data_5K26
# 
_entry.id   5K26 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5K26         
WWPDB D_1000221614 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          5K28 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5K26 
_pdbx_database_status.recvd_initial_deposition_date   2016-05-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kall, S.K.' 1 
'Lavie, A.'  2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            293 
_citation.language                  ? 
_citation.page_first                13553 
_citation.page_last                 13565 
_citation.title                     
'Identification of two distinct peptide-binding pockets in the SH3 domain of human mixed-lineage kinase 3.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA117.000262 
_citation.pdbx_database_id_PubMed   29980598 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kokoszka, M.E.' 1 ?                   
primary 'Kall, S.L.'     2 ?                   
primary 'Khosla, S.'     3 ?                   
primary 'McGinnis, J.E.' 4 ?                   
primary 'Lavie, A.'      5 0000-0001-5591-8722 
primary 'Kay, B.K.'      6 ?                   
# 
_cell.entry_id           5K26 
_cell.length_a           64.000 
_cell.length_b           64.000 
_cell.length_c           35.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5K26 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Mitogen-activated protein kinase kinase kinase 11,Chimera protein of MLK3-SH3 and MIP' 9361.192 2   
2.7.11.25,2.7.11.25 ? 'SH3 domain (UNP residues 41-105),SH3 domain (UNP residues 41-105)' ? 
2 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'                                                  195.237  1   ? ? ? ? 
3 water       nat water                                                                                   18.015   123 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Mixed lineage kinase 3,Src-homology 3 domain-containing proline-rich kinase,Mixed lineage kinase 3,Src-homology 3 domain-containing proline-rich kinase
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HMYANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGAIRINPNGTWSRQ
AETVES
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HMYANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGAIRINPNGTWSRQ
AETVES
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  HIS n 
1 2  MET n 
1 3  TYR n 
1 4  ALA n 
1 5  ASN n 
1 6  PRO n 
1 7  VAL n 
1 8  TRP n 
1 9  THR n 
1 10 ALA n 
1 11 LEU n 
1 12 PHE n 
1 13 ASP n 
1 14 TYR n 
1 15 GLU n 
1 16 PRO n 
1 17 SER n 
1 18 GLY n 
1 19 GLN n 
1 20 ASP n 
1 21 GLU n 
1 22 LEU n 
1 23 ALA n 
1 24 LEU n 
1 25 ARG n 
1 26 LYS n 
1 27 GLY n 
1 28 ASP n 
1 29 ARG n 
1 30 VAL n 
1 31 GLU n 
1 32 VAL n 
1 33 LEU n 
1 34 SER n 
1 35 ARG n 
1 36 ASP n 
1 37 ALA n 
1 38 ALA n 
1 39 ILE n 
1 40 SER n 
1 41 GLY n 
1 42 ASP n 
1 43 GLU n 
1 44 GLY n 
1 45 TRP n 
1 46 TRP n 
1 47 ALA n 
1 48 GLY n 
1 49 GLN n 
1 50 VAL n 
1 51 GLY n 
1 52 GLY n 
1 53 GLN n 
1 54 VAL n 
1 55 GLY n 
1 56 ILE n 
1 57 PHE n 
1 58 PRO n 
1 59 SER n 
1 60 ASN n 
1 61 TYR n 
1 62 VAL n 
1 63 SER n 
1 64 ARG n 
1 65 GLY n 
1 66 GLY n 
1 67 GLY n 
1 68 ALA n 
1 69 ILE n 
1 70 ARG n 
1 71 ILE n 
1 72 ASN n 
1 73 PRO n 
1 74 ASN n 
1 75 GLY n 
1 76 THR n 
1 77 TRP n 
1 78 SER n 
1 79 ARG n 
1 80 GLN n 
1 81 ALA n 
1 82 GLU n 
1 83 THR n 
1 84 VAL n 
1 85 GLU n 
1 86 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1  67 Human ? 'MAP3K11, MLK3, PTK1, SPRK' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 68 86 Human ? ?                           ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP M3K11_HUMAN Q16584 ? 1 YANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGG 41 
2 PDB 5K26        5K26   ? 1 ?                                                                 68 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5K26 A 3  ? 67 ? Q16584 41  ? 105 ? 41  105 
2 2 5K26 A 68 ? 86 ? 5K26   106 ? 124 ? 106 124 
3 1 5K26 B 3  ? 67 ? Q16584 41  ? 105 ? 41  105 
4 2 5K26 B 68 ? 86 ? 5K26   106 ? 124 ? 106 124 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5K26 HIS A 1 ? UNP Q16584 ? ? 'expression tag' 39 1 
1 5K26 MET A 2 ? UNP Q16584 ? ? 'expression tag' 40 2 
3 5K26 HIS B 1 ? UNP Q16584 ? ? 'expression tag' 39 3 
3 5K26 MET B 2 ? UNP Q16584 ? ? 'expression tag' 40 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE                              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                  ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                 ? 'C6 H15 N2 O2 1' 147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S'  195.237 
MET 'L-peptide linking' y METHIONINE                             ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5K26 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.31 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         48.53 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M Na-Phosphate, 0.1 M K-Phosphate, 0.1 M MES 6.5, 1.5 M NaCl' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-03-25 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.978720 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.978720 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5K26 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.20 
_reflns.d_resolution_low                 55.43 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       48242 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.92 
_reflns.pdbx_Rmerge_I_obs                0.042 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            19.53 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.20 
_reflns_shell.d_res_low                   1.27 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.76 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        83.1 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.418 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.55 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5K26 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     46672 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             55.43 
_refine.ls_d_res_high                            1.20 
_refine.ls_percent_reflns_obs                    97.21 
_refine.ls_R_factor_obs                          0.13865 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.13712 
_refine.ls_R_factor_R_free                       0.16826 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  2412 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.981 
_refine.correlation_coeff_Fo_to_Fc_free          0.973 
_refine.B_iso_mean                               21.026 
_refine.aniso_B[1][1]                            -0.54 
_refine.aniso_B[2][2]                            -0.54 
_refine.aniso_B[3][3]                            1.77 
_refine.aniso_B[1][2]                            -0.27 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1SEM 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.034 
_refine.pdbx_overall_ESU_R_Free                  0.036 
_refine.overall_SU_ML                            0.033 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             1.764 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1161 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             123 
_refine_hist.number_atoms_total               1296 
_refine_hist.d_res_high                       1.20 
_refine_hist.d_res_low                        55.43 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.035  0.019  ? 1292 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.005  0.020  ? 1171 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          3.006  1.928  ? 1769 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.585  3.000  ? 2685 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.022  5.000  ? 171  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.606 23.235 ? 68   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.764 15.000 ? 186  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.048 15.000 ? 15   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.178  0.200  ? 173  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.016  0.021  ? 1571 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.008  0.020  ? 336  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  3.475  1.675  ? 646  'X-RAY DIFFRACTION' ? 
r_mcbond_other               3.459  1.666  ? 645  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 4.308  2.513  ? 813  'X-RAY DIFFRACTION' ? 
r_mcangle_other              4.326  2.518  ? 814  'X-RAY DIFFRACTION' ? 
r_scbond_it                  7.900  2.172  ? 646  'X-RAY DIFFRACTION' ? 
r_scbond_other               7.901  2.171  ? 646  'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              11.004 3.101  ? 951  'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       9.850  15.211 ? 1429 'X-RAY DIFFRACTION' ? 
r_long_range_B_other         9.847  15.222 ? 1430 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           7.214  3.000  ? 2463 'X-RAY DIFFRACTION' ? 
r_sphericity_free            32.597 5.000  ? 44   'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          21.620 5.000  ? 2502 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.200 
_refine_ls_shell.d_res_low                        1.231 
_refine_ls_shell.number_reflns_R_work             2666 
_refine_ls_shell.R_factor_R_work                  0.278 
_refine_ls_shell.percent_reflns_obs               73.92 
_refine_ls_shell.R_factor_R_free                  0.274 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             115 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                     5K26 
_struct.title                        'Structure of the SH3 domain of MLK3 bound to peptide generated from phage display' 
_struct.pdbx_descriptor              'Chimera protein of MLK3-SH3 and MIP (E.C.2.7.11.25)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5K26 
_struct_keywords.text            'MLK3, SH3, phage display, signalling protein, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ILE A 39 ? GLU A 43 ? ILE A 77 GLU A 81 5 ? 5 
HELX_P HELX_P2 AA2 ILE B 39 ? GLU B 43 ? ILE B 77 GLU B 81 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 5 ? 
AA4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A 53 ? PRO A 58 ? GLN A 91  PRO A 96  
AA1 2 TRP A 45 ? VAL A 50 ? TRP A 83  VAL A 88  
AA1 3 ARG A 29 ? SER A 34 ? ARG A 67  SER A 72  
AA1 4 VAL A 7  ? ALA A 10 ? VAL A 45  ALA A 48  
AA1 5 VAL A 62 ? SER A 63 ? VAL A 100 SER A 101 
AA2 1 ILE A 69 ? ILE A 71 ? ILE A 107 ILE A 109 
AA2 2 TRP A 77 ? ARG A 79 ? TRP A 115 ARG A 117 
AA3 1 GLN B 53 ? PRO B 58 ? GLN B 91  PRO B 96  
AA3 2 TRP B 45 ? VAL B 50 ? TRP B 83  VAL B 88  
AA3 3 ARG B 29 ? SER B 34 ? ARG B 67  SER B 72  
AA3 4 VAL B 7  ? ALA B 10 ? VAL B 45  ALA B 48  
AA3 5 VAL B 62 ? ARG B 64 ? VAL B 100 ARG B 102 
AA4 1 ILE B 69 ? ILE B 71 ? ILE B 107 ILE B 109 
AA4 2 TRP B 77 ? ARG B 79 ? TRP B 115 ARG B 117 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLY A 55 ? O GLY A 93  N GLY A 48 ? N GLY A 86  
AA1 2 3 O ALA A 47 ? O ALA A 85  N SER A 34 ? N SER A 72  
AA1 3 4 O VAL A 30 ? O VAL A 68  N TRP A 8  ? N TRP A 46  
AA1 4 5 N THR A 9  ? N THR A 47  O SER A 63 ? O SER A 101 
AA2 1 2 N ARG A 70 ? N ARG A 108 O SER A 78 ? O SER A 116 
AA3 1 2 O GLY B 55 ? O GLY B 93  N GLY B 48 ? N GLY B 86  
AA3 2 3 O ALA B 47 ? O ALA B 85  N LEU B 33 ? N LEU B 71  
AA3 3 4 O VAL B 30 ? O VAL B 68  N TRP B 8  ? N TRP B 46  
AA3 4 5 N THR B 9  ? N THR B 47  O SER B 63 ? O SER B 101 
AA4 1 2 N ARG B 70 ? N ARG B 108 O SER B 78 ? O SER B 116 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    MES 
_struct_site.pdbx_auth_seq_id     201 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    8 
_struct_site.details              'binding site for residue MES A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 ALA A 4  ? ALA A 42  . ? 3_674 ? 
2 AC1 8 ARG A 35 ? ARG A 73  . ? 1_555 ? 
3 AC1 8 ASP A 36 ? ASP A 74  . ? 1_555 ? 
4 AC1 8 TRP A 46 ? TRP A 84  . ? 1_555 ? 
5 AC1 8 HOH D .  ? HOH A 302 . ? 1_555 ? 
6 AC1 8 ASP B 13 ? ASP B 51  . ? 1_555 ? 
7 AC1 8 TYR B 14 ? TYR B 52  . ? 1_555 ? 
8 AC1 8 HOH E .  ? HOH B 231 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5K26 
_atom_sites.fract_transf_matrix[1][1]   0.015625 
_atom_sites.fract_transf_matrix[1][2]   0.009021 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018042 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.028409 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 4  ? 37.709 55.873 9.727   1.00 44.94  ? 42  ALA A N   1 
ATOM   2    C CA  . ALA A 1 4  ? 36.336 55.284 10.119  1.00 45.66  ? 42  ALA A CA  1 
ATOM   3    C C   . ALA A 1 4  ? 35.478 54.420 9.025   1.00 39.49  ? 42  ALA A C   1 
ATOM   4    O O   . ALA A 1 4  ? 35.671 54.363 7.789   1.00 60.11  ? 42  ALA A O   1 
ATOM   5    C CB  . ALA A 1 4  ? 35.483 56.381 10.791  1.00 42.96  ? 42  ALA A CB  1 
ATOM   6    N N   . ASN A 1 5  ? 34.425 53.840 9.531   1.00 23.65  ? 43  ASN A N   1 
ATOM   7    C CA  . ASN A 1 5  ? 33.460 53.146 8.737   1.00 20.45  ? 43  ASN A CA  1 
ATOM   8    C C   . ASN A 1 5  ? 32.190 53.962 8.712   1.00 16.67  ? 43  ASN A C   1 
ATOM   9    O O   . ASN A 1 5  ? 31.903 54.734 9.639   1.00 17.91  ? 43  ASN A O   1 
ATOM   10   C CB  . ASN A 1 5  ? 33.214 51.835 9.486   1.00 22.96  ? 43  ASN A CB  1 
ATOM   11   C CG  . ASN A 1 5  ? 34.405 50.913 9.495   1.00 23.71  ? 43  ASN A CG  1 
ATOM   12   O OD1 . ASN A 1 5  ? 34.758 50.374 8.388   1.00 31.84  ? 43  ASN A OD1 1 
ATOM   13   N ND2 . ASN A 1 5  ? 35.086 50.788 10.589  1.00 24.87  ? 43  ASN A ND2 1 
ATOM   14   N N   . PRO A 1 6  ? 31.284 53.628 7.789   1.00 17.04  ? 44  PRO A N   1 
ATOM   15   C CA  . PRO A 1 6  ? 29.986 54.350 7.753   1.00 15.64  ? 44  PRO A CA  1 
ATOM   16   C C   . PRO A 1 6  ? 29.137 54.057 9.031   1.00 12.96  ? 44  PRO A C   1 
ATOM   17   O O   . PRO A 1 6  ? 29.129 52.926 9.505   1.00 15.42  ? 44  PRO A O   1 
ATOM   18   C CB  . PRO A 1 6  ? 29.273 53.817 6.501   1.00 19.17  ? 44  PRO A CB  1 
ATOM   19   C CG  . PRO A 1 6  ? 30.444 53.322 5.701   1.00 24.93  ? 44  PRO A CG  1 
ATOM   20   C CD  . PRO A 1 6  ? 31.339 52.663 6.686   1.00 23.98  ? 44  PRO A CD  1 
ATOM   21   N N   . VAL A 1 7  ? 28.436 55.084 9.476   1.00 12.06  ? 45  VAL A N   1 
ATOM   22   C CA  . VAL A 1 7  ? 27.575 54.964 10.652  1.00 11.62  ? 45  VAL A CA  1 
ATOM   23   C C   . VAL A 1 7  ? 26.139 55.033 10.227  1.00 10.55  ? 45  VAL A C   1 
ATOM   24   O O   . VAL A 1 7  ? 25.693 56.086 9.674   1.00 12.94  ? 45  VAL A O   1 
ATOM   25   C CB  . VAL A 1 7  ? 27.923 56.040 11.686  1.00 13.46  ? 45  VAL A CB  1 
ATOM   26   C CG1 . VAL A 1 7  ? 26.935 56.024 12.783  1.00 15.63  ? 45  VAL A CG1 1 
ATOM   27   C CG2 . VAL A 1 7  ? 29.385 55.844 12.207  1.00 16.81  ? 45  VAL A CG2 1 
ATOM   28   N N   . TRP A 1 8  ? 25.393 54.003 10.461  1.00 10.11  ? 46  TRP A N   1 
ATOM   29   C CA  . TRP A 1 8  ? 23.997 53.913 10.148  1.00 10.86  ? 46  TRP A CA  1 
ATOM   30   C C   . TRP A 1 8  ? 23.118 54.078 11.411  1.00 10.85  ? 46  TRP A C   1 
ATOM   31   O O   . TRP A 1 8  ? 23.732 54.029 12.575  1.00 14.70  ? 46  TRP A O   1 
ATOM   32   C CB  . TRP A 1 8  ? 23.683 52.560 9.452   1.00 11.28  ? 46  TRP A CB  1 
ATOM   33   C CG  . TRP A 1 8  ? 24.264 52.452 8.077   1.00 12.24  ? 46  TRP A CG  1 
ATOM   34   C CD1 . TRP A 1 8  ? 25.565 52.494 7.709   1.00 14.58  ? 46  TRP A CD1 1 
ATOM   35   C CD2 . TRP A 1 8  ? 23.531 52.140 6.886   1.00 11.29  ? 46  TRP A CD2 1 
ATOM   36   N NE1 . TRP A 1 8  ? 25.713 52.241 6.373   1.00 15.90  ? 46  TRP A NE1 1 
ATOM   37   C CE2 . TRP A 1 8  ? 24.450 52.001 5.875   1.00 12.81  ? 46  TRP A CE2 1 
ATOM   38   C CE3 . TRP A 1 8  ? 22.220 51.937 6.644   1.00 11.22  ? 46  TRP A CE3 1 
ATOM   39   C CZ2 . TRP A 1 8  ? 24.069 51.690 4.553   1.00 14.59  ? 46  TRP A CZ2 1 
ATOM   40   C CZ3 . TRP A 1 8  ? 21.807 51.611 5.313   1.00 12.56  ? 46  TRP A CZ3 1 
ATOM   41   C CH2 . TRP A 1 8  ? 22.748 51.527 4.320   1.00 13.89  ? 46  TRP A CH2 1 
ATOM   42   N N   . THR A 1 9  ? 21.871 54.306 11.341  1.00 10.86  ? 47  THR A N   1 
ATOM   43   C CA  . THR A 1 9  ? 20.980 54.518 12.490  1.00 12.08  ? 47  THR A CA  1 
ATOM   44   C C   . THR A 1 9  ? 19.956 53.486 12.527  1.00 11.25  ? 47  THR A C   1 
ATOM   45   O O   . THR A 1 9  ? 19.266 53.183 11.541  1.00 11.85  ? 47  THR A O   1 
ATOM   46   C CB  . THR A 1 9  ? 20.384 55.927 12.395  1.00 14.44  ? 47  THR A CB  1 
ATOM   47   O OG1 . THR A 1 9  ? 21.448 56.886 12.400  1.00 16.90  ? 47  THR A OG1 1 
ATOM   48   C CG2 . THR A 1 9  ? 19.465 56.210 13.582  1.00 18.29  ? 47  THR A CG2 1 
ATOM   49   N N   . ALA A 1 10 ? 19.707 52.891 13.712  1.00 11.05  ? 48  ALA A N   1 
ATOM   50   C CA  . ALA A 1 10 ? 18.674 51.901 13.840  1.00 10.69  ? 48  ALA A CA  1 
ATOM   51   C C   . ALA A 1 10 ? 17.296 52.550 13.772  1.00 10.46  ? 48  ALA A C   1 
ATOM   52   O O   . ALA A 1 10 ? 16.983 53.561 14.458  1.00 11.86  ? 48  ALA A O   1 
ATOM   53   C CB  . ALA A 1 10 ? 18.798 51.164 15.194  1.00 10.97  ? 48  ALA A CB  1 
ATOM   54   N N   . LEU A 1 11 ? 16.442 51.977 12.921  1.00 10.67  ? 49  LEU A N   1 
ATOM   55   C CA  . LEU A 1 11 ? 15.085 52.383 12.701  1.00 12.57  ? 49  LEU A CA  1 
ATOM   56   C C   . LEU A 1 11 ? 14.103 51.776 13.751  1.00 11.46  ? 49  LEU A C   1 
ATOM   57   O O   . LEU A 1 11 ? 13.110 52.396 14.059  1.00 14.04  ? 49  LEU A O   1 
ATOM   58   C CB  . LEU A 1 11 ? 14.598 51.926 11.338  1.00 12.40  ? 49  LEU A CB  1 
ATOM   59   C CG  . LEU A 1 11 ? 15.229 52.572 10.137  1.00 15.81  ? 49  LEU A CG  1 
ATOM   60   C CD1 . LEU A 1 11 ? 14.832 51.798 8.906   1.00 19.16  ? 49  LEU A CD1 1 
ATOM   61   C CD2 . LEU A 1 11 ? 14.779 54.040 10.067  1.00 20.32  ? 49  LEU A CD2 1 
ATOM   62   N N   . PHE A 1 12 ? 14.423 50.581 14.194  1.00 11.20  ? 50  PHE A N   1 
ATOM   63   C CA  . PHE A 1 12 ? 13.527 49.827 15.068  1.00 12.82  ? 50  PHE A CA  1 
ATOM   64   C C   . PHE A 1 12 ? 14.393 49.104 16.082  1.00 11.83  ? 50  PHE A C   1 
ATOM   65   O O   . PHE A 1 12 ? 15.557 48.819 15.826  1.00 12.85  ? 50  PHE A O   1 
ATOM   66   C CB  . PHE A 1 12 ? 12.771 48.733 14.251  1.00 12.89  ? 50  PHE A CB  1 
ATOM   67   C CG  . PHE A 1 12 ? 12.304 49.170 12.924  1.00 12.17  ? 50  PHE A CG  1 
ATOM   68   C CD1 . PHE A 1 12 ? 11.308 50.121 12.778  1.00 14.40  ? 50  PHE A CD1 1 
ATOM   69   C CD2 . PHE A 1 12 ? 12.873 48.654 11.770  1.00 13.49  ? 50  PHE A CD2 1 
ATOM   70   C CE1 . PHE A 1 12 ? 10.914 50.530 11.530  1.00 14.47  ? 50  PHE A CE1 1 
ATOM   71   C CE2 . PHE A 1 12 ? 12.496 49.087 10.556  1.00 14.58  ? 50  PHE A CE2 1 
ATOM   72   C CZ  . PHE A 1 12 ? 11.552 50.040 10.415  1.00 14.50  ? 50  PHE A CZ  1 
ATOM   73   N N   . ASP A 1 13 ? 13.755 48.648 17.175  1.00 12.82  ? 51  ASP A N   1 
ATOM   74   C CA  . ASP A 1 13 ? 14.439 47.776 18.084  1.00 12.02  ? 51  ASP A CA  1 
ATOM   75   C C   . ASP A 1 13 ? 14.632 46.378 17.523  1.00 12.93  ? 51  ASP A C   1 
ATOM   76   O O   . ASP A 1 13 ? 13.715 45.896 16.739  1.00 15.64  ? 51  ASP A O   1 
ATOM   77   C CB  . ASP A 1 13 ? 13.621 47.593 19.386  1.00 13.77  ? 51  ASP A CB  1 
ATOM   78   C CG  . ASP A 1 13 ? 13.400 48.858 20.212  1.00 15.52  ? 51  ASP A CG  1 
ATOM   79   O OD1 . ASP A 1 13 ? 14.076 49.900 20.010  1.00 15.97  ? 51  ASP A OD1 1 
ATOM   80   O OD2 . ASP A 1 13 ? 12.591 48.782 21.157  1.00 19.90  ? 51  ASP A OD2 1 
ATOM   81   N N   . TYR A 1 14 ? 15.740 45.739 17.765  1.00 11.80  ? 52  TYR A N   1 
ATOM   82   C CA  . TYR A 1 14 ? 15.980 44.389 17.411  1.00 12.24  ? 52  TYR A CA  1 
ATOM   83   C C   . TYR A 1 14 ? 16.524 43.650 18.687  1.00 11.16  ? 52  TYR A C   1 
ATOM   84   O O   . TYR A 1 14 ? 17.552 44.095 19.188  1.00 12.32  ? 52  TYR A O   1 
ATOM   85   C CB  . TYR A 1 14 ? 17.006 44.253 16.219  1.00 13.78  ? 52  TYR A CB  1 
ATOM   86   C CG  . TYR A 1 14 ? 17.301 42.867 15.933  1.00 13.30  ? 52  TYR A CG  1 
ATOM   87   C CD1 . TYR A 1 14 ? 16.339 42.055 15.405  1.00 16.03  ? 52  TYR A CD1 1 
ATOM   88   C CD2 . TYR A 1 14 ? 18.480 42.319 16.205  1.00 15.60  ? 52  TYR A CD2 1 
ATOM   89   C CE1 . TYR A 1 14 ? 16.498 40.723 15.184  1.00 19.59  ? 52  TYR A CE1 1 
ATOM   90   C CE2 . TYR A 1 14 ? 18.719 40.933 15.993  1.00 16.81  ? 52  TYR A CE2 1 
ATOM   91   C CZ  . TYR A 1 14 ? 17.652 40.180 15.548  1.00 19.37  ? 52  TYR A CZ  1 
ATOM   92   O OH  . TYR A 1 14 ? 17.638 38.780 15.357  1.00 22.00  ? 52  TYR A OH  1 
ATOM   93   N N   . GLU A 1 15 ? 15.891 42.554 18.913  1.00 12.10  ? 53  GLU A N   1 
ATOM   94   C CA  . GLU A 1 15 ? 16.358 41.700 20.114  1.00 13.09  ? 53  GLU A CA  1 
ATOM   95   C C   . GLU A 1 15 ? 17.067 40.427 19.529  1.00 13.32  ? 53  GLU A C   1 
ATOM   96   O O   . GLU A 1 15 ? 16.439 39.679 18.790  1.00 16.38  ? 53  GLU A O   1 
ATOM   97   C CB  . GLU A 1 15 ? 15.186 41.341 20.944  1.00 12.78  ? 53  GLU A CB  1 
ATOM   98   C CG  . GLU A 1 15 ? 15.563 40.630 22.264  1.00 12.42  ? 53  GLU A CG  1 
ATOM   99   C CD  . GLU A 1 15 ? 16.306 41.534 23.160  1.00 12.55  ? 53  GLU A CD  1 
ATOM   100  O OE1 . GLU A 1 15 ? 16.752 42.618 22.972  1.00 14.08  ? 53  GLU A OE1 1 
ATOM   101  O OE2 . GLU A 1 15 ? 16.397 41.015 24.402  1.00 14.61  ? 53  GLU A OE2 1 
ATOM   102  N N   . PRO A 1 16 ? 18.345 40.234 19.888  1.00 13.07  ? 54  PRO A N   1 
ATOM   103  C CA  . PRO A 1 16 ? 19.043 39.063 19.378  1.00 15.70  ? 54  PRO A CA  1 
ATOM   104  C C   . PRO A 1 16 ? 18.375 37.719 19.733  1.00 16.36  ? 54  PRO A C   1 
ATOM   105  O O   . PRO A 1 16 ? 17.892 37.588 20.846  1.00 18.59  ? 54  PRO A O   1 
ATOM   106  C CB  . PRO A 1 16 ? 20.431 39.133 20.026  1.00 17.54  ? 54  PRO A CB  1 
ATOM   107  C CG  . PRO A 1 16 ? 20.573 40.555 20.368  1.00 20.24  ? 54  PRO A CG  1 
ATOM   108  C CD  . PRO A 1 16 ? 19.235 41.098 20.683  1.00 15.43  ? 54  PRO A CD  1 
ATOM   109  N N   . SER A 1 17 ? 18.525 36.797 18.810  1.00 18.47  ? 55  SER A N   1 
ATOM   110  C CA  . SER A 1 17 ? 18.101 35.440 18.964  1.00 22.63  ? 55  SER A CA  1 
ATOM   111  C C   . SER A 1 17 ? 19.275 34.540 19.231  1.00 30.37  ? 55  SER A C   1 
ATOM   112  O O   . SER A 1 17 ? 19.069 33.418 19.609  1.00 42.81  ? 55  SER A O   1 
ATOM   113  C CB  . SER A 1 17 ? 17.337 35.002 17.683  1.00 32.90  ? 55  SER A CB  1 
ATOM   114  O OG  . SER A 1 17 ? 18.256 34.813 16.659  1.00 48.18  ? 55  SER A OG  1 
ATOM   115  N N   . GLY A 1 18 ? 20.474 35.018 19.046  1.00 24.93  ? 56  GLY A N   1 
ATOM   116  C CA  . GLY A 1 18 ? 21.685 34.286 19.355  1.00 34.64  ? 56  GLY A CA  1 
ATOM   117  C C   . GLY A 1 18 ? 22.795 35.213 19.885  1.00 26.37  ? 56  GLY A C   1 
ATOM   118  O O   . GLY A 1 18 ? 22.769 36.440 19.726  1.00 23.00  ? 56  GLY A O   1 
ATOM   119  N N   . GLN A 1 19 ? 23.878 34.576 20.300  1.00 25.43  ? 57  GLN A N   1 
ATOM   120  C CA  A GLN A 1 19 ? 24.923 35.362 21.000  0.50 26.30  ? 57  GLN A CA  1 
ATOM   121  C CA  B GLN A 1 19 ? 24.954 35.227 20.966  0.50 26.22  ? 57  GLN A CA  1 
ATOM   122  C C   . GLN A 1 19 ? 25.819 36.175 20.115  1.00 25.68  ? 57  GLN A C   1 
ATOM   123  O O   . GLN A 1 19 ? 26.357 37.170 20.570  1.00 38.09  ? 57  GLN A O   1 
ATOM   124  C CB  A GLN A 1 19 ? 25.860 34.590 21.988  0.50 25.28  ? 57  GLN A CB  1 
ATOM   125  C CB  B GLN A 1 19 ? 25.842 34.142 21.612  0.50 31.63  ? 57  GLN A CB  1 
ATOM   126  C CG  A GLN A 1 19 ? 25.387 34.524 23.433  0.50 31.10  ? 57  GLN A CG  1 
ATOM   127  C CG  B GLN A 1 19 ? 25.145 33.199 22.610  0.50 29.64  ? 57  GLN A CG  1 
ATOM   128  C CD  A GLN A 1 19 ? 25.259 35.835 24.193  0.50 30.98  ? 57  GLN A CD  1 
ATOM   129  C CD  B GLN A 1 19 ? 23.834 32.523 22.225  0.50 30.97  ? 57  GLN A CD  1 
ATOM   130  O OE1 A GLN A 1 19 ? 24.643 35.802 25.195  0.50 46.82  ? 57  GLN A OE1 1 
ATOM   131  O OE1 B GLN A 1 19 ? 23.747 31.708 21.323  0.50 35.14  ? 57  GLN A OE1 1 
ATOM   132  N NE2 A GLN A 1 19 ? 25.887 36.922 23.799  0.50 31.46  ? 57  GLN A NE2 1 
ATOM   133  N NE2 B GLN A 1 19 ? 22.774 32.939 22.897  0.50 53.72  ? 57  GLN A NE2 1 
ATOM   134  N N   . ASP A 1 20 ? 25.859 35.822 18.797  1.00 19.17  ? 58  ASP A N   1 
ATOM   135  C CA  . ASP A 1 20 ? 26.582 36.599 17.829  1.00 17.85  ? 58  ASP A CA  1 
ATOM   136  C C   . ASP A 1 20 ? 25.843 37.825 17.258  1.00 14.00  ? 58  ASP A C   1 
ATOM   137  O O   . ASP A 1 20 ? 26.370 38.609 16.524  1.00 13.52  ? 58  ASP A O   1 
ATOM   138  C CB  . ASP A 1 20 ? 26.957 35.703 16.635  1.00 25.50  ? 58  ASP A CB  1 
ATOM   139  C CG  . ASP A 1 20 ? 27.938 34.599 16.961  1.00 37.04  ? 58  ASP A CG  1 
ATOM   140  O OD1 . ASP A 1 20 ? 28.540 34.597 18.076  1.00 39.44  ? 58  ASP A OD1 1 
ATOM   141  O OD2 . ASP A 1 20 ? 28.086 33.692 16.060  1.00 51.35  ? 58  ASP A OD2 1 
ATOM   142  N N   . GLU A 1 21 ? 24.573 37.938 17.582  1.00 14.00  ? 59  GLU A N   1 
ATOM   143  C CA  . GLU A 1 21 ? 23.715 39.016 17.078  1.00 12.23  ? 59  GLU A CA  1 
ATOM   144  C C   . GLU A 1 21 ? 23.751 40.258 17.938  1.00 12.32  ? 59  GLU A C   1 
ATOM   145  O O   . GLU A 1 21 ? 23.922 40.121 19.196  1.00 16.54  ? 59  GLU A O   1 
ATOM   146  C CB  . GLU A 1 21 ? 22.298 38.537 16.848  1.00 13.19  ? 59  GLU A CB  1 
ATOM   147  C CG  . GLU A 1 21 ? 22.154 37.490 15.855  1.00 15.16  ? 59  GLU A CG  1 
ATOM   148  C CD  . GLU A 1 21 ? 20.755 36.953 15.672  1.00 18.14  ? 59  GLU A CD  1 
ATOM   149  O OE1 . GLU A 1 21 ? 19.783 37.552 16.226  1.00 24.08  ? 59  GLU A OE1 1 
ATOM   150  O OE2 . GLU A 1 21 ? 20.623 35.963 14.903  1.00 22.59  ? 59  GLU A OE2 1 
ATOM   151  N N   . LEU A 1 22 ? 23.704 41.430 17.424  1.00 12.75  ? 60  LEU A N   1 
ATOM   152  C CA  . LEU A 1 22 ? 23.779 42.691 18.083  1.00 12.75  ? 60  LEU A CA  1 
ATOM   153  C C   . LEU A 1 22 ? 22.449 43.218 18.340  1.00 13.30  ? 60  LEU A C   1 
ATOM   154  O O   . LEU A 1 22 ? 21.637 43.433 17.455  1.00 14.76  ? 60  LEU A O   1 
ATOM   155  C CB  . LEU A 1 22 ? 24.603 43.615 17.124  1.00 14.74  ? 60  LEU A CB  1 
ATOM   156  C CG  . LEU A 1 22 ? 24.951 44.954 17.576  1.00 15.42  ? 60  LEU A CG  1 
ATOM   157  C CD1 . LEU A 1 22 ? 26.015 44.878 18.641  1.00 18.77  ? 60  LEU A CD1 1 
ATOM   158  C CD2 . LEU A 1 22 ? 25.473 45.764 16.354  1.00 17.96  ? 60  LEU A CD2 1 
ATOM   159  N N   . ALA A 1 23 ? 22.160 43.537 19.630  1.00 13.18  ? 61  ALA A N   1 
ATOM   160  C CA  . ALA A 1 23 ? 20.995 44.172 19.978  1.00 12.42  ? 61  ALA A CA  1 
ATOM   161  C C   . ALA A 1 23 ? 20.921 45.599 19.476  1.00 12.95  ? 61  ALA A C   1 
ATOM   162  O O   . ALA A 1 23 ? 21.884 46.330 19.622  1.00 15.96  ? 61  ALA A O   1 
ATOM   163  C CB  . ALA A 1 23 ? 20.779 44.162 21.520  1.00 16.73  ? 61  ALA A CB  1 
ATOM   164  N N   . LEU A 1 24 ? 19.743 46.012 18.935  1.00 11.49  ? 62  LEU A N   1 
ATOM   165  C CA  . LEU A 1 24 ? 19.581 47.398 18.524  1.00 11.74  ? 62  LEU A CA  1 
ATOM   166  C C   . LEU A 1 24 ? 18.375 48.006 19.224  1.00 11.15  ? 62  LEU A C   1 
ATOM   167  O O   . LEU A 1 24 ? 17.421 47.314 19.441  1.00 12.00  ? 62  LEU A O   1 
ATOM   168  C CB  . LEU A 1 24 ? 19.279 47.511 16.946  1.00 13.25  ? 62  LEU A CB  1 
ATOM   169  C CG  . LEU A 1 24 ? 20.268 46.826 16.048  1.00 14.15  ? 62  LEU A CG  1 
ATOM   170  C CD1 . LEU A 1 24 ? 19.824 46.901 14.597  1.00 14.37  ? 62  LEU A CD1 1 
ATOM   171  C CD2 . LEU A 1 24 ? 21.633 47.500 16.195  1.00 17.36  ? 62  LEU A CD2 1 
ATOM   172  N N   . ARG A 1 25 ? 18.467 49.296 19.464  1.00 11.34  ? 63  ARG A N   1 
ATOM   173  C CA  . ARG A 1 25 ? 17.300 50.070 19.859  1.00 11.84  ? 63  ARG A CA  1 
ATOM   174  C C   . ARG A 1 25 ? 17.178 51.291 18.897  1.00 11.21  ? 63  ARG A C   1 
ATOM   175  O O   . ARG A 1 25 ? 18.190 51.842 18.499  1.00 11.73  ? 63  ARG A O   1 
ATOM   176  C CB  . ARG A 1 25 ? 17.377 50.491 21.377  1.00 12.43  ? 63  ARG A CB  1 
ATOM   177  C CG  . ARG A 1 25 ? 17.413 49.303 22.314  1.00 13.61  ? 63  ARG A CG  1 
ATOM   178  C CD  . ARG A 1 25 ? 16.196 48.471 22.361  1.00 13.64  ? 63  ARG A CD  1 
ATOM   179  N NE  . ARG A 1 25 ? 16.254 47.384 23.331  1.00 13.48  ? 63  ARG A NE  1 
ATOM   180  C CZ  . ARG A 1 25 ? 16.577 46.146 23.084  1.00 14.34  ? 63  ARG A CZ  1 
ATOM   181  N NH1 . ARG A 1 25 ? 16.951 45.745 21.830  1.00 15.76  ? 63  ARG A NH1 1 
ATOM   182  N NH2 . ARG A 1 25 ? 16.544 45.190 24.039  1.00 15.85  ? 63  ARG A NH2 1 
ATOM   183  N N   . LYS A 1 26 ? 15.946 51.632 18.680  1.00 12.28  ? 64  LYS A N   1 
ATOM   184  C CA  . LYS A 1 26 ? 15.678 52.758 17.782  1.00 13.21  ? 64  LYS A CA  1 
ATOM   185  C C   . LYS A 1 26 ? 16.525 53.921 18.109  1.00 12.85  ? 64  LYS A C   1 
ATOM   186  O O   . LYS A 1 26 ? 16.553 54.350 19.269  1.00 15.53  ? 64  LYS A O   1 
ATOM   187  C CB  . LYS A 1 26 ? 14.171 53.030 17.777  1.00 17.13  ? 64  LYS A CB  1 
ATOM   188  C CG  . LYS A 1 26 ? 13.748 54.191 16.929  1.00 19.05  ? 64  LYS A CG  1 
ATOM   189  C CD  . LYS A 1 26 ? 12.201 54.374 16.833  1.00 27.32  ? 64  LYS A CD  1 
ATOM   190  C CE  . LYS A 1 26 ? 11.884 55.618 15.939  1.00 34.48  ? 64  LYS A CE  1 
ATOM   191  N NZ  . LYS A 1 26 ? 10.452 55.885 16.159  1.00 54.24  ? 64  LYS A NZ  1 
ATOM   192  N N   . GLY A 1 27 ? 17.181 54.538 17.092  1.00 13.16  ? 65  GLY A N   1 
ATOM   193  C CA  . GLY A 1 27 ? 18.061 55.640 17.278  1.00 14.58  ? 65  GLY A CA  1 
ATOM   194  C C   . GLY A 1 27 ? 19.500 55.325 17.550  1.00 14.50  ? 65  GLY A C   1 
ATOM   195  O O   . GLY A 1 27 ? 20.308 56.245 17.455  1.00 17.72  ? 65  GLY A O   1 
ATOM   196  N N   . ASP A 1 28 ? 19.858 54.086 17.857  1.00 13.26  ? 66  ASP A N   1 
ATOM   197  C CA  . ASP A 1 28 ? 21.239 53.737 18.030  1.00 13.18  ? 66  ASP A CA  1 
ATOM   198  C C   . ASP A 1 28 ? 22.051 54.044 16.814  1.00 12.81  ? 66  ASP A C   1 
ATOM   199  O O   . ASP A 1 28 ? 21.631 53.719 15.663  1.00 13.71  ? 66  ASP A O   1 
ATOM   200  C CB  . ASP A 1 28 ? 21.395 52.268 18.368  1.00 13.45  ? 66  ASP A CB  1 
ATOM   201  C CG  . ASP A 1 28 ? 21.025 51.863 19.753  1.00 18.34  ? 66  ASP A CG  1 
ATOM   202  O OD1 . ASP A 1 28 ? 20.820 52.679 20.684  1.00 22.78  ? 66  ASP A OD1 1 
ATOM   203  O OD2 . ASP A 1 28 ? 20.945 50.561 19.932  1.00 18.67  ? 66  ASP A OD2 1 
ATOM   204  N N   . ARG A 1 29 ? 23.249 54.535 16.961  1.00 13.23  ? 67  ARG A N   1 
ATOM   205  C CA  . ARG A 1 29 ? 24.215 54.690 15.875  1.00 12.82  ? 67  ARG A CA  1 
ATOM   206  C C   . ARG A 1 29 ? 25.063 53.472 15.805  1.00 13.45  ? 67  ARG A C   1 
ATOM   207  O O   . ARG A 1 29 ? 25.603 53.003 16.796  1.00 18.90  ? 67  ARG A O   1 
ATOM   208  C CB  . ARG A 1 29 ? 25.036 55.968 16.138  1.00 17.86  ? 67  ARG A CB  1 
ATOM   209  C CG  . ARG A 1 29 ? 24.118 57.170 15.894  1.00 29.04  ? 67  ARG A CG  1 
ATOM   210  C CD  . ARG A 1 29 ? 24.699 58.120 14.899  1.00 32.14  ? 67  ARG A CD  1 
ATOM   211  N NE  . ARG A 1 29 ? 24.062 59.409 14.539  1.00 30.79  ? 67  ARG A NE  1 
ATOM   212  C CZ  . ARG A 1 29 ? 24.612 60.638 14.594  1.00 32.47  ? 67  ARG A CZ  1 
ATOM   213  N NH1 . ARG A 1 29 ? 25.876 60.829 14.978  1.00 45.03  ? 67  ARG A NH1 1 
ATOM   214  N NH2 . ARG A 1 29 ? 23.885 61.654 14.136  1.00 36.19  ? 67  ARG A NH2 1 
ATOM   215  N N   . VAL A 1 30 ? 25.119 52.834 14.653  1.00 11.13  ? 68  VAL A N   1 
ATOM   216  C CA  . VAL A 1 30 ? 25.744 51.645 14.420  1.00 10.87  ? 68  VAL A CA  1 
ATOM   217  C C   . VAL A 1 30 ? 26.915 51.797 13.472  1.00 10.76  ? 68  VAL A C   1 
ATOM   218  O O   . VAL A 1 30 ? 26.648 52.205 12.261  1.00 12.33  ? 68  VAL A O   1 
ATOM   219  C CB  . VAL A 1 30 ? 24.749 50.579 13.788  1.00 14.07  ? 68  VAL A CB  1 
ATOM   220  C CG1 . VAL A 1 30 ? 25.434 49.253 13.645  1.00 16.74  ? 68  VAL A CG1 1 
ATOM   221  C CG2 . VAL A 1 30 ? 23.499 50.445 14.576  1.00 17.57  ? 68  VAL A CG2 1 
ATOM   222  N N   . GLU A 1 31 ? 28.151 51.514 13.775  1.00 11.13  ? 69  GLU A N   1 
ATOM   223  C CA  . GLU A 1 31 ? 29.244 51.553 12.831  1.00 10.96  ? 69  GLU A CA  1 
ATOM   224  C C   . GLU A 1 31 ? 29.195 50.238 12.095  1.00 12.06  ? 69  GLU A C   1 
ATOM   225  O O   . GLU A 1 31 ? 29.298 49.176 12.660  1.00 12.73  ? 69  GLU A O   1 
ATOM   226  C CB  . GLU A 1 31 ? 30.523 51.774 13.622  1.00 16.32  ? 69  GLU A CB  1 
ATOM   227  C CG  . GLU A 1 31 ? 31.693 51.889 12.697  1.00 21.38  ? 69  GLU A CG  1 
ATOM   228  C CD  . GLU A 1 31 ? 33.016 52.222 13.437  1.00 31.50  ? 69  GLU A CD  1 
ATOM   229  O OE1 . GLU A 1 31 ? 33.073 52.480 14.661  1.00 33.93  ? 69  GLU A OE1 1 
ATOM   230  O OE2 . GLU A 1 31 ? 34.061 52.292 12.779  1.00 45.39  ? 69  GLU A OE2 1 
ATOM   231  N N   . VAL A 1 32 ? 29.048 50.333 10.760  1.00 11.83  ? 70  VAL A N   1 
ATOM   232  C CA  . VAL A 1 32 ? 28.928 49.156 9.936   1.00 11.34  ? 70  VAL A CA  1 
ATOM   233  C C   . VAL A 1 32 ? 30.280 48.675 9.469   1.00 12.23  ? 70  VAL A C   1 
ATOM   234  O O   . VAL A 1 32 ? 30.950 49.368 8.705   1.00 16.26  ? 70  VAL A O   1 
