
ATOM   1400 C  CA  . PHE A 1 182 ? 34.942 -29.677 0.365   1.00 11.92 ? 289  PHE A CA  1 
ATOM   1401 C  C   . PHE A 1 182 ? 34.638 -31.136 0.034   1.00 12.33 ? 289  PHE A C   1 
ATOM   1402 O  O   . PHE A 1 182 ? 34.582 -31.971 0.929   1.00 12.81 ? 289  PHE A O   1 
ATOM   1403 C  CB  . PHE A 1 182 ? 36.231 -29.594 1.204   1.00 11.32 ? 289  PHE A CB  1 
ATOM   1404 C  CG  . PHE A 1 182 ? 36.637 -28.183 1.593   1.00 14.56 ? 289  PHE A CG  1 
ATOM   1405 C  CD1 . PHE A 1 182 ? 37.242 -27.339 0.665   1.00 12.23 ? 289  PHE A CD1 1 
ATOM   1406 C  CD2 . PHE A 1 182 ? 36.458 -27.723 2.893   1.00 13.13 ? 289  PHE A CD2 1 
ATOM   1407 C  CE1 . PHE A 1 182 ? 37.651 -26.048 1.017   1.00 11.38 ? 289  PHE A CE1 1 
ATOM   1408 C  CE2 . PHE A 1 182 ? 36.856 -26.431 3.261   1.00 11.87 ? 289  PHE A CE2 1 
ATOM   1409 C  CZ  . PHE A 1 182 ? 37.453 -25.588 2.316   1.00 13.80 ? 289  PHE A CZ  1 
ATOM   1410 N  N   . VAL A 1 183 ? 34.441 -31.445 -1.248  1.00 10.57 ? 290  VAL A N   1 
ATOM   1411 C  CA  . VAL A 1 183 ? 34.142 -32.808 -1.657  1.00 12.39 ? 290  VAL A CA  1 
ATOM   1412 C  C   . VAL A 1 183 ? 35.436 -33.440 -2.152  1.00 12.64 ? 290  VAL A C   1 
ATOM   1413 O  O   . VAL A 1 183 ? 36.128 -32.823 -2.956  1.00 14.63 ? 290  VAL A O   1 
ATOM   1414 C  CB  . VAL A 1 183 ? 33.081 -32.837 -2.781  1.00 11.93 ? 290  VAL A CB  1 
ATOM   1415 C  CG1 . VAL A 1 183 ? 32.756 -34.267 -3.166  1.00 15.62 ? 290  VAL A CG1 1 
ATOM   1416 C  CG2 . VAL A 1 183 ? 31.824 -32.090 -2.341  1.00 13.10 ? 290  VAL A CG2 1 
ATOM   1417 N  N   . TRP A 1 184 ? 35.761 -34.642 -1.672  1.00 10.74 ? 291  TRP A N   1 
ATOM   1418 C  CA  . TRP A 1 184 ? 37.043 -35.290 -1.973  1.00 8.79  ? 291  TRP A CA  1 
ATOM   1419 C  C   . TRP A 1 184 ? 36.875 -36.707 -2.499  1.00 14.34 ? 291  TRP A C   1 
ATOM   1420 O  O   . TRP A 1 184 ? 36.000 -37.432 -2.050  1.00 13.15 ? 291  TRP A O   1 
ATOM   1421 C  CB  . TRP A 1 184 ? 37.941 -35.357 -0.719  1.00 12.27 ? 291  TRP A CB  1 
ATOM   1422 C  CG  . TRP A 1 184 ? 39.368 -34.958 -0.996  1.00 12.42 ? 291  TRP A CG  1 
ATOM   1423 C  CD1 . TRP A 1 184 ? 40.411 -35.772 -1.369  1.00 13.25 ? 291  TRP A CD1 1 
ATOM   1424 C  CD2 . TRP A 1 184 ? 39.890 -33.631 -0.949  1.00 12.44 ? 291  TRP A CD2 1 
ATOM   1425 N  NE1 . TRP A 1 184 ? 41.554 -35.021 -1.548  1.00 12.59 ? 291  TRP A NE1 1 
ATOM   1426 C  CE2 . TRP A 1 184 ? 41.258 -33.704 -1.296  1.00 14.50 ? 291  TRP A CE2 1 
ATOM   1427 C  CE3 . TRP A 1 184 ? 39.331 -32.381 -0.643  1.00 11.28 ? 291  TRP A CE3 1 
ATOM   1428 C  CZ2 . TRP A 1 184 ? 42.079 -32.572 -1.338  1.00 14.69 ? 291  TRP A CZ2 1 
ATOM   1429 C  CZ3 . TRP A 1 184 ? 40.152 -31.258 -0.677  1.00 11.22 ? 291  TRP A CZ3 1 
ATOM   1430 C  CH2 . TRP A 1 184 ? 41.507 -31.364 -1.019  1.00 13.14 ? 291  TRP A CH2 1 
ATOM   1431 N  N   . ALA A 1 185 ? 37.735 -37.100 -3.435  1.00 11.25 ? 292  ALA A N   1 
ATOM   1432 C  CA  . ALA A 1 185 ? 37.827 -38.491 -3.866  1.00 11.51 ? 292  ALA A CA  1 
ATOM   1433 C  C   . ALA A 1 185 ? 38.719 -39.261 -2.900  1.00 12.79 ? 292  ALA A C   1 
ATOM   1434 O  O   . ALA A 1 185 ? 39.775 -38.766 -2.521  1.00 14.33 ? 292  ALA A O   1 
ATOM   1435 C  CB  . ALA A 1 185 ? 38.387 -38.573 -5.292  1.00 12.46 ? 292  ALA A CB  1 
ATOM   1436 N  N   . SER A 1 186 ? 38.307 -40.463 -2.503  1.00 11.46 ? 293  SER A N   1 
ATOM   1437 C  CA  . SER A 1 186 ? 39.034 -41.194 -1.462  1.00 11.30 ? 293  SER A CA  1 
ATOM   1438 C  C   . SER A 1 186 ? 40.362 -41.798 -1.910  1.00 12.42 ? 293  SER A C   1 
ATOM   1439 O  O   . SER A 1 186 ? 41.144 -42.237 -1.069  1.00 14.95 ? 293  SER A O   1 
ATOM   1440 C  CB  . SER A 1 186 ? 38.165 -42.309 -0.877  1.00 11.97 ? 293  SER A CB  1 
ATOM   1441 O  OG  . SER A 1 186 ? 37.751 -43.208 -1.887  1.00 12.12 ? 293  SER A OG  1 
ATOM   1442 N  N   . GLY A 1 187 ? 40.626 -41.846 -3.211  1.00 11.69 ? 294  GLY A N   1 
ATOM   1443 C  CA  . GLY A 1 187 ? 41.914 -42.357 -3.661  1.00 12.58 ? 294  GLY A CA  1 
ATOM   1444 C  C   . GLY A 1 187 ? 41.832 -43.381 -4.789  1.00 12.07 ? 294  GLY A C   1 
ATOM   1445 O  O   . GLY A 1 187 ? 40.781 -43.970 -5.034  1.00 12.83 ? 294  GLY A O   1 
ATOM   1446 N  N   . ASN A 1 188 ? 42.960 -43.605 -5.455  1.00 11.02 ? 295  ASN A N   1 
ATOM   1447 C  CA  . ASN A 1 188 ? 43.012 -44.488 -6.618  1.00 11.87 ? 295  ASN A CA  1 
ATOM   1448 C  C   . ASN A 1 188 ? 44.035 -45.608 -6.458  1.00 13.64 ? 295  ASN A C   1 
ATOM   1449 O  O   . ASN A 1 188 ? 44.473 -46.205 -7.456  1.00 15.46 ? 295  ASN A O   1 
ATOM   1450 C  CB  . ASN A 1 188 ? 43.344 -43.672 -7.871  1.00 17.50 ? 295  ASN A CB  1 
ATOM   1451 C  CG  . ASN A 1 188 ? 42.442 -43.993 -9.028  1.00 27.23 ? 295  ASN A CG  1 
ATOM   1452 O  OD1 . ASN A 1 188 ? 41.221 -44.110 -8.870  1.00 25.02 ? 295  ASN A OD1 1 
ATOM   1453 N  ND2 . ASN A 1 188 ? 43.035 -44.151 -10.210 1.00 35.97 ? 295  ASN A ND2 1 
ATOM   1454 N  N   . GLY A 1 189 ? 44.407 -45.892 -5.211  1.00 13.17 ? 296  GLY A N   1 
ATOM   1455 C  CA  . GLY A 1 189 ? 45.511 -46.789 -4.907  1.00 11.39 ? 296  GLY A CA  1 
ATOM   1456 C  C   . GLY A 1 189 ? 45.184 -48.255 -4.702  1.00 14.12 ? 296  GLY A C   1 
ATOM   1457 O  O   . GLY A 1 189 ? 45.988 -48.988 -4.135  1.00 13.39 ? 296  GLY A O   1 
ATOM   1458 N  N   . GLY A 1 190 ? 44.017 -48.685 -5.168  1.00 12.78 ? 297  GLY A N   1 
ATOM   1459 C  CA  . GLY A 1 190 ? 43.593 -50.072 -5.020  1.00 12.83 ? 297  GLY A CA  1 
ATOM   1460 C  C   . GLY A 1 190 ? 44.611 -51.106 -5.474  1.00 14.10 ? 297  GLY A C   1 
ATOM   1461 O  O   . GLY A 1 190 ? 44.833 -52.111 -4.799  1.00 13.85 ? 297  GLY A O   1 
ATOM   1462 N  N   . ARG A 1 191 ? 45.248 -50.864 -6.614  1.00 13.85 ? 298  ARG A N   1 
ATOM   1463 C  CA  . ARG A 1 191 ? 46.211 -51.835 -7.126  1.00 14.99 ? 298  ARG A CA  1 
ATOM   1464 C  C   . ARG A 1 191 ? 47.420 -51.999 -6.191  1.00 17.85 ? 298  ARG A C   1 
ATOM   1465 O  O   . ARG A 1 191 ? 48.041 -53.066 -6.133  1.00 15.00 ? 298  ARG A O   1 
ATOM   1466 C  CB  . ARG A 1 191 ? 46.671 -51.420 -8.527  1.00 16.95 ? 298  ARG A CB  1 
ATOM   1467 C  CG  . ARG A 1 191 ? 47.611 -52.391 -9.153  1.00 23.38 ? 298  ARG A CG  1 
ATOM   1468 C  CD  . ARG A 1 191 ? 48.115 -51.867 -10.488 1.00 24.85 ? 298  ARG A CD  1 
ATOM   1469 N  NE  . ARG A 1 191 ? 48.916 -52.876 -11.163 1.00 30.06 ? 298  ARG A NE  1 
ATOM   1470 C  CZ  . ARG A 1 191 ? 49.651 -52.642 -12.243 1.00 47.53 ? 298  ARG A CZ  1 
ATOM   1471 N  NH1 . ARG A 1 191 ? 50.349 -53.626 -12.789 1.00 47.10 ? 298  ARG A NH1 1 
ATOM   1472 N  NH2 . ARG A 1 191 ? 49.689 -51.427 -12.773 1.00 43.34 ? 298  ARG A NH2 1 
ATOM   1473 N  N   . GLU A 1 192 ? 47.743 -50.939 -5.455  1.00 15.39 ? 299  GLU A N   1 
ATOM   1474 C  CA  . GLU A 1 192 ? 48.874 -50.959 -4.529  1.00 16.90 ? 299  GLU A CA  1 
ATOM   1475 C  C   . GLU A 1 192 ? 48.453 -51.319 -3.114  1.00 16.33 ? 299  GLU A C   1 
ATOM   1476 O  O   . GLU A 1 192 ? 49.237 -51.168 -2.181  1.00 16.09 ? 299  GLU A O   1 
ATOM   1477 C  CB  . GLU A 1 192 ? 49.585 -49.599 -4.515  1.00 15.11 ? 299  GLU A CB  1 
ATOM   1478 C  CG  . GLU A 1 192 ? 49.999 -49.112 -5.891  1.00 17.97 ? 299  GLU A CG  1 
ATOM   1479 C  CD  . GLU A 1 192 ? 50.903 -50.097 -6.622  1.00 32.36 ? 299  GLU A CD  1 
ATOM   1480 O  OE1 . GLU A 1 192 ? 51.756 -50.745 -5.974  1.00 33.71 ? 299  GLU A OE1 1 
ATOM   1481 O  OE2 . GLU A 1 192 ? 50.759 -50.224 -7.858  1.00 48.02 ? 299  GLU A OE2 1 
ATOM   1482 N  N   . HIS A 1 193 ? 47.215 -51.788 -2.967  1.00 14.04 ? 300  HIS A N   1 
ATOM   1483 C  CA  . HIS A 1 193 ? 46.673 -52.186 -1.667  1.00 14.16 ? 300  HIS A CA  1 
ATOM   1484 C  C   . HIS A 1 193 ? 46.727 -51.035 -0.679  1.00 14.74 ? 300  HIS A C   1 
ATOM   1485 O  O   . HIS A 1 193 ? 46.973 -51.239 0.511   1.00 14.64 ? 300  HIS A O   1 
ATOM   1486 C  CB  . HIS A 1 193 ? 47.427 -53.405 -1.116  1.00 15.85 ? 300  HIS A CB  1 
ATOM   1487 C  CG  . HIS A 1 193 ? 47.349 -54.597 -2.014  1.00 21.74 ? 300  HIS A CG  1 
ATOM   1488 N  ND1 . HIS A 1 193 ? 46.206 -55.358 -2.135  1.00 24.25 ? 300  HIS A ND1 1 
ATOM   1489 C  CD2 . HIS A 1 193 ? 48.251 -55.129 -2.874  1.00 27.17 ? 300  HIS A CD2 1 
ATOM   1490 C  CE1 . HIS A 1 193 ? 46.413 -56.317 -3.020  1.00 26.91 ? 300  HIS A CE1 1 
ATOM   1491 N  NE2 . HIS A 1 193 ? 47.647 -56.201 -3.481  1.00 23.36 ? 300  HIS A NE2 1 
ATOM   1492 N  N   . ASP A 1 194 ? 46.477 -49.828 -1.177  1.00 10.98 ? 301  ASP A N   1 
ATOM   1493 C  CA  . ASP A 1 194 ? 46.491 -48.639 -0.323  1.00 12.00 ? 301  ASP A CA  1 
ATOM   1494 C  C   . ASP A 1 194 ? 45.284 -48.644 0.613   1.00 14.71 ? 301  ASP A C   1 
ATOM   1495 O  O   . ASP A 1 194 ? 44.290 -49.297 0.338   1.00 16.68 ? 301  ASP A O   1 
ATOM   1496 C  CB  . ASP A 1 194 ? 46.494 -47.373 -1.179  1.00 11.65 ? 301  ASP A CB  1 
ATOM   1497 C  CG  . ASP A 1 194 ? 47.113 -46.174 -0.467  1.00 13.77 ? 301  ASP A CG  1 
ATOM   1498 O  OD1 . ASP A 1 194 ? 47.473 -46.278 0.725   1.00 14.03 ? 301  ASP A OD1 1 
ATOM   1499 O  OD2 . ASP A 1 194 ? 47.249 -45.118 -1.125  1.00 12.90 ? 301  ASP A OD2 1 
ATOM   1500 N  N   . SER A 1 195 ? 45.385 -47.910 1.717   1.00 10.55 ? 302  SER A N   1 
ATOM   1501 C  CA  . SER A 1 195 ? 44.332 -47.837 2.737   1.00 13.45 ? 302  SER A CA  1 
ATOM   1502 C  C   . SER A 1 195 ? 44.097 -46.342 2.958   1.00 16.19 ? 302  SER A C   1 
ATOM   1503 O  O   . SER A 1 195 ? 45.027 -45.647 3.373   1.00 17.19 ? 302  SER A O   1 
ATOM   1504 C  CB  . SER A 1 195 ? 44.788 -48.563 4.019   1.00 17.54 ? 302  SER A CB  1 
ATOM   1505 O  OG  . SER A 1 195 ? 43.746 -48.762 4.964   1.00 18.03 ? 302  SER A OG  1 
ATOM   1506 N  N   . CYS A 1 196 ? 42.906 -45.815 2.652   1.00 12.05 ? 303  CYS A N   1 
ATOM   1507 C  CA  . CYS A 1 196 ? 42.812 -44.356 2.484   1.00 11.35 ? 303  CYS A CA  1 
ATOM   1508 C  C   . CYS A 1 196 ? 42.819 -43.511 3.775   1.00 13.20 ? 303  CYS A C   1 
ATOM   1509 O  O   . CYS A 1 196 ? 42.881 -42.291 3.675   1.00 13.13 ? 303  CYS A O   1 
ATOM   1510 C  CB  . CYS A 1 196 ? 41.590 -43.951 1.624   1.00 15.09 ? 303  CYS A CB  1 
ATOM   1511 S  SG  . CYS A 1 196 ? 40.037 -44.906 1.704   1.00 18.85 ? 303  CYS A SG  1 
ATOM   1512 N  N   . ASN A 1 197 ? 42.801 -44.106 4.975   1.00 11.91 ? 304  ASN A N   1 
ATOM   1513 C  CA  . ASN A 1 197 ? 42.951 -43.252 6.166   1.00 11.34 ? 304  ASN A CA  1 
ATOM   1514 C  C   . ASN A 1 197 ? 44.386 -42.727 6.273   1.00 10.96 ? 304  ASN A C   1 
ATOM   1515 O  O   . ASN A 1 197 ? 44.661 -41.834 7.068   1.00 13.05 ? 304  ASN A O   1 
ATOM   1516 C  CB  . ASN A 1 197 ? 42.571 -43.979 7.472   1.00 10.68 ? 304  ASN A CB  1 
ATOM   1517 C  CG  . ASN A 1 197 ? 41.070 -44.189 7.619   1.00 14.82 ? 304  ASN A CG  1 
ATOM   1518 O  OD1 . ASN A 1 197 ? 40.270 -43.608 6.885   1.00 16.09 ? 304  ASN A OD1 1 
ATOM   1519 N  ND2 . ASN A 1 197 ? 40.684 -45.016 8.579   1.00 15.19 ? 304  ASN A ND2 1 
ATOM   1520 N  N   . CYS A 1 198 ? 45.291 -43.271 5.455   1.00 11.83 ? 305  CYS A N   1 
ATOM   1521 C  CA  . CYS A 1 198 ? 46.677 -42.787 5.399   1.00 12.18 ? 305  CYS A CA  1 
ATOM   1522 C  C   . CYS A 1 198 ? 46.837 -41.546 4.538   1.00 11.10 ? 305  CYS A C   1 
ATOM   1523 O  O   . CYS A 1 198 ? 47.944 -41.054 4.356   1.00 13.08 ? 305  CYS A O   1 
ATOM   1524 C  CB  . CYS A 1 198 ? 47.611 -43.870 4.861   1.00 11.34 ? 305  CYS A CB  1 
ATOM   1525 S  SG  . CYS A 1 198 ? 47.780 -45.277 5.982   1.00 15.04 ? 305  CYS A SG  1 
ATOM   1526 N  N   . ASP A 1 199 ? 45.725 -41.076 3.993   1.00 11.06 ? 306  ASP A N   1 
ATOM   1527 C  CA  . ASP A 1 199 ? 45.655 -39.863 3.179   1.00 11.07 ? 306  ASP A CA  1 
ATOM   1528 C  C   . ASP A 1 199 ? 44.903 -38.834 4.021   1.00 15.05 ? 306  ASP A C   1 
ATOM   1529 O  O   . ASP A 1 199 ? 43.693 -38.954 4.211   1.00 10.62 ? 306  ASP A O   1 
ATOM   1530 C  CB  . ASP A 1 199 ? 44.956 -40.194 1.839   1.00 10.46 ? 306  ASP A CB  1 
ATOM   1531 C  CG  . ASP A 1 199 ? 44.553 -38.962 1.016   1.00 15.59 ? 306  ASP A CG  1 
ATOM   1532 O  OD1 . ASP A 1 199 ? 44.573 -37.816 1.509   1.00 11.84 ? 306  ASP A OD1 1 
ATOM   1533 O  OD2 . ASP A 1 199 ? 44.169 -39.170 -0.154  1.00 13.63 ? 306  ASP A OD2 1 
ATOM   1534 N  N   . GLY A 1 200 ? 45.620 -37.848 4.559   1.00 10.79 ? 307  GLY A N   1 
ATOM   1535 C  CA  . GLY A 1 200 ? 45.017 -36.924 5.518   1.00 11.22 ? 307  GLY A CA  1 
ATOM   1536 C  C   . GLY A 1 200 ? 43.998 -35.968 4.915   1.00 12.19 ? 307  GLY A C   1 
ATOM   1537 O  O   . GLY A 1 200 ? 43.262 -35.308 5.647   1.00 11.76 ? 307  GLY A O   1 
ATOM   1538 N  N   . TYR A 1 201 ? 43.975 -35.853 3.588   1.00 8.79  ? 308  TYR A N   1 
ATOM   1539 C  CA  . TYR A 1 201 ? 42.987 -34.999 2.928   1.00 10.93 ? 308  TYR A CA  1 
ATOM   1540 C  C   . TYR A 1 201 ? 41.608 -35.656 2.947   1.00 12.86 ? 308  TYR A C   1 
ATOM   1541 O  O   . TYR A 1 201 ? 40.615 -35.057 3.394   1.00 13.45 ? 308  TYR A O   1 
ATOM   1542 C  CB  . TYR A 1 201 ? 43.432 -34.670 1.484   1.00 10.77 ? 308  TYR A CB  1 
ATOM   1543 C  CG  . TYR A 1 201 ? 44.727 -33.893 1.479   1.00 10.39 ? 308  TYR A CG  1 
ATOM   1544 C  CD1 . TYR A 1 201 ? 45.956 -34.554 1.529   1.00 11.75 ? 308  TYR A CD1 1 
ATOM   1545 C  CD2 . TYR A 1 201 ? 44.728 -32.502 1.477   1.00 13.59 ? 308  TYR A CD2 1 
ATOM   1546 C  CE1 . TYR A 1 201 ? 47.151 -33.848 1.554   1.00 15.33 ? 308  TYR A CE1 1 
ATOM   1547 C  CE2 . TYR A 1 201 ? 45.928 -31.781 1.498   1.00 10.97 ? 308  TYR A CE2 1 
ATOM   1548 C  CZ  . TYR A 1 201 ? 47.128 -32.466 1.531   1.00 13.28 ? 308  TYR A CZ  1 
ATOM   1549 O  OH  . TYR A 1 201 ? 48.320 -31.780 1.557   1.00 13.66 ? 308  TYR A OH  1 
ATOM   1550 N  N   . THR A 1 202 ? 41.533 -36.903 2.500   1.00 10.57 ? 309  THR A N   1 
ATOM   1551 C  CA  . THR A 1 202 ? 40.250 -37.592 2.527   1.00 10.21 ? 309  THR A CA  1 
ATOM   1552 C  C   . THR A 1 202 ? 39.863 -38.014 3.958   1.00 15.04 ? 309  THR A C   1 
ATOM   1553 O  O   . THR A 1 202 ? 38.673 -38.063 4.305   1.00 10.28 ? 309  THR A O   1 
ATOM   1554 C  CB  . THR A 1 202 ? 40.255 -38.821 1.569   1.00 13.53 ? 309  THR A CB  1 
ATOM   1555 O  OG1 . THR A 1 202 ? 38.920 -39.307 1.412   1.00 13.68 ? 309  THR A OG1 1 
ATOM   1556 C  CG2 . THR A 1 202 ? 41.169 -39.955 2.079   1.00 10.87 ? 309  THR A CG2 1 
ATOM   1557 N  N   . ASN A 1 203 ? 40.866 -38.291 4.788   1.00 10.79 ? 310  ASN A N   1 
ATOM   1558 C  CA  . ASN A 1 203 ? 40.651 -38.711 6.176   1.00 9.01  ? 310  ASN A CA  1 
ATOM   1559 C  C   . ASN A 1 203 ? 40.168 -37.557 7.085   1.00 13.45 ? 310  ASN A C   1 
ATOM   1560 O  O   . ASN A 1 203 ? 39.787 -37.773 8.236   1.00 13.45 ? 310  ASN A O   1 
ATOM   1561 C  CB  . ASN A 1 203 ? 41.957 -39.324 6.710   1.00 13.41 ? 310  ASN A CB  1 
ATOM   1562 C  CG  . ASN A 1 203 ? 41.831 -39.880 8.122   1.00 17.87 ? 310  ASN A CG  1 
ATOM   1563 O  OD1 . ASN A 1 203 ? 41.064 -40.809 8.374   1.00 16.80 ? 310  ASN A OD1 1 
ATOM   1564 N  ND2 . ASN A 1 203 ? 42.624 -39.344 9.037   1.00 19.21 ? 310  ASN A ND2 1 
ATOM   1565 N  N   . SER A 1 204 ? 40.182 -36.337 6.557   1.00 11.18 ? 311  SER A N   1 
ATOM   1566 C  CA  . SER A 1 204 ? 39.735 -35.157 7.299   1.00 12.26 ? 311  SER A CA  1 
ATOM   1567 C  C   . SER A 1 204 ? 38.232 -35.162 7.559   1.00 10.58 ? 311  SER A C   1 
ATOM   1568 O  O   . SER A 1 204 ? 37.461 -35.613 6.711   1.00 11.09 ? 311  SER A O   1 
ATOM   1569 C  CB  . SER A 1 204 ? 40.093 -33.888 6.530   1.00 11.17 ? 311  SER A CB  1 
ATOM   1570 O  OG  . SER A 1 204 ? 39.590 -32.735 7.183   1.00 13.39 ? 311  SER A OG  1 
ATOM   1571 N  N   . ILE A 1 205 ? 37.811 -34.633 8.708   1.00 9.68  ? 312  ILE A N   1 
ATOM   1572 C  CA  . ILE A 1 205 ? 36.377 -34.479 8.946   1.00 9.76  ? 312  ILE A CA  1 
ATOM   1573 C  C   . ILE A 1 205 ? 35.797 -33.351 8.087   1.00 10.23 ? 312  ILE A C   1 
ATOM   1574 O  O   . ILE A 1 205 ? 34.595 -33.320 7.842   1.00 10.66 ? 312  ILE A O   1 
ATOM   1575 C  CB  . ILE A 1 205 ? 36.048 -34.207 10.443  1.00 10.34 ? 312  ILE A CB  1 
ATOM   1576 C  CG1 . ILE A 1 205 ? 36.410 -32.771 10.860  1.00 12.40 ? 312  ILE A CG1 1 
ATOM   1577 C  CG2 . ILE A 1 205 ? 36.737 -35.244 11.340  1.00 8.99  ? 312  ILE A CG2 1 
ATOM   1578 C  CD1 . ILE A 1 205 ? 36.032 -32.454 12.324  1.00 13.52 ? 312  ILE A CD1 1 
ATOM   1579 N  N   . TYR A 1 206 ? 36.656 -32.434 7.633   1.00 10.56 ? 313  TYR A N   1 
ATOM   1580 C  CA  . TYR A 1 206 ? 36.212 -31.259 6.879   1.00 11.34 ? 313  TYR A CA  1 
ATOM   1581 C  C   . TYR A 1 206 ? 35.949 -31.565 5.423   1.00 10.22 ? 313  TYR A C   1 
ATOM   1582 O  O   . TYR A 1 206 ? 35.380 -30.737 4.705   1.00 10.88 ? 313  TYR A O   1 
ATOM   1583 C  CB  . TYR A 1 206 ? 37.247 -30.136 6.968   1.00 13.09 ? 313  TYR A CB  1 
ATOM   1584 C  CG  . TYR A 1 206 ? 37.570 -29.810 8.396   1.00 12.48 ? 313  TYR A CG  1 
ATOM   1585 C  CD1 . TYR A 1 206 ? 36.559 -29.445 9.277   1.00 11.07 ? 313  TYR A CD1 1 
ATOM   1586 C  CD2 . TYR A 1 206 ? 38.870 -29.897 8.870   1.00 16.13 ? 313  TYR A CD2 1 
ATOM   1587 C  CE1 . TYR A 1 206 ? 36.835 -29.163 10.601  1.00 14.10 ? 313  TYR A CE1 1 
ATOM   1588 C  CE2 . TYR A 1 206 ? 39.162 -29.616 10.198  1.00 17.85 ? 313  TYR A CE2 1 
ATOM   1589 C  CZ  . TYR A 1 206 ? 38.139 -29.250 11.053  1.00 20.68 ? 313  TYR A CZ  1 
ATOM   1590 O  OH  . TYR A 1 206 ? 38.414 -28.973 12.368  1.00 20.20 ? 313  TYR A OH  1 
ATOM   1591 N  N   . THR A 1 207 ? 36.376 -32.743 4.975   1.00 11.49 ? 314  THR A N   1 
ATOM   1592 C  CA  . THR A 1 207 ? 36.095 -33.145 3.602   1.00 11.46 ? 314  THR A CA  1 
ATOM   1593 C  C   . THR A 1 207 ? 35.031 -34.227 3.562   1.00 12.45 ? 314  THR A C   1 
ATOM   1594 O  O   . THR A 1 207 ? 34.997 -35.122 4.415   1.00 11.31 ? 314  THR A O   1 
ATOM   1595 C  CB  . THR A 1 207 ? 37.358 -33.654 2.874   1.00 11.24 ? 314  THR A CB  1 
ATOM   1596 O  OG1 . THR A 1 207 ? 37.857 -34.824 3.539   1.00 10.37 ? 314  THR A OG1 1 
ATOM   1597 C  CG2 . THR A 1 207 ? 38.442 -32.566 2.854   1.00 10.66 ? 314  THR A CG2 1 
ATOM   1598 N  N   . LEU A 1 208 ? 34.151 -34.120 2.573   1.00 10.66 ? 315  LEU A N   1 
ATOM   1599 C  CA  . LEU A 1 208 ? 33.075 -35.080 2.396   1.00 10.23 ? 315  LEU A CA  1 
ATOM   1600 C  C   . LEU A 1 208 ? 33.573 -36.094 1.366   1.00 12.01 ? 315  LEU A C   1 
ATOM   1601 O  O   . LEU A 1 208 ? 33.595 -35.810 0.170   1.00 12.47 ? 315  LEU A O   1 
ATOM   1602 C  CB  . LEU A 1 208 ? 31.799 -34.367 1.943   1.00 11.43 ? 315  LEU A CB  1 
ATOM   1603 C  CG  . LEU A 1 208 ? 30.446 -35.045 2.133   1.00 14.20 ? 315  LEU A CG  1 
ATOM   1604 C  CD1 . LEU A 1 208 ? 29.324 -34.011 1.949   1.00 13.22 ? 315  LEU A CD1 1 
ATOM   1605 C  CD2 . LEU A 1 208 ? 30.285 -36.202 1.150   1.00 11.83 ? 315  LEU A CD2 1 
ATOM   1606 N  N   . SER A 1 209 ? 33.998 -37.261 1.833   1.00 11.50 ? 316  SER A N   1 
ATOM   1607 C  CA  . SER A 1 209 ? 34.777 -38.169 0.994   1.00 11.93 ? 316  SER A CA  1 
ATOM   1608 C  C   . SER A 1 209 ? 33.937 -39.212 0.280   1.00 12.57 ? 316  SER A C   1 
ATOM   1609 O  O   . SER A 1 209 ? 33.021 -39.811 0.856   1.00 11.30 ? 316  SER A O   1 
ATOM   1610 C  CB  . SER A 1 209 ? 35.850 -38.849 1.839   1.00 10.90 ? 316  SER A CB  1 
ATOM   1611 O  OG  . SER A 1 209 ? 36.723 -37.860 2.364   1.00 13.37 ? 316  SER A OG  1 
ATOM   1612 N  N   . ILE A 1 210 ? 34.302 -39.444 -0.977  1.00 9.85  ? 317  ILE A N   1 
ATOM   1613 C  CA  . ILE A 1 210 ? 33.501 -40.240 -1.894  1.00 9.62  ? 317  ILE A CA  1 
ATOM   1614 C  C   . ILE A 1 210 ? 34.335 -41.347 -2.546  1.00 11.81 ? 317  ILE A C   1 
ATOM   1615 O  O   . ILE A 1 210 ? 35.447 -41.087 -3.020  1.00 11.88 ? 317  ILE A O   1 
ATOM   1616 C  CB  . ILE A 1 210 ? 32.907 -39.343 -2.998  1.00 11.77 ? 317  ILE A CB  1 
ATOM   1617 C  CG1 . ILE A 1 210 ? 32.065 -38.223 -2.377  1.00 13.17 ? 317  ILE A CG1 1 
ATOM   1618 C  CG2 . ILE A 1 210 ? 32.110 -40.174 -4.027  1.00 11.79 ? 317  ILE A CG2 1 
ATOM   1619 C  CD1 . ILE A 1 210 ? 30.810 -38.717 -1.633  1.00 13.90 ? 317  ILE A CD1 1 
ATOM   1620 N  N   . SER A 1 211 ? 33.790 -42.562 -2.583  1.00 8.85  ? 318  SER A N   1 
ATOM   1621 C  CA  . SER A 1 211 ? 34.406 -43.677 -3.313  1.00 10.99 ? 318  SER A CA  1 
ATOM   1622 C  C   . SER A 1 211 ? 33.584 -44.071 -4.545  1.00 9.43  ? 318  SER A C   1 
ATOM   1623 O  O   . SER A 1 211 ? 32.580 -43.424 -4.853  1.00 10.42 ? 318  SER A O   1 
ATOM   1624 C  CB  . SER A 1 211 ? 34.584 -44.882 -2.398  1.00 9.41  ? 318  SER A CB  1 
ATOM   1625 O  OG  . SER A 1 211 ? 35.534 -44.580 -1.382  1.00 14.26 ? 318  SER A OG  1 
ATOM   1626 N  N   . SER A 1 212 ? 34.021 -45.126 -5.239  1.00 9.97  ? 319  SER A N   1 
ATOM   1627 C  CA  . SER A 1 212 ? 33.441 -45.520 -6.533  1.00 10.50 ? 319  SER A CA  1 
ATOM   1628 C  C   . SER A 1 212 ? 32.776 -46.893 -6.526  1.00 10.00 ? 319  SER A C   1 
ATOM   1629 O  O   . SER A 1 212 ? 33.159 -47.780 -5.767  1.00 11.85 ? 319  SER A O   1 
ATOM   1630 C  CB  . SER A 1 212 ? 34.524 -45.528 -7.627  1.00 9.36  ? 319  SER A CB  1 
ATOM   1631 O  OG  . SER A 1 212 ? 35.133 -44.264 -7.784  1.00 12.06 ? 319  SER A OG  1 
ATOM   1632 N  N   . ALA A 1 213 ? 31.789 -47.065 -7.401  1.00 10.80 ? 320  ALA A N   1 
ATOM   1633 C  CA  . ALA A 1 213 ? 31.253 -48.385 -7.712  1.00 10.84 ? 320  ALA A CA  1 
ATOM   1634 C  C   . ALA A 1 213 ? 31.259 -48.570 -9.222  1.00 9.48  ? 320  ALA A C   1 
ATOM   1635 O  O   . ALA A 1 213 ? 31.040 -47.622 -9.956  1.00 11.34 ? 320  ALA A O   1 
ATOM   1636 C  CB  . ALA A 1 213 ? 29.842 -48.548 -7.181  1.00 11.88 ? 320  ALA A CB  1 
ATOM   1637 N  N   . THR A 1 214 ? 31.475 -49.790 -9.689  1.00 12.32 ? 321  THR A N   1 
ATOM   1638 C  CA  . THR A 1 214 ? 31.403 -50.030 -11.130 1.00 13.24 ? 321  THR A CA  1 
ATOM   1639 C  C   . THR A 1 214 ? 29.943 -50.128 -11.597 1.00 14.94 ? 321  THR A C   1 
ATOM   1640 O  O   . THR A 1 214 ? 29.025 -50.215 -10.780 1.00 15.39 ? 321  THR A O   1 
ATOM   1641 C  CB  . THR A 1 214 ? 32.138 -51.320 -11.538 1.00 13.26 ? 321  THR A CB  1 
ATOM   1642 O  OG1 . THR A 1 214 ? 31.393 -52.458 -11.085 1.00 13.59 ? 321  THR A OG1 1 
ATOM   1643 C  CG2 . THR A 1 214 ? 33.547 -51.362 -10.954 1.00 12.46 ? 321  THR A CG2 1 
ATOM   1644 N  N   . GLN A 1 215 ? 29.730 -50.146 -12.911 1.00 12.62 ? 322  GLN A N   1 
ATOM   1645 C  CA  . GLN A 1 215 ? 28.371 -50.233 -13.440 1.00 14.55 ? 322  GLN A CA  1 
ATOM   1646 C  C   . GLN A 1 215 ? 27.606 -51.453 -12.920 1.00 15.79 ? 322  GLN A C   1 
ATOM   1647 O  O   . GLN A 1 215 ? 26.417 -51.355 -12.635 1.00 15.60 ? 322  GLN A O   1 
ATOM   1648 C  CB  . GLN A 1 215 ? 28.389 -50.257 -14.977 1.00 14.18 ? 322  GLN A CB  1 
ATOM   1649 C  CG  . GLN A 1 215 ? 27.005 -50.162 -15.594 1.00 16.12 ? 322  GLN A CG  1 
ATOM   1650 C  CD  . GLN A 1 215 ? 27.037 -50.223 -17.111 1.00 18.94 ? 322  GLN A CD  1 
ATOM   1651 O  OE1 . GLN A 1 215 ? 27.984 -50.748 -17.707 1.00 16.27 ? 322  GLN A OE1 1 
ATOM   1652 N  NE2 . GLN A 1 215 ? 26.004 -49.674 -17.747 1.00 25.13 ? 322  GLN A NE2 1 
ATOM   1653 N  N   . PHE A 1 216 ? 28.285 -52.591 -12.781 1.00 13.89 ? 323  PHE A N   1 
ATOM   1654 C  CA  . PHE A 1 216 ? 27.616 -53.814 -12.338 1.00 17.30 ? 323  PHE A CA  1 
ATOM   1655 C  C   . PHE A 1 216 ? 27.560 -53.896 -10.806 1.00 19.85 ? 323  PHE A C   1 
ATOM   1656 O  O   . PHE A 1 216 ? 27.182 -54.921 -10.246 1.00 17.17 ? 323  PHE A O   1 
ATOM   1657 C  CB  . PHE A 1 216 ? 28.305 -55.063 -12.915 1.00 17.93 ? 323  PHE A CB  1 
ATOM   1658 C  CG  . PHE A 1 216 ? 28.375 -55.080 -14.428 1.00 16.42 ? 323  PHE A CG  1 
ATOM   1659 C  CD1 . PHE A 1 216 ? 27.526 -54.285 -15.189 1.00 19.26 ? 323  PHE A CD1 1 
ATOM   1660 C  CD2 . PHE A 1 216 ? 29.289 -55.894 -15.081 1.00 21.19 ? 323  PHE A CD2 1 
ATOM   1661 C  CE1 . PHE A 1 216 ? 27.587 -54.296 -16.590 1.00 22.92 ? 323  PHE A CE1 1 
ATOM   1662 C  CE2 . PHE A 1 216 ? 29.361 -55.918 -16.477 1.00 24.41 ? 323  PHE A CE2 1 
ATOM   1663 C  CZ  . PHE A 1 216 ? 28.510 -55.112 -17.231 1.00 21.52 ? 323  PHE A CZ  1 
ATOM   1664 N  N   . GLY A 1 217 ? 27.938 -52.811 -10.137 1.00 14.78 ? 324  GLY A N   1 
ATOM   1665 C  CA  . GLY A 1 217 ? 27.803 -52.722 -8.693  1.00 16.49 ? 324  GLY A CA  1 
ATOM   1666 C  C   . GLY A 1 217 ? 28.927 -53.353 -7.895  1.00 19.45 ? 324  GLY A C   1 
ATOM   1667 O  O   . GLY A 1 217 ? 28.712 -53.814 -6.773  1.00 16.86 ? 324  GLY A O   1 
ATOM   1668 N  N   . ASN A 1 218 ? 30.133 -53.370 -8.454  1.00 13.20 ? 325  ASN A N   1 
ATOM   1669 C  CA  . ASN A 1 218 ? 31.264 -53.955 -7.748  1.00 15.06 ? 325  ASN A CA  1 
ATOM   1670 C  C   . ASN A 1 218 ? 32.305 -52.915 -7.320  1.00 12.71 ? 325  ASN A C   1 
ATOM   1671 O  O   . ASN A 1 218 ? 32.256 -51.755 -7.731  1.00 12.03 ? 325  ASN A O   1 
ATOM   1672 C  CB  . ASN A 1 218 ? 31.909 -55.044 -8.620  1.00 17.07 ? 325  ASN A CB  1 
ATOM   1673 C  CG  . ASN A 1 218 ? 31.027 -56.282 -8.728  1.00 20.05 ? 325  ASN A CG  1 
ATOM   1674 O  OD1 . ASN A 1 218 ? 30.525 -56.784 -7.717  1.00 22.02 ? 325  ASN A OD1 1 
ATOM   1675 N  ND2 . ASN A 1 218 ? 30.802 -56.750 -9.948  1.00 17.24 ? 325  ASN A ND2 1 
ATOM   1676 N  N   . VAL A 1 219 ? 33.223 -53.342 -6.462  1.00 11.21 ? 326  VAL A N   1 
ATOM   1677 C  CA  . VAL A 1 219 ? 34.292 -52.475 -6.001  1.00 11.82 ? 326  VAL A CA  1 
ATOM   1678 C  C   . VAL A 1 219 ? 35.359 -52.461 -7.078  1.00 10.89 ? 326  VAL A C   1 
ATOM   1679 O  O   . VAL A 1 219 ? 35.950 -53.503 -7.369  1.00 13.50 ? 326  VAL A O   1 
ATOM   1680 C  CB  . VAL A 1 219 ? 34.893 -52.967 -4.679  1.00 12.83 ? 326  VAL A CB  1 
ATOM   1681 C  CG1 . VAL A 1 219 ? 36.051 -52.055 -4.260  1.00 11.72 ? 326  VAL A CG1 1 
ATOM   1682 C  CG2 . VAL A 1 219 ? 33.811 -53.044 -3.601  1.00 13.08 ? 326  VAL A CG2 1 
ATOM   1683 N  N   . PRO A 1 220 ? 35.602 -51.294 -7.686  1.00 12.49 ? 327  PRO A N   1 
ATOM   1684 C  CA  . PRO A 1 220 ? 36.551 -51.244 -8.813  1.00 12.15 ? 327  PRO A CA  1 
ATOM   1685 C  C   . PRO A 1 220 ? 37.975 -51.603 -8.399  1.00 13.54 ? 327  PRO A C   1 
ATOM   1686 O  O   . PRO A 1 220 ? 38.330 -51.495 -7.221  1.00 12.81 ? 327  PRO A O   1 
ATOM   1687 C  CB  . PRO A 1 220 ? 36.497 -49.785 -9.276  1.00 13.73 ? 327  PRO A CB  1 
ATOM   1688 C  CG  . PRO A 1 220 ? 35.286 -49.175 -8.596  1.00 15.20 ? 327  PRO A CG  1 
ATOM   1689 C  CD  . PRO A 1 220 ? 34.993 -49.986 -7.381  1.00 11.66 ? 327  PRO A CD  1 
ATOM   1690 N  N   . TRP A 1 221 ? 38.790 -51.987 -9.379  1.00 11.00 ? 328  TRP A N   1 
ATOM   1691 C  CA  . TRP A 1 221 ? 40.183 -52.339 -9.128  1.00 12.93 ? 328  TRP A CA  1 
ATOM   1692 C  C   . TRP A 1 221 ? 40.958 -51.239 -8.409  1.00 12.45 ? 328  TRP A C   1 
ATOM   1693 O  O   . TRP A 1 221 ? 41.846 -51.534 -7.613  1.00 12.99 ? 328  TRP A O   1 
ATOM   1694 C  CB  . TRP A 1 221 ? 40.892 -52.672 -10.450 1.00 12.66 ? 328  TRP A CB  1 
ATOM   1695 C  CG  . TRP A 1 221 ? 41.046 -51.506 -11.418 1.00 10.89 ? 328  TRP A CG  1 
ATOM   1696 C  CD1 . TRP A 1 221 ? 40.163 -51.113 -12.391 1.00 13.86 ? 328  TRP A CD1 1 
ATOM   1697 C  CD2 . TRP A 1 221 ? 42.173 -50.634 -11.526 1.00 12.25 ? 328  TRP A CD2 1 
ATOM   1698 N  NE1 . TRP A 1 221 ? 40.676 -50.037 -13.092 1.00 12.71 ? 328  TRP A NE1 1 
ATOM   1699 C  CE2 . TRP A 1 221 ? 41.907 -49.727 -12.574 1.00 15.93 ? 328  TRP A CE2 1 
ATOM   1700 C  CE3 . TRP A 1 221 ? 43.384 -50.528 -10.828 1.00 13.72 ? 328  TRP A CE3 1 
ATOM   1701 C  CZ2 . TRP A 1 221 ? 42.805 -48.724 -12.940 1.00 14.14 ? 328  TRP A CZ2 1 
ATOM   1702 C  CZ3 . TRP A 1 221 ? 44.273 -49.535 -11.191 1.00 17.54 ? 328  TRP A CZ3 1 
ATOM   1703 C  CH2 . TRP A 1 221 ? 43.976 -48.645 -12.236 1.00 19.44 ? 328  TRP A CH2 1 
ATOM   1704 N  N   . TYR A 1 222 ? 40.628 -49.978 -8.692  1.00 11.44 ? 329  TYR A N   1 
ATOM   1705 C  CA  . TYR A 1 222 ? 41.411 -48.846 -8.174  1.00 13.95 ? 329  TYR A CA  1 
ATOM   1706 C  C   . TYR A 1 222 ? 40.958 -48.351 -6.785  1.00 16.24 ? 329  TYR A C   1 
ATOM   1707 O  O   . TYR A 1 222 ? 41.597 -47.483 -6.187  1.00 13.26 ? 329  TYR A O   1 
ATOM   1708 C  CB  . TYR A 1 222 ? 41.361 -47.678 -9.182  1.00 12.78 ? 329  TYR A CB  1 
ATOM   1709 C  CG  . TYR A 1 222 ? 39.946 -47.344 -9.605  1.00 12.48 ? 329  TYR A CG  1 
ATOM   1710 C  CD1 . TYR A 1 222 ? 39.116 -46.605 -8.772  1.00 11.51 ? 329  TYR A CD1 1 
ATOM   1711 C  CD2 . TYR A 1 222 ? 39.435 -47.779 -10.836 1.00 12.41 ? 329  TYR A CD2 1 
ATOM   1712 C  CE1 . TYR A 1 222 ? 37.807 -46.311 -9.129  1.00 11.55 ? 329  TYR A CE1 1 
ATOM   1713 C  CE2 . TYR A 1 222 ? 38.124 -47.484 -11.209 1.00 12.57 ? 329  TYR A CE2 1 
ATOM   1714 C  CZ  . TYR A 1 222 ? 37.318 -46.747 -10.342 1.00 13.37 ? 329  TYR A CZ  1 
ATOM   1715 O  OH  . TYR A 1 222 ? 36.021 -46.443 -10.669 1.00 11.71 ? 329  TYR A OH  1 
ATOM   1716 N  N   . SER A 1 223 ? 39.866 -48.902 -6.271  1.00 9.47  ? 330  SER A N   1 
ATOM   1717 C  CA  . SER A 1 223 ? 39.271 -48.393 -5.026  1.00 9.24  ? 330  SER A CA  1 
ATOM   1718 C  C   . SER A 1 223 ? 40.147 -48.625 -3.790  1.00 11.31 ? 330  SER A C   1 
ATOM   1719 O  O   . SER A 1 223 ? 40.811 -49.660 -3.679  1.00 12.40 ? 330  SER A O   1 
ATOM   1720 C  CB  . SER A 1 223 ? 37.905 -49.046 -4.794  1.00 12.37 ? 330  SER A CB  1 
ATOM   1721 O  OG  . SER A 1 223 ? 37.408 -48.718 -3.503  1.00 14.50 ? 330  SER A OG  1 
ATOM   1722 N  N   . GLU A 1 224 ? 40.131 -47.663 -2.867  1.00 12.24 ? 331  GLU A N   1 
ATOM   1723 C  CA  . GLU A 1 224 ? 40.735 -47.836 -1.544  1.00 9.85  ? 331  GLU A CA  1 
ATOM   1724 C  C   . GLU A 1 224 ? 39.654 -47.915 -0.486  1.00 7.80  ? 331  GLU A C   1 
ATOM   1725 O  O   . GLU A 1 224 ? 38.769 -47.060 -0.435  1.00 13.21 ? 331  GLU A O   1 
ATOM   1726 C  CB  . GLU A 1 224 ? 41.682 -46.678 -1.201  1.00 11.81 ? 331  GLU A CB  1 
ATOM   1727 C  CG  . GLU A 1 224 ? 42.814 -46.490 -2.193  1.00 12.71 ? 331  GLU A CG  1 
ATOM   1728 C  CD  . GLU A 1 224 ? 43.753 -45.348 -1.796  1.00 11.69 ? 331  GLU A CD  1 
ATOM   1729 O  OE1 . GLU A 1 224 ? 44.260 -44.668 -2.706  1.00 12.32 ? 331  GLU A OE1 1 
ATOM   1730 O  OE2 . GLU A 1 224 ? 44.006 -45.151 -0.578  1.00 12.81 ? 331  GLU A OE2 1 
ATOM   1731 N  N   . ALA A 1 225 ? 39.749 -48.903 0.394   1.00 9.89  ? 332  ALA A N   1 
ATOM   1732 C  CA  . ALA A 1 225 ? 38.798 -48.985 1.502   1.00 11.18 ? 332  ALA A CA  1 
ATOM   1733 C  C   . ALA A 1 225 ? 39.339 -48.226 2.714   1.00 11.65 ? 332  ALA A C   1 
ATOM   1734 O  O   . ALA A 1 225 ? 40.540 -48.256 2.978   1.00 12.11 ? 332  ALA A O   1 
ATOM   1735 C  CB  . ALA A 1 225 ? 38.521 -50.440 1.856   1.00 14.51 ? 332  ALA A CB  1 
ATOM   1736 N  N   . CYS A 1 226 ? 38.457 -47.533 3.434   1.00 13.21 ? 333  CYS A N   1 
ATOM   1737 C  CA  . CYS A 1 226 ? 38.808 -46.936 4.721   1.00 11.71 ? 333  CYS A CA  1 
ATOM   1738 C  C   . CYS A 1 226 ? 37.552 -46.462 5.430   1.00 13.63 ? 333  CYS A C   1 
ATOM   1739 O  O   . CYS A 1 226 ? 36.499 -46.295 4.813   1.00 13.83 ? 333  CYS A O   1 
ATOM   1740 C  CB  . CYS A 1 226 ? 39.797 -45.772 4.579   1.00 15.51 ? 333  CYS A CB  1 
ATOM   1741 S  SG  . CYS A 1 226 ? 39.272 -44.415 3.517   1.00 21.39 ? 333  CYS A SG  1 
ATOM   1742 N  N   . SER A 1 227 ? 37.683 -46.234 6.732   1.00 12.78 ? 334  SER A N   1 
ATOM   1743 C  CA  . SER A 1 227 ? 36.545 -45.874 7.558   1.00 10.56 ? 334  SER A CA  1 
ATOM   1744 C  C   . SER A 1 227 ? 36.157 -44.401 7.413   1.00 9.96  ? 334  SER A C   1 
ATOM   1745 O  O   . SER A 1 227 ? 35.091 -44.005 7.865   1.00 10.90 ? 334  SER A O   1 
ATOM   1746 C  CB  . SER A 1 227 ? 36.840 -46.198 9.031   1.00 9.74  ? 334  SER A CB  1 
ATOM   1747 O  OG  . SER A 1 227 ? 38.013 -45.521 9.465   1.00 13.20 ? 334  SER A OG  1 
ATOM   1748 N  N   . SER A 1 228 ? 37.004 -43.587 6.782   1.00 11.07 ? 335  SER A N   1 
ATOM   1749 C  CA  . SER A 1 228 ? 36.711 -42.152 6.678   1.00 12.74 ? 335  SER A CA  1 
ATOM   1750 C  C   . SER A 1 228 ? 35.767 -41.820 5.525   1.00 11.72 ? 335  SER A C   1 
ATOM   1751 O  O   . SER A 1 228 ? 35.196 -40.736 5.479   1.00 11.95 ? 335  SER A O   1 
ATOM   1752 C  CB  . SER A 1 228 ? 38.010 -41.339 6.539   1.00 14.17 ? 335  SER A CB  1 
ATOM   1753 O  OG  . SER A 1 228 ? 38.780 -41.748 5.415   1.00 12.59 ? 335  SER A OG  1 
ATOM   1754 N  N   . THR A 1 229 ? 35.587 -42.757 4.601   1.00 11.19 ? 336  THR A N   1 
ATOM   1755 C  CA  . THR A 1 229 ? 34.710 -42.511 3.454   1.00 12.11 ? 336  THR A CA  1 
ATOM   1756 C  C   . THR A 1 229 ? 33.246 -42.389 3.883   1.00 13.35 ? 336  THR A C   1 
ATOM   1757 O  O   . THR A 1 229 ? 32.810 -43.086 4.803   1.00 12.93 ? 336  THR A O   1 
ATOM   1758 C  CB  . THR A 1 229 ? 34.864 -43.632 2.420   1.00 13.79 ? 336  THR A CB  1 
ATOM   1759 O  OG1 . THR A 1 229 ? 36.209 -43.609 1.929   1.00 13.69 ? 336  THR A OG1 1 
ATOM   1760 C  CG2 . THR A 1 229 ? 33.885 -43.451 1.245   1.00 13.14 ? 336  THR A CG2 1 
ATOM   1761 N  N   . LEU A 1 230 ? 32.497 -41.489 3.242   1.00 10.74 ? 337  LEU A N   1 
ATOM   1762 C  CA  . LEU A 1 230 ? 31.088 -41.293 3.597   1.00 12.26 ? 337  LEU A CA  1 
ATOM   1763 C  C   . LEU A 1 230 ? 30.110 -41.968 2.645   1.00 13.42 ? 337  LEU A C   1 
ATOM   1764 O  O   . LEU A 1 230 ? 29.089 -42.510 3.076   1.00 13.16 ? 337  LEU A O   1 
ATOM   1765 C  CB  . LEU A 1 230 ? 30.747 -39.802 3.655   1.00 12.20 ? 337  LEU A CB  1 
ATOM   1766 C  CG  . LEU A 1 230 ? 30.884 -39.090 4.992   1.00 25.03 ? 337  LEU A CG  1 
ATOM   1767 C  CD1 . LEU A 1 230 ? 30.590 -37.606 4.799   1.00 23.11 ? 337  LEU A CD1 1 
ATOM   1768 C  CD2 . LEU A 1 230 ? 29.959 -39.711 6.062   1.00 12.75 ? 337  LEU A CD2 1 
ATOM   1769 N  N   . ALA A 1 231 ? 30.399 -41.910 1.347   1.00 10.42 ? 338  ALA A N   1 
ATOM   1770 C  CA  . ALA A 1 231 ? 29.467 -42.433 0.361   1.00 9.03  ? 338  ALA A CA  1 
ATOM   1771 C  C   . ALA A 1 231 ? 30.141 -42.691 -0.975  1.00 11.43 ? 338  ALA A C   1 
ATOM   1772 O  O   . ALA A 1 231 ? 31.362 -42.575 -1.096  1.00 11.37 ? 338  ALA A O   1 
ATOM   1773 C  CB  . ALA A 1 231 ? 28.286 -41.479 0.177   1.00 11.17 ? 338  ALA A CB  1 
ATOM   1774 N  N   . THR A 1 232 ? 29.322 -43.053 -1.957  1.00 10.66 ? 339  THR A N   1 
ATOM   1775 C  CA  . THR A 1 232 ? 29.783 -43.607 -3.233  1.00 10.10 ? 339  THR A CA  1 
ATOM   1776 C  C   . THR A 1 232 ? 29.044 -43.000 -4.422  1.00 11.73 ? 339  THR A C   1 
ATOM   1777 O  O   . THR A 1 232 ? 27.845 -42.726 -4.334  1.00 11.07 ? 339  THR A O   1 
ATOM   1778 C  CB  . THR A 1 232 ? 29.568 -45.147 -3.252  1.00 11.45 ? 339  THR A CB  1 
ATOM   1779 O  OG1 . THR A 1 232 ? 30.301 -45.738 -2.185  1.00 14.37 ? 339  THR A OG1 1 
ATOM   1780 C  CG2 . THR A 1 232 ? 30.031 -45.775 -4.565  1.00 12.60 ? 339  THR A CG2 1 
ATOM   1781 N  N   . THR A 1 233 ? 29.737 -42.795 -5.543  1.00 11.75 ? 340  THR A N   1 
ATOM   1782 C  CA  . THR A 1 233 ? 29.025 -42.621 -6.806  1.00 11.10 ? 340  THR A CA  1 
ATOM   1783 C  C   . THR A 1 233 ? 29.615 -43.570 -7.839  1.00 13.74 ? 340  THR A C   1 
ATOM   1784 O  O   . THR A 1 233 ? 30.714 -44.093 -7.663  1.00 12.51 ? 340  THR A O   1 
ATOM   1785 C  CB  . THR A 1 233 ? 29.101 -41.178 -7.357  1.00 13.24 ? 340  THR A CB  1 
ATOM   1786 O  OG1 . THR A 1 233 ? 30.452 -40.873 -7.684  1.00 18.51 ? 340  THR A OG1 1 
ATOM   1787 C  CG2 . THR A 1 233 ? 28.599 -40.149 -6.343  1.00 12.12 ? 340  THR A CG2 1 
ATOM   1788 N  N   . TYR A 1 234 ? 28.901 -43.778 -8.935  1.00 14.33 ? 341  TYR A N   1 
ATOM   1789 C  CA  . TYR A 1 234 ? 29.415 -44.658 -9.977  1.00 12.37 ? 341  TYR A CA  1 
ATOM   1790 C  C   . TYR A 1 234 ? 30.641 -44.075 -10.661 1.00 14.18 ? 341  TYR A C   1 
ATOM   1791 O  O   . TYR A 1 234 ? 30.777 -42.856 -10.784 1.00 13.56 ? 341  TYR A O   1 
ATOM   1792 C  CB  . TYR A 1 234 ? 28.331 -44.927 -11.022 1.00 12.48 ? 341  TYR A CB  1 
ATOM   1793 C  CG  . TYR A 1 234 ? 27.273 -45.879 -10.544 1.00 13.53 ? 341  TYR A CG  1 
ATOM   1794 C  CD1 . TYR A 1 234 ? 27.582 -47.206 -10.311 1.00 13.47 ? 341  TYR A CD1 1 
ATOM   1795 C  CD2 . TYR A 1 234 ? 25.963 -45.455 -10.328 1.00 13.46 ? 341  TYR A CD2 1 
ATOM   1796 C  CE1 . TYR A 1 234 ? 26.624 -48.094 -9.879  1.00 18.29 ? 341  TYR A CE1 1 
ATOM   1797 C  CE2 . TYR A 1 234 ? 24.994 -46.342 -9.898  1.00 14.69 ? 341  TYR A CE2 1 
ATOM   1798 C  CZ  . TYR A 1 234 ? 25.330 -47.655 -9.674  1.00 20.08 ? 341  TYR A CZ  1 
ATOM   1799 O  OH  . TYR A 1 234 ? 24.381 -48.552 -9.244  1.00 19.67 ? 341  TYR A OH  1 
ATOM   1800 N  N   . SER A 1 235 ? 31.527 -44.963 -11.106 1.00 12.35 ? 342  SER A N   1 
ATOM   1801 C  CA  . SER A 1 235 ? 32.615 -44.604 -12.013 1.00 12.09 ? 342  SER A CA  1 
ATOM   1802 C  C   . SER A 1 235 ? 32.931 -45.825 -12.886 1.00 12.93 ? 342  SER A C   1 
ATOM   1803 O  O   . SER A 1 235 ? 32.067 -46.679 -13.113 1.00 14.23 ? 342  SER A O   1 
ATOM   1804 C  CB  . SER A 1 235 ? 33.863 -44.133 -11.241 1.00 10.53 ? 342  SER A CB  1 
ATOM   1805 O  OG  . SER A 1 235 ? 34.819 -43.558 -12.134 1.00 12.80 ? 342  SER A OG  1 
ATOM   1806 N  N   . SER A 1 236 ? 34.167 -45.909 -13.361 1.00 13.19 ? 343  SER A N   1 
ATOM   1807 C  CA  . SER A 1 236 ? 34.564 -46.959 -14.298 1.00 14.04 ? 343  SER A CA  1 
ATOM   1808 C  C   . SER A 1 236 ? 34.896 -48.294 -13.625 1.00 12.96 ? 343  SER A C   1 
ATOM   1809 O  O   . SER A 1 236 ? 35.067 -48.373 -12.404 1.00 13.44 ? 343  SER A O   1 
ATOM   1810 C  CB  . SER A 1 236 ? 35.770 -46.479 -15.104 1.00 15.47 ? 343  SER A CB  1 
ATOM   1811 O  OG  . SER A 1 236 ? 36.875 -46.278 -14.235 1.00 13.12 ? 343  SER A OG  1 
ATOM   1812 N  N   . GLY A 1 237 ? 35.001 -49.339 -14.440 1.00 11.99 ? 344  GLY A N   1 
ATOM   1813 C  CA  . GLY A 1 237 ? 35.287 -50.684 -13.966 1.00 12.43 ? 344  GLY A CA  1 
ATOM   1814 C  C   . GLY A 1 237 ? 36.057 -51.432 -15.039 1.00 14.04 ? 344  GLY A C   1 
ATOM   1815 O  O   . GLY A 1 237 ? 37.049 -50.915 -15.546 1.00 13.61 ? 344  GLY A O   1 
ATOM   1816 N  N   . ASN A 1 238 ? 35.606 -52.637 -15.388 1.00 12.66 ? 345  ASN A N   1 
ATOM   1817 C  CA  . ASN A 1 238 ? 36.299 -53.443 -16.387 1.00 11.72 ? 345  ASN A CA  1 
ATOM   1818 C  C   . ASN A 1 238 ? 35.876 -53.017 -17.800 1.00 12.37 ? 345  ASN A C   1 
ATOM   1819 O  O   . ASN A 1 238 ? 35.094 -52.080 -17.970 1.00 12.18 ? 345  ASN A O   1 
ATOM   1820 C  CB  . ASN A 1 238 ? 36.053 -54.948 -16.148 1.00 10.86 ? 345  ASN A CB  1 
ATOM   1821 C  CG  . ASN A 1 238 ? 34.583 -55.350 -16.298 1.00 13.02 ? 345  ASN A CG  1 
ATOM   1822 O  OD1 . ASN A 1 238 ? 33.884 -54.865 -17.179 1.00 13.46 ? 345  ASN A OD1 1 
ATOM   1823 N  ND2 . ASN A 1 238 ? 34.126 -56.265 -15.442 1.00 14.26 ? 345  ASN A ND2 1 
ATOM   1824 N  N   . GLN A 1 239 ? 36.376 -53.702 -18.815 1.00 11.00 ? 346  GLN A N   1 
ATOM   1825 C  CA  . GLN A 1 239 ? 36.161 -53.198 -20.164 1.00 13.47 ? 346  GLN A CA  1 
ATOM   1826 C  C   . GLN A 1 239 ? 34.796 -53.583 -20.743 1.00 15.64 ? 346  GLN A C   1 
ATOM   1827 O  O   . GLN A 1 239 ? 34.473 -53.195 -21.868 1.00 15.69 ? 346  GLN A O   1 
ATOM   1828 C  CB  . GLN A 1 239 ? 37.308 -53.658 -21.070 1.00 11.23 ? 346  GLN A CB  1 
ATOM   1829 C  CG  . GLN A 1 239 ? 38.631 -53.085 -20.583 1.00 13.33 ? 346  GLN A CG  1 
ATOM   1830 C  CD  . GLN A 1 239 ? 39.766 -53.227 -21.571 1.00 18.85 ? 346  GLN A CD  1 
ATOM   1831 O  OE1 . GLN A 1 239 ? 39.570 -53.114 -22.780 1.00 22.26 ? 346  GLN A OE1 1 
ATOM   1832 N  NE2 . GLN A 1 239 ? 40.971 -53.458 -21.056 1.00 12.70 ? 346  GLN A NE2 1 
ATOM   1833 N  N   . ASN A 1 240 ? 33.987 -54.307 -19.971 1.00 12.20 ? 347  ASN A N   1 
ATOM   1834 C  CA  . ASN A 1 240 ? 32.587 -54.548 -20.344 1.00 14.11 ? 347  ASN A CA  1 
ATOM   1835 C  C   . ASN A 1 240 ? 31.632 -53.561 -19.685 1.00 17.38 ? 347  ASN A C   1 
ATOM   1836 O  O   . ASN A 1 240 ? 30.433 -53.536 -19.997 1.00 16.40 ? 347  ASN A O   1 
ATOM   1837 C  CB  . ASN A 1 240 ? 32.158 -55.964 -19.972 1.00 14.91 ? 347  ASN A CB  1 
ATOM   1838 C  CG  . ASN A 1 240 ? 33.079 -57.015 -20.531 1.00 20.33 ? 347  ASN A CG  1 
ATOM   1839 O  OD1 . ASN A 1 240 ? 34.071 -57.384 -19.905 1.00 22.54 ? 347  ASN A OD1 1 
ATOM   1840 N  ND2 . ASN A 1 240 ? 32.755 -57.509 -21.708 1.00 22.83 ? 347  ASN A ND2 1 
ATOM   1841 N  N   . GLU A 1 241 ? 32.157 -52.775 -18.749 1.00 13.48 ? 348  GLU A N   1 
ATOM   1842 C  CA  . GLU A 1 241 ? 31.357 -51.796 -18.018 1.00 13.26 ? 348  GLU A CA  1 
ATOM   1843 C  C   . GLU A 1 241 ? 31.556 -50.407 -18.589 1.00 13.62 ? 348  GLU A C   1 
ATOM   1844 O  O   . GLU A 1 241 ? 32.652 -50.054 -19.021 1.00 13.74 ? 348  GLU A O   1 
ATOM   1845 C  CB  . GLU A 1 241 ? 31.717 -51.813 -16.518 1.00 11.15 ? 348  GLU A CB  1 
ATOM   1846 C  CG  . GLU A 1 241 ? 31.328 -53.124 -15.856 1.00 11.75 ? 348  GLU A CG  1 
ATOM   1847 C  CD  . GLU A 1 241 ? 31.881 -53.289 -14.445 1.00 18.44 ? 348  GLU A CD  1 
ATOM   1848 O  OE1 . GLU A 1 241 ? 31.068 -53.539 -13.525 1.00 15.84 ? 348  GLU A OE1 1 
ATOM   1849 O  OE2 . GLU A 1 241 ? 33.122 -53.203 -14.263 1.00 14.47 ? 348  GLU A OE2 1 
ATOM   1850 N  N   . LYS A 1 242 ? 30.492 -49.615 -18.590 1.00 12.41 ? 349  LYS A N   1 
ATOM   1851 C  CA  . LYS A 1 242 ? 30.555 -48.273 -19.145 1.00 12.14 ? 349  LYS A CA  1 
ATOM   1852 C  C   . LYS A 1 242 ? 31.334 -47.338 -18.233 1.00 18.03 ? 349  LYS A C   1 