ATOM   235  C CB  . VAL A 1 32 ? 27.918 49.361 8.796   1.00 14.16  ? 70  VAL A CB  1 
ATOM   236  C CG1 . VAL A 1 32 ? 27.850 48.102 7.906   1.00 15.54  ? 70  VAL A CG1 1 
ATOM   237  C CG2 . VAL A 1 32 ? 26.598 49.640 9.408   1.00 15.47  ? 70  VAL A CG2 1 
ATOM   238  N N   . LEU A 1 33 ? 30.698 47.523 9.931   1.00 11.82  ? 71  LEU A N   1 
ATOM   239  C CA  . LEU A 1 33 ? 31.968 46.971 9.627   1.00 11.81  ? 71  LEU A CA  1 
ATOM   240  C C   . LEU A 1 33 ? 32.000 46.116 8.373   1.00 12.79  ? 71  LEU A C   1 
ATOM   241  O O   . LEU A 1 33 ? 33.056 46.027 7.743   1.00 14.63  ? 71  LEU A O   1 
ATOM   242  C CB  . LEU A 1 33 ? 32.481 46.136 10.822  1.00 12.42  ? 71  LEU A CB  1 
ATOM   243  C CG  . LEU A 1 33 ? 32.552 46.798 12.149  1.00 14.15  ? 71  LEU A CG  1 
ATOM   244  C CD1 . LEU A 1 33 ? 32.984 45.857 13.247  1.00 16.25  ? 71  LEU A CD1 1 
ATOM   245  C CD2 . LEU A 1 33 ? 33.343 48.096 12.142  1.00 17.07  ? 71  LEU A CD2 1 
ATOM   246  N N   . SER A 1 34 ? 30.891 45.496 8.002   1.00 11.88  ? 72  SER A N   1 
ATOM   247  C CA  . SER A 1 34 ? 30.807 44.708 6.771   1.00 11.84  ? 72  SER A CA  1 
ATOM   248  C C   . SER A 1 34 ? 29.373 44.520 6.432   1.00 11.74  ? 72  SER A C   1 
ATOM   249  O O   . SER A 1 34 ? 28.571 44.187 7.275   1.00 12.45  ? 72  SER A O   1 
ATOM   250  C CB  . SER A 1 34 ? 31.390 43.372 6.966   1.00 13.80  ? 72  SER A CB  1 
ATOM   251  O OG  . SER A 1 34 ? 31.172 42.537 5.814   1.00 15.76  ? 72  SER A OG  1 
ATOM   252  N N   . ARG A 1 35 ? 29.053 44.698 5.135   1.00 12.00  ? 73  ARG A N   1 
ATOM   253  C CA  . ARG A 1 35 ? 27.774 44.402 4.634   1.00 12.27  ? 73  ARG A CA  1 
ATOM   254  C C   . ARG A 1 35 ? 27.669 43.066 3.883   1.00 13.88  ? 73  ARG A C   1 
ATOM   255  O O   . ARG A 1 35 ? 26.557 42.754 3.363   1.00 15.20  ? 73  ARG A O   1 
ATOM   256  C CB  . ARG A 1 35 ? 27.263 45.525 3.707   1.00 13.58  ? 73  ARG A CB  1 
ATOM   257  C CG  . ARG A 1 35 ? 27.316 46.850 4.428   1.00 15.83  ? 73  ARG A CG  1 
ATOM   258  C CD  . ARG A 1 35 ? 26.454 47.896 3.921   1.00 17.95  ? 73  ARG A CD  1 
ATOM   259  N NE  . ARG A 1 35 ? 26.826 48.318 2.639   1.00 18.99  ? 73  ARG A NE  1 
ATOM   260  C CZ  . ARG A 1 35 ? 26.024 48.978 1.786   1.00 22.38  ? 73  ARG A CZ  1 
ATOM   261  N NH1 . ARG A 1 35 ? 24.793 49.272 2.033   1.00 27.61  ? 73  ARG A NH1 1 
ATOM   262  N NH2 . ARG A 1 35 ? 26.495 49.372 0.677   1.00 27.05  ? 73  ARG A NH2 1 
ATOM   263  N N   . ASP A 1 36 ? 28.728 42.269 3.889   1.00 14.20  ? 74  ASP A N   1 
ATOM   264  C CA  . ASP A 1 36 ? 28.846 41.111 3.002   1.00 15.83  ? 74  ASP A CA  1 
ATOM   265  C C   . ASP A 1 36 ? 29.167 39.885 3.880   1.00 15.03  ? 74  ASP A C   1 
ATOM   266  O O   . ASP A 1 36 ? 30.259 39.694 4.357   1.00 16.88  ? 74  ASP A O   1 
ATOM   267  C CB  . ASP A 1 36 ? 29.964 41.402 2.006   1.00 20.40  ? 74  ASP A CB  1 
ATOM   268  C CG  . ASP A 1 36 ? 29.705 42.674 1.149   1.00 28.33  ? 74  ASP A CG  1 
ATOM   269  O OD1 . ASP A 1 36 ? 28.626 42.786 0.591   1.00 41.82  ? 74  ASP A OD1 1 
ATOM   270  O OD2 . ASP A 1 36 ? 30.632 43.527 0.995   1.00 43.13  ? 74  ASP A OD2 1 
ATOM   271  N N   . ALA A 1 37 ? 28.164 38.991 4.086   1.00 15.99  ? 75  ALA A N   1 
ATOM   272  C CA  . ALA A 1 37 ? 28.385 37.787 4.789   1.00 16.46  ? 75  ALA A CA  1 
ATOM   273  C C   . ALA A 1 37 ? 29.296 36.866 3.994   1.00 17.94  ? 75  ALA A C   1 
ATOM   274  O O   . ALA A 1 37 ? 29.159 36.714 2.781   1.00 20.24  ? 75  ALA A O   1 
ATOM   275  C CB  . ALA A 1 37 ? 27.039 37.105 4.983   1.00 16.43  ? 75  ALA A CB  1 
ATOM   276  N N   . ALA A 1 38 ? 30.208 36.208 4.675   1.00 19.72  ? 76  ALA A N   1 
ATOM   277  C CA  . ALA A 1 38 ? 31.057 35.188 3.992   1.00 19.99  ? 76  ALA A CA  1 
ATOM   278  C C   . ALA A 1 38 ? 30.260 34.013 3.532   1.00 18.67  ? 76  ALA A C   1 
ATOM   279  O O   . ALA A 1 38 ? 30.645 33.417 2.526   1.00 26.83  ? 76  ALA A O   1 
ATOM   280  C CB  . ALA A 1 38 ? 32.193 34.739 4.976   1.00 19.98  ? 76  ALA A CB  1 
ATOM   281  N N   . ILE A 1 39 ? 29.227 33.647 4.284   1.00 19.85  ? 77  ILE A N   1 
ATOM   282  C CA  . ILE A 1 39 ? 28.359 32.450 3.994   1.00 19.66  ? 77  ILE A CA  1 
ATOM   283  C C   . ILE A 1 39 ? 27.060 32.964 3.376   1.00 19.37  ? 77  ILE A C   1 
ATOM   284  O O   . ILE A 1 39 ? 26.367 33.824 4.007   1.00 19.26  ? 77  ILE A O   1 
ATOM   285  C CB  . ILE A 1 39 ? 28.082 31.670 5.342   1.00 23.92  ? 77  ILE A CB  1 
ATOM   286  C CG1 . ILE A 1 39 ? 29.399 31.018 5.804   1.00 28.95  ? 77  ILE A CG1 1 
ATOM   287  C CG2 . ILE A 1 39 ? 26.991 30.583 5.133   1.00 33.22  ? 77  ILE A CG2 1 
ATOM   288  C CD1 . ILE A 1 39 ? 30.237 30.417 4.722   1.00 38.33  ? 77  ILE A CD1 1 
ATOM   289  N N   . SER A 1 40 ? 26.711 32.489 2.182   1.00 20.01  ? 78  SER A N   1 
ATOM   290  C CA  . SER A 1 40 ? 25.560 33.044 1.378   1.00 19.88  ? 78  SER A CA  1 
ATOM   291  C C   . SER A 1 40 ? 24.255 32.968 2.199   1.00 17.44  ? 78  SER A C   1 
ATOM   292  O O   . SER A 1 40 ? 23.470 33.912 2.103   1.00 16.08  ? 78  SER A O   1 
ATOM   293  C CB  . SER A 1 40 ? 25.389 32.487 0.047   1.00 24.34  ? 78  SER A CB  1 
ATOM   294  O OG  . SER A 1 40 ? 25.240 31.108 0.147   1.00 34.01  ? 78  SER A OG  1 
ATOM   295  N N   . GLY A 1 41 ? 24.082 31.928 3.066   1.00 19.29  ? 79  GLY A N   1 
ATOM   296  C CA  . GLY A 1 41 ? 22.879 31.875 3.796   1.00 18.77  ? 79  GLY A CA  1 
ATOM   297  C C   . GLY A 1 41 ? 22.677 32.996 4.746   1.00 19.04  ? 79  GLY A C   1 
ATOM   298  O O   . GLY A 1 41 ? 21.554 33.201 5.210   1.00 21.86  ? 79  GLY A O   1 
ATOM   299  N N   . ASP A 1 42 ? 23.761 33.706 5.101   1.00 16.28  ? 80  ASP A N   1 
ATOM   300  C CA  . ASP A 1 42 ? 23.717 34.832 6.028   1.00 14.74  ? 80  ASP A CA  1 
ATOM   301  C C   . ASP A 1 42 ? 23.561 36.205 5.329   1.00 12.87  ? 80  ASP A C   1 
ATOM   302  O O   . ASP A 1 42 ? 23.549 37.228 6.002   1.00 13.72  ? 80  ASP A O   1 
ATOM   303  C CB  . ASP A 1 42 ? 25.025 34.857 6.881   1.00 16.35  ? 80  ASP A CB  1 
ATOM   304  C CG  . ASP A 1 42 ? 25.207 33.735 7.832   1.00 18.02  ? 80  ASP A CG  1 
ATOM   305  O OD1 . ASP A 1 42 ? 24.224 33.206 8.401   1.00 24.50  ? 80  ASP A OD1 1 
ATOM   306  O OD2 . ASP A 1 42 ? 26.386 33.434 8.120   1.00 21.51  ? 80  ASP A OD2 1 
ATOM   307  N N   . GLU A 1 43 ? 23.428 36.211 3.991   1.00 12.89  ? 81  GLU A N   1 
ATOM   308  C CA  . GLU A 1 43 ? 23.337 37.478 3.278   1.00 11.85  ? 81  GLU A CA  1 
ATOM   309  C C   . GLU A 1 43 ? 22.119 38.241 3.798   1.00 11.58  ? 81  GLU A C   1 
ATOM   310  O O   . GLU A 1 43 ? 21.068 37.637 3.999   1.00 13.19  ? 81  GLU A O   1 
ATOM   311  C CB  . GLU A 1 43 ? 23.264 37.270 1.773   1.00 13.89  ? 81  GLU A CB  1 
ATOM   312  C CG  . GLU A 1 43 ? 23.342 38.522 0.963   1.00 17.92  ? 81  GLU A CG  1 
ATOM   313  C CD  . GLU A 1 43 ? 24.689 39.186 0.959   1.00 23.35  ? 81  GLU A CD  1 
ATOM   314  O OE1 . GLU A 1 43 ? 25.684 38.518 0.983   1.00 31.26  ? 81  GLU A OE1 1 
ATOM   315  O OE2 . GLU A 1 43 ? 24.740 40.514 0.954   1.00 21.97  ? 81  GLU A OE2 1 
ATOM   316  N N   . GLY A 1 44 ? 22.277 39.529 3.924   1.00 11.70  ? 82  GLY A N   1 
ATOM   317  C CA  . GLY A 1 44 ? 21.213 40.328 4.461   1.00 11.70  ? 82  GLY A CA  1 
ATOM   318  C C   . GLY A 1 44 ? 21.494 40.748 5.972   1.00 10.55  ? 82  GLY A C   1 
ATOM   319  O O   . GLY A 1 44 ? 20.871 41.631 6.410   1.00 12.92  ? 82  GLY A O   1 
ATOM   320  N N   . TRP A 1 45 ? 22.425 40.044 6.575   1.00 10.28  ? 83  TRP A N   1 
ATOM   321  C CA  . TRP A 1 45 ? 22.915 40.377 7.923   1.00 10.26  ? 83  TRP A CA  1 
ATOM   322  C C   . TRP A 1 45 ? 24.179 41.054 7.787   1.00 9.85   ? 83  TRP A C   1 
ATOM   323  O O   . TRP A 1 45 ? 25.094 40.608 7.006   1.00 10.99  ? 83  TRP A O   1 
ATOM   324  C CB  . TRP A 1 45 ? 22.930 39.062 8.756   1.00 11.36  ? 83  TRP A CB  1 
ATOM   325  C CG  . TRP A 1 45 ? 21.624 38.560 9.095   1.00 12.13  ? 83  TRP A CG  1 
ATOM   326  C CD1 . TRP A 1 45 ? 20.743 37.934 8.235   1.00 14.71  ? 83  TRP A CD1 1 
ATOM   327  C CD2 . TRP A 1 45 ? 20.943 38.691 10.355  1.00 12.02  ? 83  TRP A CD2 1 
ATOM   328  N NE1 . TRP A 1 45 ? 19.598 37.665 8.903   1.00 16.77  ? 83  TRP A NE1 1 
ATOM   329  C CE2 . TRP A 1 45 ? 19.731 38.091 10.187  1.00 13.76  ? 83  TRP A CE2 1 
ATOM   330  C CE3 . TRP A 1 45 ? 21.321 39.172 11.622  1.00 12.80  ? 83  TRP A CE3 1 
ATOM   331  C CZ2 . TRP A 1 45 ? 18.781 37.995 11.263  1.00 16.22  ? 83  TRP A CZ2 1 
ATOM   332  C CZ3 . TRP A 1 45 ? 20.462 39.039 12.644  1.00 15.97  ? 83  TRP A CZ3 1 
ATOM   333  C CH2 . TRP A 1 45 ? 19.222 38.455 12.470  1.00 17.50  ? 83  TRP A CH2 1 
ATOM   334  N N   . TRP A 1 46 ? 24.366 42.204 8.458   1.00 9.80   ? 84  TRP A N   1 
ATOM   335  C CA  . TRP A 1 46 ? 25.503 43.002 8.380   1.00 10.20  ? 84  TRP A CA  1 
ATOM   336  C C   . TRP A 1 46 ? 26.318 42.964 9.774   1.00 10.22  ? 84  TRP A C   1 
ATOM   337  O O   . TRP A 1 46 ? 25.626 42.677 10.796  1.00 11.40  ? 84  TRP A O   1 
ATOM   338  C CB  . TRP A 1 46 ? 25.198 44.434 8.112   1.00 10.90  ? 84  TRP A CB  1 
ATOM   339  C CG  . TRP A 1 46 ? 24.633 44.655 6.657   1.00 10.30  ? 84  TRP A CG  1 
ATOM   340  C CD1 . TRP A 1 46 ? 24.505 43.677 5.735   1.00 10.19  ? 84  TRP A CD1 1 
ATOM   341  C CD2 . TRP A 1 46 ? 24.097 45.851 6.154   1.00 10.77  ? 84  TRP A CD2 1 
ATOM   342  N NE1 . TRP A 1 46 ? 23.918 44.269 4.580   1.00 10.93  ? 84  TRP A NE1 1 
ATOM   343  C CE2 . TRP A 1 46 ? 23.668 45.551 4.775   1.00 11.23  ? 84  TRP A CE2 1 
ATOM   344  C CE3 . TRP A 1 46 ? 23.919 47.101 6.647   1.00 12.26  ? 84  TRP A CE3 1 
ATOM   345  C CZ2 . TRP A 1 46 ? 23.057 46.519 3.998   1.00 12.58  ? 84  TRP A CZ2 1 
ATOM   346  C CZ3 . TRP A 1 46 ? 23.323 48.103 5.839   1.00 13.33  ? 84  TRP A CZ3 1 
ATOM   347  C CH2 . TRP A 1 46 ? 22.938 47.768 4.518   1.00 14.11  ? 84  TRP A CH2 1 
ATOM   348  N N   . ALA A 1 47 ? 27.558 43.179 9.777   1.00 10.40  ? 85  ALA A N   1 
ATOM   349  C CA  . ALA A 1 47 ? 28.333 43.252 11.066  1.00 10.59  ? 85  ALA A CA  1 
ATOM   350  C C   . ALA A 1 47 ? 28.505 44.672 11.388  1.00 10.73  ? 85  ALA A C   1 
ATOM   351  O O   . ALA A 1 47 ? 28.874 45.534 10.617  1.00 11.28  ? 85  ALA A O   1 
ATOM   352  C CB  . ALA A 1 47 ? 29.678 42.633 10.808  1.00 12.87  ? 85  ALA A CB  1 
ATOM   353  N N   . GLY A 1 48 ? 28.231 44.954 12.723  1.00 11.39  ? 86  GLY A N   1 
ATOM   354  C CA  . GLY A 1 48 ? 28.338 46.307 13.183  1.00 12.66  ? 86  GLY A CA  1 
ATOM   355  C C   . GLY A 1 48 ? 28.797 46.436 14.660  1.00 10.62  ? 86  GLY A C   1 
ATOM   356  O O   . GLY A 1 48 ? 28.911 45.375 15.328  1.00 11.23  ? 86  GLY A O   1 
ATOM   357  N N   . GLN A 1 49 ? 29.019 47.633 15.013  1.00 11.52  ? 87  GLN A N   1 
ATOM   358  C CA  . GLN A 1 49 ? 29.468 47.926 16.417  1.00 11.22  ? 87  GLN A CA  1 
ATOM   359  C C   . GLN A 1 49 ? 28.595 48.978 16.945  1.00 12.43  ? 87  GLN A C   1 
ATOM   360  O O   . GLN A 1 49 ? 28.389 50.024 16.397  1.00 12.73  ? 87  GLN A O   1 
ATOM   361  C CB  . GLN A 1 49 ? 30.906 48.364 16.315  1.00 11.75  ? 87  GLN A CB  1 
ATOM   362  C CG  . GLN A 1 49 ? 31.511 48.638 17.680  1.00 14.54  ? 87  GLN A CG  1 
ATOM   363  C CD  . GLN A 1 49 ? 33.003 48.854 17.600  1.00 16.45  ? 87  GLN A CD  1 
ATOM   364  O OE1 . GLN A 1 49 ? 33.663 48.655 16.618  1.00 20.29  ? 87  GLN A OE1 1 
ATOM   365  N NE2 . GLN A 1 49 ? 33.552 49.255 18.738  1.00 21.42  ? 87  GLN A NE2 1 
ATOM   366  N N   A VAL A 1 50 ? 28.149 48.737 18.235  0.50 12.92  ? 88  VAL A N   1 
ATOM   367  N N   B VAL A 1 50 ? 28.109 48.723 18.221  0.50 12.94  ? 88  VAL A N   1 
ATOM   368  C CA  A VAL A 1 50 ? 27.392 49.702 19.015  0.50 14.03  ? 88  VAL A CA  1 
ATOM   369  C CA  B VAL A 1 50 ? 27.279 49.668 18.938  0.50 14.58  ? 88  VAL A CA  1 
ATOM   370  C C   A VAL A 1 50 ? 27.824 49.510 20.504  0.50 13.19  ? 88  VAL A C   1 
ATOM   371  C C   B VAL A 1 50 ? 27.867 49.621 20.348  0.50 14.02  ? 88  VAL A C   1 
ATOM   372  O O   A VAL A 1 50 ? 27.885 48.397 20.939  0.50 14.42  ? 88  VAL A O   1 
ATOM   373  O O   B VAL A 1 50 ? 27.927 48.549 20.956  0.50 14.37  ? 88  VAL A O   1 
ATOM   374  C CB  A VAL A 1 50 ? 25.776 49.386 19.003  0.50 18.49  ? 88  VAL A CB  1 
ATOM   375  C CB  B VAL A 1 50 ? 25.686 49.262 19.021  0.50 17.70  ? 88  VAL A CB  1 
ATOM   376  C CG1 A VAL A 1 50 ? 25.079 50.276 20.003  0.50 22.80  ? 88  VAL A CG1 1 
ATOM   377  C CG1 B VAL A 1 50 ? 25.002 50.124 20.052  0.50 22.49  ? 88  VAL A CG1 1 
ATOM   378  C CG2 A VAL A 1 50 ? 25.178 49.457 17.646  0.50 22.45  ? 88  VAL A CG2 1 
ATOM   379  C CG2 B VAL A 1 50 ? 25.017 49.328 17.703  0.50 21.91  ? 88  VAL A CG2 1 
ATOM   380  N N   A GLY A 1 51 ? 28.058 50.561 21.256  0.50 16.50  ? 89  GLY A N   1 
ATOM   381  N N   B GLY A 1 51 ? 28.305 50.812 20.754  0.50 17.21  ? 89  GLY A N   1 
ATOM   382  C CA  A GLY A 1 51 ? 28.218 50.309 22.718  0.50 20.97  ? 89  GLY A CA  1 
ATOM   383  C CA  B GLY A 1 51 ? 29.186 50.963 21.966  0.50 23.36  ? 89  GLY A CA  1 
ATOM   384  C C   A GLY A 1 51 ? 29.379 49.377 23.122  0.50 16.23  ? 89  GLY A C   1 
ATOM   385  C C   B GLY A 1 51 ? 30.282 49.927 21.893  0.50 17.87  ? 89  GLY A C   1 
ATOM   386  O O   A GLY A 1 51 ? 29.320 48.632 24.120  0.50 17.52  ? 89  GLY A O   1 
ATOM   387  O O   B GLY A 1 51 ? 31.048 49.714 20.933  0.50 17.22  ? 89  GLY A O   1 
ATOM   388  N N   A GLY A 1 52 ? 30.457 49.355 22.354  0.50 16.27  ? 90  GLY A N   1 
ATOM   389  N N   B GLY A 1 52 ? 30.432 49.149 22.910  0.50 16.81  ? 90  GLY A N   1 
ATOM   390  C CA  A GLY A 1 52 ? 31.498 48.379 22.720  0.50 16.13  ? 90  GLY A CA  1 
ATOM   391  C CA  B GLY A 1 52 ? 31.561 48.296 22.796  0.50 14.64  ? 90  GLY A CA  1 
ATOM   392  C C   A GLY A 1 52 ? 31.283 46.949 22.258  0.50 12.93  ? 90  GLY A C   1 
ATOM   393  C C   B GLY A 1 52 ? 31.327 46.925 22.255  0.50 12.72  ? 90  GLY A C   1 
ATOM   394  O O   A GLY A 1 52 ? 32.165 46.147 22.331  0.50 15.72  ? 90  GLY A O   1 
ATOM   395  O O   B GLY A 1 52 ? 32.254 46.125 22.319  0.50 16.12  ? 90  GLY A O   1 
ATOM   396  N N   . GLN A 1 53 ? 30.119 46.650 21.733  1.00 12.74  ? 91  GLN A N   1 
ATOM   397  C CA  . GLN A 1 53 ? 29.839 45.327 21.247  1.00 12.58  ? 91  GLN A CA  1 
ATOM   398  C C   . GLN A 1 53 ? 29.882 45.243 19.694  1.00 12.06  ? 91  GLN A C   1 
ATOM   399  O O   . GLN A 1 53 ? 29.474 46.208 19.041  1.00 12.78  ? 91  GLN A O   1 
ATOM   400  C CB  . GLN A 1 53 ? 28.432 44.902 21.664  1.00 15.77  ? 91  GLN A CB  1 
ATOM   401  C CG  . GLN A 1 53 ? 28.293 44.730 23.169  1.00 21.63  ? 91  GLN A CG  1 
ATOM   402  C CD  . GLN A 1 53 ? 27.073 44.034 23.521  1.00 35.46  ? 91  GLN A CD  1 
ATOM   403  O OE1 . GLN A 1 53 ? 25.949 44.568 23.443  1.00 59.15  ? 91  GLN A OE1 1 
ATOM   404  N NE2 . GLN A 1 53 ? 27.257 42.785 23.811  1.00 42.89  ? 91  GLN A NE2 1 
ATOM   405  N N   . VAL A 1 54 ? 30.310 44.099 19.241  1.00 12.15  ? 92  VAL A N   1 
ATOM   406  C CA  . VAL A 1 54 ? 30.319 43.805 17.771  1.00 12.11  ? 92  VAL A CA  1 
ATOM   407  C C   . VAL A 1 54 ? 29.501 42.579 17.557  1.00 11.73  ? 92  VAL A C   1 
ATOM   408  O O   . VAL A 1 54 ? 29.658 41.551 18.175  1.00 15.05  ? 92  VAL A O   1 
ATOM   409  C CB  . VAL A 1 54 ? 31.701 43.599 17.251  1.00 13.52  ? 92  VAL A CB  1 
ATOM   410  C CG1 . VAL A 1 54 ? 31.657 43.128 15.782  1.00 13.59  ? 92  VAL A CG1 1 
ATOM   411  C CG2 . VAL A 1 54 ? 32.506 44.885 17.312  1.00 16.09  ? 92  VAL A CG2 1 
ATOM   412  N N   . GLY A 1 55 ? 28.540 42.639 16.588  1.00 11.22  ? 93  GLY A N   1 
ATOM   413  C CA  . GLY A 1 55 ? 27.789 41.497 16.257  1.00 11.18  ? 93  GLY A CA  1 
ATOM   414  C C   . GLY A 1 55 ? 27.047 41.747 14.892  1.00 10.88  ? 93  GLY A C   1 
ATOM   415  O O   . GLY A 1 55 ? 27.257 42.787 14.277  1.00 13.07  ? 93  GLY A O   1 
ATOM   416  N N   . ILE A 1 56 ? 26.218 40.810 14.584  1.00 10.60  ? 94  ILE A N   1 
ATOM   417  C CA  . ILE A 1 56 ? 25.456 40.879 13.305  1.00 10.38  ? 94  ILE A CA  1 
ATOM   418  C C   . ILE A 1 56 ? 24.101 41.322 13.541  1.00 10.74  ? 94  ILE A C   1 
ATOM   419  O O   . ILE A 1 56 ? 23.451 41.033 14.590  1.00 12.40  ? 94  ILE A O   1 
ATOM   420  C CB  . ILE A 1 56 ? 25.578 39.582 12.470  1.00 11.59  ? 94  ILE A CB  1 
ATOM   421  C CG1 . ILE A 1 56 ? 24.996 38.445 13.205  1.00 12.38  ? 94  ILE A CG1 1 
ATOM   422  C CG2 . ILE A 1 56 ? 26.962 39.382 12.002  1.00 13.86  ? 94  ILE A CG2 1 
ATOM   423  C CD1 . ILE A 1 56 ? 24.789 37.185 12.327  1.00 14.46  ? 94  ILE A CD1 1 
ATOM   424  N N   . PHE A 1 57 ? 23.419 41.990 12.587  1.00 10.77  ? 95  PHE A N   1 
ATOM   425  C CA  . PHE A 1 57 ? 22.150 42.500 12.735  1.00 10.96  ? 95  PHE A CA  1 
ATOM   426  C C   . PHE A 1 57 ? 21.358 42.524 11.367  1.00 9.91   ? 95  PHE A C   1 
ATOM   427  O O   . PHE A 1 57 ? 22.127 42.527 10.298  1.00 10.37  ? 95  PHE A O   1 
ATOM   428  C CB  . PHE A 1 57 ? 22.144 43.921 13.303  1.00 11.58  ? 95  PHE A CB  1 
ATOM   429  C CG  . PHE A 1 57 ? 22.835 44.933 12.502  1.00 11.37  ? 95  PHE A CG  1 
ATOM   430  C CD1 . PHE A 1 57 ? 24.157 45.158 12.550  1.00 13.36  ? 95  PHE A CD1 1 
ATOM   431  C CD2 . PHE A 1 57 ? 22.143 45.679 11.524  1.00 10.88  ? 95  PHE A CD2 1 
ATOM   432  C CE1 . PHE A 1 57 ? 24.845 46.069 11.664  1.00 13.65  ? 95  PHE A CE1 1 
ATOM   433  C CE2 . PHE A 1 57 ? 22.814 46.549 10.632  1.00 12.54  ? 95  PHE A CE2 1 
ATOM   434  C CZ  . PHE A 1 57 ? 24.113 46.740 10.717  1.00 13.76  ? 95  PHE A CZ  1 
ATOM   435  N N   . PRO A 1 58 ? 20.129 42.569 11.370  1.00 10.14  ? 96  PRO A N   1 
ATOM   436  C CA  . PRO A 1 58 ? 19.417 42.534 10.013  1.00 10.94  ? 96  PRO A CA  1 
ATOM   437  C C   . PRO A 1 58 ? 19.475 43.916 9.482   1.00 10.01  ? 96  PRO A C   1 
ATOM   438  O O   . PRO A 1 58 ? 19.070 44.948 10.004  1.00 11.10  ? 96  PRO A O   1 
ATOM   439  C CB  . PRO A 1 58 ? 17.969 42.154 10.476  1.00 12.62  ? 96  PRO A CB  1 
ATOM   440  C CG  . PRO A 1 58 ? 17.876 42.502 11.943  1.00 14.19  ? 96  PRO A CG  1 
ATOM   441  C CD  . PRO A 1 58 ? 19.229 42.418 12.511  1.00 12.29  ? 96  PRO A CD  1 
ATOM   442  N N   . SER A 1 59 ? 19.853 43.953 8.138   1.00 10.15  ? 97  SER A N   1 
ATOM   443  C CA  . SER A 1 59 ? 20.086 45.221 7.445   1.00 10.43  ? 97  SER A CA  1 
ATOM   444  C C   . SER A 1 59 ? 18.824 46.033 7.283   1.00 10.20  ? 97  SER A C   1 
ATOM   445  O O   . SER A 1 59 ? 19.009 47.211 7.172   1.00 11.54  ? 97  SER A O   1 
ATOM   446  C CB  . SER A 1 59 ? 20.755 44.958 6.094   1.00 11.68  ? 97  SER A CB  1 
ATOM   447  O OG  . SER A 1 59 ? 19.909 44.144 5.287   1.00 12.64  ? 97  SER A OG  1 
ATOM   448  N N   . ASN A 1 60 ? 17.703 45.441 7.254   1.00 9.60   ? 98  ASN A N   1 
ATOM   449  C CA  . ASN A 1 60 ? 16.495 46.168 7.098   1.00 10.87  ? 98  ASN A CA  1 
ATOM   450  C C   . ASN A 1 60 ? 15.981 47.012 8.307   1.00 10.13  ? 98  ASN A C   1 
ATOM   451  O O   . ASN A 1 60 ? 15.046 47.666 8.324   1.00 11.47  ? 98  ASN A O   1 
ATOM   452  C CB  . ASN A 1 60 ? 15.328 45.305 6.587   1.00 11.74  ? 98  ASN A CB  1 
ATOM   453  C CG  . ASN A 1 60 ? 15.130 44.038 7.417   1.00 10.90  ? 98  ASN A CG  1 
ATOM   454  O OD1 . ASN A 1 60 ? 16.013 43.484 7.972   1.00 13.66  ? 98  ASN A OD1 1 
ATOM   455  N ND2 . ASN A 1 60 ? 13.940 43.456 7.286   1.00 13.88  ? 98  ASN A ND2 1 
ATOM   456  N N   . TYR A 1 61 ? 16.835 46.885 9.404   1.00 9.49   ? 99  TYR A N   1 
ATOM   457  C CA  . TYR A 1 61 ? 16.579 47.634 10.665  1.00 9.01   ? 99  TYR A CA  1 
ATOM   458  C C   . TYR A 1 61 ? 17.350 48.843 10.742  1.00 10.06  ? 99  TYR A C   1 
ATOM   459  O O   . TYR A 1 61 ? 17.212 49.577 11.758  1.00 11.72  ? 99  TYR A O   1 
ATOM   460  C CB  . TYR A 1 61 ? 16.794 46.677 11.880  1.00 10.21  ? 99  TYR A CB  1 
ATOM   461  C CG  . TYR A 1 61 ? 15.686 45.716 12.133  1.00 9.97   ? 99  TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 61 ? 15.276 44.801 11.204  1.00 12.21  ? 99  TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 61 ? 14.966 45.805 13.381  1.00 11.51  ? 99  TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 61 ? 14.267 43.917 11.528  1.00 12.75  ? 99  TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 61 ? 13.996 44.928 13.625  1.00 13.13  ? 99  TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 61 ? 13.635 44.012 12.732  1.00 13.32  ? 99  TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 61 ? 12.565 43.122 12.998  1.00 17.78  ? 99  TYR A OH  1 
ATOM   468  N N   . VAL A 1 62 ? 18.179 49.234 9.767   1.00 10.26  ? 100 VAL A N   1 
ATOM   469  C CA  . VAL A 1 62 ? 18.971 50.409 9.835   1.00 10.69  ? 100 VAL A CA  1 
ATOM   470  C C   . VAL A 1 62 ? 18.740 51.295 8.580   1.00 10.78  ? 100 VAL A C   1 
ATOM   471  O O   . VAL A 1 62 ? 18.322 50.797 7.526   1.00 13.14  ? 100 VAL A O   1 
ATOM   472  C CB  . VAL A 1 62 ? 20.469 50.155 10.015  1.00 10.89  ? 100 VAL A CB  1 
ATOM   473  C CG1 . VAL A 1 62 ? 20.754 49.466 11.405  1.00 11.66  ? 100 VAL A CG1 1 
ATOM   474  C CG2 . VAL A 1 62 ? 21.030 49.338 8.892   1.00 11.19  ? 100 VAL A CG2 1 
ATOM   475  N N   . SER A 1 63 ? 19.090 52.542 8.662   1.00 11.02  ? 101 SER A N   1 
ATOM   476  C CA  A SER A 1 63 ? 19.004 53.519 7.582   0.50 12.55  ? 101 SER A CA  1 
ATOM   477  C CA  B SER A 1 63 ? 19.080 53.422 7.519   0.50 11.80  ? 101 SER A CA  1 
ATOM   478  C C   . SER A 1 63 ? 20.161 54.446 7.670   1.00 11.65  ? 101 SER A C   1 
ATOM   479  O O   . SER A 1 63 ? 20.827 54.632 8.704   1.00 12.52  ? 101 SER A O   1 
ATOM   480  C CB  A SER A 1 63 ? 17.727 54.307 7.730   0.50 16.64  ? 101 SER A CB  1 
ATOM   481  C CB  B SER A 1 63 ? 17.727 54.039 7.469   0.50 18.32  ? 101 SER A CB  1 
ATOM   482  O OG  A SER A 1 63 ? 17.391 54.780 6.382   0.50 22.13  ? 101 SER A OG  1 
ATOM   483  O OG  B SER A 1 63 ? 17.657 55.122 8.387   0.50 25.11  ? 101 SER A OG  1 
ATOM   484  N N   . ARG A 1 64 ? 20.413 55.185 6.591   1.00 12.92  ? 102 ARG A N   1 
ATOM   485  C CA  . ARG A 1 64 ? 21.407 56.220 6.568   1.00 13.67  ? 102 ARG A CA  1 
ATOM   486  C C   . ARG A 1 64 ? 20.793 57.500 7.049   1.00 13.78  ? 102 ARG A C   1 
ATOM   487  O O   . ARG A 1 64 ? 19.918 58.064 6.383   1.00 16.70  ? 102 ARG A O   1 
ATOM   488  C CB  . ARG A 1 64 ? 21.976 56.433 5.132   1.00 15.18  ? 102 ARG A CB  1 
ATOM   489  C CG  . ARG A 1 64 ? 22.700 55.243 4.569   1.00 15.09  ? 102 ARG A CG  1 
ATOM   490  C CD  . ARG A 1 64 ? 23.095 55.630 3.103   1.00 19.63  ? 102 ARG A CD  1 
ATOM   491  N NE  . ARG A 1 64 ? 23.745 54.596 2.402   1.00 23.39  ? 102 ARG A NE  1 
ATOM   492  C CZ  . ARG A 1 64 ? 25.043 54.352 2.475   1.00 22.39  ? 102 ARG A CZ  1 
ATOM   493  N NH1 . ARG A 1 64 ? 25.824 55.148 3.227   1.00 21.82  ? 102 ARG A NH1 1 
ATOM   494  N NH2 . ARG A 1 64 ? 25.518 53.356 1.698   1.00 25.62  ? 102 ARG A NH2 1 
ATOM   495  N N   . GLY A 1 65 ? 21.250 57.970 8.184   1.00 12.91  ? 103 GLY A N   1 
ATOM   496  C CA  . GLY A 1 65 ? 20.731 59.171 8.748   1.00 15.08  ? 103 GLY A CA  1 
ATOM   497  C C   . GLY A 1 65 ? 19.246 59.068 9.217   1.00 18.26  ? 103 GLY A C   1 
ATOM   498  O O   . GLY A 1 65 ? 18.727 57.965 9.383   1.00 22.27  ? 103 GLY A O   1 
ATOM   499  N N   . GLY A 1 66 ? 18.688 60.247 9.421   1.00 19.85  ? 104 GLY A N   1 
ATOM   500  C CA  . GLY A 1 66 ? 17.453 60.362 10.098  1.00 28.81  ? 104 GLY A CA  1 
ATOM   501  C C   . GLY A 1 66 ? 16.250 60.570 9.302   1.00 26.75  ? 104 GLY A C   1 
ATOM   502  O O   . GLY A 1 66 ? 15.209 60.740 9.884   1.00 39.28  ? 104 GLY A O   1 
ATOM   503  N N   . GLY A 1 67 ? 16.349 60.674 8.007   1.00 25.55  ? 105 GLY A N   1 
ATOM   504  C CA  . GLY A 1 67 ? 15.112 60.764 7.188   1.00 29.32  ? 105 GLY A CA  1 
ATOM   505  C C   . GLY A 1 67 ? 14.763 62.059 6.476   1.00 27.47  ? 105 GLY A C   1 
ATOM   506  O O   . GLY A 1 67 ? 14.000 62.031 5.488   1.00 30.67  ? 105 GLY A O   1 
ATOM   507  N N   . ALA A 1 68 ? 15.440 63.147 6.811   1.00 22.83  ? 106 ALA A N   1 
ATOM   508  C CA  . ALA A 1 68 ? 15.140 64.428 6.218   1.00 22.99  ? 106 ALA A CA  1 
ATOM   509  C C   . ALA A 1 68 ? 15.391 64.511 4.722   1.00 22.33  ? 106 ALA A C   1 
ATOM   510  O O   . ALA A 1 68 ? 14.674 65.241 4.048   1.00 22.59  ? 106 ALA A O   1 
ATOM   511  C CB  . ALA A 1 68 ? 15.911 65.549 6.886   1.00 26.34  ? 106 ALA A CB  1 
ATOM   512  N N   . ILE A 1 69 ? 16.382 63.805 4.206   1.00 18.66  ? 107 ILE A N   1 
ATOM   513  C CA  . ILE A 1 69 ? 16.703 63.714 2.819   1.00 19.12  ? 107 ILE A CA  1 
ATOM   514  C C   . ILE A 1 69 ? 16.486 62.285 2.375   1.00 18.83  ? 107 ILE A C   1 
ATOM   515  O O   . ILE A 1 69 ? 16.860 61.340 3.048   1.00 23.71  ? 107 ILE A O   1 
ATOM   516  C CB  . ILE A 1 69 ? 18.140 64.144 2.524   1.00 18.37  ? 107 ILE A CB  1 
ATOM   517  C CG1 . ILE A 1 69 ? 18.389 65.649 2.936   1.00 19.14  ? 107 ILE A CG1 1 
ATOM   518  C CG2 . ILE A 1 69 ? 18.530 63.914 1.063   1.00 20.13  ? 107 ILE A CG2 1 
ATOM   519  C CD1 . ILE A 1 69 ? 17.518 66.643 2.261   1.00 20.35  ? 107 ILE A CD1 1 
ATOM   520  N N   . ARG A 1 70 ? 15.757 62.112 1.267   1.00 20.32  ? 108 ARG A N   1 
ATOM   521  C CA  . ARG A 1 70 ? 15.430 60.861 0.660   1.00 19.58  ? 108 ARG A CA  1 
ATOM   522  C C   . ARG A 1 70 ? 16.206 60.688 -0.666  1.00 17.94  ? 108 ARG A C   1 
ATOM   523  O O   . ARG A 1 70 ? 16.217 61.667 -1.490  1.00 19.04  ? 108 ARG A O   1 
ATOM   524  C CB  . ARG A 1 70 ? 13.925 60.762 0.373   1.00 25.31  ? 108 ARG A CB  1 
ATOM   525  C CG  . ARG A 1 70 ? 13.396 59.499 -0.279  1.00 36.90  ? 108 ARG A CG  1 
ATOM   526  C CD  . ARG A 1 70 ? 11.866 59.524 -0.306  1.00 43.14  ? 108 ARG A CD  1 
ATOM   527  N NE  . ARG A 1 70 ? 11.435 60.392 -1.399  1.00 40.13  ? 108 ARG A NE  1 
ATOM   528  C CZ  . ARG A 1 70 ? 10.635 61.465 -1.373  1.00 43.06  ? 108 ARG A CZ  1 
ATOM   529  N NH1 . ARG A 1 70 ? 10.063 61.938 -0.286  1.00 56.51  ? 108 ARG A NH1 1 
ATOM   530  N NH2 . ARG A 1 70 ? 10.360 62.093 -2.515  1.00 37.97  ? 108 ARG A NH2 1 
ATOM   531  N N   . ILE A 1 71 ? 16.779 59.529 -0.935  1.00 17.84  ? 109 ILE A N   1 
ATOM   532  C CA  . ILE A 1 71 ? 17.303 59.150 -2.262  1.00 16.50  ? 109 ILE A CA  1 
ATOM   533  C C   . ILE A 1 71 ? 16.286 58.401 -2.979  1.00 17.84  ? 109 ILE A C   1 
ATOM   534  O O   . ILE A 1 71 ? 15.872 57.315 -2.543  1.00 21.17  ? 109 ILE A O   1 
ATOM   535  C CB  . ILE A 1 71 ? 18.602 58.422 -2.141  1.00 20.04  ? 109 ILE A CB  1 
ATOM   536  C CG1 . ILE A 1 71 ? 19.615 59.056 -1.211  1.00 18.42  ? 109 ILE A CG1 1 
ATOM   537  C CG2 . ILE A 1 71 ? 19.184 58.274 -3.498  1.00 25.34  ? 109 ILE A CG2 1 
ATOM   538  C CD1 . ILE A 1 71 ? 19.969 60.486 -1.480  1.00 18.45  ? 109 ILE A CD1 1 
ATOM   539  N N   . ASN A 1 72 ? 15.878 58.951 -4.092  1.00 17.73  ? 110 ASN A N   1 
ATOM   540  C CA  . ASN A 1 72 ? 14.783 58.358 -4.898  1.00 20.92  ? 110 ASN A CA  1 
ATOM   541  C C   . ASN A 1 72 ? 15.305 57.212 -5.757  1.00 19.70  ? 110 ASN A C   1 
ATOM   542  O O   . ASN A 1 72 ? 16.477 57.151 -6.033  1.00 19.27  ? 110 ASN A O   1 
ATOM   543  C CB  . ASN A 1 72 ? 14.173 59.446 -5.816  1.00 21.42  ? 110 ASN A CB  1 
ATOM   544  C CG  . ASN A 1 72 ? 13.538 60.569 -5.021  1.00 21.18  ? 110 ASN A CG  1 
ATOM   545  O OD1 . ASN A 1 72 ? 12.767 60.311 -4.168  1.00 23.76  ? 110 ASN A OD1 1 
ATOM   546  N ND2 . ASN A 1 72 ? 13.908 61.808 -5.288  1.00 21.27  ? 110 ASN A ND2 1 
ATOM   547  N N   . PRO A 1 73 ? 14.401 56.361 -6.252  1.00 23.27  ? 111 PRO A N   1 
ATOM   548  C CA  . PRO A 1 73 ? 14.854 55.284 -7.104  1.00 23.58  ? 111 PRO A CA  1 
ATOM   549  C C   . PRO A 1 73 ? 15.627 55.698 -8.356  1.00 20.27  ? 111 PRO A C   1 
ATOM   550  O O   . PRO A 1 73 ? 16.649 55.008 -8.721  1.00 25.62  ? 111 PRO A O   1 
ATOM   551  C CB  . PRO A 1 73 ? 13.574 54.574 -7.471  1.00 26.68  ? 111 PRO A CB  1 
ATOM   552  C CG  . PRO A 1 73 ? 12.596 54.851 -6.337  1.00 25.50  ? 111 PRO A CG  1 
ATOM   553  C CD  . PRO A 1 73 ? 12.977 56.279 -5.966  1.00 22.63  ? 111 PRO A CD  1 
ATOM   554  N N   . ASN A 1 74 ? 15.298 56.881 -8.903  1.00 21.83  ? 112 ASN A N   1 
ATOM   555  C CA  . ASN A 1 74 ? 15.988 57.371 -10.067 1.00 25.25  ? 112 ASN A CA  1 
ATOM   556  C C   . ASN A 1 74 ? 17.347 58.046 -9.723  1.00 22.82  ? 112 ASN A C   1 
ATOM   557  O O   . ASN A 1 74 ? 18.003 58.545 -10.617 1.00 26.04  ? 112 ASN A O   1 
ATOM   558  C CB  . ASN A 1 74 ? 15.150 58.274 -10.923 1.00 27.21  ? 112 ASN A CB  1 
ATOM   559  C CG  . ASN A 1 74 ? 14.851 59.620 -10.221 1.00 26.27  ? 112 ASN A CG  1 
ATOM   560  O OD1 . ASN A 1 74 ? 15.353 59.906 -9.134  1.00 23.71  ? 112 ASN A OD1 1 
ATOM   561  N ND2 . ASN A 1 74 ? 14.101 60.480 -10.883 1.00 29.86  ? 112 ASN A ND2 1 
ATOM   562  N N   . GLY A 1 75 ? 17.785 58.059 -8.449  1.00 20.45  ? 113 GLY A N   1 
ATOM   563  C CA  . GLY A 1 75 ? 19.051 58.547 -8.023  1.00 20.91  ? 113 GLY A CA  1 
ATOM   564  C C   . GLY A 1 75 ? 19.115 60.031 -7.711  1.00 19.69  ? 113 GLY A C   1 
ATOM   565  O O   . GLY A 1 75 ? 20.115 60.467 -7.211  1.00 21.79  ? 113 GLY A O   1 
ATOM   566  N N   . THR A 1 76 ? 17.966 60.729 -7.813  1.00 18.41  ? 114 THR A N   1 
ATOM   567  C CA  . THR A 1 76 ? 17.861 62.102 -7.304  1.00 16.84  ? 114 THR A CA  1 
ATOM   568  C C   . THR A 1 76 ? 17.630 62.102 -5.864  1.00 15.83  ? 114 THR A C   1 
ATOM   569  O O   . THR A 1 76 ? 17.268 61.086 -5.284  1.00 18.72  ? 114 THR A O   1 
ATOM   570  C CB  . THR A 1 76 ? 16.770 62.831 -8.065  1.00 18.79  ? 114 THR A CB  1 
ATOM   571  O OG1 . THR A 1 76 ? 15.518 62.254 -7.836  1.00 20.82  ? 114 THR A OG1 1 
ATOM   572  C CG2 . THR A 1 76 ? 17.027 62.889 -9.617  1.00 20.75  ? 114 THR A CG2 1 
ATOM   573  N N   . TRP A 1 77 ? 17.826 63.279 -5.239  1.00 15.52  ? 115 TRP A N   1 
ATOM   574  C CA  . TRP A 1 77 ? 17.480 63.501 -3.860  1.00 15.34  ? 115 TRP A CA  1 
ATOM   575  C C   . TRP A 1 77 ? 16.305 64.456 -3.685  1.00 14.60  ? 115 TRP A C   1 
ATOM   576  O O   . TRP A 1 77 ? 16.204 65.420 -4.463  1.00 16.00  ? 115 TRP A O   1 
ATOM   577  C CB  . TRP A 1 77 ? 18.724 63.915 -3.014  1.00 14.55  ? 115 TRP A CB  1 
ATOM   578  C CG  . TRP A 1 77 ? 19.279 65.290 -3.283  1.00 14.11  ? 115 TRP A CG  1 
ATOM   579  C CD1 . TRP A 1 77 ? 20.329 65.560 -4.116  1.00 13.46  ? 115 TRP A CD1 1 
ATOM   580  C CD2 . TRP A 1 77 ? 18.762 66.512 -2.826  1.00 12.75  ? 115 TRP A CD2 1 
ATOM   581  N NE1 . TRP A 1 77 ? 20.515 66.939 -4.172  1.00 12.98  ? 115 TRP A NE1 1 
ATOM   582  C CE2 . TRP A 1 77 ? 19.560 67.529 -3.393  1.00 12.31  ? 115 TRP A CE2 1 
ATOM   583  C CE3 . TRP A 1 77 ? 17.700 66.863 -1.997  1.00 14.44  ? 115 TRP A CE3 1 
ATOM   584  C CZ2 . TRP A 1 77 ? 19.322 68.849 -3.183  1.00 13.46  ? 115 TRP A CZ2 1 
ATOM   585  C CZ3 . TRP A 1 77 ? 17.444 68.223 -1.783  1.00 14.18  ? 115 TRP A CZ3 1 
ATOM   586  C CH2 . TRP A 1 77 ? 18.300 69.194 -2.346  1.00 14.23  ? 115 TRP A CH2 1 
ATOM   587  N N   . SER A 1 78 ? 15.506 64.195 -2.669  1.00 15.75  ? 116 SER A N   1 
ATOM   588  C CA  . SER A 1 78 ? 14.434 65.032 -2.297  1.00 16.94  ? 116 SER A CA  1 
ATOM   589  C C   . SER A 1 78 ? 14.426 65.330 -0.798  1.00 18.66  ? 116 SER A C   1 
ATOM   590  O O   . SER A 1 78 ? 14.781 64.477 0.000   1.00 19.95  ? 116 SER A O   1 
ATOM   591  C CB  . SER A 1 78 ? 13.125 64.295 -2.632  1.00 19.57  ? 116 SER A CB  1 
ATOM   592  O OG  . SER A 1 78 ? 12.864 64.113 -4.000  1.00 20.54  ? 116 SER A OG  1 
ATOM   593  N N   . ARG A 1 79 ? 13.924 66.490 -0.452  1.00 20.82  ? 117 ARG A N   1 
ATOM   594  C CA  . ARG A 1 79 ? 13.534 66.753 0.936   1.00 22.15  ? 117 ARG A CA  1 
ATOM   595  C C   . ARG A 1 79 ? 12.272 66.030 1.321   1.00 29.71  ? 117 ARG A C   1 
ATOM   596  O O   . ARG A 1 79 ? 11.354 65.995 0.541   1.00 28.33  ? 117 ARG A O   1 
ATOM   597  C CB  . ARG A 1 79 ? 13.278 68.223 1.222   1.00 25.79  ? 117 ARG A CB  1 
ATOM   598  C CG  . ARG A 1 79 ? 14.457 69.078 1.137   1.00 28.01  ? 117 ARG A CG  1 
ATOM   599  C CD  . ARG A 1 79 ? 14.018 70.492 1.581   1.00 29.95  ? 117 ARG A CD  1 
ATOM   600  N NE  . ARG A 1 79 ? 15.194 71.366 1.454   1.00 39.71  ? 117 ARG A NE  1 
ATOM   601  C CZ  . ARG A 1 79 ? 15.644 71.777 0.262   1.00 40.77  ? 117 ARG A CZ  1 
ATOM   602  N NH1 . ARG A 1 79 ? 14.992 71.431 -0.872  1.00 52.38  ? 117 ARG A NH1 1 
ATOM   603  N NH2 . ARG A 1 79 ? 16.681 72.526 0.175   1.00 37.73  ? 117 ARG A NH2 1 
ATOM   604  N N   . GLN A 1 80 ? 12.209 65.456 2.517   1.00 26.21  ? 118 GLN A N   1 
ATOM   605  C CA  . GLN A 1 80 ? 10.872 64.799 2.902   1.00 38.54  ? 118 GLN A CA  1 
ATOM   606  C C   . GLN A 1 80 ? 9.835  65.890 3.153   1.00 58.32  ? 118 GLN A C   1 
ATOM   607  O O   . GLN A 1 80 ? 10.325 66.906 3.656   1.00 57.78  ? 118 GLN A O   1 
ATOM   608  C CB  . GLN A 1 80 ? 10.949 63.660 3.929   1.00 50.05  ? 118 GLN A CB  1 
ATOM   609  C CG  . GLN A 1 80 ? 11.986 62.664 3.429   1.00 47.61  ? 118 GLN A CG  1 
ATOM   610  C CD  . GLN A 1 80 ? 11.627 61.152 3.397   1.00 54.99  ? 118 GLN A CD  1 
ATOM   611  O OE1 . GLN A 1 80 ? 10.767 60.705 2.597   1.00 44.95  ? 118 GLN A OE1 1 
ATOM   612  N NE2 . GLN A 1 80 ? 12.373 60.341 4.175   1.00 46.31  ? 118 GLN A NE2 1 
ATOM   613  N N   . PRO B 1 6  ? 1.754  40.092 -3.562  1.00 48.30  ? 44  PRO B N   1 