ATOM   1853 O  O   . LYS A 1 242 ? 31.657 -47.694 -17.102 1.00 14.64 ? 349  LYS A O   1 
ATOM   1854 C  CB  . LYS A 1 242 ? 29.150 -47.741 -19.384 1.00 16.22 ? 349  LYS A CB  1 
ATOM   1855 C  CG  . LYS A 1 242 ? 28.370 -48.570 -20.405 1.00 24.00 ? 349  LYS A CG  1 
ATOM   1856 C  CD  . LYS A 1 242 ? 28.947 -48.436 -21.797 1.00 33.55 ? 349  LYS A CD  1 
ATOM   1857 C  CE  . LYS A 1 242 ? 28.120 -49.235 -22.809 1.00 38.49 ? 349  LYS A CE  1 
ATOM   1858 N  NZ  . LYS A 1 242 ? 26.668 -48.949 -22.655 0.00 29.86 ? 349  LYS A NZ  1 
ATOM   1859 N  N   . GLN A 1 243 ? 31.663 -46.152 -18.733 1.00 13.45 ? 350  GLN A N   1 
ATOM   1860 C  CA  . GLN A 1 243 ? 32.495 -45.231 -17.964 1.00 15.87 ? 350  GLN A CA  1 
ATOM   1861 C  C   . GLN A 1 243 ? 31.827 -43.865 -17.907 1.00 14.37 ? 350  GLN A C   1 
ATOM   1862 O  O   . GLN A 1 243 ? 30.630 -43.750 -18.194 1.00 15.70 ? 350  GLN A O   1 
ATOM   1863 C  CB  . GLN A 1 243 ? 33.906 -45.158 -18.570 1.00 13.54 ? 350  GLN A CB  1 
ATOM   1864 C  CG  . GLN A 1 243 ? 34.550 -46.551 -18.676 1.00 15.50 ? 350  GLN A CG  1 
ATOM   1865 C  CD  . GLN A 1 243 ? 36.002 -46.525 -19.103 1.00 17.35 ? 350  GLN A CD  1 
ATOM   1866 O  OE1 . GLN A 1 243 ? 36.417 -45.648 -19.857 1.00 17.77 ? 350  GLN A OE1 1 
ATOM   1867 N  NE2 . GLN A 1 243 ? 36.790 -47.491 -18.614 1.00 14.37 ? 350  GLN A NE2 1 
ATOM   1868 N  N   . ILE A 1 244 ? 32.579 -42.832 -17.542 1.00 15.07 ? 351  ILE A N   1 
ATOM   1869 C  CA  . ILE A 1 244 ? 31.967 -41.520 -17.343 1.00 15.56 ? 351  ILE A CA  1 
ATOM   1870 C  C   . ILE A 1 244 ? 32.061 -40.664 -18.611 1.00 12.23 ? 351  ILE A C   1 
ATOM   1871 O  O   . ILE A 1 244 ? 33.100 -40.603 -19.268 1.00 16.74 ? 351  ILE A O   1 
ATOM   1872 C  CB  . ILE A 1 244 ? 32.600 -40.790 -16.156 1.00 14.25 ? 351  ILE A CB  1 
ATOM   1873 C  CG1 . ILE A 1 244 ? 32.366 -41.596 -14.873 1.00 14.50 ? 351  ILE A CG1 1 
ATOM   1874 C  CG2 . ILE A 1 244 ? 32.032 -39.365 -16.021 1.00 15.59 ? 351  ILE A CG2 1 
ATOM   1875 C  CD1 . ILE A 1 244 ? 30.905 -41.910 -14.625 1.00 15.61 ? 351  ILE A CD1 1 
ATOM   1876 N  N   . VAL A 1 245 ? 30.945 -40.027 -18.953 1.00 15.64 ? 352  VAL A N   1 
ATOM   1877 C  CA  . VAL A 1 245 ? 30.817 -39.265 -20.188 1.00 15.45 ? 352  VAL A CA  1 
ATOM   1878 C  C   . VAL A 1 245 ? 30.840 -37.773 -19.886 1.00 15.83 ? 352  VAL A C   1 
ATOM   1879 O  O   . VAL A 1 245 ? 30.005 -37.282 -19.128 1.00 17.98 ? 352  VAL A O   1 
ATOM   1880 C  CB  . VAL A 1 245 ? 29.508 -39.635 -20.919 1.00 18.03 ? 352  VAL A CB  1 
ATOM   1881 C  CG1 . VAL A 1 245 ? 29.332 -38.794 -22.195 1.00 18.48 ? 352  VAL A CG1 1 
ATOM   1882 C  CG2 . VAL A 1 245 ? 29.505 -41.113 -21.240 1.00 20.26 ? 352  VAL A CG2 1 
ATOM   1883 N  N   . THR A 1 246 ? 31.786 -37.045 -20.472 1.00 15.85 ? 353  THR A N   1 
ATOM   1884 C  CA  . THR A 1 246 ? 31.954 -35.655 -20.093 1.00 15.31 ? 353  THR A CA  1 
ATOM   1885 C  C   . THR A 1 246 ? 32.740 -34.832 -21.118 1.00 16.79 ? 353  THR A C   1 
ATOM   1886 O  O   . THR A 1 246 ? 33.144 -35.325 -22.178 1.00 15.65 ? 353  THR A O   1 
ATOM   1887 C  CB  . THR A 1 246 ? 32.642 -35.563 -18.685 1.00 14.27 ? 353  THR A CB  1 
ATOM   1888 O  OG1 . THR A 1 246 ? 32.639 -34.216 -18.217 1.00 15.65 ? 353  THR A OG1 1 
ATOM   1889 C  CG2 . THR A 1 246 ? 34.073 -36.095 -18.730 1.00 14.36 ? 353  THR A CG2 1 
ATOM   1890 N  N   . THR A 1 247 ? 32.908 -33.556 -20.797 1.00 16.09 ? 354  THR A N   1 
ATOM   1891 C  CA  . THR A 1 247 ? 33.683 -32.615 -21.600 1.00 15.45 ? 354  THR A CA  1 
ATOM   1892 C  C   . THR A 1 247 ? 35.174 -32.932 -21.570 1.00 20.14 ? 354  THR A C   1 
ATOM   1893 O  O   . THR A 1 247 ? 35.717 -33.249 -20.516 1.00 16.71 ? 354  THR A O   1 
ATOM   1894 C  CB  . THR A 1 247 ? 33.476 -31.188 -21.082 1.00 16.45 ? 354  THR A CB  1 
ATOM   1895 O  OG1 . THR A 1 247 ? 33.694 -31.178 -19.659 1.00 16.33 ? 354  THR A OG1 1 
ATOM   1896 C  CG2 . THR A 1 247 ? 32.063 -30.741 -21.356 1.00 14.96 ? 354  THR A CG2 1 
ATOM   1897 N  N   . ASP A 1 248 ? 35.847 -32.826 -22.712 1.00 16.21 ? 355  ASP A N   1 
ATOM   1898 C  CA  . ASP A 1 248 ? 37.272 -33.138 -22.759 1.00 17.22 ? 355  ASP A CA  1 
ATOM   1899 C  C   . ASP A 1 248 ? 38.060 -31.959 -23.328 1.00 16.96 ? 355  ASP A C   1 
ATOM   1900 O  O   . ASP A 1 248 ? 37.491 -31.051 -23.933 1.00 18.45 ? 355  ASP A O   1 
ATOM   1901 C  CB  . ASP A 1 248 ? 37.516 -34.405 -23.595 1.00 16.78 ? 355  ASP A CB  1 
ATOM   1902 C  CG  . ASP A 1 248 ? 38.868 -35.046 -23.315 1.00 21.50 ? 355  ASP A CG  1 
ATOM   1903 O  OD1 . ASP A 1 248 ? 39.581 -34.590 -22.390 1.00 19.92 ? 355  ASP A OD1 1 
ATOM   1904 O  OD2 . ASP A 1 248 ? 39.211 -36.026 -24.008 1.00 20.49 ? 355  ASP A OD2 1 
ATOM   1905 N  N   . LEU A 1 249 ? 39.371 -31.988 -23.128 1.00 17.41 ? 356  LEU A N   1 
ATOM   1906 C  CA  . LEU A 1 249 ? 40.256 -30.940 -23.606 1.00 20.13 ? 356  LEU A CA  1 
ATOM   1907 C  C   . LEU A 1 249 ? 40.164 -30.815 -25.126 1.00 23.69 ? 356  LEU A C   1 
ATOM   1908 O  O   . LEU A 1 249 ? 39.844 -31.789 -25.805 1.00 17.47 ? 356  LEU A O   1 
ATOM   1909 C  CB  . LEU A 1 249 ? 41.693 -31.237 -23.185 1.00 17.58 ? 356  LEU A CB  1 
ATOM   1910 C  CG  . LEU A 1 249 ? 42.692 -30.088 -23.241 1.00 25.07 ? 356  LEU A CG  1 
ATOM   1911 C  CD1 . LEU A 1 249 ? 42.313 -29.015 -22.228 1.00 23.15 ? 356  LEU A CD1 1 
ATOM   1912 C  CD2 . LEU A 1 249 ? 44.106 -30.600 -22.993 1.00 16.92 ? 356  LEU A CD2 1 
ATOM   1913 N  N   . ARG A 1 250 ? 40.440 -29.615 -25.633 1.00 21.21 ? 357  ARG A N   1 
ATOM   1914 C  CA  . ARG A 1 250 ? 40.334 -29.283 -27.062 1.00 21.66 ? 357  ARG A CA  1 
ATOM   1915 C  C   . ARG A 1 250 ? 38.901 -29.380 -27.577 1.00 23.23 ? 357  ARG A C   1 
ATOM   1916 O  O   . ARG A 1 250 ? 38.659 -29.811 -28.707 1.00 19.35 ? 357  ARG A O   1 
ATOM   1917 C  CB  . ARG A 1 250 ? 41.272 -30.167 -27.896 1.00 23.83 ? 357  ARG A CB  1 
ATOM   1918 C  CG  . ARG A 1 250 ? 42.722 -30.087 -27.420 1.00 26.23 ? 357  ARG A CG  1 
ATOM   1919 C  CD  . ARG A 1 250 ? 43.674 -30.910 -28.279 1.00 26.00 ? 357  ARG A CD  1 
ATOM   1920 N  NE  . ARG A 1 250 ? 45.013 -30.959 -27.688 1.00 26.29 ? 357  ARG A NE  1 
ATOM   1921 C  CZ  . ARG A 1 250 ? 45.960 -30.041 -27.870 1.00 28.83 ? 357  ARG A CZ  1 
ATOM   1922 N  NH1 . ARG A 1 250 ? 47.143 -30.183 -27.281 1.00 26.32 ? 357  ARG A NH1 1 
ATOM   1923 N  NH2 . ARG A 1 250 ? 45.735 -28.982 -28.640 1.00 27.71 ? 357  ARG A NH2 1 
ATOM   1924 N  N   . GLN A 1 251 ? 37.961 -28.962 -26.728 1.00 19.27 ? 358  GLN A N   1 
ATOM   1925 C  CA  . GLN A 1 251 ? 36.548 -28.808 -27.081 1.00 20.60 ? 358  GLN A CA  1 
ATOM   1926 C  C   . GLN A 1 251 ? 35.910 -30.097 -27.571 1.00 26.58 ? 358  GLN A C   1 
ATOM   1927 O  O   . GLN A 1 251 ? 35.006 -30.077 -28.411 1.00 21.93 ? 358  GLN A O   1 
ATOM   1928 C  CB  . GLN A 1 251 ? 36.390 -27.698 -28.133 1.00 23.00 ? 358  GLN A CB  1 
ATOM   1929 C  CG  . GLN A 1 251 ? 37.164 -26.442 -27.759 1.00 24.37 ? 358  GLN A CG  1 
ATOM   1930 C  CD  . GLN A 1 251 ? 36.733 -25.219 -28.541 1.00 34.74 ? 358  GLN A CD  1 
ATOM   1931 O  OE1 . GLN A 1 251 ? 35.673 -25.204 -29.163 1.00 37.17 ? 358  GLN A OE1 1 
ATOM   1932 N  NE2 . GLN A 1 251 ? 37.555 -24.180 -28.504 1.00 44.19 ? 358  GLN A NE2 1 
ATOM   1933 N  N   . LYS A 1 252 ? 36.375 -31.216 -27.021 1.00 16.70 ? 359  LYS A N   1 
ATOM   1934 C  CA  . LYS A 1 252 ? 35.877 -32.533 -27.382 1.00 17.83 ? 359  LYS A CA  1 
ATOM   1935 C  C   . LYS A 1 252 ? 34.962 -33.121 -26.308 1.00 21.70 ? 359  LYS A C   1 
ATOM   1936 O  O   . LYS A 1 252 ? 34.712 -32.517 -25.262 1.00 20.59 ? 359  LYS A O   1 
ATOM   1937 C  CB  . LYS A 1 252 ? 37.042 -33.499 -27.625 1.00 18.32 ? 359  LYS A CB  1 
ATOM   1938 C  CG  . LYS A 1 252 ? 37.988 -33.117 -28.765 1.00 29.23 ? 359  LYS A CG  1 
ATOM   1939 C  CD  . LYS A 1 252 ? 39.208 -34.040 -28.737 1.00 33.56 ? 359  LYS A CD  1 
ATOM   1940 C  CE  . LYS A 1 252 ? 40.386 -33.484 -29.518 0.00 28.00 ? 359  LYS A CE  1 
ATOM   1941 N  NZ  . LYS A 1 252 ? 41.655 -34.166 -29.126 0.00 30.65 ? 359  LYS A NZ  1 
ATOM   1942 N  N   . CYS A 1 253 ? 34.470 -34.316 -26.590 1.00 19.68 ? 360  CYS A N   1 
ATOM   1943 C  CA  . CYS A 1 253 ? 33.634 -35.057 -25.662 1.00 17.67 ? 360  CYS A CA  1 
ATOM   1944 C  C   . CYS A 1 253 ? 34.298 -36.415 -25.428 1.00 26.91 ? 360  CYS A C   1 
ATOM   1945 O  O   . CYS A 1 253 ? 34.778 -37.036 -26.375 1.00 25.02 ? 360  CYS A O   1 
ATOM   1946 C  CB  . CYS A 1 253 ? 32.222 -35.208 -26.241 1.00 23.42 ? 360  CYS A CB  1 
ATOM   1947 S  SG  . CYS A 1 253 ? 31.013 -36.026 -25.194 1.00 31.26 ? 360  CYS A SG  1 
ATOM   1948 N  N   . THR A 1 254 ? 34.361 -36.874 -24.179 1.00 18.31 ? 361  THR A N   1 
ATOM   1949 C  CA  . THR A 1 254 ? 34.936 -38.193 -23.915 1.00 13.92 ? 361  THR A CA  1 
ATOM   1950 C  C   . THR A 1 254 ? 33.893 -39.114 -23.304 1.00 15.00 ? 361  THR A C   1 
ATOM   1951 O  O   . THR A 1 254 ? 32.992 -38.663 -22.600 1.00 16.66 ? 361  THR A O   1 
ATOM   1952 C  CB  . THR A 1 254 ? 36.160 -38.121 -22.973 1.00 18.07 ? 361  THR A CB  1 
ATOM   1953 O  OG1 . THR A 1 254 ? 36.727 -39.433 -22.825 1.00 17.83 ? 361  THR A OG1 1 
ATOM   1954 C  CG2 . THR A 1 254 ? 35.751 -37.591 -21.598 1.00 16.27 ? 361  THR A CG2 1 
ATOM   1955 N  N   . GLU A 1 255 ? 34.000 -40.403 -23.600 1.00 14.37 ? 362  GLU A N   1 
ATOM   1956 C  CA  . GLU A 1 255 ? 33.143 -41.385 -22.959 1.00 15.60 ? 362  GLU A CA  1 
ATOM   1957 C  C   . GLU A 1 255 ? 33.979 -42.296 -22.071 1.00 15.33 ? 362  GLU A C   1 
ATOM   1958 O  O   . GLU A 1 255 ? 33.509 -43.350 -21.641 1.00 17.08 ? 362  GLU A O   1 
ATOM   1959 C  CB  . GLU A 1 255 ? 32.375 -42.206 -24.005 1.00 20.62 ? 362  GLU A CB  1 
ATOM   1960 C  CG  . GLU A 1 255 ? 31.372 -41.379 -24.822 1.00 26.17 ? 362  GLU A CG  1 
ATOM   1961 C  CD  . GLU A 1 255 ? 32.023 -40.593 -25.950 1.00 32.96 ? 362  GLU A CD  1 
ATOM   1962 O  OE1 . GLU A 1 255 ? 31.574 -39.455 -26.226 1.00 36.10 ? 362  GLU A OE1 1 
ATOM   1963 O  OE2 . GLU A 1 255 ? 32.975 -41.114 -26.568 1.00 28.68 ? 362  GLU A OE2 1 
ATOM   1964 N  N   . SER A 1 256 ? 35.216 -41.891 -21.792 1.00 13.61 ? 363  SER A N   1 
ATOM   1965 C  CA  . SER A 1 256 ? 36.130 -42.779 -21.074 1.00 14.89 ? 363  SER A CA  1 
ATOM   1966 C  C   . SER A 1 256 ? 36.847 -42.103 -19.896 1.00 17.74 ? 363  SER A C   1 
ATOM   1967 O  O   . SER A 1 256 ? 38.028 -42.320 -19.660 1.00 14.86 ? 363  SER A O   1 
ATOM   1968 C  CB  . SER A 1 256 ? 37.151 -43.390 -22.051 1.00 23.63 ? 363  SER A CB  1 
ATOM   1969 O  OG  . SER A 1 256 ? 37.814 -42.403 -22.822 1.00 21.83 ? 363  SER A OG  1 
ATOM   1970 N  N   . HIS A 1 257 ? 36.102 -41.304 -19.138 1.00 15.32 ? 364  HIS A N   1 
ATOM   1971 C  CA  . HIS A 1 257 ? 36.613 -40.704 -17.907 1.00 16.47 ? 364  HIS A CA  1 
ATOM   1972 C  C   . HIS A 1 257 ? 36.467 -41.760 -16.811 1.00 17.58 ? 364  HIS A C   1 
ATOM   1973 O  O   . HIS A 1 257 ? 35.460 -42.473 -16.758 1.00 14.69 ? 364  HIS A O   1 
ATOM   1974 C  CB  . HIS A 1 257 ? 35.841 -39.414 -17.603 1.00 13.24 ? 364  HIS A CB  1 
ATOM   1975 C  CG  . HIS A 1 257 ? 36.345 -38.633 -16.427 1.00 16.10 ? 364  HIS A CG  1 
ATOM   1976 N  ND1 . HIS A 1 257 ? 37.679 -38.559 -16.081 1.00 14.05 ? 364  HIS A ND1 1 
ATOM   1977 C  CD2 . HIS A 1 257 ? 35.686 -37.841 -15.547 1.00 13.97 ? 364  HIS A CD2 1 
ATOM   1978 C  CE1 . HIS A 1 257 ? 37.812 -37.783 -15.018 1.00 16.52 ? 364  HIS A CE1 1 
ATOM   1979 N  NE2 . HIS A 1 257 ? 36.617 -37.331 -14.678 1.00 16.30 ? 364  HIS A NE2 1 
ATOM   1980 N  N   . THR A 1 258 ? 37.488 -41.887 -15.966 1.00 14.58 ? 365  THR A N   1 
ATOM   1981 C  CA  . THR A 1 258 ? 37.625 -43.060 -15.092 1.00 14.90 ? 365  THR A CA  1 
ATOM   1982 C  C   . THR A 1 258 ? 38.096 -42.725 -13.687 1.00 15.15 ? 365  THR A C   1 
ATOM   1983 O  O   . THR A 1 258 ? 38.543 -41.613 -13.428 1.00 13.42 ? 365  THR A O   1 
ATOM   1984 C  CB  . THR A 1 258 ? 38.649 -44.065 -15.657 1.00 15.13 ? 365  THR A CB  1 
ATOM   1985 O  OG1 . THR A 1 258 ? 39.938 -43.435 -15.714 1.00 13.78 ? 365  THR A OG1 1 
ATOM   1986 C  CG2 . THR A 1 258 ? 38.249 -44.541 -17.061 1.00 15.09 ? 365  THR A CG2 1 
ATOM   1987 N  N   . GLY A 1 259 ? 38.018 -43.715 -12.797 1.00 12.70 ? 366  GLY A N   1 
ATOM   1988 C  CA  . GLY A 1 259 ? 38.699 -43.655 -11.516 1.00 13.09 ? 366  GLY A CA  1 
ATOM   1989 C  C   . GLY A 1 259 ? 37.890 -42.978 -10.428 1.00 13.90 ? 366  GLY A C   1 
ATOM   1990 O  O   . GLY A 1 259 ? 36.813 -42.415 -10.671 1.00 13.01 ? 366  GLY A O   1 
ATOM   1991 N  N   . THR A 1 260 ? 38.405 -43.026 -9.207  1.00 11.34 ? 367  THR A N   1 
ATOM   1992 C  CA  . THR A 1 260 ? 37.684 -42.382 -8.106  1.00 11.25 ? 367  THR A CA  1 
ATOM   1993 C  C   . THR A 1 260 ? 37.602 -40.874 -8.316  1.00 11.13 ? 367  THR A C   1 
ATOM   1994 O  O   . THR A 1 260 ? 36.687 -40.213 -7.826  1.00 13.71 ? 367  THR A O   1 
ATOM   1995 C  CB  . THR A 1 260 ? 38.349 -42.682 -6.760  1.00 11.81 ? 367  THR A CB  1 
ATOM   1996 O  OG1 . THR A 1 260 ? 38.642 -44.082 -6.707  1.00 13.88 ? 367  THR A OG1 1 
ATOM   1997 C  CG2 . THR A 1 260 ? 37.401 -42.315 -5.605  1.00 12.10 ? 367  THR A CG2 1 
ATOM   1998 N  N   . SER A 1 261 ? 38.556 -40.318 -9.054  1.00 12.43 ? 368  SER A N   1 
ATOM   1999 C  CA  . SER A 1 261 ? 38.544 -38.877 -9.278  1.00 12.82 ? 368  SER A CA  1 
ATOM   2000 C  C   . SER A 1 261 ? 37.360 -38.450 -10.156 1.00 15.78 ? 368  SER A C   1 
ATOM   2001 O  O   . SER A 1 261 ? 37.048 -37.270 -10.230 1.00 15.46 ? 368  SER A O   1 
ATOM   2002 C  CB  . SER A 1 261 ? 39.866 -38.410 -9.902  1.00 18.42 ? 368  SER A CB  1 
ATOM   2003 O  OG  . SER A 1 261 ? 39.945 -38.812 -11.256 1.00 19.21 ? 368  SER A OG  1 
ATOM   2004 N  N   . ALA A 1 262 ? 36.700 -39.399 -10.816 1.00 14.00 ? 369  ALA A N   1 
ATOM   2005 C  CA  . ALA A 1 262 ? 35.486 -39.076 -11.558 1.00 11.75 ? 369  ALA A CA  1 
ATOM   2006 C  C   . ALA A 1 262 ? 34.256 -39.185 -10.654 1.00 16.68 ? 369  ALA A C   1 
ATOM   2007 O  O   . ALA A 1 262 ? 33.188 -38.691 -10.994 1.00 15.08 ? 369  ALA A O   1 
ATOM   2008 C  CB  . ALA A 1 262 ? 35.330 -39.990 -12.783 1.00 13.09 ? 369  ALA A CB  1 
ATOM   2009 N  N   . SER A 1 263 ? 34.407 -39.826 -9.497  1.00 16.21 ? 370  SER A N   1 
ATOM   2010 C  CA  . SER A 1 263 ? 33.275 -39.955 -8.573  1.00 14.55 ? 370  SER A CA  1 
ATOM   2011 C  C   . SER A 1 263 ? 33.013 -38.684 -7.786  1.00 14.88 ? 370  SER A C   1 
ATOM   2012 O  O   . SER A 1 263 ? 31.852 -38.311 -7.552  1.00 15.14 ? 370  SER A O   1 
ATOM   2013 C  CB  . SER A 1 263 ? 33.500 -41.120 -7.608  1.00 12.47 ? 370  SER A CB  1 
ATOM   2014 O  OG  . SER A 1 263 ? 33.199 -42.353 -8.246  1.00 14.54 ? 370  SER A OG  1 
ATOM   2015 N  N   . ALA A 1 264 ? 34.081 -38.026 -7.348  1.00 14.49 ? 371  ALA A N   1 
ATOM   2016 C  CA  . ALA A 1 264 ? 33.925 -36.825 -6.529  1.00 16.09 ? 371  ALA A CA  1 
ATOM   2017 C  C   . ALA A 1 264 ? 33.142 -35.704 -7.234  1.00 12.89 ? 371  ALA A C   1 
ATOM   2018 O  O   . ALA A 1 264 ? 32.242 -35.120 -6.622  1.00 15.57 ? 371  ALA A O   1 
ATOM   2019 C  CB  . ALA A 1 264 ? 35.293 -36.311 -6.059  1.00 16.96 ? 371  ALA A CB  1 
ATOM   2020 N  N   . PRO A 1 265 ? 33.445 -35.408 -8.520  1.00 12.61 ? 372  PRO A N   1 
ATOM   2021 C  CA  . PRO A 1 265 ? 32.661 -34.359 -9.187  1.00 14.14 ? 372  PRO A CA  1 
ATOM   2022 C  C   . PRO A 1 265 ? 31.173 -34.670 -9.302  1.00 10.22 ? 372  PRO A C   1 
ATOM   2023 O  O   . PRO A 1 265 ? 30.358 -33.745 -9.224  1.00 14.41 ? 372  PRO A O   1 
ATOM   2024 C  CB  . PRO A 1 265 ? 33.292 -34.290 -10.584 1.00 13.07 ? 372  PRO A CB  1 
ATOM   2025 C  CG  . PRO A 1 265 ? 34.691 -34.748 -10.365 1.00 13.82 ? 372  PRO A CG  1 
ATOM   2026 C  CD  . PRO A 1 265 ? 34.570 -35.847 -9.364  1.00 14.08 ? 372  PRO A CD  1 
ATOM   2027 N  N   . LEU A 1 266 ? 30.816 -35.937 -9.499  1.00 10.80 ? 373  LEU A N   1 
ATOM   2028 C  CA  . LEU A 1 266 ? 29.400 -36.299 -9.544  1.00 11.57 ? 373  LEU A CA  1 
ATOM   2029 C  C   . LEU A 1 266 ? 28.748 -36.009 -8.198  1.00 14.15 ? 373  LEU A C   1 
ATOM   2030 O  O   . LEU A 1 266 ? 27.635 -35.481 -8.133  1.00 14.07 ? 373  LEU A O   1 
ATOM   2031 C  CB  . LEU A 1 266 ? 29.223 -37.768 -9.918  1.00 13.37 ? 373  LEU A CB  1 
ATOM   2032 C  CG  . LEU A 1 266 ? 29.631 -38.130 -11.338 1.00 11.74 ? 373  LEU A CG  1 
ATOM   2033 C  CD1 . LEU A 1 266 ? 29.541 -39.644 -11.546 1.00 15.72 ? 373  LEU A CD1 1 
ATOM   2034 C  CD2 . LEU A 1 266 ? 28.760 -37.373 -12.371 1.00 13.97 ? 373  LEU A CD2 1 
ATOM   2035 N  N   . ALA A 1 267 ? 29.454 -36.343 -7.121  1.00 12.22 ? 374  ALA A N   1 
ATOM   2036 C  CA  . ALA A 1 267 ? 28.981 -36.034 -5.772  1.00 14.10 ? 374  ALA A CA  1 
ATOM   2037 C  C   . ALA A 1 267 ? 28.834 -34.520 -5.583  1.00 14.20 ? 374  ALA A C   1 
ATOM   2038 O  O   . ALA A 1 267 ? 27.828 -34.045 -5.046  1.00 13.74 ? 374  ALA A O   1 
ATOM   2039 C  CB  . ALA A 1 267 ? 29.934 -36.625 -4.722  1.00 11.55 ? 374  ALA A CB  1 
ATOM   2040 N  N   . ALA A 1 268 ? 29.823 -33.757 -6.040  1.00 11.86 ? 375  ALA A N   1 
ATOM   2041 C  CA  . ALA A 1 268 ? 29.760 -32.298 -5.929  1.00 11.98 ? 375  ALA A CA  1 
ATOM   2042 C  C   . ALA A 1 268 ? 28.520 -31.738 -6.639  1.00 14.96 ? 375  ALA A C   1 
ATOM   2043 O  O   . ALA A 1 268 ? 27.882 -30.795 -6.154  1.00 13.83 ? 375  ALA A O   1 
ATOM   2044 C  CB  . ALA A 1 268 ? 31.023 -31.663 -6.495  1.00 14.03 ? 375  ALA A CB  1 
ATOM   2045 N  N   . GLY A 1 269 ? 28.188 -32.316 -7.791  1.00 13.49 ? 376  GLY A N   1 
ATOM   2046 C  CA  . GLY A 1 269 ? 26.998 -31.917 -8.527  1.00 14.65 ? 376  GLY A CA  1 
ATOM   2047 C  C   . GLY A 1 269 ? 25.728 -32.197 -7.743  1.00 15.44 ? 376  GLY A C   1 
ATOM   2048 O  O   . GLY A 1 269 ? 24.833 -31.357 -7.664  1.00 14.37 ? 376  GLY A O   1 
ATOM   2049 N  N   . ILE A 1 270 ? 25.653 -33.378 -7.145  1.00 13.70 ? 377  ILE A N   1 
ATOM   2050 C  CA  . ILE A 1 270 ? 24.492 -33.750 -6.341  1.00 14.29 ? 377  ILE A CA  1 
ATOM   2051 C  C   . ILE A 1 270 ? 24.381 -32.825 -5.126  1.00 13.96 ? 377  ILE A C   1 
ATOM   2052 O  O   . ILE A 1 270 ? 23.294 -32.392 -4.757  1.00 15.22 ? 377  ILE A O   1 
ATOM   2053 C  CB  . ILE A 1 270 ? 24.576 -35.228 -5.909  1.00 16.33 ? 377  ILE A CB  1 
ATOM   2054 C  CG1 . ILE A 1 270 ? 24.398 -36.129 -7.134  1.00 14.12 ? 377  ILE A CG1 1 
ATOM   2055 C  CG2 . ILE A 1 270 ? 23.538 -35.561 -4.824  1.00 14.42 ? 377  ILE A CG2 1 
ATOM   2056 C  CD1 . ILE A 1 270 ? 24.444 -37.626 -6.833  1.00 12.70 ? 377  ILE A CD1 1 
ATOM   2057 N  N   . ILE A 1 271 ? 25.519 -32.494 -4.529  1.00 14.23 ? 378  ILE A N   1 
ATOM   2058 C  CA  . ILE A 1 271 ? 25.540 -31.579 -3.397  1.00 13.69 ? 378  ILE A CA  1 
ATOM   2059 C  C   . ILE A 1 271 ? 25.106 -30.169 -3.842  1.00 15.02 ? 378  ILE A C   1 
ATOM   2060 O  O   . ILE A 1 271 ? 24.446 -29.451 -3.096  1.00 15.89 ? 378  ILE A O   1 
ATOM   2061 C  CB  . ILE A 1 271 ? 26.941 -31.583 -2.727  1.00 15.25 ? 378  ILE A CB  1 
ATOM   2062 C  CG1 . ILE A 1 271 ? 27.145 -32.942 -2.036  1.00 13.92 ? 378  ILE A CG1 1 
ATOM   2063 C  CG2 . ILE A 1 271 ? 27.074 -30.463 -1.700  1.00 14.73 ? 378  ILE A CG2 1 
ATOM   2064 C  CD1 . ILE A 1 271 ? 28.573 -33.248 -1.610  1.00 21.15 ? 378  ILE A CD1 1 
ATOM   2065 N  N   . ALA A 1 272 ? 25.427 -29.792 -5.074  1.00 13.71 ? 379  ALA A N   1 
ATOM   2066 C  CA  . ALA A 1 272 ? 24.953 -28.514 -5.608  1.00 14.32 ? 379  ALA A CA  1 
ATOM   2067 C  C   . ALA A 1 272 ? 23.426 -28.475 -5.724  1.00 16.93 ? 379  ALA A C   1 
ATOM   2068 O  O   . ALA A 1 272 ? 22.807 -27.467 -5.376  1.00 17.40 ? 379  ALA A O   1 
ATOM   2069 C  CB  . ALA A 1 272 ? 25.601 -28.223 -6.967  1.00 12.15 ? 379  ALA A CB  1 
ATOM   2070 N  N   . LEU A 1 273 ? 22.820 -29.565 -6.200  1.00 13.63 ? 380  LEU A N   1 
ATOM   2071 C  CA  . LEU A 1 273 ? 21.355 -29.658 -6.276  1.00 18.31 ? 380  LEU A CA  1 
ATOM   2072 C  C   . LEU A 1 273 ? 20.735 -29.527 -4.885  1.00 18.06 ? 380  LEU A C   1 
ATOM   2073 O  O   . LEU A 1 273 ? 19.711 -28.872 -4.695  1.00 15.97 ? 380  LEU A O   1 
ATOM   2074 C  CB  . LEU A 1 273 ? 20.918 -30.984 -6.893  1.00 16.77 ? 380  LEU A CB  1 
ATOM   2075 C  CG  . LEU A 1 273 ? 21.450 -31.305 -8.292  1.00 18.09 ? 380  LEU A CG  1 
ATOM   2076 C  CD1 . LEU A 1 273 ? 20.808 -32.592 -8.827  1.00 19.08 ? 380  LEU A CD1 1 
ATOM   2077 C  CD2 . LEU A 1 273 ? 21.187 -30.143 -9.227  1.00 16.60 ? 380  LEU A CD2 1 
ATOM   2078 N  N   . THR A 1 274 ? 21.369 -30.181 -3.923  1.00 14.70 ? 381  THR A N   1 
ATOM   2079 C  CA  . THR A 1 274 ? 20.903 -30.187 -2.539  1.00 14.07 ? 381  THR A CA  1 
ATOM   2080 C  C   . THR A 1 274 ? 20.960 -28.792 -1.934  1.00 17.19 ? 381  THR A C   1 
ATOM   2081 O  O   . THR A 1 274 ? 20.022 -28.356 -1.246  1.00 16.36 ? 381  THR A O   1 
ATOM   2082 C  CB  . THR A 1 274 ? 21.746 -31.177 -1.707  1.00 15.76 ? 381  THR A CB  1 
ATOM   2083 O  OG1 . THR A 1 274 ? 21.675 -32.466 -2.332  1.00 13.42 ? 381  THR A OG1 1 
ATOM   2084 C  CG2 . THR A 1 274 ? 21.232 -31.284 -0.273  1.00 15.41 ? 381  THR A CG2 1 
ATOM   2085 N  N   . LEU A 1 275 ? 22.054 -28.085 -2.202  1.00 14.46 ? 382  LEU A N   1 
ATOM   2086 C  CA  . LEU A 1 275 ? 22.210 -26.724 -1.710  1.00 18.42 ? 382  LEU A CA  1 
ATOM   2087 C  C   . LEU A 1 275 ? 21.185 -25.787 -2.342  1.00 19.34 ? 382  LEU A C   1 
ATOM   2088 O  O   . LEU A 1 275 ? 20.717 -24.849 -1.692  1.00 19.56 ? 382  LEU A O   1 
ATOM   2089 C  CB  . LEU A 1 275 ? 23.622 -26.217 -1.981  1.00 18.17 ? 382  LEU A CB  1 
ATOM   2090 C  CG  . LEU A 1 275 ? 24.299 -25.320 -0.957  1.00 31.85 ? 382  LEU A CG  1 
ATOM   2091 C  CD1 . LEU A 1 275 ? 24.041 -25.821 0.477   1.00 20.53 ? 382  LEU A CD1 1 
ATOM   2092 C  CD2 . LEU A 1 275 ? 25.787 -25.315 -1.277  1.00 24.26 ? 382  LEU A CD2 1 
ATOM   2093 N  N   . GLU A 1 276 ? 20.826 -26.032 -3.603  1.00 14.98 ? 383  GLU A N   1 
ATOM   2094 C  CA  . GLU A 1 276 ? 19.764 -25.226 -4.217  1.00 15.44 ? 383  GLU A CA  1 
ATOM   2095 C  C   . GLU A 1 276 ? 18.446 -25.443 -3.475  1.00 18.05 ? 383  GLU A C   1 
ATOM   2096 O  O   . GLU A 1 276 ? 17.670 -24.505 -3.279  1.00 21.70 ? 383  GLU A O   1 
ATOM   2097 C  CB  . GLU A 1 276 ? 19.582 -25.547 -5.708  1.00 18.05 ? 383  GLU A CB  1 
ATOM   2098 C  CG  . GLU A 1 276 ? 18.585 -24.592 -6.367  1.00 18.95 ? 383  GLU A CG  1 
ATOM   2099 C  CD  . GLU A 1 276 ? 18.252 -24.954 -7.803  1.00 26.77 ? 383  GLU A CD  1 
ATOM   2100 O  OE1 . GLU A 1 276 ? 18.784 -25.960 -8.304  1.00 22.36 ? 383  GLU A OE1 1 
ATOM   2101 O  OE2 . GLU A 1 276 ? 17.447 -24.221 -8.425  1.00 24.88 ? 383  GLU A OE2 1 
ATOM   2102 N  N   . ALA A 1 277 ? 18.202 -26.677 -3.048  1.00 18.87 ? 384  ALA A N   1 
ATOM   2103 C  CA  . ALA A 1 277 ? 16.977 -27.003 -2.327  1.00 21.14 ? 384  ALA A CA  1 
ATOM   2104 C  C   . ALA A 1 277 ? 16.942 -26.368 -0.934  1.00 23.00 ? 384  ALA A C   1 
ATOM   2105 O  O   . ALA A 1 277 ? 15.869 -26.158 -0.373  1.00 22.71 ? 384  ALA A O   1 
ATOM   2106 C  CB  . ALA A 1 277 ? 16.807 -28.514 -2.224  1.00 17.11 ? 384  ALA A CB  1 
ATOM   2107 N  N   . ASN A 1 278 ? 18.110 -26.082 -0.365  1.00 18.19 ? 385  ASN A N   1 
ATOM   2108 C  CA  . ASN A 1 278 ? 18.174 -25.418 0.941   1.00 16.59 ? 385  ASN A CA  1 
ATOM   2109 C  C   . ASN A 1 278 ? 19.524 -24.728 1.118   1.00 18.93 ? 385  ASN A C   1 
ATOM   2110 O  O   . ASN A 1 278 ? 20.512 -25.364 1.477   1.00 18.03 ? 385  ASN A O   1 
ATOM   2111 C  CB  . ASN A 1 278 ? 17.921 -26.429 2.067   1.00 15.18 ? 385  ASN A CB  1 
ATOM   2112 C  CG  . ASN A 1 278 ? 17.912 -25.795 3.453   1.00 17.09 ? 385  ASN A CG  1 
ATOM   2113 O  OD1 . ASN A 1 278 ? 18.296 -24.636 3.634   1.00 16.66 ? 385  ASN A OD1 1 
ATOM   2114 N  ND2 . ASN A 1 278 ? 17.480 -26.569 4.443   1.00 18.02 ? 385  ASN A ND2 1 
ATOM   2115 N  N   . LYS A 1 279 ? 19.551 -23.422 0.872   1.00 15.75 ? 386  LYS A N   1 
ATOM   2116 C  CA  . LYS A 1 279 ? 20.792 -22.662 0.858   1.00 17.85 ? 386  LYS A CA  1 
ATOM   2117 C  C   . LYS A 1 279 ? 21.363 -22.476 2.255   1.00 17.53 ? 386  LYS A C   1 
ATOM   2118 O  O   . LYS A 1 279 ? 22.494 -22.030 2.402   1.00 19.59 ? 386  LYS A O   1 
ATOM   2119 C  CB  . LYS A 1 279 ? 20.571 -21.290 0.210   1.00 19.18 ? 386  LYS A CB  1 
ATOM   2120 C  CG  . LYS A 1 279 ? 20.097 -21.347 -1.238  1.00 24.11 ? 386  LYS A CG  1 
ATOM   2121 C  CD  . LYS A 1 279 ? 21.259 -21.324 -2.205  1.00 39.62 ? 386  LYS A CD  1 
ATOM   2122 C  CE  . LYS A 1 279 ? 22.008 -19.994 -2.146  1.00 37.75 ? 386  LYS A CE  1 
ATOM   2123 N  NZ  . LYS A 1 279 ? 22.894 -19.802 -3.323  0.00 28.29 ? 386  LYS A NZ  1 
ATOM   2124 N  N   . ASN A 1 280 ? 20.571 -22.805 3.271   1.00 13.87 ? 387  ASN A N   1 
ATOM   2125 C  CA  . ASN A 1 280 ? 20.961 -22.583 4.659   1.00 16.13 ? 387  ASN A CA  1 
ATOM   2126 C  C   . ASN A 1 280 ? 21.674 -23.777 5.288   1.00 16.88 ? 387  ASN A C   1 
ATOM   2127 O  O   . ASN A 1 280 ? 21.990 -23.753 6.472   1.00 18.31 ? 387  ASN A O   1 
ATOM   2128 C  CB  . ASN A 1 280 ? 19.730 -22.237 5.506   1.00 17.80 ? 387  ASN A CB  1 
ATOM   2129 C  CG  . ASN A 1 280 ? 19.011 -20.991 5.016   1.00 31.76 ? 387  ASN A CG  1 
ATOM   2130 O  OD1 . ASN A 1 280 ? 19.637 -20.037 4.550   1.00 33.98 ? 387  ASN A OD1 1 
ATOM   2131 N  ND2 . ASN A 1 280 ? 17.682 -21.001 5.110   1.00 43.22 ? 387  ASN A ND2 1 
ATOM   2132 N  N   . LEU A 1 281 ? 21.913 -24.822 4.500   1.00 15.55 ? 388  LEU A N   1 
ATOM   2133 C  CA  . LEU A 1 281 ? 22.585 -26.020 5.007   1.00 16.47 ? 388  LEU A CA  1 
ATOM   2134 C  C   . LEU A 1 281 ? 24.037 -25.725 5.372   1.00 16.03 ? 388  LEU A C   1 
ATOM   2135 O  O   . LEU A 1 281 ? 24.756 -25.124 4.581   1.00 14.85 ? 388  LEU A O   1 
ATOM   2136 C  CB  . LEU A 1 281 ? 22.539 -27.139 3.967   1.00 14.75 ? 388  LEU A CB  1 
ATOM   2137 C  CG  . LEU A 1 281 ? 21.167 -27.725 3.621   1.00 16.02 ? 388  LEU A CG  1 
ATOM   2138 C  CD1 . LEU A 1 281 ? 21.256 -28.629 2.393   1.00 15.68 ? 388  LEU A CD1 1 
ATOM   2139 C  CD2 . LEU A 1 281 ? 20.586 -28.486 4.808   1.00 16.48 ? 388  LEU A CD2 1 
ATOM   2140 N  N   . THR A 1 282 ? 24.464 -26.158 6.557   1.00 14.86 ? 389  THR A N   1 
ATOM   2141 C  CA  . THR A 1 282 ? 25.861 -26.008 6.976   1.00 12.15 ? 389  THR A CA  1 
ATOM   2142 C  C   . THR A 1 282 ? 26.713 -27.139 6.417   1.00 11.71 ? 389  THR A C   1 
ATOM   2143 O  O   . THR A 1 282 ? 26.191 -28.118 5.887   1.00 12.87 ? 389  THR A O   1 
ATOM   2144 C  CB  . THR A 1 282 ? 26.019 -26.012 8.504   1.00 12.67 ? 389  THR A CB  1 
ATOM   2145 O  OG1 . THR A 1 282 ? 25.753 -27.332 8.985   1.00 12.98 ? 389  THR A OG1 1 
ATOM   2146 C  CG2 . THR A 1 282 ? 25.052 -25.019 9.162   1.00 14.47 ? 389  THR A CG2 1 
ATOM   2147 N  N   . TRP A 1 283 ? 28.029 -27.021 6.558   1.00 12.72 ? 390  TRP A N   1 
ATOM   2148 C  CA  . TRP A 1 283 ? 28.910 -28.078 6.069   1.00 14.54 ? 390  TRP A CA  1 
ATOM   2149 C  C   . TRP A 1 283 ? 28.629 -29.394 6.791   1.00 14.65 ? 390  TRP A C   1 
ATOM   2150 O  O   . TRP A 1 283 ? 28.742 -30.468 6.198   1.00 12.04 ? 390  TRP A O   1 
ATOM   2151 C  CB  . TRP A 1 283 ? 30.381 -27.674 6.217   1.00 13.10 ? 390  TRP A CB  1 
ATOM   2152 C  CG  . TRP A 1 283 ? 30.873 -27.575 7.633   1.00 11.32 ? 390  TRP A CG  1 
ATOM   2153 C  CD1 . TRP A 1 283 ? 30.709 -26.522 8.495   1.00 13.20 ? 390  TRP A CD1 1 
ATOM   2154 C  CD2 . TRP A 1 283 ? 31.648 -28.551 8.341   1.00 9.96  ? 390  TRP A CD2 1 
ATOM   2155 N  NE1 . TRP A 1 283 ? 31.324 -26.795 9.698   1.00 11.94 ? 390  TRP A NE1 1 
ATOM   2156 C  CE2 . TRP A 1 283 ? 31.893 -28.041 9.629   1.00 11.24 ? 390  TRP A CE2 1 
ATOM   2157 C  CE3 . TRP A 1 283 ? 32.131 -29.822 8.014   1.00 11.95 ? 390  TRP A CE3 1 
ATOM   2158 C  CZ2 . TRP A 1 283 ? 32.622 -28.747 10.593  1.00 13.16 ? 390  TRP A CZ2 1 
ATOM   2159 C  CZ3 . TRP A 1 283 ? 32.853 -30.530 8.983   1.00 14.06 ? 390  TRP A CZ3 1 
ATOM   2160 C  CH2 . TRP A 1 283 ? 33.090 -29.989 10.246  1.00 12.63 ? 390  TRP A CH2 1 
ATOM   2161 N  N   . ARG A 1 284 ? 28.218 -29.313 8.057   1.00 12.38 ? 391  ARG A N   1 
ATOM   2162 C  CA  . ARG A 1 284 ? 27.908 -30.529 8.802   1.00 11.34 ? 391  ARG A CA  1 
ATOM   2163 C  C   . ARG A 1 284 ? 26.521 -31.065 8.425   1.00 12.07 ? 391  ARG A C   1 
ATOM   2164 O  O   . ARG A 1 284 ? 26.341 -32.283 8.327   1.00 11.13 ? 391  ARG A O   1 
ATOM   2165 C  CB  . ARG A 1 284 ? 28.011 -30.275 10.311  1.00 11.10 ? 391  ARG A CB  1 
ATOM   2166 C  CG  . ARG A 1 284 ? 29.445 -30.344 10.833  1.00 10.76 ? 391  ARG A CG  1 
ATOM   2167 C  CD  . ARG A 1 284 ? 29.574 -29.795 12.242  1.00 13.76 ? 391  ARG A CD  1 
ATOM   2168 N  NE  . ARG A 1 284 ? 28.716 -30.487 13.210  1.00 12.22 ? 391  ARG A NE  1 
ATOM   2169 C  CZ  . ARG A 1 284 ? 27.763 -29.887 13.922  1.00 16.96 ? 391  ARG A CZ  1 
ATOM   2170 N  NH1 . ARG A 1 284 ? 27.025 -30.583 14.792  1.00 10.99 ? 391  ARG A NH1 1 
ATOM   2171 N  NH2 . ARG A 1 284 ? 27.545 -28.587 13.770  1.00 12.83 ? 391  ARG A NH2 1 
ATOM   2172 N  N   . ASP A 1 285 ? 25.553 -30.166 8.226   1.00 13.29 ? 392  ASP A N   1 
ATOM   2173 C  CA  . ASP A 1 285 ? 24.234 -30.566 7.705   1.00 12.81 ? 392  ASP A CA  1 
ATOM   2174 C  C   . ASP A 1 285 ? 24.388 -31.459 6.476   1.00 11.60 ? 392  ASP A C   1 
ATOM   2175 O  O   . ASP A 1 285 ? 23.724 -32.483 6.346   1.00 13.65 ? 392  ASP A O   1 
ATOM   2176 C  CB  . ASP A 1 285 ? 23.384 -29.354 7.301   1.00 13.29 ? 392  ASP A CB  1 
ATOM   2177 C  CG  . ASP A 1 285 ? 22.780 -28.615 8.482   1.00 16.19 ? 392  ASP A CG  1 
ATOM   2178 O  OD1 . ASP A 1 285 ? 22.564 -29.223 9.555   1.00 17.65 ? 392  ASP A OD1 1 
ATOM   2179 O  OD2 . ASP A 1 285 ? 22.492 -27.413 8.303   1.00 15.35 ? 392  ASP A OD2 1 
ATOM   2180 N  N   . MET A 1 286 ? 25.255 -31.044 5.560   1.00 11.95 ? 393  MET A N   1 
ATOM   2181 C  CA  . MET A 1 286 ? 25.418 -31.763 4.297   1.00 10.37 ? 393  MET A CA  1 
ATOM   2182 C  C   . MET A 1 286 ? 25.920 -33.198 4.521   1.00 12.60 ? 393  MET A C   1 
ATOM   2183 O  O   . MET A 1 286 ? 25.479 -34.137 3.849   1.00 11.93 ? 393  MET A O   1 
ATOM   2184 C  CB  . MET A 1 286 ? 26.374 -31.000 3.368   1.00 9.77  ? 393  MET A CB  1 
ATOM   2185 C  CG  . MET A 1 286 ? 26.346 -31.503 1.913   1.00 16.51 ? 393  MET A CG  1 
ATOM   2186 S  SD  . MET A 1 286 ? 24.712 -31.328 1.121   1.00 17.56 ? 393  MET A SD  1 
ATOM   2187 C  CE  . MET A 1 286 ? 24.589 -29.540 0.995   1.00 13.66 ? 393  MET A CE  1 
ATOM   2188 N  N   . GLN A 1 287 ? 26.838 -33.381 5.463   1.00 11.83 ? 394  GLN A N   1 
ATOM   2189 C  CA  . GLN A 1 287 ? 27.311 -34.732 5.760   1.00 10.54 ? 394  GLN A CA  1 
ATOM   2190 C  C   . GLN A 1 287 ? 26.201 -35.576 6.408   1.00 11.31 ? 394  GLN A C   1 
ATOM   2191 O  O   . GLN A 1 287 ? 26.067 -36.760 6.093   1.00 12.97 ? 394  GLN A O   1 
ATOM   2192 C  CB  . GLN A 1 287 ? 28.571 -34.685 6.643   1.00 11.92 ? 394  GLN A CB  1 
ATOM   2193 C  CG  . GLN A 1 287 ? 29.730 -33.974 5.918   1.00 12.56 ? 394  GLN A CG  1 
ATOM   2194 C  CD  . GLN A 1 287 ? 31.085 -34.150 6.588   1.00 12.69 ? 394  GLN A CD  1 
ATOM   2195 O  OE1 . GLN A 1 287 ? 31.305 -35.098 7.341   1.00 13.38 ? 394  GLN A OE1 1 
ATOM   2196 N  NE2 . GLN A 1 287 ? 32.008 -33.234 6.298   1.00 11.64 ? 394  GLN A NE2 1 
ATOM   2197 N  N   . HIS A 1 288 ? 25.394 -34.973 7.281   1.00 10.88 ? 395  HIS A N   1 
ATOM   2198 C  CA  . HIS A 1 288 ? 24.223 -35.671 7.834   1.00 12.11 ? 395  HIS A CA  1 
ATOM   2199 C  C   . HIS A 1 288 ? 23.263 -36.146 6.731   1.00 10.93 ? 395  HIS A C   1 
ATOM   2200 O  O   . HIS A 1 288 ? 22.768 -37.273 6.764   1.00 13.11 ? 395  HIS A O   1 
ATOM   2201 C  CB  . HIS A 1 288 ? 23.454 -34.770 8.812   1.00 13.00 ? 395  HIS A CB  1 
ATOM   2202 C  CG  . HIS A 1 288 ? 24.074 -34.668 10.172  1.00 13.74 ? 395  HIS A CG  1 
ATOM   2203 N  ND1 . HIS A 1 288 ? 23.768 -35.542 11.193  1.00 15.72 ? 395  HIS A ND1 1 
ATOM   2204 C  CD2 . HIS A 1 288 ? 24.951 -33.774 10.690  1.00 14.44 ? 395  HIS A CD2 1 
ATOM   2205 C  CE1 . HIS A 1 288 ? 24.443 -35.200 12.280  1.00 15.51 ? 395  HIS A CE1 1 
ATOM   2206 N  NE2 . HIS A 1 288 ? 25.169 -34.132 12.000  1.00 14.40 ? 395  HIS A NE2 1 
ATOM   2207 N  N   . LEU A 1 289 ? 22.989 -35.275 5.773   1.00 11.53 ? 396  LEU A N   1 
ATOM   2208 C  CA  . LEU A 1 289 ? 22.083 -35.620 4.680   1.00 12.13 ? 396  LEU A CA  1 
ATOM   2209 C  C   . LEU A 1 289 ? 22.605 -36.826 3.896   1.00 12.11 ? 396  LEU A C   1 
ATOM   2210 O  O   . LEU A 1 289 ? 21.856 -37.754 3.578   1.00 12.72 ? 396  LEU A O   1 
ATOM   2211 C  CB  . LEU A 1 289 ? 21.897 -34.428 3.741   1.00 12.96 ? 396  LEU A CB  1 
ATOM   2212 C  CG  . LEU A 1 289 ? 21.083 -33.265 4.312   1.00 17.86 ? 396  LEU A CG  1 
ATOM   2213 C  CD1 . LEU A 1 289 ? 20.981 -32.153 3.305   1.00 17.77 ? 396  LEU A CD1 1 
ATOM   2214 C  CD2 . LEU A 1 289 ? 19.701 -33.752 4.701   1.00 23.21 ? 396  LEU A CD2 1 
ATOM   2215 N  N   . VAL A 1 290 ? 23.901 -36.819 3.615   1.00 13.26 ? 397  VAL A N   1 
ATOM   2216 C  CA  . VAL A 1 290 ? 24.528 -37.921 2.891   1.00 12.13 ? 397  VAL A CA  1 
ATOM   2217 C  C   . VAL A 1 290 ? 24.434 -39.233 3.672   1.00 12.73 ? 397  VAL A C   1 
ATOM   2218 O  O   . VAL A 1 290 ? 24.106 -40.275 3.107   1.00 13.30 ? 397  VAL A O   1 
ATOM   2219 C  CB  . VAL A 1 290 ? 26.001 -37.586 2.568   1.00 12.91 ? 397  VAL A CB  1 
ATOM   2220 C  CG1 . VAL A 1 290 ? 26.755 -38.830 2.092   1.00 11.23 ? 397  VAL A CG1 1 
ATOM   2221 C  CG2 . VAL A 1 290 ? 26.047 -36.484 1.508   1.00 11.46 ? 397  VAL A CG2 1 
ATOM   2222 N  N   . VAL A 1 291 ? 24.706 -39.184 4.972   1.00 11.08 ? 398  VAL A N   1 
ATOM   2223 C  CA  . VAL A 1 291 ? 24.593 -40.377 5.803   1.00 10.65 ? 398  VAL A CA  1 
ATOM   2224 C  C   . VAL A 1 291 ? 23.165 -40.931 5.782   1.00 12.81 ? 398  VAL A C   1 
ATOM   2225 O  O   . VAL A 1 291 ? 22.959 -42.139 5.648   1.00 14.85 ? 398  VAL A O   1 
ATOM   2226 C  CB  . VAL A 1 291 ? 25.004 -40.097 7.263   1.00 14.14 ? 398  VAL A CB  1 
ATOM   2227 C  CG1 . VAL A 1 291 ? 24.642 -41.291 8.168   1.00 13.46 ? 398  VAL A CG1 1 
ATOM   2228 C  CG2 . VAL A 1 291 ? 26.509 -39.808 7.351   1.00 10.92 ? 398  VAL A CG2 1 
ATOM   2229 N  N   . GLN A 1 292 ? 22.180 -40.049 5.906   1.00 12.28 ? 399  GLN A N   1 
ATOM   2230 C  CA  . GLN A 1 292 ? 20.803 -40.501 6.060   1.00 13.24 ? 399  GLN A CA  1 
ATOM   2231 C  C   . GLN A 1 292 ? 20.183 -41.006 4.755   1.00 18.17 ? 399  GLN A C   1 
ATOM   2232 O  O   . GLN A 1 292 ? 19.306 -41.864 4.791   1.00 15.90 ? 399  GLN A O   1 
ATOM   2233 C  CB  . GLN A 1 292 ? 19.936 -39.379 6.640   1.00 16.63 ? 399  GLN A CB  1 
ATOM   2234 C  CG  . GLN A 1 292 ? 20.257 -39.067 8.099   1.00 15.04 ? 399  GLN A CG  1 
ATOM   2235 C  CD  . GLN A 1 292 ? 19.219 -38.177 8.745   1.00 21.15 ? 399  GLN A CD  1 
ATOM   2236 O  OE1 . GLN A 1 292 ? 18.085 -38.076 8.269   1.00 21.93 ? 399  GLN A OE1 1 
ATOM   2237 N  NE2 . GLN A 1 292 ? 19.598 -37.527 9.837   1.00 20.76 ? 399  GLN A NE2 1 
ATOM   2238 N  N   . THR A 1 293 ? 20.639 -40.495 3.612   1.00 13.75 ? 400  THR A N   1 
ATOM   2239 C  CA  . THR A 1 293 ? 19.938 -40.776 2.348   1.00 14.40 ? 400  THR A CA  1 
ATOM   2240 C  C   . THR A 1 293 ? 20.639 -41.765 1.418   1.00 16.10 ? 400  THR A C   1 
ATOM   2241 O  O   . THR A 1 293 ? 20.045 -42.229 0.441   1.00 14.20 ? 400  THR A O   1 
ATOM   2242 C  CB  . THR A 1 293 ? 19.700 -39.488 1.534   1.00 17.57 ? 400  THR A CB  1 
ATOM   2243 O  OG1 . THR A 1 293 ? 20.956 -38.861 1.243   1.00 14.74 ? 400  THR A OG1 1 
ATOM   2244 C  CG2 . THR A 1 293 ? 18.805 -38.518 2.290   1.00 15.13 ? 400  THR A CG2 1 
ATOM   2245 N  N   . SER A 1 294 ? 21.895 -42.087 1.696   1.00 14.63 ? 401  SER A N   1 
ATOM   2246 C  CA  . SER A 1 294 ? 22.655 -42.893 0.748   1.00 13.18 ? 401  SER A CA  1 
ATOM   2247 C  C   . SER A 1 294 ? 22.205 -44.356 0.814   1.00 17.58 ? 401  SER A C   1 
ATOM   2248 O  O   . SER A 1 294 ? 21.728 -44.824 1.845   1.00 15.61 ? 401  SER A O   1 
ATOM   2249 C  CB  . SER A 1 294 ? 24.154 -42.752 1.007   1.00 14.32 ? 401  SER A CB  1 
ATOM   2250 O  OG  . SER A 1 294 ? 24.570 -41.425 0.730   1.00 13.89 ? 401  SER A OG  1 
ATOM   2251 N  N   . LYS A 1 295 ? 22.346 -45.061 -0.303  1.00 16.06 ? 402  LYS A N   1 
ATOM   2252 C  CA  . LYS A 1 295 ? 21.696 -46.352 -0.499  1.00 19.71 ? 402  LYS A CA  1 
ATOM   2253 C  C   . LYS A 1 295 ? 22.686 -47.487 -0.764  1.00 16.14 ? 402  LYS A C   1 
ATOM   2254 O  O   . LYS A 1 295 ? 23.391 -47.481 -1.769  1.00 16.22 ? 402  LYS A O   1 
ATOM   2255 C  CB  . LYS A 1 295 ? 20.705 -46.262 -1.675  1.00 19.55 ? 402  LYS A CB  1 
ATOM   2256 C  CG  . LYS A 1 295 ? 19.610 -45.201 -1.521  1.00 18.94 ? 402  LYS A CG  1 
ATOM   2257 C  CD  . LYS A 1 295 ? 18.685 -45.525 -0.354  1.00 24.80 ? 402  LYS A CD  1 
ATOM   2258 C  CE  . LYS A 1 295 ? 17.355 -44.760 -0.449  1.00 29.21 ? 402  LYS A CE  1 
ATOM   2259 N  NZ  . LYS A 1 295 ? 17.524 -43.274 -0.414  1.00 22.48 ? 402  LYS A NZ  1 
ATOM   2260 N  N   . PRO A 1 296 ? 22.718 -48.478 0.130   1.00 16.58 ? 403  PRO A N   1 
ATOM   2261 C  CA  . PRO A 1 296 ? 23.553 -49.666 -0.051  1.00 15.64 ? 403  PRO A CA  1 
ATOM   2262 C  C   . PRO A 1 296 ? 23.073 -50.579 -1.171  1.00 22.69 ? 403  PRO A C   1 
ATOM   2263 O  O   . PRO A 1 296 ? 23.892 -51.292 -1.744  1.00 24.59 ? 403  PRO A O   1 
ATOM   2264 C  CB  . PRO A 1 296 ? 23.433 -50.391 1.297   1.00 21.45 ? 403  PRO A CB  1 
ATOM   2265 C  CG  . PRO A 1 296 ? 23.047 -49.323 2.266   1.00 22.11 ? 403  PRO A CG  1 
ATOM   2266 C  CD  . PRO A 1 296 ? 22.162 -48.396 1.494   1.00 18.18 ? 403  PRO A CD  1 
ATOM   2267 N  N   . ALA A 1 297 ? 21.771 -50.560 -1.459  1.00 20.88 ? 404  ALA A N   1 
ATOM   2268 C  CA  . ALA A 1 297 ? 21.155 -51.573 -2.315  1.00 31.92 ? 404  ALA A CA  1 
ATOM   2269 C  C   . ALA A 1 297 ? 21.931 -51.801 -3.600  1.00 27.55 ? 404  ALA A C   1 
ATOM   2270 O  O   . ALA A 1 297 ? 22.322 -50.851 -4.278  1.00 37.09 ? 404  ALA A O   1 
ATOM   2271 C  CB  . ALA A 1 297 ? 19.716 -51.192 -2.634  1.00 34.68 ? 404  ALA A CB  1 
ATOM   2272 N  N   . HIS A 1 298 ? 22.182 -53.071 -3.894  1.00 36.00 ? 405  HIS A N   1 
ATOM   2273 C  CA  . HIS A 1 298 ? 22.810 -53.503 -5.144  1.00 35.04 ? 405  HIS A CA  1 
ATOM   2274 C  C   . HIS A 1 298 ? 24.288 -53.119 -5.276  1.00 33.64 ? 405  HIS A C   1 
ATOM   2275 O  O   . HIS A 1 298 ? 24.864 -53.233 -6.357  1.00 33.55 ? 405  HIS A O   1 
ATOM   2276 C  CB  . HIS A 1 298 ? 22.030 -52.956 -6.346  1.00 47.40 ? 405  HIS A CB  1 
ATOM   2277 C  CG  . HIS A 1 298 ? 20.578 -53.316 -6.332  1.00 54.76 ? 405  HIS A CG  1 
ATOM   2278 N  ND1 . HIS A 1 298 ? 19.585 -52.429 -6.695  1.00 51.75 ? 405  HIS A ND1 1 
ATOM   2279 C  CD2 . HIS A 1 298 ? 19.950 -54.466 -5.987  1.00 44.53 ? 405  HIS A CD2 1 
ATOM   2280 C  CE1 . HIS A 1 298 ? 18.409 -53.020 -6.578  1.00 52.32 ? 405  HIS A CE1 1 
ATOM   2281 N  NE2 . HIS A 1 298 ? 18.603 -54.256 -6.151  1.00 57.67 ? 405  HIS A NE2 1 
ATOM   2282 N  N   . LEU A 1 299 ? 24.907 -52.667 -4.192  1.00 19.81 ? 406  LEU A N   1 
ATOM   2283 C  CA  . LEU A 1 299 ? 26.358 -52.543 -4.187  1.00 18.16 ? 406  LEU A CA  1 
ATOM   2284 C  C   . LEU A 1 299 ? 26.946 -53.769 -3.502  1.00 20.76 ? 406  LEU A C   1 
ATOM   2285 O  O   . LEU A 1 299 ? 26.600 -54.071 -2.362  1.00 23.09 ? 406  LEU A O   1 
ATOM   2286 C  CB  . LEU A 1 299 ? 26.803 -51.259 -3.491  1.00 15.96 ? 406  LEU A CB  1 
ATOM   2287 C  CG  . LEU A 1 299 ? 26.393 -49.948 -4.160  1.00 20.90 ? 406  LEU A CG  1 
ATOM   2288 C  CD1 . LEU A 1 299 ? 26.942 -48.759 -3.376  1.00 21.07 ? 406  LEU A CD1 1 
ATOM   2289 C  CD2 . LEU A 1 299 ? 26.840 -49.891 -5.625  1.00 21.93 ? 406  LEU A CD2 1 
ATOM   2290 N  N   . ASN A 1 300 ? 27.821 -54.486 -4.206  1.00 15.18 ? 407  ASN A N   1 
ATOM   2291 C  CA  . ASN A 1 300 ? 28.399 -55.713 -3.675  1.00 15.15 ? 407  ASN A CA  1 
ATOM   2292 C  C   . ASN A 1 300 ? 29.702 -55.463 -2.915  1.00 17.63 ? 407  ASN A C   1 
ATOM   2293 O  O   . ASN A 1 300 ? 30.641 -54.874 -3.449  1.00 17.17 ? 407  ASN A O   1 
ATOM   2294 C  CB  . ASN A 1 300 ? 28.648 -56.714 -4.815  1.00 16.64 ? 407  ASN A CB  1 
ATOM   2295 C  CG  . ASN A 1 300 ? 27.405 -56.953 -5.666  1.00 33.12 ? 407  ASN A CG  1 
ATOM   2296 O  OD1 . ASN A 1 300 ? 26.320 -57.228 -5.144  1.00 27.26 ? 407  ASN A OD1 1 
ATOM   2297 N  ND2 . ASN A 1 300 ? 27.559 -56.845 -6.988  1.00 26.08 ? 407  ASN A ND2 1 
ATOM   2298 N  N   . ALA A 1 301 ? 29.750 -55.906 -1.664  1.00 14.87 ? 408  ALA A N   1 
ATOM   2299 C  CA  . ALA A 1 301 ? 30.963 -55.846 -0.864  1.00 17.32 ? 408  ALA A CA  1 
ATOM   2300 C  C   . ALA A 1 301 ? 30.920 -56.973 0.150   1.00 19.18 ? 408  ALA A C   1 
ATOM   2301 O  O   . ALA A 1 301 ? 29.841 -57.422 0.540   1.00 21.92 ? 408  ALA A O   1 
ATOM   2302 C  CB  . ALA A 1 301 ? 31.095 -54.487 -0.164  1.00 18.73 ? 408  ALA A CB  1 
ATOM   2303 N  N   A ASN A 1 302 ? 32.088 -57.423 0.586   0.50 19.35 ? 409  ASN A N   1 
ATOM   2304 N  N   B ASN A 1 302 ? 32.086 -57.436 0.588   0.50 19.35 ? 409  ASN A N   1 
ATOM   2305 C  CA  A ASN A 1 302 ? 32.157 -58.506 1.552   0.50 19.61 ? 409  ASN A CA  1 
ATOM   2306 C  CA  B ASN A 1 302 ? 32.127 -58.518 1.566   0.50 19.61 ? 409  ASN A CA  1 
ATOM   2307 C  C   A ASN A 1 302 ? 32.202 -58.009 2.993   0.50 21.71 ? 409  ASN A C   1 
ATOM   2308 C  C   B ASN A 1 302 ? 32.151 -58.012 3.004   0.50 21.70 ? 409  ASN A C   1 
ATOM   2309 O  O   A ASN A 1 302 ? 32.297 -58.810 3.920   0.50 20.67 ? 409  ASN A O   1 
ATOM   2310 O  O   B ASN A 1 302 ? 32.190 -58.809 3.938   0.50 20.66 ? 409  ASN A O   1 
ATOM   2311 C  CB  A ASN A 1 302 ? 33.375 -59.389 1.265   0.50 21.57 ? 409  ASN A CB  1 
ATOM   2312 C  CB  B ASN A 1 302 ? 33.335 -59.434 1.314   0.50 21.55 ? 409  ASN A CB  1 
ATOM   2313 C  CG  A ASN A 1 302 ? 33.301 -60.055 -0.099  0.50 22.86 ? 409  ASN A CG  1 
ATOM   2314 C  CG  B ASN A 1 302 ? 34.662 -58.801 1.715   0.50 19.56 ? 409  ASN A CG  1 
ATOM   2315 O  OD1 A ASN A 1 302 ? 32.283 -60.645 -0.461  0.00 22.82 ? 409  ASN A OD1 1 
ATOM   2316 O  OD1 B ASN A 1 302 ? 34.771 -57.585 1.867   0.00 21.46 ? 409  ASN A OD1 1 
ATOM   2317 N  ND2 A ASN A 1 302 ? 34.379 -59.948 -0.869  0.00 22.86 ? 409  ASN A ND2 1 
ATOM   2318 N  ND2 B ASN A 1 302 ? 35.684 -59.636 1.870   0.00 21.52 ? 409  ASN A ND2 1 
ATOM   2319 N  N   . ASP A 1 303 ? 32.121 -56.693 3.181   1.00 16.23 ? 410  ASP A N   1 
ATOM   2320 C  CA  . ASP A 1 303 ? 32.247 -56.116 4.521   1.00 18.65 ? 410  ASP A CA  1 
ATOM   2321 C  C   . ASP A 1 303 ? 31.072 -55.247 4.984   1.00 20.92 ? 410  ASP A C   1 
ATOM   2322 O  O   . ASP A 1 303 ? 31.237 -54.444 5.908   1.00 20.14 ? 410  ASP A O   1 
ATOM   2323 C  CB  . ASP A 1 303 ? 33.535 -55.290 4.611   1.00 21.81 ? 410  ASP A CB  1 
ATOM   2324 C  CG  . ASP A 1 303 ? 33.408 -53.920 3.938   1.00 19.85 ? 410  ASP A CG  1 
ATOM   2325 O  OD1 . ASP A 1 303 ? 32.709 -53.809 2.908   1.00 16.76 ? 410  ASP A OD1 1 
ATOM   2326 O  OD2 . ASP A 1 303 ? 33.993 -52.946 4.462   1.00 19.13 ? 410  ASP A OD2 1 
ATOM   2327 N  N   . TRP A 1 304 ? 29.895 -55.408 4.381   1.00 16.64 ? 411  TRP A N   1 
ATOM   2328 C  CA  . TRP A 1 304 ? 28.729 -54.654 4.844   1.00 16.76 ? 411  TRP A CA  1 
ATOM   2329 C  C   . TRP A 1 304 ? 28.430 -55.026 6.294   1.00 18.40 ? 411  TRP A C   1 
ATOM   2330 O  O   . TRP A 1 304 ? 28.395 -56.204 6.645   1.00 19.14 ? 411  TRP A O   1 
ATOM   2331 C  CB  . TRP A 1 304 ? 27.494 -54.913 3.972   1.00 17.64 ? 411  TRP A CB  1 
ATOM   2332 C  CG  . TRP A 1 304 ? 27.447 -54.161 2.655   1.00 15.59 ? 411  TRP A CG  1 
ATOM   2333 C  CD1 . TRP A 1 304 ? 27.526 -54.706 1.401   1.00 17.42 ? 411  TRP A CD1 1 
ATOM   2334 C  CD2 . TRP A 1 304 ? 27.283 -52.746 2.465   1.00 17.51 ? 411  TRP A CD2 1 
ATOM   2335 N  NE1 . TRP A 1 304 ? 27.428 -53.720 0.447   1.00 19.76 ? 411  TRP A NE1 1 
ATOM   2336 C  CE2 . TRP A 1 304 ? 27.274 -52.508 1.073   1.00 15.49 ? 411  TRP A CE2 1 
ATOM   2337 C  CE3 . TRP A 1 304 ? 27.141 -51.655 3.335   1.00 15.06 ? 411  TRP A CE3 1 
ATOM   2338 C  CZ2 . TRP A 1 304 ? 27.130 -51.233 0.534   1.00 13.88 ? 411  TRP A CZ2 1 
ATOM   2339 C  CZ3 . TRP A 1 304 ? 27.003 -50.393 2.802   1.00 14.93 ? 411  TRP A CZ3 1 
ATOM   2340 C  CH2 . TRP A 1 304 ? 27.009 -50.186 1.411   1.00 14.88 ? 411  TRP A CH2 1 
ATOM   2341 N  N   . ALA A 1 305 ? 28.247 -54.017 7.140   1.00 16.37 ? 412  ALA A N   1 
ATOM   2342 C  CA  . ALA A 1 305 ? 27.908 -54.250 8.541   1.00 14.51 ? 412  ALA A CA  1 
ATOM   2343 C  C   . ALA A 1 305 ? 26.858 -53.247 8.969   1.00 17.94 ? 412  ALA A C   1 
ATOM   2344 O  O   . ALA A 1 305 ? 26.825 -52.125 8.470   1.00 18.24 ? 412  ALA A O   1 
ATOM   2345 C  CB  . ALA A 1 305 ? 29.136 -54.141 9.426   1.00 18.10 ? 412  ALA A CB  1 
ATOM   2346 N  N   . THR A 1 306 ? 25.997 -53.646 9.899   1.00 14.25 ? 413  THR A N   1 
ATOM   2347 C  CA  . THR A 1 306 ? 24.977 -52.741 10.392  1.00 12.63 ? 413  THR A CA  1 
ATOM   2348 C  C   . THR A 1 306 ? 25.493 -52.076 11.657  1.00 16.17 ? 413  THR A C   1 
ATOM   2349 O  O   . THR A 1 306 ? 25.926 -52.770 12.571  1.00 16.17 ? 413  THR A O   1 
ATOM   2350 C  CB  . THR A 1 306 ? 23.662 -53.494 10.670  1.00 22.36 ? 413  THR A CB  1 
ATOM   2351 O  OG1 . THR A 1 306 ? 23.245 -54.158 9.465   1.00 20.29 ? 413  THR A OG1 1 
ATOM   2352 C  CG2 . THR A 1 306 ? 22.577 -52.529 11.122  1.00 17.44 ? 413  THR A CG2 1 
ATOM   2353 N  N   . ASN A 1 307 ? 25.458 -50.745 11.715  1.00 13.39 ? 414  ASN A N   1 
ATOM   2354 C  CA  . ASN A 1 307 ? 26.016 -50.052 12.876  1.00 14.44 ? 414  ASN A CA  1 
ATOM   2355 C  C   . ASN A 1 307 ? 24.981 -49.938 14.003  1.00 20.18 ? 414  ASN A C   1 
ATOM   2356 O  O   . ASN A 1 307 ? 23.945 -50.600 13.970  1.00 14.48 ? 414  ASN A O   1 
ATOM   2357 C  CB  . ASN A 1 307 ? 26.590 -48.671 12.488  1.00 12.42 ? 414  ASN A CB  1 
ATOM   2358 C  CG  . ASN A 1 307 ? 25.532 -47.659 12.077  1.00 13.85 ? 414  ASN A CG  1 
ATOM   2359 O  OD1 . ASN A 1 307 ? 24.333 -47.887 12.214  1.00 13.82 ? 414  ASN A OD1 1 
ATOM   2360 N  ND2 . ASN A 1 307 ? 25.989 -46.511 11.562  1.00 14.39 ? 414  ASN A ND2 1 
ATOM   2361 N  N   . GLY A 1 308 ? 25.266 -49.103 14.996  1.00 14.11 ? 415  GLY A N   1 
ATOM   2362 C  CA  . GLY A 1 308 ? 24.461 -49.080 16.210  1.00 14.98 ? 415  GLY A CA  1 
ATOM   2363 C  C   . GLY A 1 308 ? 23.093 -48.445 16.029  1.00 18.58 ? 415  GLY A C   1 
ATOM   2364 O  O   . GLY A 1 308 ? 22.212 -48.614 16.872  1.00 19.42 ? 415  GLY A O   1 
ATOM   2365 N  N   . VAL A 1 309 ? 22.902 -47.708 14.938  1.00 14.24 ? 416  VAL A N   1 
ATOM   2366 C  CA  . VAL A 1 309 ? 21.612 -47.071 14.699  1.00 14.47 ? 416  VAL A CA  1 
ATOM   2367 C  C   . VAL A 1 309 ? 20.958 -47.661 13.456  1.00 16.61 ? 416  VAL A C   1 
ATOM   2368 O  O   . VAL A 1 309 ? 20.083 -47.049 12.846  1.00 18.43 ? 416  VAL A O   1 
ATOM   2369 C  CB  . VAL A 1 309 ? 21.747 -45.538 14.578  1.00 16.20 ? 416  VAL A CB  1 
ATOM   2370 C  CG1 . VAL A 1 309 ? 22.176 -44.955 15.924  1.00 14.50 ? 416  VAL A CG1 1 
ATOM   2371 C  CG2 . VAL A 1 309 ? 22.756 -45.165 13.505  1.00 14.86 ? 416  VAL A CG2 1 
ATOM   2372 N  N   . GLY A 1 310 ? 21.399 -48.861 13.102  1.00 13.79 ? 417  GLY A N   1 
ATOM   2373 C  CA  . GLY A 1 310 ? 20.721 -49.668 12.109  1.00 14.78 ? 417  GLY A CA  1 
ATOM   2374 C  C   . GLY A 1 310 ? 21.048 -49.357 10.660  1.00 18.84 ? 417  GLY A C   1 
ATOM   2375 O  O   . GLY A 1 310 ? 20.356 -49.839 9.762   1.00 15.71 ? 417  GLY A O   1 
ATOM   2376 N  N   . ARG A 1 311 ? 22.088 -48.560 10.423  1.00 15.42 ? 418  ARG A N   1 
ATOM   2377 C  CA  . ARG A 1 311 ? 22.478 -48.237 9.049   1.00 15.36 ? 418  ARG A CA  1 
ATOM   2378 C  C   . ARG A 1 311 ? 23.576 -49.176 8.567   1.00 15.77 ? 418  ARG A C   1 
ATOM   2379 O  O   . ARG A 1 311 ? 24.497 -49.506 9.310   1.00 14.43 ? 418  ARG A O   1 
ATOM   2380 C  CB  . ARG A 1 311 ? 22.943 -46.780 8.930   1.00 13.56 ? 418  ARG A CB  1 
ATOM   2381 C  CG  . ARG A 1 311 ? 21.904 -45.758 9.318   1.00 19.28 ? 418  ARG A CG  1 
ATOM   2382 C  CD  . ARG A 1 311 ? 22.273 -44.358 8.820   1.00 17.28 ? 418  ARG A CD  1 
ATOM   2383 N  NE  . ARG A 1 311 ? 21.233 -43.386 9.159   1.00 19.31 ? 418  ARG A NE  1 
ATOM   2384 C  CZ  . ARG A 1 311 ? 21.326 -42.499 10.146  1.00 23.28 ? 418  ARG A CZ  1 
ATOM   2385 N  NH1 . ARG A 1 311 ? 20.325 -41.659 10.375  1.00 19.72 ? 418  ARG A NH1 1 
ATOM   2386 N  NH2 . ARG A 1 311 ? 22.426 -42.438 10.894  1.00 16.96 ? 418  ARG A NH2 1 
ATOM   2387 N  N   . LYS A 1 312 ? 23.461 -49.622 7.320   1.00 14.69 ? 419  LYS A N   1 
ATOM   2388 C  CA  . LYS A 1 312 ? 24.492 -50.446 6.698   1.00 15.10 ? 419  LYS A CA  1 
ATOM   2389 C  C   . LYS A 1 312 ? 25.674 -49.596 6.268   1.00 14.06 ? 419  LYS A C   1 
ATOM   2390 O  O   . LYS A 1 312 ? 25.496 -48.543 5.655   1.00 15.54 ? 419  LYS A O   1 
ATOM   2391 C  CB  . LYS A 1 312 ? 23.925 -51.174 5.480   1.00 15.45 ? 419  LYS A CB  1 
ATOM   2392 C  CG  . LYS A 1 312 ? 22.757 -52.053 5.820   1.00 25.77 ? 419  LYS A CG  1 
ATOM   2393 C  CD  . LYS A 1 312 ? 23.196 -53.479 5.969   1.00 41.09 ? 419  LYS A CD  1 
ATOM   2394 C  CE  . LYS A 1 312 ? 22.923 -54.245 4.691   1.00 47.14 ? 419  LYS A CE  1 
ATOM   2395 N  NZ  . LYS A 1 312 ? 21.461 -54.441 4.500   1.00 49.63 ? 419  LYS A NZ  1 
ATOM   2396 N  N   A VAL A 1 313 ? 26.886 -50.055 6.561   0.50 13.04 ? 420  VAL A N   1 
ATOM   2397 N  N   B VAL A 1 313 ? 26.882 -50.049 6.608   0.50 13.05 ? 420  VAL A N   1 
ATOM   2398 C  CA  A VAL A 1 313 ? 28.054 -49.290 6.171   0.50 12.50 ? 420  VAL A CA  1 
ATOM   2399 C  CA  B VAL A 1 313 ? 28.097 -49.329 6.253   0.50 12.55 ? 420  VAL A CA  1 
ATOM   2400 C  C   A VAL A 1 313 ? 29.196 -50.225 5.773   0.50 14.05 ? 420  VAL A C   1 
ATOM   2401 C  C   B VAL A 1 313 ? 29.151 -50.287 5.709   0.50 14.07 ? 420  VAL A C   1 
ATOM   2402 O  O   A VAL A 1 313 ? 29.365 -51.313 6.333   0.50 15.10 ? 420  VAL A O   1 
ATOM   2403 O  O   B VAL A 1 313 ? 29.236 -51.446 6.127   0.50 14.81 ? 420  VAL A O   1 
ATOM   2404 C  CB  A VAL A 1 313 ? 28.492 -48.321 7.306   0.50 15.07 ? 420  VAL A CB  1 
ATOM   2405 C  CB  B VAL A 1 313 ? 28.699 -48.561 7.464   0.50 15.27 ? 420  VAL A CB  1 
ATOM   2406 C  CG1 A VAL A 1 313 ? 29.027 -49.091 8.499   0.50 12.13 ? 420  VAL A CG1 1 
ATOM   2407 C  CG1 B VAL A 1 313 ? 29.418 -47.303 6.991   0.50 16.47 ? 420  VAL A CG1 1 
ATOM   2408 C  CG2 A VAL A 1 313 ? 29.517 -47.309 6.796   0.50 16.39 ? 420  VAL A CG2 1 
ATOM   2409 C  CG2 B VAL A 1 313 ? 27.627 -48.198 8.471   0.50 13.74 ? 420  VAL A CG2 1 
ATOM   2410 N  N   . SER A 1 314 ? 29.947 -49.794 4.766   1.00 10.64 ? 421  SER A N   1 
ATOM   2411 C  CA  . SER A 1 314 ? 31.034 -50.560 4.177   1.00 11.44 ? 421  SER A CA  1 
ATOM   2412 C  C   . SER A 1 314 ? 32.267 -49.670 4.123   1.00 13.03 ? 421  SER A C   1 
ATOM   2413 O  O   . SER A 1 314 ? 32.144 -48.467 3.948   1.00 12.91 ? 421  SER A O   1 
ATOM   2414 C  CB  . SER A 1 314 ? 30.674 -51.020 2.757   1.00 14.67 ? 421  SER A CB  1 
ATOM   2415 O  OG  . SER A 1 314 ? 31.828 -51.468 2.061   1.00 15.04 ? 421  SER A OG  1 
ATOM   2416 N  N   . HIS A 1 315 ? 33.451 -50.251 4.258   1.00 10.21 ? 422  HIS A N   1 
ATOM   2417 C  CA  . HIS A 1 315 ? 34.672 -49.464 4.124   1.00 10.76 ? 422  HIS A CA  1 
ATOM   2418 C  C   . HIS A 1 315 ? 34.956 -49.122 2.656   1.00 13.87 ? 422  HIS A C   1 
ATOM   2419 O  O   . HIS A 1 315 ? 35.698 -48.187 2.357   1.00 13.00 ? 422  HIS A O   1 
ATOM   2420 C  CB  . HIS A 1 315 ? 35.846 -50.209 4.751   1.00 9.36  ? 422  HIS A CB  1 
ATOM   2421 C  CG  . HIS A 1 315 ? 35.729 -50.347 6.238   1.00 12.71 ? 422  HIS A CG  1 
ATOM   2422 N  ND1 . HIS A 1 315 ? 34.912 -51.284 6.832   1.00 15.88 ? 422  HIS A ND1 1 
ATOM   2423 C  CD2 . HIS A 1 315 ? 36.306 -49.652 7.249   1.00 14.37 ? 422  HIS A CD2 1 
ATOM   2424 C  CE1 . HIS A 1 315 ? 35.003 -51.172 8.150   1.00 13.45 ? 422  HIS A CE1 1 
ATOM   2425 N  NE2 . HIS A 1 315 ? 35.833 -50.183 8.427   1.00 13.01 ? 422  HIS A NE2 1 
ATOM   2426 N  N   . SER A 1 316 ? 34.358 -49.869 1.735   1.00 12.32 ? 423  SER A N   1 
ATOM   2427 C  CA  . SER A 1 316 ? 34.500 -49.529 0.312   1.00 10.93 ? 423  SER A CA  1 
ATOM   2428 C  C   . SER A 1 316 ? 33.536 -48.437 -0.125  1.00 13.94 ? 423  SER A C   1 
ATOM   2429 O  O   . SER A 1 316 ? 33.831 -47.658 -1.036  1.00 14.76 ? 423  SER A O   1 
ATOM   2430 C  CB  . SER A 1 316 ? 34.277 -50.772 -0.577  1.00 11.88 ? 423  SER A CB  1 
ATOM   2431 O  OG  . SER A 1 316 ? 35.338 -51.702 -0.458  1.00 12.82 ? 423  SER A OG  1 
ATOM   2432 N  N   . TYR A 1 317 ? 32.366 -48.398 0.500   1.00 13.39 ? 424  TYR A N   1 
ATOM   2433 C  CA  . TYR A 1 317 ? 31.276 -47.588 -0.024  1.00 12.72 ? 424  TYR A CA  1 
ATOM   2434 C  C   . TYR A 1 317 ? 30.727 -46.542 0.944   1.00 13.35 ? 424  TYR A C   1 
ATOM   2435 O  O   . TYR A 1 317 ? 29.860 -45.746 0.576   1.00 13.41 ? 424  TYR A O   1 
ATOM   2436 C  CB  . TYR A 1 317 ? 30.114 -48.486 -0.438  1.00 15.13 ? 424  TYR A CB  1 
ATOM   2437 C  CG  . TYR A 1 317 ? 30.366 -49.494 -1.547  1.00 13.24 ? 424  TYR A CG  1 
ATOM   2438 C  CD1 . TYR A 1 317 ? 30.878 -49.108 -2.784  1.00 13.91 ? 424  TYR A CD1 1 
ATOM   2439 C  CD2 . TYR A 1 317 ? 30.043 -50.836 -1.356  1.00 13.59 ? 424  TYR A CD2 1 
ATOM   2440 C  CE1 . TYR A 1 317 ? 31.057 -50.053 -3.809  1.00 13.04 ? 424  TYR A CE1 1 
ATOM   2441 C  CE2 . TYR A 1 317 ? 30.222 -51.773 -2.355  1.00 13.85 ? 424  TYR A CE2 1 
ATOM   2442 C  CZ  . TYR A 1 317 ? 30.731 -51.378 -3.578  1.00 16.27 ? 424  TYR A CZ  1 
ATOM   2443 O  OH  . TYR A 1 317 ? 30.896 -52.320 -4.565  1.00 15.13 ? 424  TYR A OH  1 
ATOM   2444 N  N   . GLY A 1 318 ? 31.207 -46.551 2.180   1.00 13.25 ? 425  GLY A N   1 
ATOM   2445 C  CA  . GLY A 1 318 ? 30.606 -45.706 3.192   1.00 13.56 ? 425  GLY A CA  1 
ATOM   2446 C  C   . GLY A 1 318 ? 29.157 -46.132 3.381   1.00 11.93 ? 425  GLY A C   1 
ATOM   2447 O  O   . GLY A 1 318 ? 28.872 -47.328 3.514   1.00 11.97 ? 425  GLY A O   1 
ATOM   2448 N  N   . TYR A 1 319 ? 28.242 -45.165 3.369   1.00 11.02 ? 426  TYR A N   1 
ATOM   2449 C  CA  . TYR A 1 319 ? 26.826 -45.469 3.578   1.00 10.69 ? 426  TYR A CA  1 
ATOM   2450 C  C   . TYR A 1 319 ? 26.120 -45.857 2.279   1.00 16.43 ? 426  TYR A C   1 
ATOM   2451 O  O   . TYR A 1 319 ? 24.925 -46.134 2.268   1.00 13.68 ? 426  TYR A O   1 
ATOM   2452 C  CB  . TYR A 1 319 ? 26.127 -44.276 4.246   1.00 9.62  ? 426  TYR A CB  1 
ATOM   2453 C  CG  . TYR A 1 319 ? 26.541 -44.196 5.689   1.00 14.43 ? 426  TYR A CG  1 
ATOM   2454 C  CD1 . TYR A 1 319 ? 27.683 -43.488 6.079   1.00 12.18 ? 426  TYR A CD1 1 
ATOM   2455 C  CD2 . TYR A 1 319 ? 25.835 -44.900 6.656   1.00 13.16 ? 426  TYR A CD2 1 
ATOM   2456 C  CE1 . TYR A 1 319 ? 28.088 -43.468 7.415   1.00 12.18 ? 426  TYR A CE1 1 
ATOM   2457 C  CE2 . TYR A 1 319 ? 26.218 -44.876 7.977   1.00 11.96 ? 426  TYR A CE2 1 
ATOM   2458 C  CZ  . TYR A 1 319 ? 27.336 -44.167 8.357   1.00 11.08 ? 426  TYR A CZ  1 
ATOM   2459 O  OH  . TYR A 1 319 ? 27.686 -44.174 9.691   1.00 10.98 ? 426  TYR A OH  1 
ATOM   2460 N  N   . GLY A 1 320 ? 26.872 -45.882 1.187   1.00 11.71 ? 427  GLY A N   1 
ATOM   2461 C  CA  . GLY A 1 320 ? 26.344 -46.386 -0.073  1.00 13.70 ? 427  GLY A CA  1 
ATOM   2462 C  C   . GLY A 1 320 ? 26.271 -45.350 -1.174  1.00 13.30 ? 427  GLY A C   1 
ATOM   2463 O  O   . GLY A 1 320 ? 26.936 -44.320 -1.137  1.00 13.06 ? 427  GLY A O   1 
ATOM   2464 N  N   . LEU A 1 321 ? 25.446 -45.636 -2.173  1.00 13.94 ? 428  LEU A N   1 
ATOM   2465 C  CA  . LEU A 1 321 ? 25.297 -44.773 -3.328  1.00 14.47 ? 428  LEU A CA  1 
ATOM   2466 C  C   . LEU A 1 321 ? 24.549 -43.490 -2.991  1.00 14.40 ? 428  LEU A C   1 
ATOM   2467 O  O   . LEU A 1 321 ? 23.511 -43.534 -2.333  1.00 16.93 ? 428  LEU A O   1 
ATOM   2468 C  CB  . LEU A 1 321 ? 24.540 -45.525 -4.423  1.00 14.51 ? 428  LEU A CB  1 
ATOM   2469 C  CG  . LEU A 1 321 ? 24.790 -45.026 -5.829  1.00 22.62 ? 428  LEU A CG  1 
ATOM   2470 C  CD1 . LEU A 1 321 ? 26.201 -45.412 -6.252  1.00 17.24 ? 428  LEU A CD1 1 
ATOM   2471 C  CD2 . LEU A 1 321 ? 23.735 -45.637 -6.758  1.00 24.09 ? 428  LEU A CD2 1 
ATOM   2472 N  N   . LEU A 1 322 ? 25.053 -42.355 -3.461  1.00 12.36 ? 429  LEU A N   1 
ATOM   2473 C  CA  . LEU A 1 322 ? 24.309 -41.108 -3.344  1.00 12.34 ? 429  LEU A CA  1 
ATOM   2474 C  C   . LEU A 1 322 ? 22.981 -41.225 -4.086  1.00 13.73 ? 429  LEU A C   1 
ATOM   2475 O  O   . LEU A 1 322 ? 22.879 -41.894 -5.110  1.00 14.24 ? 429  LEU A O   1 
ATOM   2476 C  CB  . LEU A 1 322 ? 25.111 -39.926 -3.894  1.00 14.35 ? 429  LEU A CB  1 
ATOM   2477 C  CG  . LEU A 1 322 ? 26.330 -39.497 -3.069  1.00 13.63 ? 429  LEU A CG  1 
ATOM   2478 C  CD1 . LEU A 1 322 ? 26.946 -38.261 -3.707  1.00 13.42 ? 429  LEU A CD1 1 
ATOM   2479 C  CD2 . LEU A 1 322 ? 25.927 -39.212 -1.621  1.00 15.11 ? 429  LEU A CD2 1 
ATOM   2480 N  N   . ASP A 1 323 ? 21.971 -40.569 -3.538  1.00 14.34 ? 430  ASP A N   1 
ATOM   2481 C  CA  . ASP A 1 323 ? 20.626 -40.576 -4.084  1.00 15.53 ? 430  ASP A CA  1 
ATOM   2482 C  C   . ASP A 1 323 ? 20.186 -39.116 -4.182  1.00 14.87 ? 430  ASP A C   1 
ATOM   2483 O  O   . ASP A 1 323 ? 19.795 -38.519 -3.182  1.00 16.31 ? 430  ASP A O   1 
ATOM   2484 C  CB  . ASP A 1 323 ? 19.702 -41.407 -3.175  1.00 16.21 ? 430  ASP A CB  1 
ATOM   2485 C  CG  . ASP A 1 323 ? 18.258 -41.463 -3.664  1.00 20.95 ? 430  ASP A CG  1 
ATOM   2486 O  OD1 . ASP A 1 323 ? 17.835 -40.598 -4.457  1.00 18.66 ? 430  ASP A OD1 1 
ATOM   2487 O  OD2 . ASP A 1 323 ? 17.539 -42.384 -3.224  1.00 22.62 ? 430  ASP A OD2 1 
ATOM   2488 N  N   . ALA A 1 324 ? 20.271 -38.532 -5.373  1.00 14.93 ? 431  ALA A N   1 
ATOM   2489 C  CA  . ALA A 1 324 ? 20.026 -37.103 -5.519  1.00 14.08 ? 431  ALA A CA  1 
ATOM   2490 C  C   . ALA A 1 324 ? 18.582 -36.741 -5.180  1.00 18.12 ? 431  ALA A C   1 
ATOM   2491 O  O   . ALA A 1 324 ? 18.331 -35.737 -4.514  1.00 16.12 ? 431  ALA A O   1 
ATOM   2492 C  CB  . ALA A 1 324 ? 20.366 -36.635 -6.927  1.00 15.13 ? 431  ALA A CB  1 
ATOM   2493 N  N   . GLY A 1 325 ? 17.639 -37.560 -5.634  1.00 17.20 ? 432  GLY A N   1 
ATOM   2494 C  CA  . GLY A 1 325 ? 16.235 -37.314 -5.352  1.00 22.50 ? 432  GLY A CA  1 
ATOM   2495 C  C   . GLY A 1 325 ? 15.972 -37.279 -3.857  1.00 22.51 ? 432  GLY A C   1 
ATOM   2496 O  O   . GLY A 1 325 ? 15.253 -36.408 -3.355  1.00 19.25 ? 432  GLY A O   1 
ATOM   2497 N  N   . ALA A 1 326 ? 16.570 -38.218 -3.132  1.00 17.38 ? 433  ALA A N   1 
ATOM   2498 C  CA  . ALA A 1 326 ? 16.358 -38.290 -1.696  1.00 17.12 ? 433  ALA A CA  1 
ATOM   2499 C  C   . ALA A 1 326 ? 17.047 -37.132 -0.964  1.00 18.66 ? 433  ALA A C   1 
ATOM   2500 O  O   . ALA A 1 326 ? 16.524 -36.603 0.022   1.00 17.29 ? 433  ALA A O   1 
ATOM   2501 C  CB  . ALA A 1 326 ? 16.847 -39.633 -1.159  1.00 15.15 ? 433  ALA A CB  1 
ATOM   2502 N  N   . MET A 1 327 ? 18.229 -36.753 -1.440  1.00 15.73 ? 434  MET A N   1 
ATOM   2503 C  CA  . MET A 1 327 ? 18.980 -35.649 -0.856  1.00 16.60 ? 434  MET A CA  1 
ATOM   2504 C  C   . MET A 1 327 ? 18.200 -34.346 -0.928  1.00 16.53 ? 434  MET A C   1 
ATOM   2505 O  O   . MET A 1 327 ? 18.052 -33.645 0.068   1.00 17.75 ? 434  MET A O   1 
ATOM   2506 C  CB  . MET A 1 327 ? 20.331 -35.479 -1.568  1.00 14.83 ? 434  MET A CB  1 
ATOM   2507 C  CG  . MET A 1 327 ? 21.371 -36.532 -1.180  1.00 15.58 ? 434  MET A CG  1 
ATOM   2508 S  SD  . MET A 1 327 ? 22.223 -36.103 0.346   1.00 17.44 ? 434  MET A SD  1 
ATOM   2509 C  CE  . MET A 1 327 ? 23.199 -34.698 -0.200  1.00 15.69 ? 434  MET A CE  1 
ATOM   2510 N  N   A VAL A 1 328 ? 17.681 -34.012 -2.111  0.50 16.98 ? 435  VAL A N   1 
ATOM   2511 N  N   B VAL A 1 328 ? 17.710 -34.045 -2.123  0.50 16.98 ? 435  VAL A N   1 
ATOM   2512 C  CA  A VAL A 1 328 ? 16.986 -32.737 -2.269  0.50 16.46 ? 435  VAL A CA  1 
ATOM   2513 C  CA  B VAL A 1 328 ? 16.969 -32.829 -2.378  0.50 16.47 ? 435  VAL A CA  1 
ATOM   2514 C  C   A VAL A 1 328 ? 15.639 -32.748 -1.542  0.50 17.96 ? 435  VAL A C   1 
ATOM   2515 C  C   B VAL A 1 328 ? 15.677 -32.774 -1.556  0.50 17.94 ? 435  VAL A C   1 
ATOM   2516 O  O   A VAL A 1 328 ? 15.186 -31.707 -1.067  0.50 20.00 ? 435  VAL A O   1 
ATOM   2517 O  O   B VAL A 1 328 ? 15.306 -31.724 -1.028  0.50 19.95 ? 435  VAL A O   1 
ATOM   2518 C  CB  A VAL A 1 328 ? 16.784 -32.359 -3.765  0.50 19.14 ? 435  VAL A CB  1 
ATOM   2519 C  CB  B VAL A 1 328 ? 16.670 -32.720 -3.882  0.50 20.55 ? 435  VAL A CB  1 
ATOM   2520 C  CG1 A VAL A 1 328 ? 18.137 -32.284 -4.479  0.50 16.72 ? 435  VAL A CG1 1 
ATOM   2521 C  CG1 B VAL A 1 328 ? 15.343 -32.082 -4.117  0.50 26.42 ? 435  VAL A CG1 1 
ATOM   2522 C  CG2 A VAL A 1 328 ? 15.862 -33.347 -4.473  0.50 17.87 ? 435  VAL A CG2 1 
ATOM   2523 C  CG2 B VAL A 1 328 ? 17.810 -31.989 -4.604  0.50 18.59 ? 435  VAL A CG2 1 
ATOM   2524 N  N   . ALA A 1 329 ? 15.011 -33.916 -1.433  1.00 17.42 ? 436  ALA A N   1 
ATOM   2525 C  CA  . ALA A 1 329 ? 13.752 -34.017 -0.695  1.00 21.28 ? 436  ALA A CA  1 
ATOM   2526 C  C   . ALA A 1 329 ? 13.969 -33.760 0.786   1.00 22.95 ? 436  ALA A C   1 
ATOM   2527 O  O   . ALA A 1 329 ? 13.245 -32.979 1.403   1.00 22.05 ? 436  ALA A O   1 
ATOM   2528 C  CB  . ALA A 1 329 ? 13.112 -35.385 -0.898  1.00 20.28 ? 436  ALA A CB  1 
ATOM   2529 N  N   . LEU A 1 330 ? 14.975 -34.416 1.356   1.00 19.91 ? 437  LEU A N   1 
ATOM   2530 C  CA  . LEU A 1 330 ? 15.237 -34.297 2.788   1.00 20.67 ? 437  LEU A CA  1 
ATOM   2531 C  C   . LEU A 1 330 ? 15.761 -32.906 3.157   1.00 18.04 ? 437  LEU A C   1 
ATOM   2532 O  O   . LEU A 1 330 ? 15.503 -32.412 4.258   1.00 20.24 ? 437  LEU A O   1 
ATOM   2533 C  CB  . LEU A 1 330 ? 16.227 -35.378 3.235   1.00 16.96 ? 437  LEU A CB  1 
ATOM   2534 C  CG  . LEU A 1 330 ? 16.438 -35.551 4.741   1.00 21.12 ? 437  LEU A CG  1 
ATOM   2535 C  CD1 . LEU A 1 330 ? 15.108 -35.818 5.452   1.00 24.79 ? 437  LEU A CD1 1 
ATOM   2536 C  CD2 . LEU A 1 330 ? 17.405 -36.687 5.007   1.00 22.83 ? 437  LEU A CD2 1 
ATOM   2537 N  N   . ALA A 1 331 ? 16.481 -32.271 2.234   1.00 17.14 ? 438  ALA A N   1 
ATOM   2538 C  CA  . ALA A 1 331 ? 17.056 -30.950 2.490   1.00 15.18 ? 438  ALA A CA  1 
ATOM   2539 C  C   . ALA A 1 331 ? 15.996 -29.883 2.746   1.00 21.90 ? 438  ALA A C   1 
ATOM   2540 O  O   . ALA A 1 331 ? 16.189 -28.984 3.566   1.00 18.00 ? 438  ALA A O   1 
ATOM   2541 C  CB  . ALA A 1 331 ? 17.936 -30.516 1.317   1.00 16.54 ? 438  ALA A CB  1 
ATOM   2542 N  N   . GLN A 1 332 ? 14.876 -29.988 2.044   1.00 18.17 ? 439  GLN A N   1 
ATOM   2543 C  CA  . GLN A 1 332 ? 13.944 -28.866 1.982   1.00 23.01 ? 439  GLN A CA  1 
ATOM   2544 C  C   . GLN A 1 332 ? 13.429 -28.430 3.348   1.00 24.54 ? 439  GLN A C   1 
ATOM   2545 O  O   . GLN A 1 332 ? 13.388 -27.236 3.632   1.00 27.13 ? 439  GLN A O   1 
ATOM   2546 C  CB  . GLN A 1 332 ? 12.785 -29.200 1.046   1.00 25.36 ? 439  GLN A CB  1 
ATOM   2547 C  CG  . GLN A 1 332 ? 13.200 -29.071 -0.408  1.00 28.26 ? 439  GLN A CG  1 
ATOM   2548 C  CD  . GLN A 1 332 ? 12.156 -29.583 -1.370  1.00 36.07 ? 439  GLN A CD  1 
ATOM   2549 O  OE1 . GLN A 1 332 ? 11.097 -28.978 -1.530  1.00 44.63 ? 439  GLN A OE1 1 
ATOM   2550 N  NE2 . GLN A 1 332 ? 12.452 -30.704 -2.024  1.00 34.51 ? 439  GLN A NE2 1 
ATOM   2551 N  N   . ASN A 1 333 ? 13.077 -29.371 4.212   1.00 17.70 ? 440  ASN A N   1 
ATOM   2552 C  CA  . ASN A 1 333 ? 12.668 -28.955 5.549   1.00 29.44 ? 440  ASN A CA  1 
ATOM   2553 C  C   . ASN A 1 333 ? 13.629 -29.360 6.657   1.00 32.06 ? 440  ASN A C   1 
ATOM   2554 O  O   . ASN A 1 333 ? 13.238 -29.470 7.821   1.00 24.27 ? 440  ASN A O   1 
ATOM   2555 C  CB  . ASN A 1 333 ? 11.273 -29.477 5.861   1.00 33.80 ? 440  ASN A CB  1 
ATOM   2556 C  CG  . ASN A 1 333 ? 10.221 -28.412 5.672   1.00 50.08 ? 440  ASN A CG  1 
ATOM   2557 O  OD1 . ASN A 1 333 ? 9.558  -28.355 4.635   1.00 50.23 ? 440  ASN A OD1 1 
ATOM   2558 N  ND2 . ASN A 1 333 ? 10.090 -27.531 6.662   1.00 50.61 ? 440  ASN A ND2 1 
ATOM   2559 N  N   . TRP A 1 334 ? 14.891 -29.542 6.287   1.00 23.62 ? 441  TRP A N   1 
ATOM   2560 C  CA  . TRP A 1 334 ? 15.934 -29.918 7.234   1.00 22.44 ? 441  TRP A CA  1 
ATOM   2561 C  C   . TRP A 1 334 ? 16.114 -28.887 8.343   1.00 22.91 ? 441  TRP A C   1 
ATOM   2562 O  O   . TRP A 1 334 ? 16.191 -27.685 8.081   1.00 21.06 ? 441  TRP A O   1 
ATOM   2563 C  CB  . TRP A 1 334 ? 17.264 -30.113 6.497   1.00 20.64 ? 441  TRP A CB  1 
ATOM   2564 C  CG  . TRP A 1 334 ? 18.372 -30.598 7.370   1.00 17.54 ? 441  TRP A CG  1 
ATOM   2565 C  CD1 . TRP A 1 334 ? 19.369 -29.847 7.921   1.00 18.91 ? 441  TRP A CD1 1 
ATOM   2566 C  CD2 . TRP A 1 334 ? 18.601 -31.946 7.796   1.00 18.68 ? 441  TRP A CD2 1 
ATOM   2567 N  NE1 . TRP A 1 334 ? 20.208 -30.645 8.660   1.00 16.79 ? 441  TRP A NE1 1 
ATOM   2568 C  CE2 . TRP A 1 334 ? 19.758 -31.937 8.600   1.00 17.57 ? 441  TRP A CE2 1 
ATOM   2569 C  CE3 . TRP A 1 334 ? 17.940 -33.158 7.577   1.00 21.09 ? 441  TRP A CE3 1 
ATOM   2570 C  CZ2 . TRP A 1 334 ? 20.269 -33.092 9.189   1.00 20.01 ? 441  TRP A CZ2 1 
ATOM   2571 C  CZ3 . TRP A 1 334 ? 18.451 -34.307 8.159   1.00 25.16 ? 441  TRP A CZ3 1 
ATOM   2572 C  CH2 . TRP A 1 334 ? 19.605 -34.265 8.957   1.00 29.66 ? 441  TRP A CH2 1 
ATOM   2573 N  N   . THR A 1 335 ? 16.180 -29.376 9.576   1.00 18.61 ? 442  THR A N   1 
ATOM   2574 C  CA  . THR A 1 335 ? 16.497 -28.549 10.739  1.00 20.85 ? 442  THR A CA  1 
ATOM   2575 C  C   . THR A 1 335 ? 18.004 -28.550 10.991  1.00 18.07 ? 442  THR A C   1 
ATOM   2576 O  O   . THR A 1 335 ? 18.593 -29.607 11.173  1.00 18.37 ? 442  THR A O   1 
ATOM   2577 C  CB  . THR A 1 335 ? 15.765 -29.058 12.002  1.00 27.70 ? 442  THR A CB  1 
ATOM   2578 O  OG1 . THR A 1 335 ? 14.354 -28.939 11.808  1.00 30.76 ? 442  THR A OG1 1 
ATOM   2579 C  CG2 . THR A 1 335 ? 16.172 -28.251 13.231  1.00 26.27 ? 442  THR A CG2 1 
ATOM   2580 N  N   . THR A 1 336 ? 18.604 -27.364 10.980  1.00 19.15 ? 443  THR A N   1 
ATOM   2581 C  CA  . THR A 1 336 ? 20.036 -27.174 11.213  1.00 21.35 ? 443  THR A CA  1 
ATOM   2582 C  C   . THR A 1 336 ? 20.522 -27.898 12.454  1.00 22.83 ? 443  THR A C   1 
ATOM   2583 O  O   . THR A 1 336 ? 19.946 -27.746 13.531  1.00 16.23 ? 443  THR A O   1 
ATOM   2584 C  CB  . THR A 1 336 ? 20.381 -25.681 11.383  1.00 25.68 ? 443  THR A CB  1 
ATOM   2585 O  OG1 . THR A 1 336 ? 19.777 -24.920 10.332  1.00 35.25 ? 443  THR A OG1 1 
ATOM   2586 C  CG2 . THR A 1 336 ? 21.907 -25.465 11.379  1.00 19.37 ? 443  THR A CG2 1 
ATOM   2587 N  N   . VAL A 1 337 ? 21.598 -28.664 12.323  1.00 15.89 ? 444  VAL A N   1 
ATOM   2588 C  CA  . VAL A 1 337 ? 22.105 -29.383 13.483  1.00 19.19 ? 444  VAL A CA  1 
ATOM   2589 C  C   . VAL A 1 337 ? 22.678 -28.424 14.525  1.00 15.37 ? 444  VAL A C   1 
ATOM   2590 O  O   . VAL A 1 337 ? 23.061 -27.292 14.220  1.00 16.51 ? 444  VAL A O   1 
ATOM   2591 C  CB  . VAL A 1 337 ? 23.171 -30.429 13.090  1.00 21.40 ? 444  VAL A CB  1 
ATOM   2592 C  CG1 . VAL A 1 337 ? 22.542 -31.494 12.197  1.00 25.89 ? 444  VAL A CG1 1 
ATOM   2593 C  CG2 . VAL A 1 337 ? 24.353 -29.760 12.409  1.00 18.80 ? 444  VAL A CG2 1 
ATOM   2594 N  N   . ALA A 1 338 ? 22.722 -28.891 15.769  1.00 14.49 ? 445  ALA A N   1 
ATOM   2595 C  CA  . ALA A 1 338 ? 23.233 -28.085 16.866  1.00 18.03 ? 445  ALA A CA  1 
ATOM   2596 C  C   . ALA A 1 338 ? 24.724 -27.824 16.654  1.00 15.60 ? 445  ALA A C   1 
ATOM   2597 O  O   . ALA A 1 338 ? 25.361 -28.505 15.841  1.00 14.63 ? 445  ALA A O   1 
ATOM   2598 C  CB  . ALA A 1 338 ? 22.974 -28.789 18.207  1.00 14.37 ? 445  ALA A CB  1 
ATOM   2599 N  N   . PRO A 1 339 ? 25.285 -26.827 17.363  1.00 15.90 ? 446  PRO A N   1 
ATOM   2600 C  CA  . PRO A 1 339 ? 26.719 -26.580 17.197  1.00 17.01 ? 446  PRO A CA  1 
ATOM   2601 C  C   . PRO A 1 339 ? 27.556 -27.812 17.518  1.00 13.72 ? 446  PRO A C   1 
ATOM   2602 O  O   . PRO A 1 339 ? 27.196 -28.624 18.369  1.00 14.55 ? 446  PRO A O   1 
ATOM   2603 C  CB  . PRO A 1 339 ? 27.004 -25.455 18.200  1.00 19.27 ? 446  PRO A CB  1 
ATOM   2604 C  CG  . PRO A 1 339 ? 25.705 -24.739 18.318  1.00 24.29 ? 446  PRO A CG  1 
ATOM   2605 C  CD  . PRO A 1 339 ? 24.658 -25.820 18.243  1.00 19.52 ? 446  PRO A CD  1 
ATOM   2606 N  N   . GLN A 1 340 ? 28.676 -27.936 16.829  1.00 13.85 ? 447  GLN A N   1 
ATOM   2607 C  CA  . GLN A 1 340 ? 29.542 -29.093 16.979  1.00 11.03 ? 447  GLN A CA  1 
ATOM   2608 C  C   . GLN A 1 340 ? 30.258 -29.104 18.323  1.00 12.96 ? 447  GLN A C   1 
ATOM   2609 O  O   . GLN A 1 340 ? 30.920 -28.129 18.680  1.00 15.42 ? 447  GLN A O   1 
ATOM   2610 C  CB  . GLN A 1 340 ? 30.573 -29.102 15.852  1.00 13.79 ? 447  GLN A CB  1 
ATOM   2611 C  CG  . GLN A 1 340 ? 31.451 -30.319 15.815  1.00 11.00 ? 447  GLN A CG  1 
ATOM   2612 C  CD  . GLN A 1 340 ? 32.822 -29.974 15.256  1.00 18.89 ? 447  GLN A CD  1 
ATOM   2613 O  OE1 . GLN A 1 340 ? 33.487 -29.062 15.751  1.00 19.50 ? 447  GLN A OE1 1 
ATOM   2614 N  NE2 . GLN A 1 340 ? 33.234 -30.676 14.210  1.00 16.31 ? 447  GLN A NE2 1 
ATOM   2615 N  N   . ARG A 1 341 ? 30.147 -30.214 19.053  1.00 10.45 ? 448  ARG A N   1 
ATOM   2616 C  CA  . ARG A 1 341 ? 30.889 -30.389 20.297  1.00 11.12 ? 448  ARG A CA  1 
ATOM   2617 C  C   . ARG A 1 341 ? 32.091 -31.275 20.041  1.00 11.27 ? 448  ARG A C   1 
ATOM   2618 O  O   . ARG A 1 341 ? 32.103 -32.047 19.085  1.00 11.66 ? 448  ARG A O   1 
ATOM   2619 C  CB  . ARG A 1 341 ? 30.003 -31.007 21.380  1.00 12.16 ? 448  ARG A CB  1 
ATOM   2620 C  CG  . ARG A 1 341 ? 28.744 -30.200 21.641  1.00 14.52 ? 448  ARG A CG  1 
ATOM   2621 C  CD  . ARG A 1 341 ? 27.821 -30.898 22.644  1.00 14.07 ? 448  ARG A CD  1 
ATOM   2622 N  NE  . ARG A 1 341 ? 26.678 -30.039 22.959  1.00 14.84 ? 448  ARG A NE  1 
ATOM   2623 C  CZ  . ARG A 1 341 ? 25.968 -30.105 24.080  1.00 20.00 ? 448  ARG A CZ  1 
ATOM   2624 N  NH1 . ARG A 1 341 ? 24.961 -29.263 24.271  1.00 19.04 ? 448  ARG A NH1 1 
ATOM   2625 N  NH2 . ARG A 1 341 ? 26.257 -31.012 25.004  1.00 13.14 ? 448  ARG A NH2 1 
ATOM   2626 N  N   . LYS A 1 342 ? 33.096 -31.160 20.900  1.00 12.38 ? 449  LYS A N   1 
ATOM   2627 C  CA  . LYS A 1 342 ? 34.331 -31.919 20.740  1.00 12.54 ? 449  LYS A CA  1 
ATOM   2628 C  C   . LYS A 1 342 ? 34.758 -32.425 22.102  1.00 12.20 ? 449  LYS A C   1 
ATOM   2629 O  O   . LYS A 1 342 ? 35.051 -31.635 22.993  1.00 13.25 ? 449  LYS A O   1 
ATOM   2630 C  CB  . LYS A 1 342 ? 35.433 -31.056 20.121  1.00 12.40 ? 449  LYS A CB  1 
ATOM   2631 C  CG  . LYS A 1 342 ? 36.773 -31.772 19.940  1.00 12.32 ? 449  LYS A CG  1 
ATOM   2632 C  CD  . LYS A 1 342 ? 37.824 -30.769 19.446  1.00 13.10 ? 449  LYS A CD  1 
ATOM   2633 C  CE  . LYS A 1 342 ? 39.147 -31.422 19.082  1.00 13.69 ? 449  LYS A CE  1 
ATOM   2634 N  NZ  . LYS A 1 342 ? 40.102 -30.370 18.591  1.00 14.50 ? 449  LYS A NZ  1 
ATOM   2635 N  N   . CYS A 1 343 ? 34.766 -33.739 22.263  1.00 9.74  ? 450  CYS A N   1 
ATOM   2636 C  CA  . CYS A 1 343 ? 35.163 -34.350 23.533  1.00 11.86 ? 450  CYS A CA  1 
ATOM   2637 C  C   . CYS A 1 343 ? 36.505 -35.067 23.360  1.00 13.49 ? 450  CYS A C   1 
ATOM   2638 O  O   . CYS A 1 343 ? 36.640 -35.972 22.532  1.00 16.93 ? 450  CYS A O   1 
ATOM   2639 C  CB  . CYS A 1 343 ? 34.078 -35.312 24.024  1.00 17.23 ? 450  CYS A CB  1 
ATOM   2640 S  SG  . CYS A 1 343 ? 34.434 -36.058 25.645  1.00 22.42 ? 450  CYS A SG  1 
ATOM   2641 N  N   . ILE A 1 344 ? 37.495 -34.638 24.141  1.00 12.01 ? 451  ILE A N   1 
ATOM   2642 C  CA  . ILE A 1 344 ? 38.863 -35.142 24.037  1.00 10.00 ? 451  ILE A CA  1 
ATOM   2643 C  C   . ILE A 1 344 ? 39.166 -36.083 25.182  1.00 17.06 ? 451  ILE A C   1 
ATOM   2644 O  O   . ILE A 1 344 ? 39.097 -35.677 26.340  1.00 15.61 ? 451  ILE A O   1 
ATOM   2645 C  CB  . ILE A 1 344 ? 39.892 -33.996 24.080  1.00 13.38 ? 451  ILE A CB  1 
ATOM   2646 C  CG1 . ILE A 1 344 ? 39.673 -33.035 22.909  1.00 13.98 ? 451  ILE A CG1 1 
ATOM   2647 C  CG2 . ILE A 1 344 ? 41.321 -34.545 24.114  1.00 14.46 ? 451  ILE A CG2 1 
ATOM   2648 C  CD1 . ILE A 1 344 ? 40.409 -31.710 23.087  1.00 16.21 ? 451  ILE A CD1 1 
ATOM   2649 N  N   . ILE A 1 345 ? 39.506 -37.325 24.861  1.00 11.45 ? 452  ILE A N   1 
ATOM   2650 C  CA  . ILE A 1 345 ? 39.746 -38.336 25.891  1.00 13.53 ? 452  ILE A CA  1 
ATOM   2651 C  C   . ILE A 1 345 ? 41.124 -38.956 25.716  1.00 16.38 ? 452  ILE A C   1 
ATOM   2652 O  O   . ILE A 1 345 ? 41.372 -39.687 24.753  1.00 14.77 ? 452  ILE A O   1 
ATOM   2653 C  CB  . ILE A 1 345 ? 38.682 -39.443 25.851  1.00 16.59 ? 452  ILE A CB  1 
ATOM   2654 C  CG1 . ILE A 1 345 ? 37.285 -38.821 25.937  1.00 18.71 ? 452  ILE A CG1 1 
ATOM   2655 C  CG2 . ILE A 1 345 ? 38.923 -40.454 26.999  1.00 18.33 ? 452  ILE A CG2 1 
ATOM   2656 C  CD1 . ILE A 1 345 ? 36.194 -39.672 25.334  1.00 18.92 ? 452  ILE A CD1 1 
ATOM   2657 N  N   . ASP A 1 346 ? 42.027 -38.661 26.646  1.00 16.62 ? 453  ASP A N   1 
ATOM   2658 C  CA  . ASP A 1 346 ? 43.367 -39.231 26.573  1.00 19.13 ? 453  ASP A CA  1 
ATOM   2659 C  C   . ASP A 1 346 ? 43.334 -40.601 27.240  1.00 23.79 ? 453  ASP A C   1 
ATOM   2660 O  O   . ASP A 1 346 ? 43.073 -40.702 28.437  1.00 26.49 ? 453  ASP A O   1 
ATOM   2661 C  CB  . ASP A 1 346 ? 44.387 -38.307 27.239  1.00 24.67 ? 453  ASP A CB  1 
ATOM   2662 C  CG  . ASP A 1 346 ? 45.805 -38.548 26.743  1.00 45.81 ? 453  ASP A CG  1 
ATOM   2663 O  OD1 . ASP A 1 346 ? 45.994 -38.793 25.520  1.00 40.20 ? 453  ASP A OD1 1 
ATOM   2664 O  OD2 . ASP A 1 346 ? 46.728 -38.482 27.584  1.00 49.61 ? 453  ASP A OD2 1 
ATOM   2665 N  N   . ILE A 1 347 ? 43.586 -41.651 26.464  1.00 18.93 ? 454  ILE A N   1 
ATOM   2666 C  CA  . ILE A 1 347 ? 43.237 -43.006 26.882  1.00 18.16 ? 454  ILE A CA  1 
ATOM   2667 C  C   . ILE A 1 347 ? 44.310 -43.684 27.735  1.00 21.08 ? 454  ILE A C   1 
ATOM   2668 O  O   . ILE A 1 347 ? 43.985 -44.313 28.742  1.00 23.95 ? 454  ILE A O   1 
ATOM   2669 C  CB  . ILE A 1 347 ? 42.941 -43.903 25.655  1.00 22.04 ? 454  ILE A CB  1 
ATOM   2670 C  CG1 . ILE A 1 347 ? 41.775 -43.345 24.828  1.00 18.98 ? 454  ILE A CG1 1 
ATOM   2671 C  CG2 . ILE A 1 347 ? 42.650 -45.351 26.072  1.00 16.58 ? 454  ILE A CG2 1 
ATOM   2672 C  CD1 . ILE A 1 347 ? 40.413 -43.588 25.412  1.00 19.85 ? 454  ILE A CD1 1 
ATOM   2673 N  N   . LEU A 1 348 ? 45.577 -43.566 27.343  1.00 16.80 ? 455  LEU A N   1 
ATOM   2674 C  CA  . LEU A 1 348 ? 46.645 -44.334 27.999  1.00 22.18 ? 455  LEU A CA  1 
ATOM   2675 C  C   . LEU A 1 348 ? 47.160 -43.709 29.304  1.00 28.68 ? 455  LEU A C   1 
ATOM   2676 O  O   . LEU A 1 348 ? 47.226 -42.495 29.434  1.00 22.84 ? 455  LEU A O   1 
ATOM   2677 C  CB  . LEU A 1 348 ? 47.826 -44.506 27.054  1.00 19.18 ? 455  LEU A CB  1 
ATOM   2678 C  CG  . LEU A 1 348 ? 47.561 -45.136 25.686  1.00 17.01 ? 455  LEU A CG  1 
ATOM   2679 C  CD1 . LEU A 1 348 ? 48.895 -45.310 24.959  1.00 16.86 ? 455  LEU A CD1 1 
ATOM   2680 C  CD2 . LEU A 1 348 ? 46.847 -46.464 25.855  1.00 16.85 ? 455  LEU A CD2 1 
ATOM   2681 N  N   . THR A 1 349 ? 47.553 -44.546 30.259  1.00 27.22 ? 456  THR A N   1 
ATOM   2682 C  CA  . THR A 1 349 ? 48.229 -44.039 31.455  1.00 31.90 ? 456  THR A CA  1 
ATOM   2683 C  C   . THR A 1 349 ? 49.715 -44.391 31.418  1.00 37.23 ? 456  THR A C   1 
ATOM   2684 O  O   . THR A 1 349 ? 50.509 -43.895 32.221  1.00 33.95 ? 456  THR A O   1 
ATOM   2685 C  CB  . THR A 1 349 ? 47.598 -44.593 32.741  1.00 33.89 ? 456  THR A CB  1 
ATOM   2686 O  OG1 . THR A 1 349 ? 47.610 -46.025 32.704  1.00 29.01 ? 456  THR A OG1 1 
ATOM   2687 C  CG2 . THR A 1 349 ? 46.160 -44.102 32.870  1.00 38.76 ? 456  THR A CG2 1 
ATOM   2688 N  N   . GLU A 1 350 ? 50.077 -45.247 30.469  1.00 25.45 ? 457  GLU A N   1 
ATOM   2689 C  CA  . GLU A 1 350 ? 51.454 -45.678 30.278  1.00 28.06 ? 457  GLU A CA  1 
ATOM   2690 C  C   . GLU A 1 350 ? 51.606 -46.205 28.856  1.00 21.52 ? 457  GLU A C   1 
ATOM   2691 O  O   . GLU A 1 350 ? 50.632 -46.676 28.276  1.00 22.12 ? 457  GLU A O   1 
ATOM   2692 C  CB  . GLU A 1 350 ? 51.831 -46.762 31.288  1.00 28.77 ? 457  GLU A CB  1 
ATOM   2693 C  CG  . GLU A 1 350 ? 51.011 -48.034 31.139  1.00 33.02 ? 457  GLU A CG  1 
ATOM   2694 C  CD  . GLU A 1 350 ? 51.507 -49.158 32.029  1.00 56.44 ? 457  GLU A CD  1 
ATOM   2695 O  OE1 . GLU A 1 350 ? 51.093 -50.317 31.808  1.00 56.47 ? 457  GLU A OE1 1 
ATOM   2696 O  OE2 . GLU A 1 350 ? 52.310 -48.882 32.948  1.00 53.54 ? 457  GLU A OE2 1 
ATOM   2697 N  N   . PRO A 1 351 ? 52.822 -46.134 28.294  1.00 23.21 ? 458  PRO A N   1 
ATOM   2698 C  CA  . PRO A 1 351 ? 53.017 -46.698 26.956  1.00 20.91 ? 458  PRO A CA  1 
ATOM   2699 C  C   . PRO A 1 351 ? 52.793 -48.209 26.947  1.00 27.48 ? 458  PRO A C   1 
ATOM   2700 O  O   . PRO A 1 351 ? 52.934 -48.876 27.975  1.00 23.71 ? 458  PRO A O   1 
ATOM   2701 C  CB  . PRO A 1 351 ? 54.472 -46.349 26.624  1.00 22.86 ? 458  PRO A CB  1 
ATOM   2702 C  CG  . PRO A 1 351 ? 55.131 -46.100 27.948  1.00 33.30 ? 458  PRO A CG  1 
ATOM   2703 C  CD  . PRO A 1 351 ? 54.058 -45.534 28.833  1.00 29.06 ? 458  PRO A CD  1 
ATOM   2704 N  N   . LYS A 1 352 ? 52.443 -48.738 25.781  1.00 19.52 ? 459  LYS A N   1 
ATOM   2705 C  CA  . LYS A 1 352 ? 52.079 -50.137 25.654  1.00 19.35 ? 459  LYS A CA  1 
ATOM   2706 C  C   . LYS A 1 352 ? 52.855 -50.780 24.518  1.00 25.63 ? 459  LYS A C   1 
ATOM   2707 O  O   . LYS A 1 352 ? 52.796 -50.313 23.377  1.00 18.04 ? 459  LYS A O   1 
ATOM   2708 C  CB  . LYS A 1 352 ? 50.570 -50.289 25.403  1.00 23.17 ? 459  LYS A CB  1 
ATOM   2709 C  CG  . LYS A 1 352 ? 49.674 -49.902 26.583  1.00 30.05 ? 459  LYS A CG  1 
ATOM   2710 C  CD  . LYS A 1 352 ? 49.930 -50.830 27.760  1.00 35.19 ? 459  LYS A CD  1 
ATOM   2711 C  CE  . LYS A 1 352 ? 48.704 -50.995 28.647  1.00 45.37 ? 459  LYS A CE  1 
ATOM   2712 N  NZ  . LYS A 1 352 ? 48.411 -49.783 29.457  1.00 47.87 ? 459  LYS A NZ  1 
ATOM   2713 N  N   A ASP A 1 353 ? 53.573 -51.850 24.845  0.50 24.08 ? 460  ASP A N   1 
ATOM   2714 N  N   B ASP A 1 353 ? 53.608 -51.830 24.821  0.50 24.08 ? 460  ASP A N   1 
ATOM   2715 C  CA  A ASP A 1 353 ? 54.223 -52.701 23.855  0.50 23.02 ? 460  ASP A CA  1 
ATOM   2716 C  CA  B ASP A 1 353 ? 54.301 -52.553 23.765  0.50 22.80 ? 460  ASP A CA  1 
ATOM   2717 C  C   A ASP A 1 353 ? 53.194 -53.242 22.868  0.50 21.89 ? 460  ASP A C   1 
ATOM   2718 C  C   B ASP A 1 353 ? 53.267 -53.245 22.879  0.50 21.91 ? 460  ASP A C   1 
ATOM   2719 O  O   A ASP A 1 353 ? 52.123 -53.688 23.277  0.50 22.61 ? 460  ASP A O   1 
ATOM   2720 O  O   B ASP A 1 353 ? 52.270 -53.777 23.366  0.50 22.76 ? 460  ASP A O   1 
ATOM   2721 C  CB  A ASP A 1 353 ? 54.945 -53.861 24.550  0.50 28.80 ? 460  ASP A CB  1 
ATOM   2722 C  CB  B ASP A 1 353 ? 55.302 -53.557 24.344  0.50 30.59 ? 460  ASP A CB  1 
ATOM   2723 C  CG  A ASP A 1 353 ? 55.669 -54.768 23.575  0.50 32.30 ? 460  ASP A CG  1 
ATOM   2724 C  CG  B ASP A 1 353 ? 56.571 -52.889 24.857  0.50 32.30 ? 460  ASP A CG  1 
ATOM   2725 O  OD1 A ASP A 1 353 ? 56.456 -54.247 22.762  0.50 29.50 ? 460  ASP A OD1 1 
ATOM   2726 O  OD1 B ASP A 1 353 ? 56.804 -51.709 24.525  0.50 28.56 ? 460  ASP A OD1 1 
ATOM   2727 O  OD2 A ASP A 1 353 ? 55.451 -55.999 23.616  0.50 33.09 ? 460  ASP A OD2 1 
ATOM   2728 O  OD2 B ASP A 1 353 ? 57.343 -53.548 25.583  0.50 35.05 ? 460  ASP A OD2 1 
ATOM   2729 N  N   . ILE A 1 354 ? 53.502 -53.211 21.574  1.00 20.28 ? 461  ILE A N   1 
ATOM   2730 C  CA  . ILE A 1 354 ? 52.546 -53.736 20.603  1.00 20.87 ? 461  ILE A CA  1 
ATOM   2731 C  C   . ILE A 1 354 ? 52.711 -55.245 20.412  1.00 26.95 ? 461  ILE A C   1 
ATOM   2732 O  O   . ILE A 1 354 ? 51.737 -55.991 20.504  1.00 23.27 ? 461  ILE A O   1 
ATOM   2733 C  CB  . ILE A 1 354 ? 52.669 -53.008 19.244  1.00 19.17 ? 461  ILE A CB  1 
ATOM   2734 C  CG1 . ILE A 1 354 ? 52.242 -51.544 19.407  1.00 20.18 ? 461  ILE A CG1 1 
ATOM   2735 C  CG2 . ILE A 1 354 ? 51.812 -53.696 18.189  1.00 20.29 ? 461  ILE A CG2 1 
ATOM   2736 C  CD1 . ILE A 1 354 ? 52.563 -50.644 18.178  1.00 17.33 ? 461  ILE A CD1 1 
ATOM   2737 N  N   . GLY A 1 355 ? 53.937 -55.694 20.159  1.00 26.02 ? 462  GLY A N   1 
ATOM   2738 C  CA  . GLY A 1 355 ? 54.186 -57.112 19.933  1.00 31.66 ? 462  GLY A CA  1 
ATOM   2739 C  C   . GLY A 1 355 ? 53.337 -57.700 18.815  1.00 27.37 ? 462  GLY A C   1 
ATOM   2740 O  O   . GLY A 1 355 ? 53.158 -57.069 17.769  1.00 29.89 ? 462  GLY A O   1 
ATOM   2741 N  N   . LYS A 1 356 ? 52.801 -58.899 19.044  1.00 23.89 ? 463  LYS A N   1 
ATOM   2742 C  CA  . LYS A 1 356 ? 51.971 -59.596 18.053  1.00 26.09 ? 463  LYS A CA  1 
ATOM   2743 C  C   . LYS A 1 356 ? 50.590 -58.962 17.959  1.00 27.95 ? 463  LYS A C   1 
ATOM   2744 O  O   . LYS A 1 356 ? 49.978 -58.902 16.889  1.00 20.87 ? 463  LYS A O   1 
ATOM   2745 C  CB  . LYS A 1 356 ? 51.826 -61.074 18.427  1.00 29.38 ? 463  LYS A CB  1 
ATOM   2746 C  CG  . LYS A 1 356 ? 51.822 -62.076 17.277  1.00 39.65 ? 463  LYS A CG  1 
ATOM   2747 C  CD  . LYS A 1 356 ? 51.195 -61.552 15.992  1.00 37.13 ? 463  LYS A CD  1 
ATOM   2748 C  CE  . LYS A 1 356 ? 50.893 -62.681 15.023  1.00 34.30 ? 463  LYS A CE  1 
ATOM   2749 N  NZ  . LYS A 1 356 ? 51.384 -62.371 13.648  1.00 40.33 ? 463  LYS A NZ  1 
ATOM   2750 N  N   . ARG A 1 357 ? 50.088 -58.526 19.108  1.00 27.66 ? 464  ARG A N   1 
ATOM   2751 C  CA  . ARG A 1 357 ? 48.750 -57.978 19.200  1.00 22.23 ? 464  ARG A CA  1 
ATOM   2752 C  C   . ARG A 1 357 ? 48.605 -57.145 20.470  1.00 26.94 ? 464  ARG A C   1 
ATOM   2753 O  O   . ARG A 1 357 ? 49.055 -57.542 21.542  1.00 23.89 ? 464  ARG A O   1 
ATOM   2754 C  CB  . ARG A 1 357 ? 47.710 -59.099 19.181  1.00 22.89 ? 464  ARG A CB  1 
ATOM   2755 C  CG  . ARG A 1 357 ? 46.278 -58.609 19.278  1.00 27.60 ? 464  ARG A CG  1 
ATOM   2756 C  CD  . ARG A 1 357 ? 45.274 -59.737 19.094  1.00 33.51 ? 464  ARG A CD  1 
ATOM   2757 N  NE  . ARG A 1 357 ? 43.922 -59.216 18.910  1.00 39.39 ? 464  ARG A NE  1 
ATOM   2758 C  CZ  . ARG A 1 357 ? 43.108 -58.886 19.909  1.00 48.43 ? 464  ARG A CZ  1 
ATOM   2759 N  NH1 . ARG A 1 357 ? 43.505 -59.028 21.169  1.00 42.16 ? 464  ARG A NH1 1 