ATOM   614  C CA  . PRO B 1 6  ? 2.116  41.237 -2.704  1.00 27.86  ? 44  PRO B CA  1 
ATOM   615  C C   . PRO B 1 6  ? 3.447  41.882 -3.120  1.00 22.29  ? 44  PRO B C   1 
ATOM   616  O O   . PRO B 1 6  ? 4.467  41.122 -3.491  1.00 22.20  ? 44  PRO B O   1 
ATOM   617  C CB  . PRO B 1 6  ? 2.350  40.620 -1.342  1.00 35.60  ? 44  PRO B CB  1 
ATOM   618  C CG  . PRO B 1 6  ? 2.612  39.165 -1.558  1.00 44.24  ? 44  PRO B CG  1 
ATOM   619  C CD  . PRO B 1 6  ? 1.863  38.811 -2.827  1.00 60.18  ? 44  PRO B CD  1 
ATOM   620  N N   . VAL B 1 7  ? 3.408  43.253 -3.000  1.00 24.64  ? 45  VAL B N   1 
ATOM   621  C CA  . VAL B 1 7  ? 4.487  44.108 -3.532  1.00 19.23  ? 45  VAL B CA  1 
ATOM   622  C C   . VAL B 1 7  ? 5.378  44.577 -2.448  1.00 16.93  ? 45  VAL B C   1 
ATOM   623  O O   . VAL B 1 7  ? 4.922  45.142 -1.472  1.00 17.90  ? 45  VAL B O   1 
ATOM   624  C CB  . VAL B 1 7  ? 3.901  45.264 -4.284  1.00 23.25  ? 45  VAL B CB  1 
ATOM   625  C CG1 . VAL B 1 7  ? 4.945  46.260 -4.775  1.00 28.10  ? 45  VAL B CG1 1 
ATOM   626  C CG2 . VAL B 1 7  ? 3.163  44.679 -5.485  1.00 28.70  ? 45  VAL B CG2 1 
ATOM   627  N N   . TRP B 1 8  ? 6.653  44.400 -2.650  1.00 15.18  ? 46  TRP B N   1 
ATOM   628  C CA  . TRP B 1 8  ? 7.692  44.835 -1.806  1.00 13.44  ? 46  TRP B CA  1 
ATOM   629  C C   . TRP B 1 8  ? 8.581  45.781 -2.616  1.00 12.70  ? 46  TRP B C   1 
ATOM   630  O O   . TRP B 1 8  ? 8.557  45.757 -3.877  1.00 16.09  ? 46  TRP B O   1 
ATOM   631  C CB  . TRP B 1 8  ? 8.460  43.651 -1.282  1.00 15.74  ? 46  TRP B CB  1 
ATOM   632  C CG  . TRP B 1 8  ? 7.663  42.728 -0.348  1.00 18.84  ? 46  TRP B CG  1 
ATOM   633  C CD1 . TRP B 1 8  ? 6.493  41.953 -0.703  1.00 22.41  ? 46  TRP B CD1 1 
ATOM   634  C CD2 . TRP B 1 8  ? 7.887  42.470 0.963   1.00 17.38  ? 46  TRP B CD2 1 
ATOM   635  N NE1 . TRP B 1 8  ? 6.084  41.269 0.341   1.00 23.96  ? 46  TRP B NE1 1 
ATOM   636  C CE2 . TRP B 1 8  ? 6.880  41.548 1.436   1.00 18.43  ? 46  TRP B CE2 1 
ATOM   637  C CE3 . TRP B 1 8  ? 8.847  42.896 1.852   1.00 19.67  ? 46  TRP B CE3 1 
ATOM   638  C CZ2 . TRP B 1 8  ? 6.798  41.073 2.667   1.00 19.36  ? 46  TRP B CZ2 1 
ATOM   639  C CZ3 . TRP B 1 8  ? 8.808  42.419 3.177   1.00 26.33  ? 46  TRP B CZ3 1 
ATOM   640  C CH2 . TRP B 1 8  ? 7.801  41.502 3.624   1.00 24.58  ? 46  TRP B CH2 1 
ATOM   641  N N   . THR B 1 9  ? 9.415  46.564 -1.955  1.00 11.87  ? 47  THR B N   1 
ATOM   642  C CA  . THR B 1 9  ? 10.372 47.441 -2.532  1.00 12.91  ? 47  THR B CA  1 
ATOM   643  C C   . THR B 1 9  ? 11.721 47.084 -2.150  1.00 11.35  ? 47  THR B C   1 
ATOM   644  O O   . THR B 1 9  ? 11.996 46.852 -0.943  1.00 13.32  ? 47  THR B O   1 
ATOM   645  C CB  . THR B 1 9  ? 10.003 48.866 -2.148  1.00 16.30  ? 47  THR B CB  1 
ATOM   646  O OG1 . THR B 1 9  ? 8.657  49.176 -2.570  1.00 18.47  ? 47  THR B OG1 1 
ATOM   647  C CG2 . THR B 1 9  ? 10.874 49.816 -2.797  1.00 17.74  ? 47  THR B CG2 1 
ATOM   648  N N   . ALA B 1 10 ? 12.706 47.050 -3.080  1.00 10.91  ? 48  ALA B N   1 
ATOM   649  C CA  . ALA B 1 10 ? 14.102 46.858 -2.698  1.00 10.59  ? 48  ALA B CA  1 
ATOM   650  C C   . ALA B 1 10 ? 14.664 48.023 -2.013  1.00 10.83  ? 48  ALA B C   1 
ATOM   651  O O   . ALA B 1 10 ? 14.505 49.177 -2.354  1.00 12.36  ? 48  ALA B O   1 
ATOM   652  C CB  . ALA B 1 10 ? 14.921 46.568 -3.962  1.00 11.86  ? 48  ALA B CB  1 
ATOM   653  N N   . LEU B 1 11 ? 15.321 47.704 -0.874  1.00 11.80  ? 49  LEU B N   1 
ATOM   654  C CA  . LEU B 1 11 ? 15.965 48.738 -0.035  1.00 12.06  ? 49  LEU B CA  1 
ATOM   655  C C   . LEU B 1 11 ? 17.331 49.135 -0.462  1.00 13.06  ? 49  LEU B C   1 
ATOM   656  O O   . LEU B 1 11 ? 17.776 50.231 -0.182  1.00 15.15  ? 49  LEU B O   1 
ATOM   657  C CB  . LEU B 1 11 ? 16.104 48.163 1.435   1.00 12.90  ? 49  LEU B CB  1 
ATOM   658  C CG  . LEU B 1 11 ? 14.724 47.934 2.098   1.00 14.16  ? 49  LEU B CG  1 
ATOM   659  C CD1 . LEU B 1 11 ? 14.946 47.249 3.453   1.00 15.23  ? 49  LEU B CD1 1 
ATOM   660  C CD2 . LEU B 1 11 ? 14.146 49.337 2.360   1.00 21.77  ? 49  LEU B CD2 1 
ATOM   661  N N   . PHE B 1 12 ? 18.041 48.229 -1.091  1.00 12.28  ? 50  PHE B N   1 
ATOM   662  C CA  . PHE B 1 12 ? 19.482 48.373 -1.426  1.00 13.54  ? 50  PHE B CA  1 
ATOM   663  C C   . PHE B 1 12 ? 19.769 47.783 -2.764  1.00 14.69  ? 50  PHE B C   1 
ATOM   664  O O   . PHE B 1 12 ? 19.046 46.899 -3.223  1.00 17.58  ? 50  PHE B O   1 
ATOM   665  C CB  . PHE B 1 12 ? 20.361 47.662 -0.406  1.00 15.19  ? 50  PHE B CB  1 
ATOM   666  C CG  . PHE B 1 12 ? 20.045 47.916 1.058   1.00 13.69  ? 50  PHE B CG  1 
ATOM   667  C CD1 . PHE B 1 12 ? 20.177 49.172 1.638   1.00 17.66  ? 50  PHE B CD1 1 
ATOM   668  C CD2 . PHE B 1 12 ? 19.560 46.958 1.820   1.00 14.98  ? 50  PHE B CD2 1 
ATOM   669  C CE1 . PHE B 1 12 ? 19.850 49.388 2.982   1.00 19.18  ? 50  PHE B CE1 1 
ATOM   670  C CE2 . PHE B 1 12 ? 19.259 47.162 3.191   1.00 15.22  ? 50  PHE B CE2 1 
ATOM   671  C CZ  . PHE B 1 12 ? 19.320 48.350 3.706   1.00 15.64  ? 50  PHE B CZ  1 
ATOM   672  N N   . ASP B 1 13 ? 20.805 48.327 -3.422  1.00 16.46  ? 51  ASP B N   1 
ATOM   673  C CA  . ASP B 1 13 ? 21.395 47.618 -4.583  1.00 16.16  ? 51  ASP B CA  1 
ATOM   674  C C   . ASP B 1 13 ? 21.990 46.278 -4.104  1.00 19.30  ? 51  ASP B C   1 
ATOM   675  O O   . ASP B 1 13 ? 22.663 46.200 -3.076  1.00 27.51  ? 51  ASP B O   1 
ATOM   676  C CB  . ASP B 1 13 ? 22.450 48.514 -5.180  1.00 18.68  ? 51  ASP B CB  1 
ATOM   677  C CG  . ASP B 1 13 ? 21.952 49.789 -5.783  1.00 19.79  ? 51  ASP B CG  1 
ATOM   678  O OD1 . ASP B 1 13 ? 20.748 49.955 -6.138  1.00 19.83  ? 51  ASP B OD1 1 
ATOM   679  O OD2 . ASP B 1 13 ? 22.881 50.622 -6.088  1.00 31.37  ? 51  ASP B OD2 1 
ATOM   680  N N   . TYR B 1 14 ? 21.784 45.221 -4.877  1.00 15.82  ? 52  TYR B N   1 
ATOM   681  C CA  . TYR B 1 14 ? 22.418 43.939 -4.595  1.00 18.41  ? 52  TYR B CA  1 
ATOM   682  C C   . TYR B 1 14 ? 22.829 43.307 -5.919  1.00 15.26  ? 52  TYR B C   1 
ATOM   683  O O   . TYR B 1 14 ? 21.962 43.104 -6.765  1.00 16.48  ? 52  TYR B O   1 
ATOM   684  C CB  . TYR B 1 14 ? 21.389 42.993 -3.835  1.00 21.96  ? 52  TYR B CB  1 
ATOM   685  C CG  . TYR B 1 14 ? 21.976 41.624 -3.511  1.00 19.73  ? 52  TYR B CG  1 
ATOM   686  C CD1 . TYR B 1 14 ? 23.149 41.514 -2.794  1.00 20.18  ? 52  TYR B CD1 1 
ATOM   687  C CD2 . TYR B 1 14 ? 21.512 40.515 -4.249  1.00 25.72  ? 52  TYR B CD2 1 
ATOM   688  C CE1 . TYR B 1 14 ? 23.678 40.267 -2.526  1.00 22.81  ? 52  TYR B CE1 1 
ATOM   689  C CE2 . TYR B 1 14 ? 22.100 39.233 -4.015  1.00 31.56  ? 52  TYR B CE2 1 
ATOM   690  C CZ  . TYR B 1 14 ? 23.160 39.114 -3.173  1.00 26.42  ? 52  TYR B CZ  1 
ATOM   691  O OH  . TYR B 1 14 ? 23.800 37.880 -3.023  1.00 33.31  ? 52  TYR B OH  1 
ATOM   692  N N   . GLU B 1 15 ? 24.101 42.962 -5.975  1.00 16.60  ? 53  GLU B N   1 
ATOM   693  C CA  . GLU B 1 15 ? 24.628 42.246 -7.155  1.00 18.20  ? 53  GLU B CA  1 
ATOM   694  C C   . GLU B 1 15 ? 24.846 40.796 -6.725  1.00 20.22  ? 53  GLU B C   1 
ATOM   695  O O   . GLU B 1 15 ? 25.763 40.497 -6.042  1.00 28.77  ? 53  GLU B O   1 
ATOM   696  C CB  . GLU B 1 15 ? 25.948 42.861 -7.574  1.00 21.94  ? 53  GLU B CB  1 
ATOM   697  C CG  . GLU B 1 15 ? 25.983 44.386 -7.868  1.00 29.80  ? 53  GLU B CG  1 
ATOM   698  C CD  . GLU B 1 15 ? 27.375 44.936 -8.440  1.00 46.91  ? 53  GLU B CD  1 
ATOM   699  O OE1 . GLU B 1 15 ? 28.198 43.997 -8.846  1.00 48.55  ? 53  GLU B OE1 1 
ATOM   700  O OE2 . GLU B 1 15 ? 27.600 46.313 -8.528  1.00 58.94  ? 53  GLU B OE2 1 
ATOM   701  N N   . PRO B 1 16 ? 24.107 39.967 -7.423  1.00 28.42  ? 54  PRO B N   1 
ATOM   702  C CA  . PRO B 1 16 ? 24.141 38.552 -7.129  1.00 35.94  ? 54  PRO B CA  1 
ATOM   703  C C   . PRO B 1 16 ? 25.377 37.903 -7.579  1.00 24.33  ? 54  PRO B C   1 
ATOM   704  O O   . PRO B 1 16 ? 25.883 38.266 -8.499  1.00 26.77  ? 54  PRO B O   1 
ATOM   705  C CB  . PRO B 1 16 ? 23.140 37.976 -8.150  1.00 37.95  ? 54  PRO B CB  1 
ATOM   706  C CG  . PRO B 1 16 ? 22.191 39.002 -8.314  1.00 47.98  ? 54  PRO B CG  1 
ATOM   707  C CD  . PRO B 1 16 ? 23.052 40.227 -8.429  1.00 39.19  ? 54  PRO B CD  1 
ATOM   708  N N   . SER B 1 17 ? 25.713 36.848 -6.915  1.00 26.85  ? 55  SER B N   1 
ATOM   709  C CA  . SER B 1 17 ? 26.842 36.026 -7.106  1.00 29.48  ? 55  SER B CA  1 
ATOM   710  C C   . SER B 1 17 ? 26.465 34.575 -6.979  1.00 32.33  ? 55  SER B C   1 
ATOM   711  O O   . SER B 1 17 ? 27.250 33.840 -6.493  1.00 49.95  ? 55  SER B O   1 
ATOM   712  C CB  . SER B 1 17 ? 27.919 36.337 -6.042  1.00 40.23  ? 55  SER B CB  1 
ATOM   713  O OG  . SER B 1 17 ? 27.378 36.275 -4.743  1.00 54.83  ? 55  SER B OG  1 
ATOM   714  N N   . GLY B 1 18 ? 25.274 34.170 -7.364  1.00 22.93  ? 56  GLY B N   1 
ATOM   715  C CA  . GLY B 1 18 ? 24.922 32.787 -7.429  1.00 25.65  ? 56  GLY B CA  1 
ATOM   716  C C   . GLY B 1 18 ? 23.834 32.561 -8.425  1.00 22.66  ? 56  GLY B C   1 
ATOM   717  O O   . GLY B 1 18 ? 23.115 33.469 -8.883  1.00 20.90  ? 56  GLY B O   1 
ATOM   718  N N   . GLN B 1 19 ? 23.700 31.318 -8.782  1.00 24.47  ? 57  GLN B N   1 
ATOM   719  C CA  . GLN B 1 19 ? 22.699 30.911 -9.685  1.00 26.74  ? 57  GLN B CA  1 
ATOM   720  C C   . GLN B 1 19 ? 21.265 31.182 -9.043  1.00 21.24  ? 57  GLN B C   1 
ATOM   721  O O   . GLN B 1 19 ? 20.992 31.019 -7.887  1.00 23.67  ? 57  GLN B O   1 
ATOM   722  C CB  . GLN B 1 19 ? 22.791 29.367 -9.917  1.00 33.49  ? 57  GLN B CB  1 
ATOM   723  C CG  . GLN B 1 19 ? 22.003 28.911 -11.129 1.00 44.12  ? 57  GLN B CG  1 
ATOM   724  C CD  . GLN B 1 19 ? 21.787 27.422 -11.121 1.00 67.71  ? 57  GLN B CD  1 
ATOM   725  O OE1 . GLN B 1 19 ? 20.623 26.906 -11.115 1.00 84.27  ? 57  GLN B OE1 1 
ATOM   726  N NE2 . GLN B 1 19 ? 22.912 26.700 -11.082 1.00 66.77  ? 57  GLN B NE2 1 
ATOM   727  N N   . ASP B 1 20 ? 20.348 31.583 -9.853  1.00 19.37  ? 58  ASP B N   1 
ATOM   728  C CA  . ASP B 1 20 ? 18.978 31.841 -9.559  1.00 20.56  ? 58  ASP B CA  1 
ATOM   729  C C   . ASP B 1 20 ? 18.774 33.127 -8.685  1.00 16.08  ? 58  ASP B C   1 
ATOM   730  O O   . ASP B 1 20 ? 17.664 33.385 -8.297  1.00 16.89  ? 58  ASP B O   1 
ATOM   731  C CB  . ASP B 1 20 ? 18.304 30.649 -8.908  1.00 25.14  ? 58  ASP B CB  1 
ATOM   732  C CG  . ASP B 1 20 ? 18.685 29.271 -9.479  1.00 30.00  ? 58  ASP B CG  1 
ATOM   733  O OD1 . ASP B 1 20 ? 18.748 29.120 -10.682 1.00 43.69  ? 58  ASP B OD1 1 
ATOM   734  O OD2 . ASP B 1 20 ? 18.858 28.264 -8.646  1.00 40.95  ? 58  ASP B OD2 1 
ATOM   735  N N   . GLU B 1 21 ? 19.835 33.867 -8.323  1.00 15.97  ? 59  GLU B N   1 
ATOM   736  C CA  . GLU B 1 21 ? 19.688 35.037 -7.515  1.00 14.94  ? 59  GLU B CA  1 
ATOM   737  C C   . GLU B 1 21 ? 19.339 36.273 -8.300  1.00 16.03  ? 59  GLU B C   1 
ATOM   738  O O   . GLU B 1 21 ? 19.966 36.536 -9.378  1.00 23.20  ? 59  GLU B O   1 
ATOM   739  C CB  . GLU B 1 21 ? 20.989 35.257 -6.736  1.00 17.29  ? 59  GLU B CB  1 
ATOM   740  C CG  . GLU B 1 21 ? 21.420 34.141 -5.851  1.00 18.96  ? 59  GLU B CG  1 
ATOM   741  C CD  . GLU B 1 21 ? 22.693 34.309 -5.101  1.00 26.91  ? 59  GLU B CD  1 
ATOM   742  O OE1 . GLU B 1 21 ? 23.307 35.427 -5.202  1.00 39.64  ? 59  GLU B OE1 1 
ATOM   743  O OE2 . GLU B 1 21 ? 23.080 33.324 -4.419  1.00 41.05  ? 59  GLU B OE2 1 
ATOM   744  N N   . LEU B 1 22 ? 18.359 37.070 -7.898  1.00 13.28  ? 60  LEU B N   1 
ATOM   745  C CA  . LEU B 1 22 ? 17.917 38.279 -8.555  1.00 14.40  ? 60  LEU B CA  1 
ATOM   746  C C   . LEU B 1 22 ? 18.728 39.452 -8.253  1.00 13.87  ? 60  LEU B C   1 
ATOM   747  O O   . LEU B 1 22 ? 18.963 39.791 -7.101  1.00 16.78  ? 60  LEU B O   1 
ATOM   748  C CB  . LEU B 1 22 ? 16.473 38.512 -8.222  1.00 14.97  ? 60  LEU B CB  1 
ATOM   749  C CG  . LEU B 1 22 ? 15.461 37.560 -8.652  1.00 14.54  ? 60  LEU B CG  1 
ATOM   750  C CD1 . LEU B 1 22 ? 14.079 37.988 -8.127  1.00 18.74  ? 60  LEU B CD1 1 
ATOM   751  C CD2 . LEU B 1 22 ? 15.389 37.392 -10.159 1.00 18.68  ? 60  LEU B CD2 1 
ATOM   752  N N   . ALA B 1 23 ? 19.077 40.212 -9.315  1.00 13.53  ? 61  ALA B N   1 
ATOM   753  C CA  . ALA B 1 23 ? 19.659 41.540 -9.111  1.00 13.58  ? 61  ALA B CA  1 
ATOM   754  C C   . ALA B 1 23 ? 18.608 42.448 -8.567  1.00 12.42  ? 61  ALA B C   1 
ATOM   755  O O   . ALA B 1 23 ? 17.466 42.494 -8.987  1.00 13.61  ? 61  ALA B O   1 
ATOM   756  C CB  . ALA B 1 23 ? 20.121 42.041 -10.469 1.00 16.13  ? 61  ALA B CB  1 
ATOM   757  N N   . LEU B 1 24 ? 19.035 43.279 -7.536  1.00 12.71  ? 62  LEU B N   1 
ATOM   758  C CA  . LEU B 1 24 ? 18.189 44.331 -7.031  1.00 12.07  ? 62  LEU B CA  1 
ATOM   759  C C   . LEU B 1 24 ? 18.803 45.657 -7.187  1.00 12.23  ? 62  LEU B C   1 
ATOM   760  O O   . LEU B 1 24 ? 20.035 45.801 -7.008  1.00 13.98  ? 62  LEU B O   1 
ATOM   761  C CB  . LEU B 1 24 ? 17.875 44.126 -5.478  1.00 13.10  ? 62  LEU B CB  1 
ATOM   762  C CG  . LEU B 1 24 ? 17.302 42.750 -5.143  1.00 14.63  ? 62  LEU B CG  1 
ATOM   763  C CD1 . LEU B 1 24 ? 17.197 42.630 -3.592  1.00 15.20  ? 62  LEU B CD1 1 
ATOM   764  C CD2 . LEU B 1 24 ? 15.929 42.568 -5.736  1.00 15.44  ? 62  LEU B CD2 1 
ATOM   765  N N   A ARG B 1 25 ? 18.005 46.629 -7.571  0.50 13.03  ? 63  ARG B N   1 
ATOM   766  N N   B ARG B 1 25 ? 17.963 46.649 -7.388  0.50 12.84  ? 63  ARG B N   1 
ATOM   767  C CA  A ARG B 1 25 ? 18.350 48.027 -7.383  0.50 13.53  ? 63  ARG B CA  1 
ATOM   768  C CA  B ARG B 1 25 ? 18.356 48.035 -7.542  0.50 12.81  ? 63  ARG B CA  1 
ATOM   769  C C   A ARG B 1 25 ? 17.408 48.694 -6.445  0.50 13.53  ? 63  ARG B C   1 
ATOM   770  C C   B ARG B 1 25 ? 17.422 48.770 -6.558  0.50 13.75  ? 63  ARG B C   1 
ATOM   771  O O   A ARG B 1 25 ? 16.216 48.437 -6.457  0.50 13.35  ? 63  ARG B O   1 
ATOM   772  O O   B ARG B 1 25 ? 16.230 48.496 -6.508  0.50 14.71  ? 63  ARG B O   1 
ATOM   773  C CB  A ARG B 1 25 ? 18.298 48.768 -8.697  0.50 13.28  ? 63  ARG B CB  1 
ATOM   774  C CB  B ARG B 1 25 ? 18.297 48.479 -9.005  0.50 14.51  ? 63  ARG B CB  1 
ATOM   775  C CG  A ARG B 1 25 ? 19.299 48.235 -9.690  0.50 18.11  ? 63  ARG B CG  1 
ATOM   776  C CG  B ARG B 1 25 ? 19.325 47.716 -9.807  0.50 17.13  ? 63  ARG B CG  1 
ATOM   777  C CD  A ARG B 1 25 ? 20.753 48.211 -9.210  0.50 22.36  ? 63  ARG B CD  1 
ATOM   778  C CD  B ARG B 1 25 ? 20.682 48.398 -9.987  0.50 21.47  ? 63  ARG B CD  1 
ATOM   779  N NE  A ARG B 1 25 ? 21.620 47.589 -10.245 0.50 23.99  ? 63  ARG B NE  1 
ATOM   780  N NE  B ARG B 1 25 ? 20.585 49.731 -10.499 0.50 21.46  ? 63  ARG B NE  1 
ATOM   781  C CZ  A ARG B 1 25 ? 22.167 46.369 -10.169 0.50 22.90  ? 63  ARG B CZ  1 
ATOM   782  C CZ  B ARG B 1 25 ? 20.730 50.152 -11.765 0.50 21.26  ? 63  ARG B CZ  1 
ATOM   783  N NH1 A ARG B 1 25 ? 22.048 45.666 -9.081  0.50 18.91  ? 63  ARG B NH1 1 
ATOM   784  N NH1 B ARG B 1 25 ? 21.214 49.380 -12.683 0.50 24.36  ? 63  ARG B NH1 1 
ATOM   785  N NH2 A ARG B 1 25 ? 22.883 45.828 -11.089 0.50 23.84  ? 63  ARG B NH2 1 
ATOM   786  N NH2 B ARG B 1 25 ? 20.477 51.399 -11.915 0.50 19.90  ? 63  ARG B NH2 1 
ATOM   787  N N   . LYS B 1 26 ? 17.971 49.616 -5.671  1.00 14.07  ? 64  LYS B N   1 
ATOM   788  C CA  . LYS B 1 26 ? 17.148 50.346 -4.681  1.00 14.71  ? 64  LYS B CA  1 
ATOM   789  C C   . LYS B 1 26 ? 15.910 50.912 -5.390  1.00 14.95  ? 64  LYS B C   1 
ATOM   790  O O   . LYS B 1 26 ? 16.051 51.610 -6.413  1.00 16.74  ? 64  LYS B O   1 
ATOM   791  C CB  . LYS B 1 26 ? 17.977 51.420 -3.976  1.00 17.50  ? 64  LYS B CB  1 
ATOM   792  C CG  . LYS B 1 26 ? 17.180 52.269 -3.035  1.00 20.91  ? 64  LYS B CG  1 
ATOM   793  C CD  . LYS B 1 26 ? 18.088 53.245 -2.262  1.00 24.62  ? 64  LYS B CD  1 
ATOM   794  C CE  . LYS B 1 26 ? 17.171 54.191 -1.472  1.00 29.22  ? 64  LYS B CE  1 
ATOM   795  N NZ  . LYS B 1 26 ? 16.379 53.375 -0.436  1.00 45.60  ? 64  LYS B NZ  1 
ATOM   796  N N   . GLY B 1 27 ? 14.733 50.683 -4.807  1.00 14.15  ? 65  GLY B N   1 
ATOM   797  C CA  . GLY B 1 27 ? 13.501 51.155 -5.354  1.00 14.45  ? 65  GLY B CA  1 
ATOM   798  C C   . GLY B 1 27 ? 12.794 50.181 -6.293  1.00 14.18  ? 65  GLY B C   1 
ATOM   799  O O   . GLY B 1 27 ? 11.638 50.465 -6.651  1.00 16.17  ? 65  GLY B O   1 
ATOM   800  N N   . ASP B 1 28 ? 13.420 49.088 -6.680  1.00 12.56  ? 66  ASP B N   1 
ATOM   801  C CA  . ASP B 1 28 ? 12.735 48.090 -7.506  1.00 12.87  ? 66  ASP B CA  1 
ATOM   802  C C   . ASP B 1 28 ? 11.457 47.596 -6.891  1.00 12.44  ? 66  ASP B C   1 
ATOM   803  O O   . ASP B 1 28 ? 11.435 47.308 -5.644  1.00 13.70  ? 66  ASP B O   1 
ATOM   804  C CB  . ASP B 1 28 ? 13.587 46.890 -7.743  1.00 13.10  ? 66  ASP B CB  1 
ATOM   805  C CG  . ASP B 1 28 ? 14.655 47.013 -8.803  1.00 14.60  ? 66  ASP B CG  1 
ATOM   806  O OD1 . ASP B 1 28 ? 14.715 47.993 -9.592  1.00 16.20  ? 66  ASP B OD1 1 
ATOM   807  O OD2 . ASP B 1 28 ? 15.524 46.114 -8.724  1.00 14.61  ? 66  ASP B OD2 1 
ATOM   808  N N   . ARG B 1 29 ? 10.404 47.327 -7.639  1.00 13.79  ? 67  ARG B N   1 
ATOM   809  C CA  . ARG B 1 29 ? 9.234  46.600 -7.189  1.00 14.45  ? 67  ARG B CA  1 
ATOM   810  C C   . ARG B 1 29 ? 9.550  45.146 -7.274  1.00 13.48  ? 67  ARG B C   1 
ATOM   811  O O   . ARG B 1 29 ? 10.081 44.651 -8.285  1.00 17.16  ? 67  ARG B O   1 
ATOM   812  C CB  . ARG B 1 29 ? 8.037  47.064 -8.046  1.00 19.98  ? 67  ARG B CB  1 
ATOM   813  C CG  . ARG B 1 29 ? 7.657  48.516 -7.694  1.00 30.59  ? 67  ARG B CG  1 
ATOM   814  C CD  . ARG B 1 29 ? 8.234  49.201 -6.397  1.00 44.09  ? 67  ARG B CD  1 
ATOM   815  N NE  . ARG B 1 29 ? 7.569  50.386 -5.798  1.00 56.32  ? 67  ARG B NE  1 
ATOM   816  C CZ  . ARG B 1 29 ? 8.134  51.570 -5.479  1.00 56.35  ? 67  ARG B CZ  1 
ATOM   817  N NH1 . ARG B 1 29 ? 7.354  52.493 -4.935  1.00 56.86  ? 67  ARG B NH1 1 
ATOM   818  N NH2 . ARG B 1 29 ? 9.444  51.902 -5.710  1.00 35.44  ? 67  ARG B NH2 1 
ATOM   819  N N   . VAL B 1 30 ? 9.285  44.402 -6.224  1.00 13.02  ? 68  VAL B N   1 
ATOM   820  C CA  . VAL B 1 30 ? 9.545  43.021 -6.102  1.00 12.62  ? 68  VAL B CA  1 
ATOM   821  C C   . VAL B 1 30 ? 8.225  42.331 -5.789  1.00 12.76  ? 68  VAL B C   1 
ATOM   822  O O   . VAL B 1 30 ? 7.609  42.649 -4.732  1.00 16.20  ? 68  VAL B O   1 
ATOM   823  C CB  . VAL B 1 30 ? 10.591 42.697 -4.975  1.00 14.57  ? 68  VAL B CB  1 
ATOM   824  C CG1 . VAL B 1 30 ? 10.891 41.256 -4.916  1.00 16.05  ? 68  VAL B CG1 1 
ATOM   825  C CG2 . VAL B 1 30 ? 11.856 43.516 -5.234  1.00 15.89  ? 68  VAL B CG2 1 
ATOM   826  N N   . GLU B 1 31 ? 7.801  41.358 -6.535  1.00 12.20  ? 69  GLU B N   1 
ATOM   827  C CA  A GLU B 1 31 ? 6.643  40.578 -6.131  0.50 13.22  ? 69  GLU B CA  1 
ATOM   828  C CA  B GLU B 1 31 ? 6.634  40.448 -6.201  0.50 15.36  ? 69  GLU B CA  1 
ATOM   829  C C   . GLU B 1 31 ? 7.177  39.331 -5.414  1.00 14.09  ? 69  GLU B C   1 
ATOM   830  O O   . GLU B 1 31 ? 7.947  38.558 -5.935  1.00 18.24  ? 69  GLU B O   1 
ATOM   831  C CB  A GLU B 1 31 ? 5.843  40.306 -7.419  0.50 14.36  ? 69  GLU B CB  1 
ATOM   832  C CB  B GLU B 1 31 ? 5.987  39.799 -7.485  0.50 17.10  ? 69  GLU B CB  1 
ATOM   833  C CG  A GLU B 1 31 ? 5.151  41.524 -7.997  0.50 17.70  ? 69  GLU B CG  1 
ATOM   834  C CG  B GLU B 1 31 ? 4.820  38.845 -7.167  0.50 18.56  ? 69  GLU B CG  1 
ATOM   835  C CD  A GLU B 1 31 ? 4.305  41.338 -9.289  0.50 26.01  ? 69  GLU B CD  1 
ATOM   836  C CD  B GLU B 1 31 ? 4.212  38.171 -8.382  0.50 23.09  ? 69  GLU B CD  1 
ATOM   837  O OE1 A GLU B 1 31 ? 3.659  40.274 -9.444  0.50 39.54  ? 69  GLU B OE1 1 
ATOM   838  O OE1 B GLU B 1 31 ? 4.862  37.996 -9.442  0.50 29.02  ? 69  GLU B OE1 1 
ATOM   839  O OE2 A GLU B 1 31 ? 4.322  42.290 -10.088 0.50 33.77  ? 69  GLU B OE2 1 
ATOM   840  O OE2 B GLU B 1 31 ? 3.088  37.699 -8.253  0.50 25.60  ? 69  GLU B OE2 1 
ATOM   841  N N   . VAL B 1 32 ? 6.759  39.185 -4.184  1.00 12.84  ? 70  VAL B N   1 
ATOM   842  C CA  . VAL B 1 32 ? 7.238  38.091 -3.328  1.00 11.92  ? 70  VAL B CA  1 
ATOM   843  C C   . VAL B 1 32 ? 6.329  36.890 -3.508  1.00 12.32  ? 70  VAL B C   1 
ATOM   844  O O   . VAL B 1 32 ? 5.112  37.036 -3.352  1.00 16.96  ? 70  VAL B O   1 
ATOM   845  C CB  . VAL B 1 32 ? 7.403  38.525 -1.847  1.00 13.14  ? 70  VAL B CB  1 
ATOM   846  C CG1 . VAL B 1 32 ? 7.736  37.327 -0.971  1.00 13.94  ? 70  VAL B CG1 1 
ATOM   847  C CG2 . VAL B 1 32 ? 8.468  39.544 -1.768  1.00 14.38  ? 70  VAL B CG2 1 
ATOM   848  N N   . LEU B 1 33 ? 6.951  35.767 -3.845  1.00 11.78  ? 71  LEU B N   1 
ATOM   849  C CA  . LEU B 1 33 ? 6.221  34.494 -4.052  1.00 12.35  ? 71  LEU B CA  1 
ATOM   850  C C   . LEU B 1 33 ? 6.317  33.543 -2.855  1.00 12.66  ? 71  LEU B C   1 
ATOM   851  O O   . LEU B 1 33 ? 5.411  32.753 -2.669  1.00 15.31  ? 71  LEU B O   1 
ATOM   852  C CB  . LEU B 1 33 ? 6.812  33.789 -5.287  1.00 12.90  ? 71  LEU B CB  1 
ATOM   853  C CG  . LEU B 1 33 ? 6.586  34.540 -6.595  1.00 15.01  ? 71  LEU B CG  1 
ATOM   854  C CD1 . LEU B 1 33 ? 7.304  33.791 -7.685  1.00 18.79  ? 71  LEU B CD1 1 
ATOM   855  C CD2 . LEU B 1 33 ? 5.153  34.771 -6.849  1.00 23.56  ? 71  LEU B CD2 1 
ATOM   856  N N   . SER B 1 34 ? 7.401  33.591 -2.121  1.00 11.65  ? 72  SER B N   1 
ATOM   857  C CA  . SER B 1 34 ? 7.530  32.728 -0.936  1.00 11.17  ? 72  SER B CA  1 
ATOM   858  C C   . SER B 1 34 ? 8.503  33.436 0.026   1.00 11.24  ? 72  SER B C   1 
ATOM   859  O O   . SER B 1 34 ? 9.558  33.842 -0.327  1.00 11.59  ? 72  SER B O   1 
ATOM   860  C CB  . SER B 1 34 ? 8.096  31.380 -1.262  1.00 12.53  ? 72  SER B CB  1 
ATOM   861  O OG  . SER B 1 34 ? 8.376  30.687 -0.039  1.00 14.42  ? 72  SER B OG  1 
ATOM   862  N N   A ARG B 1 35 ? 8.083  33.461 1.320   0.50 12.18  ? 73  ARG B N   1 
ATOM   863  N N   B ARG B 1 35 ? 8.051  33.471 1.311   0.50 12.19  ? 73  ARG B N   1 
ATOM   864  C CA  A ARG B 1 35 ? 8.873  33.989 2.422   0.50 12.16  ? 73  ARG B CA  1 
ATOM   865  C CA  B ARG B 1 35 ? 8.836  33.990 2.453   0.50 12.16  ? 73  ARG B CA  1 
ATOM   866  C C   A ARG B 1 35 ? 9.486  32.851 3.191   0.50 13.46  ? 73  ARG B C   1 
ATOM   867  C C   B ARG B 1 35 ? 9.483  32.853 3.200   0.50 13.54  ? 73  ARG B C   1 
ATOM   868  O O   A ARG B 1 35 ? 9.899  33.110 4.381   0.50 18.16  ? 73  ARG B O   1 
ATOM   869  O O   B ARG B 1 35 ? 9.983  33.115 4.327   0.50 18.28  ? 73  ARG B O   1 
ATOM   870  C CB  A ARG B 1 35 ? 8.015  34.902 3.298   0.50 14.03  ? 73  ARG B CB  1 
ATOM   871  C CB  B ARG B 1 35 ? 7.958  34.908 3.405   0.50 14.25  ? 73  ARG B CB  1 
ATOM   872  C CG  A ARG B 1 35 ? 7.566  36.160 2.570   0.50 12.21  ? 73  ARG B CG  1 
ATOM   873  C CG  B ARG B 1 35 ? 8.181  34.935 4.995   0.50 20.09  ? 73  ARG B CG  1 
ATOM   874  C CD  A ARG B 1 35 ? 6.679  37.045 3.408   0.50 18.30  ? 73  ARG B CD  1 
ATOM   875  C CD  B ARG B 1 35 ? 7.269  35.749 5.997   0.50 27.35  ? 73  ARG B CD  1 
ATOM   876  N NE  A ARG B 1 35 ? 5.373  36.608 3.458   0.50 25.62  ? 73  ARG B NE  1 
ATOM   877  N NE  B ARG B 1 35 ? 8.044  36.534 6.985   0.50 32.63  ? 73  ARG B NE  1 
ATOM   878  C CZ  A ARG B 1 35 ? 4.454  37.228 4.182   0.50 36.06  ? 73  ARG B CZ  1 
ATOM   879  C CZ  B ARG B 1 35 ? 8.082  37.877 7.104   0.50 37.62  ? 73  ARG B CZ  1 
ATOM   880  N NH1 A ARG B 1 35 ? 4.796  38.230 4.985   0.50 36.16  ? 73  ARG B NH1 1 
ATOM   881  N NH1 B ARG B 1 35 ? 7.210  38.743 6.511   0.50 39.71  ? 73  ARG B NH1 1 
ATOM   882  N NH2 A ARG B 1 35 ? 3.234  36.778 4.171   0.50 48.60  ? 73  ARG B NH2 1 
ATOM   883  N NH2 B ARG B 1 35 ? 8.983  38.365 7.916   0.50 49.52  ? 73  ARG B NH2 1 
ATOM   884  N N   . ASP B 1 36 ? 9.544  31.641 2.695   1.00 13.49  ? 74  ASP B N   1 
ATOM   885  C CA  A ASP B 1 36 ? 9.925  30.526 3.504   0.50 16.18  ? 74  ASP B CA  1 
ATOM   886  C CA  B ASP B 1 36 ? 9.994  30.530 3.516   0.50 16.08  ? 74  ASP B CA  1 
ATOM   887  C C   . ASP B 1 36 ? 10.695 29.464 2.703   1.00 14.50  ? 74  ASP B C   1 
ATOM   888  O O   . ASP B 1 36 ? 10.105 28.731 1.914   1.00 17.71  ? 74  ASP B O   1 
ATOM   889  C CB  A ASP B 1 36 ? 8.683  29.891 4.135   0.50 20.83  ? 74  ASP B CB  1 
ATOM   890  C CB  B ASP B 1 36 ? 8.842  29.881 4.270   0.50 20.19  ? 74  ASP B CB  1 
ATOM   891  C CG  A ASP B 1 36 ? 7.978  30.819 5.107   0.50 21.71  ? 74  ASP B CG  1 
ATOM   892  C CG  B ASP B 1 36 ? 9.294  28.852 5.354   0.50 30.33  ? 74  ASP B CG  1 
ATOM   893  O OD1 A ASP B 1 36 ? 8.326  30.924 6.299   0.50 31.56  ? 74  ASP B OD1 1 
ATOM   894  O OD1 B ASP B 1 36 ? 10.517 28.666 5.750   0.50 41.70  ? 74  ASP B OD1 1 
ATOM   895  O OD2 A ASP B 1 36 ? 6.994  31.438 4.707   0.50 28.50  ? 74  ASP B OD2 1 
ATOM   896  O OD2 B ASP B 1 36 ? 8.315  28.180 5.744   0.50 38.60  ? 74  ASP B OD2 1 
ATOM   897  N N   . ALA B 1 37 ? 12.011 29.420 2.784   1.00 15.79  ? 75  ALA B N   1 
ATOM   898  C CA  . ALA B 1 37 ? 12.789 28.422 2.137   1.00 17.56  ? 75  ALA B CA  1 
ATOM   899  C C   . ALA B 1 37 ? 12.439 27.035 2.671   1.00 17.80  ? 75  ALA B C   1 
ATOM   900  O O   . ALA B 1 37 ? 12.311 26.846 3.839   1.00 21.37  ? 75  ALA B O   1 
ATOM   901  C CB  . ALA B 1 37 ? 14.286 28.660 2.209   1.00 18.13  ? 75  ALA B CB  1 
ATOM   902  N N   . ALA B 1 38 ? 12.387 26.060 1.767   1.00 19.47  ? 76  ALA B N   1 
ATOM   903  C CA  . ALA B 1 38 ? 12.114 24.692 2.175   1.00 19.82  ? 76  ALA B CA  1 
ATOM   904  C C   . ALA B 1 38 ? 13.323 24.092 2.856   1.00 22.79  ? 76  ALA B C   1 
ATOM   905  O O   . ALA B 1 38 ? 13.150 23.136 3.588   1.00 30.95  ? 76  ALA B O   1 
ATOM   906  C CB  . ALA B 1 38 ? 11.745 23.818 1.004   1.00 23.39  ? 76  ALA B CB  1 
ATOM   907  N N   . ILE B 1 39 ? 14.517 24.510 2.483   1.00 26.93  ? 77  ILE B N   1 
ATOM   908  C CA  . ILE B 1 39 ? 15.816 23.968 3.087   1.00 26.46  ? 77  ILE B CA  1 
ATOM   909  C C   . ILE B 1 39 ? 16.436 24.911 4.088   1.00 31.02  ? 77  ILE B C   1 
ATOM   910  O O   . ILE B 1 39 ? 16.481 26.082 3.802   1.00 30.36  ? 77  ILE B O   1 
ATOM   911  C CB  . ILE B 1 39 ? 16.773 23.757 1.877   1.00 35.48  ? 77  ILE B CB  1 
ATOM   912  C CG1 . ILE B 1 39 ? 16.238 22.618 1.038   1.00 37.24  ? 77  ILE B CG1 1 
ATOM   913  C CG2 . ILE B 1 39 ? 18.166 23.438 2.326   1.00 51.12  ? 77  ILE B CG2 1 
ATOM   914  C CD1 . ILE B 1 39 ? 15.624 21.459 1.735   1.00 46.91  ? 77  ILE B CD1 1 
ATOM   915  N N   . SER B 1 40 ? 17.051 24.372 5.146   1.00 42.19  ? 78  SER B N   1 
ATOM   916  C CA  . SER B 1 40 ? 17.641 25.140 6.261   1.00 46.94  ? 78  SER B CA  1 
ATOM   917  C C   . SER B 1 40 ? 18.866 26.068 6.093   1.00 78.94  ? 78  SER B C   1 
ATOM   918  O O   . SER B 1 40 ? 18.794 27.344 6.226   1.00 105.81 ? 78  SER B O   1 
ATOM   919  C CB  . SER B 1 40 ? 18.147 24.077 7.265   1.00 37.03  ? 78  SER B CB  1 
ATOM   920  O OG  . SER B 1 40 ? 16.932 23.612 7.788   1.00 44.21  ? 78  SER B OG  1 
ATOM   921  N N   . GLY B 1 41 ? 19.603 25.451 4.887   1.00 78.83  ? 79  GLY B N   1 
ATOM   922  C CA  . GLY B 1 41 ? 20.608 26.331 4.419   1.00 58.60  ? 79  GLY B CA  1 
ATOM   923  C C   . GLY B 1 41 ? 20.231 27.627 3.693   1.00 48.90  ? 79  GLY B C   1 
ATOM   924  O O   . GLY B 1 41 ? 21.073 28.557 3.515   1.00 61.91  ? 79  GLY B O   1 
ATOM   925  N N   . ASP B 1 42 ? 18.965 27.701 3.266   1.00 38.56  ? 80  ASP B N   1 
ATOM   926  C CA  . ASP B 1 42 ? 18.507 28.785 2.386   1.00 27.92  ? 80  ASP B CA  1 
ATOM   927  C C   . ASP B 1 42 ? 17.619 29.714 3.174   1.00 23.70  ? 80  ASP B C   1 
ATOM   928  O O   . ASP B 1 42 ? 17.057 30.699 2.627   1.00 20.75  ? 80  ASP B O   1 
ATOM   929  C CB  . ASP B 1 42 ? 17.677 28.195 1.287   1.00 25.86  ? 80  ASP B CB  1 
ATOM   930  C CG  . ASP B 1 42 ? 18.490 27.486 0.187   1.00 32.41  ? 80  ASP B CG  1 
ATOM   931  O OD1 . ASP B 1 42 ? 19.682 27.792 0.005   1.00 37.06  ? 80  ASP B OD1 1 
ATOM   932  O OD2 . ASP B 1 42 ? 17.856 26.712 -0.584  1.00 30.54  ? 80  ASP B OD2 1 
ATOM   933  N N   . GLU B 1 43 ? 17.419 29.406 4.446   1.00 27.98  ? 81  GLU B N   1 
ATOM   934  C CA  . GLU B 1 43 ? 16.615 30.266 5.254   1.00 23.65  ? 81  GLU B CA  1 
ATOM   935  C C   . GLU B 1 43 ? 17.377 31.702 5.202   1.00 22.13  ? 81  GLU B C   1 
ATOM   936  O O   . GLU B 1 43 ? 18.716 31.852 5.212   1.00 38.12  ? 81  GLU B O   1 
ATOM   937  C CB  . GLU B 1 43 ? 16.529 29.738 6.692   1.00 29.57  ? 81  GLU B CB  1 
ATOM   938  C CG  . GLU B 1 43 ? 15.855 30.664 7.723   1.00 38.29  ? 81  GLU B CG  1 
ATOM   939  C CD  . GLU B 1 43 ? 16.104 30.306 9.263   1.00 69.68  ? 81  GLU B CD  1 
ATOM   940  O OE1 . GLU B 1 43 ? 16.612 29.213 9.615   1.00 94.08  ? 81  GLU B OE1 1 
ATOM   941  O OE2 . GLU B 1 43 ? 15.841 31.185 10.139  1.00 88.95  ? 81  GLU B OE2 1 
ATOM   942  N N   . GLY B 1 44 ? 16.527 32.666 5.148   1.00 18.80  ? 82  GLY B N   1 
ATOM   943  C CA  . GLY B 1 44 ? 16.869 34.030 4.998   1.00 17.32  ? 82  GLY B CA  1 
ATOM   944  C C   . GLY B 1 44 ? 16.698 34.559 3.609   1.00 13.50  ? 82  GLY B C   1 
ATOM   945  O O   . GLY B 1 44 ? 16.649 35.747 3.394   1.00 16.18  ? 82  GLY B O   1 
ATOM   946  N N   . TRP B 1 45 ? 16.524 33.626 2.671   1.00 11.70  ? 83  TRP B N   1 
ATOM   947  C CA  . TRP B 1 45 ? 16.294 34.012 1.226   1.00 10.62  ? 83  TRP B CA  1 
ATOM   948  C C   . TRP B 1 45 ? 14.814 33.713 0.925   1.00 10.29  ? 83  TRP B C   1 
ATOM   949  O O   . TRP B 1 45 ? 14.259 32.731 1.311   1.00 10.89  ? 83  TRP B O   1 
ATOM   950  C CB  . TRP B 1 45 ? 17.244 33.180 0.332   1.00 11.75  ? 83  TRP B CB  1 
ATOM   951  C CG  . TRP B 1 45 ? 18.680 33.607 0.432   1.00 12.58  ? 83  TRP B CG  1 
ATOM   952  C CD1 . TRP B 1 45 ? 19.556 33.415 1.474   1.00 15.74  ? 83  TRP B CD1 1 
ATOM   953  C CD2 . TRP B 1 45 ? 19.415 34.323 -0.560  1.00 12.24  ? 83  TRP B CD2 1 
ATOM   954  N NE1 . TRP B 1 45 ? 20.765 33.953 1.180   1.00 15.43  ? 83  TRP B NE1 1 
ATOM   955  C CE2 . TRP B 1 45 ? 20.737 34.502 -0.076  1.00 13.38  ? 83  TRP B CE2 1 
ATOM   956  C CE3 . TRP B 1 45 ? 19.118 34.768 -1.847  1.00 12.85  ? 83  TRP B CE3 1 
ATOM   957  C CZ2 . TRP B 1 45 ? 21.702 35.107 -0.820  1.00 14.02  ? 83  TRP B CZ2 1 
ATOM   958  C CZ3 . TRP B 1 45 ? 20.065 35.387 -2.585  1.00 14.25  ? 83  TRP B CZ3 1 
ATOM   959  C CH2 . TRP B 1 45 ? 21.345 35.587 -2.075  1.00 14.68  ? 83  TRP B CH2 1 
ATOM   960  N N   . TRP B 1 46 ? 14.265 34.641 0.099   1.00 9.74   ? 84  TRP B N   1 
ATOM   961  C CA  . TRP B 1 46 ? 12.924 34.570 -0.318  1.00 10.33  ? 84  TRP B CA  1 
ATOM   962  C C   . TRP B 1 46 ? 12.877 34.339 -1.886  1.00 10.05  ? 84  TRP B C   1 
ATOM   963  O O   . TRP B 1 46 ? 13.875 34.649 -2.529  1.00 11.38  ? 84  TRP B O   1 
ATOM   964  C CB  . TRP B 1 46 ? 12.187 35.831 -0.036  1.00 9.70   ? 84  TRP B CB  1 
ATOM   965  C CG  . TRP B 1 46 ? 11.854 36.014 1.478   1.00 10.50  ? 84  TRP B CG  1 
ATOM   966  C CD1 . TRP B 1 46 ? 12.145 35.154 2.463   1.00 11.65  ? 84  TRP B CD1 1 
ATOM   967  C CD2 . TRP B 1 46 ? 11.183 37.100 2.062   1.00 11.54  ? 84  TRP B CD2 1 
ATOM   968  N NE1 . TRP B 1 46 ? 11.657 35.705 3.652   1.00 12.93  ? 84  TRP B NE1 1 
ATOM   969  C CE2 . TRP B 1 46 ? 11.076 36.859 3.447   1.00 11.69  ? 84  TRP B CE2 1 
ATOM   970  C CE3 . TRP B 1 46 ? 10.673 38.283 1.535   1.00 13.03  ? 84  TRP B CE3 1 
ATOM   971  C CZ2 . TRP B 1 46 ? 10.529 37.744 4.311   1.00 15.59  ? 84  TRP B CZ2 1 
ATOM   972  C CZ3 . TRP B 1 46 ? 10.093 39.169 2.444   1.00 13.97  ? 84  TRP B CZ3 1 
ATOM   973  C CH2 . TRP B 1 46 ? 9.994  38.857 3.811   1.00 16.21  ? 84  TRP B CH2 1 
ATOM   974  N N   . ALA B 1 47 ? 11.761 33.831 -2.339  1.00 9.90   ? 85  ALA B N   1 
ATOM   975  C CA  . ALA B 1 47 ? 11.581 33.743 -3.809  1.00 9.93   ? 85  ALA B CA  1 
ATOM   976  C C   . ALA B 1 47 ? 10.683 34.791 -4.213  1.00 10.38  ? 85  ALA B C   1 
ATOM   977  O O   . ALA B 1 47 ? 9.657  35.191 -3.576  1.00 11.07  ? 85  ALA B O   1 
ATOM   978  C CB  . ALA B 1 47 ? 10.975 32.402 -4.150  1.00 12.60  ? 85  ALA B CB  1 
ATOM   979  N N   . GLY B 1 48 ? 10.959 35.334 -5.451  1.00 11.53  ? 86  GLY B N   1 
ATOM   980  C CA  . GLY B 1 48 ? 10.091 36.365 -5.913  1.00 12.27  ? 86  GLY B CA  1 
ATOM   981  C C   . GLY B 1 48 ? 10.334 36.563 -7.441  1.00 10.91  ? 86  GLY B C   1 
ATOM   982  O O   . GLY B 1 48 ? 11.015 35.831 -8.088  1.00 12.01  ? 86  GLY B O   1 
ATOM   983  N N   . GLN B 1 49 ? 9.749  37.636 -7.864  1.00 12.77  ? 87  GLN B N   1 
ATOM   984  C CA  A GLN B 1 49 ? 9.811  38.014 -9.345  0.50 13.68  ? 87  GLN B CA  1 
ATOM   985  C CA  B GLN B 1 49 ? 9.768  38.092 -9.358  0.50 14.81  ? 87  GLN B CA  1 
ATOM   986  C C   . GLN B 1 49 ? 10.116 39.547 -9.406  1.00 13.22  ? 87  GLN B C   1 
ATOM   987  O O   . GLN B 1 49 ? 9.479  40.415 -8.799  1.00 15.04  ? 87  GLN B O   1 
ATOM   988  C CB  A GLN B 1 49 ? 8.466  37.549 -10.075 0.50 20.78  ? 87  GLN B CB  1 
ATOM   989  C CB  B GLN B 1 49 ? 8.388  37.771 -9.988  0.50 17.57  ? 87  GLN B CB  1 
ATOM   990  C CG  A GLN B 1 49 ? 8.262  37.961 -11.485 0.50 23.60  ? 87  GLN B CG  1 
ATOM   991  C CG  B GLN B 1 49 ? 8.364  37.930 -11.525 0.50 19.13  ? 87  GLN B CG  1 
ATOM   992  C CD  A GLN B 1 49 ? 7.658  39.365 -11.537 0.50 18.84  ? 87  GLN B CD  1 
ATOM   993  C CD  B GLN B 1 49 ? 7.192  37.281 -12.168 0.50 22.00  ? 87  GLN B CD  1 