ATOM   2760 N  NH2 . ARG A 1 357 ? 41.895 -58.415 19.649  1.00 45.15 ? 464  ARG A NH2 1 
ATOM   2761 N  N   . LEU A 1 358 ? 47.973 -55.989 20.340  1.00 16.21 ? 465  LEU A N   1 
ATOM   2762 C  CA  . LEU A 1 358 ? 47.666 -55.153 21.494  1.00 17.19 ? 465  LEU A CA  1 
ATOM   2763 C  C   . LEU A 1 358 ? 46.193 -54.784 21.474  1.00 21.98 ? 465  LEU A C   1 
ATOM   2764 O  O   . LEU A 1 358 ? 45.671 -54.334 20.449  1.00 18.68 ? 465  LEU A O   1 
ATOM   2765 C  CB  . LEU A 1 358 ? 48.526 -53.889 21.485  1.00 18.47 ? 465  LEU A CB  1 
ATOM   2766 C  CG  . LEU A 1 358 ? 48.155 -52.807 22.497  1.00 19.18 ? 465  LEU A CG  1 
ATOM   2767 C  CD1 . LEU A 1 358 ? 48.398 -53.315 23.917  1.00 19.36 ? 465  LEU A CD1 1 
ATOM   2768 C  CD2 . LEU A 1 358 ? 48.959 -51.543 22.235  1.00 21.86 ? 465  LEU A CD2 1 
ATOM   2769 N  N   . GLU A 1 359 ? 45.518 -54.985 22.598  1.00 16.82 ? 466  GLU A N   1 
ATOM   2770 C  CA  . GLU A 1 359 ? 44.140 -54.538 22.731  1.00 17.48 ? 466  GLU A CA  1 
ATOM   2771 C  C   . GLU A 1 359 ? 44.049 -53.555 23.898  1.00 23.09 ? 466  GLU A C   1 
ATOM   2772 O  O   . GLU A 1 359 ? 44.517 -53.849 25.002  1.00 20.45 ? 466  GLU A O   1 
ATOM   2773 C  CB  . GLU A 1 359 ? 43.203 -55.734 22.930  1.00 23.57 ? 466  GLU A CB  1 
ATOM   2774 C  CG  . GLU A 1 359 ? 41.759 -55.376 23.287  1.00 27.49 ? 466  GLU A CG  1 
ATOM   2775 C  CD  . GLU A 1 359 ? 40.801 -56.560 23.120  1.00 38.15 ? 466  GLU A CD  1 
ATOM   2776 O  OE1 . GLU A 1 359 ? 39.859 -56.698 23.931  1.00 35.36 ? 466  GLU A OE1 1 
ATOM   2777 O  OE2 . GLU A 1 359 ? 40.987 -57.349 22.167  1.00 41.81 ? 466  GLU A OE2 1 
ATOM   2778 N  N   . VAL A 1 360 ? 43.479 -52.381 23.637  1.00 16.47 ? 467  VAL A N   1 
ATOM   2779 C  CA  . VAL A 1 360 ? 43.294 -51.345 24.659  1.00 16.47 ? 467  VAL A CA  1 
ATOM   2780 C  C   . VAL A 1 360 ? 41.814 -51.068 24.837  1.00 18.59 ? 467  VAL A C   1 
ATOM   2781 O  O   . VAL A 1 360 ? 41.141 -50.657 23.890  1.00 17.33 ? 467  VAL A O   1 
ATOM   2782 C  CB  . VAL A 1 360 ? 44.000 -50.025 24.284  1.00 17.25 ? 467  VAL A CB  1 
ATOM   2783 C  CG1 . VAL A 1 360 ? 43.774 -48.966 25.367  1.00 18.68 ? 467  VAL A CG1 1 
ATOM   2784 C  CG2 . VAL A 1 360 ? 45.476 -50.257 24.043  1.00 21.01 ? 467  VAL A CG2 1 
ATOM   2785 N  N   . ARG A 1 361 ? 41.303 -51.321 26.042  1.00 18.71 ? 468  ARG A N   1 
ATOM   2786 C  CA  . ARG A 1 361 ? 39.889 -51.123 26.345  1.00 13.80 ? 468  ARG A CA  1 
ATOM   2787 C  C   . ARG A 1 361 ? 39.747 -49.937 27.263  1.00 19.10 ? 468  ARG A C   1 
ATOM   2788 O  O   . ARG A 1 361 ? 40.499 -49.797 28.225  1.00 17.09 ? 468  ARG A O   1 
ATOM   2789 C  CB  . ARG A 1 361 ? 39.276 -52.358 27.013  1.00 18.38 ? 468  ARG A CB  1 
ATOM   2790 C  CG  . ARG A 1 361 ? 39.363 -53.643 26.205  1.00 21.45 ? 468  ARG A CG  1 
ATOM   2791 C  CD  . ARG A 1 361 ? 38.831 -54.804 27.037  1.00 29.30 ? 468  ARG A CD  1 
ATOM   2792 N  NE  . ARG A 1 361 ? 39.001 -56.096 26.379  1.00 37.96 ? 468  ARG A NE  1 
ATOM   2793 C  CZ  . ARG A 1 361 ? 38.665 -57.263 26.926  1.00 53.98 ? 468  ARG A CZ  1 
ATOM   2794 N  NH1 . ARG A 1 361 ? 38.856 -58.389 26.251  1.00 53.53 ? 468  ARG A NH1 1 
ATOM   2795 N  NH2 . ARG A 1 361 ? 38.138 -57.307 28.146  1.00 42.28 ? 468  ARG A NH2 1 
ATOM   2796 N  N   . LYS A 1 362 ? 38.782 -49.078 26.981  1.00 16.55 ? 469  LYS A N   1 
ATOM   2797 C  CA  . LYS A 1 362 ? 38.558 -47.950 27.858  1.00 14.92 ? 469  LYS A CA  1 
ATOM   2798 C  C   . LYS A 1 362 ? 37.086 -47.588 27.894  1.00 15.08 ? 469  LYS A C   1 
ATOM   2799 O  O   . LYS A 1 362 ? 36.464 -47.434 26.855  1.00 14.63 ? 469  LYS A O   1 
ATOM   2800 C  CB  . LYS A 1 362 ? 39.389 -46.759 27.399  1.00 20.51 ? 469  LYS A CB  1 
ATOM   2801 C  CG  . LYS A 1 362 ? 39.159 -45.504 28.215  1.00 27.52 ? 469  LYS A CG  1 
ATOM   2802 C  CD  . LYS A 1 362 ? 39.814 -45.584 29.558  1.00 29.76 ? 469  LYS A CD  1 
ATOM   2803 C  CE  . LYS A 1 362 ? 39.585 -44.280 30.315  1.00 44.59 ? 469  LYS A CE  1 
ATOM   2804 N  NZ  . LYS A 1 362 ? 40.087 -44.359 31.697  1.00 43.73 ? 469  LYS A NZ  1 
ATOM   2805 N  N   . THR A 1 363 ? 36.531 -47.456 29.093  1.00 14.53 ? 470  THR A N   1 
ATOM   2806 C  CA  . THR A 1 363 ? 35.148 -47.027 29.227  1.00 14.44 ? 470  THR A CA  1 
ATOM   2807 C  C   . THR A 1 363 ? 35.120 -45.525 29.435  1.00 16.37 ? 470  THR A C   1 
ATOM   2808 O  O   . THR A 1 363 ? 35.769 -45.013 30.341  1.00 16.59 ? 470  THR A O   1 
ATOM   2809 C  CB  . THR A 1 363 ? 34.455 -47.747 30.397  1.00 17.43 ? 470  THR A CB  1 
ATOM   2810 O  OG1 . THR A 1 363 ? 34.451 -49.151 30.119  1.00 18.72 ? 470  THR A OG1 1 
ATOM   2811 C  CG2 . THR A 1 363 ? 33.021 -47.267 30.545  1.00 16.09 ? 470  THR A CG2 1 
ATOM   2812 N  N   . VAL A 1 364 ? 34.364 -44.823 28.600  1.00 15.04 ? 471  VAL A N   1 
ATOM   2813 C  CA  . VAL A 1 364 ? 34.356 -43.366 28.620  1.00 13.53 ? 471  VAL A CA  1 
ATOM   2814 C  C   . VAL A 1 364 ? 32.962 -42.811 28.940  1.00 15.99 ? 471  VAL A C   1 
ATOM   2815 O  O   . VAL A 1 364 ? 31.956 -43.482 28.708  1.00 15.12 ? 471  VAL A O   1 
ATOM   2816 C  CB  . VAL A 1 364 ? 34.835 -42.789 27.251  1.00 13.97 ? 471  VAL A CB  1 
ATOM   2817 C  CG1 . VAL A 1 364 ? 36.146 -43.436 26.827  1.00 12.99 ? 471  VAL A CG1 1 
ATOM   2818 C  CG2 . VAL A 1 364 ? 33.777 -43.009 26.168  1.00 15.33 ? 471  VAL A CG2 1 
ATOM   2819 N  N   . THR A 1 365 ? 32.908 -41.589 29.469  1.00 12.79 ? 472  THR A N   1 
ATOM   2820 C  CA  . THR A 1 365 ? 31.631 -40.929 29.751  1.00 13.35 ? 472  THR A CA  1 
ATOM   2821 C  C   . THR A 1 365 ? 31.269 -39.887 28.687  1.00 17.89 ? 472  THR A C   1 
ATOM   2822 O  O   . THR A 1 365 ? 30.177 -39.316 28.713  1.00 18.38 ? 472  THR A O   1 
ATOM   2823 C  CB  . THR A 1 365 ? 31.645 -40.235 31.124  1.00 20.29 ? 472  THR A CB  1 
ATOM   2824 O  OG1 . THR A 1 365 ? 32.619 -39.187 31.113  1.00 23.45 ? 472  THR A OG1 1 
ATOM   2825 C  CG2 . THR A 1 365 ? 31.996 -41.231 32.215  1.00 23.76 ? 472  THR A CG2 1 
ATOM   2826 N  N   . ALA A 1 366 ? 32.193 -39.646 27.761  1.00 16.44 ? 473  ALA A N   1 
ATOM   2827 C  CA  . ALA A 1 366 ? 31.994 -38.689 26.667  1.00 16.61 ? 473  ALA A CA  1 
ATOM   2828 C  C   . ALA A 1 366 ? 31.610 -37.303 27.183  1.00 13.91 ? 473  ALA A C   1 
ATOM   2829 O  O   . ALA A 1 366 ? 30.645 -36.694 26.710  1.00 11.77 ? 473  ALA A O   1 
ATOM   2830 C  CB  . ALA A 1 366 ? 30.930 -39.213 25.672  1.00 18.55 ? 473  ALA A CB  1 
ATOM   2831 N  N   . CYS A 1 367 ? 32.385 -36.819 28.155  1.00 12.29 ? 474  CYS A N   1 
ATOM   2832 C  CA  . CYS A 1 367 ? 32.273 -35.466 28.700  1.00 13.64 ? 474  CYS A CA  1 
ATOM   2833 C  C   . CYS A 1 367 ? 30.932 -35.226 29.389  1.00 16.92 ? 474  CYS A C   1 
ATOM   2834 O  O   . CYS A 1 367 ? 30.388 -34.126 29.364  1.00 14.46 ? 474  CYS A O   1 
ATOM   2835 C  CB  . CYS A 1 367 ? 32.514 -34.428 27.600  1.00 16.67 ? 474  CYS A CB  1 
ATOM   2836 S  SG  . CYS A 1 367 ? 34.222 -34.500 26.992  1.00 19.27 ? 474  CYS A SG  1 
ATOM   2837 N  N   . LEU A 1 368 ? 30.416 -36.278 30.008  1.00 14.79 ? 475  LEU A N   1 
ATOM   2838 C  CA  . LEU A 1 368 ? 29.219 -36.186 30.836  1.00 15.87 ? 475  LEU A CA  1 
ATOM   2839 C  C   . LEU A 1 368 ? 29.302 -35.015 31.812  1.00 14.64 ? 475  LEU A C   1 
ATOM   2840 O  O   . LEU A 1 368 ? 30.323 -34.820 32.469  1.00 15.25 ? 475  LEU A O   1 
ATOM   2841 C  CB  . LEU A 1 368 ? 29.017 -37.488 31.613  1.00 15.64 ? 475  LEU A CB  1 
ATOM   2842 C  CG  . LEU A 1 368 ? 27.735 -37.585 32.445  1.00 18.74 ? 475  LEU A CG  1 
ATOM   2843 C  CD1 . LEU A 1 368 ? 26.540 -37.690 31.528  1.00 16.87 ? 475  LEU A CD1 1 
ATOM   2844 C  CD2 . LEU A 1 368 ? 27.801 -38.797 33.377  1.00 20.07 ? 475  LEU A CD2 1 
ATOM   2845 N  N   . GLY A 1 369 ? 28.236 -34.224 31.872  1.00 14.49 ? 476  GLY A N   1 
ATOM   2846 C  CA  . GLY A 1 369 ? 28.162 -33.107 32.798  1.00 19.43 ? 476  GLY A CA  1 
ATOM   2847 C  C   . GLY A 1 369 ? 28.818 -31.833 32.305  1.00 21.74 ? 476  GLY A C   1 
ATOM   2848 O  O   . GLY A 1 369 ? 28.811 -30.822 33.002  1.00 21.31 ? 476  GLY A O   1 
ATOM   2849 N  N   . GLU A 1 370 ? 29.369 -31.879 31.096  1.00 17.13 ? 477  GLU A N   1 
ATOM   2850 C  CA  . GLU A 1 370 ? 30.126 -30.762 30.531  1.00 19.37 ? 477  GLU A CA  1 
ATOM   2851 C  C   . GLU A 1 370 ? 29.456 -30.233 29.255  1.00 19.41 ? 477  GLU A C   1 
ATOM   2852 O  O   . GLU A 1 370 ? 28.639 -30.929 28.647  1.00 16.08 ? 477  GLU A O   1 
ATOM   2853 C  CB  . GLU A 1 370 ? 31.566 -31.210 30.234  1.00 19.53 ? 477  GLU A CB  1 
ATOM   2854 C  CG  . GLU A 1 370 ? 32.301 -31.810 31.439  1.00 21.27 ? 477  GLU A CG  1 
ATOM   2855 C  CD  . GLU A 1 370 ? 33.584 -32.547 31.039  1.00 34.61 ? 477  GLU A CD  1 
ATOM   2856 O  OE1 . GLU A 1 370 ? 34.199 -33.196 31.909  1.00 44.36 ? 477  GLU A OE1 1 
ATOM   2857 O  OE2 . GLU A 1 370 ? 33.976 -32.482 29.855  1.00 39.97 ? 477  GLU A OE2 1 
ATOM   2858 N  N   . PRO A 1 371 ? 29.803 -29.002 28.839  1.00 17.22 ? 478  PRO A N   1 
ATOM   2859 C  CA  . PRO A 1 371 ? 29.224 -28.441 27.611  1.00 23.01 ? 478  PRO A CA  1 
ATOM   2860 C  C   . PRO A 1 371 ? 29.561 -29.224 26.344  1.00 16.48 ? 478  PRO A C   1 
ATOM   2861 O  O   . PRO A 1 371 ? 28.862 -29.076 25.348  1.00 20.25 ? 478  PRO A O   1 
ATOM   2862 C  CB  . PRO A 1 371 ? 29.836 -27.033 27.545  1.00 28.00 ? 478  PRO A CB  1 
ATOM   2863 C  CG  . PRO A 1 371 ? 30.146 -26.701 28.959  1.00 26.73 ? 478  PRO A CG  1 
ATOM   2864 C  CD  . PRO A 1 371 ? 30.602 -27.999 29.570  1.00 21.00 ? 478  PRO A CD  1 
ATOM   2865 N  N   A ASN A 1 372 ? 30.621 -30.030 26.376  0.50 16.41 ? 479  ASN A N   1 
ATOM   2866 N  N   B ASN A 1 372 ? 30.616 -30.033 26.374  0.50 16.41 ? 479  ASN A N   1 
ATOM   2867 C  CA  A ASN A 1 372 ? 30.989 -30.855 25.226  0.50 13.74 ? 479  ASN A CA  1 
ATOM   2868 C  CA  B ASN A 1 372 ? 30.949 -30.845 25.211  0.50 13.72 ? 479  ASN A CA  1 
ATOM   2869 C  C   A ASN A 1 372 ? 30.463 -32.288 25.321  0.50 14.79 ? 479  ASN A C   1 
ATOM   2870 C  C   B ASN A 1 372 ? 30.504 -32.299 25.364  0.50 14.79 ? 479  ASN A C   1 
ATOM   2871 O  O   A ASN A 1 372 ? 30.918 -33.169 24.584  0.50 13.93 ? 479  ASN A O   1 
ATOM   2872 O  O   B ASN A 1 372 ? 31.033 -33.196 24.700  0.50 13.86 ? 479  ASN A O   1 
ATOM   2873 C  CB  A ASN A 1 372 ? 32.515 -30.893 25.055  0.50 16.55 ? 479  ASN A CB  1 
ATOM   2874 C  CB  B ASN A 1 372 ? 32.453 -30.770 24.910  0.50 16.71 ? 479  ASN A CB  1 
ATOM   2875 C  CG  A ASN A 1 372 ? 33.062 -29.673 24.325  0.50 16.81 ? 479  ASN A CG  1 
ATOM   2876 C  CG  B ASN A 1 372 ? 33.324 -30.897 26.152  0.50 18.82 ? 479  ASN A CG  1 
ATOM   2877 O  OD1 A ASN A 1 372 ? 32.663 -29.362 23.194  0.50 14.95 ? 479  ASN A OD1 1 
ATOM   2878 O  OD1 B ASN A 1 372 ? 32.864 -30.748 27.291  0.50 21.03 ? 479  ASN A OD1 1 
ATOM   2879 N  ND2 A ASN A 1 372 ? 34.001 -28.984 24.967  0.50 16.20 ? 479  ASN A ND2 1 
ATOM   2880 N  ND2 B ASN A 1 372 ? 34.605 -31.160 25.931  0.50 19.09 ? 479  ASN A ND2 1 
ATOM   2881 N  N   . HIS A 1 373 ? 29.524 -32.523 26.238  1.00 12.15 ? 480  HIS A N   1 
ATOM   2882 C  CA  . HIS A 1 373 ? 28.876 -33.836 26.356  1.00 12.96 ? 480  HIS A CA  1 
ATOM   2883 C  C   . HIS A 1 373 ? 28.299 -34.262 25.003  1.00 11.20 ? 480  HIS A C   1 
ATOM   2884 O  O   . HIS A 1 373 ? 27.532 -33.517 24.402  1.00 14.26 ? 480  HIS A O   1 
ATOM   2885 C  CB  . HIS A 1 373 ? 27.755 -33.788 27.395  1.00 14.47 ? 480  HIS A CB  1 
ATOM   2886 C  CG  . HIS A 1 373 ? 27.069 -35.101 27.609  1.00 17.31 ? 480  HIS A CG  1 
ATOM   2887 N  ND1 . HIS A 1 373 ? 25.711 -35.199 27.833  1.00 17.43 ? 480  HIS A ND1 1 
ATOM   2888 C  CD2 . HIS A 1 373 ? 27.549 -36.366 27.644  1.00 13.61 ? 480  HIS A CD2 1 
ATOM   2889 C  CE1 . HIS A 1 373 ? 25.385 -36.469 27.997  1.00 19.39 ? 480  HIS A CE1 1 
ATOM   2890 N  NE2 . HIS A 1 373 ? 26.481 -37.199 27.880  1.00 15.41 ? 480  HIS A NE2 1 
ATOM   2891 N  N   . ILE A 1 374 ? 28.653 -35.453 24.537  1.00 10.67 ? 481  ILE A N   1 
ATOM   2892 C  CA  . ILE A 1 374 ? 28.145 -35.935 23.256  1.00 9.82  ? 481  ILE A CA  1 
ATOM   2893 C  C   . ILE A 1 374 ? 27.335 -37.211 23.457  1.00 13.34 ? 481  ILE A C   1 
ATOM   2894 O  O   . ILE A 1 374 ? 27.839 -38.192 24.000  1.00 13.06 ? 481  ILE A O   1 
ATOM   2895 C  CB  . ILE A 1 374 ? 29.291 -36.195 22.258  1.00 13.33 ? 481  ILE A CB  1 
ATOM   2896 C  CG1 . ILE A 1 374 ? 29.956 -34.866 21.865  1.00 12.17 ? 481  ILE A CG1 1 
ATOM   2897 C  CG2 . ILE A 1 374 ? 28.780 -36.927 21.008  1.00 12.11 ? 481  ILE A CG2 1 
ATOM   2898 C  CD1 . ILE A 1 374 ? 31.289 -35.047 21.161  1.00 14.46 ? 481  ILE A CD1 1 
ATOM   2899 N  N   . THR A 1 375 ? 26.081 -37.195 23.015  1.00 14.09 ? 482  THR A N   1 
ATOM   2900 C  CA  . THR A 1 375 ? 25.270 -38.407 23.019  1.00 14.52 ? 482  THR A CA  1 
ATOM   2901 C  C   . THR A 1 375 ? 24.985 -38.856 21.601  1.00 17.23 ? 482  THR A C   1 
ATOM   2902 O  O   . THR A 1 375 ? 24.444 -39.942 21.390  1.00 14.02 ? 482  THR A O   1 
ATOM   2903 C  CB  . THR A 1 375 ? 23.921 -38.207 23.738  1.00 20.19 ? 482  THR A CB  1 
ATOM   2904 O  OG1 . THR A 1 375 ? 23.136 -37.243 23.022  1.00 17.15 ? 482  THR A OG1 1 
ATOM   2905 C  CG2 . THR A 1 375 ? 24.144 -37.732 25.161  1.00 17.36 ? 482  THR A CG2 1 
ATOM   2906 N  N   . ARG A 1 376 ? 25.338 -38.001 20.641  1.00 15.07 ? 483  ARG A N   1 
ATOM   2907 C  CA  . ARG A 1 376 ? 25.078 -38.236 19.224  1.00 15.29 ? 483  ARG A CA  1 
ATOM   2908 C  C   . ARG A 1 376 ? 26.351 -37.965 18.423  1.00 13.05 ? 483  ARG A C   1 
ATOM   2909 O  O   . ARG A 1 376 ? 26.674 -36.815 18.121  1.00 12.51 ? 483  ARG A O   1 
ATOM   2910 C  CB  . ARG A 1 376 ? 23.939 -37.339 18.747  1.00 17.84 ? 483  ARG A CB  1 
ATOM   2911 C  CG  . ARG A 1 376 ? 23.319 -37.766 17.467  1.00 32.99 ? 483  ARG A CG  1 
ATOM   2912 C  CD  . ARG A 1 376 ? 22.102 -36.921 17.150  1.00 32.51 ? 483  ARG A CD  1 
ATOM   2913 N  NE  . ARG A 1 376 ? 21.751 -37.091 15.752  1.00 31.46 ? 483  ARG A NE  1 
ATOM   2914 C  CZ  . ARG A 1 376 ? 21.202 -36.148 15.004  1.00 34.29 ? 483  ARG A CZ  1 
ATOM   2915 N  NH1 . ARG A 1 376 ? 20.931 -36.397 13.729  1.00 34.78 ? 483  ARG A NH1 1 
ATOM   2916 N  NH2 . ARG A 1 376 ? 20.925 -34.962 15.537  1.00 28.23 ? 483  ARG A NH2 1 
ATOM   2917 N  N   . LEU A 1 377 ? 27.068 -39.033 18.099  1.00 10.67 ? 484  LEU A N   1 
ATOM   2918 C  CA  . LEU A 1 377 ? 28.367 -38.933 17.447  1.00 13.99 ? 484  LEU A CA  1 
ATOM   2919 C  C   . LEU A 1 377 ? 28.254 -38.494 15.997  1.00 14.60 ? 484  LEU A C   1 
ATOM   2920 O  O   . LEU A 1 377 ? 27.295 -38.832 15.307  1.00 11.96 ? 484  LEU A O   1 
ATOM   2921 C  CB  . LEU A 1 377 ? 29.075 -40.288 17.527  1.00 13.78 ? 484  LEU A CB  1 
ATOM   2922 C  CG  . LEU A 1 377 ? 30.580 -40.418 17.306  1.00 20.50 ? 484  LEU A CG  1 
ATOM   2923 C  CD1 . LEU A 1 377 ? 31.364 -39.561 18.301  1.00 14.36 ? 484  LEU A CD1 1 
ATOM   2924 C  CD2 . LEU A 1 377 ? 30.956 -41.898 17.469  1.00 23.30 ? 484  LEU A CD2 1 
ATOM   2925 N  N   . GLU A 1 378 ? 29.236 -37.723 15.542  1.00 11.67 ? 485  GLU A N   1 
ATOM   2926 C  CA  . GLU A 1 378 ? 29.436 -37.533 14.107  1.00 12.23 ? 485  GLU A CA  1 
ATOM   2927 C  C   . GLU A 1 378 ? 30.712 -38.306 13.766  1.00 11.35 ? 485  GLU A C   1 
ATOM   2928 O  O   . GLU A 1 378 ? 30.686 -39.539 13.756  1.00 14.07 ? 485  GLU A O   1 
ATOM   2929 C  CB  . GLU A 1 378 ? 29.488 -36.038 13.762  1.00 14.71 ? 485  GLU A CB  1 
ATOM   2930 C  CG  . GLU A 1 378 ? 28.090 -35.392 13.981  1.00 13.44 ? 485  GLU A CG  1 
ATOM   2931 C  CD  . GLU A 1 378 ? 28.061 -33.880 13.909  1.00 15.32 ? 485  GLU A CD  1 
ATOM   2932 O  OE1 . GLU A 1 378 ? 26.958 -33.321 14.090  1.00 16.84 ? 485  GLU A OE1 1 
ATOM   2933 O  OE2 . GLU A 1 378 ? 29.112 -33.239 13.694  1.00 15.03 ? 485  GLU A OE2 1 
ATOM   2934 N  N   . HIS A 1 379 ? 31.825 -37.610 13.554  1.00 10.80 ? 486  HIS A N   1 
ATOM   2935 C  CA  . HIS A 1 379 ? 33.121 -38.262 13.320  1.00 11.10 ? 486  HIS A CA  1 
ATOM   2936 C  C   . HIS A 1 379 ? 33.755 -38.687 14.640  1.00 12.85 ? 486  HIS A C   1 
ATOM   2937 O  O   . HIS A 1 379 ? 33.576 -38.015 15.655  1.00 11.35 ? 486  HIS A O   1 
ATOM   2938 C  CB  . HIS A 1 379 ? 34.092 -37.317 12.581  1.00 9.81  ? 486  HIS A CB  1 
ATOM   2939 C  CG  . HIS A 1 379 ? 33.440 -36.482 11.524  1.00 11.17 ? 486  HIS A CG  1 
ATOM   2940 N  ND1 . HIS A 1 379 ? 32.740 -35.334 11.812  1.00 12.31 ? 486  HIS A ND1 1 
ATOM   2941 C  CD2 . HIS A 1 379 ? 33.398 -36.625 10.175  1.00 11.61 ? 486  HIS A CD2 1 
ATOM   2942 C  CE1 . HIS A 1 379 ? 32.277 -34.807 10.690  1.00 11.37 ? 486  HIS A CE1 1 
ATOM   2943 N  NE2 . HIS A 1 379 ? 32.663 -35.569 9.682   1.00 12.11 ? 486  HIS A NE2 1 
ATOM   2944 N  N   . ALA A 1 380 ? 34.480 -39.806 14.634  1.00 9.87  ? 487  ALA A N   1 
ATOM   2945 C  CA  . ALA A 1 380 ? 35.359 -40.149 15.746  1.00 10.62 ? 487  ALA A CA  1 
ATOM   2946 C  C   . ALA A 1 380 ? 36.763 -40.345 15.215  1.00 11.20 ? 487  ALA A C   1 
ATOM   2947 O  O   . ALA A 1 380 ? 36.934 -40.882 14.124  1.00 12.13 ? 487  ALA A O   1 
ATOM   2948 C  CB  . ALA A 1 380 ? 34.887 -41.409 16.462  1.00 11.82 ? 487  ALA A CB  1 
ATOM   2949 N  N   . GLN A 1 381 ? 37.753 -39.890 15.978  1.00 10.82 ? 488  GLN A N   1 
ATOM   2950 C  CA  . GLN A 1 381 ? 39.155 -40.100 15.634  1.00 11.95 ? 488  GLN A CA  1 
ATOM   2951 C  C   . GLN A 1 381 ? 39.875 -40.862 16.729  1.00 15.52 ? 488  GLN A C   1 
ATOM   2952 O  O   . GLN A 1 381 ? 39.657 -40.622 17.923  1.00 13.32 ? 488  GLN A O   1 
ATOM   2953 C  CB  . GLN A 1 381 ? 39.876 -38.770 15.413  1.00 11.77 ? 488  GLN A CB  1 
ATOM   2954 C  CG  . GLN A 1 381 ? 39.362 -37.944 14.243  1.00 9.93  ? 488  GLN A CG  1 
ATOM   2955 C  CD  . GLN A 1 381 ? 39.846 -36.515 14.327  1.00 12.42 ? 488  GLN A CD  1 
ATOM   2956 O  OE1 . GLN A 1 381 ? 40.071 -35.991 15.425  1.00 12.87 ? 488  GLN A OE1 1 
ATOM   2957 N  NE2 . GLN A 1 381 ? 40.020 -35.870 13.169  1.00 10.23 ? 488  GLN A NE2 1 
ATOM   2958 N  N   . ALA A 1 382 ? 40.729 -41.788 16.322  1.00 11.62 ? 489  ALA A N   1 
ATOM   2959 C  CA  . ALA A 1 382 ? 41.715 -42.329 17.244  1.00 10.65 ? 489  ALA A CA  1 
ATOM   2960 C  C   . ALA A 1 382 ? 43.055 -41.742 16.826  1.00 12.59 ? 489  ALA A C   1 
ATOM   2961 O  O   . ALA A 1 382 ? 43.605 -42.118 15.795  1.00 12.16 ? 489  ALA A O   1 
ATOM   2962 C  CB  . ALA A 1 382 ? 41.737 -43.832 17.204  1.00 12.66 ? 489  ALA A CB  1 
ATOM   2963 N  N   . ARG A 1 383 ? 43.542 -40.776 17.594  1.00 10.60 ? 490  ARG A N   1 
ATOM   2964 C  CA  . ARG A 1 383 ? 44.788 -40.107 17.261  1.00 11.55 ? 490  ARG A CA  1 
ATOM   2965 C  C   . ARG A 1 383 ? 45.907 -40.877 17.934  1.00 12.14 ? 490  ARG A C   1 
ATOM   2966 O  O   . ARG A 1 383 ? 46.028 -40.863 19.162  1.00 13.05 ? 490  ARG A O   1 
ATOM   2967 C  CB  . ARG A 1 383 ? 44.757 -38.637 17.701  1.00 13.61 ? 490  ARG A CB  1 
ATOM   2968 C  CG  . ARG A 1 383 ? 43.551 -37.864 17.142  1.00 11.07 ? 490  ARG A CG  1 
ATOM   2969 C  CD  . ARG A 1 383 ? 43.739 -36.345 17.261  1.00 12.94 ? 490  ARG A CD  1 
ATOM   2970 N  NE  . ARG A 1 383 ? 42.598 -35.597 16.718  1.00 14.80 ? 490  ARG A NE  1 
ATOM   2971 C  CZ  . ARG A 1 383 ? 42.528 -34.272 16.693  1.00 14.57 ? 490  ARG A CZ  1 
ATOM   2972 N  NH1 . ARG A 1 383 ? 41.459 -33.666 16.183  1.00 15.09 ? 490  ARG A NH1 1 
ATOM   2973 N  NH2 . ARG A 1 383 ? 43.533 -33.551 17.178  1.00 13.90 ? 490  ARG A NH2 1 
ATOM   2974 N  N   . LEU A 1 384 ? 46.700 -41.577 17.125  1.00 10.80 ? 491  LEU A N   1 
ATOM   2975 C  CA  . LEU A 1 384 ? 47.678 -42.527 17.635  1.00 11.61 ? 491  LEU A CA  1 
ATOM   2976 C  C   . LEU A 1 384 ? 49.107 -42.076 17.393  1.00 13.05 ? 491  LEU A C   1 
ATOM   2977 O  O   . LEU A 1 384 ? 49.448 -41.601 16.308  1.00 12.66 ? 491  LEU A O   1 
ATOM   2978 C  CB  . LEU A 1 384 ? 47.484 -43.902 16.984  1.00 12.68 ? 491  LEU A CB  1 
ATOM   2979 C  CG  . LEU A 1 384 ? 46.061 -44.459 16.999  1.00 11.68 ? 491  LEU A CG  1 
ATOM   2980 C  CD1 . LEU A 1 384 ? 46.058 -45.840 16.385  1.00 14.77 ? 491  LEU A CD1 1 
ATOM   2981 C  CD2 . LEU A 1 384 ? 45.541 -44.510 18.439  1.00 12.74 ? 491  LEU A CD2 1 
ATOM   2982 N  N   . THR A 1 385 ? 49.938 -42.259 18.409  1.00 13.50 ? 492  THR A N   1 
ATOM   2983 C  CA  . THR A 1 385 ? 51.377 -42.106 18.265  1.00 14.34 ? 492  THR A CA  1 
ATOM   2984 C  C   . THR A 1 385 ? 52.018 -43.442 18.624  1.00 12.60 ? 492  THR A C   1 
ATOM   2985 O  O   . THR A 1 385 ? 51.813 -43.960 19.722  1.00 12.41 ? 492  THR A O   1 
ATOM   2986 C  CB  . THR A 1 385 ? 51.920 -40.977 19.151  1.00 14.31 ? 492  THR A CB  1 
ATOM   2987 O  OG1 . THR A 1 385 ? 51.194 -39.772 18.866  1.00 15.85 ? 492  THR A OG1 1 
ATOM   2988 C  CG2 . THR A 1 385 ? 53.414 -40.740 18.881  1.00 12.34 ? 492  THR A CG2 1 
ATOM   2989 N  N   . LEU A 1 386 ? 52.759 -44.015 17.679  1.00 13.66 ? 493  LEU A N   1 
ATOM   2990 C  CA  . LEU A 1 386 ? 53.382 -45.317 17.904  1.00 15.23 ? 493  LEU A CA  1 
ATOM   2991 C  C   . LEU A 1 386 ? 54.643 -45.480 17.076  1.00 16.91 ? 493  LEU A C   1 
ATOM   2992 O  O   . LEU A 1 386 ? 54.808 -44.850 16.025  1.00 15.73 ? 493  LEU A O   1 
ATOM   2993 C  CB  . LEU A 1 386 ? 52.398 -46.460 17.603  1.00 13.18 ? 493  LEU A CB  1 
ATOM   2994 C  CG  . LEU A 1 386 ? 51.876 -46.657 16.168  1.00 14.29 ? 493  LEU A CG  1 
ATOM   2995 C  CD1 . LEU A 1 386 ? 52.835 -47.487 15.312  1.00 14.58 ? 493  LEU A CD1 1 
ATOM   2996 C  CD2 . LEU A 1 386 ? 50.492 -47.307 16.188  1.00 17.83 ? 493  LEU A CD2 1 
ATOM   2997 N  N   . SER A 1 387 ? 55.532 -46.334 17.570  1.00 16.63 ? 494  SER A N   1 
ATOM   2998 C  CA  . SER A 1 387 ? 56.686 -46.784 16.806  1.00 17.25 ? 494  SER A CA  1 
ATOM   2999 C  C   . SER A 1 387 ? 56.463 -48.223 16.366  1.00 16.28 ? 494  SER A C   1 
ATOM   3000 O  O   . SER A 1 387 ? 55.786 -48.997 17.046  1.00 16.30 ? 494  SER A O   1 
ATOM   3001 C  CB  . SER A 1 387 ? 57.956 -46.682 17.644  1.00 20.38 ? 494  SER A CB  1 
ATOM   3002 O  OG  . SER A 1 387 ? 57.773 -47.360 18.872  1.00 17.59 ? 494  SER A OG  1 
ATOM   3003 N  N   . TYR A 1 388 ? 57.027 -48.576 15.220  1.00 17.20 ? 495  TYR A N   1 
ATOM   3004 C  CA  . TYR A 1 388 ? 56.964 -49.942 14.734  1.00 18.68 ? 495  TYR A CA  1 
ATOM   3005 C  C   . TYR A 1 388 ? 58.057 -50.122 13.698  1.00 16.17 ? 495  TYR A C   1 
ATOM   3006 O  O   . TYR A 1 388 ? 58.430 -49.173 13.018  1.00 19.61 ? 495  TYR A O   1 
ATOM   3007 C  CB  . TYR A 1 388 ? 55.590 -50.245 14.144  1.00 15.53 ? 495  TYR A CB  1 
ATOM   3008 C  CG  . TYR A 1 388 ? 55.179 -51.693 14.259  1.00 21.77 ? 495  TYR A CG  1 
ATOM   3009 C  CD1 . TYR A 1 388 ? 54.957 -52.271 15.499  1.00 20.36 ? 495  TYR A CD1 1 
ATOM   3010 C  CD2 . TYR A 1 388 ? 54.996 -52.476 13.124  1.00 20.61 ? 495  TYR A CD2 1 
ATOM   3011 C  CE1 . TYR A 1 388 ? 54.578 -53.585 15.615  1.00 20.42 ? 495  TYR A CE1 1 
ATOM   3012 C  CE2 . TYR A 1 388 ? 54.621 -53.792 13.228  1.00 19.52 ? 495  TYR A CE2 1 
ATOM   3013 C  CZ  . TYR A 1 388 ? 54.406 -54.340 14.474  1.00 25.07 ? 495  TYR A CZ  1 
ATOM   3014 O  OH  . TYR A 1 388 ? 54.025 -55.651 14.599  1.00 31.18 ? 495  TYR A OH  1 
ATOM   3015 N  N   . ASN A 1 389 ? 58.579 -51.332 13.571  1.00 18.65 ? 496  ASN A N   1 
ATOM   3016 C  CA  . ASN A 1 389 ? 59.682 -51.538 12.645  1.00 25.31 ? 496  ASN A CA  1 
ATOM   3017 C  C   . ASN A 1 389 ? 59.236 -51.671 11.180  1.00 22.72 ? 496  ASN A C   1 
ATOM   3018 O  O   . ASN A 1 389 ? 59.988 -51.317 10.272  1.00 21.75 ? 496  ASN A O   1 
ATOM   3019 C  CB  . ASN A 1 389 ? 60.491 -52.765 13.059  1.00 22.73 ? 496  ASN A CB  1 
ATOM   3020 C  CG  . ASN A 1 389 ? 59.695 -54.033 12.967  1.00 23.65 ? 496  ASN A CG  1 
ATOM   3021 O  OD1 . ASN A 1 389 ? 58.632 -54.152 13.574  1.00 24.39 ? 496  ASN A OD1 1 
ATOM   3022 N  ND2 . ASN A 1 389 ? 60.189 -54.989 12.185  1.00 21.81 ? 496  ASN A ND2 1 
ATOM   3023 N  N   . ARG A 1 390 ? 58.021 -52.166 10.941  1.00 17.16 ? 497  ARG A N   1 
ATOM   3024 C  CA  . ARG A 1 390 ? 57.498 -52.263 9.566   1.00 20.53 ? 497  ARG A CA  1 
ATOM   3025 C  C   . ARG A 1 390 ? 56.022 -51.887 9.523   1.00 19.17 ? 497  ARG A C   1 
ATOM   3026 O  O   . ARG A 1 390 ? 55.154 -52.701 9.839   1.00 15.99 ? 497  ARG A O   1 
ATOM   3027 C  CB  . ARG A 1 390 ? 57.679 -53.666 8.979   1.00 21.32 ? 497  ARG A CB  1 
ATOM   3028 C  CG  . ARG A 1 390 ? 57.317 -53.692 7.505   1.00 24.37 ? 497  ARG A CG  1 
ATOM   3029 C  CD  . ARG A 1 390 ? 57.347 -55.073 6.875   1.00 31.90 ? 497  ARG A CD  1 
ATOM   3030 N  NE  . ARG A 1 390 ? 57.540 -54.946 5.433   1.00 32.96 ? 497  ARG A NE  1 
ATOM   3031 C  CZ  . ARG A 1 390 ? 56.571 -54.726 4.549   1.00 34.37 ? 497  ARG A CZ  1 
ATOM   3032 N  NH1 . ARG A 1 390 ? 56.881 -54.614 3.262   1.00 31.54 ? 497  ARG A NH1 1 
ATOM   3033 N  NH2 . ARG A 1 390 ? 55.300 -54.620 4.939   1.00 32.86 ? 497  ARG A NH2 1 
ATOM   3034 N  N   . ARG A 1 391 ? 55.751 -50.654 9.119   1.00 14.83 ? 498  ARG A N   1 
ATOM   3035 C  CA  . ARG A 1 391 ? 54.450 -50.045 9.359   1.00 13.90 ? 498  ARG A CA  1 
ATOM   3036 C  C   . ARG A 1 391 ? 53.310 -50.793 8.663   1.00 15.91 ? 498  ARG A C   1 
ATOM   3037 O  O   . ARG A 1 391 ? 52.229 -50.949 9.229   1.00 12.62 ? 498  ARG A O   1 
ATOM   3038 C  CB  . ARG A 1 391 ? 54.478 -48.580 8.904   1.00 14.40 ? 498  ARG A CB  1 
ATOM   3039 C  CG  . ARG A 1 391 ? 53.295 -47.748 9.413   1.00 16.73 ? 498  ARG A CG  1 
ATOM   3040 C  CD  . ARG A 1 391 ? 53.544 -46.263 9.171   1.00 13.61 ? 498  ARG A CD  1 
ATOM   3041 N  NE  . ARG A 1 391 ? 53.926 -46.003 7.783   1.00 15.42 ? 498  ARG A NE  1 
ATOM   3042 C  CZ  . ARG A 1 391 ? 54.442 -44.855 7.357   1.00 15.64 ? 498  ARG A CZ  1 
ATOM   3043 N  NH1 . ARG A 1 391 ? 54.766 -44.701 6.079   1.00 14.06 ? 498  ARG A NH1 1 
ATOM   3044 N  NH2 . ARG A 1 391 ? 54.644 -43.861 8.210   1.00 14.44 ? 498  ARG A NH2 1 
ATOM   3045 N  N   . GLY A 1 392 ? 53.555 -51.243 7.434   1.00 14.18 ? 499  GLY A N   1 
ATOM   3046 C  CA  . GLY A 1 392 ? 52.519 -51.883 6.634   1.00 12.89 ? 499  GLY A CA  1 
ATOM   3047 C  C   . GLY A 1 392 ? 52.065 -53.252 7.124   1.00 15.59 ? 499  GLY A C   1 
ATOM   3048 O  O   . GLY A 1 392 ? 51.094 -53.807 6.605   1.00 14.86 ? 499  GLY A O   1 
ATOM   3049 N  N   . ASP A 1 393 ? 52.758 -53.810 8.114   1.00 13.30 ? 500  ASP A N   1 
ATOM   3050 C  CA  . ASP A 1 393 ? 52.328 -55.087 8.680   1.00 16.51 ? 500  ASP A CA  1 
ATOM   3051 C  C   . ASP A 1 393 ? 51.218 -54.878 9.712   1.00 17.65 ? 500  ASP A C   1 
ATOM   3052 O  O   . ASP A 1 393 ? 50.552 -55.833 10.116  1.00 16.62 ? 500  ASP A O   1 
ATOM   3053 C  CB  . ASP A 1 393 ? 53.505 -55.834 9.318   1.00 16.71 ? 500  ASP A CB  1 
ATOM   3054 C  CG  . ASP A 1 393 ? 54.411 -56.492 8.289   1.00 22.10 ? 500  ASP A CG  1 
ATOM   3055 O  OD1 . ASP A 1 393 ? 54.049 -56.517 7.093   1.00 21.89 ? 500  ASP A OD1 1 
ATOM   3056 O  OD2 . ASP A 1 393 ? 55.484 -56.992 8.686   1.00 25.84 ? 500  ASP A OD2 1 
ATOM   3057 N  N   . LEU A 1 394 ? 51.020 -53.630 10.130  1.00 12.80 ? 501  LEU A N   1 
ATOM   3058 C  CA  . LEU A 1 394 ? 49.971 -53.317 11.104  1.00 15.94 ? 501  LEU A CA  1 
ATOM   3059 C  C   . LEU A 1 394 ? 48.565 -53.274 10.500  1.00 13.01 ? 501  LEU A C   1 
ATOM   3060 O  O   . LEU A 1 394 ? 48.352 -52.739 9.403   1.00 13.30 ? 501  LEU A O   1 
ATOM   3061 C  CB  . LEU A 1 394 ? 50.256 -51.968 11.782  1.00 13.32 ? 501  LEU A CB  1 
ATOM   3062 C  CG  . LEU A 1 394 ? 51.484 -51.875 12.687  1.00 17.33 ? 501  LEU A CG  1 
ATOM   3063 C  CD1 . LEU A 1 394 ? 51.700 -50.423 13.098  1.00 20.84 ? 501  LEU A CD1 1 
ATOM   3064 C  CD2 . LEU A 1 394 ? 51.315 -52.747 13.918  1.00 18.65 ? 501  LEU A CD2 1 
ATOM   3065 N  N   . ALA A 1 395 ? 47.609 -53.850 11.225  1.00 11.78 ? 502  ALA A N   1 
ATOM   3066 C  CA  . ALA A 1 395 ? 46.196 -53.572 10.998  1.00 15.30 ? 502  ALA A CA  1 
ATOM   3067 C  C   . ALA A 1 395 ? 45.606 -53.054 12.304  1.00 13.80 ? 502  ALA A C   1 
ATOM   3068 O  O   . ALA A 1 395 ? 45.905 -53.574 13.386  1.00 14.89 ? 502  ALA A O   1 
ATOM   3069 C  CB  . ALA A 1 395 ? 45.446 -54.810 10.514  1.00 16.08 ? 502  ALA A CB  1 
ATOM   3070 N  N   . ILE A 1 396 ? 44.780 -52.018 12.211  1.00 12.07 ? 503  ILE A N   1 
ATOM   3071 C  CA  . ILE A 1 396 ? 44.249 -51.365 13.406  1.00 11.61 ? 503  ILE A CA  1 
ATOM   3072 C  C   . ILE A 1 396 ? 42.734 -51.285 13.310  1.00 13.05 ? 503  ILE A C   1 
ATOM   3073 O  O   . ILE A 1 396 ? 42.202 -50.877 12.265  1.00 10.54 ? 503  ILE A O   1 
ATOM   3074 C  CB  . ILE A 1 396 ? 44.833 -49.952 13.573  1.00 12.07 ? 503  ILE A CB  1 
ATOM   3075 C  CG1 . ILE A 1 396 ? 46.365 -50.004 13.586  1.00 15.46 ? 503  ILE A CG1 1 
ATOM   3076 C  CG2 . ILE A 1 396 ? 44.307 -49.286 14.856  1.00 11.89 ? 503  ILE A CG2 1 
ATOM   3077 C  CD1 . ILE A 1 396 ? 47.032 -48.622 13.584  1.00 14.32 ? 503  ILE A CD1 1 
ATOM   3078 N  N   . HIS A 1 397 ? 42.046 -51.707 14.374  1.00 12.01 ? 504  HIS A N   1 
ATOM   3079 C  CA  . HIS A 1 397 ? 40.589 -51.620 14.430  1.00 11.89 ? 504  HIS A CA  1 
ATOM   3080 C  C   . HIS A 1 397 ? 40.134 -50.872 15.673  1.00 13.81 ? 504  HIS A C   1 
ATOM   3081 O  O   . HIS A 1 397 ? 40.829 -50.851 16.696  1.00 13.65 ? 504  HIS A O   1 
ATOM   3082 C  CB  . HIS A 1 397 ? 39.945 -53.010 14.397  1.00 13.36 ? 504  HIS A CB  1 
ATOM   3083 C  CG  . HIS A 1 397 ? 40.145 -53.728 13.102  1.00 13.97 ? 504  HIS A CG  1 
ATOM   3084 N  ND1 . HIS A 1 397 ? 41.329 -54.354 12.777  1.00 14.94 ? 504  HIS A ND1 1 
ATOM   3085 C  CD2 . HIS A 1 397 ? 39.327 -53.886 12.037  1.00 15.85 ? 504  HIS A CD2 1 
ATOM   3086 C  CE1 . HIS A 1 397 ? 41.222 -54.889 11.570  1.00 16.45 ? 504  HIS A CE1 1 
ATOM   3087 N  NE2 . HIS A 1 397 ? 40.019 -54.615 11.098  1.00 15.76 ? 504  HIS A NE2 1 
ATOM   3088 N  N   . LEU A 1 398 ? 38.963 -50.256 15.570  1.00 11.46 ? 505  LEU A N   1 
ATOM   3089 C  CA  . LEU A 1 398 ? 38.356 -49.546 16.694  1.00 12.13 ? 505  LEU A CA  1 
ATOM   3090 C  C   . LEU A 1 398 ? 36.885 -49.942 16.820  1.00 14.53 ? 505  LEU A C   1 
ATOM   3091 O  O   . LEU A 1 398 ? 36.125 -49.829 15.865  1.00 14.05 ? 505  LEU A O   1 
ATOM   3092 C  CB  . LEU A 1 398 ? 38.489 -48.033 16.510  1.00 11.59 ? 505  LEU A CB  1 
ATOM   3093 C  CG  . LEU A 1 398 ? 37.906 -47.076 17.561  1.00 11.24 ? 505  LEU A CG  1 
ATOM   3094 C  CD1 . LEU A 1 398 ? 38.742 -47.102 18.844  1.00 12.66 ? 505  LEU A CD1 1 
ATOM   3095 C  CD2 . LEU A 1 398 ? 37.827 -45.655 17.013  1.00 14.25 ? 505  LEU A CD2 1 
ATOM   3096 N  N   . VAL A 1 399 ? 36.489 -50.403 18.002  1.00 11.49 ? 506  VAL A N   1 
ATOM   3097 C  CA  . VAL A 1 399 ? 35.120 -50.849 18.223  1.00 12.35 ? 506  VAL A CA  1 
ATOM   3098 C  C   . VAL A 1 399 ? 34.381 -49.885 19.144  1.00 11.27 ? 506  VAL A C   1 
ATOM   3099 O  O   . VAL A 1 399 ? 34.857 -49.575 20.240  1.00 14.09 ? 506  VAL A O   1 
ATOM   3100 C  CB  . VAL A 1 399 ? 35.078 -52.266 18.830  1.00 16.76 ? 506  VAL A CB  1 
ATOM   3101 C  CG1 . VAL A 1 399 ? 33.645 -52.801 18.818  1.00 15.38 ? 506  VAL A CG1 1 
ATOM   3102 C  CG2 . VAL A 1 399 ? 36.000 -53.196 18.055  1.00 16.09 ? 506  VAL A CG2 1 
ATOM   3103 N  N   . SER A 1 400 ? 33.218 -49.416 18.699  1.00 11.67 ? 507  SER A N   1 
ATOM   3104 C  CA  . SER A 1 400 ? 32.424 -48.468 19.470  1.00 10.24 ? 507  SER A CA  1 
ATOM   3105 C  C   . SER A 1 400 ? 31.622 -49.194 20.551  1.00 12.10 ? 507  SER A C   1 
ATOM   3106 O  O   . SER A 1 400 ? 31.459 -50.413 20.496  1.00 13.84 ? 507  SER A O   1 
ATOM   3107 C  CB  . SER A 1 400 ? 31.476 -47.693 18.552  1.00 13.76 ? 507  SER A CB  1 
ATOM   3108 O  OG  . SER A 1 400 ? 30.401 -48.531 18.149  1.00 12.49 ? 507  SER A OG  1 
ATOM   3109 N  N   . PRO A 1 401 ? 31.110 -48.443 21.534  1.00 11.62 ? 508  PRO A N   1 
ATOM   3110 C  CA  . PRO A 1 401 ? 30.268 -49.066 22.562  1.00 14.21 ? 508  PRO A CA  1 
ATOM   3111 C  C   . PRO A 1 401 ? 29.042 -49.770 21.996  1.00 17.72 ? 508  PRO A C   1 
ATOM   3112 O  O   . PRO A 1 401 ? 28.529 -50.699 22.616  1.00 17.24 ? 508  PRO A O   1 
ATOM   3113 C  CB  . PRO A 1 401 ? 29.854 -47.880 23.436  1.00 14.89 ? 508  PRO A CB  1 
ATOM   3114 C  CG  . PRO A 1 401 ? 31.019 -46.955 23.354  1.00 14.75 ? 508  PRO A CG  1 
ATOM   3115 C  CD  . PRO A 1 401 ? 31.559 -47.096 21.937  1.00 11.35 ? 508  PRO A CD  1 
ATOM   3116 N  N   A MET A 1 402 ? 28.586 -49.333 20.825  0.50 14.03 ? 509  MET A N   1 
ATOM   3117 N  N   B MET A 1 402 ? 28.567 -49.341 20.834  0.50 14.03 ? 509  MET A N   1 
ATOM   3118 C  CA  A MET A 1 402 ? 27.440 -49.955 20.170  0.50 15.15 ? 509  MET A CA  1 
ATOM   3119 C  CA  B MET A 1 402 ? 27.422 -50.007 20.232  0.50 15.14 ? 509  MET A CA  1 
ATOM   3120 C  C   A MET A 1 402 ? 27.850 -51.175 19.343  0.50 16.91 ? 509  MET A C   1 
ATOM   3121 C  C   B MET A 1 402 ? 27.856 -51.154 19.316  0.50 16.91 ? 509  MET A C   1 
ATOM   3122 O  O   A MET A 1 402 ? 27.021 -51.785 18.675  0.50 18.05 ? 509  MET A O   1 
ATOM   3123 O  O   B MET A 1 402 ? 27.047 -51.693 18.565  0.50 18.17 ? 509  MET A O   1 
ATOM   3124 C  CB  A MET A 1 402 ? 26.714 -48.934 19.291  0.50 14.58 ? 509  MET A CB  1 
ATOM   3125 C  CB  B MET A 1 402 ? 26.559 -48.995 19.482  0.50 15.04 ? 509  MET A CB  1 
ATOM   3126 C  CG  A MET A 1 402 ? 26.036 -47.836 20.098  0.50 11.94 ? 509  MET A CG  1 
ATOM   3127 C  CG  B MET A 1 402 ? 25.529 -48.329 20.385  0.50 18.09 ? 509  MET A CG  1 
ATOM   3128 S  SD  A MET A 1 402 ? 24.787 -48.473 21.244  0.50 9.49  ? 509  MET A SD  1 
ATOM   3129 S  SD  B MET A 1 402 ? 25.122 -46.684 19.816  0.50 27.40 ? 509  MET A SD  1 
ATOM   3130 C  CE  A MET A 1 402 ? 23.531 -49.028 20.095  0.50 10.66 ? 509  MET A CE  1 
ATOM   3131 C  CE  B MET A 1 402 ? 23.518 -46.398 20.505  0.50 19.54 ? 509  MET A CE  1 
ATOM   3132 N  N   . GLY A 1 403 ? 29.133 -51.524 19.398  1.00 15.03 ? 510  GLY A N   1 
ATOM   3133 C  CA  . GLY A 1 403 ? 29.637 -52.723 18.751  1.00 14.80 ? 510  GLY A CA  1 
ATOM   3134 C  C   . GLY A 1 403 ? 30.061 -52.583 17.301  1.00 16.81 ? 510  GLY A C   1 
ATOM   3135 O  O   . GLY A 1 403 ? 30.264 -53.583 16.608  1.00 15.20 ? 510  GLY A O   1 
ATOM   3136 N  N   . THR A 1 404 ? 30.211 -51.349 16.840  1.00 11.96 ? 511  THR A N   1 
ATOM   3137 C  CA  . THR A 1 404 ? 30.556 -51.113 15.436  1.00 12.81 ? 511  THR A CA  1 
ATOM   3138 C  C   . THR A 1 404 ? 32.069 -51.170 15.288  1.00 16.06 ? 511  THR A C   1 
ATOM   3139 O  O   . THR A 1 404 ? 32.779 -50.363 15.889  1.00 12.71 ? 511  THR A O   1 
ATOM   3140 C  CB  . THR A 1 404 ? 30.008 -49.759 14.947  1.00 14.09 ? 511  THR A CB  1 
ATOM   3141 O  OG1 . THR A 1 404 ? 28.580 -49.758 15.088  1.00 14.78 ? 511  THR A OG1 1 
ATOM   3142 C  CG2 . THR A 1 404 ? 30.366 -49.508 13.475  1.00 13.24 ? 511  THR A CG2 1 
ATOM   3143 N  N   . ARG A 1 405 ? 32.554 -52.140 14.513  1.00 13.52 ? 512  ARG A N   1 
ATOM   3144 C  CA  . ARG A 1 405 ? 33.990 -52.324 14.322  1.00 14.68 ? 512  ARG A CA  1 
ATOM   3145 C  C   . ARG A 1 405 ? 34.466 -51.573 13.081  1.00 14.58 ? 512  ARG A C   1 
ATOM   3146 O  O   . ARG A 1 405 ? 34.164 -51.965 11.952  1.00 15.66 ? 512  ARG A O   1 
ATOM   3147 C  CB  . ARG A 1 405 ? 34.323 -53.815 14.206  1.00 16.28 ? 512  ARG A CB  1 
ATOM   3148 C  CG  . ARG A 1 405 ? 35.815 -54.135 14.256  1.00 18.43 ? 512  ARG A CG  1 
ATOM   3149 C  CD  . ARG A 1 405 ? 36.031 -55.637 14.479  1.00 24.70 ? 512  ARG A CD  1 
ATOM   3150 N  NE  . ARG A 1 405 ? 37.414 -55.979 14.817  1.00 23.57 ? 512  ARG A NE  1 
ATOM   3151 C  CZ  . ARG A 1 405 ? 38.268 -56.549 13.973  1.00 30.90 ? 512  ARG A CZ  1 
ATOM   3152 N  NH1 . ARG A 1 405 ? 37.889 -56.827 12.727  1.00 27.51 ? 512  ARG A NH1 1 
ATOM   3153 N  NH2 . ARG A 1 405 ? 39.503 -56.843 14.372  1.00 30.51 ? 512  ARG A NH2 1 
ATOM   3154 N  N   . SER A 1 406 ? 35.198 -50.486 13.305  1.00 12.19 ? 513  SER A N   1 
ATOM   3155 C  CA  . SER A 1 406 ? 35.802 -49.711 12.232  1.00 13.06 ? 513  SER A CA  1 
ATOM   3156 C  C   . SER A 1 406 ? 37.226 -50.160 11.971  1.00 13.50 ? 513  SER A C   1 
ATOM   3157 O  O   . SER A 1 406 ? 38.028 -50.280 12.892  1.00 12.31 ? 513  SER A O   1 
ATOM   3158 C  CB  . SER A 1 406 ? 35.792 -48.212 12.578  1.00 12.96 ? 513  SER A CB  1 
ATOM   3159 O  OG  . SER A 1 406 ? 34.475 -47.698 12.555  1.00 13.40 ? 513  SER A OG  1 
ATOM   3160 N  N   . THR A 1 407 ? 37.550 -50.408 10.708  1.00 12.32 ? 514  THR A N   1 
ATOM   3161 C  CA  . THR A 1 407 ? 38.947 -50.605 10.342  1.00 12.51 ? 514  THR A CA  1 
ATOM   3162 C  C   . THR A 1 407 ? 39.606 -49.235 10.209  1.00 12.97 ? 514  THR A C   1 
ATOM   3163 O  O   . THR A 1 407 ? 39.279 -48.468 9.302   1.00 14.08 ? 514  THR A O   1 
ATOM   3164 C  CB  . THR A 1 407 ? 39.091 -51.386 9.017   1.00 13.26 ? 514  THR A CB  1 
ATOM   3165 O  OG1 . THR A 1 407 ? 38.411 -52.646 9.123   1.00 15.58 ? 514  THR A OG1 1 
ATOM   3166 C  CG2 . THR A 1 407 ? 40.579 -51.630 8.676   1.00 12.17 ? 514  THR A CG2 1 
ATOM   3167 N  N   . LEU A 1 408 ? 40.538 -48.929 11.101  1.00 13.43 ? 515  LEU A N   1 
ATOM   3168 C  CA  . LEU A 1 408 ? 41.289 -47.679 11.005  1.00 10.21 ? 515  LEU A CA  1 
ATOM   3169 C  C   . LEU A 1 408 ? 42.452 -47.796 10.015  1.00 12.29 ? 515  LEU A C   1 
ATOM   3170 O  O   . LEU A 1 408 ? 42.841 -46.811 9.389   1.00 13.00 ? 515  LEU A O   1 
ATOM   3171 C  CB  . LEU A 1 408 ? 41.817 -47.267 12.381  1.00 8.63  ? 515  LEU A CB  1 
ATOM   3172 C  CG  . LEU A 1 408 ? 40.737 -46.968 13.427  1.00 11.18 ? 515  LEU A CG  1 
ATOM   3173 C  CD1 . LEU A 1 408 ? 41.375 -46.422 14.699  1.00 12.25 ? 515  LEU A CD1 1 
ATOM   3174 C  CD2 . LEU A 1 408 ? 39.685 -46.000 12.847  1.00 13.94 ? 515  LEU A CD2 1 
ATOM   3175 N  N   . LEU A 1 409 ? 43.002 -49.001 9.898   1.00 11.45 ? 516  LEU A N   1 
ATOM   3176 C  CA  . LEU A 1 409 ? 44.175 -49.257 9.068   1.00 11.31 ? 516  LEU A CA  1 
ATOM   3177 C  C   . LEU A 1 409 ? 44.195 -50.718 8.660   1.00 15.77 ? 516  LEU A C   1 
ATOM   3178 O  O   . LEU A 1 409 ? 44.153 -51.605 9.518   1.00 10.45 ? 516  LEU A O   1 
ATOM   3179 C  CB  . LEU A 1 409 ? 45.473 -48.914 9.821   1.00 11.22 ? 516  LEU A CB  1 
ATOM   3180 C  CG  . LEU A 1 409 ? 46.775 -49.095 9.025   1.00 12.39 ? 516  LEU A CG  1 
ATOM   3181 C  CD1 . LEU A 1 409 ? 46.841 -48.135 7.822   1.00 11.83 ? 516  LEU A CD1 1 
ATOM   3182 C  CD2 . LEU A 1 409 ? 48.005 -48.914 9.923   1.00 13.00 ? 516  LEU A CD2 1 
ATOM   3183 N  N   . ALA A 1 410 ? 44.250 -50.969 7.354   1.00 12.19 ? 517  ALA A N   1 
ATOM   3184 C  CA  . ALA A 1 410 ? 44.436 -52.325 6.858   1.00 14.51 ? 517  ALA A CA  1 
ATOM   3185 C  C   . ALA A 1 410 ? 45.916 -52.517 6.546   1.00 13.71 ? 517  ALA A C   1 
ATOM   3186 O  O   . ALA A 1 410 ? 46.632 -51.540 6.346   1.00 13.52 ? 517  ALA A O   1 
ATOM   3187 C  CB  . ALA A 1 410 ? 43.591 -52.579 5.623   1.00 12.38 ? 517  ALA A CB  1 
ATOM   3188 N  N   . ALA A 1 411 ? 46.360 -53.769 6.508   1.00 12.79 ? 518  ALA A N   1 
ATOM   3189 C  CA  . ALA A 1 411 ? 47.730 -54.082 6.128   1.00 16.14 ? 518  ALA A CA  1 
ATOM   3190 C  C   . ALA A 1 411 ? 48.047 -53.468 4.768   1.00 14.39 ? 518  ALA A C   1 
ATOM   3191 O  O   . ALA A 1 411 ? 47.234 -53.528 3.846   1.00 15.34 ? 518  ALA A O   1 
ATOM   3192 C  CB  . ALA A 1 411 ? 47.945 -55.594 6.096   1.00 15.12 ? 518  ALA A CB  1 
ATOM   3193 N  N   . ARG A 1 412 ? 49.222 -52.861 4.662   1.00 14.58 ? 519  ARG A N   1 
ATOM   3194 C  CA  . ARG A 1 412 ? 49.694 -52.289 3.403   1.00 13.67 ? 519  ARG A CA  1 
ATOM   3195 C  C   . ARG A 1 412 ? 51.021 -52.942 3.049   1.00 14.25 ? 519  ARG A C   1 
ATOM   3196 O  O   . ARG A 1 412 ? 52.069 -52.559 3.570   1.00 14.64 ? 519  ARG A O   1 
ATOM   3197 C  CB  . ARG A 1 412 ? 49.845 -50.770 3.507   1.00 12.55 ? 519  ARG A CB  1 
ATOM   3198 C  CG  . ARG A 1 412 ? 48.514 -50.039 3.690   1.00 14.22 ? 519  ARG A CG  1 
ATOM   3199 C  CD  . ARG A 1 412 ? 48.605 -48.581 3.240   1.00 13.62 ? 519  ARG A CD  1 
ATOM   3200 N  NE  . ARG A 1 412 ? 49.649 -47.844 3.952   1.00 13.76 ? 519  ARG A NE  1 
ATOM   3201 C  CZ  . ARG A 1 412 ? 50.078 -46.630 3.619   1.00 13.63 ? 519  ARG A CZ  1 
ATOM   3202 N  NH1 . ARG A 1 412 ? 51.047 -46.062 4.336   1.00 14.18 ? 519  ARG A NH1 1 
ATOM   3203 N  NH2 . ARG A 1 412 ? 49.567 -45.990 2.563   1.00 11.66 ? 519  ARG A NH2 1 
ATOM   3204 N  N   . PRO A 1 413 ? 50.976 -53.950 2.170   1.00 13.72 ? 520  PRO A N   1 
ATOM   3205 C  CA  . PRO A 1 413 ? 52.156 -54.786 1.913   1.00 17.82 ? 520  PRO A CA  1 
ATOM   3206 C  C   . PRO A 1 413 ? 53.384 -54.004 1.448   1.00 20.62 ? 520  PRO A C   1 
ATOM   3207 O  O   . PRO A 1 413 ? 54.499 -54.436 1.733   1.00 19.33 ? 520  PRO A O   1 
ATOM   3208 C  CB  . PRO A 1 413 ? 51.676 -55.758 0.813   1.00 20.00 ? 520  PRO A CB  1 
ATOM   3209 C  CG  . PRO A 1 413 ? 50.373 -55.163 0.280   1.00 27.45 ? 520  PRO A CG  1 
ATOM   3210 C  CD  . PRO A 1 413 ? 49.781 -54.422 1.449   1.00 15.30 ? 520  PRO A CD  1 
ATOM   3211 N  N   . HIS A 1 414 ? 53.187 -52.883 0.760   1.00 17.15 ? 521  HIS A N   1 
ATOM   3212 C  CA  . HIS A 1 414 ? 54.305 -52.107 0.244   1.00 14.12 ? 521  HIS A CA  1 
ATOM   3213 C  C   . HIS A 1 414 ? 54.899 -51.132 1.250   1.00 15.00 ? 521  HIS A C   1 
ATOM   3214 O  O   . HIS A 1 414 ? 55.951 -50.559 0.997   1.00 15.05 ? 521  HIS A O   1 
ATOM   3215 C  CB  . HIS A 1 414 ? 53.881 -51.329 -0.997  1.00 15.42 ? 521  HIS A CB  1 
ATOM   3216 C  CG  . HIS A 1 414 ? 53.449 -52.201 -2.129  1.00 22.81 ? 521  HIS A CG  1 
ATOM   3217 N  ND1 . HIS A 1 414 ? 54.277 -53.146 -2.694  1.00 23.49 ? 521  HIS A ND1 1 
ATOM   3218 C  CD2 . HIS A 1 414 ? 52.272 -52.283 -2.793  1.00 24.46 ? 521  HIS A CD2 1 
ATOM   3219 C  CE1 . HIS A 1 414 ? 53.632 -53.767 -3.666  1.00 27.56 ? 521  HIS A CE1 1 
ATOM   3220 N  NE2 . HIS A 1 414 ? 52.414 -53.263 -3.746  1.00 23.31 ? 521  HIS A NE2 1 
ATOM   3221 N  N   . ASP A 1 415 ? 54.229 -50.931 2.381   1.00 12.27 ? 522  ASP A N   1 
ATOM   3222 C  CA  . ASP A 1 415 ? 54.671 -49.918 3.329   1.00 13.16 ? 522  ASP A CA  1 
ATOM   3223 C  C   . ASP A 1 415 ? 55.721 -50.501 4.264   1.00 17.00 ? 522  ASP A C   1 
ATOM   3224 O  O   . ASP A 1 415 ? 55.389 -51.103 5.271   1.00 17.35 ? 522  ASP A O   1 
ATOM   3225 C  CB  . ASP A 1 415 ? 53.473 -49.375 4.119   1.00 12.82 ? 522  ASP A CB  1 
ATOM   3226 C  CG  . ASP A 1 415 ? 53.845 -48.230 5.057   1.00 18.11 ? 522  ASP A CG  1 
ATOM   3227 O  OD1 . ASP A 1 415 ? 54.998 -47.743 4.998   1.00 18.06 ? 522  ASP A OD1 1 
ATOM   3228 O  OD2 . ASP A 1 415 ? 52.968 -47.812 5.850   1.00 15.98 ? 522  ASP A OD2 1 
ATOM   3229 N  N   . TYR A 1 416 ? 56.995 -50.320 3.930   1.00 16.27 ? 523  TYR A N   1 
ATOM   3230 C  CA  . TYR A 1 416 ? 58.064 -50.888 4.745   1.00 15.27 ? 523  TYR A CA  1 
ATOM   3231 C  C   . TYR A 1 416 ? 58.614 -49.882 5.760   1.00 21.64 ? 523  TYR A C   1 
ATOM   3232 O  O   . TYR A 1 416 ? 59.619 -50.140 6.409   1.00 20.35 ? 523  TYR A O   1 
ATOM   3233 C  CB  . TYR A 1 416 ? 59.200 -51.385 3.852   1.00 18.93 ? 523  TYR A CB  1 
ATOM   3234 C  CG  . TYR A 1 416 ? 59.754 -50.296 2.965   1.00 26.11 ? 523  TYR A CG  1 
ATOM   3235 C  CD1 . TYR A 1 416 ? 60.742 -49.430 3.425   1.00 33.32 ? 523  TYR A CD1 1 
ATOM   3236 C  CD2 . TYR A 1 416 ? 59.274 -50.119 1.673   1.00 29.45 ? 523  TYR A CD2 1 
ATOM   3237 C  CE1 . TYR A 1 416 ? 61.240 -48.422 2.618   1.00 40.78 ? 523  TYR A CE1 1 
ATOM   3238 C  CE2 . TYR A 1 416 ? 59.765 -49.113 0.858   1.00 32.55 ? 523  TYR A CE2 1 
ATOM   3239 C  CZ  . TYR A 1 416 ? 60.748 -48.272 1.333   1.00 52.09 ? 523  TYR A CZ  1 
ATOM   3240 O  OH  . TYR A 1 416 ? 61.234 -47.279 0.515   1.00 60.71 ? 523  TYR A OH  1 
ATOM   3241 N  N   . SER A 1 417 ? 57.966 -48.731 5.883   1.00 16.58 ? 524  SER A N   1 
ATOM   3242 C  CA  . SER A 1 417 ? 58.487 -47.649 6.722   1.00 15.58 ? 524  SER A CA  1 
ATOM   3243 C  C   . SER A 1 417 ? 58.721 -48.030 8.183   1.00 18.49 ? 524  SER A C   1 
ATOM   3244 O  O   . SER A 1 417 ? 57.929 -48.755 8.785   1.00 16.39 ? 524  SER A O   1 
ATOM   3245 C  CB  . SER A 1 417 ? 57.540 -46.448 6.681   1.00 20.59 ? 524  SER A CB  1 
ATOM   3246 O  OG  . SER A 1 417 ? 58.010 -45.408 7.526   1.00 20.60 ? 524  SER A OG  1 
ATOM   3247 N  N   . ALA A 1 418 ? 59.811 -47.523 8.753   1.00 17.46 ? 525  ALA A N   1 
ATOM   3248 C  CA  . ALA A 1 418 ? 60.079 -47.686 10.179  1.00 17.34 ? 525  ALA A CA  1 
ATOM   3249 C  C   . ALA A 1 418 ? 59.700 -46.427 10.960  1.00 17.40 ? 525  ALA A C   1 
ATOM   3250 O  O   . ALA A 1 418 ? 60.068 -46.281 12.124  1.00 19.86 ? 525  ALA A O   1 
ATOM   3251 C  CB  . ALA A 1 418 ? 61.555 -48.028 10.414  1.00 21.39 ? 525  ALA A CB  1 
ATOM   3252 N  N   . ASP A 1 419 ? 58.965 -45.521 10.323  1.00 17.85 ? 526  ASP A N   1 
ATOM   3253 C  CA  . ASP A 1 419 ? 58.662 -44.225 10.930  1.00 18.95 ? 526  ASP A CA  1 
ATOM   3254 C  C   . ASP A 1 419 ? 57.404 -44.189 11.802  1.00 21.11 ? 526  ASP A C   1 
ATOM   3255 O  O   . ASP A 1 419 ? 57.156 -43.186 12.463  1.00 18.49 ? 526  ASP A O   1 
ATOM   3256 C  CB  . ASP A 1 419 ? 58.537 -43.159 9.838   1.00 20.04 ? 526  ASP A CB  1 
ATOM   3257 C  CG  . ASP A 1 419 ? 59.874 -42.827 9.195   1.00 26.10 ? 526  ASP A CG  1 
ATOM   3258 O  OD1 . ASP A 1 419 ? 60.923 -43.056 9.836   1.00 35.88 ? 526  ASP A OD1 1 
ATOM   3259 O  OD2 . ASP A 1 419 ? 59.871 -42.330 8.054   1.00 43.95 ? 526  ASP A OD2 1 
ATOM   3260 N  N   . GLY A 1 420 ? 56.617 -45.263 11.806  1.00 17.27 ? 527  GLY A N   1 
ATOM   3261 C  CA  . GLY A 1 420 ? 55.433 -45.329 12.658  1.00 14.87 ? 527  GLY A CA  1 
ATOM   3262 C  C   . GLY A 1 420 ? 54.390 -44.267 12.346  1.00 14.21 ? 527  GLY A C   1 
ATOM   3263 O  O   . GLY A 1 420 ? 54.295 -43.798 11.210  1.00 14.41 ? 527  GLY A O   1 
ATOM   3264 N  N   . PHE A 1 421 ? 53.607 -43.893 13.362  1.00 12.42 ? 528  PHE A N   1 
ATOM   3265 C  CA  . PHE A 1 421 ? 52.604 -42.844 13.229  1.00 17.79 ? 528  PHE A CA  1 
ATOM   3266 C  C   . PHE A 1 421 ? 52.829 -41.763 14.282  1.00 15.62 ? 528  PHE A C   1 
ATOM   3267 O  O   . PHE A 1 421 ? 53.046 -42.059 15.457  1.00 15.65 ? 528  PHE A O   1 
ATOM   3268 C  CB  . PHE A 1 421 ? 51.189 -43.425 13.355  1.00 11.90 ? 528  PHE A CB  1 
ATOM   3269 C  CG  . PHE A 1 421 ? 50.772 -44.265 12.177  1.00 11.99 ? 528  PHE A CG  1 
ATOM   3270 C  CD1 . PHE A 1 421 ? 50.330 -43.666 11.000  1.00 11.63 ? 528  PHE A CD1 1 
ATOM   3271 C  CD2 . PHE A 1 421 ? 50.827 -45.651 12.242  1.00 13.42 ? 528  PHE A CD2 1 
ATOM   3272 C  CE1 . PHE A 1 421 ? 49.945 -44.443 9.910   1.00 12.78 ? 528  PHE A CE1 1 
ATOM   3273 C  CE2 . PHE A 1 421 ? 50.443 -46.430 11.157  1.00 14.84 ? 528  PHE A CE2 1 
ATOM   3274 C  CZ  . PHE A 1 421 ? 49.998 -45.830 9.992   1.00 13.17 ? 528  PHE A CZ  1 
ATOM   3275 N  N   . ASN A 1 422 ? 52.788 -40.509 13.853  1.00 14.43 ? 529  ASN A N   1 
ATOM   3276 C  CA  . ASN A 1 422 ? 53.028 -39.395 14.762  1.00 16.22 ? 529  ASN A CA  1 
ATOM   3277 C  C   . ASN A 1 422 ? 51.760 -38.577 14.969  1.00 17.31 ? 529  ASN A C   1 
ATOM   3278 O  O   . ASN A 1 422 ? 51.454 -37.684 14.172  1.00 16.89 ? 529  ASN A O   1 
ATOM   3279 C  CB  . ASN A 1 422 ? 54.150 -38.516 14.222  1.00 19.56 ? 529  ASN A CB  1 
ATOM   3280 C  CG  . ASN A 1 422 ? 54.513 -37.390 15.168  1.00 29.38 ? 529  ASN A CG  1 
ATOM   3281 O  OD1 . ASN A 1 422 ? 54.144 -37.406 16.344  1.00 33.68 ? 529  ASN A OD1 1 
ATOM   3282 N  ND2 . ASN A 1 422 ? 55.240 -36.400 14.658  1.00 34.47 ? 529  ASN A ND2 1 
ATOM   3283 N  N   . ASP A 1 423 ? 51.021 -38.913 16.023  1.00 11.93 ? 530  ASP A N   1 
ATOM   3284 C  CA  . ASP A 1 423 ? 49.710 -38.319 16.294  1.00 12.97 ? 530  ASP A CA  1 
ATOM   3285 C  C   . ASP A 1 423 ? 48.822 -38.335 15.045  1.00 12.81 ? 530  ASP A C   1 
ATOM   3286 O  O   . ASP A 1 423 ? 48.247 -37.310 14.655  1.00 14.22 ? 530  ASP A O   1 
ATOM   3287 C  CB  . ASP A 1 423 ? 49.867 -36.886 16.816  1.00 12.32 ? 530  ASP A CB  1 
ATOM   3288 C  CG  . ASP A 1 423 ? 48.600 -36.356 17.471  1.00 16.87 ? 530  ASP A CG  1 
ATOM   3289 O  OD1 . ASP A 1 423 ? 47.869 -37.158 18.096  1.00 16.31 ? 530  ASP A OD1 1 
ATOM   3290 O  OD2 . ASP A 1 423 ? 48.344 -35.134 17.367  1.00 18.44 ? 530  ASP A OD2 1 
ATOM   3291 N  N   . TRP A 1 424 ? 48.715 -39.496 14.408  1.00 11.67 ? 531  TRP A N   1 
ATOM   3292 C  CA  . TRP A 1 424 ? 47.910 -39.585 13.190  1.00 12.58 ? 531  TRP A CA  1 
ATOM   3293 C  C   . TRP A 1 424 ? 46.441 -39.801 13.546  1.00 11.50 ? 531  TRP A C   1 
ATOM   3294 O  O   . TRP A 1 424 ? 46.106 -40.747 14.259  1.00 13.86 ? 531  TRP A O   1 
ATOM   3295 C  CB  . TRP A 1 424 ? 48.417 -40.710 12.277  1.00 11.19 ? 531  TRP A CB  1 
ATOM   3296 C  CG  . TRP A 1 424 ? 47.727 -40.693 10.970  1.00 12.23 ? 531  TRP A CG  1 
ATOM   3297 C  CD1 . TRP A 1 424 ? 46.704 -41.508 10.565  1.00 13.29 ? 531  TRP A CD1 1 
ATOM   3298 C  CD2 . TRP A 1 424 ? 47.978 -39.792 9.882   1.00 12.44 ? 531  TRP A CD2 1 
ATOM   3299 N  NE1 . TRP A 1 424 ? 46.302 -41.163 9.294   1.00 13.65 ? 531  TRP A NE1 1 
ATOM   3300 C  CE2 . TRP A 1 424 ? 47.077 -40.121 8.851   1.00 13.96 ? 531  TRP A CE2 1 
ATOM   3301 C  CE3 . TRP A 1 424 ? 48.879 -38.736 9.686   1.00 14.25 ? 531  TRP A CE3 1 
ATOM   3302 C  CZ2 . TRP A 1 424 ? 47.046 -39.432 7.632   1.00 13.36 ? 531  TRP A CZ2 1 
ATOM   3303 C  CZ3 . TRP A 1 424 ? 48.845 -38.055 8.474   1.00 13.85 ? 531  TRP A CZ3 1 
ATOM   3304 C  CH2 . TRP A 1 424 ? 47.940 -38.406 7.468   1.00 13.23 ? 531  TRP A CH2 1 
ATOM   3305 N  N   . ALA A 1 425 ? 45.565 -38.925 13.050  1.00 11.27 ? 532  ALA A N   1 
ATOM   3306 C  CA  . ALA A 1 425 ? 44.153 -38.936 13.452  1.00 14.05 ? 532  ALA A CA  1 
ATOM   3307 C  C   . ALA A 1 425 ? 43.276 -39.839 12.575  1.00 14.71 ? 532  ALA A C   1 
ATOM   3308 O  O   . ALA A 1 425 ? 42.468 -39.343 11.787  1.00 16.96 ? 532  ALA A O   1 
ATOM   3309 C  CB  . ALA A 1 425 ? 43.590 -37.501 13.441  1.00 13.07 ? 532  ALA A CB  1 
ATOM   3310 N  N   . PHE A 1 426 ? 43.410 -41.153 12.741  1.00 9.75  ? 533  PHE A N   1 
ATOM   3311 C  CA  . PHE A 1 426 ? 42.569 -42.109 12.028  1.00 10.71 ? 533  PHE A CA  1 
ATOM   3312 C  C   . PHE A 1 426 ? 41.103 -41.797 12.272  1.00 12.73 ? 533  PHE A C   1 
ATOM   3313 O  O   . PHE A 1 426 ? 40.687 -41.714 13.418  1.00 12.93 ? 533  PHE A O   1 
ATOM   3314 C  CB  . PHE A 1 426 ? 42.859 -43.544 12.485  1.00 10.62 ? 533  PHE A CB  1 
ATOM   3315 C  CG  . PHE A 1 426 ? 44.256 -44.007 12.209  1.00 9.92  ? 533  PHE A CG  1 
ATOM   3316 C  CD1 . PHE A 1 426 ? 44.595 -44.538 10.964  1.00 11.86 ? 533  PHE A CD1 1 
ATOM   3317 C  CD2 . PHE A 1 426 ? 45.226 -43.948 13.206  1.00 11.86 ? 533  PHE A CD2 1 
ATOM   3318 C  CE1 . PHE A 1 426 ? 45.884 -44.986 10.706  1.00 12.47 ? 533  PHE A CE1 1 
ATOM   3319 C  CE2 . PHE A 1 426 ? 46.531 -44.384 12.956  1.00 12.92 ? 533  PHE A CE2 1 
ATOM   3320 C  CZ  . PHE A 1 426 ? 46.856 -44.912 11.703  1.00 13.77 ? 533  PHE A CZ  1 
ATOM   3321 N  N   . MET A 1 427 ? 40.313 -41.649 11.213  1.00 9.99  ? 534  MET A N   1 
ATOM   3322 C  CA  . MET A 1 427 ? 38.935 -41.199 11.389  1.00 10.85 ? 534  MET A CA  1 
ATOM   3323 C  C   . MET A 1 427 ? 37.927 -42.236 10.906  1.00 11.30 ? 534  MET A C   1 
ATOM   3324 O  O   . MET A 1 427 ? 38.132 -42.888 9.879   1.00 12.48 ? 534  MET A O   1 
ATOM   3325 C  CB  . MET A 1 427 ? 38.705 -39.867 10.659  1.00 10.26 ? 534  MET A CB  1 
ATOM   3326 C  CG  . MET A 1 427 ? 37.372 -39.177 11.020  1.00 12.32 ? 534  MET A CG  1 
ATOM   3327 S  SD  . MET A 1 427 ? 36.031 -39.643 9.883   1.00 12.28 ? 534  MET A SD  1 
ATOM   3328 C  CE  . MET A 1 427 ? 36.400 -38.613 8.451   1.00 11.92 ? 534  MET A CE  1 
ATOM   3329 N  N   . THR A 1 428 ? 36.829 -42.383 11.643  1.00 11.74 ? 535  THR A N   1 
ATOM   3330 C  CA  . THR A 1 428 ? 35.741 -43.230 11.166  1.00 9.53  ? 535  THR A CA  1 
ATOM   3331 C  C   . THR A 1 428 ? 34.402 -42.491 11.150  1.00 12.17 ? 535  THR A C   1 
ATOM   3332 O  O   . THR A 1 428 ? 34.082 -41.722 12.066  1.00 10.56 ? 535  THR A O   1 
ATOM   3333 C  CB  . THR A 1 428 ? 35.588 -44.516 12.013  1.00 10.61 ? 535  THR A CB  1 
ATOM   3334 O  OG1 . THR A 1 428 ? 34.465 -45.257 11.513  1.00 11.20 ? 535  THR A OG1 1 
ATOM   3335 C  CG2 . THR A 1 428 ? 35.385 -44.198 13.517  1.00 10.24 ? 535  THR A CG2 1 
ATOM   3336 N  N   . THR A 1 429 ? 33.636 -42.722 10.085  1.00 9.94  ? 536  THR A N   1 
ATOM   3337 C  CA  . THR A 1 429 ? 32.278 -42.218 9.958   1.00 10.96 ? 536  THR A CA  1 
ATOM   3338 C  C   . THR A 1 429 ? 31.245 -43.290 10.306  1.00 11.28 ? 536  THR A C   1 
ATOM   3339 O  O   . THR A 1 429 ? 30.041 -43.032 10.264  1.00 11.19 ? 536  THR A O   1 
ATOM   3340 C  CB  . THR A 1 429 ? 31.982 -41.770 8.526   1.00 11.57 ? 536  THR A CB  1 
ATOM   3341 O  OG1 . THR A 1 429 ? 32.110 -42.917 7.673   1.00 12.00 ? 536  THR A OG1 1 
ATOM   3342 C  CG2 . THR A 1 429 ? 32.965 -40.680 8.079   1.00 11.29 ? 536  THR A CG2 1 
ATOM   3343 N  N   . HIS A 1 430 ? 31.714 -44.495 10.611  1.00 8.99  ? 537  HIS A N   1 
ATOM   3344 C  CA  . HIS A 1 430 ? 30.818 -45.655 10.707  1.00 11.89 ? 537  HIS A CA  1 
ATOM   3345 C  C   . HIS A 1 430 ? 29.963 -45.688 11.986  1.00 13.19 ? 537  HIS A C   1 
ATOM   3346 O  O   . HIS A 1 430 ? 29.038 -46.499 12.095  1.00 11.52 ? 537  HIS A O   1 
ATOM   3347 C  CB  . HIS A 1 430 ? 31.625 -46.954 10.605  1.00 8.97  ? 537  HIS A CB  1 
ATOM   3348 C  CG  . HIS A 1 430 ? 32.198 -47.203 9.244   1.00 11.07 ? 537  HIS A CG  1 
ATOM   3349 N  ND1 . HIS A 1 430 ? 32.507 -48.463 8.787   1.00 12.55 ? 537  HIS A ND1 1 
ATOM   3350 C  CD2 . HIS A 1 430 ? 32.505 -46.350 8.237   1.00 11.13 ? 537  HIS A CD2 1 
ATOM   3351 C  CE1 . HIS A 1 430 ? 32.981 -48.379 7.553   1.00 13.31 ? 537  HIS A CE1 1 
ATOM   3352 N  NE2 . HIS A 1 430 ? 32.983 -47.108 7.194   1.00 12.89 ? 537  HIS A NE2 1 
ATOM   3353 N  N   . SER A 1 431 ? 30.269 -44.820 12.944  1.00 11.24 ? 538  SER A N   1 
ATOM   3354 C  CA  . SER A 1 431 ? 29.503 -44.768 14.189  1.00 12.20 ? 538  SER A CA  1 
ATOM   3355 C  C   . SER A 1 431 ? 28.667 -43.505 14.283  1.00 12.60 ? 538  SER A C   1 
ATOM   3356 O  O   . SER A 1 431 ? 28.192 -43.144 15.366  1.00 12.45 ? 538  SER A O   1 
ATOM   3357 C  CB  . SER A 1 431 ? 30.438 -44.886 15.399  1.00 10.96 ? 538  SER A CB  1 
ATOM   3358 O  OG  . SER A 1 431 ? 30.864 -46.234 15.555  1.00 13.10 ? 538  SER A OG  1 
ATOM   3359 N  N   . TRP A 1 432 ? 28.494 -42.835 13.146  1.00 10.07 ? 539  TRP A N   1 
ATOM   3360 C  CA  . TRP A 1 432 ? 27.644 -41.652 13.043  1.00 11.84 ? 539  TRP A CA  1 
ATOM   3361 C  C   . TRP A 1 432 ? 26.261 -41.905 13.684  1.00 14.30 ? 539  TRP A C   1 
ATOM   3362 O  O   . TRP A 1 432 ? 25.628 -42.933 13.415  1.00 12.84 ? 539  TRP A O   1 
ATOM   3363 C  CB  . TRP A 1 432 ? 27.496 -41.268 11.562  1.00 12.17 ? 539  TRP A CB  1 
ATOM   3364 C  CG  . TRP A 1 432 ? 27.060 -39.868 11.261  1.00 10.75 ? 539  TRP A CG  1 
ATOM   3365 C  CD1 . TRP A 1 432 ? 25.778 -39.379 11.277  1.00 14.02 ? 539  TRP A CD1 1 
ATOM   3366 C  CD2 . TRP A 1 432 ? 27.896 -38.782 10.828  1.00 12.71 ? 539  TRP A CD2 1 
ATOM   3367 N  NE1 . TRP A 1 432 ? 25.775 -38.055 10.902  1.00 16.11 ? 539  TRP A NE1 1 
ATOM   3368 C  CE2 . TRP A 1 432 ? 27.063 -37.665 10.626  1.00 15.74 ? 539  TRP A CE2 1 
ATOM   3369 C  CE3 . TRP A 1 432 ? 29.276 -38.646 10.608  1.00 13.77 ? 539  TRP A CE3 1 
ATOM   3370 C  CZ2 . TRP A 1 432 ? 27.559 -36.424 10.212  1.00 13.58 ? 539  TRP A CZ2 1 
ATOM   3371 C  CZ3 . TRP A 1 432 ? 29.767 -37.409 10.189  1.00 12.33 ? 539  TRP A CZ3 1 
ATOM   3372 C  CH2 . TRP A 1 432 ? 28.911 -36.321 9.997   1.00 15.06 ? 539  TRP A CH2 1 
ATOM   3373 N  N   . ASP A 1 433 ? 25.839 -40.969 14.538  1.00 12.89 ? 540  ASP A N   1 
ATOM   3374 C  CA  . ASP A 1 433 ? 24.559 -40.971 15.284  1.00 10.97 ? 540  ASP A CA  1 
ATOM   3375 C  C   . ASP A 1 433 ? 24.499 -41.957 16.463  1.00 12.00 ? 540  ASP A C   1 
ATOM   3376 O  O   . ASP A 1 433 ? 23.482 -42.009 17.169  1.00 13.15 ? 540  ASP A O   1 
ATOM   3377 C  CB  . ASP A 1 433 ? 23.368 -41.222 14.344  1.00 11.26 ? 540  ASP A CB  1 
ATOM   3378 C  CG  . ASP A 1 433 ? 22.963 -39.975 13.563  1.00 16.34 ? 540  ASP A CG  1 
ATOM   3379 O  OD1 . ASP A 1 433 ? 23.144 -38.859 14.087  1.00 17.41 ? 540  ASP A OD1 1 
ATOM   3380 O  OD2 . ASP A 1 433 ? 22.450 -40.107 12.429  1.00 17.51 ? 540  ASP A OD2 1 
ATOM   3381 N  N   . GLU A 1 434 ? 25.580 -42.701 16.698  1.00 10.84 ? 541  GLU A N   1 
ATOM   3382 C  CA  . GLU A 1 434 ? 25.667 -43.577 17.877  1.00 12.54 ? 541  GLU A CA  1 
ATOM   3383 C  C   . GLU A 1 434 ? 25.941 -42.781 19.145  1.00 12.38 ? 541  GLU A C   1 
ATOM   3384 O  O   . GLU A 1 434 ? 26.535 -41.711 19.092  1.00 12.23 ? 541  GLU A O   1 
ATOM   3385 C  CB  . GLU A 1 434 ? 26.770 -44.619 17.715  1.00 11.59 ? 541  GLU A CB  1 
ATOM   3386 C  CG  . GLU A 1 434 ? 26.514 -45.634 16.612  1.00 13.55 ? 541  GLU A CG  1 
ATOM   3387 C  CD  . GLU A 1 434 ? 27.600 -46.677 16.519  1.00 13.81 ? 541  GLU A CD  1 
ATOM   3388 O  OE1 . GLU A 1 434 ? 28.553 -46.650 17.334  1.00 12.28 ? 541  GLU A OE1 1 
ATOM   3389 O  OE2 . GLU A 1 434 ? 27.509 -47.531 15.614  1.00 14.23 ? 541  GLU A OE2 1 
ATOM   3390 N  N   . ASP A 1 435 ? 25.527 -43.333 20.283  1.00 12.18 ? 542  ASP A N   1 
ATOM   3391 C  CA  . ASP A 1 435 ? 25.908 -42.801 21.591  1.00 12.39 ? 542  ASP A CA  1 
ATOM   3392 C  C   . ASP A 1 435 ? 27.299 -43.332 21.915  1.00 8.41  ? 542  ASP A C   1 
ATOM   3393 O  O   . ASP A 1 435 ? 27.505 -44.541 21.943  1.00 13.98 ? 542  ASP A O   1 
ATOM   3394 C  CB  . ASP A 1 435 ? 24.870 -43.219 22.650  1.00 13.70 ? 542  ASP A CB  1 
ATOM   3395 C  CG  . ASP A 1 435 ? 25.070 -42.538 23.997  1.00 18.64 ? 542  ASP A CG  1 
ATOM   3396 O  OD1 . ASP A 1 435 ? 26.213 -42.166 24.348  1.00 15.60 ? 542  ASP A OD1 1 
ATOM   3397 O  OD2 . ASP A 1 435 ? 24.056 -42.399 24.723  1.00 16.79 ? 542  ASP A OD2 1 
ATOM   3398 N  N   . PRO A 1 436 ? 28.278 -42.436 22.133  1.00 9.25  ? 543  PRO A N   1 
ATOM   3399 C  CA  . PRO A 1 436 ? 29.660 -42.909 22.300  1.00 13.88 ? 543  PRO A CA  1 
ATOM   3400 C  C   . PRO A 1 436 ? 30.043 -43.184 23.753  1.00 14.33 ? 543  PRO A C   1 
ATOM   3401 O  O   . PRO A 1 436 ? 31.209 -43.441 24.045  1.00 14.47 ? 543  PRO A O   1 
ATOM   3402 C  CB  . PRO A 1 436 ? 30.480 -41.747 21.746  1.00 14.36 ? 543  PRO A CB  1 
ATOM   3403 C  CG  . PRO A 1 436 ? 29.676 -40.546 22.220  1.00 13.48 ? 543  PRO A CG  1 
ATOM   3404 C  CD  . PRO A 1 436 ? 28.218 -40.968 22.037  1.00 11.25 ? 543  PRO A CD  1 
ATOM   3405 N  N   . SER A 1 437 ? 29.078 -43.100 24.662  1.00 13.27 ? 544  SER A N   1 
ATOM   3406 C  CA  . SER A 1 437 ? 29.332 -43.466 26.051  1.00 12.35 ? 544  SER A CA  1 
ATOM   3407 C  C   . SER A 1 437 ? 29.556 -44.966 26.172  1.00 13.18 ? 544  SER A C   1 
ATOM   3408 O  O   . SER A 1 437 ? 28.879 -45.739 25.508  1.00 15.00 ? 544  SER A O   1 
ATOM   3409 C  CB  . SER A 1 437 ? 28.153 -43.031 26.934  1.00 17.50 ? 544  SER A CB  1 
ATOM   3410 O  OG  . SER A 1 437 ? 28.235 -43.632 28.208  1.00 21.18 ? 544  SER A OG  1 
ATOM   3411 N  N   . GLY A 1 438 ? 30.503 -45.389 27.005  1.00 15.07 ? 545  GLY A N   1 
ATOM   3412 C  CA  . GLY A 1 438 ? 30.726 -46.810 27.213  1.00 15.72 ? 545  GLY A CA  1 
ATOM   3413 C  C   . GLY A 1 438 ? 32.098 -47.295 26.785  1.00 14.45 ? 545  GLY A C   1 
ATOM   3414 O  O   . GLY A 1 438 ? 33.036 -46.508 26.688  1.00 13.19 ? 545  GLY A O   1 
ATOM   3415 N  N   . GLU A 1 439 ? 32.210 -48.592 26.518  1.00 13.28 ? 546  GLU A N   1 
ATOM   3416 C  CA  . GLU A 1 439 ? 33.512 -49.197 26.267  1.00 13.60 ? 546  GLU A CA  1 
ATOM   3417 C  C   . GLU A 1 439 ? 33.938 -49.068 24.805  1.00 11.31 ? 546  GLU A C   1 
ATOM   3418 O  O   . GLU A 1 439 ? 33.263 -49.590 23.912  1.00 12.73 ? 546  GLU A O   1 
ATOM   3419 C  CB  . GLU A 1 439 ? 33.503 -50.677 26.645  1.00 16.48 ? 546  GLU A CB  1 
ATOM   3420 C  CG  . GLU A 1 439 ? 34.837 -51.353 26.401  1.00 18.41 ? 546  GLU A CG  1 
ATOM   3421 C  CD  . GLU A 1 439 ? 34.734 -52.877 26.370  1.00 30.47 ? 546  GLU A CD  1 
ATOM   3422 O  OE1 . GLU A 1 439 ? 35.787 -53.550 26.413  1.00 28.71 ? 546  GLU A OE1 1 
ATOM   3423 O  OE2 . GLU A 1 439 ? 33.604 -53.403 26.293  1.00 28.33 ? 546  GLU A OE2 1 
ATOM   3424 N  N   . TRP A 1 440 ? 35.067 -48.397 24.581  1.00 11.79 ? 547  TRP A N   1 
ATOM   3425 C  CA  . TRP A 1 440 ? 35.737 -48.401 23.280  1.00 14.49 ? 547  TRP A CA  1 
ATOM   3426 C  C   . TRP A 1 440 ? 36.890 -49.403 23.307  1.00 13.21 ? 547  TRP A C   1 
ATOM   3427 O  O   . TRP A 1 440 ? 37.557 -49.559 24.332  1.00 15.21 ? 547  TRP A O   1 
ATOM   3428 C  CB  . TRP A 1 440 ? 36.266 -46.999 22.929  1.00 10.50 ? 547  TRP A CB  1 
ATOM   3429 C  CG  . TRP A 1 440 ? 35.184 -46.020 22.589  1.00 11.67 ? 547  TRP A CG  1 
ATOM   3430 C  CD1 . TRP A 1 440 ? 34.405 -45.316 23.468  1.00 13.35 ? 547  TRP A CD1 1 
ATOM   3431 C  CD2 . TRP A 1 440 ? 34.763 -45.623 21.274  1.00 12.67 ? 547  TRP A CD2 1 
ATOM   3432 N  NE1 . TRP A 1 440 ? 33.523 -44.513 22.778  1.00 13.26 ? 547  TRP A NE1 1 
ATOM   3433 C  CE2 . TRP A 1 440 ? 33.730 -44.676 21.431  1.00 12.09 ? 547  TRP A CE2 1 
ATOM   3434 C  CE3 . TRP A 1 440 ? 35.166 -45.978 19.977  1.00 11.58 ? 547  TRP A CE3 1 
ATOM   3435 C  CZ2 . TRP A 1 440 ? 33.078 -44.089 20.345  1.00 12.65 ? 547  TRP A CZ2 1 
ATOM   3436 C  CZ3 . TRP A 1 440 ? 34.522 -45.394 18.898  1.00 12.93 ? 547  TRP A CZ3 1 
ATOM   3437 C  CH2 . TRP A 1 440 ? 33.487 -44.463 19.085  1.00 14.89 ? 547  TRP A CH2 1 
ATOM   3438 N  N   . VAL A 1 441 ? 37.139 -50.072 22.187  1.00 12.60 ? 548  VAL A N   1 
ATOM   3439 C  CA  . VAL A 1 441 ? 38.252 -51.014 22.108  1.00 12.90 ? 548  VAL A CA  1 
ATOM   3440 C  C   . VAL A 1 441 ? 39.153 -50.692 20.919  1.00 13.09 ? 548  VAL A C   1 
ATOM   3441 O  O   . VAL A 1 441 ? 38.679 -50.616 19.796  1.00 12.62 ? 548  VAL A O   1 
ATOM   3442 C  CB  . VAL A 1 441 ? 37.757 -52.474 21.983  1.00 15.69 ? 548  VAL A CB  1 
ATOM   3443 C  CG1 . VAL A 1 441 ? 38.934 -53.429 22.032  1.00 15.36 ? 548  VAL A CG1 1 
ATOM   3444 C  CG2 . VAL A 1 441 ? 36.746 -52.808 23.097  1.00 15.23 ? 548  VAL A CG2 1 
ATOM   3445 N  N   . LEU A 1 442 ? 40.441 -50.489 21.176  1.00 12.74 ? 549  LEU A N   1 
ATOM   3446 C  CA  . LEU A 1 442 ? 41.424 -50.339 20.099  1.00 11.42 ? 549  LEU A CA  1 
ATOM   3447 C  C   . LEU A 1 442 ? 42.192 -51.639 19.956  1.00 14.15 ? 549  LEU A C   1 
ATOM   3448 O  O   . LEU A 1 442 ? 42.687 -52.170 20.942  1.00 15.53 ? 549  LEU A O   1 
ATOM   3449 C  CB  . LEU A 1 442 ? 42.400 -49.193 20.381  1.00 10.73 ? 549  LEU A CB  1 
ATOM   3450 C  CG  . LEU A 1 442 ? 43.430 -48.925 19.272  1.00 13.50 ? 549  LEU A CG  1 
ATOM   3451 C  CD1 . LEU A 1 442 ? 42.760 -48.244 18.064  1.00 11.35 ? 549  LEU A CD1 1 
ATOM   3452 C  CD2 . LEU A 1 442 ? 44.585 -48.082 19.804  1.00 13.47 ? 549  LEU A CD2 1 
ATOM   3453 N  N   . GLU A 1 443 ? 42.285 -52.140 18.728  1.00 13.15 ? 550  GLU A N   1 
ATOM   3454 C  CA  . GLU A 1 443 ? 43.027 -53.358 18.428  1.00 13.39 ? 550  GLU A CA  1 
ATOM   3455 C  C   . GLU A 1 443 ? 44.146 -53.035 17.450  1.00 15.88 ? 550  GLU A C   1 
ATOM   3456 O  O   . GLU A 1 443 ? 43.898 -52.443 16.400  1.00 15.70 ? 550  GLU A O   1 
ATOM   3457 C  CB  . GLU A 1 443 ? 42.084 -54.426 17.851  1.00 17.08 ? 550  GLU A CB  1 
ATOM   3458 C  CG  . GLU A 1 443 ? 40.980 -54.829 18.840  1.00 25.65 ? 550  GLU A CG  1 
ATOM   3459 C  CD  . GLU A 1 443 ? 39.740 -55.449 18.191  1.00 33.56 ? 550  GLU A CD  1 
ATOM   3460 O  OE1 . GLU A 1 443 ? 38.972 -56.109 18.923  1.00 32.75 ? 550  GLU A OE1 1 
ATOM   3461 O  OE2 . GLU A 1 443 ? 39.515 -55.271 16.973  1.00 30.00 ? 550  GLU A OE2 1 
ATOM   3462 N  N   . ILE A 1 444 ? 45.376 -53.390 17.813  1.00 13.05 ? 551  ILE A N   1 
ATOM   3463 C  CA  . ILE A 1 444 ? 46.525 -53.261 16.916  1.00 13.62 ? 551  ILE A CA  1 
ATOM   3464 C  C   . ILE A 1 444 ? 47.167 -54.632 16.763  1.00 15.93 ? 551  ILE A C   1 
ATOM   3465 O  O   . ILE A 1 444 ? 47.547 -55.253 17.756  1.00 16.88 ? 551  ILE A O   1 
ATOM   3466 C  CB  . ILE A 1 444 ? 47.569 -52.261 17.449  1.00 16.61 ? 551  ILE A CB  1 
ATOM   3467 C  CG1 . ILE A 1 444 ? 46.947 -50.878 17.628  1.00 13.98 ? 551  ILE A CG1 1 
ATOM   3468 C  CG2 . ILE A 1 444 ? 48.774 -52.182 16.501  1.00 15.34 ? 551  ILE A CG2 1 
ATOM   3469 C  CD1 . ILE A 1 444 ? 47.878 -49.873 18.339  1.00 15.04 ? 551  ILE A CD1 1 
ATOM   3470 N  N   A GLU A 1 445 ? 47.285 -55.122 15.536  0.50 15.19 ? 552  GLU A N   1 
ATOM   3471 N  N   B GLU A 1 445 ? 47.288 -55.093 15.518  0.50 15.17 ? 552  GLU A N   1 
ATOM   3472 C  CA  A GLU A 1 445 ? 47.876 -56.440 15.366  0.50 17.40 ? 552  GLU A CA  1 
ATOM   3473 C  CA  B GLU A 1 445 ? 47.769 -56.443 15.231  0.50 17.53 ? 552  GLU A CA  1 
ATOM   3474 C  C   A GLU A 1 445 ? 48.882 -56.505 14.232  0.50 17.46 ? 552  GLU A C   1 
ATOM   3475 C  C   B GLU A 1 445 ? 48.912 -56.466 14.218  0.50 17.46 ? 552  GLU A C   1 
ATOM   3476 O  O   A GLU A 1 445 ? 48.782 -55.800 13.222  0.50 16.28 ? 552  GLU A O   1 
ATOM   3477 O  O   B GLU A 1 445 ? 48.923 -55.693 13.254  0.50 16.03 ? 552  GLU A O   1 
ATOM   3478 C  CB  A GLU A 1 445 ? 46.787 -57.497 15.156  0.50 20.56 ? 552  GLU A CB  1 
ATOM   3479 C  CB  B GLU A 1 445 ? 46.622 -57.314 14.703  0.50 19.04 ? 552  GLU A CB  1 
ATOM   3480 C  CG  A GLU A 1 445 ? 46.100 -57.456 13.812  0.50 21.43 ? 552  GLU A CG  1 
ATOM   3481 C  CG  B GLU A 1 445 ? 45.370 -57.317 15.569  0.50 22.40 ? 552  GLU A CG  1 
ATOM   3482 C  CD  A GLU A 1 445 ? 44.863 -58.342 13.771  0.50 32.76 ? 552  GLU A CD  1 
ATOM   3483 C  CD  B GLU A 1 445 ? 44.144 -57.807 14.817  0.50 30.37 ? 552  GLU A CD  1 
ATOM   3484 O  OE1 A GLU A 1 445 ? 45.002 -59.579 13.901  0.50 33.34 ? 552  GLU A OE1 1 
ATOM   3485 O  OE1 B GLU A 1 445 ? 44.289 -58.222 13.647  0.00 30.19 ? 552  GLU A OE1 1 
ATOM   3486 O  OE2 A GLU A 1 445 ? 43.749 -57.796 13.620  0.50 30.08 ? 552  GLU A OE2 1 
ATOM   3487 O  OE2 B GLU A 1 445 ? 43.035 -57.763 15.389  0.00 29.85 ? 552  GLU A OE2 1 
ATOM   3488 N  N   . ASN A 1 446 ? 49.865 -57.366 14.441  1.00 13.89 ? 553  ASN A N   1 
ATOM   3489 C  CA  . ASN A 1 446 ? 50.867 -57.680 13.447  1.00 19.90 ? 553  ASN A CA  1 
ATOM   3490 C  C   . ASN A 1 446 ? 50.273 -58.740 12.513  1.00 20.31 ? 553  ASN A C   1 
ATOM   3491 O  O   . ASN A 1 446 ? 50.041 -59.877 12.934  1.00 20.97 ? 553  ASN A O   1 
ATOM   3492 C  CB  . ASN A 1 446 ? 52.143 -58.179 14.132  1.00 20.25 ? 553  ASN A CB  1 
ATOM   3493 C  CG  . ASN A 1 446 ? 53.198 -58.617 13.144  1.00 20.97 ? 553  ASN A CG  1 
ATOM   3494 O  OD1 . ASN A 1 446 ? 53.118 -58.297 11.959  1.00 16.08 ? 553  ASN A OD1 1 
ATOM   3495 N  ND2 . ASN A 1 446 ? 54.198 -59.352 13.627  1.00 20.74 ? 553  ASN A ND2 1 
ATOM   3496 N  N   . THR A 1 447 ? 49.992 -58.366 11.265  1.00 18.93 ? 554  THR A N   1 
ATOM   3497 C  CA  . THR A 1 447 ? 49.337 -59.291 10.337  1.00 18.26 ? 554  THR A CA  1 
ATOM   3498 C  C   . THR A 1 447 ? 50.341 -60.228 9.668   1.00 20.00 ? 554  THR A C   1 
ATOM   3499 O  O   . THR A 1 447 ? 49.957 -61.118 8.913   1.00 21.58 ? 554  THR A O   1 
ATOM   3500 C  CB  . THR A 1 447 ? 48.553 -58.562 9.220   1.00 19.79 ? 554  THR A CB  1 
ATOM   3501 O  OG1 . THR A 1 447 ? 49.458 -57.799 8.415   1.00 16.04 ? 554  THR A OG1 1 
ATOM   3502 C  CG2 . THR A 1 447 ? 47.484 -57.647 9.806   1.00 20.65 ? 554  THR A CG2 1 
ATOM   3503 N  N   . SER A 1 448 ? 51.624 -60.022 9.931   1.00 20.17 ? 555  SER A N   1 
ATOM   3504 C  CA  . SER A 1 448 ? 52.647 -60.850 9.301   1.00 21.06 ? 555  SER A CA  1 
ATOM   3505 C  C   . SER A 1 448 ? 53.195 -61.882 10.271  1.00 24.39 ? 555  SER A C   1 
ATOM   3506 O  O   . SER A 1 448 ? 52.909 -61.838 11.463  1.00 22.87 ? 555  SER A O   1 
ATOM   3507 C  CB  . SER A 1 448 ? 53.793 -59.995 8.768   1.00 23.57 ? 555  SER A CB  1 
ATOM   3508 O  OG  . SER A 1 448 ? 54.640 -59.597 9.829   1.00 35.86 ? 555  SER A OG  1 
ATOM   3509 N  N   . GLU A 1 449 ? 54.001 -62.797 9.741   1.00 25.54 ? 556  GLU A N   1 
ATOM   3510 C  CA  . GLU A 1 449 ? 54.645 -63.836 10.531  1.00 31.82 ? 556  GLU A CA  1 
ATOM   3511 C  C   . GLU A 1 449 ? 55.944 -63.347 11.161  1.00 31.32 ? 556  GLU A C   1 
ATOM   3512 O  O   . GLU A 1 449 ? 56.529 -64.026 12.004  1.00 29.46 ? 556  GLU A O   1 
ATOM   3513 C  CB  . GLU A 1 449 ? 54.923 -65.059 9.654   1.00 37.99 ? 556  GLU A CB  1 
ATOM   3514 C  CG  . GLU A 1 449 ? 54.578 -66.367 10.319  1.00 55.77 ? 556  GLU A CG  1 
ATOM   3515 C  CD  . GLU A 1 449 ? 53.116 -66.438 10.699  1.00 57.60 ? 556  GLU A CD  1 
ATOM   3516 O  OE1 . GLU A 1 449 ? 52.272 -66.026 9.874   1.00 65.94 ? 556  GLU A OE1 1 
ATOM   3517 O  OE2 . GLU A 1 449 ? 52.812 -66.896 11.821  1.00 55.29 ? 556  GLU A OE2 1 
ATOM   3518 N  N   . ALA A 1 450 ? 56.391 -62.166 10.744  1.00 24.81 ? 557  ALA A N   1 
ATOM   3519 C  CA  . ALA A 1 450 ? 57.667 -61.629 11.196  1.00 27.16 ? 557  ALA A CA  1 
ATOM   3520 C  C   . ALA A 1 450 ? 57.638 -61.233 12.664  1.00 31.21 ? 557  ALA A C   1 
ATOM   3521 O  O   . ALA A 1 450 ? 56.592 -60.875 13.214  1.00 25.02 ? 557  ALA A O   1 
ATOM   3522 C  CB  . ALA A 1 450 ? 58.070 -60.435 10.339  1.00 26.37 ? 557  ALA A CB  1 
ATOM   3523 N  N   . ASN A 1 451 ? 58.802 -61.289 13.296  1.00 25.16 ? 558  ASN A N   1 
ATOM   3524 C  CA  . ASN A 1 451 ? 58.914 -60.871 14.680  1.00 29.42 ? 558  ASN A CA  1 
ATOM   3525 C  C   . ASN A 1 451 ? 59.079 -59.362 14.739  1.00 27.82 ? 558  ASN A C   1 
ATOM   3526 O  O   . ASN A 1 451 ? 60.188 -58.849 14.849  1.00 31.09 ? 558  ASN A O   1 
ATOM   3527 C  CB  . ASN A 1 451 ? 60.084 -61.576 15.368  1.00 29.47 ? 558  ASN A CB  1 
ATOM   3528 C  CG  . ASN A 1 451 ? 59.949 -63.083 15.337  1.00 38.90 ? 558  ASN A CG  1 
ATOM   3529 O  OD1 . ASN A 1 451 ? 60.889 -63.795 14.984  0.00 34.74 ? 558  ASN A OD1 1 
ATOM   3530 N  ND2 . ASN A 1 451 ? 58.766 -63.580 15.698  1.00 43.51 ? 558  ASN A ND2 1 
ATOM   3531 N  N   . ASN A 1 452 ? 57.964 -58.653 14.636  1.00 24.08 ? 559  ASN A N   1 
ATOM   3532 C  CA  . ASN A 1 452 ? 57.992 -57.197 14.622  1.00 25.40 ? 559  ASN A CA  1 
ATOM   3533 C  C   . ASN A 1 452 ? 57.903 -56.645 16.036  1.00 25.66 ? 559  ASN A C   1 
ATOM   3534 O  O   . ASN A 1 452 ? 57.589 -57.380 16.972  1.00 27.17 ? 559  ASN A O   1 
ATOM   3535 C  CB  . ASN A 1 452 ? 56.853 -56.658 13.758  1.00 20.35 ? 559  ASN A CB  1 
ATOM   3536 C  CG  . ASN A 1 452 ? 57.027 -56.999 12.295  1.00 21.70 ? 559  ASN A CG  1 
ATOM   3537 O  OD1 . ASN A 1 452 ? 58.150 -57.169 11.817  1.00 24.74 ? 559  ASN A OD1 1 
ATOM   3538 N  ND2 . ASN A 1 452 ? 55.916 -57.084 11.568  1.00 21.63 ? 559  ASN A ND2 1 
ATOM   3539 N  N   . TYR A 1 453 ? 58.180 -55.355 16.197  1.00 20.10 ? 560  TYR A N   1 
ATOM   3540 C  CA  . TYR A 1 453 ? 58.211 -54.761 17.529  1.00 20.46 ? 560  TYR A CA  1 
ATOM   3541 C  C   . TYR A 1 453 ? 57.935 -53.265 17.479  1.00 21.37 ? 560  TYR A C   1 
ATOM   3542 O  O   . TYR A 1 453 ? 58.254 -52.591 16.497  1.00 20.28 ? 560  TYR A O   1 
ATOM   3543 C  CB  . TYR A 1 453 ? 59.567 -55.014 18.195  1.00 22.89 ? 560  TYR A CB  1 
ATOM   3544 C  CG  . TYR A 1 453 ? 60.723 -54.516 17.356  1.00 25.77 ? 560  TYR A CG  1 
ATOM   3545 C  CD1 . TYR A 1 453 ? 61.302 -55.324 16.388  1.00 27.86 ? 560  TYR A CD1 1 
ATOM   3546 C  CD2 . TYR A 1 453 ? 61.219 -53.230 17.519  1.00 29.36 ? 560  TYR A CD2 1 
ATOM   3547 C  CE1 . TYR A 1 453 ? 62.346 -54.867 15.610  1.00 28.62 ? 560  TYR A CE1 1 
ATOM   3548 C  CE2 . TYR A 1 453 ? 62.257 -52.764 16.745  1.00 31.85 ? 560  TYR A CE2 1 
ATOM   3549 C  CZ  . TYR A 1 453 ? 62.818 -53.586 15.794  1.00 33.50 ? 560  TYR A CZ  1 
ATOM   3550 O  OH  . TYR A 1 453 ? 63.858 -53.125 15.023  1.00 38.95 ? 560  TYR A OH  1 
ATOM   3551 N  N   . GLY A 1 454 ? 57.353 -52.748 18.551  1.00 18.64 ? 561  GLY A N   1 
ATOM   3552 C  CA  . GLY A 1 454 ? 57.077 -51.327 18.641  1.00 17.52 ? 561  GLY A CA  1 
ATOM   3553 C  C   . GLY A 1 454 ? 56.249 -51.017 19.868  1.00 17.27 ? 561  GLY A C   1 
ATOM   3554 O  O   . GLY A 1 454 ? 55.885 -51.919 20.621  1.00 19.67 ? 561  GLY A O   1 
ATOM   3555 N  N   . THR A 1 455 ? 55.953 -49.734 20.056  1.00 17.92 ? 562  THR A N   1 
ATOM   3556 C  CA  . THR A 1 455 ? 55.275 -49.248 21.255  1.00 17.94 ? 562  THR A CA  1 
ATOM   3557 C  C   . THR A 1 455 ? 54.219 -48.211 20.906  1.00 17.07 ? 562  THR A C   1 
ATOM   3558 O  O   . THR A 1 455 ? 54.483 -47.306 20.123  1.00 17.00 ? 562  THR A O   1 
ATOM   3559 C  CB  . THR A 1 455 ? 56.287 -48.614 22.227  1.00 19.98 ? 562  THR A CB  1 
ATOM   3560 O  OG1 . THR A 1 455 ? 57.341 -49.548 22.476  1.00 23.21 ? 562  THR A OG1 1 
ATOM   3561 C  CG2 . THR A 1 455 ? 55.624 -48.217 23.541  1.00 18.69 ? 562  THR A CG2 1 
ATOM   3562 N  N   . LEU A 1 456 ? 53.027 -48.351 21.481  1.00 15.73 ? 563  LEU A N   1 
ATOM   3563 C  CA  . LEU A 1 456 ? 52.012 -47.304 21.409  1.00 16.82 ? 563  LEU A CA  1 
ATOM   3564 C  C   . LEU A 1 456 ? 52.220 -46.331 22.576  1.00 16.55 ? 563  LEU A C   1 
ATOM   3565 O  O   . LEU A 1 456 ? 52.147 -46.737 23.740  1.00 20.19 ? 563  LEU A O   1 
ATOM   3566 C  CB  . LEU A 1 456 ? 50.611 -47.908 21.463  1.00 12.88 ? 563  LEU A CB  1 
ATOM   3567 C  CG  . LEU A 1 456 ? 49.426 -46.941 21.449  1.00 15.88 ? 563  LEU A CG  1 
ATOM   3568 C  CD1 . LEU A 1 456 ? 49.293 -46.269 20.079  1.00 14.94 ? 563  LEU A CD1 1 
ATOM   3569 C  CD2 . LEU A 1 456 ? 48.135 -47.688 21.825  1.00 14.11 ? 563  LEU A CD2 1 
ATOM   3570 N  N   . THR A 1 457 ? 52.481 -45.059 22.275  1.00 16.83 ? 564  THR A N   1 
ATOM   3571 C  CA  . THR A 1 457 ? 52.788 -44.097 23.335  1.00 16.32 ? 564  THR A CA  1 
ATOM   3572 C  C   . THR A 1 457 ? 51.678 -43.085 23.591  1.00 18.67 ? 564  THR A C   1 
ATOM   3573 O  O   . THR A 1 457 ? 51.667 -42.437 24.633  1.00 15.38 ? 564  THR A O   1 
ATOM   3574 C  CB  . THR A 1 457 ? 54.076 -43.310 23.040  1.00 19.61 ? 564  THR A CB  1 
ATOM   3575 O  OG1 . THR A 1 457 ? 53.951 -42.627 21.786  1.00 17.87 ? 564  THR A OG1 1 
ATOM   3576 C  CG2 . THR A 1 457 ? 55.275 -44.245 23.008  1.00 19.53 ? 564  THR A CG2 1 
ATOM   3577 N  N   . LYS A 1 458 ? 50.766 -42.921 22.637  1.00 14.12 ? 565  LYS A N   1 
ATOM   3578 C  CA  . LYS A 1 458 ? 49.626 -42.029 22.849  1.00 16.49 ? 565  LYS A CA  1 
ATOM   3579 C  C   . LYS A 1 458 ? 48.415 -42.492 22.054  1.00 16.50 ? 565  LYS A C   1 
ATOM   3580 O  O   . LYS A 1 458 ? 48.529 -42.861 20.887  1.00 15.10 ? 565  LYS A O   1 
ATOM   3581 C  CB  . LYS A 1 458 ? 49.965 -40.578 22.478  1.00 17.62 ? 565  LYS A CB  1 
ATOM   3582 C  CG  . LYS A 1 458 ? 48.923 -39.575 22.990  1.00 16.58 ? 565  LYS A CG  1 
ATOM   3583 C  CD  . LYS A 1 458 ? 49.134 -38.166 22.431  1.00 18.11 ? 565  LYS A CD  1 
ATOM   3584 C  CE  . LYS A 1 458 ? 50.376 -37.484 22.993  1.00 29.15 ? 565  LYS A CE  1 
ATOM   3585 N  NZ  . LYS A 1 458 ? 50.639 -36.196 22.250  1.00 29.17 ? 565  LYS A NZ  1 
ATOM   3586 N  N   . PHE A 1 459 ? 47.259 -42.455 22.708  1.00 13.34 ? 566  PHE A N   1 
ATOM   3587 C  CA  . PHE A 1 459 ? 45.976 -42.778 22.096  1.00 15.66 ? 566  PHE A CA  1 
ATOM   3588 C  C   . PHE A 1 459 ? 44.978 -41.749 22.619  1.00 14.45 ? 566  PHE A C   1 
ATOM   3589 O  O   . PHE A 1 459 ? 44.531 -41.826 23.757  1.00 14.82 ? 566  PHE A O   1 
ATOM   3590 C  CB  . PHE A 1 459 ? 45.570 -44.224 22.437  1.00 13.01 ? 566  PHE A CB  1 
ATOM   3591 C  CG  . PHE A 1 459 ? 44.144 -44.609 22.050  1.00 13.67 ? 566  PHE A CG  1 
ATOM   3592 C  CD1 . PHE A 1 459 ? 43.401 -43.875 21.131  1.00 12.14 ? 566  PHE A CD1 1 
ATOM   3593 C  CD2 . PHE A 1 459 ? 43.548 -45.715 22.652  1.00 13.62 ? 566  PHE A CD2 1 
ATOM   3594 C  CE1 . PHE A 1 459 ? 42.093 -44.252 20.810  1.00 16.30 ? 566  PHE A CE1 1 
ATOM   3595 C  CE2 . PHE A 1 459 ? 42.254 -46.099 22.336  1.00 13.84 ? 566  PHE A CE2 1 
ATOM   3596 C  CZ  . PHE A 1 459 ? 41.527 -45.375 21.414  1.00 15.56 ? 566  PHE A CZ  1 
ATOM   3597 N  N   . THR A 1 460 ? 44.661 -40.769 21.781  1.00 12.02 ? 567  THR A N   1 
ATOM   3598 C  CA  . THR A 1 460 ? 43.625 -39.800 22.102  1.00 13.59 ? 567  THR A CA  1 
ATOM   3599 C  C   . THR A 1 460 ? 42.361 -40.145 21.338  1.00 13.64 ? 567  THR A C   1 
ATOM   3600 O  O   . THR A 1 460 ? 42.368 -40.188 20.109  1.00 13.06 ? 567  THR A O   1 
ATOM   3601 C  CB  . THR A 1 460 ? 44.027 -38.364 21.723  1.00 13.49 ? 567  THR A CB  1 
ATOM   3602 O  OG1 . THR A 1 460 ? 45.363 -38.108 22.161  1.00 16.96 ? 567  THR A OG1 1 
ATOM   3603 C  CG2 . THR A 1 460 ? 43.071 -37.363 22.365  1.00 15.20 ? 567  THR A CG2 1 
ATOM   3604 N  N   . LEU A 1 461 ? 41.276 -40.390 22.058  1.00 12.99 ? 568  LEU A N   1 
ATOM   3605 C  CA  . LEU A 1 461 ? 39.996 -40.596 21.401  1.00 12.78 ? 568  LEU A CA  1 
ATOM   3606 C  C   . LEU A 1 461 ? 39.333 -39.234 21.298  1.00 12.71 ? 568  LEU A C   1 
ATOM   3607 O  O   . LEU A 1 461 ? 39.063 -38.595 22.308  1.00 13.43 ? 568  LEU A O   1 
ATOM   3608 C  CB  . LEU A 1 461 ? 39.124 -41.595 22.174  1.00 13.74 ? 568  LEU A CB  1 
ATOM   3609 C  CG  . LEU A 1 461 ? 37.762 -41.945 21.567  1.00 11.62 ? 568  LEU A CG  1 
ATOM   3610 C  CD1 . LEU A 1 461 ? 37.949 -42.706 20.265  1.00 11.56 ? 568  LEU A CD1 1 
ATOM   3611 C  CD2 . LEU A 1 461 ? 36.920 -42.761 22.563  1.00 13.68 ? 568  LEU A CD2 1 
ATOM   3612 N  N   . VAL A 1 462 ? 39.102 -38.769 20.076  1.00 11.56 ? 569  VAL A N   1 
ATOM   3613 C  CA  . VAL A 1 462 ? 38.450 -37.486 19.886  1.00 10.55 ? 569  VAL A CA  1 
ATOM   3614 C  C   . VAL A 1 462 ? 37.068 -37.715 19.288  1.00 12.32 ? 569  VAL A C   1 
ATOM   3615 O  O   . VAL A 1 462 ? 36.930 -38.290 18.210  1.00 13.14 ? 569  VAL A O   1 
ATOM   3616 C  CB  . VAL A 1 462 ? 39.284 -36.555 18.979  1.00 13.23 ? 569  VAL A CB  1 
ATOM   3617 C  CG1 . VAL A 1 462 ? 38.586 -35.201 18.815  1.00 13.96 ? 569  VAL A CG1 1 
ATOM   3618 C  CG2 . VAL A 1 462 ? 40.692 -36.361 19.560  1.00 14.07 ? 569  VAL A CG2 1 
ATOM   3619 N  N   . LEU A 1 463 ? 36.050 -37.271 20.007  1.00 11.34 ? 570  LEU A N   1 
ATOM   3620 C  CA  . LEU A 1 463 ? 34.670 -37.448 19.589  1.00 13.04 ? 570  LEU A CA  1 
ATOM   3621 C  C   . LEU A 1 463 ? 34.089 -36.107 19.157  1.00 13.12 ? 570  LEU A C   1 
ATOM   3622 O  O   . LEU A 1 463 ? 34.250 -35.107 19.855  1.00 14.81 ? 570  LEU A O   1 
ATOM   3623 C  CB  . LEU A 1 463 ? 33.837 -38.038 20.731  1.00 12.08 ? 570  LEU A CB  1 
ATOM   3624 C  CG  . LEU A 1 463 ? 34.414 -39.277 21.429  1.00 11.67 ? 570  LEU A CG  1 
ATOM   3625 C  CD1 . LEU A 1 463 ? 33.573 -39.626 22.650  1.00 16.22 ? 570  LEU A CD1 1 
ATOM   3626 C  CD2 . LEU A 1 463 ? 34.468 -40.444 20.452  1.00 16.54 ? 570  LEU A CD2 1 
ATOM   3627 N  N   . TYR A 1 464 ? 33.427 -36.088 18.006  1.00 9.94  ? 571  TYR A N   1 
ATOM   3628 C  CA  . TYR A 1 464 ? 32.692 -34.911 17.577  1.00 11.01 ? 571  TYR A CA  1 
ATOM   3629 C  C   . TYR A 1 464 ? 31.208 -35.235 17.539  1.00 10.72 ? 571  TYR A C   1 
ATOM   3630 O  O   . TYR A 1 464 ? 30.833 -36.377 17.287  1.00 13.59 ? 571  TYR A O   1 
ATOM   3631 C  CB  . TYR A 1 464 ? 33.140 -34.459 16.192  1.00 9.97  ? 571  TYR A CB  1 
ATOM   3632 C  CG  . TYR A 1 464 ? 34.555 -33.945 16.099  1.00 12.01 ? 571  TYR A CG  1 
ATOM   3633 C  CD1 . TYR A 1 464 ? 34.850 -32.617 16.410  1.00 14.00 ? 571  TYR A CD1 1 
ATOM   3634 C  CD2 . TYR A 1 464 ? 35.592 -34.771 15.672  1.00 12.29 ? 571  TYR A CD2 1 
ATOM   3635 C  CE1 . TYR A 1 464 ? 36.153 -32.125 16.302  1.00 12.67 ? 571  TYR A CE1 1 
ATOM   3636 C  CE2 . TYR A 1 464 ? 36.899 -34.290 15.554  1.00 10.47 ? 571  TYR A CE2 1 
ATOM   3637 C  CZ  . TYR A 1 464 ? 37.165 -32.970 15.873  1.00 14.56 ? 571  TYR A CZ  1 
ATOM   3638 O  OH  . TYR A 1 464 ? 38.446 -32.478 15.750  1.00 15.29 ? 571  TYR A OH  1 
ATOM   3639 N  N   . GLY A 1 465 ? 30.361 -34.240 17.769  1.00 12.53 ? 572  GLY A N   1 
ATOM   3640 C  CA  . GLY A 1 465 ? 28.924 -34.471 17.664  1.00 10.23 ? 572  GLY A CA  1 
ATOM   3641 C  C   . GLY A 1 465 ? 28.082 -33.529 18.507  1.00 13.49 ? 572  GLY A C   1 
ATOM   3642 O  O   . GLY A 1 465 ? 28.486 -32.405 18.802  1.00 12.94 ? 572  GLY A O   1 
ATOM   3643 N  N   . THR A 1 466 ? 26.885 -33.984 18.876  1.00 13.18 ? 573  THR A N   1 
ATOM   3644 C  CA  . THR A 1 466 ? 25.935 -33.139 19.580  1.00 10.64 ? 573  THR A CA  1 
ATOM   3645 C  C   . THR A 1 466 ? 25.272 -33.937 20.691  1.00 12.70 ? 573  THR A C   1 
ATOM   3646 O  O   . THR A 1 466 ? 25.653 -35.067 20.951  1.00 12.52 ? 573  THR A O   1 
ATOM   3647 C  CB  . THR A 1 466 ? 24.849 -32.574 18.631  1.00 12.29 ? 573  THR A CB  1 
ATOM   3648 O  OG1 . THR A 1 466 ? 24.097 -33.657 18.064  1.00 15.01 ? 573  THR A OG1 1 
ATOM   3649 C  CG2 . THR A 1 466 ? 25.488 -31.772 17.489  1.00 13.26 ? 573  THR A CG2 1 
ATOM   3650 N  N   . ALA A 1 467 ? 24.280 -33.338 21.342  1.00 14.51 ? 574  ALA A N   1 
ATOM   3651 C  CA  . ALA A 1 467 ? 23.527 -34.038 22.376  1.00 13.93 ? 574  ALA A CA  1 
ATOM   3652 C  C   . ALA A 1 467 ? 22.019 -33.837 22.188  1.00 19.65 ? 574  ALA A C   1 
ATOM   3653 O  O   . ALA A 1 467 ? 21.275 -33.755 23.157  1.00 21.86 ? 574  ALA A O   1 
ATOM   3654 C  CB  . ALA A 1 467 ? 23.958 -33.569 23.750  1.00 16.39 ? 574  ALA A CB  1 
ATOM   3655 N  N   . SER A 1 468 ? 21.569 -33.762 20.941  1.00 19.80 ? 575  SER A N   1 
ATOM   3656 C  CA  . SER A 1 468 ? 20.149 -33.542 20.671  1.00 26.69 ? 575  SER A CA  1 
ATOM   3657 C  C   . SER A 1 468 ? 19.755 -33.918 19.252  1.00 32.95 ? 575  SER A C   1 
ATOM   3658 O  O   . SER A 1 468 ? 20.604 -33.967 18.359  1.00 27.89 ? 575  SER A O   1 
ATOM   3659 C  CB  . SER A 1 468 ? 19.784 -32.078 20.916  1.00 32.29 ? 575  SER A CB  1 
ATOM   3660 O  OG  . SER A 1 468 ? 20.449 -31.237 19.983  1.00 31.06 ? 575  SER A OG  1 
ATOM   3661 N  N   . GLY A 1 469 ? 18.464 -34.186 19.057  1.00 31.47 ? 576  GLY A N   1 
ATOM   3662 C  CA  . GLY A 1 469 ? 17.888 -34.325 17.727  1.00 27.50 ? 576  GLY A CA  1 
ATOM   3663 C  C   . GLY A 1 469 ? 17.961 -35.684 17.057  1.00 28.60 ? 576  GLY A C   1 
ATOM   3664 O  O   . GLY A 1 469 ? 17.849 -35.777 15.832  1.00 31.53 ? 576  GLY A O   1 
ATOM   3665 N  N   . SER A 1 470 ? 18.127 -36.747 17.837  1.00 28.52 ? 577  SER A N   1 
ATOM   3666 C  CA  . SER A 1 470 ? 18.249 -38.079 17.244  1.00 29.25 ? 577  SER A CA  1 