ATOM   994  O OE1 A GLN B 1 49 ? 8.209  40.306 -12.152 0.50 28.27  ? 87  GLN B OE1 1 
ATOM   995  O OE1 B GLN B 1 49 ? 6.378  36.740 -11.499 0.50 34.32  ? 87  GLN B OE1 1 
ATOM   996  N NE2 A GLN B 1 49 ? 6.502  39.500 -10.951 0.50 19.23  ? 87  GLN B NE2 1 
ATOM   997  N NE2 B GLN B 1 49 ? 7.135  37.323 -13.498 0.50 42.23  ? 87  GLN B NE2 1 
ATOM   998  N N   . VAL B 1 50 ? 11.135 39.883 -10.257 1.00 13.84  ? 88  VAL B N   1 
ATOM   999  C CA  . VAL B 1 50 ? 11.542 41.240 -10.553 1.00 15.42  ? 88  VAL B CA  1 
ATOM   1000 C C   . VAL B 1 50 ? 11.673 41.302 -12.108 1.00 15.85  ? 88  VAL B C   1 
ATOM   1001 O O   . VAL B 1 50 ? 12.311 40.459 -12.679 1.00 15.96  ? 88  VAL B O   1 
ATOM   1002 C CB  . VAL B 1 50 ? 12.900 41.594 -9.940  1.00 16.10  ? 88  VAL B CB  1 
ATOM   1003 C CG1 . VAL B 1 50 ? 13.396 42.940 -10.382 1.00 21.00  ? 88  VAL B CG1 1 
ATOM   1004 C CG2 . VAL B 1 50 ? 12.832 41.534 -8.377  1.00 20.61  ? 88  VAL B CG2 1 
ATOM   1005 N N   . GLY B 1 51 ? 10.957 42.238 -12.710 1.00 20.29  ? 89  GLY B N   1 
ATOM   1006 C CA  . GLY B 1 51 ? 11.049 42.435 -14.063 1.00 21.69  ? 89  GLY B CA  1 
ATOM   1007 C C   . GLY B 1 51 ? 10.589 41.219 -14.912 1.00 23.69  ? 89  GLY B C   1 
ATOM   1008 O O   . GLY B 1 51 ? 11.205 41.002 -15.947 1.00 26.59  ? 89  GLY B O   1 
ATOM   1009 N N   . GLY B 1 52 ? 9.693  40.402 -14.389 1.00 22.21  ? 90  GLY B N   1 
ATOM   1010 C CA  . GLY B 1 52 ? 9.306  39.201 -15.124 1.00 27.77  ? 90  GLY B CA  1 
ATOM   1011 C C   . GLY B 1 52 ? 10.192 37.991 -14.897 1.00 24.07  ? 90  GLY B C   1 
ATOM   1012 O O   . GLY B 1 52 ? 9.922  36.974 -15.468 1.00 29.48  ? 90  GLY B O   1 
ATOM   1013 N N   . GLN B 1 53 ? 11.261 38.092 -14.080 1.00 18.30  ? 91  GLN B N   1 
ATOM   1014 C CA  . GLN B 1 53 ? 12.132 36.938 -13.882 1.00 16.13  ? 91  GLN B CA  1 
ATOM   1015 C C   . GLN B 1 53 ? 11.927 36.445 -12.448 1.00 14.91  ? 91  GLN B C   1 
ATOM   1016 O O   . GLN B 1 53 ? 12.022 37.280 -11.490 1.00 15.05  ? 91  GLN B O   1 
ATOM   1017 C CB  . GLN B 1 53 ? 13.510 37.470 -13.979 1.00 21.28  ? 91  GLN B CB  1 
ATOM   1018 C CG  . GLN B 1 53 ? 14.579 36.514 -13.799 1.00 21.15  ? 91  GLN B CG  1 
ATOM   1019 C CD  . GLN B 1 53 ? 14.512 35.380 -14.784 1.00 23.72  ? 91  GLN B CD  1 
ATOM   1020 O OE1 . GLN B 1 53 ? 14.356 35.606 -16.023 1.00 24.89  ? 91  GLN B OE1 1 
ATOM   1021 N NE2 . GLN B 1 53 ? 14.644 34.199 -14.299 1.00 29.24  ? 91  GLN B NE2 1 
ATOM   1022 N N   . VAL B 1 54 ? 11.785 35.189 -12.288 1.00 14.95  ? 92  VAL B N   1 
ATOM   1023 C CA  . VAL B 1 54 ? 11.665 34.581 -10.946 1.00 13.85  ? 92  VAL B CA  1 
ATOM   1024 C C   . VAL B 1 54 ? 12.993 34.132 -10.485 1.00 15.07  ? 92  VAL B C   1 
ATOM   1025 O O   . VAL B 1 54 ? 13.860 33.642 -11.197 1.00 19.76  ? 92  VAL B O   1 
ATOM   1026 C CB  . VAL B 1 54 ? 10.761 33.352 -11.039 1.00 16.11  ? 92  VAL B CB  1 
ATOM   1027 C CG1 . VAL B 1 54 ? 10.728 32.549 -9.762  1.00 17.43  ? 92  VAL B CG1 1 
ATOM   1028 C CG2 . VAL B 1 54 ? 9.348  33.760 -11.474 1.00 20.25  ? 92  VAL B CG2 1 
ATOM   1029 N N   . GLY B 1 55 ? 13.263 34.364 -9.197  1.00 12.54  ? 93  GLY B N   1 
ATOM   1030 C CA  . GLY B 1 55 ? 14.546 33.921 -8.625  1.00 11.89  ? 93  GLY B CA  1 
ATOM   1031 C C   . GLY B 1 55 ? 14.477 34.182 -7.027  1.00 10.33  ? 93  GLY B C   1 
ATOM   1032 O O   . GLY B 1 55 ? 13.386 34.369 -6.534  1.00 12.24  ? 93  GLY B O   1 
ATOM   1033 N N   . ILE B 1 56 ? 15.639 34.195 -6.479  1.00 10.50  ? 94  ILE B N   1 
ATOM   1034 C CA  . ILE B 1 56 ? 15.713 34.344 -4.967  1.00 9.38   ? 94  ILE B CA  1 
ATOM   1035 C C   . ILE B 1 56 ? 16.495 35.524 -4.705  1.00 10.34  ? 94  ILE B C   1 
ATOM   1036 O O   . ILE B 1 56 ? 17.367 36.064 -5.385  1.00 11.81  ? 94  ILE B O   1 
ATOM   1037 C CB  . ILE B 1 56 ? 16.221 33.094 -4.351  1.00 11.32  ? 94  ILE B CB  1 
ATOM   1038 C CG1 . ILE B 1 56 ? 17.613 32.778 -4.751  1.00 12.34  ? 94  ILE B CG1 1 
ATOM   1039 C CG2 . ILE B 1 56 ? 15.232 31.981 -4.551  1.00 12.94  ? 94  ILE B CG2 1 
ATOM   1040 C CD1 . ILE B 1 56 ? 18.298 31.635 -3.913  1.00 15.54  ? 94  ILE B CD1 1 
ATOM   1041 N N   . PHE B 1 57 ? 16.245 36.051 -3.460  1.00 10.45  ? 95  PHE B N   1 
ATOM   1042 C CA  . PHE B 1 57 ? 16.944 37.235 -2.971  1.00 11.42  ? 95  PHE B CA  1 
ATOM   1043 C C   . PHE B 1 57 ? 16.935 37.255 -1.434  1.00 10.96  ? 95  PHE B C   1 
ATOM   1044 O O   . PHE B 1 57 ? 16.109 36.601 -0.792  1.00 10.77  ? 95  PHE B O   1 
ATOM   1045 C CB  . PHE B 1 57 ? 16.297 38.529 -3.511  1.00 11.99  ? 95  PHE B CB  1 
ATOM   1046 C CG  . PHE B 1 57 ? 14.880 38.667 -3.214  1.00 11.50  ? 95  PHE B CG  1 
ATOM   1047 C CD1 . PHE B 1 57 ? 13.996 38.102 -4.060  1.00 17.35  ? 95  PHE B CD1 1 
ATOM   1048 C CD2 . PHE B 1 57 ? 14.440 39.254 -2.013  1.00 15.27  ? 95  PHE B CD2 1 
ATOM   1049 C CE1 . PHE B 1 57 ? 12.681 38.098 -3.776  1.00 26.64  ? 95  PHE B CE1 1 
ATOM   1050 C CE2 . PHE B 1 57 ? 13.130 39.250 -1.737  1.00 19.67  ? 95  PHE B CE2 1 
ATOM   1051 C CZ  . PHE B 1 57 ? 12.273 38.674 -2.603  1.00 24.13  ? 95  PHE B CZ  1 
ATOM   1052 N N   . PRO B 1 58 ? 17.849 38.021 -0.848  1.00 11.60  ? 96  PRO B N   1 
ATOM   1053 C CA  . PRO B 1 58 ? 17.857 38.110 0.685   1.00 11.53  ? 96  PRO B CA  1 
ATOM   1054 C C   . PRO B 1 58 ? 16.671 38.884 1.134   1.00 11.03  ? 96  PRO B C   1 
ATOM   1055 O O   . PRO B 1 58 ? 16.397 39.984 0.755   1.00 11.58  ? 96  PRO B O   1 
ATOM   1056 C CB  . PRO B 1 58 ? 19.214 38.868 0.904   1.00 12.94  ? 96  PRO B CB  1 
ATOM   1057 C CG  . PRO B 1 58 ? 20.030 38.679 -0.366  1.00 13.81  ? 96  PRO B CG  1 
ATOM   1058 C CD  . PRO B 1 58 ? 18.980 38.750 -1.387  1.00 12.66  ? 96  PRO B CD  1 
ATOM   1059 N N   . SER B 1 59 ? 15.953 38.234 2.136   1.00 11.97  ? 97  SER B N   1 
ATOM   1060 C CA  . SER B 1 59 ? 14.766 38.834 2.675   1.00 11.86  ? 97  SER B CA  1 
ATOM   1061 C C   . SER B 1 59 ? 14.967 40.230 3.229   1.00 10.73  ? 97  SER B C   1 
ATOM   1062 O O   . SER B 1 59 ? 14.119 41.044 3.178   1.00 12.17  ? 97  SER B O   1 
ATOM   1063 C CB  . SER B 1 59 ? 14.209 37.909 3.691   1.00 13.74  ? 97  SER B CB  1 
ATOM   1064 O OG  . SER B 1 59 ? 15.006 37.743 4.810   1.00 15.50  ? 97  SER B OG  1 
ATOM   1065 N N   . ASN B 1 60 ? 16.171 40.435 3.818   1.00 9.97   ? 98  ASN B N   1 
ATOM   1066 C CA  A ASN B 1 60 ? 16.399 41.671 4.520   0.50 10.08  ? 98  ASN B CA  1 
ATOM   1067 C CA  B ASN B 1 60 ? 16.407 41.728 4.511   0.50 9.90   ? 98  ASN B CA  1 
ATOM   1068 C C   . ASN B 1 60 ? 16.620 42.899 3.619   1.00 10.11  ? 98  ASN B C   1 
ATOM   1069 O O   . ASN B 1 60 ? 16.761 44.017 4.003   1.00 12.76  ? 98  ASN B O   1 
ATOM   1070 C CB  A ASN B 1 60 ? 17.517 41.478 5.506   0.50 11.29  ? 98  ASN B CB  1 
ATOM   1071 C CB  B ASN B 1 60 ? 17.612 41.694 5.381   0.50 11.85  ? 98  ASN B CB  1 
ATOM   1072 C CG  A ASN B 1 60 ? 17.137 40.598 6.661   0.50 14.25  ? 98  ASN B CG  1 
ATOM   1073 C CG  B ASN B 1 60 ? 17.623 40.549 6.292   0.50 11.99  ? 98  ASN B CG  1 
ATOM   1074 O OD1 A ASN B 1 60 ? 16.021 40.214 6.847   0.50 14.31  ? 98  ASN B OD1 1 
ATOM   1075 O OD1 B ASN B 1 60 ? 17.153 40.699 7.444   0.50 20.53  ? 98  ASN B OD1 1 
ATOM   1076 N ND2 A ASN B 1 60 ? 18.132 40.304 7.472   0.50 17.14  ? 98  ASN B ND2 1 
ATOM   1077 N ND2 B ASN B 1 60 ? 18.071 39.445 5.854   0.50 11.89  ? 98  ASN B ND2 1 
ATOM   1078 N N   . TYR B 1 61 ? 16.686 42.608 2.226   1.00 10.70  ? 99  TYR B N   1 
ATOM   1079 C CA  . TYR B 1 61 ? 16.889 43.668 1.239   1.00 9.80   ? 99  TYR B CA  1 
ATOM   1080 C C   . TYR B 1 61 ? 15.630 44.194 0.700   1.00 10.46  ? 99  TYR B C   1 
ATOM   1081 O O   . TYR B 1 61 ? 15.690 45.011 -0.289  1.00 12.36  ? 99  TYR B O   1 
ATOM   1082 C CB  . TYR B 1 61 ? 17.896 43.229 0.212   1.00 10.76  ? 99  TYR B CB  1 
ATOM   1083 C CG  . TYR B 1 61 ? 19.305 43.029 0.765   1.00 10.98  ? 99  TYR B CG  1 
ATOM   1084 C CD1 . TYR B 1 61 ? 19.724 43.488 2.063   1.00 11.77  ? 99  TYR B CD1 1 
ATOM   1085 C CD2 . TYR B 1 61 ? 20.256 42.372 0.025   1.00 11.51  ? 99  TYR B CD2 1 
ATOM   1086 C CE1 . TYR B 1 61 ? 20.997 43.283 2.427   1.00 12.20  ? 99  TYR B CE1 1 
ATOM   1087 C CE2 . TYR B 1 61 ? 21.492 42.099 0.454   1.00 11.54  ? 99  TYR B CE2 1 
ATOM   1088 C CZ  . TYR B 1 61 ? 21.890 42.585 1.717   1.00 11.86  ? 99  TYR B CZ  1 
ATOM   1089 O OH  . TYR B 1 61 ? 23.170 42.400 2.176   1.00 14.34  ? 99  TYR B OH  1 
ATOM   1090 N N   . VAL B 1 62 ? 14.485 43.850 1.177   1.00 10.82  ? 100 VAL B N   1 
ATOM   1091 C CA  . VAL B 1 62 ? 13.234 44.360 0.783   1.00 11.45  ? 100 VAL B CA  1 
ATOM   1092 C C   . VAL B 1 62 ? 12.352 44.871 1.935   1.00 11.82  ? 100 VAL B C   1 
ATOM   1093 O O   . VAL B 1 62 ? 12.549 44.382 3.091   1.00 12.83  ? 100 VAL B O   1 
ATOM   1094 C CB  . VAL B 1 62 ? 12.380 43.371 -0.074  1.00 12.19  ? 100 VAL B CB  1 
ATOM   1095 C CG1 . VAL B 1 62 ? 13.126 43.065 -1.387  1.00 13.02  ? 100 VAL B CG1 1 
ATOM   1096 C CG2 . VAL B 1 62 ? 12.066 42.084 0.663   1.00 12.83  ? 100 VAL B CG2 1 
ATOM   1097 N N   . SER B 1 63 ? 11.407 45.706 1.683   1.00 12.30  ? 101 SER B N   1 
ATOM   1098 C CA  . SER B 1 63 ? 10.432 46.139 2.605   1.00 13.75  ? 101 SER B CA  1 
ATOM   1099 C C   . SER B 1 63 ? 9.045  46.086 2.045   1.00 12.81  ? 101 SER B C   1 
ATOM   1100 O O   . SER B 1 63 ? 8.869  46.302 0.821   1.00 13.96  ? 101 SER B O   1 
ATOM   1101 C CB  . SER B 1 63 ? 10.757 47.577 3.119   1.00 20.69  ? 101 SER B CB  1 
ATOM   1102 O OG  . SER B 1 63 ? 10.529 48.571 2.234   1.00 27.91  ? 101 SER B OG  1 
ATOM   1103 N N   A ARG B 1 64 ? 8.039  45.848 2.844   0.50 13.24  ? 102 ARG B N   1 
ATOM   1104 N N   B ARG B 1 64 ? 8.003  45.915 2.851   0.50 15.45  ? 102 ARG B N   1 
ATOM   1105 C CA  A ARG B 1 64 ? 6.749  45.594 2.248   0.50 12.58  ? 102 ARG B CA  1 
ATOM   1106 C CA  B ARG B 1 64 ? 6.643  45.616 2.352   0.50 15.09  ? 102 ARG B CA  1 
ATOM   1107 C C   A ARG B 1 64 ? 6.023  46.875 1.940   0.50 12.40  ? 102 ARG B C   1 
ATOM   1108 C C   B ARG B 1 64 ? 5.865  46.869 1.980   0.50 14.96  ? 102 ARG B C   1 
ATOM   1109 O O   A ARG B 1 64 ? 5.966  47.797 2.783   0.50 12.99  ? 102 ARG B O   1 
ATOM   1110 O O   B ARG B 1 64 ? 5.620  47.789 2.779   0.50 13.41  ? 102 ARG B O   1 
ATOM   1111 C CB  A ARG B 1 64 ? 5.952  44.767 3.231   0.50 13.60  ? 102 ARG B CB  1 
ATOM   1112 C CB  B ARG B 1 64 ? 5.905  44.770 3.420   0.50 20.94  ? 102 ARG B CB  1 
ATOM   1113 C CG  A ARG B 1 64 ? 4.487  44.441 2.848   0.50 13.24  ? 102 ARG B CG  1 
ATOM   1114 C CG  B ARG B 1 64 ? 4.343  44.778 3.392   0.50 33.51  ? 102 ARG B CG  1 
ATOM   1115 C CD  A ARG B 1 64 ? 4.117  43.537 1.766   0.50 17.96  ? 102 ARG B CD  1 
ATOM   1116 C CD  B ARG B 1 64 ? 3.516  43.889 2.445   0.50 32.64  ? 102 ARG B CD  1 
ATOM   1117 N NE  A ARG B 1 64 ? 2.699  43.212 1.669   0.50 25.21  ? 102 ARG B NE  1 
ATOM   1118 N NE  B ARG B 1 64 ? 2.905  42.549 2.896   0.50 39.98  ? 102 ARG B NE  1 
ATOM   1119 C CZ  A ARG B 1 64 ? 1.870  43.716 0.740   0.50 28.56  ? 102 ARG B CZ  1 
ATOM   1120 C CZ  B ARG B 1 64 ? 3.039  41.793 3.997   0.50 30.70  ? 102 ARG B CZ  1 
ATOM   1121 N NH1 A ARG B 1 64 ? 2.286  44.645 -0.135  0.50 30.36  ? 102 ARG B NH1 1 
ATOM   1122 N NH1 B ARG B 1 64 ? 3.488  42.094 5.276   0.50 34.98  ? 102 ARG B NH1 1 
ATOM   1123 N NH2 A ARG B 1 64 ? 0.635  43.294 0.689   0.50 27.02  ? 102 ARG B NH2 1 
ATOM   1124 N NH2 B ARG B 1 64 ? 2.441  40.702 3.786   0.50 33.61  ? 102 ARG B NH2 1 
ATOM   1125 N N   . GLY B 1 65 ? 5.349  46.881 0.763   1.00 14.49  ? 103 GLY B N   1 
ATOM   1126 C CA  . GLY B 1 65 ? 4.607  47.941 0.246   1.00 14.95  ? 103 GLY B CA  1 
ATOM   1127 C C   . GLY B 1 65 ? 5.267  48.681 -0.897  1.00 18.64  ? 103 GLY B C   1 
ATOM   1128 O O   . GLY B 1 65 ? 6.468  48.976 -0.772  1.00 20.91  ? 103 GLY B O   1 
ATOM   1129 N N   . GLY B 1 66 ? 4.463  49.046 -1.884  1.00 18.66  ? 104 GLY B N   1 
ATOM   1130 C CA  . GLY B 1 66 ? 4.980  49.877 -2.952  1.00 25.06  ? 104 GLY B CA  1 
ATOM   1131 C C   . GLY B 1 66 ? 4.292  51.197 -3.178  1.00 21.68  ? 104 GLY B C   1 
ATOM   1132 O O   . GLY B 1 66 ? 4.663  51.971 -4.076  1.00 32.58  ? 104 GLY B O   1 
ATOM   1133 N N   . GLY B 1 67 ? 3.356  51.492 -2.286  1.00 21.73  ? 105 GLY B N   1 
ATOM   1134 C CA  . GLY B 1 67 ? 2.564  52.690 -2.396  1.00 22.67  ? 105 GLY B CA  1 
ATOM   1135 C C   . GLY B 1 67 ? 2.693  53.491 -1.137  1.00 19.41  ? 105 GLY B C   1 
ATOM   1136 O O   . GLY B 1 67 ? 3.742  53.638 -0.508  1.00 24.50  ? 105 GLY B O   1 
ATOM   1137 N N   . ALA B 1 68 ? 1.615  54.096 -0.733  1.00 23.07  ? 106 ALA B N   1 
ATOM   1138 C CA  . ALA B 1 68 ? 1.566  55.030 0.387   1.00 24.84  ? 106 ALA B CA  1 
ATOM   1139 C C   . ALA B 1 68 ? 1.746  54.473 1.769   1.00 20.74  ? 106 ALA B C   1 
ATOM   1140 O O   . ALA B 1 68 ? 2.109  55.222 2.668   1.00 25.67  ? 106 ALA B O   1 
ATOM   1141 C CB  . ALA B 1 68 ? 0.246  55.786 0.338   1.00 30.42  ? 106 ALA B CB  1 
ATOM   1142 N N   . ILE B 1 69 ? 1.427  53.206 1.958   1.00 20.37  ? 107 ILE B N   1 
ATOM   1143 C CA  . ILE B 1 69 ? 1.529  52.537 3.295   1.00 17.84  ? 107 ILE B CA  1 
ATOM   1144 C C   . ILE B 1 69 ? 2.619  51.505 3.221   1.00 15.54  ? 107 ILE B C   1 
ATOM   1145 O O   . ILE B 1 69 ? 2.586  50.592 2.307   1.00 21.62  ? 107 ILE B O   1 
ATOM   1146 C CB  . ILE B 1 69 ? 0.154  51.948 3.686   1.00 19.16  ? 107 ILE B CB  1 
ATOM   1147 C CG1 . ILE B 1 69 ? -0.963 52.992 3.764   1.00 19.35  ? 107 ILE B CG1 1 
ATOM   1148 C CG2 . ILE B 1 69 ? 0.218  51.170 4.953   1.00 18.69  ? 107 ILE B CG2 1 
ATOM   1149 C CD1 . ILE B 1 69 ? -0.676 54.160 4.717   1.00 19.51  ? 107 ILE B CD1 1 
ATOM   1150 N N   . ARG B 1 70 ? 3.543  51.552 4.145   1.00 14.92  ? 108 ARG B N   1 
ATOM   1151 C CA  . ARG B 1 70 ? 4.599  50.556 4.223   1.00 15.51  ? 108 ARG B CA  1 
ATOM   1152 C C   . ARG B 1 70 ? 4.480  49.766 5.493   1.00 12.42  ? 108 ARG B C   1 
ATOM   1153 O O   . ARG B 1 70 ? 4.068  50.343 6.549   1.00 14.31  ? 108 ARG B O   1 
ATOM   1154 C CB  . ARG B 1 70 ? 5.925  51.251 4.193   1.00 20.84  ? 108 ARG B CB  1 
ATOM   1155 C CG  . ARG B 1 70 ? 5.978  52.125 2.957   1.00 27.87  ? 108 ARG B CG  1 
ATOM   1156 C CD  . ARG B 1 70 ? 5.706  51.404 1.551   1.00 27.38  ? 108 ARG B CD  1 
ATOM   1157 N NE  . ARG B 1 70 ? 5.919  52.230 0.363   1.00 26.56  ? 108 ARG B NE  1 
ATOM   1158 C CZ  . ARG B 1 70 ? 7.058  52.439 -0.252  1.00 32.46  ? 108 ARG B CZ  1 
ATOM   1159 N NH1 . ARG B 1 70 ? 8.199  51.935 0.277   1.00 40.32  ? 108 ARG B NH1 1 
ATOM   1160 N NH2 . ARG B 1 70 ? 7.083  53.261 -1.273  1.00 41.56  ? 108 ARG B NH2 1 
ATOM   1161 N N   . ILE B 1 71 ? 4.804  48.517 5.419   1.00 11.76  ? 109 ILE B N   1 
ATOM   1162 C CA  . ILE B 1 71 ? 4.832  47.662 6.616   1.00 11.77  ? 109 ILE B CA  1 
ATOM   1163 C C   . ILE B 1 71 ? 6.270  47.418 6.968   1.00 12.91  ? 109 ILE B C   1 
ATOM   1164 O O   . ILE B 1 71 ? 7.068  46.972 6.126   1.00 14.38  ? 109 ILE B O   1 
ATOM   1165 C CB  . ILE B 1 71 ? 4.064  46.340 6.408   1.00 13.00  ? 109 ILE B CB  1 
ATOM   1166 C CG1 . ILE B 1 71 ? 2.711  46.491 5.689   1.00 13.72  ? 109 ILE B CG1 1 
ATOM   1167 C CG2 . ILE B 1 71 ? 4.017  45.556 7.715   1.00 15.52  ? 109 ILE B CG2 1 
ATOM   1168 C CD1 . ILE B 1 71 ? 1.728  47.347 6.376   1.00 13.76  ? 109 ILE B CD1 1 
ATOM   1169 N N   . ASN B 1 72 ? 6.609  47.760 8.188   1.00 13.44  ? 110 ASN B N   1 
ATOM   1170 C CA  . ASN B 1 72 ? 7.984  47.617 8.667   1.00 14.00  ? 110 ASN B CA  1 
ATOM   1171 C C   . ASN B 1 72 ? 8.192  46.208 9.188   1.00 15.30  ? 110 ASN B C   1 
ATOM   1172 O O   . ASN B 1 72 ? 7.287  45.508 9.597   1.00 17.44  ? 110 ASN B O   1 
ATOM   1173 C CB  . ASN B 1 72 ? 8.153  48.674 9.766   1.00 13.76  ? 110 ASN B CB  1 
ATOM   1174 C CG  . ASN B 1 72 ? 8.005  50.056 9.243   1.00 14.54  ? 110 ASN B CG  1 
ATOM   1175 O OD1 . ASN B 1 72 ? 8.565  50.377 8.225   1.00 17.82  ? 110 ASN B OD1 1 
ATOM   1176 N ND2 . ASN B 1 72 ? 7.235  50.882 9.930   1.00 14.91  ? 110 ASN B ND2 1 
ATOM   1177 N N   . PRO B 1 73 ? 9.505  45.800 9.328   1.00 16.34  ? 111 PRO B N   1 
ATOM   1178 C CA  . PRO B 1 73 ? 9.773  44.453 9.752   1.00 19.64  ? 111 PRO B CA  1 
ATOM   1179 C C   . PRO B 1 73 ? 9.547  44.173 11.201  1.00 22.22  ? 111 PRO B C   1 
ATOM   1180 O O   . PRO B 1 73 ? 9.507  43.012 11.540  1.00 25.95  ? 111 PRO B O   1 
ATOM   1181 C CB  . PRO B 1 73 ? 11.220 44.235 9.379   1.00 22.06  ? 111 PRO B CB  1 
ATOM   1182 C CG  . PRO B 1 73 ? 11.809 45.614 9.374   1.00 17.03  ? 111 PRO B CG  1 
ATOM   1183 C CD  . PRO B 1 73 ? 10.707 46.471 8.858   1.00 15.14  ? 111 PRO B CD  1 
ATOM   1184 N N   . ASN B 1 74 ? 9.374  45.190 12.031  1.00 17.36  ? 112 ASN B N   1 
ATOM   1185 C CA  . ASN B 1 74 ? 8.967  45.004 13.428  1.00 22.31  ? 112 ASN B CA  1 
ATOM   1186 C C   . ASN B 1 74 ? 7.456  44.935 13.595  1.00 20.72  ? 112 ASN B C   1 
ATOM   1187 O O   . ASN B 1 74 ? 6.961  44.886 14.705  1.00 26.69  ? 112 ASN B O   1 
ATOM   1188 C CB  . ASN B 1 74 ? 9.589  46.144 14.208  1.00 22.12  ? 112 ASN B CB  1 
ATOM   1189 C CG  . ASN B 1 74 ? 8.940  47.461 13.987  1.00 18.69  ? 112 ASN B CG  1 
ATOM   1190 O OD1 . ASN B 1 74 ? 8.290  47.703 12.992  1.00 16.85  ? 112 ASN B OD1 1 
ATOM   1191 N ND2 . ASN B 1 74 ? 9.122  48.358 14.907  1.00 22.08  ? 112 ASN B ND2 1 
ATOM   1192 N N   . GLY B 1 75 ? 6.722  44.908 12.472  1.00 20.79  ? 113 GLY B N   1 
ATOM   1193 C CA  . GLY B 1 75 ? 5.316  44.810 12.461  1.00 21.84  ? 113 GLY B CA  1 
ATOM   1194 C C   . GLY B 1 75 ? 4.510  46.035 12.562  1.00 17.26  ? 113 GLY B C   1 
ATOM   1195 O O   . GLY B 1 75 ? 3.278  45.942 12.623  1.00 21.32  ? 113 GLY B O   1 
ATOM   1196 N N   . THR B 1 76 ? 5.146  47.198 12.554  1.00 15.21  ? 114 THR B N   1 
ATOM   1197 C CA  . THR B 1 76 ? 4.510  48.482 12.525  1.00 14.16  ? 114 THR B CA  1 
ATOM   1198 C C   . THR B 1 76 ? 4.188  48.913 11.107  1.00 12.81  ? 114 THR B C   1 
ATOM   1199 O O   . THR B 1 76 ? 4.767  48.395 10.167  1.00 15.37  ? 114 THR B O   1 
ATOM   1200 C CB  . THR B 1 76 ? 5.300  49.570 13.292  1.00 16.04  ? 114 THR B CB  1 
ATOM   1201 O OG1 . THR B 1 76 ? 6.495  49.809 12.572  1.00 15.87  ? 114 THR B OG1 1 
ATOM   1202 C CG2 . THR B 1 76 ? 5.559  49.137 14.715  1.00 19.03  ? 114 THR B CG2 1 
ATOM   1203 N N   . TRP B 1 77 ? 3.326  49.896 10.922  1.00 12.16  ? 115 TRP B N   1 
ATOM   1204 C CA  . TRP B 1 77 ? 3.055  50.476 9.630   1.00 12.14  ? 115 TRP B CA  1 
ATOM   1205 C C   . TRP B 1 77 ? 3.366  51.965 9.691   1.00 13.31  ? 115 TRP B C   1 
ATOM   1206 O O   . TRP B 1 77 ? 3.168  52.634 10.686  1.00 15.41  ? 115 TRP B O   1 
ATOM   1207 C CB  . TRP B 1 77 ? 1.616  50.177 9.147   1.00 11.40  ? 115 TRP B CB  1 
ATOM   1208 C CG  . TRP B 1 77 ? 0.548  50.875 9.917   1.00 11.70  ? 115 TRP B CG  1 
ATOM   1209 C CD1 . TRP B 1 77 ? -0.208 50.371 10.977  1.00 11.22  ? 115 TRP B CD1 1 
ATOM   1210 C CD2 . TRP B 1 77 ? 0.032  52.173 9.677   1.00 11.81  ? 115 TRP B CD2 1 
ATOM   1211 N NE1 . TRP B 1 77 ? -1.113 51.290 11.352  1.00 12.45  ? 115 TRP B NE1 1 
ATOM   1212 C CE2 . TRP B 1 77 ? -0.993 52.414 10.620  1.00 12.40  ? 115 TRP B CE2 1 
ATOM   1213 C CE3 . TRP B 1 77 ? 0.353  53.167 8.782   1.00 13.21  ? 115 TRP B CE3 1 
ATOM   1214 C CZ2 . TRP B 1 77 ? -1.650 53.591 10.668  1.00 12.78  ? 115 TRP B CZ2 1 
ATOM   1215 C CZ3 . TRP B 1 77 ? -0.322 54.368 8.811   1.00 14.22  ? 115 TRP B CZ3 1 
ATOM   1216 C CH2 . TRP B 1 77 ? -1.325 54.564 9.824   1.00 14.94  ? 115 TRP B CH2 1 
ATOM   1217 N N   . SER B 1 78 ? 3.802  52.424 8.499   1.00 13.81  ? 116 SER B N   1 
ATOM   1218 C CA  . SER B 1 78 ? 4.178  53.807 8.269   1.00 16.88  ? 116 SER B CA  1 
ATOM   1219 C C   . SER B 1 78 ? 3.556  54.354 7.018   1.00 15.43  ? 116 SER B C   1 
ATOM   1220 O O   . SER B 1 78 ? 3.359  53.596 6.049   1.00 18.63  ? 116 SER B O   1 
ATOM   1221 C CB  . SER B 1 78 ? 5.697  53.963 8.134   1.00 20.33  ? 116 SER B CB  1 
ATOM   1222 O OG  . SER B 1 78 ? 6.413  53.607 9.256   1.00 21.64  ? 116 SER B OG  1 
ATOM   1223 N N   . ARG B 1 79 ? 3.342  55.684 6.955   1.00 19.75  ? 117 ARG B N   1 
ATOM   1224 C CA  . ARG B 1 79 ? 3.039  56.360 5.677   1.00 22.61  ? 117 ARG B CA  1 
ATOM   1225 C C   . ARG B 1 79 ? 4.356  56.616 4.949   1.00 22.82  ? 117 ARG B C   1 
ATOM   1226 O O   . ARG B 1 79 ? 5.291  57.043 5.567   1.00 32.31  ? 117 ARG B O   1 
ATOM   1227 C CB  . ARG B 1 79 ? 2.353  57.667 5.943   1.00 28.74  ? 117 ARG B CB  1 
ATOM   1228 C CG  . ARG B 1 79 ? 1.011  57.477 6.537   1.00 33.38  ? 117 ARG B CG  1 
ATOM   1229 C CD  . ARG B 1 79 ? 0.253  58.786 6.542   1.00 44.23  ? 117 ARG B CD  1 
ATOM   1230 N NE  . ARG B 1 79 ? -0.771 58.765 7.603   1.00 45.70  ? 117 ARG B NE  1 
ATOM   1231 C CZ  . ARG B 1 79 ? -2.064 58.594 7.384   1.00 35.72  ? 117 ARG B CZ  1 
ATOM   1232 N NH1 . ARG B 1 79 ? -2.559 58.478 6.096   1.00 37.77  ? 117 ARG B NH1 1 
ATOM   1233 N NH2 . ARG B 1 79 ? -2.856 58.593 8.424   1.00 35.69  ? 117 ARG B NH2 1 
ATOM   1234 N N   . GLN B 1 80 ? 4.395  56.400 3.617   1.00 27.42  ? 118 GLN B N   1 
ATOM   1235 C CA  . GLN B 1 80 ? 5.639  56.493 2.789   1.00 38.37  ? 118 GLN B CA  1 
ATOM   1236 C C   . GLN B 1 80 ? 5.129  57.685 2.116   1.00 61.83  ? 118 GLN B C   1 
ATOM   1237 O O   . GLN B 1 80 ? 5.218  58.727 2.811   1.00 68.63  ? 118 GLN B O   1 
ATOM   1238 C CB  . GLN B 1 80 ? 5.733  55.355 1.755   1.00 50.63  ? 118 GLN B CB  1 
HETATM 1239 O O1  . MES C 2 .  ? 23.722 45.175 -0.440  1.00 49.69  ? 201 MES A O1  1 
HETATM 1240 C C2  . MES C 2 .  ? 24.682 44.141 -0.753  1.00 36.10  ? 201 MES A C2  1 
HETATM 1241 C C3  . MES C 2 .  ? 26.188 44.363 -0.954  1.00 58.57  ? 201 MES A C3  1 
HETATM 1242 N N4  . MES C 2 .  ? 26.608 45.700 -0.614  1.00 64.78  ? 201 MES A N4  1 
HETATM 1243 C C5  . MES C 2 .  ? 25.636 46.132 0.366   1.00 46.90  ? 201 MES A C5  1 
HETATM 1244 C C6  . MES C 2 .  ? 24.364 45.681 0.650   1.00 29.02  ? 201 MES A C6  1 
HETATM 1245 C C7  . MES C 2 .  ? 28.063 45.766 -0.191  1.00 59.86  ? 201 MES A C7  1 
HETATM 1246 C C8  . MES C 2 .  ? 28.365 46.859 0.844   1.00 61.41  ? 201 MES A C8  1 
HETATM 1247 S S   . MES C 2 .  ? 29.794 47.720 1.104   1.00 86.75  ? 201 MES A S   1 
HETATM 1248 O O1S . MES C 2 .  ? 29.446 49.148 1.276   1.00 110.32 ? 201 MES A O1S 1 
HETATM 1249 O O2S . MES C 2 .  ? 30.417 47.565 -0.260  1.00 141.59 ? 201 MES A O2S 1 
HETATM 1250 O O3S . MES C 2 .  ? 30.709 47.296 2.212   1.00 99.48  ? 201 MES A O3S 1 
HETATM 1251 O O   . HOH D 3 .  ? 25.873 38.547 22.583  1.00 38.93  ? 301 HOH A O   1 
HETATM 1252 O O   . HOH D 3 .  ? 31.011 45.474 3.262   1.00 30.24  ? 302 HOH A O   1 
HETATM 1253 O O   . HOH D 3 .  ? 21.502 59.027 13.651  1.00 29.50  ? 303 HOH A O   1 
HETATM 1254 O O   . HOH D 3 .  ? 36.873 49.024 8.056   1.00 24.74  ? 304 HOH A O   1 
HETATM 1255 O O   . HOH D 3 .  ? 15.034 37.958 17.513  1.00 40.57  ? 305 HOH A O   1 
HETATM 1256 O O   . HOH D 3 .  ? 18.905 54.374 21.080  1.00 35.30  ? 306 HOH A O   1 
HETATM 1257 O O   . HOH D 3 .  ? 11.808 54.269 12.712  1.00 30.19  ? 307 HOH A O   1 
HETATM 1258 O O   . HOH D 3 .  ? 15.083 53.960 21.460  1.00 41.02  ? 308 HOH A O   1 
HETATM 1259 O O   . HOH D 3 .  ? 11.082 46.322 17.016  1.00 40.34  ? 309 HOH A O   1 
HETATM 1260 O O   . HOH D 3 .  ? 18.283 35.062 13.912  1.00 38.40  ? 310 HOH A O   1 
HETATM 1261 O O   . HOH D 3 .  ? 23.025 53.878 21.700  1.00 46.52  ? 311 HOH A O   1 
HETATM 1262 O O   . HOH D 3 .  ? 23.810 38.644 21.469  1.00 38.16  ? 312 HOH A O   1 
HETATM 1263 O O   . HOH D 3 .  ? 16.785 50.828 5.283   1.00 38.67  ? 313 HOH A O   1 
HETATM 1264 O O   . HOH D 3 .  ? 13.556 51.901 21.778  1.00 27.65  ? 314 HOH A O   1 
HETATM 1265 O O   . HOH D 3 .  ? 13.503 56.084 -1.997  1.00 38.84  ? 315 HOH A O   1 
HETATM 1266 O O   . HOH D 3 .  ? 20.037 58.701 16.305  1.00 31.98  ? 316 HOH A O   1 
HETATM 1267 O O   . HOH D 3 .  ? 16.804 57.387 6.977   1.00 44.60  ? 317 HOH A O   1 
HETATM 1268 O O   . HOH D 3 .  ? 20.014 35.583 5.503   1.00 21.67  ? 318 HOH A O   1 
HETATM 1269 O O   . HOH D 3 .  ? 23.234 57.218 10.215  1.00 14.26  ? 319 HOH A O   1 
HETATM 1270 O O   . HOH D 3 .  ? 18.398 60.309 5.830   1.00 24.60  ? 320 HOH A O   1 
HETATM 1271 O O   . HOH D 3 .  ? 23.871 46.104 21.538  1.00 34.55  ? 321 HOH A O   1 
HETATM 1272 O O   . HOH D 3 .  ? 13.348 41.180 8.752   1.00 43.50  ? 322 HOH A O   1 
HETATM 1273 O O   . HOH D 3 .  ? 18.195 55.009 -5.656  1.00 36.69  ? 323 HOH A O   1 
HETATM 1274 O O   . HOH D 3 .  ? 12.880 48.004 6.617   1.00 22.89  ? 324 HOH A O   1 
HETATM 1275 O O   . HOH D 3 .  ? 31.581 57.489 9.471   1.00 34.50  ? 325 HOH A O   1 
HETATM 1276 O O   . HOH D 3 .  ? 35.571 47.044 8.350   1.00 30.09  ? 326 HOH A O   1 
HETATM 1277 O O   . HOH D 3 .  ? 13.454 67.523 5.140   1.00 37.18  ? 327 HOH A O   1 
HETATM 1278 O O   . HOH D 3 .  ? 11.624 43.193 15.659  1.00 33.66  ? 328 HOH A O   1 
HETATM 1279 O O   . HOH D 3 .  ? 28.809 34.573 7.220   1.00 20.49  ? 329 HOH A O   1 
HETATM 1280 O O   . HOH D 3 .  ? 25.783 47.427 22.565  1.00 29.37  ? 330 HOH A O   1 
HETATM 1281 O O   . HOH D 3 .  ? 21.971 58.503 -6.353  1.00 33.49  ? 331 HOH A O   1 
HETATM 1282 O O   . HOH D 3 .  ? 14.300 49.431 6.229   1.00 38.44  ? 332 HOH A O   1 
HETATM 1283 O O   . HOH D 3 .  ? 19.637 58.362 3.566   1.00 204.61 ? 333 HOH A O   1 
HETATM 1284 O O   . HOH D 3 .  ? 21.824 35.053 12.471  1.00 44.65  ? 334 HOH A O   1 
HETATM 1285 O O   . HOH D 3 .  ? 15.536 55.998 14.016  1.00 28.28  ? 335 HOH A O   1 
HETATM 1286 O O   . HOH D 3 .  ? 11.249 66.453 -4.405  1.00 34.93  ? 336 HOH A O   1 
HETATM 1287 O O   . HOH D 3 .  ? 25.162 40.350 4.131   1.00 14.63  ? 337 HOH A O   1 
HETATM 1288 O O   . HOH D 3 .  ? 24.185 43.013 21.763  1.00 37.60  ? 338 HOH A O   1 
HETATM 1289 O O   . HOH D 3 .  ? 35.932 54.039 14.153  1.00 38.08  ? 339 HOH A O   1 
HETATM 1290 O O   . HOH D 3 .  ? 37.369 49.000 10.364  1.00 28.42  ? 340 HOH A O   1 
HETATM 1291 O O   . HOH D 3 .  ? 19.174 54.634 4.009   1.00 29.69  ? 341 HOH A O   1 
HETATM 1292 O O   . HOH D 3 .  ? 24.581 29.059 3.251   1.00 39.59  ? 342 HOH A O   1 
HETATM 1293 O O   . HOH D 3 .  ? 11.769 46.105 21.996  1.00 41.21  ? 343 HOH A O   1 
HETATM 1294 O O   . HOH D 3 .  ? 32.169 40.067 17.908  1.00 24.12  ? 344 HOH A O   1 
HETATM 1295 O O   . HOH D 3 .  ? 12.933 49.272 24.045  1.00 198.69 ? 345 HOH A O   1 
HETATM 1296 O O   . HOH D 3 .  ? 31.296 52.193 16.998  1.00 36.74  ? 346 HOH A O   1 
HETATM 1297 O O   . HOH D 3 .  ? 18.940 38.784 23.335  1.00 23.55  ? 347 HOH A O   1 
HETATM 1298 O O   . HOH D 3 .  ? 28.404 30.424 0.885   1.00 39.61  ? 348 HOH A O   1 
HETATM 1299 O O   . HOH D 3 .  ? 17.396 36.750 7.073   1.00 30.34  ? 349 HOH A O   1 
HETATM 1300 O O   . HOH D 3 .  ? 13.207 68.215 -2.841  1.00 27.76  ? 350 HOH A O   1 
HETATM 1301 O O   . HOH D 3 .  ? 16.571 57.247 1.065   1.00 28.00  ? 351 HOH A O   1 
HETATM 1302 O O   . HOH D 3 .  ? 23.973 55.534 19.745  1.00 30.84  ? 352 HOH A O   1 
HETATM 1303 O O   . HOH D 3 .  ? 10.820 49.370 17.551  1.00 31.20  ? 353 HOH A O   1 
HETATM 1304 O O   . HOH D 3 .  ? 27.891 51.135 4.540   1.00 26.53  ? 354 HOH A O   1 
HETATM 1305 O O   . HOH D 3 .  ? 28.708 53.067 17.094  1.00 38.66  ? 355 HOH A O   1 
HETATM 1306 O O   . HOH D 3 .  ? 27.372 30.362 -2.056  1.00 48.28  ? 356 HOH A O   1 
HETATM 1307 O O   . HOH D 3 .  ? 23.166 51.550 0.549   1.00 18.13  ? 357 HOH A O   1 
HETATM 1308 O O   . HOH D 3 .  ? 12.357 58.081 -8.796  1.00 24.14  ? 358 HOH A O   1 
HETATM 1309 O O   . HOH D 3 .  ? 17.631 63.609 9.082   1.00 28.79  ? 359 HOH A O   1 
HETATM 1310 O O   . HOH D 3 .  ? 18.980 73.949 -1.529  1.00 49.06  ? 360 HOH A O   1 
HETATM 1311 O O   . HOH D 3 .  ? 20.967 53.295 1.482   1.00 28.37  ? 361 HOH A O   1 
HETATM 1312 O O   . HOH D 3 .  ? 20.700 62.738 9.644   1.00 13.74  ? 362 HOH A O   1 
HETATM 1313 O O   . HOH D 3 .  ? 18.337 35.322 23.114  1.00 44.57  ? 363 HOH A O   1 
HETATM 1314 O O   . HOH D 3 .  ? 26.913 40.822 20.346  1.00 47.32  ? 364 HOH A O   1 
HETATM 1315 O O   . HOH D 3 .  ? 24.012 33.903 16.844  1.00 32.38  ? 365 HOH A O   1 
HETATM 1316 O O   . HOH D 3 .  ? 17.663 53.831 -11.647 1.00 39.09  ? 366 HOH A O   1 
HETATM 1317 O O   . HOH D 3 .  ? 31.957 43.035 23.900  1.00 38.53  ? 367 HOH A O   1 
HETATM 1318 O O   . HOH D 3 .  ? 21.788 30.853 -0.275  1.00 50.48  ? 368 HOH A O   1 
HETATM 1319 O O   . HOH D 3 .  ? 23.860 28.699 -2.196  1.00 48.56  ? 369 HOH A O   1 
HETATM 1320 O O   . HOH D 3 .  ? 26.251 48.188 -3.352  1.00 35.59  ? 370 HOH A O   1 
HETATM 1321 O O   . HOH D 3 .  ? 21.204 55.728 -0.439  1.00 22.83  ? 371 HOH A O   1 
HETATM 1322 O O   . HOH D 3 .  ? 14.924 39.628 11.470  1.00 48.55  ? 372 HOH A O   1 
HETATM 1323 O O   . HOH D 3 .  ? 34.758 35.269 2.257   1.00 41.90  ? 373 HOH A O   1 
HETATM 1324 O O   . HOH D 3 .  ? 19.442 56.661 1.695   1.00 56.35  ? 374 HOH A O   1 
HETATM 1325 O O   . HOH D 3 .  ? 32.653 54.611 2.673   1.00 48.04  ? 375 HOH A O   1 
HETATM 1326 O O   . HOH E 3 .  ? 14.848 32.747 5.419   1.00 36.23  ? 201 HOH B O   1 
HETATM 1327 O O   . HOH E 3 .  ? 18.263 38.193 4.428   1.00 20.26  ? 202 HOH B O   1 
HETATM 1328 O O   . HOH E 3 .  ? 20.153 31.774 6.703   1.00 59.21  ? 203 HOH B O   1 
HETATM 1329 O O   . HOH E 3 .  ? 22.022 30.362 -5.854  1.00 34.41  ? 204 HOH B O   1 
HETATM 1330 O O   . HOH E 3 .  ? 14.648 38.281 7.127   1.00 33.92  ? 205 HOH B O   1 
HETATM 1331 O O   . HOH E 3 .  ? 17.294 52.177 1.536   1.00 39.71  ? 206 HOH B O   1 
HETATM 1332 O O   . HOH E 3 .  ? 17.930 52.980 -7.584  1.00 24.13  ? 207 HOH B O   1 
HETATM 1333 O O   . HOH E 3 .  ? 8.245  49.522 1.360   1.00 24.14  ? 208 HOH B O   1 
HETATM 1334 O O   . HOH E 3 .  ? 20.304 52.040 -7.673  1.00 35.92  ? 209 HOH B O   1 
HETATM 1335 O O   . HOH E 3 .  ? 1.734  50.305 -0.188  1.00 25.41  ? 210 HOH B O   1 
HETATM 1336 O O   . HOH E 3 .  ? 9.072  45.297 5.653   1.00 17.47  ? 211 HOH B O   1 
HETATM 1337 O O   . HOH E 3 .  ? 13.391 39.627 6.698   1.00 39.60  ? 212 HOH B O   1 
HETATM 1338 O O   . HOH E 3 .  ? 13.305 41.839 -17.475 1.00 20.98  ? 213 HOH B O   1 
HETATM 1339 O O   . HOH E 3 .  ? 15.182 26.060 -0.447  1.00 22.91  ? 214 HOH B O   1 
HETATM 1340 O O   . HOH E 3 .  ? 12.153 41.754 4.994   1.00 24.76  ? 215 HOH B O   1 
HETATM 1341 O O   . HOH E 3 .  ? 11.943 45.236 5.685   1.00 17.90  ? 216 HOH B O   1 
HETATM 1342 O O   . HOH E 3 .  ? 3.056  32.702 -4.184  1.00 35.11  ? 217 HOH B O   1 
HETATM 1343 O O   . HOH E 3 .  ? 9.372  44.210 -10.960 1.00 51.22  ? 218 HOH B O   1 
HETATM 1344 O O   . HOH E 3 .  ? 13.894 51.633 -1.142  1.00 26.81  ? 219 HOH B O   1 
HETATM 1345 O O   . HOH E 3 .  ? 10.408 49.231 6.443   1.00 34.71  ? 220 HOH B O   1 
HETATM 1346 O O   . HOH E 3 .  ? 19.406 38.032 -4.935  1.00 22.88  ? 221 HOH B O   1 
HETATM 1347 O O   . HOH E 3 .  ? 1.337  44.296 13.854  1.00 22.94  ? 222 HOH B O   1 
HETATM 1348 O O   . HOH E 3 .  ? 13.603 31.781 3.899   1.00 24.96  ? 223 HOH B O   1 
HETATM 1349 O O   . HOH E 3 .  ? 16.656 33.473 -11.738 1.00 33.22  ? 224 HOH B O   1 
HETATM 1350 O O   . HOH E 3 .  ? 15.891 38.674 9.260   1.00 44.54  ? 225 HOH B O   1 
HETATM 1351 O O   . HOH E 3 .  ? 14.941 50.821 -9.100  1.00 31.59  ? 226 HOH B O   1 
HETATM 1352 O O   . HOH E 3 .  ? 8.721  51.073 15.784  1.00 32.74  ? 227 HOH B O   1 
HETATM 1353 O O   . HOH E 3 .  ? 10.430 48.227 -10.377 1.00 36.82  ? 228 HOH B O   1 
HETATM 1354 O O   . HOH E 3 .  ? 7.891  42.552 -9.914  1.00 41.78  ? 229 HOH B O   1 
HETATM 1355 O O   . HOH E 3 .  ? 6.378  42.776 9.189   1.00 44.41  ? 230 HOH B O   1 
HETATM 1356 O O   . HOH E 3 .  ? 26.042 43.724 -3.943  1.00 26.73  ? 231 HOH B O   1 
HETATM 1357 O O   . HOH E 3 .  ? 10.404 53.682 -3.590  1.00 44.76  ? 232 HOH B O   1 
HETATM 1358 O O   . HOH E 3 .  ? 3.754  56.948 9.581   1.00 31.00  ? 233 HOH B O   1 
HETATM 1359 O O   . HOH E 3 .  ? 11.318 33.553 -14.715 1.00 32.41  ? 234 HOH B O   1 
HETATM 1360 O O   . HOH E 3 .  ? 21.244 31.999 -12.661 1.00 41.60  ? 235 HOH B O   1 
HETATM 1361 O O   . HOH E 3 .  ? 21.957 50.829 -2.232  1.00 25.28  ? 236 HOH B O   1 
HETATM 1362 O O   . HOH E 3 .  ? 23.940 48.598 -1.780  1.00 46.37  ? 237 HOH B O   1 
HETATM 1363 O O   . HOH E 3 .  ? 8.225  51.622 14.248  1.00 31.21  ? 238 HOH B O   1 
HETATM 1364 O O   . HOH E 3 .  ? 11.060 35.143 6.587   1.00 57.43  ? 239 HOH B O   1 
HETATM 1365 O O   . HOH E 3 .  ? 1.622  47.915 -2.006  1.00 31.70  ? 240 HOH B O   1 
HETATM 1366 O O   . HOH E 3 .  ? -5.838 58.727 9.244   1.00 44.74  ? 241 HOH B O   1 
HETATM 1367 O O   . HOH E 3 .  ? 11.309 45.833 -10.928 1.00 54.24  ? 242 HOH B O   1 
HETATM 1368 O O   . HOH E 3 .  ? 13.112 34.135 6.029   1.00 36.12  ? 243 HOH B O   1 
HETATM 1369 O O   . HOH E 3 .  ? 13.323 30.307 -11.656 1.00 30.71  ? 244 HOH B O   1 
HETATM 1370 O O   . HOH E 3 .  ? 14.140 55.678 0.790   1.00 52.58  ? 245 HOH B O   1 
HETATM 1371 O O   . HOH E 3 .  ? 4.216  35.646 -0.266  1.00 47.46  ? 246 HOH B O   1 
HETATM 1372 O O   . HOH E 3 .  ? 10.612 41.357 6.771   1.00 45.57  ? 247 HOH B O   1 