ATOM   3667 C  C   . SER A 1 470 ? 16.952 -38.580 16.611  1.00 28.88 ? 577  SER A C   1 
ATOM   3668 O  O   . SER A 1 470 ? 15.857 -38.257 17.076  1.00 30.48 ? 577  SER A O   1 
ATOM   3669 C  CB  . SER A 1 470 ? 18.718 -39.091 18.287  1.00 30.46 ? 577  SER A CB  1 
ATOM   3670 O  OG  . SER A 1 470 ? 20.073 -38.868 18.642  1.00 29.31 ? 577  SER A OG  1 
ATOM   3671 N  N   . LEU A 1 471 ? 17.104 -39.369 15.548  1.00 28.04 ? 578  LEU A N   1 
ATOM   3672 C  CA  . LEU A 1 471 ? 16.010 -40.108 14.918  1.00 30.45 ? 578  LEU A CA  1 
ATOM   3673 C  C   . LEU A 1 471 ? 15.867 -41.480 15.551  1.00 28.52 ? 578  LEU A C   1 
ATOM   3674 O  O   . LEU A 1 471 ? 16.814 -41.995 16.145  1.00 24.75 ? 578  LEU A O   1 
ATOM   3675 C  CB  . LEU A 1 471 ? 16.252 -40.303 13.412  1.00 28.94 ? 578  LEU A CB  1 
ATOM   3676 C  CG  . LEU A 1 471 ? 16.454 -39.109 12.487  1.00 36.32 ? 578  LEU A CG  1 
ATOM   3677 C  CD1 . LEU A 1 471 ? 16.481 -39.580 11.025  1.00 31.70 ? 578  LEU A CD1 1 
ATOM   3678 C  CD2 . LEU A 1 471 ? 15.364 -38.077 12.717  1.00 44.26 ? 578  LEU A CD2 1 
ATOM   3679 N  N   . VAL A 1 472 ? 14.697 -42.085 15.391  1.00 27.45 ? 579  VAL A N   1 
ATOM   3680 C  CA  . VAL A 1 472 ? 14.534 -43.498 15.708  1.00 31.17 ? 579  VAL A CA  1 
ATOM   3681 C  C   . VAL A 1 472 ? 15.455 -44.321 14.798  1.00 30.42 ? 579  VAL A C   1 
ATOM   3682 O  O   . VAL A 1 472 ? 15.463 -44.119 13.582  1.00 30.85 ? 579  VAL A O   1 
ATOM   3683 C  CB  . VAL A 1 472 ? 13.067 -43.940 15.533  1.00 28.24 ? 579  VAL A CB  1 
ATOM   3684 C  CG1 . VAL A 1 472 ? 12.920 -45.451 15.721  1.00 30.42 ? 579  VAL A CG1 1 
ATOM   3685 C  CG2 . VAL A 1 472 ? 12.164 -43.165 16.486  1.00 23.70 ? 579  VAL A CG2 1 
ATOM   3686 N  N   . PRO A 1 473 ? 16.245 -45.237 15.385  1.00 27.84 ? 580  PRO A N   1 
ATOM   3687 C  CA  . PRO A 1 473 ? 17.189 -46.064 14.619  1.00 32.22 ? 580  PRO A CA  1 
ATOM   3688 C  C   . PRO A 1 473 ? 16.538 -46.791 13.443  1.00 41.49 ? 580  PRO A C   1 
ATOM   3689 O  O   . PRO A 1 473 ? 15.374 -47.194 13.528  1.00 41.99 ? 580  PRO A O   1 
ATOM   3690 C  CB  . PRO A 1 473 ? 17.697 -47.069 15.654  1.00 31.70 ? 580  PRO A CB  1 
ATOM   3691 C  CG  . PRO A 1 473 ? 17.555 -46.370 16.948  1.00 29.82 ? 580  PRO A CG  1 
ATOM   3692 C  CD  . PRO A 1 473 ? 16.329 -45.508 16.832  1.00 29.96 ? 580  PRO A CD  1 
ATOM   3693 N  N   . ARG A 1 474 ? 17.300 -46.948 12.364  1.00 35.22 ? 581  ARG A N   1 
ATOM   3694 C  CA  . ARG A 1 474 ? 16.818 -47.557 11.129  1.00 37.59 ? 581  ARG A CA  1 
ATOM   3695 C  C   . ARG A 1 474 ? 16.481 -49.043 11.290  1.00 41.40 ? 581  ARG A C   1 
ATOM   3696 O  O   . ARG A 1 474 ? 16.992 -49.716 12.188  1.00 47.51 ? 581  ARG A O   1 
ATOM   3697 C  CB  . ARG A 1 474 ? 17.864 -47.372 10.026  1.00 33.99 ? 581  ARG A CB  1 
ATOM   3698 C  CG  . ARG A 1 474 ? 17.500 -48.018 8.693   1.00 32.76 ? 581  ARG A CG  1 
ATOM   3699 C  CD  . ARG A 1 474 ? 18.512 -47.651 7.619   1.00 32.56 ? 581  ARG A CD  1 
ATOM   3700 N  NE  . ARG A 1 474 ? 18.489 -46.220 7.317   1.00 38.70 ? 581  ARG A NE  1 
ATOM   3701 C  CZ  . ARG A 1 474 ? 19.365 -45.611 6.519   1.00 37.06 ? 581  ARG A CZ  1 
ATOM   3702 N  NH1 . ARG A 1 474 ? 19.277 -44.305 6.293   1.00 29.51 ? 581  ARG A NH1 1 
ATOM   3703 N  NH2 . ARG A 1 474 ? 20.336 -46.310 5.953   1.00 34.97 ? 581  ARG A NH2 1 
HETATM 3704 CA CA  . CA  B 2 .   ? 46.780 -18.786 -16.504 1.00 20.29 ? 601  CA  A CA  1 
HETATM 3705 CA CA  . CA  C 2 .   ? 25.552 -30.429 -23.363 1.00 19.51 ? 602  CA  A CA  1 
HETATM 3706 CA CA  . CA  D 2 .   ? 45.620 -43.357 -1.180  1.00 12.78 ? 603  CA  A CA  1 
HETATM 3707 NA NA  . NA  E 3 .   ? 36.765 -36.720 4.596   1.00 11.35 ? 604  NA  A NA  1 
HETATM 3708 NA NA  . NA  F 3 .   ? 51.832 -32.778 3.748   1.00 25.37 ? 605  NA  A NA  1 
HETATM 3709 NA NA  . NA  G 3 .   ? 52.810 -31.711 0.879   1.00 28.73 ? 606  NA  A NA  1 
HETATM 3710 NA NA  . NA  H 3 .   ? 30.586 -20.744 11.256  1.00 23.44 ? 607  NA  A NA  1 
HETATM 3711 NA NA  . NA  I 3 .   ? 26.964 -46.704 25.939  0.50 29.59 ? 608  NA  A NA  1 
HETATM 3712 NA NA  . NA  J 3 .   ? 31.610 -54.750 25.939  0.50 31.11 ? 609  NA  A NA  1 
HETATM 3713 NA NA  . NA  K 3 .   ? 53.478 -34.945 6.165   1.00 32.74 ? 610  NA  A NA  1 
HETATM 3714 NA NA  . NA  L 3 .   ? 26.286 -54.064 14.592  1.00 39.66 ? 611  NA  A NA  1 
HETATM 3715 CL CL  . CL  M 4 .   ? 38.775 -29.309 16.034  1.00 17.46 ? 612  CL  A CL  1 
HETATM 3716 O  O   . HOH N 5 .   ? 56.952 -54.995 20.837  1.00 16.77 ? 701  HOH A O   1 
HETATM 3717 O  O   . HOH N 5 .   ? 22.328 -48.642 -4.196  1.00 27.39 ? 702  HOH A O   1 
HETATM 3718 O  O   . HOH N 5 .   ? 52.117 -20.205 -3.640  1.00 27.34 ? 703  HOH A O   1 
HETATM 3719 O  O   . HOH N 5 .   ? 46.484 -33.260 -14.914 1.00 28.57 ? 704  HOH A O   1 
HETATM 3720 O  O   . HOH N 5 .   ? 18.035 -40.477 -12.733 1.00 40.65 ? 705  HOH A O   1 
HETATM 3721 O  O   . HOH N 5 .   ? 7.273  -28.962 4.269   1.00 53.26 ? 706  HOH A O   1 
HETATM 3722 O  O   . HOH N 5 .   ? 40.407 -47.997 7.224   1.00 21.03 ? 707  HOH A O   1 
HETATM 3723 O  O   . HOH N 5 .   ? 21.322 -48.502 5.649   1.00 21.43 ? 708  HOH A O   1 
HETATM 3724 O  O   . HOH N 5 .   ? 38.572 -16.767 -15.773 1.00 25.32 ? 709  HOH A O   1 
HETATM 3725 O  O   . HOH N 5 .   ? 11.274 -29.897 -18.440 1.00 44.04 ? 710  HOH A O   1 
HETATM 3726 O  O   . HOH N 5 .   ? 20.565 -25.788 8.188   1.00 24.19 ? 711  HOH A O   1 
HETATM 3727 O  O   . HOH N 5 .   ? 16.504 -18.859 5.276   1.00 43.95 ? 712  HOH A O   1 
HETATM 3728 O  O   . HOH N 5 .   ? 50.523 -36.008 -4.625  1.00 36.31 ? 713  HOH A O   1 
HETATM 3729 O  O   . HOH N 5 .   ? 42.709 -46.803 6.050   1.00 19.90 ? 714  HOH A O   1 
HETATM 3730 O  O   . HOH N 5 .   ? 53.834 -31.207 -9.488  1.00 37.13 ? 715  HOH A O   1 
HETATM 3731 O  O   . HOH N 5 .   ? 21.294 -40.238 16.973  1.00 27.74 ? 716  HOH A O   1 
HETATM 3732 O  O   . HOH N 5 .   ? 49.469 -62.784 12.119  1.00 42.13 ? 717  HOH A O   1 
HETATM 3733 O  O   . HOH N 5 .   ? 21.737 -39.228 -28.865 1.00 36.01 ? 718  HOH A O   1 
HETATM 3734 O  O   . HOH N 5 .   ? 21.755 -44.437 5.095   1.00 28.37 ? 719  HOH A O   1 
HETATM 3735 O  O   . HOH N 5 .   ? 34.302 -26.317 -30.942 1.00 46.50 ? 720  HOH A O   1 
HETATM 3736 O  O   . HOH N 5 .   ? 20.541 -34.153 12.666  1.00 46.81 ? 721  HOH A O   1 
HETATM 3737 O  O   . HOH N 5 .   ? 46.805 -60.810 12.655  1.00 46.78 ? 722  HOH A O   1 
HETATM 3738 O  O   . HOH N 5 .   ? 26.517 -57.338 -10.495 1.00 31.21 ? 723  HOH A O   1 
HETATM 3739 O  O   . HOH N 5 .   ? 41.902 -50.175 3.888   1.00 18.44 ? 724  HOH A O   1 
HETATM 3740 O  O   . HOH N 5 .   ? 57.778 -53.596 1.131   1.00 35.77 ? 725  HOH A O   1 
HETATM 3741 O  O   . HOH N 5 .   ? 43.620 -18.182 -21.930 1.00 38.06 ? 726  HOH A O   1 
HETATM 3742 O  O   . HOH N 5 .   ? 32.810 -21.450 0.701   1.00 17.21 ? 727  HOH A O   1 
HETATM 3743 O  O   . HOH N 5 .   ? 56.910 -58.613 7.346   1.00 29.57 ? 728  HOH A O   1 
HETATM 3744 O  O   . HOH N 5 .   ? 44.982 -38.168 -6.720  1.00 26.29 ? 729  HOH A O   1 
HETATM 3745 O  O   . HOH N 5 .   ? 18.519 -31.915 12.241  1.00 38.69 ? 730  HOH A O   1 
HETATM 3746 O  O   . HOH N 5 .   ? 59.407 -54.713 3.632   1.00 39.60 ? 731  HOH A O   1 
HETATM 3747 O  O   . HOH N 5 .   ? 31.327 -14.252 -10.829 1.00 31.60 ? 732  HOH A O   1 
HETATM 3748 O  O   . HOH N 5 .   ? 33.658 -17.855 12.745  1.00 29.51 ? 733  HOH A O   1 
HETATM 3749 O  O   . HOH N 5 .   ? 60.896 -51.795 7.893   1.00 29.52 ? 734  HOH A O   1 
HETATM 3750 O  O   . HOH N 5 .   ? 53.872 -57.824 4.894   1.00 48.60 ? 735  HOH A O   1 
HETATM 3751 O  O   . HOH N 5 .   ? 40.755 -53.786 -24.956 1.00 26.17 ? 736  HOH A O   1 
HETATM 3752 O  O   . HOH N 5 .   ? 28.790 -51.475 25.051  1.00 18.92 ? 737  HOH A O   1 
HETATM 3753 O  O   . HOH N 5 .   ? 56.231 -44.126 -4.747  1.00 40.33 ? 738  HOH A O   1 
HETATM 3754 O  O   . HOH N 5 .   ? 16.964 -24.982 -10.834 1.00 30.49 ? 739  HOH A O   1 
HETATM 3755 O  O   . HOH N 5 .   ? 17.707 -37.466 -24.365 1.00 38.15 ? 740  HOH A O   1 
HETATM 3756 O  O   . HOH N 5 .   ? 32.899 -35.367 32.393  1.00 28.48 ? 741  HOH A O   1 
HETATM 3757 O  O   . HOH N 5 .   ? 35.010 -40.027 -27.723 1.00 31.27 ? 742  HOH A O   1 
HETATM 3758 O  O   . HOH N 5 .   ? 38.207 -36.999 -26.188 1.00 23.01 ? 743  HOH A O   1 
HETATM 3759 O  O   . HOH N 5 .   ? 29.907 -59.187 -6.972  1.00 32.96 ? 744  HOH A O   1 
HETATM 3760 O  O   . HOH N 5 .   ? 45.594 -48.510 -7.932  1.00 23.08 ? 745  HOH A O   1 
HETATM 3761 O  O   . HOH N 5 .   ? 58.624 -43.586 5.761   1.00 45.30 ? 746  HOH A O   1 
HETATM 3762 O  O   . HOH N 5 .   ? 49.701 -28.893 2.782   1.00 13.63 ? 747  HOH A O   1 
HETATM 3763 O  O   . HOH N 5 .   ? 19.494 -40.245 14.967  1.00 34.02 ? 748  HOH A O   1 
HETATM 3764 O  O   . HOH N 5 .   ? 34.157 -49.531 -21.091 1.00 23.01 ? 749  HOH A O   1 
HETATM 3765 O  O   . HOH N 5 .   ? 28.858 -57.940 2.908   1.00 24.06 ? 750  HOH A O   1 
HETATM 3766 O  O   . HOH N 5 .   ? 49.038 -19.166 -17.456 1.00 24.75 ? 751  HOH A O   1 
HETATM 3767 O  O   . HOH N 5 .   ? 53.067 -30.290 -14.419 1.00 38.02 ? 752  HOH A O   1 
HETATM 3768 O  O   . HOH N 5 .   ? 49.153 -33.005 -1.776  1.00 25.50 ? 753  HOH A O   1 
HETATM 3769 O  O   . HOH N 5 .   ? 31.376 -59.375 -2.572  1.00 35.43 ? 754  HOH A O   1 
HETATM 3770 O  O   . HOH N 5 .   ? 54.115 -49.145 -4.237  1.00 29.41 ? 755  HOH A O   1 
HETATM 3771 O  O   . HOH N 5 .   ? 35.462 -56.009 25.549  1.00 30.24 ? 756  HOH A O   1 
HETATM 3772 O  O   . HOH N 5 .   ? 40.645 -17.172 1.846   1.00 23.83 ? 757  HOH A O   1 
HETATM 3773 O  O   . HOH N 5 .   ? 58.750 -46.182 14.395  1.00 19.88 ? 758  HOH A O   1 
HETATM 3774 O  O   . HOH N 5 .   ? 37.992 -41.382 2.742   1.00 13.26 ? 759  HOH A O   1 
HETATM 3775 O  O   . HOH N 5 .   ? 35.073 -53.679 1.262   1.00 31.34 ? 760  HOH A O   1 
HETATM 3776 O  O   . HOH N 5 .   ? 19.865 -51.485 7.765   1.00 41.77 ? 761  HOH A O   1 
HETATM 3777 O  O   . HOH N 5 .   ? 23.911 -31.885 -31.843 1.00 39.50 ? 762  HOH A O   1 
HETATM 3778 O  O   . HOH N 5 .   ? 52.702 -15.586 -14.509 1.00 43.00 ? 763  HOH A O   1 
HETATM 3779 O  O   . HOH N 5 .   ? 54.523 -22.218 -3.099  1.00 23.32 ? 764  HOH A O   1 
HETATM 3780 O  O   . HOH N 5 .   ? 30.689 -23.088 10.497  1.00 21.15 ? 765  HOH A O   1 
HETATM 3781 O  O   . HOH N 5 .   ? 38.249 -16.990 7.729   1.00 27.27 ? 766  HOH A O   1 
HETATM 3782 O  O   . HOH N 5 .   ? 48.776 -31.759 -14.735 1.00 46.11 ? 767  HOH A O   1 
HETATM 3783 O  O   . HOH N 5 .   ? 14.368 -48.712 15.442  1.00 36.51 ? 768  HOH A O   1 
HETATM 3784 O  O   . HOH N 5 .   ? 13.805 -32.707 6.261   1.00 30.89 ? 769  HOH A O   1 
HETATM 3785 O  O   . HOH N 5 .   ? 12.187 -31.872 3.560   1.00 35.61 ? 770  HOH A O   1 
HETATM 3786 O  O   . HOH N 5 .   ? 27.757 -26.787 24.611  1.00 30.02 ? 771  HOH A O   1 
HETATM 3787 O  O   . HOH N 5 .   ? 48.678 -45.860 -7.573  1.00 33.26 ? 772  HOH A O   1 
HETATM 3788 O  O   . HOH N 5 .   ? 38.147 -39.615 -25.059 1.00 23.49 ? 773  HOH A O   1 
HETATM 3789 O  O   . HOH N 5 .   ? 48.335 -34.756 13.939  1.00 29.26 ? 774  HOH A O   1 
HETATM 3790 O  O   . HOH N 5 .   ? 46.037 -34.272 18.357  1.00 14.52 ? 775  HOH A O   1 
HETATM 3791 O  O   . HOH N 5 .   ? 38.674 -15.422 -9.191  1.00 24.08 ? 776  HOH A O   1 
HETATM 3792 O  O   . HOH N 5 .   ? 20.579 -41.528 -19.451 1.00 36.84 ? 777  HOH A O   1 
HETATM 3793 O  O   . HOH N 5 .   ? 36.222 -28.987 13.871  1.00 23.63 ? 778  HOH A O   1 
HETATM 3794 O  O   . HOH N 5 .   ? 32.377 -30.325 -28.062 1.00 41.01 ? 779  HOH A O   1 
HETATM 3795 O  O   . HOH N 5 .   ? 41.194 -32.527 -8.261  1.00 22.25 ? 780  HOH A O   1 
HETATM 3796 O  O   . HOH N 5 .   ? 13.312 -34.805 -23.667 1.00 36.08 ? 781  HOH A O   1 
HETATM 3797 O  O   . HOH N 5 .   ? 23.400 -23.087 -18.723 1.00 35.17 ? 782  HOH A O   1 
HETATM 3798 O  O   . HOH N 5 .   ? 53.198 -36.851 0.031   1.00 41.19 ? 783  HOH A O   1 
HETATM 3799 O  O   . HOH N 5 .   ? 22.298 -25.936 -18.958 1.00 20.94 ? 784  HOH A O   1 
HETATM 3800 O  O   . HOH N 5 .   ? 53.284 -43.095 26.651  1.00 31.46 ? 785  HOH A O   1 
HETATM 3801 O  O   . HOH N 5 .   ? 46.557 -20.660 -17.997 1.00 19.32 ? 786  HOH A O   1 
HETATM 3802 O  O   . HOH N 5 .   ? 24.997 -34.704 15.776  1.00 14.87 ? 787  HOH A O   1 
HETATM 3803 O  O   . HOH N 5 .   ? 40.523 -41.876 -17.805 1.00 31.16 ? 788  HOH A O   1 
HETATM 3804 O  O   . HOH N 5 .   ? 37.518 -50.572 -1.518  1.00 14.91 ? 789  HOH A O   1 
HETATM 3805 O  O   . HOH N 5 .   ? 27.941 -52.237 -19.929 1.00 16.23 ? 790  HOH A O   1 
HETATM 3806 O  O   A HOH N 5 .   ? 42.132 -38.738 -4.005  0.50 17.75 ? 791  HOH A O   1 
HETATM 3807 O  O   B HOH N 5 .   ? 42.695 -38.149 -2.063  0.50 12.96 ? 791  HOH A O   1 
HETATM 3808 O  O   . HOH N 5 .   ? 46.495 -41.693 -7.792  1.00 29.89 ? 792  HOH A O   1 
HETATM 3809 O  O   . HOH N 5 .   ? 32.330 -50.781 30.260  1.00 20.64 ? 793  HOH A O   1 
HETATM 3810 O  O   . HOH N 5 .   ? 52.629 -21.532 -18.114 1.00 43.21 ? 794  HOH A O   1 
HETATM 3811 O  O   . HOH N 5 .   ? 25.196 -37.260 14.760  1.00 16.93 ? 795  HOH A O   1 
HETATM 3812 O  O   . HOH N 5 .   ? 17.911 -21.969 -4.108  1.00 29.42 ? 796  HOH A O   1 
HETATM 3813 O  O   . HOH N 5 .   ? 59.277 -57.284 9.389   1.00 28.06 ? 797  HOH A O   1 
HETATM 3814 O  O   . HOH N 5 .   ? 38.275 -48.508 -14.734 1.00 13.71 ? 798  HOH A O   1 
HETATM 3815 O  O   . HOH N 5 .   ? 31.699 -48.933 -14.516 1.00 12.69 ? 799  HOH A O   1 
HETATM 3816 O  O   . HOH N 5 .   ? 50.317 -59.829 22.148  1.00 35.40 ? 800  HOH A O   1 
HETATM 3817 O  O   . HOH N 5 .   ? 42.985 -53.960 -7.518  1.00 14.18 ? 801  HOH A O   1 
HETATM 3818 O  O   . HOH N 5 .   ? 23.525 -47.048 4.617   1.00 16.00 ? 802  HOH A O   1 
HETATM 3819 O  O   . HOH N 5 .   ? 22.604 -41.378 20.066  1.00 33.42 ? 803  HOH A O   1 
HETATM 3820 O  O   . HOH N 5 .   ? 25.013 -51.082 -9.877  1.00 36.57 ? 804  HOH A O   1 
HETATM 3821 O  O   . HOH N 5 .   ? 41.683 -29.368 -17.797 1.00 15.71 ? 805  HOH A O   1 
HETATM 3822 O  O   . HOH N 5 .   ? 56.769 -48.017 11.253  1.00 17.01 ? 806  HOH A O   1 
HETATM 3823 O  O   . HOH N 5 .   ? 54.691 -35.233 -32.937 1.00 45.79 ? 807  HOH A O   1 
HETATM 3824 O  O   . HOH N 5 .   ? 25.067 -43.901 10.973  1.00 14.30 ? 808  HOH A O   1 
HETATM 3825 O  O   . HOH N 5 .   ? 39.068 -15.692 -13.094 1.00 21.46 ? 809  HOH A O   1 
HETATM 3826 O  O   . HOH N 5 .   ? 40.025 -39.302 -17.166 1.00 22.95 ? 810  HOH A O   1 
HETATM 3827 O  O   . HOH N 5 .   ? 39.997 -44.115 -20.035 1.00 35.40 ? 811  HOH A O   1 
HETATM 3828 O  O   . HOH N 5 .   ? 34.734 -48.446 -3.639  1.00 12.78 ? 812  HOH A O   1 
HETATM 3829 O  O   . HOH N 5 .   ? 48.545 -39.457 19.321  1.00 14.64 ? 813  HOH A O   1 
HETATM 3830 O  O   . HOH N 5 .   ? 34.735 -49.494 -17.310 1.00 12.59 ? 814  HOH A O   1 
HETATM 3831 O  O   . HOH N 5 .   ? 34.796 -54.457 -12.566 1.00 12.91 ? 815  HOH A O   1 
HETATM 3832 O  O   . HOH N 5 .   ? 31.769 -32.996 13.321  1.00 13.64 ? 816  HOH A O   1 
HETATM 3833 O  O   . HOH N 5 .   ? 50.537 -54.118 -5.483  1.00 26.93 ? 817  HOH A O   1 
HETATM 3834 O  O   . HOH N 5 .   ? 15.854 -40.350 -11.228 1.00 32.21 ? 818  HOH A O   1 
HETATM 3835 O  O   . HOH N 5 .   ? 21.716 -22.647 8.919   1.00 24.42 ? 819  HOH A O   1 
HETATM 3836 O  O   . HOH N 5 .   ? 36.547 -46.053 0.721   1.00 12.45 ? 820  HOH A O   1 
HETATM 3837 O  O   . HOH N 5 .   ? 28.066 -24.303 -27.188 1.00 39.46 ? 821  HOH A O   1 
HETATM 3838 O  O   . HOH N 5 .   ? 43.467 -54.886 14.338  1.00 19.91 ? 822  HOH A O   1 
HETATM 3839 O  O   . HOH N 5 .   ? 26.983 -46.027 28.228  1.00 13.86 ? 823  HOH A O   1 
HETATM 3840 O  O   . HOH N 5 .   ? 53.906 -33.198 2.639   1.00 23.33 ? 824  HOH A O   1 
HETATM 3841 O  O   . HOH N 5 .   ? 33.323 -47.758 15.005  1.00 12.55 ? 825  HOH A O   1 
HETATM 3842 O  O   . HOH N 5 .   ? 52.134 -37.470 19.939  1.00 23.14 ? 826  HOH A O   1 
HETATM 3843 O  O   . HOH N 5 .   ? 20.183 -31.048 -27.385 1.00 17.77 ? 827  HOH A O   1 
HETATM 3844 O  O   . HOH N 5 .   ? 29.437 -54.544 -22.307 1.00 36.43 ? 828  HOH A O   1 
HETATM 3845 O  O   . HOH N 5 .   ? 47.055 -20.254 12.965  1.00 29.24 ? 829  HOH A O   1 
HETATM 3846 O  O   . HOH N 5 .   ? 46.701 -38.198 -24.506 1.00 32.69 ? 830  HOH A O   1 
HETATM 3847 O  O   . HOH N 5 .   ? 36.406 -53.868 5.299   1.00 34.17 ? 831  HOH A O   1 
HETATM 3848 O  O   . HOH N 5 .   ? 54.792 -62.604 14.286  1.00 38.69 ? 832  HOH A O   1 
HETATM 3849 O  O   . HOH N 5 .   ? 37.082 -32.273 25.805  1.00 24.14 ? 833  HOH A O   1 
HETATM 3850 O  O   . HOH N 5 .   ? 44.385 -29.524 13.029  1.00 30.37 ? 834  HOH A O   1 
HETATM 3851 O  O   . HOH N 5 .   ? 32.445 -53.731 10.794  1.00 39.16 ? 835  HOH A O   1 
HETATM 3852 O  O   . HOH N 5 .   ? 15.580 -28.145 -16.583 1.00 37.03 ? 836  HOH A O   1 
HETATM 3853 O  O   . HOH N 5 .   ? 22.077 -37.751 11.106  1.00 23.89 ? 837  HOH A O   1 
HETATM 3854 O  O   . HOH N 5 .   ? 43.819 -41.828 -0.723  1.00 10.59 ? 838  HOH A O   1 
HETATM 3855 O  O   . HOH N 5 .   ? 33.965 -18.782 -21.179 1.00 28.03 ? 839  HOH A O   1 
HETATM 3856 O  O   . HOH N 5 .   ? 24.209 -53.106 15.020  1.00 28.02 ? 840  HOH A O   1 
HETATM 3857 O  O   . HOH N 5 .   ? 38.946 -45.239 -3.285  1.00 13.05 ? 841  HOH A O   1 
HETATM 3858 O  O   . HOH N 5 .   ? 47.496 -26.799 -16.983 1.00 15.48 ? 842  HOH A O   1 
HETATM 3859 O  O   . HOH N 5 .   ? 54.591 -49.254 30.113  1.00 35.51 ? 843  HOH A O   1 
HETATM 3860 O  O   . HOH N 5 .   ? 34.948 -43.426 32.409  1.00 37.82 ? 844  HOH A O   1 
HETATM 3861 O  O   . HOH N 5 .   ? 24.410 -17.735 -2.375  1.00 41.70 ? 845  HOH A O   1 
HETATM 3862 O  O   . HOH N 5 .   ? 18.522 -25.616 14.483  1.00 41.06 ? 846  HOH A O   1 
HETATM 3863 O  O   . HOH N 5 .   ? 46.333 -36.383 20.275  1.00 16.27 ? 847  HOH A O   1 
HETATM 3864 O  O   . HOH N 5 .   ? 40.881 -37.117 10.654  1.00 17.74 ? 848  HOH A O   1 
HETATM 3865 O  O   . HOH N 5 .   ? 29.347 -36.907 -16.470 1.00 16.67 ? 849  HOH A O   1 
HETATM 3866 O  O   . HOH N 5 .   ? 54.261 -37.264 5.772   1.00 29.82 ? 850  HOH A O   1 
HETATM 3867 O  O   . HOH N 5 .   ? 21.795 -47.150 -15.231 1.00 45.79 ? 851  HOH A O   1 
HETATM 3868 O  O   . HOH N 5 .   ? 22.552 -39.825 -0.761  1.00 17.24 ? 852  HOH A O   1 
HETATM 3869 O  O   . HOH N 5 .   ? 45.822 -38.958 -2.456  1.00 18.29 ? 853  HOH A O   1 
HETATM 3870 O  O   . HOH N 5 .   ? 45.333 -52.032 2.564   1.00 16.58 ? 854  HOH A O   1 
HETATM 3871 O  O   . HOH N 5 .   ? 26.053 -58.961 -3.041  1.00 49.66 ? 855  HOH A O   1 
HETATM 3872 O  O   . HOH N 5 .   ? 51.682 -56.040 5.133   1.00 24.98 ? 856  HOH A O   1 
HETATM 3873 O  O   . HOH N 5 .   ? 44.585 -34.121 -12.058 1.00 37.18 ? 857  HOH A O   1 
HETATM 3874 O  O   . HOH N 5 .   ? 20.578 -54.418 8.887   1.00 41.93 ? 858  HOH A O   1 
HETATM 3875 O  O   . HOH N 5 .   ? 51.364 -32.028 -9.617  1.00 26.47 ? 859  HOH A O   1 
HETATM 3876 O  O   . HOH N 5 .   ? 28.001 -17.102 -4.518  1.00 23.15 ? 860  HOH A O   1 
HETATM 3877 O  O   . HOH N 5 .   ? 25.703 -28.500 20.666  1.00 16.45 ? 861  HOH A O   1 
HETATM 3878 O  O   . HOH N 5 .   ? 16.404 -39.935 7.150   1.00 38.58 ? 862  HOH A O   1 
HETATM 3879 O  O   . HOH N 5 .   ? 32.429 -38.415 -28.618 1.00 37.52 ? 863  HOH A O   1 
HETATM 3880 O  O   . HOH N 5 .   ? 33.770 -45.666 4.995   1.00 10.90 ? 864  HOH A O   1 
HETATM 3881 O  O   . HOH N 5 .   ? 40.913 -28.911 20.770  1.00 13.02 ? 865  HOH A O   1 
HETATM 3882 O  O   . HOH N 5 .   ? 28.664 -52.738 12.774  1.00 31.98 ? 866  HOH A O   1 
HETATM 3883 O  O   . HOH N 5 .   ? 33.132 -29.315 4.023   1.00 10.35 ? 867  HOH A O   1 
HETATM 3884 O  O   . HOH N 5 .   ? 13.392 -42.616 -8.727  1.00 44.41 ? 868  HOH A O   1 
HETATM 3885 O  O   . HOH N 5 .   ? 14.794 -42.271 -3.331  1.00 28.53 ? 869  HOH A O   1 
HETATM 3886 O  O   . HOH N 5 .   ? 27.053 -39.996 25.921  1.00 20.06 ? 870  HOH A O   1 
HETATM 3887 O  O   . HOH N 5 .   ? 34.716 -38.102 4.851   1.00 13.85 ? 871  HOH A O   1 
HETATM 3888 O  O   . HOH N 5 .   ? 18.057 -25.807 7.336   1.00 24.14 ? 872  HOH A O   1 
HETATM 3889 O  O   . HOH N 5 .   ? 48.513 -42.071 1.789   1.00 14.24 ? 873  HOH A O   1 
HETATM 3890 O  O   . HOH N 5 .   ? 50.831 -32.892 1.744   1.00 18.74 ? 874  HOH A O   1 
HETATM 3891 O  O   . HOH N 5 .   ? 20.177 -21.216 -5.426  1.00 32.97 ? 875  HOH A O   1 
HETATM 3892 O  O   . HOH N 5 .   ? 50.666 -15.711 -15.885 1.00 35.31 ? 876  HOH A O   1 
HETATM 3893 O  O   . HOH N 5 .   ? 37.612 -46.945 -21.973 1.00 35.95 ? 877  HOH A O   1 
HETATM 3894 O  O   . HOH N 5 .   ? 26.027 -39.858 28.438  1.00 23.40 ? 878  HOH A O   1 
HETATM 3895 O  O   . HOH N 5 .   ? 53.282 -57.698 23.644  1.00 38.63 ? 879  HOH A O   1 
HETATM 3896 O  O   . HOH N 5 .   ? 31.212 -25.547 17.762  1.00 22.48 ? 880  HOH A O   1 
HETATM 3897 O  O   . HOH N 5 .   ? 25.780 -17.195 -6.600  1.00 44.94 ? 881  HOH A O   1 
HETATM 3898 O  O   . HOH N 5 .   ? 51.491 -54.164 25.985  1.00 33.38 ? 882  HOH A O   1 
HETATM 3899 O  O   . HOH N 5 .   ? 50.191 -64.303 9.305   1.00 47.05 ? 883  HOH A O   1 
HETATM 3900 O  O   . HOH N 5 .   ? 35.321 -51.037 -23.369 1.00 36.06 ? 884  HOH A O   1 
HETATM 3901 O  O   . HOH N 5 .   ? 24.930 -49.799 -20.681 1.00 30.14 ? 885  HOH A O   1 
HETATM 3902 O  O   . HOH N 5 .   ? 46.761 -22.140 -22.192 1.00 26.99 ? 886  HOH A O   1 
HETATM 3903 O  O   . HOH N 5 .   ? 43.763 -54.660 -4.730  1.00 29.25 ? 887  HOH A O   1 
HETATM 3904 O  O   . HOH N 5 .   ? 53.785 -24.240 -13.602 1.00 32.77 ? 888  HOH A O   1 
HETATM 3905 O  O   . HOH N 5 .   ? 15.133 -23.478 -3.687  1.00 48.38 ? 889  HOH A O   1 
HETATM 3906 O  O   . HOH N 5 .   ? 43.551 -34.209 8.172   1.00 14.63 ? 890  HOH A O   1 
HETATM 3907 O  O   . HOH N 5 .   ? 54.101 -24.240 4.226   1.00 19.04 ? 891  HOH A O   1 
HETATM 3908 O  O   . HOH N 5 .   ? 31.743 -17.783 -20.524 1.00 36.89 ? 892  HOH A O   1 
HETATM 3909 O  O   . HOH N 5 .   ? 57.850 -45.200 20.605  1.00 24.51 ? 893  HOH A O   1 
HETATM 3910 O  O   . HOH N 5 .   ? 22.253 -24.826 15.190  1.00 32.40 ? 894  HOH A O   1 
HETATM 3911 O  O   . HOH N 5 .   ? 39.050 -55.736 8.757   1.00 26.15 ? 895  HOH A O   1 
HETATM 3912 O  O   . HOH N 5 .   ? 43.280 -17.768 -2.058  1.00 30.77 ? 896  HOH A O   1 
HETATM 3913 O  O   . HOH N 5 .   ? 12.797 -30.875 10.168  1.00 44.78 ? 897  HOH A O   1 
HETATM 3914 O  O   . HOH N 5 .   ? 35.630 -56.157 11.269  1.00 32.38 ? 898  HOH A O   1 
HETATM 3915 O  O   . HOH N 5 .   ? 29.319 -13.739 -4.515  1.00 39.80 ? 899  HOH A O   1 
HETATM 3916 O  O   . HOH N 5 .   ? 50.460 -48.698 6.632   1.00 14.90 ? 900  HOH A O   1 
HETATM 3917 O  O   . HOH N 5 .   ? 38.296 -35.125 -8.987  1.00 23.41 ? 901  HOH A O   1 
HETATM 3918 O  O   . HOH N 5 .   ? 17.968 -26.947 -27.755 1.00 49.47 ? 902  HOH A O   1 
HETATM 3919 O  O   . HOH N 5 .   ? 51.106 -34.253 20.322  1.00 31.92 ? 903  HOH A O   1 
HETATM 3920 O  O   . HOH N 5 .   ? 13.524 -25.559 -1.737  1.00 36.21 ? 904  HOH A O   1 
HETATM 3921 O  O   . HOH N 5 .   ? 42.054 -42.079 -20.234 1.00 44.97 ? 905  HOH A O   1 
HETATM 3922 O  O   A HOH N 5 .   ? 44.272 -39.838 -4.949  0.50 21.64 ? 906  HOH A O   1 
HETATM 3923 O  O   B HOH N 5 .   ? 44.234 -38.244 -4.061  0.50 21.64 ? 906  HOH A O   1 
HETATM 3924 O  O   . HOH N 5 .   ? 27.023 -52.026 15.806  1.00 14.63 ? 907  HOH A O   1 
HETATM 3925 O  O   . HOH N 5 .   ? 12.832 -27.222 9.406   1.00 50.60 ? 908  HOH A O   1 
HETATM 3926 O  O   . HOH N 5 .   ? 36.414 -32.138 28.563  1.00 39.09 ? 909  HOH A O   1 
HETATM 3927 O  O   . HOH N 5 .   ? 50.098 -33.663 15.787  1.00 31.90 ? 910  HOH A O   1 
HETATM 3928 O  O   . HOH N 5 .   ? 20.833 -43.503 -6.091  1.00 22.24 ? 911  HOH A O   1 
HETATM 3929 O  O   . HOH N 5 .   ? 31.843 -50.853 10.046  1.00 23.11 ? 912  HOH A O   1 
HETATM 3930 O  O   . HOH N 5 .   ? 27.306 -30.669 35.340  1.00 37.55 ? 913  HOH A O   1 
HETATM 3931 O  O   . HOH N 5 .   ? 41.834 -32.073 8.771   1.00 15.98 ? 914  HOH A O   1 
HETATM 3932 O  O   . HOH N 5 .   ? 49.525 -33.105 18.868  1.00 30.00 ? 915  HOH A O   1 
HETATM 3933 O  O   . HOH N 5 .   ? 17.084 -40.003 -23.310 1.00 42.95 ? 916  HOH A O   1 
HETATM 3934 O  O   . HOH N 5 .   ? 46.458 -53.226 26.906  1.00 37.25 ? 917  HOH A O   1 
HETATM 3935 O  O   . HOH N 5 .   ? 20.483 -37.029 23.859  1.00 33.41 ? 918  HOH A O   1 
HETATM 3936 O  O   . HOH N 5 .   ? 26.082 -31.287 29.710  1.00 33.16 ? 919  HOH A O   1 
HETATM 3937 O  O   . HOH N 5 .   ? 23.806 -45.747 -21.446 1.00 37.03 ? 920  HOH A O   1 
HETATM 3938 O  O   . HOH N 5 .   ? 28.364 -44.879 -21.573 1.00 31.73 ? 921  HOH A O   1 
HETATM 3939 O  O   . HOH N 5 .   ? 23.435 -20.550 -11.745 1.00 24.33 ? 922  HOH A O   1 
HETATM 3940 O  O   . HOH N 5 .   ? 27.325 -35.424 -15.506 1.00 14.83 ? 923  HOH A O   1 
HETATM 3941 O  O   . HOH N 5 .   ? 37.391 -22.109 1.772   1.00 13.75 ? 924  HOH A O   1 
HETATM 3942 O  O   . HOH N 5 .   ? 31.646 -42.242 13.344  1.00 11.94 ? 925  HOH A O   1 
HETATM 3943 O  O   . HOH N 5 .   ? 45.878 -55.584 2.514   1.00 32.07 ? 926  HOH A O   1 
HETATM 3944 O  O   . HOH N 5 .   ? 11.283 -26.572 -6.910  1.00 52.81 ? 927  HOH A O   1 
HETATM 3945 O  O   . HOH N 5 .   ? 51.865 -30.349 -0.696  1.00 23.12 ? 928  HOH A O   1 
HETATM 3946 O  O   . HOH N 5 .   ? 54.651 -20.551 -9.463  1.00 42.45 ? 929  HOH A O   1 
HETATM 3947 O  O   . HOH N 5 .   ? 25.451 -25.989 13.556  1.00 24.24 ? 930  HOH A O   1 
HETATM 3948 O  O   . HOH N 5 .   ? 54.328 -22.956 -11.188 1.00 49.20 ? 931  HOH A O   1 
HETATM 3949 O  O   . HOH N 5 .   ? 31.888 -51.902 7.408   1.00 19.69 ? 932  HOH A O   1 
HETATM 3950 O  O   . HOH N 5 .   ? 48.104 -60.535 15.588  1.00 39.40 ? 933  HOH A O   1 
HETATM 3951 O  O   . HOH N 5 .   ? 31.402 -45.187 -21.399 1.00 18.54 ? 934  HOH A O   1 
HETATM 3952 O  O   . HOH N 5 .   ? 37.352 -36.029 28.510  1.00 29.77 ? 935  HOH A O   1 
HETATM 3953 O  O   . HOH N 5 .   ? 49.304 -51.102 7.330   1.00 12.47 ? 936  HOH A O   1 
HETATM 3954 O  O   . HOH N 5 .   ? 47.552 -55.522 -7.403  1.00 26.20 ? 937  HOH A O   1 
HETATM 3955 O  O   . HOH N 5 .   ? 47.116 -47.310 30.021  1.00 31.40 ? 938  HOH A O   1 
HETATM 3956 O  O   . HOH N 5 .   ? 55.100 -40.377 -1.474  1.00 26.97 ? 939  HOH A O   1 
HETATM 3957 O  O   . HOH N 5 .   ? 52.089 -19.577 15.469  1.00 17.41 ? 940  HOH A O   1 
HETATM 3958 O  O   . HOH N 5 .   ? 43.337 -37.722 -8.763  1.00 39.50 ? 941  HOH A O   1 
HETATM 3959 O  O   . HOH N 5 .   ? 41.664 -33.886 -26.241 1.00 27.01 ? 942  HOH A O   1 
HETATM 3960 O  O   . HOH N 5 .   ? 40.512 -39.729 -14.121 1.00 26.18 ? 943  HOH A O   1 
HETATM 3961 O  O   . HOH N 5 .   ? 50.924 -56.311 23.245  1.00 27.88 ? 944  HOH A O   1 
HETATM 3962 O  O   . HOH N 5 .   ? 50.735 -51.320 0.253   1.00 13.30 ? 945  HOH A O   1 
HETATM 3963 O  O   . HOH N 5 .   ? 18.692 -33.251 24.159  1.00 36.67 ? 946  HOH A O   1 
HETATM 3964 O  O   . HOH N 5 .   ? 28.435 -54.857 14.884  1.00 40.90 ? 947  HOH A O   1 
HETATM 3965 O  O   . HOH N 5 .   ? 31.986 -55.952 -12.390 1.00 19.66 ? 948  HOH A O   1 
HETATM 3966 O  O   . HOH N 5 .   ? 10.773 -36.255 -8.864  1.00 36.54 ? 949  HOH A O   1 
HETATM 3967 O  O   . HOH N 5 .   ? 36.124 -53.583 10.484  1.00 16.86 ? 950  HOH A O   1 
HETATM 3968 O  O   . HOH N 5 .   ? 47.768 -30.712 -21.857 1.00 22.34 ? 951  HOH A O   1 
HETATM 3969 O  O   . HOH N 5 .   ? 19.667 -39.735 12.733  1.00 43.64 ? 952  HOH A O   1 
HETATM 3970 O  O   . HOH N 5 .   ? 14.516 -38.010 1.424   1.00 26.44 ? 953  HOH A O   1 
HETATM 3971 O  O   . HOH N 5 .   ? 19.090 -42.716 14.634  1.00 36.89 ? 954  HOH A O   1 
HETATM 3972 O  O   . HOH N 5 .   ? 16.462 -29.210 -26.645 1.00 45.87 ? 955  HOH A O   1 
HETATM 3973 O  O   . HOH N 5 .   ? 43.733 -34.735 -9.158  1.00 34.95 ? 956  HOH A O   1 
HETATM 3974 O  O   . HOH N 5 .   ? 28.885 -33.106 -21.458 1.00 17.72 ? 957  HOH A O   1 
HETATM 3975 O  O   . HOH N 5 .   ? 29.635 -58.669 5.991   1.00 37.64 ? 958  HOH A O   1 
HETATM 3976 O  O   . HOH N 5 .   ? 23.895 -58.600 -5.682  1.00 54.02 ? 959  HOH A O   1 
HETATM 3977 O  O   . HOH N 5 .   ? 17.044 -21.580 -7.468  1.00 42.96 ? 960  HOH A O   1 
HETATM 3978 O  O   . HOH N 5 .   ? 47.475 -55.277 -10.697 1.00 30.87 ? 961  HOH A O   1 
HETATM 3979 O  O   . HOH N 5 .   ? 18.307 -51.797 9.942   1.00 44.35 ? 962  HOH A O   1 
HETATM 3980 O  O   . HOH N 5 .   ? 37.437 -32.677 -8.807  1.00 22.29 ? 963  HOH A O   1 
HETATM 3981 O  O   . HOH N 5 .   ? 36.404 -56.972 18.068  1.00 39.20 ? 964  HOH A O   1 
HETATM 3982 O  O   . HOH N 5 .   ? 13.845 -28.641 -13.753 1.00 39.53 ? 965  HOH A O   1 
HETATM 3983 O  O   . HOH N 5 .   ? 15.855 -32.087 10.364  1.00 29.87 ? 966  HOH A O   1 
HETATM 3984 O  O   . HOH N 5 .   ? 28.162 -23.241 -23.422 1.00 25.39 ? 967  HOH A O   1 
HETATM 3985 O  O   . HOH N 5 .   ? 28.937 -46.201 20.132  1.00 15.29 ? 968  HOH A O   1 
HETATM 3986 O  O   . HOH N 5 .   ? 14.746 -31.143 -22.754 1.00 29.32 ? 969  HOH A O   1 
HETATM 3987 O  O   . HOH N 5 .   ? 36.706 -50.819 29.609  1.00 20.89 ? 970  HOH A O   1 
HETATM 3988 O  O   . HOH N 5 .   ? 40.188 -41.062 -21.988 1.00 24.17 ? 971  HOH A O   1 
HETATM 3989 O  O   . HOH N 5 .   ? 33.777 -36.393 6.748   1.00 15.13 ? 972  HOH A O   1 
HETATM 3990 O  O   . HOH N 5 .   ? 39.406 -21.240 3.466   1.00 17.56 ? 973  HOH A O   1 
HETATM 3991 O  O   . HOH N 5 .   ? 29.062 -18.217 -18.246 1.00 36.09 ? 974  HOH A O   1 
HETATM 3992 O  O   . HOH N 5 .   ? 29.897 -41.976 -28.418 1.00 40.72 ? 975  HOH A O   1 
HETATM 3993 O  O   . HOH N 5 .   ? 24.843 -21.076 -14.980 1.00 34.55 ? 976  HOH A O   1 
HETATM 3994 O  O   . HOH N 5 .   ? 32.648 -52.040 22.525  1.00 20.85 ? 977  HOH A O   1 
HETATM 3995 O  O   . HOH N 5 .   ? 24.253 -54.590 -0.812  1.00 38.78 ? 978  HOH A O   1 
HETATM 3996 O  O   . HOH N 5 .   ? 49.856 -44.351 -0.233  1.00 12.18 ? 979  HOH A O   1 
HETATM 3997 O  O   . HOH N 5 .   ? 61.103 -62.289 11.921  1.00 38.77 ? 980  HOH A O   1 
HETATM 3998 O  O   . HOH N 5 .   ? 17.776 -35.820 -28.704 1.00 42.45 ? 981  HOH A O   1 
HETATM 3999 O  O   . HOH N 5 .   ? 54.965 -57.148 2.526   1.00 43.57 ? 982  HOH A O   1 
HETATM 4000 O  O   . HOH N 5 .   ? 55.735 -43.558 19.744  1.00 20.76 ? 983  HOH A O   1 
HETATM 4001 O  O   . HOH N 5 .   ? 25.475 -18.177 3.302   1.00 38.10 ? 984  HOH A O   1 
HETATM 4002 O  O   . HOH N 5 .   ? 51.565 -36.997 11.390  1.00 36.62 ? 985  HOH A O   1 
HETATM 4003 O  O   . HOH N 5 .   ? 49.799 -41.264 26.468  1.00 23.08 ? 986  HOH A O   1 
HETATM 4004 O  O   . HOH N 5 .   ? 11.694 -25.062 4.444   1.00 46.07 ? 987  HOH A O   1 
HETATM 4005 O  O   . HOH N 5 .   ? 24.778 -21.585 0.710   1.00 22.24 ? 988  HOH A O   1 
HETATM 4006 O  O   . HOH N 5 .   ? 32.106 -26.819 25.013  1.00 38.44 ? 989  HOH A O   1 
HETATM 4007 O  O   . HOH N 5 .   ? 16.314 -30.790 -19.577 1.00 27.64 ? 990  HOH A O   1 
HETATM 4008 O  O   . HOH N 5 .   ? 47.384 -41.670 -0.743  1.00 12.87 ? 991  HOH A O   1 
HETATM 4009 O  O   . HOH N 5 .   ? 59.802 -50.161 16.540  1.00 23.69 ? 992  HOH A O   1 
HETATM 4010 O  O   . HOH N 5 .   ? 41.244 -16.168 -22.278 1.00 43.72 ? 993  HOH A O   1 
HETATM 4011 O  O   . HOH N 5 .   ? 14.594 -26.043 6.328   1.00 35.89 ? 994  HOH A O   1 
HETATM 4012 O  O   . HOH N 5 .   ? 55.728 -24.599 -10.045 1.00 31.89 ? 995  HOH A O   1 
HETATM 4013 O  O   . HOH N 5 .   ? 60.012 -49.170 19.106  1.00 31.16 ? 996  HOH A O   1 
HETATM 4014 O  O   . HOH N 5 .   ? 40.883 -41.056 30.288  1.00 38.56 ? 997  HOH A O   1 
HETATM 4015 O  O   . HOH N 5 .   ? 42.910 -42.996 31.080  1.00 42.82 ? 998  HOH A O   1 
HETATM 4016 O  O   . HOH N 5 .   ? 21.122 -38.805 21.655  1.00 36.16 ? 999  HOH A O   1 
HETATM 4017 O  O   . HOH N 5 .   ? 30.303 -18.917 -0.652  1.00 25.21 ? 1000 HOH A O   1 
HETATM 4018 O  O   . HOH N 5 .   ? 42.061 -35.716 -24.419 1.00 29.23 ? 1001 HOH A O   1 
HETATM 4019 O  O   . HOH N 5 .   ? 43.014 -52.221 28.200  1.00 23.90 ? 1002 HOH A O   1 
HETATM 4020 O  O   . HOH N 5 .   ? 52.841 -23.161 -16.062 1.00 35.52 ? 1003 HOH A O   1 
HETATM 4021 O  O   . HOH N 5 .   ? 48.183 -17.405 -6.230  1.00 26.44 ? 1004 HOH A O   1 
HETATM 4022 O  O   . HOH N 5 .   ? 16.542 -34.032 21.227  1.00 50.78 ? 1005 HOH A O   1 
HETATM 4023 O  O   . HOH N 5 .   ? 52.661 -32.202 -3.369  1.00 41.20 ? 1006 HOH A O   1 
HETATM 4024 O  O   . HOH N 5 .   ? 38.038 -50.538 -18.250 1.00 15.73 ? 1007 HOH A O   1 
HETATM 4025 O  O   . HOH N 5 .   ? 27.738 -20.050 11.605  1.00 39.89 ? 1008 HOH A O   1 
HETATM 4026 O  O   . HOH N 5 .   ? 19.438 -37.529 -26.623 1.00 41.04 ? 1009 HOH A O   1 
HETATM 4027 O  O   . HOH N 5 .   ? 62.888 -51.282 10.467  1.00 41.67 ? 1010 HOH A O   1 
HETATM 4028 O  O   . HOH N 5 .   ? 34.918 -38.092 28.799  1.00 25.99 ? 1011 HOH A O   1 
HETATM 4029 O  O   . HOH N 5 .   ? 32.561 -21.460 -26.570 1.00 41.69 ? 1012 HOH A O   1 
HETATM 4030 O  O   . HOH N 5 .   ? 54.900 -21.781 14.633  1.00 15.45 ? 1013 HOH A O   1 
HETATM 4031 O  O   . HOH N 5 .   ? 16.919 -24.803 10.869  1.00 30.42 ? 1014 HOH A O   1 
HETATM 4032 O  O   . HOH N 5 .   ? 36.858 -45.783 -5.159  1.00 11.35 ? 1015 HOH A O   1 
HETATM 4033 O  O   . HOH N 5 .   ? 41.094 -41.392 -10.548 1.00 26.69 ? 1016 HOH A O   1 
HETATM 4034 O  O   . HOH N 5 .   ? 49.538 -38.442 26.822  1.00 38.48 ? 1017 HOH A O   1 
HETATM 4035 O  O   . HOH N 5 .   ? 23.970 -32.886 27.518  1.00 28.23 ? 1018 HOH A O   1 
HETATM 4036 O  O   . HOH N 5 .   ? 48.524 -29.745 9.705   1.00 35.39 ? 1019 HOH A O   1 
HETATM 4037 O  O   . HOH N 5 .   ? 31.004 -31.151 4.495   1.00 12.02 ? 1020 HOH A O   1 
HETATM 4038 O  O   . HOH N 5 .   ? 25.654 -33.763 30.603  1.00 21.31 ? 1021 HOH A O   1 
HETATM 4039 O  O   . HOH N 5 .   ? 31.572 -15.511 7.731   1.00 41.34 ? 1022 HOH A O   1 
HETATM 4040 O  O   . HOH N 5 .   ? 55.091 -23.740 -6.031  1.00 39.48 ? 1023 HOH A O   1 
HETATM 4041 O  O   . HOH N 5 .   ? 21.787 -31.567 16.472  1.00 24.02 ? 1024 HOH A O   1 
HETATM 4042 O  O   . HOH N 5 .   ? 45.818 -59.461 22.900  1.00 40.29 ? 1025 HOH A O   1 
HETATM 4043 O  O   . HOH N 5 .   ? 36.999 -56.889 23.347  1.00 38.17 ? 1026 HOH A O   1 
HETATM 4044 O  O   . HOH N 5 .   ? 20.911 -24.559 -23.431 1.00 37.79 ? 1027 HOH A O   1 
HETATM 4045 O  O   . HOH N 5 .   ? 64.575 -54.910 12.809  1.00 48.27 ? 1028 HOH A O   1 
HETATM 4046 O  O   . HOH N 5 .   ? 58.429 -40.541 12.514  1.00 49.87 ? 1029 HOH A O   1 
HETATM 4047 O  O   . HOH N 5 .   ? 41.763 -51.029 0.182   1.00 19.13 ? 1030 HOH A O   1 
HETATM 4048 O  O   . HOH N 5 .   ? 46.642 -56.743 24.669  1.00 20.84 ? 1031 HOH A O   1 
HETATM 4049 O  O   . HOH N 5 .   ? 10.074 -27.955 -4.140  1.00 48.59 ? 1032 HOH A O   1 
HETATM 4050 O  O   . HOH N 5 .   ? 44.815 -37.382 8.992   1.00 24.76 ? 1033 HOH A O   1 
HETATM 4051 O  O   . HOH N 5 .   ? 25.506 -25.186 -28.704 1.00 42.14 ? 1034 HOH A O   1 
HETATM 4052 O  O   . HOH N 5 .   ? 28.023 -41.012 29.784  1.00 23.53 ? 1035 HOH A O   1 
HETATM 4053 O  O   . HOH N 5 .   ? 24.864 -55.587 -8.130  1.00 34.91 ? 1036 HOH A O   1 
HETATM 4054 O  O   . HOH N 5 .   ? 16.133 -42.017 1.860   1.00 41.32 ? 1037 HOH A O   1 
HETATM 4055 O  O   . HOH N 5 .   ? 19.267 -44.292 12.198  1.00 31.14 ? 1038 HOH A O   1 
HETATM 4056 O  O   . HOH N 5 .   ? 28.805 -58.833 -10.572 1.00 28.18 ? 1039 HOH A O   1 
HETATM 4057 O  O   . HOH N 5 .   ? 39.942 -32.875 13.233  1.00 17.32 ? 1040 HOH A O   1 
HETATM 4058 O  O   . HOH N 5 .   ? 19.692 -50.050 16.298  1.00 39.98 ? 1041 HOH A O   1 
HETATM 4059 O  O   . HOH N 5 .   ? 40.771 -14.248 -6.190  1.00 29.98 ? 1042 HOH A O   1 
HETATM 4060 O  O   . HOH N 5 .   ? 53.781 -39.773 22.561  1.00 18.03 ? 1043 HOH A O   1 
HETATM 4061 O  O   . HOH N 5 .   ? 34.780 -12.393 4.715   1.00 39.25 ? 1044 HOH A O   1 
HETATM 4062 O  O   . HOH N 5 .   ? 47.134 -41.530 25.583  1.00 12.20 ? 1045 HOH A O   1 
HETATM 4063 O  O   . HOH N 5 .   ? 48.627 -59.021 5.842   1.00 40.97 ? 1046 HOH A O   1 
HETATM 4064 O  O   . HOH N 5 .   ? 20.595 -33.535 -29.748 1.00 39.83 ? 1047 HOH A O   1 
HETATM 4065 O  O   . HOH N 5 .   ? 54.080 -26.707 -22.441 1.00 31.19 ? 1048 HOH A O   1 
HETATM 4066 O  O   . HOH N 5 .   ? 41.387 -37.422 29.270  1.00 32.76 ? 1049 HOH A O   1 
HETATM 4067 O  O   . HOH N 5 .   ? 29.004 -34.134 -18.793 1.00 17.75 ? 1050 HOH A O   1 
HETATM 4068 O  O   . HOH N 5 .   ? 53.146 -60.315 21.637  1.00 33.86 ? 1051 HOH A O   1 
HETATM 4069 O  O   . HOH N 5 .   ? 56.620 -43.207 -0.770  1.00 36.08 ? 1052 HOH A O   1 
HETATM 4070 O  O   . HOH N 5 .   ? 41.037 -27.243 -12.415 1.00 19.43 ? 1053 HOH A O   1 
HETATM 4071 O  O   . HOH N 5 .   ? 55.483 -30.396 -2.454  1.00 39.47 ? 1054 HOH A O   1 
HETATM 4072 O  O   . HOH N 5 .   ? 15.927 -36.265 9.246   1.00 30.78 ? 1055 HOH A O   1 
HETATM 4073 O  O   . HOH N 5 .   ? 31.412 -56.093 17.752  1.00 36.03 ? 1056 HOH A O   1 
HETATM 4074 O  O   . HOH N 5 .   ? 40.005 -33.685 10.502  1.00 12.71 ? 1057 HOH A O   1 
HETATM 4075 O  O   . HOH N 5 .   ? 51.942 -34.734 14.185  1.00 37.33 ? 1058 HOH A O   1 
HETATM 4076 O  O   . HOH N 5 .   ? 22.742 -29.612 26.246  1.00 39.93 ? 1059 HOH A O   1 
HETATM 4077 O  O   . HOH N 5 .   ? 54.817 -30.964 -20.409 1.00 45.70 ? 1060 HOH A O   1 
HETATM 4078 O  O   . HOH N 5 .   ? 57.799 -50.745 -1.349  1.00 43.44 ? 1061 HOH A O   1 
HETATM 4079 O  O   . HOH N 5 .   ? 27.780 -15.176 -2.706  1.00 41.84 ? 1062 HOH A O   1 
HETATM 4080 O  O   . HOH N 5 .   ? 30.945 -53.220 27.659  1.00 25.43 ? 1063 HOH A O   1 
HETATM 4081 O  O   . HOH N 5 .   ? 54.346 -31.181 -6.769  1.00 25.57 ? 1064 HOH A O   1 
HETATM 4082 O  O   . HOH N 5 .   ? 56.130 -41.475 7.165   1.00 23.05 ? 1065 HOH A O   1 
HETATM 4083 O  O   . HOH N 5 .   ? 14.685 -42.481 0.153   1.00 39.73 ? 1066 HOH A O   1 
HETATM 4084 O  O   . HOH N 5 .   ? 40.698 -15.898 -2.077  1.00 23.15 ? 1067 HOH A O   1 
HETATM 4085 O  O   . HOH N 5 .   ? 52.971 -23.962 -8.484  1.00 25.49 ? 1068 HOH A O   1 
HETATM 4086 O  O   . HOH N 5 .   ? 49.217 -41.241 -7.046  1.00 22.06 ? 1069 HOH A O   1 
HETATM 4087 O  O   . HOH N 5 .   ? 28.902 -33.920 -29.070 1.00 22.31 ? 1070 HOH A O   1 
HETATM 4088 O  O   . HOH N 5 .   ? 24.926 -30.554 27.660  1.00 37.43 ? 1071 HOH A O   1 
HETATM 4089 O  O   . HOH N 5 .   ? 49.313 -23.782 -23.733 1.00 20.23 ? 1072 HOH A O   1 
HETATM 4090 O  O   . HOH N 5 .   ? 26.355 -18.498 9.687   1.00 39.70 ? 1073 HOH A O   1 
HETATM 4091 O  O   . HOH N 5 .   ? 30.888 -54.034 12.868  1.00 19.05 ? 1074 HOH A O   1 
HETATM 4092 O  O   . HOH N 5 .   ? 39.698 -47.386 -19.404 1.00 25.90 ? 1075 HOH A O   1 
HETATM 4093 O  O   . HOH N 5 .   ? 50.650 -32.191 -16.554 1.00 42.54 ? 1076 HOH A O   1 
HETATM 4094 O  O   . HOH N 5 .   ? 27.602 -26.723 11.290  1.00 13.76 ? 1077 HOH A O   1 
HETATM 4095 O  O   . HOH N 5 .   ? 18.111 -44.534 -5.269  1.00 38.94 ? 1078 HOH A O   1 
HETATM 4096 O  O   . HOH N 5 .   ? 35.985 -41.885 -25.338 1.00 19.69 ? 1079 HOH A O   1 
HETATM 4097 O  O   . HOH N 5 .   ? 44.286 -54.562 0.067   1.00 36.04 ? 1080 HOH A O   1 
HETATM 4098 O  O   . HOH N 5 .   ? 17.930 -42.221 8.608   1.00 30.49 ? 1081 HOH A O   1 
HETATM 4099 O  O   . HOH N 5 .   ? 56.381 -42.263 15.935  1.00 34.77 ? 1082 HOH A O   1 
HETATM 4100 O  O   . HOH N 5 .   ? 49.815 -28.963 -28.023 1.00 29.31 ? 1083 HOH A O   1 
HETATM 4101 O  O   . HOH N 5 .   ? 12.673 -40.637 13.661  1.00 36.55 ? 1084 HOH A O   1 
HETATM 4102 O  O   . HOH N 5 .   ? 47.342 -36.759 -17.174 1.00 49.21 ? 1085 HOH A O   1 
HETATM 4103 O  O   . HOH N 5 .   ? 62.819 -54.544 10.724  1.00 33.51 ? 1086 HOH A O   1 
HETATM 4104 O  O   . HOH N 5 .   ? 40.302 -25.080 -26.816 1.00 39.43 ? 1087 HOH A O   1 
HETATM 4105 O  O   . HOH N 5 .   ? 57.376 -45.635 3.210   1.00 40.52 ? 1088 HOH A O   1 
HETATM 4106 O  O   . HOH N 5 .   ? 34.607 -56.295 -0.884  1.00 31.36 ? 1089 HOH A O   1 
HETATM 4107 O  O   . HOH N 5 .   ? 44.007 -20.161 2.929   1.00 18.47 ? 1090 HOH A O   1 
HETATM 4108 O  O   . HOH N 5 .   ? 41.691 -44.708 -12.889 1.00 41.22 ? 1091 HOH A O   1 
HETATM 4109 O  O   . HOH N 5 .   ? 55.324 -59.599 16.450  1.00 19.29 ? 1092 HOH A O   1 
HETATM 4110 O  O   . HOH N 5 .   ? 54.441 -23.807 1.312   1.00 14.70 ? 1093 HOH A O   1 
HETATM 4111 O  O   . HOH N 5 .   ? 34.465 -35.376 -29.453 1.00 19.45 ? 1094 HOH A O   1 
HETATM 4112 O  O   . HOH N 5 .   ? 29.633 -25.522 15.223  1.00 18.64 ? 1095 HOH A O   1 
HETATM 4113 O  O   . HOH N 5 .   ? 16.740 -25.543 -17.388 1.00 30.63 ? 1096 HOH A O   1 
HETATM 4114 O  O   . HOH N 5 .   ? 23.122 -30.508 21.319  1.00 10.80 ? 1097 HOH A O   1 
HETATM 4115 O  O   . HOH N 5 .   ? 33.200 -54.331 8.252   1.00 32.44 ? 1098 HOH A O   1 
HETATM 4116 O  O   . HOH N 5 .   ? 54.902 -40.849 10.662  1.00 36.77 ? 1099 HOH A O   1 
HETATM 4117 O  O   . HOH N 5 .   ? 24.061 -53.445 -10.381 1.00 49.28 ? 1100 HOH A O   1 
HETATM 4118 O  O   . HOH N 5 .   ? 46.650 -37.899 -5.177  1.00 33.80 ? 1101 HOH A O   1 
HETATM 4119 O  O   . HOH N 5 .   ? 53.248 -38.066 -1.829  1.00 15.40 ? 1102 HOH A O   1 