HETATM 1373 O O   . HOH E 3 .  ? 13.298 53.649 -2.967  1.00 36.54  ? 248 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ALA A 4  ? 0.6535 0.7543 0.2997 -0.3505 -0.1750 0.1019  42  ALA A N   
2    C CA  . ALA A 4  ? 0.3946 0.6397 0.7006 -0.1807 -0.2057 -0.0210 42  ALA A CA  
3    C C   . ALA A 4  ? 0.4755 0.7461 0.2788 -0.2837 -0.1007 0.1881  42  ALA A C   
4    O O   . ALA A 4  ? 0.7018 1.2050 0.3770 -0.5330 -0.1044 0.3097  42  ALA A O   
5    C CB  . ALA A 4  ? 0.4804 0.5942 0.5577 -0.2307 -0.1767 -0.0450 42  ALA A CB  
6    N N   . ASN A 5  ? 0.2545 0.3510 0.2928 -0.0154 -0.0361 0.0770  43  ASN A N   
7    C CA  . ASN A 5  ? 0.2601 0.3655 0.1512 0.0089  0.0093  0.0753  43  ASN A CA  
8    C C   . ASN A 5  ? 0.2493 0.2716 0.1123 -0.0418 0.0092  0.0464  43  ASN A C   
9    O O   . ASN A 5  ? 0.2656 0.3008 0.1140 -0.0004 -0.0268 0.0659  43  ASN A O   
10   C CB  . ASN A 5  ? 0.2680 0.3299 0.2745 0.0069  0.0225  0.0729  43  ASN A CB  
11   C CG  . ASN A 5  ? 0.2660 0.4055 0.2293 0.0210  -0.0173 0.0348  43  ASN A CG  
12   O OD1 . ASN A 5  ? 0.4276 0.3517 0.4302 0.0787  -0.0136 -0.0229 43  ASN A OD1 
13   N ND2 . ASN A 5  ? 0.2877 0.3777 0.2794 0.0079  -0.0484 0.0118  43  ASN A ND2 
14   N N   . PRO A 6  ? 0.2428 0.3054 0.0989 -0.0406 0.0238  0.0360  44  PRO A N   
15   C CA  . PRO A 6  ? 0.2441 0.2658 0.0844 -0.0359 -0.0008 0.0621  44  PRO A CA  
16   C C   . PRO A 6  ? 0.2447 0.2161 0.0316 0.0056  -0.0171 0.0302  44  PRO A C   
17   O O   . PRO A 6  ? 0.2772 0.2160 0.0926 0.0186  0.0394  0.0384  44  PRO A O   
18   C CB  . PRO A 6  ? 0.2816 0.4020 0.0448 -0.0381 0.0340  0.0179  44  PRO A CB  
19   C CG  . PRO A 6  ? 0.3543 0.5146 0.0782 -0.0475 0.0151  -0.1005 44  PRO A CG  
20   C CD  . PRO A 6  ? 0.3403 0.4196 0.1512 -0.0582 0.0150  -0.0355 44  PRO A CD  
21   N N   . VAL A 7  ? 0.2275 0.1897 0.0408 -0.0325 0.0035  0.0490  45  VAL A N   
22   C CA  . VAL A 7  ? 0.2162 0.1888 0.0363 -0.0439 0.0120  0.0368  45  VAL A CA  
23   C C   . VAL A 7  ? 0.1787 0.1914 0.0306 -0.0234 -0.0142 0.0278  45  VAL A C   
24   O O   . VAL A 7  ? 0.2441 0.2020 0.0455 -0.0175 -0.0001 0.0446  45  VAL A O   
25   C CB  . VAL A 7  ? 0.2524 0.2012 0.0578 -0.0274 -0.0169 0.0201  45  VAL A CB  
26   C CG1 . VAL A 7  ? 0.2872 0.2358 0.0706 -0.0305 -0.0181 -0.0031 45  VAL A CG1 
27   C CG2 . VAL A 7  ? 0.2789 0.2730 0.0865 -0.0273 -0.0388 0.0129  45  VAL A CG2 
28   N N   . TRP A 8  ? 0.1839 0.1712 0.0289 -0.0194 -0.0049 0.0228  46  TRP A N   
29   C CA  . TRP A 8  ? 0.1911 0.1779 0.0435 -0.0102 0.0164  0.0492  46  TRP A CA  
30   C C   . TRP A 8  ? 0.1903 0.1900 0.0319 -0.0150 0.0052  0.0319  46  TRP A C   
31   O O   . TRP A 8  ? 0.2280 0.2993 0.0312 0.0218  -0.0094 0.0375  46  TRP A O   
32   C CB  . TRP A 8  ? 0.1906 0.2046 0.0333 -0.0237 -0.0009 0.0377  46  TRP A CB  
33   C CG  . TRP A 8  ? 0.2049 0.2346 0.0255 -0.0354 -0.0029 0.0071  46  TRP A CG  
34   C CD1 . TRP A 8  ? 0.2183 0.3065 0.0289 -0.0508 0.0198  0.0151  46  TRP A CD1 
35   C CD2 . TRP A 8  ? 0.1970 0.2066 0.0254 -0.0090 0.0038  0.0033  46  TRP A CD2 
36   N NE1 . TRP A 8  ? 0.2343 0.3369 0.0328 -0.0627 0.0396  -0.0119 46  TRP A NE1 
37   C CE2 . TRP A 8  ? 0.1999 0.2498 0.0370 -0.0177 0.0302  -0.0006 46  TRP A CE2 
38   C CE3 . TRP A 8  ? 0.1926 0.2040 0.0298 -0.0055 0.0022  0.0281  46  TRP A CE3 
39   C CZ2 . TRP A 8  ? 0.2542 0.2685 0.0316 -0.0307 0.0378  -0.0010 46  TRP A CZ2 
40   C CZ3 . TRP A 8  ? 0.2246 0.2144 0.0379 -0.0066 -0.0269 0.0052  46  TRP A CZ3 
41   C CH2 . TRP A 8  ? 0.2649 0.2345 0.0284 -0.0154 0.0188  -0.0086 46  TRP A CH2 
42   N N   . THR A 9  ? 0.1897 0.1945 0.0283 -0.0093 0.0035  0.0220  47  THR A N   
43   C CA  . THR A 9  ? 0.2081 0.2230 0.0276 -0.0061 0.0122  -0.0178 47  THR A CA  
44   C C   . THR A 9  ? 0.1973 0.2046 0.0255 -0.0318 0.0050  0.0023  47  THR A C   
45   O O   . THR A 9  ? 0.2225 0.2009 0.0266 -0.0279 -0.0105 0.0128  47  THR A O   
46   C CB  . THR A 9  ? 0.2540 0.2118 0.0826 -0.0068 0.0143  -0.0177 47  THR A CB  
47   O OG1 . THR A 9  ? 0.2989 0.2176 0.1253 -0.0300 0.0370  0.0052  47  THR A OG1 
48   C CG2 . THR A 9  ? 0.3335 0.2269 0.1345 -0.0183 0.0566  -0.0147 47  THR A CG2 
49   N N   . ALA A 10 ? 0.2052 0.1884 0.0263 -0.0197 0.0075  0.0099  48  ALA A N   
50   C CA  . ALA A 10 ? 0.2065 0.1734 0.0262 -0.0077 0.0067  0.0092  48  ALA A CA  
51   C C   . ALA A 10 ? 0.2144 0.1566 0.0263 -0.0335 0.0052  0.0098  48  ALA A C   
52   O O   . ALA A 10 ? 0.2434 0.1812 0.0259 -0.0056 -0.0021 -0.0095 48  ALA A O   
53   C CB  . ALA A 10 ? 0.1878 0.2002 0.0287 -0.0160 0.0042  0.0236  48  ALA A CB  
54   N N   . LEU A 11 ? 0.1916 0.1821 0.0315 -0.0134 -0.0043 0.0017  49  LEU A N   
55   C CA  . LEU A 11 ? 0.2144 0.2358 0.0274 -0.0070 -0.0167 0.0122  49  LEU A CA  
56   C C   . LEU A 11 ? 0.1951 0.2139 0.0262 0.0039  0.0048  -0.0119 49  LEU A C   
57   O O   . LEU A 11 ? 0.2298 0.2499 0.0538 0.0282  -0.0006 -0.0030 49  LEU A O   
58   C CB  . LEU A 11 ? 0.2054 0.2357 0.0299 -0.0102 -0.0253 0.0162  49  LEU A CB  
59   C CG  . LEU A 11 ? 0.2624 0.2935 0.0445 -0.0004 -0.0064 0.0606  49  LEU A CG  
60   C CD1 . LEU A 11 ? 0.2952 0.3931 0.0393 -0.0669 -0.0355 0.0443  49  LEU A CD1 
61   C CD2 . LEU A 11 ? 0.2901 0.3132 0.1687 -0.0296 0.0373  0.1274  49  LEU A CD2 
62   N N   . PHE A 12 ? 0.1827 0.2158 0.0267 0.0032  0.0039  0.0160  50  PHE A N   
63   C CA  . PHE A 12 ? 0.2023 0.2590 0.0256 0.0009  0.0025  0.0086  50  PHE A CA  
64   C C   . PHE A 12 ? 0.1871 0.2358 0.0265 -0.0187 0.0115  -0.0104 50  PHE A C   
65   O O   . PHE A 12 ? 0.2086 0.2463 0.0333 -0.0230 0.0084  0.0396  50  PHE A O   
66   C CB  . PHE A 12 ? 0.1922 0.2690 0.0286 -0.0127 -0.0085 0.0190  50  PHE A CB  
67   C CG  . PHE A 12 ? 0.1830 0.2542 0.0253 -0.0076 -0.0023 -0.0012 50  PHE A CG  
68   C CD1 . PHE A 12 ? 0.2157 0.2899 0.0415 -0.0120 -0.0023 -0.0058 50  PHE A CD1 
69   C CD2 . PHE A 12 ? 0.2144 0.2703 0.0278 0.0082  0.0126  0.0031  50  PHE A CD2 
70   C CE1 . PHE A 12 ? 0.2102 0.2829 0.0568 0.0033  -0.0046 0.0048  50  PHE A CE1 
71   C CE2 . PHE A 12 ? 0.2417 0.2835 0.0287 -0.0069 0.0215  0.0173  50  PHE A CE2 
72   C CZ  . PHE A 12 ? 0.2267 0.2966 0.0275 -0.0201 -0.0211 0.0029  50  PHE A CZ  
73   N N   . ASP A 13 ? 0.1997 0.2595 0.0279 0.0072  0.0175  0.0148  51  ASP A N   
74   C CA  . ASP A 13 ? 0.2012 0.2251 0.0303 -0.0095 0.0191  0.0232  51  ASP A CA  
75   C C   . ASP A 13 ? 0.2601 0.2044 0.0265 -0.0193 0.0154  0.0039  51  ASP A C   
76   O O   . ASP A 13 ? 0.2795 0.2767 0.0380 -0.0128 -0.0342 -0.0005 51  ASP A O   
77   C CB  . ASP A 13 ? 0.2317 0.2632 0.0281 -0.0282 0.0190  0.0133  51  ASP A CB  
78   C CG  . ASP A 13 ? 0.2551 0.3020 0.0325 -0.0262 0.0256  0.0317  51  ASP A CG  
79   O OD1 . ASP A 13 ? 0.2665 0.3044 0.0356 -0.0113 0.0260  -0.0100 51  ASP A OD1 
80   O OD2 . ASP A 13 ? 0.3100 0.3807 0.0653 -0.0588 0.0558  -0.0077 51  ASP A OD2 
81   N N   . TYR A 14 ? 0.2197 0.2009 0.0275 -0.0047 0.0006  0.0195  52  TYR A N   
82   C CA  . TYR A 14 ? 0.2260 0.2080 0.0307 -0.0161 0.0100  0.0291  52  TYR A CA  
83   C C   . TYR A 14 ? 0.2121 0.1837 0.0283 -0.0339 0.0100  0.0176  52  TYR A C   
84   O O   . TYR A 14 ? 0.2198 0.2192 0.0290 -0.0441 0.0057  0.0240  52  TYR A O   
85   C CB  . TYR A 14 ? 0.2354 0.2509 0.0370 -0.0045 0.0118  0.0496  52  TYR A CB  
86   C CG  . TYR A 14 ? 0.2229 0.2527 0.0297 -0.0162 0.0115  0.0280  52  TYR A CG  
87   C CD1 . TYR A 14 ? 0.3176 0.2490 0.0425 -0.0271 0.0508  0.0214  52  TYR A CD1 
88   C CD2 . TYR A 14 ? 0.2966 0.2622 0.0339 0.0038  0.0482  0.0049  52  TYR A CD2 
89   C CE1 . TYR A 14 ? 0.3862 0.2704 0.0874 -0.0076 0.0495  0.0051  52  TYR A CE1 
90   C CE2 . TYR A 14 ? 0.2916 0.3101 0.0368 0.0284  0.0536  0.0201  52  TYR A CE2 
91   C CZ  . TYR A 14 ? 0.4093 0.2807 0.0460 0.0245  0.0886  0.0136  52  TYR A CZ  
92   O OH  . TYR A 14 ? 0.3991 0.3079 0.1287 -0.0002 0.0463  -0.0323 52  TYR A OH  
93   N N   . GLU A 15 ? 0.2374 0.1967 0.0253 -0.0423 -0.0027 0.0024  53  GLU A N   
94   C CA  . GLU A 15 ? 0.2206 0.2455 0.0313 -0.0361 -0.0144 0.0350  53  GLU A CA  
95   C C   . GLU A 15 ? 0.2561 0.2108 0.0390 -0.0433 0.0339  0.0329  53  GLU A C   
96   O O   . GLU A 15 ? 0.2991 0.2692 0.0541 -0.0439 -0.0002 -0.0112 53  GLU A O   
97   C CB  . GLU A 15 ? 0.2297 0.2241 0.0315 -0.0462 0.0155  0.0272  53  GLU A CB  
98   C CG  . GLU A 15 ? 0.2546 0.1867 0.0306 -0.0389 0.0186  0.0209  53  GLU A CG  
99   C CD  . GLU A 15 ? 0.2467 0.2046 0.0254 -0.0262 0.0000  0.0035  53  GLU A CD  
100  O OE1 . GLU A 15 ? 0.2945 0.2149 0.0255 -0.0330 -0.0047 0.0045  53  GLU A OE1 
101  O OE2 . GLU A 15 ? 0.2675 0.2568 0.0308 -0.0028 0.0064  0.0350  53  GLU A OE2 
102  N N   . PRO A 16 ? 0.2454 0.2202 0.0309 -0.0067 0.0243  0.0232  54  PRO A N   
103  C CA  . PRO A 16 ? 0.2850 0.2385 0.0730 -0.0226 0.0304  0.0026  54  PRO A CA  
104  C C   . PRO A 16 ? 0.3084 0.2829 0.0302 0.0369  0.0356  -0.0041 54  PRO A C   
105  O O   . PRO A 16 ? 0.3540 0.3021 0.0501 -0.0092 0.0589  0.0264  54  PRO A O   
106  C CB  . PRO A 16 ? 0.2664 0.3077 0.0921 -0.0189 0.0677  0.0365  54  PRO A CB  
107  C CG  . PRO A 16 ? 0.3040 0.2742 0.1907 0.0284  -0.0116 0.0351  54  PRO A CG  
108  C CD  . PRO A 16 ? 0.2998 0.2131 0.0730 -0.0103 -0.0152 0.0089  54  PRO A CD  
109  N N   . SER A 17 ? 0.3273 0.2823 0.0920 -0.0152 0.0739  -0.0234 55  SER A N   
110  C CA  . SER A 17 ? 0.3268 0.2805 0.2522 -0.0435 0.0669  -0.0117 55  SER A CA  
111  C C   . SER A 17 ? 0.3818 0.3246 0.4473 -0.0296 0.1475  0.0835  55  SER A C   
112  O O   . SER A 17 ? 0.5969 0.3445 0.6849 -0.0350 0.2254  0.1862  55  SER A O   
113  C CB  . SER A 17 ? 0.4286 0.3680 0.4535 -0.0627 -0.0118 -0.1664 55  SER A CB  
114  O OG  . SER A 17 ? 0.7612 0.5221 0.5471 0.0298  0.1428  -0.1919 55  SER A OG  
115  N N   . GLY A 18 ? 0.3692 0.3057 0.2721 -0.0220 0.0197  0.0808  56  GLY A N   
116  C CA  . GLY A 18 ? 0.3805 0.3359 0.5997 0.0158  0.0531  0.1320  56  GLY A CA  
117  C C   . GLY A 18 ? 0.3629 0.3873 0.2516 0.0634  0.0721  0.1651  56  GLY A C   
118  O O   . GLY A 18 ? 0.3379 0.3639 0.1718 0.0206  0.0531  0.1323  56  GLY A O   
119  N N   . GLN A 19 ? 0.3969 0.3279 0.2412 0.0257  0.0790  0.1546  57  GLN A N   
120  C CA  A GLN A 19 ? 0.3941 0.4159 0.1890 0.0168  0.0361  0.1587  57  GLN A CA  
121  C CA  B GLN A 19 ? 0.3983 0.4505 0.1472 0.0231  0.0308  0.1600  57  GLN A CA  
122  C C   . GLN A 19 ? 0.3466 0.5017 0.1273 -0.0432 -0.0046 0.1302  57  GLN A C   
123  O O   . GLN A 19 ? 0.4526 0.7714 0.2232 -0.1032 -0.1550 0.0157  57  GLN A O   
124  C CB  A GLN A 19 ? 0.3893 0.4216 0.1495 0.0166  0.0387  0.1395  57  GLN A CB  
125  C CB  B GLN A 19 ? 0.4439 0.4566 0.3012 0.0706  0.0294  0.1793  57  GLN A CB  
126  C CG  A GLN A 19 ? 0.3737 0.5866 0.2211 -0.0239 0.1705  0.0107  57  GLN A CG  
127  C CG  B GLN A 19 ? 0.5156 0.4849 0.1255 0.0860  0.0241  0.1431  57  GLN A CG  
128  C CD  A GLN A 19 ? 0.4027 0.5906 0.1837 -0.1750 -0.0582 -0.0231 57  GLN A CD  
129  C CD  B GLN A 19 ? 0.4322 0.3648 0.3796 0.0872  0.1865  0.1564  57  GLN A CD  
130  O OE1 A GLN A 19 ? 1.0078 0.7119 0.0592 -0.2993 0.0417  0.0441  57  GLN A OE1 
131  O OE1 B GLN A 19 ? 0.4311 0.2443 0.6596 0.0898  0.2124  0.1712  57  GLN A OE1 
132  N NE2 A GLN A 19 ? 0.6023 0.3537 0.2393 -0.0300 0.0483  -0.0372 57  GLN A NE2 
133  N NE2 B GLN A 19 ? 0.4420 0.8159 0.7832 0.0979  0.2340  -0.1161 57  GLN A NE2 
134  N N   . ASP A 20 ? 0.2954 0.2694 0.1635 0.0133  0.0252  0.0903  58  ASP A N   
135  C CA  . ASP A 20 ? 0.2680 0.2782 0.1319 -0.0122 -0.0170 0.0863  58  ASP A CA  
136  C C   . ASP A 20 ? 0.2438 0.2495 0.0385 -0.0021 -0.0164 0.0499  58  ASP A C   
137  O O   . ASP A 20 ? 0.2343 0.2332 0.0459 -0.0233 -0.0134 0.0527  58  ASP A O   
138  C CB  . ASP A 20 ? 0.4502 0.3226 0.1959 0.0825  0.1390  0.0975  58  ASP A CB  
139  C CG  . ASP A 20 ? 0.4889 0.5075 0.4107 0.0655  0.1108  0.1760  58  ASP A CG  
140  O OD1 . ASP A 20 ? 0.4060 0.5961 0.4961 0.0431  0.1050  0.2256  58  ASP A OD1 
141  O OD2 . ASP A 20 ? 0.9744 0.6178 0.3587 0.1072  0.1017  0.1226  58  ASP A OD2 
142  N N   . GLU A 21 ? 0.2397 0.2439 0.0480 -0.0086 0.0131  0.0498  59  GLU A N   
143  C CA  . GLU A 21 ? 0.2357 0.2006 0.0282 0.0028  0.0015  0.0224  59  GLU A CA  
144  C C   . GLU A 21 ? 0.2312 0.2106 0.0262 -0.0311 -0.0135 0.0055  59  GLU A C   
145  O O   . GLU A 21 ? 0.3466 0.2538 0.0280 -0.0015 -0.0217 0.0168  59  GLU A O   
146  C CB  . GLU A 21 ? 0.2544 0.2139 0.0328 0.0158  0.0072  0.0070  59  GLU A CB  
147  C CG  . GLU A 21 ? 0.2777 0.2474 0.0507 -0.0096 0.0107  -0.0081 59  GLU A CG  
148  C CD  . GLU A 21 ? 0.3367 0.2834 0.0688 -0.0439 0.0128  -0.0180 59  GLU A CD  
149  O OE1 . GLU A 21 ? 0.3297 0.4538 0.1314 -0.1079 0.0694  -0.0736 59  GLU A OE1 
150  O OE2 . GLU A 21 ? 0.3645 0.3489 0.1446 -0.0935 0.0367  -0.0633 59  GLU A OE2 
151  N N   . LEU A 22 ? 0.2485 0.1800 0.0557 -0.0161 -0.0172 0.0301  60  LEU A N   
152  C CA  . LEU A 22 ? 0.2375 0.2001 0.0467 -0.0120 -0.0528 0.0409  60  LEU A CA  
153  C C   . LEU A 22 ? 0.2476 0.2266 0.0310 0.0031  -0.0334 0.0111  60  LEU A C   
154  O O   . LEU A 22 ? 0.2396 0.2812 0.0400 0.0046  -0.0434 0.0159  60  LEU A O   
155  C CB  . LEU A 22 ? 0.2751 0.2245 0.0602 -0.0188 -0.0410 0.0420  60  LEU A CB  
156  C CG  . LEU A 22 ? 0.2487 0.2450 0.0919 -0.0323 -0.0260 0.0186  60  LEU A CG  
157  C CD1 . LEU A 22 ? 0.2702 0.2961 0.1466 -0.0483 -0.0532 -0.0170 60  LEU A CD1 
158  C CD2 . LEU A 22 ? 0.2952 0.2909 0.0960 -0.0720 0.0114  0.0160  60  LEU A CD2 
159  N N   . ALA A 23 ? 0.2522 0.2188 0.0295 0.0004  -0.0252 0.0165  61  ALA A N   
160  C CA  . ALA A 23 ? 0.2408 0.2012 0.0299 0.0009  -0.0153 0.0247  61  ALA A CA  
161  C C   . ALA A 23 ? 0.2262 0.2340 0.0318 -0.0244 0.0102  -0.0041 61  ALA A C   
162  O O   . ALA A 23 ? 0.2664 0.2483 0.0914 -0.0378 -0.0322 0.0227  61  ALA A O   
163  C CB  . ALA A 23 ? 0.3405 0.2678 0.0271 -0.0171 0.0102  0.0161  61  ALA A CB  
164  N N   . LEU A 24 ? 0.2069 0.2019 0.0276 -0.0006 0.0125  0.0161  62  LEU A N   
165  C CA  . LEU A 24 ? 0.2163 0.2022 0.0275 -0.0195 0.0203  -0.0056 62  LEU A CA  
166  C C   . LEU A 24 ? 0.2085 0.1892 0.0259 0.0062  -0.0096 -0.0045 62  LEU A C   
167  O O   . LEU A 24 ? 0.2080 0.2224 0.0255 -0.0309 0.0064  -0.0004 62  LEU A O   
168  C CB  . LEU A 24 ? 0.2417 0.2280 0.0334 0.0052  0.0356  0.0221  62  LEU A CB  
169  C CG  . LEU A 24 ? 0.2716 0.2282 0.0375 -0.0005 0.0425  0.0314  62  LEU A CG  
170  C CD1 . LEU A 24 ? 0.2838 0.2245 0.0376 0.0277  0.0464  0.0328  62  LEU A CD1 
171  C CD2 . LEU A 24 ? 0.2794 0.2928 0.0870 0.0179  0.0519  0.0478  62  LEU A CD2 
172  N N   . ARG A 25 ? 0.2111 0.1918 0.0280 -0.0093 -0.0037 0.0209  63  ARG A N   
173  C CA  . ARG A 25 ? 0.2134 0.2107 0.0256 -0.0038 -0.0073 0.0025  63  ARG A CA  
174  C C   . ARG A 25 ? 0.2040 0.1962 0.0256 -0.0042 -0.0002 -0.0069 63  ARG A C   
175  O O   . ARG A 25 ? 0.1987 0.2214 0.0254 -0.0059 -0.0031 -0.0027 63  ARG A O   
176  C CB  . ARG A 25 ? 0.2279 0.2187 0.0255 -0.0213 -0.0004 -0.0062 63  ARG A CB  
177  C CG  . ARG A 25 ? 0.2499 0.2371 0.0299 -0.0182 -0.0180 0.0273  63  ARG A CG  
178  C CD  . ARG A 25 ? 0.2650 0.2266 0.0265 -0.0136 0.0102  0.0117  63  ARG A CD  
179  N NE  . ARG A 25 ? 0.2675 0.2142 0.0304 -0.0211 0.0259  0.0188  63  ARG A NE  
180  C CZ  . ARG A 25 ? 0.2858 0.2293 0.0296 -0.0200 0.0217  0.0206  63  ARG A CZ  
181  N NH1 . ARG A 25 ? 0.3249 0.2420 0.0317 -0.0320 0.0401  0.0102  63  ARG A NH1 
182  N NH2 . ARG A 25 ? 0.3245 0.2296 0.0478 -0.0124 0.0450  0.0157  63  ARG A NH2 
183  N N   . LYS A 26 ? 0.2080 0.2298 0.0284 0.0010  0.0188  0.0158  64  LYS A N   
184  C CA  . LYS A 26 ? 0.2513 0.2187 0.0319 -0.0015 0.0026  -0.0040 64  LYS A CA  
185  C C   . LYS A 26 ? 0.2507 0.2108 0.0266 0.0085  0.0134  -0.0090 64  LYS A C   
186  O O   . LYS A 26 ? 0.3126 0.2474 0.0301 -0.0121 0.0287  -0.0217 64  LYS A O   
187  C CB  . LYS A 26 ? 0.2811 0.2601 0.1094 0.0353  0.0130  0.0102  64  LYS A CB  
188  C CG  . LYS A 26 ? 0.3303 0.2780 0.1156 0.0402  -0.0243 -0.0189 64  LYS A CG  
189  C CD  . LYS A 26 ? 0.3627 0.4239 0.2512 0.1050  -0.0393 0.0503  64  LYS A CD  
190  C CE  . LYS A 26 ? 0.5106 0.5192 0.2801 0.1044  -0.0451 0.0731  64  LYS A CE  
191  N NZ  . LYS A 26 ? 0.5774 0.8322 0.6511 0.1727  -0.1836 -0.0486 64  LYS A NZ  
192  N N   . GLY A 27 ? 0.2412 0.2244 0.0344 -0.0111 0.0274  -0.0055 65  GLY A N   
193  C CA  . GLY A 27 ? 0.2859 0.2149 0.0532 -0.0046 0.0319  -0.0044 65  GLY A CA  
194  C C   . GLY A 27 ? 0.2632 0.2222 0.0652 -0.0203 0.0300  -0.0004 65  GLY A C   
195  O O   . GLY A 27 ? 0.3123 0.2348 0.1259 -0.0413 0.0416  -0.0140 65  GLY A O   
196  N N   . ASP A 28 ? 0.2537 0.2245 0.0256 -0.0058 0.0072  0.0031  66  ASP A N   
197  C CA  . ASP A 28 ? 0.2372 0.2271 0.0363 -0.0395 0.0014  0.0062  66  ASP A CA  
198  C C   . ASP A 28 ? 0.2571 0.2020 0.0275 -0.0376 0.0041  -0.0198 66  ASP A C   
199  O O   . ASP A 28 ? 0.2499 0.2444 0.0265 -0.0348 -0.0137 -0.0074 66  ASP A O   
200  C CB  . ASP A 28 ? 0.2311 0.2401 0.0396 -0.0119 -0.0199 0.0141  66  ASP A CB  
201  C CG  . ASP A 28 ? 0.3427 0.3058 0.0483 -0.0019 -0.0406 0.0603  66  ASP A CG  
202  O OD1 . ASP A 28 ? 0.3914 0.4214 0.0527 -0.0792 0.0199  0.0059  66  ASP A OD1 
203  O OD2 . ASP A 28 ? 0.3026 0.3219 0.0848 -0.0124 -0.0077 0.0563  66  ASP A OD2 
204  N N   . ARG A 29 ? 0.2564 0.2154 0.0307 -0.0596 0.0101  -0.0224 67  ARG A N   
205  C CA  . ARG A 29 ? 0.2370 0.2244 0.0255 -0.0324 -0.0043 0.0046  67  ARG A CA  
206  C C   . ARG A 29 ? 0.2539 0.2263 0.0306 -0.0060 -0.0244 -0.0225 67  ARG A C   
207  O O   . ARG A 29 ? 0.3357 0.3205 0.0617 0.0290  -0.0690 -0.0236 67  ARG A O   
208  C CB  . ARG A 29 ? 0.2747 0.2448 0.1587 -0.0441 0.0572  -0.0189 67  ARG A CB  
209  C CG  . ARG A 29 ? 0.4294 0.2467 0.4272 -0.0470 0.0134  0.0099  67  ARG A CG  
210  C CD  . ARG A 29 ? 0.5405 0.5304 0.1502 0.1231  -0.0344 0.0846  67  ARG A CD  
211  N NE  . ARG A 29 ? 0.5558 0.3644 0.2495 0.0208  0.0551  0.0420  67  ARG A NE  
212  C CZ  . ARG A 29 ? 0.4404 0.4385 0.3546 -0.0395 -0.0585 0.0699  67  ARG A CZ  
213  N NH1 . ARG A 29 ? 0.5424 0.8529 0.3154 -0.2117 -0.0605 0.1864  67  ARG A NH1 
214  N NH2 . ARG A 29 ? 0.6638 0.4389 0.2723 0.0105  -0.1868 0.0192  67  ARG A NH2 
215  N N   . VAL A 30 ? 0.2127 0.1822 0.0279 0.0030  -0.0152 0.0143  68  VAL A N   
216  C CA  . VAL A 30 ? 0.1953 0.1887 0.0287 -0.0052 -0.0022 0.0236  68  VAL A CA  
217  C C   . VAL A 30 ? 0.1891 0.1928 0.0269 -0.0071 0.0033  0.0157  68  VAL A C   
218  O O   . VAL A 30 ? 0.2297 0.2063 0.0322 0.0012  -0.0027 0.0353  68  VAL A O   
219  C CB  . VAL A 30 ? 0.2745 0.1929 0.0671 -0.0377 0.0348  0.0036  68  VAL A CB  
220  C CG1 . VAL A 30 ? 0.3177 0.2279 0.0904 -0.0460 0.0449  -0.0117 68  VAL A CG1 
221  C CG2 . VAL A 30 ? 0.2923 0.2753 0.0998 -0.0519 0.0012  0.0305  68  VAL A CG2 
222  N N   . GLU A 31 ? 0.1916 0.2026 0.0286 -0.0206 0.0004  0.0241  69  GLU A N   
223  C CA  . GLU A 31 ? 0.1903 0.1761 0.0500 -0.0171 -0.0026 0.0298  69  GLU A CA  
224  C C   . GLU A 31 ? 0.2441 0.1839 0.0299 0.0077  -0.0008 0.0270  69  GLU A C   
225  O O   . GLU A 31 ? 0.2654 0.1898 0.0283 -0.0043 -0.0084 0.0214  69  GLU A O   
226  C CB  . GLU A 31 ? 0.2227 0.2601 0.1371 -0.0093 -0.0388 0.0227  69  GLU A CB  
227  C CG  . GLU A 31 ? 0.2546 0.3344 0.2232 -0.0046 -0.0004 -0.0137 69  GLU A CG  
228  C CD  . GLU A 31 ? 0.2841 0.5090 0.4035 0.0761  -0.0953 -0.1127 69  GLU A CD  
229  O OE1 . GLU A 31 ? 0.3201 0.4739 0.4950 -0.0265 -0.0335 -0.1710 69  GLU A OE1 
230  O OE2 . GLU A 31 ? 0.2867 0.7142 0.7236 0.0629  0.0325  -0.0550 69  GLU A OE2 
231  N N   . VAL A 32 ? 0.2204 0.2029 0.0259 -0.0148 -0.0055 0.0096  70  VAL A N   
232  C CA  . VAL A 32 ? 0.2119 0.1934 0.0256 -0.0149 0.0078  -0.0014 70  VAL A CA  
233  C C   . VAL A 32 ? 0.2074 0.2003 0.0569 -0.0160 0.0176  0.0242  70  VAL A C   
234  O O   . VAL A 32 ? 0.2815 0.2419 0.0942 -0.0144 0.0484  0.0475  70  VAL A O   
235  C CB  . VAL A 32 ? 0.2393 0.2728 0.0256 -0.0309 -0.0065 -0.0033 70  VAL A CB  
236  C CG1 . VAL A 32 ? 0.2692 0.2904 0.0307 -0.0153 -0.0134 -0.0189 70  VAL A CG1 
237  C CG2 . VAL A 32 ? 0.2418 0.2951 0.0508 0.0274  -0.0287 0.0044  70  VAL A CG2 
238  N N   . LEU A 33 ? 0.2104 0.2116 0.0271 -0.0022 -0.0032 0.0179  71  LEU A N   
239  C CA  . LEU A 33 ? 0.1978 0.2250 0.0257 -0.0232 -0.0069 0.0052  71  LEU A CA  
240  C C   . LEU A 33 ? 0.2126 0.2464 0.0268 -0.0049 0.0127  0.0058  71  LEU A C   
241  O O   . LEU A 33 ? 0.2205 0.2869 0.0484 -0.0223 0.0234  -0.0275 71  LEU A O   
242  C CB  . LEU A 33 ? 0.1890 0.2354 0.0474 -0.0033 -0.0101 -0.0001 71  LEU A CB  
243  C CG  . LEU A 33 ? 0.2217 0.2588 0.0569 -0.0076 -0.0141 0.0068  71  LEU A CG  
244  C CD1 . LEU A 33 ? 0.2731 0.2887 0.0554 0.0112  -0.0236 0.0008  71  LEU A CD1 
245  C CD2 . LEU A 33 ? 0.2653 0.2782 0.1048 -0.0098 -0.0585 -0.0344 71  LEU A CD2 
246  N N   . SER A 34 ? 0.2000 0.2258 0.0253 -0.0230 0.0002  0.0006  72  SER A N   
247  C CA  . SER A 34 ? 0.1974 0.2261 0.0261 -0.0130 0.0108  -0.0066 72  SER A CA  
248  C C   . SER A 34 ? 0.1878 0.2321 0.0262 -0.0106 0.0123  0.0008  72  SER A C   
249  O O   . SER A 34 ? 0.1771 0.2679 0.0278 -0.0032 0.0086  0.0218  72  SER A O   
250  C CB  . SER A 34 ? 0.2079 0.2704 0.0460 0.0031  -0.0020 -0.0367 72  SER A CB  
251  O OG  . SER A 34 ? 0.2570 0.2820 0.0598 0.0203  -0.0094 -0.0456 72  SER A OG  
252  N N   . ARG A 35 ? 0.1936 0.2362 0.0258 -0.0278 0.0058  0.0076  73  ARG A N   
253  C CA  . ARG A 35 ? 0.2057 0.2312 0.0292 -0.0229 0.0184  0.0181  73  ARG A CA  
254  C C   . ARG A 35 ? 0.2219 0.2647 0.0408 0.0070  -0.0007 -0.0025 73  ARG A C   
255  O O   . ARG A 35 ? 0.2175 0.3008 0.0590 -0.0066 -0.0249 -0.0254 73  ARG A O   
256  C CB  . ARG A 35 ? 0.2200 0.2631 0.0328 -0.0252 -0.0040 0.0079  73  ARG A CB  
257  C CG  . ARG A 35 ? 0.2775 0.2358 0.0882 -0.0214 -0.0096 0.0334  73  ARG A CG  
258  C CD  . ARG A 35 ? 0.2968 0.3203 0.0646 -0.0327 -0.0216 -0.0286 73  ARG A CD  
259  N NE  . ARG A 35 ? 0.3090 0.3305 0.0820 -0.0284 0.0057  0.0081  73  ARG A NE  
260  C CZ  . ARG A 35 ? 0.4282 0.3895 0.0325 -0.0061 -0.0279 0.0360  73  ARG A CZ  
261  N NH1 . ARG A 35 ? 0.5469 0.3532 0.1490 0.0676  0.0062  0.0789  73  ARG A NH1 
262  N NH2 . ARG A 35 ? 0.5214 0.3900 0.1163 -0.0249 0.0492  0.0502  73  ARG A NH2 
263  N N   . ASP A 36 ? 0.2317 0.2772 0.0304 0.0078  -0.0104 -0.0208 74  ASP A N   
264  C CA  . ASP A 36 ? 0.2679 0.3016 0.0316 0.0013  -0.0010 -0.0417 74  ASP A CA  
265  C C   . ASP A 36 ? 0.2543 0.2734 0.0433 0.0014  0.0026  -0.0346 74  ASP A C   
266  O O   . ASP A 36 ? 0.2282 0.2880 0.1248 -0.0098 -0.0313 -0.0343 74  ASP A O   
267  C CB  . ASP A 36 ? 0.3486 0.3561 0.0703 -0.0200 0.0464  -0.0289 74  ASP A CB  
268  C CG  . ASP A 36 ? 0.3586 0.5102 0.2076 -0.0123 0.1540  0.0753  74  ASP A CG  
269  O OD1 . ASP A 36 ? 0.5537 0.7192 0.3160 0.1291  0.0705  0.1860  74  ASP A OD1 
270  O OD2 . ASP A 36 ? 0.6539 0.7377 0.2471 -0.2255 0.0127  0.1523  74  ASP A OD2 
271  N N   . ALA A 37 ? 0.2133 0.2724 0.1216 0.0140  -0.0098 -0.0319 75  ALA A N   
272  C CA  . ALA A 37 ? 0.2293 0.2803 0.1156 0.0194  -0.0007 -0.0462 75  ALA A CA  
273  C C   . ALA A 37 ? 0.2315 0.2859 0.1640 0.0059  -0.0071 -0.0757 75  ALA A C   
274  O O   . ALA A 37 ? 0.2538 0.3565 0.1587 0.0280  -0.0114 -0.1066 75  ALA A O   
275  C CB  . ALA A 37 ? 0.2471 0.2479 0.1290 0.0146  -0.0118 -0.0462 75  ALA A CB  
276  N N   . ALA A 38 ? 0.2310 0.2883 0.2298 0.0243  -0.0293 -0.1148 76  ALA A N   
277  C CA  . ALA A 38 ? 0.2466 0.2986 0.2143 -0.0114 -0.0212 -0.0768 76  ALA A CA  
278  C C   . ALA A 38 ? 0.2346 0.2938 0.1808 -0.0002 0.0067  -0.0938 76  ALA A C   
279  O O   . ALA A 38 ? 0.3397 0.3833 0.2964 0.0008  0.0762  -0.1820 76  ALA A O   
280  C CB  . ALA A 38 ? 0.2532 0.2983 0.2075 -0.0012 -0.0365 -0.0987 76  ALA A CB  
281  N N   . ILE A 39 ? 0.2275 0.3023 0.2244 0.0097  -0.0330 -0.0920 77  ILE A N   
282  C CA  . ILE A 39 ? 0.2538 0.2862 0.2069 0.0237  -0.0386 -0.0734 77  ILE A CA  
283  C C   . ILE A 39 ? 0.2224 0.2939 0.2197 -0.0019 -0.0538 -0.1002 77  ILE A C   
284  O O   . ILE A 39 ? 0.2536 0.2717 0.2064 0.0135  -0.0358 -0.0859 77  ILE A O   
285  C CB  . ILE A 39 ? 0.3299 0.2804 0.2986 0.0164  -0.0790 -0.0294 77  ILE A CB  
286  C CG1 . ILE A 39 ? 0.3761 0.3524 0.3714 0.0314  -0.0979 -0.0523 77  ILE A CG1 
287  C CG2 . ILE A 39 ? 0.4372 0.2885 0.5365 0.0042  -0.1306 -0.0199 77  ILE A CG2 
288  C CD1 . ILE A 39 ? 0.3483 0.5884 0.5197 0.0385  -0.0547 -0.0948 77  ILE A CD1 
289  N N   . SER A 40 ? 0.2715 0.2726 0.2161 0.0265  -0.0418 -0.0921 78  SER A N   
290  C CA  . SER A 40 ? 0.2800 0.3084 0.1667 0.0273  -0.0205 -0.0857 78  SER A CA  
291  C C   . SER A 40 ? 0.2673 0.2558 0.1394 -0.0121 -0.0475 -0.0682 78  SER A C   
292  O O   . SER A 40 ? 0.2390 0.2656 0.1063 0.0124  -0.0489 -0.0719 78  SER A O   
293  C CB  . SER A 40 ? 0.3276 0.4355 0.1615 0.0106  0.0015  -0.1019 78  SER A CB  
294  O OG  . SER A 40 ? 0.4724 0.4097 0.4098 0.0519  -0.1343 -0.2009 78  SER A OG  
295  N N   . GLY A 41 ? 0.2785 0.2531 0.2011 -0.0044 -0.0113 -0.0622 79  GLY A N   
296  C CA  . GLY A 41 ? 0.2840 0.2496 0.1795 -0.0103 -0.0396 -0.0469 79  GLY A CA  
297  C C   . GLY A 41 ? 0.2767 0.2977 0.1487 -0.0391 -0.0176 -0.0590 79  GLY A C   
298  O O   . GLY A 41 ? 0.2870 0.2600 0.2833 -0.0621 0.0279  -0.0508 79  GLY A O   
299  N N   . ASP A 42 ? 0.2327 0.2418 0.1437 0.0070  -0.0218 -0.0418 80  ASP A N   
300  C CA  . ASP A 42 ? 0.2512 0.2291 0.0794 0.0022  -0.0101 -0.0086 80  ASP A CA  
301  C C   . ASP A 42 ? 0.2137 0.2220 0.0531 -0.0159 -0.0269 -0.0266 80  ASP A C   
302  O O   . ASP A 42 ? 0.2471 0.2148 0.0593 -0.0027 -0.0458 -0.0381 80  ASP A O   
303  C CB  . ASP A 42 ? 0.2792 0.2291 0.1127 0.0046  -0.0366 -0.0027 80  ASP A CB  
304  C CG  . ASP A 42 ? 0.2828 0.2902 0.1117 0.0429  -0.0259 -0.0176 80  ASP A CG  
305  O OD1 . ASP A 42 ? 0.3098 0.3465 0.2745 -0.0060 -0.0144 0.0873  80  ASP A OD1 
306  O OD2 . ASP A 42 ? 0.3050 0.2861 0.2259 0.0369  -0.0683 -0.0283 80  ASP A OD2 
307  N N   . GLU A 43 ? 0.2238 0.2152 0.0508 0.0048  -0.0217 -0.0377 81  GLU A N   
308  C CA  . GLU A 43 ? 0.1919 0.2259 0.0321 -0.0095 -0.0167 -0.0311 81  GLU A CA  
309  C C   . GLU A 43 ? 0.1922 0.2180 0.0298 -0.0171 -0.0240 -0.0118 81  GLU A C   
310  O O   . GLU A 43 ? 0.2064 0.2200 0.0748 -0.0107 -0.0286 -0.0258 81  GLU A O   
311  C CB  . GLU A 43 ? 0.2277 0.2628 0.0373 -0.0167 -0.0034 -0.0529 81  GLU A CB  
312  C CG  . GLU A 43 ? 0.3162 0.3006 0.0638 0.0118  0.0248  -0.0094 81  GLU A CG  
313  C CD  . GLU A 43 ? 0.3477 0.3673 0.1720 0.0505  0.1132  -0.0057 81  GLU A CD  
314  O OE1 . GLU A 43 ? 0.3199 0.3255 0.5421 0.0426  0.1817  0.0086  81  GLU A OE1 
315  O OE2 . GLU A 43 ? 0.3215 0.4367 0.0765 0.0756  -0.0101 -0.0530 81  GLU A OE2 
316  N N   . GLY A 44 ? 0.2165 0.2003 0.0274 -0.0010 -0.0178 -0.0085 82  GLY A N   
317  C CA  . GLY A 44 ? 0.2007 0.2072 0.0364 -0.0055 -0.0441 -0.0010 82  GLY A CA  
318  C C   . GLY A 44 ? 0.1852 0.1701 0.0452 0.0040  -0.0061 -0.0322 82  GLY A C   
319  O O   . GLY A 44 ? 0.2192 0.2306 0.0408 0.0308  -0.0442 -0.0400 82  GLY A O   
320  N N   . TRP A 45 ? 0.1796 0.1807 0.0301 0.0124  -0.0147 -0.0242 83  TRP A N   
321  C CA  . TRP A 45 ? 0.1801 0.1775 0.0320 -0.0079 -0.0129 -0.0286 83  TRP A CA  
322  C C   . TRP A 45 ? 0.1779 0.1674 0.0288 -0.0058 -0.0199 0.0122  83  TRP A C   
323  O O   . TRP A 45 ? 0.1834 0.2070 0.0271 0.0005  -0.0114 -0.0132 83  TRP A O   
324  C CB  . TRP A 45 ? 0.2179 0.1845 0.0292 -0.0282 -0.0270 -0.0005 83  TRP A CB  
325  C CG  . TRP A 45 ? 0.2162 0.2182 0.0263 -0.0456 -0.0096 0.0122  83  TRP A CG  
326  C CD1 . TRP A 45 ? 0.2477 0.2596 0.0515 -0.0578 -0.0147 -0.0243 83  TRP A CD1 
327  C CD2 . TRP A 45 ? 0.2202 0.2096 0.0269 -0.0309 -0.0082 0.0162  83  TRP A CD2 
328  N NE1 . TRP A 45 ? 0.2491 0.3276 0.0605 -0.1071 -0.0364 0.0041  83  TRP A NE1 
329  C CE2 . TRP A 45 ? 0.2452 0.2411 0.0365 -0.0357 -0.0048 0.0236  83  TRP A CE2 
330  C CE3 . TRP A 45 ? 0.2352 0.2250 0.0258 -0.0160 -0.0036 -0.0090 83  TRP A CE3 
331  C CZ2 . TRP A 45 ? 0.2348 0.2813 0.1001 -0.0441 0.0063  0.0356  83  TRP A CZ2 
332  C CZ3 . TRP A 45 ? 0.3122 0.2498 0.0447 -0.0209 0.0491  0.0072  83  TRP A CZ3 
333  C CH2 . TRP A 45 ? 0.2981 0.3138 0.0529 -0.0456 0.0542  0.0292  83  TRP A CH2 
334  N N   . TRP A 46 ? 0.1674 0.1776 0.0273 -0.0164 -0.0169 0.0004  84  TRP A N   
335  C CA  . TRP A 46 ? 0.1751 0.1859 0.0265 -0.0029 -0.0133 0.0016  84  TRP A CA  
336  C C   . TRP A 46 ? 0.1806 0.1817 0.0259 -0.0237 -0.0095 0.0036  84  TRP A C   
337  O O   . TRP A 46 ? 0.1828 0.2208 0.0296 -0.0255 -0.0191 0.0224  84  TRP A O   
338  C CB  . TRP A 46 ? 0.1828 0.1992 0.0319 -0.0175 -0.0257 -0.0173 84  TRP A CB  
339  C CG  . TRP A 46 ? 0.1920 0.1739 0.0253 -0.0027 -0.0023 0.0011  84  TRP A CG  
340  C CD1 . TRP A 46 ? 0.1945 0.1647 0.0279 0.0060  -0.0152 0.0125  84  TRP A CD1 
341  C CD2 . TRP A 46 ? 0.1988 0.1846 0.0257 0.0099  0.0021  0.0078  84  TRP A CD2 
342  N NE1 . TRP A 46 ? 0.1816 0.2046 0.0291 -0.0077 -0.0127 0.0228  84  TRP A NE1 
343  C CE2 . TRP A 46 ? 0.2066 0.1892 0.0306 -0.0063 0.0072  0.0285  84  TRP A CE2 
344  C CE3 . TRP A 46 ? 0.2372 0.1988 0.0295 0.0037  0.0082  0.0263  84  TRP A CE3 
345  C CZ2 . TRP A 46 ? 0.2279 0.2129 0.0371 0.0043  -0.0129 0.0451  84  TRP A CZ2 
346  C CZ3 . TRP A 46 ? 0.2688 0.2068 0.0309 -0.0028 0.0095  0.0286  84  TRP A CZ3 
347  C CH2 . TRP A 46 ? 0.2794 0.2221 0.0346 0.0051  0.0129  0.0416  84  TRP A CH2 
348  N N   . ALA A 47 ? 0.1727 0.1955 0.0270 -0.0175 -0.0090 0.0147  85  ALA A N   
349  C CA  . ALA A 47 ? 0.1945 0.1773 0.0303 -0.0182 -0.0286 0.0090  85  ALA A CA  
350  C C   . ALA A 47 ? 0.1779 0.1998 0.0300 -0.0158 -0.0091 0.0276  85  ALA A C   
351  O O   . ALA A 47 ? 0.2132 0.1887 0.0267 -0.0281 -0.0127 0.0116  85  ALA A O   
352  C CB  . ALA A 47 ? 0.2326 0.2026 0.0538 -0.0089 -0.0466 0.0138  85  ALA A CB  
353  N N   . GLY A 48 ? 0.2140 0.1875 0.0312 -0.0098 -0.0229 0.0236  86  GLY A N   
354  C CA  . GLY A 48 ? 0.2255 0.2140 0.0413 -0.0077 -0.0412 0.0393  86  GLY A CA  
355  C C   . GLY A 48 ? 0.1914 0.1780 0.0339 -0.0252 -0.0164 0.0346  86  GLY A C   
356  O O   . GLY A 48 ? 0.2196 0.1751 0.0317 -0.0212 -0.0335 0.0135  86  GLY A O   
357  N N   . GLN A 49 ? 0.2400 0.1591 0.0385 -0.0189 -0.0451 0.0262  87  GLN A N   
358  C CA  . GLN A 49 ? 0.2271 0.1639 0.0353 0.0063  -0.0367 0.0203  87  GLN A CA  
359  C C   . GLN A 49 ? 0.2439 0.1850 0.0430 -0.0056 -0.0379 0.0432  87  GLN A C   
360  O O   . GLN A 49 ? 0.2648 0.1931 0.0255 0.0109  -0.0001 0.0061  87  GLN A O   
361  C CB  . GLN A 49 ? 0.2371 0.1761 0.0332 0.0126  -0.0365 -0.0176 87  GLN A CB  
362  C CG  . GLN A 49 ? 0.2833 0.2362 0.0329 -0.0129 -0.0439 -0.0026 87  GLN A CG  
363  C CD  . GLN A 49 ? 0.2775 0.3038 0.0436 0.0154  -0.0526 -0.0482 87  GLN A CD  
364  O OE1 . GLN A 49 ? 0.2669 0.4067 0.0973 -0.0060 -0.0563 -0.0572 87  GLN A OE1 
365  N NE2 . GLN A 49 ? 0.3315 0.3826 0.0997 0.0554  -0.1327 -0.0728 87  GLN A NE2 
366  N N   A VAL A 50 ? 0.2582 0.2022 0.0303 -0.0133 -0.0259 0.0206  88  VAL A N   
367  N N   B VAL A 50 ? 0.2583 0.2032 0.0299 -0.0152 -0.0254 0.0195  88  VAL A N   
368  C CA  A VAL A 50 ? 0.2839 0.2133 0.0356 0.0209  -0.0163 0.0216  88  VAL A CA  
369  C CA  B VAL A 50 ? 0.2947 0.2244 0.0346 0.0113  -0.0086 0.0268  88  VAL A CA  
370  C C   A VAL A 50 ? 0.2231 0.2287 0.0491 0.0173  -0.0375 -0.0021 88  VAL A C   
371  C C   B VAL A 50 ? 0.2385 0.2325 0.0614 0.0053  -0.0271 0.0009  88  VAL A C   
372  O O   A VAL A 50 ? 0.2302 0.2846 0.0327 -0.0009 -0.0234 0.0352  88  VAL A O   
373  O O   B VAL A 50 ? 0.2295 0.2864 0.0298 -0.0006 -0.0132 0.0310  88  VAL A O   
374  C CB  A VAL A 50 ? 0.2687 0.3551 0.0786 0.0623  -0.0413 -0.0115 88  VAL A CB  
375  C CB  B VAL A 50 ? 0.2563 0.3441 0.0720 0.0540  -0.0381 0.0096  88  VAL A CB  
376  C CG1 A VAL A 50 ? 0.2680 0.4149 0.1831 0.0729  -0.0954 -0.0691 88  VAL A CG1 
377  C CG1 B VAL A 50 ? 0.2689 0.4043 0.1812 0.0591  -0.0718 -0.0384 88  VAL A CG1 
378  C CG2 A VAL A 50 ? 0.3406 0.4099 0.1022 0.0123  -0.0649 0.0431  88  VAL A CG2 
379  C CG2 B VAL A 50 ? 0.3263 0.4037 0.1021 0.0196  -0.0708 0.0529  88  VAL A CG2 
380  N N   A GLY A 51 ? 0.2713 0.2427 0.1127 0.0219  -0.0177 -0.0324 89  GLY A N   
381  N N   B GLY A 51 ? 0.2822 0.2545 0.1170 0.0485  -0.0790 -0.0810 89  GLY A N   
382  C CA  A GLY A 51 ? 0.3261 0.3947 0.0758 0.0650  -0.0827 -0.1119 89  GLY A CA  
383  C CA  B GLY A 51 ? 0.4520 0.3793 0.0561 0.0237  -0.1114 0.0184  89  GLY A CA  
384  C C   A GLY A 51 ? 0.2483 0.3384 0.0299 -0.0306 0.0311  -0.0136 89  GLY A C   
385  C C   B GLY A 51 ? 0.2400 0.3823 0.0566 -0.0459 -0.0748 -0.0264 89  GLY A C   
386  O O   A GLY A 51 ? 0.2890 0.3406 0.0358 -0.0153 0.0473  -0.0257 89  GLY A O   
387  O O   B GLY A 51 ? 0.2924 0.2776 0.0843 -0.0917 -0.0280 0.0500  89  GLY A O   
388  N N   A GLY A 52 ? 0.2500 0.2600 0.1080 -0.0344 0.0577  -0.0830 90  GLY A N   
389  N N   B GLY A 52 ? 0.2696 0.2680 0.1009 -0.0172 0.0101  -0.0602 90  GLY A N   
390  C CA  A GLY A 52 ? 0.2333 0.2869 0.0923 -0.0250 -0.0234 -0.0499 90  GLY A CA  
391  C CA  B GLY A 52 ? 0.2403 0.2780 0.0377 -0.0166 -0.0106 -0.0539 90  GLY A CA  
392  C C   A GLY A 52 ? 0.1943 0.2568 0.0399 -0.0036 -0.0033 -0.0070 90  GLY A C   
393  C C   B GLY A 52 ? 0.1977 0.2520 0.0334 -0.0019 -0.0067 -0.0093 90  GLY A C   
394  O O   A GLY A 52 ? 0.2325 0.2702 0.0943 -0.0052 -0.0432 -0.0152 90  GLY A O   
395  O O   B GLY A 52 ? 0.2403 0.2709 0.1011 -0.0020 -0.0306 0.0052  90  GLY A O   
396  N N   . GLN A 53 ? 0.2187 0.2346 0.0305 -0.0309 -0.0309 0.0123  91  GLN A N   
397  C CA  . GLN A 53 ? 0.2119 0.2241 0.0417 -0.0267 -0.0405 0.0443  91  GLN A CA  
398  C C   . GLN A 53 ? 0.2250 0.1898 0.0434 -0.0295 -0.0542 0.0312  91  GLN A C   
399  O O   . GLN A 53 ? 0.2494 0.2031 0.0328 -0.0105 -0.0331 0.0230  91  GLN A O   
400  C CB  . GLN A 53 ? 0.2991 0.2598 0.0401 -0.0465 -0.0203 0.0145  91  GLN A CB  
401  C CG  . GLN A 53 ? 0.3541 0.4212 0.0464 -0.0854 0.0388  -0.0364 91  GLN A CG  
402  C CD  . GLN A 53 ? 0.5501 0.5487 0.2482 -0.1715 0.1474  0.1104  91  GLN A CD  
403  O OE1 . GLN A 53 ? 0.4680 0.9829 0.7963 -0.0923 0.1178  0.3104  91  GLN A OE1 
404  N NE2 . GLN A 53 ? 0.7584 0.6384 0.2326 0.0412  -0.0005 0.1544  91  GLN A NE2 
405  N N   . VAL A 54 ? 0.2242 0.1914 0.0458 -0.0088 -0.0593 0.0243  92  VAL A N   
406  C CA  . VAL A 54 ? 0.2172 0.2076 0.0353 -0.0033 -0.0399 0.0182  92  VAL A CA  
407  C C   . VAL A 54 ? 0.1947 0.2113 0.0395 -0.0092 -0.0347 0.0381  92  VAL A C   
408  O O   . VAL A 54 ? 0.2852 0.2282 0.0581 -0.0417 -0.0817 0.0505  92  VAL A O   
409  C CB  . VAL A 54 ? 0.2222 0.2170 0.0743 -0.0018 -0.0568 0.0101  92  VAL A CB  
410  C CG1 . VAL A 54 ? 0.2165 0.2365 0.0631 0.0074  -0.0132 0.0185  92  VAL A CG1 
411  C CG2 . VAL A 54 ? 0.2160 0.2879 0.1073 -0.0181 -0.0441 0.0187  92  VAL A CG2 
412  N N   . GLY A 55 ? 0.1988 0.1925 0.0347 -0.0034 -0.0375 0.0157  93  GLY A N   
413  C CA  . GLY A 55 ? 0.1974 0.1954 0.0317 -0.0028 -0.0301 0.0143  93  GLY A CA  
414  C C   . GLY A 55 ? 0.1907 0.1908 0.0318 -0.0280 -0.0285 0.0209  93  GLY A C   
415  O O   . GLY A 55 ? 0.2570 0.2009 0.0385 -0.0519 -0.0501 0.0310  93  GLY A O   
416  N N   . ILE A 56 ? 0.1910 0.1753 0.0362 -0.0267 -0.0335 0.0298  94  ILE A N   
417  C CA  . ILE A 56 ? 0.1763 0.1842 0.0339 -0.0030 -0.0294 0.0218  94  ILE A CA  
418  C C   . ILE A 56 ? 0.1752 0.1975 0.0354 -0.0138 -0.0380 -0.0051 94  ILE A C   
419  O O   . ILE A 56 ? 0.2025 0.2418 0.0269 0.0055  -0.0102 0.0142  94  ILE A O   
420  C CB  . ILE A 56 ? 0.2091 0.1980 0.0332 0.0055  -0.0026 0.0343  94  ILE A CB  
421  C CG1 . ILE A 56 ? 0.2178 0.2198 0.0327 -0.0174 -0.0060 0.0091  94  ILE A CG1 
422  C CG2 . ILE A 56 ? 0.2312 0.2176 0.0776 0.0231  0.0001  -0.0013 94  ILE A CG2 
423  C CD1 . ILE A 56 ? 0.2397 0.2219 0.0878 -0.0233 -0.0167 -0.0050 94  ILE A CD1 
424  N N   . PHE A 57 ? 0.1769 0.2003 0.0320 0.0073  -0.0312 0.0052  95  PHE A N   
425  C CA  . PHE A 57 ? 0.1962 0.1843 0.0357 -0.0036 -0.0255 0.0329  95  PHE A CA  
426  C C   . PHE A 57 ? 0.1640 0.1862 0.0262 -0.0051 -0.0068 0.0101  95  PHE A C   
427  O O   . PHE A 57 ? 0.1738 0.1946 0.0254 -0.0025 0.0003  0.0034  95  PHE A O   
428  C CB  . PHE A 57 ? 0.2058 0.2028 0.0311 0.0120  -0.0273 0.0153  95  PHE A CB  
429  C CG  . PHE A 57 ? 0.2146 0.1771 0.0401 0.0065  -0.0467 -0.0238 95  PHE A CG  
430  C CD1 . PHE A 57 ? 0.2449 0.2080 0.0548 0.0119  -0.0407 -0.0015 95  PHE A CD1 
431  C CD2 . PHE A 57 ? 0.1971 0.1861 0.0301 0.0013  -0.0259 -0.0120 95  PHE A CD2 
432  C CE1 . PHE A 57 ? 0.2143 0.2454 0.0587 -0.0277 -0.0536 -0.0446 95  PHE A CE1 
433  C CE2 . PHE A 57 ? 0.2279 0.2226 0.0259 0.0106  -0.0101 -0.0059 95  PHE A CE2 
434  C CZ  . PHE A 57 ? 0.2254 0.2069 0.0903 -0.0246 -0.0115 -0.0232 95  PHE A CZ  
435  N N   . PRO A 58 ? 0.1404 0.2186 0.0260 -0.0092 -0.0063 0.0086  96  PRO A N   
436  C CA  . PRO A 58 ? 0.1945 0.1886 0.0323 0.0094  -0.0341 -0.0067 96  PRO A CA  
437  C C   . PRO A 58 ? 0.1672 0.1842 0.0288 0.0036  -0.0204 0.0092  96  PRO A C   
438  O O   . PRO A 58 ? 0.1986 0.1931 0.0298 0.0086  -0.0271 0.0049  96  PRO A O   
439  C CB  . PRO A 58 ? 0.1956 0.2532 0.0306 -0.0033 -0.0244 -0.0058 96  PRO A CB  
440  C CG  . PRO A 58 ? 0.2113 0.2977 0.0298 0.0093  0.0056  0.0347  96  PRO A CG  
441  C CD  . PRO A 58 ? 0.1911 0.2462 0.0294 0.0013  0.0261  0.0028  96  PRO A CD  
442  N N   . SER A 59 ? 0.1788 0.1782 0.0284 -0.0138 -0.0219 0.0035  97  SER A N   
443  C CA  . SER A 59 ? 0.1905 0.1786 0.0269 -0.0209 0.0122  -0.0119 97  SER A CA  
444  C C   . SER A 59 ? 0.2216 0.1404 0.0254 -0.0052 0.0012  0.0038  97  SER A C   
445  O O   . SER A 59 ? 0.1901 0.2227 0.0258 -0.0066 -0.0086 -0.0017 97  SER A O   
446  C CB  . SER A 59 ? 0.2060 0.2019 0.0358 -0.0226 0.0385  0.0146  97  SER A CB  
447  O OG  . SER A 59 ? 0.2364 0.2181 0.0255 -0.0100 0.0003  0.0064  97  SER A OG  
448  N N   . ASN A 60 ? 0.1741 0.1638 0.0265 -0.0126 -0.0089 -0.0090 98  ASN A N   
449  C CA  . ASN A 60 ? 0.1952 0.1896 0.0279 -0.0029 0.0084  -0.0191 98  ASN A CA  
450  C C   . ASN A 60 ? 0.1820 0.1744 0.0283 0.0037  -0.0199 -0.0091 98  ASN A C   
451  O O   . ASN A 60 ? 0.1899 0.2198 0.0260 0.0163  -0.0108 -0.0029 98  ASN A O   
452  C CB  . ASN A 60 ? 0.1706 0.2441 0.0313 0.0020  -0.0233 -0.0225 98  ASN A CB  
453  C CG  . ASN A 60 ? 0.1555 0.2311 0.0274 0.0120  0.0069  -0.0185 98  ASN A CG  
454  O OD1 . ASN A 60 ? 0.2145 0.2528 0.0515 -0.0315 -0.0167 0.0018  98  ASN A OD1 
455  N ND2 . ASN A 60 ? 0.2264 0.2587 0.0422 -0.0015 0.0105  0.0174  98  ASN A ND2 
456  N N   . TYR A 61 ? 0.1593 0.1752 0.0260 0.0003  -0.0031 -0.0100 99  TYR A N   
457  C CA  . TYR A 61 ? 0.1599 0.1564 0.0260 0.0002  -0.0040 -0.0089 99  TYR A CA  
458  C C   . TYR A 61 ? 0.1808 0.1758 0.0255 -0.0140 0.0051  -0.0006 99  TYR A C   
459  O O   . TYR A 61 ? 0.2147 0.2031 0.0273 -0.0230 0.0078  -0.0183 99  TYR A O   
460  C CB  . TYR A 61 ? 0.1823 0.1779 0.0276 0.0017  -0.0185 0.0044  99  TYR A CB  
461  C CG  . TYR A 61 ? 0.1718 0.1807 0.0264 -0.0085 -0.0066 0.0114  99  TYR A CG  
462  C CD1 . TYR A 61 ? 0.2251 0.2087 0.0301 -0.0203 -0.0303 -0.0037 99  TYR A CD1 
463  C CD2 . TYR A 61 ? 0.2046 0.2068 0.0258 -0.0101 -0.0033 -0.0084 99  TYR A CD2 
464  C CE1 . TYR A 61 ? 0.2501 0.2038 0.0306 -0.0305 -0.0344 0.0048  99  TYR A CE1 
465  C CE2 . TYR A 61 ? 0.2236 0.2487 0.0263 -0.0155 -0.0020 -0.0150 99  TYR A CE2 
466  C CZ  . TYR A 61 ? 0.2296 0.2437 0.0326 -0.0442 -0.0246 0.0353  99  TYR A CZ  
467  O OH  . TYR A 61 ? 0.2653 0.3122 0.0979 -0.0807 -0.0382 0.0375  99  TYR A OH  
468  N N   . VAL A 62 ? 0.1870 0.1763 0.0264 -0.0237 0.0089  0.0080  100 VAL A N   
469  C CA  . VAL A 62 ? 0.1853 0.1923 0.0282 -0.0055 -0.0013 0.0222  100 VAL A CA  
470  C C   . VAL A 62 ? 0.2008 0.1806 0.0279 -0.0249 -0.0133 0.0174  100 VAL A C   
471  O O   . VAL A 62 ? 0.2467 0.2250 0.0272 -0.0262 -0.0205 0.0055  100 VAL A O   
472  C CB  . VAL A 62 ? 0.2048 0.1813 0.0275 -0.0296 0.0159  0.0082  100 VAL A CB  
473  C CG1 . VAL A 62 ? 0.2029 0.2139 0.0261 -0.0049 -0.0046 0.0113  100 VAL A CG1 
474  C CG2 . VAL A 62 ? 0.2000 0.1895 0.0354 -0.0013 0.0030  0.0109  100 VAL A CG2 
475  N N   . SER A 63 ? 0.2000 0.1914 0.0273 -0.0263 -0.0079 0.0175  101 SER A N   
476  C CA  A SER A 63 ? 0.2135 0.2251 0.0380 -0.0223 -0.0020 0.0501  101 SER A CA  
477  C CA  B SER A 63 ? 0.2221 0.1952 0.0310 -0.0174 -0.0009 0.0311  101 SER A CA  
478  C C   . SER A 63 ? 0.2286 0.1830 0.0307 -0.0229 -0.0120 0.0283  101 SER A C   
479  O O   . SER A 63 ? 0.2305 0.2155 0.0296 -0.0284 -0.0115 0.0276  101 SER A O   
480  C CB  A SER A 63 ? 0.2980 0.1958 0.1384 0.0058  -0.0132 0.0855  101 SER A CB  
481  C CB  B SER A 63 ? 0.2332 0.2949 0.1678 -0.0073 -0.0281 0.0263  101 SER A CB  
482  O OG  A SER A 63 ? 0.3221 0.3628 0.1558 0.0283  0.0174  0.1412  101 SER A OG  
483  O OG  B SER A 63 ? 0.3517 0.2528 0.3495 0.0287  0.0896  -0.0416 101 SER A OG  
484  N N   . ARG A 64 ? 0.2552 0.2041 0.0315 -0.0272 -0.0063 0.0333  102 ARG A N   
485  C CA  . ARG A 64 ? 0.2604 0.2205 0.0385 -0.0148 -0.0068 0.0330  102 ARG A CA  
486  C C   . ARG A 64 ? 0.2573 0.2314 0.0349 -0.0319 -0.0155 0.0286  102 ARG A C   
487  O O   . ARG A 64 ? 0.2830 0.2628 0.0887 -0.0217 -0.0432 0.0419  102 ARG A O   
488  C CB  . ARG A 64 ? 0.2990 0.2117 0.0658 -0.0156 0.0254  0.0657  102 ARG A CB  
489  C CG  . ARG A 64 ? 0.3133 0.2082 0.0518 -0.0199 0.0246  0.0239  102 ARG A CG  
490  C CD  . ARG A 64 ? 0.3483 0.3096 0.0880 -0.0405 0.0788  0.0317  102 ARG A CD  
491  N NE  . ARG A 64 ? 0.4485 0.3554 0.0847 -0.0738 0.0921  0.0270  102 ARG A NE  
492  C CZ  . ARG A 64 ? 0.4733 0.3370 0.0402 -0.0462 0.0680  0.0303  102 ARG A CZ  
493  N NH1 . ARG A 64 ? 0.3683 0.3513 0.1094 -0.0016 0.0630  0.0508  102 ARG A NH1 
494  N NH2 . ARG A 64 ? 0.4483 0.3938 0.1310 -0.0401 0.1430  0.0196  102 ARG A NH2 
495  N N   . GLY A 65 ? 0.2585 0.2020 0.0300 -0.0024 -0.0033 0.0207  103 GLY A N   
496  C CA  . GLY A 65 ? 0.2894 0.2144 0.0691 -0.0050 0.0029  0.0326  103 GLY A CA  
497  C C   . GLY A 65 ? 0.3164 0.3052 0.0719 0.0472  0.0701  0.0255  103 GLY A C   
498  O O   . GLY A 65 ? 0.3525 0.3145 0.1789 -0.0037 0.0774  0.1170  103 GLY A O   
499  N N   . GLY A 66 ? 0.3118 0.3378 0.1046 0.0389  0.0916  0.0375  104 GLY A N   
500  C CA  . GLY A 66 ? 0.3605 0.4472 0.2869 0.0523  0.1779  0.0697  104 GLY A CA  
501  C C   . GLY A 66 ? 0.3908 0.4131 0.2125 0.0343  0.1566  0.0508  104 GLY A C   
502  O O   . GLY A 66 ? 0.3719 0.7655 0.3549 0.0824  0.1676  0.1886  104 GLY A O   
503  N N   . GLY A 67 ? 0.3172 0.4524 0.2013 -0.0287 0.1073  0.0633  105 GLY A N   
504  C CA  . GLY A 67 ? 0.3195 0.4269 0.3677 -0.0538 0.0468  0.0574  105 GLY A CA  
505  C C   . GLY A 67 ? 0.3875 0.4358 0.2204 -0.0272 0.0155  0.0024  105 GLY A C   
506  O O   . GLY A 67 ? 0.3527 0.5502 0.2621 -0.0647 0.0190  0.0525  105 GLY A O   
507  N N   . ALA A 68 ? 0.3520 0.3806 0.1345 0.0119  0.1032  0.0478  106 ALA A N   
508  C CA  . ALA A 68 ? 0.2839 0.3875 0.2020 0.0179  0.0938  0.0661  106 ALA A CA  
509  C C   . ALA A 68 ? 0.3304 0.3139 0.2040 0.0431  0.1090  0.0645  106 ALA A C   
510  O O   . ALA A 68 ? 0.2954 0.3672 0.1955 0.0282  0.0590  0.0436  106 ALA A O   
511  C CB  . ALA A 68 ? 0.4152 0.3817 0.2036 0.0608  0.0563  0.0765  106 ALA A CB  
512  N N   . ILE A 69 ? 0.2839 0.2996 0.1253 0.0217  0.0443  -0.0117 107 ILE A N   
513  C CA  . ILE A 69 ? 0.2952 0.3012 0.1298 0.0037  0.0576  0.0082  107 ILE A CA  
514  C C   . ILE A 69 ? 0.2984 0.2879 0.1289 -0.0268 0.0445  0.0093  107 ILE A C   
515  O O   . ILE A 69 ? 0.4557 0.2926 0.1523 0.0364  0.0336  0.0244  107 ILE A O   
516  C CB  . ILE A 69 ? 0.2693 0.3122 0.1162 -0.0077 0.0569  0.0233  107 ILE A CB  
517  C CG1 . ILE A 69 ? 0.2504 0.3664 0.1101 -0.0207 0.0257  0.0316  107 ILE A CG1 
518  C CG2 . ILE A 69 ? 0.2875 0.3141 0.1629 -0.0285 0.0917  0.0074  107 ILE A CG2 
519  C CD1 . ILE A 69 ? 0.2777 0.3112 0.1843 -0.0201 0.0028  0.0110  107 ILE A CD1 
520  N N   . ARG A 70 ? 0.3269 0.2905 0.1543 0.0042  0.0230  -0.0118 108 ARG A N   
521  C CA  . ARG A 70 ? 0.3016 0.2865 0.1556 0.0029  0.0768  0.0023  108 ARG A CA  
522  C C   . ARG A 70 ? 0.2981 0.2627 0.1209 -0.0018 0.0536  0.0212  108 ARG A C   
523  O O   . ARG A 70 ? 0.3371 0.2465 0.1396 -0.0329 0.0381  0.0175  108 ARG A O   
524  C CB  . ARG A 70 ? 0.2996 0.3624 0.2995 -0.0630 0.1192  -0.0066 108 ARG A CB  
525  C CG  . ARG A 70 ? 0.4206 0.4190 0.5621 -0.0520 0.0499  -0.0171 108 ARG A CG  
526  C CD  . ARG A 70 ? 0.4337 0.7015 0.5037 0.0118  -0.0524 -0.0372 108 ARG A CD  
527  N NE  . ARG A 70 ? 0.3037 0.6805 0.5404 -0.0857 -0.0400 -0.0571 108 ARG A NE  
528  C CZ  . ARG A 70 ? 0.5136 0.7486 0.3738 0.1400  -0.1109 0.1049  108 ARG A CZ  
529  N NH1 . ARG A 70 ? 0.7939 1.0899 0.2632 0.0782  -0.1463 -0.1356 108 ARG A NH1 
530  N NH2 . ARG A 70 ? 0.4320 0.7169 0.2937 -0.0753 -0.0868 0.0707  108 ARG A NH2 
531  N N   . ILE A 71 ? 0.3188 0.2449 0.1139 -0.0026 0.0160  0.0031  109 ILE A N   
532  C CA  . ILE A 71 ? 0.3189 0.2141 0.0940 -0.0125 -0.0037 0.0062  109 ILE A CA  
533  C C   . ILE A 71 ? 0.3146 0.2468 0.1162 0.0062  0.0193  0.0161  109 ILE A C   
534  O O   . ILE A 71 ? 0.3732 0.2475 0.1834 -0.0519 -0.0062 0.0447  109 ILE A O   
535  C CB  . ILE A 71 ? 0.3221 0.2441 0.1952 0.0011  0.0074  -0.0260 109 ILE A CB  
536  C CG1 . ILE A 71 ? 0.2889 0.2557 0.1552 0.0097  0.0160  0.0534  109 ILE A CG1 
537  C CG2 . ILE A 71 ? 0.3503 0.3698 0.2426 0.0490  0.0085  -0.0132 109 ILE A CG2 
538  C CD1 . ILE A 71 ? 0.3003 0.2671 0.1335 0.0233  0.0165  0.0402  109 ILE A CD1 
539  N N   . ASN A 72 ? 0.3344 0.2304 0.1089 -0.0191 -0.0072 0.0059  110 ASN A N   
540  C CA  . ASN A 72 ? 0.3867 0.2706 0.1374 -0.0340 -0.0387 0.0219  110 ASN A CA  
541  C C   . ASN A 72 ? 0.2989 0.3262 0.1234 -0.0135 -0.0431 -0.0273 110 ASN A C   
542  O O   . ASN A 72 ? 0.3260 0.2819 0.1241 -0.0002 -0.0247 0.0055  110 ASN A O   
543  C CB  . ASN A 72 ? 0.3772 0.2288 0.2079 -0.0563 -0.0735 0.0338  110 ASN A CB  
544  C CG  . ASN A 72 ? 0.3103 0.2689 0.2252 -0.0275 -0.0112 0.0589  110 ASN A CG  
545  O OD1 . ASN A 72 ? 0.3531 0.2945 0.2550 -0.0259 0.0194  0.0157  110 ASN A OD1 
546  N ND2 . ASN A 72 ? 0.3229 0.2418 0.2433 -0.0072 -0.0565 0.0163  110 ASN A ND2 
547  N N   . PRO A 73 ? 0.3993 0.2760 0.2087 -0.0345 -0.0507 0.0051  111 PRO A N   
548  C CA  . PRO A 73 ? 0.4602 0.2858 0.1499 -0.0011 -0.0308 0.0110  111 PRO A CA  
549  C C   . PRO A 73 ? 0.4093 0.2486 0.1122 -0.0200 -0.0681 -0.0046 111 PRO A C   
550  O O   . PRO A 73 ? 0.4793 0.2915 0.2025 -0.0111 -0.0421 -0.0084 111 PRO A O   
551  C CB  . PRO A 73 ? 0.4698 0.2820 0.2619 -0.0316 0.0047  0.0464  111 PRO A CB  
552  C CG  . PRO A 73 ? 0.4413 0.2853 0.2420 -0.0775 -0.0154 -0.0109 111 PRO A CG  
553  C CD  . PRO A 73 ? 0.4052 0.2559 0.1985 -0.0317 -0.0293 0.0261  111 PRO A CD  
554  N N   . ASN A 74 ? 0.4336 0.2678 0.1280 -0.0406 -0.1015 0.0235  112 ASN A N   
555  C CA  . ASN A 74 ? 0.4538 0.3471 0.1585 -0.0782 -0.0903 0.0419  112 ASN A CA  
556  C C   . ASN A 74 ? 0.3695 0.3660 0.1313 -0.0277 -0.0634 0.0590  112 ASN A C   
557  O O   . ASN A 74 ? 0.4818 0.4205 0.0868 -0.1138 -0.0179 -0.0031 112 ASN A O   
558  C CB  . ASN A 74 ? 0.4493 0.3789 0.2054 -0.0381 -0.1053 0.0547  112 ASN A CB  
559  C CG  . ASN A 74 ? 0.4493 0.3446 0.2040 -0.1021 -0.1256 0.0860  112 ASN A CG  
560  O OD1 . ASN A 74 ? 0.4348 0.2903 0.1757 -0.0683 -0.1047 0.0265  112 ASN A OD1 
561  N ND2 . ASN A 74 ? 0.5314 0.3584 0.2447 -0.0684 -0.1898 0.0738  112 ASN A ND2 
562  N N   . GLY A 75 ? 0.3377 0.3208 0.1184 -0.0414 -0.0310 0.0018  113 GLY A N   
563  C CA  . GLY A 75 ? 0.3504 0.3141 0.1300 -0.0314 -0.0528 0.0028  113 GLY A CA  
564  C C   . GLY A 75 ? 0.3177 0.3109 0.1193 -0.0057 -0.0512 -0.0348 113 GLY A C   
565  O O   . GLY A 75 ? 0.3434 0.3085 0.1760 -0.0105 -0.0948 -0.0339 113 GLY A O   
566  N N   . THR A 76 ? 0.3169 0.2729 0.1094 -0.0483 -0.0401 -0.0261 114 THR A N   
567  C CA  . THR A 76 ? 0.2906 0.2627 0.0864 -0.0484 -0.0650 0.0149  114 THR A CA  
568  C C   . THR A 76 ? 0.2755 0.2352 0.0906 -0.0022 -0.0537 0.0063  114 THR A C   
569  O O   . THR A 76 ? 0.3388 0.2231 0.1494 -0.0453 -0.0409 0.0395  114 THR A O   
570  C CB  . THR A 76 ? 0.3066 0.2779 0.1294 -0.0277 -0.0753 0.0330  114 THR A CB  
571  O OG1 . THR A 76 ? 0.3072 0.2970 0.1866 -0.0415 -0.0805 0.0613  114 THR A OG1 
572  C CG2 . THR A 76 ? 0.3829 0.2993 0.1062 -0.0789 -0.0935 0.0530  114 THR A CG2 
573  N N   . TRP A 77 ? 0.2405 0.2237 0.1253 -0.0343 -0.0109 0.0080  115 TRP A N   
574  C CA  . TRP A 77 ? 0.2584 0.1934 0.1309 -0.0253 0.0236  0.0179  115 TRP A CA  
575  C C   . TRP A 77 ? 0.2397 0.2147 0.1002 -0.0426 -0.0053 0.0161  115 TRP A C   
576  O O   . TRP A 77 ? 0.2508 0.2455 0.1114 -0.0380 -0.0080 0.0290  115 TRP A O   
577  C CB  . TRP A 77 ? 0.2164 0.2148 0.1213 -0.0107 0.0056  0.0485  115 TRP A CB  
578  C CG  . TRP A 77 ? 0.2261 0.2074 0.1027 -0.0010 0.0017  0.0447  115 TRP A CG  
579  C CD1 . TRP A 77 ? 0.2245 0.2517 0.0350 0.0102  -0.0236 0.0320  115 TRP A CD1 
580  C CD2 . TRP A 77 ? 0.1928 0.2163 0.0751 -0.0074 0.0064  0.0327  115 TRP A CD2 
581  N NE1 . TRP A 77 ? 0.2038 0.2326 0.0565 -0.0205 -0.0058 0.0291  115 TRP A NE1 
582  C CE2 . TRP A 77 ? 0.2228 0.2127 0.0322 -0.0181 -0.0069 0.0247  115 TRP A CE2 
583  C CE3 . TRP A 77 ? 0.2160 0.2403 0.0923 -0.0227 -0.0006 0.0051  115 TRP A CE3 
584  C CZ2 . TRP A 77 ? 0.2377 0.2230 0.0506 -0.0314 -0.0058 0.0218  115 TRP A CZ2 
585  C CZ3 . TRP A 77 ? 0.2192 0.2640 0.0556 -0.0125 0.0097  0.0144  115 TRP A CZ3 
586  C CH2 . TRP A 77 ? 0.2703 0.2199 0.0501 0.0057  -0.0144 0.0071  115 TRP A CH2 
587  N N   . SER A 78 ? 0.2448 0.2199 0.1335 -0.0353 0.0047  0.0457  116 SER A N   
588  C CA  . SER A 78 ? 0.2235 0.2408 0.1791 -0.0117 -0.0172 0.0485  116 SER A CA  
589  C C   . SER A 78 ? 0.2659 0.2436 0.1992 -0.0165 -0.0045 -0.0165 116 SER A C   
590  O O   . SER A 78 ? 0.2648 0.2854 0.2074 0.0067  0.0302  0.0253  116 SER A O   
591  C CB  . SER A 78 ? 0.2415 0.3139 0.1882 -0.0225 -0.0409 0.0113  116 SER A CB  
592  O OG  . SER A 78 ? 0.2588 0.3402 0.1811 -0.0404 -0.0366 -0.0123 116 SER A OG  
593  N N   . ARG A 79 ? 0.2819 0.2503 0.2587 0.0015  0.0383  0.0343  117 ARG A N   
594  C CA  . ARG A 79 ? 0.2289 0.3215 0.2910 0.0075  0.0450  0.0027  117 ARG A CA  
595  C C   . ARG A 79 ? 0.2785 0.4281 0.4222 -0.0304 0.0088  0.0956  117 ARG A C   
596  O O   . ARG A 79 ? 0.2822 0.4454 0.3489 -0.0103 -0.0112 -0.0096 117 ARG A O   
597  C CB  . ARG A 79 ? 0.2646 0.3663 0.3488 0.0235  -0.0142 -0.0521 117 ARG A CB  
598  C CG  . ARG A 79 ? 0.3466 0.3611 0.3564 -0.0196 0.0489  -0.0843 117 ARG A CG  
599  C CD  . ARG A 79 ? 0.4207 0.4029 0.3143 0.0488  0.0238  -0.1048 117 ARG A CD  
600  N NE  . ARG A 79 ? 0.5511 0.4775 0.4799 0.0819  0.2722  -0.1041 117 ARG A NE  
601  C CZ  . ARG A 79 ? 0.4218 0.4664 0.6605 0.0933  0.2773  0.1280  117 ARG A CZ  
602  N NH1 . ARG A 79 ? 0.7774 0.5779 0.6347 0.1365  0.4577  0.1288  117 ARG A NH1 
603  N NH2 . ARG A 79 ? 0.4069 0.3792 0.6474 0.0889  0.0209  -0.0692 117 ARG A NH2 
604  N N   . GLN A 80 ? 0.3062 0.3898 0.2996 -0.0257 0.0490  0.0624  118 GLN A N   
605  C CA  . GLN A 80 ? 0.3710 0.6255 0.4676 -0.0871 0.1654  -0.0210 118 GLN A CA  
606  C C   . GLN A 80 ? 0.6055 0.7976 0.8125 0.1124  0.1263  -0.0016 118 GLN A C   
607  O O   . GLN A 80 ? 0.4279 0.9844 0.7830 -0.0050 0.3264  0.0720  118 GLN A O   
608  C CB  . GLN A 80 ? 0.6423 0.6610 0.5983 0.0215  0.0731  0.0347  118 GLN A CB  
609  C CG  . GLN A 80 ? 0.4799 0.6711 0.6579 -0.0733 0.1747  0.1767  118 GLN A CG  
610  C CD  . GLN A 80 ? 0.7275 0.7692 0.5926 -0.1975 -0.3068 0.1372  118 GLN A CD  
611  O OE1 . GLN A 80 ? 0.5947 0.7927 0.3202 -0.0765 -0.1445 0.0081  118 GLN A OE1 
612  N NE2 . GLN A 80 ? 0.6268 0.6018 0.5310 0.0763  -0.0096 0.0262  118 GLN A NE2 
613  N N   . PRO B 6  ? 0.6317 0.5053 0.6980 -0.2586 0.0868  -0.1261 44  PRO B N   
614  C CA  . PRO B 6  ? 0.4420 0.4021 0.2142 -0.0907 0.1231  -0.0025 44  PRO B CA  
615  C C   . PRO B 6  ? 0.3163 0.3744 0.1559 -0.0325 0.0447  -0.0635 44  PRO B C   
616  O O   . PRO B 6  ? 0.3014 0.4002 0.1418 0.0278  0.0674  -0.0290 44  PRO B O   
617  C CB  . PRO B 6  ? 0.7712 0.3800 0.2012 -0.1464 0.2218  -0.0441 44  PRO B CB  
618  C CG  . PRO B 6  ? 0.7504 0.3995 0.5309 -0.0544 0.1928  0.0788  44  PRO B CG  
619  C CD  . PRO B 6  ? 0.8305 0.6271 0.8287 -0.1848 -0.0640 0.0208  44  PRO B CD  
620  N N   . VAL B 7  ? 0.2883 0.4320 0.2157 -0.0892 0.0261  -0.1565 45  VAL B N   
621  C CA  . VAL B 7  ? 0.2505 0.3625 0.1175 -0.0381 -0.0295 -0.0650 45  VAL B CA  
622  C C   . VAL B 7  ? 0.2381 0.3553 0.0496 -0.0654 0.0178  -0.0630 45  VAL B C   
623  O O   . VAL B 7  ? 0.2602 0.3587 0.0612 0.0209  0.0198  -0.0500 45  VAL B O   
624  C CB  . VAL B 7  ? 0.2570 0.4897 0.1365 0.0062  -0.0628 -0.0208 45  VAL B CB  
625  C CG1 . VAL B 7  ? 0.3750 0.5510 0.1415 -0.0226 -0.0359 -0.0125 45  VAL B CG1 
626  C CG2 . VAL B 7  ? 0.3470 0.5188 0.2247 -0.0005 -0.1016 -0.0358 45  VAL B CG2 
627  N N   . TRP B 8  ? 0.2297 0.2919 0.0550 -0.0515 0.0378  -0.0333 46  TRP B N   
628  C CA  . TRP B 8  ? 0.1955 0.2552 0.0597 -0.0187 0.0163  -0.0250 46  TRP B CA  
629  C C   . TRP B 8  ? 0.2217 0.2308 0.0298 -0.0328 0.0269  -0.0132 46  TRP B C   
630  O O   . TRP B 8  ? 0.2975 0.2788 0.0350 -0.0414 0.0364  -0.0349 46  TRP B O   
631  C CB  . TRP B 8  ? 0.2713 0.2512 0.0754 -0.0098 0.0664  -0.0077 46  TRP B CB  
632  C CG  . TRP B 8  ? 0.3269 0.2580 0.1309 0.0205  0.0911  -0.0044 46  TRP B CG  
633  C CD1 . TRP B 8  ? 0.3318 0.2919 0.2274 0.0610  0.0515  -0.0201 46  TRP B CD1 
634  C CD2 . TRP B 8  ? 0.3287 0.2206 0.1108 0.0146  0.0700  -0.0128 46  TRP B CD2 
635  N NE1 . TRP B 8  ? 0.4553 0.3557 0.0992 0.1250  0.0416  -0.0149 46  TRP B NE1 
636  C CE2 . TRP B 8  ? 0.3295 0.2291 0.1414 0.0374  0.1395  0.0461  46  TRP B CE2 
637  C CE3 . TRP B 8  ? 0.2751 0.2906 0.1815 0.0400  -0.0475 -0.0479 46  TRP B CE3 
638  C CZ2 . TRP B 8  ? 0.3526 0.2770 0.1058 -0.0087 0.0980  0.0181  46  TRP B CZ2 
639  C CZ3 . TRP B 8  ? 0.4516 0.2737 0.2749 0.0125  0.1817  0.0354  46  TRP B CZ3 
640  C CH2 . TRP B 8  ? 0.4142 0.3469 0.1729 -0.0183 0.0302  0.0540  46  TRP B CH2 
641  N N   . THR B 9  ? 0.1877 0.2233 0.0400 -0.0298 0.0178  -0.0061 47  THR B N   
642  C CA  . THR B 9  ? 0.1899 0.2500 0.0506 -0.0078 0.0218  0.0039  47  THR B CA  
643  C C   . THR B 9  ? 0.1850 0.2208 0.0255 -0.0072 0.0004  -0.0062 47  THR B C   
644  O O   . THR B 9  ? 0.2329 0.2466 0.0264 -0.0107 0.0078  0.0130  47  THR B O   
645  C CB  . THR B 9  ? 0.2503 0.2433 0.1257 -0.0047 0.0291  0.0414  47  THR B CB  
646  O OG1 . THR B 9  ? 0.2909 0.3101 0.1006 0.0447  0.0295  0.0212  47  THR B OG1 
647  C CG2 . THR B 9  ? 0.2640 0.2810 0.1291 -0.0104 0.0244  0.0119  47  THR B CG2 
648  N N   . ALA B 10 ? 0.1928 0.1952 0.0264 0.0023  0.0133  -0.0026 48  ALA B N   
649  C CA  . ALA B 10 ? 0.2044 0.1626 0.0352 -0.0152 0.0295  0.0237  48  ALA B CA  
650  C C   . ALA B 10 ? 0.2150 0.1699 0.0264 -0.0068 -0.0111 0.0087  48  ALA B C   
651  O O   . ALA B 10 ? 0.2569 0.1866 0.0261 -0.0080 -0.0134 0.0002  48  ALA B O   
652  C CB  . ALA B 10 ? 0.2131 0.2068 0.0305 -0.0275 0.0271  0.0114  48  ALA B CB  
653  N N   . LEU B 11 ? 0.2137 0.2070 0.0276 -0.0227 -0.0130 0.0172  49  LEU B N   
654  C CA  . LEU B 11 ? 0.2257 0.2052 0.0274 -0.0209 -0.0205 0.0028  49  LEU B CA  
655  C C   . LEU B 11 ? 0.2648 0.2016 0.0297 -0.0236 -0.0297 0.0143  49  LEU B C   
656  O O   . LEU B 11 ? 0.2764 0.2266 0.0727 -0.0440 -0.0045 -0.0141 49  LEU B O   
657  C CB  . LEU B 11 ? 0.2236 0.2381 0.0284 -0.0267 -0.0249 0.0046  49  LEU B CB  
658  C CG  . LEU B 11 ? 0.2407 0.2697 0.0274 -0.0363 -0.0205 0.0101  49  LEU B CG  
659  C CD1 . LEU B 11 ? 0.2888 0.2612 0.0286 -0.0375 0.0116  0.0236  49  LEU B CD1 
660  C CD2 . LEU B 11 ? 0.3261 0.3638 0.1372 0.0346  0.0781  0.0727  49  LEU B CD2 
661  N N   . PHE B 12 ? 0.2253 0.2150 0.0259 -0.0259 -0.0115 0.0018  50  PHE B N   
662  C CA  . PHE B 12 ? 0.2554 0.2302 0.0286 -0.0430 -0.0268 -0.0007 50  PHE B CA  
663  C C   . PHE B 12 ? 0.2546 0.2735 0.0298 -0.0154 -0.0316 0.0079  50  PHE B C   
664  O O   . PHE B 12 ? 0.2779 0.3282 0.0619 -0.0612 0.0177  -0.0739 50  PHE B O   
665  C CB  . PHE B 12 ? 0.2412 0.2751 0.0607 -0.0026 0.0034  0.0142  50  PHE B CB  
666  C CG  . PHE B 12 ? 0.2404 0.2447 0.0347 -0.0340 -0.0267 0.0212  50  PHE B CG  
667  C CD1 . PHE B 12 ? 0.3174 0.2731 0.0803 -0.0870 -0.0729 0.0365  50  PHE B CD1 
668  C CD2 . PHE B 12 ? 0.2934 0.2258 0.0500 -0.0535 -0.0562 0.0233  50  PHE B CD2 
669  C CE1 . PHE B 12 ? 0.3739 0.2882 0.0667 -0.0931 -0.1124 0.0162  50  PHE B CE1 
670  C CE2 . PHE B 12 ? 0.2721 0.2422 0.0639 -0.0311 -0.0331 0.0408  50  PHE B CE2 
671  C CZ  . PHE B 12 ? 0.2950 0.2585 0.0405 -0.0240 -0.0399 0.0217  50  PHE B CZ  
672  N N   . ASP B 13 ? 0.2811 0.2955 0.0487 -0.0416 0.0335  -0.0040 51  ASP B N   
673  C CA  . ASP B 13 ? 0.2265 0.3609 0.0265 -0.0134 0.0047  0.0045  51  ASP B CA  
674  C C   . ASP B 13 ? 0.3111 0.3758 0.0462 0.0608  -0.0032 0.0117  51  ASP B C   
675  O O   . ASP B 13 ? 0.3661 0.5816 0.0972 0.0973  -0.0756 -0.0095 51  ASP B O   
676  C CB  . ASP B 13 ? 0.2650 0.3578 0.0869 -0.0206 0.0274  0.0059  51  ASP B CB  
677  C CG  . ASP B 13 ? 0.2783 0.3612 0.1124 -0.0610 0.0071  0.0234  51  ASP B CG  
678  O OD1 . ASP B 13 ? 0.2893 0.3880 0.0761 -0.0858 -0.0154 0.0452  51  ASP B OD1 
679  O OD2 . ASP B 13 ? 0.3346 0.5772 0.2799 -0.1789 0.0092  0.0961  51  ASP B OD2 
680  N N   . TYR B 14 ? 0.2660 0.3062 0.0289 0.0236  0.0234  0.0217  52  TYR B N   
681  C CA  . TYR B 14 ? 0.2973 0.3711 0.0308 0.0475  0.0335  0.0278  52  TYR B CA  
682  C C   . TYR B 14 ? 0.2365 0.2951 0.0481 0.0223  0.0144  0.0132  52  TYR B C   
683  O O   . TYR B 14 ? 0.2457 0.3360 0.0443 0.0049  0.0212  0.0223  52  TYR B O   
684  C CB  . TYR B 14 ? 0.3557 0.4033 0.0751 0.0988  0.1186  0.0855  52  TYR B CB  
685  C CG  . TYR B 14 ? 0.3262 0.3859 0.0375 0.0634  0.0588  0.0283  52  TYR B CG  
686  C CD1 . TYR B 14 ? 0.3615 0.3265 0.0786 0.0443  0.0441  0.0374  52  TYR B CD1 
687  C CD2 . TYR B 14 ? 0.3914 0.3815 0.2043 -0.0018 0.0796  0.1219  52  TYR B CD2 
688  C CE1 . TYR B 14 ? 0.3838 0.4461 0.0368 0.0734  0.0578  0.0414  52  TYR B CE1 
689  C CE2 . TYR B 14 ? 0.3504 0.4282 0.4203 -0.0988 0.0211  0.2698  52  TYR B CE2 
690  C CZ  . TYR B 14 ? 0.3880 0.3898 0.2260 0.0214  0.0506  0.1234  52  TYR B CZ  
691  O OH  . TYR B 14 ? 0.3958 0.3457 0.5241 0.0077  0.1150  0.2118  52  TYR B OH  
692  N N   . GLU B 15 ? 0.2560 0.3383 0.0361 0.0061  0.0395  0.0211  53  GLU B N   
693  C CA  . GLU B 15 ? 0.2891 0.3030 0.0991 0.0090  0.0558  0.0346  53  GLU B CA  
694  C C   . GLU B 15 ? 0.2661 0.3874 0.1148 0.0939  0.0347  -0.0309 53  GLU B C   
695  O O   . GLU B 15 ? 0.4492 0.4071 0.2368 0.0730  -0.0611 0.0127  53  GLU B O   
696  C CB  . GLU B 15 ? 0.3194 0.4064 0.1079 0.0233  0.1043  0.0638  53  GLU B CB  
697  C CG  . GLU B 15 ? 0.4404 0.4183 0.2736 -0.0056 0.1273  0.0348  53  GLU B CG  
698  C CD  . GLU B 15 ? 0.3442 0.8732 0.5646 -0.0244 0.1556  0.0866  53  GLU B CD  
699  O OE1 . GLU B 15 ? 0.3876 0.8933 0.5635 -0.0943 0.2404  0.0252  53  GLU B OE1 
700  O OE2 . GLU B 15 ? 1.1848 0.9478 0.1069 -0.0500 -0.0853 -0.0808 53  GLU B OE2 
701  N N   . PRO B 16 ? 0.2873 0.2710 0.5216 -0.0186 0.1736  -0.0581 54  PRO B N   
702  C CA  . PRO B 16 ? 0.4096 0.2988 0.6571 0.0614  0.1325  0.0204  54  PRO B CA  
703  C C   . PRO B 16 ? 0.3575 0.2390 0.3278 -0.0163 0.1516  -0.0253 54  PRO B C   
704  O O   . PRO B 16 ? 0.3741 0.3666 0.2765 0.0178  0.0986  0.0473  54  PRO B O   
705  C CB  . PRO B 16 ? 0.5571 0.5030 0.3818 0.0135  0.0038  0.0533  54  PRO B CB  
706  C CG  . PRO B 16 ? 0.4532 0.3874 0.9821 -0.0192 0.0503  -0.0675 54  PRO B CG  
707  C CD  . PRO B 16 ? 0.3554 0.3918 0.7418 -0.0428 -0.0309 -0.0878 54  PRO B CD  
708  N N   . SER B 17 ? 0.4969 0.3044 0.2187 0.0270  0.1321  0.0214  55  SER B N   
709  C CA  . SER B 17 ? 0.3541 0.3449 0.4208 0.0137  -0.0571 -0.0458 55  SER B CA  
710  C C   . SER B 17 ? 0.3702 0.3611 0.4968 0.0845  0.0434  -0.0797 55  SER B C   
711  O O   . SER B 17 ? 0.6138 0.6539 0.6301 0.2097  -0.2864 -0.0218 55  SER B O   
712  C CB  . SER B 17 ? 0.4492 0.5503 0.5290 -0.0348 -0.1531 -0.0785 55  SER B CB  
713  O OG  . SER B 17 ? 0.6707 0.6905 0.7221 0.0329  0.0885  0.1504  55  SER B OG  
714  N N   . GLY B 18 ? 0.3621 0.3156 0.1933 0.0602  0.0870  0.0704  56  GLY B N   
715  C CA  . GLY B 18 ? 0.3444 0.3252 0.3049 0.0518  0.0422  0.0474  56  GLY B CA  
716  C C   . GLY B 18 ? 0.3655 0.2975 0.1980 0.0046  0.0761  0.0499  56  GLY B C   
717  O O   . GLY B 18 ? 0.3417 0.3009 0.1515 0.0150  0.0408  0.0068  56  GLY B O   
718  N N   . GLN B 19 ? 0.2910 0.3186 0.3198 0.0442  0.0356  -0.0223 57  GLN B N   
719  C CA  . GLN B 19 ? 0.3010 0.3935 0.3213 0.0462  0.0511  -0.1291 57  GLN B CA  
720  C C   . GLN B 19 ? 0.2717 0.3844 0.1508 -0.0104 0.0362  -0.0729 57  GLN B C   
721  O O   . GLN B 19 ? 0.3724 0.3229 0.2038 0.0073  0.0539  -0.0355 57  GLN B O   
722  C CB  . GLN B 19 ? 0.3881 0.4175 0.4667 0.0981  0.0319  -0.1491 57  GLN B CB  
723  C CG  . GLN B 19 ? 0.5483 0.5014 0.6266 0.0403  -0.0290 -0.2586 57  GLN B CG  
724  C CD  . GLN B 19 ? 0.8359 0.5443 1.1925 0.0524  0.0603  -0.3317 57  GLN B CD  
725  O OE1 . GLN B 19 ? 1.1420 0.7277 1.3320 -0.3491 0.7324  -0.4334 57  GLN B OE1 
726  N NE2 . GLN B 19 ? 0.7359 0.6306 1.1701 0.1114  0.1712  -0.4244 57  GLN B NE2 
727  N N   . ASP B 20 ? 0.2916 0.3067 0.1374 -0.0189 0.0351  -0.0696 58  ASP B N   
728  C CA  . ASP B 20 ? 0.2773 0.3689 0.1347 0.0182  0.0518  -0.0668 58  ASP B CA  
729  C C   . ASP B 20 ? 0.2196 0.3240 0.0673 -0.0109 0.0261  -0.0238 58  ASP B C   
730  O O   . ASP B 20 ? 0.2306 0.3769 0.0340 0.0004  0.0300  -0.0390 58  ASP B O   
731  C CB  . ASP B 20 ? 0.2934 0.3412 0.3203 -0.0370 0.0878  -0.0763 58  ASP B CB  
732  C CG  . ASP B 20 ? 0.3745 0.3313 0.4338 -0.0417 0.0359  -0.0074 58  ASP B CG  
733  O OD1 . ASP B 20 ? 0.5456 0.6379 0.4763 -0.1300 0.0580  -0.3232 58  ASP B OD1 
734  O OD2 . ASP B 20 ? 0.6236 0.3897 0.5423 -0.0402 -0.0259 0.0368  58  ASP B OD2 
735  N N   . GLU B 21 ? 0.2404 0.2733 0.0929 0.0277  0.0426  -0.0222 59  GLU B N   
736  C CA  . GLU B 21 ? 0.2589 0.2412 0.0675 0.0153  0.0625  0.0005  59  GLU B CA  
737  C C   . GLU B 21 ? 0.3238 0.2544 0.0306 0.0118  0.0323  0.0214  59  GLU B C   
738  O O   . GLU B 21 ? 0.4234 0.3254 0.1324 0.0209  0.1652  0.0493  59  GLU B O   
739  C CB  . GLU B 21 ? 0.2654 0.2634 0.1278 0.0039  0.0613  -0.0206 59  GLU B CB  
740  C CG  . GLU B 21 ? 0.2861 0.3240 0.1103 0.0275  0.0455  -0.0301 59  GLU B CG  
741  C CD  . GLU B 21 ? 0.3281 0.6001 0.0942 0.0636  0.0137  -0.0350 59  GLU B CD  
742  O OE1 . GLU B 21 ? 0.3622 0.9764 0.1674 -0.2552 0.0360  0.0174  59  GLU B OE1 
743  O OE2 . GLU B 21 ? 0.3875 0.9316 0.2405 0.2217  0.0662  0.0757  59  GLU B OE2 
744  N N   . LEU B 22 ? 0.2402 0.2312 0.0330 0.0041  0.0399  0.0092  60  LEU B N   
745  C CA  . LEU B 22 ? 0.2612 0.2516 0.0341 0.0020  -0.0109 0.0404  60  LEU B CA  
746  C C   . LEU B 22 ? 0.2795 0.2145 0.0330 0.0025  0.0426  0.0105  60  LEU B C   
747  O O   . LEU B 22 ? 0.3524 0.2593 0.0255 -0.0296 0.0036  0.0066  60  LEU B O   
748  C CB  . LEU B 22 ? 0.2788 0.2509 0.0389 0.0046  -0.0317 0.0215  60  LEU B CB  
749  C CG  . LEU B 22 ? 0.2543 0.2683 0.0296 -0.0026 0.0008  0.0323  60  LEU B CG  
750  C CD1 . LEU B 22 ? 0.2909 0.2907 0.1303 -0.0311 0.0135  0.0318  60  LEU B CD1 
751  C CD2 . LEU B 22 ? 0.3695 0.3060 0.0342 -0.0816 -0.0318 -0.0034 60  LEU B CD2 
752  N N   . ALA B 23 ? 0.2638 0.2138 0.0363 -0.0069 0.0454  0.0196  61  ALA B N   
753  C CA  . ALA B 23 ? 0.2062 0.2751 0.0347 0.0094  0.0189  0.0439  61  ALA B CA  
754  C C   . ALA B 23 ? 0.2164 0.2211 0.0343 0.0054  0.0295  0.0303  61  ALA B C   
755  O O   . ALA B 23 ? 0.2316 0.2582 0.0271 0.0194  0.0191  0.0032  61  ALA B O   
756  C CB  . ALA B 23 ? 0.2913 0.2759 0.0454 -0.0080 0.0691  0.0212  61  ALA B CB  
757  N N   . LEU B 24 ? 0.2292 0.2246 0.0289 -0.0135 0.0146  0.0215  62  LEU B N   
758  C CA  . LEU B 24 ? 0.2068 0.2249 0.0266 -0.0210 0.0113  0.0096  62  LEU B CA  
759  C C   . LEU B 24 ? 0.2131 0.2263 0.0253 -0.0075 0.0009  0.0025  62  LEU B C   
760  O O   . LEU B 24 ? 0.2431 0.2575 0.0304 -0.0151 0.0030  0.0080  62  LEU B O   
761  C CB  . LEU B 24 ? 0.2315 0.2392 0.0269 -0.0170 0.0142  0.0104  62  LEU B CB  
762  C CG  . LEU B 24 ? 0.2627 0.2528 0.0401 -0.0197 0.0586  0.0034  62  LEU B CG  
763  C CD1 . LEU B 24 ? 0.2984 0.2413 0.0376 -0.0234 0.0518  0.0185  62  LEU B CD1 
764  C CD2 . LEU B 24 ? 0.2831 0.2341 0.0695 -0.0425 0.0287  0.0454  62  LEU B CD2 
765  N N   A ARG B 25 ? 0.2266 0.2272 0.0409 -0.0169 0.0181  0.0485  63  ARG B N   
766  N N   B ARG B 25 ? 0.2308 0.2243 0.0328 -0.0216 -0.0086 -0.0281 63  ARG B N   
767  C CA  A ARG B 25 ? 0.2312 0.2388 0.0440 -0.0179 0.0136  0.0602  63  ARG B CA  
768  C CA  B ARG B 25 ? 0.2228 0.2333 0.0305 -0.0074 -0.0307 0.0103  63  ARG B CA  
769  C C   A ARG B 25 ? 0.2471 0.2006 0.0663 -0.0335 -0.0018 0.0333  63  ARG B C   
770  C C   B ARG B 25 ? 0.2796 0.2131 0.0296 -0.0028 -0.0150 0.0173  63  ARG B C   
771  O O   A ARG B 25 ? 0.2453 0.2287 0.0332 -0.0429 -0.0112 0.0400  63  ARG B O   
772  O O   B ARG B 25 ? 0.2699 0.2606 0.0282 -0.0303 -0.0231 -0.0102 63  ARG B O   
773  C CB  A ARG B 25 ? 0.2633 0.2065 0.0347 -0.0259 -0.0051 0.0412  63  ARG B CB  
774  C CB  B ARG B 25 ? 0.2450 0.2745 0.0315 0.0372  -0.0313 0.0151  63  ARG B CB  
775  C CG  A ARG B 25 ? 0.2942 0.2419 0.1517 0.0165  0.0191  0.0064  63  ARG B CG  
776  C CG  B ARG B 25 ? 0.2938 0.3131 0.0437 0.0170  0.0523  0.0517  63  ARG B CG  
777  C CD  A ARG B 25 ? 0.3058 0.4706 0.0729 -0.0984 0.0239  -0.0862 63  ARG B CD  