HETATM 4120 O  O   . HOH N 5 .   ? 36.933 -29.228 23.314  1.00 30.02 ? 1103 HOH A O   1 
HETATM 4121 O  O   . HOH N 5 .   ? 37.770 -50.907 -23.944 1.00 37.30 ? 1104 HOH A O   1 
HETATM 4122 O  O   . HOH N 5 .   ? 53.823 -52.955 27.708  1.00 24.84 ? 1105 HOH A O   1 
HETATM 4123 O  O   . HOH N 5 .   ? 38.013 -48.110 31.717  1.00 14.53 ? 1106 HOH A O   1 
HETATM 4124 O  O   . HOH N 5 .   ? 20.573 -24.281 -26.355 1.00 41.27 ? 1107 HOH A O   1 
HETATM 4125 O  O   . HOH N 5 .   ? 22.800 -18.983 2.786   1.00 38.08 ? 1108 HOH A O   1 
HETATM 4126 O  O   . HOH N 5 .   ? 61.996 -46.425 6.863   1.00 28.61 ? 1109 HOH A O   1 
HETATM 4127 O  O   . HOH N 5 .   ? 46.123 -43.530 1.276   1.00 11.42 ? 1110 HOH A O   1 
HETATM 4128 O  O   . HOH N 5 .   ? 13.786 -31.961 12.153  1.00 49.16 ? 1111 HOH A O   1 
HETATM 4129 O  O   . HOH N 5 .   ? 42.713 -41.331 -23.425 1.00 19.94 ? 1112 HOH A O   1 
HETATM 4130 O  O   . HOH N 5 .   ? 52.636 -40.118 10.786  1.00 19.71 ? 1113 HOH A O   1 
HETATM 4131 O  O   . HOH N 5 .   ? 56.978 -50.409 -3.369  1.00 38.47 ? 1114 HOH A O   1 
HETATM 4132 O  O   . HOH N 5 .   ? 36.862 -49.714 -20.769 1.00 18.52 ? 1115 HOH A O   1 
HETATM 4133 O  O   . HOH N 5 .   ? 21.553 -32.770 26.080  1.00 40.62 ? 1116 HOH A O   1 
HETATM 4134 O  O   . HOH N 5 .   ? 35.724 -53.577 29.511  1.00 45.16 ? 1117 HOH A O   1 
HETATM 4135 O  O   . HOH N 5 .   ? 39.912 -18.388 4.203   1.00 31.84 ? 1118 HOH A O   1 
HETATM 4136 O  O   . HOH N 5 .   ? 31.652 -25.577 12.536  1.00 27.69 ? 1119 HOH A O   1 
HETATM 4137 O  O   . HOH N 5 .   ? 53.941 -63.173 6.656   1.00 28.46 ? 1120 HOH A O   1 
HETATM 4138 O  O   . HOH N 5 .   ? 39.508 -58.335 10.543  1.00 47.00 ? 1121 HOH A O   1 
HETATM 4139 O  O   . HOH N 5 .   ? 47.808 -35.881 -6.138  1.00 36.19 ? 1122 HOH A O   1 
HETATM 4140 O  O   . HOH N 5 .   ? 26.416 -56.518 11.028  1.00 28.07 ? 1123 HOH A O   1 
HETATM 4141 O  O   . HOH N 5 .   ? 34.925 -59.053 5.574   1.00 46.36 ? 1124 HOH A O   1 
HETATM 4142 O  O   . HOH N 5 .   ? 55.334 -41.642 4.354   1.00 12.77 ? 1125 HOH A O   1 
HETATM 4143 O  O   . HOH N 5 .   ? 43.360 -27.690 -30.198 1.00 37.53 ? 1126 HOH A O   1 
HETATM 4144 O  O   . HOH N 5 .   ? 18.694 -44.384 3.049   1.00 36.97 ? 1127 HOH A O   1 
HETATM 4145 O  O   . HOH N 5 .   ? 25.641 -23.737 -25.110 1.00 30.79 ? 1128 HOH A O   1 
HETATM 4146 O  O   . HOH N 5 .   ? 18.285 -26.377 -20.124 1.00 40.48 ? 1129 HOH A O   1 
HETATM 4147 O  O   . HOH N 5 .   ? 31.542 -16.379 -18.305 1.00 46.84 ? 1130 HOH A O   1 
HETATM 4148 O  O   . HOH N 5 .   ? 26.516 -54.887 18.673  1.00 41.85 ? 1131 HOH A O   1 
HETATM 4149 O  O   . HOH N 5 .   ? 19.109 -21.950 9.548   1.00 45.41 ? 1132 HOH A O   1 
HETATM 4150 O  O   . HOH N 5 .   ? 53.992 -30.861 -25.699 1.00 31.72 ? 1133 HOH A O   1 
HETATM 4151 O  O   . HOH N 5 .   ? 55.535 -56.740 -0.147  1.00 49.98 ? 1134 HOH A O   1 
HETATM 4152 O  O   . HOH N 5 .   ? 44.393 -35.473 -29.981 1.00 51.83 ? 1135 HOH A O   1 
HETATM 4153 O  O   . HOH N 5 .   ? 39.570 -19.398 -23.559 1.00 34.85 ? 1136 HOH A O   1 
HETATM 4154 O  O   . HOH N 5 .   ? 36.762 -34.810 32.808  1.00 46.02 ? 1137 HOH A O   1 
HETATM 4155 O  O   . HOH N 5 .   ? 44.380 -56.168 7.065   1.00 11.84 ? 1138 HOH A O   1 
HETATM 4156 O  O   . HOH N 5 .   ? 14.636 -24.727 2.171   1.00 39.76 ? 1139 HOH A O   1 
HETATM 4157 O  O   . HOH N 5 .   ? 24.206 -52.720 17.578  1.00 28.78 ? 1140 HOH A O   1 
HETATM 4158 O  O   . HOH N 5 .   ? 16.856 -21.790 0.575   1.00 22.20 ? 1141 HOH A O   1 
HETATM 4159 O  O   . HOH N 5 .   ? 28.799 -51.122 10.749  1.00 34.33 ? 1142 HOH A O   1 
HETATM 4160 O  O   . HOH N 5 .   ? 34.284 -26.604 13.899  1.00 34.89 ? 1143 HOH A O   1 
HETATM 4161 O  O   . HOH N 5 .   ? 36.593 -20.721 -28.487 1.00 44.33 ? 1144 HOH A O   1 
HETATM 4162 O  O   . HOH N 5 .   ? 36.060 -35.088 30.149  1.00 42.79 ? 1145 HOH A O   1 
HETATM 4163 O  O   . HOH N 5 .   ? 34.962 -14.355 -1.547  1.00 19.08 ? 1146 HOH A O   1 
HETATM 4164 O  O   . HOH N 5 .   ? 28.901 -14.154 7.661   1.00 47.16 ? 1147 HOH A O   1 
HETATM 4165 O  O   . HOH N 5 .   ? 35.101 -16.108 4.601   1.00 27.09 ? 1148 HOH A O   1 
HETATM 4166 O  O   . HOH N 5 .   ? 44.346 -47.433 29.315  1.00 41.64 ? 1149 HOH A O   1 
HETATM 4167 O  O   . HOH N 5 .   ? 37.478 -53.074 -12.081 1.00 6.02  ? 1150 HOH A O   1 
HETATM 4168 O  O   . HOH N 5 .   ? 35.867 -40.432 29.804  1.00 17.14 ? 1151 HOH A O   1 
HETATM 4169 O  O   . HOH N 5 .   ? 19.130 -49.271 -0.191  1.00 15.14 ? 1152 HOH A O   1 
HETATM 4170 O  O   . HOH N 5 .   ? 15.181 -26.273 -12.976 1.00 42.96 ? 1153 HOH A O   1 
HETATM 4171 O  O   . HOH N 5 .   ? 38.354 -52.820 5.921   1.00 21.17 ? 1154 HOH A O   1 
HETATM 4172 O  O   . HOH N 5 .   ? 34.765 -29.576 30.962  1.00 41.04 ? 1155 HOH A O   1 
HETATM 4173 O  O   . HOH N 5 .   ? 46.273 -37.575 -20.734 1.00 35.08 ? 1156 HOH A O   1 
HETATM 4174 O  O   . HOH N 5 .   ? 39.239 -43.761 -25.356 1.00 38.22 ? 1157 HOH A O   1 
HETATM 4175 O  O   . HOH N 5 .   ? 52.602 -28.667 9.331   1.00 27.23 ? 1158 HOH A O   1 
HETATM 4176 O  O   . HOH N 5 .   ? 15.796 -42.312 -13.455 1.00 47.68 ? 1159 HOH A O   1 
HETATM 4177 O  O   . HOH N 5 .   ? 41.547 -22.379 -26.658 1.00 41.46 ? 1160 HOH A O   1 
HETATM 4178 O  O   . HOH N 5 .   ? 26.989 -57.432 -0.947  1.00 19.80 ? 1161 HOH A O   1 
HETATM 4179 O  O   . HOH N 5 .   ? 22.281 -21.325 -15.637 1.00 35.26 ? 1162 HOH A O   1 
HETATM 4180 O  O   . HOH N 5 .   ? 55.407 -27.477 1.057   1.00 8.76  ? 1163 HOH A O   1 
HETATM 4181 O  O   . HOH N 5 .   ? 23.252 -49.159 -16.114 1.00 31.02 ? 1164 HOH A O   1 
HETATM 4182 O  O   . HOH N 5 .   ? 61.192 -48.755 14.677  1.00 39.54 ? 1165 HOH A O   1 
HETATM 4183 O  O   . HOH N 5 .   ? 24.872 -55.847 7.206   1.00 34.22 ? 1166 HOH A O   1 
HETATM 4184 O  O   . HOH N 5 .   ? 50.491 -35.008 -0.185  1.00 19.54 ? 1167 HOH A O   1 
HETATM 4185 O  O   . HOH N 5 .   ? 51.477 -35.300 7.492   1.00 23.31 ? 1168 HOH A O   1 
HETATM 4186 O  O   . HOH N 5 .   ? 45.699 -33.556 -29.544 1.00 43.23 ? 1169 HOH A O   1 
HETATM 4187 O  O   . HOH N 5 .   ? 38.875 -50.876 30.870  1.00 45.11 ? 1170 HOH A O   1 
HETATM 4188 O  O   . HOH N 5 .   ? 37.124 -17.985 5.099   1.00 30.15 ? 1171 HOH A O   1 
HETATM 4189 O  O   . HOH N 5 .   ? 18.805 -37.136 21.138  1.00 23.08 ? 1172 HOH A O   1 
HETATM 4190 O  O   . HOH N 5 .   ? 25.105 -55.773 13.642  1.00 42.70 ? 1173 HOH A O   1 
HETATM 4191 O  O   . HOH N 5 .   ? 49.360 -34.089 8.133   1.00 37.68 ? 1174 HOH A O   1 
HETATM 4192 O  O   . HOH N 5 .   ? 52.573 -32.498 6.053   1.00 24.51 ? 1175 HOH A O   1 
HETATM 4193 O  O   . HOH N 5 .   ? 36.608 -37.345 -29.118 1.00 46.83 ? 1176 HOH A O   1 
HETATM 4194 O  O   . HOH N 5 .   ? 33.002 -56.024 24.355  1.00 24.41 ? 1177 HOH A O   1 
HETATM 4195 O  O   . HOH N 5 .   ? 16.850 -23.412 7.241   1.00 39.86 ? 1178 HOH A O   1 
HETATM 4196 O  O   . HOH N 5 .   ? 13.165 -39.406 -5.303  1.00 30.66 ? 1179 HOH A O   1 
HETATM 4197 O  O   . HOH N 5 .   ? 27.343 -28.184 30.932  1.00 39.35 ? 1180 HOH A O   1 
HETATM 4198 O  O   . HOH N 5 .   ? 27.901 -17.668 -0.699  1.00 36.94 ? 1181 HOH A O   1 
HETATM 4199 O  O   . HOH N 5 .   ? 53.007 -21.491 -7.382  1.00 42.35 ? 1182 HOH A O   1 
HETATM 4200 O  O   . HOH N 5 .   ? 31.682 -51.570 -22.773 1.00 46.14 ? 1183 HOH A O   1 
HETATM 4201 O  O   . HOH N 5 .   ? 56.718 -61.751 17.630  1.00 44.60 ? 1184 HOH A O   1 
HETATM 4202 O  O   . HOH N 5 .   ? 45.501 -51.116 28.419  1.00 37.38 ? 1185 HOH A O   1 
HETATM 4203 O  O   . HOH N 5 .   ? 42.413 -37.479 -17.260 1.00 13.86 ? 1186 HOH A O   1 
HETATM 4204 O  O   . HOH N 5 .   ? 46.493 -17.460 -18.532 1.00 21.67 ? 1187 HOH A O   1 
HETATM 4205 O  O   . HOH N 5 .   ? 52.815 -39.352 25.376  1.00 43.29 ? 1188 HOH A O   1 
HETATM 4206 O  O   . HOH N 5 .   ? 50.384 -55.314 -9.339  1.00 44.35 ? 1189 HOH A O   1 
HETATM 4207 O  O   . HOH N 5 .   ? 17.858 -19.191 7.975   1.00 47.60 ? 1190 HOH A O   1 
HETATM 4208 O  O   . HOH N 5 .   ? 50.903 -42.324 28.947  1.00 42.68 ? 1191 HOH A O   1 
HETATM 4209 O  O   . HOH N 5 .   ? 47.966 -48.492 -12.970 1.00 37.47 ? 1192 HOH A O   1 
HETATM 4210 O  O   . HOH N 5 .   ? 34.730 -57.308 28.025  1.00 35.59 ? 1193 HOH A O   1 
HETATM 4211 O  O   . HOH N 5 .   ? 28.420 -59.209 -2.011  1.00 46.81 ? 1194 HOH A O   1 
HETATM 4212 O  O   . HOH N 5 .   ? 55.444 -38.046 3.558   1.00 44.30 ? 1195 HOH A O   1 
HETATM 4213 O  O   . HOH N 5 .   ? 23.485 -27.263 21.904  1.00 38.26 ? 1196 HOH A O   1 
HETATM 4214 O  O   . HOH N 5 .   ? 32.885 -53.087 29.636  1.00 26.98 ? 1197 HOH A O   1 
HETATM 4215 O  O   . HOH N 5 .   ? 63.173 -50.172 13.398  1.00 44.01 ? 1198 HOH A O   1 
HETATM 4216 O  O   . HOH N 5 .   ? 19.342 -31.979 14.794  1.00 39.58 ? 1199 HOH A O   1 
HETATM 4217 O  O   . HOH N 5 .   ? 18.392 -41.824 -20.164 1.00 52.18 ? 1200 HOH A O   1 
HETATM 4218 O  O   . HOH N 5 .   ? 28.184 -23.981 10.551  1.00 26.46 ? 1201 HOH A O   1 
HETATM 4219 O  O   . HOH N 5 .   ? 25.662 -29.945 31.826  1.00 47.33 ? 1202 HOH A O   1 
HETATM 4220 O  O   . HOH N 5 .   ? 24.946 -58.241 -8.807  1.00 47.32 ? 1203 HOH A O   1 
HETATM 4221 O  O   . HOH N 5 .   ? 39.554 -50.236 5.667   1.00 17.77 ? 1204 HOH A O   1 
HETATM 4222 O  O   . HOH N 5 .   ? 54.134 -31.297 -11.786 1.00 46.63 ? 1205 HOH A O   1 
HETATM 4223 O  O   . HOH N 5 .   ? 37.710 -29.698 25.319  1.00 31.46 ? 1206 HOH A O   1 
HETATM 4224 O  O   . HOH N 5 .   ? 19.598 -22.105 12.383  1.00 38.65 ? 1207 HOH A O   1 
HETATM 4225 O  O   . HOH N 5 .   ? 8.606  -34.206 -8.851  1.00 42.42 ? 1208 HOH A O   1 
HETATM 4226 O  O   . HOH N 5 .   ? 49.055 -33.479 -4.766  1.00 42.35 ? 1209 HOH A O   1 
HETATM 4227 O  O   . HOH N 5 .   ? 14.782 -22.776 4.239   1.00 46.52 ? 1210 HOH A O   1 
HETATM 4228 O  O   . HOH N 5 .   ? 30.580 -37.846 -31.814 1.00 57.46 ? 1211 HOH A O   1 
HETATM 4229 O  O   . HOH N 5 .   ? 13.762 -29.023 -21.348 1.00 40.36 ? 1212 HOH A O   1 
HETATM 4230 O  O   . HOH N 5 .   ? 29.956 -18.448 11.738  1.00 30.83 ? 1213 HOH A O   1 
HETATM 4231 O  O   . HOH N 5 .   ? 20.492 -51.921 14.668  1.00 39.09 ? 1214 HOH A O   1 
HETATM 4232 O  O   . HOH N 5 .   ? 12.452 -36.577 2.655   1.00 35.46 ? 1215 HOH A O   1 
HETATM 4233 O  O   . HOH N 5 .   ? 50.219 -25.016 14.195  1.00 38.59 ? 1216 HOH A O   1 
HETATM 4234 O  O   . HOH N 5 .   ? 19.725 -28.313 -29.135 1.00 40.01 ? 1217 HOH A O   1 
HETATM 4235 O  O   . HOH N 5 .   ? 26.437 -22.173 11.227  1.00 34.18 ? 1218 HOH A O   1 
HETATM 4236 O  O   . HOH N 5 .   ? 30.374 -58.649 -12.970 1.00 33.73 ? 1219 HOH A O   1 
HETATM 4237 O  O   . HOH N 5 .   ? 49.202 -35.845 11.508  1.00 30.62 ? 1220 HOH A O   1 
HETATM 4238 O  O   . HOH N 5 .   ? 25.438 -18.815 0.422   1.00 32.27 ? 1221 HOH A O   1 
HETATM 4239 O  O   . HOH N 5 .   ? 21.485 -30.240 24.118  1.00 46.88 ? 1222 HOH A O   1 
HETATM 4240 O  O   . HOH N 5 .   ? 41.249 -40.265 -6.403  1.00 10.31 ? 1223 HOH A O   1 
HETATM 4241 O  O   . HOH N 5 .   ? 8.658  -30.863 2.171   1.00 48.37 ? 1224 HOH A O   1 
HETATM 4242 O  O   . HOH N 5 .   ? 48.478 -21.420 -18.965 1.00 40.15 ? 1225 HOH A O   1 
HETATM 4243 O  O   . HOH N 5 .   ? 43.146 -52.404 -1.590  1.00 40.48 ? 1226 HOH A O   1 
HETATM 4244 O  O   . HOH N 5 .   ? 43.304 -21.170 -25.273 1.00 44.05 ? 1227 HOH A O   1 
HETATM 4245 O  O   . HOH N 5 .   ? 56.699 -42.344 1.712   1.00 38.22 ? 1228 HOH A O   1 
HETATM 4246 O  O   . HOH N 5 .   ? 61.318 -55.519 8.753   1.00 43.34 ? 1229 HOH A O   1 
HETATM 4247 O  O   . HOH N 5 .   ? 26.314 -26.478 22.101  1.00 38.58 ? 1230 HOH A O   1 
HETATM 4248 O  O   . HOH N 5 .   ? 20.842 -26.144 -29.356 1.00 48.39 ? 1231 HOH A O   1 
HETATM 4249 O  O   . HOH N 5 .   ? 11.842 -38.177 -12.927 1.00 45.53 ? 1232 HOH A O   1 
HETATM 4250 O  O   . HOH N 5 .   ? 48.160 -48.137 -9.506  1.00 36.58 ? 1233 HOH A O   1 
HETATM 4251 O  O   . HOH N 5 .   ? 42.109 -55.443 8.124   1.00 29.93 ? 1234 HOH A O   1 
HETATM 4252 O  O   . HOH N 5 .   ? 63.858 -45.074 8.648   1.00 48.24 ? 1235 HOH A O   1 
HETATM 4253 O  O   . HOH N 5 .   ? 35.733 -54.969 7.847   1.00 37.25 ? 1236 HOH A O   1 
HETATM 4254 O  O   . HOH N 5 .   ? 40.879 -48.087 -16.320 1.00 14.42 ? 1237 HOH A O   1 
HETATM 4255 O  O   . HOH N 5 .   ? 42.702 -52.175 2.204   1.00 22.00 ? 1238 HOH A O   1 
HETATM 4256 O  O   . HOH N 5 .   ? 55.501 -34.001 5.069   1.00 37.78 ? 1239 HOH A O   1 
HETATM 4257 O  O   . HOH N 5 .   ? 35.828 -56.006 21.037  1.00 27.08 ? 1240 HOH A O   1 
HETATM 4258 O  O   . HOH N 5 .   ? 49.222 -56.887 25.276  1.00 36.79 ? 1241 HOH A O   1 
HETATM 4259 O  O   . HOH N 5 .   ? 52.165 -30.441 2.833   1.00 21.79 ? 1242 HOH A O   1 
HETATM 4260 O  O   . HOH N 5 .   ? 56.414 -30.939 -9.333  1.00 44.79 ? 1243 HOH A O   1 
HETATM 4261 O  O   . HOH N 5 .   ? 29.012 -21.446 12.963  1.00 33.20 ? 1244 HOH A O   1 
HETATM 4262 O  O   . HOH N 5 .   ? 59.088 -43.743 15.696  1.00 47.07 ? 1245 HOH A O   1 
HETATM 4263 O  O   . HOH N 5 .   ? 46.199 -19.057 -21.249 1.00 39.11 ? 1246 HOH A O   1 
HETATM 4264 O  O   . HOH N 5 .   ? 31.729 -16.422 10.684  1.00 34.30 ? 1247 HOH A O   1 
HETATM 4265 O  O   . HOH N 5 .   ? 12.208 -33.436 -25.580 1.00 47.23 ? 1248 HOH A O   1 
HETATM 4266 O  O   . HOH N 5 .   ? 23.282 -51.355 -14.863 1.00 46.05 ? 1249 HOH A O   1 
HETATM 4267 O  O   . HOH N 5 .   ? 12.927 -40.353 -12.177 1.00 40.21 ? 1250 HOH A O   1 
HETATM 4268 O  O   . HOH N 5 .   ? 23.955 -55.037 1.481   1.00 45.06 ? 1251 HOH A O   1 
HETATM 4269 O  O   . HOH N 5 .   ? 44.403 -17.122 -4.706  1.00 43.11 ? 1252 HOH A O   1 
HETATM 4270 O  O   . HOH N 5 .   ? 38.685 -49.356 -22.545 1.00 35.78 ? 1253 HOH A O   1 
HETATM 4271 O  O   . HOH N 5 .   ? 42.286 -18.943 -24.058 1.00 41.63 ? 1254 HOH A O   1 
HETATM 4272 O  O   . HOH N 5 .   ? 42.827 -57.370 9.879   1.00 33.42 ? 1255 HOH A O   1 
HETATM 4273 O  O   . HOH N 5 .   ? 31.081 -36.559 -29.693 1.00 48.94 ? 1256 HOH A O   1 
HETATM 4274 O  O   . HOH N 5 .   ? 45.923 -35.875 -8.187  1.00 35.53 ? 1257 HOH A O   1 
HETATM 4275 O  O   . HOH N 5 .   ? 40.571 -40.339 -25.256 1.00 39.50 ? 1258 HOH A O   1 
HETATM 4276 O  O   . HOH N 5 .   ? 52.322 -32.642 22.349  1.00 24.97 ? 1259 HOH A O   1 
HETATM 4277 O  O   . HOH N 5 .   ? 61.025 -53.920 6.963   1.00 43.86 ? 1260 HOH A O   1 
HETATM 4278 O  O   . HOH N 5 .   ? 24.127 -21.766 -21.415 1.00 38.34 ? 1261 HOH A O   1 
HETATM 4279 O  O   . HOH N 5 .   ? 60.997 -44.912 4.992   1.00 47.50 ? 1262 HOH A O   1 
HETATM 4280 O  O   . HOH N 5 .   ? 23.194 -18.341 -13.090 1.00 44.53 ? 1263 HOH A O   1 
HETATM 4281 O  O   . HOH N 5 .   ? 37.252 -54.181 2.594   1.00 32.45 ? 1264 HOH A O   1 
HETATM 4282 O  O   . HOH N 5 .   ? 59.977 -44.117 19.535  1.00 45.92 ? 1265 HOH A O   1 
HETATM 4283 O  O   . HOH N 5 .   ? 35.772 -58.419 9.758   1.00 48.30 ? 1266 HOH A O   1 
HETATM 4284 O  O   . HOH N 5 .   ? 58.034 -26.678 -0.320  1.00 41.19 ? 1267 HOH A O   1 
HETATM 4285 O  O   . HOH N 5 .   ? 40.788 -26.413 -29.244 1.00 28.05 ? 1268 HOH A O   1 
HETATM 4286 O  O   . HOH N 5 .   ? 55.686 -47.054 31.801  1.00 45.46 ? 1269 HOH A O   1 
HETATM 4287 O  O   . HOH N 5 .   ? 32.808 -47.219 -22.443 1.00 31.24 ? 1270 HOH A O   1 
HETATM 4288 O  O   . HOH N 5 .   ? 24.228 -53.525 -15.245 1.00 46.83 ? 1271 HOH A O   1 
HETATM 4289 O  O   . HOH N 5 .   ? 40.191 -15.103 -17.658 1.00 36.94 ? 1272 HOH A O   1 
HETATM 4290 O  O   . HOH N 5 .   ? 31.531 -25.536 22.295  1.00 45.94 ? 1273 HOH A O   1 
HETATM 4291 O  O   . HOH N 5 .   ? 51.695 -37.653 -6.253  1.00 50.33 ? 1274 HOH A O   1 
HETATM 4292 O  O   . HOH N 5 .   ? 36.061 -59.399 23.415  1.00 49.68 ? 1275 HOH A O   1 
HETATM 4293 O  O   . HOH N 5 .   ? 34.335 -18.603 -24.055 1.00 42.77 ? 1276 HOH A O   1 
HETATM 4294 O  O   . HOH N 5 .   ? 26.166 -58.293 2.206   1.00 38.81 ? 1277 HOH A O   1 
HETATM 4295 O  O   . HOH N 5 .   ? 53.317 -33.306 -0.827  1.00 27.98 ? 1278 HOH A O   1 
HETATM 4296 O  O   . HOH N 5 .   ? 46.554 -34.975 8.353   1.00 15.91 ? 1279 HOH A O   1 
HETATM 4297 O  O   . HOH N 5 .   ? 29.113 -31.208 -31.290 1.00 42.39 ? 1280 HOH A O   1 
HETATM 4298 O  O   . HOH N 5 .   ? 36.109 -48.575 33.899  1.00 45.98 ? 1281 HOH A O   1 
HETATM 4299 O  O   . HOH N 5 .   ? 18.566 -48.112 2.588   1.00 45.19 ? 1282 HOH A O   1 
HETATM 4300 O  O   . HOH N 5 .   ? 58.609 -45.610 23.244  1.00 31.73 ? 1283 HOH A O   1 
HETATM 4301 O  O   . HOH N 5 .   ? 16.791 -33.904 -30.092 1.00 45.58 ? 1284 HOH A O   1 
HETATM 4302 O  O   . HOH N 5 .   ? 35.157 -44.558 -25.468 1.00 41.51 ? 1285 HOH A O   1 
HETATM 4303 O  O   . HOH N 5 .   ? 45.744 -58.833 6.651   1.00 37.70 ? 1286 HOH A O   1 
HETATM 4304 O  O   . HOH N 5 .   ? 49.797 -57.726 3.724   1.00 37.48 ? 1287 HOH A O   1 
HETATM 4305 O  O   . HOH N 5 .   ? 23.969 -54.800 -13.116 1.00 41.42 ? 1288 HOH A O   1 
HETATM 4306 O  O   . HOH N 5 .   ? 26.491 -55.545 16.471  1.00 46.90 ? 1289 HOH A O   1 
HETATM 4307 O  O   . HOH N 5 .   ? 40.816 -48.484 32.524  1.00 52.52 ? 1290 HOH A O   1 
HETATM 4308 O  O   . HOH N 5 .   ? 41.882 -37.844 -26.967 1.00 47.69 ? 1291 HOH A O   1 
HETATM 4309 O  O   . HOH N 5 .   ? 38.771 -53.316 -26.988 1.00 30.42 ? 1292 HOH A O   1 
HETATM 4310 O  O   . HOH N 5 .   ? 33.399 -54.462 22.135  1.00 20.69 ? 1293 HOH A O   1 
HETATM 4311 O  O   . HOH N 5 .   ? 8.409  -32.179 -6.930  1.00 47.88 ? 1294 HOH A O   1 
HETATM 4312 O  O   . HOH N 5 .   ? 35.439 -14.172 6.488   1.00 33.01 ? 1295 HOH A O   1 
HETATM 4313 O  O   . HOH N 5 .   ? 19.871 -50.451 4.224   1.00 29.68 ? 1296 HOH A O   1 
HETATM 4314 O  O   . HOH N 5 .   ? 46.470 -39.083 -8.115  1.00 46.14 ? 1297 HOH A O   1 
HETATM 4315 O  O   . HOH N 5 .   ? 28.265 -15.787 -18.901 1.00 48.76 ? 1298 HOH A O   1 
HETATM 4316 O  O   . HOH N 5 .   ? 33.769 -56.528 17.178  1.00 36.78 ? 1299 HOH A O   1 
HETATM 4317 O  O   . HOH N 5 .   ? 25.611 -23.723 14.169  1.00 40.40 ? 1300 HOH A O   1 
HETATM 4318 O  O   . HOH N 5 .   ? 26.060 -54.028 -20.075 1.00 41.42 ? 1301 HOH A O   1 
HETATM 4319 O  O   . HOH N 5 .   ? 28.637 -60.875 -8.453  1.00 45.66 ? 1302 HOH A O   1 
HETATM 4320 O  O   . HOH N 5 .   ? 40.459 -54.653 5.720   1.00 33.15 ? 1303 HOH A O   1 
HETATM 4321 O  O   . HOH N 5 .   ? 55.007 -30.613 0.441   1.00 29.21 ? 1304 HOH A O   1 
HETATM 4322 O  O   . HOH N 5 .   ? 43.644 -56.235 3.937   1.00 34.35 ? 1305 HOH A O   1 
HETATM 4323 O  O   . HOH N 5 .   ? 57.976 -47.976 26.720  1.00 38.95 ? 1306 HOH A O   1 
HETATM 4324 O  O   . HOH N 5 .   ? 38.945 -13.010 -13.783 1.00 46.12 ? 1307 HOH A O   1 
HETATM 4325 O  O   . HOH N 5 .   ? 15.577 -40.058 3.027   1.00 40.04 ? 1308 HOH A O   1 
HETATM 4326 O  O   . HOH N 5 .   ? 30.980 -29.005 -30.128 1.00 36.97 ? 1309 HOH A O   1 
HETATM 4327 O  O   . HOH N 5 .   ? 56.980 -41.647 18.569  1.00 44.29 ? 1310 HOH A O   1 
HETATM 4328 O  O   . HOH N 5 .   ? 31.590 -55.634 20.451  1.00 28.05 ? 1311 HOH A O   1 
HETATM 4329 O  O   . HOH N 5 .   ? 47.255 -26.208 12.319  1.00 42.13 ? 1312 HOH A O   1 
HETATM 4330 O  O   . HOH N 5 .   ? 10.544 -38.350 -10.422 1.00 47.17 ? 1313 HOH A O   1 
HETATM 4331 O  O   . HOH N 5 .   ? 14.491 -33.784 8.710   1.00 33.02 ? 1314 HOH A O   1 
HETATM 4332 O  O   . HOH N 5 .   ? 56.485 -37.816 7.320   1.00 43.70 ? 1315 HOH A O   1 
HETATM 4333 O  O   . HOH N 5 .   ? 13.091 -39.649 -0.181  1.00 38.48 ? 1316 HOH A O   1 
HETATM 4334 O  O   . HOH N 5 .   ? 29.392 -44.866 -23.701 1.00 33.08 ? 1317 HOH A O   1 
HETATM 4335 O  O   . HOH N 5 .   ? 37.223 -15.115 -18.058 1.00 42.31 ? 1318 HOH A O   1 
HETATM 4336 O  O   . HOH N 5 .   ? 22.577 -55.877 13.753  1.00 45.66 ? 1319 HOH A O   1 
HETATM 4337 O  O   . HOH N 5 .   ? 11.164 -33.774 5.545   1.00 45.84 ? 1320 HOH A O   1 
HETATM 4338 O  O   . HOH N 5 .   ? 17.681 -48.504 -2.556  1.00 39.75 ? 1321 HOH A O   1 
HETATM 4339 O  O   . HOH N 5 .   ? 29.915 -28.986 37.194  1.00 39.20 ? 1322 HOH A O   1 
HETATM 4340 O  O   . HOH N 5 .   ? 49.772 -21.953 -21.740 1.00 43.35 ? 1323 HOH A O   1 
HETATM 4341 O  O   . HOH N 5 .   ? 28.066 -24.841 -29.637 1.00 48.82 ? 1324 HOH A O   1 
HETATM 4342 O  O   . HOH N 5 .   ? 23.465 -21.848 10.799  1.00 26.58 ? 1325 HOH A O   1 
HETATM 4343 O  O   . HOH N 5 .   ? 45.628 -21.020 -24.448 1.00 39.35 ? 1326 HOH A O   1 
HETATM 4344 O  O   . HOH N 5 .   ? 53.544 -31.185 7.880   1.00 38.30 ? 1327 HOH A O   1 
HETATM 4345 O  O   . HOH N 5 .   ? 49.206 -54.724 27.110  1.00 36.45 ? 1328 HOH A O   1 
HETATM 4346 O  O   . HOH N 5 .   ? 57.396 -31.185 -6.850  1.00 51.80 ? 1329 HOH A O   1 
HETATM 4347 O  O   . HOH N 5 .   ? 56.345 -42.799 26.285  1.00 31.27 ? 1330 HOH A O   1 
HETATM 4348 O  O   . HOH N 5 .   ? 55.939 -32.955 -1.900  1.00 54.76 ? 1331 HOH A O   1 
HETATM 4349 O  O   . HOH N 5 .   ? 48.725 -34.443 -9.432  1.00 43.70 ? 1332 HOH A O   1 
HETATM 4350 O  O   . HOH N 5 .   ? 50.409 -33.449 -6.872  1.00 41.84 ? 1333 HOH A O   1 
HETATM 4351 O  O   . HOH N 5 .   ? 28.256 -23.018 15.080  1.00 46.72 ? 1334 HOH A O   1 
HETATM 4352 O  O   . HOH N 5 .   ? 57.787 -45.282 25.698  1.00 31.69 ? 1335 HOH A O   1 
HETATM 4353 O  O   . HOH N 5 .   ? 55.850 -31.380 4.166   1.00 48.13 ? 1336 HOH A O   1 
HETATM 4354 O  O   . HOH N 5 .   ? 41.738 -54.339 2.995   1.00 32.02 ? 1337 HOH A O   1 
HETATM 4355 O  O   . HOH N 5 .   ? 39.800 -57.118 4.830   1.00 54.80 ? 1338 HOH A O   1 
HETATM 4356 O  O   . HOH N 5 .   ? 42.577 -16.228 -25.459 1.00 52.96 ? 1339 HOH A O   1 
HETATM 4357 O  O   . HOH N 5 .   ? 29.976 -26.720 -30.617 1.00 39.33 ? 1340 HOH A O   1 
HETATM 4358 O  O   . HOH N 5 .   ? 18.168 -18.286 10.546  1.00 54.57 ? 1341 HOH A O   1 
HETATM 4359 O  O   . HOH N 5 .   ? 55.077 -33.667 -12.765 1.00 53.95 ? 1342 HOH A O   1 
HETATM 4360 O  O   . HOH N 5 .   ? 47.829 -19.077 -24.557 1.00 54.45 ? 1343 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   108 ?   ?   ?   A . n 
A 1 2   VAL 2   109 109 VAL VAL A . n 
A 1 3   TYR 3   110 110 TYR TYR A . n 
A 1 4   GLN 4   111 111 GLN GLN A . n 
A 1 5   GLU 5   112 112 GLU GLU A . n 
A 1 6   PRO 6   113 113 PRO PRO A . n 
A 1 7   THR 7   114 114 THR THR A . n 
A 1 8   ASP 8   115 115 ASP ASP A . n 
A 1 9   PRO 9   116 116 PRO PRO A . n 
A 1 10  LYS 10  117 117 LYS LYS A . n 
A 1 11  PHE 11  118 118 PHE PHE A . n 
A 1 12  PRO 12  119 119 PRO PRO A . n 
A 1 13  GLN 13  120 120 GLN GLN A . n 
A 1 14  GLN 14  121 121 GLN GLN A . n 
A 1 15  TRP 15  122 122 TRP TRP A . n 
A 1 16  TYR 16  123 123 TYR TYR A . n 
A 1 17  LEU 17  124 124 LEU LEU A . n 
A 1 18  SER 18  125 125 SER SER A . n 
A 1 19  GLY 19  126 126 GLY GLY A . n 
A 1 20  VAL 20  127 127 VAL VAL A . n 
A 1 21  THR 21  128 128 THR THR A . n 
A 1 22  GLN 22  129 129 GLN GLN A . n 
A 1 23  ARG 23  130 130 ARG ARG A . n 
A 1 24  ASP 24  131 131 ASP ASP A . n 
A 1 25  LEU 25  132 132 LEU LEU A . n 
A 1 26  ASN 26  133 133 ASN ASN A . n 
A 1 27  VAL 27  134 134 VAL VAL A . n 
A 1 28  LYS 28  135 135 LYS LYS A . n 
A 1 29  ALA 29  136 136 ALA ALA A . n 
A 1 30  ALA 30  137 137 ALA ALA A . n 
A 1 31  TRP 31  138 138 TRP TRP A . n 
A 1 32  ALA 32  139 139 ALA ALA A . n 
A 1 33  GLN 33  140 140 GLN GLN A . n 
A 1 34  GLY 34  141 141 GLY GLY A . n 
A 1 35  TYR 35  142 142 TYR TYR A . n 
A 1 36  THR 36  143 143 THR THR A . n 
A 1 37  GLY 37  144 144 GLY GLY A . n 
A 1 38  HIS 38  145 145 HIS HIS A . n 
A 1 39  GLY 39  146 146 GLY GLY A . n 
A 1 40  ILE 40  147 147 ILE ILE A . n 
A 1 41  VAL 41  148 148 VAL VAL A . n 
A 1 42  VAL 42  149 149 VAL VAL A . n 
A 1 43  SER 43  150 150 SER SER A . n 
A 1 44  ILE 44  151 151 ILE ILE A . n 
A 1 45  LEU 45  152 152 LEU LEU A . n 
A 1 46  ASP 46  153 153 ASP ASP A . n 
A 1 47  ASP 47  154 154 ASP ASP A . n 
A 1 48  GLY 48  155 155 GLY GLY A . n 
A 1 49  ILE 49  156 156 ILE ILE A . n 
A 1 50  GLU 50  157 157 GLU GLU A . n 
A 1 51  LYS 51  158 158 LYS LYS A . n 
A 1 52  ASN 52  159 159 ASN ASN A . n 
A 1 53  HIS 53  160 160 HIS HIS A . n 
A 1 54  PRO 54  161 161 PRO PRO A . n 
A 1 55  ASP 55  162 162 ASP ASP A . n 
A 1 56  LEU 56  163 163 LEU LEU A . n 
A 1 57  ALA 57  164 164 ALA ALA A . n 
A 1 58  GLY 58  165 165 GLY GLY A . n 
A 1 59  ASN 59  166 166 ASN ASN A . n 
A 1 60  TYR 60  167 167 TYR TYR A . n 
A 1 61  ASP 61  168 168 ASP ASP A . n 
A 1 62  PRO 62  169 169 PRO PRO A . n 
A 1 63  GLY 63  170 170 GLY GLY A . n 
A 1 64  ALA 64  171 171 ALA ALA A . n 
A 1 65  SER 65  172 172 SER SER A . n 
A 1 66  PHE 66  173 173 PHE PHE A . n 
A 1 67  ASP 67  174 174 ASP ASP A . n 
A 1 68  VAL 68  175 175 VAL VAL A . n 
A 1 69  ASN 69  176 176 ASN ASN A . n 
A 1 70  ASP 70  177 177 ASP ASP A . n 
A 1 71  GLN 71  178 178 GLN GLN A . n 
A 1 72  ASP 72  179 179 ASP ASP A . n 
A 1 73  PRO 73  180 180 PRO PRO A . n 
A 1 74  ASP 74  181 181 ASP ASP A . n 
A 1 75  PRO 75  182 182 PRO PRO A . n 
A 1 76  GLN 76  183 183 GLN GLN A . n 
A 1 77  PRO 77  184 184 PRO PRO A . n 
A 1 78  ARG 78  185 185 ARG ARG A . n 
A 1 79  TYR 79  186 186 TYR TYR A . n 
A 1 80  THR 80  187 187 THR THR A . n 
A 1 81  GLN 81  188 188 GLN GLN A . n 
A 1 82  MET 82  189 189 MET MET A . n 
A 1 83  ASN 83  190 190 ASN ASN A . n 
A 1 84  ASP 84  191 191 ASP ASP A . n 
A 1 85  ASN 85  192 192 ASN ASN A . n 
A 1 86  ARG 86  193 193 ARG ARG A . n 
A 1 87  HIS 87  194 194 HIS HIS A . n 
A 1 88  GLY 88  195 195 GLY GLY A . n 
A 1 89  THR 89  196 196 THR THR A . n 
A 1 90  ARG 90  197 197 ARG ARG A . n 
A 1 91  CYS 91  198 198 CYS CYS A . n 
A 1 92  ALA 92  199 199 ALA ALA A . n 
A 1 93  GLY 93  200 200 GLY GLY A . n 
A 1 94  GLU 94  201 201 GLU GLU A . n 
A 1 95  VAL 95  202 202 VAL VAL A . n 
A 1 96  ALA 96  203 203 ALA ALA A . n 
A 1 97  ALA 97  204 204 ALA ALA A . n 
A 1 98  VAL 98  205 205 VAL VAL A . n 
A 1 99  ALA 99  206 206 ALA ALA A . n 
A 1 100 ASN 100 207 207 ASN ASN A . n 
A 1 101 ASN 101 208 208 ASN ASN A . n 
A 1 102 GLY 102 209 209 GLY GLY A . n 
A 1 103 VAL 103 210 210 VAL VAL A . n 
A 1 104 CYS 104 211 211 CYS CYS A . n 
A 1 105 GLY 105 212 212 GLY GLY A . n 
A 1 106 VAL 106 213 213 VAL VAL A . n 
A 1 107 GLY 107 214 214 GLY GLY A . n 
A 1 108 VAL 108 215 215 VAL VAL A . n 
A 1 109 ALA 109 216 216 ALA ALA A . n 
A 1 110 TYR 110 217 217 TYR TYR A . n 
A 1 111 ASN 111 218 218 ASN ASN A . n 
A 1 112 ALA 112 219 219 ALA ALA A . n 
A 1 113 ARG 113 220 220 ARG ARG A . n 
A 1 114 ILE 114 221 221 ILE ILE A . n 
A 1 115 GLY 115 222 222 GLY GLY A . n 
A 1 116 GLY 116 223 223 GLY GLY A . n 
A 1 117 VAL 117 224 224 VAL VAL A . n 
A 1 118 ARG 118 225 225 ARG ARG A . n 
A 1 119 MET 119 226 226 MET MET A . n 
A 1 120 LEU 120 227 227 LEU LEU A . n 
A 1 121 ASP 121 228 228 ASP ASP A . n 
A 1 122 GLY 122 229 229 GLY GLY A . n 
A 1 123 GLU 123 230 230 GLU GLU A . n 
A 1 124 VAL 124 231 231 VAL VAL A . n 
A 1 125 THR 125 232 232 THR THR A . n 
A 1 126 ASP 126 233 233 ASP ASP A . n 
A 1 127 ALA 127 234 234 ALA ALA A . n 
A 1 128 VAL 128 235 235 VAL VAL A . n 
A 1 129 GLU 129 236 236 GLU GLU A . n 
A 1 130 ALA 130 237 237 ALA ALA A . n 
A 1 131 ARG 131 238 238 ARG ARG A . n 
A 1 132 SER 132 239 239 SER SER A . n 
A 1 133 LEU 133 240 240 LEU LEU A . n 
A 1 134 GLY 134 241 241 GLY GLY A . n 
A 1 135 LEU 135 242 242 LEU LEU A . n 
A 1 136 ASN 136 243 243 ASN ASN A . n 
A 1 137 PRO 137 244 244 PRO PRO A . n 
A 1 138 ASN 138 245 245 ASN ASN A . n 
A 1 139 HIS 139 246 246 HIS HIS A . n 
A 1 140 ILE 140 247 247 ILE ILE A . n 
A 1 141 HIS 141 248 248 HIS HIS A . n 
A 1 142 ILE 142 249 249 ILE ILE A . n 
A 1 143 TYR 143 250 250 TYR TYR A . n 
A 1 144 SER 144 251 251 SER SER A . n 
A 1 145 ALA 145 252 252 ALA ALA A . n 
A 1 146 SER 146 253 253 SER SER A . n 
A 1 147 TRP 147 254 254 TRP TRP A . n 
A 1 148 GLY 148 255 255 GLY GLY A . n 
A 1 149 PRO 149 256 256 PRO PRO A . n 
A 1 150 GLU 150 257 257 GLU GLU A . n 
A 1 151 ASP 151 258 258 ASP ASP A . n 
A 1 152 ASP 152 259 259 ASP ASP A . n 
A 1 153 GLY 153 260 260 GLY GLY A . n 
A 1 154 LYS 154 261 261 LYS LYS A . n 
A 1 155 THR 155 262 262 THR THR A . n 
A 1 156 VAL 156 263 263 VAL VAL A . n 
A 1 157 ASP 157 264 264 ASP ASP A . n 
A 1 158 GLY 158 265 265 GLY GLY A . n 
A 1 159 PRO 159 266 266 PRO PRO A . n 
A 1 160 ALA 160 267 267 ALA ALA A . n 
A 1 161 ARG 161 268 268 ARG ARG A . n 
A 1 162 LEU 162 269 269 LEU LEU A . n 
A 1 163 ALA 163 270 270 ALA ALA A . n 
A 1 164 GLU 164 271 271 GLU GLU A . n 
A 1 165 GLU 165 272 272 GLU GLU A . n 
A 1 166 ALA 166 273 273 ALA ALA A . n 
A 1 167 PHE 167 274 274 PHE PHE A . n 
A 1 168 PHE 168 275 275 PHE PHE A . n 
A 1 169 ARG 169 276 276 ARG ARG A . n 
A 1 170 GLY 170 277 277 GLY GLY A . n 
A 1 171 VAL 171 278 278 VAL VAL A . n 
A 1 172 SER 172 279 279 SER SER A . n 
A 1 173 GLN 173 280 280 GLN GLN A . n 
A 1 174 GLY 174 281 281 GLY GLY A . n 
A 1 175 ARG 175 282 282 ARG ARG A . n 
A 1 176 GLY 176 283 283 GLY GLY A . n 
A 1 177 GLY 177 284 284 GLY GLY A . n 
A 1 178 LEU 178 285 285 LEU LEU A . n 
A 1 179 GLY 179 286 286 GLY GLY A . n 
A 1 180 SER 180 287 287 SER SER A . n 
A 1 181 ILE 181 288 288 ILE ILE A . n 
A 1 182 PHE 182 289 289 PHE PHE A . n 
A 1 183 VAL 183 290 290 VAL VAL A . n 
A 1 184 TRP 184 291 291 TRP TRP A . n 
A 1 185 ALA 185 292 292 ALA ALA A . n 
A 1 186 SER 186 293 293 SER SER A . n 
A 1 187 GLY 187 294 294 GLY GLY A . n 
A 1 188 ASN 188 295 295 ASN ASN A . n 
A 1 189 GLY 189 296 296 GLY GLY A . n 
A 1 190 GLY 190 297 297 GLY GLY A . n 
A 1 191 ARG 191 298 298 ARG ARG A . n 
A 1 192 GLU 192 299 299 GLU GLU A . n 
A 1 193 HIS 193 300 300 HIS HIS A . n 
A 1 194 ASP 194 301 301 ASP ASP A . n 
A 1 195 SER 195 302 302 SER SER A . n 
A 1 196 CYS 196 303 303 CYS CYS A . n 
A 1 197 ASN 197 304 304 ASN ASN A . n 
A 1 198 CYS 198 305 305 CYS CYS A . n 
A 1 199 ASP 199 306 306 ASP ASP A . n 
A 1 200 GLY 200 307 307 GLY GLY A . n 
A 1 201 TYR 201 308 308 TYR TYR A . n 
A 1 202 THR 202 309 309 THR THR A . n 
A 1 203 ASN 203 310 310 ASN ASN A . n 
A 1 204 SER 204 311 311 SER SER A . n 
A 1 205 ILE 205 312 312 ILE ILE A . n 
A 1 206 TYR 206 313 313 TYR TYR A . n 
A 1 207 THR 207 314 314 THR THR A . n 
A 1 208 LEU 208 315 315 LEU LEU A . n 
A 1 209 SER 209 316 316 SER SER A . n 
A 1 210 ILE 210 317 317 ILE ILE A . n 
A 1 211 SER 211 318 318 SER SER A . n 
A 1 212 SER 212 319 319 SER SER A . n 
A 1 213 ALA 213 320 320 ALA ALA A . n 
A 1 214 THR 214 321 321 THR THR A . n 
A 1 215 GLN 215 322 322 GLN GLN A . n 
A 1 216 PHE 216 323 323 PHE PHE A . n 
A 1 217 GLY 217 324 324 GLY GLY A . n 
A 1 218 ASN 218 325 325 ASN ASN A . n 
A 1 219 VAL 219 326 326 VAL VAL A . n 
A 1 220 PRO 220 327 327 PRO PRO A . n 
A 1 221 TRP 221 328 328 TRP TRP A . n 
A 1 222 TYR 222 329 329 TYR TYR A . n 
A 1 223 SER 223 330 330 SER SER A . n 
A 1 224 GLU 224 331 331 GLU GLU A . n 
A 1 225 ALA 225 332 332 ALA ALA A . n 
A 1 226 CYS 226 333 333 CYS CYS A . n 
A 1 227 SER 227 334 334 SER SER A . n 
A 1 228 SER 228 335 335 SER SER A . n 
A 1 229 THR 229 336 336 THR THR A . n 
A 1 230 LEU 230 337 337 LEU LEU A . n 
A 1 231 ALA 231 338 338 ALA ALA A . n 
A 1 232 THR 232 339 339 THR THR A . n 
A 1 233 THR 233 340 340 THR THR A . n 
A 1 234 TYR 234 341 341 TYR TYR A . n 
A 1 235 SER 235 342 342 SER SER A . n 
A 1 236 SER 236 343 343 SER SER A . n 
A 1 237 GLY 237 344 344 GLY GLY A . n 
A 1 238 ASN 238 345 345 ASN ASN A . n 
A 1 239 GLN 239 346 346 GLN GLN A . n 
A 1 240 ASN 240 347 347 ASN ASN A . n 
A 1 241 GLU 241 348 348 GLU GLU A . n 
A 1 242 LYS 242 349 349 LYS LYS A . n 
A 1 243 GLN 243 350 350 GLN GLN A . n 
A 1 244 ILE 244 351 351 ILE ILE A . n 
A 1 245 VAL 245 352 352 VAL VAL A . n 
A 1 246 THR 246 353 353 THR THR A . n 
A 1 247 THR 247 354 354 THR THR A . n 
A 1 248 ASP 248 355 355 ASP ASP A . n 
A 1 249 LEU 249 356 356 LEU LEU A . n 
A 1 250 ARG 250 357 357 ARG ARG A . n 
A 1 251 GLN 251 358 358 GLN GLN A . n 
A 1 252 LYS 252 359 359 LYS LYS A . n 
A 1 253 CYS 253 360 360 CYS CYS A . n 
A 1 254 THR 254 361 361 THR THR A . n 
A 1 255 GLU 255 362 362 GLU GLU A . n 
A 1 256 SER 256 363 363 SER SER A . n 
A 1 257 HIS 257 364 364 HIS HIS A . n 
A 1 258 THR 258 365 365 THR THR A . n 
A 1 259 GLY 259 366 366 GLY GLY A . n 
A 1 260 THR 260 367 367 THR THR A . n 
A 1 261 SER 261 368 368 SER SER A . n 
A 1 262 ALA 262 369 369 ALA ALA A . n 
A 1 263 SER 263 370 370 SER SER A . n 
A 1 264 ALA 264 371 371 ALA ALA A . n 
A 1 265 PRO 265 372 372 PRO PRO A . n 
A 1 266 LEU 266 373 373 LEU LEU A . n 
A 1 267 ALA 267 374 374 ALA ALA A . n 
A 1 268 ALA 268 375 375 ALA ALA A . n 
A 1 269 GLY 269 376 376 GLY GLY A . n 
A 1 270 ILE 270 377 377 ILE ILE A . n 
A 1 271 ILE 271 378 378 ILE ILE A . n 
A 1 272 ALA 272 379 379 ALA ALA A . n 
A 1 273 LEU 273 380 380 LEU LEU A . n 
A 1 274 THR 274 381 381 THR THR A . n 
A 1 275 LEU 275 382 382 LEU LEU A . n 
A 1 276 GLU 276 383 383 GLU GLU A . n 
A 1 277 ALA 277 384 384 ALA ALA A . n 
A 1 278 ASN 278 385 385 ASN ASN A . n 
A 1 279 LYS 279 386 386 LYS LYS A . n 
A 1 280 ASN 280 387 387 ASN ASN A . n 
A 1 281 LEU 281 388 388 LEU LEU A . n 
A 1 282 THR 282 389 389 THR THR A . n 
A 1 283 TRP 283 390 390 TRP TRP A . n 
A 1 284 ARG 284 391 391 ARG ARG A . n 
A 1 285 ASP 285 392 392 ASP ASP A . n 
A 1 286 MET 286 393 393 MET MET A . n 
A 1 287 GLN 287 394 394 GLN GLN A . n 
A 1 288 HIS 288 395 395 HIS HIS A . n 
A 1 289 LEU 289 396 396 LEU LEU A . n 
A 1 290 VAL 290 397 397 VAL VAL A . n 
A 1 291 VAL 291 398 398 VAL VAL A . n 
A 1 292 GLN 292 399 399 GLN GLN A . n 
A 1 293 THR 293 400 400 THR THR A . n 
A 1 294 SER 294 401 401 SER SER A . n 
A 1 295 LYS 295 402 402 LYS LYS A . n 
A 1 296 PRO 296 403 403 PRO PRO A . n 
A 1 297 ALA 297 404 404 ALA ALA A . n 
A 1 298 HIS 298 405 405 HIS HIS A . n 
A 1 299 LEU 299 406 406 LEU LEU A . n 
A 1 300 ASN 300 407 407 ASN ASN A . n 
A 1 301 ALA 301 408 408 ALA ALA A . n 
A 1 302 ASN 302 409 409 ASN ASN A . n 
A 1 303 ASP 303 410 410 ASP ASP A . n 
A 1 304 TRP 304 411 411 TRP TRP A . n 
A 1 305 ALA 305 412 412 ALA ALA A . n 
A 1 306 THR 306 413 413 THR THR A . n 
A 1 307 ASN 307 414 414 ASN ASN A . n 
A 1 308 GLY 308 415 415 GLY GLY A . n 
A 1 309 VAL 309 416 416 VAL VAL A . n 
A 1 310 GLY 310 417 417 GLY GLY A . n 
A 1 311 ARG 311 418 418 ARG ARG A . n 
A 1 312 LYS 312 419 419 LYS LYS A . n 
A 1 313 VAL 313 420 420 VAL VAL A . n 
A 1 314 SER 314 421 421 SER SER A . n 
A 1 315 HIS 315 422 422 HIS HIS A . n 
A 1 316 SER 316 423 423 SER SER A . n 
A 1 317 TYR 317 424 424 TYR TYR A . n 
A 1 318 GLY 318 425 425 GLY GLY A . n 
A 1 319 TYR 319 426 426 TYR TYR A . n 
A 1 320 GLY 320 427 427 GLY GLY A . n 
A 1 321 LEU 321 428 428 LEU LEU A . n 
A 1 322 LEU 322 429 429 LEU LEU A . n 
A 1 323 ASP 323 430 430 ASP ASP A . n 
A 1 324 ALA 324 431 431 ALA ALA A . n 
A 1 325 GLY 325 432 432 GLY GLY A . n 
A 1 326 ALA 326 433 433 ALA ALA A . n 
A 1 327 MET 327 434 434 MET MET A . n 
A 1 328 VAL 328 435 435 VAL VAL A . n 
A 1 329 ALA 329 436 436 ALA ALA A . n 
A 1 330 LEU 330 437 437 LEU LEU A . n 
A 1 331 ALA 331 438 438 ALA ALA A . n 
A 1 332 GLN 332 439 439 GLN GLN A . n 
A 1 333 ASN 333 440 440 ASN ASN A . n 
A 1 334 TRP 334 441 441 TRP TRP A . n 
A 1 335 THR 335 442 442 THR THR A . n 
A 1 336 THR 336 443 443 THR THR A . n 
A 1 337 VAL 337 444 444 VAL VAL A . n 
A 1 338 ALA 338 445 445 ALA ALA A . n 
A 1 339 PRO 339 446 446 PRO PRO A . n 
A 1 340 GLN 340 447 447 GLN GLN A . n 
A 1 341 ARG 341 448 448 ARG ARG A . n 
A 1 342 LYS 342 449 449 LYS LYS A . n 
A 1 343 CYS 343 450 450 CYS CYS A . n 
A 1 344 ILE 344 451 451 ILE ILE A . n 
A 1 345 ILE 345 452 452 ILE ILE A . n 
A 1 346 ASP 346 453 453 ASP ASP A . n 
A 1 347 ILE 347 454 454 ILE ILE A . n 
A 1 348 LEU 348 455 455 LEU LEU A . n 
A 1 349 THR 349 456 456 THR THR A . n 
A 1 350 GLU 350 457 457 GLU GLU A . n 
A 1 351 PRO 351 458 458 PRO PRO A . n 
A 1 352 LYS 352 459 459 LYS LYS A . n 
A 1 353 ASP 353 460 460 ASP ASP A . n 
A 1 354 ILE 354 461 461 ILE ILE A . n 
A 1 355 GLY 355 462 462 GLY GLY A . n 
A 1 356 LYS 356 463 463 LYS LYS A . n 
A 1 357 ARG 357 464 464 ARG ARG A . n 
A 1 358 LEU 358 465 465 LEU LEU A . n 
A 1 359 GLU 359 466 466 GLU GLU A . n 
A 1 360 VAL 360 467 467 VAL VAL A . n 
A 1 361 ARG 361 468 468 ARG ARG A . n 
A 1 362 LYS 362 469 469 LYS LYS A . n 
A 1 363 THR 363 470 470 THR THR A . n 
A 1 364 VAL 364 471 471 VAL VAL A . n 
A 1 365 THR 365 472 472 THR THR A . n 
A 1 366 ALA 366 473 473 ALA ALA A . n 
A 1 367 CYS 367 474 474 CYS CYS A . n 
A 1 368 LEU 368 475 475 LEU LEU A . n 
A 1 369 GLY 369 476 476 GLY GLY A . n 
A 1 370 GLU 370 477 477 GLU GLU A . n 
A 1 371 PRO 371 478 478 PRO PRO A . n 
A 1 372 ASN 372 479 479 ASN ASN A . n 
A 1 373 HIS 373 480 480 HIS HIS A . n 
A 1 374 ILE 374 481 481 ILE ILE A . n 
A 1 375 THR 375 482 482 THR THR A . n 
A 1 376 ARG 376 483 483 ARG ARG A . n 
A 1 377 LEU 377 484 484 LEU LEU A . n 
A 1 378 GLU 378 485 485 GLU GLU A . n 
A 1 379 HIS 379 486 486 HIS HIS A . n 
A 1 380 ALA 380 487 487 ALA ALA A . n 
A 1 381 GLN 381 488 488 GLN GLN A . n 
A 1 382 ALA 382 489 489 ALA ALA A . n 
A 1 383 ARG 383 490 490 ARG ARG A . n 
A 1 384 LEU 384 491 491 LEU LEU A . n 
A 1 385 THR 385 492 492 THR THR A . n 
A 1 386 LEU 386 493 493 LEU LEU A . n 
A 1 387 SER 387 494 494 SER SER A . n 
A 1 388 TYR 388 495 495 TYR TYR A . n 
A 1 389 ASN 389 496 496 ASN ASN A . n 
A 1 390 ARG 390 497 497 ARG ARG A . n 
A 1 391 ARG 391 498 498 ARG ARG A . n 
A 1 392 GLY 392 499 499 GLY GLY A . n 
A 1 393 ASP 393 500 500 ASP ASP A . n 
A 1 394 LEU 394 501 501 LEU LEU A . n 
A 1 395 ALA 395 502 502 ALA ALA A . n 
A 1 396 ILE 396 503 503 ILE ILE A . n 
A 1 397 HIS 397 504 504 HIS HIS A . n 
A 1 398 LEU 398 505 505 LEU LEU A . n 
A 1 399 VAL 399 506 506 VAL VAL A . n 
A 1 400 SER 400 507 507 SER SER A . n 
A 1 401 PRO 401 508 508 PRO PRO A . n 
A 1 402 MET 402 509 509 MET MET A . n 
A 1 403 GLY 403 510 510 GLY GLY A . n 
A 1 404 THR 404 511 511 THR THR A . n 
A 1 405 ARG 405 512 512 ARG ARG A . n 
A 1 406 SER 406 513 513 SER SER A . n 
A 1 407 THR 407 514 514 THR THR A . n 
A 1 408 LEU 408 515 515 LEU LEU A . n 
A 1 409 LEU 409 516 516 LEU LEU A . n 
A 1 410 ALA 410 517 517 ALA ALA A . n 
A 1 411 ALA 411 518 518 ALA ALA A . n 
A 1 412 ARG 412 519 519 ARG ARG A . n 
A 1 413 PRO 413 520 520 PRO PRO A . n 
A 1 414 HIS 414 521 521 HIS HIS A . n 
A 1 415 ASP 415 522 522 ASP ASP A . n 
A 1 416 TYR 416 523 523 TYR TYR A . n 
A 1 417 SER 417 524 524 SER SER A . n 
A 1 418 ALA 418 525 525 ALA ALA A . n 
A 1 419 ASP 419 526 526 ASP ASP A . n 
A 1 420 GLY 420 527 527 GLY GLY A . n 
A 1 421 PHE 421 528 528 PHE PHE A . n 
A 1 422 ASN 422 529 529 ASN ASN A . n 
A 1 423 ASP 423 530 530 ASP ASP A . n 
A 1 424 TRP 424 531 531 TRP TRP A . n 
A 1 425 ALA 425 532 532 ALA ALA A . n 
A 1 426 PHE 426 533 533 PHE PHE A . n 
A 1 427 MET 427 534 534 MET MET A . n 
A 1 428 THR 428 535 535 THR THR A . n 
A 1 429 THR 429 536 536 THR THR A . n 
A 1 430 HIS 430 537 537 HIS HIS A . n 
A 1 431 SER 431 538 538 SER SER A . n 
A 1 432 TRP 432 539 539 TRP TRP A . n 
A 1 433 ASP 433 540 540 ASP ASP A . n 
A 1 434 GLU 434 541 541 GLU GLU A . n 
A 1 435 ASP 435 542 542 ASP ASP A . n 
A 1 436 PRO 436 543 543 PRO PRO A . n 
A 1 437 SER 437 544 544 SER SER A . n 
A 1 438 GLY 438 545 545 GLY GLY A . n 
A 1 439 GLU 439 546 546 GLU GLU A . n 
A 1 440 TRP 440 547 547 TRP TRP A . n 
A 1 441 VAL 441 548 548 VAL VAL A . n 
A 1 442 LEU 442 549 549 LEU LEU A . n 
A 1 443 GLU 443 550 550 GLU GLU A . n 
A 1 444 ILE 444 551 551 ILE ILE A . n 
A 1 445 GLU 445 552 552 GLU GLU A . n 
A 1 446 ASN 446 553 553 ASN ASN A . n 
A 1 447 THR 447 554 554 THR THR A . n 
A 1 448 SER 448 555 555 SER SER A . n 
A 1 449 GLU 449 556 556 GLU GLU A . n 
A 1 450 ALA 450 557 557 ALA ALA A . n 
A 1 451 ASN 451 558 558 ASN ASN A . n 
A 1 452 ASN 452 559 559 ASN ASN A . n 
A 1 453 TYR 453 560 560 TYR TYR A . n 
A 1 454 GLY 454 561 561 GLY GLY A . n 
A 1 455 THR 455 562 562 THR THR A . n 
A 1 456 LEU 456 563 563 LEU LEU A . n 
A 1 457 THR 457 564 564 THR THR A . n 
A 1 458 LYS 458 565 565 LYS LYS A . n 
A 1 459 PHE 459 566 566 PHE PHE A . n 
A 1 460 THR 460 567 567 THR THR A . n 
A 1 461 LEU 461 568 568 LEU LEU A . n 
A 1 462 VAL 462 569 569 VAL VAL A . n 
A 1 463 LEU 463 570 570 LEU LEU A . n 
A 1 464 TYR 464 571 571 TYR TYR A . n 
A 1 465 GLY 465 572 572 GLY GLY A . n 
A 1 466 THR 466 573 573 THR THR A . n 
A 1 467 ALA 467 574 574 ALA ALA A . n 
A 1 468 SER 468 575 575 SER SER A . n 
A 1 469 GLY 469 576 576 GLY GLY A . n 
A 1 470 SER 470 577 577 SER SER A . n 
A 1 471 LEU 471 578 578 LEU LEU A . n 
A 1 472 VAL 472 579 579 VAL VAL A . n 
A 1 473 PRO 473 580 580 PRO PRO A . n 
A 1 474 ARG 474 581 581 ARG ARG A . n 
A 1 475 GLY 475 582 ?   ?   ?   A . n 
A 1 476 SER 476 583 ?   ?   ?   A . n 
A 1 477 HIS 477 584 ?   ?   ?   A . n 
A 1 478 HIS 478 585 ?   ?   ?   A . n 
A 1 479 HIS 479 586 ?   ?   ?   A . n 
A 1 480 HIS 480 587 ?   ?   ?   A . n 
A 1 481 HIS 481 588 ?   ?   ?   A . n 
A 1 482 HIS 482 589 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1   601  1   CA  CA  A . 
C 2 CA  1   602  2   CA  CA  A . 
D 2 CA  1   603  3   CA  CA  A . 
E 3 NA  1   604  4   NA  NA  A . 
F 3 NA  1   605  5   NA  NA  A . 
G 3 NA  1   606  6   NA  NA  A . 
H 3 NA  1   607  7   NA  NA  A . 
I 3 NA  1   608  8   NA  NA  A . 
J 3 NA  1   609  9   NA  NA  A . 
K 3 NA  1   610  10  NA  NA  A . 
L 3 NA  1   611  11  NA  NA  A . 
M 4 CL  1   612  12  CL  CL  A . 
N 5 HOH 1   701  41  HOH HOH A . 
N 5 HOH 2   702  272 HOH HOH A . 
N 5 HOH 3   703  607 HOH HOH A . 
N 5 HOH 4   704  189 HOH HOH A . 
N 5 HOH 5   705  412 HOH HOH A . 
N 5 HOH 6   706  662 HOH HOH A . 
N 5 HOH 7   707  284 HOH HOH A . 
N 5 HOH 8   708  201 HOH HOH A . 
N 5 HOH 9   709  227 HOH HOH A . 
N 5 HOH 10  710  555 HOH HOH A . 
N 5 HOH 11  711  166 HOH HOH A . 
N 5 HOH 12  712  608 HOH HOH A . 
N 5 HOH 13  713  515 HOH HOH A . 
N 5 HOH 14  714  108 HOH HOH A . 
N 5 HOH 15  715  234 HOH HOH A . 
N 5 HOH 16  716  226 HOH HOH A . 
N 5 HOH 17  717  483 HOH HOH A . 
N 5 HOH 18  718  464 HOH HOH A . 
N 5 HOH 19  719  179 HOH HOH A . 
N 5 HOH 20  720  587 HOH HOH A . 
N 5 HOH 21  721  584 HOH HOH A . 
N 5 HOH 22  722  726 HOH HOH A . 
N 5 HOH 23  723  157 HOH HOH A . 
N 5 HOH 24  724  56  HOH HOH A . 
N 5 HOH 25  725  217 HOH HOH A . 
N 5 HOH 26  726  324 HOH HOH A . 
N 5 HOH 27  727  53  HOH HOH A . 
N 5 HOH 28  728  605 HOH HOH A . 
N 5 HOH 29  729  187 HOH HOH A . 
N 5 HOH 30  730  354 HOH HOH A . 
N 5 HOH 31  731  177 HOH HOH A . 
N 5 HOH 32  732  231 HOH HOH A . 
N 5 HOH 33  733  238 HOH HOH A . 
N 5 HOH 34  734  223 HOH HOH A . 
N 5 HOH 35  735  591 HOH HOH A . 
N 5 HOH 36  736  206 HOH HOH A . 
N 5 HOH 37  737  93  HOH HOH A . 
N 5 HOH 38  738  288 HOH HOH A . 
N 5 HOH 39  739  199 HOH HOH A . 
N 5 HOH 40  740  380 HOH HOH A . 
N 5 HOH 41  741  173 HOH HOH A . 
N 5 HOH 42  742  228 HOH HOH A . 
N 5 HOH 43  743  178 HOH HOH A . 
N 5 HOH 44  744  263 HOH HOH A . 
N 5 HOH 45  745  188 HOH HOH A . 
N 5 HOH 46  746  428 HOH HOH A . 
N 5 HOH 47  747  14  HOH HOH A . 
N 5 HOH 48  748  310 HOH HOH A . 
N 5 HOH 49  749  153 HOH HOH A . 
N 5 HOH 50  750  162 HOH HOH A . 
N 5 HOH 51  751  3   HOH HOH A . 
N 5 HOH 52  752  548 HOH HOH A . 
N 5 HOH 53  753  119 HOH HOH A . 
N 5 HOH 54  754  661 HOH HOH A . 
N 5 HOH 55  755  278 HOH HOH A . 
N 5 HOH 56  756  140 HOH HOH A . 
N 5 HOH 57  757  95  HOH HOH A . 
N 5 HOH 58  758  80  HOH HOH A . 
N 5 HOH 59  759  20  HOH HOH A . 
N 5 HOH 60  760  259 HOH HOH A . 
N 5 HOH 61  761  579 HOH HOH A . 
N 5 HOH 62  762  725 HOH HOH A . 
N 5 HOH 63  763  522 HOH HOH A . 
N 5 HOH 64  764  164 HOH HOH A . 
N 5 HOH 65  765  90  HOH HOH A . 
N 5 HOH 66  766  126 HOH HOH A . 
N 5 HOH 67  767  440 HOH HOH A . 
N 5 HOH 68  768  308 HOH HOH A . 
N 5 HOH 69  769  244 HOH HOH A . 
N 5 HOH 70  770  360 HOH HOH A . 
N 5 HOH 71  771  208 HOH HOH A . 
N 5 HOH 72  772  335 HOH HOH A . 
N 5 HOH 73  773  152 HOH HOH A . 
N 5 HOH 74  774  250 HOH HOH A . 
N 5 HOH 75  775  39  HOH HOH A . 
N 5 HOH 76  776  271 HOH HOH A . 
N 5 HOH 77  777  524 HOH HOH A . 
N 5 HOH 78  778  215 HOH HOH A . 
N 5 HOH 79  779  484 HOH HOH A . 
N 5 HOH 80  780  654 HOH HOH A . 
N 5 HOH 81  781  342 HOH HOH A . 
N 5 HOH 82  782  754 HOH HOH A . 
N 5 HOH 83  783  343 HOH HOH A . 
N 5 HOH 84  784  136 HOH HOH A . 
N 5 HOH 85  785  274 HOH HOH A . 
N 5 HOH 86  786  2   HOH HOH A . 
N 5 HOH 87  787  121 HOH HOH A . 
N 5 HOH 88  788  333 HOH HOH A . 
N 5 HOH 89  789  33  HOH HOH A . 
N 5 HOH 90  790  100 HOH HOH A . 
N 5 HOH 91  791  181 HOH HOH A . 
N 5 HOH 92  792  235 HOH HOH A . 
N 5 HOH 93  793  155 HOH HOH A . 
N 5 HOH 94  794  556 HOH HOH A . 
N 5 HOH 95  795  55  HOH HOH A . 
N 5 HOH 96  796  219 HOH HOH A . 
N 5 HOH 97  797  294 HOH HOH A . 
N 5 HOH 98  798  84  HOH HOH A . 
N 5 HOH 99  799  50  HOH HOH A . 
N 5 HOH 100 800  281 HOH HOH A . 
N 5 HOH 101 801  70  HOH HOH A . 
N 5 HOH 102 802  58  HOH HOH A . 
N 5 HOH 103 803  431 HOH HOH A . 
N 5 HOH 104 804  203 HOH HOH A . 
N 5 HOH 105 805  28  HOH HOH A . 
N 5 HOH 106 806  61  HOH HOH A . 
N 5 HOH 107 807  633 HOH HOH A . 
N 5 HOH 108 808  29  HOH HOH A . 
N 5 HOH 109 809  116 HOH HOH A . 
N 5 HOH 110 810  172 HOH HOH A . 
N 5 HOH 111 811  401 HOH HOH A . 
N 5 HOH 112 812  40  HOH HOH A . 
N 5 HOH 113 813  37  HOH HOH A . 
N 5 HOH 114 814  17  HOH HOH A . 
N 5 HOH 115 815  85  HOH HOH A . 
N 5 HOH 116 816  44  HOH HOH A . 
N 5 HOH 117 817  163 HOH HOH A . 
N 5 HOH 118 818  330 HOH HOH A . 
N 5 HOH 119 819  221 HOH HOH A . 
N 5 HOH 120 820  19  HOH HOH A . 
N 5 HOH 121 821  486 HOH HOH A . 
N 5 HOH 122 822  115 HOH HOH A . 
N 5 HOH 123 823  43  HOH HOH A . 
N 5 HOH 124 824  142 HOH HOH A . 
N 5 HOH 125 825  82  HOH HOH A . 
N 5 HOH 126 826  145 HOH HOH A . 
N 5 HOH 127 827  47  HOH HOH A . 
N 5 HOH 128 828  337 HOH HOH A . 
N 5 HOH 129 829  405 HOH HOH A . 
N 5 HOH 130 830  270 HOH HOH A . 
N 5 HOH 131 831  312 HOH HOH A . 
N 5 HOH 132 832  675 HOH HOH A . 
N 5 HOH 133 833  148 HOH HOH A . 
N 5 HOH 134 834  211 HOH HOH A . 
N 5 HOH 135 835  609 HOH HOH A . 
N 5 HOH 136 836  314 HOH HOH A . 
N 5 HOH 137 837  139 HOH HOH A . 
N 5 HOH 138 838  5   HOH HOH A . 
N 5 HOH 139 839  150 HOH HOH A . 
N 5 HOH 140 840  133 HOH HOH A . 
N 5 HOH 141 841  48  HOH HOH A . 
N 5 HOH 142 842  24  HOH HOH A . 
N 5 HOH 143 843  434 HOH HOH A . 
N 5 HOH 144 844  429 HOH HOH A . 
N 5 HOH 145 845  315 HOH HOH A . 
N 5 HOH 146 846  373 HOH HOH A . 
N 5 HOH 147 847  92  HOH HOH A . 
N 5 HOH 148 848  147 HOH HOH A . 
N 5 HOH 149 849  106 HOH HOH A . 
N 5 HOH 150 850  267 HOH HOH A . 
N 5 HOH 151 851  534 HOH HOH A . 
N 5 HOH 152 852  81  HOH HOH A . 
N 5 HOH 153 853  9   HOH HOH A . 
N 5 HOH 154 854  109 HOH HOH A . 
N 5 HOH 155 855  590 HOH HOH A . 
N 5 HOH 156 856  205 HOH HOH A . 
N 5 HOH 157 857  425 HOH HOH A . 
N 5 HOH 158 858  348 HOH HOH A . 
N 5 HOH 159 859  275 HOH HOH A . 
N 5 HOH 160 860  193 HOH HOH A . 
N 5 HOH 161 861  69  HOH HOH A . 
N 5 HOH 162 862  309 HOH HOH A . 
N 5 HOH 163 863  613 HOH HOH A . 
N 5 HOH 164 864  23  HOH HOH A . 
N 5 HOH 165 865  22  HOH HOH A . 
N 5 HOH 166 866  427 HOH HOH A . 
N 5 HOH 167 867  34  HOH HOH A . 
N 5 HOH 168 868  383 HOH HOH A . 
N 5 HOH 169 869  146 HOH HOH A . 
N 5 HOH 170 870  134 HOH HOH A . 
N 5 HOH 171 871  10  HOH HOH A . 
N 5 HOH 172 872  232 HOH HOH A . 
N 5 HOH 173 873  7   HOH HOH A . 
N 5 HOH 174 874  76  HOH HOH A . 
N 5 HOH 175 875  402 HOH HOH A . 
N 5 HOH 176 876  321 HOH HOH A . 
N 5 HOH 177 877  268 HOH HOH A . 
N 5 HOH 178 878  397 HOH HOH A . 
N 5 HOH 179 879  371 HOH HOH A . 
N 5 HOH 180 880  125 HOH HOH A . 
N 5 HOH 181 881  466 HOH HOH A . 
N 5 HOH 182 882  341 HOH HOH A . 
N 5 HOH 183 883  580 HOH HOH A . 
N 5 HOH 184 884  611 HOH HOH A . 
N 5 HOH 185 885  656 HOH HOH A . 
N 5 HOH 186 886  236 HOH HOH A . 
N 5 HOH 187 887  374 HOH HOH A . 
N 5 HOH 188 888  257 HOH HOH A . 
N 5 HOH 189 889  471 HOH HOH A . 
N 5 HOH 190 890  31  HOH HOH A . 
N 5 HOH 191 891  62  HOH HOH A . 
N 5 HOH 192 892  334 HOH HOH A . 
N 5 HOH 193 893  127 HOH HOH A . 
N 5 HOH 194 894  387 HOH HOH A . 
N 5 HOH 195 895  286 HOH HOH A . 
N 5 HOH 196 896  246 HOH HOH A . 
N 5 HOH 197 897  349 HOH HOH A . 
N 5 HOH 198 898  220 HOH HOH A . 
N 5 HOH 199 899  287 HOH HOH A . 
N 5 HOH 200 900  54  HOH HOH A . 
N 5 HOH 201 901  135 HOH HOH A . 
N 5 HOH 202 902  620 HOH HOH A . 
N 5 HOH 203 903  229 HOH HOH A . 
N 5 HOH 204 904  254 HOH HOH A . 
N 5 HOH 205 905  413 HOH HOH A . 
N 5 HOH 206 906  355 HOH HOH A . 
N 5 HOH 207 907  42  HOH HOH A . 
N 5 HOH 208 908  391 HOH HOH A . 
N 5 HOH 209 909  518 HOH HOH A . 
N 5 HOH 210 910  262 HOH HOH A . 
N 5 HOH 211 911  160 HOH HOH A . 
N 5 HOH 212 912  113 HOH HOH A . 
N 5 HOH 213 913  305 HOH HOH A . 
N 5 HOH 214 914  72  HOH HOH A . 
N 5 HOH 215 915  171 HOH HOH A . 
N 5 HOH 216 916  593 HOH HOH A . 
N 5 HOH 217 917  307 HOH HOH A . 
N 5 HOH 218 918  670 HOH HOH A . 
N 5 HOH 219 919  264 HOH HOH A . 
N 5 HOH 220 920  562 HOH HOH A . 
N 5 HOH 221 921  664 HOH HOH A . 
N 5 HOH 222 922  202 HOH HOH A . 
N 5 HOH 223 923  64  HOH HOH A . 
N 5 HOH 224 924  99  HOH HOH A . 
N 5 HOH 225 925  83  HOH HOH A . 
N 5 HOH 226 926  302 HOH HOH A . 
N 5 HOH 227 927  744 HOH HOH A . 
N 5 HOH 228 928  138 HOH HOH A . 
N 5 HOH 229 929  539 HOH HOH A . 
N 5 HOH 230 930  218 HOH HOH A . 
N 5 HOH 231 931  684 HOH HOH A . 
N 5 HOH 232 932  110 HOH HOH A . 
N 5 HOH 233 933  467 HOH HOH A . 
N 5 HOH 234 934  65  HOH HOH A . 
N 5 HOH 235 935  195 HOH HOH A . 
N 5 HOH 236 936  32  HOH HOH A . 
N 5 HOH 237 937  233 HOH HOH A . 
N 5 HOH 238 938  197 HOH HOH A . 
N 5 HOH 239 939  184 HOH HOH A . 
N 5 HOH 240 940  122 HOH HOH A . 
N 5 HOH 241 941  682 HOH HOH A . 
N 5 HOH 242 942  320 HOH HOH A . 
N 5 HOH 243 943  258 HOH HOH A . 
N 5 HOH 244 944  247 HOH HOH A . 
N 5 HOH 245 945  16  HOH HOH A . 
N 5 HOH 246 946  364 HOH HOH A . 
N 5 HOH 247 947  409 HOH HOH A . 
N 5 HOH 248 948  107 HOH HOH A . 
N 5 HOH 249 949  326 HOH HOH A . 
N 5 HOH 250 950  105 HOH HOH A . 
N 5 HOH 251 951  141 HOH HOH A . 
N 5 HOH 252 952  491 HOH HOH A . 
N 5 HOH 253 953  112 HOH HOH A . 
N 5 HOH 254 954  418 HOH HOH A . 
N 5 HOH 255 955  625 HOH HOH A . 
N 5 HOH 256 956  410 HOH HOH A . 
N 5 HOH 257 957  66  HOH HOH A . 
N 5 HOH 258 958  459 HOH HOH A . 
N 5 HOH 259 959  700 HOH HOH A . 
N 5 HOH 260 960  482 HOH HOH A . 
N 5 HOH 261 961  249 HOH HOH A . 
N 5 HOH 262 962  475 HOH HOH A . 
N 5 HOH 263 963  190 HOH HOH A . 
N 5 HOH 264 964  362 HOH HOH A . 
N 5 HOH 265 965  407 HOH HOH A . 
N 5 HOH 266 966  245 HOH HOH A . 
N 5 HOH 267 967  251 HOH HOH A . 
N 5 HOH 268 968  59  HOH HOH A . 
N 5 HOH 269 969  198 HOH HOH A . 
N 5 HOH 270 970  128 HOH HOH A . 
N 5 HOH 271 971  185 HOH HOH A . 
N 5 HOH 272 972  11  HOH HOH A . 
N 5 HOH 273 973  79  HOH HOH A . 
N 5 HOH 274 974  319 HOH HOH A . 
N 5 HOH 275 975  666 HOH HOH A . 
N 5 HOH 276 976  676 HOH HOH A . 
N 5 HOH 277 977  194 HOH HOH A . 
N 5 HOH 278 978  406 HOH HOH A . 
N 5 HOH 279 979  8   HOH HOH A . 
N 5 HOH 280 980  276 HOH HOH A . 
N 5 HOH 281 981  469 HOH HOH A . 
N 5 HOH 282 982  563 HOH HOH A . 
N 5 HOH 283 983  154 HOH HOH A . 
N 5 HOH 284 984  298 HOH HOH A . 
N 5 HOH 285 985  451 HOH HOH A . 
N 5 HOH 286 986  212 HOH HOH A . 
N 5 HOH 287 987  582 HOH HOH A . 
N 5 HOH 288 988  87  HOH HOH A . 
N 5 HOH 289 989  476 HOH HOH A . 
N 5 HOH 290 990  296 HOH HOH A . 
N 5 HOH 291 991  6   HOH HOH A . 
N 5 HOH 292 992  156 HOH HOH A . 
N 5 HOH 293 993  359 HOH HOH A . 
N 5 HOH 294 994  336 HOH HOH A . 
N 5 HOH 295 995  266 HOH HOH A . 
N 5 HOH 296 996  388 HOH HOH A . 
N 5 HOH 297 997  389 HOH HOH A . 
N 5 HOH 298 998  481 HOH HOH A . 
N 5 HOH 299 999  677 HOH HOH A . 
N 5 HOH 300 1000 510 HOH HOH A . 
N 5 HOH 301 1001 214 HOH HOH A . 
N 5 HOH 302 1002 144 HOH HOH A . 
N 5 HOH 303 1003 344 HOH HOH A . 
N 5 HOH 304 1004 507 HOH HOH A . 
N 5 HOH 305 1005 695 HOH HOH A . 
N 5 HOH 306 1006 748 HOH HOH A . 
N 5 HOH 307 1007 77  HOH HOH A . 
N 5 HOH 308 1008 514 HOH HOH A . 
N 5 HOH 309 1009 421 HOH HOH A . 
N 5 HOH 310 1010 317 HOH HOH A . 
N 5 HOH 311 1011 241 HOH HOH A . 
N 5 HOH 312 1012 299 HOH HOH A . 
N 5 HOH 313 1013 57  HOH HOH A . 
N 5 HOH 314 1014 598 HOH HOH A . 
N 5 HOH 315 1015 27  HOH HOH A . 
N 5 HOH 316 1016 97  HOH HOH A . 
N 5 HOH 317 1017 345 HOH HOH A . 
N 5 HOH 318 1018 399 HOH HOH A . 
N 5 HOH 319 1019 668 HOH HOH A . 
N 5 HOH 320 1020 89  HOH HOH A . 
N 5 HOH 321 1021 75  HOH HOH A . 
N 5 HOH 322 1022 432 HOH HOH A . 
N 5 HOH 323 1023 494 HOH HOH A . 
N 5 HOH 324 1024 174 HOH HOH A . 
N 5 HOH 325 1025 667 HOH HOH A . 
N 5 HOH 326 1026 256 HOH HOH A . 
N 5 HOH 327 1027 303 HOH HOH A . 
N 5 HOH 328 1028 637 HOH HOH A . 
N 5 HOH 329 1029 644 HOH HOH A . 
N 5 HOH 330 1030 96  HOH HOH A . 
N 5 HOH 331 1031 117 HOH HOH A . 
N 5 HOH 332 1032 715 HOH HOH A . 
N 5 HOH 333 1033 224 HOH HOH A . 
N 5 HOH 334 1034 589 HOH HOH A . 
N 5 HOH 335 1035 151 HOH HOH A . 
N 5 HOH 336 1036 358 HOH HOH A . 
N 5 HOH 337 1037 702 HOH HOH A . 
N 5 HOH 338 1038 448 HOH HOH A . 
N 5 HOH 339 1039 170 HOH HOH A . 
N 5 HOH 340 1040 118 HOH HOH A . 
N 5 HOH 341 1041 465 HOH HOH A . 
N 5 HOH 342 1042 600 HOH HOH A . 
N 5 HOH 343 1043 60  HOH HOH A . 
N 5 HOH 344 1044 462 HOH HOH A . 
N 5 HOH 345 1045 26  HOH HOH A . 
N 5 HOH 346 1046 551 HOH HOH A . 
N 5 HOH 347 1047 446 HOH HOH A . 
N 5 HOH 348 1048 521 HOH HOH A . 
N 5 HOH 349 1049 293 HOH HOH A . 
N 5 HOH 350 1050 129 HOH HOH A . 
N 5 HOH 351 1051 169 HOH HOH A . 
N 5 HOH 352 1052 424 HOH HOH A . 
N 5 HOH 353 1053 102 HOH HOH A . 
N 5 HOH 354 1054 478 HOH HOH A . 
N 5 HOH 355 1055 417 HOH HOH A . 
N 5 HOH 356 1056 385 HOH HOH A . 
N 5 HOH 357 1057 52  HOH HOH A . 
N 5 HOH 358 1058 453 HOH HOH A . 
N 5 HOH 359 1059 352 HOH HOH A . 
N 5 HOH 360 1060 640 HOH HOH A . 
N 5 HOH 361 1061 517 HOH HOH A . 
N 5 HOH 362 1062 346 HOH HOH A . 
N 5 HOH 363 1063 132 HOH HOH A . 
N 5 HOH 364 1064 269 HOH HOH A . 
N 5 HOH 365 1065 131 HOH HOH A . 
N 5 HOH 366 1066 658 HOH HOH A . 
N 5 HOH 367 1067 200 HOH HOH A . 
N 5 HOH 368 1068 209 HOH HOH A . 
N 5 HOH 369 1069 255 HOH HOH A . 
N 5 HOH 370 1070 123 HOH HOH A . 
N 5 HOH 371 1071 439 HOH HOH A . 
N 5 HOH 372 1072 101 HOH HOH A . 
N 5 HOH 373 1073 693 HOH HOH A . 
N 5 HOH 374 1074 74  HOH HOH A . 
N 5 HOH 375 1075 396 HOH HOH A . 
N 5 HOH 376 1076 629 HOH HOH A . 
N 5 HOH 377 1077 21  HOH HOH A . 
N 5 HOH 378 1078 686 HOH HOH A . 
N 5 HOH 379 1079 143 HOH HOH A . 
N 5 HOH 380 1080 273 HOH HOH A . 
N 5 HOH 381 1081 222 HOH HOH A . 
N 5 HOH 382 1082 252 HOH HOH A . 
N 5 HOH 383 1083 230 HOH HOH A . 
N 5 HOH 384 1084 290 HOH HOH A . 
N 5 HOH 385 1085 730 HOH HOH A . 
N 5 HOH 386 1086 279 HOH HOH A . 
N 5 HOH 387 1087 561 HOH HOH A . 
N 5 HOH 388 1088 659 HOH HOH A . 
N 5 HOH 389 1089 395 HOH HOH A . 
N 5 HOH 390 1090 88  HOH HOH A . 
N 5 HOH 391 1091 652 HOH HOH A . 
N 5 HOH 392 1092 103 HOH HOH A . 
N 5 HOH 393 1093 94  HOH HOH A . 
N 5 HOH 394 1094 180 HOH HOH A . 
N 5 HOH 395 1095 67  HOH HOH A . 
N 5 HOH 396 1096 243 HOH HOH A . 
N 5 HOH 397 1097 30  HOH HOH A . 
N 5 HOH 398 1098 248 HOH HOH A . 
N 5 HOH 399 1099 323 HOH HOH A . 
N 5 HOH 400 1100 689 HOH HOH A . 
N 5 HOH 401 1101 671 HOH HOH A . 
N 5 HOH 402 1102 46  HOH HOH A . 
N 5 HOH 403 1103 400 HOH HOH A . 
N 5 HOH 404 1104 616 HOH HOH A . 
N 5 HOH 405 1105 165 HOH HOH A . 
N 5 HOH 406 1106 36  HOH HOH A . 
N 5 HOH 407 1107 318 HOH HOH A . 
N 5 HOH 408 1108 618 HOH HOH A . 
N 5 HOH 409 1109 120 HOH HOH A . 
N 5 HOH 410 1110 4   HOH HOH A . 
N 5 HOH 411 1111 382 HOH HOH A . 
N 5 HOH 412 1112 78  HOH HOH A . 
N 5 HOH 413 1113 35  HOH HOH A . 
N 5 HOH 414 1114 442 HOH HOH A . 
N 5 HOH 415 1115 98  HOH HOH A . 
N 5 HOH 416 1116 560 HOH HOH A . 
N 5 HOH 417 1117 673 HOH HOH A . 
N 5 HOH 418 1118 167 HOH HOH A . 
N 5 HOH 419 1119 606 HOH HOH A . 
N 5 HOH 420 1120 655 HOH HOH A . 
N 5 HOH 421 1121 706 HOH HOH A . 
N 5 HOH 422 1122 419 HOH HOH A . 
N 5 HOH 423 1123 196 HOH HOH A . 
N 5 HOH 424 1124 712 HOH HOH A . 
N 5 HOH 425 1125 38  HOH HOH A . 
N 5 HOH 426 1126 457 HOH HOH A . 
N 5 HOH 427 1127 415 HOH HOH A . 
N 5 HOH 428 1128 511 HOH HOH A . 
N 5 HOH 429 1129 528 HOH HOH A . 
N 5 HOH 430 1130 705 HOH HOH A . 
N 5 HOH 431 1131 529 HOH HOH A . 
N 5 HOH 432 1132 537 HOH HOH A . 
N 5 HOH 433 1133 191 HOH HOH A . 
N 5 HOH 434 1134 492 HOH HOH A . 
N 5 HOH 435 1135 564 HOH HOH A . 
N 5 HOH 436 1136 338 HOH HOH A . 
N 5 HOH 437 1137 558 HOH HOH A . 
N 5 HOH 438 1138 25  HOH HOH A . 
N 5 HOH 439 1139 365 HOH HOH A . 
N 5 HOH 440 1140 372 HOH HOH A . 
N 5 HOH 441 1141 653 HOH HOH A . 
N 5 HOH 442 1142 685 HOH HOH A . 
N 5 HOH 443 1143 182 HOH HOH A . 
N 5 HOH 444 1144 531 HOH HOH A . 
N 5 HOH 445 1145 628 HOH HOH A . 
N 5 HOH 446 1146 49  HOH HOH A . 
N 5 HOH 447 1147 461 HOH HOH A . 
N 5 HOH 448 1148 353 HOH HOH A . 
N 5 HOH 449 1149 253 HOH HOH A . 
N 5 HOH 450 1150 596 HOH HOH A . 
N 5 HOH 451 1151 45  HOH HOH A . 
N 5 HOH 452 1152 394 HOH HOH A . 
N 5 HOH 453 1153 455 HOH HOH A . 
N 5 HOH 454 1154 86  HOH HOH A . 
N 5 HOH 455 1155 237 HOH HOH A . 
N 5 HOH 456 1156 663 HOH HOH A . 
N 5 HOH 457 1157 711 HOH HOH A . 
N 5 HOH 458 1158 216 HOH HOH A . 
N 5 HOH 459 1159 350 HOH HOH A . 
N 5 HOH 460 1160 573 HOH HOH A . 
N 5 HOH 461 1161 505 HOH HOH A . 
N 5 HOH 462 1162 519 HOH HOH A . 
N 5 HOH 463 1163 13  HOH HOH A . 
N 5 HOH 464 1164 509 HOH HOH A . 
N 5 HOH 465 1165 449 HOH HOH A . 
N 5 HOH 466 1166 660 HOH HOH A . 
N 5 HOH 467 1167 504 HOH HOH A . 
N 5 HOH 468 1168 130 HOH HOH A . 
N 5 HOH 469 1169 485 HOH HOH A . 
N 5 HOH 470 1170 698 HOH HOH A . 
N 5 HOH 471 1171 603 HOH HOH A . 
N 5 HOH 472 1172 651 HOH HOH A . 
N 5 HOH 473 1173 525 HOH HOH A . 
N 5 HOH 474 1174 357 HOH HOH A . 
N 5 HOH 475 1175 168 HOH HOH A . 
N 5 HOH 476 1176 645 HOH HOH A . 
N 5 HOH 477 1177 137 HOH HOH A . 
N 5 HOH 478 1178 447 HOH HOH A . 
N 5 HOH 479 1179 508 HOH HOH A . 
N 5 HOH 480 1180 450 HOH HOH A . 
N 5 HOH 481 1181 520 HOH HOH A . 
N 5 HOH 482 1182 547 HOH HOH A . 
N 5 HOH 483 1183 722 HOH HOH A . 
N 5 HOH 484 1184 347 HOH HOH A . 
N 5 HOH 485 1185 361 HOH HOH A . 
N 5 HOH 486 1186 15  HOH HOH A . 
N 5 HOH 487 1187 1   HOH HOH A . 
N 5 HOH 488 1188 495 HOH HOH A . 
N 5 HOH 489 1189 497 HOH HOH A . 
N 5 HOH 490 1190 602 HOH HOH A . 
N 5 HOH 491 1191 463 HOH HOH A . 
N 5 HOH 492 1192 751 HOH HOH A . 
N 5 HOH 493 1193 423 HOH HOH A . 
N 5 HOH 494 1194 692 HOH HOH A . 
N 5 HOH 495 1195 752 HOH HOH A . 
N 5 HOH 496 1196 445 HOH HOH A . 
N 5 HOH 497 1197 176 HOH HOH A . 
N 5 HOH 498 1198 458 HOH HOH A . 
N 5 HOH 499 1199 311 HOH HOH A . 
N 5 HOH 500 1200 740 HOH HOH A . 
N 5 HOH 501 1201 210 HOH HOH A . 
N 5 HOH 502 1202 390 HOH HOH A . 
N 5 HOH 503 1203 468 HOH HOH A . 
N 5 HOH 504 1204 124 HOH HOH A . 
N 5 HOH 505 1205 452 HOH HOH A . 
N 5 HOH 506 1206 436 HOH HOH A . 
N 5 HOH 507 1207 523 HOH HOH A . 
N 5 HOH 508 1208 474 HOH HOH A . 
N 5 HOH 509 1209 414 HOH HOH A . 
N 5 HOH 510 1210 513 HOH HOH A . 
N 5 HOH 511 1211 643 HOH HOH A . 
N 5 HOH 512 1212 500 HOH HOH A . 
N 5 HOH 513 1213 306 HOH HOH A . 
N 5 HOH 514 1214 454 HOH HOH A . 
N 5 HOH 515 1215 614 HOH HOH A . 
N 5 HOH 516 1216 753 HOH HOH A . 
N 5 HOH 517 1217 599 HOH HOH A . 
N 5 HOH 518 1218 239 HOH HOH A . 
N 5 HOH 519 1219 183 HOH HOH A . 
N 5 HOH 520 1220 213 HOH HOH A . 
N 5 HOH 521 1221 240 HOH HOH A . 
N 5 HOH 522 1222 502 HOH HOH A . 
N 5 HOH 523 1223 18  HOH HOH A . 
N 5 HOH 524 1224 699 HOH HOH A . 
N 5 HOH 525 1225 426 HOH HOH A . 
N 5 HOH 526 1226 393 HOH HOH A . 
N 5 HOH 527 1227 367 HOH HOH A . 
N 5 HOH 528 1228 378 HOH HOH A . 
N 5 HOH 529 1229 477 HOH HOH A . 
N 5 HOH 530 1230 392 HOH HOH A . 
N 5 HOH 531 1231 626 HOH HOH A . 
N 5 HOH 532 1232 567 HOH HOH A . 
N 5 HOH 533 1233 295 HOH HOH A . 
N 5 HOH 534 1234 300 HOH HOH A . 
N 5 HOH 535 1235 650 HOH HOH A . 
N 5 HOH 536 1236 376 HOH HOH A . 
N 5 HOH 537 1237 68  HOH HOH A . 
N 5 HOH 538 1238 242 HOH HOH A . 
N 5 HOH 539 1239 225 HOH HOH A . 
N 5 HOH 540 1240 192 HOH HOH A . 
N 5 HOH 541 1241 301 HOH HOH A . 
N 5 HOH 542 1242 158 HOH HOH A . 
N 5 HOH 543 1243 283 HOH HOH A . 
N 5 HOH 544 1244 328 HOH HOH A . 
N 5 HOH 545 1245 498 HOH HOH A . 
N 5 HOH 546 1246 456 HOH HOH A . 
N 5 HOH 547 1247 292 HOH HOH A . 
N 5 HOH 548 1248 585 HOH HOH A . 
N 5 HOH 549 1249 542 HOH HOH A . 
N 5 HOH 550 1250 532 HOH HOH A . 
N 5 HOH 551 1251 444 HOH HOH A . 
N 5 HOH 552 1252 416 HOH HOH A . 
N 5 HOH 553 1253 619 HOH HOH A . 
N 5 HOH 554 1254 488 HOH HOH A . 
N 5 HOH 555 1255 351 HOH HOH A . 
N 5 HOH 556 1256 646 HOH HOH A . 
N 5 HOH 557 1257 411 HOH HOH A . 
N 5 HOH 558 1258 433 HOH HOH A . 
N 5 HOH 559 1259 91  HOH HOH A . 
N 5 HOH 560 1260 430 HOH HOH A . 
N 5 HOH 561 1261 261 HOH HOH A . 
N 5 HOH 562 1262 615 HOH HOH A . 
N 5 HOH 563 1263 473 HOH HOH A . 
N 5 HOH 564 1264 285 HOH HOH A . 
N 5 HOH 565 1265 370 HOH HOH A . 
N 5 HOH 566 1266 386 HOH HOH A . 
N 5 HOH 567 1267 437 HOH HOH A . 
N 5 HOH 568 1268 506 HOH HOH A . 
N 5 HOH 569 1269 496 HOH HOH A . 
N 5 HOH 570 1270 304 HOH HOH A . 
N 5 HOH 571 1271 621 HOH HOH A . 
N 5 HOH 572 1272 610 HOH HOH A . 
N 5 HOH 573 1273 557 HOH HOH A . 
N 5 HOH 574 1274 632 HOH HOH A . 
N 5 HOH 575 1275 493 HOH HOH A . 
N 5 HOH 576 1276 472 HOH HOH A . 
N 5 HOH 577 1277 289 HOH HOH A . 
N 5 HOH 578 1278 325 HOH HOH A . 
N 5 HOH 579 1279 73  HOH HOH A . 
N 5 HOH 580 1280 723 HOH HOH A . 
N 5 HOH 581 1281 339 HOH HOH A . 
N 5 HOH 582 1282 636 HOH HOH A . 
N 5 HOH 583 1283 322 HOH HOH A . 
N 5 HOH 584 1284 541 HOH HOH A . 
N 5 HOH 585 1285 316 HOH HOH A . 
N 5 HOH 586 1286 329 HOH HOH A . 
N 5 HOH 587 1287 375 HOH HOH A . 
N 5 HOH 588 1288 545 HOH HOH A . 
N 5 HOH 589 1289 526 HOH HOH A . 
N 5 HOH 590 1290 340 HOH HOH A . 
N 5 HOH 591 1291 594 HOH HOH A . 
N 5 HOH 592 1292 604 HOH HOH A . 
N 5 HOH 593 1293 207 HOH HOH A . 
N 5 HOH 594 1294 566 HOH HOH A . 
N 5 HOH 595 1295 366 HOH HOH A . 
N 5 HOH 596 1296 175 HOH HOH A . 
N 5 HOH 597 1297 553 HOH HOH A . 
N 5 HOH 598 1298 260 HOH HOH A . 
N 5 HOH 599 1299 527 HOH HOH A . 
N 5 HOH 600 1300 313 HOH HOH A . 
N 5 HOH 601 1301 489 HOH HOH A . 
N 5 HOH 602 1302 438 HOH HOH A . 
N 5 HOH 603 1303 331 HOH HOH A . 
N 5 HOH 604 1304 280 HOH HOH A . 
N 5 HOH 605 1305 408 HOH HOH A . 
N 5 HOH 606 1306 487 HOH HOH A . 
N 5 HOH 607 1307 503 HOH HOH A . 
N 5 HOH 608 1308 404 HOH HOH A . 
N 5 HOH 609 1309 282 HOH HOH A . 
N 5 HOH 610 1310 546 HOH HOH A . 
N 5 HOH 611 1311 161 HOH HOH A . 
N 5 HOH 612 1312 533 HOH HOH A . 
N 5 HOH 613 1313 581 HOH HOH A . 
N 5 HOH 614 1314 297 HOH HOH A . 
N 5 HOH 615 1315 422 HOH HOH A . 
N 5 HOH 616 1316 435 HOH HOH A . 
N 5 HOH 617 1317 379 HOH HOH A . 
N 5 HOH 618 1318 569 HOH HOH A . 
N 5 HOH 619 1319 577 HOH HOH A . 
N 5 HOH 620 1320 443 HOH HOH A . 
N 5 HOH 621 1321 441 HOH HOH A . 
N 5 HOH 622 1322 420 HOH HOH A . 
N 5 HOH 623 1323 479 HOH HOH A . 
N 5 HOH 624 1324 470 HOH HOH A . 
N 5 HOH 625 1325 159 HOH HOH A . 
N 5 HOH 626 1326 204 HOH HOH A . 
N 5 HOH 627 1327 356 HOH HOH A . 
N 5 HOH 628 1328 186 HOH HOH A . 
N 5 HOH 629 1329 648 HOH HOH A . 
N 5 HOH 630 1330 368 HOH HOH A . 
N 5 HOH 631 1331 627 HOH HOH A . 
N 5 HOH 632 1332 480 HOH HOH A . 
N 5 HOH 633 1333 384 HOH HOH A . 
N 5 HOH 634 1334 543 HOH HOH A . 
N 5 HOH 635 1335 277 HOH HOH A . 
N 5 HOH 636 1336 588 HOH HOH A . 
N 5 HOH 637 1337 332 HOH HOH A . 
N 5 HOH 638 1338 578 HOH HOH A . 
N 5 HOH 639 1339 592 HOH HOH A . 
N 5 HOH 640 1340 381 HOH HOH A . 
N 5 HOH 641 1341 634 HOH HOH A . 
N 5 HOH 642 1342 499 HOH HOH A . 
N 5 HOH 643 1343 490 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1290  ? 
1 MORE         -97   ? 
1 'SSA (A^2)'  17850 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A NA  608  ? I NA  . 
2 1 A NA  609  ? J NA  . 
3 1 A HOH 1192 ? N HOH . 
4 1 A HOH 1219 ? N HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   OD2 ? A ASP 8   ? A ASP 115  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 OD1 ? A ASP 55  ? A ASP 162  ? 1_555  151.0 ? 
2   OD2 ? A ASP 8   ? A ASP 115  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 OD2 ? A ASP 55  ? A ASP 162  ? 1_555  156.6 ? 
3   OD1 ? A ASP 55  ? A ASP 162  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 OD2 ? A ASP 55  ? A ASP 162  ? 1_555  52.2  ? 
4   OD2 ? A ASP 8   ? A ASP 115  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A VAL 98  ? A VAL 205  ? 1_555  89.5  ? 
5   OD1 ? A ASP 55  ? A ASP 162  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A VAL 98  ? A VAL 205  ? 1_555  87.0  ? 
6   OD2 ? A ASP 55  ? A ASP 162  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A VAL 98  ? A VAL 205  ? 1_555  97.0  ? 
7   OD2 ? A ASP 8   ? A ASP 115  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 OD1 ? A ASN 101 ? A ASN 208  ? 1_555  76.1  ? 
8   OD1 ? A ASP 55  ? A ASP 162  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 OD1 ? A ASN 101 ? A ASN 208  ? 1_555  75.3  ? 
9   OD2 ? A ASP 55  ? A ASP 162  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 OD1 ? A ASN 101 ? A ASN 208  ? 1_555  125.9 ? 
10  O   ? A VAL 98  ? A VAL 205  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 OD1 ? A ASN 101 ? A ASN 208  ? 1_555  92.1  ? 
11  OD2 ? A ASP 8   ? A ASP 115  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A VAL 103 ? A VAL 210  ? 1_555  92.3  ? 
12  OD1 ? A ASP 55  ? A ASP 162  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A VAL 103 ? A VAL 210  ? 1_555  92.3  ? 
13  OD2 ? A ASP 55  ? A ASP 162  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A VAL 103 ? A VAL 210  ? 1_555  80.7  ? 
14  O   ? A VAL 98  ? A VAL 205  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A VAL 103 ? A VAL 210  ? 1_555  177.5 ? 
15  OD1 ? A ASN 101 ? A ASN 208  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A VAL 103 ? A VAL 210  ? 1_555  90.0  ? 
16  OD2 ? A ASP 8   ? A ASP 115  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A GLY 105 ? A GLY 212  ? 1_555  81.9  ? 
17  OD1 ? A ASP 55  ? A ASP 162  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A GLY 105 ? A GLY 212  ? 1_555  126.5 ? 
18  OD2 ? A ASP 55  ? A ASP 162  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A GLY 105 ? A GLY 212  ? 1_555  75.9  ? 
19  O   ? A VAL 98  ? A VAL 205  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A GLY 105 ? A GLY 212  ? 1_555  87.5  ? 
20  OD1 ? A ASN 101 ? A ASN 208  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A GLY 105 ? A GLY 212  ? 1_555  158.0 ? 
21  O   ? A VAL 103 ? A VAL 210  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A GLY 105 ? A GLY 212  ? 1_555  91.1  ? 
22  OD2 ? A ASP 67  ? A ASP 174  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD1 ? A ASP 72  ? A ASP 179  ? 1_555  99.8  ? 
23  OD2 ? A ASP 67  ? A ASP 174  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD2 ? A ASP 72  ? A ASP 179  ? 1_555  88.2  ? 
24  OD1 ? A ASP 72  ? A ASP 179  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD2 ? A ASP 72  ? A ASP 179  ? 1_555  50.0  ? 
25  OD2 ? A ASP 67  ? A ASP 174  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A ASP 74  ? A ASP 181  ? 1_555  93.9  ? 
26  OD1 ? A ASP 72  ? A ASP 179  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A ASP 74  ? A ASP 181  ? 1_555  75.6  ? 
27  OD2 ? A ASP 72  ? A ASP 179  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A ASP 74  ? A ASP 181  ? 1_555  125.0 ? 
28  OD2 ? A ASP 67  ? A ASP 174  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 786  ? 1_555  89.6  ? 
29  OD1 ? A ASP 72  ? A ASP 179  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 786  ? 1_555  158.4 ? 
30  OD2 ? A ASP 72  ? A ASP 179  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 786  ? 1_555  150.7 ? 
31  O   ? A ASP 74  ? A ASP 181  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 786  ? 1_555  84.4  ? 
32  OD2 ? A ASP 67  ? A ASP 174  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 1187 ? 1_555  166.2 ? 
33  OD1 ? A ASP 72  ? A ASP 179  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 1187 ? 1_555  90.4  ? 
34  OD2 ? A ASP 72  ? A ASP 179  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 1187 ? 1_555  91.2  ? 
35  O   ? A ASP 74  ? A ASP 181  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 1187 ? 1_555  97.8  ? 
36  O   ? N HOH .   ? A HOH 786  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 1187 ? 1_555  84.1  ? 
37  OD2 ? A ASP 67  ? A ASP 174  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 751  ? 1_555  83.8  ? 
38  OD1 ? A ASP 72  ? A ASP 179  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 751  ? 1_555  126.0 ? 
39  OD2 ? A ASP 72  ? A ASP 179  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 751  ? 1_555  76.5  ? 
40  O   ? A ASP 74  ? A ASP 181  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 751  ? 1_555  158.4 ? 
41  O   ? N HOH .   ? A HOH 786  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 751  ? 1_555  74.1  ? 
42  O   ? N HOH .   ? A HOH 1187 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? N HOH .   ? A HOH 751  ? 1_555  82.6  ? 
43  OD1 ? A ASP 151 ? A ASP 258  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 OD2 ? A ASP 194 ? A ASP 301  ? 1_555  98.7  ? 
44  OD1 ? A ASP 151 ? A ASP 258  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 OE1 ? A GLU 224 ? A GLU 331  ? 1_555  78.8  ? 
45  OD2 ? A ASP 194 ? A ASP 301  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 OE1 ? A GLU 224 ? A GLU 331  ? 1_555  89.9  ? 
46  OD1 ? A ASP 151 ? A ASP 258  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 OE2 ? A GLU 224 ? A GLU 331  ? 1_555  131.9 ? 
47  OD2 ? A ASP 194 ? A ASP 301  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 OE2 ? A GLU 224 ? A GLU 331  ? 1_555  84.6  ? 
48  OE1 ? A GLU 224 ? A GLU 331  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 OE2 ? A GLU 224 ? A GLU 331  ? 1_555  53.1  ? 
49  OD1 ? A ASP 151 ? A ASP 258  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 838  ? 1_555  95.4  ? 
50  OD2 ? A ASP 194 ? A ASP 301  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 838  ? 1_555  165.9 ? 
51  OE1 ? A GLU 224 ? A GLU 331  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 838  ? 1_555  92.5  ? 
52  OE2 ? A GLU 224 ? A GLU 331  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 838  ? 1_555  85.8  ? 
53  OD1 ? A ASP 151 ? A ASP 258  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 991  ? 1_555  72.6  ? 
54  OD2 ? A ASP 194 ? A ASP 301  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 991  ? 1_555  90.7  ? 
55  OE1 ? A GLU 224 ? A GLU 331  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 991  ? 1_555  151.2 ? 
56  OE2 ? A GLU 224 ? A GLU 331  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 991  ? 1_555  155.5 ? 
57  O   ? N HOH .   ? A HOH 838  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 991  ? 1_555  93.8  ? 
58  OD1 ? A ASP 151 ? A ASP 258  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 1110 ? 1_555  146.9 ? 
59  OD2 ? A ASP 194 ? A ASP 301  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 1110 ? 1_555  77.9  ? 
60  OE1 ? A GLU 224 ? A GLU 331  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 1110 ? 1_555  133.6 ? 
61  OE2 ? A GLU 224 ? A GLU 331  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 1110 ? 1_555  81.0  ? 
62  O   ? N HOH .   ? A HOH 838  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 1110 ? 1_555  90.5  ? 
63  O   ? N HOH .   ? A HOH 991  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? N HOH .   ? A HOH 1110 ? 1_555  74.5  ? 
64  OD1 ? A ASP 157 ? A ASP 264  ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? A GLY 158 ? A GLY 265  ? 1_555  81.2  ? 
65  OD1 ? A ASP 157 ? A ASP 264  ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? N HOH .   ? A HOH 824  ? 1_555  82.2  ? 
66  O   ? A GLY 158 ? A GLY 265  ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? N HOH .   ? A HOH 824  ? 1_555  160.8 ? 
67  OD1 ? A ASP 157 ? A ASP 264  ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? N HOH .   ? A HOH 874  ? 1_555  99.7  ? 
68  O   ? A GLY 158 ? A GLY 265  ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? N HOH .   ? A HOH 874  ? 1_555  85.5  ? 
69  O   ? N HOH .   ? A HOH 824  ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? N HOH .   ? A HOH 874  ? 1_555  87.9  ? 
70  OD1 ? A ASP 157 ? A ASP 264  ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? N HOH .   ? A HOH 1242 ? 1_555  165.1 ? 
71  O   ? A GLY 158 ? A GLY 265  ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? N HOH .   ? A HOH 1242 ? 1_555  112.9 ? 
72  O   ? N HOH .   ? A HOH 824  ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? N HOH .   ? A HOH 1242 ? 1_555  83.1  ? 
73  O   ? N HOH .   ? A HOH 874  ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? N HOH .   ? A HOH 1242 ? 1_555  77.5  ? 
74  OD1 ? A ASP 157 ? A ASP 264  ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? N HOH .   ? A HOH 1175 ? 1_555  83.9  ? 
75  O   ? A GLY 158 ? A GLY 265  ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? N HOH .   ? A HOH 1175 ? 1_555  86.4  ? 
76  O   ? N HOH .   ? A HOH 824  ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? N HOH .   ? A HOH 1175 ? 1_555  101.3 ? 
77  O   ? N HOH .   ? A HOH 874  ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? N HOH .   ? A HOH 1175 ? 1_555  170.6 ? 
78  O   ? N HOH .   ? A HOH 1242 ? 1_555 NA ? F NA . ? A NA 605 ? 1_555 O   ? N HOH .   ? A HOH 1175 ? 1_555  101.3 ? 
79  OD1 ? A ASP 157 ? A ASP 264  ? 1_555 NA ? K NA . ? A NA 610 ? 1_555 O   ? N HOH .   ? A HOH 850  ? 1_555  87.5  ? 
80  OD1 ? A ASP 157 ? A ASP 264  ? 1_555 NA ? K NA . ? A NA 610 ? 1_555 O   ? N HOH .   ? A HOH 1239 ? 1_555  101.2 ? 
81  O   ? N HOH .   ? A HOH 850  ? 1_555 NA ? K NA . ? A NA 610 ? 1_555 O   ? N HOH .   ? A HOH 1239 ? 1_555  91.6  ? 
82  OD1 ? A ASP 157 ? A ASP 264  ? 1_555 NA ? K NA . ? A NA 610 ? 1_555 O   ? N HOH .   ? A HOH 1168 ? 1_555  84.9  ? 
83  O   ? N HOH .   ? A HOH 850  ? 1_555 NA ? K NA . ? A NA 610 ? 1_555 O   ? N HOH .   ? A HOH 1168 ? 1_555  102.1 ? 
84  O   ? N HOH .   ? A HOH 1239 ? 1_555 NA ? K NA . ? A NA 610 ? 1_555 O   ? N HOH .   ? A HOH 1168 ? 1_555  165.3 ? 
85  OD1 ? A ASP 157 ? A ASP 264  ? 1_555 NA ? K NA . ? A NA 610 ? 1_555 O   ? N HOH .   ? A HOH 1175 ? 1_555  82.3  ? 
86  O   ? N HOH .   ? A HOH 850  ? 1_555 NA ? K NA . ? A NA 610 ? 1_555 O   ? N HOH .   ? A HOH 1175 ? 1_555  168.3 ? 
87  O   ? N HOH .   ? A HOH 1239 ? 1_555 NA ? K NA . ? A NA 610 ? 1_555 O   ? N HOH .   ? A HOH 1175 ? 1_555  84.7  ? 
88  O   ? N HOH .   ? A HOH 1168 ? 1_555 NA ? K NA . ? A NA 610 ? 1_555 O   ? N HOH .   ? A HOH 1175 ? 1_555  82.8  ? 
89  O   ? A SER 172 ? A SER 279  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? A GLY 177 ? A GLY 284  ? 1_555  89.3  ? 
90  O   ? A SER 172 ? A SER 279  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 765  ? 1_555  92.6  ? 
91  O   ? A GLY 177 ? A GLY 284  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 765  ? 1_555  73.1  ? 
92  O   ? A SER 172 ? A SER 279  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 1008 ? 1_555  138.0 ? 
93  O   ? A GLY 177 ? A GLY 284  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 1008 ? 1_555  63.3  ? 
94  O   ? N HOH .   ? A HOH 765  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 1008 ? 1_555  107.5 ? 
95  O   ? A SER 172 ? A SER 279  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 1213 ? 1_555  93.4  ? 
96  O   ? A GLY 177 ? A GLY 284  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 1213 ? 1_555  94.3  ? 
97  O   ? N HOH .   ? A HOH 765  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 1213 ? 1_555  166.0 ? 
98  O   ? N HOH .   ? A HOH 1008 ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 1213 ? 1_555  60.3  ? 
99  O   ? A SER 172 ? A SER 279  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 1244 ? 1_555  170.5 ? 
100 O   ? A GLY 177 ? A GLY 284  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 1244 ? 1_555  100.0 ? 
101 O   ? N HOH .   ? A HOH 765  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 1244 ? 1_555  88.2  ? 
102 O   ? N HOH .   ? A HOH 1008 ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 1244 ? 1_555  50.1  ? 
103 O   ? N HOH .   ? A HOH 1213 ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 1244 ? 1_555  88.0  ? 
104 O   ? A SER 172 ? A SER 279  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 733  ? 10_555 83.2  ? 
105 O   ? A GLY 177 ? A GLY 284  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 733  ? 10_555 170.6 ? 
106 O   ? N HOH .   ? A HOH 765  ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 733  ? 10_555 112.8 ? 
107 O   ? N HOH .   ? A HOH 1008 ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 733  ? 10_555 119.4 ? 
108 O   ? N HOH .   ? A HOH 1213 ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 733  ? 10_555 80.5  ? 
109 O   ? N HOH .   ? A HOH 1244 ? 1_555 NA ? H NA . ? A NA 607 ? 1_555 O   ? N HOH .   ? A HOH 733  ? 10_555 87.7  ? 
110 O   ? A THR 202 ? A THR 309  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 O   ? A SER 204 ? A SER 311  ? 1_555  97.6  ? 
111 O   ? A THR 202 ? A THR 309  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 O   ? A THR 207 ? A THR 314  ? 1_555  166.6 ? 
112 O   ? A SER 204 ? A SER 311  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 O   ? A THR 207 ? A THR 314  ? 1_555  88.5  ? 
113 O   ? A THR 202 ? A THR 309  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 OG1 ? A THR 207 ? A THR 314  ? 1_555  91.6  ? 
114 O   ? A SER 204 ? A SER 311  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 OG1 ? A THR 207 ? A THR 314  ? 1_555  84.1  ? 
115 O   ? A THR 207 ? A THR 314  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 OG1 ? A THR 207 ? A THR 314  ? 1_555  77.2  ? 
116 O   ? A THR 202 ? A THR 309  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 OG  ? A SER 209 ? A SER 316  ? 1_555  69.1  ? 
117 O   ? A SER 204 ? A SER 311  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 OG  ? A SER 209 ? A SER 316  ? 1_555  164.7 ? 
118 O   ? A THR 207 ? A THR 314  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 OG  ? A SER 209 ? A SER 316  ? 1_555  103.0 ? 
119 OG1 ? A THR 207 ? A THR 314  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 OG  ? A SER 209 ? A SER 316  ? 1_555  88.6  ? 
120 O   ? A THR 202 ? A THR 309  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 O   ? N HOH .   ? A HOH 871  ? 1_555  111.4 ? 
121 O   ? A SER 204 ? A SER 311  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 O   ? N HOH .   ? A HOH 871  ? 1_555  113.0 ? 
122 O   ? A THR 207 ? A THR 314  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 O   ? N HOH .   ? A HOH 871  ? 1_555  76.7  ? 
123 OG1 ? A THR 207 ? A THR 314  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 O   ? N HOH .   ? A HOH 871  ? 1_555  148.1 ? 
124 OG  ? A SER 209 ? A SER 316  ? 1_555 NA ? E NA . ? A NA 604 ? 1_555 O   ? N HOH .   ? A HOH 871  ? 1_555  79.9  ? 
125 O   ? A THR 306 ? A THR 413  ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 840  ? 1_555  78.5  ? 
126 O   ? A THR 306 ? A THR 413  ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 1173 ? 1_555  88.6  ? 
127 O   ? N HOH .   ? A HOH 840  ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 1173 ? 1_555  85.6  ? 
128 O   ? A THR 306 ? A THR 413  ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 907  ? 1_555  90.8  ? 
129 O   ? N HOH .   ? A HOH 840  ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 907  ? 1_555  80.6  ? 
130 O   ? N HOH .   ? A HOH 1173 ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 907  ? 1_555  166.0 ? 
131 O   ? A THR 306 ? A THR 413  ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 947  ? 1_555  115.2 ? 
132 O   ? N HOH .   ? A HOH 840  ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 947  ? 1_555  161.6 ? 
133 O   ? N HOH .   ? A HOH 1173 ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 947  ? 1_555  106.1 ? 
134 O   ? N HOH .   ? A HOH 907  ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 947  ? 1_555  86.8  ? 
135 O   ? A THR 306 ? A THR 413  ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 1289 ? 1_555  173.3 ? 
136 O   ? N HOH .   ? A HOH 840  ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 1289 ? 1_555  100.7 ? 
137 O   ? N HOH .   ? A HOH 1173 ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 1289 ? 1_555  84.7  ? 
138 O   ? N HOH .   ? A HOH 907  ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 1289 ? 1_555  95.6  ? 
139 O   ? N HOH .   ? A HOH 947  ? 1_555 NA ? L NA . ? A NA 611 ? 1_555 O   ? N HOH .   ? A HOH 1289 ? 1_555  67.0  ? 
140 O   ? A SER 437 ? A SER 544  ? 1_555 NA ? I NA . ? A NA 608 ? 1_555 O   ? N HOH .   ? A HOH 823  ? 1_555  93.3  ? 
141 O   ? A SER 437 ? A SER 544  ? 1_555 NA ? I NA . ? A NA 608 ? 1_555 O   ? A SER 437 ? A SER 544  ? 1_555  0.0   ? 
142 O   ? N HOH .   ? A HOH 823  ? 1_555 NA ? I NA . ? A NA 608 ? 1_555 O   ? A SER 437 ? A SER 544  ? 1_555  93.3  ? 
143 O   ? A SER 437 ? A SER 544  ? 1_555 NA ? I NA . ? A NA 608 ? 1_555 O   ? N HOH .   ? A HOH 823  ? 9_555  88.3  ? 
144 O   ? N HOH .   ? A HOH 823  ? 1_555 NA ? I NA . ? A NA 608 ? 1_555 O   ? N HOH .   ? A HOH 823  ? 9_555  152.0 ? 
145 O   ? A SER 437 ? A SER 544  ? 1_555 NA ? I NA . ? A NA 608 ? 1_555 O   ? N HOH .   ? A HOH 823  ? 9_555  88.3  ? 
146 OE2 ? A GLU 439 ? A GLU 546  ? 1_555 NA ? J NA . ? A NA 609 ? 1_555 O   ? N HOH .   ? A HOH 1063 ? 1_555  76.7  ? 
147 OE2 ? A GLU 439 ? A GLU 546  ? 1_555 NA ? J NA . ? A NA 609 ? 1_555 O   ? N HOH .   ? A HOH 1177 ? 1_555  85.2  ? 
148 O   ? N HOH .   ? A HOH 1063 ? 1_555 NA ? J NA . ? A NA 609 ? 1_555 O   ? N HOH .   ? A HOH 1177 ? 1_555  161.5 ? 
149 OE2 ? A GLU 439 ? A GLU 546  ? 1_555 NA ? J NA . ? A NA 609 ? 1_555 OE2 ? A GLU 439 ? A GLU 546  ? 1_555  0.0   ? 
150 O   ? N HOH .   ? A HOH 1063 ? 1_555 NA ? J NA . ? A NA 609 ? 1_555 OE2 ? A GLU 439 ? A GLU 546  ? 1_555  76.7  ? 
151 O   ? N HOH .   ? A HOH 1177 ? 1_555 NA ? J NA . ? A NA 609 ? 1_555 OE2 ? A GLU 439 ? A GLU 546  ? 1_555  85.2  ? 
152 OE2 ? A GLU 439 ? A GLU 546  ? 1_555 NA ? J NA . ? A NA 609 ? 1_555 O   ? N HOH .   ? A HOH 1063 ? 9_555  97.7  ? 
153 O   ? N HOH .   ? A HOH 1063 ? 1_555 NA ? J NA . ? A NA 609 ? 1_555 O   ? N HOH .   ? A HOH 1063 ? 9_555  92.5  ? 
154 O   ? N HOH .   ? A HOH 1177 ? 1_555 NA ? J NA . ? A NA 609 ? 1_555 O   ? N HOH .   ? A HOH 1063 ? 9_555  93.5  ? 
155 OE2 ? A GLU 439 ? A GLU 546  ? 1_555 NA ? J NA . ? A NA 609 ? 1_555 O   ? N HOH .   ? A HOH 1063 ? 9_555  97.7  ? 
156 OE2 ? A GLU 439 ? A GLU 546  ? 1_555 NA ? J NA . ? A NA 609 ? 1_555 O   ? N HOH .   ? A HOH 1177 ? 9_555  100.7 ? 
157 O   ? N HOH .   ? A HOH 1063 ? 1_555 NA ? J NA . ? A NA 609 ? 1_555 O   ? N HOH .   ? A HOH 1177 ? 9_555  93.5  ? 
158 O   ? N HOH .   ? A HOH 1177 ? 1_555 NA ? J NA . ? A NA 609 ? 1_555 O   ? N HOH .   ? A HOH 1177 ? 9_555  86.2  ? 
159 OE2 ? A GLU 439 ? A GLU 546  ? 1_555 NA ? J NA . ? A NA 609 ? 1_555 O   ? N HOH .   ? A HOH 1177 ? 9_555  100.7 ? 
160 O   ? N HOH .   ? A HOH 1063 ? 9_555 NA ? J NA . ? A NA 609 ? 1_555 O   ? N HOH .   ? A HOH 1177 ? 9_555  161.5 ? 
161 O   ? N HOH .   ? A HOH 1278 ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 928  ? 1_555  89.6  ? 
162 O   ? N HOH .   ? A HOH 1278 ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 824  ? 1_555  90.7  ? 
163 O   ? N HOH .   ? A HOH 928  ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 824  ? 1_555  178.8 ? 
164 O   ? N HOH .   ? A HOH 1278 ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 874  ? 1_555  95.8  ? 
165 O   ? N HOH .   ? A HOH 928  ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 874  ? 1_555  101.3 ? 
166 O   ? N HOH .   ? A HOH 824  ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 874  ? 1_555  79.8  ? 
167 O   ? N HOH .   ? A HOH 1278 ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 1242 ? 1_555  169.7 ? 
168 O   ? N HOH .   ? A HOH 928  ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 1242 ? 1_555  97.7  ? 
169 O   ? N HOH .   ? A HOH 824  ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 1242 ? 1_555  82.1  ? 
170 O   ? N HOH .   ? A HOH 874  ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 1242 ? 1_555  75.7  ? 
171 O   ? N HOH .   ? A HOH 1278 ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 1304 ? 1_555  88.9  ? 
172 O   ? N HOH .   ? A HOH 928  ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 1304 ? 1_555  88.9  ? 
173 O   ? N HOH .   ? A HOH 824  ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 1304 ? 1_555  90.0  ? 
174 O   ? N HOH .   ? A HOH 874  ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 1304 ? 1_555  168.8 ? 
175 O   ? N HOH .   ? A HOH 1242 ? 1_555 NA ? G NA . ? A NA 606 ? 1_555 O   ? N HOH .   ? A HOH 1304 ? 1_555  98.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-10-05 
2 'Structure model' 1 1 2016-10-12 
3 'Structure model' 1 2 2016-10-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Structure summary'   
2 3 'Structure model' 'Database references' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .        4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OD1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    460 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   A 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    701 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.12 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 153 ? ? -159.18 -134.62 
2  1 ASN A 192 ? ? -101.94 44.41   
3  1 ALA A 203 ? ? -145.42 29.77   
4  1 CYS A 211 ? ? 46.68   -129.89 
5  1 ALA A 216 ? ? -112.70 73.42   
6  1 MET A 226 ? ? -140.18 -7.74   
7  1 ASN A 243 ? ? 36.85   57.04   
8  1 SER A 342 ? ? -149.66 -153.54 
9  1 GLN A 350 ? ? -128.76 -163.76 
10 1 GLU A 485 ? ? -108.49 -104.55 
11 1 ASP A 540 ? ? 74.37   -0.01   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 1340 ? 5.82 . 
2 1 O ? A HOH 1341 ? 6.10 . 
3 1 O ? A HOH 1342 ? 6.13 . 
4 1 O ? A HOH 1343 ? 6.74 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A GLN 111 ? OE1 ? A GLN 4   OE1 
2  1 Y 0 A GLN 111 ? NE2 ? A GLN 4   NE2 
3  1 Y 0 A VAL 127 ? CG1 ? A VAL 20  CG1 
4  1 Y 0 A VAL 127 ? CG2 ? A VAL 20  CG2 
5  1 Y 0 A THR 128 ? OG1 ? A THR 21  OG1 
6  1 Y 0 A THR 128 ? CG2 ? A THR 21  CG2 
7  1 Y 0 A GLN 129 ? CG  ? A GLN 22  CG  
8  1 Y 0 A GLN 129 ? CD  ? A GLN 22  CD  
9  1 Y 0 A GLN 129 ? OE1 ? A GLN 22  OE1 
10 1 Y 0 A GLN 129 ? NE2 ? A GLN 22  NE2 
11 1 Y 0 A ARG 130 ? NH1 ? A ARG 23  NH1 
12 1 Y 0 A ARG 130 ? NH2 ? A ARG 23  NH2 
13 1 Y 0 A LYS 135 ? CE  ? A LYS 28  CE  
14 1 Y 0 A LYS 135 ? NZ  ? A LYS 28  NZ  
15 1 Y 0 A ASP 191 ? OD1 ? A ASP 84  OD1 
16 1 Y 0 A ASP 191 ? OD2 ? A ASP 84  OD2 
17 1 Y 0 A LYS 261 ? NZ  ? A LYS 154 NZ  
18 1 Y 0 A LYS 349 ? NZ  ? A LYS 242 NZ  
19 1 Y 0 A LYS 359 ? CE  ? A LYS 252 CE  
20 1 Y 0 A LYS 359 ? NZ  ? A LYS 252 NZ  
21 1 Y 0 A LYS 386 ? NZ  ? A LYS 279 NZ  
22 1 Y 0 A ASN 409 ? OD1 A A ASN 302 OD1 
23 1 Y 0 A ASN 409 ? OD1 B A ASN 302 OD1 
24 1 Y 0 A ASN 409 ? ND2 A A ASN 302 ND2 
25 1 Y 0 A ASN 409 ? ND2 B A ASN 302 ND2 
26 1 Y 0 A GLU 552 ? OE1 B A GLU 445 OE1 
27 1 Y 0 A GLU 552 ? OE2 B A GLU 445 OE2 
28 1 Y 0 A ASN 558 ? OD1 ? A ASN 451 OD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 108 ? A ASP 1   
2 1 Y 1 A GLY 582 ? A GLY 475 
3 1 Y 1 A SER 583 ? A SER 476 
4 1 Y 1 A HIS 584 ? A HIS 477 
5 1 Y 1 A HIS 585 ? A HIS 478 
6 1 Y 1 A HIS 586 ? A HIS 479 
7 1 Y 1 A HIS 587 ? A HIS 480 
8 1 Y 1 A HIS 588 ? A HIS 481 
9 1 Y 1 A HIS 589 ? A HIS 482 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'  CA  
3 'SODIUM ION'   NA  
4 'CHLORIDE ION' CL  
5 water          HOH 
#