778  C CD  B ARG B 25 ? 0.2454 0.3978 0.1723 0.0112  -0.0075 0.0986  63  ARG B CD  
779  N NE  A ARG B 25 ? 0.3048 0.4580 0.1487 -0.0317 0.0246  -0.0932 63  ARG B NE  
780  N NE  B ARG B 25 ? 0.2849 0.3986 0.1315 -0.1001 0.0229  0.1113  63  ARG B NE  
781  C CZ  A ARG B 25 ? 0.3235 0.4619 0.0846 0.0005  0.1300  0.0293  63  ARG B CZ  
782  C CZ  B ARG B 25 ? 0.2450 0.4258 0.1368 -0.1340 0.0092  0.1347  63  ARG B CZ  
783  N NH1 A ARG B 25 ? 0.2332 0.4085 0.0766 -0.0329 0.0939  0.0327  63  ARG B NH1 
784  N NH1 B ARG B 25 ? 0.3492 0.4063 0.1697 -0.0753 -0.1426 0.2054  63  ARG B NH1 
785  N NH2 A ARG B 25 ? 0.2849 0.5809 0.0397 -0.0223 0.0521  -0.0509 63  ARG B NH2 
786  N NH2 B ARG B 25 ? 0.2510 0.4704 0.0344 -0.0806 0.0149  0.0527  63  ARG B NH2 
787  N N   . LYS B 26 ? 0.2570 0.2485 0.0291 -0.0392 0.0135  0.0233  64  LYS B N   
788  C CA  . LYS B 26 ? 0.2788 0.2370 0.0430 -0.0466 0.0010  0.0247  64  LYS B CA  
789  C C   . LYS B 26 ? 0.2830 0.2374 0.0473 -0.0280 0.0053  0.0328  64  LYS B C   
790  O O   . LYS B 26 ? 0.3230 0.2666 0.0464 -0.0449 0.0005  0.0453  64  LYS B O   
791  C CB  . LYS B 26 ? 0.3516 0.2630 0.0503 -0.0841 -0.0099 0.0072  64  LYS B CB  
792  C CG  . LYS B 26 ? 0.4121 0.3071 0.0751 -0.1093 0.0148  -0.0363 64  LYS B CG  
793  C CD  . LYS B 26 ? 0.4219 0.3587 0.1549 -0.0757 -0.0372 -0.0318 64  LYS B CD  
794  C CE  . LYS B 26 ? 0.5377 0.4124 0.1600 -0.0481 -0.0374 -0.1443 64  LYS B CE  
795  N NZ  . LYS B 26 ? 0.6775 0.7329 0.3222 -0.0980 0.1342  -0.2663 64  LYS B NZ  
796  N N   . GLY B 27 ? 0.2918 0.2192 0.0266 -0.0223 0.0161  -0.0073 65  GLY B N   
797  C CA  . GLY B 27 ? 0.2585 0.2315 0.0589 -0.0087 0.0221  -0.0005 65  GLY B CA  
798  C C   . GLY B 27 ? 0.2594 0.2418 0.0373 0.0123  -0.0092 0.0257  65  GLY B C   
799  O O   . GLY B 27 ? 0.2803 0.2794 0.0546 0.0225  0.0025  0.0012  65  GLY B O   
800  N N   . ASP B 28 ? 0.2417 0.2093 0.0262 -0.0127 0.0052  0.0116  66  ASP B N   
801  C CA  . ASP B 28 ? 0.2384 0.2228 0.0278 -0.0333 -0.0085 0.0219  66  ASP B CA  
802  C C   . ASP B 28 ? 0.2227 0.2238 0.0261 -0.0215 0.0071  0.0092  66  ASP B C   
803  O O   . ASP B 28 ? 0.2266 0.2664 0.0276 -0.0116 0.0170  0.0133  66  ASP B O   
804  C CB  . ASP B 28 ? 0.2455 0.2264 0.0256 -0.0309 0.0080  -0.0043 66  ASP B CB  
805  C CG  . ASP B 28 ? 0.2615 0.2653 0.0277 -0.0064 0.0031  -0.0078 66  ASP B CG  
806  O OD1 . ASP B 28 ? 0.3123 0.2751 0.0280 -0.0157 0.0257  0.0083  66  ASP B OD1 
807  O OD2 . ASP B 28 ? 0.2716 0.2571 0.0263 -0.0094 0.0149  -0.0046 66  ASP B OD2 
808  N N   . ARG B 29 ? 0.2224 0.2698 0.0315 -0.0179 -0.0063 0.0176  67  ARG B N   
809  C CA  . ARG B 29 ? 0.2476 0.2467 0.0548 -0.0065 0.0069  0.0268  67  ARG B CA  
810  C C   . ARG B 29 ? 0.2422 0.2443 0.0254 0.0044  0.0052  0.0025  67  ARG B C   
811  O O   . ARG B 29 ? 0.3364 0.2846 0.0306 0.0338  0.0408  0.0049  67  ARG B O   
812  C CB  . ARG B 29 ? 0.2530 0.3274 0.1786 -0.0060 -0.0290 0.0785  67  ARG B CB  
813  C CG  . ARG B 29 ? 0.3869 0.4161 0.3592 0.0667  -0.1115 -0.0068 67  ARG B CG  
814  C CD  . ARG B 29 ? 0.4485 0.6723 0.5543 0.0224  -0.1341 -0.1401 67  ARG B CD  
815  N NE  . ARG B 29 ? 0.7284 0.6535 0.7579 -0.1015 0.3108  -0.0805 67  ARG B NE  
816  C CZ  . ARG B 29 ? 0.4939 0.6670 0.9801 0.0452  0.0745  -0.0633 67  ARG B CZ  
817  N NH1 . ARG B 29 ? 0.6796 0.6273 0.8532 0.0529  0.4101  0.2645  67  ARG B NH1 
818  N NH2 . ARG B 29 ? 0.4516 0.5111 0.3836 0.1637  0.0310  0.0039  67  ARG B NH2 
819  N N   . VAL B 30 ? 0.2245 0.2376 0.0326 0.0102  0.0301  0.0166  68  VAL B N   
820  C CA  . VAL B 30 ? 0.2245 0.2275 0.0272 0.0008  0.0185  0.0063  68  VAL B CA  
821  C C   . VAL B 30 ? 0.2388 0.2190 0.0267 -0.0087 0.0170  0.0020  68  VAL B C   
822  O O   . VAL B 30 ? 0.2755 0.2739 0.0659 -0.0275 0.0623  -0.0446 68  VAL B O   
823  C CB  . VAL B 30 ? 0.2487 0.2749 0.0300 0.0030  -0.0140 0.0100  68  VAL B CB  
824  C CG1 . VAL B 30 ? 0.2714 0.3023 0.0361 0.0110  -0.0126 0.0524  68  VAL B CG1 
825  C CG2 . VAL B 30 ? 0.2736 0.2828 0.0470 0.0031  -0.0444 -0.0376 68  VAL B CG2 
826  N N   . GLU B 31 ? 0.2257 0.2122 0.0254 0.0065  0.0027  0.0041  69  GLU B N   
827  C CA  A GLU B 31 ? 0.2521 0.2230 0.0270 -0.0111 -0.0005 -0.0183 69  GLU B CA  
828  C CA  B GLU B 31 ? 0.2407 0.2827 0.0600 0.0052  0.0056  0.0319  69  GLU B CA  
829  C C   . GLU B 31 ? 0.2399 0.2537 0.0417 0.0042  0.0421  0.0010  69  GLU B C   
830  O O   . GLU B 31 ? 0.3471 0.2862 0.0594 0.0718  0.0838  0.0369  69  GLU B O   
831  C CB  A GLU B 31 ? 0.2327 0.2856 0.0272 -0.0116 0.0117  -0.0186 69  GLU B CB  
832  C CB  B GLU B 31 ? 0.2034 0.3152 0.1310 0.0177  -0.0014 0.0090  69  GLU B CB  
833  C CG  A GLU B 31 ? 0.2832 0.3070 0.0820 -0.0120 -0.0200 0.0388  69  GLU B CG  
834  C CG  B GLU B 31 ? 0.1967 0.3526 0.1555 -0.0031 -0.0326 -0.0035 69  GLU B CG  
835  C CD  A GLU B 31 ? 0.3829 0.5107 0.0943 -0.0064 -0.0669 0.0586  69  GLU B CD  
836  C CD  B GLU B 31 ? 0.2873 0.4017 0.1882 -0.0590 -0.1005 0.0316  69  GLU B CD  
837  O OE1 A GLU B 31 ? 0.4352 0.6789 0.3879 -0.1100 -0.1254 0.0053  69  GLU B OE1 
838  O OE1 B GLU B 31 ? 0.3839 0.4068 0.3118 -0.0399 0.0014  -0.1018 69  GLU B OE1 
839  O OE2 A GLU B 31 ? 0.5327 0.4647 0.2855 -0.0228 -0.1287 0.1249  69  GLU B OE2 
840  O OE2 B GLU B 31 ? 0.2495 0.3514 0.3715 -0.0296 -0.1104 -0.0604 69  GLU B OE2 
841  N N   . VAL B 32 ? 0.2510 0.2066 0.0302 0.0029  0.0268  -0.0010 70  VAL B N   
842  C CA  . VAL B 32 ? 0.2209 0.1916 0.0403 0.0012  0.0294  -0.0214 70  VAL B CA  
843  C C   . VAL B 32 ? 0.2153 0.1915 0.0611 -0.0080 0.0221  0.0025  70  VAL B C   
844  O O   . VAL B 32 ? 0.2348 0.2433 0.1662 -0.0047 0.0448  -0.0151 70  VAL B O   
845  C CB  . VAL B 32 ? 0.2463 0.2251 0.0275 -0.0154 0.0215  0.0001  70  VAL B CB  
846  C CG1 . VAL B 32 ? 0.2633 0.2322 0.0339 -0.0109 0.0181  -0.0270 70  VAL B CG1 
847  C CG2 . VAL B 32 ? 0.2552 0.2034 0.0876 -0.0095 -0.0010 -0.0504 70  VAL B CG2 
848  N N   . LEU B 33 ? 0.1957 0.2143 0.0374 -0.0209 0.0166  -0.0052 71  LEU B N   
849  C CA  . LEU B 33 ? 0.2050 0.2292 0.0351 -0.0185 -0.0048 -0.0071 71  LEU B CA  
850  C C   . LEU B 33 ? 0.2120 0.2372 0.0314 -0.0364 0.0111  -0.0131 71  LEU B C   
851  O O   . LEU B 33 ? 0.2246 0.2597 0.0971 -0.0565 -0.0172 0.0242  71  LEU B O   
852  C CB  . LEU B 33 ? 0.2450 0.2190 0.0260 -0.0453 0.0005  -0.0113 71  LEU B CB  
853  C CG  . LEU B 33 ? 0.2788 0.2656 0.0260 -0.0512 -0.0010 0.0118  71  LEU B CG  
854  C CD1 . LEU B 33 ? 0.3755 0.3092 0.0293 -0.0511 0.0299  -0.0241 71  LEU B CD1 
855  C CD2 . LEU B 33 ? 0.3550 0.3922 0.1480 -0.0392 -0.0838 0.0124  71  LEU B CD2 
856  N N   . SER B 34 ? 0.2140 0.2029 0.0255 -0.0420 0.0062  -0.0001 72  SER B N   
857  C CA  . SER B 34 ? 0.1950 0.2003 0.0289 -0.0558 0.0023  0.0172  72  SER B CA  
858  C C   . SER B 34 ? 0.1865 0.2147 0.0255 -0.0320 0.0022  -0.0065 72  SER B C   
859  O O   . SER B 34 ? 0.2050 0.2095 0.0258 -0.0502 -0.0069 -0.0050 72  SER B O   
860  C CB  . SER B 34 ? 0.2467 0.2017 0.0274 -0.0417 -0.0152 0.0164  72  SER B CB  
861  O OG  . SER B 34 ? 0.3219 0.1984 0.0274 -0.0520 -0.0157 0.0172  72  SER B OG  
862  N N   A ARG B 35 ? 0.2235 0.2131 0.0261 -0.0471 0.0090  -0.0107 73  ARG B N   
863  N N   B ARG B 35 ? 0.2234 0.2137 0.0261 -0.0470 0.0090  -0.0103 73  ARG B N   
864  C CA  A ARG B 35 ? 0.2440 0.1900 0.0280 -0.0456 0.0048  -0.0212 73  ARG B CA  
865  C CA  B ARG B 35 ? 0.2437 0.1899 0.0282 -0.0453 0.0051  -0.0218 73  ARG B CA  
866  C C   A ARG B 35 ? 0.2762 0.2018 0.0333 -0.0200 -0.0051 -0.0089 73  ARG B C   
867  C C   B ARG B 35 ? 0.2763 0.2019 0.0362 -0.0202 -0.0061 -0.0085 73  ARG B C   
868  O O   A ARG B 35 ? 0.4005 0.2435 0.0459 -0.0540 -0.0479 0.0043  73  ARG B O   
869  O O   B ARG B 35 ? 0.4020 0.2427 0.0498 -0.0558 -0.0517 0.0070  73  ARG B O   
870  C CB  A ARG B 35 ? 0.2408 0.2227 0.0693 -0.0646 0.0579  -0.0546 73  ARG B CB  
871  C CB  B ARG B 35 ? 0.2464 0.2259 0.0690 -0.0640 0.0609  -0.0537 73  ARG B CB  
872  C CG  A ARG B 35 ? 0.2210 0.2143 0.0283 -0.0481 0.0210  -0.0170 73  ARG B CG  
873  C CG  B ARG B 35 ? 0.3260 0.3281 0.1092 -0.0455 -0.0110 -0.0237 73  ARG B CG  
874  C CD  A ARG B 35 ? 0.2787 0.2560 0.1605 0.0372  0.0071  -0.0509 73  ARG B CD  
875  C CD  B ARG B 35 ? 0.3881 0.3528 0.2983 0.0197  0.0132  -0.0564 73  ARG B CD  
876  N NE  A ARG B 35 ? 0.3508 0.4615 0.1609 0.0184  0.0191  -0.1008 73  ARG B NE  
877  N NE  B ARG B 35 ? 0.4622 0.5536 0.2240 -0.0156 -0.0294 -0.0734 73  ARG B NE  
878  C CZ  A ARG B 35 ? 0.4045 0.6526 0.3131 0.0030  0.2104  -0.0432 73  ARG B CZ  
879  C CZ  B ARG B 35 ? 0.5446 0.7004 0.1843 0.0088  0.1833  -0.1615 73  ARG B CZ  
880  N NH1 A ARG B 35 ? 0.5550 0.7113 0.1076 0.1030  0.1678  -0.1065 73  ARG B NH1 
881  N NH1 B ARG B 35 ? 0.5848 0.7678 0.1561 0.0614  0.2429  -0.1098 73  ARG B NH1 
882  N NH2 A ARG B 35 ? 0.3878 0.9137 0.5449 -0.0248 0.1068  -0.1806 73  ARG B NH2 
883  N NH2 B ARG B 35 ? 0.4932 0.8946 0.4936 -0.0532 0.0887  -0.1976 73  ARG B NH2 
884  N N   . ASP B 36 ? 0.2950 0.1914 0.0261 -0.0294 0.0140  -0.0050 74  ASP B N   
885  C CA  A ASP B 36 ? 0.3577 0.1945 0.0623 -0.0217 -0.0049 -0.0060 74  ASP B CA  
886  C CA  B ASP B 36 ? 0.3611 0.1924 0.0571 -0.0267 -0.0052 -0.0074 74  ASP B CA  
887  C C   . ASP B 36 ? 0.3078 0.2112 0.0318 -0.0047 -0.0398 0.0139  74  ASP B C   
888  O O   . ASP B 36 ? 0.3449 0.2864 0.0413 -0.0483 -0.0463 -0.0179 74  ASP B O   
889  C CB  A ASP B 36 ? 0.4640 0.2612 0.0661 -0.0716 0.0651  0.0014  74  ASP B CB  
890  C CB  B ASP B 36 ? 0.4835 0.2479 0.0355 -0.0741 0.0658  -0.0236 74  ASP B CB  
891  C CG  A ASP B 36 ? 0.4965 0.2694 0.0588 0.0143  0.0183  0.0426  74  ASP B CG  
892  C CG  B ASP B 36 ? 0.7914 0.2144 0.1462 -0.1493 -0.0182 0.0443  74  ASP B CG  
893  O OD1 A ASP B 36 ? 0.7285 0.4196 0.0509 -0.0559 0.0077  0.0411  74  ASP B OD1 
894  O OD1 B ASP B 36 ? 0.9413 0.5855 0.0576 -0.1016 0.0972  -0.0374 74  ASP B OD1 
895  O OD2 A ASP B 36 ? 0.4419 0.3646 0.2764 0.0265  0.0865  0.1283  74  ASP B OD2 
896  O OD2 B ASP B 36 ? 0.9268 0.3826 0.1570 -0.1971 0.0917  -0.0572 74  ASP B OD2 
897  N N   . ALA B 37 ? 0.3198 0.2235 0.0564 -0.0365 -0.0688 0.0013  75  ALA B N   
898  C CA  . ALA B 37 ? 0.3421 0.2309 0.0941 -0.0441 -0.0592 0.0509  75  ALA B CA  
899  C C   . ALA B 37 ? 0.3885 0.2283 0.0596 -0.0425 -0.0466 0.0336  75  ALA B C   
900  O O   . ALA B 37 ? 0.4549 0.2941 0.0629 -0.0702 -0.0824 0.0717  75  ALA B O   
901  C CB  . ALA B 37 ? 0.3162 0.2828 0.0896 -0.0106 -0.0596 0.0194  75  ALA B CB  
902  N N   . ALA B 38 ? 0.4028 0.2100 0.1270 -0.0232 -0.0874 0.0247  76  ALA B N   
903  C CA  . ALA B 38 ? 0.3662 0.2570 0.1296 -0.0589 -0.0756 0.0546  76  ALA B CA  
904  C C   . ALA B 38 ? 0.4558 0.2784 0.1314 -0.0193 -0.1044 0.0488  76  ALA B C   
905  O O   . ALA B 38 ? 0.5594 0.3444 0.2721 -0.0377 -0.1203 0.1648  76  ALA B O   
906  C CB  . ALA B 38 ? 0.4629 0.2451 0.1806 -0.0437 -0.1168 0.0160  76  ALA B CB  
907  N N   . ILE B 39 ? 0.4277 0.2833 0.3120 -0.0034 -0.1913 0.0764  77  ILE B N   
908  C CA  . ILE B 39 ? 0.4121 0.2640 0.3290 -0.0509 -0.1050 0.0773  77  ILE B CA  
909  C C   . ILE B 39 ? 0.5605 0.3132 0.3047 0.0087  -0.1951 0.0990  77  ILE B C   
910  O O   . ILE B 39 ? 0.6365 0.3215 0.1954 0.0430  -0.1550 0.0660  77  ILE B O   
911  C CB  . ILE B 39 ? 0.5965 0.5071 0.2445 0.1560  -0.1030 -0.0589 77  ILE B CB  
912  C CG1 . ILE B 39 ? 0.6105 0.4820 0.3221 0.0935  -0.0475 -0.0236 77  ILE B CG1 
913  C CG2 . ILE B 39 ? 0.6132 0.5576 0.7716 0.0181  -0.1235 -0.0454 77  ILE B CG2 
914  C CD1 . ILE B 39 ? 0.6877 0.5814 0.5130 0.0645  -0.0408 0.0899  77  ILE B CD1 
915  N N   . SER B 40 ? 0.7636 0.4564 0.3829 -0.0886 -0.2535 0.2776  78  SER B N   
916  C CA  . SER B 40 ? 0.7001 0.8239 0.2595 0.1150  -0.2344 0.1005  78  SER B CA  
917  C C   . SER B 40 ? 1.1158 1.4513 0.4319 -0.4488 -0.2636 0.3519  78  SER B C   
918  O O   . SER B 40 ? 1.5408 1.8927 0.5868 -0.6306 -0.6062 0.5308  78  SER B O   
919  C CB  . SER B 40 ? 0.4992 0.4749 0.4326 -0.0672 -0.0668 0.0749  78  SER B CB  
920  O OG  . SER B 40 ? 0.5654 0.6530 0.4614 -0.0480 0.0226  0.1003  78  SER B OG  
921  N N   . GLY B 41 ? 1.0960 1.2114 0.6877 -0.4348 -0.6538 0.6847  79  GLY B N   
922  C CA  . GLY B 41 ? 0.7451 0.6664 0.8149 0.0298  -0.5418 0.3696  79  GLY B CA  
923  C C   . GLY B 41 ? 0.5486 0.6117 0.6977 -0.0556 -0.2592 0.3915  79  GLY B C   
924  O O   . GLY B 41 ? 0.5460 0.5668 1.2395 -0.1407 -0.5203 0.3752  79  GLY B O   
925  N N   . ASP B 42 ? 0.5781 0.4165 0.4704 -0.0224 -0.3453 0.1342  80  ASP B N   
926  C CA  . ASP B 42 ? 0.4254 0.3516 0.2837 -0.0495 -0.1108 0.1028  80  ASP B CA  
927  C C   . ASP B 42 ? 0.4410 0.2818 0.1773 -0.0947 -0.1644 0.0913  80  ASP B C   
928  O O   . ASP B 42 ? 0.4071 0.2638 0.1172 -0.0716 -0.0995 0.0374  80  ASP B O   
929  C CB  . ASP B 42 ? 0.3941 0.3196 0.2686 0.0106  -0.1056 0.0586  80  ASP B CB  
930  C CG  . ASP B 42 ? 0.3441 0.5147 0.3724 0.0730  -0.1154 -0.0265 80  ASP B CG  
931  O OD1 . ASP B 42 ? 0.3409 0.5250 0.5420 0.0532  -0.1084 0.0694  80  ASP B OD1 
932  O OD2 . ASP B 42 ? 0.4411 0.3601 0.3591 0.0473  -0.1088 0.0428  80  ASP B OD2 
933  N N   . GLU B 43 ? 0.4725 0.3983 0.1920 -0.1352 -0.1674 0.1556  81  GLU B N   
934  C CA  . GLU B 43 ? 0.4439 0.3282 0.1263 -0.1480 -0.0647 0.0622  81  GLU B CA  
935  C C   . GLU B 43 ? 0.5168 0.2694 0.0546 -0.0950 -0.0704 -0.0037 81  GLU B C   
936  O O   . GLU B 43 ? 0.6550 0.4131 0.3802 -0.2292 -0.3610 0.1517  81  GLU B O   
937  C CB  . GLU B 43 ? 0.6377 0.3432 0.1425 -0.1517 -0.0930 0.0745  81  GLU B CB  
938  C CG  . GLU B 43 ? 0.6366 0.5130 0.3049 -0.0088 0.1110  0.1693  81  GLU B CG  
939  C CD  . GLU B 43 ? 1.2512 1.0614 0.3348 -0.0559 0.0225  0.1124  81  GLU B CD  
940  O OE1 . GLU B 43 ? 2.3929 0.9632 0.2182 -0.2657 -0.2804 0.1985  81  GLU B OE1 
941  O OE2 . GLU B 43 ? 1.6748 0.8783 0.8265 -0.1827 0.0291  -0.1781 81  GLU B OE2 
942  N N   . GLY B 44 ? 0.4255 0.2507 0.0380 -0.0277 -0.0692 0.0172  82  GLY B N   
943  C CA  . GLY B 44 ? 0.3399 0.2842 0.0336 -0.0423 -0.0500 0.0165  82  GLY B CA  
944  C C   . GLY B 44 ? 0.2795 0.2007 0.0327 -0.0212 -0.0415 -0.0071 82  GLY B C   
945  O O   . GLY B 44 ? 0.3608 0.2177 0.0363 -0.0229 -0.0497 -0.0171 82  GLY B O   
946  N N   . TRP B 45 ? 0.2365 0.1807 0.0272 -0.0349 -0.0194 0.0071  83  TRP B N   
947  C CA  . TRP B 45 ? 0.2027 0.1719 0.0287 -0.0382 -0.0231 0.0120  83  TRP B CA  
948  C C   . TRP B 45 ? 0.2100 0.1523 0.0283 -0.0230 -0.0066 -0.0178 83  TRP B C   
949  O O   . TRP B 45 ? 0.2133 0.1740 0.0265 -0.0322 -0.0121 0.0101  83  TRP B O   
950  C CB  . TRP B 45 ? 0.2052 0.2009 0.0402 -0.0208 -0.0141 0.0029  83  TRP B CB  
951  C CG  . TRP B 45 ? 0.1967 0.2548 0.0263 -0.0180 -0.0095 -0.0098 83  TRP B CG  
952  C CD1 . TRP B 45 ? 0.2441 0.3091 0.0447 -0.0275 -0.0385 0.0128  83  TRP B CD1 
953  C CD2 . TRP B 45 ? 0.1963 0.2422 0.0264 -0.0427 -0.0089 -0.0093 83  TRP B CD2 
954  N NE1 . TRP B 45 ? 0.2052 0.3124 0.0686 -0.0181 -0.0202 0.0218  83  TRP B NE1 
955  C CE2 . TRP B 45 ? 0.2291 0.2404 0.0388 -0.0405 0.0005  -0.0160 83  TRP B CE2 
956  C CE3 . TRP B 45 ? 0.2373 0.2251 0.0256 -0.0169 0.0065  -0.0047 83  TRP B CE3 
957  C CZ2 . TRP B 45 ? 0.2061 0.2622 0.0642 -0.0399 0.0040  -0.0569 83  TRP B CZ2 
958  C CZ3 . TRP B 45 ? 0.2493 0.2363 0.0558 -0.0130 -0.0035 -0.0080 83  TRP B CZ3 
959  C CH2 . TRP B 45 ? 0.2476 0.2499 0.0600 -0.0310 0.0065  -0.0351 83  TRP B CH2 
960  N N   . TRP B 46 ? 0.1779 0.1664 0.0255 -0.0137 0.0008  -0.0057 84  TRP B N   
961  C CA  . TRP B 46 ? 0.1741 0.1891 0.0293 -0.0244 0.0105  0.0211  84  TRP B CA  
962  C C   . TRP B 46 ? 0.1722 0.1803 0.0292 -0.0271 0.0091  0.0207  84  TRP B C   
963  O O   . TRP B 46 ? 0.1873 0.2152 0.0298 -0.0449 -0.0044 -0.0267 84  TRP B O   
964  C CB  . TRP B 46 ? 0.1499 0.1927 0.0258 -0.0198 -0.0070 0.0060  84  TRP B CB  
965  C CG  . TRP B 46 ? 0.1905 0.1828 0.0257 -0.0180 0.0008  0.0076  84  TRP B CG  
966  C CD1 . TRP B 46 ? 0.2253 0.1904 0.0266 -0.0081 0.0063  -0.0140 84  TRP B CD1 
967  C CD2 . TRP B 46 ? 0.2238 0.1868 0.0278 -0.0162 0.0107  -0.0182 84  TRP B CD2 
968  N NE1 . TRP B 46 ? 0.2430 0.2175 0.0307 -0.0239 0.0165  -0.0298 84  TRP B NE1 
969  C CE2 . TRP B 46 ? 0.2001 0.2112 0.0329 -0.0389 0.0216  -0.0343 84  TRP B CE2 
970  C CE3 . TRP B 46 ? 0.2512 0.1842 0.0596 -0.0195 0.0252  -0.0198 84  TRP B CE3 
971  C CZ2 . TRP B 46 ? 0.3009 0.2429 0.0483 -0.0118 0.0546  -0.0442 84  TRP B CZ2 
972  C CZ3 . TRP B 46 ? 0.2665 0.1857 0.0783 -0.0077 0.0212  -0.0186 84  TRP B CZ3 
973  C CH2 . TRP B 46 ? 0.2811 0.2650 0.0695 -0.0084 0.0659  -0.0560 84  TRP B CH2 
974  N N   . ALA B 47 ? 0.1746 0.1747 0.0265 -0.0320 0.0132  -0.0061 85  ALA B N   
975  C CA  . ALA B 47 ? 0.1839 0.1637 0.0294 0.0035  0.0160  -0.0182 85  ALA B CA  
976  C C   . ALA B 47 ? 0.1785 0.1835 0.0321 -0.0214 0.0144  -0.0311 85  ALA B C   
977  O O   . ALA B 47 ? 0.1838 0.2111 0.0254 -0.0147 0.0002  0.0044  85  ALA B O   
978  C CB  . ALA B 47 ? 0.2329 0.2075 0.0383 0.0046  0.0037  0.0172  85  ALA B CB  
979  N N   . GLY B 48 ? 0.1907 0.2220 0.0253 0.0042  0.0008  0.0030  86  GLY B N   
980  C CA  . GLY B 48 ? 0.2032 0.2272 0.0357 -0.0151 0.0368  -0.0270 86  GLY B CA  
981  C C   . GLY B 48 ? 0.1916 0.1961 0.0266 0.0263  0.0047  -0.0130 86  GLY B C   
982  O O   . GLY B 48 ? 0.2076 0.2232 0.0253 0.0166  0.0018  0.0013  86  GLY B O   
983  N N   . GLN B 49 ? 0.2266 0.2266 0.0319 0.0384  0.0221  -0.0242 87  GLN B N   
984  C CA  A GLN B 49 ? 0.2405 0.2525 0.0265 0.0234  -0.0094 -0.0143 87  GLN B CA  
985  C CA  B GLN B 49 ? 0.2776 0.2444 0.0404 0.0047  0.0617  0.0013  87  GLN B CA  
986  C C   . GLN B 49 ? 0.2197 0.2573 0.0254 0.0211  -0.0030 0.0020  87  GLN B C   
987  O O   . GLN B 49 ? 0.2842 0.2556 0.0317 0.0237  0.0322  0.0261  87  GLN B O   
988  C CB  A GLN B 49 ? 0.3169 0.3883 0.0841 0.0024  -0.0915 -0.0437 87  GLN B CB  
989  C CB  B GLN B 49 ? 0.3074 0.3100 0.0501 -0.0367 0.0446  0.0103  87  GLN B CB  
990  C CG  A GLN B 49 ? 0.3874 0.4105 0.0988 0.0520  0.0268  0.0165  87  GLN B CG  
991  C CG  B GLN B 49 ? 0.3111 0.3738 0.0418 0.0475  -0.0586 -0.0487 87  GLN B CG  
992  C CD  A GLN B 49 ? 0.2964 0.3651 0.0543 -0.0011 0.0082  0.0050  87  GLN B CD  
993  C CD  B GLN B 49 ? 0.2616 0.4130 0.1610 0.0051  -0.0883 0.0471  87  GLN B CD  
994  O OE1 A GLN B 49 ? 0.3506 0.6028 0.1207 -0.1164 0.1071  0.1038  87  GLN B OE1 
995  O OE1 B GLN B 49 ? 0.3149 0.6475 0.3412 -0.1322 -0.0741 -0.0977 87  GLN B OE1 
996  N NE2 A GLN B 49 ? 0.3213 0.2844 0.1249 -0.0066 0.0514  -0.0213 87  GLN B NE2 
997  N NE2 B GLN B 49 ? 0.5537 0.8458 0.2049 0.0670  -0.1322 0.0858  87  GLN B NE2 
998  N N   . VAL B 50 ? 0.2380 0.2590 0.0287 0.0189  0.0164  0.0238  88  VAL B N   
999  C CA  . VAL B 50 ? 0.2716 0.2879 0.0264 0.0117  0.0035  0.0167  88  VAL B CA  
1000 C C   . VAL B 50 ? 0.2599 0.3082 0.0342 0.0296  -0.0033 0.0493  88  VAL B C   
1001 O O   . VAL B 50 ? 0.2722 0.3065 0.0277 0.0190  0.0204  0.0159  88  VAL B O   
1002 C CB  . VAL B 50 ? 0.2889 0.2918 0.0309 0.0095  0.0192  0.0078  88  VAL B CB  
1003 C CG1 . VAL B 50 ? 0.2866 0.3421 0.1689 0.0060  0.0750  0.0327  88  VAL B CG1 
1004 C CG2 . VAL B 50 ? 0.3778 0.3698 0.0351 -0.0104 0.0496  -0.0329 88  VAL B CG2 
1005 N N   . GLY B 51 ? 0.2942 0.3962 0.0804 0.0788  0.0486  0.1210  89  GLY B N   
1006 C CA  . GLY B 51 ? 0.3268 0.4362 0.0607 0.0120  -0.0122 0.0795  89  GLY B CA  
1007 C C   . GLY B 51 ? 0.3395 0.4645 0.0959 -0.0370 -0.0182 0.1757  89  GLY B C   
1008 O O   . GLY B 51 ? 0.3819 0.5609 0.0672 -0.0273 -0.0132 0.1035  89  GLY B O   
1009 N N   . GLY B 52 ? 0.2733 0.4801 0.0905 -0.0026 -0.0303 0.1566  90  GLY B N   
1010 C CA  . GLY B 52 ? 0.3681 0.5304 0.1563 0.0167  -0.0672 0.0298  90  GLY B CA  
1011 C C   . GLY B 52 ? 0.3231 0.5379 0.0534 -0.0472 -0.0500 -0.0666 90  GLY B C   
1012 O O   . GLY B 52 ? 0.4156 0.5408 0.1637 -0.1013 -0.1425 -0.0288 90  GLY B O   
1013 N N   . GLN B 53 ? 0.2870 0.3824 0.0258 -0.0188 -0.0115 -0.0033 91  GLN B N   
1014 C CA  . GLN B 53 ? 0.2458 0.3387 0.0283 -0.0242 0.0144  -0.0268 91  GLN B CA  
1015 C C   . GLN B 53 ? 0.2217 0.3124 0.0321 0.0133  -0.0222 -0.0364 91  GLN B C   
1016 O O   . GLN B 53 ? 0.2758 0.2702 0.0257 0.0193  -0.0053 -0.0090 91  GLN B O   
1017 C CB  . GLN B 53 ? 0.3327 0.4481 0.0276 -0.0067 0.0122  -0.0278 91  GLN B CB  
1018 C CG  . GLN B 53 ? 0.3497 0.4030 0.0508 -0.0018 0.0155  -0.0438 91  GLN B CG  
1019 C CD  . GLN B 53 ? 0.4193 0.3794 0.1023 0.0456  0.0317  -0.0429 91  GLN B CD  
1020 O OE1 . GLN B 53 ? 0.4267 0.4654 0.0534 -0.0271 0.0690  -0.0889 91  GLN B OE1 
1021 N NE2 . GLN B 53 ? 0.5654 0.4369 0.1086 0.0672  -0.1083 -0.0754 91  GLN B NE2 
1022 N N   . VAL B 54 ? 0.2609 0.2721 0.0348 -0.0222 0.0039  -0.0485 92  VAL B N   
1023 C CA  . VAL B 54 ? 0.2237 0.2735 0.0288 0.0075  0.0187  -0.0200 92  VAL B CA  
1024 C C   . VAL B 54 ? 0.2378 0.2933 0.0415 0.0188  0.0038  -0.0652 92  VAL B C   
1025 O O   . VAL B 54 ? 0.2569 0.4396 0.0540 0.0806  -0.0435 -0.1042 92  VAL B O   
1026 C CB  . VAL B 54 ? 0.2634 0.3055 0.0430 -0.0006 0.0183  -0.0032 92  VAL B CB  
1027 C CG1 . VAL B 54 ? 0.2844 0.2868 0.0907 -0.0270 -0.0104 0.0101  92  VAL B CG1 
1028 C CG2 . VAL B 54 ? 0.2732 0.3805 0.1155 -0.0529 -0.0554 -0.0276 92  VAL B CG2 
1029 N N   . GLY B 55 ? 0.2118 0.2380 0.0264 -0.0013 -0.0028 -0.0154 93  GLY B N   
1030 C CA  . GLY B 55 ? 0.2096 0.2118 0.0301 -0.0016 0.0246  -0.0172 93  GLY B CA  
1031 C C   . GLY B 55 ? 0.1609 0.2044 0.0270 -0.0111 0.0143  -0.0068 93  GLY B C   
1032 O O   . GLY B 55 ? 0.1690 0.2700 0.0257 0.0153  -0.0056 -0.0073 93  GLY B O   
1033 N N   . ILE B 56 ? 0.1475 0.2219 0.0292 -0.0081 0.0155  -0.0206 94  ILE B N   
1034 C CA  . ILE B 56 ? 0.1662 0.1625 0.0276 -0.0138 0.0163  -0.0090 94  ILE B CA  
1035 C C   . ILE B 56 ? 0.1822 0.1843 0.0264 -0.0103 0.0130  0.0013  94  ILE B C   
1036 O O   . ILE B 56 ? 0.2083 0.2146 0.0256 -0.0390 -0.0060 0.0054  94  ILE B O   
1037 C CB  . ILE B 56 ? 0.2080 0.1770 0.0449 -0.0250 0.0038  -0.0223 94  ILE B CB  
1038 C CG1 . ILE B 56 ? 0.2075 0.2154 0.0457 -0.0054 -0.0187 -0.0132 94  ILE B CG1 
1039 C CG2 . ILE B 56 ? 0.2606 0.1854 0.0455 -0.0096 -0.0205 -0.0024 94  ILE B CG2 
1040 C CD1 . ILE B 56 ? 0.2544 0.2313 0.1045 -0.0061 -0.0315 -0.0028 94  ILE B CD1 
1041 N N   . PHE B 57 ? 0.1850 0.1860 0.0258 -0.0295 0.0075  -0.0058 95  PHE B N   
1042 C CA  . PHE B 57 ? 0.2043 0.2036 0.0259 -0.0190 0.0033  0.0096  95  PHE B CA  
1043 C C   . PHE B 57 ? 0.1962 0.1911 0.0288 -0.0392 -0.0101 -0.0191 95  PHE B C   
1044 O O   . PHE B 57 ? 0.1972 0.1860 0.0259 -0.0431 -0.0102 0.0003  95  PHE B O   
1045 C CB  . PHE B 57 ? 0.2126 0.2017 0.0410 -0.0259 0.0065  -0.0203 95  PHE B CB  
1046 C CG  . PHE B 57 ? 0.2377 0.1718 0.0273 -0.0106 -0.0185 0.0082  95  PHE B CG  
1047 C CD1 . PHE B 57 ? 0.2791 0.2295 0.1503 0.0038  -0.0768 -0.0278 95  PHE B CD1 
1048 C CD2 . PHE B 57 ? 0.2899 0.2552 0.0349 0.0148  0.0322  0.0019  95  PHE B CD2 
1049 C CE1 . PHE B 57 ? 0.2933 0.2713 0.4476 -0.0448 -0.0989 -0.0161 95  PHE B CE1 
1050 C CE2 . PHE B 57 ? 0.3205 0.2913 0.1355 0.0865  0.0883  0.1065  95  PHE B CE2 
1051 C CZ  . PHE B 57 ? 0.2409 0.3129 0.3627 0.0000  0.0224  0.1562  95  PHE B CZ  
1052 N N   . PRO B 58 ? 0.2212 0.1926 0.0269 -0.0625 0.0163  0.0002  96  PRO B N   
1053 C CA  . PRO B 58 ? 0.2241 0.1816 0.0321 -0.0231 -0.0346 -0.0068 96  PRO B CA  
1054 C C   . PRO B 58 ? 0.2009 0.1748 0.0434 -0.0210 -0.0152 -0.0477 96  PRO B C   
1055 O O   . PRO B 58 ? 0.2269 0.1859 0.0271 -0.0097 -0.0121 -0.0125 96  PRO B O   
1056 C CB  . PRO B 58 ? 0.2421 0.2041 0.0452 -0.0182 -0.0326 -0.0075 96  PRO B CB  
1057 C CG  . PRO B 58 ? 0.2259 0.2117 0.0870 -0.0322 -0.0042 -0.0391 96  PRO B CG  
1058 C CD  . PRO B 58 ? 0.2185 0.2110 0.0515 -0.0398 -0.0027 -0.0332 96  PRO B CD  
1059 N N   . SER B 59 ? 0.2216 0.2052 0.0280 -0.0406 -0.0224 0.0000  97  SER B N   
1060 C CA  . SER B 59 ? 0.2229 0.1991 0.0284 -0.0177 -0.0211 -0.0105 97  SER B CA  
1061 C C   . SER B 59 ? 0.1527 0.2288 0.0259 0.0029  0.0076  0.0064  97  SER B C   
1062 O O   . SER B 59 ? 0.1928 0.2428 0.0268 0.0002  -0.0158 -0.0014 97  SER B O   
1063 C CB  . SER B 59 ? 0.2550 0.2195 0.0475 -0.0406 -0.0092 -0.0176 97  SER B CB  
1064 O OG  . SER B 59 ? 0.3000 0.2597 0.0291 -0.0447 0.0174  0.0219  97  SER B OG  
1065 N N   . ASN B 60 ? 0.1764 0.1766 0.0255 -0.0030 -0.0027 0.0044  98  ASN B N   
1066 C CA  A ASN B 60 ? 0.1958 0.1592 0.0280 0.0037  -0.0148 0.0133  98  ASN B CA  
1067 C CA  B ASN B 60 ? 0.1914 0.1567 0.0278 -0.0026 -0.0179 0.0090  98  ASN B CA  
1068 C C   . ASN B 60 ? 0.1930 0.1626 0.0283 0.0000  0.0223  -0.0024 98  ASN B C   
1069 O O   . ASN B 60 ? 0.2850 0.1697 0.0298 -0.0364 0.0342  -0.0053 98  ASN B O   
1070 C CB  A ASN B 60 ? 0.2069 0.1689 0.0529 -0.0114 -0.0393 -0.0133 98  ASN B CB  
1071 C CB  B ASN B 60 ? 0.2015 0.2190 0.0298 -0.0240 -0.0251 -0.0095 98  ASN B CB  
1072 C CG  A ASN B 60 ? 0.2572 0.2028 0.0811 -0.0258 -0.0390 0.0085  98  ASN B CG  
1073 C CG  B ASN B 60 ? 0.1770 0.2203 0.0580 -0.0147 -0.0688 -0.0036 98  ASN B CG  
1074 O OD1 A ASN B 60 ? 0.2684 0.2375 0.0378 -0.0718 -0.0433 0.0431  98  ASN B OD1 
1075 O OD1 B ASN B 60 ? 0.4076 0.3309 0.0415 -0.0718 -0.0177 0.0467  98  ASN B OD1 
1076 N ND2 A ASN B 60 ? 0.3273 0.2621 0.0616 -0.0614 -0.1000 -0.0060 98  ASN B ND2 
1077 N ND2 B ASN B 60 ? 0.2155 0.2082 0.0280 -0.0275 -0.0225 0.0039  98  ASN B ND2 
1078 N N   . TYR B 61 ? 0.2104 0.1700 0.0259 -0.0186 0.0103  -0.0011 99  TYR B N   
1079 C CA  . TYR B 61 ? 0.1717 0.1749 0.0258 -0.0214 0.0083  -0.0008 99  TYR B CA  
1080 C C   . TYR B 61 ? 0.1611 0.2108 0.0255 0.0093  0.0042  -0.0024 99  TYR B C   
1081 O O   . TYR B 61 ? 0.2221 0.2191 0.0282 0.0077  0.0098  0.0219  99  TYR B O   
1082 C CB  . TYR B 61 ? 0.1858 0.1944 0.0286 -0.0024 0.0229  -0.0040 99  TYR B CB  
1083 C CG  . TYR B 61 ? 0.1817 0.2068 0.0286 -0.0222 0.0214  -0.0106 99  TYR B CG  
1084 C CD1 . TYR B 61 ? 0.2070 0.2147 0.0253 0.0005  0.0013  0.0012  99  TYR B CD1 
1085 C CD2 . TYR B 61 ? 0.1850 0.2264 0.0257 -0.0264 -0.0078 0.0012  99  TYR B CD2 
1086 C CE1 . TYR B 61 ? 0.2066 0.2278 0.0288 -0.0102 0.0195  -0.0177 99  TYR B CE1 
1087 C CE2 . TYR B 61 ? 0.1775 0.2337 0.0272 -0.0002 0.0103  -0.0160 99  TYR B CE2 
1088 C CZ  . TYR B 61 ? 0.1872 0.2374 0.0257 -0.0089 -0.0077 0.0006  99  TYR B CZ  
1089 O OH  . TYR B 61 ? 0.2167 0.2958 0.0321 -0.0174 -0.0013 -0.0328 99  TYR B OH  
1090 N N   . VAL B 62 ? 0.1563 0.2292 0.0254 0.0065  0.0026  0.0031  100 VAL B N   
1091 C CA  . VAL B 62 ? 0.1789 0.2226 0.0333 -0.0010 0.0336  0.0113  100 VAL B CA  
1092 C C   . VAL B 62 ? 0.1838 0.2317 0.0334 0.0236  0.0306  0.0255  100 VAL B C   
1093 O O   . VAL B 62 ? 0.2303 0.2296 0.0273 0.0071  0.0129  0.0162  100 VAL B O   
1094 C CB  . VAL B 62 ? 0.1822 0.2515 0.0293 -0.0007 -0.0107 0.0271  100 VAL B CB  
1095 C CG1 . VAL B 62 ? 0.2242 0.2447 0.0255 0.0100  -0.0068 0.0003  100 VAL B CG1 
1096 C CG2 . VAL B 62 ? 0.2200 0.2334 0.0338 0.0070  0.0018  0.0150  100 VAL B CG2 
1097 N N   . SER B 63 ? 0.1921 0.2386 0.0365 0.0261  0.0422  0.0168  101 SER B N   
1098 C CA  . SER B 63 ? 0.1855 0.2885 0.0485 0.0276  0.0358  0.0064  101 SER B CA  
1099 C C   . SER B 63 ? 0.1939 0.2621 0.0304 0.0402  0.0291  0.0034  101 SER B C   
1100 O O   . SER B 63 ? 0.2423 0.2620 0.0259 0.0138  0.0115  0.0036  101 SER B O   
1101 C CB  . SER B 63 ? 0.2896 0.3226 0.1738 0.0133  -0.0434 -0.0068 101 SER B CB  
1102 O OG  . SER B 63 ? 0.4282 0.3508 0.2815 -0.0255 -0.1071 0.0315  101 SER B OG  
1103 N N   A ARG B 64 ? 0.1965 0.2443 0.0622 -0.0020 0.0463  -0.0735 102 ARG B N   
1104 N N   B ARG B 64 ? 0.2176 0.3231 0.0463 0.0529  0.0483  0.0633  102 ARG B N   
1105 C CA  A ARG B 64 ? 0.2279 0.2126 0.0373 -0.0002 0.0043  -0.0135 102 ARG B CA  
1106 C CA  B ARG B 64 ? 0.2717 0.2504 0.0511 0.0236  0.0752  -0.0180 102 ARG B CA  
1107 C C   A ARG B 64 ? 0.2332 0.2107 0.0272 0.0079  0.0191  -0.0054 102 ARG B C   
1108 C C   B ARG B 64 ? 0.2723 0.2686 0.0275 0.0157  0.0216  0.0102  102 ARG B C   
1109 O O   A ARG B 64 ? 0.2113 0.2432 0.0389 0.0294  0.0369  -0.0306 102 ARG B O   
1110 O O   B ARG B 64 ? 0.2313 0.2523 0.0256 0.0191  -0.0028 0.0077  102 ARG B O   
1111 C CB  A ARG B 64 ? 0.2255 0.1884 0.1025 0.0141  0.0374  -0.0021 102 ARG B CB  
1112 C CB  B ARG B 64 ? 0.4040 0.3155 0.0759 -0.0036 0.1384  -0.0060 102 ARG B CB  
1113 C CG  A ARG B 64 ? 0.2282 0.2397 0.0350 -0.0199 0.0259  0.0307  102 ARG B CG  
1114 C CG  B ARG B 64 ? 0.4248 0.4549 0.3934 0.0000  0.0571  -0.0025 102 ARG B CG  
1115 C CD  A ARG B 64 ? 0.3152 0.2636 0.1036 0.0045  0.1029  -0.0319 102 ARG B CD  
1116 C CD  B ARG B 64 ? 0.6624 0.3895 0.1883 0.0602  0.1039  -0.0810 102 ARG B CD  
1117 N NE  A ARG B 64 ? 0.3780 0.3869 0.1928 -0.0582 0.0528  -0.1860 102 ARG B NE  
1118 N NE  B ARG B 64 ? 0.7181 0.4620 0.3390 0.1953  0.4492  0.1133  102 ARG B NE  
1119 C CZ  A ARG B 64 ? 0.3473 0.4531 0.2848 -0.0050 0.0754  -0.1599 102 ARG B CZ  
1120 C CZ  B ARG B 64 ? 0.5761 0.2410 0.3490 0.1074  0.1607  -0.0381 102 ARG B CZ  
1121 N NH1 A ARG B 64 ? 0.3509 0.5257 0.2766 -0.1040 0.1749  -0.2253 102 ARG B NH1 
1122 N NH1 B ARG B 64 ? 0.6951 0.4796 0.1543 0.1692  0.2670  0.0236  102 ARG B NH1 
1123 N NH2 A ARG B 64 ? 0.3448 0.4594 0.2221 -0.0728 0.1144  -0.2064 102 ARG B NH2 
1124 N NH2 B ARG B 64 ? 0.5471 0.2511 0.4785 0.0232  0.2735  -0.0089 102 ARG B NH2 
1125 N N   . GLY B 65 ? 0.2518 0.2547 0.0440 0.0161  0.0043  -0.0251 103 GLY B N   
1126 C CA  . GLY B 65 ? 0.2329 0.2855 0.0495 -0.0047 -0.0211 0.0193  103 GLY B CA  
1127 C C   . GLY B 65 ? 0.2961 0.3566 0.0554 -0.0401 -0.0171 0.0596  103 GLY B C   
1128 O O   . GLY B 65 ? 0.3001 0.3928 0.1016 -0.0239 0.0276  0.0199  103 GLY B O   
1129 N N   . GLY B 66 ? 0.2965 0.3594 0.0531 0.0357  0.0150  0.0275  104 GLY B N   
1130 C CA  . GLY B 66 ? 0.3851 0.5016 0.0655 0.1132  0.0343  0.1084  104 GLY B CA  
1131 C C   . GLY B 66 ? 0.3619 0.4151 0.0466 0.0645  0.0101  0.0385  104 GLY B C   
1132 O O   . GLY B 66 ? 0.5559 0.5441 0.1376 0.0954  0.1083  0.1666  104 GLY B O   
1133 N N   . GLY B 67 ? 0.3358 0.3885 0.1011 0.0653  0.0395  0.0634  105 GLY B N   
1134 C CA  . GLY B 67 ? 0.3591 0.4106 0.0913 0.0661  -0.0089 0.0640  105 GLY B CA  
1135 C C   . GLY B 67 ? 0.2708 0.3345 0.1321 0.0245  -0.0011 0.0593  105 GLY B C   
1136 O O   . GLY B 67 ? 0.3092 0.3916 0.2301 -0.0112 -0.0175 0.0498  105 GLY B O   
1137 N N   . ALA B 68 ? 0.3247 0.4232 0.1285 0.0848  0.0715  0.1410  106 ALA B N   
1138 C CA  . ALA B 68 ? 0.3734 0.3717 0.1985 0.0209  0.0736  0.1447  106 ALA B CA  
1139 C C   . ALA B 68 ? 0.3290 0.3322 0.1265 0.0058  0.0418  0.0571  106 ALA B C   
1140 O O   . ALA B 68 ? 0.4884 0.3274 0.1595 -0.0636 0.0758  0.0427  106 ALA B O   
1141 C CB  . ALA B 68 ? 0.4444 0.4293 0.2820 0.1321  0.0747  0.1300  106 ALA B CB  
1142 N N   . ILE B 69 ? 0.3744 0.3218 0.0777 0.0332  0.0113  0.0648  107 ILE B N   
1143 C CA  . ILE B 69 ? 0.2960 0.3279 0.0537 0.0074  0.0005  0.0484  107 ILE B CA  
1144 C C   . ILE B 69 ? 0.3057 0.2580 0.0264 0.0143  0.0045  0.0160  107 ILE B C   
1145 O O   . ILE B 69 ? 0.4554 0.3355 0.0303 0.0270  -0.0306 -0.0027 107 ILE B O   
1146 C CB  . ILE B 69 ? 0.3385 0.3321 0.0573 -0.0448 -0.0031 0.0326  107 ILE B CB  
1147 C CG1 . ILE B 69 ? 0.3073 0.3470 0.0809 -0.0043 0.0013  0.0304  107 ILE B CG1 
1148 C CG2 . ILE B 69 ? 0.3452 0.2704 0.0943 -0.0155 -0.0110 0.0271  107 ILE B CG2 
1149 C CD1 . ILE B 69 ? 0.2783 0.3097 0.1532 0.0170  0.0411  0.0564  107 ILE B CD1 
1150 N N   . ARG B 70 ? 0.2893 0.2462 0.0314 0.0092  0.0117  0.0200  108 ARG B N   
1151 C CA  . ARG B 70 ? 0.2920 0.2640 0.0332 -0.0021 0.0285  0.0246  108 ARG B CA  
1152 C C   . ARG B 70 ? 0.2180 0.2254 0.0285 -0.0011 0.0200  0.0149  108 ARG B C   
1153 O O   . ARG B 70 ? 0.2465 0.2590 0.0382 0.0204  0.0193  -0.0087 108 ARG B O   
1154 C CB  . ARG B 70 ? 0.3349 0.2713 0.1854 -0.0193 0.1135  0.0143  108 ARG B CB  
1155 C CG  . ARG B 70 ? 0.3799 0.4935 0.1854 -0.0867 0.0945  0.0652  108 ARG B CG  
1156 C CD  . ARG B 70 ? 0.4984 0.3910 0.1508 0.0855  0.0318  0.0953  108 ARG B CD  
1157 N NE  . ARG B 70 ? 0.3331 0.4558 0.2203 0.0563  0.0412  0.1352  108 ARG B NE  
1158 C CZ  . ARG B 70 ? 0.3417 0.6328 0.2588 -0.0740 0.0003  0.0878  108 ARG B CZ  
1159 N NH1 . ARG B 70 ? 0.4469 0.5031 0.5818 -0.0144 -0.1426 0.1234  108 ARG B NH1 
1160 N NH2 . ARG B 70 ? 0.5870 0.5829 0.4092 -0.0549 0.0632  0.1347  108 ARG B NH2 
1161 N N   . ILE B 71 ? 0.1935 0.2260 0.0271 0.0006  0.0173  0.0009  109 ILE B N   
1162 C CA  . ILE B 71 ? 0.1778 0.2375 0.0319 0.0065  0.0294  0.0152  109 ILE B CA  
1163 C C   . ILE B 71 ? 0.1909 0.2742 0.0254 0.0144  0.0038  -0.0003 109 ILE B C   
1164 O O   . ILE B 71 ? 0.1860 0.3191 0.0412 0.0187  0.0012  -0.0250 109 ILE B O   
1165 C CB  . ILE B 71 ? 0.1998 0.2614 0.0325 0.0179  0.0355  0.0049  109 ILE B CB  
1166 C CG1 . ILE B 71 ? 0.2034 0.2393 0.0785 -0.0038 0.0230  -0.0042 109 ILE B CG1 
1167 C CG2 . ILE B 71 ? 0.2395 0.2560 0.0941 0.0156  0.0379  0.0507  109 ILE B CG2 
1168 C CD1 . ILE B 71 ? 0.1998 0.2836 0.0394 -0.0156 0.0197  -0.0258 109 ILE B CD1 
1169 N N   . ASN B 72 ? 0.1836 0.3011 0.0258 0.0071  0.0024  -0.0118 110 ASN B N   
1170 C CA  . ASN B 72 ? 0.1984 0.3075 0.0259 0.0072  0.0000  -0.0134 110 ASN B CA  
1171 C C   . ASN B 72 ? 0.1841 0.3048 0.0923 0.0071  -0.0014 0.0040  110 ASN B C   
1172 O O   . ASN B 72 ? 0.2118 0.3539 0.0967 0.0041  -0.0233 0.0174  110 ASN B O   
1173 C CB  . ASN B 72 ? 0.2012 0.2933 0.0282 0.0284  -0.0176 -0.0199 110 ASN B CB  
1174 C CG  . ASN B 72 ? 0.2007 0.3185 0.0332 0.0171  -0.0079 -0.0149 110 ASN B CG  
1175 O OD1 . ASN B 72 ? 0.2617 0.3740 0.0411 0.0073  -0.0038 0.0140  110 ASN B OD1 
1176 N ND2 . ASN B 72 ? 0.2037 0.2719 0.0908 0.0073  0.0138  -0.0031 110 ASN B ND2 
1177 N N   . PRO B 73 ? 0.2231 0.3146 0.0832 -0.0111 -0.0197 -0.0006 111 PRO B N   
1178 C CA  . PRO B 73 ? 0.2178 0.2965 0.2317 -0.0172 0.0184  0.0158  111 PRO B CA  
1179 C C   . PRO B 73 ? 0.2718 0.3144 0.2581 -0.0502 -0.0941 0.0794  111 PRO B C   
1180 O O   . PRO B 73 ? 0.2919 0.3314 0.3626 -0.0063 -0.0653 0.0774  111 PRO B O   
1181 C CB  . PRO B 73 ? 0.2627 0.2708 0.3044 0.0175  0.0004  -0.0308 111 PRO B CB  
1182 C CG  . PRO B 73 ? 0.2012 0.2883 0.1575 0.0262  -0.0135 -0.0082 111 PRO B CG  
1183 C CD  . PRO B 73 ? 0.2151 0.2746 0.0854 0.0024  0.0390  -0.0050 111 PRO B CD  
1184 N N   . ASN B 74 ? 0.2042 0.3078 0.1476 -0.0361 -0.0351 0.0543  112 ASN B N   
1185 C CA  . ASN B 74 ? 0.2691 0.3864 0.1918 -0.0060 0.0175  0.1074  112 ASN B CA  
1186 C C   . ASN B 74 ? 0.2497 0.4316 0.1059 -0.0615 -0.0178 0.0796  112 ASN B C   
1187 O O   . ASN B 74 ? 0.2781 0.5852 0.1507 -0.0711 -0.0411 0.1435  112 ASN B O   
1188 C CB  . ASN B 74 ? 0.2565 0.4643 0.1195 -0.0352 -0.0290 0.0873  112 ASN B CB  
1189 C CG  . ASN B 74 ? 0.2113 0.4468 0.0520 -0.0307 -0.0430 0.0022  112 ASN B CG  
1190 O OD1 . ASN B 74 ? 0.2179 0.3866 0.0354 -0.0245 -0.0371 0.0118  112 ASN B OD1 
1191 N ND2 . ASN B 74 ? 0.1997 0.6108 0.0283 -0.0720 -0.0142 -0.0261 112 ASN B ND2 
1192 N N   . GLY B 75 ? 0.2337 0.3785 0.1775 -0.0138 -0.0571 0.0796  113 GLY B N   
1193 C CA  . GLY B 75 ? 0.2658 0.3734 0.1906 0.0058  -0.0504 0.0911  113 GLY B CA  
1194 C C   . GLY B 75 ? 0.2132 0.3215 0.1208 -0.0231 -0.0659 0.0091  113 GLY B C   
1195 O O   . GLY B 75 ? 0.2096 0.3332 0.2671 -0.0191 -0.0763 0.0402  113 GLY B O   
1196 N N   . THR B 76 ? 0.1864 0.3464 0.0450 -0.0127 -0.0197 0.0088  114 THR B N   
1197 C CA  . THR B 76 ? 0.1734 0.3331 0.0314 0.0010  -0.0193 -0.0334 114 THR B CA  
1198 C C   . THR B 76 ? 0.1715 0.2890 0.0262 -0.0110 0.0036  -0.0147 114 THR B C   
1199 O O   . THR B 76 ? 0.1878 0.3663 0.0299 0.0311  0.0007  -0.0252 114 THR B O   
1200 C CB  . THR B 76 ? 0.2270 0.3396 0.0427 -0.0317 0.0027  -0.0347 114 THR B CB  
1201 O OG1 . THR B 76 ? 0.2086 0.3634 0.0306 -0.0405 -0.0037 -0.0135 114 THR B OG1 
1202 C CG2 . THR B 76 ? 0.2196 0.4759 0.0274 -0.0592 0.0000  -0.0301 114 THR B CG2 
1203 N N   . TRP B 77 ? 0.1767 0.2548 0.0304 0.0070  0.0239  -0.0160 115 TRP B N   
1204 C CA  . TRP B 77 ? 0.2056 0.2263 0.0293 -0.0013 0.0232  -0.0143 115 TRP B CA  
1205 C C   . TRP B 77 ? 0.1879 0.2883 0.0296 -0.0031 0.0096  -0.0158 115 TRP B C   
1206 O O   . TRP B 77 ? 0.2172 0.2906 0.0774 -0.0297 0.0265  -0.0738 115 TRP B O   
1207 C CB  . TRP B 77 ? 0.1934 0.2091 0.0306 -0.0090 0.0275  -0.0133 115 TRP B CB  
1208 C CG  . TRP B 77 ? 0.1885 0.2264 0.0294 -0.0114 0.0094  -0.0273 115 TRP B CG  
1209 C CD1 . TRP B 77 ? 0.1744 0.2249 0.0267 -0.0029 -0.0069 -0.0149 115 TRP B CD1 
1210 C CD2 . TRP B 77 ? 0.1834 0.2298 0.0353 -0.0237 0.0094  -0.0226 115 TRP B CD2 
1211 N NE1 . TRP B 77 ? 0.1857 0.2530 0.0343 0.0103  0.0039  -0.0315 115 TRP B NE1 
1212 C CE2 . TRP B 77 ? 0.1960 0.2392 0.0359 0.0065  0.0052  -0.0217 115 TRP B CE2 
1213 C CE3 . TRP B 77 ? 0.2014 0.2396 0.0609 0.0088  0.0120  -0.0145 115 TRP B CE3 
1214 C CZ2 . TRP B 77 ? 0.1924 0.2489 0.0440 -0.0065 0.0145  -0.0269 115 TRP B CZ2 
1215 C CZ3 . TRP B 77 ? 0.2203 0.2599 0.0599 -0.0352 0.0037  -0.0077 115 TRP B CZ3 
1216 C CH2 . TRP B 77 ? 0.2536 0.2460 0.0680 -0.0109 0.0144  -0.0325 115 TRP B CH2 
1217 N N   . SER B 78 ? 0.2227 0.2518 0.0502 -0.0014 0.0287  -0.0117 116 SER B N   
1218 C CA  . SER B 78 ? 0.2763 0.2728 0.0922 0.0026  0.0198  -0.0147 116 SER B CA  
1219 C C   . SER B 78 ? 0.2378 0.2503 0.0979 -0.0026 0.0200  0.0113  116 SER B C   
1220 O O   . SER B 78 ? 0.3242 0.2970 0.0863 0.0115  -0.0033 0.0259  116 SER B O   
1221 C CB  . SER B 78 ? 0.3111 0.2703 0.1908 -0.0521 -0.0319 0.0471  116 SER B CB  
1222 O OG  . SER B 78 ? 0.2858 0.3665 0.1698 -0.0490 -0.0057 -0.0017 116 SER B OG  
1223 N N   . ARG B 79 ? 0.3552 0.2476 0.1476 -0.0132 0.0192  -0.0154 117 ARG B N   
1224 C CA  . ARG B 79 ? 0.3743 0.2532 0.2315 -0.0111 0.0451  0.0690  117 ARG B CA  
1225 C C   . ARG B 79 ? 0.3485 0.3524 0.1659 -0.0643 -0.0074 0.0480  117 ARG B C   
1226 O O   . ARG B 79 ? 0.3875 0.5620 0.2781 -0.1121 -0.0497 0.0946  117 ARG B O   
1227 C CB  . ARG B 79 ? 0.4427 0.3055 0.3435 -0.0041 0.0804  -0.0048 117 ARG B CB  
1228 C CG  . ARG B 79 ? 0.5267 0.3141 0.4274 -0.0334 0.1507  0.0301  117 ARG B CG  
1229 C CD  . ARG B 79 ? 0.5599 0.4461 0.6744 0.1005  0.0481  0.0158  117 ARG B CD  
1230 N NE  . ARG B 79 ? 0.4359 0.4920 0.8084 0.1578  0.0401  -0.1490 117 ARG B NE  
1231 C CZ  . ARG B 79 ? 0.4243 0.4245 0.5084 0.0265  0.0294  -0.0677 117 ARG B CZ  
1232 N NH1 . ARG B 79 ? 0.4993 0.3272 0.6083 -0.0184 -0.1230 0.0944  117 ARG B NH1 
1233 N NH2 . ARG B 79 ? 0.4392 0.4279 0.4887 -0.0205 -0.0320 -0.0743 117 ARG B NH2 
1234 N N   . GLN B 80 ? 0.4140 0.4629 0.1647 -0.0798 0.0303  0.0986  118 GLN B N   
1235 C CA  . GLN B 80 ? 0.4680 0.8586 0.1311 -0.1040 0.0100  0.1511  118 GLN B CA  
1236 C C   . GLN B 80 ? 0.8554 1.0176 0.4761 0.0822  -0.2803 0.2411  118 GLN B C   
1237 O O   . GLN B 80 ? 1.3266 0.7490 0.5317 -0.1465 0.1861  0.3365  118 GLN B O   
1238 C CB  . GLN B 80 ? 0.7197 1.0538 0.1499 -0.1466 -0.1736 0.0262  118 GLN B CB  
1239 O O1  . MES C .  ? 0.9330 0.6745 0.2804 -0.0890 -0.2974 0.0368  201 MES A O1  
1240 C C2  . MES C .  ? 0.6662 0.4121 0.2931 -0.2079 -0.3048 0.0829  201 MES A C2  
1241 C C3  . MES C .  ? 0.6434 0.7840 0.7979 -0.0720 -0.3025 -0.0118 201 MES A C3  
1242 N N4  . MES C .  ? 1.1243 0.8071 0.5299 0.0082  -0.1991 -0.1557 201 MES A N4  
1243 C C5  . MES C .  ? 0.8401 0.6986 0.2432 -0.0559 -0.2018 -0.0174 201 MES A C5  
1244 C C6  . MES C .  ? 0.7184 0.3486 0.0354 -0.0102 0.0480  -0.0474 201 MES A C6  
1245 C C7  . MES C .  ? 1.1462 0.9932 0.1349 0.1805  0.0620  -0.2054 201 MES A C7  
1246 C C8  . MES C .  ? 0.7501 0.9037 0.6793 -0.0354 -0.1705 -0.1102 201 MES A C8  
1247 S S   . MES C .  ? 0.5789 2.0818 0.6352 -0.2912 -0.0832 0.5724  201 MES A S   
1248 O O1S . MES C .  ? 0.3993 2.3834 1.4089 -0.3181 0.3487  -0.7646 201 MES A O1S 
1249 O O2S . MES C .  ? 0.9542 3.0893 1.3361 0.8672  0.7085  1.5937  201 MES A O2S 
1250 O O3S . MES C .  ? 0.8340 2.4887 0.4567 0.5882  -0.0963 -0.4550 201 MES A O3S 
1251 O O   . HOH D .  ? 0.4322 0.7970 0.2498 0.0865  -0.0195 0.2241  301 HOH A O   
1252 O O   . HOH D .  ? 0.3290 0.6759 0.1441 -0.0839 0.0672  0.0781  302 HOH A O   
1253 O O   . HOH D .  ? 0.4725 0.3786 0.2698 -0.0256 0.0312  0.0203  303 HOH A O   
1254 O O   . HOH D .  ? 0.2994 0.4268 0.2136 -0.0021 -0.0010 0.0323  304 HOH A O   
1255 O O   . HOH D .  ? 0.6640 0.6795 0.1980 -0.3704 0.0194  -0.1401 305 HOH A O   
1256 O O   . HOH D .  ? 0.5576 0.6633 0.1202 -0.0674 -0.0257 -0.1325 306 HOH A O   
1257 O O   . HOH D .  ? 0.3633 0.4012 0.3826 0.0514  0.0337  0.0880  307 HOH A O   
1258 O O   . HOH D .  ? 0.8512 0.5081 0.1989 -0.1008 0.2410  -0.0878 308 HOH A O   
1259 O O   . HOH D .  ? 0.4075 0.9972 0.1278 -0.2585 -0.0688 0.0917  309 HOH A O   
1260 O O   . HOH D .  ? 0.5366 0.5027 0.4197 -0.1616 -0.0625 0.0788  310 HOH A O   
1261 O O   . HOH D .  ? 0.7575 0.8579 0.1519 -0.3350 -0.0560 -0.0721 311 HOH A O   
1262 O O   . HOH D .  ? 0.5364 0.6283 0.2850 -0.0648 -0.0499 0.2930  312 HOH A O   
1263 O O   . HOH D .  ? 0.7361 0.6269 0.1063 0.1742  -0.1580 -0.0429 313 HOH A O   
1264 O O   . HOH D .  ? 0.5084 0.3713 0.1709 0.0284  0.0953  -0.0836 314 HOH A O   
1265 O O   . HOH D .  ? 0.6903 0.4931 0.2922 -0.2052 0.0547  -0.0283 315 HOH A O   
1266 O O   . HOH D .  ? 0.6138 0.2735 0.3274 -0.0195 0.0329  -0.0393 316 HOH A O   
1267 O O   . HOH D .  ? 0.5949 0.4004 0.6991 -0.0329 -0.3009 0.0022  317 HOH A O   
1268 O O   . HOH D .  ? 0.3105 0.3172 0.1955 -0.0531 -0.0059 -0.0292 318 HOH A O   
1269 O O   . HOH D .  ? 0.2323 0.2276 0.0819 -0.0292 -0.0088 0.0493  319 HOH A O   
1270 O O   . HOH D .  ? 0.3392 0.4143 0.1812 -0.0033 0.0249  0.0399  320 HOH A O   
1271 O O   . HOH D .  ? 0.5041 0.6235 0.1848 -0.2233 -0.1607 0.1062  321 HOH A O   
1272 O O   . HOH D .  ? 0.8575 0.5476 0.2475 0.1140  0.0857  0.0416  322 HOH A O   
1273 O O   . HOH D .  ? 0.5646 0.4377 0.3917 0.0315  -0.1632 0.0520  323 HOH A O   
1274 O O   . HOH D .  ? 0.3115 0.4253 0.1327 0.0187  0.0198  0.0220  324 HOH A O   
1275 O O   . HOH D .  ? 0.4944 0.3553 0.4611 -0.0999 -0.2243 0.1414  325 HOH A O   
1276 O O   . HOH D .  ? 0.2675 0.4986 0.3769 -0.0566 0.0020  -0.1117 326 HOH A O   
1277 O O   . HOH D .  ? 0.5279 0.5585 0.3262 0.0849  0.0460  0.0288  327 HOH A O   
1278 O O   . HOH D .  ? 0.3953 0.6478 0.2357 -0.0596 0.0853  0.1923  328 HOH A O   
1279 O O   . HOH D .  ? 0.3013 0.2964 0.1805 0.0343  -0.0294 -0.0599 329 HOH A O   
1280 O O   . HOH D .  ? 0.4203 0.5284 0.1671 -0.1153 0.0004  0.0463  330 HOH A O   
1281 O O   . HOH D .  ? 0.5968 0.4524 0.2231 -0.0091 -0.1176 -0.1117 331 HOH A O   
1282 O O   . HOH D .  ? 0.8122 0.3455 0.3027 0.0929  -0.0615 -0.0862 332 HOH A O   
1283 O O   . HOH D .  ? 2.0055 3.8611 1.9076 -1.8710 -1.2300 2.0538  333 HOH A O   
1284 O O   . HOH D .  ? 0.3612 0.4217 0.9135 -0.1127 0.2008  -0.2665 334 HOH A O   
1285 O O   . HOH D .  ? 0.4553 0.3708 0.2483 0.0359  -0.0567 -0.0107 335 HOH A O   
1286 O O   . HOH D .  ? 0.4533 0.4463 0.4273 0.0341  0.0991  0.1280  336 HOH A O   
1287 O O   . HOH D .  ? 0.2750 0.2524 0.0281 -0.0328 -0.0111 -0.0212 337 HOH A O   
1288 O O   . HOH D .  ? 0.6499 0.5331 0.2457 0.2293  -0.3034 -0.1624 338 HOH A O   
1289 O O   . HOH D .  ? 0.5432 0.5687 0.3350 -0.0466 -0.0664 0.0023  339 HOH A O   
1290 O O   . HOH D .  ? 0.3364 0.4647 0.2786 0.0585  -0.0557 -0.0446 340 HOH A O   
1291 O O   . HOH D .  ? 0.4935 0.5132 0.1212 -0.1089 -0.0964 0.0673  341 HOH A O   
1292 O O   . HOH D .  ? 0.6798 0.2923 0.5319 0.0617  -0.1795 -0.1037 342 HOH A O   
1293 O O   . HOH D .  ? 0.7325 0.5426 0.2905 -0.2646 0.2190  -0.0935 343 HOH A O   
1294 O O   . HOH D .  ? 0.3471 0.3007 0.2685 0.0211  -0.0692 0.0140  344 HOH A O   
1295 O O   . HOH D .  ? 2.0599 3.1959 2.2936 2.0390  1.5857  1.9754  345 HOH A O   
1296 O O   . HOH D .  ? 0.8311 0.3993 0.1654 -0.0589 -0.2129 0.0456  346 HOH A O   
1297 O O   . HOH D .  ? 0.4048 0.4390 0.0507 -0.0002 0.0712  -0.0284 347 HOH A O   
1298 O O   . HOH D .  ? 0.3979 0.6724 0.4346 0.1456  -0.0313 -0.3376 348 HOH A O   
1299 O O   . HOH D .  ? 0.5185 0.3424 0.2916 -0.0778 -0.2127 -0.0695 349 HOH A O   
1300 O O   . HOH D .  ? 0.3576 0.3045 0.3924 0.0312  0.0072  0.1234  350 HOH A O   
1301 O O   . HOH D .  ? 0.4753 0.3490 0.2392 0.0458  0.0984  0.1538  351 HOH A O   
1302 O O   . HOH D .  ? 0.4640 0.6141 0.0936 -0.1804 -0.0289 -0.0802 352 HOH A O   
1303 O O   . HOH D .  ? 0.1998 0.9414 0.0440 0.1064  0.0004  0.0128  353 HOH A O   
1304 O O   . HOH D .  ? 0.2999 0.4821 0.2259 -0.0802 0.0541  -0.1895 354 HOH A O   
1305 O O   . HOH D .  ? 0.4837 0.6464 0.3387 -0.0620 -0.1263 -0.1058 355 HOH A O   
1306 O O   . HOH D .  ? 0.7380 0.5818 0.5144 -0.0439 -0.0493 -0.0088 356 HOH A O   
1307 O O   . HOH D .  ? 0.3566 0.2686 0.0636 -0.0531 -0.0259 0.0705  357 HOH A O   
1308 O O   . HOH D .  ? 0.4405 0.3000 0.1767 -0.0499 -0.0753 0.0216  358 HOH A O   
1309 O O   . HOH D .  ? 0.3772 0.4477 0.2690 -0.0163 0.0074  0.0018  359 HOH A O   
1310 O O   . HOH D .  ? 0.9399 0.6872 0.2369 0.1618  0.0231  0.0242  360 HOH A O   
1311 O O   . HOH D .  ? 0.5802 0.3370 0.1606 -0.0674 -0.0878 0.0731  361 HOH A O   
1312 O O   . HOH D .  ? 0.2486 0.2213 0.0521 0.0274  0.0640  0.0330  362 HOH A O   
1313 O O   . HOH D .  ? 0.5201 0.8620 0.3112 -0.0523 0.1074  -0.1519 363 HOH A O   
1314 O O   . HOH D .  ? 0.6141 0.7549 0.4289 -0.1206 -0.2952 0.1956  364 HOH A O   
1315 O O   . HOH D .  ? 0.4922 0.4220 0.3158 0.0115  -0.1032 -0.1002 365 HOH A O   
1316 O O   . HOH D .  ? 0.7080 0.5929 0.1843 -0.0449 0.1452  -0.0441 366 HOH A O   
1317 O O   . HOH D .  ? 0.5423 0.5825 0.3390 0.0650  -0.0397 -0.0313 367 HOH A O   
1318 O O   . HOH D .  ? 0.7135 0.6196 0.5848 -0.0788 0.0489  -0.3607 368 HOH A O   
1319 O O   . HOH D .  ? 0.8637 0.7375 0.2435 0.3376  -0.1187 -0.0860 369 HOH A O   
1320 O O   . HOH D .  ? 0.5561 0.5315 0.2644 -0.0573 -0.0114 0.0599  370 HOH A O   
1321 O O   . HOH D .  ? 0.4518 0.2796 0.1358 0.0503  -0.0235 0.0469  371 HOH A O   
1322 O O   . HOH D .  ? 0.4063 0.6344 0.8038 -0.0795 -0.0438 -0.1600 372 HOH A O   
1323 O O   . HOH D .  ? 0.3977 0.6081 0.5862 -0.0481 0.0990  -0.2072 373 HOH A O   
1324 O O   . HOH D .  ? 0.4999 0.7997 0.8412 0.0321  -0.1010 0.6081  374 HOH A O   
1325 O O   . HOH D .  ? 0.6679 0.7487 0.4085 -0.1132 0.1678  0.1796  375 HOH A O   
1326 O O   . HOH E .  ? 0.6916 0.4916 0.1933 -0.2919 -0.1373 0.0866  201 HOH B O   
1327 O O   . HOH E .  ? 0.3162 0.3321 0.1213 -0.0245 -0.0290 -0.0021 202 HOH B O   
1328 O O   . HOH E .  ? 0.3874 1.4522 0.4101 -0.3642 -0.1793 0.4142  203 HOH B O   
1329 O O   . HOH E .  ? 0.3954 0.4068 0.5051 0.0244  0.0349  0.0495  204 HOH B O   
1330 O O   . HOH E .  ? 0.6254 0.5389 0.1244 -0.1336 -0.0095 0.0451  205 HOH B O   
1331 O O   . HOH E .  ? 0.7051 0.4039 0.3995 0.0154  0.0656  -0.1690 206 HOH B O   
1332 O O   . HOH E .  ? 0.3736 0.3632 0.1800 -0.0715 0.0618  0.0973  207 HOH B O   
1333 O O   . HOH E .  ? 0.3611 0.3468 0.2093 0.0264  0.0045  -0.0154 208 HOH B O   
1334 O O   . HOH E .  ? 0.5238 0.4984 0.3425 -0.0961 0.0762  0.0669  209 HOH B O   
1335 O O   . HOH E .  ? 0.3836 0.5004 0.0813 -0.0231 0.0089  0.0503  210 HOH B O   
1336 O O   . HOH E .  ? 0.2920 0.3380 0.0337 0.0434  0.0128  -0.0179 211 HOH B O   
1337 O O   . HOH E .  ? 0.7877 0.5879 0.1289 0.1633  -0.0781 -0.1101 212 HOH B O   
1338 O O   . HOH E .  ? 0.3389 0.3879 0.0701 -0.0987 -0.0696 0.0819  213 HOH B O   
1339 O O   . HOH E .  ? 0.3835 0.2976 0.1894 -0.0092 -0.1101 0.0245  214 HOH B O   
1340 O O   . HOH E .  ? 0.3067 0.4017 0.2322 -0.0469 0.0452  -0.0824 215 HOH B O   
1341 O O   . HOH E .  ? 0.2482 0.4038 0.0279 0.0079  0.0070  -0.0136 216 HOH B O   
1342 O O   . HOH E .  ? 0.3570 0.4985 0.4782 -0.1294 -0.1315 0.1090  217 HOH B O   
1343 O O   . HOH E .  ? 1.2145 0.6028 0.1286 0.3018  0.0281  0.0101  218 HOH B O   
1344 O O   . HOH E .  ? 0.5634 0.3281 0.1270 0.0471  -0.0220 -0.0484 219 HOH B O   
1345 O O   . HOH E .  ? 0.4901 0.5750 0.2534 0.0440  0.1596  0.0452  220 HOH B O   
1346 O O   . HOH E .  ? 0.3256 0.4249 0.1187 -0.0427 -0.0068 0.0638  221 HOH B O   
1347 O O   . HOH E .  ? 0.2583 0.4349 0.1782 0.0437  -0.0421 0.0983  222 HOH B O   
1348 O O   . HOH E .  ? 0.4390 0.3483 0.1608 -0.0546 0.0151  0.0538  223 HOH B O   
1349 O O   . HOH E .  ? 0.4028 0.6365 0.2227 0.1491  0.0413  0.0003  224 HOH B O   
1350 O O   . HOH E .  ? 0.5671 0.8115 0.3137 -0.2177 -0.1267 0.3563  225 HOH B O   
1351 O O   . HOH E .  ? 0.6108 0.3889 0.2006 -0.1326 -0.0577 0.0504  226 HOH B O   
1352 O O   . HOH E .  ? 0.3688 0.6013 0.2737 -0.0593 0.0094  -0.1812 227 HOH B O   
1353 O O   . HOH E .  ? 0.4825 0.8254 0.0910 -0.2371 -0.0923 0.1772  228 HOH B O   
1354 O O   . HOH E .  ? 0.6045 0.6719 0.3111 0.0026  0.0460  0.0475  229 HOH B O   
1355 O O   . HOH E .  ? 0.7083 0.6109 0.3679 -0.2765 -0.1297 0.0802  230 HOH B O   
1356 O O   . HOH E .  ? 0.4102 0.4669 0.1384 0.0180  -0.0028 -0.0398 231 HOH B O   
1357 O O   . HOH E .  ? 0.8151 0.3820 0.5035 0.0581  -0.0234 0.0256  232 HOH B O   
1358 O O   . HOH E .  ? 0.5105 0.3738 0.2932 -0.0675 0.0927  -0.1322 233 HOH B O   
1359 O O   . HOH E .  ? 0.5987 0.5165 0.1162 -0.1376 0.0160  -0.1293 234 HOH B O   
1360 O O   . HOH E .  ? 0.4755 0.9384 0.1665 -0.0304 0.0251  0.1148  235 HOH B O   
1361 O O   . HOH E .  ? 0.3995 0.3682 0.1928 -0.1537 0.0055  -0.0203 236 HOH B O   
1362 O O   . HOH E .  ? 0.6551 0.8346 0.2719 -0.2117 -0.1888 0.0233  237 HOH B O   
1363 O O   . HOH E .  ? 0.3301 0.6299 0.2256 -0.0053 0.0109  -0.1466 238 HOH B O   
1364 O O   . HOH E .  ? 1.5112 0.5468 0.1239 0.1618  0.0098  0.0341  239 HOH B O   
1365 O O   . HOH E .  ? 0.4186 0.5331 0.2527 -0.0588 -0.1357 -0.0813 240 HOH B O   
1366 O O   . HOH E .  ? 0.4372 0.5097 0.7528 0.0677  -0.0796 -0.3070 241 HOH B O   
1367 O O   . HOH E .  ? 1.0320 0.8731 0.1558 0.2076  -0.1685 0.0074  242 HOH B O   
1368 O O   . HOH E .  ? 0.5927 0.6031 0.1765 0.1395  -0.1007 -0.0151 243 HOH B O   
1369 O O   . HOH E .  ? 0.4354 0.5648 0.1665 -0.0522 0.0431  -0.0328 244 HOH B O   
1370 O O   . HOH E .  ? 1.1999 0.3372 0.4607 0.0678  0.1940  0.0662  245 HOH B O   
1371 O O   . HOH E .  ? 0.4476 0.9250 0.4306 -0.1052 0.1551  -0.2332 246 HOH B O   
1372 O O   . HOH E .  ? 0.7063 0.8236 0.2013 -0.1107 0.1382  -0.0640 247 HOH B O   
1373 O O   . HOH E .  ? 0.9021 0.3193 0.1667 0.0880  -0.0664 -0.0356 248 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  HIS 1  39  ?   ?   ?   A . n 
A 1 2  MET 2  40  ?   ?   ?   A . n 
A 1 3  TYR 3  41  ?   ?   ?   A . n 
A 1 4  ALA 4  42  42  ALA ALA A . n 
A 1 5  ASN 5  43  43  ASN ASN A . n 
A 1 6  PRO 6  44  44  PRO PRO A . n 
A 1 7  VAL 7  45  45  VAL VAL A . n 
A 1 8  TRP 8  46  46  TRP TRP A . n 
A 1 9  THR 9  47  47  THR THR A . n 
A 1 10 ALA 10 48  48  ALA ALA A . n 
A 1 11 LEU 11 49  49  LEU LEU A . n 
A 1 12 PHE 12 50  50  PHE PHE A . n 
A 1 13 ASP 13 51  51  ASP ASP A . n 
A 1 14 TYR 14 52  52  TYR TYR A . n 
A 1 15 GLU 15 53  53  GLU GLU A . n 
A 1 16 PRO 16 54  54  PRO PRO A . n 
A 1 17 SER 17 55  55  SER SER A . n 
A 1 18 GLY 18 56  56  GLY GLY A . n 
A 1 19 GLN 19 57  57  GLN GLN A . n 
A 1 20 ASP 20 58  58  ASP ASP A . n 
A 1 21 GLU 21 59  59  GLU GLU A . n 
A 1 22 LEU 22 60  60  LEU LEU A . n 
A 1 23 ALA 23 61  61  ALA ALA A . n 
A 1 24 LEU 24 62  62  LEU LEU A . n 
A 1 25 ARG 25 63  63  ARG ARG A . n 
A 1 26 LYS 26 64  64  LYS LYS A . n 
A 1 27 GLY 27 65  65  GLY GLY A . n 
A 1 28 ASP 28 66  66  ASP ASP A . n 
A 1 29 ARG 29 67  67  ARG ARG A . n 
A 1 30 VAL 30 68  68  VAL VAL A . n 
A 1 31 GLU 31 69  69  GLU GLU A . n 
A 1 32 VAL 32 70  70  VAL VAL A . n 
A 1 33 LEU 33 71  71  LEU LEU A . n 
A 1 34 SER 34 72  72  SER SER A . n 
A 1 35 ARG 35 73  73  ARG ARG A . n 
A 1 36 ASP 36 74  74  ASP ASP A . n 
A 1 37 ALA 37 75  75  ALA ALA A . n 
A 1 38 ALA 38 76  76  ALA ALA A . n 
A 1 39 ILE 39 77  77  ILE ILE A . n 
A 1 40 SER 40 78  78  SER SER A . n 
A 1 41 GLY 41 79  79  GLY GLY A . n 
A 1 42 ASP 42 80  80  ASP ASP A . n 
A 1 43 GLU 43 81  81  GLU GLU A . n 
A 1 44 GLY 44 82  82  GLY GLY A . n 
A 1 45 TRP 45 83  83  TRP TRP A . n 
A 1 46 TRP 46 84  84  TRP TRP A . n 
A 1 47 ALA 47 85  85  ALA ALA A . n 
A 1 48 GLY 48 86  86  GLY GLY A . n 
A 1 49 GLN 49 87  87  GLN GLN A . n 
A 1 50 VAL 50 88  88  VAL VAL A . n 
A 1 51 GLY 51 89  89  GLY GLY A . n 
A 1 52 GLY 52 90  90  GLY GLY A . n 
A 1 53 GLN 53 91  91  GLN GLN A . n 
A 1 54 VAL 54 92  92  VAL VAL A . n 
A 1 55 GLY 55 93  93  GLY GLY A . n 
A 1 56 ILE 56 94  94  ILE ILE A . n 
A 1 57 PHE 57 95  95  PHE PHE A . n 
A 1 58 PRO 58 96  96  PRO PRO A . n 
A 1 59 SER 59 97  97  SER SER A . n 
A 1 60 ASN 60 98  98  ASN ASN A . n 
A 1 61 TYR 61 99  99  TYR TYR A . n 
A 1 62 VAL 62 100 100 VAL VAL A . n 
A 1 63 SER 63 101 101 SER SER A . n 
A 1 64 ARG 64 102 102 ARG ARG A . n 
A 1 65 GLY 65 103 103 GLY GLY A . n 
A 1 66 GLY 66 104 104 GLY GLY A . n 
A 1 67 GLY 67 105 105 GLY GLY A . n 
A 1 68 ALA 68 106 106 ALA ALA A . n 
A 1 69 ILE 69 107 107 ILE ILE A . n 
A 1 70 ARG 70 108 108 ARG ARG A . n 
A 1 71 ILE 71 109 109 ILE ILE A . n 
A 1 72 ASN 72 110 110 ASN ASN A . n 
A 1 73 PRO 73 111 111 PRO PRO A . n 
A 1 74 ASN 74 112 112 ASN ASN A . n 
A 1 75 GLY 75 113 113 GLY GLY A . n 
A 1 76 THR 76 114 114 THR THR A . n 
A 1 77 TRP 77 115 115 TRP TRP A . n 
A 1 78 SER 78 116 116 SER SER A . n 
A 1 79 ARG 79 117 117 ARG ARG A . n 
A 1 80 GLN 80 118 118 GLN GLN A . n 
A 1 81 ALA 81 119 ?   ?   ?   A . n 
A 1 82 GLU 82 120 ?   ?   ?   A . n 
A 1 83 THR 83 121 ?   ?   ?   A . n 
A 1 84 VAL 84 122 ?   ?   ?   A . n 
A 1 85 GLU 85 123 ?   ?   ?   A . n 
A 1 86 SER 86 124 ?   ?   ?   A . n 
B 1 1  HIS 1  39  ?   ?   ?   B . n 
B 1 2  MET 2  40  ?   ?   ?   B . n 
B 1 3  TYR 3  41  ?   ?   ?   B . n 
B 1 4  ALA 4  42  ?   ?   ?   B . n 
B 1 5  ASN 5  43  ?   ?   ?   B . n 
B 1 6  PRO 6  44  44  PRO PRO B . n 
B 1 7  VAL 7  45  45  VAL VAL B . n 
B 1 8  TRP 8  46  46  TRP TRP B . n 
B 1 9  THR 9  47  47  THR THR B . n 
B 1 10 ALA 10 48  48  ALA ALA B . n 
B 1 11 LEU 11 49  49  LEU LEU B . n 
B 1 12 PHE 12 50  50  PHE PHE B . n 
B 1 13 ASP 13 51  51  ASP ASP B . n 
B 1 14 TYR 14 52  52  TYR TYR B . n 
B 1 15 GLU 15 53  53  GLU GLU B . n 
B 1 16 PRO 16 54  54  PRO PRO B . n 
B 1 17 SER 17 55  55  SER SER B . n 
B 1 18 GLY 18 56  56  GLY GLY B . n 
B 1 19 GLN 19 57  57  GLN GLN B . n 
B 1 20 ASP 20 58  58  ASP ASP B . n 
B 1 21 GLU 21 59  59  GLU GLU B . n 
B 1 22 LEU 22 60  60  LEU LEU B . n 
B 1 23 ALA 23 61  61  ALA ALA B . n 
B 1 24 LEU 24 62  62  LEU LEU B . n 
B 1 25 ARG 25 63  63  ARG ARG B . n 
B 1 26 LYS 26 64  64  LYS LYS B . n 
B 1 27 GLY 27 65  65  GLY GLY B . n 
B 1 28 ASP 28 66  66  ASP ASP B . n 
B 1 29 ARG 29 67  67  ARG ARG B . n 
B 1 30 VAL 30 68  68  VAL VAL B . n 
B 1 31 GLU 31 69  69  GLU GLU B . n 
B 1 32 VAL 32 70  70  VAL VAL B . n 
B 1 33 LEU 33 71  71  LEU LEU B . n 
B 1 34 SER 34 72  72  SER SER B . n 
B 1 35 ARG 35 73  73  ARG ARG B . n 
B 1 36 ASP 36 74  74  ASP ASP B . n 
B 1 37 ALA 37 75  75  ALA ALA B . n 
B 1 38 ALA 38 76  76  ALA ALA B . n 
B 1 39 ILE 39 77  77  ILE ILE B . n 
B 1 40 SER 40 78  78  SER SER B . n 
B 1 41 GLY 41 79  79  GLY GLY B . n 
B 1 42 ASP 42 80  80  ASP ASP B . n 
B 1 43 GLU 43 81  81  GLU GLU B . n 
B 1 44 GLY 44 82  82  GLY GLY B . n 
B 1 45 TRP 45 83  83  TRP TRP B . n 
B 1 46 TRP 46 84  84  TRP TRP B . n 
B 1 47 ALA 47 85  85  ALA ALA B . n 
B 1 48 GLY 48 86  86  GLY GLY B . n 
B 1 49 GLN 49 87  87  GLN GLN B . n 
B 1 50 VAL 50 88  88  VAL VAL B . n 
B 1 51 GLY 51 89  89  GLY GLY B . n 
B 1 52 GLY 52 90  90  GLY GLY B . n 
B 1 53 GLN 53 91  91  GLN GLN B . n 
B 1 54 VAL 54 92  92  VAL VAL B . n 
B 1 55 GLY 55 93  93  GLY GLY B . n 
B 1 56 ILE 56 94  94  ILE ILE B . n 
B 1 57 PHE 57 95  95  PHE PHE B . n 
B 1 58 PRO 58 96  96  PRO PRO B . n 
B 1 59 SER 59 97  97  SER SER B . n 
B 1 60 ASN 60 98  98  ASN ASN B . n 
B 1 61 TYR 61 99  99  TYR TYR B . n 
B 1 62 VAL 62 100 100 VAL VAL B . n 
B 1 63 SER 63 101 101 SER SER B . n 
B 1 64 ARG 64 102 102 ARG ARG B . n 
B 1 65 GLY 65 103 103 GLY GLY B . n 
B 1 66 GLY 66 104 104 GLY GLY B . n 
B 1 67 GLY 67 105 105 GLY GLY B . n 
B 1 68 ALA 68 106 106 ALA ALA B . n 
B 1 69 ILE 69 107 107 ILE ILE B . n 
B 1 70 ARG 70 108 108 ARG ARG B . n 
B 1 71 ILE 71 109 109 ILE ILE B . n 
B 1 72 ASN 72 110 110 ASN ASN B . n 
B 1 73 PRO 73 111 111 PRO PRO B . n 
B 1 74 ASN 74 112 112 ASN ASN B . n 
B 1 75 GLY 75 113 113 GLY GLY B . n 
B 1 76 THR 76 114 114 THR THR B . n 
B 1 77 TRP 77 115 115 TRP TRP B . n 
B 1 78 SER 78 116 116 SER SER B . n 
B 1 79 ARG 79 117 117 ARG ARG B . n 
B 1 80 GLN 80 118 118 GLN ALA B . n 
B 1 81 ALA 81 119 ?   ?   ?   B . n 
B 1 82 GLU 82 120 ?   ?   ?   B . n 
B 1 83 THR 83 121 ?   ?   ?   B . n 
B 1 84 VAL 84 122 ?   ?   ?   B . n 
B 1 85 GLU 85 123 ?   ?   ?   B . n 
B 1 86 SER 86 124 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MES 1  201 1   MES MES A . 
D 3 HOH 1  301 98  HOH HOH A . 
D 3 HOH 2  302 35  HOH HOH A . 
D 3 HOH 3  303 45  HOH HOH A . 
D 3 HOH 4  304 24  HOH HOH A . 
D 3 HOH 5  305 56  HOH HOH A . 
D 3 HOH 6  306 49  HOH HOH A . 
D 3 HOH 7  307 50  HOH HOH A . 
D 3 HOH 8  308 107 HOH HOH A . 
D 3 HOH 9  309 60  HOH HOH A . 
D 3 HOH 10 310 52  HOH HOH A . 
D 3 HOH 11 311 64  HOH HOH A . 
D 3 HOH 12 312 63  HOH HOH A . 
D 3 HOH 13 313 59  HOH HOH A . 
D 3 HOH 14 314 3   HOH HOH A . 
D 3 HOH 15 315 99  HOH HOH A . 
D 3 HOH 16 316 44  HOH HOH A . 
D 3 HOH 17 317 33  HOH HOH A . 
D 3 HOH 18 318 11  HOH HOH A . 
D 3 HOH 19 319 -2  HOH HOH A . 
D 3 HOH 20 320 86  HOH HOH A . 
D 3 HOH 21 321 39  HOH HOH A . 
D 3 HOH 22 322 81  HOH HOH A . 
D 3 HOH 23 323 115 HOH HOH A . 
D 3 HOH 24 324 57  HOH HOH A . 
D 3 HOH 25 325 53  HOH HOH A . 
D 3 HOH 26 326 30  HOH HOH A . 
D 3 HOH 27 327 78  HOH HOH A . 
D 3 HOH 28 328 12  HOH HOH A . 
D 3 HOH 29 329 6   HOH HOH A . 
D 3 HOH 30 330 22  HOH HOH A . 
D 3 HOH 31 331 69  HOH HOH A . 
D 3 HOH 32 332 82  HOH HOH A . 
D 3 HOH 33 333 100 HOH HOH A . 
D 3 HOH 34 334 26  HOH HOH A . 
D 3 HOH 35 335 48  HOH HOH A . 
D 3 HOH 36 336 79  HOH HOH A . 
D 3 HOH 37 337 0   HOH HOH A . 
D 3 HOH 38 338 34  HOH HOH A . 
D 3 HOH 39 339 85  HOH HOH A . 
D 3 HOH 40 340 84  HOH HOH A . 
D 3 HOH 41 341 17  HOH HOH A . 
D 3 HOH 42 342 55  HOH HOH A . 
D 3 HOH 43 343 46  HOH HOH A . 
D 3 HOH 44 344 32  HOH HOH A . 
D 3 HOH 45 345 80  HOH HOH A . 
D 3 HOH 46 346 36  HOH HOH A . 
D 3 HOH 47 347 14  HOH HOH A . 
D 3 HOH 48 348 27  HOH HOH A . 
D 3 HOH 49 349 18  HOH HOH A . 
D 3 HOH 50 350 31  HOH HOH A . 
D 3 HOH 51 351 8   HOH HOH A . 
D 3 HOH 52 352 29  HOH HOH A . 
D 3 HOH 53 353 9   HOH HOH A . 
D 3 HOH 54 354 23  HOH HOH A . 
D 3 HOH 55 355 76  HOH HOH A . 
D 3 HOH 56 356 106 HOH HOH A . 
D 3 HOH 57 357 1   HOH HOH A . 
D 3 HOH 58 358 5   HOH HOH A . 
D 3 HOH 59 359 19  HOH HOH A . 
D 3 HOH 60 360 68  HOH HOH A . 
D 3 HOH 61 361 38  HOH HOH A . 
D 3 HOH 62 362 -3  HOH HOH A . 
D 3 HOH 63 363 51  HOH HOH A . 
D 3 HOH 64 364 71  HOH HOH A . 
D 3 HOH 65 365 47  HOH HOH A . 
D 3 HOH 66 366 67  HOH HOH A . 
D 3 HOH 67 367 83  HOH HOH A . 
D 3 HOH 68 368 109 HOH HOH A . 
D 3 HOH 69 369 105 HOH HOH A . 
D 3 HOH 70 370 119 HOH HOH A . 
D 3 HOH 71 371 28  HOH HOH A . 
D 3 HOH 72 372 41  HOH HOH A . 
D 3 HOH 73 373 102 HOH HOH A . 
D 3 HOH 74 374 87  HOH HOH A . 
D 3 HOH 75 375 104 HOH HOH A . 
E 3 HOH 1  201 113 HOH HOH B . 
E 3 HOH 2  202 62  HOH HOH B . 
E 3 HOH 3  203 116 HOH HOH B . 
E 3 HOH 4  204 77  HOH HOH B . 
E 3 HOH 5  205 92  HOH HOH B . 
E 3 HOH 6  206 54  HOH HOH B . 
E 3 HOH 7  207 25  HOH HOH B . 
E 3 HOH 8  208 43  HOH HOH B . 
E 3 HOH 9  209 42  HOH HOH B . 
E 3 HOH 10 210 13  HOH HOH B . 
E 3 HOH 11 211 -1  HOH HOH B . 
E 3 HOH 12 212 90  HOH HOH B . 
E 3 HOH 13 213 2   HOH HOH B . 
E 3 HOH 14 214 15  HOH HOH B . 
E 3 HOH 15 215 4   HOH HOH B . 
E 3 HOH 16 216 10  HOH HOH B . 
E 3 HOH 17 217 75  HOH HOH B . 
E 3 HOH 18 218 111 HOH HOH B . 
E 3 HOH 19 219 16  HOH HOH B . 
E 3 HOH 20 220 74  HOH HOH B . 
E 3 HOH 21 221 117 HOH HOH B . 
E 3 HOH 22 222 7   HOH HOH B . 
E 3 HOH 23 223 93  HOH HOH B . 
E 3 HOH 24 224 88  HOH HOH B . 
E 3 HOH 25 225 91  HOH HOH B . 
E 3 HOH 26 226 58  HOH HOH B . 
E 3 HOH 27 227 37  HOH HOH B . 
E 3 HOH 28 228 118 HOH HOH B . 
E 3 HOH 29 229 73  HOH HOH B . 
E 3 HOH 30 230 61  HOH HOH B . 
E 3 HOH 31 231 120 HOH HOH B . 
E 3 HOH 32 232 101 HOH HOH B . 
E 3 HOH 33 233 21  HOH HOH B . 
E 3 HOH 34 234 20  HOH HOH B . 
E 3 HOH 35 235 95  HOH HOH B . 
E 3 HOH 36 236 89  HOH HOH B . 
E 3 HOH 37 237 96  HOH HOH B . 
E 3 HOH 38 238 97  HOH HOH B . 
E 3 HOH 39 239 114 HOH HOH B . 
E 3 HOH 40 240 110 HOH HOH B . 
E 3 HOH 41 241 70  HOH HOH B . 
E 3 HOH 42 242 121 HOH HOH B . 
E 3 HOH 43 243 108 HOH HOH B . 
E 3 HOH 44 244 40  HOH HOH B . 
E 3 HOH 45 245 65  HOH HOH B . 
E 3 HOH 46 246 72  HOH HOH B . 
E 3 HOH 47 247 103 HOH HOH B . 
E 3 HOH 48 248 66  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1320 ? 
1 MORE         -6   ? 
1 'SSA (A^2)'  9590 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-12-13 
2 'Structure model' 1 1 2018-12-26 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_CSD'          
5  2 'Structure model' '_citation.journal_id_ISSN'         
6  2 'Structure model' '_citation.journal_volume'          
7  2 'Structure model' '_citation.page_first'              
8  2 'Structure model' '_citation.page_last'               
9  2 'Structure model' '_citation.pdbx_database_id_DOI'    
10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
11 2 'Structure model' '_citation.title'                   
12 2 'Structure model' '_citation.year'                    
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? .        4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 N   B GLY 82  ? ? O B HOH 201 ? ? 1.70 
2 1 O   B HOH 227 ? ? O B HOH 238 ? ? 1.70 
3 1 O   B HOH 205 ? ? O B HOH 212 ? ? 1.89 
4 1 ND2 B ASN 98  ? B O B HOH 202 ? ? 1.91 
5 1 NE2 A GLN 57  ? A O A HOH 301 ? ? 2.03 
6 1 O   A HOH 324 ? ? O A HOH 332 ? ? 2.05 
7 1 O   B GLU 81  ? ? O B HOH 203 ? ? 2.07 
8 1 O3S A MES 201 ? ? O A HOH 302 ? ? 2.12 
9 1 O   B HOH 201 ? ? O B HOH 223 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NE2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLN 
_pdbx_validate_symm_contact.auth_seq_id_1     57 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    B 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     235 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   1_556 
_pdbx_validate_symm_contact.dist              1.83 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 53 ? ? OE2 A GLU 53 ? ? 1.349 1.252 0.097 0.011 N 
2 1 CD A GLU 81 ? ? OE2 A GLU 81 ? ? 1.329 1.252 0.077 0.011 N 
3 1 CG B TRP 46 ? ? CD1 B TRP 46 ? ? 1.448 1.363 0.085 0.014 N 
4 1 CD B GLU 53 ? ? OE2 B GLU 53 ? ? 1.398 1.252 0.146 0.011 N 
5 1 C  B SER 78 ? ? N   B GLY 79 ? ? 1.542 1.336 0.206 0.023 Y 
6 1 C  B GLU 81 ? ? O   B GLU 81 ? ? 1.347 1.229 0.118 0.019 N 
7 1 CA B GLY 93 ? ? C   B GLY 93 ? ? 1.621 1.514 0.107 0.016 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CG A GLU 53  ? ? CD A GLU 53  ? ? OE1 A GLU 53  ? ? 130.78 118.30 12.48  2.00 N 
2  1 NE A ARG 73  ? ? CZ A ARG 73  ? ? NH1 A ARG 73  ? ? 124.06 120.30 3.76   0.50 N 
3  1 NE A ARG 102 ? ? CZ A ARG 102 ? ? NH2 A ARG 102 ? ? 116.73 120.30 -3.57  0.50 N 
4  1 NE A ARG 108 ? ? CZ A ARG 108 ? ? NH1 A ARG 108 ? ? 124.32 120.30 4.02   0.50 N 
5  1 NE B ARG 63  ? A CZ B ARG 63  ? A NH2 B ARG 63  ? A 124.78 120.30 4.48   0.50 N 
6  1 NE B ARG 63  ? B CZ B ARG 63  ? B NH2 B ARG 63  ? B 113.23 120.30 -7.07  0.50 N 
7  1 CB B ASP 66  ? ? CG B ASP 66  ? ? OD2 B ASP 66  ? ? 112.83 118.30 -5.47  0.90 N 
8  1 NE B ARG 67  ? ? CZ B ARG 67  ? ? NH2 B ARG 67  ? ? 124.92 120.30 4.62   0.50 N 
9  1 NE B ARG 73  ? B CZ B ARG 73  ? B NH1 B ARG 73  ? B 125.14 120.30 4.84   0.50 N 
10 1 NE B ARG 73  ? B CZ B ARG 73  ? B NH2 B ARG 73  ? B 116.48 120.30 -3.82  0.50 N 
11 1 CB B ASP 74  ? B CG B ASP 74  ? B OD1 B ASP 74  ? B 125.35 118.30 7.05   0.90 N 
12 1 CB B ASP 74  ? B CG B ASP 74  ? B OD2 B ASP 74  ? B 110.13 118.30 -8.17  0.90 N 
13 1 CA B SER 78  ? ? C  B SER 78  ? ? N   B GLY 79  ? ? 102.91 116.20 -13.29 2.00 Y 
14 1 CD B ARG 102 ? B NE B ARG 102 ? B CZ  B ARG 102 ? B 133.68 123.60 10.08  1.40 N 
15 1 NE B ARG 102 ? B CZ B ARG 102 ? B NH1 B ARG 102 ? B 131.74 120.30 11.44  0.50 N 
16 1 NE B ARG 102 ? B CZ B ARG 102 ? B NH2 B ARG 102 ? B 107.61 120.30 -12.69 0.50 N 
17 1 N  B GLN 118 ? ? CA B GLN 118 ? ? C   B GLN 118 ? ? 90.88  111.00 -20.12 2.70 N 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             SER 
_pdbx_validate_main_chain_plane.auth_asym_id             B 
_pdbx_validate_main_chain_plane.auth_seq_id              78 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -18.91 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B GLN 118 ? CG  ? B GLN 80 CG  
2 1 Y 1 B GLN 118 ? CD  ? B GLN 80 CD  
3 1 Y 1 B GLN 118 ? OE1 ? B GLN 80 OE1 
4 1 Y 1 B GLN 118 ? NE2 ? B GLN 80 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS 39  ? A HIS 1  
2  1 Y 1 A MET 40  ? A MET 2  
3  1 Y 1 A TYR 41  ? A TYR 3  
4  1 Y 1 A ALA 119 ? A ALA 81 
5  1 Y 1 A GLU 120 ? A GLU 82 
6  1 Y 1 A THR 121 ? A THR 83 
7  1 Y 1 A VAL 122 ? A VAL 84 
8  1 Y 1 A GLU 123 ? A GLU 85 
9  1 Y 1 A SER 124 ? A SER 86 
10 1 Y 1 B HIS 39  ? B HIS 1  
11 1 Y 1 B MET 40  ? B MET 2  
12 1 Y 1 B TYR 41  ? B TYR 3  
13 1 Y 1 B ALA 42  ? B ALA 4  
14 1 Y 1 B ASN 43  ? B ASN 5  
15 1 Y 1 B ALA 119 ? B ALA 81 
16 1 Y 1 B GLU 120 ? B GLU 82 
17 1 Y 1 B THR 121 ? B THR 83 
18 1 Y 1 B VAL 122 ? B VAL 84 
19 1 Y 1 B GLU 123 ? B GLU 85 
20 1 Y 1 B SER 124 ? B SER 86 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 
3 water                                  HOH 
#